2UU9J

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gug-codon in the a-site and paromomycin.
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
98
structure length
98
Chain Sequence
b'KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RRNA
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
molecule tags Ribosome
total genus 10
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 2uu9J00
3IMQJ 4KYZA 1FJGJ 3T1HJ 4LF6J 4KHPJ 4YHHJ 3JAMU 1HNZJ 4LFBJ 2KL8A 3J81U 2F4VJ 4DR4J 1XNRJ 4JYAJ 4LFAJ 1N32J 4K0KJ 1HNWJ 2UXCJ 4B3TJ 4JI0J 1N34J 4NXMJ 1IBLJ 4DV7J 4DR1J 3D3BJ 4LF5J 3J80U 4LF4J 4RJVA 2UUBJ 2HHHJ 3W1YC 1IBMJ 5IWAJ 4X65J 4B3MJ 4B3RJ 2UUAJ 4LFCJ 5LMNJ 4JI3J 4JI8J 2MTLA 2VQFJ 2UUCJ 4DV0J 1IBKJ 2UXBJ 3R2CJ 3J7AN 4DR2J 1XNQJ 4NEZA 1HR0J 4DUZJ 3OTOJ 5LMUJ 4JI6J 4OX9J 4HHUA 2E5LJ 4DR7J 4GKKJ 4B3SJ 1I94J 4LF8J 4X66J 4JI4J 4DV3J 5AJ3J 4NXNJ 4JI5J 4DR6J 2VQEJ 4YY3J 4DV1J 4DV4J 1HNXJ 4DV6J 2MEWA 5IT9U 5A2QU 4NEYA 4LF9J 3D3CJ 1N36J 2UU9J 4V1Ak 3R2DJ 2KVQE 4DR3J 4JI7J 4DV2J 2ZM6J 4DUYJ 4AQYJ 4X62J 4JV5J 2UXDJ 4JI1J 4KY3A 5LM7E 5BR8J 1N33J 3T1YJ 4DV5J 4PWWA 4JI2J 4X64J 4LF7J 1XMOJ 4DR5J 1XMQJ 5FLXU 1J5EJ 4GKJJ 2MQ8A
chains in the Genus database with same CATH superfamily
1XR6A 3VGTA 1J27A 4HT5A 5AXKA 2IDLA 4PG6A 4Q0BA 3MM7B 3SDEA 4J9QA 2GHPA 2BYCA 2QLFB 3N6LA 4Y28C 2DITA 1SL0A 4CO2A 4F4XA 2B6AB 2AJ4A 4YUDA 3MM7A 1XIQA 4KB7A 5F41A 3T1AA 1Q79A 2UVWA 4CNYA 1M5VC 3H25A 3KLGA 3SCKE 2KXHA 1FWPA 4DQRA 3TJ9A 2H1YA 4QBUA 2CZ9A 2YX1A 4O4RA 1R43A 1VBKA 3V4IB 2NUUG 1HNZF 2VG5A 4ZLNA 1VQSA 3H5YA 1R0CB 3EICA 3VQSA 3CC7S 4PZVA 1RGVA 3TZZA 2UV8A 3KLEB 4X62J 1N88A 1WJ9A 2JLGA 2RH3A 1RDRA 2HNDB 4C98A 1DTTB 4ECVA 1X5TA 1Y11A 2YH0A 1H2TZ 2RE1A 1ELOA 2XSFA 3MMCA 1KQSR 3EVOA 5JVHQ 4YN3B 1P9YA 2UUAF 2C2ZB 1KQFB 4C11A 3PRBA 4O3RA 4YS2A 1N34J 3HZEA 1XQIA 1DY3A 1M1KT 1B0VA 1EQ0A 2HHHJ 2QC3A 5KAKA 4RW6B 1KKHA 1RA7A 4H4KA 4DV4F 2HWIA 4OZ5A 4IH7A 5D4LA 2XMKA 5A0YB 4EBEA 2P6TA 4Y34A 1QTNB 4ZVHA 2CPJA 4YR3A 4EBDA 1HNWF 5B0BA 5C24B 2EEYA 3GJQB 3R7BB 5KT6A 2AJFE 2W2NP 1FJCA 4KHRA 4C8YA 2APOA 4BWJA 4PWDA 3CULA 4AQYJ 4IG3A 5A76A 2ASJA 3FJ2A 1AYEA 3ZNJ1 3CMES 4WKYA 1D9AA 3NMRA 1UCNA 3I5AA 2EVZA 1TV6B 2RUSA 3IGNA 3OTCA 4JI4F 2OELA 1NUEA 4TQRA 4LQ3A 4ECTA 1LV5A 4DFJA 4JV2A 3M9NB 3TWZA 1ZPVA 2KZMA 1ZH5A 1Z2LA 1IBMJ 1AROP 2G0IA 4X65J 2W2QP 1RWUA 1FNXH 5EUHA 1YJ9S 4MT1A 5LSRA 1EKRA 1BD6A 1FNMA 2FVQA 2DNKA 4J90A 2VZ9A 1HBOB 2YTCA 1VJWA 4IYQA 1Q53A 5CQGA 1RT1B 2KM8B 1VQKS 2WVFA 4WF9Q 3HX9A 3T6BA 4FYVB 3ZFVA 1YJWS 3D5MA 5ETSA 2Y9HA 4CH7A 5SUHA 5E7OB 1AT1B 4N77A 4DSKA 4E0DA 3OD2A 2E9TA 3G9CA 2RDIA 4O3NA 4A8MP 2VU5A 1RTIB 2MKJA 3D68A 1QUVA 2JVOA 3GFHA 4PUOA 2V8HA 2LDIA 2BE9B 4JI6F 2HG4A 2VBZA 4DQSA 3PV8A 2C2OB 1TKTA 3KDNA 4J9UE 4JI5F 5HLFA 1NPRA 2HZVA 5KFZA 3WC0A 5JUMA 3CJ5A 1XR7A 4EU0A 5CD4A 1NLKL 4DUYF 4X66F 3PX6A 2BANA 3N28A 1RT6B 3GSIA 5DGAA 4IUFA 2HRTA 1X8DA 4HH1A 2W9BA 3MEDA 4ED8A 4J7CA 3W3SA 1R8AA 1S1WA 2VBYA 3OSNA 4YEAA 1IKWA 3K5PA 1UJ5A 2YVSA 3CW2C 5T7LB 3GR1A 1H2UX 1KTVA 3GCXP 4PCQA 3GYNA 1U1KA 3WC2A 5LXRA 3M4XA 4O4GB 4ZPCA 2YPZA 2HHSA 3EZOA 2HVZA 1VCTA 3J7Z5 3NKYA 2J0WA 3C14B 2E7VA 1EETB 4O4GA 5F0WA 3I9ZA 1NB2A 1XMQJ 4Y3CA 1OSCA 4U96A 4A8SA 2XHWA 4DL3A 3K57A 3QRPA 3N5BA 4ID5A 1YK9A 2VPWB 1W2BR 2AEMA 3C14A 4DZDA 2FY1A 1EETA 1OPIA 1WC6A 2UP1A 4DOZA 4K4XA 3CJ3A 2MQMA 2OTLS 3BQ0A 3I55S 3PO4A 1ICEB 2C42A 1ZS6A 1FTRA 3I0RB 4IR9A 2RQCA 2RS2A 2M2BA 3KLFA 3AQOA 1YJNS 2XWYA 1F1BB 2NYHA 1X4DA 4JI1F 2XB2D 2YQ0A 2FHKA 4R8UB 3BBCA 5EHHA 1NSQA 4ETXA 5KFUA 2ZH9A 1FESA 1NK9A 2DCLA 2W7AA 3VWSA 2VKZG 1IKVA 4R8UA 4WFNQ 3WIUA 2HMIB 3IG1A 4K4SA 4QJVA 3CJRA 1MU2B 5KFYA 4AFFA 2IY5B 2MY7A 4BC7A 2QLBB 2JL9A 1JLFB 5KFVA 2H48B 3CJ2A 5BYSA 4NCBA 3MECB 2MDAA 4DUZF 4E98A 1TK5A 1FJ7A 4ETZA 3Q2TC 1BUXA 1SJ1A 1CG2A 3DDKA 4F26A 1U47A 2DYAA 4JYAJ 4LFAJ 1B3TA 3UVJA 1FRXA 2KFYA 2OSRA 4KV8B 3GP9A 3M8QA 3B4MA 2ZVIA 4C3KA 3VGVA 2YXLA 4JI7F 4ZS6A 4G6VB 2EK6A 3DM2A 3V6DB 1IR2A 4CNZA 4KV8A 2JC1A 3TA1A 3MURP 2C1EB 2R7RA 2JEIA 1IWGA 2EWHA 2B4UA 2XQCA 4F3QA 2QG9B 3I9V9 4FKYA 4KH0B 2XY5A 3TUZC 1EHWA 2FLOA 4B08A 2B9YA 4O23A 2ZHAA 1Q0NA 2HQ3A 1GEHA 4NXNJ 3UD4P 1P27B 4J9LA 1ZM4A 4G1IA 3SIPB 1WG5A 2D3OR 3RB4A 4DR3J 3QLHA 3HHLB 2OH2A 1GXUA 1LXNA 4NLOA 2WK4A 1D09B 1N6QA 4FN5A 1SUQB 3GONA 2UZAA 4MYTA 3HHLA 3HP6A 5F8JA 5H9FJ 1HPZB 2V8PA 1NJYA 1RA6A 4PXCA 3GV8B 1NSAA 2ROPA 2GHWA 3ZXWA 1HPZA 1U0HA 4Y0FA 1VIOA 1U2FA 1UFLA 3RW6A 4CLFA 2HGMA 4PG5A 4WP8A 4WCEQ 1DBDA 1DFDA 2HRUA 1HWJA 4IQMA 2VQFJ 2NUHA 2I5JA 2B5JB 2UXBJ 2JX2A 2W4DA 2E9RX 1CJUB 2BJ9A 3E2EA 5T41A 3GJRB 3DGPB 1UZDA 2B5JA 1TZ0A 1I94J 5CHCB 3ONQA 3S7RA 3FRYA 4YY3J 1JKHB 3DGPA 5I42B 3BGOP 5D0EA 4X4NA 1WF2A 3J7ZT 3BYRA 1K73T 1H0HB 3CDEA 2ZM6J 3TR5A 1MROA 4DCJB 3BKUA 4KIAA 3CCVS 4Y00A 3FEYB 1RABB 4OV1A 1BC6A 3DRRB 2AW0A 1Q8LA 4TY9A 1KP6A 2QIFA 3NAHA 3HVTB 4YB6A 3ETMA 4HEA9 1BGXT 2UXCJ 1CQMA 3ISZA 4XIUA 3UCZP 5D6GA 2LA4A 3DRRA 4LF4J 1S4FA 3HJVA 4X62F 1F0XA 1BQNA 4DV3F 5B0FA 4LFCJ 5K14B 3KXDA 2O67A 2ZH6A 2QMUB 3AOBA 2GJ2A 2HHTA 1N5QA 2R2RA 5K14A 3Q8VA 3D28A 2QMXA 4ELTA 1S0NA 1PILA 3I87A 2DNZA 3LP0B 1N34F 1KHVA 4RL1A 4PXBA 5A2QU 2CZ4A 4UQTA 2HHHF 1N36J 4XDCA 3N6MA 5L9NA 5I3UB 2ACMA 2CQCA 1SV5B 1C0UA 5DG9A 4QR2A 3JYTA 2R8HA 5IC4B 6FD1A 4B3OB 1T02A 5I3UA 1FRIA 2CQ1A 4OZ2A 2DJWA 1SV5A 2IC3B 1IWAA 2W4CA 2BJ1A 4UZBA 3ZZTA 3H59A 4F2RA 3U02A 4B3OA 1BE4A 1HQUA 4PG7A 4P75A 2CQBA 2IC3A 5DGBA 3P45B 2BEFA 3A8KA 4HVZA 2YWFA 3MAAB 3CPWR 1WSVA 5GADU 3HHEA 3UR0A 2HHXA 1RTDA 2JFDA 3JQJA 4PAAA 2HFNA 4IH5A 5KFNA 1S49A 2WSEC 5HVFA 1X4EA 5HK4A 4ZVRB 3BBFA 4RNMA 4FYYB 4F4KA 4PPZA 4X2BA 1TVRA 1VDHA 3N79A 2DY9A 5LXYA 4RW4A 5DDPC 4D3GA 4ZVPB 1EJ7L 1XTZA 4NWBA 4P72A 1IBMF 4X65F 4ZHRA 2JHEA 1N5YB 3DLKB 2IJNA 1RLDA 3KLHA 2DGVA 5EWGA 3ENVA 2QYCA 3A12A 4FXVA 5IQ6A 5IC6B 3J80Y 3DLKA 2ZNZA 3K5MA 3CO9A 3OLBA 3BQ2A 1BWEA 4YR2A 1PG5B 2O1PA 2EFVA 3UCUP 3NG8A 1MWQA 2JEJA 2CJAA 2ZH4A 2BM1A 4F4YA 1SC4B 3Q8UA 3R97A 4B9MA 5KFIA 4CO0A 2G0CA 5AXMA 4C8MA 1Q82T 3KNAA 3HHLD 4XPEA 4ILMA 1REVA 4OI4A 2LEAA 4OHYA 5HI7A 2F8HA 2WB1D 1C1BB 5AJ3J 4ILRA 2G2OA 2HAIA 3QT7A 4DPYA 4OZ0A 3GB0A 4HHJA 3F41A 4ZCKA 2ZH2A 4KKOB 3OHAA 1C1BA 5KG2A 1YJVA 4C0HA 1VI7A 4UY85 3PM9A 3ILIA 3MAQA 4KKOA 1RWWB 3BBBA 2R8KA 1Y3KA 3PW7A 2JOQA 2IYGA 3TJAA 4I1TA 2D41A 3QGGA 2LEPA 4ZP6A 2NR0A 1REGX 3JSYA 4TQSA 3UCGA 3TAPA 1N8RT 2FTRA 1NK4A 3ADAC 2WCXA 1LWCB 1NK0A 3O44A 2OD6A 4HHHA 5IT0A 2R7XA 2M5YA 4RJVA 3MGJA 2W8LA 1LWCA 1VLYA 3CCLS 2CXEA 2HPUA 4JI8J 1XMQF 1TFYA 2O01C 4DFPA 2YWHA 5J2NB 1Y4ZB 1TTHB 2M7SA 3CCRS 5KOWA 4QWCA 4DBQA 2FVCA 2DNNA 2YKMB 2J8AA 4OX9J 4EYHB 4GC6A 4YDXA 2E1AA 2XSJB 2KN4A 1NJIT 2D3O1 1NPPA 2PI5A 3BR9A 5J2NA 2W8KA 4DSIA 2HS3A 2V2ZA 3VAJA 4DV1J 1X0FA 5D3GB 2RVJA 4NLRA 2ZKTA 2MPUA 3CDBA 2GW8A 2VC0A 4DV2J 1FDBA 2BMBA 3O3LA 3MPDA 4FXWA 1YBAA 3RTVA 1HQ2A 2BOAA 4AYBD 3OLAA 4IQXA 2N3LA 3OJSA 2RIJA 2AEFA 3EGNA 4LIRA 1XC9A 5FD1A 3EPGA 5DG7A 2MLXA 2OPQA 2YNFB 2GCFA 4MKVA 3EE3A 2RS8A 1QTMA 3KK1A 1LWXA 4OX6A 5IWAJ 4RR5A 3LGNA 3Q8PB 3GG1A 2D7SA 3LALA 4NRTA 2FHJA 3DOLA 1S6PB 1X5SA 4RW9B 2Y3YA 3AOAA 4JYAF 4LFAF 3V2UC 4C6AA 3ENQA 4I67A 1G1XA 3DYAB 3W9HA 4DPTA 1S9EB 2I2YA 1I3OB 3CNQP 4GKJF 3NGTA 1T9WA 4K2XA 4K2JA 1N5VA 3IR6B 2NXEA 5ADZA 1MSWD 1S9GB 3IRXA 1UVNA 5L39A 2FZCB 5E3AA 5CD4H 2IM1A 4JI2J 2GMJA 1S9GA 4OI2A 3FZ2A 2MKCA 4KT0C 3N01A 4DL2A 4NPOA 4NLTA 5F8LA 4WXWA 4NXNF 1QUPA 2ZOGA 1YI2S 2ZVSA 1LEOA 3BO4A 2C2EA 2XMUA 2DRAA 1RT4A 2VFRA 2DY1A 3G82B 4TU9A 4DR3F 3HSZA 4MKYA 3QO9B 1UVIA 3BSNA 4ANDA 4KGVB 3ITHB 1XR5A 1UEKA 4WFYA 3TVYA 4XPCA 3HJFA 2BE7D 2KZZA 5JJBA 4R25A 1IUJA 2V0NA 2BQUA 5HVHA 1GTHA 4HTJA 1FKAF 2GO9A 3CJ0A 1YWXA 1JLGB 4YB1P 2AMCB 3N6NA 4JBCA 2U1AA 2KM8C 4OYIA 3FEXB 1RT2A 4LVOP 1RWKB 4L6V3 1PCAA 2HRYA 4ZKAA 4K59A 2K7KA 2OFGX 2BJDA 4YOEA 3QT6A 2VQFF 2UXBF 4KPCA 4CDIA 4CLPA 4X4SA 1MMNA 3FQKA 1T9UA 3HT3A 2GGPB 3KYLA 4IRDA 3OV7A 2XS2A 1QD1A 3PNIA 4WK3A 4I2PA 2CFXA 4UUXA 1PC4A 3UDCA 1U6ZA 3VAIA 1URNA 1NAQA 2Q6BA 3OTDA 1HBNA 3I6PA 2ZM6F 2O5DA 2J0SD 1FRJA 4DR6F 1SCJB 3LGHA 1KVIA 3ZNUA 2QL5B 1HWUA 3ZZOA 1HR0J 3NAIA 3W66A 3OTOJ 2WRMA 4CO3A 4V19J 5KFCA 3M05A 2MSSA 4M8LA 4ZVEA 2CAJA 3PR4A 1OMSA 2D69A 4BLGA 4QZVB 4FBTA 1U1PA 2CIMA 3VAHA 5ETLA 1U09A 4LF4F 4U6PA 4NEYA 4L76A 4FKXA 1T3OA 2DD8S 3HFKA 3M8PB 2ASDA 4YB7A 1L3KA 4DN9A 3M30B 2HQIA 3M8PA 4OJ1A 5IOLA 1WHVA 3A4TA 1FXRA 1FCAA 4G3IA 1X4GA 4AL6A 1WKKA 1X31C 1J2VA 2XY7A 2EG1A 1IR0A 1N36F 2JVRA 1WHXA 2WVDA 4XK8C 2M0GB 2EKNA 1FKOB 1JK9B 1NJWA 4KAIA 2W7PA 2AYMA 2ACYA 2HVIA 2B4PA 2W9AA 4ALZA 4F02A 1FKOA 5CXTA 1T95A 1SVDA 1S1VB 3T3FA 3J7AN 5IT4A 1XN9A 4ECZA 1UFKA 3BDPA 3P3DA 3CDUA 3PY8A 2CPIA 4EO6A 3FBFA 3MMBB 3BS9A 2HWHA 2W25A 2I6WA 5F8IA 3VQTA 4IG0B 1S1UA 4ERDA 2EG2A 1M1HA 1HFEL 4PG4A 1HD1A 2GHVC 4TYAA 4O0IA 2YNHA 4RU9A 3MEGA 1HBUB 2HBZB 2MGZB 2J5AA 4LF7J 3UE2A 3L09A 4CIOA 2FHJD 2GAGC 4F0HA 4TKTA 4F4WA 2YWGA 3GYGA 5B0CA 2EFOA 3RZAA 3MM8A 3HHKA 5LL6d 3OVSA 4QWDA 1PYTA 1CJKA 3FRZA 2IRUA 4Q44A 1B99A 4ES1A 4OZLA 4OV6A 1YZ7A 5HO4A 2X7IA 5D8HB 1IR1A 1TR0A 1F5CA 1QE1B 2XMTA 3OFFA 3DLGA 2PEHA 1XNQJ 1N0UA 2DCUB 2XMAA 2H5IB 3P8BB 1RSCA 3NWRA 1S6OA 4HL9A 4MKBA 2FVRA 2NPIA 3PW2A 3NRBA 3BQ1A 3V81B 4L3NA 5KG0A 4LUBA 2W2MP 2G2YA 5CZXA 4USJC 4DJBA 3CEDA 4N56A 5HP1B 5C42A 1X9MA 2CDQA 1VS3A 1H6KX 3DCAA 4QR0A 3UN5A 4NMXA 1LXJA 5HP1A 1JLEB 2ZBPA 4QIEA 2MLYA 5E3PA 4GVLA 5D0GA 3TANA 3RBXA 2Y1IA 4IOBA 4XDDA 2JEFA 2R8JA 4CWBA 3F0NA 1NZ8A 5AJ3F 1M0SA 1WEYA 4PEOA 2VBXA 4ES2A 4AXJA 1VQLS 2OMLA 4CT8A 3K5NA 1O6XA 2HVEA 5AXNA 3W5YA 2XY6A 3W8GA 2OPPB 2JZ5A 4M5NA 3GFXA 1HMVB 3DOKB 3A8EA 4CRJA 3CCZA 2Z56B 2VH7A 4LRAA 3SYZA 3QJPA 2E9ZA 4Z2XA 3PX4A 2MZ1A 2VG6B 1HLWA 2CJ9A 1KN6A 1RK8A 2EFGA 2V2VA 3B6BA 3GZ7A 5HJXA 3E01A 2MZQA 1TELA 2V50A 1MN9A 2XO7A 4JV5J 4JI8F 1A6LA 1U6FA 4J9VA 4QW8A 1NPKA 5A8KB 2OTJS 4M5HA 1C2PA 2ZBRA 4K7QA 4OX9F 3F73A 1H7WA 1U8SA 3KWMA 4DV1F 1TL3A 3NGUA 2VPXB 3NBPA 4DX6A 4U8YA 2MJUA 3NGKA 2H3EB 5DQGA 3MOZA 1FX2A 4OIXA 3TEHB 1GXLA 3EXCX 1YVFA 4K4TA 2X1AA 2KXNB 3DMJB 4DV2F 2FJAB 1V6HA 3TO8A 2QSFA 4ILLA 3LAKA 3NXZA 3TVKA 2DR6A 1EZZB 3LPEA 3KK2A 2GJIA 1NZAA 4USUA 1SQEA 3VAFA 1TMJA 4C48A 4ZVOB 1VQMS 3CD0A 3MR5A 2VG7A 2R9LA 4C0BA 2PMWA 4NLSA 2ZZTA 2MEWA 3I5BA 3O1LA 4R0JA 3Q8YA 1JLQA 3FKBA 1X9SA 3BSCA 5LM7E 3CCSS 1S76D 2GQQA 4Q2LA 1U4BA 1FRLA 3LP2B 3W65A 5CYMB 4PR6A 2M8DB 3OL9A 3I4HX 3FFIB 3EM1A 4WZQA 1B7YB 1F2GA 1OIAA 2CRLA 5CYMA 4DV7J 1VYAA 2GX8A 3K0JA 3J80U 3C16B 3MCOA 1CEZA 3T6JA 1FHTA 1U49A 3IM8A 4USVA 3POTB 1RBAA 2HW3A 1RT3B 2PDAA 2UUCJ 3V4MA 3DLEB 1VQ8S 1WWHA 3K58A 2A6MA 1TUWA 3POTA 2MMYA 5T14A 4OI0A 3KTQA 4OI1A 4OYBA 5E33A 3M2VB 5M2PA 3R5JB 2FHOB 2W2PP 3K59A 4IO9Q 1SQFA 2DR9A 4OJ3A 2VV5A 5K8MA 3RR7A 1KOHA 1B70B 3X3UA 3ZO7A 5DO2A 3ET6B 4I6YA 4RU2A 1N48A 4FYWB 3OFHA 3W9JA 1TKXB 3DGVA 5L9XA 3HD1A 1HQEB 3A3OB 1YZ6A 5DM7Q 3K7RA 3ET6A 3AODA 1FI4A 3KLIB 1SKWA 2J7KA 3K2YA 2N7YA 2L3MA 4MYUA 1HQEA 1HYSA 4USMA 1OJ4A 2DGUA 2WVCA 1HNVB 1OY6A 3OSPA 5ETKA 2B7BB 3UNGC 2OLWA 3W61A 5DDRC 2MTLA 1TU0B 2AX0A 3G6ES 1VLOA 3EJMA 1GX5A 1M5PC 2MQOA 1ULRA 1J5OA 3D0HE 3TARA 3QGHA 5IV4A 4CTAB 5F9LA 1Y3JA 5LJ3Y 2MQQA 1SQGA 2YX4A 3DLJA 5KT7A 2DEIA 3HVAA 4U8VA 1ZM2A 3QSIA 2KO1A 4LF9J 2HZAA 3R7SB 2R4FA 4NOHA 3CJKA 4P10A 4LF6F 2BKNA 1RT7B 4OJHA 3NNAA 5J2PA 4WKRA 4LRBA 1R7IA 3FSIA 4G1QA 4E8UA 4DV5J 4DPWA 5F0UA 1HR0F 4QPXA 2LXUA 1RT7A 4A4JA 3OTOF 5DDOC 2FJBB 4B02A 3IMQJ 1X4FA 5D15A 2DHAA 4LMZA 3M8RA 5L38A 1NK8A 3R1HA 4PYDA 2DNQA 2DXEA 2RHSB 1AZSA 2H5JB 2LU1A 3NGRA 3M6VA 2RF2B 3W7BA 2CQPA 2J9DA 3PFEA 1CULA 4O3OA 1SH2A 3FBCA 1RT5A 3PTWA 2GVZA 2YKAA 4ZIVA 5FDLB 1GMVA 3EUNA 3S1TA 4GKKJ 2V69A 2QTWA 4F4AA 1RI7A 3HD2A 1F5BA 1F3FA 4HDGA 4J37A 1T03B 4BHQA 4B9SA 1MWZA 5EX3A 4K8RA 2KJWA 4KHPF 3DDNA 4KRWA 1FWLA 4CLSA 3QMQA 1H2VZ 2QA1A 5B0AA 5GAGI 4DSEA 4C8LA 2Q1LA 4N47A 2LQJA 3M1VA 4QOTA 1JJ2R 4ER8A 2ZH7A 1AFJA 5F3TA 4N76A 2D3ZA 4DU8A 2DR8A 4NMLA 4DPUA 1SB6A 2B56A 2B0GA 3D0GE 1HARA 3BH7B 3PVXA 3MI7X 1S1TA 4TNOA 3C6TB 3BEGB 1T9VA 3DRPA 2UUBJ 1R6YA 5B09A 3GSDA 4N7TA 3TUJC 2GVDA 2UUAJ 4MIBA 4DU7A 4EI2A 3C6TA 4YDDB 5DM6Q 1B4SA 3TZWA 1CLFA 2DT9A 2C3UA 1G3OA 3DFEA 2J9EA 3KNGA 4KC5A 5BYQA 1KD1T 1E6YA 2KYZA 2VF3A 1Q8KA 3MTJA 4DV4J 2EFPA 4N8OA 2DNOA 2XS7A 3PKYA 4OQJA 3L7OA 3QJJA 1ZAVA 3H2UB 2GIQA 2YWEA 4MFBB 3BZQA 2XMJA 3FBBA 4LF2A 1UPMB 2IM3A 4I2QB 2RRAA 1XNQF 1P9QC 2ASLA 4L72B 3CMAS 4ZVQB 1HWKA 1SH3A 3QAUA 5CA5A 3WZ0A 1Y9OA 4LVNP 2WBRA 1Q5VA 3CCQS 3NMAA 4TVAB 2KL8A 1C1CB 3GMGA 2N4DA 3G6VA 2ZJPQ 1JLBA 2RAQA 3A8IA 3MUVP 3CJTA 3CDWA 1V3RA 9RUBA 3RBDA 4EGLA 3AJ2A 2G9OA 2C2RA 1U1MA 1JLAA 3MFIA 2WOMA 3T5HA 1OWXA 2FLPA 2V4JA 1MNEA 3R2CJ 2QN6B 2YPYA 2BE2A 1JJ4A 3D9BA 4JV1A 2RILA 4B3SJ 2D74B 1UEUA 4UOHA 3Q0AA 3NS7B 3US5A 2LQ5A 1TQLA 3GFYA 4N5SA 3UDLA 3H0PA 4BCAA 3J7YI 1VIXA 4KR0B 3C6UB 2HFVA 3LO3A 1F5AA 3TA2A 2BKPA 4UOGA 3UD5A 2A2DA 2XO6A 2E5HA 2YNGB 3C6UA 2R7UA 1SI9A 2JRSA 4I7FB 2QEXS 1RAFB 2FD2A 1RISA 2EC0A 2LA6A 2Q3PA 2LQ8A 2YNGA 1KBRA 4I7FA 2MKKA 2PA3A 4ITSA 1NDCA 2FVPA 4KBIA 3D66A 4ICLB 2LQBA 3FVYA 3GILA 3JB9k 2IM0A 3TQ1A 4DL7A 4TY8A 3B78A 2EFQA 4NEZA 1OY9A 4DS5A 2OI2A 4DSLA 3U27A 4X66J 4M94A 3D2WA 2Y1LB 3CDAA 2VOOA 3H90A 1B64A 3PFOA 5ETMA 3H98A 3UWTA 1PIEA 1Q86T 2AQ4A 1X5PA 4OLOA 1C4AA 1MW7A 4PXEA 4P9SA 1SH0A 4DG1A 5CCMA 3C2PA 4O0NA 1FDNA 3D6TB 4DX7A 2WB4A 3EX7B 2IMOA 2H5EA 2AWZA 3VAGA 4B3MF 4CCHA 3RRKA 1FRMA 5G4DA 1SJQA 1SPBP 1CJTA 2ZUGA 3BGFA 5KFEA 4J9RA 4LF5J 1NRKA 1Q4RA 4EEYA 2ZWOA 4ANCA 3MEEA 2PD1A 2E66A 4H4OA 3I5CA 1S7HA 4Q43A 2XLJA 1RTJA 3VGUA 4Y2AA 4F0KA 4MMOA 2BOPA 1VHFA 4DR2J 2V2QA 2VFSA 3W2VA 2ZDPA 1WG4A 2F40A 2ZHOA 3AY0A 3SSSA 3QWUA 3H8YA 3IRWP 4WZMA 4DV7F 3H5SA 2PC6A 3EDQB 4OZ1A 1HL6A 3O2IA 1NCLA 2VFTA 2YY3A 1YJTA 5SZTA 1R89A 1RBLA 2ASYA 1LWFB 4QIWD 3HKZD 1TL1A 1DLOB 2DNMA 4Z37A 1D0EA 4LF1A 5U47A 2M70A 4XO0A 3MUMP 5B08A 3RB3A 4DV0F 1D9DA 1NU4A 3GV7B 2WONA 2D1CA 1FRHA 4OYPA 2F63A 3EGVA 4Q2MA 4I6WA 3AXMA 5RUBA 2LP4A 4CQ1A 4ZVGA 4IRKA 3H7HB 3D67A 1H7XA 3CD5A 2V94A 1CC7A 2R2UA 4QIVA 4M5DB 2CPEA 2Q6CA 3OFGA 4FP9A 1HNIA 3N9UC 2A2CA 3PACA 2NXJA 2XGPA 2QLJB 3M2UA 2XZTB 5KG3A 2F7VA 2DGWA 3RR8A 1S12A 4P71A 3FGVA 4X4PA 2OPRB 2FC8A 3D0IE 1JWWA 1WSRA 1GAOA 4Q8EA 4BC9A 1U2CA 1UW9A 4K4WA 2M4MA 5E2QA 1E6VA 4NYZA 2AF6A 1LNQA 3DOMB 2A10A 4LF9F 3M32B 1IBLJ 3P49B 1H38A 3LOUA 3TUPA 3BREA 2H65B 2Z4PA 5IFMA 4DV5F 5KT5A 3CJQA 1U1QA 2RDJA 4DQQA 1BQMA 2MY8A 4QCLA 2CQ0A 3MWBA 2QSWA 5IM0B 2BABA 1RHMB 4O3PA 1WTFA 3MHYA 4EK2A 4LF8J 2B43A 1LW0B 4K5RA 5IM0A 1WEZA 3EZUA 3QNWB 5G0RB 4I69A 3IM9A 2KKHA 2NSCA 4J91A 1FVSA 2ADBA 3UNYA 4ZLLA 3THPA 3MM6B 3LF0A 5G0RA 2YKPA 4NLPA 2LXIA 1F9EB 4KH1B 4FS2A 5L46A 2C3PA 1JNRB 1HI1A 4GKKF 2C2KB 5HAOA 1HI8A 4YHHJ 4DQPA 3QIPB 3MMJA 5DG8A 4JI3F 2Y0BB 3T5JA 2X1BA 5A8RB 4UUWA 2MZTA 2UVUA 2B6AA 5B0DA 1VFJA 2RUGA 3UW1A 5LMUF 5KT2A 1JJCB 2R8GA 3QPIA 1WORA 4OHVA 2DK2A 2HHVA 2F8EX 1RAOA 3FCHA 3G6XA 4RWWA 1I51B 3DRYA 2BRKA 3AA8A 3V4IA 3WBZA 1CPZA 1WC4A 2IPOB 4QYZK 3ULHA 3EGZA 4OYOA 1QAXA 3R5AA 4LRFA 4RPFA 4UZCA 2XZWA 2E5IA 3K5LA 1X9WA 3BDEA 4DV3J 4HYKA 1NBEB 3O5TB 4BDPA 3KLEA 2CG8A 2UUBF 4NLWA 4DQIA 1UVMA 3G8QA 3HVRA 3D1OA 1SBRA 1FXDA 2HNDA 1DTTA 2HQFA 3LANA 3QGPA 2KT5A 1KLMB 2HEKA 3KG1A 4X4OA 1L3UA 3ILLA 3NCPA 1C4CA 2M52A 2MZSA 6FDRA 5HMXA 4F50A 4LFBJ 4WXOA 5DZ7A 3HULA 1RAGB 4WFAQ 1RBOB 2ZH1A 3D6MB 1PBAA 4RW6A 2C28A 4MIWA 5HSPA 3A13A 2R42A 5KFBA 2DVIA 5A0YA 4NLYA 1X4HA 3FEZA 1FA0A 2V8GA 1IN0A 1WKJA 2XMVA 2ABYA 4FNIA 1VR6A 1RAAB 5L1JA 4NE9C 5E41A 2WVBA 3SCJE 3OR2B 5C24A 2ZHBA 4LSLB 2AZ1A 5BYRA 2BJ7A 1HI0P 3L3CA 2KB2A 2KVQE 3U7JA 4LSLA 4Q8FA 1G7CB 1WEXA 1TV6A 5ETPA 3OL7A 4W4MA 2CVIA 4IKAA 3TOQA 1JIHA 1U24A 2M9KA 5K5MA 1LQ9A 1CVJA 3WQPA 4B3SF 2RKIB 5MLCV 2LVWA 4PQAA 1PSDA 3MDFA 1IJEB 3HXMA 2RKIA 3SZ2A 3D3BJ 4RKUC 3TQEA 4OYZA 5D4NA 5ETNA 1CS4B 3ZZRA 1HBOA 3OHBA 3M7VA 1RT1A 2LCWA 3KG0A 4L75A 1ACMB 3HVWA 1CS4A 2DIUA 2CNLB 4KGMA 3KLVA 4CP5A 2PE8A 3I56S 4BBYA 3T5KA 4W92B 4B9VA 4O44B 4OL8A 4NI2B 4DR7J 4ELVA 2L41A 2F9JA 2ZBCA 5KFRA 4F4ZA 1EX8A 1HNXJ 1RTIA 3AFGA 5D0RA 4O44A 4NI2A 3TW0A 1N5TA 3UO0A 1T7PA 4H54A 5DLGA 3J7YU 3CE8A 1F6TA 5CAAA 1A0OB 4FF1A 4ZN3A 2FJWA 3CJ8A 4DSJA 2BUNA 3HMJG 2OPSB 2IVFB 2ZDOA 1RAIB 3CTRA 1OQ3A 4RW8B 3QFHA 4CZCA 3PR5B 5JXSA 4C97A 4FYXB 2K3IA 2HHUA 2B8PA 2CWXA 2HBYB 2J8SA 5LSLA 2MHEA 1RT6A 2P9GA 4YFUA 4CT9A 2C2NA 2H9ZA 3MM9B 3SV4A 2IRYA 1FKPB 1UW4A 4I68A 4CI0B 2UUWA 3MM9A 2QL7B 1YSJA 1TL5A 3I96A 5T7LA 4DMZA 4K4YA 4PQUB 1FKPA 3GIIA 1SL1A 2EBGA 1FD8A 1Q5YA 5KFLA 1I1GA 2IBKA 4LF5F 4ZPDA 2QE5A 1FFSB 5IS2A 2KTQA 3VZIA 2AP6A 4P2MA 1B0TA 1S10A 3UQSA 1S99A 2ZZNA 1Q7LB 4DR2F 3W5XA 3JTPA 4V19X 2IA6A 2RDDA 3PZPA 3DXBA 2DGXA 1S9FA 5M2UA 1NHUA 3PIPQ 4DFKA 2FZGB 1ZZNA 4QW9A 2ZEJA 3AJDA 2FLNA 2Z2YB 2B8QA 4DR1J 3LUYA 1ITPA 1WG1A 3AB4B 4DCPB 3I0RA 2VL1A 4OYXA 2AIRB 3GPAA 2P9EA 3CMQA 3ZZZA 2CQIA 4KFBB 2QL9B 3ZTOA 1YBTA 1LK5A 5KFPA 3CCWA 4L3KA 4NYOA 3RW7A 4KFBA 4DWIA 4M5GA 2LXFA 4UT4A 4BS2A 2HMIA 4CM0A 1MU2A 4ZN1A 3V6HA 3GFZA 5KFHA 4J9NA 4DV6J 3UN2A 1JLFA 2AJ1A 1ZAWA 4WE1B 5K20B 1KHWA 3MECA 2XWXA 1DARA 1FT8A 1BMQB 3OUYB 4OYMA 3G8TA 2IHR1 1VGYA 3RGIA 2ROGA 3QATA 5GAEI 4GKJJ 3CGIA 4ZVFA 1RB0A 4XAKA 1AUDA 3ENAA 2V67A 1R27B 2GO8A 3D6FB 3LP1B 4CLUA 1Y5IB 2YKOA 1Q8BA 3P4UB 4F7VA 4LSNB 2JDJA 3V6DA 1BLUA 4TLRA 3D7SB 4C3MA 3CCUS 1S5ZA 2R3VA 2JJ4D 3IBCB 3EZ5A 1IKYB 5CCLA 1UJ4A 1Q78A 1PAUB 3U1MA 3T9NA 1Q1KA 2BXJA 4CM2A 1FWKA 2HBRB 4A8QA 2Z8QA 2Y1JA 3FMWA 3U1LA 3IO1A 4U7UK 2DGOA 1WTBA 1G6BA 1RJJA 1IBLF 3DI6B 3I0SB 2YQ1A 4ENOA 1Q81T 2RSQA 2DTJA 1CQNA 4J9OA 1U1LA 3DI6A 2JFKA 3I0SA 1OYDA 3R1LA 3PJWA 1H98A 3RU0A 2KG0A 1YHQS 1SUQA 2I0XA 1YJRA 3QFWA 4P52A 4LR9A 5AXLA 4R0EA 3EMTA 1J5EJ 1FVQA 4MIAA 1TK8A 4FF4A 4USWA 1TKZB 3CCTA 4LF8F 2OFHX 3AOCA 2L9NA 2R7SA 3H42A 5AE3A 2MHNA 3OXFA 2G4BA 2ZE2B 1SKSA 3TVZA 2WTFA 4DPOA 4NCGB 4TN2A 2IYIA 1F60B 5C7PA 1CJUA 1NSPA 3BSOA 3NNHA 1FK9B 3UDVA 1T3NA 3U1NA 3ZZYA 4NCGA 2HBQB 2LKZA 4YHHF 4CLZA 2F5GA 5K8NA 4IDKB 4LBPA 4PPDA 1JKHA 4DS4A 1IKXB 1FK9A 5I42A 2F1FA 1FERA 5E3RA 4DR6J 2BBEA 2V2KA 3KUEA 4DDFA 3BM7A 4IDKA 4H4MB 1IKXA 8AT1B 2L9WA 4ID8A 4CLKA 2YX7A 3NWGA 4A8WA 3I32A 2QFJA 3VVUA 3MCMA 2PMHA 3IAM9 4H4MA 3G6YA 2YBVA 3D4JA 2J6UA 1N5SA 2XEXA 2W24A 4GO5X 4NCAA 1S77D 3Q83A 3HVTA 2Z30B 1HHTP 4AL7A 1MLAA 2ROEA 3ZZ0A 1IM6A 3HK2A 2CQHA 4LBIA 4PXDA 2LECA 1ZOTA 2V8VA 2CYYA 1Y5NB 4FPRA 4JOUA 3W62A 1WDDA 1KRPA 4G65A 2PO4A 1L3VA 2R7WA 4RUBA 4NLVA 5D4OA 2QRRA 3LP0A 4LFBF 4ZVUB 1XJWB 3H4BA 2HHWA 4DUTA 3HSDA 3ZTRA 3T5LA 1P6TA 5E5NA 2V63A 5J2QB 1P8GA 2DR7A 4URGA 1HBMB 1VQOS 5J1EB 5F8HA 1K47A 4ZJLA 1ZZFA 1L3SA 1PYOB 4YB5A 5KFFA 5KFDA 2KH9A 3CCJS 1LOUA 4PRFA 5KG6A 3M8ZA 3NCRA 3R5DA 2COLA 3QIDA 4DL0C 2AD9A 3DC2A 3K5OA 1PC5A 5L1IA 4U67Q 3MAAA 1SJ3P 3RBZA 2ZFHA 3IP0A 1T05B 3MD1A 3M8YA 2PIIA 2HIYA 3ISNC 2POKA 3P96A 4DX8H 1T05A 4FYDA 4CLWA 2MKHA 3H4DA 2B9XA 2RHQB 2IVMA 4HI1A 3P6YC 2Z57B 5KFGA 1UWBB 3EGWB 4PABA 3SMZA 2XS5A 4WBFA 1DTQB 2ADCA 4ED0A 1YG0A 2BM0A 2IM2A 4MK8A 2CJBA 2HLTA 3KFWX 2DKOB 2H4WB 3UD3P 3DRSB 2HS0A 1RP5A 1N5YA 2IAJB 1RKIA 1DTQA 2MXYA 4NZ7A 2UV8G 1AW0A 2E7XA 3DRSA 1VBYA 4YMEA 4AT1B 4R5PB 3Q8QB 4TXSA 1VRUB 1Q8IA 4ZLPA 1UFWA 1YQHA 4DR7F 2MKIA 1T9XA 2BA9A 3A3NB 4ED4A 4I0WA 1HNXF 3DHWC 1RZMA 2L08A 3V6JA 3RAMA 2MLZA 5KFTA 3BB5A 5HBMB 2DO4A 3EYZA 1XERA 1WI8A 4RWXA 3OL8A 2FIUA 3RG6A 3GU0A 2C22A 2BKOA 1NDPA 4LRCA 3DLBA 1O0PA 1K44A 3BJYA 1VOMA 3Q8SB 2H54B 3PCOB 4X4QA 1FDAA 4FVMA 2QV6A 4F3OA 2K7JA 3W2WB 2E5LJ 4JV0A 3VR1A 1BHNA 1QAYA 3CF5Q 2QA2A 2HGNA 4ED6A 3O6QA 3R27A 2X3DA 2Z0GA 2F3JA 3RBEA 1KWMA 4P2XA 3N0VA 5KT4A 3K17A 1AUSL 2UXDJ 4JB8B 1PJ6A 2BDPA 2DGQA 3C3LA 2HQGA 2ZOFA 2KU7A 3AHPA 1U1NA 5DJBA 5JVGQ 1VBZA 1ZBTA 1B0PA 3THTA 4OZ3A 4OZNA 3SDEB 3IR5B 4Y6IA 3MXHP 1QSLA 1O51A 2ATCB 2FHMA 9ATCB 2RQ4A 4ECQA 4DCOB 2YKMA 5CYQB 4X4RA 4TLQA 2XSJA 1RE1B 2AU0A 2HLUA 2BQRA 3KLGB 2W9CB 4KQZA 5CYQA 5D3GA 2GMLA 1R0BG 4HR2A 2VG5B 4DR1F 4ZP9A 2W9CA 4M95A 2Z2ZA 1GNKA 2UU9J 3TJ8A 2VFVA 1BQXA 4Q45A 1DQAA 3TEGA 3B8HA 3S8SA 3HSGA 2XYPB 1WUUA 3R6GB 4EYIB 1YGYA 1VJQA 4C8ZA 2PI4A 2KFNA 1JNZB 2YNFA 2HK2A 4A8XA 3MMCB 4QQBA 2A0FB 2HAFA 5A6WA 1SKUB 4DV6F 3M6UA 2QLXA 2W4PA 4C11B 2HSEB 4A46A 4ZPAA 2EK1A 4AE5A 1T9TA 2AGQA 3BO2A 3UFCX 3BSAA 2E1PA 3PYFA 3W1YC 4IFVB 2Y8YA 3DU6A 2VQEF 3NS6A 4W90B 3E51A 1H74A 1S6PA 3OFEA 1APSA 4RW9A 4IFVA 1X4AA 1K0TA 5GADI 5LT5A 3DYAA 2NLWA 1S9EA 6AT1B 2ZH3A 3ETOA 3T1YF 4DF4A 4B9LA 1GT8A 2YKNB 1X0PA 1WI6A 4E2FB 2WW4A 1WELA 2BW7A 2FGCA 3BN7A 5FLXY 2VHGA 1FX4A 4W98A 3FSXA 2KHDA 2I9SA 3V6KA 3AH6A 3RB6A 4C3LA 1TMMA 2U2FA 2YKNA 3Q24A 1PAEX 2LFVA 2NYIA 4PWDB 4PWUA 3L7PA 2CJYB 4IG3B 3DHXA 2HIQA 1M90T 5GAEU 2ZC4A 3VALA 3FC9A 4UW2A 5KG7A 2DR5A 4ANEA 2LEBA 5KFOA 4DX5A 3RUBL 3G82A 4RZRA 3B54A 5KTQA 3LPYA 3QO9A 4ECXA 1HWLA 3ITHA 1VC5A 2KFZA 2EC2A 2NCKL 2DH7A 5L1LA 2FJDB 1J5EF 3C8YA 1RTZA 4UY8T 1JLGA 3PW4A 1VRTB 4OYAA 1Z2ZA 1RWNB 4HHUA 4LIWA 2VOPA 1HKAA 2E5JA 2W01A 1NJZA 4MK7A 4G1PA 5H9EK 3QAEA 1VRTA 2ZZMA 5KFXA 4QIFA 3JQMA 2LU2A 3BF4A 2M88A 1ZYQA 2KRRA 2F4VF 2KG1A 2GGPA 4PWWA 4YQWA 2FJVA 1W26A 3RJMB 1S6UA 4B9UA 2OEKA 3OTEA 2DISA 4PUOB 4C2MA 1G2EA 2FGOA 4LF6J 2DHHA 2R7QA 2DNLA 2XBPA 4RW7B 2DGSA 1TKTB 5HLFB 2IBOA 4RW7A 4EUVA 3JSBA 2GA7A 1JXVA 4ZPBA 2YKQA 1C0TB 2HYIB 2BANB 3KHGA 1H3DA 2J0XA 1YRTA 4P7TA 2W9BB 3W8PA 1UP1A 3MEDB 3JS9A 2KRBA 1C0TA 4FXDA 1S1WB 2V4QA 1GMUA 1QSYA 3GQCA 3LH2S 1O8BA 1TKDA 1IKWB 2OUGA 5HVGA 2VDHA 4TU8A 3T1HF 2MKYA 2ATLA 3GTYX 2CNNB 3BGLA 3SBMA 5CYJA 2NSBA 3AD7C 2G0JA 1VMBA 4CLYA 4KY3A 3PRDA 4AL5A 2DHXA 3M30A 7AT1B 5HJYA 1DQ9A 3NEKA 3VVTA 2FY8A 1KOOA 4KHPJ 5C5JA 2Z58B 3F56A 5DETA 4ID5B 2OD4A 1VQNS 5K8OA 3GWCA 1S0OA 1NDKA 2CA9A 2DRBA 1WKLA 2FC9A 3IC1A 1S1VA 4QU6A 1S4EA 3SFUA 2BR0A 1CSJA 3BGUA 4ED2A 2K2PA 4AUKA 4X4UA 1I6JA 4B17A 4J5OA 3KLFB 1DURA 3MMBA 4IR1A 2UUTA 1WACA 3KUHA 4IG0A 3OJUA 2O66A 1JXEA 1WC5A 5GMKa 4J9KA 3OBIA 1KS2A 5D0HA 3HFZB 4K5SA 1RTHB 4ZPTR 2EKYA 1IKVB 1VISA 4HT7A 5ETVA 3IBWA 1HBUA 3GR0A 2MGZA 3IG1B 1X5OA 1SIZA 4URSA 3K8WA 2V9WA 1RTHA 4GRSA 2XNQA 2PEBA 4X4VA 1T0TV 2C3OA 2C3MA 1VQ4S 5LSOA 3KHRA 2AYBA 3GYXB 5KOXA 4OFZA 4P2SA 2AV5A 1Q7YT 3DLHA 2DEJA 5A6PA 2VPZB 2BJ8A 4D3HA 1FO1A 1YLXA 3UVJB 1QE1A 3ZTQA 3QWPA 4KPYA 2XGQA 3M8QB 2AEJA 2KHCA 4KSEB 2P2CB 2KDOA 5J2MB 3Q8RB 3DM2B 4NA2A 1U0SA 1S6QB 3V81A 4KJIA 4OJGA 2B9EA 1RAEB 4J9MA 4WFZA 2O3DA 3Q23A 5J2MA 2XI2A 5C2CA 1S6QA 4RNFA 3BKFA 2R2SA 1WDTA 1PJ7A 2KT3A 3GLJA 1JLEA 3N5FA 1VQYA 4P73A 2EBEA 3UN3A 1OO0B 3VAKA 3QLHB 4HLBA 2ZUAA 1MMDA 1K0VA 1RHQB 3LA0A 2E5LF 4OZJA 2CJQA 1N6QB 2ZITA 3CJ4A 4DHVA 2GJFA 3OTBA 4FZVA 2DBBA 2DPJA 5HMZA 5DS7A 3R7NB 3HHNB 2OPPA 2MSTA 1DJ0A 1HMVA 3DOKA 2UXDF 4LBHA 3KJVB 1U0HB 1N54B 1WC3A 3VV2B 3FZBA 1UJ6A 2VG6A 3KJVA 4L74A 1PJ5A 2PT0A 2I5JB 3PDNA 4NZ0A 2IMWP 2HZCA 1FRKA 3EPIA 5IV3A 4AXIA 4ZA1A 2LDYA 3KJNB 3SV3A 4RX6A 4ZVSB 3AT1B 1YRXA 1NM2A 3P5TL 1U2RA 2HFUA 1XWLA 3TZXA 2CPYA 4I6AA 2KJVA 3R2DJ 1QDUB 5A8KA 4DLGA 1FD2A 1WNEA 3K8VA 1S0VA 1SC3B 1MROB 2CPXA 3FMBA 3WX8A 1RU2A 4DSFA 2MQ8A 3L9ZA 1KDNA 3LW5C 3QT5A 1WF0A 1FE0A 2CWKA 2XG8A 3MOJB 4FPIA 1FEEA 2RD5C 3VZHA 1W25A 2D3UA 2CNKB 3DMJA 1OYEA 1KONA 2QZ8A 2UU9F 4ZCMA 1N0VC 2MJNA 1XK8A 1K1SA 3IBFB 4B3MJ 2X1GA 4M63A 4EZ9A 4USTA 3FUYA 1OQ6A 1BQNB 4WWSA 1VQ9S 2RQKA 4NA3A 2KYXA 2CDRB 2F4FA 2V34A 1SJFA 1R3NA 3ELHA 1CC8A 2IVYA 4DXLA 3AXKA 3DXSX 1D8ZA 4QYZJ 4K4VA 2B4VA 2JH3A 2LYVA 5ETOA 1GX6A 2CJXB 3D3CJ 3KK3B 3C19A 3PXGa 3MCSA 3ZTPA 2NQPA 2OHDA 4C8OA 1U45A 4ECWA 3SEOA 1U1RA 2VA2A 3KK3A 1C0UB 3LP2A 3VGSA 3JYTB 5HN0A 1UVKA 2MKSA 3TUIC 4F04B 2XMMA 3FFIA 3SFGA 4PG8A 4QWBA 4WYLA 3C16A 4U95A 1PYSB 1LFPA 2Y1RI 1HQUB 2YWWA 3JTNA 5GAHI 3CWJA 4NLQA 2FQQB 1RT3A 1RAHB 1YRUA 2JNJA 2Z2LA 3DLEA 4DL4A 1W2IA 3SCIE 5DQHA 4DV0J 1RTDB 3SSRA 5HROB 1JLCB 4USHA 3MFHA 1TAQA 4J9PA 4CH0S 2WZ1A 1KSPA 3M2VA 4AQYF 2LMIA 2FPHX 5HROA 2GV1A 1JLCA 2VICA 1NEEA 1TVRB 4ATNA 4UF4A 3WX4A 2GC8A 1VHIA 4RW4B 5DQIA 4KTQA 4ZJOA 1LK7A 4GMKA 2HHPA 5KG4A 2W1BA 1RQ0A 5I3QA 2LQ9A 1TKXA 4ZHRB 5KFKA 4ELUA 4XTTA 1JMTA 2VJUA 1FE4A 3PX0A 3KLHB 3CIZA 3QZ7A 4EMDA 2FYXA 4KYZA 2ERRA 3KLIA 1P1LA 2OO4A 1V3ZA 1WOSA 4OYWA 4KHMA 1SJ4P 3D6HB 2IIHA 5F8MA 1N32J 1V3SA 4OHWA 1HNVA 3CO0P 2BRLA 1DAXA 1HW8A 2LLZA 4MAKA 4RO0A 2RRBA 1B7FA 3KJQB 1QSSA 2IRXA 4C9DA 2ZH8A 2R7OA 4RNNA 3H2VE 3L7UA 3HPOA 3PW0A 3MF5A 2G1DA 3EWGA 2MQPA 2DPIA 1QY7A 3QBCA 4CTAA 1LWEB 4C4WA 5F8GA 1QVGR 3FSYA 5I3PA 4O3SA 1LWEA 1REVB 2E7WA 1URRA 5KT3A 2FDNA 4LSZB 2QYGA 1NKCA 4NLDA 1FFWB 1FDDA 1RYRA 3F44A 1IXKA 2K8GA 4WP3A 5DRKA 3TAMB 2ZJQQ 1N33J 3G4SS 1RKJA 1XMOJ 1FEHA 3DLLQ 2CKWA 3BPSP 1GH8A 2OP5A 1EP4B 3TAMA 2IA0A 1YX2A 2BACA 2BX6A 2XMWA 4F25A 2GFFA 2GIRA 3R5CA 1SC6A 1EP4A 2J6TA 2WBMA 2RF2A 2VJVA 3MPVA 3BO3A 1ZETA 4FF3A 3RRHA 5K9FA 1FXLA 3ICLA 2I38A 3PEHA 1L5UA 5KFSA 3T19A 2HFOA 1Q95G 8RUCA 3OVAA 2GMHA 4JI3J 4IO1A 5FDLA 7FD1A 2L48A 2J0QD 3M8SA 2JLFA 5LMUJ 1BWVA 1R8CA 4UTGA 1RHRB 4C8KA 1Y0HA 1T94A 1EKSA 3V5RA 4I56A 1T03A 3VF0B 4WP9A 1RHJB 2CPFA 1HHSA 4F0MA 4UOCA 4WYWA 4O3QA 4NA1A 5E3CA 1RU1A 3IWNC 3WDOA 2GNKA 5I4MA 3BH6B 3I82A 2FVSA 2DH9A 2C3YA 4HKQA 2W2OP 4EO8A 5JMNA 2MQLA 3D1QA 1CJVB 2JC0A 4EBCA 5FLXU 2X1FA 2Q66A 3M9OB 4TU7A 3R8YA 3ZC4A 1CJVA 2CPZA 3MR7A 1HD0A 1XNRJ 3CD6S 2Z2MA 2GIFA 3C15B 2OPQB 4M5LA 4ECSA 3R5GA 4NZ6A 2BJEA 2GS8A 1WD6A 4Y2CA 3C15A 1U8WA 2E5GA 5ITHA 3KK1B 3CUNA 4U7UD 1OY8A 3EXYA 2AT1B 2NZCA 2CQGA 2VUGA 4Y65A 1RXOB 2Y0SD 4QIGA 3HT0A 3IXQA 4H4KC 5CH7B 3DOLB 2P9CA 3AD8C 1RUSA 3IN5A 1I5OB 1T11A 5HQLA 3BKTA 2EFNA 3NOGA 4MFBA 3FCWA 1X60A 1RCOB 2DGTA 2N4CA 2RMLA 4I2QA 3AA9A 2HK3A 3KUGA 2XCAA 2C2MB 3IRXB 3OL6A 1RAJA 1OS5A 4P7VA 4M1KA 3T41A 2RU3A 3PW5A 1NMEB 1C1CA 4WJBA 3OW2R 1XMBA 1K9MT 3KHLA 3PYEA 4OI6A 3DKDA 2JWNA 3E3XA 3ZZPA 1O5JA 4DPXA 3OPKA 2ZJRQ 4YP3A 1RHKB 2IJRA 1KLNA 4IRCA 3CC4S 5L8RC 2VDIA 2N3OA 1RT4B 4Y2KA 1TP7A 4OMFG 4DI6A 2A3JA 1F3VA 1VRQC 2B7CB 3PHEA 5A8WB 2B51A 1A7GE 3OXGA 2F9DA 4C8NA 5J1PA 1GMWA 2GAHC 2VD3A 2HKEA 1YJ7A 4ED1A 1GTEA 4OLPA 3JSRA 1GQEA 2JEGA 1PKUA 5A8WA 3I31A 1MN7A 4DEZA 3GCWP 1WOOA 3TZYA 1L3TA 5J1NA 2NPFA 1RT2B 3W5ZA 2OGUA 4IOAQ 3HDSA 3HKWA 4S0MA 3H2LA 2A1BA 4FS1A 1UA0A 5EX0A 3G86A 4A8KA 4Y2MA 3CT9A 2IDEA 4DR5J 3IFEA 1YTYA 2MYFA 4UQGA 1K1QA 1S79A 5KFQA 2P8IA 3MD3A 4X4TA 1V9OA 1HA1A 4I2PB 1ZTTA 1S57A 4ICLA 1NK6A 2VB6A 3KJFB 1UEVA 3VTIA 3MAHA 1X4CA 2CADA 3AD9C 1I94F 4F36A 4QU7A 4PKDB 3OR1B 1IJFB 1HBNB 4GC7A 4WK1A 4IFYB 4YY3F 3MR2A 5THWA 3BPDA 4Z7CA 1S72S 2QT7A 3OR1A 4NYPA 1R8BA 2OKQA 4IFYA 3L4BC 2DNYA 3OVBA 3D1HA 1R8PA 2AZ3A 1SL2A 3QT8A 4USIA 1D9FA 1R31A 2P6SA 3ILOA 2UXCF 3QGIA 2CZVC 1UL3A 1IM4A 1YITS 1KQKA 3RAQA 4OHXA 1R8HA 1KC8T 2EPIA 1D8YA 1NSKL 4L73A 3KOAA 1TL7B 2K3KA 4LFCF 4ZOSA 4CYUB 1DRZA 4F67A 2RT3A 4EWTA 2AGOA 2BZ2A 3LWMA 1S97A 4A8YA 1TL7A 4OHZA 2CVEA 5H1SV 3PO5A 4CYUA 4GVBB 2SXLA 3EDRB 4JUZA 4WPAA 2VIHA 2FLLA 4P74A 1S7IA 4KGZB 1IBKJ 5IT9Y 2J7WA 4GVBA 3DNCA 4I4BA 4RNOA 2E1MC 1TL4A 3DRXA 1M5SA 1KEKA 4ED5A 5DZ6A 3KG4A 3TAQA 4M5JA 4J9SA 1X7VA 1F9FA 4QYRA 3HI9A 3HF5A 5E0OA 3MEKA 2DHSA 3TX8A 1LWFA 1N4LA 2AGPA 3R5BA 2KT2A 1DLOA 1S1UB 3JAMY 2J6SA 1FJEB 3J81Y 3FQLA 4ECRA 2VFUA 2YNHB 3G2XA 2E44A 3Q89A 4USKA 3PYGA 2L9DA 1KVJA 3MEGB 1MWYA 4WIIA 1NO8A 3RB0A 3NL0A 3KKFA 3QSYB 5M2RA 1PO6A 2OSQA 3QZ8A 1UA1A 2CQDA 3RAXA 3BV8A 1PGZA 3AAWB 3MM8B 5B0EA 4OX7A 5GAHU 1CJKB 1QVFR 4B3RJ 5L1KA 3BGRB 2K06A 4KE5A 5CABA 1H72C 1KFDA 1M5HA 4M5DA 2PFDA 2V6AA 3LAMA 2HHQA 3DLGB 2UVVA 1IQTA 4X84A 3BGRA 2UVRA 2BW2A 2D9OA 1N32F 1KVKA 2GQCA 3LWLA 4HACB 2OMOA 1XBWA 4BWMA 1IBCB 3EVMA 1NH8A 5MAOA 3MZIA 3A3PB 3AB2B 4HACA 2OPRA 5C42B 2ALZA 4RNHA 1N56A 1WF1A 1SC1B 3MTKA 5H9FK 3NY0A 3FK4A 5LJ5Y 3PHTA 5D78A 2NS1B 2G1HA 3DOMA 3NGDA 4ZP8A 1LW2B 3M32A 1GMWD 2AJ0A 3ENWA 5ETRA 2RU9A 3HHLC 3JQKA 1D1UA 3IS9B 1LW2A 3GIRA 2VODA 3AJ1A 2NREA 3KHHA 2CJKA 4B9NA 3KMSA 2ZBIA 1N33F 3M6XA 1V5VA 3IS9A 5LMNJ 1XMOF 1VQ5S 3SI8A 2VBWA 5IZHA 3R9LA 1WOPA 1LW0A 1F9HA 3W9IA 3GJSB 2PA8D 2DHGA 3OQ2A 3NS5A 2AYEA 2IFXA 3MM6A 4LREA 1N52B 2Q79A 2J9CA 3QQCD 1TK0A 3MR3A 1G4CA 4DN0A 4V1Ak 2M8HA 5FJ4A 1NKBA 3E01B 3HLUA 4HH0A 2ZNYA 3LQVA 5AE2A 1W7WA 1TAUA 4KO0B 1BXNA 3QIPA 3QRQA 1V5IB 1RWPB 3PIOQ 4WU2A 5A8RA 1UTAA 4F3MA 2ILZA 2DB1A 4Y2IA 4KO0A 4JI0J 5DLFA 3UPFA 2XYHB 4QWAA 1UVJA 1TL3B 4FNHA 1ZPWX 5ETTA 3NBPB 1UZHA 2MZRA 4CH1A 3JXOA 3PYDA 1Q16B 2VC1A 1KFSA 3MMAB 3KK2B 2VA3A 3FNNA 3UR3C 1XNRF 3MUTP 2DRDA 2DXFA 5HANA 1UVLA 4MK9A 1DQ8A 5GAGU 3EVWA 4RLEA 2VG7B 3MMAA 5C25B 1QM9A 4HDHA 2AYGA 1EAYC 1SIWB 4OX8A 3DN9A 1NK7A 2BVZA 5LOQA 4A48A 1VC6A 1KLMA 5C25A 4EFAC 1DHMA 4ZLJA 2WW8A 8ATCB 1AXQA 1JLQB 2B3TB 4WIQA 4ED3A 3CXCR 3VAMA 4A47A 2EW9A 1FJGJ 5IWAF 2PGCA 2Y8WA 5KFAA 2DXDA 3QYYA 1PBUA 5B7WA 4LQ9A 3X1LB 3FCVA 4PYAA 2B9WA 3OT9A 2PMZD 1VBXA 3CSKA 1NNDA 4WFXA 3MCNA 5GMEA 2WSCC 3IWLA 3TA0A 3OR2A 1ROFA 2N7CA 3ISND 3GE9A 4JI2F 1U25A 3NCQA 1YBUA 2QMWA 4LR7A 2JLEA 3NGSA 2HFSA 3LTOA 3VHQA 5BR8J 3D54A 4CO1A 2R7TA 1AFIA 3H40A 1Y7PA 1JJHA 1UKUA 4ZMMA 2DNGA 5KG5A 1A9NB 1KQGB 2YNIB 3BR8A 1F2HA 4FF2A 3PJ9A 4K0KJ 4B3TJ 1Z4UA 3PJXA 4NXMJ 2XM3A 1EQMA 4P2FA 2YNIA 3CD7A 4ZCLA 2QGFB 2HURA 3HHDA 1RADB 4FBUA 1HYSB 2HWTA 3ZZUA 4DR5F 3GIJA 2CUYA 2ALYB 1ZAXA 1RWXB 4P6QA 2RJZA 2F8MA 3MM5B 4ZPWR 3MPWA 1J5OB 2WSFC 1GK8A 1SXLA 1VQ6S 1UWAA 5H9EJ 1M1GA 3M6WA 3PEJA 3MM5A 3LGMA 2QLWA 3CJKB 5EWFA 2I8EA 2OPSA 4QPTA 2AJ2A 2G13A 2VONA 1UETA 4X64J 4RW8A 1YKWA 5J2PB 1KNZA 2XC9A 2XLKA 2DNHA 1Y10A 4G1QB 4C0OC 1ZA2B 3NNCA 1T9YA 3A1YG 1YIJS 4DR4J 4GO7X 5IQQA 2R7VA 3T9ZA 2HQDA 1H73A 3HCXA 2HFZA 1AZSB 5KFWA 3SXLA 3MPUB 3G8SA 4ES3A 4M5KA 4LRDA 4PQUA 3CCMS 1CULB 1DZ5A 3B4DA 4KGXB 3JSMB 2MB0B 1Y5LB 5KFJA 1RT5B 4RBTA 2GVZB 3DU5A 2CQ2A 2V9KA 3HM9A 2BQ3A 2FUG9 3JSMA 4Q7AA 2V4RA 4HI2A 1FTCA 2Q43A 2AJQA 2C2DA 2HNYB 5K8PA 4FVCA 2BJ3A 3I4PA 2ZWPA 4ZJQA 2N82B 2QA4G 2M3DA 1IBKF 5ETQA 2RRNA 4OI3A 2HNYA 3WHIA 1S59A 1NK5A 3B82A 3W64A 5IXUA 1NHKL 2PSZA 3M1VB 4ZVTB 1HNZJ 2XHCA 4LT6A 1MG7A 1T8EA 5HMYA 3MPYA 4WFBQ 4QWEA 1NB7A 5C2GA 4DF8A 3IAS9 1X4BA 1HW9A 1NDLA 4HTIA 1S1TB 2DNRA 1WHYA 3DRPB 3K89A 2XLIA 4CO4A 2GVDB 3O8WA 2HNZB 4ECUA 4ZITA 2AHOB 2CPHA 1WHWA 1JB0C 4MTPA 4MJKA 2DIVA 4WE1A 1HWIA 3GIMA 2HNZA 4NL5A 4LF7F 1QAJA 2VQEJ 1TUGB 2WAQD 1E6YB 3OUYA 4I64A 4B3RF 2DH8A 4RBVA 1JXLA 4ZIWA 2QFIA 4A8OA 5F9NA 1QLNA 3T1YJ 3M9MB 3BN4A 1YDLA 3KMQA 3PKMA 3E8OA 2ILYA 1VQ7S 2NXUA 3IWXA 3R3TA 4Q5VA 3LP1A 2NZ4A 2CPDA 2NXNA 3Q86A 1CBKA 4LSNA 4NASA 1RWOB 1HNWJ 1GXTA 1WC1A 3TNVA 1K8AT 3A8JA 1MMLA 2V68A 2DO0A 1NXIA 3M2RB 1JLBB 1SKRA 2CQ4A 5KG1A 5DDQC 2H51B 1IKYA 2AX1A 2G2ZA 2KI2A 1NHVA 4MH8A 4ECYA 3M2RA 2OJ3A 3RRGA 1JLAB 3J81j 2WOMB 5AE1A 2V4JB 3J7A1 5CZVA 2WHOA 1P1TA 2BE2B 4DZ6A 4ZPVR 4JI4J 2ZKUA 1R6VA 3WIVA 4YR0A 4C7QA 4DLEA 2OIHA 2HVHA 2GZOA 2YWKA 1BY9A 4MKAA 2VPYB 2ZC3A 3SQGB 2QA4S 4N41A 2XTJP 5LMNF 7FDRA 4TYBA 2OAUA 3RYLA 4NLUA 2A18A 4WU3A 3C66A 2MQNA 1TKZA 1M5KC 4Z7YA 3M8WA 4RUAA 3SQGA 2R8IA 3NOCA 2E1CA 2ZD1B 1S48A 4KGKA 1VK8A 1RWMB 2ZE2A 2F4VJ 1AA1B 2QX0A 3CJSA 5F3ZA 2IJFA 1UPPA 3GG0A 3H5XA 2ZD1A 4DL6A 3G96A 3CB4A 1SJRA 4CLLA 3Q2SC 1QJHA 4WTOB 4B9TA 4K4ZA 1U1OA 4AD6A 3KDOA 1EB0A 2XNRA 3TYTA 1U48A 2ZH5A 1NJXA 2X51A 4FDFA 2YH1A 3QJLA 1FNOA 4JI6J 4TY8B 4JV5F 2V8DA 5E3QA 4NX9A 3HFVA 1UMJA 4IH6A 3G87A 4NLGA 4JI0F 3FBEA 4JI5J 2X3GA 5IT9U 3GJTB 3HSJA 1R0AB 2V5HG 1ZM3A 1Y00A 1LKZA 4K4UA 2QJ3A 2J9DE 4U7CA 1XEZA 2GQ2A 2OEMA 3JTOA 1RYSA 4LJMA 4DUYJ 5AT1B 2HGLA 4F2SA 4NRUA 1HIYA 4JP8A 1R0AA 3PRVA 3N4WA 3IR7B 3S6EA 4CO5A 1ZM9A 5D4PA 4DG1B 4NLXA 3HO1A 3T1HJ 3IGVA 4RUHA 3ILJA 3UI3A 3JAMU 2P5VA 3J81U 4A8FA 1M5OC 1EIYB 3S01A 1QAIA 3QRRA 3IA0A 1RHUB 4M5MA 2QO3A 1JX4A 1RWVB 2E29A 1FF2A 1CJTB 1KR4A 3NLCA 5GMDA 3SCLE 5HL7Q 3THVA 3MEEB 2J7UA 3Q22A 4H4OB 5HMWA 1FJGF 4ZDNA 5EN1A 3OXLA 1RTJB 5HATA 3C46A 5KFMA 1RCXB 1D3WA 5F8NA 3W2VB 5J2QA 1HBMA 3SSQA 5J1EA 3DDIA 2OEJA 1U02A 3UDEA 4N8NA 3CVKA 2XCPA 1S0MA 4IOCQ 1S1XB 5BXIA 4ZK7M 2WVEA 3TP2A 2VKRA 2XYGB 1ZTWA 1TUVA 2XULA 3CCES 2KVIA 2CG4A 1IVZA 1U7LA 1S1XA 1OPZA 4CLTA 4JI1J 1TL1B 2EXUA 1U26A 2PN6A 2W7OA 2YQ3A 5FIIA 1OSDA 2UUCF 2MZJA 5EGYA 2CNOB 5EWEA 3GV5B 4QR1A 1NKEA 2WONB 5BR8F 5HQ8A 3FDSA 5EDWA 3MR6A 1ZA1B 1UWBA 3TI0A 5A2QY 4DUZJ 1TFWA 1UAWA 4LR8A 3CIMA 3NP5A 4URQU 4K0KF 4B3TF 2XZDB 2FJEB 4NXMF 2VASA 3GIKA 2IAJA 4M5IA 2R2TA 4ZCIA 4K50A 1HNIB 5B0GA 1Z1ZA 4WTYA 5HQMA 2AKWB 2CQ3A 2DNPA 1FFGB 2RB7A 4R5PA 2K1RB 3H5UA 4JI7J 1VRUA 3M2UB 1VK3A 4U9RA 1LFWA 1YJUA 2EI5A 2HVDA 3H20A 5BJRA 5GVQA 2K1RA 2HS4A 3SQOP 3W60A 1EARA 2E1RA 1JQGA 1AB8A 2I1RA 3R6LB 5HBMA 4UOFA 2PFFB 1E6VB 4ED7A 2ZOMA 1VC0A 2FB0A 1IQZA 3PG9A 2KXFA 4X64F 3CC2S 2D9PA 2HQCA 3TX0A 2F65A 4F8RA 3ZTSA 3W2WA 2B4OA 2FZKB 3BYPA 4RUCA 1BQMB 4DR4F 2BV3A 4DL5A 3HZGA 2RQMA 3G71S 4DFMA 1RACB 2NXCA 4EZ6A 4ZP7A 1WC0A 1HHQA 2RNEA 3TRGA 2A6OA 1KTQA 4RBUA 1NH7A 2FJXA 1RLCL 1VQPS 2H4YB 1GFWB 2XI3A 3P5BP 3W63A 3VCDA 2J76E 2JSXA 1U6BA 3L95X 2ZBQA 4Q0BB 3AQPA 5D77A
chains in the Genus database with same CATH topology
3IMQJ 4KYZA 1FJGJ 3T1HJ 4LF6J 4KHPJ 4YHHJ 3JAMU 1HNZJ 4LFBJ 2KL8A 3J81U 2F4VJ 4DR4J 1XNRJ 4JYAJ 4LFAJ 1N32J 4K0KJ 1HNWJ 2UXCJ 4B3TJ 4JI0J 1N34J 4NXMJ 1IBLJ 4DV7J 4DR1J 3D3BJ 4LF5J 3J80U 4LF4J 4RJVA 2UUBJ 2HHHJ 3W1YC 1IBMJ 5IWAJ 4X65J 4B3MJ 4B3RJ 2UUAJ 4LFCJ 5LMNJ 4JI3J 4JI8J 2MTLA 2VQFJ 2UUCJ 4DV0J 1IBKJ 2UXBJ 3R2CJ 3J7AN 4DR2J 1XNQJ 4NEZA 1HR0J 4DUZJ 3OTOJ 5LMUJ 4JI6J 4OX9J 4HHUA 2E5LJ 4DR7J 4GKKJ 4B3SJ 1I94J 4LF8J 4X66J 4JI4J 4DV3J 5AJ3J 4NXNJ 4JI5J 4DR6J 2VQEJ 4YY3J 4DV1J 4DV4J 1HNXJ 4DV6J 2MEWA 5IT9U 5A2QU 4NEYA 4LF9J 3D3CJ 1N36J 2UU9J 4V1Ak 3R2DJ 2KVQE 4DR3J 4JI7J 4DV2J 2ZM6J 4DUYJ 4AQYJ 4X62J 4JV5J 2UXDJ 4JI1J 4KY3A 5LM7E 5BR8J 1N33J 3T1YJ 4DV5J 4PWWA 4JI2J 4X64J 4LF7J 1XMOJ 4DR5J 1XMQJ 5FLXU 1J5EJ 4GKJJ 2MQ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IMQ J;  4KYZ A;  1FJG J;  3T1H J;  4LF6 J;  4KHP J;  4YHH J;  3JAM U;  1HNZ J;  4LFB J;  2KL8 A;  3J81 U;  2F4V J;  4DR4 J;  1XNR J;  4JYA J;  4LFA J;  1N32 J;  4K0K J;  1HNW J;  2UXC J;  4B3T J;  4JI0 J;  1N34 J;  4NXM J;  1IBL J;  4DV7 J;  4DR1 J;  3D3B J;  4LF5 J;  3J80 U;  4LF4 J;  4RJV A;  2UUB J;  2HHH J;  3W1Y C;  1IBM J;  5IWA J;  4X65 J;  4B3M J;  4B3R J;  2UUA J;  4LFC J;  5LMN J;  4JI3 J;  4JI8 J;  2MTL A;  2VQF J;  2UUC J;  4DV0 J;  1IBK J;  2UXB J;  3R2C J;  3J7A N;  4DR2 J;  1XNQ J;  4NEZ A;  1HR0 J;  4DUZ J;  3OTO J;  5LMU J;  4JI6 J;  4OX9 J;  4HHU A;  2E5L J;  4DR7 J;  4GKK J;  4B3S J;  1I94 J;  4LF8 J;  4X66 J;  4JI4 J;  4DV3 J;  5AJ3 J;  4NXN J;  4JI5 J;  4DR6 J;  2VQE J;  4YY3 J;  4DV1 J;  4DV4 J;  1HNX J;  4DV6 J;  2MEW A;  5IT9 U;  5A2Q U;  4NEY A;  4LF9 J;  3D3C J;  1N36 J;  2UU9 J;  4V1A k;  3R2D J;  2KVQ E;  4DR3 J;  4JI7 J;  4DV2 J;  2ZM6 J;  4DUY J;  4AQY J;  4X62 J;  4JV5 J;  2UXD J;  4JI1 J;  4KY3 A;  5LM7 E;  5BR8 J;  1N33 J;  3T1Y J;  4DV5 J;  4PWW A;  4JI2 J;  4X64 J;  4LF7 J;  1XMO J;  4DR5 J;  1XMQ J;  5FLX U;  1J5E J;  4GKJ J;  2MQ8 A; 
#chains in the Genus database with same CATH topology
 1XR6 A;  3VGT A;  1J27 A;  4HT5 A;  5AXK A;  2IDL A;  4PG6 A;  4Q0B A;  3MM7 B;  3SDE A;  4J9Q A;  2GHP A;  2BYC A;  2QLF B;  3N6L A;  4Y28 C;  2DIT A;  1SL0 A;  4CO2 A;  4F4X A;  2B6A B;  2AJ4 A;  4YUD A;  3MM7 A;  1XIQ A;  4KB7 A;  5F41 A;  3T1A A;  1Q79 A;  2UVW A;  4CNY A;  1M5V C;  3H25 A;  3KLG A;  3SCK E;  2KXH A;  1FWP A;  4DQR A;  3TJ9 A;  2H1Y A;  4QBU A;  2CZ9 A;  2YX1 A;  4O4R A;  1R43 A;  1VBK A;  3V4I B;  2NUU G;  1HNZ F;  2VG5 A;  4ZLN A;  1VQS A;  3H5Y A;  1R0C B;  3EIC A;  3VQS A;  3CC7 S;  4PZV A;  1RGV A;  3TZZ A;  2UV8 A;  3KLE B;  4X62 J;  1N88 A;  1WJ9 A;  2JLG A;  2RH3 A;  1RDR A;  2HND B;  4C98 A;  1DTT B;  4ECV A;  1X5T A;  1Y11 A;  2YH0 A;  1H2T Z;  2RE1 A;  1ELO A;  2XSF A;  3MMC A;  1KQS R;  3EVO A;  5JVH Q;  4YN3 B;  1P9Y A;  2UUA F;  2C2Z B;  1KQF B;  4C11 A;  3PRB A;  4O3R A;  4YS2 A;  1N34 J;  3HZE A;  1XQI A;  1DY3 A;  1M1K T;  1B0V A;  1EQ0 A;  2HHH J;  2QC3 A;  5KAK A;  4RW6 B;  1KKH A;  1RA7 A;  4H4K A;  4DV4 F;  2HWI A;  4OZ5 A;  4IH7 A;  5D4L A;  2XMK A;  5A0Y B;  4EBE A;  2P6T A;  4Y34 A;  1QTN B;  4ZVH A;  2CPJ A;  4YR3 A;  4EBD A;  1HNW F;  5B0B A;  5C24 B;  2EEY A;  3GJQ B;  3R7B B;  5KT6 A;  2AJF E;  2W2N P;  1FJC A;  4KHR A;  4C8Y A;  2APO A;  4BWJ A;  4PWD A;  3CUL A;  4AQY J;  4IG3 A;  5A76 A;  2ASJ A;  3FJ2 A;  1AYE A;  3ZNJ 1;  3CME S;  4WKY A;  1D9A A;  3NMR A;  1UCN A;  3I5A A;  2EVZ A;  1TV6 B;  2RUS A;  3IGN A;  3OTC A;  4JI4 F;  2OEL A;  1NUE A;  4TQR A;  4LQ3 A;  4ECT A;  1LV5 A;  4DFJ A;  4JV2 A;  3M9N B;  3TWZ A;  1ZPV A;  2KZM A;  1ZH5 A;  1Z2L A;  1IBM J;  1ARO P;  2G0I A;  4X65 J;  2W2Q P;  1RWU A;  1FNX H;  5EUH A;  1YJ9 S;  4MT1 A;  5LSR A;  1EKR A;  1BD6 A;  1FNM A;  2FVQ A;  2DNK A;  4J90 A;  2VZ9 A;  1HBO B;  2YTC A;  1VJW A;  4IYQ A;  1Q53 A;  5CQG A;  1RT1 B;  2KM8 B;  1VQK S;  2WVF A;  4WF9 Q;  3HX9 A;  3T6B A;  4FYV B;  3ZFV A;  1YJW S;  3D5M A;  5ETS A;  2Y9H A;  4CH7 A;  5SUH A;  5E7O B;  1AT1 B;  4N77 A;  4DSK A;  4E0D A;  3OD2 A;  2E9T A;  3G9C A;  2RDI A;  4O3N A;  4A8M P;  2VU5 A;  1RTI B;  2MKJ A;  3D68 A;  1QUV A;  2JVO A;  3GFH A;  4PUO A;  2V8H A;  2LDI A;  2BE9 B;  4JI6 F;  2HG4 A;  2VBZ A;  4DQS A;  3PV8 A;  2C2O B;  1TKT A;  3KDN A;  4J9U E;  4JI5 F;  5HLF A;  1NPR A;  2HZV A;  5KFZ A;  3WC0 A;  5JUM A;  3CJ5 A;  1XR7 A;  4EU0 A;  5CD4 A;  1NLK L;  4DUY F;  4X66 F;  3PX6 A;  2BAN A;  3N28 A;  1RT6 B;  3GSI A;  5DGA A;  4IUF A;  2HRT A;  1X8D A;  4HH1 A;  2W9B A;  3MED A;  4ED8 A;  4J7C A;  3W3S A;  1R8A A;  1S1W A;  2VBY A;  3OSN A;  4YEA A;  1IKW A;  3K5P A;  1UJ5 A;  2YVS A;  3CW2 C;  5T7L B;  3GR1 A;  1H2U X;  1KTV A;  3GCX P;  4PCQ A;  3GYN A;  1U1K A;  3WC2 A;  5LXR A;  3M4X A;  4O4G B;  4ZPC A;  2YPZ A;  2HHS A;  3EZO A;  2HVZ A;  1VCT A;  3J7Z 5;  3NKY A;  2J0W A;  3C14 B;  2E7V A;  1EET B;  4O4G A;  5F0W A;  3I9Z A;  1NB2 A;  1XMQ J;  4Y3C A;  1OSC A;  4U96 A;  4A8S A;  2XHW A;  4DL3 A;  3K57 A;  3QRP A;  3N5B A;  4ID5 A;  1YK9 A;  2VPW B;  1W2B R;  2AEM A;  3C14 A;  4DZD A;  2FY1 A;  1EET A;  1OPI A;  1WC6 A;  2UP1 A;  4DOZ A;  4K4X A;  3CJ3 A;  2MQM A;  2OTL S;  3BQ0 A;  3I55 S;  3PO4 A;  1ICE B;  2C42 A;  1ZS6 A;  1FTR A;  3I0R B;  4IR9 A;  2RQC A;  2RS2 A;  2M2B A;  3KLF A;  3AQO A;  1YJN S;  2XWY A;  1F1B B;  2NYH A;  1X4D A;  4JI1 F;  2XB2 D;  2YQ0 A;  2FHK A;  4R8U B;  3BBC A;  5EHH A;  1NSQ A;  4ETX A;  5KFU A;  2ZH9 A;  1FES A;  1NK9 A;  2DCL A;  2W7A A;  3VWS A;  2VKZ G;  1IKV A;  4R8U A;  4WFN Q;  3WIU A;  2HMI B;  3IG1 A;  4K4S A;  4QJV A;  3CJR A;  1MU2 B;  5KFY A;  4AFF A;  2IY5 B;  2MY7 A;  4BC7 A;  2QLB B;  2JL9 A;  1JLF B;  5KFV A;  2H48 B;  3CJ2 A;  5BYS A;  4NCB A;  3MEC B;  2MDA A;  4DUZ F;  4E98 A;  1TK5 A;  1FJ7 A;  4ETZ A;  3Q2T C;  1BUX A;  1SJ1 A;  1CG2 A;  3DDK A;  4F26 A;  1U47 A;  2DYA A;  4JYA J;  4LFA J;  1B3T A;  3UVJ A;  1FRX A;  2KFY A;  2OSR A;  4KV8 B;  3GP9 A;  3M8Q A;  3B4M A;  2ZVI A;  4C3K A;  3VGV A;  2YXL A;  4JI7 F;  4ZS6 A;  4G6V B;  2EK6 A;  3DM2 A;  3V6D B;  1IR2 A;  4CNZ A;  4KV8 A;  2JC1 A;  3TA1 A;  3MUR P;  2C1E B;  2R7R A;  2JEI A;  1IWG A;  2EWH A;  2B4U A;  2XQC A;  4F3Q A;  2QG9 B;  3I9V 9;  4FKY A;  4KH0 B;  2XY5 A;  3TUZ C;  1EHW A;  2FLO A;  4B08 A;  2B9Y A;  4O23 A;  2ZHA A;  1Q0N A;  2HQ3 A;  1GEH A;  4NXN J;  3UD4 P;  1P27 B;  4J9L A;  1ZM4 A;  4G1I A;  3SIP B;  1WG5 A;  2D3O R;  3RB4 A;  4DR3 J;  3QLH A;  3HHL B;  2OH2 A;  1GXU A;  1LXN A;  4NLO A;  2WK4 A;  1D09 B;  1N6Q A;  4FN5 A;  1SUQ B;  3GON A;  2UZA A;  4MYT A;  3HHL A;  3HP6 A;  5F8J A;  5H9F J;  1HPZ B;  2V8P A;  1NJY A;  1RA6 A;  4PXC A;  3GV8 B;  1NSA A;  2ROP A;  2GHW A;  3ZXW A;  1HPZ A;  1U0H A;  4Y0F A;  1VIO A;  1U2F A;  1UFL A;  3RW6 A;  4CLF A;  2HGM A;  4PG5 A;  4WP8 A;  4WCE Q;  1DBD A;  1DFD A;  2HRU A;  1HWJ A;  4IQM A;  2VQF J;  2NUH A;  2I5J A;  2B5J B;  2UXB J;  2JX2 A;  2W4D A;  2E9R X;  1CJU B;  2BJ9 A;  3E2E A;  5T41 A;  3GJR B;  3DGP B;  1UZD A;  2B5J A;  1TZ0 A;  1I94 J;  5CHC B;  3ONQ A;  3S7R A;  3FRY A;  4YY3 J;  1JKH B;  3DGP A;  5I42 B;  3BGO P;  5D0E A;  4X4N A;  1WF2 A;  3J7Z T;  3BYR A;  1K73 T;  1H0H B;  3CDE A;  2ZM6 J;  3TR5 A;  1MRO A;  4DCJ B;  3BKU A;  4KIA A;  3CCV S;  4Y00 A;  3FEY B;  1RAB B;  4OV1 A;  1BC6 A;  3DRR B;  2AW0 A;  1Q8L A;  4TY9 A;  1KP6 A;  2QIF A;  3NAH A;  3HVT B;  4YB6 A;  3ETM A;  4HEA 9;  1BGX T;  2UXC J;  1CQM A;  3ISZ A;  4XIU A;  3UCZ P;  5D6G A;  2LA4 A;  3DRR A;  4LF4 J;  1S4F A;  3HJV A;  4X62 F;  1F0X A;  1BQN A;  4DV3 F;  5B0F A;  4LFC J;  5K14 B;  3KXD A;  2O67 A;  2ZH6 A;  2QMU B;  3AOB A;  2GJ2 A;  2HHT A;  1N5Q A;  2R2R A;  5K14 A;  3Q8V A;  3D28 A;  2QMX A;  4ELT A;  1S0N A;  1PIL A;  3I87 A;  2DNZ A;  3LP0 B;  1N34 F;  1KHV A;  4RL1 A;  4PXB A;  5A2Q U;  2CZ4 A;  4UQT A;  2HHH F;  1N36 J;  4XDC A;  3N6M A;  5L9N A;  5I3U B;  2ACM A;  2CQC A;  1SV5 B;  1C0U A;  5DG9 A;  4QR2 A;  3JYT A;  2R8H A;  5IC4 B;  6FD1 A;  4B3O B;  1T02 A;  5I3U A;  1FRI A;  2CQ1 A;  4OZ2 A;  2DJW A;  1SV5 A;  2IC3 B;  1IWA A;  2W4C A;  2BJ1 A;  4UZB A;  3ZZT A;  3H59 A;  4F2R A;  3U02 A;  4B3O A;  1BE4 A;  1HQU A;  4PG7 A;  4P75 A;  2CQB A;  2IC3 A;  5DGB A;  3P45 B;  2BEF A;  3A8K A;  4HVZ A;  2YWF A;  3MAA B;  3CPW R;  1WSV A;  5GAD U;  3HHE A;  3UR0 A;  2HHX A;  1RTD A;  2JFD A;  3JQJ A;  4PAA A;  2HFN A;  4IH5 A;  5KFN A;  1S49 A;  2WSE C;  5HVF A;  1X4E A;  5HK4 A;  4ZVR B;  3BBF A;  4RNM A;  4FYY B;  4F4K A;  4PPZ A;  4X2B A;  1TVR A;  1VDH A;  3N79 A;  2DY9 A;  5LXY A;  4RW4 A;  5DDP C;  4D3G A;  4ZVP B;  1EJ7 L;  1XTZ A;  4NWB A;  4P72 A;  1IBM F;  4X65 F;  4ZHR A;  2JHE A;  1N5Y B;  3DLK B;  2IJN A;  1RLD A;  3KLH A;  2DGV A;  5EWG A;  3ENV A;  2QYC A;  3A12 A;  4FXV A;  5IQ6 A;  5IC6 B;  3J80 Y;  3DLK A;  2ZNZ A;  3K5M A;  3CO9 A;  3OLB A;  3BQ2 A;  1BWE A;  4YR2 A;  1PG5 B;  2O1P A;  2EFV A;  3UCU P;  3NG8 A;  1MWQ A;  2JEJ A;  2CJA A;  2ZH4 A;  2BM1 A;  4F4Y A;  1SC4 B;  3Q8U A;  3R97 A;  4B9M A;  5KFI A;  4CO0 A;  2G0C A;  5AXM A;  4C8M A;  1Q82 T;  3KNA A;  3HHL D;  4XPE A;  4ILM A;  1REV A;  4OI4 A;  2LEA A;  4OHY A;  5HI7 A;  2F8H A;  2WB1 D;  1C1B B;  5AJ3 J;  4ILR A;  2G2O A;  2HAI A;  3QT7 A;  4DPY A;  4OZ0 A;  3GB0 A;  4HHJ A;  3F41 A;  4ZCK A;  2ZH2 A;  4KKO B;  3OHA A;  1C1B A;  5KG2 A;  1YJV A;  4C0H A;  1VI7 A;  4UY8 5;  3PM9 A;  3ILI A;  3MAQ A;  4KKO A;  1RWW B;  3BBB A;  2R8K A;  1Y3K A;  3PW7 A;  2JOQ A;  2IYG A;  3TJA A;  4I1T A;  2D41 A;  3QGG A;  2LEP A;  4ZP6 A;  2NR0 A;  1REG X;  3JSY A;  4TQS A;  3UCG A;  3TAP A;  1N8R T;  2FTR A;  1NK4 A;  3ADA C;  2WCX A;  1LWC B;  1NK0 A;  3O44 A;  2OD6 A;  4HHH A;  5IT0 A;  2R7X A;  2M5Y A;  4RJV A;  3MGJ A;  2W8L A;  1LWC A;  1VLY A;  3CCL S;  2CXE A;  2HPU A;  4JI8 J;  1XMQ F;  1TFY A;  2O01 C;  4DFP A;  2YWH A;  5J2N B;  1Y4Z B;  1TTH B;  2M7S A;  3CCR S;  5KOW A;  4QWC A;  4DBQ A;  2FVC A;  2DNN A;  2YKM B;  2J8A A;  4OX9 J;  4EYH B;  4GC6 A;  4YDX A;  2E1A A;  2XSJ B;  2KN4 A;  1NJI T;  2D3O 1;  1NPP A;  2PI5 A;  3BR9 A;  5J2N A;  2W8K A;  4DSI A;  2HS3 A;  2V2Z A;  3VAJ A;  4DV1 J;  1X0F A;  5D3G B;  2RVJ A;  4NLR A;  2ZKT A;  2MPU A;  3CDB A;  2GW8 A;  2VC0 A;  4DV2 J;  1FDB A;  2BMB A;  3O3L A;  3MPD A;  4FXW A;  1YBA A;  3RTV A;  1HQ2 A;  2BOA A;  4AYB D;  3OLA A;  4IQX A;  2N3L A;  3OJS A;  2RIJ A;  2AEF A;  3EGN A;  4LIR A;  1XC9 A;  5FD1 A;  3EPG A;  5DG7 A;  2MLX A;  2OPQ A;  2YNF B;  2GCF A;  4MKV A;  3EE3 A;  2RS8 A;  1QTM A;  3KK1 A;  1LWX A;  4OX6 A;  5IWA J;  4RR5 A;  3LGN A;  3Q8P B;  3GG1 A;  2D7S A;  3LAL A;  4NRT A;  2FHJ A;  3DOL A;  1S6P B;  1X5S A;  4RW9 B;  2Y3Y A;  3AOA A;  4JYA F;  4LFA F;  3V2U C;  4C6A A;  3ENQ A;  4I67 A;  1G1X A;  3DYA B;  3W9H A;  4DPT A;  1S9E B;  2I2Y A;  1I3O B;  3CNQ P;  4GKJ F;  3NGT A;  1T9W A;  4K2X A;  4K2J A;  1N5V A;  3IR6 B;  2NXE A;  5ADZ A;  1MSW D;  1S9G B;  3IRX A;  1UVN A;  5L39 A;  2FZC B;  5E3A A;  5CD4 H;  2IM1 A;  4JI2 J;  2GMJ A;  1S9G A;  4OI2 A;  3FZ2 A;  2MKC A;  4KT0 C;  3N01 A;  4DL2 A;  4NPO A;  4NLT A;  5F8L A;  4WXW A;  4NXN F;  1QUP A;  2ZOG A;  1YI2 S;  2ZVS A;  1LEO A;  3BO4 A;  2C2E A;  2XMU A;  2DRA A;  1RT4 A;  2VFR A;  2DY1 A;  3G82 B;  4TU9 A;  4DR3 F;  3HSZ A;  4MKY A;  3QO9 B;  1UVI A;  3BSN A;  4AND A;  4KGV B;  3ITH B;  1XR5 A;  1UEK A;  4WFY A;  3TVY A;  4XPC A;  3HJF A;  2BE7 D;  2KZZ A;  5JJB A;  4R25 A;  1IUJ A;  2V0N A;  2BQU A;  5HVH A;  1GTH A;  4HTJ A;  1FKA F;  2GO9 A;  3CJ0 A;  1YWX A;  1JLG B;  4YB1 P;  2AMC B;  3N6N A;  4JBC A;  2U1A A;  2KM8 C;  4OYI A;  3FEX B;  1RT2 A;  4LVO P;  1RWK B;  4L6V 3;  1PCA A;  2HRY A;  4ZKA A;  4K59 A;  2K7K A;  2OFG X;  2BJD A;  4YOE A;  3QT6 A;  2VQF F;  2UXB F;  4KPC A;  4CDI A;  4CLP A;  4X4S A;  1MMN A;  3FQK A;  1T9U A;  3HT3 A;  2GGP B;  3KYL A;  4IRD A;  3OV7 A;  2XS2 A;  1QD1 A;  3PNI A;  4WK3 A;  4I2P A;  2CFX A;  4UUX A;  1PC4 A;  3UDC A;  1U6Z A;  3VAI A;  1URN A;  1NAQ A;  2Q6B A;  3OTD A;  1HBN A;  3I6P A;  2ZM6 F;  2O5D A;  2J0S D;  1FRJ A;  4DR6 F;  1SCJ B;  3LGH A;  1KVI A;  3ZNU A;  2QL5 B;  1HWU A;  3ZZO A;  1HR0 J;  3NAI A;  3W66 A;  3OTO J;  2WRM A;  4CO3 A;  4V19 J;  5KFC A;  3M05 A;  2MSS A;  4M8L A;  4ZVE A;  2CAJ A;  3PR4 A;  1OMS A;  2D69 A;  4BLG A;  4QZV B;  4FBT A;  1U1P A;  2CIM A;  3VAH A;  5ETL A;  1U09 A;  4LF4 F;  4U6P A;  4NEY A;  4L76 A;  4FKX A;  1T3O A;  2DD8 S;  3HFK A;  3M8P B;  2ASD A;  4YB7 A;  1L3K A;  4DN9 A;  3M30 B;  2HQI A;  3M8P A;  4OJ1 A;  5IOL A;  1WHV A;  3A4T A;  1FXR A;  1FCA A;  4G3I A;  1X4G A;  4AL6 A;  1WKK A;  1X31 C;  1J2V A;  2XY7 A;  2EG1 A;  1IR0 A;  1N36 F;  2JVR A;  1WHX A;  2WVD A;  4XK8 C;  2M0G B;  2EKN A;  1FKO B;  1JK9 B;  1NJW A;  4KAI A;  2W7P A;  2AYM A;  2ACY A;  2HVI A;  2B4P A;  2W9A A;  4ALZ A;  4F02 A;  1FKO A;  5CXT A;  1T95 A;  1SVD A;  1S1V B;  3T3F A;  3J7A N;  5IT4 A;  1XN9 A;  4ECZ A;  1UFK A;  3BDP A;  3P3D A;  3CDU A;  3PY8 A;  2CPI A;  4EO6 A;  3FBF A;  3MMB B;  3BS9 A;  2HWH A;  2W25 A;  2I6W A;  5F8I A;  3VQT A;  4IG0 B;  1S1U A;  4ERD A;  2EG2 A;  1M1H A;  1HFE L;  4PG4 A;  1HD1 A;  2GHV C;  4TYA A;  4O0I A;  2YNH A;  4RU9 A;  3MEG A;  1HBU B;  2HBZ B;  2MGZ B;  2J5A A;  4LF7 J;  3UE2 A;  3L09 A;  4CIO A;  2FHJ D;  2GAG C;  4F0H A;  4TKT A;  4F4W A;  2YWG A;  3GYG A;  5B0C A;  2EFO A;  3RZA A;  3MM8 A;  3HHK A;  5LL6 d;  3OVS A;  4QWD A;  1PYT A;  1CJK A;  3FRZ A;  2IRU A;  4Q44 A;  1B99 A;  4ES1 A;  4OZL A;  4OV6 A;  1YZ7 A;  5HO4 A;  2X7I A;  5D8H B;  1IR1 A;  1TR0 A;  1F5C A;  1QE1 B;  2XMT A;  3OFF A;  3DLG A;  2PEH A;  1XNQ J;  1N0U A;  2DCU B;  2XMA A;  2H5I B;  3P8B B;  1RSC A;  3NWR A;  1S6O A;  4HL9 A;  4MKB A;  2FVR A;  2NPI A;  3PW2 A;  3NRB A;  3BQ1 A;  3V81 B;  4L3N A;  5KG0 A;  4LUB A;  2W2M P;  2G2Y A;  5CZX A;  4USJ C;  4DJB A;  3CED A;  4N56 A;  5HP1 B;  5C42 A;  1X9M A;  2CDQ A;  1VS3 A;  1H6K X;  3DCA A;  4QR0 A;  3UN5 A;  4NMX A;  1LXJ A;  5HP1 A;  1JLE B;  2ZBP A;  4QIE A;  2MLY A;  5E3P A;  4GVL A;  5D0G A;  3TAN A;  3RBX A;  2Y1I A;  4IOB A;  4XDD A;  2JEF A;  2R8J A;  4CWB A;  3F0N A;  1NZ8 A;  5AJ3 F;  1M0S A;  1WEY A;  4PEO A;  2VBX A;  4ES2 A;  4AXJ A;  1VQL S;  2OML A;  4CT8 A;  3K5N A;  1O6X A;  2HVE A;  5AXN A;  3W5Y A;  2XY6 A;  3W8G A;  2OPP B;  2JZ5 A;  4M5N A;  3GFX A;  1HMV B;  3DOK B;  3A8E A;  4CRJ A;  3CCZ A;  2Z56 B;  2VH7 A;  4LRA A;  3SYZ A;  3QJP A;  2E9Z A;  4Z2X A;  3PX4 A;  2MZ1 A;  2VG6 B;  1HLW A;  2CJ9 A;  1KN6 A;  1RK8 A;  2EFG A;  2V2V A;  3B6B A;  3GZ7 A;  5HJX A;  3E01 A;  2MZQ A;  1TEL A;  2V50 A;  1MN9 A;  2XO7 A;  4JV5 J;  4JI8 F;  1A6L A;  1U6F A;  4J9V A;  4QW8 A;  1NPK A;  5A8K B;  2OTJ S;  4M5H A;  1C2P A;  2ZBR A;  4K7Q A;  4OX9 F;  3F73 A;  1H7W A;  1U8S A;  3KWM A;  4DV1 F;  1TL3 A;  3NGU A;  2VPX B;  3NBP A;  4DX6 A;  4U8Y A;  2MJU A;  3NGK A;  2H3E B;  5DQG A;  3MOZ A;  1FX2 A;  4OIX A;  3TEH B;  1GXL A;  3EXC X;  1YVF A;  4K4T A;  2X1A A;  2KXN B;  3DMJ B;  4DV2 F;  2FJA B;  1V6H A;  3TO8 A;  2QSF A;  4ILL A;  3LAK A;  3NXZ A;  3TVK A;  2DR6 A;  1EZZ B;  3LPE A;  3KK2 A;  2GJI A;  1NZA A;  4USU A;  1SQE A;  3VAF A;  1TMJ A;  4C48 A;  4ZVO B;  1VQM S;  3CD0 A;  3MR5 A;  2VG7 A;  2R9L A;  4C0B A;  2PMW A;  4NLS A;  2ZZT A;  2MEW A;  3I5B A;  3O1L A;  4R0J A;  3Q8Y A;  1JLQ A;  3FKB A;  1X9S A;  3BSC A;  5LM7 E;  3CCS S;  1S76 D;  2GQQ A;  4Q2L A;  1U4B A;  1FRL A;  3LP2 B;  3W65 A;  5CYM B;  4PR6 A;  2M8D B;  3OL9 A;  3I4H X;  3FFI B;  3EM1 A;  4WZQ A;  1B7Y B;  1F2G A;  1OIA A;  2CRL A;  5CYM A;  4DV7 J;  1VYA A;  2GX8 A;  3K0J A;  3J80 U;  3C16 B;  3MCO A;  1CEZ A;  3T6J A;  1FHT A;  1U49 A;  3IM8 A;  4USV A;  3POT B;  1RBA A;  2HW3 A;  1RT3 B;  2PDA A;  2UUC J;  3V4M A;  3DLE B;  1VQ8 S;  1WWH A;  3K58 A;  2A6M A;  1TUW A;  3POT A;  2MMY A;  5T14 A;  4OI0 A;  3KTQ A;  4OI1 A;  4OYB A;  5E33 A;  3M2V B;  5M2P A;  3R5J B;  2FHO B;  2W2P P;  3K59 A;  4IO9 Q;  1SQF A;  2DR9 A;  4OJ3 A;  2VV5 A;  5K8M A;  3RR7 A;  1KOH A;  1B70 B;  3X3U A;  3ZO7 A;  5DO2 A;  3ET6 B;  4I6Y A;  4RU2 A;  1N48 A;  4FYW B;  3OFH A;  3W9J A;  1TKX B;  3DGV A;  5L9X A;  3HD1 A;  1HQE B;  3A3O B;  1YZ6 A;  5DM7 Q;  3K7R A;  3ET6 A;  3AOD A;  1FI4 A;  3KLI B;  1SKW A;  2J7K A;  3K2Y A;  2N7Y A;  2L3M A;  4MYU A;  1HQE A;  1HYS A;  4USM A;  1OJ4 A;  2DGU A;  2WVC A;  1HNV B;  1OY6 A;  3OSP A;  5ETK A;  2B7B B;  3UNG C;  2OLW A;  3W61 A;  5DDR C;  2MTL A;  1TU0 B;  2AX0 A;  3G6E S;  1VLO A;  3EJM A;  1GX5 A;  1M5P C;  2MQO A;  1ULR A;  1J5O A;  3D0H E;  3TAR A;  3QGH A;  5IV4 A;  4CTA B;  5F9L A;  1Y3J A;  5LJ3 Y;  2MQQ A;  1SQG A;  2YX4 A;  3DLJ A;  5KT7 A;  2DEI A;  3HVA A;  4U8V A;  1ZM2 A;  3QSI A;  2KO1 A;  4LF9 J;  2HZA A;  3R7S B;  2R4F A;  4NOH A;  3CJK A;  4P10 A;  4LF6 F;  2BKN A;  1RT7 B;  4OJH A;  3NNA A;  5J2P A;  4WKR A;  4LRB A;  1R7I A;  3FSI A;  4G1Q A;  4E8U A;  4DV5 J;  4DPW A;  5F0U A;  1HR0 F;  4QPX A;  2LXU A;  1RT7 A;  4A4J A;  3OTO F;  5DDO C;  2FJB B;  4B02 A;  3IMQ J;  1X4F A;  5D15 A;  2DHA A;  4LMZ A;  3M8R A;  5L38 A;  1NK8 A;  3R1H A;  4PYD A;  2DNQ A;  2DXE A;  2RHS B;  1AZS A;  2H5J B;  2LU1 A;  3NGR A;  3M6V A;  2RF2 B;  3W7B A;  2CQP A;  2J9D A;  3PFE A;  1CUL A;  4O3O A;  1SH2 A;  3FBC A;  1RT5 A;  3PTW A;  2GVZ A;  2YKA A;  4ZIV A;  5FDL B;  1GMV A;  3EUN A;  3S1T A;  4GKK J;  2V69 A;  2QTW A;  4F4A A;  1RI7 A;  3HD2 A;  1F5B A;  1F3F A;  4HDG A;  4J37 A;  1T03 B;  4BHQ A;  4B9S A;  1MWZ A;  5EX3 A;  4K8R A;  2KJW A;  4KHP F;  3DDN A;  4KRW A;  1FWL A;  4CLS A;  3QMQ A;  1H2V Z;  2QA1 A;  5B0A A;  5GAG I;  4DSE A;  4C8L A;  2Q1L A;  4N47 A;  2LQJ A;  3M1V A;  4QOT A;  1JJ2 R;  4ER8 A;  2ZH7 A;  1AFJ A;  5F3T A;  4N76 A;  2D3Z A;  4DU8 A;  2DR8 A;  4NML A;  4DPU A;  1SB6 A;  2B56 A;  2B0G A;  3D0G E;  1HAR A;  3BH7 B;  3PVX A;  3MI7 X;  1S1T A;  4TNO A;  3C6T B;  3BEG B;  1T9V A;  3DRP A;  2UUB J;  1R6Y A;  5B09 A;  3GSD A;  4N7T A;  3TUJ C;  2GVD A;  2UUA J;  4MIB A;  4DU7 A;  4EI2 A;  3C6T A;  4YDD B;  5DM6 Q;  1B4S A;  3TZW A;  1CLF A;  2DT9 A;  2C3U A;  1G3O A;  3DFE A;  2J9E A;  3KNG A;  4KC5 A;  5BYQ A;  1KD1 T;  1E6Y A;  2KYZ A;  2VF3 A;  1Q8K A;  3MTJ A;  4DV4 J;  2EFP A;  4N8O A;  2DNO A;  2XS7 A;  3PKY A;  4OQJ A;  3L7O A;  3QJJ A;  1ZAV A;  3H2U B;  2GIQ A;  2YWE A;  4MFB B;  3BZQ A;  2XMJ A;  3FBB A;  4LF2 A;  1UPM B;  2IM3 A;  4I2Q B;  2RRA A;  1XNQ F;  1P9Q C;  2ASL A;  4L72 B;  3CMA S;  4ZVQ B;  1HWK A;  1SH3 A;  3QAU A;  5CA5 A;  3WZ0 A;  1Y9O A;  4LVN P;  2WBR A;  1Q5V A;  3CCQ S;  3NMA A;  4TVA B;  2KL8 A;  1C1C B;  3GMG A;  2N4D A;  3G6V A;  2ZJP Q;  1JLB A;  2RAQ A;  3A8I A;  3MUV P;  3CJT A;  3CDW A;  1V3R A;  9RUB A;  3RBD A;  4EGL A;  3AJ2 A;  2G9O A;  2C2R A;  1U1M A;  1JLA A;  3MFI A;  2WOM A;  3T5H A;  1OWX A;  2FLP A;  2V4J A;  1MNE A;  3R2C J;  2QN6 B;  2YPY A;  2BE2 A;  1JJ4 A;  3D9B A;  4JV1 A;  2RIL A;  4B3S J;  2D74 B;  1UEU A;  4UOH A;  3Q0A A;  3NS7 B;  3US5 A;  2LQ5 A;  1TQL A;  3GFY A;  4N5S A;  3UDL A;  3H0P A;  4BCA A;  3J7Y I;  1VIX A;  4KR0 B;  3C6U B;  2HFV A;  3LO3 A;  1F5A A;  3TA2 A;  2BKP A;  4UOG A;  3UD5 A;  2A2D A;  2XO6 A;  2E5H A;  2YNG B;  3C6U A;  2R7U A;  1SI9 A;  2JRS A;  4I7F B;  2QEX S;  1RAF B;  2FD2 A;  1RIS A;  2EC0 A;  2LA6 A;  2Q3P A;  2LQ8 A;  2YNG A;  1KBR A;  4I7F A;  2MKK A;  2PA3 A;  4ITS A;  1NDC A;  2FVP A;  4KBI A;  3D66 A;  4ICL B;  2LQB A;  3FVY A;  3GIL A;  3JB9 k;  2IM0 A;  3TQ1 A;  4DL7 A;  4TY8 A;  3B78 A;  2EFQ A;  4NEZ A;  1OY9 A;  4DS5 A;  2OI2 A;  4DSL A;  3U27 A;  4X66 J;  4M94 A;  3D2W A;  2Y1L B;  3CDA A;  2VOO A;  3H90 A;  1B64 A;  3PFO A;  5ETM A;  3H98 A;  3UWT A;  1PIE A;  1Q86 T;  2AQ4 A;  1X5P A;  4OLO A;  1C4A A;  1MW7 A;  4PXE A;  4P9S A;  1SH0 A;  4DG1 A;  5CCM A;  3C2P A;  4O0N A;  1FDN A;  3D6T B;  4DX7 A;  2WB4 A;  3EX7 B;  2IMO A;  2H5E A;  2AWZ A;  3VAG A;  4B3M F;  4CCH A;  3RRK A;  1FRM A;  5G4D A;  1SJQ A;  1SPB P;  1CJT A;  2ZUG A;  3BGF A;  5KFE A;  4J9R A;  4LF5 J;  1NRK A;  1Q4R A;  4EEY A;  2ZWO A;  4ANC A;  3MEE A;  2PD1 A;  2E66 A;  4H4O A;  3I5C A;  1S7H A;  4Q43 A;  2XLJ A;  1RTJ A;  3VGU A;  4Y2A A;  4F0K A;  4MMO A;  2BOP A;  1VHF A;  4DR2 J;  2V2Q A;  2VFS A;  3W2V A;  2ZDP A;  1WG4 A;  2F40 A;  2ZHO A;  3AY0 A;  3SSS A;  3QWU A;  3H8Y A;  3IRW P;  4WZM A;  4DV7 F;  3H5S A;  2PC6 A;  3EDQ B;  4OZ1 A;  1HL6 A;  3O2I A;  1NCL A;  2VFT A;  2YY3 A;  1YJT A;  5SZT A;  1R89 A;  1RBL A;  2ASY A;  1LWF B;  4QIW D;  3HKZ D;  1TL1 A;  1DLO B;  2DNM A;  4Z37 A;  1D0E A;  4LF1 A;  5U47 A;  2M70 A;  4XO0 A;  3MUM P;  5B08 A;  3RB3 A;  4DV0 F;  1D9D A;  1NU4 A;  3GV7 B;  2WON A;  2D1C A;  1FRH A;  4OYP A;  2F63 A;  3EGV A;  4Q2M A;  4I6W A;  3AXM A;  5RUB A;  2LP4 A;  4CQ1 A;  4ZVG A;  4IRK A;  3H7H B;  3D67 A;  1H7X A;  3CD5 A;  2V94 A;  1CC7 A;  2R2U A;  4QIV A;  4M5D B;  2CPE A;  2Q6C A;  3OFG A;  4FP9 A;  1HNI A;  3N9U C;  2A2C A;  3PAC A;  2NXJ A;  2XGP A;  2QLJ B;  3M2U A;  2XZT B;  5KG3 A;  2F7V A;  2DGW A;  3RR8 A;  1S12 A;  4P71 A;  3FGV A;  4X4P A;  2OPR B;  2FC8 A;  3D0I E;  1JWW A;  1WSR A;  1GAO A;  4Q8E A;  4BC9 A;  1U2C A;  1UW9 A;  4K4W A;  2M4M A;  5E2Q A;  1E6V A;  4NYZ A;  2AF6 A;  1LNQ A;  3DOM B;  2A10 A;  4LF9 F;  3M32 B;  1IBL J;  3P49 B;  1H38 A;  3LOU A;  3TUP A;  3BRE A;  2H65 B;  2Z4P A;  5IFM A;  4DV5 F;  5KT5 A;  3CJQ A;  1U1Q A;  2RDJ A;  4DQQ A;  1BQM A;  2MY8 A;  4QCL A;  2CQ0 A;  3MWB A;  2QSW A;  5IM0 B;  2BAB A;  1RHM B;  4O3P A;  1WTF A;  3MHY A;  4EK2 A;  4LF8 J;  2B43 A;  1LW0 B;  4K5R A;  5IM0 A;  1WEZ A;  3EZU A;  3QNW B;  5G0R B;  4I69 A;  3IM9 A;  2KKH A;  2NSC A;  4J91 A;  1FVS A;  2ADB A;  3UNY A;  4ZLL A;  3THP A;  3MM6 B;  3LF0 A;  5G0R A;  2YKP A;  4NLP A;  2LXI A;  1F9E B;  4KH1 B;  4FS2 A;  5L46 A;  2C3P A;  1JNR B;  1HI1 A;  4GKK F;  2C2K B;  5HAO A;  1HI8 A;  4YHH J;  4DQP A;  3QIP B;  3MMJ A;  5DG8 A;  4JI3 F;  2Y0B B;  3T5J A;  2X1B A;  5A8R B;  4UUW A;  2MZT A;  2UVU A;  2B6A A;  5B0D A;  1VFJ A;  2RUG A;  3UW1 A;  5LMU F;  5KT2 A;  1JJC B;  2R8G A;  3QPI A;  1WOR A;  4OHV A;  2DK2 A;  2HHV A;  2F8E X;  1RAO A;  3FCH A;  3G6X A;  4RWW A;  1I51 B;  3DRY A;  2BRK A;  3AA8 A;  3V4I A;  3WBZ A;  1CPZ A;  1WC4 A;  2IPO B;  4QYZ K;  3ULH A;  3EGZ A;  4OYO A;  1QAX A;  3R5A A;  4LRF A;  4RPF A;  4UZC A;  2XZW A;  2E5I A;  3K5L A;  1X9W A;  3BDE A;  4DV3 J;  4HYK A;  1NBE B;  3O5T B;  4BDP A;  3KLE A;  2CG8 A;  2UUB F;  4NLW A;  4DQI A;  1UVM A;  3G8Q A;  3HVR A;  3D1O A;  1SBR A;  1FXD A;  2HND A;  1DTT A;  2HQF A;  3LAN A;  3QGP A;  2KT5 A;  1KLM B;  2HEK A;  3KG1 A;  4X4O A;  1L3U A;  3ILL A;  3NCP A;  1C4C A;  2M52 A;  2MZS A;  6FDR A;  5HMX A;  4F50 A;  4LFB J;  4WXO A;  5DZ7 A;  3HUL A;  1RAG B;  4WFA Q;  1RBO B;  2ZH1 A;  3D6M B;  1PBA A;  4RW6 A;  2C28 A;  4MIW A;  5HSP A;  3A13 A;  2R42 A;  5KFB A;  2DVI A;  5A0Y A;  4NLY A;  1X4H A;  3FEZ A;  1FA0 A;  2V8G A;  1IN0 A;  1WKJ A;  2XMV A;  2ABY A;  4FNI A;  1VR6 A;  1RAA B;  5L1J A;  4NE9 C;  5E41 A;  2WVB A;  3SCJ E;  3OR2 B;  5C24 A;  2ZHB A;  4LSL B;  2AZ1 A;  5BYR A;  2BJ7 A;  1HI0 P;  3L3C A;  2KB2 A;  2KVQ E;  3U7J A;  4LSL A;  4Q8F A;  1G7C B;  1WEX A;  1TV6 A;  5ETP A;  3OL7 A;  4W4M A;  2CVI A;  4IKA A;  3TOQ A;  1JIH A;  1U24 A;  2M9K A;  5K5M A;  1LQ9 A;  1CVJ A;  3WQP A;  4B3S F;  2RKI B;  5MLC V;  2LVW A;  4PQA A;  1PSD A;  3MDF A;  1IJE B;  3HXM A;  2RKI A;  3SZ2 A;  3D3B J;  4RKU C;  3TQE A;  4OYZ A;  5D4N A;  5ETN A;  1CS4 B;  3ZZR A;  1HBO A;  3OHB A;  3M7V A;  1RT1 A;  2LCW A;  3KG0 A;  4L75 A;  1ACM B;  3HVW A;  1CS4 A;  2DIU A;  2CNL B;  4KGM A;  3KLV A;  4CP5 A;  2PE8 A;  3I56 S;  4BBY A;  3T5K A;  4W92 B;  4B9V A;  4O44 B;  4OL8 A;  4NI2 B;  4DR7 J;  4ELV A;  2L41 A;  2F9J A;  2ZBC A;  5KFR A;  4F4Z A;  1EX8 A;  1HNX J;  1RTI A;  3AFG A;  5D0R A;  4O44 A;  4NI2 A;  3TW0 A;  1N5T A;  3UO0 A;  1T7P A;  4H54 A;  5DLG A;  3J7Y U;  3CE8 A;  1F6T A;  5CAA A;  1A0O B;  4FF1 A;  4ZN3 A;  2FJW A;  3CJ8 A;  4DSJ A;  2BUN A;  3HMJ G;  2OPS B;  2IVF B;  2ZDO A;  1RAI B;  3CTR A;  1OQ3 A;  4RW8 B;  3QFH A;  4CZC A;  3PR5 B;  5JXS A;  4C97 A;  4FYX B;  2K3I A;  2HHU A;  2B8P A;  2CWX A;  2HBY B;  2J8S A;  5LSL A;  2MHE A;  1RT6 A;  2P9G A;  4YFU A;  4CT9 A;  2C2N A;  2H9Z A;  3MM9 B;  3SV4 A;  2IRY A;  1FKP B;  1UW4 A;  4I68 A;  4CI0 B;  2UUW A;  3MM9 A;  2QL7 B;  1YSJ A;  1TL5 A;  3I96 A;  5T7L A;  4DMZ A;  4K4Y A;  4PQU B;  1FKP A;  3GII A;  1SL1 A;  2EBG A;  1FD8 A;  1Q5Y A;  5KFL A;  1I1G A;  2IBK A;  4LF5 F;  4ZPD A;  2QE5 A;  1FFS B;  5IS2 A;  2KTQ A;  3VZI A;  2AP6 A;  4P2M A;  1B0T A;  1S10 A;  3UQS A;  1S99 A;  2ZZN A;  1Q7L B;  4DR2 F;  3W5X A;  3JTP A;  4V19 X;  2IA6 A;  2RDD A;  3PZP A;  3DXB A;  2DGX A;  1S9F A;  5M2U A;  1NHU A;  3PIP Q;  4DFK A;  2FZG B;  1ZZN A;  4QW9 A;  2ZEJ A;  3AJD A;  2FLN A;  2Z2Y B;  2B8Q A;  4DR1 J;  3LUY A;  1ITP A;  1WG1 A;  3AB4 B;  4DCP B;  3I0R A;  2VL1 A;  4OYX A;  2AIR B;  3GPA A;  2P9E A;  3CMQ A;  3ZZZ A;  2CQI A;  4KFB B;  2QL9 B;  3ZTO A;  1YBT A;  1LK5 A;  5KFP A;  3CCW A;  4L3K A;  4NYO A;  3RW7 A;  4KFB A;  4DWI A;  4M5G A;  2LXF A;  4UT4 A;  4BS2 A;  2HMI A;  4CM0 A;  1MU2 A;  4ZN1 A;  3V6H A;  3GFZ A;  5KFH A;  4J9N A;  4DV6 J;  3UN2 A;  1JLF A;  2AJ1 A;  1ZAW A;  4WE1 B;  5K20 B;  1KHW A;  3MEC A;  2XWX A;  1DAR A;  1FT8 A;  1BMQ B;  3OUY B;  4OYM A;  3G8T A;  2IHR 1;  1VGY A;  3RGI A;  2ROG A;  3QAT A;  5GAE I;  4GKJ J;  3CGI A;  4ZVF A;  1RB0 A;  4XAK A;  1AUD A;  3ENA A;  2V67 A;  1R27 B;  2GO8 A;  3D6F B;  3LP1 B;  4CLU A;  1Y5I B;  2YKO A;  1Q8B A;  3P4U B;  4F7V A;  4LSN B;  2JDJ A;  3V6D A;  1BLU A;  4TLR A;  3D7S B;  4C3M A;  3CCU S;  1S5Z A;  2R3V A;  2JJ4 D;  3IBC B;  3EZ5 A;  1IKY B;  5CCL A;  1UJ4 A;  1Q78 A;  1PAU B;  3U1M A;  3T9N A;  1Q1K A;  2BXJ A;  4CM2 A;  1FWK A;  2HBR B;  4A8Q A;  2Z8Q A;  2Y1J A;  3FMW A;  3U1L A;  3IO1 A;  4U7U K;  2DGO A;  1WTB A;  1G6B A;  1RJJ A;  1IBL F;  3DI6 B;  3I0S B;  2YQ1 A;  4ENO A;  1Q81 T;  2RSQ A;  2DTJ A;  1CQN A;  4J9O A;  1U1L A;  3DI6 A;  2JFK A;  3I0S A;  1OYD A;  3R1L A;  3PJW A;  1H98 A;  3RU0 A;  2KG0 A;  1YHQ S;  1SUQ A;  2I0X A;  1YJR A;  3QFW A;  4P52 A;  4LR9 A;  5AXL A;  4R0E A;  3EMT A;  1J5E J;  1FVQ A;  4MIA A;  1TK8 A;  4FF4 A;  4USW A;  1TKZ B;  3CCT A;  4LF8 F;  2OFH X;  3AOC A;  2L9N A;  2R7S A;  3H42 A;  5AE3 A;  2MHN A;  3OXF A;  2G4B A;  2ZE2 B;  1SKS A;  3TVZ A;  2WTF A;  4DPO A;  4NCG B;  4TN2 A;  2IYI A;  1F60 B;  5C7P A;  1CJU A;  1NSP A;  3BSO A;  3NNH A;  1FK9 B;  3UDV A;  1T3N A;  3U1N A;  3ZZY A;  4NCG A;  2HBQ B;  2LKZ A;  4YHH F;  4CLZ A;  2F5G A;  5K8N A;  4IDK B;  4LBP A;  4PPD A;  1JKH A;  4DS4 A;  1IKX B;  1FK9 A;  5I42 A;  2F1F A;  1FER A;  5E3R A;  4DR6 J;  2BBE A;  2V2K A;  3KUE A;  4DDF A;  3BM7 A;  4IDK A;  4H4M B;  1IKX A;  8AT1 B;  2L9W A;  4ID8 A;  4CLK A;  2YX7 A;  3NWG A;  4A8W A;  3I32 A;  2QFJ A;  3VVU A;  3MCM A;  2PMH A;  3IAM 9;  4H4M A;  3G6Y A;  2YBV A;  3D4J A;  2J6U A;  1N5S A;  2XEX A;  2W24 A;  4GO5 X;  4NCA A;  1S77 D;  3Q83 A;  3HVT A;  2Z30 B;  1HHT P;  4AL7 A;  1MLA A;  2ROE A;  3ZZ0 A;  1IM6 A;  3HK2 A;  2CQH A;  4LBI A;  4PXD A;  2LEC A;  1ZOT A;  2V8V A;  2CYY A;  1Y5N B;  4FPR A;  4JOU A;  3W62 A;  1WDD A;  1KRP A;  4G65 A;  2PO4 A;  1L3V A;  2R7W A;  4RUB A;  4NLV A;  5D4O A;  2QRR A;  3LP0 A;  4LFB F;  4ZVU B;  1XJW B;  3H4B A;  2HHW A;  4DUT A;  3HSD A;  3ZTR A;  3T5L A;  1P6T A;  5E5N A;  2V63 A;  5J2Q B;  1P8G A;  2DR7 A;  4URG A;  1HBM B;  1VQO S;  5J1E B;  5F8H A;  1K47 A;  4ZJL A;  1ZZF A;  1L3S A;  1PYO B;  4YB5 A;  5KFF A;  5KFD A;  2KH9 A;  3CCJ S;  1LOU A;  4PRF A;  5KG6 A;  3M8Z A;  3NCR A;  3R5D A;  2COL A;  3QID A;  4DL0 C;  2AD9 A;  3DC2 A;  3K5O A;  1PC5 A;  5L1I A;  4U67 Q;  3MAA A;  1SJ3 P;  3RBZ A;  2ZFH A;  3IP0 A;  1T05 B;  3MD1 A;  3M8Y A;  2PII A;  2HIY A;  3ISN C;  2POK A;  3P96 A;  4DX8 H;  1T05 A;  4FYD A;  4CLW A;  2MKH A;  3H4D A;  2B9X A;  2RHQ B;  2IVM A;  4HI1 A;  3P6Y C;  2Z57 B;  5KFG A;  1UWB B;  3EGW B;  4PAB A;  3SMZ A;  2XS5 A;  4WBF A;  1DTQ B;  2ADC A;  4ED0 A;  1YG0 A;  2BM0 A;  2IM2 A;  4MK8 A;  2CJB A;  2HLT A;  3KFW X;  2DKO B;  2H4W B;  3UD3 P;  3DRS B;  2HS0 A;  1RP5 A;  1N5Y A;  2IAJ B;  1RKI A;  1DTQ A;  2MXY A;  4NZ7 A;  2UV8 G;  1AW0 A;  2E7X A;  3DRS A;  1VBY A;  4YME A;  4AT1 B;  4R5P B;  3Q8Q B;  4TXS A;  1VRU B;  1Q8I A;  4ZLP A;  1UFW A;  1YQH A;  4DR7 F;  2MKI A;  1T9X A;  2BA9 A;  3A3N B;  4ED4 A;  4I0W A;  1HNX F;  3DHW C;  1RZM A;  2L08 A;  3V6J A;  3RAM A;  2MLZ A;  5KFT A;  3BB5 A;  5HBM B;  2DO4 A;  3EYZ A;  1XER A;  1WI8 A;  4RWX A;  3OL8 A;  2FIU A;  3RG6 A;  3GU0 A;  2C22 A;  2BKO A;  1NDP A;  4LRC A;  3DLB A;  1O0P A;  1K44 A;  3BJY A;  1VOM A;  3Q8S B;  2H54 B;  3PCO B;  4X4Q A;  1FDA A;  4FVM A;  2QV6 A;  4F3O A;  2K7J A;  3W2W B;  2E5L J;  4JV0 A;  3VR1 A;  1BHN A;  1QAY A;  3CF5 Q;  2QA2 A;  2HGN A;  4ED6 A;  3O6Q A;  3R27 A;  2X3D A;  2Z0G A;  2F3J A;  3RBE A;  1KWM A;  4P2X A;  3N0V A;  5KT4 A;  3K17 A;  1AUS L;  2UXD J;  4JB8 B;  1PJ6 A;  2BDP A;  2DGQ A;  3C3L A;  2HQG A;  2ZOF A;  2KU7 A;  3AHP A;  1U1N A;  5DJB A;  5JVG Q;  1VBZ A;  1ZBT A;  1B0P A;  3THT A;  4OZ3 A;  4OZN A;  3SDE B;  3IR5 B;  4Y6I A;  3MXH P;  1QSL A;  1O51 A;  2ATC B;  2FHM A;  9ATC B;  2RQ4 A;  4ECQ A;  4DCO B;  2YKM A;  5CYQ B;  4X4R A;  4TLQ A;  2XSJ A;  1RE1 B;  2AU0 A;  2HLU A;  2BQR A;  3KLG B;  2W9C B;  4KQZ A;  5CYQ A;  5D3G A;  2GML A;  1R0B G;  4HR2 A;  2VG5 B;  4DR1 F;  4ZP9 A;  2W9C A;  4M95 A;  2Z2Z A;  1GNK A;  2UU9 J;  3TJ8 A;  2VFV A;  1BQX A;  4Q45 A;  1DQA A;  3TEG A;  3B8H A;  3S8S A;  3HSG A;  2XYP B;  1WUU A;  3R6G B;  4EYI B;  1YGY A;  1VJQ A;  4C8Z A;  2PI4 A;  2KFN A;  1JNZ B;  2YNF A;  2HK2 A;  4A8X A;  3MMC B;  4QQB A;  2A0F B;  2HAF A;  5A6W A;  1SKU B;  4DV6 F;  3M6U A;  2QLX A;  2W4P A;  4C11 B;  2HSE B;  4A46 A;  4ZPA A;  2EK1 A;  4AE5 A;  1T9T A;  2AGQ A;  3BO2 A;  3UFC X;  3BSA A;  2E1P A;  3PYF A;  3W1Y C;  4IFV B;  2Y8Y A;  3DU6 A;  2VQE F;  3NS6 A;  4W90 B;  3E51 A;  1H74 A;  1S6P A;  3OFE A;  1APS A;  4RW9 A;  4IFV A;  1X4A A;  1K0T A;  5GAD I;  5LT5 A;  3DYA A;  2NLW A;  1S9E A;  6AT1 B;  2ZH3 A;  3ETO A;  3T1Y F;  4DF4 A;  4B9L A;  1GT8 A;  2YKN B;  1X0P A;  1WI6 A;  4E2F B;  2WW4 A;  1WEL A;  2BW7 A;  2FGC A;  3BN7 A;  5FLX Y;  2VHG A;  1FX4 A;  4W98 A;  3FSX A;  2KHD A;  2I9S A;  3V6K A;  3AH6 A;  3RB6 A;  4C3L A;  1TMM A;  2U2F A;  2YKN A;  3Q24 A;  1PAE X;  2LFV A;  2NYI A;  4PWD B;  4PWU A;  3L7P A;  2CJY B;  4IG3 B;  3DHX A;  2HIQ A;  1M90 T;  5GAE U;  2ZC4 A;  3VAL A;  3FC9 A;  4UW2 A;  5KG7 A;  2DR5 A;  4ANE A;  2LEB A;  5KFO A;  4DX5 A;  3RUB L;  3G82 A;  4RZR A;  3B54 A;  5KTQ A;  3LPY A;  3QO9 A;  4ECX A;  1HWL A;  3ITH A;  1VC5 A;  2KFZ A;  2EC2 A;  2NCK L;  2DH7 A;  5L1L A;  2FJD B;  1J5E F;  3C8Y A;  1RTZ A;  4UY8 T;  1JLG A;  3PW4 A;  1VRT B;  4OYA A;  1Z2Z A;  1RWN B;  4HHU A;  4LIW A;  2VOP A;  1HKA A;  2E5J A;  2W01 A;  1NJZ A;  4MK7 A;  4G1P A;  5H9E K;  3QAE A;  1VRT A;  2ZZM A;  5KFX A;  4QIF A;  3JQM A;  2LU2 A;  3BF4 A;  2M88 A;  1ZYQ A;  2KRR A;  2F4V F;  2KG1 A;  2GGP A;  4PWW A;  4YQW A;  2FJV A;  1W26 A;  3RJM B;  1S6U A;  4B9U A;  2OEK A;  3OTE A;  2DIS A;  4PUO B;  4C2M A;  1G2E A;  2FGO A;  4LF6 J;  2DHH A;  2R7Q A;  2DNL A;  2XBP A;  4RW7 B;  2DGS A;  1TKT B;  5HLF B;  2IBO A;  4RW7 A;  4EUV A;  3JSB A;  2GA7 A;  1JXV A;  4ZPB A;  2YKQ A;  1C0T B;  2HYI B;  2BAN B;  3KHG A;  1H3D A;  2J0X A;  1YRT A;  4P7T A;  2W9B B;  3W8P A;  1UP1 A;  3MED B;  3JS9 A;  2KRB A;  1C0T A;  4FXD A;  1S1W B;  2V4Q A;  1GMU A;  1QSY A;  3GQC A;  3LH2 S;  1O8B A;  1TKD A;  1IKW B;  2OUG A;  5HVG A;  2VDH A;  4TU8 A;  3T1H F;  2MKY A;  2ATL A;  3GTY X;  2CNN B;  3BGL A;  3SBM A;  5CYJ A;  2NSB A;  3AD7 C;  2G0J A;  1VMB A;  4CLY A;  4KY3 A;  3PRD A;  4AL5 A;  2DHX A;  3M30 A;  7AT1 B;  5HJY A;  1DQ9 A;  3NEK A;  3VVT A;  2FY8 A;  1KOO A;  4KHP J;  5C5J A;  2Z58 B;  3F56 A;  5DET A;  4ID5 B;  2OD4 A;  1VQN S;  5K8O A;  3GWC A;  1S0O A;  1NDK A;  2CA9 A;  2DRB A;  1WKL A;  2FC9 A;  3IC1 A;  1S1V A;  4QU6 A;  1S4E A;  3SFU A;  2BR0 A;  1CSJ A;  3BGU A;  4ED2 A;  2K2P A;  4AUK A;  4X4U A;  1I6J A;  4B17 A;  4J5O A;  3KLF B;  1DUR A;  3MMB A;  4IR1 A;  2UUT A;  1WAC A;  3KUH A;  4IG0 A;  3OJU A;  2O66 A;  1JXE A;  1WC5 A;  5GMK a;  4J9K A;  3OBI A;  1KS2 A;  5D0H A;  3HFZ B;  4K5S A;  1RTH B;  4ZPT R;  2EKY A;  1IKV B;  1VIS A;  4HT7 A;  5ETV A;  3IBW A;  1HBU A;  3GR0 A;  2MGZ A;  3IG1 B;  1X5O A;  1SIZ A;  4URS A;  3K8W A;  2V9W A;  1RTH A;  4GRS A;  2XNQ A;  2PEB A;  4X4V A;  1T0T V;  2C3O A;  2C3M A;  1VQ4 S;  5LSO A;  3KHR A;  2AYB A;  3GYX B;  5KOX A;  4OFZ A;  4P2S A;  2AV5 A;  1Q7Y T;  3DLH A;  2DEJ A;  5A6P A;  2VPZ B;  2BJ8 A;  4D3H A;  1FO1 A;  1YLX A;  3UVJ B;  1QE1 A;  3ZTQ A;  3QWP A;  4KPY A;  2XGQ A;  3M8Q B;  2AEJ A;  2KHC A;  4KSE B;  2P2C B;  2KDO A;  5J2M B;  3Q8R B;  3DM2 B;  4NA2 A;  1U0S A;  1S6Q B;  3V81 A;  4KJI A;  4OJG A;  2B9E A;  1RAE B;  4J9M A;  4WFZ A;  2O3D A;  3Q23 A;  5J2M A;  2XI2 A;  5C2C A;  1S6Q A;  4RNF A;  3BKF A;  2R2S A;  1WDT A;  1PJ7 A;  2KT3 A;  3GLJ A;  1JLE A;  3N5F A;  1VQY A;  4P73 A;  2EBE A;  3UN3 A;  1OO0 B;  3VAK A;  3QLH B;  4HLB A;  2ZUA A;  1MMD A;  1K0V A;  1RHQ B;  3LA0 A;  2E5L F;  4OZJ A;  2CJQ A;  1N6Q B;  2ZIT A;  3CJ4 A;  4DHV A;  2GJF A;  3OTB A;  4FZV A;  2DBB A;  2DPJ A;  5HMZ A;  5DS7 A;  3R7N B;  3HHN B;  2OPP A;  2MST A;  1DJ0 A;  1HMV A;  3DOK A;  2UXD F;  4LBH A;  3KJV B;  1U0H B;  1N54 B;  1WC3 A;  3VV2 B;  3FZB A;  1UJ6 A;  2VG6 A;  3KJV A;  4L74 A;  1PJ5 A;  2PT0 A;  2I5J B;  3PDN A;  4NZ0 A;  2IMW P;  2HZC A;  1FRK A;  3EPI A;  5IV3 A;  4AXI A;  4ZA1 A;  2LDY A;  3KJN B;  3SV3 A;  4RX6 A;  4ZVS B;  3AT1 B;  1YRX A;  1NM2 A;  3P5T L;  1U2R A;  2HFU A;  1XWL A;  3TZX A;  2CPY A;  4I6A A;  2KJV A;  3R2D J;  1QDU B;  5A8K A;  4DLG A;  1FD2 A;  1WNE A;  3K8V A;  1S0V A;  1SC3 B;  1MRO B;  2CPX A;  3FMB A;  3WX8 A;  1RU2 A;  4DSF A;  2MQ8 A;  3L9Z A;  1KDN A;  3LW5 C;  3QT5 A;  1WF0 A;  1FE0 A;  2CWK A;  2XG8 A;  3MOJ B;  4FPI A;  1FEE A;  2RD5 C;  3VZH A;  1W25 A;  2D3U A;  2CNK B;  3DMJ A;  1OYE A;  1KON A;  2QZ8 A;  2UU9 F;  4ZCM A;  1N0V C;  2MJN A;  1XK8 A;  1K1S A;  3IBF B;  4B3M J;  2X1G A;  4M63 A;  4EZ9 A;  4UST A;  3FUY A;  1OQ6 A;  1BQN B;  4WWS A;  1VQ9 S;  2RQK A;  4NA3 A;  2KYX A;  2CDR B;  2F4F A;  2V34 A;  1SJF A;  1R3N A;  3ELH A;  1CC8 A;  2IVY A;  4DXL A;  3AXK A;  3DXS X;  1D8Z A;  4QYZ J;  4K4V A;  2B4V A;  2JH3 A;  2LYV A;  5ETO A;  1GX6 A;  2CJX B;  3D3C J;  3KK3 B;  3C19 A;  3PXG a;  3MCS A;  3ZTP A;  2NQP A;  2OHD A;  4C8O A;  1U45 A;  4ECW A;  3SEO A;  1U1R A;  2VA2 A;  3KK3 A;  1C0U B;  3LP2 A;  3VGS A;  3JYT B;  5HN0 A;  1UVK A;  2MKS A;  3TUI C;  4F04 B;  2XMM A;  3FFI A;  3SFG A;  4PG8 A;  4QWB A;  4WYL A;  3C16 A;  4U95 A;  1PYS B;  1LFP A;  2Y1R I;  1HQU B;  2YWW A;  3JTN A;  5GAH I;  3CWJ A;  4NLQ A;  2FQQ B;  1RT3 A;  1RAH B;  1YRU A;  2JNJ A;  2Z2L A;  3DLE A;  4DL4 A;  1W2I A;  3SCI E;  5DQH A;  4DV0 J;  1RTD B;  3SSR A;  5HRO B;  1JLC B;  4USH A;  3MFH A;  1TAQ A;  4J9P A;  4CH0 S;  2WZ1 A;  1KSP A;  3M2V A;  4AQY F;  2LMI A;  2FPH X;  5HRO A;  2GV1 A;  1JLC A;  2VIC A;  1NEE A;  1TVR B;  4ATN A;  4UF4 A;  3WX4 A;  2GC8 A;  1VHI A;  4RW4 B;  5DQI A;  4KTQ A;  4ZJO A;  1LK7 A;  4GMK A;  2HHP A;  5KG4 A;  2W1B A;  1RQ0 A;  5I3Q A;  2LQ9 A;  1TKX A;  4ZHR B;  5KFK A;  4ELU A;  4XTT A;  1JMT A;  2VJU A;  1FE4 A;  3PX0 A;  3KLH B;  3CIZ A;  3QZ7 A;  4EMD A;  2FYX A;  4KYZ A;  2ERR A;  3KLI A;  1P1L A;  2OO4 A;  1V3Z A;  1WOS A;  4OYW A;  4KHM A;  1SJ4 P;  3D6H B;  2IIH A;  5F8M A;  1N32 J;  1V3S A;  4OHW A;  1HNV A;  3CO0 P;  2BRL A;  1DAX A;  1HW8 A;  2LLZ A;  4MAK A;  4RO0 A;  2RRB A;  1B7F A;  3KJQ B;  1QSS A;  2IRX A;  4C9D A;  2ZH8 A;  2R7O A;  4RNN A;  3H2V E;  3L7U A;  3HPO A;  3PW0 A;  3MF5 A;  2G1D A;  3EWG A;  2MQP A;  2DPI A;  1QY7 A;  3QBC A;  4CTA A;  1LWE B;  4C4W A;  5F8G A;  1QVG R;  3FSY A;  5I3P A;  4O3S A;  1LWE A;  1REV B;  2E7W A;  1URR A;  5KT3 A;  2FDN A;  4LSZ B;  2QYG A;  1NKC A;  4NLD A;  1FFW B;  1FDD A;  1RYR A;  3F44 A;  1IXK A;  2K8G A;  4WP3 A;  5DRK A;  3TAM B;  2ZJQ Q;  1N33 J;  3G4S S;  1RKJ A;  1XMO J;  1FEH A;  3DLL Q;  2CKW A;  3BPS P;  1GH8 A;  2OP5 A;  1EP4 B;  3TAM A;  2IA0 A;  1YX2 A;  2BAC A;  2BX6 A;  2XMW A;  4F25 A;  2GFF A;  2GIR A;  3R5C A;  1SC6 A;  1EP4 A;  2J6T A;  2WBM A;  2RF2 A;  2VJV A;  3MPV A;  3BO3 A;  1ZET A;  4FF3 A;  3RRH A;  5K9F A;  1FXL A;  3ICL A;  2I38 A;  3PEH A;  1L5U A;  5KFS A;  3T19 A;  2HFO A;  1Q95 G;  8RUC A;  3OVA A;  2GMH A;  4JI3 J;  4IO1 A;  5FDL A;  7FD1 A;  2L48 A;  2J0Q D;  3M8S A;  2JLF A;  5LMU J;  1BWV A;  1R8C A;  4UTG A;  1RHR B;  4C8K A;  1Y0H A;  1T94 A;  1EKS A;  3V5R A;  4I56 A;  1T03 A;  3VF0 B;  4WP9 A;  1RHJ B;  2CPF A;  1HHS A;  4F0M A;  4UOC A;  4WYW A;  4O3Q A;  4NA1 A;  5E3C A;  1RU1 A;  3IWN C;  3WDO A;  2GNK A;  5I4M A;  3BH6 B;  3I82 A;  2FVS A;  2DH9 A;  2C3Y A;  4HKQ A;  2W2O P;  4EO8 A;  5JMN A;  2MQL A;  3D1Q A;  1CJV B;  2JC0 A;  4EBC A;  5FLX U;  2X1F A;  2Q66 A;  3M9O B;  4TU7 A;  3R8Y A;  3ZC4 A;  1CJV A;  2CPZ A;  3MR7 A;  1HD0 A;  1XNR J;  3CD6 S;  2Z2M A;  2GIF A;  3C15 B;  2OPQ B;  4M5L A;  4ECS A;  3R5G A;  4NZ6 A;  2BJE A;  2GS8 A;  1WD6 A;  4Y2C A;  3C15 A;  1U8W A;  2E5G A;  5ITH A;  3KK1 B;  3CUN A;  4U7U D;  1OY8 A;  3EXY A;  2AT1 B;  2NZC A;  2CQG A;  2VUG A;  4Y65 A;  1RXO B;  2Y0S D;  4QIG A;  3HT0 A;  3IXQ A;  4H4K C;  5CH7 B;  3DOL B;  2P9C A;  3AD8 C;  1RUS A;  3IN5 A;  1I5O B;  1T11 A;  5HQL A;  3BKT A;  2EFN A;  3NOG A;  4MFB A;  3FCW A;  1X60 A;  1RCO B;  2DGT A;  2N4C A;  2RML A;  4I2Q A;  3AA9 A;  2HK3 A;  3KUG A;  2XCA A;  2C2M B;  3IRX B;  3OL6 A;  1RAJ A;  1OS5 A;  4P7V A;  4M1K A;  3T41 A;  2RU3 A;  3PW5 A;  1NME B;  1C1C A;  4WJB A;  3OW2 R;  1XMB A;  1K9M T;  3KHL A;  3PYE A;  4OI6 A;  3DKD A;  2JWN A;  3E3X A;  3ZZP A;  1O5J A;  4DPX A;  3OPK A;  2ZJR Q;  4YP3 A;  1RHK B;  2IJR A;  1KLN A;  4IRC A;  3CC4 S;  5L8R C;  2VDI A;  2N3O A;  1RT4 B;  4Y2K A;  1TP7 A;  4OMF G;  4DI6 A;  2A3J A;  1F3V A;  1VRQ C;  2B7C B;  3PHE A;  5A8W B;  2B51 A;  1A7G E;  3OXG A;  2F9D A;  4C8N A;  5J1P A;  1GMW A;  2GAH C;  2VD3 A;  2HKE A;  1YJ7 A;  4ED1 A;  1GTE A;  4OLP A;  3JSR A;  1GQE A;  2JEG A;  1PKU A;  5A8W A;  3I31 A;  1MN7 A;  4DEZ A;  3GCW P;  1WOO A;  3TZY A;  1L3T A;  5J1N A;  2NPF A;  1RT2 B;  3W5Z A;  2OGU A;  4IOA Q;  3HDS A;  3HKW A;  4S0M A;  3H2L A;  2A1B A;  4FS1 A;  1UA0 A;  5EX0 A;  3G86 A;  4A8K A;  4Y2M A;  3CT9 A;  2IDE A;  4DR5 J;  3IFE A;  1YTY A;  2MYF A;  4UQG A;  1K1Q A;  1S79 A;  5KFQ A;  2P8I A;  3MD3 A;  4X4T A;  1V9O A;  1HA1 A;  4I2P B;  1ZTT A;  1S57 A;  4ICL A;  1NK6 A;  2VB6 A;  3KJF B;  1UEV A;  3VTI A;  3MAH A;  1X4C A;  2CAD A;  3AD9 C;  1I94 F;  4F36 A;  4QU7 A;  4PKD B;  3OR1 B;  1IJF B;  1HBN B;  4GC7 A;  4WK1 A;  4IFY B;  4YY3 F;  3MR2 A;  5THW A;  3BPD A;  4Z7C A;  1S72 S;  2QT7 A;  3OR1 A;  4NYP A;  1R8B A;  2OKQ A;  4IFY A;  3L4B C;  2DNY A;  3OVB A;  3D1H A;  1R8P A;  2AZ3 A;  1SL2 A;  3QT8 A;  4USI A;  1D9F A;  1R31 A;  2P6S A;  3ILO A;  2UXC F;  3QGI A;  2CZV C;  1UL3 A;  1IM4 A;  1YIT S;  1KQK A;  3RAQ A;  4OHX A;  1R8H A;  1KC8 T;  2EPI A;  1D8Y A;  1NSK L;  4L73 A;  3KOA A;  1TL7 B;  2K3K A;  4LFC F;  4ZOS A;  4CYU B;  1DRZ A;  4F67 A;  2RT3 A;  4EWT A;  2AGO A;  2BZ2 A;  3LWM A;  1S97 A;  4A8Y A;  1TL7 A;  4OHZ A;  2CVE A;  5H1S V;  3PO5 A;  4CYU A;  4GVB B;  2SXL A;  3EDR B;  4JUZ A;  4WPA A;  2VIH A;  2FLL A;  4P74 A;  1S7I A;  4KGZ B;  1IBK J;  5IT9 Y;  2J7W A;  4GVB A;  3DNC A;  4I4B A;  4RNO A;  2E1M C;  1TL4 A;  3DRX A;  1M5S A;  1KEK A;  4ED5 A;  5DZ6 A;  3KG4 A;  3TAQ A;  4M5J A;  4J9S A;  1X7V A;  1F9F A;  4QYR A;  3HI9 A;  3HF5 A;  5E0O A;  3MEK A;  2DHS A;  3TX8 A;  1LWF A;  1N4L A;  2AGP A;  3R5B A;  2KT2 A;  1DLO A;  1S1U B;  3JAM Y;  2J6S A;  1FJE B;  3J81 Y;  3FQL A;  4ECR A;  2VFU A;  2YNH B;  3G2X A;  2E44 A;  3Q89 A;  4USK A;  3PYG A;  2L9D A;  1KVJ A;  3MEG B;  1MWY A;  4WII A;  1NO8 A;  3RB0 A;  3NL0 A;  3KKF A;  3QSY B;  5M2R A;  1PO6 A;  2OSQ A;  3QZ8 A;  1UA1 A;  2CQD A;  3RAX A;  3BV8 A;  1PGZ A;  3AAW B;  3MM8 B;  5B0E A;  4OX7 A;  5GAH U;  1CJK B;  1QVF R;  4B3R J;  5L1K A;  3BGR B;  2K06 A;  4KE5 A;  5CAB A;  1H72 C;  1KFD A;  1M5H A;  4M5D A;  2PFD A;  2V6A A;  3LAM A;  2HHQ A;  3DLG B;  2UVV A;  1IQT A;  4X84 A;  3BGR A;  2UVR A;  2BW2 A;  2D9O A;  1N32 F;  1KVK A;  2GQC A;  3LWL A;  4HAC B;  2OMO A;  1XBW A;  4BWM A;  1IBC B;  3EVM A;  1NH8 A;  5MAO A;  3MZI A;  3A3P B;  3AB2 B;  4HAC A;  2OPR A;  5C42 B;  2ALZ A;  4RNH A;  1N56 A;  1WF1 A;  1SC1 B;  3MTK A;  5H9F K;  3NY0 A;  3FK4 A;  5LJ5 Y;  3PHT A;  5D78 A;  2NS1 B;  2G1H A;  3DOM A;  3NGD A;  4ZP8 A;  1LW2 B;  3M32 A;  1GMW D;  2AJ0 A;  3ENW A;  5ETR A;  2RU9 A;  3HHL C;  3JQK A;  1D1U A;  3IS9 B;  1LW2 A;  3GIR A;  2VOD A;  3AJ1 A;  2NRE A;  3KHH A;  2CJK A;  4B9N A;  3KMS A;  2ZBI A;  1N33 F;  3M6X A;  1V5V A;  3IS9 A;  5LMN J;  1XMO F;  1VQ5 S;  3SI8 A;  2VBW A;  5IZH A;  3R9L A;  1WOP A;  1LW0 A;  1F9H A;  3W9I A;  3GJS B;  2PA8 D;  2DHG A;  3OQ2 A;  3NS5 A;  2AYE A;  2IFX A;  3MM6 A;  4LRE A;  1N52 B;  2Q79 A;  2J9C A;  3QQC D;  1TK0 A;  3MR3 A;  1G4C A;  4DN0 A;  4V1A k;  2M8H A;  5FJ4 A;  1NKB A;  3E01 B;  3HLU A;  4HH0 A;  2ZNY A;  3LQV A;  5AE2 A;  1W7W A;  1TAU A;  4KO0 B;  1BXN A;  3QIP A;  3QRQ A;  1V5I B;  1RWP B;  3PIO Q;  4WU2 A;  5A8R A;  1UTA A;  4F3M A;  2ILZ A;  2DB1 A;  4Y2I A;  4KO0 A;  4JI0 J;  5DLF A;  3UPF A;  2XYH B;  4QWA A;  1UVJ A;  1TL3 B;  4FNH A;  1ZPW X;  5ETT A;  3NBP B;  1UZH A;  2MZR A;  4CH1 A;  3JXO A;  3PYD A;  1Q16 B;  2VC1 A;  1KFS A;  3MMA B;  3KK2 B;  2VA3 A;  3FNN A;  3UR3 C;  1XNR F;  3MUT P;  2DRD A;  2DXF A;  5HAN A;  1UVL A;  4MK9 A;  1DQ8 A;  5GAG U;  3EVW A;  4RLE A;  2VG7 B;  3MMA A;  5C25 B;  1QM9 A;  4HDH A;  2AYG A;  1EAY C;  1SIW B;  4OX8 A;  3DN9 A;  1NK7 A;  2BVZ A;  5LOQ A;  4A48 A;  1VC6 A;  1KLM A;  5C25 A;  4EFA C;  1DHM A;  4ZLJ A;  2WW8 A;  8ATC B;  1AXQ A;  1JLQ B;  2B3T B;  4WIQ A;  4ED3 A;  3CXC R;  3VAM A;  4A47 A;  2EW9 A;  1FJG J;  5IWA F;  2PGC A;  2Y8W A;  5KFA A;  2DXD A;  3QYY A;  1PBU A;  5B7W A;  4LQ9 A;  3X1L B;  3FCV A;  4PYA A;  2B9W A;  3OT9 A;  2PMZ D;  1VBX A;  3CSK A;  1NND A;  4WFX A;  3MCN A;  5GME A;  2WSC C;  3IWL A;  3TA0 A;  3OR2 A;  1ROF A;  2N7C A;  3ISN D;  3GE9 A;  4JI2 F;  1U25 A;  3NCQ A;  1YBU A;  2QMW A;  4LR7 A;  2JLE A;  3NGS A;  2HFS A;  3LTO A;  3VHQ A;  5BR8 J;  3D54 A;  4CO1 A;  2R7T A;  1AFI A;  3H40 A;  1Y7P A;  1JJH A;  1UKU A;  4ZMM A;  2DNG A;  5KG5 A;  1A9N B;  1KQG B;  2YNI B;  3BR8 A;  1F2H A;  4FF2 A;  3PJ9 A;  4K0K J;  4B3T J;  1Z4U A;  3PJX A;  4NXM J;  2XM3 A;  1EQM A;  4P2F A;  2YNI A;  3CD7 A;  4ZCL A;  2QGF B;  2HUR A;  3HHD A;  1RAD B;  4FBU A;  1HYS B;  2HWT A;  3ZZU A;  4DR5 F;  3GIJ A;  2CUY A;  2ALY B;  1ZAX A;  1RWX B;  4P6Q A;  2RJZ A;  2F8M A;  3MM5 B;  4ZPW R;  3MPW A;  1J5O B;  2WSF C;  1GK8 A;  1SXL A;  1VQ6 S;  1UWA A;  5H9E J;  1M1G A;  3M6W A;  3PEJ A;  3MM5 A;  3LGM A;  2QLW A;  3CJK B;  5EWF A;  2I8E A;  2OPS A;  4QPT A;  2AJ2 A;  2G13 A;  2VON A;  1UET A;  4X64 J;  4RW8 A;  1YKW A;  5J2P B;  1KNZ A;  2XC9 A;  2XLK A;  2DNH A;  1Y10 A;  4G1Q B;  4C0O C;  1ZA2 B;  3NNC A;  1T9Y A;  3A1Y G;  1YIJ S;  4DR4 J;  4GO7 X;  5IQQ A;  2R7V A;  3T9Z A;  2HQD A;  1H73 A;  3HCX A;  2HFZ A;  1AZS B;  5KFW A;  3SXL A;  3MPU B;  3G8S A;  4ES3 A;  4M5K A;  4LRD A;  4PQU A;  3CCM S;  1CUL B;  1DZ5 A;  3B4D A;  4KGX B;  3JSM B;  2MB0 B;  1Y5L B;  5KFJ A;  1RT5 B;  4RBT A;  2GVZ B;  3DU5 A;  2CQ2 A;  2V9K A;  3HM9 A;  2BQ3 A;  2FUG 9;  3JSM A;  4Q7A A;  2V4R A;  4HI2 A;  1FTC A;  2Q43 A;  2AJQ A;  2C2D A;  2HNY B;  5K8P A;  4FVC A;  2BJ3 A;  3I4P A;  2ZWP A;  4ZJQ A;  2N82 B;  2QA4 G;  2M3D A;  1IBK F;  5ETQ A;  2RRN A;  4OI3 A;  2HNY A;  3WHI A;  1S59 A;  1NK5 A;  3B82 A;  3W64 A;  5IXU A;  1NHK L;  2PSZ A;  3M1V B;  4ZVT B;  1HNZ J;  2XHC A;  4LT6 A;  1MG7 A;  1T8E A;  5HMY A;  3MPY A;  4WFB Q;  4QWE A;  1NB7 A;  5C2G A;  4DF8 A;  3IAS 9;  1X4B A;  1HW9 A;  1NDL A;  4HTI A;  1S1T B;  2DNR A;  1WHY A;  3DRP B;  3K89 A;  2XLI A;  4CO4 A;  2GVD B;  3O8W A;  2HNZ B;  4ECU A;  4ZIT A;  2AHO B;  2CPH A;  1WHW A;  1JB0 C;  4MTP A;  4MJK A;  2DIV A;  4WE1 A;  1HWI A;  3GIM A;  2HNZ A;  4NL5 A;  4LF7 F;  1QAJ A;  2VQE J;  1TUG B;  2WAQ D;  1E6Y B;  3OUY A;  4I64 A;  4B3R F;  2DH8 A;  4RBV A;  1JXL A;  4ZIW A;  2QFI A;  4A8O A;  5F9N A;  1QLN A;  3T1Y J;  3M9M B;  3BN4 A;  1YDL A;  3KMQ A;  3PKM A;  3E8O A;  2ILY A;  1VQ7 S;  2NXU A;  3IWX A;  3R3T A;  4Q5V A;  3LP1 A;  2NZ4 A;  2CPD A;  2NXN A;  3Q86 A;  1CBK A;  4LSN A;  4NAS A;  1RWO B;  1HNW J;  1GXT A;  1WC1 A;  3TNV A;  1K8A T;  3A8J A;  1MML A;  2V68 A;  2DO0 A;  1NXI A;  3M2R B;  1JLB B;  1SKR A;  2CQ4 A;  5KG1 A;  5DDQ C;  2H51 B;  1IKY A;  2AX1 A;  2G2Z A;  2KI2 A;  1NHV A;  4MH8 A;  4ECY A;  3M2R A;  2OJ3 A;  3RRG A;  1JLA B;  3J81 j;  2WOM B;  5AE1 A;  2V4J B;  3J7A 1;  5CZV A;  2WHO A;  1P1T A;  2BE2 B;  4DZ6 A;  4ZPV R;  4JI4 J;  2ZKU A;  1R6V A;  3WIV A;  4YR0 A;  4C7Q A;  4DLE A;  2OIH A;  2HVH A;  2GZO A;  2YWK A;  1BY9 A;  4MKA A;  2VPY B;  2ZC3 A;  3SQG B;  2QA4 S;  4N41 A;  2XTJ P;  5LMN F;  7FDR A;  4TYB A;  2OAU A;  3RYL A;  4NLU A;  2A18 A;  4WU3 A;  3C66 A;  2MQN A;  1TKZ A;  1M5K C;  4Z7Y A;  3M8W A;  4RUA A;  3SQG A;  2R8I A;  3NOC A;  2E1C A;  2ZD1 B;  1S48 A;  4KGK A;  1VK8 A;  1RWM B;  2ZE2 A;  2F4V J;  1AA1 B;  2QX0 A;  3CJS A;  5F3Z A;  2IJF A;  1UPP A;  3GG0 A;  3H5X A;  2ZD1 A;  4DL6 A;  3G96 A;  3CB4 A;  1SJR A;  4CLL A;  3Q2S C;  1QJH A;  4WTO B;  4B9T A;  4K4Z A;  1U1O A;  4AD6 A;  3KDO A;  1EB0 A;  2XNR A;  3TYT A;  1U48 A;  2ZH5 A;  1NJX A;  2X51 A;  4FDF A;  2YH1 A;  3QJL A;  1FNO A;  4JI6 J;  4TY8 B;  4JV5 F;  2V8D A;  5E3Q A;  4NX9 A;  3HFV A;  1UMJ A;  4IH6 A;  3G87 A;  4NLG A;  4JI0 F;  3FBE A;  4JI5 J;  2X3G A;  5IT9 U;  3GJT B;  3HSJ A;  1R0A B;  2V5H G;  1ZM3 A;  1Y00 A;  1LKZ A;  4K4U A;  2QJ3 A;  2J9D E;  4U7C A;  1XEZ A;  2GQ2 A;  2OEM A;  3JTO A;  1RYS A;  4LJM A;  4DUY J;  5AT1 B;  2HGL A;  4F2S A;  4NRU A;  1HIY A;  4JP8 A;  1R0A A;  3PRV A;  3N4W A;  3IR7 B;  3S6E A;  4CO5 A;  1ZM9 A;  5D4P A;  4DG1 B;  4NLX A;  3HO1 A;  3T1H J;  3IGV A;  4RUH A;  3ILJ A;  3UI3 A;  3JAM U;  2P5V A;  3J81 U;  4A8F A;  1M5O C;  1EIY B;  3S01 A;  1QAI A;  3QRR A;  3IA0 A;  1RHU B;  4M5M A;  2QO3 A;  1JX4 A;  1RWV B;  2E29 A;  1FF2 A;  1CJT B;  1KR4 A;  3NLC A;  5GMD A;  3SCL E;  5HL7 Q;  3THV A;  3MEE B;  2J7U A;  3Q22 A;  4H4O B;  5HMW A;  1FJG F;  4ZDN A;  5EN1 A;  3OXL A;  1RTJ B;  5HAT A;  3C46 A;  5KFM A;  1RCX B;  1D3W A;  5F8N A;  3W2V B;  5J2Q A;  1HBM A;  3SSQ A;  5J1E A;  3DDI A;  2OEJ A;  1U02 A;  3UDE A;  4N8N A;  3CVK A;  2XCP A;  1S0M A;  4IOC Q;  1S1X B;  5BXI A;  4ZK7 M;  2WVE A;  3TP2 A;  2VKR A;  2XYG B;  1ZTW A;  1TUV A;  2XUL A;  3CCE S;  2KVI A;  2CG4 A;  1IVZ A;  1U7L A;  1S1X A;  1OPZ A;  4CLT A;  4JI1 J;  1TL1 B;  2EXU A;  1U26 A;  2PN6 A;  2W7O A;  2YQ3 A;  5FII A;  1OSD A;  2UUC F;  2MZJ A;  5EGY A;  2CNO B;  5EWE A;  3GV5 B;  4QR1 A;  1NKE A;  2WON B;  5BR8 F;  5HQ8 A;  3FDS A;  5EDW A;  3MR6 A;  1ZA1 B;  1UWB A;  3TI0 A;  5A2Q Y;  4DUZ J;  1TFW A;  1UAW A;  4LR8 A;  3CIM A;  3NP5 A;  4URQ U;  4K0K F;  4B3T F;  2XZD B;  2FJE B;  4NXM F;  2VAS A;  3GIK A;  2IAJ A;  4M5I A;  2R2T A;  4ZCI A;  4K50 A;  1HNI B;  5B0G A;  1Z1Z A;  4WTY A;  5HQM A;  2AKW B;  2CQ3 A;  2DNP A;  1FFG B;  2RB7 A;  4R5P A;  2K1R B;  3H5U A;  4JI7 J;  1VRU A;  3M2U B;  1VK3 A;  4U9R A;  1LFW A;  1YJU A;  2EI5 A;  2HVD A;  3H20 A;  5BJR A;  5GVQ A;  2K1R A;  2HS4 A;  3SQO P;  3W60 A;  1EAR A;  2E1R A;  1JQG A;  1AB8 A;  2I1R A;  3R6L B;  5HBM A;  4UOF A;  2PFF B;  1E6V B;  4ED7 A;  2ZOM A;  1VC0 A;  2FB0 A;  1IQZ A;  3PG9 A;  2KXF A;  4X64 F;  3CC2 S;  2D9P A;  2HQC A;  3TX0 A;  2F65 A;  4F8R A;  3ZTS A;  3W2W A;  2B4O A;  2FZK B;  3BYP A;  4RUC A;  1BQM B;  4DR4 F;  2BV3 A;  4DL5 A;  3HZG A;  2RQM A;  3G71 S;  4DFM A;  1RAC B;  2NXC A;  4EZ6 A;  4ZP7 A;  1WC0 A;  1HHQ A;  2RNE A;  3TRG A;  2A6O A;  1KTQ A;  4RBU A;  1NH7 A;  2FJX A;  1RLC L;  1VQP S;  2H4Y B;  1GFW B;  2XI3 A;  3P5B P;  3W63 A;  3VCD A;  2J76 E;  2JSX A;  1U6B A;  3L95 X;  2ZBQ A;  4Q0B B;  3AQP A;  5D77 A; 
#chains in the Genus database with same CATH homology
 3IMQ J;  4KYZ A;  1FJG J;  3T1H J;  4LF6 J;  4KHP J;  4YHH J;  3JAM U;  1HNZ J;  4LFB J;  2KL8 A;  3J81 U;  2F4V J;  4DR4 J;  1XNR J;  4JYA J;  4LFA J;  1N32 J;  4K0K J;  1HNW J;  2UXC J;  4B3T J;  4JI0 J;  1N34 J;  4NXM J;  1IBL J;  4DV7 J;  4DR1 J;  3D3B J;  4LF5 J;  3J80 U;  4LF4 J;  4RJV A;  2UUB J;  2HHH J;  3W1Y C;  1IBM J;  5IWA J;  4X65 J;  4B3M J;  4B3R J;  2UUA J;  4LFC J;  5LMN J;  4JI3 J;  4JI8 J;  2MTL A;  2VQF J;  2UUC J;  4DV0 J;  1IBK J;  2UXB J;  3R2C J;  3J7A N;  4DR2 J;  1XNQ J;  4NEZ A;  1HR0 J;  4DUZ J;  3OTO J;  5LMU J;  4JI6 J;  4OX9 J;  4HHU A;  2E5L J;  4DR7 J;  4GKK J;  4B3S J;  1I94 J;  4LF8 J;  4X66 J;  4JI4 J;  4DV3 J;  5AJ3 J;  4NXN J;  4JI5 J;  4DR6 J;  2VQE J;  4YY3 J;  4DV1 J;  4DV4 J;  1HNX J;  4DV6 J;  2MEW A;  5IT9 U;  5A2Q U;  4NEY A;  4LF9 J;  3D3C J;  1N36 J;  2UU9 J;  4V1A k;  3R2D J;  2KVQ E;  4DR3 J;  4JI7 J;  4DV2 J;  2ZM6 J;  4DUY J;  4AQY J;  4X62 J;  4JV5 J;  2UXD J;  4JI1 J;  4KY3 A;  5LM7 E;  5BR8 J;  1N33 J;  3T1Y J;  4DV5 J;  4PWW A;  4JI2 J;  4X64 J;  4LF7 J;  1XMO J;  4DR5 J;  1XMQ J;  5FLX U;  1J5E J;  4GKJ J;  2MQ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...