2UU9J

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gug-codon in the a-site and paromomycin.
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RRNA
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
total genus 10
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 2uu9J00
3D3CJ 3J80U 1HNWJ 4LFAJ 4LFBJ 1N32J 4JI5J 5FLXU 4RJVA 1XNQJ 2UUAJ 4DR3J 2UXDJ 4OX9J 1IBMJ 2MQ8A 4NXMJ 4JI7J 4JYAJ 2UUBJ 4DV6J 5IT9U 4DR2J 3R2CJ 2HHHJ 4X65J 4DR6J 4LF6J 4DR7J 5AJ3J 2UXBJ 4JI6J 4YHHJ 4DV3J 4JI2J 3OTOJ 4X62J 1IBKJ 2VQEJ 3T1HJ 4KY3A 4B3SJ 1IBLJ 1N36J 4V1Ak 5BR8J 3JAMU 4LF4J 4LF7J 4DUZJ 4DV1J 4B3TJ 1XNRJ 4DV7J 4DV5J 1XMQJ 4DV2J 4JI1J 3R2DJ 2KVQE 4LF8J 4NXNJ 4X66J 1N33J 4YY3J 4DUYJ 1HNZJ 4JV5J 2VQFJ 5LMNJ 3T1YJ 1HNXJ 2UXCJ 2MEWA 4B3RJ 3IMQJ 1HR0J 4DR5J 4GKJJ 2ZM6J 4PWWA 4KHPJ 4DR1J 2MTLA 1J5EJ 4JI0J 4GKKJ 5A2QU 1FJGJ 4X64J 2E5LJ 2F4VJ 4KYZA 4HHUA 4LF9J 1XMOJ 4JI3J 4LF5J 3D3BJ 1N34J 4DR4J 3J81U 5LMUJ 2UUCJ 4B3MJ 4NEYA 4K0KJ 4JI8J 5LM7E 1I94J 4JI4J 3J7AN 4NEZA 5IWAJ 4LFCJ 4DV0J 2UU9J 3W1YC 4DV4J 2KL8A 4AQYJ
chains in the Genus database with same CATH superfamily
2FVCA 3IR5B 2C2EA 3I56S 3Q8YA 3HO1A 4NYPA 2MQOA 4NZ6A 1T95A 2IFXA 4L3KA 4CYUB 1HQEA 1WEYA 2J7KA 3VZHA 4R5PB 1TAUA 4Y2KA 4PABA 9ATCB 2FC8A 4UOHA 1T8EA 4CLPA 3I0SB 3HHNB 1HPZA 3UVJB 4B9NA 1YQHA 1RT2B 2DNLA 3DLGB 3T6JA 5T7LA 1TKZA 4LBPA 1Q82T 4C8KA 1T0TV 3AD7C 4FBTA 1HNZJ 2LU2A 1GX6A 4RW6A 1CULA 3C6TB 2RVJA 2DIUA 2PGCA 3DMJA 4OX9F 1FVQA 4ZVGA 1RKIA 1RUSA 4HHJA 2PEHA 5ETKA 1NHKL 2ZOGA 5F8LA 4EBEA 3CT9A 2EI5A 4G1QA 2HMIB 1YWXA 2CPDA 5EX0A 4ZVOB 2HK3A 3SCKE 2B8PA 3NNCA 3DRRB 5D4NA 2B5JB 4RNNA 2UP1A 1M5KC 4P52A 2ZH1A 2OFGX 4LF6J 1WELA 3SCIE 4U8YA 3W2VB 1KLMB 3MM9B 1RADB 4DEZA 5KFOA 4Q7AA 2YWFA 5B0DA 2MDAA 2AP6A 5DS7A 4F0HA 2GNKA 3MUTP 3NGKA 1N54B 4YDDB 2VIHA 4KBIA 1CEZA 2BW2A 1JQGA 1LWCA 1EQ0A 1WC4A 2VL1A 4RNMA 2H5JB 2AYGA 2VPYB 4P7TA 2P6SA 4QYZK 3CJ0A 2MLXA 1S6PA 2FHOB 3FCWA 1NPPA 3OV7A 3MR2A 2VG7A 2YKMA 2CKWA 4FPIA 4LVOP 5J2QB 2ACMA 1PSDA 3V6HA 2IVFB 3ILOA 2RQCA 2C3YA 3LWLA 1RZMA 2XQCA 4WFAQ 2BJEA 4GMKA 2PIIA 1AXQA 2J7WA 1V5VA 5KG7A 1Q1KA 4P73A 5EHHA 2QC3A 5AT1B 2IVYA 1Q53A 1WC3A 1O6XA 7FDRA 1RTDA 4ZN3A 4DUYJ 4JI4F 3K5MA 2DTJA 3DOKA 2KDOA 2J7UA 4CRJA 2WAQD 3KJFB 3G86A 1LW0B 3D9BA 3R8YA 1J5EJ 4JI0J 4OI3A 5FJ4A 4X4SA 3EVWA 2B9EA 3PHTA 1C0UA 3Q8SB 4LF9J 4Q2MA 4PR6A 3ZNUA 5ETRA 1FESA 3CD7A 3BO2A 3TR5A 3R7NB 1RWVB 1FK9A 3OSPA 2FD2A 4OI1A 4ICLA 3JQMA 4L74A 1S0NA 3DLEA 1IWAA 2YXLA 1K44A 4BWMA 3M05A 1HBOA 3HMJG 1P1LA 1RKJA 3TA0A 2OGUA 3MM7A 3QLHB 4F4ZA 4A8XA 2BM0A 4YQWA 3H42A 3W7BA 3R5CA 2W7OA 1R0CB 2VB6A 2BJ3A 1WC6A 1WSRA 4ZLPA 3NG8A 2HNDB 3HKZD 4CDIA 1SB6A 2N4CA 1TUVA 2UXBF 5LSRA 3E01A 2J5AA 1Q5YA 3CJRA 1SJQA 4ZITA 3J81Y 2PMZD 1HNWF 2GZOA 1OY8A 5C25A 3HJFA 3GMGA 5L39A 2ZOFA 4W92B 2H4WB 1DTTA 2ZKUA 4L6V3 1GTHA 1NMEB 1WC0A 4DR4J 3UFCX 5B0BA 3MM5A 5KFZA 1NPKA 3I82A 4F26A 4DR5F 4CH1A 3DHWC 2L08A 3C15A 3QZ7A 4ID8A 4OX9J 2R42A 4PXCA 4GC7A 1VFJA 4I56A 3Q24A 1YJNS 3SDEA 3HPOA 3N4WA 1H73A 3MCOA 3PM9A 3BPDA 1RK8A 1KFDA 3H0PA 5F3TA 3NL0A 3WZ0A 1RHMB 3ZZRA 2QX0A 4NI2A 4YMEA 3DLLQ 1E6YA 2VC0A 2YWHA 2ZBCA 3G8TA 5LXYA 4NCAA 4YY3J 3FRZA 1IR2A 3VVTA 2GA7A 1CS4A 2HFVA 2AJ2A 3KLGB 2B6AB 2WVDA 3AD8C 2R8IA 3HSGA 2N82B 4O4GA 1WKLA 2GW8A 4L76A 3H5SA 5DDOC 1ZH5A 3UD5A 4IG0B 3W65A 3TZXA 5DG8A 4USJC 3MF5A 5M2RA 1RT7A 5GADI 3CJQA 3TUZC 1ZYQA 3BPSP 4QWBA 1NAQA 4OFZA 4JI8J 4WXWA 3OFHA 2AU0A 2FLLA 3FBFA 4CTAB 3WX8A 2MLYA 4CNYA 3DM2A 1GXTA 3EZUA 4K8RA 3KK1A 3O5TB 1NK4A 4CO1A 4ZVFA 5F8IA 5LMNF 2D1CA 4ER8A 4ZVSB 3OHBA 4BDPA 2CJKA 1GK8A 2C2ZB 2ZZTA 4DSFA 3QIPA 3KLEA 4CWBA 1Q16B 1WWHA 1WEXA 3A1YG 4DBQA 3MEGA 3JTPA 2AQ4A 4OZ2A 1RT6A 4USTA 1CJTB 4OZ1A 2KXNB 4JI2F 2LEPA 4ZVEA 3K7RA 4ZIVA 3MMCA 2QO3A 1YI2S 2IIHA 3TUIC 2MKKA 3W66A 1RYRA 2AZ3A 1VC5A 4BBYA 2JEJA 2X3GA 4AYBD 1HNVA 2V8PA 2JEFA 5KFFA 3UDVA 4PXBA 5EWFA 1C0TA 3LW5C 2CYYA 1XN9A 3GJRB 5A6PA 4EMDA 2NXJA 3JQJA 4JI4J 3SCLE 5HVFA 2A0FB 3P6YC 2R2UA 5A8RB 5J1EA 3PKMA 3NLCA 3ZTOA 3UCUP 2M5YA 1URNA 1RT5B 2KRBA 1N34F 4OYMA 4ED1A 2MZTA 4OZLA 2H5EA 1D1UA 4FF2A 1HI0P 3W61A 3HZEA 3MAAA 3M8RA 2R7XA 4NA1A 3DRPA 1F9FA 1NB7A 1HBNA 5K14A 1ZETA 2R7QA 2UUAF 4DV5J 3GYXB 3VAGA 2DHAA 2I0XA 3WX4A 3U27A 2U1AA 1QM9A 4O23A 2VQFJ 1R43A 5AE1A 1FEHA 1Z4UA 5E33A 2QL9B 4NZ0A 1RTJB 2V8HA 5HBMB 1TKXB 4J9VA 1SI9A 1SC6A 1QAJA 5DG9A 4P75A 1ZTTA 2V69A 3T1YF 3KG1A 2W9CA 5BYSA 1DQAA 1B4SA 2C2KB 1MN7A 1NDLA 4AL6A 3TZYA 2E1CA 1HNWJ 4GKKF 4K4ZA 2B3TB 3VHQA 2W4DA 3HHKA 2XI3A 4DV6J 2D9PA 4IFYA 5KFSA 4M5MA 2L9WA 4PXDA 3NS6A 4K59A 2EKYA 3AOCA 2FLOA 3I4PA 4GVLA 1NHUA 3K5NA 3OPKA 5KFGA 3IS9A 3H2UB 3ET6A 4B17A 1WF1A 2FB0A 4C97A 1U6ZA 2P9EA 1Q8IA 5CH7B 2J6TA 1KN6A 1REGX 2E66A 4HEA9 3H98A 1Z1ZA 5IS2A 2L41A 1F3VA 3ITHA 3EWGA 4DSJA 2KVIA 1CC7A 4FYYB 4E2FB 1N36F 4OYIA 3V6JA 4V19J 2ROPA 5KFXA 3GIKA 3I9V9 4K2XA 3BGUA 4A8MP 4IG3A 3N6MA 2AJ0A 1T3NA 3QRPA 3MPVA 4HTIA 1X4BA 1ZOTA 2C3MA 4ATNA 2C3UA 4ENOA 1FHTA 2OO4A 3ZZZA 2I38A 1H2TZ 3T5JA 5I42A 4JI3F 1NDKA 4QJVA 5KG0A 5AXNA 3M9MB 3OVBA 2NYHA 4H54A 5LMNJ 3MMBB 2AIRB 2RQMA 1VRUA 2R7RA 4UOCA 1R0AB 2I1RA 1CJUA 3IP0A 3ZZYA 1YJWS 4QOTA 3L7OA 3SZ2A 1BUXA 1OSCA 4K2JA 3FC9A 2R9LA 1Q95G 3HULA 4M5HA 1HNXF 5IT9Y 1QTNB 4F3OA 2F8MA 1XEZA 4RW7B 3UWTA 1FNMA 2ATLA 1AW0A 5KFBA 2ZDOA 1VLYA 3MFHA 5C2CA 5HQLA 1Q8KA 1RP5A 3CCES 5U47A 3H25A 1UVLA 3FDSA 2ZKTA 1S1TB 2RDDA 5D0HA 2K3IA 4ED6A 2BKPA 3EDRB 7AT1B 2DNQA 5D8HB 5L9NA 1M5OC 3FUYA 4P2MA 4B3TJ 4M5DB 3VALA 4U7UK 1PCAA 2ZH7A 2ZHBA 5KFJA 2UVWA 3TZWA 3DOMA 3FFIA 2RB7A 4KGMA 5GMEA 3M9NB 4IH5A 2UVVA 4HH1A 3K8WA 3ENWA 1F5CA 4TNOA 2RUGA 3C6UB 3IBFB 4R25A 4QYZJ 3BEGB 2B7CB 1SBRA 2KFZA 3CJKB 4B08A 4CLKA 3EUNA 4DFJA 1Q86T 1UL3A 4OHVA 1A6LA 3SI8A 3D28A 4H4KA 1X0FA 1M1GA 1GNKA 1RBAA 4GO7X 1PC5A 2CQPA 1H7XA 2CQHA 4DHVA 2CPEA 2ZE2B 3MOZA 1OS5A 1PYOB 3IR6B 3V81B 1SQEA 2YWKA 2HZAA 1YJ7A 5DZ6A 3Q8QB 3OFFA 2XY5A 2GO9A 4LSZB 4JV5F 3T5KA 2A18A 3CJTA 1S5ZA 3JSRA 1BC6A 4N76A 1N0UA 1NH7A 2EBGA 3SBMA 1RT1B 3CC4S 4BC9A 1L3UA 3M30A 1DY3A 4RWXA 1N88A 2OSQA 1Q81T 2F40A 4U7CA 4DPTA 4KKOB 1WHYA 4LF7F 1I1GA 4Q44A 2FVRA 4ED7A 3Q86A 3V4IB 1S77D 5A2QY 2ASDA 2C1EB 4UY85 4TLRA 2W2PP 2WB1D 3GWCA 2MJNA 4HR2A 1RI7A 3M8WA 2YNFB 1JLQA 1LWEB 3MAHA 5HROA 3UPFA 2MKYA 4MFBB 1CJVA 1FTCA 3OJSA 1TELA 4USKA 4A8YA 3PVXA 3OTDA 5CQGA 1FWLA 2XS5A 3KLHB 3IR7B 2DKOB 2R7WA 4NLTA 4FXVA 1BE4A 5J1NA 1N36J 4PG8A 3HI9A 1RU2A 1Y00A 3LO3A 4X64F 3SV3A 3J7A1 2Z57B 3DHXA 3BBCA 3MM6A 2JH3A 2DVIA 2QEXS 3R2DJ 1M90T 2RMLA 2F8EX 4NMLA 4GVBA 4WFZA 4Y6IA 3KLVA 2RT3A 5E41A 1FKOB 5ITHA 1SIWB 2HNZB 2GQCA 1WC1A 3R6GB 3THTA 3LGMA 3WQPA 2R7SA 4ZCKA 4F4XA 2N3LA 4LF4F 2NZCA 3MTKA 4FN5A 5KFMA 1TZ0A 1RU1A 3UR0A 3Q8VA 2ILZA 4DL0C 1C1BB 4JI3J 2Z56B 5FLXY 2JVRA 2M2BA 1HW9A 3ENQA 2WSCC 3OR1B 4DR1F 3AOBA 5DO2A 1KTVA 1SVDA 2K1RA 3QT6A 5IV4A 3TJAA 4KHRA 3VZIA 3W8GA 4OJ3A 3I31A 3HX9A 4NLYA 2YKNA 1YHQS 3RB6A 4LRAA 3RR8A 4NX9A 2W9BB 4RR5A 1NDPA 2PD1A 1SJRA 1S1WB 5J2NA 2W8LA 2GVDB 5CYMB 1OYDA 3OQ2A 1W2BR 4A47A 3QYYA 1FE0A 5KFRA 4OYPA 4WCEQ 1IBMF 2OI2A 1HNIA 3A13A 2CJBA 3A4TA 3Q8UA 2VBYA 2DXEA 5GAHU 4WP9A 1GAOA 4KT0C 3IO1A 3CO9A 1U09A 4FYWB 3BKFA 1EKRA 1MMLA 4DL3A 2HGLA 5ETSA 4C0HA 1RDRA 3QFHA 2XHCA 2QMXA 2ZFHA 3GIMA 5KFUA 1XR5A 1FTRA 2FGCA 5DJBA 4EFAC 2V2ZA 2E29A 4LRDA 4RNOA 3T6BA 4ECYA 4OQJA 5DQIA 3TVZA 2MKCA 1L3KA 4A48A 3KHRA 4F50A 2BABA 1JLEA 2CZ4A 3ILIA 4PQUA 3CTRA 3OVSA 2H65B 3KLFA 2OPRB 4IO9Q 1VGYA 1FE4A 1HA1A 4P2XA 3VWSA 4LT6A 2J9CA 1OIAA 3VCDA 5IT0A 1T05B 1IJEB 2VOOA 1N5YB 2VD3A 3RAQA 2JZ5A 3KMQA 2C2OB 2BE2A 5LXRA 3LALA 4U7UD 1X7VA 1XC9A 4NRUA 3RBDA 5HMZA 2DR8A 4DX6A 1N5TA 4MK7A 2Q6CA 1Q8BA 4TY8B 4ANCA 3HHLA 2J6SA 1NRKA 3QNWB 3PEHA 2XB2D 3CCTA 5IOLA 2E1MC 3SCJE 1ELOA 1RHQB 1WDTA 2F1FA 1XNRF 3OSNA 3A3NB 4WWSA 2XGPA 4NLGA 3LAKA 4OHXA 1L5UA 3MUMP 4JI6F 4ELUA 4JBCA 3FKBA 5D4PA 2RNEA 2XNRA 2JL9A 4AL7A 4O3OA 4Q5VA 1R6VA 1DLOB 4NA2A 3V6DA 2XLKA 4XTTA 1FRHA 2PMHA 4DPWA 4CO4A 1LK5A 1JJCB 4N8NA 4IOAQ 3RBZA 4AUKA 2F4VF 2VPXB 2DHHA 3GIRA 2OPPB 4U67Q 2HZVA 5IQQA 5HP1B 4MKBA 3Q22A 3FBBA 3G4SS 2GFFA 3MAQA 3NBPA 2ZZMA 5ETMA 2DY9A 1BQMA 4J9MA 5IM0A 3TEHB 4ZVRB 5IQ6A 3QO9B 3AB2B 2Q1LA 2PE8A 4R8UB 1ZPWX 3I96A 4MKVA 2GIRA 2MHNA 3H40A 4EYHB 4X66J 1F0XA 1MU2B 3GSIA 1ZTWA 2M70A 1T9VA 4ZJQA 1DZ5A 4DV0F 4K4VA 3U1MA 3NS5A 4F4KA 1U26A 2QFIA 2C28A 1Y9OA 2DHSA 2MTLA 3W2WA 3GCXP 2B9YA 3BB5A 3HHEA 1FKAF 1NDCA 4J9QA 3ADAC 2I9SA 5AE2A 4X64J 5B0GA 2FY8A 2GGPB 3EGVA 3DXSX 3KXDA 1EQMA 4PQAA 2C2NA 4LF2A 2BANB 4R0JA 4XDDA 1EETB 4DPYA 1VHFA 2F5GA 1O8BA 1VRTB 4JYAJ 1T9WA 3BV8A 3PJWA 2EWHA 1DHMA 2A6OA 4ES3A 5DQHA 2UUCF 4PG4A 4FS1A 4Y2MA 2KT5A 4DG1B 4F02A 3MM8B 5EWGA 4C6AA 4GO5X 4OYWA 1EJ7L 3PKYA 3H20A 2JFDA 3DOLA 4K4TA 1VQYA 3OL9A 4PWDB 2KXHA 4NCGA 1P1TA 3UDCA 3QSIA 1QVFR 5C7PA 1RWPB 3NMAA 1JB0C 1XMQF 2VG6B 2K7KA 4C8LA 3RRKA 3CJ2A 4DF8A 1QE1B 1NB2A 3DNCA 1OY9A 1RWOB 4OYBA 2HBZB 2O67A 5I4MA 2CIMA 1HLWA 1X4EA 1RBLA 3QMQA 2ZNYA 2OUGA 2QA2A 1NBEB 1T3OA 1W7WA 3JYTA 3M6WA 4CLWA 5AJ3J 4LQ9A 4O3SA 2XTJP 2NQPA 2VQEJ 2DRDA 2VBWA 5L1KA 1N8RT 1TL5A 3JSYA 2RE1A 1ULRA 1RT4B 4CIOA 4KPCA 4CLTA 3CO0P 5DLGA 1FX2A 4LIRA 2IAJA 1U0HB 2G2OA 3ZFVA 4C11B 1M5HA 4C3KA 2LA4A 1YBTA 3W8PA 3NNHA 3TOQA 1CVJA 3W5XA 2EEYA 3K58A 4IQMA 4OI2A 5KAKA 4ZPCA 3FCHA 2ROGA 4PWWA 2LKZA 5JXSA 4J9PA 1XMBA 3B78A 1G6BA 2KTQA 2NR0A 5HQ8A 4I7FA 2HHWA 5KFWA 2RF2B 1BQNB 2LEAA 4QU6A 1X4FA 1VLOA 2NPFA 1JNZB 1X4DA 3RR7A 5KT2A 3J80U 1YIJS 4A8FA 1D3WA 4C0OC 2W8KA 2MQ8A 3JAMY 1B0PA 4Y28C 1RWNB 1FFSB 3TX8A 5B0CA 4DPUA 4JI6J 4FXWA 4B3OA 1AZSA 3GIIA 2AT1B 2MZSA 3DFEA 1S6OA 2AW0A 2X51A 1Q7LB 2ZVIA 3AOAA 2IJFA 3GCWP 1HQEB 2APOA 2DD8S 1HBMB 4ZK7M 4FKXA 5L1JA 2IDLA 3CULA 4ETZA 2JRSA 3KK2A 1RWKB 3V6KA 3AD9C 3RAMA 3KHLA 1VBYA 1M1HA 2HFUA 2W2QP 2BJ7A 2CJQA 2IC3B 2DGQA 4DR6F 1TKZB 4IFVA 4ERDA 1S1UA 3ZZTA 3IA0A 2FUG9 2CPYA 4QIVA 4ZLNA 4RW6B 3CCJS 2I5JB 1RWXB 4LFCJ 4DV0J 1CULB 1SL1A 2OEMA 2JWNA 1UFLA 3DMJB 1U2FA 4LR7A 5HLFA 3TJ8A 3HVAA 3MDFA 3TQEA 4DLGA 2P5VA 3GONA 3SEOA 1JKHB 1U1NA 4C9DA 5JUMA 3F73A 1AT1B 5KFHA 2RHSB 5LMUF 1LOUA 3DLKB 4YB5A 1X5PA 4WK1A 1YKWA 2HNYB 4G1QB 4KV8A 1PJ7A 2BUNA 2RU9A 2V9KA 2M8DB 1HHTP 5LSLA 3M4XA 1OWXA 2GVZA 1HI8A 3M2RA 1UW4A 1K1SA 4EBDA 2V63A 5KG1A 3UE2A 3UCZP 4F3MA 5K8MA 1N5VA 3IBWA 3OVAA 1MWQA 1FJGJ 4F7VA 4K4XA 2V50A 1UWBA 3H5YA 5LJ5Y 1JLAA 1DTQA 1JWWA 2X1BA 5LSOA 4ZCIA 3OL6A 4QBUA 2QRRA 2Y1LB 1WI8A 1TU0B 5KOXA 4TY9A 1BWEA 3PX6A 2EFVA 2POKA 3AH6A 3EICA 4PPDA 1TV6B 3DCAA 2MYFA 2JNJA 2LQ8A 2QG9B 3BGOP 2DITA 3UI3A 3OW2R 1CBKA 1R27B 3D7SB 2AJ1A 1VQ7S 2FJAB 4I2PA 3CCZA 5HI7A 2QLXA 2YWGA 4M63A 4UOGA 3IGVA 4DFPA 2V8GA 2FJXA 4PRFA 4NRTA 4E0DA 2Y0BB 2YH0A 4YB1P 1VC6A 1OQ6A 5HMYA 2YNIA 1GMWD 2GO8A 1TMJA 3HVRA 1JLFA 3QBCA 2WTFA 1IBKF 3LUYA 1GXLA 3CDWA 5T14A 1TL3A 2BZ2A 4ED0A 4JI5F 2CWXA 2UXDF 3CMES 2FZKB 3QWUA 2J9DE 5D4OA 1JLGB 3VTIA 4B9TA 4FF4A 1FEEA 5CHCB 2U2FA 3NKYA 4S0MA 1NSAA 5SUHA 3T5HA 6FDRA 3DOKB 4MK8A 1SQFA 2OKQA 4Z7CA 3MMAA 1ACMB 1LWFB 4CYUA 4M95A 1PG5B 3BSOA 4R5PA 4JB8B 1K1QA 2BQ3A 3QJPA 3I0SA 1X9MA 5SZTA 1C0UB 4PYDA 1RT2A 5JVGQ 2BM1A 4Y65A 2ZM6F 1IXKA 4WE1B 4HVZA 5DDPC 2JLEA 2NXNA 4WTYA 5HSPA 2PSZA 3W3SA 5BR8J 2MY7A 2YVSA 1R8CA 1B64A 3H5XA 1YITS 3NNAA 2CPJA 3ETMA 1M5PC 4XPCA 1DURA 4F0MA 4DFMA 3M8PB 3PY8A 3FZ2A 4RX6A 3IMQJ 3H90A 1S9EA 1UEVA 4W4MA 3AY0A 4JI1F 1WHXA 4CLYA 3Q89A 4M5NA 3FBCA 2HMIA 5GMDA 5E3PA 2DT9A 6FD1A 3R5DA 5HATA 2Y1RI 2B5JA 2XY7A 1VQKS 4BCAA 1WI6A 2FHJD 2KI2A 2FLNA 4ZMMA 2O1PA 3CDBA 3D1HA 1FRMA 1S0OA 1OPZA 3VAHA 4ZCLA 4O3PA 2HURA 1B0TA 1NEEA 4LRBA 3ZO7A 1KLMA 3NY0A 2UUBJ 4YB7A 2IDEA 4DR6J 3JTOA 1JXEA 5DG7A 4NL5A 1LQ9A 2HS3A 2KM8B 3G6YA 1U1LA 1YX2A 2IM0A 1X5SA 5EWEA 1TTHB 2J8SA 1KBRA 1NH8A 3D6FB 4U95A 2R8GA 4NLOA 3BSCA 3LGNA 3PX0A 4ED2A 2UXCJ 4RBUA 4EI2A 3D66A 2ZH5A 1YTYA 1WNEA 2OTLS 5CZVA 1XR6A 2AGQA 3VAKA 3KLIB 2AWZA 3M6VA 4UQTA 1QAXA 1RISA 3HSZA 2VZ9A 4RW9A 2ZHAA 4NI2B 5F9LA 3PYFA 4HACA 3DGPB 3N0VA 2FZCB 4ECVA 2W25A 5J2QA 1CS4B 2CDRB 2ASJA 4HTJA 4M5IA 2MQPA 4AQYJ 1VQNS 5HAOA 1F5AA 2W1BA 4O4GB 3PV8A 3GTYX 2VG5A 3Q8PB 3KWMA 4IYQA 4P2FA 4ZHRA 3KYLA 2ZD1B 1RT7B 1KDNA 3I0RB 3G82B 5HMXA 5IWAF 3CC2S 5F9NA 4V19X 2MQLA 4NE9C 2F4FA 3PO5A 2EFGA 3HT3A 4F0KA 1N5QA 2MY8A 4PG7A 3DI6B 2V4RA 2CJ9A 4OV6A 4DSEA 4RW4A 3G6VA 1CQNA 2RQ4A 3QIPB 4Y3CA 3KLEB 3L7PA 4J91A 1R31A 2BJ1A 3HVWA 3VAIA 3MEGB 3D68A 3TW0A 4ECSA 3O3LA 3K59A 1RT6B 4PAAA 2Z30B 5HL7Q 4DUTA 3M2UB 2KYXA 3MMCB 1IR1A 4DJBA 3VGUA 4JI5J 1L3TA 2UXDJ 1H74A 5GAEI 3CIZA 2N3OA 4Z37A 5E3AA 3TAMA 3HFZB 5HJXA 4MIBA 1RAHB 2OMOA 2HNDA 3HVTB 1RACB 2IRUA 3KJNB 1U6FA 4M5KA 4OZNA 4O44B 1KOOA 1KQKA 1N52B 2QL5B 3MCSA 4EK2A 2PA3A 1AUDA 4NLDA 2Y3YA 2GIQA 1VJWA 4QIGA 1FNOA 2FVSA 1XNQF 1FF2A 2ZM6J 4NXMF 3DRPB 1HIYA 5K14B 1HARA 1Z2LA 2NSCA 4ETXA 2YKOA 1A9NB 2MKIA 4CLSA 3NOCA 4ZLLA 3TRGA 2R2SA 4NASA 3W64A 4B9VA 1YJRA 2V8VA 2HLUA 5KFQA 5HQMA 2KB2A 3D67A 2KT2A 3ENAA 2XSJB 3TAQA 1V3RA 5GADU 4FF1A 1X5TA 8ATCB 2DGTA 4YHHJ 1SXLA 1EKSA 4DL2A 4X62J 4RUAA 1OQ3A 1K73T 3EGZA 2C2MB 2LXIA 2ZDPA 1PILA 2DNMA 4FYVB 3KLGA 2QMWA 1VIXA 2H3EB 4WFBQ 4LF6F 3K89A 1JJ4A 3DC2A 2E5GA 1IUJA 2Q66A 4IFYB 3A8JA 3A8EA 1R8BA 2EK1A 2HS4A 1Y4ZB 2N7CA 3KTQA 4N5SA 4IG0A 2COLA 2JEGA 3AXMA 1W2IA 3CVKA 1SCJB 2XBPA 1RTIB 1UEUA 2GAGC 1VQ6S 2QA1A 4A4JA 5AXMA 1B0VA 3R27A 4RNFA 3FRYA 2WW4A 2QA4G 2NREA 2HKEA 4CTAA 1CG2A 2JLFA 4DQPA 1FO1A 3QIDA 5J2MB 3MCNA 1IR0A 2X1GA 4RNHA 2DNGA 4DSIA 1FERA 2QSWA 5H9EK 4ZP9A 3KUEA 3Q2SC 4FKYA 2JC1A 2QLWA 2HFSA 2RQKA 2D41A 4DFKA 4LQ3A 2CPFA 3T3FA 1CPZA 2WK4A 4KGXB 3ISND 3G96A 1NXIA 4UTGA 2HYIB 2AJ4A 5A76A 3O1LA 3AQOA 1S7IA 3TVYA 2GHPA 2IPOB 2H4YB 4DL4A 2KZMA 4CLZA 2CA9A 4IG3B 3ZTSA 1SQGA 2AX0A 3G6XA 1UZHA 3L7UA 3BO3A 3HXMA 2LXFA 1MROA 2G1HA 4DL6A 3CWJA 5HVGA 1NO8A 2XMJA 1V3SA 4ECXA 4L3NA 4P9SA 3CJ8A 3QJLA 3J7YU 5KFKA 3DDNA 3AODA 4FVMA 3OR2B 3SXLA 3KNGA 3CJ4A 1Y10A 3E8OA 3GB0A 2E1RA 2J9EA 1VRUB 1RT5A 3MEEA 1BGXT 1SV5B 2W01A 5F8NA 1Q5VA 5ETOA 2R2RA 4I1TA 1WKJA 2V4QA 1JMTA 4LF9F 5MLCV 2MGZB 2R7UA 1I51B 2CJAA 4LR9A 1WEZA 4MYUA 1FA0A 4L72B 2LYVA 2FJWA 1TL4A 3KJQB 3E3XA 1FRLA 3L9ZA 1VC0A 2IJRA 4RU9A 2DR7A 3QRRA 3RBXA 1CLFA 1RBOB 3C2PA 1PKUA 1HYSA 1UP1A 3O2IA 4QQBA 4KAIA 1TKXA 1HWJA 2SXLA 2DGXA 3GLJA 1FCAA 1ZAWA 3BREA 3MGJA 2MKSA 2HSEB 3FQKA 5RUBA 3EPIA 4J9NA 2CVEA 1QSLA 1VDHA 2WONA 3LGHA 1KOHA 3OTOF 1VBXA 4H4OA 3ELHA 3LP1B 2IMWP 3DOMB 3D6HB 3MEDB 3OLBA 3B8HA 4EWTA 3JSMB 1ZA1B 2GJFA 3SV4A 4TU9A 1TUWA 3ILJA 2BE9B 1XNQJ 2BA9A 4NXMJ 4J9LA 4DR4F 4LSLB 1R89A 3RG6A 1HR0F 4RBTA 1RA7A 4OHZA 4WPAA 1KEKA 2G1DA 2OD4A 1KNZA 2OIHA 4WFXA 3N5FA 3PW4A 3HCXA 2QIFA 4QZVB 2HVEA 3KHGA 1JNRB 1KQFB 4EZ6A 4CO3A 4E98A 2NXUA 4ZVPB 2G13A 5F0WA 1V3ZA 2EFNA 1HQ2A 2HRYA 2XMVA 1E6VA 4DX8H 2HHHF 1Q7YT 1BHNA 4CT8A 1XMOJ 2DRBA 1VJQA 4J9SA 2Y1IA 4YY3F 5K8NA 3AB4B 3NCPA 2MSSA 4IRCA 1WF2A 4NEYA 4C2MA 2AEFA 1TK0A 2XWYA 1I94J 1IKXB 2VJVA 4DS5A 3QSYB 4DV7F 1REVB 1EP4A 4ANEA 1IVZA 2OELA 3MD3A 1VYAA 2W24A 1D9FA 1UA0A 3NAHA 5H9FK 4KIAA 3A8KA 3CGIA 3DN9A 4JI8F 1TL7B 3G8SA 4AXJA 5KFCA 2UV8A 1G4CA 4WK3A 5IZHA 3VV2B 4UQGA 1GEHA 5HROB 3BN7A 4DWIA 4OLOA 5ETLA 4WFNQ 5DM7Q 4ED3A 2KVQE 2V4JB 1LW2B 2FLPA 3MMBA 1FVSA 2UZAA 3RUBL 4K5RA 3HKWA 4C3MA 4Y2IA 1R0AA 1CC8A 1ZZNA 1LKZA 3M7VA 3POTB 1ZM9A 2CG4A 3LP2B 4TXSA 3CD0A 2J0XA 3G6ES 4Q2LA 1HD0A 5DGAA 3MM6B 5LOQA 3KHHA 4NCBA 3J81U 4GVBB 4CLLA 4M5LA 4PKDB 2NPIA 3G2XA 1FI4A 4RUCA 4FP9A 3T9ZA 3QT8A 3RU0A 5I3UA 2XULA 3CEDA 4CLFA 1NK7A 1VK3A 3J80Y 3FCVA 1RXOB 3I55S 1CJKB 4TQRA 2ACYA 1MW7A 2RHQB 4ID5B 3ZTRA 1NK8A 5E7OB 4KY3A 1DARA 3B4DA 3HK2A 2VA2A 2V68A 2VU5A 4W90B 3N5BA 2YH1A 3MPWA 5A6WA 4I6YA 1T9XA 1OYEA 4Q0BB 2ZH8A 3C14B 4ECUA 5CYQB 1FJCA 2RJZA 2X3DA 4YR2A 1S48A 2YKNB 2JLGA 1S0VA 2DBBA 3ZTPA 1N6QA 3RB3A 3Q23A 3MXHP 3C6UA 2LEBA 3BM7A 1YG0A 2ZEJA 1DBDA 4RWWA 3CJKA 4OX8A 4JI7F 2RKIA 4URQU 4DV5F 3MI7X 2OP5A 1NUEA 4YB6A 3OT9A 1EB0A 2JJ4D 3W9JA 2R2TA 1ZM4A 3BQ2A 1Y3KA 2W4CA 4O0IA 2UUTA 4MTPA 4A8KA 2FY1A 3TZZA 5D6GA 2VQFF 4K0KJ 4B9SA 2IRXA 1UVKA 2H9ZA 1KQSR 1FRIA 2KN4A 3NCQA 5FIIA 1S6QA 2ZE2A 4LBHA 3ZTQA 2BDPA 3L95X 1N33F 1U4BA 4OHYA 1S10A 2WHOA 2HFOA 4KH1B 3DRYA 3N28A 1KTQA 2JC0A 3OTOJ 3ONQA 2GMLA 2W2OP 2R8HA 4G1IA 3BGLA 1FXDA 2VFTA 3ZZ0A 1RQ0A 3DU5A 2MQQA 2RH3A 1RT1A 3CPWR 4DV6F 4Y0FA 4LF8J 3X1LB 1S12A 3P8BB 1Y5NB 3Q83A 5CZXA 2XZTB 3LH2S 2LQJA 3V4IA 3HFVA 2QZ8A 1HR0J 2NSBA 4ANDA 2MKHA 3PJXA 1M5VC 1LWEA 3R5JB 1PBAA 2ZH2A 2LXUA 1KVJA 4MFBA 3OTEA 3UR3C 3TI0A 2K2PA 4Q8EA 3HHLB 3HFKA 4IRDA 2IA0A 3EVMA 4F3QA 4EU0A 2XYGB 3PYEA 1RT3B 3KLHA 3J81j 4TLQA 3UCGA 4UZCA 2VDHA 3W62A 1I3OB 2I8EA 2P9GA 2B9XA 2HHHJ 2AGOA 3OXLA 1RAEB 4DV3J 3SSRA 3BDPA 2BQRA 3DGVA 1WOPA 2KRRA 1SIZA 1S1XB 2CADA 2XMAA 4J9UE 4DV7J 2YNHB 1FKOA 3PRBA 1XQIA 4HDGA 2CQ0A 4B3MF 4I2QB 5JMNA 5KFIA 3LOUA 2JSXA 4RU2A 3D0HE 4OYAA 3CCVS 3CDUA 2PFFB 2FHMA 4I68A 1N32F 1BQMB 3KK3B 3V2UC 1H2VZ 2PFDA 2VONA 3PYDA 4P71A 4MIAA 2V2VA 3A3OB 3HZGA 2VFVA 1LEOA 3R1HA 1VQ4S 3OR1A 1U2CA 4USHA 3CC7S 3OHAA 5L1IA 4BLGA 4CI0B 2CQ1A 4WTOB 2C2DA 5JJBA 1UVJA 3I5BA 3B82A 1SL2A 3TUPA 1HKAA 3T5LA 2C22A 3R5AA 1S1WA 1T03B 2OPSB 3FJ2A 2GVDA 4QR0A 5CYMA 2E5JA 1VHIA 3K5PA 5F8HA 4KHPF 3M8QA 3Q0AA 3LPYA 4USWA 2Y8WA 2BX6A 1VQ8S 2LFVA 3WC2A 4DV2J 4UF4A 4QWDA 4W98A 4ILLA 1NKBA 2LVWA 2LU1A 5ETVA 3ZXWA 5DQGA 1S7HA 2OFHX 4HT5A 3KDNA 2VPZB 3THPA 4CLUA 3GJQB 2MLZA 3OLAA 1EZZB 5K8OA 4B3TF 4TQSA 1KSPA 1APSA 2D3O1 4WBFA 5ETNA 4IO1A 2XCPA 1XWLA 2NZ4A 2HHVA 3LP0A 4EO8A 4YUDA 3D6MB 1RLDA 2DH7A 2HWHA 3KOAA 1X8DA 2DO4A 3L3CA 3OFGA 3D6TB 4CZCA 2R3VA 4I67A 4LIWA 1UKUA 1M0SA 1WD6A 4IDKA 2H54B 1RTHA 1KLNA 4JI7J 5H9EJ 4QWCA 1N5YA 3IWXA 2G2YA 4O3RA 4DU8A 1RB0A 3CXCR 5E3CA 1QUVA 3D2WA 1YRTA 3J7YI 3TARA 1O5JA 1TK5A 3N6NA 3GG1A 2LP4A 3MEKA 4WJBA 2ASLA 4RW8B 2Z2YB 4TY8A 1SC3B 2KHCA 3AHPA 1N5SA 1N33J 3FK4A 2HFZA 3IFEA 4KO0B 5KG4A 1KFSA 3U1LA 2DO0A 2VHGA 3S6EA 4ZN1A 2E9ZA 2YTCA 3P45B 4QIEA 2DPJA 5HK4A 2G0IA 1X5OA 4DV1F 3JTNA 4WP3A 4B9UA 2HEKA 2J0SD 2MZ1A 2KXFA 4XK8C 3P4UB 2PN6A 1ZZFA 2DY1A 3PNIA 2ALYB 5IT9U 3ZZPA 2VKZG 1IKVB 4DR7J 3QO9A 2D3ZA 4NOHA 1Y0HA 4F67A 4R8UA 1HL6A 4U8VA 3BH6B 1ZS6A 1RHUB 5BYQA 3NCRA 1XIQA 2KYZA 1C4AA 4JV1A 4KJIA 2E5LF 2VBZA 2QL7B 1MU2A 1U24A 2FDNA 5EDWA 2ERRA 4NMXA 4QU7A 2UU9F 3UN2A 3CE8A 3EXCX 2PT0A 5M2PA 3QPIA 1T94A 1I5OB 2GGPA 3HP6A 1QUPA 4ZPVR 3NOGA 2DPIA 2YQ3A 2WZ1A 4BHQA 4OJHA 4YR0A 2J6UA 3CCWA 2DNKA 3TO8A 4FPRA 1EETA 4O3NA 4L75A 4B3MJ 4UZBA 5CA5A 4CO2A 3D1OA 5CXTA 3KK2B 4DV4J 1VRTA 2P2CB 1HWLA 1WC5A 2XNQA 4DS4A 3TQ1A 2FQQB 1N32J 2V2KA 2NYIA 4TU8A 3M6XA 4KR0B 3J7ZT 3KUHA 1KS2A 3MM8A 4A8SA 5GAGI 1DAXA 2B4OA 3TP2A 3Q8RB 4DSKA 3C46A 5BXIA 3CJ5A 2EVZA 2YPZA 2A2CA 2VODA 2H5IB 3PO4A 1SUQB 1UETA 2I2YA 2XZWA 2YKAA 3OL8A 4IR1A 1UWAA 4URSA 3EZOA 3UDEA 1TK8A 4ZA1A 4LSNB 2EXUA 2EC0A 1F2HA 1V5IB 1QE1A 4KV8B 4KHPJ 2M4MA 3W5ZA 5IT4A 4PXEA 1PGZA 1VK8A 5KFLA 1SC4B 3BF4A 1J2VA 4B3SF 3PR4A 2OPQB 2GVZB 2IA6A 1X4HA 4KFBA 1TFWA 4CO0A 3HDSA 3LA0A 5DDRC 3DDKA 2MHEA 4DCOB 1S6UA 2FVQA 4C8MA 3WBZA 2ZWOA 4IKAA 2IM3A 1UEKA 2LQ9A 2O01C 4ZP7A 4OYZA 1X4CA 1J5OB 4Z2XA 1RT4A 4UT4A 4UUWA 2P6TA 2V94A 1H3DA 4ZVHA 2RS8A 4ECRA 1MMNA 2JFKA 4PPZA 1VQ9S 1Q78A 2VDIA 2D3OR 4ZJOA 4KRWA 1QSYA 3JS9A 4X4OA 4PG6A 1BMQB 3BN4A 5KFEA 4LR8A 2NCKL 2F3JA 1UPMB 5HVHA 4XO0A 3DRSB 2PA8D 2RF2A 1BQNA 2E5IA 1S4FA 2OH2A 1H0HB 1LFPA 2BYCA 4J7CA 4Y2AA 1K9MT 1NK6A 3J7AN 4NEZA 5M2UA 3WIVA 4PCQA 1FD2A 1TMMA 1TL3B 4P72A 4PG5A 4JUZA 5FLXU 1GMVA 1TL1B 2O3DA 3EE3A 3GJSB 2I6WA 4UUXA 1ITPA 3PFOA 4B02A 4XDCA 4C4WA 3UNYA 2IM2A 3SQGB 1VQLS 1T02A 1KR4A 4ZPTR 5FD1A 3PJ9A 1RCXB 3MMAB 2UV8G 3BJYA 4DV1J 3ULHA 4LF5F 2CAJA 2JX2A 3TAPA 1HBMA 2XEXA 1CQMA 4HKQA 2H1YA 4WFYA 2IC3A 4USUA 2D9OA 1U1MA 4IH6A 3GSDA 3KG0A 3G87A 3TWZA 4GC6A 5EGYA 4X65F 2A2DA 2E5LJ 4QWAA 4ECQA 2HQCA 3UN5A 4HHHA 4X66F 2I5JA 4Y2CA 2KT3A 1S9GA 5H1SV 4USVA 3BBFA 4CT9A 1X0PA 5L8RC 3UD4P 4YEAA 3HLUA 4C48A 2UU9J 2DCUB 2WOMA 1JKHA 3B6BA 3K5OA 4PUOA 4DQRA 4OZ5A 5KOWA 4X4VA 1S9EB 2WCXA 3DLKA 5J2PA 4UOFA 1RWUA 3A12A 4DR2J 3MHYA 1RAJA 2HNYA 4MKAA 1MSWD 3MFIA 5KG3A 1PBUA 2CZVC 3GV7B 1WOOA 3MURP 3VR1A 1FDBA 3W5YA 4FDFA 5JVHQ 2HBRB 1T9UA 2V8DA 1U6BA 3C8YA 2A1BA 4JYAF 2FJVA 1YJTA 1RA6A 1OO0B 4CM0A 3C16B 3IRXA 3GFXA 4LRFA 4J9RA 2Z2LA 2AHOB 3SSQA 3U7JA 2XHWA 1TVRB 3RRHA 1F5BA 1S76D 3I87A 4OZ3A 3K2YA 1L3VA 4NYOA 3MR7A 4A8OA 2BMBA 4QPXA 2LDIA 1H98A 2BACA 4AE5A 3QT7A 3TUJC 4WKYA 1EARA 3FEXB 1TV6A 2VASA 4LUBA 1U1PA 3KG4A 3TEGA 1K0VA 3M32B 1X31C 3NGSA 2CQBA 4LVNP 3MZIA 3NGDA 4RW9B 1NSQA 3TA1A 3UDLA 3SFGA 3EJMA 1VISA 4HACB 2DRAA 1V9OA 2BJ8A 4KQZA 4B3SJ 3F41A 4JV0A 3OTCA 4MK9A 1IM4A 4DUZJ 4C98A 5HO4A 2FVPA 3H2VE 2ZH6A 1YZ7A 2OHDA 1RHKB 5D3GA 2VG5B 1TR0A 4ZHRB 5AJ3F 1R8AA 1TKTB 1B99A 3P5BP 2VQEF 1IJFB 4N56A 1JLGA 1NHVA 2DGSA 3PACA 3NWRA 4YP3A 2IYIA 4HI2A 3S1TA 3I32A 1LWFA 3D0IE 2LQBA 2QE5A 2DGUA 5CD4H 2D69A 1O51A 2QN6B 1T7PA 4RW4B 1HHSA 3D54A 1YRUA 3SFUA 2WBMA 1B7YB 1U8SA 4WE1A 3FEZA 2AD9A 4GKJF 4NLVA 2JEIA 3PFEA 2OLWA 5K5MA 4H4MB 1ZM2A 3OBIA 5D77A 5IXUA 1QAYA 2BJ9A 1NK0A 3I5CA 3M8PA 2EBEA 2R7OA 3CB4A 1IBCB 1RAGB 5KFTA 4BS2A 2YNGB 2G0CA 1X9WA 1P8GA 3R5BA 3TAMB 4HYKA 2IMOA 2VICA 5C5JA 3VF0B 3LANA 1ZAVA 4OI4A 1WSVA 3M8SA 3MTJA 4HDHA 1T11A 4LF5J 2E44A 3D3BJ 3IG1A 3EM1A 3KJVB 4WP8A 1LV5A 2VFUA 5C24B 2CNKB 2CQ3A 3AA9A 2MKJA 4OZJA 1XK8A 4CH0S 1RAFB 2WBRA 4XAKA 1A0OB 4J5OA 5C42B 2UVRA 2CDQA 4X65J 4YFUA 2HS0A 3PR5B 2DJWA 4N77A 1DJ0A 1NJXA 2N7YA 3H8YA 4F4YA 2FPHX 4TYAA 3OJUA 4LFCF 2ZC3A 4V1Ak 2PDAA 1D9AA 4X4NA 2RUSA 2ZOMA 1WG1A 3GYNA 2DYAA 4CH7A 4ELVA 1QSSA 1G3OA 5CD4A 1NNDA 1RTZA 4KE5A 4DLEA 3I4HX 2CWKA 3KLIA 1H6KX 2MEWA 3M1VB 3QGHA 4LFAF 1KVIA 3U1NA 3WIUA 5F8JA 3HHLD 3DGPA 2X1FA 2H48B 1JLCB 3GJTB 2BXJA 3DLHA 4QR2A 3U02A 2E5HA 2GHVC 3MECB 3P49B 1AB8A 2ZBRA 2VUGA 3OUYB 1Y5LB 2ZUGA 1UFWA 4LF1A 2ZD1A 4M5GA 1FJGF 2HG4A 3H4DA 3I0RA 3G82A 5B08A 3BGRB 2EK6A 2R4FA 4ES1A 3QAUA 2GV1A 1Q8LA 5G0RB 4IOCQ 2VA3A 3JAMU 1JLBB 4ZVQB 1B3TA 3DI6A 1OJ4A 1Y7PA 5GAEU 1KC8T 1U1OA 2BOPA 3CD5A 3PTWA 3D4JA 1HW8A 5HN0A 1NZAA 4PZVA 1FJ7A 1BWVA 4QIWD 4RBVA 2XS7A 5HANA 1YK9A 1SKUB 2DIVA 3P3DA 3R97A 5A8WB 3VGTA 1XBWA 2UUWA 2QT7A 2X7IA 2XSFA 1XJWB 2JOQA 4DR3F 2BEFA 2EFQA 4OMFG 4WYLA 2Z8QA 3ICLA 3OD2A 3KFWX 2WSEC 1R7IA 1DQ8A 3DYAA 3CD6S 2OMLA 4TVAB 4X4RA 1LFWA 3M2UA 1IKWA 3GU0A 1RAIB 2HQGA 3VQTA 5GMKa 4RPFA 5DDQC 2LDYA 4J9OA 4NWBA 5KT6A 2XYHB 4F8RA 1HMVB 2AYMA 1SJ1A 3QJJA 2JDJA 3RB0A 1KP6A 1MROB 2ZWPA 2CNOB 2CQCA 4USIA 4DSLA 4RUHA 1Y5IB 3QT5A 3HVTA 5ETQA 5D78A 5K9FA 3GV5B 2OAUA 2ZBPA 4O44A 4NA3A 2PI5A 4ZVUB 1C1CA 3A8IA 1U02A 2BW7A 2XI2A 3MEEB 1QD1A 2ALZA 3M2VA 1RHRB 1YBUA 2MJUA 4C8ZA 1HBUA 4QIFA 4RL1A 3PEJA 2FZGB 4MMOA 1YJ9S 2BV3A 4GKJJ 5BR8F 4G65A 4ZP6A 4G1PA 4ECZA 1OPIA 1FKPB 5T41A 2Z4PA 2WVCA 2BVZA 3BSAA 3HD1A 1HYSB 2DNNA 5C2GA 5A8KA 2HIYA 3TJ9A 4D3HA 2XSJA 3DRXA 3CCQS 4OIXA 3US5A 4JOUA 1G1XA 2DK2A 1HQUA 4ECTA 3IWNC 4UW2A 4YDXA 3Q2TC 1MG7A 4ECWA 2WONB 4MKYA 4ZP8A 2UXBJ 3RJMB 2YX4A 3N01A 2DEIA 4A8QA 4IOBA 4H4OB 2HRUA 2M52A 5D0RA 1KHWA 4PWUA 2XS2A 3K0JA 2GS8A 2LLZA 1S0MA 1HPZB 2AYEA 2UUBF 2AJQA 4NLXA 5T7LB 3BBBA 4HT7A 4U96A 3LWMA 1XERA 4DPXA 4KGZB 4AFFA 1RTIA 2LQ5A 4DR5J 2CUYA 4WIIA 3GYGA 1F1BB 2CZ9A 2YBVA 3QQCD 5J2MA 3GR0A 3NEKA 2BJDA 1W26A 3M9OB 1RLCL 5J1PA 1F60B 5A0YA 5LM7E 2UXCF 4P7VA 2CXEA 2RD5C 2UVUA 2AMCB 2BRKA 3FMWA 4LFAJ 3CMAS 2HQFA 1E6VB 2V9WA 1FXLA 1S1VA 1F9EB 1UCNA 2CG8A 3TVKA 3I5AA 5DETA 2WSFC 1AUSL 1XR7A 2B4VA 3BH7B 4CP5A 1X60A 1F6TA 2GX8A 3SYZA 4AQYF 2GMHA 1EP4B 1JXLA 2BQUA 1M1KT 1PJ5A 2A6MA 2E9RX 1Z2ZA 3DDIA 2K7JA 4L73A 4E8UA 2CFXA 2GMJA 5LJ3Y 4OJ1A 1WDDA 3K57A 2W7AA 5IC4B 1LWCB 3OR2A 3T1AA 3ISNC 1Y11A 1EX8A 5FDLA 2G9OA 1QAIA 2HQIA 4HI1A 1SV5A 1S6PB 2YKPA 1IQZA 4EO6A 2MGZA 3G8QA 2QYCA 2VG7B 2YKMB 2XC9A 1I6JA 3KMSA 1MWZA 1YJVA 4XIUA 4DR3J 1T9YA 2Z2ZA 3R1LA 5KT5A 4IRKA 1WHWA 2Y9HA 2EW9A 1GQEA 3VGVA 3H59A 3P96A 4JI2J 1IKYA 3IN5A 1VBZA 3DKDA 3FVYA 5D15A 3DLBA 2ZNZA 2ADCA 1QLNA 5I3UB 1HHQA 1RCOB 3NMRA 4CCHA 4AT1B 1FWKA 1B70B 4KH0B 1VQPS 1VI7A 3LAMA 3HHDA 2EPIA 3SMZA 3ENVA 2FJDB 2W9AA 1UVIA 1RTDB 4RO0A 1WTBA 4LFBF 2RILA 3FSXA 1PAUB 2Y8YA 2AEMA 3D5MA 5B7WA 3LP1A 2NLWA 7FD1A 5KT3A 3N79A 1N34J 3GFYA 2B9WA 3MEDA 3JSMA 2HAIA 4WYWA 1S79A 4URGA 3UVJA 4DCJB 3R3TA 3DLGA 3IM9A 1N6QB 1LK7A 5ETPA 2QTWA 2WVEA 1G7CB 1D09B 1FK9B 2PEBA 4LSLA 3W63A 2UUAJ 4FNHA 2RKIB 4ICLB 3BYRA 1LNQA 2ABYA 1NJZA 3DLEB 6AT1B 3VAMA 4F2RA 4WZMA 3C6TA 4N41A 5EN1A 1HBOB 2J0QD 4NYZA 4OI0A 2YWEA 2KJVA 1SKSA 1FRKA 1NJIT 2OEJA 1S6QB 5ETTA 3MM7B 2KU7A 1RSCA 5F8MA 3H7HB 1P27B 1SPBP 2Q3PA 2MZRA 4P2SA 3QGPA 2DCLA 3AT1B 4MH8A 4A46A 4YHHF 2ZJQQ 4X62F 3NGTA 3QATA 4X4PA 3T1YJ 3NAIA 4DCPB 2DISA 4QWEA 3DRRA 3TANA 3QAEA 2Q6BA 4IR9A 3E01B 1GXUA 2IVMA 1RAOA 2B56A 4GKKJ 3CMQA 4DQSA 4MJKA 1D0EA 1ZAXA 5E3RA 5C25B 2KFNA 1IKXA 2N4DA 1KKHA 3W2VA 1FX4A 2DXFA 1REVA 1FDDA 3MM9A 4C0BA 1R0BG 3F56A 1DTTB 4ZS6A 5CYJA 2E7XA 4O0NA 3MPUB 2HW3A 4NLQA 1N48A 3W1YC 3LTOA 3MM5B 2MMYA 1TL7A 2A10A 2YKQA 4FVCA 2IBOA 3C15B 2B51A 4JV2A 4DX5A 1FT8A 3F0NA 4ZLJA 2WW8A 4FF3A 4KB7A 2FJEB 3B54A 2ZVSA 2EC2A 4TN2A 2V4JA 1LW2A 3SDEB 1RHJB 1U7LA 5L9XA 2XZDB 2HHSA 3IXQA 2JHEA 4O4RA 1NSKL 3GZ7A 1E6YB 3I6PA 3POTA 3VVUA 3LP2A 4F36A 4EZ9A 5AXLA 1ZM3A 2VFSA 5KG5A 1DQ9A 4I6AA 3SIPB 2W7PA 3T9NA 3O8WA 4KGKA 1YVFA 4KYZA 1CSJA 5E3QA 2GHWA 4DI6A 4ZPAA 1HWIA 2D74B 5IC6B 1VS3A 4TYBA 2YWWA 1R8PA 5THWA 3E2EA 1CJKA 3W60A 4NXNF 4ID5A 4KGVB 3SQOP 3DM2B 1SH0A 3KK1B 2QYGA 1S49A 4DMZA 2W2NP 4NLSA 1LW0A 3RRGA 5D4LA 4Q0BA 2HFNA 4J9KA 3C14A 1BLUA 5CYQA 4Q45A 2E7VA 2ZITA 1NJWA 3BS9A 2RRNA 4CM2A 4EUVA 2YPYA 3CSKA 3CUNA 3KDOA 1NK5A 3GPAA 1PYTA 3AJ1A 3MCMA 3HM9A 3C66A 1HNXJ 1P9YA 2VH7A 1D9DA 1Q79A 4NLWA 2AX1A 2RSQA 1SJFA 3M8QB 2FHKA 2CQGA 1K0TA 4WF9Q 5F8GA 5KFNA 3J7Z5 2OJ3A 1FD8A 3IGNA 1HNVB 3QLHA 1LWXA 1RYSA 4DOZA 1BY9A 1C0TB 2HBQB 1HI1A 3BR8A 3N9UC 3NP5A 4LMZA 2F63A 2AV5A 3OXFA 5GVQA 3PRVA 5CCMA 1WG4A 4LFBJ 2F9DA 3GILA 3FMBA 4MAKA 3RW6A 3WHIA 2M7SA 5J1EB 3LP0B 1UZDA 2HQ3A 1H72C 2ZUAA 3PIPQ 1VMBA 4C3LA 3VGSA 2DNRA 4K4UA 3MPYA 4DDFA 3MAAB 4Y34A 2PO4A 1NM2A 4C7QA 4ZPDA 2HGMA 2H51B 4IDKB 3IRWP 1HBNB 1RTHB 5BJRA 3THVA 3JQKA 3ISZA 2K8GA 1FRJA 4DN9A 4OI6A 1NZ8A 3UW1A 4EEYA 2IY5B 3BYPA 2J76E 1H7WA 2RDIA 2KFYA 2CJXB 1YJUA 2MQMA 2HZCA 2E9TA 5KG2A 1RT3A 3HT0A 1B7FA 2RRBA 3WDOA 3EPGA 4NPOA 3RYLA 2ATCB 2G4BA 1QY7A 1HFEL 4QYRA 4Z7YA 4JV5J 2W9CB 1S99A 2A3JA 3GV8B 2CNLB 1XMOF 3CNQP 4J37A 4DL5A 3PW5A 1SJ3P 2CPZA 2B6AA 3JXOA 2XLJA 1S1XA 1I94F 3MR6A 4P10A 3RW7A 4IH7A 1NPRA 3RTVA 2YNHA 3M8ZA 4LF7J 4I2QA 3PZPA 3F44A 1H2UX 3NRBA 1IQTA 3I9ZA 4ZOSA 3MPDA 4ZKAA 2MXYA 2GCFA 1QJHA 3IS9B 4ZIWA 3ET6B 3KK3A 4EYIB 3IAS9 3UD3P 1ICEB 1JJHA 3PW2A 1UTAA 1S97A 2VC1A 4B9LA 4WZQA 1VR6A 1NU4A 2L48A 1FDNA 1U25A 2IJNA 4I69A 4DF4A 4FYXB 4OJGA 4CNZA 2E1AA 3PX4A 1R6YA 2OD6A 1S57A 3ITHB 4K4WA 4FNIA 2RIJA 1MNEA 4RZRA 1WJ9A 3BGFA 3B4MA 3LQVA 2JVOA 3D3CJ 1YLXA 4DX7A 1T03A 2OPSA 1JXVA 1S4EA 1UJ5A 3CW2C 2BRLA 1CJTA 3MMJA 3N6LA 2Z2MA 2HK2A 3G9CA 3CDEA 3ZNJ1 4YS2A 3JSBA 3QWPA 1YDLA 2XMWA 3KKFA 4LF4J 3AJ2A 2EG1A 5CAAA 5KG6A 1ZA2B 1EHWA 4U6PA 3L4BC 3FNNA 5I42B 1RWMB 4NXNJ 2KM8C 2XG8A 4HH0A 3MWBA 2GIFA 1U45A 2BKOA 2QSFA 5A8RA 2R7TA 5EX3A 1PO6A 3SSSA 1TQLA 5LL6d 4DR1J 4ITSA 5DGBA 3T41A 4F2SA 1CJUB 3QFWA 2B0GA 5IFMA 4QCLA 2V0NA 2M9KA 3S8SA 1L3SA 4MT1A 4I0WA 1UPPA 1SKWA 2HPUA 4ZCMA 1IBMJ 1QVGR 1WKKA 3FSIA 2Q79A 3ZZUA 2R7VA 2CPXA 4K0KF 5E2QA 3AJDA 4RW8A 3BKUA 1RTJA 2V67A 2J0WA 3PW7A 1FWPA 1U1KA 5HBMA 1RWWB 1GFWB 4KFBB 1M5SA 4CO5A 2V2QA 1T9TA 2RAQA 2XWXA 3EDQB 4KO0A 1WUUA 4M5JA 5G4DA 2MB0B 5CABA 4ILMA 1TFYA 1NSPA 1AA1B 1H38A 2DHXA 2XMMA 1IM6A 4TU7A 3FFIB 2ROEA 1RABB 2O66A 4OLPA 3GP9A 2RU3A 2OTJS 4LF8F 2HVDA 1WORA 5KT7A 4BC7A 3NXZA 1X4GA 3C3LA 2HHPA 2YX1A 2BOAA 1YBAA 4RUBA 2BE7D 2L9DA 3D0GE 3UQSA 2HBYB 1IKVA 4TKTA 2HIQA 1UAWA 4ED8A 1K47A 1FNXH 3FBEA 4BWJA 1DRZA 1VCTA 2W4PA 3BZQA 1FJEB 4NLRA 2DR9A 1XNRJ 2E7WA 1A7GE 3M8YA 5I3PA 1KONA 3H4BA 4WIQA 2HLTA 1UMJA 2G0JA 2XCAA 2YY3A 5DM6Q 3ILLA 5GAGU 4DV3F 1U8WA 1SL0A 3M6UA 1AFIA 4A8WA 3HF5A 1U1QA 2X1AA 4U9RA 1BD6A 3NS7B 3M30B 1UVNA 2NUUG 2F4VJ 4OL8A 5KFVA 1U49A 3R5GA 2ZJPQ 5MAOA 4GRSA 1MN9A 4ILRA 4ZDNA 5LT5A 1TAQA 4HLBA 4G6VB 2DEJA 4HL9A 2DNZA 2R8JA 5EUHA 3CF5Q 3CDAA 4R0EA 1JK9B 4B9MA 1JLQB 2C42A 2K3KA 1C4CA 2DR5A 4WKRA 2E1PA 1CJVB 3OXGA 1HWUA 1SKRA 2LA6A 2DGOA 2YQ1A 1N0VC 4P6QA 4OX6A 4K7QA 2DNPA 4C8NA 2AF6A 3S01A 3HD2A 1S9GB 1SUQA 1X4AA 3OL7A 2B7BB 4NLPA 1YSJA 4AXIA 1FFWB 2GC8A 5BYRA 1GMWA 8AT1B 2DNYA 2WOMB 1R3NA 4PUOB 5K8PA 4DN0A 1FFGB 3HSDA 4LSNA 5J2PB 3HJVA 4RW7A 5E5NA 2AGPA 3E51A 2Y1JA 1R8HA 1BQXA 4DV2F 4Q8FA 1NLKL 2J9DA 4ZPWR 2MSTA 2OPQA 4QPTA 5D0EA 2DGVA 3GIJA 1S1TA 2UUCJ 1VQSA 4DPOA 3IRXB 3DU6A 1KHVA 3L09A 1JX4A 2ZH9A 4WU3A 1O0PA 4ZJLA 4M5DA 3X3UA 1ZBTA 3IM8A 2AEJA 3WC0A 3FQLA 2ZC4A 1J5OA 2HHXA 3A3PB 2FGOA 1EAYC 1KVKA 2K1RB 4LREA 1C2PA 4ALZA 2HVZA 3R7BB 4X4UA 2L9NA 5AE3A 4G3IA 5L46A 4RKUC 2XM3A 1XMQJ 5J2NB 2CRLA 2G2ZA 3R9LA 3RB4A 3D1QA 4K4SA 2ZZNA 1HNIB 2GJ2A 3DRSA 5AXKA 3EZ5A 2IYGA 3QRQA 1TP7A 3GR1A 1X9SA 1UA1A 2NXEA 3FEYB 2DGWA 2M88A 4X84A 3V81A 3TX0A 4M8LA 5HJYA 2FHJA 3CCSS 4LRCA 5D3GB 1K8AT 1GT8A 2LCWA 4F4WA 2QLFB 1TL1A 2XMKA 4M94A 2XYPB 2IM1A 1AROP 2C3PA 4KSEB 3EX7B 4X2BA 4FYDA 1P6TA 4OHWA 2VBXA 2V5HG 3PIOQ 4YN3B 1WTFA 2M0GB 2Z0GA 3SQGA 1JLEB 3BR9A 4PQUB 3HSJA 3AXKA 3KLFB 3BQ0A 5DRKA 4ZPBA 5B09A 5GAHI 2DHGA 4KKOA 1ROFA 4DXLA 4NZ7A 3BKTA 1VIOA 4F04B 2F8HA 3RGIA 3AAWB 2BE2B 3VAFA 5D0GA 4DR7F 1MMDA 2BR0A 2YNFA 3DXBA 3PDNA 1PYSB 2DXDA 2AYBA 3EXYA 5B0AA 3MR5A 2ZHOA 5HMWA 2FYXA 3V5RA 3AFGA 2HHTA 1U48A 2HHQA 3GFHA 2O5DA 3KUGA 2FJBB 1XTZA 2HWIA 4I6WA 3PW0A 1NJYA 3V6DB 2LECA 4C8YA 2AZ1A 1S9FA 3V4MA 5B0FA 2KH9A 2NS1B 4Q43A 1LXJA 4LJMA 2QGFB 2HNZA 3IG1B 3O44A 3LPEA 3MD1A 1N4LA 4DV4F 1GTEA 1F9HA 2CJYB 1OMSA 3NBPB 2J8AA 3C16A 1C1BA 5IM0B 4QW9A 4RLEA 4F4AA 2VF3A 4ZVTB 4DL7A 3UO0A 4MYTA 2HHUA 4K5SA 2RRAA 1GMUA 3VAJA 1TVRA 3OFEA 1OY6A 2Q43A 4H4KC 1EIYB 4ES2A 4FXDA 3OTBA 3VQSA 1U47A 1NKCA 2Z58B 1F3FA 4PEOA 5DLFA 2QLJB 4QW8A 1VQOS 1KD1T 2KG1A 1IWGA 3W2WB 2CPIA 2QA4S 3MUVP 2W9BA 5LMUJ 3T1HF 1KQGB 2NUHA 1V6HA 3C19A 5KT4A 3PXGa 2CQIA 3M32A 2QMUB 2MZQA 4ED4A 1FDAA 3MR3A 2NXCA 2EKNA 2XGQA 2HAFA 1TKDA 4AL5A 2QFJA 2DNOA 5L1LA 1UVMA 3PG9A 1G2EA 1HWKA 2CQDA 1SC1B 2PMWA 5F41A 2F9JA 1W25A 1SH2A 2D7SA 4LBIA 3BQ1A 2QV6A 1TKTA 3JB9k 1OSDA 2ZBQA 4DU7A 2VOPA 1HD1A 1LXNA 2KHDA 3DOLB 1QTMA 1TUGB 4N47A 2GQQA 3IC1A 3P5TL 2B8QA 4NCGB 4IUFA 3GFZA 5KFYA 3R6LB 2OPRA 2XMTA 1NCLA 4D3GA 2XO7A 4KHMA 1YGYA 2P9CA 4O3QA 3GE9A 1T05A 4JP8A 4I64A 2ZJRQ 2M8HA 1IBLF 5I3QA 2V6AA 1KRPA 2KJWA 2FTRA 2D3UA 3KNAA 1P9QC 2VPWB 3DYAB 4KPYA 1WG5A 2HWTA 2WVFA 1IN0A 3MOJB 4H4MA 5KFPA 4B3RF 4UY8T 1IKWB 3RZAA 1PC4A 1IBKJ 1WF0A 3JYTB 3QGIA 3CCRS 1PAEX 1UFKA 4DQQA 4ED5A 2MQNA 2YQ0A 2YNGA 4P74A 1S59A 2WRMA 1DLOA 4WU2A 2IAJB 3NGRA 2RDJA 1VQ5S 3RAXA 4FBUA 2OEKA 1S72S 3LF0A 3CCLS 2KO1A 1C1CB 2LMIA 4PYAA 4YOEA 4IQXA 2OPPA 5KFDA 3ZC4A 3KJVA 5HP1A 2EFOA 2R8KA 3M2VB 5C24A 2P8IA 3R7SB 1RJJA 2XLIA 3CIMA 3DLJA 1HBUB 3K8VA 1Y3JA 1KWMA 2B4UA 3IAM9 4EBCA 2KG0A 5C42A 1WOSA 4I7FB 4CQ1A 3IWLA 1YRXA 1UJ4A 3ETOA 1GH8A 1RGVA 1HNZF 5KFAA 2KKHA 1VBKA 3FSYA 2XY6A 3T19A 3H2LA 1J27A 2WB4A 2DNHA 2CQ4A 3S7RA 3CJ3A 3K17A 1U0SA 4WXOA 2Y0SD 5B0EA 5CCLA 5A8KB 3PCOB 1QDUB 3FGVA 4B3OB 2HVHA 1NKEA 1Q4RA 5L38A 1AZSB 3UN3A 2ZH4A 3EGWB 2ZBIA 5F3ZA 3EYZA 4JI1J 1NK9A 2AKWB 3PYGA 1HQUB 4DR2F 1WHVA 1Q0NA 1JIHA 3M1VA 3O6QA 2BANA 1FXRA 4C8OA 4OV1A 3QZ8A 3AA8A 1JLCA 2WVBA 1D8YA 1UJ6A 3MECA 2ADBA 2CVIA 2HQDA 4OX7A 2HVIA 1N56A 3OUYA 3BSNA 2VV5A 2GJIA 3TA2A 9RUBA 4DG1A 4IFVB 1U1RA 3RBEA 1S1UB 4QR1A 2ILYA 1YZ6A 3BGRA 2MPUA 2ASYA 1VQMS 3UNGC 4ELTA 4PWDA 1U2RA 1WACA 2CQ2A 4X4TA 2PI4A 4J90A 2FIUA 4N8OA 1SJ4P 5HLFB 3HHLC 5G0RA 1PIEA 1JLBA 2DR6A 2IHR1 5A0YB 3T1HJ 3PRDA 2QLBB 3EMTA 3K5LA 3GQCA 4DZ6A 2VG6A 1URRA 2IBKA 2ZH3A 4X4QA 2PC6A 2FC9A 2EFPA 5A8WA 2DB1A 3PHEA 3AQPA 2GAHC 1PJ6A 2V34A 2L3MA 1S1VB 5DZ7A 5IV3A 2C3OA 5K20B 1AFJA 3CCMS 4KC5A 4OYXA 3ZZOA 4FS2A 3IBCB 2IRYA 3M2RB 4DZDA 4DUZF 4USMA 3EGNA 2AJFE 5A2QU 2F7VA 4HHUA 5ADZA 1HMVA 2BBEA 2EG2A 5H9FJ 2F65A 1UWBB 3NWGA 1AYEA 1JLAB 5IWAJ 2XO6A 1DTQB 1F2GA 4NLUA 2M3DA 1ZPVA 2K06A 2GQ2A 3H5UA 4RJVA 1U0HA 2VFRA 4DUYF 2OSRA 4C11A 2B4PA 4M1KA 4Y00A 1VOMA 8RUCA 3R2CJ 5E0OA 5F0UA 4AD6A 1GX5A 2DH8A 4MIWA 2CNNB 3W9HA 5FDLB 1MLAA 4I4BA 4EGLA 2MZJA 2B43A 2YX7A 1RAAB 2DH9A 3TNVA 4JI0F 1J5EF 4OZ0A 3BDEA 1IBLJ 2VJUA 2VKRA 4FZVA 4DQIA 4I2PB 3G71S 4OYOA 5KTQA 4K4YA 2RS2A 2CPHA 1MWYA 2HGNA 1FRXA 1IKYB 2YNIB 4B3RJ 4XPEA 2BKNA 3CJSA 2KZZA 3FZBA 4YR3A 1JLFB 2W2MP 2HRTA 4KTQA 1FKPA 1D8ZA 1DFDA 1VRQC 3BO4A 4K50A 1UW9A 3TYTA 2XMUA 3NGUA 3W9IA 3EVOA 1RE1B 4F25A 3GG0A 3QGGA 4N7TA 1SH3A 3CCUS 1JJ2R 1BXNA 2C2RA 2KL8A 2QJ3A
chains in the Genus database with same CATH topology
3D3CJ 3J80U 1HNWJ 4LFAJ 4LFBJ 1N32J 4JI5J 5FLXU 4RJVA 1XNQJ 2UUAJ 4DR3J 2UXDJ 4OX9J 1IBMJ 2MQ8A 4NXMJ 4JI7J 4JYAJ 2UUBJ 4DV6J 5IT9U 4DR2J 3R2CJ 2HHHJ 4X65J 4DR6J 4LF6J 4DR7J 5AJ3J 2UXBJ 4JI6J 4YHHJ 4DV3J 4JI2J 3OTOJ 4X62J 1IBKJ 2VQEJ 3T1HJ 4KY3A 4B3SJ 1IBLJ 1N36J 4V1Ak 5BR8J 3JAMU 4LF4J 4LF7J 4DUZJ 4DV1J 4B3TJ 1XNRJ 4DV7J 4DV5J 1XMQJ 4DV2J 4JI1J 3R2DJ 2KVQE 4LF8J 4NXNJ 4X66J 1N33J 4YY3J 4DUYJ 1HNZJ 4JV5J 2VQFJ 5LMNJ 3T1YJ 1HNXJ 2UXCJ 2MEWA 4B3RJ 3IMQJ 1HR0J 4DR5J 4GKJJ 2ZM6J 4PWWA 4KHPJ 4DR1J 2MTLA 1J5EJ 4JI0J 4GKKJ 5A2QU 1FJGJ 4X64J 2E5LJ 2F4VJ 4KYZA 4HHUA 4LF9J 1XMOJ 4JI3J 4LF5J 3D3BJ 1N34J 4DR4J 3J81U 5LMUJ 2UUCJ 4B3MJ 4NEYA 4K0KJ 4JI8J 5LM7E 1I94J 4JI4J 3J7AN 4NEZA 5IWAJ 4LFCJ 4DV0J 2UU9J 3W1YC 4DV4J 2KL8A 4AQYJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D3C J;  3J80 U;  1HNW J;  4LFA J;  4LFB J;  1N32 J;  4JI5 J;  5FLX U;  4RJV A;  1XNQ J;  2UUA J;  4DR3 J;  2UXD J;  4OX9 J;  1IBM J;  2MQ8 A;  4NXM J;  4JI7 J;  4JYA J;  2UUB J;  4DV6 J;  5IT9 U;  4DR2 J;  3R2C J;  2HHH J;  4X65 J;  4DR6 J;  4LF6 J;  4DR7 J;  5AJ3 J;  2UXB J;  4JI6 J;  4YHH J;  4DV3 J;  4JI2 J;  3OTO J;  4X62 J;  1IBK J;  2VQE J;  3T1H J;  4KY3 A;  4B3S J;  1IBL J;  1N36 J;  4V1A k;  5BR8 J;  3JAM U;  4LF4 J;  4LF7 J;  4DUZ J;  4DV1 J;  4B3T J;  1XNR J;  4DV7 J;  4DV5 J;  1XMQ J;  4DV2 J;  4JI1 J;  3R2D J;  2KVQ E;  4LF8 J;  4NXN J;  4X66 J;  1N33 J;  4YY3 J;  4DUY J;  1HNZ J;  4JV5 J;  2VQF J;  5LMN J;  3T1Y J;  1HNX J;  2UXC J;  2MEW A;  4B3R J;  3IMQ J;  1HR0 J;  4DR5 J;  4GKJ J;  2ZM6 J;  4PWW A;  4KHP J;  4DR1 J;  2MTL A;  1J5E J;  4JI0 J;  4GKK J;  5A2Q U;  1FJG J;  4X64 J;  2E5L J;  2F4V J;  4KYZ A;  4HHU A;  4LF9 J;  1XMO J;  4JI3 J;  4LF5 J;  3D3B J;  1N34 J;  4DR4 J;  3J81 U;  5LMU J;  2UUC J;  4B3M J;  4NEY A;  4K0K J;  4JI8 J;  5LM7 E;  1I94 J;  4JI4 J;  3J7A N;  4NEZ A;  5IWA J;  4LFC J;  4DV0 J;  2UU9 J;  3W1Y C;  4DV4 J;  2KL8 A;  4AQY J; 
#chains in the Genus database with same CATH topology
 2FVC A;  3IR5 B;  2C2E A;  3I56 S;  3Q8Y A;  3HO1 A;  4NYP A;  2MQO A;  4NZ6 A;  1T95 A;  2IFX A;  4L3K A;  4CYU B;  1HQE A;  1WEY A;  2J7K A;  3VZH A;  4R5P B;  1TAU A;  4Y2K A;  4PAB A;  9ATC B;  2FC8 A;  4UOH A;  1T8E A;  4CLP A;  3I0S B;  3HHN B;  1HPZ A;  3UVJ B;  4B9N A;  1YQH A;  1RT2 B;  2DNL A;  3DLG B;  3T6J A;  5T7L A;  1TKZ A;  4LBP A;  1Q82 T;  4C8K A;  1T0T V;  3AD7 C;  4FBT A;  1HNZ J;  2LU2 A;  1GX6 A;  4RW6 A;  1CUL A;  3C6T B;  2RVJ A;  2DIU A;  2PGC A;  3DMJ A;  4OX9 F;  1FVQ A;  4ZVG A;  1RKI A;  1RUS A;  4HHJ A;  2PEH A;  5ETK A;  1NHK L;  2ZOG A;  5F8L A;  4EBE A;  3CT9 A;  2EI5 A;  4G1Q A;  2HMI B;  1YWX A;  2CPD A;  5EX0 A;  4ZVO B;  2HK3 A;  3SCK E;  2B8P A;  3NNC A;  3DRR B;  5D4N A;  2B5J B;  4RNN A;  2UP1 A;  1M5K C;  4P52 A;  2ZH1 A;  2OFG X;  4LF6 J;  1WEL A;  3SCI E;  4U8Y A;  3W2V B;  1KLM B;  3MM9 B;  1RAD B;  4DEZ A;  5KFO A;  4Q7A A;  2YWF A;  5B0D A;  2MDA A;  2AP6 A;  5DS7 A;  4F0H A;  2GNK A;  3MUT P;  3NGK A;  1N54 B;  4YDD B;  2VIH A;  4KBI A;  1CEZ A;  2BW2 A;  1JQG A;  1LWC A;  1EQ0 A;  1WC4 A;  2VL1 A;  4RNM A;  2H5J B;  2AYG A;  2VPY B;  4P7T A;  2P6S A;  4QYZ K;  3CJ0 A;  2MLX A;  1S6P A;  2FHO B;  3FCW A;  1NPP A;  3OV7 A;  3MR2 A;  2VG7 A;  2YKM A;  2CKW A;  4FPI A;  4LVO P;  5J2Q B;  2ACM A;  1PSD A;  3V6H A;  2IVF B;  3ILO A;  2RQC A;  2C3Y A;  3LWL A;  1RZM A;  2XQC A;  4WFA Q;  2BJE A;  4GMK A;  2PII A;  1AXQ A;  2J7W A;  1V5V A;  5KG7 A;  1Q1K A;  4P73 A;  5EHH A;  2QC3 A;  5AT1 B;  2IVY A;  1Q53 A;  1WC3 A;  1O6X A;  7FDR A;  1RTD A;  4ZN3 A;  4DUY J;  4JI4 F;  3K5M A;  2DTJ A;  3DOK A;  2KDO A;  2J7U A;  4CRJ A;  2WAQ D;  3KJF B;  3G86 A;  1LW0 B;  3D9B A;  3R8Y A;  1J5E J;  4JI0 J;  4OI3 A;  5FJ4 A;  4X4S A;  3EVW A;  2B9E A;  3PHT A;  1C0U A;  3Q8S B;  4LF9 J;  4Q2M A;  4PR6 A;  3ZNU A;  5ETR A;  1FES A;  3CD7 A;  3BO2 A;  3TR5 A;  3R7N B;  1RWV B;  1FK9 A;  3OSP A;  2FD2 A;  4OI1 A;  4ICL A;  3JQM A;  4L74 A;  1S0N A;  3DLE A;  1IWA A;  2YXL A;  1K44 A;  4BWM A;  3M05 A;  1HBO A;  3HMJ G;  1P1L A;  1RKJ A;  3TA0 A;  2OGU A;  3MM7 A;  3QLH B;  4F4Z A;  4A8X A;  2BM0 A;  4YQW A;  3H42 A;  3W7B A;  3R5C A;  2W7O A;  1R0C B;  2VB6 A;  2BJ3 A;  1WC6 A;  1WSR A;  4ZLP A;  3NG8 A;  2HND B;  3HKZ D;  4CDI A;  1SB6 A;  2N4C A;  1TUV A;  2UXB F;  5LSR A;  3E01 A;  2J5A A;  1Q5Y A;  3CJR A;  1SJQ A;  4ZIT A;  3J81 Y;  2PMZ D;  1HNW F;  2GZO A;  1OY8 A;  5C25 A;  3HJF A;  3GMG A;  5L39 A;  2ZOF A;  4W92 B;  2H4W B;  1DTT A;  2ZKU A;  4L6V 3;  1GTH A;  1NME B;  1WC0 A;  4DR4 J;  3UFC X;  5B0B A;  3MM5 A;  5KFZ A;  1NPK A;  3I82 A;  4F26 A;  4DR5 F;  4CH1 A;  3DHW C;  2L08 A;  3C15 A;  3QZ7 A;  4ID8 A;  4OX9 J;  2R42 A;  4PXC A;  4GC7 A;  1VFJ A;  4I56 A;  3Q24 A;  1YJN S;  3SDE A;  3HPO A;  3N4W A;  1H73 A;  3MCO A;  3PM9 A;  3BPD A;  1RK8 A;  1KFD A;  3H0P A;  5F3T A;  3NL0 A;  3WZ0 A;  1RHM B;  3ZZR A;  2QX0 A;  4NI2 A;  4YME A;  3DLL Q;  1E6Y A;  2VC0 A;  2YWH A;  2ZBC A;  3G8T A;  5LXY A;  4NCA A;  4YY3 J;  3FRZ A;  1IR2 A;  3VVT A;  2GA7 A;  1CS4 A;  2HFV A;  2AJ2 A;  3KLG B;  2B6A B;  2WVD A;  3AD8 C;  2R8I A;  3HSG A;  2N82 B;  4O4G A;  1WKL A;  2GW8 A;  4L76 A;  3H5S A;  5DDO C;  1ZH5 A;  3UD5 A;  4IG0 B;  3W65 A;  3TZX A;  5DG8 A;  4USJ C;  3MF5 A;  5M2R A;  1RT7 A;  5GAD I;  3CJQ A;  3TUZ C;  1ZYQ A;  3BPS P;  4QWB A;  1NAQ A;  4OFZ A;  4JI8 J;  4WXW A;  3OFH A;  2AU0 A;  2FLL A;  3FBF A;  4CTA B;  3WX8 A;  2MLY A;  4CNY A;  3DM2 A;  1GXT A;  3EZU A;  4K8R A;  3KK1 A;  3O5T B;  1NK4 A;  4CO1 A;  4ZVF A;  5F8I A;  5LMN F;  2D1C A;  4ER8 A;  4ZVS B;  3OHB A;  4BDP A;  2CJK A;  1GK8 A;  2C2Z B;  2ZZT A;  4DSF A;  3QIP A;  3KLE A;  4CWB A;  1Q16 B;  1WWH A;  1WEX A;  3A1Y G;  4DBQ A;  3MEG A;  3JTP A;  2AQ4 A;  4OZ2 A;  1RT6 A;  4UST A;  1CJT B;  4OZ1 A;  2KXN B;  4JI2 F;  2LEP A;  4ZVE A;  3K7R A;  4ZIV A;  3MMC A;  2QO3 A;  1YI2 S;  2IIH A;  3TUI C;  2MKK A;  3W66 A;  1RYR A;  2AZ3 A;  1VC5 A;  4BBY A;  2JEJ A;  2X3G A;  4AYB D;  1HNV A;  2V8P A;  2JEF A;  5KFF A;  3UDV A;  4PXB A;  5EWF A;  1C0T A;  3LW5 C;  2CYY A;  1XN9 A;  3GJR B;  5A6P A;  4EMD A;  2NXJ A;  3JQJ A;  4JI4 J;  3SCL E;  5HVF A;  2A0F B;  3P6Y C;  2R2U A;  5A8R B;  5J1E A;  3PKM A;  3NLC A;  3ZTO A;  3UCU P;  2M5Y A;  1URN A;  1RT5 B;  2KRB A;  1N34 F;  4OYM A;  4ED1 A;  2MZT A;  4OZL A;  2H5E A;  1D1U A;  4FF2 A;  1HI0 P;  3W61 A;  3HZE A;  3MAA A;  3M8R A;  2R7X A;  4NA1 A;  3DRP A;  1F9F A;  1NB7 A;  1HBN A;  5K14 A;  1ZET A;  2R7Q A;  2UUA F;  4DV5 J;  3GYX B;  3VAG A;  2DHA A;  2I0X A;  3WX4 A;  3U27 A;  2U1A A;  1QM9 A;  4O23 A;  2VQF J;  1R43 A;  5AE1 A;  1FEH A;  1Z4U A;  5E33 A;  2QL9 B;  4NZ0 A;  1RTJ B;  2V8H A;  5HBM B;  1TKX B;  4J9V A;  1SI9 A;  1SC6 A;  1QAJ A;  5DG9 A;  4P75 A;  1ZTT A;  2V69 A;  3T1Y F;  3KG1 A;  2W9C A;  5BYS A;  1DQA A;  1B4S A;  2C2K B;  1MN7 A;  1NDL A;  4AL6 A;  3TZY A;  2E1C A;  1HNW J;  4GKK F;  4K4Z A;  2B3T B;  3VHQ A;  2W4D A;  3HHK A;  2XI3 A;  4DV6 J;  2D9P A;  4IFY A;  5KFS A;  4M5M A;  2L9W A;  4PXD A;  3NS6 A;  4K59 A;  2EKY A;  3AOC A;  2FLO A;  3I4P A;  4GVL A;  1NHU A;  3K5N A;  3OPK A;  5KFG A;  3IS9 A;  3H2U B;  3ET6 A;  4B17 A;  1WF1 A;  2FB0 A;  4C97 A;  1U6Z A;  2P9E A;  1Q8I A;  5CH7 B;  2J6T A;  1KN6 A;  1REG X;  2E66 A;  4HEA 9;  3H98 A;  1Z1Z A;  5IS2 A;  2L41 A;  1F3V A;  3ITH A;  3EWG A;  4DSJ A;  2KVI A;  1CC7 A;  4FYY B;  4E2F B;  1N36 F;  4OYI A;  3V6J A;  4V19 J;  2ROP A;  5KFX A;  3GIK A;  3I9V 9;  4K2X A;  3BGU A;  4A8M P;  4IG3 A;  3N6M A;  2AJ0 A;  1T3N A;  3QRP A;  3MPV A;  4HTI A;  1X4B A;  1ZOT A;  2C3M A;  4ATN A;  2C3U A;  4ENO A;  1FHT A;  2OO4 A;  3ZZZ A;  2I38 A;  1H2T Z;  3T5J A;  5I42 A;  4JI3 F;  1NDK A;  4QJV A;  5KG0 A;  5AXN A;  3M9M B;  3OVB A;  2NYH A;  4H54 A;  5LMN J;  3MMB B;  2AIR B;  2RQM A;  1VRU A;  2R7R A;  4UOC A;  1R0A B;  2I1R A;  1CJU A;  3IP0 A;  3ZZY A;  1YJW S;  4QOT A;  3L7O A;  3SZ2 A;  1BUX A;  1OSC A;  4K2J A;  3FC9 A;  2R9L A;  1Q95 G;  3HUL A;  4M5H A;  1HNX F;  5IT9 Y;  1QTN B;  4F3O A;  2F8M A;  1XEZ A;  4RW7 B;  3UWT A;  1FNM A;  2ATL A;  1AW0 A;  5KFB A;  2ZDO A;  1VLY A;  3MFH A;  5C2C A;  5HQL A;  1Q8K A;  1RP5 A;  3CCE S;  5U47 A;  3H25 A;  1UVL A;  3FDS A;  2ZKT A;  1S1T B;  2RDD A;  5D0H A;  2K3I A;  4ED6 A;  2BKP A;  3EDR B;  7AT1 B;  2DNQ A;  5D8H B;  5L9N A;  1M5O C;  3FUY A;  4P2M A;  4B3T J;  4M5D B;  3VAL A;  4U7U K;  1PCA A;  2ZH7 A;  2ZHB A;  5KFJ A;  2UVW A;  3TZW A;  3DOM A;  3FFI A;  2RB7 A;  4KGM A;  5GME A;  3M9N B;  4IH5 A;  2UVV A;  4HH1 A;  3K8W A;  3ENW A;  1F5C A;  4TNO A;  2RUG A;  3C6U B;  3IBF B;  4R25 A;  4QYZ J;  3BEG B;  2B7C B;  1SBR A;  2KFZ A;  3CJK B;  4B08 A;  4CLK A;  3EUN A;  4DFJ A;  1Q86 T;  1UL3 A;  4OHV A;  1A6L A;  3SI8 A;  3D28 A;  4H4K A;  1X0F A;  1M1G A;  1GNK A;  1RBA A;  4GO7 X;  1PC5 A;  2CQP A;  1H7X A;  2CQH A;  4DHV A;  2CPE A;  2ZE2 B;  3MOZ A;  1OS5 A;  1PYO B;  3IR6 B;  3V81 B;  1SQE A;  2YWK A;  2HZA A;  1YJ7 A;  5DZ6 A;  3Q8Q B;  3OFF A;  2XY5 A;  2GO9 A;  4LSZ B;  4JV5 F;  3T5K A;  2A18 A;  3CJT A;  1S5Z A;  3JSR A;  1BC6 A;  4N76 A;  1N0U A;  1NH7 A;  2EBG A;  3SBM A;  1RT1 B;  3CC4 S;  4BC9 A;  1L3U A;  3M30 A;  1DY3 A;  4RWX A;  1N88 A;  2OSQ A;  1Q81 T;  2F40 A;  4U7C A;  4DPT A;  4KKO B;  1WHY A;  4LF7 F;  1I1G A;  4Q44 A;  2FVR A;  4ED7 A;  3Q86 A;  3V4I B;  1S77 D;  5A2Q Y;  2ASD A;  2C1E B;  4UY8 5;  4TLR A;  2W2P P;  2WB1 D;  3GWC A;  2MJN A;  4HR2 A;  1RI7 A;  3M8W A;  2YNF B;  1JLQ A;  1LWE B;  3MAH A;  5HRO A;  3UPF A;  2MKY A;  4MFB B;  1CJV A;  1FTC A;  3OJS A;  1TEL A;  4USK A;  4A8Y A;  3PVX A;  3OTD A;  5CQG A;  1FWL A;  2XS5 A;  3KLH B;  3IR7 B;  2DKO B;  2R7W A;  4NLT A;  4FXV A;  1BE4 A;  5J1N A;  1N36 J;  4PG8 A;  3HI9 A;  1RU2 A;  1Y00 A;  3LO3 A;  4X64 F;  3SV3 A;  3J7A 1;  2Z57 B;  3DHX A;  3BBC A;  3MM6 A;  2JH3 A;  2DVI A;  2QEX S;  3R2D J;  1M90 T;  2RML A;  2F8E X;  4NML A;  4GVB A;  4WFZ A;  4Y6I A;  3KLV A;  2RT3 A;  5E41 A;  1FKO B;  5ITH A;  1SIW B;  2HNZ B;  2GQC A;  1WC1 A;  3R6G B;  3THT A;  3LGM A;  3WQP A;  2R7S A;  4ZCK A;  4F4X A;  2N3L A;  4LF4 F;  2NZC A;  3MTK A;  4FN5 A;  5KFM A;  1TZ0 A;  1RU1 A;  3UR0 A;  3Q8V A;  2ILZ A;  4DL0 C;  1C1B B;  4JI3 J;  2Z56 B;  5FLX Y;  2JVR A;  2M2B A;  1HW9 A;  3ENQ A;  2WSC C;  3OR1 B;  4DR1 F;  3AOB A;  5DO2 A;  1KTV A;  1SVD A;  2K1R A;  3QT6 A;  5IV4 A;  3TJA A;  4KHR A;  3VZI A;  3W8G A;  4OJ3 A;  3I31 A;  3HX9 A;  4NLY A;  2YKN A;  1YHQ S;  3RB6 A;  4LRA A;  3RR8 A;  4NX9 A;  2W9B B;  4RR5 A;  1NDP A;  2PD1 A;  1SJR A;  1S1W B;  5J2N A;  2W8L A;  2GVD B;  5CYM B;  1OYD A;  3OQ2 A;  1W2B R;  4A47 A;  3QYY A;  1FE0 A;  5KFR A;  4OYP A;  4WCE Q;  1IBM F;  2OI2 A;  1HNI A;  3A13 A;  2CJB A;  3A4T A;  3Q8U A;  2VBY A;  2DXE A;  5GAH U;  4WP9 A;  1GAO A;  4KT0 C;  3IO1 A;  3CO9 A;  1U09 A;  4FYW B;  3BKF A;  1EKR A;  1MML A;  4DL3 A;  2HGL A;  5ETS A;  4C0H A;  1RDR A;  3QFH A;  2XHC A;  2QMX A;  2ZFH A;  3GIM A;  5KFU A;  1XR5 A;  1FTR A;  2FGC A;  5DJB A;  4EFA C;  2V2Z A;  2E29 A;  4LRD A;  4RNO A;  3T6B A;  4ECY A;  4OQJ A;  5DQI A;  3TVZ A;  2MKC A;  1L3K A;  4A48 A;  3KHR A;  4F50 A;  2BAB A;  1JLE A;  2CZ4 A;  3ILI A;  4PQU A;  3CTR A;  3OVS A;  2H65 B;  3KLF A;  2OPR B;  4IO9 Q;  1VGY A;  1FE4 A;  1HA1 A;  4P2X A;  3VWS A;  4LT6 A;  2J9C A;  1OIA A;  3VCD A;  5IT0 A;  1T05 B;  1IJE B;  2VOO A;  1N5Y B;  2VD3 A;  3RAQ A;  2JZ5 A;  3KMQ A;  2C2O B;  2BE2 A;  5LXR A;  3LAL A;  4U7U D;  1X7V A;  1XC9 A;  4NRU A;  3RBD A;  5HMZ A;  2DR8 A;  4DX6 A;  1N5T A;  4MK7 A;  2Q6C A;  1Q8B A;  4TY8 B;  4ANC A;  3HHL A;  2J6S A;  1NRK A;  3QNW B;  3PEH A;  2XB2 D;  3CCT A;  5IOL A;  2E1M C;  3SCJ E;  1ELO A;  1RHQ B;  1WDT A;  2F1F A;  1XNR F;  3OSN A;  3A3N B;  4WWS A;  2XGP A;  4NLG A;  3LAK A;  4OHX A;  1L5U A;  3MUM P;  4JI6 F;  4ELU A;  4JBC A;  3FKB A;  5D4P A;  2RNE A;  2XNR A;  2JL9 A;  4AL7 A;  4O3O A;  4Q5V A;  1R6V A;  1DLO B;  4NA2 A;  3V6D A;  2XLK A;  4XTT A;  1FRH A;  2PMH A;  4DPW A;  4CO4 A;  1LK5 A;  1JJC B;  4N8N A;  4IOA Q;  3RBZ A;  4AUK A;  2F4V F;  2VPX B;  2DHH A;  3GIR A;  2OPP B;  4U67 Q;  2HZV A;  5IQQ A;  5HP1 B;  4MKB A;  3Q22 A;  3FBB A;  3G4S S;  2GFF A;  3MAQ A;  3NBP A;  2ZZM A;  5ETM A;  2DY9 A;  1BQM A;  4J9M A;  5IM0 A;  3TEH B;  4ZVR B;  5IQ6 A;  3QO9 B;  3AB2 B;  2Q1L A;  2PE8 A;  4R8U B;  1ZPW X;  3I96 A;  4MKV A;  2GIR A;  2MHN A;  3H40 A;  4EYH B;  4X66 J;  1F0X A;  1MU2 B;  3GSI A;  1ZTW A;  2M70 A;  1T9V A;  4ZJQ A;  1DZ5 A;  4DV0 F;  4K4V A;  3U1M A;  3NS5 A;  4F4K A;  1U26 A;  2QFI A;  2C28 A;  1Y9O A;  2DHS A;  2MTL A;  3W2W A;  3GCX P;  2B9Y A;  3BB5 A;  3HHE A;  1FKA F;  1NDC A;  4J9Q A;  3ADA C;  2I9S A;  5AE2 A;  4X64 J;  5B0G A;  2FY8 A;  2GGP B;  3EGV A;  3DXS X;  3KXD A;  1EQM A;  4PQA A;  2C2N A;  4LF2 A;  2BAN B;  4R0J A;  4XDD A;  1EET B;  4DPY A;  1VHF A;  2F5G A;  1O8B A;  1VRT B;  4JYA J;  1T9W A;  3BV8 A;  3PJW A;  2EWH A;  1DHM A;  2A6O A;  4ES3 A;  5DQH A;  2UUC F;  4PG4 A;  4FS1 A;  4Y2M A;  2KT5 A;  4DG1 B;  4F02 A;  3MM8 B;  5EWG A;  4C6A A;  4GO5 X;  4OYW A;  1EJ7 L;  3PKY A;  3H20 A;  2JFD A;  3DOL A;  4K4T A;  1VQY A;  3OL9 A;  4PWD B;  2KXH A;  4NCG A;  1P1T A;  3UDC A;  3QSI A;  1QVF R;  5C7P A;  1RWP B;  3NMA A;  1JB0 C;  1XMQ F;  2VG6 B;  2K7K A;  4C8L A;  3RRK A;  3CJ2 A;  4DF8 A;  1QE1 B;  1NB2 A;  3DNC A;  1OY9 A;  1RWO B;  4OYB A;  2HBZ B;  2O67 A;  5I4M A;  2CIM A;  1HLW A;  1X4E A;  1RBL A;  3QMQ A;  2ZNY A;  2OUG A;  2QA2 A;  1NBE B;  1T3O A;  1W7W A;  3JYT A;  3M6W A;  4CLW A;  5AJ3 J;  4LQ9 A;  4O3S A;  2XTJ P;  2NQP A;  2VQE J;  2DRD A;  2VBW A;  5L1K A;  1N8R T;  1TL5 A;  3JSY A;  2RE1 A;  1ULR A;  1RT4 B;  4CIO A;  4KPC A;  4CLT A;  3CO0 P;  5DLG A;  1FX2 A;  4LIR A;  2IAJ A;  1U0H B;  2G2O A;  3ZFV A;  4C11 B;  1M5H A;  4C3K A;  2LA4 A;  1YBT A;  3W8P A;  3NNH A;  3TOQ A;  1CVJ A;  3W5X A;  2EEY A;  3K58 A;  4IQM A;  4OI2 A;  5KAK A;  4ZPC A;  3FCH A;  2ROG A;  4PWW A;  2LKZ A;  5JXS A;  4J9P A;  1XMB A;  3B78 A;  1G6B A;  2KTQ A;  2NR0 A;  5HQ8 A;  4I7F A;  2HHW A;  5KFW A;  2RF2 B;  1BQN B;  2LEA A;  4QU6 A;  1X4F A;  1VLO A;  2NPF A;  1JNZ B;  1X4D A;  3RR7 A;  5KT2 A;  3J80 U;  1YIJ S;  4A8F A;  1D3W A;  4C0O C;  2W8K A;  2MQ8 A;  3JAM Y;  1B0P A;  4Y28 C;  1RWN B;  1FFS B;  3TX8 A;  5B0C A;  4DPU A;  4JI6 J;  4FXW A;  4B3O A;  1AZS A;  3GII A;  2AT1 B;  2MZS A;  3DFE A;  1S6O A;  2AW0 A;  2X51 A;  1Q7L B;  2ZVI A;  3AOA A;  2IJF A;  3GCW P;  1HQE B;  2APO A;  2DD8 S;  1HBM B;  4ZK7 M;  4FKX A;  5L1J A;  2IDL A;  3CUL A;  4ETZ A;  2JRS A;  3KK2 A;  1RWK B;  3V6K A;  3AD9 C;  3RAM A;  3KHL A;  1VBY A;  1M1H A;  2HFU A;  2W2Q P;  2BJ7 A;  2CJQ A;  2IC3 B;  2DGQ A;  4DR6 F;  1TKZ B;  4IFV A;  4ERD A;  1S1U A;  3ZZT A;  3IA0 A;  2FUG 9;  2CPY A;  4QIV A;  4ZLN A;  4RW6 B;  3CCJ S;  2I5J B;  1RWX B;  4LFC J;  4DV0 J;  1CUL B;  1SL1 A;  2OEM A;  2JWN A;  1UFL A;  3DMJ B;  1U2F A;  4LR7 A;  5HLF A;  3TJ8 A;  3HVA A;  3MDF A;  3TQE A;  4DLG A;  2P5V A;  3GON A;  3SEO A;  1JKH B;  1U1N A;  4C9D A;  5JUM A;  3F73 A;  1AT1 B;  5KFH A;  2RHS B;  5LMU F;  1LOU A;  3DLK B;  4YB5 A;  1X5P A;  4WK1 A;  1YKW A;  2HNY B;  4G1Q B;  4KV8 A;  1PJ7 A;  2BUN A;  2RU9 A;  2V9K A;  2M8D B;  1HHT P;  5LSL A;  3M4X A;  1OWX A;  2GVZ A;  1HI8 A;  3M2R A;  1UW4 A;  1K1S A;  4EBD A;  2V63 A;  5KG1 A;  3UE2 A;  3UCZ P;  4F3M A;  5K8M A;  1N5V A;  3IBW A;  3OVA A;  1MWQ A;  1FJG J;  4F7V A;  4K4X A;  2V50 A;  1UWB A;  3H5Y A;  5LJ5 Y;  1JLA A;  1DTQ A;  1JWW A;  2X1B A;  5LSO A;  4ZCI A;  3OL6 A;  4QBU A;  2QRR A;  2Y1L B;  1WI8 A;  1TU0 B;  5KOX A;  4TY9 A;  1BWE A;  3PX6 A;  2EFV A;  2POK A;  3AH6 A;  3EIC A;  4PPD A;  1TV6 B;  3DCA A;  2MYF A;  2JNJ A;  2LQ8 A;  2QG9 B;  3BGO P;  2DIT A;  3UI3 A;  3OW2 R;  1CBK A;  1R27 B;  3D7S B;  2AJ1 A;  1VQ7 S;  2FJA B;  4I2P A;  3CCZ A;  5HI7 A;  2QLX A;  2YWG A;  4M63 A;  4UOG A;  3IGV A;  4DFP A;  2V8G A;  2FJX A;  4PRF A;  4NRT A;  4E0D A;  2Y0B B;  2YH0 A;  4YB1 P;  1VC6 A;  1OQ6 A;  5HMY A;  2YNI A;  1GMW D;  2GO8 A;  1TMJ A;  3HVR A;  1JLF A;  3QBC A;  2WTF A;  1IBK F;  3LUY A;  1GXL A;  3CDW A;  5T14 A;  1TL3 A;  2BZ2 A;  4ED0 A;  4JI5 F;  2CWX A;  2UXD F;  3CME S;  2FZK B;  3QWU A;  2J9D E;  5D4O A;  1JLG B;  3VTI A;  4B9T A;  4FF4 A;  1FEE A;  5CHC B;  2U2F A;  3NKY A;  4S0M A;  1NSA A;  5SUH A;  3T5H A;  6FDR A;  3DOK B;  4MK8 A;  1SQF A;  2OKQ A;  4Z7C A;  3MMA A;  1ACM B;  1LWF B;  4CYU A;  4M95 A;  1PG5 B;  3BSO A;  4R5P A;  4JB8 B;  1K1Q A;  2BQ3 A;  3QJP A;  3I0S A;  1X9M A;  5SZT A;  1C0U B;  4PYD A;  1RT2 A;  5JVG Q;  2BM1 A;  4Y65 A;  2ZM6 F;  1IXK A;  4WE1 B;  4HVZ A;  5DDP C;  2JLE A;  2NXN A;  4WTY A;  5HSP A;  2PSZ A;  3W3S A;  5BR8 J;  2MY7 A;  2YVS A;  1R8C A;  1B64 A;  3H5X A;  1YIT S;  3NNA A;  2CPJ A;  3ETM A;  1M5P C;  4XPC A;  1DUR A;  4F0M A;  4DFM A;  3M8P B;  3PY8 A;  3FZ2 A;  4RX6 A;  3IMQ J;  3H90 A;  1S9E A;  1UEV A;  4W4M A;  3AY0 A;  4JI1 F;  1WHX A;  4CLY A;  3Q89 A;  4M5N A;  3FBC A;  2HMI A;  5GMD A;  5E3P A;  2DT9 A;  6FD1 A;  3R5D A;  5HAT A;  2Y1R I;  2B5J A;  2XY7 A;  1VQK S;  4BCA A;  1WI6 A;  2FHJ D;  2KI2 A;  2FLN A;  4ZMM A;  2O1P A;  3CDB A;  3D1H A;  1FRM A;  1S0O A;  1OPZ A;  3VAH A;  4ZCL A;  4O3P A;  2HUR A;  1B0T A;  1NEE A;  4LRB A;  3ZO7 A;  1KLM A;  3NY0 A;  2UUB J;  4YB7 A;  2IDE A;  4DR6 J;  3JTO A;  1JXE A;  5DG7 A;  4NL5 A;  1LQ9 A;  2HS3 A;  2KM8 B;  3G6Y A;  1U1L A;  1YX2 A;  2IM0 A;  1X5S A;  5EWE A;  1TTH B;  2J8S A;  1KBR A;  1NH8 A;  3D6F B;  4U95 A;  2R8G A;  4NLO A;  3BSC A;  3LGN A;  3PX0 A;  4ED2 A;  2UXC J;  4RBU A;  4EI2 A;  3D66 A;  2ZH5 A;  1YTY A;  1WNE A;  2OTL S;  5CZV A;  1XR6 A;  2AGQ A;  3VAK A;  3KLI B;  2AWZ A;  3M6V A;  4UQT A;  1QAX A;  1RIS A;  3HSZ A;  2VZ9 A;  4RW9 A;  2ZHA A;  4NI2 B;  5F9L A;  3PYF A;  4HAC A;  3DGP B;  3N0V A;  2FZC B;  4ECV A;  2W25 A;  5J2Q A;  1CS4 B;  2CDR B;  2ASJ A;  4HTJ A;  4M5I A;  2MQP A;  4AQY J;  1VQN S;  5HAO A;  1F5A A;  2W1B A;  4O4G B;  3PV8 A;  3GTY X;  2VG5 A;  3Q8P B;  3KWM A;  4IYQ A;  4P2F A;  4ZHR A;  3KYL A;  2ZD1 B;  1RT7 B;  1KDN A;  3I0R B;  3G82 B;  5HMX A;  5IWA F;  3CC2 S;  5F9N A;  4V19 X;  2MQL A;  4NE9 C;  2F4F A;  3PO5 A;  2EFG A;  3HT3 A;  4F0K A;  1N5Q A;  2MY8 A;  4PG7 A;  3DI6 B;  2V4R A;  2CJ9 A;  4OV6 A;  4DSE A;  4RW4 A;  3G6V A;  1CQN A;  2RQ4 A;  3QIP B;  4Y3C A;  3KLE B;  3L7P A;  4J91 A;  1R31 A;  2BJ1 A;  3HVW A;  3VAI A;  3MEG B;  3D68 A;  3TW0 A;  4ECS A;  3O3L A;  3K59 A;  1RT6 B;  4PAA A;  2Z30 B;  5HL7 Q;  4DUT A;  3M2U B;  2KYX A;  3MMC B;  1IR1 A;  4DJB A;  3VGU A;  4JI5 J;  1L3T A;  2UXD J;  1H74 A;  5GAE I;  3CIZ A;  2N3O A;  4Z37 A;  5E3A A;  3TAM A;  3HFZ B;  5HJX A;  4MIB A;  1RAH B;  2OMO A;  2HND A;  3HVT B;  1RAC B;  2IRU A;  3KJN B;  1U6F A;  4M5K A;  4OZN A;  4O44 B;  1KOO A;  1KQK A;  1N52 B;  2QL5 B;  3MCS A;  4EK2 A;  2PA3 A;  1AUD A;  4NLD A;  2Y3Y A;  2GIQ A;  1VJW A;  4QIG A;  1FNO A;  2FVS A;  1XNQ F;  1FF2 A;  2ZM6 J;  4NXM F;  3DRP B;  1HIY A;  5K14 B;  1HAR A;  1Z2L A;  2NSC A;  4ETX A;  2YKO A;  1A9N B;  2MKI A;  4CLS A;  3NOC A;  4ZLL A;  3TRG A;  2R2S A;  4NAS A;  3W64 A;  4B9V A;  1YJR A;  2V8V A;  2HLU A;  5KFQ A;  5HQM A;  2KB2 A;  3D67 A;  2KT2 A;  3ENA A;  2XSJ B;  3TAQ A;  1V3R A;  5GAD U;  4FF1 A;  1X5T A;  8ATC B;  2DGT A;  4YHH J;  1SXL A;  1EKS A;  4DL2 A;  4X62 J;  4RUA A;  1OQ3 A;  1K73 T;  3EGZ A;  2C2M B;  2LXI A;  2ZDP A;  1PIL A;  2DNM A;  4FYV B;  3KLG A;  2QMW A;  1VIX A;  2H3E B;  4WFB Q;  4LF6 F;  3K89 A;  1JJ4 A;  3DC2 A;  2E5G A;  1IUJ A;  2Q66 A;  4IFY B;  3A8J A;  3A8E A;  1R8B A;  2EK1 A;  2HS4 A;  1Y4Z B;  2N7C A;  3KTQ A;  4N5S A;  4IG0 A;  2COL A;  2JEG A;  3AXM A;  1W2I A;  3CVK A;  1SCJ B;  2XBP A;  1RTI B;  1UEU A;  2GAG C;  1VQ6 S;  2QA1 A;  4A4J A;  5AXM A;  1B0V A;  3R27 A;  4RNF A;  3FRY A;  2WW4 A;  2QA4 G;  2NRE A;  2HKE A;  4CTA A;  1CG2 A;  2JLF A;  4DQP A;  1FO1 A;  3QID A;  5J2M B;  3MCN A;  1IR0 A;  2X1G A;  4RNH A;  2DNG A;  4DSI A;  1FER A;  2QSW A;  5H9E K;  4ZP9 A;  3KUE A;  3Q2S C;  4FKY A;  2JC1 A;  2QLW A;  2HFS A;  2RQK A;  2D41 A;  4DFK A;  4LQ3 A;  2CPF A;  3T3F A;  1CPZ A;  2WK4 A;  4KGX B;  3ISN D;  3G96 A;  1NXI A;  4UTG A;  2HYI B;  2AJ4 A;  5A76 A;  3O1L A;  3AQO A;  1S7I A;  3TVY A;  2GHP A;  2IPO B;  2H4Y B;  4DL4 A;  2KZM A;  4CLZ A;  2CA9 A;  4IG3 B;  3ZTS A;  1SQG A;  2AX0 A;  3G6X A;  1UZH A;  3L7U A;  3BO3 A;  3HXM A;  2LXF A;  1MRO A;  2G1H A;  4DL6 A;  3CWJ A;  5HVG A;  1NO8 A;  2XMJ A;  1V3S A;  4ECX A;  4L3N A;  4P9S A;  3CJ8 A;  3QJL A;  3J7Y U;  5KFK A;  3DDN A;  3AOD A;  4FVM A;  3OR2 B;  3SXL A;  3KNG A;  3CJ4 A;  1Y10 A;  3E8O A;  3GB0 A;  2E1R A;  2J9E A;  1VRU B;  1RT5 A;  3MEE A;  1BGX T;  1SV5 B;  2W01 A;  5F8N A;  1Q5V A;  5ETO A;  2R2R A;  4I1T A;  1WKJ A;  2V4Q A;  1JMT A;  4LF9 F;  5MLC V;  2MGZ B;  2R7U A;  1I51 B;  2CJA A;  4LR9 A;  1WEZ A;  4MYU A;  1FA0 A;  4L72 B;  2LYV A;  2FJW A;  1TL4 A;  3KJQ B;  3E3X A;  1FRL A;  3L9Z A;  1VC0 A;  2IJR A;  4RU9 A;  2DR7 A;  3QRR A;  3RBX A;  1CLF A;  1RBO B;  3C2P A;  1PKU A;  1HYS A;  1UP1 A;  3O2I A;  4QQB A;  4KAI A;  1TKX A;  1HWJ A;  2SXL A;  2DGX A;  3GLJ A;  1FCA A;  1ZAW A;  3BRE A;  3MGJ A;  2MKS A;  2HSE B;  3FQK A;  5RUB A;  3EPI A;  4J9N A;  2CVE A;  1QSL A;  1VDH A;  2WON A;  3LGH A;  1KOH A;  3OTO F;  1VBX A;  4H4O A;  3ELH A;  3LP1 B;  2IMW P;  3DOM B;  3D6H B;  3MED B;  3OLB A;  3B8H A;  4EWT A;  3JSM B;  1ZA1 B;  2GJF A;  3SV4 A;  4TU9 A;  1TUW A;  3ILJ A;  2BE9 B;  1XNQ J;  2BA9 A;  4NXM J;  4J9L A;  4DR4 F;  4LSL B;  1R89 A;  3RG6 A;  1HR0 F;  4RBT A;  1RA7 A;  4OHZ A;  4WPA A;  1KEK A;  2G1D A;  2OD4 A;  1KNZ A;  2OIH A;  4WFX A;  3N5F A;  3PW4 A;  3HCX A;  2QIF A;  4QZV B;  2HVE A;  3KHG A;  1JNR B;  1KQF B;  4EZ6 A;  4CO3 A;  4E98 A;  2NXU A;  4ZVP B;  2G13 A;  5F0W A;  1V3Z A;  2EFN A;  1HQ2 A;  2HRY A;  2XMV A;  1E6V A;  4DX8 H;  2HHH F;  1Q7Y T;  1BHN A;  4CT8 A;  1XMO J;  2DRB A;  1VJQ A;  4J9S A;  2Y1I A;  4YY3 F;  5K8N A;  3AB4 B;  3NCP A;  2MSS A;  4IRC A;  1WF2 A;  4NEY A;  4C2M A;  2AEF A;  1TK0 A;  2XWY A;  1I94 J;  1IKX B;  2VJV A;  4DS5 A;  3QSY B;  4DV7 F;  1REV B;  1EP4 A;  4ANE A;  1IVZ A;  2OEL A;  3MD3 A;  1VYA A;  2W24 A;  1D9F A;  1UA0 A;  3NAH A;  5H9F K;  4KIA A;  3A8K A;  3CGI A;  3DN9 A;  4JI8 F;  1TL7 B;  3G8S A;  4AXJ A;  5KFC A;  2UV8 A;  1G4C A;  4WK3 A;  5IZH A;  3VV2 B;  4UQG A;  1GEH A;  5HRO B;  3BN7 A;  4DWI A;  4OLO A;  5ETL A;  4WFN Q;  5DM7 Q;  4ED3 A;  2KVQ E;  2V4J B;  1LW2 B;  2FLP A;  3MMB A;  1FVS A;  2UZA A;  3RUB L;  4K5R A;  3HKW A;  4C3M A;  4Y2I A;  1R0A A;  1CC8 A;  1ZZN A;  1LKZ A;  3M7V A;  3POT B;  1ZM9 A;  2CG4 A;  3LP2 B;  4TXS A;  3CD0 A;  2J0X A;  3G6E S;  4Q2L A;  1HD0 A;  5DGA A;  3MM6 B;  5LOQ A;  3KHH A;  4NCB A;  3J81 U;  4GVB B;  4CLL A;  4M5L A;  4PKD B;  2NPI A;  3G2X A;  1FI4 A;  4RUC A;  4FP9 A;  3T9Z A;  3QT8 A;  3RU0 A;  5I3U A;  2XUL A;  3CED A;  4CLF A;  1NK7 A;  1VK3 A;  3J80 Y;  3FCV A;  1RXO B;  3I55 S;  1CJK B;  4TQR A;  2ACY A;  1MW7 A;  2RHQ B;  4ID5 B;  3ZTR A;  1NK8 A;  5E7O B;  4KY3 A;  1DAR A;  3B4D A;  3HK2 A;  2VA2 A;  2V68 A;  2VU5 A;  4W90 B;  3N5B A;  2YH1 A;  3MPW A;  5A6W A;  4I6Y A;  1T9X A;  1OYE A;  4Q0B B;  2ZH8 A;  3C14 B;  4ECU A;  5CYQ B;  1FJC A;  2RJZ A;  2X3D A;  4YR2 A;  1S48 A;  2YKN B;  2JLG A;  1S0V A;  2DBB A;  3ZTP A;  1N6Q A;  3RB3 A;  3Q23 A;  3MXH P;  3C6U A;  2LEB A;  3BM7 A;  1YG0 A;  2ZEJ A;  1DBD A;  4RWW A;  3CJK A;  4OX8 A;  4JI7 F;  2RKI A;  4URQ U;  4DV5 F;  3MI7 X;  2OP5 A;  1NUE A;  4YB6 A;  3OT9 A;  1EB0 A;  2JJ4 D;  3W9J A;  2R2T A;  1ZM4 A;  3BQ2 A;  1Y3K A;  2W4C A;  4O0I A;  2UUT A;  4MTP A;  4A8K A;  2FY1 A;  3TZZ A;  5D6G A;  2VQF F;  4K0K J;  4B9S A;  2IRX A;  1UVK A;  2H9Z A;  1KQS R;  1FRI A;  2KN4 A;  3NCQ A;  5FII A;  1S6Q A;  2ZE2 A;  4LBH A;  3ZTQ A;  2BDP A;  3L95 X;  1N33 F;  1U4B A;  4OHY A;  1S10 A;  2WHO A;  2HFO A;  4KH1 B;  3DRY A;  3N28 A;  1KTQ A;  2JC0 A;  3OTO J;  3ONQ A;  2GML A;  2W2O P;  2R8H A;  4G1I A;  3BGL A;  1FXD A;  2VFT A;  3ZZ0 A;  1RQ0 A;  3DU5 A;  2MQQ A;  2RH3 A;  1RT1 A;  3CPW R;  4DV6 F;  4Y0F A;  4LF8 J;  3X1L B;  1S12 A;  3P8B B;  1Y5N B;  3Q83 A;  5CZX A;  2XZT B;  3LH2 S;  2LQJ A;  3V4I A;  3HFV A;  2QZ8 A;  1HR0 J;  2NSB A;  4AND A;  2MKH A;  3PJX A;  1M5V C;  1LWE A;  3R5J B;  1PBA A;  2ZH2 A;  2LXU A;  1KVJ A;  4MFB A;  3OTE A;  3UR3 C;  3TI0 A;  2K2P A;  4Q8E A;  3HHL B;  3HFK A;  4IRD A;  2IA0 A;  3EVM A;  4F3Q A;  4EU0 A;  2XYG B;  3PYE A;  1RT3 B;  3KLH A;  3J81 j;  4TLQ A;  3UCG A;  4UZC A;  2VDH A;  3W62 A;  1I3O B;  2I8E A;  2P9G A;  2B9X A;  2HHH J;  2AGO A;  3OXL A;  1RAE B;  4DV3 J;  3SSR A;  3BDP A;  2BQR A;  3DGV A;  1WOP A;  2KRR A;  1SIZ A;  1S1X B;  2CAD A;  2XMA A;  4J9U E;  4DV7 J;  2YNH B;  1FKO A;  3PRB A;  1XQI A;  4HDG A;  2CQ0 A;  4B3M F;  4I2Q B;  5JMN A;  5KFI A;  3LOU A;  2JSX A;  4RU2 A;  3D0H E;  4OYA A;  3CCV S;  3CDU A;  2PFF B;  2FHM A;  4I68 A;  1N32 F;  1BQM B;  3KK3 B;  3V2U C;  1H2V Z;  2PFD A;  2VON A;  3PYD A;  4P71 A;  4MIA A;  2V2V A;  3A3O B;  3HZG A;  2VFV A;  1LEO A;  3R1H A;  1VQ4 S;  3OR1 A;  1U2C A;  4USH A;  3CC7 S;  3OHA A;  5L1I A;  4BLG A;  4CI0 B;  2CQ1 A;  4WTO B;  2C2D A;  5JJB A;  1UVJ A;  3I5B A;  3B82 A;  1SL2 A;  3TUP A;  1HKA A;  3T5L A;  2C22 A;  3R5A A;  1S1W A;  1T03 B;  2OPS B;  3FJ2 A;  2GVD A;  4QR0 A;  5CYM A;  2E5J A;  1VHI A;  3K5P A;  5F8H A;  4KHP F;  3M8Q A;  3Q0A A;  3LPY A;  4USW A;  2Y8W A;  2BX6 A;  1VQ8 S;  2LFV A;  3WC2 A;  4DV2 J;  4UF4 A;  4QWD A;  4W98 A;  4ILL A;  1NKB A;  2LVW A;  2LU1 A;  5ETV A;  3ZXW A;  5DQG A;  1S7H A;  2OFH X;  4HT5 A;  3KDN A;  2VPZ B;  3THP A;  4CLU A;  3GJQ B;  2MLZ A;  3OLA A;  1EZZ B;  5K8O A;  4B3T F;  4TQS A;  1KSP A;  1APS A;  2D3O 1;  4WBF A;  5ETN A;  4IO1 A;  2XCP A;  1XWL A;  2NZ4 A;  2HHV A;  3LP0 A;  4EO8 A;  4YUD A;  3D6M B;  1RLD A;  2DH7 A;  2HWH A;  3KOA A;  1X8D A;  2DO4 A;  3L3C A;  3OFG A;  3D6T B;  4CZC A;  2R3V A;  4I67 A;  4LIW A;  1UKU A;  1M0S A;  1WD6 A;  4IDK A;  2H54 B;  1RTH A;  1KLN A;  4JI7 J;  5H9E J;  4QWC A;  1N5Y A;  3IWX A;  2G2Y A;  4O3R A;  4DU8 A;  1RB0 A;  3CXC R;  5E3C A;  1QUV A;  3D2W A;  1YRT A;  3J7Y I;  3TAR A;  1O5J A;  1TK5 A;  3N6N A;  3GG1 A;  2LP4 A;  3MEK A;  4WJB A;  2ASL A;  4RW8 B;  2Z2Y B;  4TY8 A;  1SC3 B;  2KHC A;  3AHP A;  1N5S A;  1N33 J;  3FK4 A;  2HFZ A;  3IFE A;  4KO0 B;  5KG4 A;  1KFS A;  3U1L A;  2DO0 A;  2VHG A;  3S6E A;  4ZN1 A;  2E9Z A;  2YTC A;  3P45 B;  4QIE A;  2DPJ A;  5HK4 A;  2G0I A;  1X5O A;  4DV1 F;  3JTN A;  4WP3 A;  4B9U A;  2HEK A;  2J0S D;  2MZ1 A;  2KXF A;  4XK8 C;  3P4U B;  2PN6 A;  1ZZF A;  2DY1 A;  3PNI A;  2ALY B;  5IT9 U;  3ZZP A;  2VKZ G;  1IKV B;  4DR7 J;  3QO9 A;  2D3Z A;  4NOH A;  1Y0H A;  4F67 A;  4R8U A;  1HL6 A;  4U8V A;  3BH6 B;  1ZS6 A;  1RHU B;  5BYQ A;  3NCR A;  1XIQ A;  2KYZ A;  1C4A A;  4JV1 A;  4KJI A;  2E5L F;  2VBZ A;  2QL7 B;  1MU2 A;  1U24 A;  2FDN A;  5EDW A;  2ERR A;  4NMX A;  4QU7 A;  2UU9 F;  3UN2 A;  3CE8 A;  3EXC X;  2PT0 A;  5M2P A;  3QPI A;  1T94 A;  1I5O B;  2GGP A;  3HP6 A;  1QUP A;  4ZPV R;  3NOG A;  2DPI A;  2YQ3 A;  2WZ1 A;  4BHQ A;  4OJH A;  4YR0 A;  2J6U A;  3CCW A;  2DNK A;  3TO8 A;  4FPR A;  1EET A;  4O3N A;  4L75 A;  4B3M J;  4UZB A;  5CA5 A;  4CO2 A;  3D1O A;  5CXT A;  3KK2 B;  4DV4 J;  1VRT A;  2P2C B;  1HWL A;  1WC5 A;  2XNQ A;  4DS4 A;  3TQ1 A;  2FQQ B;  1N32 J;  2V2K A;  2NYI A;  4TU8 A;  3M6X A;  4KR0 B;  3J7Z T;  3KUH A;  1KS2 A;  3MM8 A;  4A8S A;  5GAG I;  1DAX A;  2B4O A;  3TP2 A;  3Q8R B;  4DSK A;  3C46 A;  5BXI A;  3CJ5 A;  2EVZ A;  2YPZ A;  2A2C A;  2VOD A;  2H5I B;  3PO4 A;  1SUQ B;  1UET A;  2I2Y A;  2XZW A;  2YKA A;  3OL8 A;  4IR1 A;  1UWA A;  4URS A;  3EZO A;  3UDE A;  1TK8 A;  4ZA1 A;  4LSN B;  2EXU A;  2EC0 A;  1F2H A;  1V5I B;  1QE1 A;  4KV8 B;  4KHP J;  2M4M A;  3W5Z A;  5IT4 A;  4PXE A;  1PGZ A;  1VK8 A;  5KFL A;  1SC4 B;  3BF4 A;  1J2V A;  4B3S F;  3PR4 A;  2OPQ B;  2GVZ B;  2IA6 A;  1X4H A;  4KFB A;  1TFW A;  4CO0 A;  3HDS A;  3LA0 A;  5DDR C;  3DDK A;  2MHE A;  4DCO B;  1S6U A;  2FVQ A;  4C8M A;  3WBZ A;  2ZWO A;  4IKA A;  2IM3 A;  1UEK A;  2LQ9 A;  2O01 C;  4ZP7 A;  4OYZ A;  1X4C A;  1J5O B;  4Z2X A;  1RT4 A;  4UT4 A;  4UUW A;  2P6T A;  2V94 A;  1H3D A;  4ZVH A;  2RS8 A;  4ECR A;  1MMN A;  2JFK A;  4PPZ A;  1VQ9 S;  1Q78 A;  2VDI A;  2D3O R;  4ZJO A;  4KRW A;  1QSY A;  3JS9 A;  4X4O A;  4PG6 A;  1BMQ B;  3BN4 A;  5KFE A;  4LR8 A;  2NCK L;  2F3J A;  1UPM B;  5HVH A;  4XO0 A;  3DRS B;  2PA8 D;  2RF2 A;  1BQN A;  2E5I A;  1S4F A;  2OH2 A;  1H0H B;  1LFP A;  2BYC A;  4J7C A;  4Y2A A;  1K9M T;  1NK6 A;  3J7A N;  4NEZ A;  5M2U A;  3WIV A;  4PCQ A;  1FD2 A;  1TMM A;  1TL3 B;  4P72 A;  4PG5 A;  4JUZ A;  5FLX U;  1GMV A;  1TL1 B;  2O3D A;  3EE3 A;  3GJS B;  2I6W A;  4UUX A;  1ITP A;  3PFO A;  4B02 A;  4XDC A;  4C4W A;  3UNY A;  2IM2 A;  3SQG B;  1VQL S;  1T02 A;  1KR4 A;  4ZPT R;  5FD1 A;  3PJ9 A;  1RCX B;  3MMA B;  2UV8 G;  3BJY A;  4DV1 J;  3ULH A;  4LF5 F;  2CAJ A;  2JX2 A;  3TAP A;  1HBM A;  2XEX A;  1CQM A;  4HKQ A;  2H1Y A;  4WFY A;  2IC3 A;  4USU A;  2D9O A;  1U1M A;  4IH6 A;  3GSD A;  3KG0 A;  3G87 A;  3TWZ A;  4GC6 A;  5EGY A;  4X65 F;  2A2D A;  2E5L J;  4QWA A;  4ECQ A;  2HQC A;  3UN5 A;  4HHH A;  4X66 F;  2I5J A;  4Y2C A;  2KT3 A;  1S9G A;  5H1S V;  4USV A;  3BBF A;  4CT9 A;  1X0P A;  5L8R C;  3UD4 P;  4YEA A;  3HLU A;  4C48 A;  2UU9 J;  2DCU B;  2WOM A;  1JKH A;  3B6B A;  3K5O A;  4PUO A;  4DQR A;  4OZ5 A;  5KOW A;  4X4V A;  1S9E B;  2WCX A;  3DLK A;  5J2P A;  4UOF A;  1RWU A;  3A12 A;  4DR2 J;  3MHY A;  1RAJ A;  2HNY A;  4MKA A;  1MSW D;  3MFI A;  5KG3 A;  1PBU A;  2CZV C;  3GV7 B;  1WOO A;  3MUR P;  3VR1 A;  1FDB A;  3W5Y A;  4FDF A;  5JVH Q;  2HBR B;  1T9U A;  2V8D A;  1U6B A;  3C8Y A;  2A1B A;  4JYA F;  2FJV A;  1YJT A;  1RA6 A;  1OO0 B;  4CM0 A;  3C16 B;  3IRX A;  3GFX A;  4LRF A;  4J9R A;  2Z2L A;  2AHO B;  3SSQ A;  3U7J A;  2XHW A;  1TVR B;  3RRH A;  1F5B A;  1S76 D;  3I87 A;  4OZ3 A;  3K2Y A;  1L3V A;  4NYO A;  3MR7 A;  4A8O A;  2BMB A;  4QPX A;  2LDI A;  1H98 A;  2BAC A;  4AE5 A;  3QT7 A;  3TUJ C;  4WKY A;  1EAR A;  3FEX B;  1TV6 A;  2VAS A;  4LUB A;  1U1P A;  3KG4 A;  3TEG A;  1K0V A;  3M32 B;  1X31 C;  3NGS A;  2CQB A;  4LVN P;  3MZI A;  3NGD A;  4RW9 B;  1NSQ A;  3TA1 A;  3UDL A;  3SFG A;  3EJM A;  1VIS A;  4HAC B;  2DRA A;  1V9O A;  2BJ8 A;  4KQZ A;  4B3S J;  3F41 A;  4JV0 A;  3OTC A;  4MK9 A;  1IM4 A;  4DUZ J;  4C98 A;  5HO4 A;  2FVP A;  3H2V E;  2ZH6 A;  1YZ7 A;  2OHD A;  1RHK B;  5D3G A;  2VG5 B;  1TR0 A;  4ZHR B;  5AJ3 F;  1R8A A;  1TKT B;  1B99 A;  3P5B P;  2VQE F;  1IJF B;  4N56 A;  1JLG A;  1NHV A;  2DGS A;  3PAC A;  3NWR A;  4YP3 A;  2IYI A;  4HI2 A;  3S1T A;  3I32 A;  1LWF A;  3D0I E;  2LQB A;  2QE5 A;  2DGU A;  5CD4 H;  2D69 A;  1O51 A;  2QN6 B;  1T7P A;  4RW4 B;  1HHS A;  3D54 A;  1YRU A;  3SFU A;  2WBM A;  1B7Y B;  1U8S A;  4WE1 A;  3FEZ A;  2AD9 A;  4GKJ F;  4NLV A;  2JEI A;  3PFE A;  2OLW A;  5K5M A;  4H4M B;  1ZM2 A;  3OBI A;  5D77 A;  5IXU A;  1QAY A;  2BJ9 A;  1NK0 A;  3I5C A;  3M8P A;  2EBE A;  2R7O A;  3CB4 A;  1IBC B;  1RAG B;  5KFT A;  4BS2 A;  2YNG B;  2G0C A;  1X9W A;  1P8G A;  3R5B A;  3TAM B;  4HYK A;  2IMO A;  2VIC A;  5C5J A;  3VF0 B;  3LAN A;  1ZAV A;  4OI4 A;  1WSV A;  3M8S A;  3MTJ A;  4HDH A;  1T11 A;  4LF5 J;  2E44 A;  3D3B J;  3IG1 A;  3EM1 A;  3KJV B;  4WP8 A;  1LV5 A;  2VFU A;  5C24 B;  2CNK B;  2CQ3 A;  3AA9 A;  2MKJ A;  4OZJ A;  1XK8 A;  4CH0 S;  1RAF B;  2WBR A;  4XAK A;  1A0O B;  4J5O A;  5C42 B;  2UVR A;  2CDQ A;  4X65 J;  4YFU A;  2HS0 A;  3PR5 B;  2DJW A;  4N77 A;  1DJ0 A;  1NJX A;  2N7Y A;  3H8Y A;  4F4Y A;  2FPH X;  4TYA A;  3OJU A;  4LFC F;  2ZC3 A;  4V1A k;  2PDA A;  1D9A A;  4X4N A;  2RUS A;  2ZOM A;  1WG1 A;  3GYN A;  2DYA A;  4CH7 A;  4ELV A;  1QSS A;  1G3O A;  5CD4 A;  1NND A;  1RTZ A;  4KE5 A;  4DLE A;  3I4H X;  2CWK A;  3KLI A;  1H6K X;  2MEW A;  3M1V B;  3QGH A;  4LFA F;  1KVI A;  3U1N A;  3WIU A;  5F8J A;  3HHL D;  3DGP A;  2X1F A;  2H48 B;  1JLC B;  3GJT B;  2BXJ A;  3DLH A;  4QR2 A;  3U02 A;  2E5H A;  2GHV C;  3MEC B;  3P49 B;  1AB8 A;  2ZBR A;  2VUG A;  3OUY B;  1Y5L B;  2ZUG A;  1UFW A;  4LF1 A;  2ZD1 A;  4M5G A;  1FJG F;  2HG4 A;  3H4D A;  3I0R A;  3G82 A;  5B08 A;  3BGR B;  2EK6 A;  2R4F A;  4ES1 A;  3QAU A;  2GV1 A;  1Q8L A;  5G0R B;  4IOC Q;  2VA3 A;  3JAM U;  1JLB B;  4ZVQ B;  1B3T A;  3DI6 A;  1OJ4 A;  1Y7P A;  5GAE U;  1KC8 T;  1U1O A;  2BOP A;  3CD5 A;  3PTW A;  3D4J A;  1HW8 A;  5HN0 A;  1NZA A;  4PZV A;  1FJ7 A;  1BWV A;  4QIW D;  4RBV A;  2XS7 A;  5HAN A;  1YK9 A;  1SKU B;  2DIV A;  3P3D A;  3R97 A;  5A8W B;  3VGT A;  1XBW A;  2UUW A;  2QT7 A;  2X7I A;  2XSF A;  1XJW B;  2JOQ A;  4DR3 F;  2BEF A;  2EFQ A;  4OMF G;  4WYL A;  2Z8Q A;  3ICL A;  3OD2 A;  3KFW X;  2WSE C;  1R7I A;  1DQ8 A;  3DYA A;  3CD6 S;  2OML A;  4TVA B;  4X4R A;  1LFW A;  3M2U A;  1IKW A;  3GU0 A;  1RAI B;  2HQG A;  3VQT A;  5GMK a;  4RPF A;  5DDQ C;  2LDY A;  4J9O A;  4NWB A;  5KT6 A;  2XYH B;  4F8R A;  1HMV B;  2AYM A;  1SJ1 A;  3QJJ A;  2JDJ A;  3RB0 A;  1KP6 A;  1MRO B;  2ZWP A;  2CNO B;  2CQC A;  4USI A;  4DSL A;  4RUH A;  1Y5I B;  3QT5 A;  3HVT A;  5ETQ A;  5D78 A;  5K9F A;  3GV5 B;  2OAU A;  2ZBP A;  4O44 A;  4NA3 A;  2PI5 A;  4ZVU B;  1C1C A;  3A8I A;  1U02 A;  2BW7 A;  2XI2 A;  3MEE B;  1QD1 A;  2ALZ A;  3M2V A;  1RHR B;  1YBU A;  2MJU A;  4C8Z A;  1HBU A;  4QIF A;  4RL1 A;  3PEJ A;  2FZG B;  4MMO A;  1YJ9 S;  2BV3 A;  4GKJ J;  5BR8 F;  4G65 A;  4ZP6 A;  4G1P A;  4ECZ A;  1OPI A;  1FKP B;  5T41 A;  2Z4P A;  2WVC A;  2BVZ A;  3BSA A;  3HD1 A;  1HYS B;  2DNN A;  5C2G A;  5A8K A;  2HIY A;  3TJ9 A;  4D3H A;  2XSJ A;  3DRX A;  3CCQ S;  4OIX A;  3US5 A;  4JOU A;  1G1X A;  2DK2 A;  1HQU A;  4ECT A;  3IWN C;  4UW2 A;  4YDX A;  3Q2T C;  1MG7 A;  4ECW A;  2WON B;  4MKY A;  4ZP8 A;  2UXB J;  3RJM B;  2YX4 A;  3N01 A;  2DEI A;  4A8Q A;  4IOB A;  4H4O B;  2HRU A;  2M52 A;  5D0R A;  1KHW A;  4PWU A;  2XS2 A;  3K0J A;  2GS8 A;  2LLZ A;  1S0M A;  1HPZ B;  2AYE A;  2UUB F;  2AJQ A;  4NLX A;  5T7L B;  3BBB A;  4HT7 A;  4U96 A;  3LWM A;  1XER A;  4DPX A;  4KGZ B;  4AFF A;  1RTI A;  2LQ5 A;  4DR5 J;  2CUY A;  4WII A;  3GYG A;  1F1B B;  2CZ9 A;  2YBV A;  3QQC D;  5J2M A;  3GR0 A;  3NEK A;  2BJD A;  1W26 A;  3M9O B;  1RLC L;  5J1P A;  1F60 B;  5A0Y A;  5LM7 E;  2UXC F;  4P7V A;  2CXE A;  2RD5 C;  2UVU A;  2AMC B;  2BRK A;  3FMW A;  4LFA J;  3CMA S;  2HQF A;  1E6V B;  2V9W A;  1FXL A;  1S1V A;  1F9E B;  1UCN A;  2CG8 A;  3TVK A;  3I5A A;  5DET A;  2WSF C;  1AUS L;  1XR7 A;  2B4V A;  3BH7 B;  4CP5 A;  1X60 A;  1F6T A;  2GX8 A;  3SYZ A;  4AQY F;  2GMH A;  1EP4 B;  1JXL A;  2BQU A;  1M1K T;  1PJ5 A;  2A6M A;  2E9R X;  1Z2Z A;  3DDI A;  2K7J A;  4L73 A;  4E8U A;  2CFX A;  2GMJ A;  5LJ3 Y;  4OJ1 A;  1WDD A;  3K57 A;  2W7A A;  5IC4 B;  1LWC B;  3OR2 A;  3T1A A;  3ISN C;  1Y11 A;  1EX8 A;  5FDL A;  2G9O A;  1QAI A;  2HQI A;  4HI1 A;  1SV5 A;  1S6P B;  2YKP A;  1IQZ A;  4EO6 A;  2MGZ A;  3G8Q A;  2QYC A;  2VG7 B;  2YKM B;  2XC9 A;  1I6J A;  3KMS A;  1MWZ A;  1YJV A;  4XIU A;  4DR3 J;  1T9Y A;  2Z2Z A;  3R1L A;  5KT5 A;  4IRK A;  1WHW A;  2Y9H A;  2EW9 A;  1GQE A;  3VGV A;  3H59 A;  3P96 A;  4JI2 J;  1IKY A;  3IN5 A;  1VBZ A;  3DKD A;  3FVY A;  5D15 A;  3DLB A;  2ZNZ A;  2ADC A;  1QLN A;  5I3U B;  1HHQ A;  1RCO B;  3NMR A;  4CCH A;  4AT1 B;  1FWK A;  1B70 B;  4KH0 B;  1VQP S;  1VI7 A;  3LAM A;  3HHD A;  2EPI A;  3SMZ A;  3ENV A;  2FJD B;  2W9A A;  1UVI A;  1RTD B;  4RO0 A;  1WTB A;  4LFB F;  2RIL A;  3FSX A;  1PAU B;  2Y8Y A;  2AEM A;  3D5M A;  5B7W A;  3LP1 A;  2NLW A;  7FD1 A;  5KT3 A;  3N79 A;  1N34 J;  3GFY A;  2B9W A;  3MED A;  3JSM A;  2HAI A;  4WYW A;  1S79 A;  4URG A;  3UVJ A;  4DCJ B;  3R3T A;  3DLG A;  3IM9 A;  1N6Q B;  1LK7 A;  5ETP A;  2QTW A;  2WVE A;  1G7C B;  1D09 B;  1FK9 B;  2PEB A;  4LSL A;  3W63 A;  2UUA J;  4FNH A;  2RKI B;  4ICL B;  3BYR A;  1LNQ A;  2ABY A;  1NJZ A;  3DLE B;  6AT1 B;  3VAM A;  4F2R A;  4WZM A;  3C6T A;  4N41 A;  5EN1 A;  1HBO B;  2J0Q D;  4NYZ A;  4OI0 A;  2YWE A;  2KJV A;  1SKS A;  1FRK A;  1NJI T;  2OEJ A;  1S6Q B;  5ETT A;  3MM7 B;  2KU7 A;  1RSC A;  5F8M A;  3H7H B;  1P27 B;  1SPB P;  2Q3P A;  2MZR A;  4P2S A;  3QGP A;  2DCL A;  3AT1 B;  4MH8 A;  4A46 A;  4YHH F;  2ZJQ Q;  4X62 F;  3NGT A;  3QAT A;  4X4P A;  3T1Y J;  3NAI A;  4DCP B;  2DIS A;  4QWE A;  3DRR A;  3TAN A;  3QAE A;  2Q6B A;  4IR9 A;  3E01 B;  1GXU A;  2IVM A;  1RAO A;  2B56 A;  4GKK J;  3CMQ A;  4DQS A;  4MJK A;  1D0E A;  1ZAX A;  5E3R A;  5C25 B;  2KFN A;  1IKX A;  2N4D A;  1KKH A;  3W2V A;  1FX4 A;  2DXF A;  1REV A;  1FDD A;  3MM9 A;  4C0B A;  1R0B G;  3F56 A;  1DTT B;  4ZS6 A;  5CYJ A;  2E7X A;  4O0N A;  3MPU B;  2HW3 A;  4NLQ A;  1N48 A;  3W1Y C;  3LTO A;  3MM5 B;  2MMY A;  1TL7 A;  2A10 A;  2YKQ A;  4FVC A;  2IBO A;  3C15 B;  2B51 A;  4JV2 A;  4DX5 A;  1FT8 A;  3F0N A;  4ZLJ A;  2WW8 A;  4FF3 A;  4KB7 A;  2FJE B;  3B54 A;  2ZVS A;  2EC2 A;  4TN2 A;  2V4J A;  1LW2 A;  3SDE B;  1RHJ B;  1U7L A;  5L9X A;  2XZD B;  2HHS A;  3IXQ A;  2JHE A;  4O4R A;  1NSK L;  3GZ7 A;  1E6Y B;  3I6P A;  3POT A;  3VVU A;  3LP2 A;  4F36 A;  4EZ9 A;  5AXL A;  1ZM3 A;  2VFS A;  5KG5 A;  1DQ9 A;  4I6A A;  3SIP B;  2W7P A;  3T9N A;  3O8W A;  4KGK A;  1YVF A;  4KYZ A;  1CSJ A;  5E3Q A;  2GHW A;  4DI6 A;  4ZPA A;  1HWI A;  2D74 B;  5IC6 B;  1VS3 A;  4TYB A;  2YWW A;  1R8P A;  5THW A;  3E2E A;  1CJK A;  3W60 A;  4NXN F;  4ID5 A;  4KGV B;  3SQO P;  3DM2 B;  1SH0 A;  3KK1 B;  2QYG A;  1S49 A;  4DMZ A;  2W2N P;  4NLS A;  1LW0 A;  3RRG A;  5D4L A;  4Q0B A;  2HFN A;  4J9K A;  3C14 A;  1BLU A;  5CYQ A;  4Q45 A;  2E7V A;  2ZIT A;  1NJW A;  3BS9 A;  2RRN A;  4CM2 A;  4EUV A;  2YPY A;  3CSK A;  3CUN A;  3KDO A;  1NK5 A;  3GPA A;  1PYT A;  3AJ1 A;  3MCM A;  3HM9 A;  3C66 A;  1HNX J;  1P9Y A;  2VH7 A;  1D9D A;  1Q79 A;  4NLW A;  2AX1 A;  2RSQ A;  1SJF A;  3M8Q B;  2FHK A;  2CQG A;  1K0T A;  4WF9 Q;  5F8G A;  5KFN A;  3J7Z 5;  2OJ3 A;  1FD8 A;  3IGN A;  1HNV B;  3QLH A;  1LWX A;  1RYS A;  4DOZ A;  1BY9 A;  1C0T B;  2HBQ B;  1HI1 A;  3BR8 A;  3N9U C;  3NP5 A;  4LMZ A;  2F63 A;  2AV5 A;  3OXF A;  5GVQ A;  3PRV A;  5CCM A;  1WG4 A;  4LFB J;  2F9D A;  3GIL A;  3FMB A;  4MAK A;  3RW6 A;  3WHI A;  2M7S A;  5J1E B;  3LP0 B;  1UZD A;  2HQ3 A;  1H72 C;  2ZUA A;  3PIP Q;  1VMB A;  4C3L A;  3VGS A;  2DNR A;  4K4U A;  3MPY A;  4DDF A;  3MAA B;  4Y34 A;  2PO4 A;  1NM2 A;  4C7Q A;  4ZPD A;  2HGM A;  2H51 B;  4IDK B;  3IRW P;  1HBN B;  1RTH B;  5BJR A;  3THV A;  3JQK A;  3ISZ A;  2K8G A;  1FRJ A;  4DN9 A;  4OI6 A;  1NZ8 A;  3UW1 A;  4EEY A;  2IY5 B;  3BYP A;  2J76 E;  1H7W A;  2RDI A;  2KFY A;  2CJX B;  1YJU A;  2MQM A;  2HZC A;  2E9T A;  5KG2 A;  1RT3 A;  3HT0 A;  1B7F A;  2RRB A;  3WDO A;  3EPG A;  4NPO A;  3RYL A;  2ATC B;  2G4B A;  1QY7 A;  1HFE L;  4QYR A;  4Z7Y A;  4JV5 J;  2W9C B;  1S99 A;  2A3J A;  3GV8 B;  2CNL B;  1XMO F;  3CNQ P;  4J37 A;  4DL5 A;  3PW5 A;  1SJ3 P;  2CPZ A;  2B6A A;  3JXO A;  2XLJ A;  1S1X A;  1I94 F;  3MR6 A;  4P10 A;  3RW7 A;  4IH7 A;  1NPR A;  3RTV A;  2YNH A;  3M8Z A;  4LF7 J;  4I2Q A;  3PZP A;  3F44 A;  1H2U X;  3NRB A;  1IQT A;  3I9Z A;  4ZOS A;  3MPD A;  4ZKA A;  2MXY A;  2GCF A;  1QJH A;  3IS9 B;  4ZIW A;  3ET6 B;  3KK3 A;  4EYI B;  3IAS 9;  3UD3 P;  1ICE B;  1JJH A;  3PW2 A;  1UTA A;  1S97 A;  2VC1 A;  4B9L A;  4WZQ A;  1VR6 A;  1NU4 A;  2L48 A;  1FDN A;  1U25 A;  2IJN A;  4I69 A;  4DF4 A;  4FYX B;  4OJG A;  4CNZ A;  2E1A A;  3PX4 A;  1R6Y A;  2OD6 A;  1S57 A;  3ITH B;  4K4W A;  4FNI A;  2RIJ A;  1MNE A;  4RZR A;  1WJ9 A;  3BGF A;  3B4M A;  3LQV A;  2JVO A;  3D3C J;  1YLX A;  4DX7 A;  1T03 A;  2OPS A;  1JXV A;  1S4E A;  1UJ5 A;  3CW2 C;  2BRL A;  1CJT A;  3MMJ A;  3N6L A;  2Z2M A;  2HK2 A;  3G9C A;  3CDE A;  3ZNJ 1;  4YS2 A;  3JSB A;  3QWP A;  1YDL A;  2XMW A;  3KKF A;  4LF4 J;  3AJ2 A;  2EG1 A;  5CAA A;  5KG6 A;  1ZA2 B;  1EHW A;  4U6P A;  3L4B C;  3FNN A;  5I42 B;  1RWM B;  4NXN J;  2KM8 C;  2XG8 A;  4HH0 A;  3MWB A;  2GIF A;  1U45 A;  2BKO A;  2QSF A;  5A8R A;  2R7T A;  5EX3 A;  1PO6 A;  3SSS A;  1TQL A;  5LL6 d;  4DR1 J;  4ITS A;  5DGB A;  3T41 A;  4F2S A;  1CJU B;  3QFW A;  2B0G A;  5IFM A;  4QCL A;  2V0N A;  2M9K A;  3S8S A;  1L3S A;  4MT1 A;  4I0W A;  1UPP A;  1SKW A;  2HPU A;  4ZCM A;  1IBM J;  1QVG R;  1WKK A;  3FSI A;  2Q79 A;  3ZZU A;  2R7V A;  2CPX A;  4K0K F;  5E2Q A;  3AJD A;  4RW8 A;  3BKU A;  1RTJ A;  2V67 A;  2J0W A;  3PW7 A;  1FWP A;  1U1K A;  5HBM A;  1RWW B;  1GFW B;  4KFB B;  1M5S A;  4CO5 A;  2V2Q A;  1T9T A;  2RAQ A;  2XWX A;  3EDQ B;  4KO0 A;  1WUU A;  4M5J A;  5G4D A;  2MB0 B;  5CAB A;  4ILM A;  1TFY A;  1NSP A;  1AA1 B;  1H38 A;  2DHX A;  2XMM A;  1IM6 A;  4TU7 A;  3FFI B;  2ROE A;  1RAB B;  2O66 A;  4OLP A;  3GP9 A;  2RU3 A;  2OTJ S;  4LF8 F;  2HVD A;  1WOR A;  5KT7 A;  4BC7 A;  3NXZ A;  1X4G A;  3C3L A;  2HHP A;  2YX1 A;  2BOA A;  1YBA A;  4RUB A;  2BE7 D;  2L9D A;  3D0G E;  3UQS A;  2HBY B;  1IKV A;  4TKT A;  2HIQ A;  1UAW A;  4ED8 A;  1K47 A;  1FNX H;  3FBE A;  4BWJ A;  1DRZ A;  1VCT A;  2W4P A;  3BZQ A;  1FJE B;  4NLR A;  2DR9 A;  1XNR J;  2E7W A;  1A7G E;  3M8Y A;  5I3P A;  1KON A;  3H4B A;  4WIQ A;  2HLT A;  1UMJ A;  2G0J A;  2XCA A;  2YY3 A;  5DM6 Q;  3ILL A;  5GAG U;  4DV3 F;  1U8W A;  1SL0 A;  3M6U A;  1AFI A;  4A8W A;  3HF5 A;  1U1Q A;  2X1A A;  4U9R A;  1BD6 A;  3NS7 B;  3M30 B;  1UVN A;  2NUU G;  2F4V J;  4OL8 A;  5KFV A;  1U49 A;  3R5G A;  2ZJP Q;  5MAO A;  4GRS A;  1MN9 A;  4ILR A;  4ZDN A;  5LT5 A;  1TAQ A;  4HLB A;  4G6V B;  2DEJ A;  4HL9 A;  2DNZ A;  2R8J A;  5EUH A;  3CF5 Q;  3CDA A;  4R0E A;  1JK9 B;  4B9M A;  1JLQ B;  2C42 A;  2K3K A;  1C4C A;  2DR5 A;  4WKR A;  2E1P A;  1CJV B;  3OXG A;  1HWU A;  1SKR A;  2LA6 A;  2DGO A;  2YQ1 A;  1N0V C;  4P6Q A;  4OX6 A;  4K7Q A;  2DNP A;  4C8N A;  2AF6 A;  3S01 A;  3HD2 A;  1S9G B;  1SUQ A;  1X4A A;  3OL7 A;  2B7B B;  4NLP A;  1YSJ A;  4AXI A;  1FFW B;  2GC8 A;  5BYR A;  1GMW A;  8AT1 B;  2DNY A;  2WOM B;  1R3N A;  4PUO B;  5K8P A;  4DN0 A;  1FFG B;  3HSD A;  4LSN A;  5J2P B;  3HJV A;  4RW7 A;  5E5N A;  2AGP A;  3E51 A;  2Y1J A;  1R8H A;  1BQX A;  4DV2 F;  4Q8F A;  1NLK L;  2J9D A;  4ZPW R;  2MST A;  2OPQ A;  4QPT A;  5D0E A;  2DGV A;  3GIJ A;  1S1T A;  2UUC J;  1VQS A;  4DPO A;  3IRX B;  3DU6 A;  1KHV A;  3L09 A;  1JX4 A;  2ZH9 A;  4WU3 A;  1O0P A;  4ZJL A;  4M5D A;  3X3U A;  1ZBT A;  3IM8 A;  2AEJ A;  3WC0 A;  3FQL A;  2ZC4 A;  1J5O A;  2HHX A;  3A3P B;  2FGO A;  1EAY C;  1KVK A;  2K1R B;  4LRE A;  1C2P A;  4ALZ A;  2HVZ A;  3R7B B;  4X4U A;  2L9N A;  5AE3 A;  4G3I A;  5L46 A;  4RKU C;  2XM3 A;  1XMQ J;  5J2N B;  2CRL A;  2G2Z A;  3R9L A;  3RB4 A;  3D1Q A;  4K4S A;  2ZZN A;  1HNI B;  2GJ2 A;  3DRS A;  5AXK A;  3EZ5 A;  2IYG A;  3QRQ A;  1TP7 A;  3GR1 A;  1X9S A;  1UA1 A;  2NXE A;  3FEY B;  2DGW A;  2M88 A;  4X84 A;  3V81 A;  3TX0 A;  4M8L A;  5HJY A;  2FHJ A;  3CCS S;  4LRC A;  5D3G B;  1K8A T;  1GT8 A;  2LCW A;  4F4W A;  2QLF B;  1TL1 A;  2XMK A;  4M94 A;  2XYP B;  2IM1 A;  1ARO P;  2C3P A;  4KSE B;  3EX7 B;  4X2B A;  4FYD A;  1P6T A;  4OHW A;  2VBX A;  2V5H G;  3PIO Q;  4YN3 B;  1WTF A;  2M0G B;  2Z0G A;  3SQG A;  1JLE B;  3BR9 A;  4PQU B;  3HSJ A;  3AXK A;  3KLF B;  3BQ0 A;  5DRK A;  4ZPB A;  5B09 A;  5GAH I;  2DHG A;  4KKO A;  1ROF A;  4DXL A;  4NZ7 A;  3BKT A;  1VIO A;  4F04 B;  2F8H A;  3RGI A;  3AAW B;  2BE2 B;  3VAF A;  5D0G A;  4DR7 F;  1MMD A;  2BR0 A;  2YNF A;  3DXB A;  3PDN A;  1PYS B;  2DXD A;  2AYB A;  3EXY A;  5B0A A;  3MR5 A;  2ZHO A;  5HMW A;  2FYX A;  3V5R A;  3AFG A;  2HHT A;  1U48 A;  2HHQ A;  3GFH A;  2O5D A;  3KUG A;  2FJB B;  1XTZ A;  2HWI A;  4I6W A;  3PW0 A;  1NJY A;  3V6D B;  2LEC A;  4C8Y A;  2AZ1 A;  1S9F A;  3V4M A;  5B0F A;  2KH9 A;  2NS1 B;  4Q43 A;  1LXJ A;  4LJM A;  2QGF B;  2HNZ A;  3IG1 B;  3O44 A;  3LPE A;  3MD1 A;  1N4L A;  4DV4 F;  1GTE A;  1F9H A;  2CJY B;  1OMS A;  3NBP B;  2J8A A;  3C16 A;  1C1B A;  5IM0 B;  4QW9 A;  4RLE A;  4F4A A;  2VF3 A;  4ZVT B;  4DL7 A;  3UO0 A;  4MYT A;  2HHU A;  4K5S A;  2RRA A;  1GMU A;  3VAJ A;  1TVR A;  3OFE A;  1OY6 A;  2Q43 A;  4H4K C;  1EIY B;  4ES2 A;  4FXD A;  3OTB A;  3VQS A;  1U47 A;  1NKC A;  2Z58 B;  1F3F A;  4PEO A;  5DLF A;  2QLJ B;  4QW8 A;  1VQO S;  1KD1 T;  2KG1 A;  1IWG A;  3W2W B;  2CPI A;  2QA4 S;  3MUV P;  2W9B A;  5LMU J;  3T1H F;  1KQG B;  2NUH A;  1V6H A;  3C19 A;  5KT4 A;  3PXG a;  2CQI A;  3M32 A;  2QMU B;  2MZQ A;  4ED4 A;  1FDA A;  3MR3 A;  2NXC A;  2EKN A;  2XGQ A;  2HAF A;  1TKD A;  4AL5 A;  2QFJ A;  2DNO A;  5L1L A;  1UVM A;  3PG9 A;  1G2E A;  1HWK A;  2CQD A;  1SC1 B;  2PMW A;  5F41 A;  2F9J A;  1W25 A;  1SH2 A;  2D7S A;  4LBI A;  3BQ1 A;  2QV6 A;  1TKT A;  3JB9 k;  1OSD A;  2ZBQ A;  4DU7 A;  2VOP A;  1HD1 A;  1LXN A;  2KHD A;  3DOL B;  1QTM A;  1TUG B;  4N47 A;  2GQQ A;  3IC1 A;  3P5T L;  2B8Q A;  4NCG B;  4IUF A;  3GFZ A;  5KFY A;  3R6L B;  2OPR A;  2XMT A;  1NCL A;  4D3G A;  2XO7 A;  4KHM A;  1YGY A;  2P9C A;  4O3Q A;  3GE9 A;  1T05 A;  4JP8 A;  4I64 A;  2ZJR Q;  2M8H A;  1IBL F;  5I3Q A;  2V6A A;  1KRP A;  2KJW A;  2FTR A;  2D3U A;  3KNA A;  1P9Q C;  2VPW B;  3DYA B;  4KPY A;  1WG5 A;  2HWT A;  2WVF A;  1IN0 A;  3MOJ B;  4H4M A;  5KFP A;  4B3R F;  4UY8 T;  1IKW B;  3RZA A;  1PC4 A;  1IBK J;  1WF0 A;  3JYT B;  3QGI A;  3CCR S;  1PAE X;  1UFK A;  4DQQ A;  4ED5 A;  2MQN A;  2YQ0 A;  2YNG A;  4P74 A;  1S59 A;  2WRM A;  1DLO A;  4WU2 A;  2IAJ B;  3NGR A;  2RDJ A;  1VQ5 S;  3RAX A;  4FBU A;  2OEK A;  1S72 S;  3LF0 A;  3CCL S;  2KO1 A;  1C1C B;  2LMI A;  4PYA A;  4YOE A;  4IQX A;  2OPP A;  5KFD A;  3ZC4 A;  3KJV A;  5HP1 A;  2EFO A;  2R8K A;  3M2V B;  5C24 A;  2P8I A;  3R7S B;  1RJJ A;  2XLI A;  3CIM A;  3DLJ A;  1HBU B;  3K8V A;  1Y3J A;  1KWM A;  2B4U A;  3IAM 9;  4EBC A;  2KG0 A;  5C42 A;  1WOS A;  4I7F B;  4CQ1 A;  3IWL A;  1YRX A;  1UJ4 A;  3ETO A;  1GH8 A;  1RGV A;  1HNZ F;  5KFA A;  2KKH A;  1VBK A;  3FSY A;  2XY6 A;  3T19 A;  3H2L A;  1J27 A;  2WB4 A;  2DNH A;  2CQ4 A;  3S7R A;  3CJ3 A;  3K17 A;  1U0S A;  4WXO A;  2Y0S D;  5B0E A;  5CCL A;  5A8K B;  3PCO B;  1QDU B;  3FGV A;  4B3O B;  2HVH A;  1NKE A;  1Q4R A;  5L38 A;  1AZS B;  3UN3 A;  2ZH4 A;  3EGW B;  2ZBI A;  5F3Z A;  3EYZ A;  4JI1 J;  1NK9 A;  2AKW B;  3PYG A;  1HQU B;  4DR2 F;  1WHV A;  1Q0N A;  1JIH A;  3M1V A;  3O6Q A;  2BAN A;  1FXR A;  4C8O A;  4OV1 A;  3QZ8 A;  3AA8 A;  1JLC A;  2WVB A;  1D8Y A;  1UJ6 A;  3MEC A;  2ADB A;  2CVI A;  2HQD A;  4OX7 A;  2HVI A;  1N56 A;  3OUY A;  3BSN A;  2VV5 A;  2GJI A;  3TA2 A;  9RUB A;  4DG1 A;  4IFV B;  1U1R A;  3RBE A;  1S1U B;  4QR1 A;  2ILY A;  1YZ6 A;  3BGR A;  2MPU A;  2ASY A;  1VQM S;  3UNG C;  4ELT A;  4PWD A;  1U2R A;  1WAC A;  2CQ2 A;  4X4T A;  2PI4 A;  4J90 A;  2FIU A;  4N8O A;  1SJ4 P;  5HLF B;  3HHL C;  5G0R A;  1PIE A;  1JLB A;  2DR6 A;  2IHR 1;  5A0Y B;  3T1H J;  3PRD A;  2QLB B;  3EMT A;  3K5L A;  3GQC A;  4DZ6 A;  2VG6 A;  1URR A;  2IBK A;  2ZH3 A;  4X4Q A;  2PC6 A;  2FC9 A;  2EFP A;  5A8W A;  2DB1 A;  3PHE A;  3AQP A;  2GAH C;  1PJ6 A;  2V34 A;  2L3M A;  1S1V B;  5DZ7 A;  5IV3 A;  2C3O A;  5K20 B;  1AFJ A;  3CCM S;  4KC5 A;  4OYX A;  3ZZO A;  4FS2 A;  3IBC B;  2IRY A;  3M2R B;  4DZD A;  4DUZ F;  4USM A;  3EGN A;  2AJF E;  5A2Q U;  2F7V A;  4HHU A;  5ADZ A;  1HMV A;  2BBE A;  2EG2 A;  5H9F J;  2F65 A;  1UWB B;  3NWG A;  1AYE A;  1JLA B;  5IWA J;  2XO6 A;  1DTQ B;  1F2G A;  4NLU A;  2M3D A;  1ZPV A;  2K06 A;  2GQ2 A;  3H5U A;  4RJV A;  1U0H A;  2VFR A;  4DUY F;  2OSR A;  4C11 A;  2B4P A;  4M1K A;  4Y00 A;  1VOM A;  8RUC A;  3R2C J;  5E0O A;  5F0U A;  4AD6 A;  1GX5 A;  2DH8 A;  4MIW A;  2CNN B;  3W9H A;  5FDL B;  1MLA A;  4I4B A;  4EGL A;  2MZJ A;  2B43 A;  2YX7 A;  1RAA B;  2DH9 A;  3TNV A;  4JI0 F;  1J5E F;  4OZ0 A;  3BDE A;  1IBL J;  2VJU A;  2VKR A;  4FZV A;  4DQI A;  4I2P B;  3G71 S;  4OYO A;  5KTQ A;  4K4Y A;  2RS2 A;  2CPH A;  1MWY A;  2HGN A;  1FRX A;  1IKY B;  2YNI B;  4B3R J;  4XPE A;  2BKN A;  3CJS A;  2KZZ A;  3FZB A;  4YR3 A;  1JLF B;  2W2M P;  2HRT A;  4KTQ A;  1FKP A;  1D8Z A;  1DFD A;  1VRQ C;  3BO4 A;  4K50 A;  1UW9 A;  3TYT A;  2XMU A;  3NGU A;  3W9I A;  3EVO A;  1RE1 B;  4F25 A;  3GG0 A;  3QGG A;  4N7T A;  1SH3 A;  3CCU S;  1JJ2 R;  1BXN A;  2C2R A;  2KL8 A;  2QJ3 A; 
#chains in the Genus database with same CATH homology
 3D3C J;  3J80 U;  1HNW J;  4LFA J;  4LFB J;  1N32 J;  4JI5 J;  5FLX U;  4RJV A;  1XNQ J;  2UUA J;  4DR3 J;  2UXD J;  4OX9 J;  1IBM J;  2MQ8 A;  4NXM J;  4JI7 J;  4JYA J;  2UUB J;  4DV6 J;  5IT9 U;  4DR2 J;  3R2C J;  2HHH J;  4X65 J;  4DR6 J;  4LF6 J;  4DR7 J;  5AJ3 J;  2UXB J;  4JI6 J;  4YHH J;  4DV3 J;  4JI2 J;  3OTO J;  4X62 J;  1IBK J;  2VQE J;  3T1H J;  4KY3 A;  4B3S J;  1IBL J;  1N36 J;  4V1A k;  5BR8 J;  3JAM U;  4LF4 J;  4LF7 J;  4DUZ J;  4DV1 J;  4B3T J;  1XNR J;  4DV7 J;  4DV5 J;  1XMQ J;  4DV2 J;  4JI1 J;  3R2D J;  2KVQ E;  4LF8 J;  4NXN J;  4X66 J;  1N33 J;  4YY3 J;  4DUY J;  1HNZ J;  4JV5 J;  2VQF J;  5LMN J;  3T1Y J;  1HNX J;  2UXC J;  2MEW A;  4B3R J;  3IMQ J;  1HR0 J;  4DR5 J;  4GKJ J;  2ZM6 J;  4PWW A;  4KHP J;  4DR1 J;  2MTL A;  1J5E J;  4JI0 J;  4GKK J;  5A2Q U;  1FJG J;  4X64 J;  2E5L J;  2F4V J;  4KYZ A;  4HHU A;  4LF9 J;  1XMO J;  4JI3 J;  4LF5 J;  3D3B J;  1N34 J;  4DR4 J;  3J81 U;  5LMU J;  2UUC J;  4B3M J;  4NEY A;  4K0K J;  4JI8 J;  5LM7 E;  1I94 J;  4JI4 J;  3J7A N;  4NEZ A;  5IWA J;  4LFC J;  4DV0 J;  2UU9 J;  3W1Y C;  4DV4 J;  2KL8 A;  4AQY J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...