2UU9J

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gug-codon in the a-site and paromomycin.
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RRNA
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
molecule tags Ribosome
total genus 10
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 2uu9J00
1N34J 4K0KJ 4X66J 4DV1J 1IBLJ 4HHUA 4LF9J 2KVQE 3W1YC 1J5EJ 4DR4J 2UXBJ 1XMQJ 4JYAJ 2HHHJ 2VQFJ 4LF6J 4LF7J 5LMUJ 2ZM6J 2F4VJ 4LF5J 4YHHJ 4JI7J 4NXNJ 1XMOJ 2UUBJ 4KYZA 4NEZA 4DV5J 1I94J 2MEWA 4DV4J 1IBMJ 2UUAJ 1IBKJ 1XNRJ 3D3BJ 2UXDJ 5A2QU 4DV6J 5BR8J 3T1HJ 3J7AN 4LFCJ 4DUZJ 4OX9J 4JI4J 4NXMJ 4B3MJ 5AJ3J 3IMQJ 4GKKJ 1N32J 4B3RJ 4LF8J 3J80U 4DR3J 4DR5J 4X64J 1HR0J 4JI8J 2UXCJ 4DV3J 4RJVA 5LM7E 4JI6J 4DV7J 4GKJJ 4LFBJ 1HNZJ 2UU9J 4V1Ak 3D3CJ 4JI5J 4JI3J 1N33J 4JV5J 4X65J 4DR2J 3R2CJ 4LF4J 1FJGJ 4DV2J 3T1YJ 2UUCJ 4B3SJ 1HNXJ 1HNWJ 1N36J 4B3TJ 5IWAJ 5FLXU 4PWWA 4X62J 4NEYA 4YY3J 5LMNJ 2KL8A 4JI2J 1XNQJ 4DUYJ 4JI1J 3OTOJ 3R2DJ 4KHPJ 4AQYJ 3JAMU 2MQ8A 5IT9U 2E5LJ 2VQEJ 4KY3A 2MTLA 4LFAJ 3J81U 4DR7J 4JI0J 4DR6J 4DV0J 4DR1J
chains in the Genus database with same CATH superfamily
2G1HA 1JKHA 1WUUA 1IWGA 2AEMA 4FPRA 1WSVA 4ECUA 3X1LB 2VG5A 2ZKUA 3OTOF 3EXCX 3ZZOA 4DS4A 3CCMS 2GCFA 2KN4A 2J6TA 2O5DA 3M8RA 3N6LA 4LRAA 4QW8A 5KFLA 4UOCA 1C0TB 4USIA 4K0KF 4DL6A 2N3LA 2OEKA 3EJMA 3CO0P 4TY8A 4HKQA 2H4WB 1HD1A 2MJNA 3TNVA 5C2CA 3K2YA 4URGA 1GH8A 5EHHA 1S9GB 3TOQA 4OX9F 4C7QA 3MI7X 5I3QA 5C2GA 2KDOA 1F2GA 3KLIB 4ETXA 1KLMA 2LQBA 1MMNA 5ETPA 3RRGA 2XI3A 2EFVA 4DV2J 3CGIA 4CLSA 3CIMA 4GKJF 1KP6A 4I69A 2RNEA 4MK8A 1TKTA 5CYJA 2HRYA 3MAAA 1MROB 3VAFA 3R5GA 4DN9A 3WQPA 1HARA 4LFAJ 1RT3B 2M8HA 6FDRA 3G71S 2LU1A 1F2HA 2YXLA 1IR0A 4DHVA 1JWWA 4I2PB 1QAXA 5DDPC 2LKZA 2PI5A 4MTPA 1VRQC 2AX1A 2E5IA 2HHWA 2PI4A 3RBDA 1SJQA 5EX0A 2ZHAA 1P1LA 1VQ4S 1WHXA 1TL1B 4ENOA 1VQ6S 3AA9A 3QO9A 4OZJA 2FC8A 5JXSA 3O3LA 1K1QA 3VGVA 4MT1A 5A8WB 3J80Y 2V68A 3PJXA 4TKTA 2FY8A 5JJBA 5HMWA 1KKHA 3BR9A 1NKEA 2JEJA 1X4EA 4OZ5A 4OL8A 3OL6A 4LF4J 3THPA 1D8YA 1Y11A 2MDAA 2D3UA 2O66A 2MQNA 2LVWA 4Q2MA 1H6KX 3JTOA 3LGHA 4OIXA 3D54A 4DI6A 2DHGA 3TUIC 3MEEA 5EGYA 4KHMA 1FJEB 3HZEA 1G1XA 4HYKA 3BS9A 5HBMA 1KVKA 2AZ3A 5L9XA 3ILJA 5KFBA 4F0MA 3OTBA 3HVAA 1CJVB 2MZSA 4DV5J 2MY8A 3HLUA 3D3BJ 2QMXA 3KK2A 3ZC4A 1S1UA 3CT9A 2XC9A 3U02A 1U0SA 4BWJA 3HHDA 3SEOA 1SCJB 5AXNA 2F5GA 1P6TA 4CWBA 1OPZA 4KGVB 4ZPDA 3DI6A 3ETOA 2AV5A 3DNCA 1VK3A 1RZMA 2ACYA 2LXIA 3V81B 4F36A 9RUBA 4LR7A 3PW4A 1JLFB 2V63A 5K8MA 3LGMA 1PYTA 4OJ1A 4LVNP 4WPAA 3MPYA 3VAIA 4YY3F 2BXJA 4GO5X 2NQPA 4LFBF 5KFUA 1Y00A 3RAQA 2WVDA 4L74A 3LF0A 4B3SF 1S1WB 1SL0A 5HI7A 4QOTA 5C7PA 5F0UA 4CT9A 4TU9A 1T95A 1RP5A 2GVZA 3QT6A 1EP4B 1XMQF 2XMJA 4WFNQ 4DR4J 2DR7A 4WFYA 1EETA 1F6TA 2ZNZA 2AGOA 2W4CA 3LWLA 1H73A 1FERA 1NPRA 4D3HA 1O0PA 3DOMA 3MM5A 3ZZRA 1GMUA 4ED1A 5B0FA 2RKIA 2W1BA 1ACMB 1WC0A 4I6WA 2AT1B 1GNKA 2RRNA 4JI6J 5LM7E 3BBBA 4EU0A 1E6YA 1FXLA 3QJJA 3AODA 2PMZD 4X4RA 1NJZA 3SZ2A 4PYAA 4HI1A 1NJXA 1KC8T 2YX4A 2XHCA 4IG3B 3C14A 3FGVA 4USJC 1RAIB 2W25A 3I96A 3MHYA 1TL7B 1WEZA 2KL8A 2G13A 3QZ8A 3QT7A 2VC1A 3D67A 3M7VA 4DR1J 2R2TA 4ZHRB 5ETVA 1TTHB 2B9WA 1TR0A 1WC4A 1D09B 3M32A 2X1AA 4F2SA 3G8SA 3CD5A 4KYZA 4B9SA 2DRAA 1NMEB 3I9ZA 3WC0A 5B0GA 2D3O1 2J9DA 2RDIA 5HK4A 2D74B 1NK9A 1VS3A 4F50A 2BW7A 3GMGA 1FWLA 2DIUA 4O3SA 1T94A 3LUYA 4QU7A 1CS4B 3T41A 3PCOB 5HQMA 1RT3A 2RU3A 1CPZA 2DVIA 1LQ9A 1AUDA 1HKAA 4RZRA 4N5SA 2B5JA 2NXEA 2X1GA 4ZLJA 3MUMP 3EDQB 4ELVA 2BR0A 5KFAA 1T02A 4FYYB 1PAUB 1ELOA 3PJWA 5AXLA 4RR5A 1NJIT 5GAHI 5KT7A 2P9GA 2VU5A 4HHJA 3HVRA 1JK9B 1SQEA 3KJVB 3F0NA 1MSWD 2VBWA 1DARA 4QYZK 3HT0A 3DRSA 4ZP7A 3S7RA 4OX8A 2W9AA 4Z7YA 5A8WA 1LXJA 4ED0A 3DGPA 1IKVB 5T41A 4W4MA 4LSNA 2M3DA 1W26A 1AROP 1F5CA 3MM9B 3AOBA 3OJUA 2J7WA 1REVA 5EWEA 4ZPWR 1UEKA 1F0XA 2A0FB 5A6WA 3KJQB 3GR1A 4DUZJ 4ANCA 3F44A 2B8QA 1S7IA 3OL8A 1WHYA 4WZQA 1N5TA 3M8ZA 3B6BA 3MGJA 4U95A 3HSJA 4HT5A 3KDOA 5HLFB 5CD4H 3EZOA 4CLTA 3DLJA 3D3CJ 3ISND 2VIHA 3UN3A 2R2UA 4OI4A 2Z0GA 2MZTA 1NDLA 2PC6A 5K14B 3VWSA 3TQEA 2EXUA 1P8GA 4J9SA 2IAJB 4WU3A 5D0GA 2GO9A 4JI0J 1OMSA 4ECSA 4N77A 5GAEI 5LMNF 4DS5A 2BM0A 4O0IA 5F8MA 4IO9Q 5CCLA 2VJUA 4GC7A 2CNOB 2A10A 1SL1A 3QJLA 2JDJA 2PT0A 3JSRA 2HQCA 5GMDA 3CB4A 3GLJA 3CUNA 4ZJLA 1ZAXA 4WU2A 2ZKTA 3VTIA 1S76D 4IOAQ 5DZ6A 1S1WA 1XERA 4NLUA 3ENAA 3H25A 3TUJC 4JI5J 2ZWOA 3PIPQ 3TYTA 3UN2A 3W5YA 2LA4A 4K7QA 3IO1A 1T9VA 2KJVA 5KFOA 2OPRB 4NL5A 4XDCA 4DV0F 3X3UA 3AD7C 4LBIA 2DR5A 1RA6A 3GFYA 1X5TA 4ZLNA 2WONA 3E01B 3KHGA 5KFRA 1M1GA 1KQSR 1RA7A 3IRXA 2E1CA 1FVSA 2UUBF 2WZ1A 1CJUB 3P5BP 4RW9B 4HLBA 4NYOA 1H38A 1X0PA 2UUAJ 2W8KA 1RWOB 3T1HF 3KUEA 1OJ4A 2L41A 1KOHA 1TMJA 3I87A 4G65A 3EGVA 2HNDB 1BHNA 5KFMA 3K5LA 4GO7X 2C2KB 2DR9A 1T03A 1NU4A 4DV4F 2B51A 4U96A 3BQ2A 2V9WA 2UU9J 3GSDA 4LF8F 1NPKA 2ZZTA 4ID8A 4IG0A 3MM8B 1LWFB 1TKZB 1R6YA 4ZLPA 1RTZA 1JLAB 4UOGA 3MXHP 2X1BA 1TQLA 1KONA 2ZOMA 1MWZA 2YPYA 1CG2A 3W2WA 5DS7A 5I42B 2XY6A 3MEGB 2ZE2A 2VH7A 3GV8B 1SV5B 4L73A 1XNQF 2ACMA 2HS4A 1MU2B 1LKZA 1NBEB 3BGLA 1RT7B 3CCZA 3MMAB 1LW2B 1XR5A 1VQSA 3UO0A 3BB5A 1OS5A 4M8LA 2FJDB 1BUXA 1BWEA 2IFXA 1UL3A 4NCBA 4LUBA 3UN5A 4B3RJ 2B4VA 1FF2A 5E33A 2XCPA 3J7YU 3M8WA 4HACB 3NY0A 2NUUG 3A3PB 1FFWB 1Y5LB 3VQSA 1U25A 1GT8A 4OLOA 4OQJA 3OSPA 1JLBB 1BXNA 2QLBB 4ZVHA 5CCMA 5ETNA 2YWEA 3A13A 2BABA 2GJ2A 5CYMB 2JLFA 5J2MB 2BJ9A 3I4HX 3VGTA 5KFQA 3K59A 5BYSA 3AA8A 1RYRA 5K5MA 2RT3A 2XMKA 1IR1A 1OQ6A 2R7SA 1VC6A 2HBYB 1IBLJ 1EB0A 2MB0B 3DLLQ 1TAQA 5A8KA 4JI2F 4PEOA 1DRZA 3W64A 2D3OR 4TNOA 3R9LA 4LF7J 2G2ZA 2W7AA 2R7OA 1VQ5S 3R5CA 3P49B 2VBXA 2PDAA 1S79A 3MZIA 2RSQA 3AXKA 1TP7A 3OW2R 4C11A 5BR8J 1S0NA 2MLYA 4B3MF 4N41A 2C2EA 4EZ9A 3OVSA 1SJ3P 2R7UA 1S49A 3P4UB 2LXUA 2AJQA 5KFCA 2DHAA 3MEDA 2OTLS 2Y9HA 1U2RA 4DX8H 2DNZA 2Q1LA 2DGWA 2MKYA 3IBCB 3UDCA 4MK7A 4KE5A 1Q95G 4YR3A 2ZUGA 3HXMA 4ZN1A 4PXCA 3ZXWA 2YWKA 4HTJA 3OR2B 3V4MA 2ADBA 2BRKA 2YKOA 3NBPB 2AWZA 3LP2A 2M0GB 3KLVA 4CT8A 3FVYA 3DM2B 5F8GA 5JVHQ 4TU7A 4L3KA 2XLKA 4NMXA 5D78A 5D8HB 3BGOP 1HLWA 2MYFA 3EWGA 2C42A 3A8EA 2W9BA 3PY8A 4KGZB 1N52B 2J0WA 4NLDA 2R7RA 3ADAC 4JP8A 4K8RA 2KG1A 1WKJA 2CVIA 3FUYA 3W2VB 5IQQA 2LYVA 1HI8A 1VC5A 3JQJA 4ID5A 3Q22A 2AGPA 4C48A 1R89A 2HFZA 4LR9A 1XMOF 4LREA 2WOMB 1UP1A 4PG5A 5MAOA 3EM1A 2EKYA 5KFFA 4KGMA 3VAJA 1U47A 2V94A 3EZUA 2XZWA 3KK3A 5KT6A 3TVZA 5J1EB 2QL5B 3T1YJ 2IJFA 1WG1A 3POTB 2WB1D 4KQZA 4I56A 5KG3A 1CJUA 4JI1F 1C0UB 1NXIA 4WXWA 2C28A 3MMBB 3OVAA 4ECRA 5CQGA 4UQGA 5IS2A 1QTMA 2CQ4A 2V0NA 3GFHA 1UWAA 4J9RA 4ECZA 4FXWA 4RPFA 4KGXB 4F2RA 1GXTA 4DF4A 3HHKA 2Z2YB 4NLVA 3BPSP 2I0XA 3FRZA 3VCDA 4YP3A 4FYVB 4URQU 1TKZA 5J2NB 3BZQA 3I5CA 1Y5IB 2HPUA 3DRPA 1B4SA 2ROPA 3HCXA 1O51A 1ZPVA 2KYZA 3BREA 2JX2A 2OEMA 3O1LA 4WYLA 1O6XA 2HHUA 4USKA 3TZZA 3UDLA 4EZ6A 4W90B 1AYEA 2PIIA 1HYSB 1AXQA 3BBFA 2GMHA 5IC6B 3OV7A 3PX6A 2MQQA 1SH0A 2OO4A 2GC8A 3QSYB 2B7CB 2VPWB 3MMCB 4X62F 5CHCB 1VRTA 2XS7A 2BOAA 1SUQA 3JXOA 3IAS9 1KHVA 5BXIA 3W1YC 3RB4A 5KFTA 3HFVA 1H7WA 1N54B 1RLCL 4KV8A 3P5TL 3LP0B 1GX5A 2GNKA 2WSEC 1X60A 2UVUA 3H4DA 1M5VC 1KS2A 2BANB 4OX6A 3KJNB 1X5SA 1EQMA 2I8EA 4HH0A 1CC7A 3DLEB 3H2UB 4U67Q 3NS7B 2DGTA 4A8OA 4ELTA 4RJVA 1SC1B 3I0RB 1B64A 1G2EA 1CBKA 4C8LA 3FCWA 3JB9k 2ZD1B 2XY5A 2KO1A 3KLEB 2P9EA 4CI0B 3NKYA 4DV2F 3BSOA 3DCAA 1X4CA 2DPJA 5ITHA 3HJFA 5F8JA 4RW7B 3TJ9A 2DH9A 3S1TA 1NLKL 4M5LA 1CVJA 1U48A 1RWNB 4QPTA 5IQ6A 4FBTA 3J7A1 3O5TB 2Y3YA 2R8IA 1R43A 3AB2B 2FZKB 2VZ9A 2CQBA 3GIJA 3NLCA 1MMLA 2WVFA 4KKOB 4WK3A 1X8DA 4F4KA 1PYSB 1RU2A 2ZH1A 1FEEA 5K8PA 1RBOB 2J9EA 3CPWR 4L72B 1JJ4A 3C6UA 4E2FB 4BCAA 1IBKJ 2M8DB 4RW8A 1RHMB 1SXLA 3KNGA 3ONQA 3GP9A 4ER8A 3FC9A 2MQLA 1ZA1B 2WRMA 1FO1A 3ZO7A 3F56A 2VC0A 2HHVA 7FD1A 3MWBA 1N48A 2RJZA 1U6ZA 2HWTA 3RBXA 3W5XA 3JSMB 4O44B 3A1YG 1CEZA 2IC3A 1FK9B 1HBMB 3L7PA 2PO4A 1QJHA 3IBFB 1N4LA 2GV1A 2MZRA 4LF4F 2Y1LB 1OY6A 2DHXA 2Z56B 2UUCJ 4CNZA 1T8EA 2HHPA 4CDIA 3H20A 5I3UB 1BQMA 1JJ2R 4XPEA 1VK8A 3BQ1A 3QGIA 1FFSB 1HBUA 2YNGB 4Y2MA 3PG9A 5B0CA 2G4BA 4MFBA 4P2XA 1RABB 3I6PA 1R3NA 4HVZA 3QJPA 3UR3C 2BE9B 3H5UA 1U0HB 2EPIA 4QR0A 2A6MA 5M2RA 5ADZA 3A8JA 2ZBPA 4BLGA 2DNGA 4OYWA 4DSIA 4I7FA 4G6VB 4JI4J 3R6GB 3KG1A 1X9WA 1X4BA 1DURA 4DR5J 1FI4A 2HNZB 4GRSA 1SC4B 2WK4A 3WZ0A 1KOOA 4DV7J 2JLEA 1SBRA 4DCPB 4UT4A 3MAHA 3UPFA 4U7UD 2V2VA 4DX5A 2QA2A 3ILOA 4J9VA 1N5YB 2QLFB 2R2RA 4B3TJ 3MURP 2EKNA 4U9RA 3MCSA 4OYZA 2ILZA 3OTOJ 3H5YA 1TL3B 4O4GB 5KFWA 1OYDA 4XK8C 1KQKA 4RBUA 5A8RA 4CM2A 2XS5A 4K0KJ 1X4DA 1H2TZ 4U6PA 2GAHC 4CM0A 3MM7B 3OSNA 3C16B 4AQYF 5A0YB 2ATLA 3C19A 4I2QB 3QGHA 3W8GA 7FDRA 2AYBA 3DU6A 1K9MT 4NEZA 4NCGB 3HKWA 1R8BA 2EK6A 5LJ3Y 1DTQB 4OX9J 2XY7A 2DB1A 3CJ0A 1N6QA 2K7JA 5E41A 3SBMA 1UA1A 1V9OA 3TEHB 1LV5A 3UFCX 1UEUA 4ZCLA 1QUVA 3TEGA 1C1CB 2XSJA 2GW8A 3UD3P 1NDPA 3IBWA 2RRAA 4GKJJ 1WELA 3IR6B 4USHA 2MHNA 5JUMA 3MMCA 5BYRA 1Y3JA 2OPQB 1YBAA 2FZCB 3FCHA 1FKAF 1S9EA 1W7WA 2CNKB 3PVXA 3MOJB 2RF2B 3UI3A 1MN9A 5HJXA 1RHUB 4U8VA 3TAMB 1PO6A 3OQ2A 3JYTA 2B43A 4KFBB 4WCEQ 4WP3A 4PCQA 2J7UA 1NK6A 1IKWB 2WCXA 2HZAA 1YBUA 4CO1A 2VG7A 2CNLB 2HQFA 5DDOC 2QC3A 3NS6A 1H74A 2V69A 4F4AA 2C3YA 5EWFA 1H72C 2HWHA 4WXOA 2HVZA 2FHMA 4Y2AA 2CQDA 2NSBA 2O67A 2R9LA 3N6MA 2QA4G 3BKTA 2ZC3A 1ZPWX 3R1HA 4NI2B 1Q53A 3ZNUA 4KKOA 4I6YA 4NWBA 3OXGA 2OPPB 5KG5A 1LWCB 4LIWA 4IRDA 3TP2A 3JQKA 1OSCA 2EWHA 2HQDA 4OFZA 3FJ2A 4KH1B 4JB8B 3D5MA 4Q8EA 3VQTA 5CAAA 1REGX 1FJGF 2VKRA 4ZIVA 4V19X 5DLFA 4RW4B 2E1AA 4UZCA 4H54A 1NSKL 1JQGA 3BSNA 4KTQA 3LAMA 2R2SA 4IRCA 1AA1B 1W2IA 3HSZA 4NPOA 1HBMA 1XNRJ 4LRFA 3KUHA 1FRHA 4LFCJ 3CW2C 5AXKA 4UY85 2BX6A 4GKKJ 4TLRA 2HVEA 2AW0A 1M1KT 3DMJB 1CLFA 3AH6A 2KG0A 2RILA 3M9MB 3D6TB 1HMVA 1WHWA 2ZITA 2CNNB 1T11A 4LFBJ 4F02A 4EFAC 4ZPVR 1N33J 4NOHA 1QY7A 5E3AA 3VHQA 4B3SJ 1RB0A 4ECWA 4BDPA 1HQEB 2XO7A 3PRVA 3CCQS 2HQGA 4ZVTB 1FNMA 1HHSA 2JVOA 3G2XA 5F8NA 1S12A 1IR2A 2YH0A 3TZWA 3HULA 2VFTA 1Q7YT 4DUTA 2A2CA 3K57A 2YNFB 2QFIA 3JTNA 2HSEB 3HVTB 5LT5A 3EUNA 2DY9A 1FKOA 2MSTA 2J8AA 1NCLA 3K8WA 3OHAA 2VPZB 3B78A 4CLFA 2I5JA 1A9NB 1NNDA 2LEBA 3BGRB 4O4RA 3QMQA 1KD1T 2ZBRA 2CQ2A 2CDRB 1K73T 3RYLA 3V6DB 4IR9A 2QSFA 5AJ3F 3BDEA 1EQ0A 2DNMA 3CCRS 4ZIWA 2JVRA 3VAGA 1B0VA 3TARA 1M5PC 4IOCQ 3HHLB 1CJKB 4NYZA 3QZ7A 3D4JA 4NZ6A 2ZH5A 4RBTA 4KRWA 3BSAA 1J5OB 3AD8C 2FC9A 1VR6A 4KO0B 5IT9Y 1QDUB 4HR2A 4I67A 2ATCB 4K59A 4DQRA 4P6QA 3Q8SB 2D9OA 2CPYA 3H2VE 1HNIB 4J5OA 3CO9A 1FRKA 4EBEA 3M2VA 5DM7Q 1WF1A 4LSLB 1U1OA 3FKBA 1DLOA 1WORA 2EFNA 5ETRA 4HT7A 5D77A 5B7WA 1FTRA 1J5EF 3BKUA 3KHHA 1VBYA 1N0VC 3RJMB 1RGVA 2VJVA 5DG8A 1CQNA 1TKXA 4OJGA 2IVMA 2OD4A 5CYQA 2Q6BA 5HROA 3C3LA 1PIEA 4DL7A 4EYIB 4HH1A 3LALA 3GIKA 1EKRA 1CJTA 2GVDA 4HHHA 2XHWA 3R5AA 4J9LA 1S48A 3N4WA 2BW2A 3MTJA 2LQ8A 4RUBA 1QVFR 2PD1A 1FA0A 3T9ZA 2DPIA 4B9TA 1OYEA 2D3ZA 3V6JA 3RRHA 4Y3CA 1IXKA 2CQCA 1S1VA 2CJKA 2IJRA 2HKEA 4FF2A 4NA2A 2CQIA 3OR1B 2G0IA 4C8MA 2DH8A 4X66F 2UP1A 2OAUA 1RT4A 4DQQA 2BBEA 2ZJRQ 1RBAA 1B7YB 2LXFA 2QA4S 1ZOTA 3PW7A 2XGQA 3FQKA 1HPZB 3PHEA 1VQYA 3UQSA 2OJ3A 5G0RB 2MJUA 2KTQA 5HP1A 2NXNA 3M2RB 4N8OA 4KJIA 4UY8T 1IKYA 2R4FA 2ZUAA 4EEYA 4EBCA 3GIIA 3PYGA 4H4OA 3EYZA 2NXCA 1ZZNA 4QCLA 4AD6A 5LMNJ 1JXLA 2IVFB 3BN7A 3FNNA 2ZH2A 2FVPA 4DL2A 2QLJB 3VR1A 3DOKB 2EBGA 3AJ2A 2E1RA 4BWMA 3IWNC 2HNYB 2IA0A 5LXYA 2AU0A 3O6QA 2F9DA 1QLNA 1X4HA 3T6BA 3GYXB 1ZAVA 4R25A 2CJ9A 1RT5B 4FNHA 2YY3A 2IPOB 5IM0A 1UPPA 5IXUA 1YJNS 2COLA 3PIOQ 1GQEA 3HPOA 4JYAF 2M9KA 1LEOA 3BQ0A 3M8SA 3NCQA 1QAYA 3J81j 1LWEA 4PUOA 1UZDA 4M5NA 2Q6CA 2H5EA 2XNQA 1Y7PA 4CLWA 1Q81T 3DLGA 3JS9A 1HNVA 4IR1A 3GJSB 1M5OC 3QIDA 2GQQA 1OSDA 2Y1JA 2F8MA 1S4FA 4PQUB 1S0MA 3ZZZA 2PMWA 3BGRA 5HO4A 2QIFA 3DRXA 1C1BB 4X4UA 1FJCA 5ETTA 4A8KA 1XWLA 2O01C 2HGLA 5FJ4A 5LSLA 4BS2A 1JLQA 1I1GA 1YHQS 2V8VA 1HBNA 3SDEB 1HWIA 2K1RB 2DGXA 3FMBA 2HVHA 4QWEA 3KK1A 4QPXA 4DV4J 4B9UA 3KNAA 3M8PB 1P9QC 2K3IA 4UW2A 2CADA 1N88A 1SIZA 4M94A 4OMFG 1AFIA 2HHHF 3LAKA 1JNRB 2MKIA 4LF8J 5E0OA 4YB7A 4B3OB 4AYBD 4DL5A 4DX7A 1J5OA 2GHVC 4WKRA 1LNQA 1QSLA 4N76A 3GPAA 4OI2A 1S7HA 3DRYA 3ZZ0A 1CULB 4A8MP 3UD5A 1TELA 2YKMB 2QYCA 3VV2B 4Y6IA 1JLCB 3QYYA 4PG6A 1S5ZA 3OPKA 1YJRA 1XNQJ 5H9EJ 4H4KC 2BOPA 3BYRA 2XLJA 4Q0BB 1WOOA 4IFVB 3TJ8A 2QX0A 4DR2F 2V34A 4ED8A 4DR6J 3V5RA 2XEXA 2H3EB 4DLEA 2MKCA 1JKHB 2VG5B 1G6BA 3MD3A 4YOEA 3FSIA 1ROFA 1KEKA 3KLHA 1RK8A 2CPJA 3RUBL 4LMZA 2VBZA 3MUVP 5LOQA 3QT5A 2XBPA 4TY8B 2EC0A 1S10A 3W63A 2DTJA 2FHJD 4PXDA 3KUGA 3GILA 3CEDA 1URNA 2XYGB 2UXCF 3BSCA 2E5JA 2NXJA 3ENVA 3FSXA 3RR8A 1FRMA 4FP9A 1JB0C 5U47A 1KLMB 1R8HA 2FB0A 4ZJOA 4ES1A 1HNZF 1WF2A 4JI2J 4ZOSA 4IOBA 2DNNA 4QR2A 1F5AA 2MQ8A 2I6WA 5GADI 4WK1A 1TKTB 3MAAB 2V4QA 1F5BA 1YSJA 4ZVFA 2ZH6A 4C4WA 1EJ7L 2ABYA 2YWGA 4B9MA 2QLWA 1IM6A 4J90A 2M4MA 4Y2IA 1N8RT 1WI8A 4O3OA 3HVWA 3IM8A 2CQHA 5B0DA 1S6QA 2ZHOA 2A1BA 3B54A 5IFMA 4N56A 2FHJA 4LRDA 1ZAWA 1SC3B 3MFHA 3OTDA 3MR3A 1KLNA 3RBEA 3FEXB 2GHWA 3QO9B 3MR2A 4NE9C 1RWPB 2VONA 3PKMA 3SCIE 4LIRA 1DAXA 1T0TV 2YPZA 1GEHA 3DXSX 1NK0A 4TXSA 3UDEA 1Q79A 1DHMA 3DXBA 2JZ5A 2EFOA 2BE2A 2VODA 2VKZG 4F3OA 4MIBA 2BVZA 1RAEB 3A8KA 3EE3A 4DG1A 5KFXA 2Z30B 1VGYA 1F1BB 1RJJA 3R1LA 3MEEB 4A47A 3U7JA 5T14A 1VFJA 3K7RA 2DITA 3D6FB 4CO2A 3ITHA 3CXCR 3QNWB 1WDTA 4C0BA 5HBMB 4TYAA 4Q43A 3GYGA 3CVKA 2YX7A 2OELA 4BC9A 3SFGA 1XMOJ 2V2ZA 1M1HA 2DXEA 2MZ1A 4X4SA 4C2MA 2RHSB 3D2WA 2OSRA 3LP1A 3GWCA 3UCGA 4IQXA 3KMSA 4ICLA 2ZFHA 4DCOB 1RLDA 4TYBA 3PXGa 1Q0NA 1D1UA 4RU2A 2R7QA 1R8AA 4ZN3A 3ZTRA 4OHZA 4FYDA 2CJQA 5F9LA 1UW9A 4H4MA 3D0IE 3FBCA 4PYDA 4QQBA 4Y2CA 3W60A 2M52A 3M8PA 1MNEA 1U1QA 2AD9A 2E29A 1LW0A 5LJ5Y 2XQCA 1MN7A 5GAGI 1SKSA 1GX6A 2G0JA 2YWWA 2BKNA 3QRPA 1T9WA 1R27B 2GVZB 4YHHJ 3KDNA 4DR7F 1YQHA 5AE3A 2KH9A 2QTWA 1EETB 5HQLA 1VCTA 5J2QA 2RQ4A 3P45B 3ZZYA 1ZH5A 4KAIA 4DR5F 1FTCA 4N7TA 1FWKA 4ZK7M 2QL7B 3DOMB 2F65A 1U8SA 3B4DA 3MM5B 1XIQA 1ZM9A 4DV7F 1RHQB 2RKIB 1ZM2A 4DFPA 1YJWS 2KZZA 2CRLA 4NA3A 1E6YB 2CPXA 3G6VA 4J7CA 4ILRA 1JXEA 3IWLA 4WZMA 1X4GA 4EO6A 4B3TF 4X4QA 2RQCA 4X62J 1TFWA 3C14B 4FZVA 4ZVSB 5M2PA 4ZA1A 1WEXA 1XK8A 2ZH4A 4ES3A 2BJ1A 1XTZA 4OYAA 4JOUA 2V2QA 1TK5A 3UCZP 4DL3A 2F7VA 4M95A 1RWXB 1NAQA 1YG0A 1Q5YA 3D7SB 5T7LA 4GVBA 3ZZTA 3TVKA 2H1YA 2E5LF 1HW8A 4QIEA 3E2EA 2ILYA 3SCLE 2F63A 1RT1A 3M32B 1R8CA 3DN9A 4QIWD 2MKHA 4FVCA 2HZVA 4PABA 1U24A 4MKBA 5HANA 1MW7A 5HATA 1HD0A 5E7OB 2Z2MA 2DK2A 1WTBA 1ZYQA 3I82A 3NMRA 2W4PA 2V4RA 1DY3A 3BGFA 3QAUA 3BEGB 2PEHA 4A8WA 4JI8F 3R2CJ 4WYWA 1VBZA 4QZVB 4FF4A 2AJ4A 1RTIA 2B5JB 1S59A 4WE1A 3QGGA 2LDIA 1S6PA 2D7SA 4NLYA 2RAQA 3SYZA 1JIHA 2WVCA 3NNCA 1NK8A 2BJ7A 2Z58B 1UJ6A 2LFVA 3HMJG 1Z2ZA 3ZTPA 3S01A 4C3LA 2YNIA 3BR8A 4LRCA 1SKUB 2ZNYA 4PQAA 3UDVA 5D0EA 5LXRA 2W7PA 2MY7A 3DRSB 2KM8B 2BJ3A 5JVGQ 2UXDJ 1PC5A 3DGPB 2D1CA 4PRFA 4LSNB 5IV4A 2QEXS 4WFZA 3WHIA 4NX9A 3RW6A 1REVB 4ZPBA 2X1FA 1JLGA 3RW7A 4BHQA 3LA0A 4LT6A 3EGWB 2AQ4A 2FJEB 5L38A 4OYOA 2RD5C 3IA0A 2GIFA 2KHCA 3W9JA 5K8OA 3EGZA 2AJFE 3JAMY 1X9MA 4WP9A 1RTJA 2XZDB 3IM9A 2YKQA 3QLHA 2DRDA 3PHTA 3IS9A 5G4DA 2MQPA 2VD3A 3J7Z5 4MMOA 2NR0A 2MZQA 3C6TA 2HMIA 4DFMA 5HMZA 5MLCV 4EUVA 1FHTA 3GYNA 5HAOA 2HGNA 1FRXA 3QAEA 4X4PA 2AMCB 3CMAS 1NSPA 5KAKA 2UUWA 1A6LA 3U27A 1YI2S 4ZITA 2MKKA 1XNRF 4IFYA 3M6XA 4LF9F 2ZDPA 4LFCF 1NHKL 4DU8A 3I0SA 4OV1A 5D4NA 3EVMA 4GKKF 1WG5A 4LF6F 2B9YA 4RNMA 4URSA 4FKYA 1C2PA 2LEPA 2W2OP 2HAFA 2H5IB 4ZVQB 2JC0A 1YITS 3C15B 3LH2S 4DSLA 1RE1B 1TL4A 3EXYA 3P3DA 1U7LA 2YVSA 3NCRA 3TWZA 4GC6A 1N33F 2BMBA 5ETMA 4DLGA 1N36J 1TZ0A 3KLGA 2VPYB 4ZPTR 1U2CA 2BEFA 4MKYA 4A8YA 4AQYJ 2HFVA 1UWBA 3HZGA 4UUWA 4J9UE 2OKQA 1ZS6A 2R7XA 1SH3A 5KT4A 2PE8A 2B56A 2EC2A 4GMKA 1P9YA 4Y0FA 1ZA2B 5DLGA 1DFDA 1WG4A 2ZJQQ 5DRKA 1IJEB 2IRXA 4FKXA 3SQGA 3HD1A 2WONB 1TMMA 4CYUA 1R8PA 3EICA 4O0NA 3TANA 3IRXB 1OO0B 4WKYA 4X4NA 4USMA 4A8QA 5F3TA 4CO4A 3VF0B 3DDIA 3FEZA 3H8YA 5IZHA 2I1RA 2YQ3A 1GMWD 3PO5A 1FDAA 1YK9A 1I94F 2KT3A 1U49A 1U4BA 1RT2A 3Q23A 1T03B 3OUYA 2VG6A 1N32F 1FT8A 4TVAB 1U02A 1TL5A 4JUZA 4CTAA 1OPIA 1HNXJ 1BWVA 2KVIA 2RDDA 2EG1A 1FNOA 3MPVA 2DNYA 4IG0B 2RVJA 1LFWA 1FX4A 3WX8A 4OZ2A 4EI2A 1RAAB 3L09A 1UFKA 4A8SA 1GFWB 2MGZA 4ZCMA 1D9DA 4UUXA 4XTTA 2IM1A 3M8YA 3W2WB 2HS0A 1GMWA 3FQLA 2ZE2B 4M5GA 2E1PA 2KKHA 2KU7A 3L7UA 2JC1A 2DBBA 4OHWA 2E7XA 1TVRA 5CABA 2DO0A 2G2OA 1L3SA 3FBEA 4M5JA 1IQZA 4C8YA 4OX7A 3M6VA 4XDDA 1R6VA 1T9XA 2KT5A 4Y34A 4B9LA 1VI7A 3SFUA 2M5YA 2AF6A 3W8PA 5SZTA 4YS2A 4E8UA 3PW0A 1NH8A 2ZZMA 1Z2LA 1LXNA 3O44A 4ITSA 3HP6A 4ZP9A 1E6VA 1FRIA 3W62A 1FJGJ 4MIWA 4KC5A 1D8ZA 3Q83A 3VALA 1EHWA 5EWGA 2IY5B 3R2DJ 3WIVA 3UNYA 4QYRA 3SMZA 4RNOA 2H4YB 4DSKA 3D1HA 3CCWA 2E5GA 3UD4P 2FJWA 2W2NP 2GFFA 5FD1A 5A8KB 4I4BA 3MM6A 1FCAA 3BGUA 5KT5A 4NRTA 1H3DA 3M1VB 3V2UC 4ILMA 5DETA 1Y9OA 2C2ZB 1NSQA 4M5DA 4DFKA 3D6MB 2KFZA 4B9NA 1U2FA 4IQMA 4C11B 4CH0S 1J27A 3GFZA 2EK1A 2LQ9A 3PYEA 4CLLA 3CDWA 2OPSB 2IA6A 2KT2A 1IBMF 4R5PA 5KFDA 1RYSA 5C25A 2E9ZA 4P2FA 3MEDB 4YFUA 2VA2A 2A6OA 1Q8KA 1TFYA 2MZJA 1TU0B 4K4UA 4CH7A 1HR0F 1X4AA 3D1OA 1IJFB 1HNWJ 4D3GA 3GTYX 1CQMA 3NS5A 2KRBA 4BC7A 1U26A 3THVA 5I3PA 3LTOA 2F9JA 3CCJS 2XMWA 3CC7S 1KNZA 2AYMA 4P9SA 4P52A 1BD6A 1T3NA 1HHQA 3UVJA 2NPFA 3OHBA 3LP2B 4K5RA 5RUBA 3RU0A 2FYXA 5ETSA 2E66A 4M5KA 3C15A 4PG8A 3CCES 2M88A 2VOPA 3H0PA 1FESA 3Q24A 1GXLA 1UFWA 4H4KA 1N34F 1NDKA 3MCMA 8RUCA 1HI0P 2BDPA 2W9BB 2N4CA 2Y8YA 2V67A 1UFLA 2XULA 3GG0A 5AJ3J 4PWUA 2V4JA 2ZM6F 3OXFA 4HDGA 2W9CA 2FHOB 4AUKA 2FTRA 4ID5B 3N6NA 6FD1A 4EO8A 4F25A 2Z2ZA 4C6AA 1LFPA 2QMWA 1WC5A 5C42A 3O2IA 3BYPA 4DZDA 4PXBA 3MF5A 3IR7B 3KK3B 1D9FA 1RQ0A 4CCHA 2YWFA 2BM1A 2QRRA 3PEJA 1MMDA 2DRBA 4C8KA 3ZNJ1 1VQ8S 3M9NB 3B8HA 3PO4A 2ZBQA 2C1EB 4WTOB 3TA2A 3OLBA 2HAIA 3KG0A 2DGUA 2Z8QA 2FJVA 2HHQA 3AT1B 1J5EJ 3AAWB 3D9BA 2VQFJ 4KBIA 4C3KA 2RE1A 3BO2A 5HL7Q 2VHGA 2AYGA 3DRRB 2MMYA 2MKJA 1RAGB 1VQLS 3IRWP 3ELHA 1UEVA 2OFGX 3DRPB 3GZ7A 1W2BR 2IBOA 3CJKA 5H9EK 2FLOA 3KLFB 2RRBA 2J6SA 3D66A 1UVJA 4TLQA 3R27A 1DQAA 1R0CB 3PKYA 4F4ZA 4L6V3 4QWAA 3IN5A 3IAM9 4PZVA 4CZCA 3AQOA 1ICEB 2R7VA 5HN0A 5CXTA 3QT8A 3B4MA 2HURA 3FZ2A 2NYIA 1RWKB 3IP0A 2YKAA 2X7IA 4DR6F 3OXLA 3CCVS 3J81U 1WC6A 4NLOA 3RGIA 2OTJS 4X66J 3T5KA 2QV6A 4P73A 3RB0A 2EFQA 3OD2A 2IIHA 1VRTB 1RACB 1SUQB 4YN3B 3IGVA 2F8HA 4KV8B 3OL9A 2B4UA 2KRRA 2ZOFA 2I2YA 1TK8A 3MEKA 3GJTB 3J7AN 2FZGB 2CQ0A 2HW3A 1X5OA 2R8HA 3TR5A 1WD6A 1BMQB 1YJUA 1FVQA 4NXNF 3QRQA 5F0WA 2C2RA 4ECXA 2G9OA 3T19A 1G4CA 3GR0A 2D69A 3OBIA 4Z7CA 5ETKA 2VOOA 3CF5Q 2PSZA 3W5ZA 2HZCA 2KZMA 3NGSA 2EI5A 4AE5A 3N01A 1Y0HA 3HFKA 4IDKA 2QZ8A 1UVKA 2B9EA 1V3ZA 2E9RX 3J7YI 1U1MA 4Q5VA 3M1VA 1U1LA 1UW4A 4LR8A 4M5MA 3DOLA 5GMKa 1QE1A 3ENWA 4X65F 2DGOA 3IXQA 4R8UA 2DD8S 3QATA 2LU2A 3Q89A 2UV8A 2OPSA 4FXDA 4QBUA 3T5JA 3M2UA 4JYAJ 1XN9A 2UUTA 1NZAA 2XLIA 4DU7A 4KIAA 3JTPA 2VL1A 3CCSS 1P27B 1VC0A 3PFEA 2B4PA 1S0OA 3C6UB 5LMUF 2ZH9A 4RW8B 3Q8RB 4F4YA 5L1LA 2HVIA 1NRKA 1PG5B 2GGPA 3MECB 2WAQD 2JNJA 2JEIA 3E8OA 2FGCA 2NLWA 1S97A 1S6OA 2C2MB 2V8GA 4X2BA 2CPDA 2K7KA 2EFPA 3G6XA 1RWVB 5F41A 3NG8A 4HL9A 1LK7A 2IC3B 1HWKA 4MYTA 5H9FJ 2F4FA 1DBDA 2DYAA 1TKDA 3GU0A 1VIXA 2L9WA 3ISZA 1WSRA 1YVFA 4ZVOB 1HBOA 1PBUA 2QE5A 3OJSA 3RTVA 3KMQA 1BQMB 3IR5B 1I5OB 3HF5A 1HBUB 4DV1J 3NCPA 2IRYA 1UPMB 2HBRB 2ZEJA 4MFBB 2HHHJ 1B3TA 5BYQA 3Q8QB 1U6FA 2VASA 4ILLA 5C24A 3TAQA 4OHXA 3KTQA 2XSFA 1B0TA 1JXVA 4I1TA 3M8QA 3K89A 1AZSA 3PACA 1YLXA 4I7FB 3BO4A 3BH7B 2R8KA 2ZJPQ 1R7IA 4USVA 4WFAQ 1XEZA 5D0RA 1FFGB 2FUG9 1PILA 2VPXB 5EN1A 2G1DA 1R0AA 4DR2J 4WFXA 1U1NA 5J2PB 1PJ7A 3BN4A 4ECYA 3KHLA 4Y28C 2YX1A 3K17A 3F41A 3PRBA 1NHUA 4KY3A 3PDNA 3DRRA 1GMVA 3QFHA 4OV6A 1RWWB 2RS8A 5D4PA 1HIYA 1M5KC 1FXRA 4J9MA 2XB2D 1S1TA 4ZPCA 2KYXA 2V5HG 5A8RB 4OZLA 1Y4ZB 5HSPA 3G9CA 2P6TA 1IN0A 4YHHF 4V19J 3D1QA 1ZM3A 1JNZB 1Y3KA 3KLFA 1Q82T 3C8YA 2CQPA 3NNHA 2XI2A 3Q2TC 4RNHA 1RT6B 3E51A 3G6YA 1S1XA 3EGNA 1GAOA 4ZCIA 4ED3A 2UXCJ 5E3PA 1H98A 1N6QB 2OI2A 2DISA 4DV6F 4UQTA 3GONA 2MKSA 3G82A 2WTFA 1L3UA 1HNZJ 2XSJB 2U1AA 2B7BB 3CJRA 5KT3A 3EPIA 3M30A 3QWUA 5KG6A 2QYGA 3BM7A 1RTDA 3W3SA 1PYOB 3MFIA 4NLPA 4G1PA 4OZ1A 2ZH7A 2PFDA 2LLZA 4FVMA 1DJ0A 1EAYC 2P9CA 5GVQA 1S9EB 3PNIA 3NNAA 2MTLA 1DTTB 1RWMB 4RW6A 1VHFA 2YWHA 1JJCB 4NMLA 3JYTB 3PYFA 1I6JA 3R3TA 3Q8VA 3R8YA 1SL2A 3M9OB 1IKXA 2IHR1 2VG7B 3DHXA 4O23A 3VAKA 1S4EA 7AT1B 1UVMA 3T9NA 3FRYA 5KFGA 4ZVEA 5J1PA 2YH1A 1FRLA 3PR5B 1DQ8A 5LL6d 5K9FA 4MK9A 3CJTA 2H5JB 5KFSA 2FVCA 2GJIA 2CYYA 2NYHA 3C2PA 2HIYA 1Q1KA 2R42A 2QA1A 3AQPA 1TV6A 3I55S 6AT1B 3ZZUA 4YB6A 4NLWA 5L1KA 1T05A 2P5VA 3SV4A 5IOLA 3WC2A 2HK2A 3MUTP 1RISA 1RSCA 2YTCA 1RTHA 2MSSA 3V4IA 5IWAF 1PKUA 1FX2A 2AJ0A 3L3CA 3MECA 1SI9A 1NKBA 2YQ1A 4Y2KA 3UW1A 1WOPA 3IG1A 4LF2A 1FKPA 4JV0A 2UXDF 2UVWA 3PW5A 3L95X 3U1MA 2VFVA 5HVGA 1VRUA 2BQRA 2W2MP 2CWKA 2YNHB 1CSJA 3ET6A 1WC3A 2WW8A 2UVVA 1S77D 1HW9A 4CLPA 3DYAA 3IC1A 1QAIA 4NZ7A 2YKNA 2R8JA 3VVUA 1HMVB 3TO8A 1YZ7A 4F0KA 2W2QP 3H5SA 1FDDA 2YBVA 1SPBP 4RX6A 2X3DA 1NJYA 3PV8A 1FNXH 4J9NA 3GJRB 1VQMS 3TI0A 2PGCA 2QG9B 2IM2A 2AKWB 2V2KA 4KHPJ 1Z4UA 2RUGA 4ATNA 2E5HA 4DR7J 3TX8A 1SKWA 2VB6A 3BJYA 4HHUA 2C3MA 1C0TA 1OIAA 1O8BA 2ERRA 2I38A 2CPFA 2HG4A 3AXMA 3CSKA 4EBDA 1SJRA 4JI7J 2M2BA 1K8AT 1ZM4A 2APOA 2WVBA 1HL6A 3FZBA 2XNRA 1FKOB 3N0VA 2WSFC 3BH6B 3EVOA 4FF1A 4ZPAA 5E3CA 3CDUA 2JWNA 3KKFA 5J2PA 3CMQA 1RXOB 2I5JB 4ANDA 2LECA 3E3XA 1N5VA 1S9GA 3AOAA 1D0EA 3W65A 1B7FA 4EMDA 2NCKL 5GAHU 5AE1A 2W4DA 1N5SA 3KLIA 4K50A 1FJ7A 4EYHB 8AT1B 1F60B 2CG4A 2W24A 1MROA 2CJAA 1N36F 3N5FA 2HIQA 2ZHBA 4DFJA 5KOWA 3DLBA 2P8IA 2MXYA 1RKJA 4Y65A 2E5LJ 1RT6A 4I2PA 1WDDA 3W66A 3CC4S 4CLZA 4Q2LA 1TAUA 2HFSA 4RU9A 4CO5A 1SJ1A 2PEBA 3T5LA 1WEYA 5KG4A 5A2QY 4DL4A 3TZYA 1ZBTA 4KSEB 3CJ8A 1H2VZ 1VISA 4DQPA 3F73A 1TL1A 3RB6A 3W9HA 1NK7A 1K44A 2CQ1A 3M2VB 4E98A 1TUGB 5CD4A 4FBUA 4PPZA 1DLOB 2RU9A 4X4OA 2F4VF 2FVQA 2NPIA 1VHIA 1SJFA 4LF1A 3K58A 3BBCA 4JI8J 5L39A 4DPXA 1UKUA 4OHVA 4RLEA 5B08A 2OEJA 2KFNA 2CJXB 1DTTA 1V3SA 3ZZPA 1TKXB 2WSCC 5GAEU 5CYQB 4X64F 4J9PA 2DKOB 5HROB 1XC9A 3HHNB 3CJ5A 1HNXF 4K4WA 1NPPA 5E3RA 4ZKAA 1U1RA 5J1NA 1RADB 3KFWX 3PEHA 1CJTB 1V6HA 2GVDB 3RG6A 3MCOA 5KG7A 3P8BB 4PXEA 2KJWA 4J9OA 5HVHA 1YGYA 2KFYA 3TA0A 2CVEA 1AFJA 4A8XA 4K4ZA 1AUSL 1CJVA 5DM6Q 1IBCB 2FQQB 5IT0A 4PKDB 3PM9A 1S1VB 2J0XA 4DMZA 3G4SS 1N5QA 2DIVA 3CCUS 2AZ1A 4RKUC 2ZH3A 1OQ3A 3QPIA 2JHEA 4CLUA 2WBMA 1T3OA 3LO3A 3LW5C 4KPYA 3V81A 1RT4B 1F3FA 2ASDA 3I5BA 1JLFA 2UZAA 4QIFA 2E1MC 3M4XA 1YJVA 3Q0AA 4HTIA 3GJQB 4DR3F 3HJVA 4RO0A 3WIUA 4JV5J 4WBFA 2E7WA 3OFHA 5HP1B 1QTNB 4F3MA 2W8LA 2B6AB 2ZOGA 1IKYB 5EDWA 2HLTA 4H4OB 4JI3F 1EP4A 4X4TA 1WNEA 5HMXA 2YNHA 3KYLA 4Z2XA 2VV5A 4YB5A 4LF9J 4DZ6A 2UXBJ 3LQVA 1C4CA 4LF6J 2HFNA 2CIMA 3K5MA 5IT4A 1VBKA 3Q8UA 2CPHA 4HI2A 2JEFA 2HHTA 1L3VA 2GAGC 5DGAA 1FXDA 4TQSA 2K06A 5IM0B 1AT1B 1MLAA 4Q44A 1PC4A 4MYUA 2L08A 1NJWA 3H5XA 3HD2A 5B0AA 1Q7LB 4ED4A 2HFOA 4KPCA 3R5JB 4IG3A 4DPTA 5L46A 1FEHA 3WX4A 1YIJS 2WB4A 1VJQA 2MQOA 3T5HA 1M0SA 5I4MA 1KRPA 1TL7A 3HSGA 2ASJA 1LWEB 4PUOB 2GQ2A 2KXHA 3NL0A 1X31C 1HNWF 4IUFA 2XMVA 2MQMA 2V9KA 3DLGB 2ZVSA 1HNVB 4JV1A 4ZHRA 3MR6A 4DQSA 3AJ1A 4C0HA 3T1AA 3I31A 3DDKA 1YDLA 4OHYA 3GIRA 4DJBA 4NCAA 1I51B 4K4TA 2BACA 2OSQA 2ASYA 3Q86A 2CWXA 4DSJA 3OVBA 2VQEF 2BJEA 3AY0A 2W7OA 3CJSA 1JLQB 4USUA 2CZ9A 1UMJA 1HBNB 3PTWA 1SQFA 5CA5A 3C46A 1I94J 4L3NA 2NXUA 1YTYA 1HI1A 5C5JA 1URRA 1TK0A 3A4TA 4QWCA 3KK1B 2GO8A 3RB3A 3AOCA 1N32J 3AD9C 3R5BA 5KG1A 1CS4A 2CKWA 5AXMA 4G1QB 3SXLA 3DLKB 4OI6A 1L3KA 5FLXY 1A7GE 4I68A 1NSAA 4LSZB 3SSSA 2CZ4A 2AP6A 4P72A 3DHWC 5KG0A 2GQCA 4OI3A 4A48A 3K8VA 1IM4A 4PAAA 2HGMA 2CZVC 3HO1A 3KJVA 4QWBA 2ZWPA 4TQRA 4USWA 2J8SA 5B09A 5F8IA 1X4FA 1JLEB 2VDHA 2BYCA 1Q5VA 5L1JA 5E3QA 1FDBA 1IKVA 2K2PA 4ZLLA 3MM9A 2VQFF 1BQNB 5ETLA 1Q16B 4NLRA 4U7UK 1KTQA 4Q8FA 5LSRA 1UVLA 1FDNA 1UETA 5CH7B 2CUYA 2IMWP 1KSPA 5F3ZA 3VZIA 2EFGA 1U1KA 2ZBCA 3J80U 1EZZB 3MTKA 4WJBA 3KLHB 2RHQB 3LGNA 5HLFA 3H90A 3NXZA 3PFOA 4K5SA 4C98A 5AE2A 3ZTSA 1ITPA 3H42A 1KHWA 4WWSA 3CD0A 1UZHA 3TVYA 4F26A 3CCTA 1YWXA 3G86A 4J37A 5K14A 2XTJP 2J9CA 1H2UX 5IC4B 2FDNA 1K47A 2IAJA 1V5VA 1ZTTA 2ALYB 2CQGA 1WKKA 5KFNA 1YKWA 3JAMU 1JX4A 4A8FA 4MH8A 5D6GA 1FD8A 1N0UA 4XPCA 4O3QA 4J9KA 2Y1RI 5JMNA 3ULHA 3ENQA 2U2FA 4NRUA 3TX0A 2VFRA 1IBMJ 3CNQP 4F4XA 4FYWB 4TY9A 4BBYA 1S6QB 1HFEL 4B08A 1VQKS 2K3KA 1ZETA 2DEJA 2B6AA 4WP8A 1HR0J 2ADCA 2IYGA 3DLHA 1KTVA 2FHKA 5A76A 4IYQA 1G3OA 2XWYA 1NB2A 1S6UA 3G6ES 3K0JA 2FJAB 4KHRA 2XO6A 3DKDA 3CC2S 3RBZA 3D6HB 3FSYA 2HBZB 3QBCA 2OPRA 1GXUA 1OY9A 4P2SA 1KFSA 4CLYA 5D4LA 1NH7A 1VIOA 2BE2B 1SJ4P 2HVDA 3E01A 2RUSA 1DZ5A 4RL1A 1N34J 2H65B 4F67A 5F8HA 2QN6B 5DDQC 4KT0C 4DG1B 3W61A 4MKAA 4RW9A 1XQIA 4ZJQA 4O3PA 2OD6A 2ZM6J 4YDXA 2VA3A 2Y1IA 3FK4A 4F8RA 3KJFB 2HNDA 3O8WA 4NLXA 2HHSA 3ITHB 3TA1A 1O5JA 2CXEA 3OTCA 4LF5F 4R0EA 2V8PA 3LP1B 3BF4A 4L76A 5H9FK 4ICLB 2AIRB 4IH6A 1OY8A 3NOCA 2J76E 4NXMF 3MM8A 1LWFA 4V1Ak 2B8PA 4QIVA 3P96A 1KQGB 1JLAA 3CD7A 3HHEA 1Q8LA 1CC8A 2PA3A 2X51A 1S99A 1S57A 5K8NA 2DT9A 5D3GB 3GQCA 4IH5A 2HFUA 5I42A 4H4MB 2ROGA 1YRUA 3MEGA 5KOXA 1SV5A 5K20B 1MU2A 2XM3A 3TQ1A 3RRKA 4DV1F 1RT7A 1FRJA 2F8EX 4OYBA 1LW0B 4G1QA 2PA8D 4DUYF 1RBLA 3MMAA 1LW2A 2N4DA 2FLLA 2Y8WA 2LCWA 4J9QA 4FS1A 3DLKA 1U8WA 2IVYA 3MPUB 2VFSA 1WHVA 2OGUA 2FIUA 3HT3A 3HHLC 3IGNA 3JQMA 4TU8A 2GX8A 4M5IA 2RS2A 4HACA 3TUZC 1FE4A 1YRXA 3MR5A 5F9NA 4K2XA 5J2QB 1JLBA 3A3NB 3MPDA 3SIPB 4QR1A 4RBVA 1KVJA 2AX0A 2R8GA 1SIWB 1NK4A 1VQPS 1JLEA 1IQTA 5CYMA 2Q3PA 2OMOA 2NSCA 3GB0A 3ETMA 3BKFA 2N3OA 5J2MA 2R7TA 2VICA 2ZZNA 2E7VA 3EX7B 2DJWA 4QWDA 5KFVA 3IFEA 1BQNA 3HX9A 3AB4B 2Y0SD 3PZPA 1KBRA 4ECQA 3TJAA 4P74A 1JJHA 1T9UA 3N79A 2DGVA 2CAJA 2OLWA 3PR4A 3K5NA 1KVIA 2BJ8A 2GIQA 4WF9Q 2HRUA 1RHRB 3HM9A 1NO8A 2OIHA 2V6AA 3CE8A 3H98A 4NZ0A 4RWWA 3OFEA 3PX4A 4K4YA 4UF4A 2DCLA 5T7LB 4LFAF 4GVBB 4NXNJ 4CNYA 1RAJA 2HYIB 3I56S 4FDFA 4DPUA 4K4XA 3BV8A 1RT1B 4FNIA 3UE2A 4OI1A 4OLPA 4P2MA 1TUVA 2O1PA 2YQ0A 2L48A 2KXFA 1Y10A 5DG7A 2CA9A 3OR2A 4RNFA 2KB2A 1HA1A 3M6UA 3OFGA 2DXFA 2V8DA 2ASLA 4FYXB 4P71A 3PW2A 3L4BC 4X65J 3NBPA 1PJ6A 3OL7A 4YB1P 2J9DE 2VBYA 4DX6A 2D9PA 1RU1A 2PMHA 3DM2A 4KH0B 4P75A 4YUDA 3DDNA 1RCOB 1RTIB 2DY1A 4WE1B 1ULRA 4HEA9 1S6PB 4AT1B 3SV3A 1UTAA 3AFGA 2BV3A 4DXLA 2KHDA 4WFBQ 5LMUJ 2FVSA 3W2VA 2RDJA 2IDLA 2YNIB 4X84A 2XS2A 1FE0A 4NLSA 5L9NA 1XBWA 1M5HA 1APSA 2H51B 2L9NA 3QIPB 5THWA 4RUHA 2BJDA 2CJYB 2WOMA 3NWGA 4AL5A 2B3TB 4DV3J 4IH7A 4KB7A 5F8LA 4DV5F 2FD2A 1OWXA 4CP5A 4U8YA 1VQNS 1BY9A 1JLGB 4P10A 5J1EA 2DEIA 1FWPA 3POTA 1C0UA 3MMBA 4LBHA 2AYEA 3H59A 2HQ3A 4NA1A 2FGOA 3SCKE 3FDSA 4FXVA 2XMAA 3V6HA 1RTJB 3KXDA 4PG7A 1VQOS 3QLHB 3SCJE 2C3UA 4Y00A 3IS9B 1N56A 4EWTA 1HWLA 4FS2A 1U45A 2NREA 3C6TB 2XYPB 2HMIB 2LQJA 1NKCA 2KVQE 2M70A 3NEKA 3PX0A 3EPGA 1M5SA 4J91A 2FY1A 5J2NA 3JSBA 2IM3A 1U6BA 3D28A 4EGLA 1KDNA 2DHSA 2C22A 4DR4F 2QMUB 1T9YA 1H7XA 4NLGA 1VMBA 2H48B 3MR7A 4IO1A 4DPWA 4JV2A 4IFYB 5D3GA 2HK3A 2P2CB 3ILLA 4Q7AA 3I0SB 4DEZA 1EX8A 3PYDA 4NYPA 9ATCB 2OH2A 4RUAA 2XMUA 5LSOA 3R7BB 1HYSA 4ZCKA 4HDHA 2XCAA 4JI6F 3NGTA 4O3RA 1F3VA 5KFIA 4KHPF 1QSYA 3RZAA 4C0OC 1LWXA 3KLGB 2AEJA 2XMMA 2IMOA 4M63A 4NLTA 4XO0A 1KFDA 3LP0A 1UWBB 1R0BG 2DH7A 1HHTP 2DR8A 3A8IA 2F3JA 2BANA 5DG9A 4P7VA 4W98A 1PGZA 4JI7F 2FLPA 3JSYA 1EKSA 5KFEA 3NWRA 5D15A 4DR1F 3DLEA 2CG8A 5KTQA 3NP5A 3WDOA 4DV6J 3SQGB 3HFZB 3V6KA 1UAWA 2RQMA 2F1FA 4CYUB 2BQ3A 3L9ZA 3I9V9 4YQWA 3US5A 1Q78A 3I0RA 3ZFVA 1S0VA 1RCXB 2XG8A 5HMYA 2XWXA 1HWJA 2ZD1A 4OI0A 2JOQA 2Z4PA 5E5NA 3KLEA 4LRBA 2WHOA 4WIIA 3HDSA 3Q2SC 3A12A 1C4AA 4RW7A 4YEAA 4YMEA 2CPZA 1RT2B 4L75A 1UJ5A 4OYMA 4OZNA 3OUYB 4A4JA 2OFHX 2VG6B 1VQ7S 1GTHA 2I9SA 4CTAB 4WTYA 2OHDA 4WIQA 3GIMA 1UVNA 2A18A 2H54B 3IWXA 4LQ3A 1NUEA 1SH2A 1UCNA 2LP4A 1RHKB 4DCJB 1Q8IA 2GMJA 2ROEA 1XMBA 3J81Y 3H7HB 4PWDB 3GCWP 2MGZB 1WF0A 4MKVA 4F04B 4KR0B 4ZVUB 3NAHA 3VAMA 5KT2A 4ECVA 2HS3A 4XAKA 3FMWA 2AJ2A 1TVRB 3ZTQA 3CJ2A 3T3FA 1MG7A 2XYHB 3JSMA 2DNHA 4O44A 2VFUA 3TUPA 1GK8A 1FK9A 2Q79A 3R6LB 3CWJA 2QGFB 2O3DA 1LOUA 5HQ8A 4DUZF 4X4VA 1VQ9S 2J0SD 2MLXA 2GS8A 3U1NA 2MLZA 3GV7B 4FF3A 5I3UA 4ZS6A 1Q8BA 4Z37A 4OYPA 1K1SA 1RI7A 4G3IA 2JFKA 4F7VA 5IWAJ 2YNGA 2POKA 3M6WA 4DDFA 5DQIA 4YY3J 1E6VB 1RWUA 3MDFA 4Q45A 2Z2LA 2ZDOA 4LVOP 3LOUA 3QIPA 1YJ9S 2Y0BB 3RAXA 2JSXA 2CFXA 3S8SA 3QFWA 2OMLA 3HI9A 3D0GE 3KG4A 3QRRA 2FJBB 2XMTA 2OUGA 1U0HA 5E2QA 1XMQJ 1EIYB 3TZXA 1BQXA 2XGPA 4USTA 2N82B 1YRTA 3EDRB 4JI0F 2MEWA 2QO3A 4N47A 3N9UC 4ED5A 4TN2A 1VJWA 3MM6B 4M1KA 2BKPA 2HNZA 3IMQJ 1Y5NB 3OTEA 3KWMA 2GA7A 1VLOA 2ALZA 2EBEA 2BQUA 4M5DB 3TAPA 1J2VA 1K0VA 1RUSA 8ATCB 5FIIA 5ETQA 1N5YA 2L3MA 4R5PB 3H40A 4QU6A 4JV5F 5C25B 4DSEA 3NGRA 2LQ5A 1F9HA 2A2DA 2C3PA 1X9SA 5H1SV 2IM0A 4B17A 1YJ7A 2AHOB 1X5PA 1TL3A 4O4GA 1S72S 4MAKA 4AFFA 3B82A 2ZH8A 4CQ1A 2W2PP 4JI5F 4A46A 3MM7A 2LMIA 3WBZA 1SC6A 3C16A 4DOZA 2Q66A 5A0YA 1V3RA 1KR4A 3CDAA 5GMEA 3NGKA 3AJDA 4I2QA 2UXBF 2JL9A 1AW0A 2GJFA 4NCGA 3UVJB 1U09A 3CULA 1F9EB 4ERDA 1DTQA 2QL9B 3G8QA 2DGSA 2W01A 2DHHA 3R7NB 2WW4A 1HWUA 1QUPA 2J6UA 3OFFA 4DBQA 1C1CA 2CDQA 4DN0A 4AXJA 1RKIA 1QM9A 3AHPA 4C3MA 3MAQA 2Z57B 2BUNA 4YR0A 2Q43A 2UUAF 2V4JB 2OPQA 2W9CB 2UVRA 4K2JA 2EW9A 2OP5A 4KGKA 4LBPA 3CCLS 1EARA 1MWYA 1VDHA 2P6SA 3N28A 2RF2A 1Q4RA 2DO4A 5C42B 3MMJA 3M05A 4ZVRB 3TAMA 3FCVA 3MCNA 2UU9F 2FPHX 5FDLB 4IKAA 3LPYA 4KFBA 2PFFB 2EEYA 1IKWA 3W7BA 2C2OB 1ZTWA 1HQUB 2F40A 2YKPA 2CQ3A 2B9XA 1ZZFA 3R97A 2DNKA 1NB7A 4GVLA 4ECTA 4OYIA 3CDEA 2DXDA 2F4VJ 5ETOA 4CIOA 2DNQA 2JFDA 2SXLA 5DQGA 4ANEA 2B4OA 4QYZJ 1T7PA 2ZVIA 3CMES 2RMLA 4AL7A 2C2DA 4X64J 3W9IA 3ZTOA 3A3OB 4NI2A 2A3JA 1WACA 3NOGA 2OPPA 1LWCA 3FFIB 3QSIA 1NDCA 1UA0A 2EVZA 3SSQA 3DC2A 4B3RF 3EVWA 1Z1ZA 4I64A 4PWDA 3CJKB 1QVGR 1NEEA 2C3OA 4F3QA 1RDRA 4NEYA 1IVZA 2VUGA 2UV8G 3SSRA 1YJTA 4RW4A 3SI8A 4DPYA 1FD2A 4PPDA 5EUHA 2VDIA 3G96A 3R5DA 3K5PA 1NZ8A 1PCAA 5D0HA 5DQHA 3GV5B 3MD1A 3BO3A 1SVDA 2BRLA 1IBLF 3DMJA 3N5BA 5BJRA 4K4SA 3KHRA 4LF7F 2AJ1A 1RHJB 4DR3J 1AB8A 3RR7A 5A6PA 1IUJA 2GHPA 1VBXA 1P1TA 4ED6A 1K0TA 2HHXA 5BR8F 3VVTA 1BE4A 4ELUA 2HWIA 4ZVPB 3S6EA 1HQEA 4JI3J 3PRDA 1UVIA 2KM8C 3TRGA 1KQFB 2DNLA 4UZBA 3GE9A 3OLAA 3FBFA 2EG2A 4PWWA 4R0JA 4JBCA 1Q86T 2N7YA 4C8ZA 2FLNA 4IDKB 2YNFA 5L8RC 1F9FA 3VAHA 3GSIA 2NZCA 3UWTA 1SB6A 4DL0C 3HHLD 3J7ZT 3P6YC 3HVTA 3THTA 2RQKA 4DV0J 2JEGA 3DOLB 4OZ0A 2WBRA 1QE1B 2BE7D 3G8TA 2E44A 4I6AA 1X7VA 3NGUA 2R7WA 2M7SA 4R8UB 1D3WA 3VGUA 3EZ5A 1W25A 1L3TA 3VZHA 2UUBJ 2GZOA 3M2UB 5SUHA 4RNNA 3KOAA 3T1HJ 2XZTB 2X3GA 4ZDNA 3CJ4A 3V6DA 5CZVA 2MHEA 4B9VA 2V8HA 4EK2A 1WWHA 4DPOA 3FEYB 5AT1B 4ED2A 1X0FA 4W92B 3HK2A 2GGPB 3OT9A 3HHLA 1KWMA 1PSDA 1CJKA 1RAOA 2G0CA 4F4WA 1M90T 2RH3A 4ZMMA 1NK5A 4KO0A 2NS1B 2QT7A 1B0PA 5CZXA 2VQEJ 4OZ3A 3ISNC 3Q8YA 1BLUA 3T1YF 1HNIA 1HBOB 1TUWA 4B02A 2IRUA 4LSLA 2LDYA 4F0HA 4QW9A 2LA6A 1HQ2A 2IJNA 3NMAA 4DSFA 2DNOA 5KFJA 3H4BA 3I5AA 1H0HB 5A2QU 2QLXA 3HKZD 1IWAA 2JRSA 5C24B 3BDPA 2V50A 4UOHA 3UCUP 4PR6A 2DCUB 4ALZA 2J7KA 1VOMA 2N7CA 5DO2A 1WKLA 5FDLA 3M8QB 2QJ3A 1WOSA 4C9DA 4FN5A 2IDEA 5DDRC 4QIGA 2AGQA 5GADU 1HQUA 4NASA 3PJ9A 1AZSB 2WVEA 2ZC4A 2LEAA 3G87A 3SQOP 5D4OA 2PN6A 4C97A 4ZP8A 1XR7A 4DF8A 4RWXA 4ES2A 1R0AB 3NRBA 4LQ9A 1PJ5A 3DFEA 3TW0A 2AEFA 2HLUA 3LANA 4S0MA 3R7SB 4E0DA 1R31A 2R3VA 2BZ2A 1PAEX 2HBQB 3D68A 3OR1A 3FFIA 5B0BA 1S1TB 2FJXA 4O3NA 4ZVGA 4ZP6A 2HRTA 4OJHA 1QSSA 4IRKA 1WI6A 3L7OA 4MJKA 4C8NA 1VYAA 4B3MJ 3I32A 3I4PA 4CLKA 2MPUA 1HPZA 3UNGC 2ZBIA 2H9ZA 2CPIA 1YZ6A 1WTFA 5G0RA 1SKRA 1WJ9A 1S1XB 2HEKA 3RAMA 3EMTA 2DGQA 3NGDA 4AL6A 3M2RA 2B0GA 2E9TA 2DNPA 1DQ9A 2BKOA 1A0OB 3G82B 1B70B 4DWIA 1XJWB 2JLGA 3M30B 3DOKA 1RTDB 2HNYA 4LJMA 3BPDA 4UTGA 3Q8PB 4YR2A 1LK5A 2DNRA 3CIZA 1S9FA 3CTRA 1RT5A 4UOFA 4RW6B 3CD6S 3HSDA 2FVRA 5KFHA 1I3OB 4NLQA 1KN6A 5IV3A 3K5OA 4QJVA 4PG4A 2K8GA 5DJBA 5KFPA 4ETZA 3CJQA 1IKXB 4OYXA 4U7CA 1JMTA 5M2UA 1D9AA 1B99A 1U1PA 5KFYA 4M5HA 1V5IB 3DGVA 1IBKF 2GMLA 3LWMA 3GCXP 2KI2A 1PBAA 5GAGU 3LPEA 1BC6A 2L9DA 3T6JA 3KK2B 1S1UB 5KFZA 1YBTA 3VGSA 5B0EA 3ICLA 1RAHB 2D41A 1SQGA 4I0WA 4PQUA 3GFXA 2NZ4A 1TV6B 3QWPA 4CO0A 2HQIA 4JI1J 4XIUA 1C1BA 2KXNB 2RIJA 3DI6B 1NM2A 1YX2A 1T05B 3GG1A 5KG2A 4C8OA 4YDDB 3SDEA 1MWQA 1RAFB 1L5UA 2UUCF 4FPIA 2K1RA 4CO3A 2QSWA 2GIRA 3ILIA 2CPEA 1NHVA 3V4IB 1RTHB 3NAIA 3D0HE 1QD1A 1VLYA 2J0QD 3CDBA 3U1LA 2JH3A 4LF5J 4MIAA 1QAJA 4K4VA 5DZ7A 2CJBA 3H2LA 3CJ3A 2IBKA 1UJ4A 2RB7A 2QFJA 4B3OA 4NXMJ 3C66A 2VF3A 3QGPA 3IG1B 1FKPB 3DU5A 4RUCA 1BGXT 4DV3F 4DQIA 1VRUB 1GTEA 5L1IA 4ED7A 1CULA 5DGBA 4CH1A 2YKMA 2NUHA 3ET6B 1JLCA 1WC1A 4JI4F 2J5AA 5KFKA 4OJ3A 2DR6A 4N8NA 4CRJA 3FBBA 3DYAB 5HJYA 2G2YA 2YKNB 5EX3A 4Q0BA 3MOZA 4AXIA 1XR6A 2C2NA 3MPWA 5FLXU 4P7TA 4IFVA 3QQCD 4DUYJ 4G1IA 3UR0A 2IYIA 2BA9A 1G7CB 1T9TA 5IT9U 5HVFA 2JJ4D
chains in the Genus database with same CATH topology
1N34J 4K0KJ 4X66J 4DV1J 1IBLJ 4HHUA 4LF9J 2KVQE 3W1YC 1J5EJ 4DR4J 2UXBJ 1XMQJ 4JYAJ 2HHHJ 2VQFJ 4LF6J 4LF7J 5LMUJ 2ZM6J 2F4VJ 4LF5J 4YHHJ 4JI7J 4NXNJ 1XMOJ 2UUBJ 4KYZA 4NEZA 4DV5J 1I94J 2MEWA 4DV4J 1IBMJ 2UUAJ 1IBKJ 1XNRJ 3D3BJ 2UXDJ 5A2QU 4DV6J 5BR8J 3T1HJ 3J7AN 4LFCJ 4DUZJ 4OX9J 4JI4J 4NXMJ 4B3MJ 5AJ3J 3IMQJ 4GKKJ 1N32J 4B3RJ 4LF8J 3J80U 4DR3J 4DR5J 4X64J 1HR0J 4JI8J 2UXCJ 4DV3J 4RJVA 5LM7E 4JI6J 4DV7J 4GKJJ 4LFBJ 1HNZJ 2UU9J 4V1Ak 3D3CJ 4JI5J 4JI3J 1N33J 4JV5J 4X65J 4DR2J 3R2CJ 4LF4J 1FJGJ 4DV2J 3T1YJ 2UUCJ 4B3SJ 1HNXJ 1HNWJ 1N36J 4B3TJ 5IWAJ 5FLXU 4PWWA 4X62J 4NEYA 4YY3J 5LMNJ 2KL8A 4JI2J 1XNQJ 4DUYJ 4JI1J 3OTOJ 3R2DJ 4KHPJ 4AQYJ 3JAMU 2MQ8A 5IT9U 2E5LJ 2VQEJ 4KY3A 2MTLA 4LFAJ 3J81U 4DR7J 4JI0J 4DR6J 4DV0J 4DR1J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N34 J;  4K0K J;  4X66 J;  4DV1 J;  1IBL J;  4HHU A;  4LF9 J;  2KVQ E;  3W1Y C;  1J5E J;  4DR4 J;  2UXB J;  1XMQ J;  4JYA J;  2HHH J;  2VQF J;  4LF6 J;  4LF7 J;  5LMU J;  2ZM6 J;  2F4V J;  4LF5 J;  4YHH J;  4JI7 J;  4NXN J;  1XMO J;  2UUB J;  4KYZ A;  4NEZ A;  4DV5 J;  1I94 J;  2MEW A;  4DV4 J;  1IBM J;  2UUA J;  1IBK J;  1XNR J;  3D3B J;  2UXD J;  5A2Q U;  4DV6 J;  5BR8 J;  3T1H J;  3J7A N;  4LFC J;  4DUZ J;  4OX9 J;  4JI4 J;  4NXM J;  4B3M J;  5AJ3 J;  3IMQ J;  4GKK J;  1N32 J;  4B3R J;  4LF8 J;  3J80 U;  4DR3 J;  4DR5 J;  4X64 J;  1HR0 J;  4JI8 J;  2UXC J;  4DV3 J;  4RJV A;  5LM7 E;  4JI6 J;  4DV7 J;  4GKJ J;  4LFB J;  1HNZ J;  2UU9 J;  4V1A k;  3D3C J;  4JI5 J;  4JI3 J;  1N33 J;  4JV5 J;  4X65 J;  4DR2 J;  3R2C J;  4LF4 J;  1FJG J;  4DV2 J;  3T1Y J;  2UUC J;  4B3S J;  1HNX J;  1HNW J;  1N36 J;  4B3T J;  5IWA J;  5FLX U;  4PWW A;  4X62 J;  4NEY A;  4YY3 J;  5LMN J;  2KL8 A;  4JI2 J;  1XNQ J;  4DUY J;  4JI1 J;  3OTO J;  3R2D J;  4KHP J;  4AQY J;  3JAM U;  2MQ8 A;  5IT9 U;  2E5L J;  2VQE J;  4KY3 A;  2MTL A;  4LFA J;  3J81 U;  4DR7 J;  4JI0 J;  4DR6 J;  4DV0 J;  4DR1 J; 
#chains in the Genus database with same CATH topology
 2G1H A;  1JKH A;  1WUU A;  1IWG A;  2AEM A;  4FPR A;  1WSV A;  4ECU A;  3X1L B;  2VG5 A;  2ZKU A;  3OTO F;  3EXC X;  3ZZO A;  4DS4 A;  3CCM S;  2GCF A;  2KN4 A;  2J6T A;  2O5D A;  3M8R A;  3N6L A;  4LRA A;  4QW8 A;  5KFL A;  4UOC A;  1C0T B;  4USI A;  4K0K F;  4DL6 A;  2N3L A;  2OEK A;  3EJM A;  3CO0 P;  4TY8 A;  4HKQ A;  2H4W B;  1HD1 A;  2MJN A;  3TNV A;  5C2C A;  3K2Y A;  4URG A;  1GH8 A;  5EHH A;  1S9G B;  3TOQ A;  4OX9 F;  4C7Q A;  3MI7 X;  5I3Q A;  5C2G A;  2KDO A;  1F2G A;  3KLI B;  4ETX A;  1KLM A;  2LQB A;  1MMN A;  5ETP A;  3RRG A;  2XI3 A;  2EFV A;  4DV2 J;  3CGI A;  4CLS A;  3CIM A;  4GKJ F;  1KP6 A;  4I69 A;  2RNE A;  4MK8 A;  1TKT A;  5CYJ A;  2HRY A;  3MAA A;  1MRO B;  3VAF A;  3R5G A;  4DN9 A;  3WQP A;  1HAR A;  4LFA J;  1RT3 B;  2M8H A;  6FDR A;  3G71 S;  2LU1 A;  1F2H A;  2YXL A;  1IR0 A;  4DHV A;  1JWW A;  4I2P B;  1QAX A;  5DDP C;  2LKZ A;  2PI5 A;  4MTP A;  1VRQ C;  2AX1 A;  2E5I A;  2HHW A;  2PI4 A;  3RBD A;  1SJQ A;  5EX0 A;  2ZHA A;  1P1L A;  1VQ4 S;  1WHX A;  1TL1 B;  4ENO A;  1VQ6 S;  3AA9 A;  3QO9 A;  4OZJ A;  2FC8 A;  5JXS A;  3O3L A;  1K1Q A;  3VGV A;  4MT1 A;  5A8W B;  3J80 Y;  2V68 A;  3PJX A;  4TKT A;  2FY8 A;  5JJB A;  5HMW A;  1KKH A;  3BR9 A;  1NKE A;  2JEJ A;  1X4E A;  4OZ5 A;  4OL8 A;  3OL6 A;  4LF4 J;  3THP A;  1D8Y A;  1Y11 A;  2MDA A;  2D3U A;  2O66 A;  2MQN A;  2LVW A;  4Q2M A;  1H6K X;  3JTO A;  3LGH A;  4OIX A;  3D54 A;  4DI6 A;  2DHG A;  3TUI C;  3MEE A;  5EGY A;  4KHM A;  1FJE B;  3HZE A;  1G1X A;  4HYK A;  3BS9 A;  5HBM A;  1KVK A;  2AZ3 A;  5L9X A;  3ILJ A;  5KFB A;  4F0M A;  3OTB A;  3HVA A;  1CJV B;  2MZS A;  4DV5 J;  2MY8 A;  3HLU A;  3D3B J;  2QMX A;  3KK2 A;  3ZC4 A;  1S1U A;  3CT9 A;  2XC9 A;  3U02 A;  1U0S A;  4BWJ A;  3HHD A;  3SEO A;  1SCJ B;  5AXN A;  2F5G A;  1P6T A;  4CWB A;  1OPZ A;  4KGV B;  4ZPD A;  3DI6 A;  3ETO A;  2AV5 A;  3DNC A;  1VK3 A;  1RZM A;  2ACY A;  2LXI A;  3V81 B;  4F36 A;  9RUB A;  4LR7 A;  3PW4 A;  1JLF B;  2V63 A;  5K8M A;  3LGM A;  1PYT A;  4OJ1 A;  4LVN P;  4WPA A;  3MPY A;  3VAI A;  4YY3 F;  2BXJ A;  4GO5 X;  2NQP A;  4LFB F;  5KFU A;  1Y00 A;  3RAQ A;  2WVD A;  4L74 A;  3LF0 A;  4B3S F;  1S1W B;  1SL0 A;  5HI7 A;  4QOT A;  5C7P A;  5F0U A;  4CT9 A;  4TU9 A;  1T95 A;  1RP5 A;  2GVZ A;  3QT6 A;  1EP4 B;  1XMQ F;  2XMJ A;  4WFN Q;  4DR4 J;  2DR7 A;  4WFY A;  1EET A;  1F6T A;  2ZNZ A;  2AGO A;  2W4C A;  3LWL A;  1H73 A;  1FER A;  1NPR A;  4D3H A;  1O0P A;  3DOM A;  3MM5 A;  3ZZR A;  1GMU A;  4ED1 A;  5B0F A;  2RKI A;  2W1B A;  1ACM B;  1WC0 A;  4I6W A;  2AT1 B;  1GNK A;  2RRN A;  4JI6 J;  5LM7 E;  3BBB A;  4EU0 A;  1E6Y A;  1FXL A;  3QJJ A;  3AOD A;  2PMZ D;  4X4R A;  1NJZ A;  3SZ2 A;  4PYA A;  4HI1 A;  1NJX A;  1KC8 T;  2YX4 A;  2XHC A;  4IG3 B;  3C14 A;  3FGV A;  4USJ C;  1RAI B;  2W25 A;  3I96 A;  3MHY A;  1TL7 B;  1WEZ A;  2KL8 A;  2G13 A;  3QZ8 A;  3QT7 A;  2VC1 A;  3D67 A;  3M7V A;  4DR1 J;  2R2T A;  4ZHR B;  5ETV A;  1TTH B;  2B9W A;  1TR0 A;  1WC4 A;  1D09 B;  3M32 A;  2X1A A;  4F2S A;  3G8S A;  3CD5 A;  4KYZ A;  4B9S A;  2DRA A;  1NME B;  3I9Z A;  3WC0 A;  5B0G A;  2D3O 1;  2J9D A;  2RDI A;  5HK4 A;  2D74 B;  1NK9 A;  1VS3 A;  4F50 A;  2BW7 A;  3GMG A;  1FWL A;  2DIU A;  4O3S A;  1T94 A;  3LUY A;  4QU7 A;  1CS4 B;  3T41 A;  3PCO B;  5HQM A;  1RT3 A;  2RU3 A;  1CPZ A;  2DVI A;  1LQ9 A;  1AUD A;  1HKA A;  4RZR A;  4N5S A;  2B5J A;  2NXE A;  2X1G A;  4ZLJ A;  3MUM P;  3EDQ B;  4ELV A;  2BR0 A;  5KFA A;  1T02 A;  4FYY B;  1PAU B;  1ELO A;  3PJW A;  5AXL A;  4RR5 A;  1NJI T;  5GAH I;  5KT7 A;  2P9G A;  2VU5 A;  4HHJ A;  3HVR A;  1JK9 B;  1SQE A;  3KJV B;  3F0N A;  1MSW D;  2VBW A;  1DAR A;  4QYZ K;  3HT0 A;  3DRS A;  4ZP7 A;  3S7R A;  4OX8 A;  2W9A A;  4Z7Y A;  5A8W A;  1LXJ A;  4ED0 A;  3DGP A;  1IKV B;  5T41 A;  4W4M A;  4LSN A;  2M3D A;  1W26 A;  1ARO P;  1F5C A;  3MM9 B;  3AOB A;  3OJU A;  2J7W A;  1REV A;  5EWE A;  4ZPW R;  1UEK A;  1F0X A;  2A0F B;  5A6W A;  3KJQ B;  3GR1 A;  4DUZ J;  4ANC A;  3F44 A;  2B8Q A;  1S7I A;  3OL8 A;  1WHY A;  4WZQ A;  1N5T A;  3M8Z A;  3B6B A;  3MGJ A;  4U95 A;  3HSJ A;  4HT5 A;  3KDO A;  5HLF B;  5CD4 H;  3EZO A;  4CLT A;  3DLJ A;  3D3C J;  3ISN D;  2VIH A;  3UN3 A;  2R2U A;  4OI4 A;  2Z0G A;  2MZT A;  1NDL A;  2PC6 A;  5K14 B;  3VWS A;  3TQE A;  2EXU A;  1P8G A;  4J9S A;  2IAJ B;  4WU3 A;  5D0G A;  2GO9 A;  4JI0 J;  1OMS A;  4ECS A;  4N77 A;  5GAE I;  5LMN F;  4DS5 A;  2BM0 A;  4O0I A;  5F8M A;  4IO9 Q;  5CCL A;  2VJU A;  4GC7 A;  2CNO B;  2A10 A;  1SL1 A;  3QJL A;  2JDJ A;  2PT0 A;  3JSR A;  2HQC A;  5GMD A;  3CB4 A;  3GLJ A;  3CUN A;  4ZJL A;  1ZAX A;  4WU2 A;  2ZKT A;  3VTI A;  1S76 D;  4IOA Q;  5DZ6 A;  1S1W A;  1XER A;  4NLU A;  3ENA A;  3H25 A;  3TUJ C;  4JI5 J;  2ZWO A;  3PIP Q;  3TYT A;  3UN2 A;  3W5Y A;  2LA4 A;  4K7Q A;  3IO1 A;  1T9V A;  2KJV A;  5KFO A;  2OPR B;  4NL5 A;  4XDC A;  4DV0 F;  3X3U A;  3AD7 C;  4LBI A;  2DR5 A;  1RA6 A;  3GFY A;  1X5T A;  4ZLN A;  2WON A;  3E01 B;  3KHG A;  5KFR A;  1M1G A;  1KQS R;  1RA7 A;  3IRX A;  2E1C A;  1FVS A;  2UUB F;  2WZ1 A;  1CJU B;  3P5B P;  4RW9 B;  4HLB A;  4NYO A;  1H38 A;  1X0P A;  2UUA J;  2W8K A;  1RWO B;  3T1H F;  3KUE A;  1OJ4 A;  2L41 A;  1KOH A;  1TMJ A;  3I87 A;  4G65 A;  3EGV A;  2HND B;  1BHN A;  5KFM A;  3K5L A;  4GO7 X;  2C2K B;  2DR9 A;  1T03 A;  1NU4 A;  4DV4 F;  2B51 A;  4U96 A;  3BQ2 A;  2V9W A;  2UU9 J;  3GSD A;  4LF8 F;  1NPK A;  2ZZT A;  4ID8 A;  4IG0 A;  3MM8 B;  1LWF B;  1TKZ B;  1R6Y A;  4ZLP A;  1RTZ A;  1JLA B;  4UOG A;  3MXH P;  2X1B A;  1TQL A;  1KON A;  2ZOM A;  1MWZ A;  2YPY A;  1CG2 A;  3W2W A;  5DS7 A;  5I42 B;  2XY6 A;  3MEG B;  2ZE2 A;  2VH7 A;  3GV8 B;  1SV5 B;  4L73 A;  1XNQ F;  2ACM A;  2HS4 A;  1MU2 B;  1LKZ A;  1NBE B;  3BGL A;  1RT7 B;  3CCZ A;  3MMA B;  1LW2 B;  1XR5 A;  1VQS A;  3UO0 A;  3BB5 A;  1OS5 A;  4M8L A;  2FJD B;  1BUX A;  1BWE A;  2IFX A;  1UL3 A;  4NCB A;  4LUB A;  3UN5 A;  4B3R J;  2B4V A;  1FF2 A;  5E33 A;  2XCP A;  3J7Y U;  3M8W A;  4HAC B;  3NY0 A;  2NUU G;  3A3P B;  1FFW B;  1Y5L B;  3VQS A;  1U25 A;  1GT8 A;  4OLO A;  4OQJ A;  3OSP A;  1JLB B;  1BXN A;  2QLB B;  4ZVH A;  5CCM A;  5ETN A;  2YWE A;  3A13 A;  2BAB A;  2GJ2 A;  5CYM B;  2JLF A;  5J2M B;  2BJ9 A;  3I4H X;  3VGT A;  5KFQ A;  3K59 A;  5BYS A;  3AA8 A;  1RYR A;  5K5M A;  2RT3 A;  2XMK A;  1IR1 A;  1OQ6 A;  2R7S A;  1VC6 A;  2HBY B;  1IBL J;  1EB0 A;  2MB0 B;  3DLL Q;  1TAQ A;  5A8K A;  4JI2 F;  4PEO A;  1DRZ A;  3W64 A;  2D3O R;  4TNO A;  3R9L A;  4LF7 J;  2G2Z A;  2W7A A;  2R7O A;  1VQ5 S;  3R5C A;  3P49 B;  2VBX A;  2PDA A;  1S79 A;  3MZI A;  2RSQ A;  3AXK A;  1TP7 A;  3OW2 R;  4C11 A;  5BR8 J;  1S0N A;  2MLY A;  4B3M F;  4N41 A;  2C2E A;  4EZ9 A;  3OVS A;  1SJ3 P;  2R7U A;  1S49 A;  3P4U B;  2LXU A;  2AJQ A;  5KFC A;  2DHA A;  3MED A;  2OTL S;  2Y9H A;  1U2R A;  4DX8 H;  2DNZ A;  2Q1L A;  2DGW A;  2MKY A;  3IBC B;  3UDC A;  4MK7 A;  4KE5 A;  1Q95 G;  4YR3 A;  2ZUG A;  3HXM A;  4ZN1 A;  4PXC A;  3ZXW A;  2YWK A;  4HTJ A;  3OR2 B;  3V4M A;  2ADB A;  2BRK A;  2YKO A;  3NBP B;  2AWZ A;  3LP2 A;  2M0G B;  3KLV A;  4CT8 A;  3FVY A;  3DM2 B;  5F8G A;  5JVH Q;  4TU7 A;  4L3K A;  2XLK A;  4NMX A;  5D78 A;  5D8H B;  3BGO P;  1HLW A;  2MYF A;  3EWG A;  2C42 A;  3A8E A;  2W9B A;  3PY8 A;  4KGZ B;  1N52 B;  2J0W A;  4NLD A;  2R7R A;  3ADA C;  4JP8 A;  4K8R A;  2KG1 A;  1WKJ A;  2CVI A;  3FUY A;  3W2V B;  5IQQ A;  2LYV A;  1HI8 A;  1VC5 A;  3JQJ A;  4ID5 A;  3Q22 A;  2AGP A;  4C48 A;  1R89 A;  2HFZ A;  4LR9 A;  1XMO F;  4LRE A;  2WOM B;  1UP1 A;  4PG5 A;  5MAO A;  3EM1 A;  2EKY A;  5KFF A;  4KGM A;  3VAJ A;  1U47 A;  2V94 A;  3EZU A;  2XZW A;  3KK3 A;  5KT6 A;  3TVZ A;  5J1E B;  2QL5 B;  3T1Y J;  2IJF A;  1WG1 A;  3POT B;  2WB1 D;  4KQZ A;  4I56 A;  5KG3 A;  1CJU A;  4JI1 F;  1C0U B;  1NXI A;  4WXW A;  2C28 A;  3MMB B;  3OVA A;  4ECR A;  5CQG A;  4UQG A;  5IS2 A;  1QTM A;  2CQ4 A;  2V0N A;  3GFH A;  1UWA A;  4J9R A;  4ECZ A;  4FXW A;  4RPF A;  4KGX B;  4F2R A;  1GXT A;  4DF4 A;  3HHK A;  2Z2Y B;  4NLV A;  3BPS P;  2I0X A;  3FRZ A;  3VCD A;  4YP3 A;  4FYV B;  4URQ U;  1TKZ A;  5J2N B;  3BZQ A;  3I5C A;  1Y5I B;  2HPU A;  3DRP A;  1B4S A;  2ROP A;  3HCX A;  1O51 A;  1ZPV A;  2KYZ A;  3BRE A;  2JX2 A;  2OEM A;  3O1L A;  4WYL A;  1O6X A;  2HHU A;  4USK A;  3TZZ A;  3UDL A;  4EZ6 A;  4W90 B;  1AYE A;  2PII A;  1HYS B;  1AXQ A;  3BBF A;  2GMH A;  5IC6 B;  3OV7 A;  3PX6 A;  2MQQ A;  1SH0 A;  2OO4 A;  2GC8 A;  3QSY B;  2B7C B;  2VPW B;  3MMC B;  4X62 F;  5CHC B;  1VRT A;  2XS7 A;  2BOA A;  1SUQ A;  3JXO A;  3IAS 9;  1KHV A;  5BXI A;  3W1Y C;  3RB4 A;  5KFT A;  3HFV A;  1H7W A;  1N54 B;  1RLC L;  4KV8 A;  3P5T L;  3LP0 B;  1GX5 A;  2GNK A;  2WSE C;  1X60 A;  2UVU A;  3H4D A;  1M5V C;  1KS2 A;  2BAN B;  4OX6 A;  3KJN B;  1X5S A;  1EQM A;  2I8E A;  4HH0 A;  1CC7 A;  3DLE B;  3H2U B;  4U67 Q;  3NS7 B;  2DGT A;  4A8O A;  4ELT A;  4RJV A;  1SC1 B;  3I0R B;  1B64 A;  1G2E A;  1CBK A;  4C8L A;  3FCW A;  3JB9 k;  2ZD1 B;  2XY5 A;  2KO1 A;  3KLE B;  2P9E A;  4CI0 B;  3NKY A;  4DV2 F;  3BSO A;  3DCA A;  1X4C A;  2DPJ A;  5ITH A;  3HJF A;  5F8J A;  4RW7 B;  3TJ9 A;  2DH9 A;  3S1T A;  1NLK L;  4M5L A;  1CVJ A;  1U48 A;  1RWN B;  4QPT A;  5IQ6 A;  4FBT A;  3J7A 1;  3O5T B;  2Y3Y A;  2R8I A;  1R43 A;  3AB2 B;  2FZK B;  2VZ9 A;  2CQB A;  3GIJ A;  3NLC A;  1MML A;  2WVF A;  4KKO B;  4WK3 A;  1X8D A;  4F4K A;  1PYS B;  1RU2 A;  2ZH1 A;  1FEE A;  5K8P A;  1RBO B;  2J9E A;  3CPW R;  4L72 B;  1JJ4 A;  3C6U A;  4E2F B;  4BCA A;  1IBK J;  2M8D B;  4RW8 A;  1RHM B;  1SXL A;  3KNG A;  3ONQ A;  3GP9 A;  4ER8 A;  3FC9 A;  2MQL A;  1ZA1 B;  2WRM A;  1FO1 A;  3ZO7 A;  3F56 A;  2VC0 A;  2HHV A;  7FD1 A;  3MWB A;  1N48 A;  2RJZ A;  1U6Z A;  2HWT A;  3RBX A;  3W5X A;  3JSM B;  4O44 B;  3A1Y G;  1CEZ A;  2IC3 A;  1FK9 B;  1HBM B;  3L7P A;  2PO4 A;  1QJH A;  3IBF B;  1N4L A;  2GV1 A;  2MZR A;  4LF4 F;  2Y1L B;  1OY6 A;  2DHX A;  2Z56 B;  2UUC J;  4CNZ A;  1T8E A;  2HHP A;  4CDI A;  3H20 A;  5I3U B;  1BQM A;  1JJ2 R;  4XPE A;  1VK8 A;  3BQ1 A;  3QGI A;  1FFS B;  1HBU A;  2YNG B;  4Y2M A;  3PG9 A;  5B0C A;  2G4B A;  4MFB A;  4P2X A;  1RAB B;  3I6P A;  1R3N A;  4HVZ A;  3QJP A;  3UR3 C;  2BE9 B;  3H5U A;  1U0H B;  2EPI A;  4QR0 A;  2A6M A;  5M2R A;  5ADZ A;  3A8J A;  2ZBP A;  4BLG A;  2DNG A;  4OYW A;  4DSI A;  4I7F A;  4G6V B;  4JI4 J;  3R6G B;  3KG1 A;  1X9W A;  1X4B A;  1DUR A;  4DR5 J;  1FI4 A;  2HNZ B;  4GRS A;  1SC4 B;  2WK4 A;  3WZ0 A;  1KOO A;  4DV7 J;  2JLE A;  1SBR A;  4DCP B;  4UT4 A;  3MAH A;  3UPF A;  4U7U D;  2V2V A;  4DX5 A;  2QA2 A;  3ILO A;  4J9V A;  1N5Y B;  2QLF B;  2R2R A;  4B3T J;  3MUR P;  2EKN A;  4U9R A;  3MCS A;  4OYZ A;  2ILZ A;  3OTO J;  3H5Y A;  1TL3 B;  4O4G B;  5KFW A;  1OYD A;  4XK8 C;  1KQK A;  4RBU A;  5A8R A;  4CM2 A;  2XS5 A;  4K0K J;  1X4D A;  1H2T Z;  4U6P A;  2GAH C;  4CM0 A;  3MM7 B;  3OSN A;  3C16 B;  4AQY F;  5A0Y B;  2ATL A;  3C19 A;  4I2Q B;  3QGH A;  3W8G A;  7FDR A;  2AYB A;  3DU6 A;  1K9M T;  4NEZ A;  4NCG B;  3HKW A;  1R8B A;  2EK6 A;  5LJ3 Y;  1DTQ B;  4OX9 J;  2XY7 A;  2DB1 A;  3CJ0 A;  1N6Q A;  2K7J A;  5E41 A;  3SBM A;  1UA1 A;  1V9O A;  3TEH B;  1LV5 A;  3UFC X;  1UEU A;  4ZCL A;  1QUV A;  3TEG A;  1C1C B;  2XSJ A;  2GW8 A;  3UD3 P;  1NDP A;  3IBW A;  2RRA A;  4GKJ J;  1WEL A;  3IR6 B;  4USH A;  2MHN A;  5JUM A;  3MMC A;  5BYR A;  1Y3J A;  2OPQ B;  1YBA A;  2FZC B;  3FCH A;  1FKA F;  1S9E A;  1W7W A;  2CNK B;  3PVX A;  3MOJ B;  2RF2 B;  3UI3 A;  1MN9 A;  5HJX A;  1RHU B;  4U8V A;  3TAM B;  1PO6 A;  3OQ2 A;  3JYT A;  2B43 A;  4KFB B;  4WCE Q;  4WP3 A;  4PCQ A;  2J7U A;  1NK6 A;  1IKW B;  2WCX A;  2HZA A;  1YBU A;  4CO1 A;  2VG7 A;  2CNL B;  2HQF A;  5DDO C;  2QC3 A;  3NS6 A;  1H74 A;  2V69 A;  4F4A A;  2C3Y A;  5EWF A;  1H72 C;  2HWH A;  4WXO A;  2HVZ A;  2FHM A;  4Y2A A;  2CQD A;  2NSB A;  2O67 A;  2R9L A;  3N6M A;  2QA4 G;  3BKT A;  2ZC3 A;  1ZPW X;  3R1H A;  4NI2 B;  1Q53 A;  3ZNU A;  4KKO A;  4I6Y A;  4NWB A;  3OXG A;  2OPP B;  5KG5 A;  1LWC B;  4LIW A;  4IRD A;  3TP2 A;  3JQK A;  1OSC A;  2EWH A;  2HQD A;  4OFZ A;  3FJ2 A;  4KH1 B;  4JB8 B;  3D5M A;  4Q8E A;  3VQT A;  5CAA A;  1REG X;  1FJG F;  2VKR A;  4ZIV A;  4V19 X;  5DLF A;  4RW4 B;  2E1A A;  4UZC A;  4H54 A;  1NSK L;  1JQG A;  3BSN A;  4KTQ A;  3LAM A;  2R2S A;  4IRC A;  1AA1 B;  1W2I A;  3HSZ A;  4NPO A;  1HBM A;  1XNR J;  4LRF A;  3KUH A;  1FRH A;  4LFC J;  3CW2 C;  5AXK A;  4UY8 5;  2BX6 A;  4GKK J;  4TLR A;  2HVE A;  2AW0 A;  1M1K T;  3DMJ B;  1CLF A;  3AH6 A;  2KG0 A;  2RIL A;  3M9M B;  3D6T B;  1HMV A;  1WHW A;  2ZIT A;  2CNN B;  1T11 A;  4LFB J;  4F02 A;  4EFA C;  4ZPV R;  1N33 J;  4NOH A;  1QY7 A;  5E3A A;  3VHQ A;  4B3S J;  1RB0 A;  4ECW A;  4BDP A;  1HQE B;  2XO7 A;  3PRV A;  3CCQ S;  2HQG A;  4ZVT B;  1FNM A;  1HHS A;  2JVO A;  3G2X A;  5F8N A;  1S12 A;  1IR2 A;  2YH0 A;  3TZW A;  3HUL A;  2VFT A;  1Q7Y T;  4DUT A;  2A2C A;  3K57 A;  2YNF B;  2QFI A;  3JTN A;  2HSE B;  3HVT B;  5LT5 A;  3EUN A;  2DY9 A;  1FKO A;  2MST A;  2J8A A;  1NCL A;  3K8W A;  3OHA A;  2VPZ B;  3B78 A;  4CLF A;  2I5J A;  1A9N B;  1NND A;  2LEB A;  3BGR B;  4O4R A;  3QMQ A;  1KD1 T;  2ZBR A;  2CQ2 A;  2CDR B;  1K73 T;  3RYL A;  3V6D B;  4IR9 A;  2QSF A;  5AJ3 F;  3BDE A;  1EQ0 A;  2DNM A;  3CCR S;  4ZIW A;  2JVR A;  3VAG A;  1B0V A;  3TAR A;  1M5P C;  4IOC Q;  3HHL B;  1CJK B;  4NYZ A;  3QZ7 A;  3D4J A;  4NZ6 A;  2ZH5 A;  4RBT A;  4KRW A;  3BSA A;  1J5O B;  3AD8 C;  2FC9 A;  1VR6 A;  4KO0 B;  5IT9 Y;  1QDU B;  4HR2 A;  4I67 A;  2ATC B;  4K59 A;  4DQR A;  4P6Q A;  3Q8S B;  2D9O A;  2CPY A;  3H2V E;  1HNI B;  4J5O A;  3CO9 A;  1FRK A;  4EBE A;  3M2V A;  5DM7 Q;  1WF1 A;  4LSL B;  1U1O A;  3FKB A;  1DLO A;  1WOR A;  2EFN A;  5ETR A;  4HT7 A;  5D77 A;  5B7W A;  1FTR A;  1J5E F;  3BKU A;  3KHH A;  1VBY A;  1N0V C;  3RJM B;  1RGV A;  2VJV A;  5DG8 A;  1CQN A;  1TKX A;  4OJG A;  2IVM A;  2OD4 A;  5CYQ A;  2Q6B A;  5HRO A;  3C3L A;  1PIE A;  4DL7 A;  4EYI B;  4HH1 A;  3LAL A;  3GIK A;  1EKR A;  1CJT A;  2GVD A;  4HHH A;  2XHW A;  3R5A A;  4J9L A;  1S48 A;  3N4W A;  2BW2 A;  3MTJ A;  2LQ8 A;  4RUB A;  1QVF R;  2PD1 A;  1FA0 A;  3T9Z A;  2DPI A;  4B9T A;  1OYE A;  2D3Z A;  3V6J A;  3RRH A;  4Y3C A;  1IXK A;  2CQC A;  1S1V A;  2CJK A;  2IJR A;  2HKE A;  4FF2 A;  4NA2 A;  2CQI A;  3OR1 B;  2G0I A;  4C8M A;  2DH8 A;  4X66 F;  2UP1 A;  2OAU A;  1RT4 A;  4DQQ A;  2BBE A;  2ZJR Q;  1RBA A;  1B7Y B;  2LXF A;  2QA4 S;  1ZOT A;  3PW7 A;  2XGQ A;  3FQK A;  1HPZ B;  3PHE A;  1VQY A;  3UQS A;  2OJ3 A;  5G0R B;  2MJU A;  2KTQ A;  5HP1 A;  2NXN A;  3M2R B;  4N8O A;  4KJI A;  4UY8 T;  1IKY A;  2R4F A;  2ZUA A;  4EEY A;  4EBC A;  3GII A;  3PYG A;  4H4O A;  3EYZ A;  2NXC A;  1ZZN A;  4QCL A;  4AD6 A;  5LMN J;  1JXL A;  2IVF B;  3BN7 A;  3FNN A;  2ZH2 A;  2FVP A;  4DL2 A;  2QLJ B;  3VR1 A;  3DOK B;  2EBG A;  3AJ2 A;  2E1R A;  4BWM A;  3IWN C;  2HNY B;  2IA0 A;  5LXY A;  2AU0 A;  3O6Q A;  2F9D A;  1QLN A;  1X4H A;  3T6B A;  3GYX B;  1ZAV A;  4R25 A;  2CJ9 A;  1RT5 B;  4FNH A;  2YY3 A;  2IPO B;  5IM0 A;  1UPP A;  5IXU A;  1YJN S;  2COL A;  3PIO Q;  1GQE A;  3HPO A;  4JYA F;  2M9K A;  1LEO A;  3BQ0 A;  3M8S A;  3NCQ A;  1QAY A;  3J81 j;  1LWE A;  4PUO A;  1UZD A;  4M5N A;  2Q6C A;  2H5E A;  2XNQ A;  1Y7P A;  4CLW A;  1Q81 T;  3DLG A;  3JS9 A;  1HNV A;  4IR1 A;  3GJS B;  1M5O C;  3QID A;  2GQQ A;  1OSD A;  2Y1J A;  2F8M A;  1S4F A;  4PQU B;  1S0M A;  3ZZZ A;  2PMW A;  3BGR A;  5HO4 A;  2QIF A;  3DRX A;  1C1B B;  4X4U A;  1FJC A;  5ETT A;  4A8K A;  1XWL A;  2O01 C;  2HGL A;  5FJ4 A;  5LSL A;  4BS2 A;  1JLQ A;  1I1G A;  1YHQ S;  2V8V A;  1HBN A;  3SDE B;  1HWI A;  2K1R B;  2DGX A;  3FMB A;  2HVH A;  4QWE A;  3KK1 A;  4QPX A;  4DV4 J;  4B9U A;  3KNA A;  3M8P B;  1P9Q C;  2K3I A;  4UW2 A;  2CAD A;  1N88 A;  1SIZ A;  4M94 A;  4OMF G;  1AFI A;  2HHH F;  3LAK A;  1JNR B;  2MKI A;  4LF8 J;  5E0O A;  4YB7 A;  4B3O B;  4AYB D;  4DL5 A;  4DX7 A;  1J5O A;  2GHV C;  4WKR A;  1LNQ A;  1QSL A;  4N76 A;  3GPA A;  4OI2 A;  1S7H A;  3DRY A;  3ZZ0 A;  1CUL B;  4A8M P;  3UD5 A;  1TEL A;  2YKM B;  2QYC A;  3VV2 B;  4Y6I A;  1JLC B;  3QYY A;  4PG6 A;  1S5Z A;  3OPK A;  1YJR A;  1XNQ J;  5H9E J;  4H4K C;  2BOP A;  3BYR A;  2XLJ A;  4Q0B B;  1WOO A;  4IFV B;  3TJ8 A;  2QX0 A;  4DR2 F;  2V34 A;  4ED8 A;  4DR6 J;  3V5R A;  2XEX A;  2H3E B;  4DLE A;  2MKC A;  1JKH B;  2VG5 B;  1G6B A;  3MD3 A;  4YOE A;  3FSI A;  1ROF A;  1KEK A;  3KLH A;  1RK8 A;  2CPJ A;  3RUB L;  4LMZ A;  2VBZ A;  3MUV P;  5LOQ A;  3QT5 A;  2XBP A;  4TY8 B;  2EC0 A;  1S10 A;  3W63 A;  2DTJ A;  2FHJ D;  4PXD A;  3KUG A;  3GIL A;  3CED A;  1URN A;  2XYG B;  2UXC F;  3BSC A;  2E5J A;  2NXJ A;  3ENV A;  3FSX A;  3RR8 A;  1FRM A;  4FP9 A;  1JB0 C;  5U47 A;  1KLM B;  1R8H A;  2FB0 A;  4ZJO A;  4ES1 A;  1HNZ F;  1WF2 A;  4JI2 J;  4ZOS A;  4IOB A;  2DNN A;  4QR2 A;  1F5A A;  2MQ8 A;  2I6W A;  5GAD I;  4WK1 A;  1TKT B;  3MAA B;  2V4Q A;  1F5B A;  1YSJ A;  4ZVF A;  2ZH6 A;  4C4W A;  1EJ7 L;  2ABY A;  2YWG A;  4B9M A;  2QLW A;  1IM6 A;  4J90 A;  2M4M A;  4Y2I A;  1N8R T;  1WI8 A;  4O3O A;  3HVW A;  3IM8 A;  2CQH A;  5B0D A;  1S6Q A;  2ZHO A;  2A1B A;  3B54 A;  5IFM A;  4N56 A;  2FHJ A;  4LRD A;  1ZAW A;  1SC3 B;  3MFH A;  3OTD A;  3MR3 A;  1KLN A;  3RBE A;  3FEX B;  2GHW A;  3QO9 B;  3MR2 A;  4NE9 C;  1RWP B;  2VON A;  3PKM A;  3SCI E;  4LIR A;  1DAX A;  1T0T V;  2YPZ A;  1GEH A;  3DXS X;  1NK0 A;  4TXS A;  3UDE A;  1Q79 A;  1DHM A;  3DXB A;  2JZ5 A;  2EFO A;  2BE2 A;  2VOD A;  2VKZ G;  4F3O A;  4MIB A;  2BVZ A;  1RAE B;  3A8K A;  3EE3 A;  4DG1 A;  5KFX A;  2Z30 B;  1VGY A;  1F1B B;  1RJJ A;  3R1L A;  3MEE B;  4A47 A;  3U7J A;  5T14 A;  1VFJ A;  3K7R A;  2DIT A;  3D6F B;  4CO2 A;  3ITH A;  3CXC R;  3QNW B;  1WDT A;  4C0B A;  5HBM B;  4TYA A;  4Q43 A;  3GYG A;  3CVK A;  2YX7 A;  2OEL A;  4BC9 A;  3SFG A;  1XMO J;  2V2Z A;  1M1H A;  2DXE A;  2MZ1 A;  4X4S A;  4C2M A;  2RHS B;  3D2W A;  2OSR A;  3LP1 A;  3GWC A;  3UCG A;  4IQX A;  3KMS A;  4ICL A;  2ZFH A;  4DCO B;  1RLD A;  4TYB A;  3PXG a;  1Q0N A;  1D1U A;  4RU2 A;  2R7Q A;  1R8A A;  4ZN3 A;  3ZTR A;  4OHZ A;  4FYD A;  2CJQ A;  5F9L A;  1UW9 A;  4H4M A;  3D0I E;  3FBC A;  4PYD A;  4QQB A;  4Y2C A;  3W60 A;  2M52 A;  3M8P A;  1MNE A;  1U1Q A;  2AD9 A;  2E29 A;  1LW0 A;  5LJ5 Y;  2XQC A;  1MN7 A;  5GAG I;  1SKS A;  1GX6 A;  2G0J A;  2YWW A;  2BKN A;  3QRP A;  1T9W A;  1R27 B;  2GVZ B;  4YHH J;  3KDN A;  4DR7 F;  1YQH A;  5AE3 A;  2KH9 A;  2QTW A;  1EET B;  5HQL A;  1VCT A;  5J2Q A;  2RQ4 A;  3P45 B;  3ZZY A;  1ZH5 A;  4KAI A;  4DR5 F;  1FTC A;  4N7T A;  1FWK A;  4ZK7 M;  2QL7 B;  3DOM B;  2F65 A;  1U8S A;  3B4D A;  3MM5 B;  1XIQ A;  1ZM9 A;  4DV7 F;  1RHQ B;  2RKI B;  1ZM2 A;  4DFP A;  1YJW S;  2KZZ A;  2CRL A;  4NA3 A;  1E6Y B;  2CPX A;  3G6V A;  4J7C A;  4ILR A;  1JXE A;  3IWL A;  4WZM A;  1X4G A;  4EO6 A;  4B3T F;  4X4Q A;  2RQC A;  4X62 J;  1TFW A;  3C14 B;  4FZV A;  4ZVS B;  5M2P A;  4ZA1 A;  1WEX A;  1XK8 A;  2ZH4 A;  4ES3 A;  2BJ1 A;  1XTZ A;  4OYA A;  4JOU A;  2V2Q A;  1TK5 A;  3UCZ P;  4DL3 A;  2F7V A;  4M95 A;  1RWX B;  1NAQ A;  1YG0 A;  1Q5Y A;  3D7S B;  5T7L A;  4GVB A;  3ZZT A;  3TVK A;  2H1Y A;  2E5L F;  1HW8 A;  4QIE A;  3E2E A;  2ILY A;  3SCL E;  2F63 A;  1RT1 A;  3M32 B;  1R8C A;  3DN9 A;  4QIW D;  2MKH A;  4FVC A;  2HZV A;  4PAB A;  1U24 A;  4MKB A;  5HAN A;  1MW7 A;  5HAT A;  1HD0 A;  5E7O B;  2Z2M A;  2DK2 A;  1WTB A;  1ZYQ A;  3I82 A;  3NMR A;  2W4P A;  2V4R A;  1DY3 A;  3BGF A;  3QAU A;  3BEG B;  2PEH A;  4A8W A;  4JI8 F;  3R2C J;  4WYW A;  1VBZ A;  4QZV B;  4FF4 A;  2AJ4 A;  1RTI A;  2B5J B;  1S59 A;  4WE1 A;  3QGG A;  2LDI A;  1S6P A;  2D7S A;  4NLY A;  2RAQ A;  3SYZ A;  1JIH A;  2WVC A;  3NNC A;  1NK8 A;  2BJ7 A;  2Z58 B;  1UJ6 A;  2LFV A;  3HMJ G;  1Z2Z A;  3ZTP A;  3S01 A;  4C3L A;  2YNI A;  3BR8 A;  4LRC A;  1SKU B;  2ZNY A;  4PQA A;  3UDV A;  5D0E A;  5LXR A;  2W7P A;  2MY7 A;  3DRS B;  2KM8 B;  2BJ3 A;  5JVG Q;  2UXD J;  1PC5 A;  3DGP B;  2D1C A;  4PRF A;  4LSN B;  5IV4 A;  2QEX S;  4WFZ A;  3WHI A;  4NX9 A;  3RW6 A;  1REV B;  4ZPB A;  2X1F A;  1JLG A;  3RW7 A;  4BHQ A;  3LA0 A;  4LT6 A;  3EGW B;  2AQ4 A;  2FJE B;  5L38 A;  4OYO A;  2RD5 C;  3IA0 A;  2GIF A;  2KHC A;  3W9J A;  5K8O A;  3EGZ A;  2AJF E;  3JAM Y;  1X9M A;  4WP9 A;  1RTJ A;  2XZD B;  3IM9 A;  2YKQ A;  3QLH A;  2DRD A;  3PHT A;  3IS9 A;  5G4D A;  2MQP A;  2VD3 A;  3J7Z 5;  4MMO A;  2NR0 A;  2MZQ A;  3C6T A;  2HMI A;  4DFM A;  5HMZ A;  5MLC V;  4EUV A;  1FHT A;  3GYN A;  5HAO A;  2HGN A;  1FRX A;  3QAE A;  4X4P A;  2AMC B;  3CMA S;  1NSP A;  5KAK A;  2UUW A;  1A6L A;  3U27 A;  1YI2 S;  4ZIT A;  2MKK A;  1XNR F;  4IFY A;  3M6X A;  4LF9 F;  2ZDP A;  4LFC F;  1NHK L;  4DU8 A;  3I0S A;  4OV1 A;  5D4N A;  3EVM A;  4GKK F;  1WG5 A;  4LF6 F;  2B9Y A;  4RNM A;  4URS A;  4FKY A;  1C2P A;  2LEP A;  2W2O P;  2HAF A;  2H5I B;  4ZVQ B;  2JC0 A;  1YIT S;  3C15 B;  3LH2 S;  4DSL A;  1RE1 B;  1TL4 A;  3EXY A;  3P3D A;  1U7L A;  2YVS A;  3NCR A;  3TWZ A;  4GC6 A;  1N33 F;  2BMB A;  5ETM A;  4DLG A;  1N36 J;  1TZ0 A;  3KLG A;  2VPY B;  4ZPT R;  1U2C A;  2BEF A;  4MKY A;  4A8Y A;  4AQY J;  2HFV A;  1UWB A;  3HZG A;  4UUW A;  4J9U E;  2OKQ A;  1ZS6 A;  2R7X A;  1SH3 A;  5KT4 A;  2PE8 A;  2B56 A;  2EC2 A;  4GMK A;  1P9Y A;  4Y0F A;  1ZA2 B;  5DLG A;  1DFD A;  1WG4 A;  2ZJQ Q;  5DRK A;  1IJE B;  2IRX A;  4FKX A;  3SQG A;  3HD1 A;  2WON B;  1TMM A;  4CYU A;  1R8P A;  3EIC A;  4O0N A;  3TAN A;  3IRX B;  1OO0 B;  4WKY A;  4X4N A;  4USM A;  4A8Q A;  5F3T A;  4CO4 A;  3VF0 B;  3DDI A;  3FEZ A;  3H8Y A;  5IZH A;  2I1R A;  2YQ3 A;  1GMW D;  3PO5 A;  1FDA A;  1YK9 A;  1I94 F;  2KT3 A;  1U49 A;  1U4B A;  1RT2 A;  3Q23 A;  1T03 B;  3OUY A;  2VG6 A;  1N32 F;  1FT8 A;  4TVA B;  1U02 A;  1TL5 A;  4JUZ A;  4CTA A;  1OPI A;  1HNX J;  1BWV A;  2KVI A;  2RDD A;  2EG1 A;  1FNO A;  3MPV A;  2DNY A;  4IG0 B;  2RVJ A;  1LFW A;  1FX4 A;  3WX8 A;  4OZ2 A;  4EI2 A;  1RAA B;  3L09 A;  1UFK A;  4A8S A;  1GFW B;  2MGZ A;  4ZCM A;  1D9D A;  4UUX A;  4XTT A;  2IM1 A;  3M8Y A;  3W2W B;  2HS0 A;  1GMW A;  3FQL A;  2ZE2 B;  4M5G A;  2E1P A;  2KKH A;  2KU7 A;  3L7U A;  2JC1 A;  2DBB A;  4OHW A;  2E7X A;  1TVR A;  5CAB A;  2DO0 A;  2G2O A;  1L3S A;  3FBE A;  4M5J A;  1IQZ A;  4C8Y A;  4OX7 A;  3M6V A;  4XDD A;  1R6V A;  1T9X A;  2KT5 A;  4Y34 A;  4B9L A;  1VI7 A;  3SFU A;  2M5Y A;  2AF6 A;  3W8P A;  5SZT A;  4YS2 A;  4E8U A;  3PW0 A;  1NH8 A;  2ZZM A;  1Z2L A;  1LXN A;  3O44 A;  4ITS A;  3HP6 A;  4ZP9 A;  1E6V A;  1FRI A;  3W62 A;  1FJG J;  4MIW A;  4KC5 A;  1D8Z A;  3Q83 A;  3VAL A;  1EHW A;  5EWG A;  2IY5 B;  3R2D J;  3WIV A;  3UNY A;  4QYR A;  3SMZ A;  4RNO A;  2H4Y B;  4DSK A;  3D1H A;  3CCW A;  2E5G A;  3UD4 P;  2FJW A;  2W2N P;  2GFF A;  5FD1 A;  5A8K B;  4I4B A;  3MM6 A;  1FCA A;  3BGU A;  5KT5 A;  4NRT A;  1H3D A;  3M1V B;  3V2U C;  4ILM A;  5DET A;  1Y9O A;  2C2Z B;  1NSQ A;  4M5D A;  4DFK A;  3D6M B;  2KFZ A;  4B9N A;  1U2F A;  4IQM A;  4C11 B;  4CH0 S;  1J27 A;  3GFZ A;  2EK1 A;  2LQ9 A;  3PYE A;  4CLL A;  3CDW A;  2OPS B;  2IA6 A;  2KT2 A;  1IBM F;  4R5P A;  5KFD A;  1RYS A;  5C25 A;  2E9Z A;  4P2F A;  3MED B;  4YFU A;  2VA2 A;  2A6O A;  1Q8K A;  1TFY A;  2MZJ A;  1TU0 B;  4K4U A;  4CH7 A;  1HR0 F;  1X4A A;  3D1O A;  1IJF B;  1HNW J;  4D3G A;  3GTY X;  1CQM A;  3NS5 A;  2KRB A;  4BC7 A;  1U26 A;  3THV A;  5I3P A;  3LTO A;  2F9J A;  3CCJ S;  2XMW A;  3CC7 S;  1KNZ A;  2AYM A;  4P9S A;  4P52 A;  1BD6 A;  1T3N A;  1HHQ A;  3UVJ A;  2NPF A;  3OHB A;  3LP2 B;  4K5R A;  5RUB A;  3RU0 A;  2FYX A;  5ETS A;  2E66 A;  4M5K A;  3C15 A;  4PG8 A;  3CCE S;  2M88 A;  2VOP A;  3H0P A;  1FES A;  3Q24 A;  1GXL A;  1UFW A;  4H4K A;  1N34 F;  1NDK A;  3MCM A;  8RUC A;  1HI0 P;  2BDP A;  2W9B B;  2N4C A;  2Y8Y A;  2V67 A;  1UFL A;  2XUL A;  3GG0 A;  5AJ3 J;  4PWU A;  2V4J A;  2ZM6 F;  3OXF A;  4HDG A;  2W9C A;  2FHO B;  4AUK A;  2FTR A;  4ID5 B;  3N6N A;  6FD1 A;  4EO8 A;  4F25 A;  2Z2Z A;  4C6A A;  1LFP A;  2QMW A;  1WC5 A;  5C42 A;  3O2I A;  3BYP A;  4DZD A;  4PXB A;  3MF5 A;  3IR7 B;  3KK3 B;  1D9F A;  1RQ0 A;  4CCH A;  2YWF A;  2BM1 A;  2QRR A;  3PEJ A;  1MMD A;  2DRB A;  4C8K A;  3ZNJ 1;  1VQ8 S;  3M9N B;  3B8H A;  3PO4 A;  2ZBQ A;  2C1E B;  4WTO B;  3TA2 A;  3OLB A;  2HAI A;  3KG0 A;  2DGU A;  2Z8Q A;  2FJV A;  2HHQ A;  3AT1 B;  1J5E J;  3AAW B;  3D9B A;  2VQF J;  4KBI A;  4C3K A;  2RE1 A;  3BO2 A;  5HL7 Q;  2VHG A;  2AYG A;  3DRR B;  2MMY A;  2MKJ A;  1RAG B;  1VQL S;  3IRW P;  3ELH A;  1UEV A;  2OFG X;  3DRP B;  3GZ7 A;  1W2B R;  2IBO A;  3CJK A;  5H9E K;  2FLO A;  3KLF B;  2RRB A;  2J6S A;  3D66 A;  1UVJ A;  4TLQ A;  3R27 A;  1DQA A;  1R0C B;  3PKY A;  4F4Z A;  4L6V 3;  4QWA A;  3IN5 A;  3IAM 9;  4PZV A;  4CZC A;  3AQO A;  1ICE B;  2R7V A;  5HN0 A;  5CXT A;  3QT8 A;  3B4M A;  2HUR A;  3FZ2 A;  2NYI A;  1RWK B;  3IP0 A;  2YKA A;  2X7I A;  4DR6 F;  3OXL A;  3CCV S;  3J81 U;  1WC6 A;  4NLO A;  3RGI A;  2OTJ S;  4X66 J;  3T5K A;  2QV6 A;  4P73 A;  3RB0 A;  2EFQ A;  3OD2 A;  2IIH A;  1VRT B;  1RAC B;  1SUQ B;  4YN3 B;  3IGV A;  2F8H A;  4KV8 B;  3OL9 A;  2B4U A;  2KRR A;  2ZOF A;  2I2Y A;  1TK8 A;  3MEK A;  3GJT B;  3J7A N;  2FZG B;  2CQ0 A;  2HW3 A;  1X5O A;  2R8H A;  3TR5 A;  1WD6 A;  1BMQ B;  1YJU A;  1FVQ A;  4NXN F;  3QRQ A;  5F0W A;  2C2R A;  4ECX A;  2G9O A;  3T19 A;  1G4C A;  3GR0 A;  2D69 A;  3OBI A;  4Z7C A;  5ETK A;  2VOO A;  3CF5 Q;  2PSZ A;  3W5Z A;  2HZC A;  2KZM A;  3NGS A;  2EI5 A;  4AE5 A;  3N01 A;  1Y0H A;  3HFK A;  4IDK A;  2QZ8 A;  1UVK A;  2B9E A;  1V3Z A;  2E9R X;  3J7Y I;  1U1M A;  4Q5V A;  3M1V A;  1U1L A;  1UW4 A;  4LR8 A;  4M5M A;  3DOL A;  5GMK a;  1QE1 A;  3ENW A;  4X65 F;  2DGO A;  3IXQ A;  4R8U A;  2DD8 S;  3QAT A;  2LU2 A;  3Q89 A;  2UV8 A;  2OPS A;  4FXD A;  4QBU A;  3T5J A;  3M2U A;  4JYA J;  1XN9 A;  2UUT A;  1NZA A;  2XLI A;  4DU7 A;  4KIA A;  3JTP A;  2VL1 A;  3CCS S;  1P27 B;  1VC0 A;  3PFE A;  2B4P A;  1S0O A;  3C6U B;  5LMU F;  2ZH9 A;  4RW8 B;  3Q8R B;  4F4Y A;  5L1L A;  2HVI A;  1NRK A;  1PG5 B;  2GGP A;  3MEC B;  2WAQ D;  2JNJ A;  2JEI A;  3E8O A;  2FGC A;  2NLW A;  1S97 A;  1S6O A;  2C2M B;  2V8G A;  4X2B A;  2CPD A;  2K7K A;  2EFP A;  3G6X A;  1RWV B;  5F41 A;  3NG8 A;  4HL9 A;  1LK7 A;  2IC3 B;  1HWK A;  4MYT A;  5H9F J;  2F4F A;  1DBD A;  2DYA A;  1TKD A;  3GU0 A;  1VIX A;  2L9W A;  3ISZ A;  1WSR A;  1YVF A;  4ZVO B;  1HBO A;  1PBU A;  2QE5 A;  3OJS A;  3RTV A;  3KMQ A;  1BQM B;  3IR5 B;  1I5O B;  3HF5 A;  1HBU B;  4DV1 J;  3NCP A;  2IRY A;  1UPM B;  2HBR B;  2ZEJ A;  4MFB B;  2HHH J;  1B3T A;  5BYQ A;  3Q8Q B;  1U6F A;  2VAS A;  4ILL A;  5C24 A;  3TAQ A;  4OHX A;  3KTQ A;  2XSF A;  1B0T A;  1JXV A;  4I1T A;  3M8Q A;  3K89 A;  1AZS A;  3PAC A;  1YLX A;  4I7F B;  3BO4 A;  3BH7 B;  2R8K A;  2ZJP Q;  1R7I A;  4USV A;  4WFA Q;  1XEZ A;  5D0R A;  1FFG B;  2FUG 9;  1PIL A;  2VPX B;  5EN1 A;  2G1D A;  1R0A A;  4DR2 J;  4WFX A;  1U1N A;  5J2P B;  1PJ7 A;  3BN4 A;  4ECY A;  3KHL A;  4Y28 C;  2YX1 A;  3K17 A;  3F41 A;  3PRB A;  1NHU A;  4KY3 A;  3PDN A;  3DRR A;  1GMV A;  3QFH A;  4OV6 A;  1RWW B;  2RS8 A;  5D4P A;  1HIY A;  1M5K C;  1FXR A;  4J9M A;  2XB2 D;  1S1T A;  4ZPC A;  2KYX A;  2V5H G;  5A8R B;  4OZL A;  1Y4Z B;  5HSP A;  3G9C A;  2P6T A;  1IN0 A;  4YHH F;  4V19 J;  3D1Q A;  1ZM3 A;  1JNZ B;  1Y3K A;  3KLF A;  1Q82 T;  3C8Y A;  2CQP A;  3NNH A;  2XI2 A;  3Q2T C;  4RNH A;  1RT6 B;  3E51 A;  3G6Y A;  1S1X A;  3EGN A;  1GAO A;  4ZCI A;  4ED3 A;  2UXC J;  5E3P A;  1H98 A;  1N6Q B;  2OI2 A;  2DIS A;  4DV6 F;  4UQT A;  3GON A;  2MKS A;  3G82 A;  2WTF A;  1L3U A;  1HNZ J;  2XSJ B;  2U1A A;  2B7B B;  3CJR A;  5KT3 A;  3EPI A;  3M30 A;  3QWU A;  5KG6 A;  2QYG A;  3BM7 A;  1RTD A;  3W3S A;  1PYO B;  3MFI A;  4NLP A;  4G1P A;  4OZ1 A;  2ZH7 A;  2PFD A;  2LLZ A;  4FVM A;  1DJ0 A;  1EAY C;  2P9C A;  5GVQ A;  1S9E B;  3PNI A;  3NNA A;  2MTL A;  1DTT B;  1RWM B;  4RW6 A;  1VHF A;  2YWH A;  1JJC B;  4NML A;  3JYT B;  3PYF A;  1I6J A;  3R3T A;  3Q8V A;  3R8Y A;  1SL2 A;  3M9O B;  1IKX A;  2IHR 1;  2VG7 B;  3DHX A;  4O23 A;  3VAK A;  1S4E A;  7AT1 B;  1UVM A;  3T9N A;  3FRY A;  5KFG A;  4ZVE A;  5J1P A;  2YH1 A;  1FRL A;  3PR5 B;  1DQ8 A;  5LL6 d;  5K9F A;  4MK9 A;  3CJT A;  2H5J B;  5KFS A;  2FVC A;  2GJI A;  2CYY A;  2NYH A;  3C2P A;  2HIY A;  1Q1K A;  2R42 A;  2QA1 A;  3AQP A;  1TV6 A;  3I55 S;  6AT1 B;  3ZZU A;  4YB6 A;  4NLW A;  5L1K A;  1T05 A;  2P5V A;  3SV4 A;  5IOL A;  3WC2 A;  2HK2 A;  3MUT P;  1RIS A;  1RSC A;  2YTC A;  1RTH A;  2MSS A;  3V4I A;  5IWA F;  1PKU A;  1FX2 A;  2AJ0 A;  3L3C A;  3MEC A;  1SI9 A;  1NKB A;  2YQ1 A;  4Y2K A;  3UW1 A;  1WOP A;  3IG1 A;  4LF2 A;  1FKP A;  4JV0 A;  2UXD F;  2UVW A;  3PW5 A;  3L95 X;  3U1M A;  2VFV A;  5HVG A;  1VRU A;  2BQR A;  2W2M P;  2CWK A;  2YNH B;  1CSJ A;  3ET6 A;  1WC3 A;  2WW8 A;  2UVV A;  1S77 D;  1HW9 A;  4CLP A;  3DYA A;  3IC1 A;  1QAI A;  4NZ7 A;  2YKN A;  2R8J A;  3VVU A;  1HMV B;  3TO8 A;  1YZ7 A;  4F0K A;  2W2Q P;  3H5S A;  1FDD A;  2YBV A;  1SPB P;  4RX6 A;  2X3D A;  1NJY A;  3PV8 A;  1FNX H;  4J9N A;  3GJR B;  1VQM S;  3TI0 A;  2PGC A;  2QG9 B;  2IM2 A;  2AKW B;  2V2K A;  4KHP J;  1Z4U A;  2RUG A;  4ATN A;  2E5H A;  4DR7 J;  3TX8 A;  1SKW A;  2VB6 A;  3BJY A;  4HHU A;  2C3M A;  1C0T A;  1OIA A;  1O8B A;  2ERR A;  2I38 A;  2CPF A;  2HG4 A;  3AXM A;  3CSK A;  4EBD A;  1SJR A;  4JI7 J;  2M2B A;  1K8A T;  1ZM4 A;  2APO A;  2WVB A;  1HL6 A;  3FZB A;  2XNR A;  1FKO B;  3N0V A;  2WSF C;  3BH6 B;  3EVO A;  4FF1 A;  4ZPA A;  5E3C A;  3CDU A;  2JWN A;  3KKF A;  5J2P A;  3CMQ A;  1RXO B;  2I5J B;  4AND A;  2LEC A;  3E3X A;  1N5V A;  1S9G A;  3AOA A;  1D0E A;  3W65 A;  1B7F A;  4EMD A;  2NCK L;  5GAH U;  5AE1 A;  2W4D A;  1N5S A;  3KLI A;  4K50 A;  1FJ7 A;  4EYH B;  8AT1 B;  1F60 B;  2CG4 A;  2W24 A;  1MRO A;  2CJA A;  1N36 F;  3N5F A;  2HIQ A;  2ZHB A;  4DFJ A;  5KOW A;  3DLB A;  2P8I A;  2MXY A;  1RKJ A;  4Y65 A;  2E5L J;  1RT6 A;  4I2P A;  1WDD A;  3W66 A;  3CC4 S;  4CLZ A;  4Q2L A;  1TAU A;  2HFS A;  4RU9 A;  4CO5 A;  1SJ1 A;  2PEB A;  3T5L A;  1WEY A;  5KG4 A;  5A2Q Y;  4DL4 A;  3TZY A;  1ZBT A;  4KSE B;  3CJ8 A;  1H2V Z;  1VIS A;  4DQP A;  3F73 A;  1TL1 A;  3RB6 A;  3W9H A;  1NK7 A;  1K44 A;  2CQ1 A;  3M2V B;  4E98 A;  1TUG B;  5CD4 A;  4FBU A;  4PPZ A;  1DLO B;  2RU9 A;  4X4O A;  2F4V F;  2FVQ A;  2NPI A;  1VHI A;  1SJF A;  4LF1 A;  3K58 A;  3BBC A;  4JI8 J;  5L39 A;  4DPX A;  1UKU A;  4OHV A;  4RLE A;  5B08 A;  2OEJ A;  2KFN A;  2CJX B;  1DTT A;  1V3S A;  3ZZP A;  1TKX B;  2WSC C;  5GAE U;  5CYQ B;  4X64 F;  4J9P A;  2DKO B;  5HRO B;  1XC9 A;  3HHN B;  3CJ5 A;  1HNX F;  4K4W A;  1NPP A;  5E3R A;  4ZKA A;  1U1R A;  5J1N A;  1RAD B;  3KFW X;  3PEH A;  1CJT B;  1V6H A;  2GVD B;  3RG6 A;  3MCO A;  5KG7 A;  3P8B B;  4PXE A;  2KJW A;  4J9O A;  5HVH A;  1YGY A;  2KFY A;  3TA0 A;  2CVE A;  1AFJ A;  4A8X A;  4K4Z A;  1AUS L;  1CJV A;  5DM6 Q;  1IBC B;  2FQQ B;  5IT0 A;  4PKD B;  3PM9 A;  1S1V B;  2J0X A;  4DMZ A;  3G4S S;  1N5Q A;  2DIV A;  3CCU S;  2AZ1 A;  4RKU C;  2ZH3 A;  1OQ3 A;  3QPI A;  2JHE A;  4CLU A;  2WBM A;  1T3O A;  3LO3 A;  3LW5 C;  4KPY A;  3V81 A;  1RT4 B;  1F3F A;  2ASD A;  3I5B A;  1JLF A;  2UZA A;  4QIF A;  2E1M C;  3M4X A;  1YJV A;  3Q0A A;  4HTI A;  3GJQ B;  4DR3 F;  3HJV A;  4RO0 A;  3WIU A;  4JV5 J;  4WBF A;  2E7W A;  3OFH A;  5HP1 B;  1QTN B;  4F3M A;  2W8L A;  2B6A B;  2ZOG A;  1IKY B;  5EDW A;  2HLT A;  4H4O B;  4JI3 F;  1EP4 A;  4X4T A;  1WNE A;  5HMX A;  2YNH A;  3KYL A;  4Z2X A;  2VV5 A;  4YB5 A;  4LF9 J;  4DZ6 A;  2UXB J;  3LQV A;  1C4C A;  4LF6 J;  2HFN A;  2CIM A;  3K5M A;  5IT4 A;  1VBK A;  3Q8U A;  2CPH A;  4HI2 A;  2JEF A;  2HHT A;  1L3V A;  2GAG C;  5DGA A;  1FXD A;  4TQS A;  2K06 A;  5IM0 B;  1AT1 B;  1MLA A;  4Q44 A;  1PC4 A;  4MYU A;  2L08 A;  1NJW A;  3H5X A;  3HD2 A;  5B0A A;  1Q7L B;  4ED4 A;  2HFO A;  4KPC A;  3R5J B;  4IG3 A;  4DPT A;  5L46 A;  1FEH A;  3WX4 A;  1YIJ S;  2WB4 A;  1VJQ A;  2MQO A;  3T5H A;  1M0S A;  5I4M A;  1KRP A;  1TL7 A;  3HSG A;  2ASJ A;  1LWE B;  4PUO B;  2GQ2 A;  2KXH A;  3NL0 A;  1X31 C;  1HNW F;  4IUF A;  2XMV A;  2MQM A;  2V9K A;  3DLG B;  2ZVS A;  1HNV B;  4JV1 A;  4ZHR A;  3MR6 A;  4DQS A;  3AJ1 A;  4C0H A;  3T1A A;  3I31 A;  3DDK A;  1YDL A;  4OHY A;  3GIR A;  4DJB A;  4NCA A;  1I51 B;  4K4T A;  2BAC A;  2OSQ A;  2ASY A;  3Q86 A;  2CWX A;  4DSJ A;  3OVB A;  2VQE F;  2BJE A;  3AY0 A;  2W7O A;  3CJS A;  1JLQ B;  4USU A;  2CZ9 A;  1UMJ A;  1HBN B;  3PTW A;  1SQF A;  5CA5 A;  3C46 A;  1I94 J;  4L3N A;  2NXU A;  1YTY A;  1HI1 A;  5C5J A;  1URR A;  1TK0 A;  3A4T A;  4QWC A;  3KK1 B;  2GO8 A;  3RB3 A;  3AOC A;  1N32 J;  3AD9 C;  3R5B A;  5KG1 A;  1CS4 A;  2CKW A;  5AXM A;  4G1Q B;  3SXL A;  3DLK B;  4OI6 A;  1L3K A;  5FLX Y;  1A7G E;  4I68 A;  1NSA A;  4LSZ B;  3SSS A;  2CZ4 A;  2AP6 A;  4P72 A;  3DHW C;  5KG0 A;  2GQC A;  4OI3 A;  4A48 A;  3K8V A;  1IM4 A;  4PAA A;  2HGM A;  2CZV C;  3HO1 A;  3KJV A;  4QWB A;  2ZWP A;  4TQR A;  4USW A;  2J8S A;  5B09 A;  5F8I A;  1X4F A;  1JLE B;  2VDH A;  2BYC A;  1Q5V A;  5L1J A;  5E3Q A;  1FDB A;  1IKV A;  2K2P A;  4ZLL A;  3MM9 A;  2VQF F;  1BQN B;  5ETL A;  1Q16 B;  4NLR A;  4U7U K;  1KTQ A;  4Q8F A;  5LSR A;  1UVL A;  1FDN A;  1UET A;  5CH7 B;  2CUY A;  2IMW P;  1KSP A;  5F3Z A;  3VZI A;  2EFG A;  1U1K A;  2ZBC A;  3J80 U;  1EZZ B;  3MTK A;  4WJB A;  3KLH B;  2RHQ B;  3LGN A;  5HLF A;  3H90 A;  3NXZ A;  3PFO A;  4K5S A;  4C98 A;  5AE2 A;  3ZTS A;  1ITP A;  3H42 A;  1KHW A;  4WWS A;  3CD0 A;  1UZH A;  3TVY A;  4F26 A;  3CCT A;  1YWX A;  3G86 A;  4J37 A;  5K14 A;  2XTJ P;  2J9C A;  1H2U X;  5IC4 B;  2FDN A;  1K47 A;  2IAJ A;  1V5V A;  1ZTT A;  2ALY B;  2CQG A;  1WKK A;  5KFN A;  1YKW A;  3JAM U;  1JX4 A;  4A8F A;  4MH8 A;  5D6G A;  1FD8 A;  1N0U A;  4XPC A;  4O3Q A;  4J9K A;  2Y1R I;  5JMN A;  3ULH A;  3ENQ A;  2U2F A;  4NRU A;  3TX0 A;  2VFR A;  1IBM J;  3CNQ P;  4F4X A;  4FYW B;  4TY9 A;  4BBY A;  1S6Q B;  1HFE L;  4B08 A;  1VQK S;  2K3K A;  1ZET A;  2DEJ A;  2B6A A;  4WP8 A;  1HR0 J;  2ADC A;  2IYG A;  3DLH A;  1KTV A;  2FHK A;  5A76 A;  4IYQ A;  1G3O A;  2XWY A;  1NB2 A;  1S6U A;  3G6E S;  3K0J A;  2FJA B;  4KHR A;  2XO6 A;  3DKD A;  3CC2 S;  3RBZ A;  3D6H B;  3FSY A;  2HBZ B;  3QBC A;  2OPR A;  1GXU A;  1OY9 A;  4P2S A;  1KFS A;  4CLY A;  5D4L A;  1NH7 A;  1VIO A;  2BE2 B;  1SJ4 P;  2HVD A;  3E01 A;  2RUS A;  1DZ5 A;  4RL1 A;  1N34 J;  2H65 B;  4F67 A;  5F8H A;  2QN6 B;  5DDQ C;  4KT0 C;  4DG1 B;  3W61 A;  4MKA A;  4RW9 A;  1XQI A;  4ZJQ A;  4O3P A;  2OD6 A;  2ZM6 J;  4YDX A;  2VA3 A;  2Y1I A;  3FK4 A;  4F8R A;  3KJF B;  2HND A;  3O8W A;  4NLX A;  2HHS A;  3ITH B;  3TA1 A;  1O5J A;  2CXE A;  3OTC A;  4LF5 F;  4R0E A;  2V8P A;  3LP1 B;  3BF4 A;  4L76 A;  5H9F K;  4ICL B;  2AIR B;  4IH6 A;  1OY8 A;  3NOC A;  2J76 E;  4NXM F;  3MM8 A;  1LWF A;  4V1A k;  2B8P A;  4QIV A;  3P96 A;  1KQG B;  1JLA A;  3CD7 A;  3HHE A;  1Q8L A;  1CC8 A;  2PA3 A;  2X51 A;  1S99 A;  1S57 A;  5K8N A;  2DT9 A;  5D3G B;  3GQC A;  4IH5 A;  2HFU A;  5I42 A;  4H4M B;  2ROG A;  1YRU A;  3MEG A;  5KOX A;  1SV5 A;  5K20 B;  1MU2 A;  2XM3 A;  3TQ1 A;  3RRK A;  4DV1 F;  1RT7 A;  1FRJ A;  2F8E X;  4OYB A;  1LW0 B;  4G1Q A;  2PA8 D;  4DUY F;  1RBL A;  3MMA A;  1LW2 A;  2N4D A;  2FLL A;  2Y8W A;  2LCW A;  4J9Q A;  4FS1 A;  3DLK A;  1U8W A;  2IVY A;  3MPU B;  2VFS A;  1WHV A;  2OGU A;  2FIU A;  3HT3 A;  3HHL C;  3IGN A;  3JQM A;  4TU8 A;  2GX8 A;  4M5I A;  2RS2 A;  4HAC A;  3TUZ C;  1FE4 A;  1YRX A;  3MR5 A;  5F9N A;  4K2X A;  5J2Q B;  1JLB A;  3A3N B;  3MPD A;  3SIP B;  4QR1 A;  4RBV A;  1KVJ A;  2AX0 A;  2R8G A;  1SIW B;  1NK4 A;  1VQP S;  1JLE A;  1IQT A;  5CYM A;  2Q3P A;  2OMO A;  2NSC A;  3GB0 A;  3ETM A;  3BKF A;  2N3O A;  5J2M A;  2R7T A;  2VIC A;  2ZZN A;  2E7V A;  3EX7 B;  2DJW A;  4QWD A;  5KFV A;  3IFE A;  1BQN A;  3HX9 A;  3AB4 B;  2Y0S D;  3PZP A;  1KBR A;  4ECQ A;  3TJA A;  4P74 A;  1JJH A;  1T9U A;  3N79 A;  2DGV A;  2CAJ A;  2OLW A;  3PR4 A;  3K5N A;  1KVI A;  2BJ8 A;  2GIQ A;  4WF9 Q;  2HRU A;  1RHR B;  3HM9 A;  1NO8 A;  2OIH A;  2V6A A;  3CE8 A;  3H98 A;  4NZ0 A;  4RWW A;  3OFE A;  3PX4 A;  4K4Y A;  4UF4 A;  2DCL A;  5T7L B;  4LFA F;  4GVB B;  4NXN J;  4CNY A;  1RAJ A;  2HYI B;  3I56 S;  4FDF A;  4DPU A;  4K4X A;  3BV8 A;  1RT1 B;  4FNI A;  3UE2 A;  4OI1 A;  4OLP A;  4P2M A;  1TUV A;  2O1P A;  2YQ0 A;  2L48 A;  2KXF A;  1Y10 A;  5DG7 A;  2CA9 A;  3OR2 A;  4RNF A;  2KB2 A;  1HA1 A;  3M6U A;  3OFG A;  2DXF A;  2V8D A;  2ASL A;  4FYX B;  4P71 A;  3PW2 A;  3L4B C;  4X65 J;  3NBP A;  1PJ6 A;  3OL7 A;  4YB1 P;  2J9D E;  2VBY A;  4DX6 A;  2D9P A;  1RU1 A;  2PMH A;  3DM2 A;  4KH0 B;  4P75 A;  4YUD A;  3DDN A;  1RCO B;  1RTI B;  2DY1 A;  4WE1 B;  1ULR A;  4HEA 9;  1S6P B;  4AT1 B;  3SV3 A;  1UTA A;  3AFG A;  2BV3 A;  4DXL A;  2KHD A;  4WFB Q;  5LMU J;  2FVS A;  3W2V A;  2RDJ A;  2IDL A;  2YNI B;  4X84 A;  2XS2 A;  1FE0 A;  4NLS A;  5L9N A;  1XBW A;  1M5H A;  1APS A;  2H51 B;  2L9N A;  3QIP B;  5THW A;  4RUH A;  2BJD A;  2CJY B;  2WOM A;  3NWG A;  4AL5 A;  2B3T B;  4DV3 J;  4IH7 A;  4KB7 A;  5F8L A;  4DV5 F;  2FD2 A;  1OWX A;  4CP5 A;  4U8Y A;  1VQN S;  1BY9 A;  1JLG B;  4P10 A;  5J1E A;  2DEI A;  1FWP A;  3POT A;  1C0U A;  3MMB A;  4LBH A;  2AYE A;  3H59 A;  2HQ3 A;  4NA1 A;  2FGO A;  3SCK E;  3FDS A;  4FXV A;  2XMA A;  3V6H A;  1RTJ B;  3KXD A;  4PG7 A;  1VQO S;  3QLH B;  3SCJ E;  2C3U A;  4Y00 A;  3IS9 B;  1N56 A;  4EWT A;  1HWL A;  4FS2 A;  1U45 A;  2NRE A;  3C6T B;  2XYP B;  2HMI B;  2LQJ A;  1NKC A;  2KVQ E;  2M70 A;  3NEK A;  3PX0 A;  3EPG A;  1M5S A;  4J91 A;  2FY1 A;  5J2N A;  3JSB A;  2IM3 A;  1U6B A;  3D28 A;  4EGL A;  1KDN A;  2DHS A;  2C22 A;  4DR4 F;  2QMU B;  1T9Y A;  1H7X A;  4NLG A;  1VMB A;  2H48 B;  3MR7 A;  4IO1 A;  4DPW A;  4JV2 A;  4IFY B;  5D3G A;  2HK3 A;  2P2C B;  3ILL A;  4Q7A A;  3I0S B;  4DEZ A;  1EX8 A;  3PYD A;  4NYP A;  9ATC B;  2OH2 A;  4RUA A;  2XMU A;  5LSO A;  3R7B B;  1HYS A;  4ZCK A;  4HDH A;  2XCA A;  4JI6 F;  3NGT A;  4O3R A;  1F3V A;  5KFI A;  4KHP F;  1QSY A;  3RZA A;  4C0O C;  1LWX A;  3KLG B;  2AEJ A;  2XMM A;  2IMO A;  4M63 A;  4NLT A;  4XO0 A;  1KFD A;  3LP0 A;  1UWB B;  1R0B G;  2DH7 A;  1HHT P;  2DR8 A;  3A8I A;  2F3J A;  2BAN A;  5DG9 A;  4P7V A;  4W98 A;  1PGZ A;  4JI7 F;  2FLP A;  3JSY A;  1EKS A;  5KFE A;  3NWR A;  5D15 A;  4DR1 F;  3DLE A;  2CG8 A;  5KTQ A;  3NP5 A;  3WDO A;  4DV6 J;  3SQG B;  3HFZ B;  3V6K A;  1UAW A;  2RQM A;  2F1F A;  4CYU B;  2BQ3 A;  3L9Z A;  3I9V 9;  4YQW A;  3US5 A;  1Q78 A;  3I0R A;  3ZFV A;  1S0V A;  1RCX B;  2XG8 A;  5HMY A;  2XWX A;  1HWJ A;  2ZD1 A;  4OI0 A;  2JOQ A;  2Z4P A;  5E5N A;  3KLE A;  4LRB A;  2WHO A;  4WII A;  3HDS A;  3Q2S C;  3A12 A;  1C4A A;  4RW7 A;  4YEA A;  4YME A;  2CPZ A;  1RT2 B;  4L75 A;  1UJ5 A;  4OYM A;  4OZN A;  3OUY B;  4A4J A;  2OFH X;  2VG6 B;  1VQ7 S;  1GTH A;  2I9S A;  4CTA B;  4WTY A;  2OHD A;  4WIQ A;  3GIM A;  1UVN A;  2A18 A;  2H54 B;  3IWX A;  4LQ3 A;  1NUE A;  1SH2 A;  1UCN A;  2LP4 A;  1RHK B;  4DCJ B;  1Q8I A;  2GMJ A;  2ROE A;  1XMB A;  3J81 Y;  3H7H B;  4PWD B;  3GCW P;  2MGZ B;  1WF0 A;  4MKV A;  4F04 B;  4KR0 B;  4ZVU B;  3NAH A;  3VAM A;  5KT2 A;  4ECV A;  2HS3 A;  4XAK A;  3FMW A;  2AJ2 A;  1TVR B;  3ZTQ A;  3CJ2 A;  3T3F A;  1MG7 A;  2XYH B;  3JSM A;  2DNH A;  4O44 A;  2VFU A;  3TUP A;  1GK8 A;  1FK9 A;  2Q79 A;  3R6L B;  3CWJ A;  2QGF B;  2O3D A;  1LOU A;  5HQ8 A;  4DUZ F;  4X4V A;  1VQ9 S;  2J0S D;  2MLX A;  2GS8 A;  3U1N A;  2MLZ A;  3GV7 B;  4FF3 A;  5I3U A;  4ZS6 A;  1Q8B A;  4Z37 A;  4OYP A;  1K1S A;  1RI7 A;  4G3I A;  2JFK A;  4F7V A;  5IWA J;  2YNG A;  2POK A;  3M6W A;  4DDF A;  5DQI A;  4YY3 J;  1E6V B;  1RWU A;  3MDF A;  4Q45 A;  2Z2L A;  2ZDO A;  4LVO P;  3LOU A;  3QIP A;  1YJ9 S;  2Y0B B;  3RAX A;  2JSX A;  2CFX A;  3S8S A;  3QFW A;  2OML A;  3HI9 A;  3D0G E;  3KG4 A;  3QRR A;  2FJB B;  2XMT A;  2OUG A;  1U0H A;  5E2Q A;  1XMQ J;  1EIY B;  3TZX A;  1BQX A;  2XGP A;  4UST A;  2N82 B;  1YRT A;  3EDR B;  4JI0 F;  2MEW A;  2QO3 A;  4N47 A;  3N9U C;  4ED5 A;  4TN2 A;  1VJW A;  3MM6 B;  4M1K A;  2BKP A;  2HNZ A;  3IMQ J;  1Y5N B;  3OTE A;  3KWM A;  2GA7 A;  1VLO A;  2ALZ A;  2EBE A;  2BQU A;  4M5D B;  3TAP A;  1J2V A;  1K0V A;  1RUS A;  8ATC B;  5FII A;  5ETQ A;  1N5Y A;  2L3M A;  4R5P B;  3H40 A;  4QU6 A;  4JV5 F;  5C25 B;  4DSE A;  3NGR A;  2LQ5 A;  1F9H A;  2A2D A;  2C3P A;  1X9S A;  5H1S V;  2IM0 A;  4B17 A;  1YJ7 A;  2AHO B;  1X5P A;  1TL3 A;  4O4G A;  1S72 S;  4MAK A;  4AFF A;  3B82 A;  2ZH8 A;  4CQ1 A;  2W2P P;  4JI5 F;  4A46 A;  3MM7 A;  2LMI A;  3WBZ A;  1SC6 A;  3C16 A;  4DOZ A;  2Q66 A;  5A0Y A;  1V3R A;  1KR4 A;  3CDA A;  5GME A;  3NGK A;  3AJD A;  4I2Q A;  2UXB F;  2JL9 A;  1AW0 A;  2GJF A;  4NCG A;  3UVJ B;  1U09 A;  3CUL A;  1F9E B;  4ERD A;  1DTQ A;  2QL9 B;  3G8Q A;  2DGS A;  2W01 A;  2DHH A;  3R7N B;  2WW4 A;  1HWU A;  1QUP A;  2J6U A;  3OFF A;  4DBQ A;  1C1C A;  2CDQ A;  4DN0 A;  4AXJ A;  1RKI A;  1QM9 A;  3AHP A;  4C3M A;  3MAQ A;  2Z57 B;  2BUN A;  4YR0 A;  2Q43 A;  2UUA F;  2V4J B;  2OPQ A;  2W9C B;  2UVR A;  4K2J A;  2EW9 A;  2OP5 A;  4KGK A;  4LBP A;  3CCL S;  1EAR A;  1MWY A;  1VDH A;  2P6S A;  3N28 A;  2RF2 A;  1Q4R A;  2DO4 A;  5C42 B;  3MMJ A;  3M05 A;  4ZVR B;  3TAM A;  3FCV A;  3MCN A;  2UU9 F;  2FPH X;  5FDL B;  4IKA A;  3LPY A;  4KFB A;  2PFF B;  2EEY A;  1IKW A;  3W7B A;  2C2O B;  1ZTW A;  1HQU B;  2F40 A;  2YKP A;  2CQ3 A;  2B9X A;  1ZZF A;  3R97 A;  2DNK A;  1NB7 A;  4GVL A;  4ECT A;  4OYI A;  3CDE A;  2DXD A;  2F4V J;  5ETO A;  4CIO A;  2DNQ A;  2JFD A;  2SXL A;  5DQG A;  4ANE A;  2B4O A;  4QYZ J;  1T7P A;  2ZVI A;  3CME S;  2RML A;  4AL7 A;  2C2D A;  4X64 J;  3W9I A;  3ZTO A;  3A3O B;  4NI2 A;  2A3J A;  1WAC A;  3NOG A;  2OPP A;  1LWC A;  3FFI B;  3QSI A;  1NDC A;  1UA0 A;  2EVZ A;  3SSQ A;  3DC2 A;  4B3R F;  3EVW A;  1Z1Z A;  4I64 A;  4PWD A;  3CJK B;  1QVG R;  1NEE A;  2C3O A;  4F3Q A;  1RDR A;  4NEY A;  1IVZ A;  2VUG A;  2UV8 G;  3SSR A;  1YJT A;  4RW4 A;  3SI8 A;  4DPY A;  1FD2 A;  4PPD A;  5EUH A;  2VDI A;  3G96 A;  3R5D A;  3K5P A;  1NZ8 A;  1PCA A;  5D0H A;  5DQH A;  3GV5 B;  3MD1 A;  3BO3 A;  1SVD A;  2BRL A;  1IBL F;  3DMJ A;  3N5B A;  5BJR A;  4K4S A;  3KHR A;  4LF7 F;  2AJ1 A;  1RHJ B;  4DR3 J;  1AB8 A;  3RR7 A;  5A6P A;  1IUJ A;  2GHP A;  1VBX A;  1P1T A;  4ED6 A;  1K0T A;  2HHX A;  5BR8 F;  3VVT A;  1BE4 A;  4ELU A;  2HWI A;  4ZVP B;  3S6E A;  1HQE A;  4JI3 J;  3PRD A;  1UVI A;  2KM8 C;  3TRG A;  1KQF B;  2DNL A;  4UZB A;  3GE9 A;  3OLA A;  3FBF A;  2EG2 A;  4PWW A;  4R0J A;  4JBC A;  1Q86 T;  2N7Y A;  4C8Z A;  2FLN A;  4IDK B;  2YNF A;  5L8R C;  1F9F A;  3VAH A;  3GSI A;  2NZC A;  3UWT A;  1SB6 A;  4DL0 C;  3HHL D;  3J7Z T;  3P6Y C;  3HVT A;  3THT A;  2RQK A;  4DV0 J;  2JEG A;  3DOL B;  4OZ0 A;  2WBR A;  1QE1 B;  2BE7 D;  3G8T A;  2E44 A;  4I6A A;  1X7V A;  3NGU A;  2R7W A;  2M7S A;  4R8U B;  1D3W A;  3VGU A;  3EZ5 A;  1W25 A;  1L3T A;  3VZH A;  2UUB J;  2GZO A;  3M2U B;  5SUH A;  4RNN A;  3KOA A;  3T1H J;  2XZT B;  2X3G A;  4ZDN A;  3CJ4 A;  3V6D A;  5CZV A;  2MHE A;  4B9V A;  2V8H A;  4EK2 A;  1WWH A;  4DPO A;  3FEY B;  5AT1 B;  4ED2 A;  1X0F A;  4W92 B;  3HK2 A;  2GGP B;  3OT9 A;  3HHL A;  1KWM A;  1PSD A;  1CJK A;  1RAO A;  2G0C A;  4F4W A;  1M90 T;  2RH3 A;  4ZMM A;  1NK5 A;  4KO0 A;  2NS1 B;  2QT7 A;  1B0P A;  5CZX A;  2VQE J;  4OZ3 A;  3ISN C;  3Q8Y A;  1BLU A;  3T1Y F;  1HNI A;  1HBO B;  1TUW A;  4B02 A;  2IRU A;  4LSL A;  2LDY A;  4F0H A;  4QW9 A;  2LA6 A;  1HQ2 A;  2IJN A;  3NMA A;  4DSF A;  2DNO A;  5KFJ A;  3H4B A;  3I5A A;  1H0H B;  5A2Q U;  2QLX A;  3HKZ D;  1IWA A;  2JRS A;  5C24 B;  3BDP A;  2V50 A;  4UOH A;  3UCU P;  4PR6 A;  2DCU B;  4ALZ A;  2J7K A;  1VOM A;  2N7C A;  5DO2 A;  1WKL A;  5FDL A;  3M8Q B;  2QJ3 A;  1WOS A;  4C9D A;  4FN5 A;  2IDE A;  5DDR C;  4QIG A;  2AGQ A;  5GAD U;  1HQU A;  4NAS A;  3PJ9 A;  1AZS B;  2WVE A;  2ZC4 A;  2LEA A;  3G87 A;  3SQO P;  5D4O A;  2PN6 A;  4C97 A;  4ZP8 A;  1XR7 A;  4DF8 A;  4RWX A;  4ES2 A;  1R0A B;  3NRB A;  4LQ9 A;  1PJ5 A;  3DFE A;  3TW0 A;  2AEF A;  2HLU A;  3LAN A;  4S0M A;  3R7S B;  4E0D A;  1R31 A;  2R3V A;  2BZ2 A;  1PAE X;  2HBQ B;  3D68 A;  3OR1 A;  3FFI A;  5B0B A;  1S1T B;  2FJX A;  4O3N A;  4ZVG A;  4ZP6 A;  2HRT A;  4OJH A;  1QSS A;  4IRK A;  1WI6 A;  3L7O A;  4MJK A;  4C8N A;  1VYA A;  4B3M J;  3I32 A;  3I4P A;  4CLK A;  2MPU A;  1HPZ A;  3UNG C;  2ZBI A;  2H9Z A;  2CPI A;  1YZ6 A;  1WTF A;  5G0R A;  1SKR A;  1WJ9 A;  1S1X B;  2HEK A;  3RAM A;  3EMT A;  2DGQ A;  3NGD A;  4AL6 A;  3M2R A;  2B0G A;  2E9T A;  2DNP A;  1DQ9 A;  2BKO A;  1A0O B;  3G82 B;  1B70 B;  4DWI A;  1XJW B;  2JLG A;  3M30 B;  3DOK A;  1RTD B;  2HNY A;  4LJM A;  3BPD A;  4UTG A;  3Q8P B;  4YR2 A;  1LK5 A;  2DNR A;  3CIZ A;  1S9F A;  3CTR A;  1RT5 A;  4UOF A;  4RW6 B;  3CD6 S;  3HSD A;  2FVR A;  5KFH A;  1I3O B;  4NLQ A;  1KN6 A;  5IV3 A;  3K5O A;  4QJV A;  4PG4 A;  2K8G A;  5DJB A;  5KFP A;  4ETZ A;  3CJQ A;  1IKX B;  4OYX A;  4U7C A;  1JMT A;  5M2U A;  1D9A A;  1B99 A;  1U1P A;  5KFY A;  4M5H A;  1V5I B;  3DGV A;  1IBK F;  2GML A;  3LWM A;  3GCX P;  2KI2 A;  1PBA A;  5GAG U;  3LPE A;  1BC6 A;  2L9D A;  3T6J A;  3KK2 B;  1S1U B;  5KFZ A;  1YBT A;  3VGS A;  5B0E A;  3ICL A;  1RAH B;  2D41 A;  1SQG A;  4I0W A;  4PQU A;  3GFX A;  2NZ4 A;  1TV6 B;  3QWP A;  4CO0 A;  2HQI A;  4JI1 J;  4XIU A;  1C1B A;  2KXN B;  2RIJ A;  3DI6 B;  1NM2 A;  1YX2 A;  1T05 B;  3GG1 A;  5KG2 A;  4C8O A;  4YDD B;  3SDE A;  1MWQ A;  1RAF B;  1L5U A;  2UUC F;  4FPI A;  2K1R A;  4CO3 A;  2QSW A;  2GIR A;  3ILI A;  2CPE A;  1NHV A;  3V4I B;  1RTH B;  3NAI A;  3D0H E;  1QD1 A;  1VLY A;  2J0Q D;  3CDB A;  3U1L A;  2JH3 A;  4LF5 J;  4MIA A;  1QAJ A;  4K4V A;  5DZ7 A;  2CJB A;  3H2L A;  3CJ3 A;  2IBK A;  1UJ4 A;  2RB7 A;  2QFJ A;  4B3O A;  4NXM J;  3C66 A;  2VF3 A;  3QGP A;  3IG1 B;  1FKP B;  3DU5 A;  4RUC A;  1BGX T;  4DV3 F;  4DQI A;  1VRU B;  1GTE A;  5L1I A;  4ED7 A;  1CUL A;  5DGB A;  4CH1 A;  2YKM A;  2NUH A;  3ET6 B;  1JLC A;  1WC1 A;  4JI4 F;  2J5A A;  5KFK A;  4OJ3 A;  2DR6 A;  4N8N A;  4CRJ A;  3FBB A;  3DYA B;  5HJY A;  2G2Y A;  2YKN B;  5EX3 A;  4Q0B A;  3MOZ A;  4AXI A;  1XR6 A;  2C2N A;  3MPW A;  5FLX U;  4P7T A;  4IFV A;  3QQC D;  4DUY J;  4G1I A;  3UR0 A;  2IYI A;  2BA9 A;  1G7C B;  1T9T A;  5IT9 U;  5HVF A;  2JJ4 D; 
#chains in the Genus database with same CATH homology
 1N34 J;  4K0K J;  4X66 J;  4DV1 J;  1IBL J;  4HHU A;  4LF9 J;  2KVQ E;  3W1Y C;  1J5E J;  4DR4 J;  2UXB J;  1XMQ J;  4JYA J;  2HHH J;  2VQF J;  4LF6 J;  4LF7 J;  5LMU J;  2ZM6 J;  2F4V J;  4LF5 J;  4YHH J;  4JI7 J;  4NXN J;  1XMO J;  2UUB J;  4KYZ A;  4NEZ A;  4DV5 J;  1I94 J;  2MEW A;  4DV4 J;  1IBM J;  2UUA J;  1IBK J;  1XNR J;  3D3B J;  2UXD J;  5A2Q U;  4DV6 J;  5BR8 J;  3T1H J;  3J7A N;  4LFC J;  4DUZ J;  4OX9 J;  4JI4 J;  4NXM J;  4B3M J;  5AJ3 J;  3IMQ J;  4GKK J;  1N32 J;  4B3R J;  4LF8 J;  3J80 U;  4DR3 J;  4DR5 J;  4X64 J;  1HR0 J;  4JI8 J;  2UXC J;  4DV3 J;  4RJV A;  5LM7 E;  4JI6 J;  4DV7 J;  4GKJ J;  4LFB J;  1HNZ J;  2UU9 J;  4V1A k;  3D3C J;  4JI5 J;  4JI3 J;  1N33 J;  4JV5 J;  4X65 J;  4DR2 J;  3R2C J;  4LF4 J;  1FJG J;  4DV2 J;  3T1Y J;  2UUC J;  4B3S J;  1HNX J;  1HNW J;  1N36 J;  4B3T J;  5IWA J;  5FLX U;  4PWW A;  4X62 J;  4NEY A;  4YY3 J;  5LMN J;  2KL8 A;  4JI2 J;  1XNQ J;  4DUY J;  4JI1 J;  3OTO J;  3R2D J;  4KHP J;  4AQY J;  3JAM U;  2MQ8 A;  5IT9 U;  2E5L J;  2VQE J;  4KY3 A;  2MTL A;  4LFA J;  3J81 U;  4DR7 J;  4JI0 J;  4DR6 J;  4DV0 J;  4DR1 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...