2UU9J

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gug-codon in the a-site and paromomycin.
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RRNA
total genus 10
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 2uu9J00
4KYZA 4DV5J 3J7AN 1XMQJ 4DR6J 4LF8J 1N32J 4LF6J 2UUAJ 4NXMJ 2HHHJ 2MTLA 2MEWA 3J81U 3IMQJ 4NEZA 4LFBJ 4DV6J 1J5EJ 1IBMJ 3R2DJ 5LM7E 4GKJJ 4JI0J 4DUZJ 1HNZJ 5IWAJ 4DUYJ 3JAMU 4OX9J 2KL8A 3T1YJ 4LF9J 4B3MJ 4RJVA 1HR0J 3OTOJ 3D3CJ 2UXDJ 4JI8J 4X66J 4JI2J 2UXCJ 1I94J 4JI1J 1N34J 5BR8J 4X65J 4HHUA 4YY3J 1HNWJ 4YHHJ 4V1Ak 5A2QU 4DR1J 1N36J 4LF7J 4JI5J 4X62J 2UU9J 5AJ3J 1XNQJ 4PWWA 4DV3J 4K0KJ 4LF5J 4KY3A 4LF4J 2MQ8A 4JV5J 1XNRJ 4DV4J 4LFAJ 3T1HJ 3J80U 4DV2J 2UUBJ 2E5LJ 4DR3J 4X64J 2UUCJ 4DV7J 4NEYA 5FLXU 4B3SJ 2UXBJ 3R2CJ 1HNXJ 3D3BJ 4LFCJ 4JI6J 4DR7J 4NXNJ 1FJGJ 4AQYJ 1IBLJ 4JYAJ 5IT9U 1N33J 4JI3J 2VQEJ 1IBKJ 5LMUJ 4DV0J 4KHPJ 4B3TJ 4DV1J 2ZM6J 1XMOJ 4DR4J 4DR5J 4JI7J 4DR2J 2F4VJ 4B3RJ 4GKKJ 4JI4J 3W1YC 5LMNJ 2KVQE 2VQFJ
chains in the Genus database with same CATH superfamily
4KYZA 2ZOFA 4F3OA 5BR8F 4ETXA 2YPYA 4DV5J 3FSXA 4KFBB 3HSZA 1FA0A 1Y0HA 3TUJC 2RF2B 4DPWA 3FBCA 3BDEA 4JI0F 4CLFA 1YGYA 5GAGI 3NMAA 3V81B 1RWOB 2H1YA 4GO7X 1CJUA 2G13A 4KSEB 3ILJA 3FRYA 3PHEA 3ZC4A 1C1BA 4KQZA 2HQFA 3AFGA 4DN9A 1MWYA 2GAGC 3DDNA 2I0XA 5E3CA 3J81U 1S0OA 2XS5A 4Q43A 1IKWA 2I5JA 4RWXA 4BBYA 2RQMA 3G87A 2XCAA 2R7WA 1WG4A 2IDEA 1GH8A 1IQZA 4USKA 1P9QC 1KFSA 4B02A 1NRKA 3P5BP 3WIVA 1S1UA 4HACA 4NEZA 3HFKA 5DZ7A 5KFCA 1KHWA 2QLXA 4CLZA 2OIHA 5D3GB 5K8PA 3TP2A 2WONA 4HH0A 1KSPA 2OPQB 3M32A 2M3DA 1HLWA 4NLVA 4WP8A 2B8PA 1U4BA 4L3KA 1UVJA 1KQKA 1DTTA 2NSBA 2RRNA 3NS7B 1WKLA 5F0UA 2WVDA 1FVQA 1GMUA 5KT5A 3QLHA 3SCKE 3OTOJ 1GX5A 1VGYA 4G1QA 3BBFA 5FDLA 5BJRA 3HP6A 1UVMA 4K5SA 2ERRA 3CD6S 3KMQA 4U7UD 3PEJA 2LYVA 4I7FA 4P7VA 1MU2A 4ITSA 4JI2J 1D9AA 1I94F 2DHSA 4F50A 4JI1J 2CVIA 4WYWA 2R7SA 3MHYA 3QLHB 4WKRA 2NXEA 2V50A 5BR8J 2QG9B 1AA1B 4CT8A 3OVBA 2HRTA 3IRXA 4IG0B 4ECVA 1RKJA 1VOMA 2IHR1 5KG4A 4C8KA 2U1AA 4ZLPA 4YHHJ 2WVCA 1AUSL 2ZE2A 5JJBA 1ZTTA 5FJ4A 4ETZA 1SI9A 2COLA 4JI5J 3TO8A 2B7BB 4V19X 2L9NA 2XYHB 2CQIA 4AFFA 3EXYA 3DYAB 2I5JB 3I5BA 4XTTA 5F41A 4C0HA 4O4GA 3FKBA 3D6TB 2A10A 5DM6Q 1X9WA 4YB7A 2QL5B 1Q8KA 1SV5A 2Y3YA 5SUHA 3KUHA 4DV2F 4MK8A 1NZAA 2KT3A 2B6AB 5KFOA 5A76A 3UNYA 1GTEA 2MQ8A 1PAUB 2FLOA 3D6FB 4YN3B 4CH1A 1UJ6A 3KLEA 4I6YA 4RKUC 2FVSA 4JI1F 3E8OA 2AX1A 3LF0A 2YKNA 3KLFB 2HVEA 3KLGA 1HQ2A 1RHRB 3JTPA 4MT1A 3GIJA 2AYMA 3SV3A 1FKPB 2UUBJ 1CG2A 2L48A 4TU7A 1X4HA 2N3LA 4I2QA 1FNXH 4G1IA 4ECYA 4ZVPB 2O5DA 1XBWA 1QAJA 2DHHA 2WBMA 2JSXA 1HBUB 2GHVC 4EFAC 2H4WB 3OL7A 3GV8B 1QVGR 1YJUA 2BVZA 2DH7A 2OEMA 3R2CJ 3HF5A 4XO0A 3TAQA 3B82A 4IG3B 1LWEB 2VBZA 1NMEB 3BGRB 5IV3A 2RRAA 2DR9A 1CULA 3CDEA 3QGIA 4R0EA 3J7YI 3KJVA 3FBEA 4LRDA 2ZC4A 4L73A 3U27A 3OJUA 3PZPA 1NK6A 2FHKA 3MOJB 1N4LA 4ZCIA 1C4CA 2O1PA 2BE2B 3C16A 2BKOA 1Z2LA 3HVTA 5T7LB 4X4NA 3BSAA 5E0OA 1TVRA 1X5PA 3MFHA 5HVHA 3C6TB 3K59A 3V5RA 4ELTA 1O51A 2DNQA 4RR5A 3G6VA 4N76A 4P6QA 2IAJB 2R4FA 2XTJP 2FJXA 1Q82T 2R2RA 3EUNA 2BQ3A 3R27A 1ZS6A 2XB2D 2IYIA 1NHUA 5AT1B 2FVRA 3VF0B 2NYHA 1NDKA 2Z30B 1Q8LA 2GJFA 4ZPVR 3HFVA 2GS8A 1R89A 3BPSP 4K4XA 2CJQA 3J7AN 2FQQB 3AJ2A 5DQIA 4ECZA 3MWBA 1X4FA 2RS8A 1N5QA 3TRGA 3DNCA 1U1PA 2HYIB 3FZBA 4DV7F 1FI4A 2R42A 2R2UA 2BA9A 3GP9A 2CWXA 5ETOA 1C0UB 4NYZA 5DDRC 2H48B 4FS2A 2OP5A 5KG3A 2CQ4A 3U1NA 3T1YF 2DNHA 1RT3B 2XMKA 4OI2A 5KT2A 2MZ1A 1IWGA 3DMJB 3DRYA 3MR5A 5I4MA 3Q8UA 2W25A 5KG2A 4DR2F 2CQ2A 3IBCB 1MMNA 1MROA 4Y3CA 2ZJRQ 2B3TB 4MFBB 1YQHA 2W1BA 1YJRA 4ID8A 5DRKA 1VQYA 4NMXA 2X1BA 5JXSA 4K4SA 2IFXA 2KN4A 4LBHA 4I69A 3G8TA 4FBUA 5IOLA 2P9EA 4ZVQB 3RB3A 3MUTP 1K1QA 1BXNA 1S9GB 2MQMA 1QDUB 2QZ8A 3FMWA 3IG1A 3BH7B 4I0WA 3UDEA 3VZHA 4NZ0A 4F7VA 1NJXA 3ENWA 3R5BA 4B9SA 5EWFA 3Q24A 3BQ2A 4ZDNA 2ZNYA 5A2QY 4FPIA 4X64F 1PG5B 3B4MA 1QUPA 4ZVUB 2PI5A 1TL7B 2OMOA 1VI7A 3QIPA 2YX7A 3AA8A 5K8NA 3IG1B 5KFEA 2V4JB 2UXCJ 5BYSA 4MKYA 3M2RA 3QIDA 4FXVA 1GMWD 1B70B 4DG1B 3OVSA 3NMRA 3VR1A 4BLGA 4CLYA 5J1EA 3KNGA 2HNDA 4NA3A 4X65J 1D3WA 3IWLA 3PTWA 3VAHA 2V9KA 1L3TA 3MR6A 2D1CA 1F1BB 4KR0B 1SUQB 4RW6B 3OXGA 3JQMA 4DPUA 5GADI 2FJVA 3SZ2A 3UWTA 5B0DA 3H42A 3T6JA 3OTDA 2AV5A 4IOAQ 5H9FJ 3ZTPA 1T05B 1WI6A 3P5TL 2CG4A 2HS3A 1XJWB 2MQNA 1DARA 3FCWA 1V3SA 1H98A 4RW4B 4QW9A 1HARA 4QR2A 3ZZRA 1XMBA 4ILLA 1WDDA 3CJSA 2L41A 2JLGA 3MPYA 2ASLA 1HA1A 4DPXA 2C2ZB 5B09A 2G4BA 3D5MA 2CJ9A 4PG4A 4USJC 1M5VC 3K5LA 3UN5A 2AP6A 5EDWA 1RXOB 1XNRJ 2G0JA 4DV4J 4RW4A 3T1HJ 2LVWA 1TV6A 2O66A 4OYBA 2C2MB 1G1XA 1RADB 1RTIB 1S6PB 5KFTA 2KFYA 3KK2B 3DRXA 5J2NB 4ZLJA 4ZPCA 3UDLA 5KT7A 5F8HA 2HNYA 5EN1A 4F0KA 5G0RA 2V8HA 4MIBA 4YEAA 4C6AA 1LXJA 2UXBJ 4Y34A 3TAMA 3L9ZA 4CTAA 2JL9A 4PEOA 2CQHA 4DG1A 3RG6A 2G1HA 2KRBA 2Z56B 4HDHA 4NXNJ 2WOMA 3HX9A 2BM1A 3MEEB 4C3LA 2ZKUA 3R5CA 4I64A 1FDDA 3G6ES 1LWEA 4USVA 4D3GA 3B6BA 3PEHA 1RBAA 3T19A 1VIOA 3THTA 5CCLA 3O6QA 1A9NB 1Y9OA 4XAKA 4RNMA 4DV0F 5K9FA 4J5OA 3M1VA 3ETMA 3MEEA 4OX9F 4A48A 1HMVA 2FVPA 2FY1A 2R8HA 4DV1J 3BS9A 4B3TJ 1TL5A 2CQ0A 3QPIA 3MF5A 3HPOA 4C9DA 2R7VA 2MZTA 1S48A 5FD1A 1K0TA 1QUVA 2XGQA 1SC3B 3V6KA 1OQ3A 2HIYA 3QT5A 1UVIA 1X7VA 3K58A 4M5JA 5F9NA 1RWWB 4ED1A 1FDAA 4NI2A 1JLEB 4Q0BB 3EDQB 1OIAA 2WTFA 1QJHA 1Y5NB 3WDOA 4EGLA 4QPXA 2JEJA 4C0OC 1FJGF 1N32J 8ATCB 4KC5A 5HMYA 5KFIA 1ZZNA 2JDJA 3TEGA 4NLOA 4NXMJ 1V5VA 1KRPA 5CAAA 1KQGB 1NDCA 1V5IB 4QWBA 2ZHAA 3NWRA 2E1AA 3SXLA 4HVZA 1BQMA 2FHMA 2WSEC 3PHTA 3TQEA 3O44A 1T9TA 4OYAA 1VBZA 1VQLS 4DWIA 2R7UA 2OHDA 4WPAA 4BDPA 2BW7A 3HZEA 3CJ3A 2NUHA 4O4GB 1T0TV 4DR4F 4ZIWA 4U8YA 3UW1A 4PXBA 2W4DA 4ALZA 2CPHA 5LSOA 3I9ZA 2GVDA 4LRCA 2AF6A 2QFIA 2FHJA 4QIFA 5G0RB 3OTCA 4LBPA 3VHQA 2ATCB 2J0WA 2UXBF 1GQEA 4B3MJ 3ONQA 3MAQA 1ZA2B 1U1QA 1NKEA 1HHSA 2CQBA 1LFWA 4ZIVA 5GMDA 4DPTA 2MQOA 1KOOA 2JNJA 3NP5A 4OJGA 5H1SV 2VA2A 1Y3KA 3TUIC 1M5OC 1BQXA 1GXLA 1S97A 3THVA 4QU7A 1HBMA 4PWUA 2ZHOA 4O3OA 4ECQA 1NH8A 3OVAA 1WUUA 1S1TB 2CZ4A 4Q2LA 4DR1J 2V6AA 3BGRA 3D0HE 3ISND 4ID5B 3MMBA 4CO3A 3QAUA 1BUXA 5RUBA 2WB4A 3A3PB 3DGVA 1VBYA 1QLNA 3JSMA 3CC2S 4F26A 4X4PA 1GFWB 1VRTB 4UZCA 4ZJLA 1WTFA 2Y9HA 2BACA 2JWNA 4FYVB 3PR5B 2DISA 2HAFA 1WD6A 2VJUA 1U2RA 2CJBA 4KFBA 4NCAA 4Q0BA 5KFNA 1JLQB 2YTCA 4EBEA 1Q8IA 2MKKA 3AD9C 1CC7A 1B64A 4Y00A 4CO5A 4TY8A 3V81A 3U1LA 4YUDA 1PO6A 3KJQB 1ZM9A 4RPFA 2EFVA 4DV4F 3DOLB 4AE5A 3OUYA 2VKRA 1XWLA 2VJVA 3PW2A 1C1BB 2A0FB 4HHHA 3KG4A 4AXIA 2MMYA 3A8EA 1RBLA 2EWHA 5F9LA 2VPWB 3BH6B 3ISNC 1X5SA 4TQSA 2DNPA 1L5UA 2DR6A 2A2DA 4UZBA 5LSRA 1MMDA 2FHJD 2J0XA 4KGVB 4G6VB 5CYMB 3SQOP 1X0PA 2DBBA 4CWBA 1ZBTA 3SV4A 4R5PB 4EU0A 1SKWA 2HK2A 4OX8A 1FDBA 4DS4A 3MM9B 2GFFA 3GYNA 1SKSA 3FFIB 3PG9A 4NXMF 1JLGA 1SJ1A 2AW0A 2Z4PA 4WIQA 3D9BA 3HHNB 2JOQA 2WBRA 2N7YA 3LP0A 3CC7S 1HBOA 1NO8A 3PRDA 3MR2A 4QYZJ 3M8SA 2ZD1B 3F56A 4CYUA 3LQVA 2DNGA 1YJVA 5KFYA 1N33J 4LFAF 5L39A 2H5JB 3PW0A 3T1AA 2V34A 2F8EX 1EQ0A 3QWUA 3H0PA 3Q86A 4DDFA 5ITHA 5I3UA 2BDPA 4DX8H 2KTQA 3CJ4A 4Y2MA 1A0OB 2HBYB 3KHRA 2BXJA 2VQFJ 1DJ0A 2F1FA 1JLBB 1TAQA 4NI2B 3EGVA 2HFVA 2ZBRA 2HZCA 1OY9A 2BV3A 2DEIA 2MZJA 3P45B 2DNKA 4ZPTR 5IT9Y 4L74A 2NS1B 4ZPDA 1DHMA 2CPEA 4LF8J 1HHQA 3GE9A 3MAAB 3TEHB 2AEJA 1JX4A 3HXMA 2P5VA 2UUAJ 2GV1A 2ALZA 3QZ8A 3NEKA 2K2PA 2MTLA 4RO0A 4X84A 3OHBA 2K8GA 1UEVA 2PSZA 4WE1A 2K3IA 3MURP 1VQSA 2E66A 1JK9B 2CA9A 1FNMA 1TU0B 3NAHA 2MJUA 3I56S 3KLHB 3H7HB 3B54A 4Z7YA 4DV6J 1OY6A 1H2UX 2R3VA 2ZBIA 2AQ4A 1HW8A 4NLTA 3GTYX 3CTRA 2M8DB 3EVWA 4YOEA 1O6XA 2BW2A 4OV6A 4ZLLA 4K4WA 4UQGA 2R7OA 5CH7B 4DPOA 3ZZOA 2X3DA 3DOKA 2J7WA 3C6UA 3AXKA 1JIHA 2PA8D 2ASDA 1JMTA 2HMIA 2AGOA 4ZP6A 4U6PA 1P6TA 1SIZA 4PRFA 1N33F 2M0GB 1NU4A 2M88A 4EYIB 2IA6A 1N0VC 2NCKL 2ZZTA 3J81j 3V4IA 4IRKA 2QTWA 2HVIA 3LP2A 4CRJA 4AD6A 4ED3A 4DSFA 5GAHU 3JYTA 2GIQA 2G2YA 5M2RA 1HBOB 1FTRA 1WJ9A 1EZZB 3A13A 4GC7A 1D8YA 1HIYA 2GO9A 1S0VA 3MMJA 1U1LA 1KDNA 1HPZA 2IMOA 3KG0A 1FK9B 1RT7B 3OR2A 3FEZA 5ETMA 2MY8A 2VPYB 5GMKa 3TAMB 2KJVA 1RT5A 1BD6A 2NR0A 3OR1B 4X4VA 4ED6A 1LFPA 2V2QA 3VGTA 1FT8A 1LV5A 1I6JA 2OPPB 3D66A 4A8WA 5B0CA 5HVGA 4A8XA 1AYEA 1S9FA 3L7OA 1VQ5S 1U47A 1VQ6S 2A1BA 3IXQA 4WBFA 5B08A 2Z2MA 3HHLD 2ABYA 2BJ3A 3HHEA 1GAOA 3IM8A 5EHHA 2WW4A 4KKOA 1TK5A 3N6MA 4ZCLA 2DT9A 3EXCX 2MSTA 2CUYA 4LSNB 2Z58B 2BKPA 2OTLS 2VF3A 4CNZA 2PEBA 4FYXB 5C24A 2MHEA 2OD4A 2VG6A 3BSCA 3IRWP 4DN0A 2DXEA 4OHYA 1WHVA 4PPZA 3UQSA 3MR7A 2N82B 4DV2J 3V4IB 5LL6d 3MUVP 2ROPA 5D4OA 1TAUA 2EG2A 3O3LA 1T9VA 2D74B 3N4WA 1ZM4A 9ATCB 1VLOA 2WCXA 4XDCA 4ZVFA 3BSNA 4OZ2A 2YKPA 2CYYA 1EETA 1LW2B 1SH0A 2QRRA 5JVGQ 4J9PA 1TZ0A 1CVJA 3KUGA 3W61A 1B99A 1WC3A 2O01C 4UOHA 4CLLA 2XULA 1FEHA 3GJRB 4LT6A 1Z1ZA 2K3KA 4PYDA 3WQPA 4PZVA 3DOMA 1RK8A 4LSLA 4LRAA 2A18A 4PG7A 5ETQA 1NK5A 4YR2A 3AD7C 4ICLA 5D4PA 3TYTA 2HQ3A 3KLVA 1M5KC 1HBUA 3J7ZT 1R8HA 3LAKA 2Z8QA 2DRBA 2UVUA 2ZBQA 1EHWA 2N4DA 1XQIA 4NYOA 3RBZA 2UVWA 4KB7A 1YJNS 3X1LB 1T94A 1UJ5A 1U0HA 3B4DA 2LEBA 2UV8G 4R25A 3DLGA 3PFOA 4P72A 2WK4A 4PUOA 4P73A 5HAOA 3BKFA 4K50A 3D6HB 3LGHA 2HKEA 2AJ0A 2VH7A 3CDUA 3E3XA 4Y2CA 3RRHA 3QSIA 2HIQA 1EX8A 2FIUA 2W2OP 4WYLA 3M8RA 3D7SB 2L08A 3L7UA 3BQ1A 1Q8BA 2D3OR 2CG8A 5E7OB 2V4RA 3V6JA 3HK2A 1Y00A 5GVQA 3CCMS 1WC6A 1NK0A 5L1JA 1NK7A 4ANCA 3ZFVA 1S12A 2IVYA 1Q16B 2D9OA 3DM2B 4OI6A 4C98A 3R3TA 1IKYA 1KWMA 1U1KA 4DSJA 3M2VA 5KFHA 1BHNA 2WHOA 5HBMB 5E41A 2YNIA 1NJYA 1J5OB 4F2SA 4JI0J 3U1MA 4F2RA 3QT6A 1ELOA 2OELA 4LR8A 2G9OA 5K20B 2FJEB 4OX9J 3QYYA 1HYSA 3PRBA 2GGPB 1P27B 3GCWP 2K1RA 1RA6A 4AT1B 5CYMA 2V5HG 3JYTB 1VQMS 2E7VA 2FLPA 5DGAA 2K7KA 1YJ7A 2ZVIA 2UXDJ 2VB6A 2RMLA 4XDDA 3OLBA 2YPZA 2FB0A 3UVJB 3OLAA 1KOHA 4P7TA 5IXUA 2VDIA 1RTHA 1S1UB 2QLWA 2WW8A 4HACB 3SCJE 3DOMB 4KT0C 5MAOA 2J9DA 3CD5A 2DCUB 5KFMA 2CVEA 5HLFA 4N41A 1HNIB 1WHXA 2PDAA 4QYZK 1DLOA 3DRSB 3TUPA 3E51A 4RW7B 3C46A 4K4YA 2ZKTA 2FLNA 4PXDA 1YLXA 1H3DA 2MQLA 2DR8A 4DUTA 1SC1B 1DFDA 3A8IA 4WTOB 5CD4H 2R7TA 1TUVA 2GIRA 2AJFE 5LMUF 4CLKA 3SIPB 1B7YB 4M63A 3R5JB 2XS2A 4JUZA 2W9BA 4LUBA 2KB2A 4OHZA 3OTOF 1VQ7S 1NM2A 3V6HA 3OT9A 1NJWA 2VONA 5J1NA 1EP4A 2F8HA 3I31A 2YKOA 4U96A 2N3OA 5DLFA 1VC0A 3DLHA 3Q83A 3H5UA 1RWXB 2PE8A 1FJCA 1WC0A 3D0GE 4OHVA 3TVKA 2VG6B 1L3VA 1RE1B 2RNEA 2RSQA 3F44A 2JEIA 4FNHA 1AW0A 2LU2A 4FYWB 2PFFB 2DNRA 1RYRA 3JQJA 4HI2A 2GVZA 1UWAA 1IBCB 2GQQA 2HHWA 2WB1D 4RBVA 2FD2A 3VVTA 3L3CA 2Z2LA 5U47A 3DLKB 4KKOB 4N56A 3AJDA 1ZYQA 1C0TB 3RB0A 1K47A 2OFGX 3ADAC 4YP3A 2UUCJ 5KFVA 2X7IA 3WZ0A 2OPRA 2OMLA 4OLOA 3R9LA 2VG5B 4X65F 2W7PA 1TL3A 5J2QB 1HI0P 2W4PA 2KYXA 4KE5A 4N8OA 5BYQA 5DDOC 1UW4A 3LP2B 3P6YC 3VALA 3CCWA 2UXDF 3KK3B 1WWHA 4NLDA 3TWZA 2UVRA 3GIMA 4JI6J 4FZVA 3MECA 1DTTB 3EGWB 2AT1B 4LF8F 2F63A 2Q3PA 2GMJA 2V8DA 2D9PA 3JSYA 2W7OA 4DSKA 1N54B 4C48A 2B5JA 3OQ2A 3SDEB 1QVFR 2KRRA 4ZP7A 1G2EA 3M9OB 2HGLA 2PC6A 4DV5F 4FF1A 3G8QA 4URSA 2Y1JA 2Q43A 2BABA 2FVCA 1NK8A 5D3GA 1RWVB 3CIMA 3H90A 2LMIA 2QMWA 3NBPA 3US5A 5EX0A 2OD6A 4J9LA 1R8CA 1NB7A 1CS4B 1UFWA 3PKYA 3IN5A 1QSSA 2CPDA 4JI4J 4B3RJ 4F25A 5KFJA 2KT5A 1S77D 1JLCA 4ZCKA 2CNOB 4ZVEA 4LMZA 2MSSA 4USWA 2V4QA 2XNQA 3I0SB 3FQLA 5IWAF 3CF5Q 1UMJA 3ZNJ1 4RBTA 4ZVHA 5KG1A 4DR6J 2ZFHA 1HD1A 4PWDA 5G4DA 1T9XA 5K5MA 3FEXB 1HMVB 4DFPA 3ZZYA 4F4AA 4ANDA 2E44A 4EI2A 4Y28C 1REGX 3BYRA 1S9EA 4MK9A 5KG0A 5KFRA 1YIJS 4OYPA 2BRKA 4BWJA 1SL2A 1BC6A 1WEXA 2XZWA 1ZH5A 1FCAA 2MPUA 4FF4A 2LFVA 4LFBJ 4LF6F 2W9CB 2HK3A 3GFYA 2FC9A 1YHQS 2BANA 5LM7E 1NK4A 5HROB 4I67A 4ELVA 1FX4A 2IYGA 4ED8A 4G65A 2A6OA 2HRYA 2L9WA 1S72S 1VR6A 1RHUB 1S1VB 2Y0SD 2UV8A 4GVLA 2EVZA 2DR7A 3PYGA 4ECRA 2R8JA 3LP1A 2LDIA 2XEXA 4H4MA 3PYDA 2OAUA 3KK2A 9RUBA 4USMA 1UWBB 5LXRA 2ASYA 3KK3A 4DR3F 1U25A 2ADBA 1SJFA 2JH3A 3KUEA 2MLYA 5HATA 3BO3A 2PI4A 2V8GA 4HT5A 2FDNA 3R97A 3N79A 2R8GA 1L3KA 3Q23A 3LP1B 2HNYB 2OPQA 1RT6B 2DGVA 1N5SA 4QQBA 1RWUA 5CZVA 4ZHRA 1MNEA 1XR7A 4DF4A 3BO2A 2G2OA 3VAFA 1E6VB 2DO4A 1CJTB 3N9UC 1FWPA 1NAQA 2O67A 4QW8A 5J2PB 1EQMA 4K8RA 1TMJA 3RJMB 3ZZTA 1WTBA 1S9EB 2MXYA 5KT4A 5AE2A 3BKTA 5L8RC 4OZJA 1S0MA 1D9DA 2FJBB 4X4OA 4KBIA 4E2FB 3K5MA 1SUQA 1EKSA 1R8PA 3MDFA 4KAIA 4ZPWR 4DXLA 2LQ9A 1FERA 1OQ6A 4QPTA 3OHAA 4LF5J 3M9NB 1S57A 1U0HB 2RF2A 4K2JA 3NGDA 3M2RB 1F6TA 4LFCF 1H2VZ 2JFDA 3GMGA 1JLEA 4LIWA 3DOLA 2RKIA 2V68A 3OUYB 3K5NA 2W24A 3NS6A 5EUHA 4C11A 1FTCA 1VRTA 3SFGA 2QT7A 4DX6A 5IM0A 1ZAVA 2KKHA 2QMXA 1MG7A 1UKUA 4Y2KA 3R6GB 2E5LJ 2RDJA 3T9ZA 3CT9A 3GR1A 3T5JA 3P96A 1M5SA 2CZVC 1SL0A 4IR9A 3ENAA 1ULRA 4J9QA 2EW9A 1LQ9A 2W2PP 3CO0P 3MEDB 4IFVB 2FJAB 4LR7A 2E29A 4U7UK 2XCPA 2YH1A 3UCZP 3ZZZA 4Y65A 1SH3A 2ZD1A 4IR1A 2CAJA 2VZ9A 4GMKA 2EFPA 2ZNZA 1XC9A 4DR7J 3CO9A 3FK4A 1R0CB 2HFZA 4FNIA 5D0GA 4EWTA 1VQKS 1X8DA 5K8OA 3W3SA 1F0XA 1Z2ZA 2DTJA 2HQDA 3QRRA 1W25A 1S10A 3IGNA 3IS9A 4E98A 3PX0A 2DIUA 1J5OA 5H9FK 2M70A 3M8PA 4WFNQ 1RAFB 4MFBA 4Q2MA 3TZZA 3GFXA 1UL3A 2LA6A 4LF5F 3G2XA 2YWEA 3HVAA 1X9MA 4QYRA 2OFHX 4DR5J 2B8QA 3FFIA 4A8YA 3BO4A 2WONB 1VQ4S 4F4KA 1N36F 2ZJQQ 1IJEB 1H7XA 1NXIA 2HFUA 1WHYA 2YNGB 3I0RB 3NLCA 4WFZA 5AXMA 3SSRA 4X4SA 3PX4A 3G9CA 4UUWA 4MKAA 3C19A 1RCXB 1FRKA 4P10A 3HVRA 3EDRB 3C14A 4O44A 2VBWA 2IM0A 2SXLA 4OYMA 4K7QA 1RWPB 1U48A 1R31A 4DSLA 4Y2AA 3HFZB 3OFHA 3J7YU 2GHWA 4C3KA 3ENQA 1FX2A 1VLYA 2KU7A 4OHWA 4N47A 1ZPVA 4M5DB 2HS4A 2VOOA 2QFJA 5KFQA 3SSSA 5E33A 1WOSA 4R8UA 1YITS 3ZO7A 2VPZB 2ZUAA 4JP8A 5HN0A 1S1XB 4RL1A 2PMZD 1RBOB 2VC0A 3MGJA 4EUVA 2OEKA 1N56A 1I1GA 4UOCA 4CLUA 3CWJA 2HLTA 4GKJJ 1SPBP 1FRLA 1YBTA 2OEJA 2RHSB 3I5CA 2IVFB 3D1HA 3CJKA 4CP5A 4DUYJ 5DG7A 3W62A 2DHAA 2H9ZA 3R5AA 2GJ2A 1TKTA 3W2VA 3EYZA 1Q81T 2B4UA 4KHPF 1XERA 1R7IA 3M8QA 2E5HA 4I4BA 5LMNF 1Q5YA 4EYHB 2BBEA 2Z2YB 4OIXA 5I42A 4AQYF 8AT1B 2QYCA 1B4SA 5D0EA 2QLFB 2B56A 2I1RA 3I32A 5HK4A 5KOWA 1PKUA 2KVIA 3ZZUA 3PX6A 2DXFA 2JVRA 2QGFB 5KFAA 1RHMB 2C2OB 4O4RA 3ZTRA 5EWEA 4DLEA 4B9VA 2MKIA 2DRAA 2E9ZA 4B3OB 3HKZD 3KLFA 2BOAA 3KDOA 2QC3A 4HTJA 5KFGA 1S9GA 2HVZA 4JI3F 3FCVA 1HWJA 2HBZB 4OYIA 3PXGa 4IRCA 4C8MA 1X5OA 3KNAA 3BKUA 1S6UA 3T5LA 2QA4G 3CCZA 1NPKA 4NRUA 4P74A 2GHPA 2Q6CA 3KLGB 3LP0B 5THWA 4O3NA 1U02A 1UAWA 1PYOB 1VBKA 5EX3A 1N34F 2MDAA 2MB0B 2DVIA 1S7HA 1KS2A 4FVCA 3GJQB 5D6GA 4F36A 2YWFA 4ECSA 3SQGA 3EZOA 1HW9A 1UETA 2GO8A 4PWWA 4ZOSA 4XIUA 5DS7A 1HKAA 2QA2A 4P2MA 1E6VA 2YQ0A 1YTYA 3W66A 3ET6A 3PVXA 1K0VA 4PG8A 2EC0A 4FYDA 4DQRA 2CKWA 3PACA 5ETTA 4ILRA 1PILA 3P4UB 3KJNB 2AHOB 1MU2B 3P3DA 1OY8A 4BHQA 2Y8YA 1F9HA 1G3OA 1PBAA 3PIOQ 2IRUA 2XBPA 4ZPAA 2ZH4A 3PYEA 4TY8B 4WF9Q 1UTAA 2DGSA 4MJKA 2HPUA 3EJMA 3PJWA 4M5NA 1KTQA 1SJ4P 3UNGC 3MM8B 4DZ6A 2UUAF 1ZZFA 3BQ0A 1VC5A 1WDTA 5FLXU 1FRJA 2LEAA 3KK1B 4B3SJ 2DH9A 4DEZA 2UUWA 4MAKA 5J1PA 2QV6A 8RUCA 4XPCA 3T3FA 2PIIA 4TLRA 1PC4A 1TK0A 2LKZA 2QLBB 1O0PA 1X5TA 4F3QA 2AGQA 3MXHP 4KJIA 1Y5IB 1RU1A 2WSCC 2FJWA 2MZSA 3OTBA 4JB8B 3QRPA 2PEHA 3C66A 1W26A 2CPFA 4I6AA 3DOKB 1B0TA 1PBUA 1V6HA 2W8KA 2POKA 3K5PA 2LXUA 1QTNB 4Q8FA 1X4BA 1FJ7A 2V2KA 2CPYA 4C8YA 2W7AA 2FUG9 1VQOS 3VAMA 2XSJB 1RAIB 3QT8A 3HD1A 2BJ7A 3DMJA 3RTVA 3QFHA 3M6WA 1F3VA 3H59A 2AYBA 2J9EA 4FF2A 2V2ZA 4NA2A 3PKMA 1XMQF 1R8AA 4TNOA 5K14B 4RUCA 1KBRA 3Q8PB 3M9MB 1LOUA 2BQRA 3K7RA 3L7PA 4ZLNA 1U8SA 2HSEB 2ZH2A 3N01A 4WU2A 2U2FA 2B9YA 4FVMA 1IBMF 3LA0A 1T9WA 2CRLA 3OBIA 4ZN1A 4TXSA 1UEKA 1JXVA 3DN9A 4NE9C 4J9SA 3QJJA 3M6XA 1HNXF 4URGA 3W9IA 1N32F 4WZQA 3M6VA 1FF2A 5KT6A 2C28A 3LANA 1TUWA 5CHCB 2UXCF 3IR5B 3CDBA 1APSA 3AQOA 2NPIA 1LEOA 1CJVA 1OO0B 4YDXA 3VGSA 4ECTA 2IJNA 3PR4A 4BC9A 2O3DA 3BBCA 4NLGA 3FVYA 2JEFA 2KFNA 1SXLA 2YWWA 4Y0FA 4Q45A 4EBCA 3HHKA 1GEHA 4HLBA 1S99A 1U7LA 1Y7PA 4KV8A 4H4KA 2MHNA 4L72B 1AZSB 1RTJB 4ECUA 1KD1T 5C5JA 5M2PA 1IBKF 1Q7YT 3PDNA 4UW2A 4Y6IA 5GAEU 1D0EA 4W92B 1RTDA 3R1HA 5KTQA 1LWFA 4GKKF 1JLGB 2W9AA 4JV0A 1WKKA 3AOAA 2VDHA 4DR1F 4JI8J 3W9JA 3NL0A 1RTHB 3DFEA 1FJEB 4DL6A 2Z2ZA 2DNYA 2HAIA 1EJ7L 3SCIE 3MD1A 4WJBA 2RH3A 4F8RA 4L76A 3MEDA 2LEPA 1EIYB 3R5DA 3OL8A 2RD5C 2HVHA 2XM3A 1N36J 1VYAA 1C1CA 2KH9A 3D2WA 2LDYA 1WC1A 5T41A 1RHQB 2HMIB 1DTQA 1AT1B 1GXUA 3NGUA 4GO5X 2JC0A 2V63A 2AX0A 2OI2A 4B3MF 3BN4A 3ICLA 5IV4A 4LQ9A 7AT1B 3MTKA 2I38A 3F41A 3VGUA 3TOQA 2XI2A 4PAAA 3MEGB 4JOUA 1YBUA 2IJFA 3D1OA 4MK7A 3WHIA 1N8RT 4AL5A 5CA5A 3FNNA 5HLFB 2OUGA 4R8UB 2XY7A 3RAMA 5GAHI 2D7SA 2W2MP 3M05A 4DU8A 1YX2A 3JSMB 4JV5J 1JXEA 4O44B 3MUMP 1VQNS 2WSFC 4ED5A 3I4PA 1DRZA 2IM1A 4CI0B 4HDGA 2KXFA 2BZ2A 2M9KA 2VKZG 4OZ1A 2YWKA 3S7RA 3DYAA 1MLAA 2KT2A 2V8PA 1VK8A 2H51B 2V94A 1S6QA 2X1GA 1UP1A 2VFRA 2J76E 2DXDA 4KO0B 3TARA 1SV5B 4A4JA 4M5IA 4DR6F 3M2UA 4F02A 2XS7A 1TVRB 1UW9A 1HNVA 3KDNA 2IMWP 1CJKB 2IC3B 1VQ9S 2E9RX 4QU6A 3GSDA 2IAJA 5D78A 4RNFA 2B5JB 2H54B 3SDEA 5L38A 2FVQA 3DDIA 4JV1A 4LFCJ 2HHXA 2WVEA 3A12A 5L1IA 2GAHC 1FXRA 3AHPA 3AY0A 3HLUA 3I9V9 1IKVB 3ILLA 3MECB 4GVBB 3PCOB 2AYGA 4B3TF 1F9EB 1GMVA 1UZHA 2OO4A 4OYWA 5E3QA 5EWGA 3G6XA 4X66F 2XMMA 3FEYB 4NCGA 4R5PA 2VG7B 1P8GA 1ZM2A 2YWHA 2HGNA 5HQMA 5DQHA 3I96A 1TKTB 2X3GA 3G82A 3AJ1A 4NOHA 1XMOJ 4JI7F 3BGOP 4YR3A 4J9KA 2BE9B 3Q8RB 2F4VJ 2QJ3A 3GFHA 1FKPA 3WC0A 4C97A 1PJ6A 3IFEA 1M1KT 2B4PA 1KR4A 1GT8A 2AKWB 1SCJB 3CD0A 2FZKB 4RW8A 4QCLA 4J9MA 4R0JA 4UOGA 4DFKA 3M32B 2KZMA 1RAEB 1HD0A 3GPAA 1T03B 3RW6A 1U09A 1YWXA 1LWCA 2CDRB 3I55S 2M8HA 1S5ZA 2XC9A 1KNZA 3A1YG 3NBPB 1YRXA 2ZC3A 5M2UA 2DNNA 2ILYA 3M1VB 3NOCA 1PYTA 5A8WB 3MCMA 4JI2F 2VFUA 3RW7A 2J8SA 2PO4A 3UDCA 2ZBCA 5ETVA 1ZAWA 1JLQA 1XNRF 1FXDA 3T5HA 1AB8A 2ZBPA 4IG0A 3MAAA 1TL7A 1RTZA 4NLUA 4IYQA 4QR0A 4DS5A 1U1OA 4OI0A 4USTA 4LFBF 1DY3A 3MCSA 4MMOA 1WC4A 2M7SA 4ZVSB 2VBYA 4KPCA 3DXBA 3GIRA 2J0SD 1RTDB 4RW9A 1YBAA 2E7XA 2VG7A 4OJHA 2WVFA 2ZOGA 2RIJA 3DRRB 4UY85 2QIFA 1H7WA 1ITPA 4DV6F 2FJDB 3MCOA 5E3RA 1GMWA 2NXNA 1FFWB 1LWFB 3GJSB 2QE5A 1TL3B 1M1HA 4B08A 5HP1A 1D9FA 4QIVA 2K1RB 3D54A 5T14A 4V19J 1DQ8A 1FE4A 1P1TA 4I56A 2FTRA 3LALA 3GQCA 3DHXA 3VGVA 2MGZA 3GONA 3IS9B 4P9SA 2KI2A 4AL7A 1O8BA 2HVDA 4HHUA 1OYEA 4YY3J 5CYQA 2KDOA 1N5VA 4RWWA 1YKWA 1WELA 5DDQC 1TKDA 5IT4A 2XQCA 3JXOA 3MM9A 3MZIA 1X4CA 2QO3A 4NLPA 1XNQF 4OX7A 3DKDA 4QIEA 1M1GA 2DGTA 5AXKA 3BGUA 2UP1A 4M5GA 4DR4J 1CSJA 2I8EA 3KTQA 3V4MA 1U1RA 1WF2A 1FRMA 2YH0A 1RT2B 1Q5VA 4TY9A 2XY5A 1VRUB 2NUUG 4OQJA 2HNDB 3O5TB 2FGOA 2VL1A 3KHGA 3OFGA 3EX7B 3L4BC 2IBOA 4CO0A 3SYZA 3RRKA 3D1QA 3CGIA 3W63A 1UVNA 3KHHA 4LFAJ 1JNZB 2W9BB 1QE1B 3DRPB 2MKSA 3I0SA 3MEGA 1R6VA 1MSWD 3QIPB 4F04B 5CCMA 3H98A 2QX0A 3TJ8A 4PWDB 1BWEA 2GJIA 4J9NA 4DL5A 2WVBA 5A8RA 4ZK7M 1IQTA 4OHXA 2RAQA 3EM1A 3IP0A 3KXDA 3RGIA 4O3SA 4DV7J 1NBEB 1B7FA 2ZUGA 3W65A 2RE1A 2ZH5A 2F8MA 4KHRA 1F3FA 4M5LA 1QSLA 1K9MT 4PCQA 2C3OA 5J2MA 1U8WA 6FD1A 3CCTA 2MYFA 2P9GA 3FQKA 3Q89A 2MY7A 2PFDA 4KTQA 3E2EA 3LO3A 4GRSA 4K4UA 2ZE2B 1S4FA 4NRTA 2A6MA 3AT1B 4AQYJ 2NQPA 2GX8A 2E1PA 2CJXB 5ETSA 1S6PA 3OV7A 3ILOA 2BQUA 3HMJG 3BR9A 3K2YA 4GVBA 5LMUJ 1RAOA 4URQU 1CC8A 3PIPQ 5HBMA 4UF4A 3NCRA 1NK9A 4GKJF 2GQ2A 2V8VA 1PCAA 2HQIA 3RYLA 3PW7A 5L9XA 3IR6B 1FNOA 2DPIA 1WSRA 4TVAB 1UWBA 1KFDA 5AXLA 4D3HA 2YX1A 2DIVA 5C25A 1NJZA 2DPJA 2XHCA 1A7GE 1QD1A 1XN9A 2IM3A 3DXSX 3H8YA 1S79A 3R8YA 5DDPC 2RQ4A 2ZH9A 3I6PA 3H20A 1S1WB 2QYGA 2JFKA 4PABA 2EPIA 5HVFA 4P2FA 3PM9A 3BV8A 2ZEJA 3N0VA 3OR1A 5C7PA 4FBTA 3NOGA 1QAYA 3IMQJ 4RUBA 4BWMA 3IRXB 3OJSA 1SB6A 3KHLA 2R7RA 2HHUA 1URRA 2FZGB 3H5SA 3V2UC 2V9WA 1KQFB 1RA7A 3LGNA 3MMAA 2E1RA 3BB5A 4M5MA 3S8SA 2C22A 4C8ZA 4WIIA 1RISA 3BPDA 4H54A 3A8JA 3HVWA 1RT5B 4ZP8A 5F0WA 3UCUP 4X2BA 4MH8A 4KH1B 4WTYA 4DL0C 1FRHA 2HGMA 1RT4A 4OZ3A 1VISA 3Q8YA 4NYPA 2D3UA 3MPDA 1JLFA 2MKJA 3O2IA 1S76D 4OFZA 3W9HA 3CIZA 4B3OA 2GA7A 3MM6B 2KM8B 2YNFA 2JC1A 4ES3A 2HBRB 3TVZA 2AGPA 4K4VA 1NPRA 3IGVA 1H0HB 2XLJA 4X66J 2KXNB 4IO1A 4OJ3A 2GGPA 4C8NA 1EETB 2R9LA 2OJ3A 1VDHA 1I94J 4IH7A 5CQGA 3BGLA 1IR0A 3GWCA 4CTAB 4CLTA 2HLUA 1W7WA 3PJ9A 1SQGA 1HWUA 1IKVA 3OFEA 2N7CA 1F5CA 2C3MA 2PT0A 1HQEB 1XR6A 1R0AB 3K8VA 4W98A 3CEDA 1NB2A 2WOMB 1SC4B 3OD2A 3AAWB 3D0IE 3KWMA 2HHVA 4PPDA 4L75A 4C8LA 4HL9A 1DQ9A 4HTIA 4ECWA 2E5JA 5SZTA 2VASA 1PGZA 4HKQA 1WG5A 2ADCA 4PXCA 3F0NA 1ACMB 4P2XA 2JLEA 1VQPS 1R43A 4TYBA 1GX6A 3UD3P 4K0KJ 4EO6A 3I0RA 1Q1KA 1C4AA 3R7SB 1FESA 4B17A 2HG4A 1GXTA 1KKHA 4NLSA 1JJCB 3M30A 5JVHQ 2CJYB 4DCOB 3OFFA 2DHGA 4EMDA 3LUYA 1RWNB 3CJ0A 2ZHBA 4B9LA 1EP4B 1Q86T 2JJ4D 1BWVA 4NLQA 4WU3A 4NEYA 3DLBA 2B9XA 1WACA 3CJ5A 4XK8C 2BM0A 2FPHX 2HURA 2OLWA 3NKYA 4MIAA 5DG9A 4FPRA 4WCEQ 3TAPA 3BDPA 4PG6A 3LGMA 2DH8A 1K73T 1T7PA 2VOPA 4TU8A 4IO9Q 4ECXA 1DQAA 4U8VA 1FE0A 3D28A 2DGWA 3UD4P 5E3PA 1M0SA 2CIMA 4RW6A 2VICA 2XMUA 4ZVOB 3QJLA 1HQEA 2IVMA 5LT5A 3GIIA 1R0AA 3J7Z5 4KH0B 2KHCA 2ZVSA 5E3AA 5C42A 5IQQA 3CJKB 4P75A 3T1HF 1C2PA 3HI9A 3QMQA 1LKZA 4ZMMA 4C11B 5J2MB 5F3ZA 5I42B 3KG1A 3KK1A 4OMFG 3KFWX 4LJMA 2LXFA 4QZVB 2E7WA 3G86A 1OS5A 1R6YA 2BJDA 3UCGA 3IWXA 3CDWA 5IC6B 2ZM6J 1X9SA 2YKMA 3MCNA 2VFTA 4P2SA 1IJFB 5KFUA 4F4XA 3CMAS 5HI7A 2E5GA 3CCLS 4DMZA 2QN6B 4WE1B 4S0MA 3K17A 3M2VB 4DOZA 2W8LA 2LXIA 4NCBA 1KHVA 1H2TZ 3UDVA 3KLHA 3LWMA 2J7KA 2B51A 3D4JA 3LH2S 3CCJS 1XMQJ 1IBLF 1Y11A 1MN9A 1WNEA 1BQNA 3Q0AA 1CS4A 2XMVA 3KLIA 2W01A 4DI6A 4CLSA 2ZDPA 1GK8A 2ATLA 2E5IA 4M5KA 3K89A 4N7TA 1RABB 3QFWA 4NLRA 3THPA 1H6KX 2DITA 2I2YA 2BJ9A 2OGUA 5I3PA 3SBMA 4C4WA 2LQJA 1JLCB 1ZM3A 3RZAA 5F8IA 1XEZA 4DU7A 2RU3A 1QY7A 2ZH7A 5A8KA 4U67Q 5H9EJ 2R2SA 1VRUA 5D77A 4RBUA 4ANEA 4ZKAA 4QOTA 3UE2A 3BGFA 5CYJA 4PR6A 1UPMB 1PIEA 3BF4A 5L46A 5I3UB 4DV1F 1IBMJ 1Z4UA 5KG5A 1T05A 1NSKL 2LQ8A 2J6TA 4DUZJ 1UJ4A 1WI8A 2CNNB 3ULHA 3M7VA 2EKYA 3JAMU 1HPZB 3MOZA 3TZWA 1U6ZA 1VRQC 4NLWA 2VV5A 3N5FA 1T3OA 3NGKA 3AH6A 4OYOA 5F8GA 4X62F 1FD2A 4LF9J 2HWTA 1AROP 1ZAXA 3V6DB 1TP7A 3KJFB 4ATNA 3N6NA 3OXLA 1LW0B 2UUTA 1SBRA 3MAHA 3MD3A 4CM0A 1U1NA 4N77A 4KGXB 1FJGJ 1UA0A 2C2NA 3M8QB 4KGMA 3QAEA 1S1VA 2J7UA 2DCLA 2OPRB 3ETOA 2P8IA 4I68A 3RBEA 2CWKA 3HO1A 3MM6A 2MJNA 4IDKA 5KG6A 4F0HA 2C2EA 2RJZA 2V2VA 1HI1A 1YJWS 3C2PA 1N5TA 1V3ZA 5A2QU 3R5GA 3HHLA 3W2VB 1R0BG 4IOBA 3K8WA 4YB6A 2YX4A 4Q5VA 4ZA1A 2DB1A 1N5YB 1UPPA 1XTZA 1GTHA 3FDSA 4OI1A 3T41A 1RWKB 3H25A 1VHIA 3GU0A 2IDLA 3TX0A 2EEYA 2XG8A 5HMZA 2QA4S 3GIKA 5A0YA 4B9NA 1Q0NA 2EFOA 4RX6A 5F8NA 1WKJA 3TANA 3AD8C 1OSCA 4TKTA 1WORA 3MEKA 1YVFA 2ZWOA 4OI4A 3SSQA 4A8SA 3F73A 2ZZMA 3AOBA 3A8KA 4CNYA 2YNGA 4Q7AA 5B7WA 4I6WA 3GG0A 5EGYA 3CXCR 1NKBA 3FBBA 3MPWA 3N28A 4DSIA 2EG1A 3L95X 1CQMA 4LRBA 3V6DA 3PJXA 3KMSA 2HHTA 2KM8C 5E2QA 1CEZA 3KOAA 5B0FA 3QT7A 2C2DA 2VD3A 1JLAA 3NXZA 1FEEA 2E1MC 2BR0A 3HJFA 3MMCB 4RUAA 1CJKA 4Z2XA 2Q79A 1IM4A 4HI1A 1K1SA 3ZNUA 2BOPA 1E6YA 1IKXA 1U26A 2HNZB 2VPXB 2YBVA 1TELA 3MMAB 4K4ZA 1IBLJ 1NZ8A 3PW5A 3QGHA 5DQGA 1LW0A 1SVDA 1S6QB 4N8NA 2BYCA 1RT3A 1S0NA 1VK3A 1NSAA 3PNIA 4H4MB 3W5YA 1KP6A 2EKNA 2CNKB 2HWHA 5AE3A 4DV0J 1KTVA 1IKXB 4DL4A 5HP1B 1UCNA 4ER8A 3CNQP 3QGGA 4ES1A 3VAJA 2BX6A 3CMQA 1OWXA 2KO1A 2A3JA 1QAIA 1NHKL 1SIWB 4U9RA 2C42A 2ZM6F 4DR2J 1G7CB 3NAIA 2XWXA 2NPFA 2WRMA 5ETKA 5LMNJ 1N88A 3B8HA 2D3O1 3RRGA 4CLWA 5DGBA 1EB0A 3RR7A 3ZTSA 4OZLA 4JI5F 2P2CB 3C6UB 4RLEA 4I2QB 3KLIB 1UVKA 3M8ZA 2HS0A 3CSKA 4LRFA 1SQEA 1IN0A 2J9CA 5B0GA 3TW0A 5A8WA 4HHJA 2X1AA 4DL3A 4DR5F 2CZ9A 3DU5A 2ZH3A 1I3OB 1Q79A 4YQWA 2MQPA 1RYSA 2F4VF 2F3JA 2MKHA 1PJ5A 5D0HA 3RUBL 3Q22A 2P6SA 1FDNA 4PUOB 2EC2A 2BE2A 3L09A 5J1EB 5FLXY 1LWXA 4C8OA 2EXUA 1KEKA 2BRLA 2VFSA 2F7VA 4ID5A 3NCQA 4LBIA 1J5EJ 4K2XA 1YSJA 4IG3A 1EKRA 1YK9A 1LWCB 2OPSA 4FP9A 5JMNA 3CCRS 1U1MA 4DQSA 1JKHA 2QEXS 1HNZJ 2XY6A 3FZ2A 2YKQA 2KL8A 1CJTA 1NEEA 2N4CA 3E01A 2FY8A 2H3EB 3I5AA 1N6QB 4X4RA 4CLPA 4JYAF 1AFJA 2CNLB 1SC6A 4RNHA 2UU9F 1H74A 2XYGB 1TTHB 4K0KF 5C42B 4A8KA 4OV1A 3EVOA 5B0EA 1YRUA 2G1DA 2LCWA 1H38A 3PYFA 3CJTA 2VIHA 4B9TA 1MWQA 2DRDA 4LQ3A 3EGZA 3BBBA 3Q2TC 3SI8A 4LIRA 1U6BA 1W2IA 2IIHA 2VU5A 4JBCA 2IC3A 3JSBA 3AXMA 5HJXA 3U7JA 2W4CA 1UFKA 2CJAA 5ETNA 3UI3A 4ZS6A 2LU1A 2D3ZA 1KONA 1IKYB 1YZ7A 2ALYB 4F3MA 1KC8T 3MM7B 2PN6A 4WFBQ 5LXYA 2BKNA 3MM5A 4NWBA 3CCUS 2HW3A 3SCLE 2VUGA 1DZ5A 1XNQJ 1Q4RA 4ZP9A 1REVB 5F3TA 2CPIA 4NLYA 3G96A 4FS1A 4PQUB 3AA9A 3DDKA 5D4LA 5GMEA 3W5XA 5A8KB 4YY3F 3FMBA 1S1WA 3DLEB 4JI6F 1M5PC 2MKYA 4F4YA 4FYYB 3NWGA 4M8LA 2M2BA 2MLXA 1H72C 4DF8A 3JAMY 4HEA9 1RQ0A 3IBFB 3TA2A 4I7FB 3VQTA 1NDLA 1NDPA 1WHWA 2GNKA 4AUKA 4MYUA 2DGOA 1B0PA 1JJ2R 1KLNA 5A0YB 1HBNB 3MTJA 2B7CB 1DTQB 3CCSS 4DR3J 2UUCF 5IT0A 4IRDA 2FGCA 2IM2A 1HNWF 3TJ9A 4WFYA 3NNAA 4TQRA 3C15B 1DLOB 2NXCA 3DRSA 4W4MA 1LXNA 2PMHA 3R7NB 3C6TA 3GYGA 2XI3A 4USHA 5DM7Q 2NZCA 3BN7A 4O0IA 1FD8A 4M94A 1D1UA 4H4OA 4OL8A 4L6V3 5D15A 4P52A 4O3QA 3SMZA 1RHKB 4DLGA 2ZJPQ 2F9DA 4HR2A 3QO9A 1RLCL 2ZITA 4PXEA 1RHJB 1X4AA 2VA3A 4LF2A 1RDRA 3R7BB 1WC5A 1KVJA 2YNFB 2KZZA 1IM6A 5FIIA 2APOA 1X4DA 1W2BR 5E5NA 1IKWB 2DJWA 2KHDA 2VG5A 4LF4F 4M5DA 1F60B 1NH7A 4TU9A 1CQNA 1IWAA 4MKVA 2HEKA 4WFXA 2MZQA 4WXOA 4CIOA 1LK5A 1O5JA 1MWZA 1RTIA 3AQPA 3H2VE 5IC4B 4OZ0A 4EEYA 1NPPA 1FWKA 3RU0A 2NLWA 3KYLA 1WEZA 1Q95G 5KFKA 5C24B 3HM9A 3RR8A 3W5ZA 3WC2A 3ZZPA 4IH6A 1Y5LB 5DJBA 4PQAA 2R8IA 3Q8QB 1F2GA 3WX8A 4OI3A 1TKXB 4WKYA 2B6AA 4LF6J 2AJQA 2BANB 3VZIA 1V9OA 4QWDA 4I2PA 3T6BA 3FRZA 4I1TA 5KFPA 2JRSA 5I3QA 3GJTB 5KFFA 4CCHA 5F8JA 2KFZA 4DZDA 4RUHA 3HSDA 4FXDA 3IO1A 5IQ6A 2ZDOA 3DGPB 1VC6A 2XHWA 5HMXA 4DCPB 4Q8EA 3UN3A 2RILA 2OSQA 2LP4A 5HSPA 2XLKA 3H5XA 3MMCA 5HQLA 7FDRA 4N5SA 2C2RA 4BS2A 1TFWA 1FK9A 1RT7A 3OR2B 2QA1A 1PJ7A 3HD2A 2MKCA 3POTB 4CO1A 3BSOA 3M2UB 2V4JA 4K59A 4L3NA 1TUGB 2HNZA 2HBQB 3JTOA 3K5OA 5IFMA 3T1YJ 1CULB 1OYDA 4BC7A 3TUZC 1K8AT 2HFOA 4NLXA 2C3PA 1NJIT 2QLJB 4H4OB 3DLGB 3D3CJ 5A8RB 4ELUA 4UOFA 2UUBF 4M95A 1JLAB 4DFMA 1X4EA 1HQUA 2L3MA 1S59A 3QO9B 4G1PA 4HT7A 2W9CA 3RB4A 3CD7A 5KFDA 1FKAF 3DLJA 4OYXA 2R8KA 1KVKA 3E01B 1HWLA 1IR2A 2PMWA 1N6QA 3FCHA 2CQ3A 1D09B 1Y4ZB 4ERDA 3EPGA 3VAIA 2LQBA 4JV5F 1KN6A 2AJ2A 2DO0A 2NZ4A 1F5BA 4LF1A 4ZJOA 2G2ZA 5JUMA 4XPEA 2V0NA 3CPWR 2IBKA 1FKOA 3DI6A 4LR9A 1N48A 4F67A 4ENOA 2HHSA 2R7XA 1FFSB 1RACB 4ZVGA 3SEOA 2E5LF 5J2QA 3D6MB 1JQGA 4YMEA 2ZZNA 6FDRA 1SJRA 4NA1A 4DV3J 1AUDA 1RSCA 5J2NA 3GV7B 4DX5A 4F0MA 3DLEA 1JJHA 3AODA 1L3UA 4ZHRB 3HHLC 4JV2A 4CM2A 4YS2A 1TK8A 2DK2A 4LF4J 4LVOP 1RAJA 2HWIA 3GZ7A 3NCPA 4CO4A 4DJBA 5LSLA 2OPPA 5AJ3F 2PA3A 3ITHB 1G4CA 3H40A 2FHOB 3I82A 2V67A 3CMES 4ES2A 3BJYA 3RAQA 1B3TA 2Y8WA 1PC5A 1J5EF 2RT3A 1HBMB 1AFIA 4QIGA 2JLFA 2EI5A 3W2WA 3GSIA 2A2CA 2YNHA 5L1KA 5K14A 2Q66A 3TZXA 3W60A 2HRUA 3N5BA 4C7QA 3NG8A 2NREA 1R8BA 2CQPA 3AOCA 4USIA 2EK1A 3C16B 3HVTB 3VVUA 2IRYA 1M90T 3D3BJ 2PGCA 2J6SA 2B43A 1TL1B 1BGXT 3JSRA 2RUGA 3ENVA 1NCLA 3OL6A 2FYXA 3PFEA 3HSGA 1RB0A 3G8SA 1YJTA 4IFYA 1NKCA 2OH2A 1CLFA 2AEMA 4O23A 2D41A 1ZOTA 2MZRA 2VQEJ 3GV5B 2OPSB 1M5HA 2JVOA 2OTJS 1HNVB 1I5OB 2DKOB 4WP3A 3OW2R 1PSDA 1VQ8S 3TI0A 2DEJA 4PG5A 4FKXA 3W7BA 2XYPB 4U7CA 3DLLQ 5F8LA 1WSVA 1XMOF 2UZAA 4JI7J 2NXUA 4GKKJ 2XMJA 3W1YC 4YHHF 3M4XA 3ILIA 3H5YA 3JTNA 2HZVA 1S4EA 4ZJQA 1QAXA 2L9DA 5IM0B 1AXQA 3EVMA 4USUA 2VODA 4EBDA 3CJRA 3GB0A 4ED0A 3QQCD 3TA1A 3I87A 1MW7A 1S1XA 4J9VA 4IQXA 5D0RA 5BYRA 3W64A 4CZCA 4KGKA 4DPYA 3QGPA 5KAKA 4WFAQ 3C8YA 1IXKA 2H4YB 3FGVA 2AIRB 1RAAB 5CZXA 3ZTQA 3HT3A 1U49A 5D8HB 1RT2A 2D69A 3T5KA 2CPJA 2HHHJ 2Q6BA 4DSEA 2MEWA 1RJJA 4J9RA 1CJUB 2IY5B 1RWMB 2ROEA 2LQ5A 1DURA 3MM7A 4K4TA 1X0FA 1T03A 2X1FA 3T9NA 3K0JA 4PQUA 1RT6A 4DHVA 3J81Y 1RGVA 2J8AA 1T95A 4I2PB 1NNDA 1TL1A 2X51A 3SFUA 5C25B 1NLKL 3TZYA 3HULA 2AD9A 5C2GA 3R2DJ 2HHQA 4WZMA 4ZPBA 2K7JA 1JB0C 3ZZ0A 4YR0A 4MYTA 2RB7A 2AJ4A 5KOXA 5KFWA 2XO7A 5J2PA 2DGUA 4CYUB 5A6PA 2CQ1A 4B9UA 3K57A 3RB6A 4FDFA 1TMMA 1JXLA 5ADZA 4MTPA 4B3SF 2XO6A 2GZOA 1OPZA 1X60A 2LA4A 4RJVA 2XZTB 3PV8A 1CBKA 2DR5A 4ILMA 3A3NB 1LK7A 1ICEB 1NSPA 2GQCA 4FXWA 2PD1A 1UEUA 3JQKA 1K44A 3S6EA 3ZXWA 5HL7Q 3VAKA 3OSPA 2FLLA 4DR7F 2AZ1A 4RW9B 1I51B 3HT0A 4CQ1A 1C0TA 2G0IA 3NNHA 2P6TA 3HZGA 1CJVB 5HANA 3DHWC 3QJPA 3FSIA 4KV8B 2F5GA 2XLIA 4CT9A 5HROA 4B9MA 2I6WA 1HNWJ 1SJ3P 4V1Ak 1WOOA 2ACMA 4YDDB 2NSCA 1VS3A 3BREA 5DETA 2DNMA 4ZITA 3EWGA 4DL2A 1U24A 4QR1A 2Y0BB 2AZ3A 4X4QA 1PYSB 2DNOA 3VAGA 2FZCB 4J91A 5IS2A 2LECA 4A8FA 1WOPA 2UVVA 3RBDA 1TQLA 4EZ9A 5C2CA 2RU9A 4HH1A 3EGNA 1GNKA 2B4OA 3IR7B 1D8ZA 4ZN3A 1TFYA 1H73A 3DCAA 5IZHA 4YB1P 3HHLB 4CH0S 2RUSA 3MR3A 2Y1RI 4A47A 4A8QA 4PKDB 1SQFA 5ETLA 3S01A 4TYAA 2LLZA 4C3MA 1FFGB 4LSLB 2ZH1A 1UZDA 1F2HA 3D68A 1VJWA 4DL7A 1FXLA 2EK6A 5ETRA 5GADU 3FUYA 4RW8B 1C1CB 4KRWA 1DBDA 1S1TA 3CCVS 3NGTA 3LTOA 3UPFA 2XSFA 4QIWD 3UR0A 4CO2A 1T8EA 3CULA 1HNXJ 5A6WA 3NGRA 2F65A 2BE7D 4K5RA 5K8MA 4Z7CA 1ROFA 1KLMA 1TKZB 2YNHB 4UQTA 3POTA 2BJ8A 3QBCA 4QBUA 4KGZB 1VMBA 5DLGA 2QL7B 5B0BA 4JI3J 3QATA 4YB5A 3GR0A 3DRRA 1P1LA 5KT3A 3AB4B 3CJQA 3HKWA 1KLMB 1TKZA 2DD8S 2RDIA 3PW4A 1NUEA 1Y10A 3FBFA 2BJEA 1MMLA 3UN2A 2JZ5A 4LSNA 1NHVA 5DZ6A 4LF7F 2B4VA 2R7QA 2DHXA 2YY3A 1RT1A 2B9WA 2KG0A 4WK1A 3LOUA 3G6YA 2Y1IA 1YDLA 2MLZA 4DUYF 1OMSA 2AJ1A 3IM9A 5CABA 1JWWA 2GVDB 1F9FA 4IQMA 4LSZB 3U02A 3S1TA 4YFUA 3MM5B 2BJ1A 3AB2B 3W8PA 4FN5A 2QL9B 3ZTOA 2R2TA 2GIFA 3NRBA 1VIXA 3ITHA 4C0BA 1OPIA 1WG1A 4G3IA 3MFIA 1WF1A 2YQ1A 3VWSA 3PO5A 3TA0A 3M8PB 2K06A 2DY1A 2GMHA 1FKOB 3DI6B 1Q53A 5HMWA 2ASJA 2JX2A 5LJ3Y 1YG0A 1N52B 4TN2A 3GG1A 4IKAA 2EFQA 1P9YA 2J5AA 3FSYA 1VFJA 1LW2A 2ACYA 4LF9F 3PRVA 3PY8A 4M1KA 2XMWA 1FWLA 3MMBB 4KPYA 4WWSA 1ZPWX 3KJVB 3MPVA 2VQFF 1XK8A 1JLBA 1V3RA 5KFBA 2AU0A 4NL5A 5LOQA 2XGPA 3EZ5A 3CW2C 1YRTA 3CVKA 3N6LA 4E8UA 1DAXA 3VQSA 4IUFA 4WP9A 2J6UA 4QWEA 1T9UA 1VHFA 2JHEA 2VFVA 1NSQA 2EBGA 5BXIA 2C2KB 4LREA 4OLPA 4QJVA 4QWCA 2P9CA 1HI8A 4NMLA 4M5HA 3UR3C 1N34J 2HHHF 2CXEA 3CDAA 2GC8A 4UT4A 1Y3JA 3MPUB 4MIWA 3BZQA 4RNOA 1E6YB 2EFGA 1BMQB 1J2VA 2C3YA 2VC1A 1FRIA 1RKIA 3GFZA 4J9UE 1HYSB 3HSJA 5ETPA 1YZ6A 2QSWA 3DLKA 3OXFA 4UUXA 2UU9J 1BQMB 1TL4A 2YWGA 3ISZA 1N0UA 4J90A 1EAYC 1T9YA 2RS2A 4WXWA 1EARA 1XR5A 5KG7A 3NGSA 1RP5A 4AL6A 1HNZF 4OZ5A 3JS9A 4EO8A 2YKAA 4J7CA 2CPZA 6AT1B 1BQNB 3D67A 4PYAA 3J80Y 4KY3A 3R1LA 2RVJA 3HCXA 4KHMA 4DQIA 2AYEA 2HZAA 2MGZB 4IH5A 4W90B 1WEYA 3CCES 1WF0A 4A46A 1TV6B 1HL6A 5KFXA 2WAQD 3DC2A 5MLCV 3H4BA 3DU6A 2E1CA 3NNCA 1VCTA 5CYQB 1VBXA 3WBZA 2ZH8A 1IR1A 1OJ4A 3M8WA 4KIAA 5FDLB 1SJQA 3J80U 3WIUA 2B9EA 2CDQA 2XSJA 1KQSR 5CXTA 3HHDA 3QWPA 4A8MP 4RW7A 1MN7A 4MKBA 5AXNA 1X31C 5LJ5Y 1U0SA 4ICLB 2MQQA 1QSYA 2GW8A 2RHQB 2ZWPA 3A3OB 2IRXA 5F8MA 2H65B 2IPOB 3TR5A 4X4UA 4RNNA 3BR8A 2GMLA 2NYIA 2XWYA 4JI8F 2HHPA 4NASA 3IBWA 2BEFA 5L9NA 3CUNA 3LW5C 4F4WA 1BLUA 1RT4B 3R6LB 1RLDA 2Z57B 4FKYA 1HBNA 3BM7A 5IT9U 1VJQA 4ZCMA 4GC6A 1JKHB 2OSRA 3O8WA 1SKUB 1IBKJ 4IFVA 3FJ2A 3C15A 2KXHA 1XIQA 4U95A 3G71S 1QE1A 2NXJA 3DRPA 3B78A 3EMTA 3NS5A 4OX6A 5KFLA 3O1LA 3TNVA 4DBQA 3MM8A 4DUZF 3Q8VA 1U45A 1TR0A 2HFNA 3VTIA 3FC9A 5B0AA 4NX9A 2RQCA 2CPXA 2M5YA 1F5AA 1JLFB 3GCXP 1KVIA 2M52A 1AZSA 1PAEX 1R27B 1RT1B 1RTJA 2F40A 1Q7LB 3DM2A 2RRBA 3GILA 4E0DA 5DG8A 2E9TA 4Z37A 2YNIB 2GVZB 2F4FA 4HYKA 4Y2IA 1B0VA 3P49B 3A4TA 1RZMA 2DNZA 1RI7A 2ZH6A 1X4GA 2C3UA 1QTMA 4H4KC 2B0GA 2CQCA 4IDKB 7FD1A 2J0QD 2VBXA 2XMTA 4ED4A 1T3NA 3W8GA 1FHTA 2AWZA 2H5EA 2IA0A 3C14B 1U6FA 3GYXB 2QMUB 4AYBD 4ED7A 3M6UA 4DFJA 1UFLA 2CQGA 2XNRA 1Q78A 1REVA 2BUNA 2RQKA 1LNQA 3OTEA 4ZVTB 3IAS9 1YJ9S 3OL9A 3VV2B 1T02A 2CQDA 3CE8A 2GCFA 2KYZA 3UFCX 5IWAJ 1RUSA 3TJAA 5HQ8A 4O0NA 2YVSA 5KFSA 4QWAA 3HJVA 2VQEF 3TQ1A 3X3UA 1HFEL 4UY8T 2EFNA 2XMAA 2XZDB 2M4MA 4O3PA 4RU2A 1T11A 1HNIA 3VCDA 4B3RF 3G4SS 1SL1A 1HR0J 4NZ7A 1CPZA 1R3NA 3UO0A 2YXLA 3Q2SC 4NZ6A 2ZOMA 2HFSA 2CFXA 4OJ1A 2DY9A 3EE3A 3QZ7A 5L1LA 2AMCB 4JYAJ 5HJYA 1HQUB 1RAGB 4DCJB 2FC8A 4IOCQ 1FO1A 4P71A 5GAGU 2IJRA 5HO4A 1L3SA 3I4HX 5D4NA 5CD4A 2W2QP 4NXNF 1ZA1B 4LF7J 2RKIB 4LVNP 4RU9A 4Q44A 3GLJA 1S6OA 3UD5A 2AEFA 4DX7A 2WZ1A 2VHGA 1FVSA 1G6BA 1SH2A 4X62J 3MI7X 5AJ3J 4O3RA 3IA0A 3IWNC 4AXJA 2DYAA 4EZ6A 3EZUA 1QM9A 4A8OA 1MROB 2DGXA 2YKNB 2ROGA 3H2LA 2V69A 4OZNA 4J9OA 2CJKA 1JNRB 3LWLA 3TVYA 5KFZA 4C2MA 1N5YA 2HQGA 4DV3F 4J37A 3G82B 3HDSA 2Z0GA 3LPEA 1FRXA 1OSDA 4RZRA 1ZETA 4ED2A 1U2CA 2YKMB 2QSFA 3KKFA 2I9SA 4DQPA 2YQ3A 3Q8SB 2BMBA 5H9EK 3J7A1 4EK2A 1HWIA 1C0UA 2Q1LA 3EICA 4OYZA 1HHTP 3KLEB 3OPKA 1S7IA 3UVJA 4WK3A 3SQGB 4UTGA 4NCGB 1TKXA 2OKQA 1U2FA 1ZTWA 2KJWA 1S49A 3RBXA 3ELHA 1RAHB 3H2UB 3LAMA 4ZVRB 4X64J 3ET6B 1BY9A 4DQQA 3M8YA 4CDIA 2DGQA 4X4TA 3C3LA 4BCAA 3CJ2A 3H4DA 1HWKA 3IAM9 2F9JA 3WX4A 1RCOB 5T7LA 3EPIA 3JB9k 2H5IB 1YI2S 1URNA 5DO2A 2Y1LB 1JJ4A 2JEGA 1IVZA 2EBEA 2RDDA 2G0CA 1J27A 3BYPA 4IFYB 2J9DE 3CJ8A 3LPYA 5AE1A 2DNLA 3DGPA 1HR0F 1IUJA 4FF3A 1UVLA 3CC4S 3OSNA 3NY0A 3QNWB 3W2WB 4CH7A 3QRQA 2ILZA 1RU2A 2KG1A 3BEGB 3IC1A 3CB4A 2C1EB 1SKRA 1BE4A 3PO4A 4NPOA 4KHPJ 5GAEI 3M30B 3TX8A 4JI4F 3CCQS 3QSYB 4TLQA 4KO0A 3P8BB 4F4ZA 4G1QB 3RAXA 1UA1A 1A6LA 2HQCA 2KVQE 2CADA 2W2NP
chains in the Genus database with same CATH topology
4KYZA 4DV5J 3J7AN 1XMQJ 4DR6J 4LF8J 1N32J 4LF6J 2UUAJ 4NXMJ 2HHHJ 2MTLA 2MEWA 3J81U 3IMQJ 4NEZA 4LFBJ 4DV6J 1J5EJ 1IBMJ 3R2DJ 5LM7E 4GKJJ 4JI0J 4DUZJ 1HNZJ 5IWAJ 4DUYJ 3JAMU 4OX9J 2KL8A 3T1YJ 4LF9J 4B3MJ 4RJVA 1HR0J 3OTOJ 3D3CJ 2UXDJ 4JI8J 4X66J 4JI2J 2UXCJ 1I94J 4JI1J 1N34J 5BR8J 4X65J 4HHUA 4YY3J 1HNWJ 4YHHJ 4V1Ak 5A2QU 4DR1J 1N36J 4LF7J 4JI5J 4X62J 2UU9J 5AJ3J 1XNQJ 4PWWA 4DV3J 4K0KJ 4LF5J 4KY3A 4LF4J 2MQ8A 4JV5J 1XNRJ 4DV4J 4LFAJ 3T1HJ 3J80U 4DV2J 2UUBJ 2E5LJ 4DR3J 4X64J 2UUCJ 4DV7J 4NEYA 5FLXU 4B3SJ 2UXBJ 3R2CJ 1HNXJ 3D3BJ 4LFCJ 4JI6J 4DR7J 4NXNJ 1FJGJ 4AQYJ 1IBLJ 4JYAJ 5IT9U 1N33J 4JI3J 2VQEJ 1IBKJ 5LMUJ 4DV0J 4KHPJ 4B3TJ 4DV1J 2ZM6J 1XMOJ 4DR4J 4DR5J 4JI7J 4DR2J 2F4VJ 4B3RJ 4GKKJ 4JI4J 3W1YC 5LMNJ 2KVQE 2VQFJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KYZ A;  4DV5 J;  3J7A N;  1XMQ J;  4DR6 J;  4LF8 J;  1N32 J;  4LF6 J;  2UUA J;  4NXM J;  2HHH J;  2MTL A;  2MEW A;  3J81 U;  3IMQ J;  4NEZ A;  4LFB J;  4DV6 J;  1J5E J;  1IBM J;  3R2D J;  5LM7 E;  4GKJ J;  4JI0 J;  4DUZ J;  1HNZ J;  5IWA J;  4DUY J;  3JAM U;  4OX9 J;  2KL8 A;  3T1Y J;  4LF9 J;  4B3M J;  4RJV A;  1HR0 J;  3OTO J;  3D3C J;  2UXD J;  4JI8 J;  4X66 J;  4JI2 J;  2UXC J;  1I94 J;  4JI1 J;  1N34 J;  5BR8 J;  4X65 J;  4HHU A;  4YY3 J;  1HNW J;  4YHH J;  4V1A k;  5A2Q U;  4DR1 J;  1N36 J;  4LF7 J;  4JI5 J;  4X62 J;  2UU9 J;  5AJ3 J;  1XNQ J;  4PWW A;  4DV3 J;  4K0K J;  4LF5 J;  4KY3 A;  4LF4 J;  2MQ8 A;  4JV5 J;  1XNR J;  4DV4 J;  4LFA J;  3T1H J;  3J80 U;  4DV2 J;  2UUB J;  2E5L J;  4DR3 J;  4X64 J;  2UUC J;  4DV7 J;  4NEY A;  5FLX U;  4B3S J;  2UXB J;  3R2C J;  1HNX J;  3D3B J;  4LFC J;  4JI6 J;  4DR7 J;  4NXN J;  1FJG J;  4AQY J;  1IBL J;  4JYA J;  5IT9 U;  1N33 J;  4JI3 J;  2VQE J;  1IBK J;  5LMU J;  4DV0 J;  4KHP J;  4B3T J;  4DV1 J;  2ZM6 J;  1XMO J;  4DR4 J;  4DR5 J;  4JI7 J;  4DR2 J;  2F4V J;  4B3R J;  4GKK J;  4JI4 J;  3W1Y C;  5LMN J;  2KVQ E;  2VQF J; 
#chains in the Genus database with same CATH topology
 4KYZ A;  2ZOF A;  4F3O A;  5BR8 F;  4ETX A;  2YPY A;  4DV5 J;  3FSX A;  4KFB B;  3HSZ A;  1FA0 A;  1Y0H A;  3TUJ C;  2RF2 B;  4DPW A;  3FBC A;  3BDE A;  4JI0 F;  4CLF A;  1YGY A;  5GAG I;  3NMA A;  3V81 B;  1RWO B;  2H1Y A;  4GO7 X;  1CJU A;  2G13 A;  4KSE B;  3ILJ A;  3FRY A;  3PHE A;  3ZC4 A;  1C1B A;  4KQZ A;  2HQF A;  3AFG A;  4DN9 A;  1MWY A;  2GAG C;  3DDN A;  2I0X A;  5E3C A;  3J81 U;  1S0O A;  2XS5 A;  4Q43 A;  1IKW A;  2I5J A;  4RWX A;  4BBY A;  2RQM A;  3G87 A;  2XCA A;  2R7W A;  1WG4 A;  2IDE A;  1GH8 A;  1IQZ A;  4USK A;  1P9Q C;  1KFS A;  4B02 A;  1NRK A;  3P5B P;  3WIV A;  1S1U A;  4HAC A;  4NEZ A;  3HFK A;  5DZ7 A;  5KFC A;  1KHW A;  2QLX A;  4CLZ A;  2OIH A;  5D3G B;  5K8P A;  3TP2 A;  2WON A;  4HH0 A;  1KSP A;  2OPQ B;  3M32 A;  2M3D A;  1HLW A;  4NLV A;  4WP8 A;  2B8P A;  1U4B A;  4L3K A;  1UVJ A;  1KQK A;  1DTT A;  2NSB A;  2RRN A;  3NS7 B;  1WKL A;  5F0U A;  2WVD A;  1FVQ A;  1GMU A;  5KT5 A;  3QLH A;  3SCK E;  3OTO J;  1GX5 A;  1VGY A;  4G1Q A;  3BBF A;  5FDL A;  5BJR A;  3HP6 A;  1UVM A;  4K5S A;  2ERR A;  3CD6 S;  3KMQ A;  4U7U D;  3PEJ A;  2LYV A;  4I7F A;  4P7V A;  1MU2 A;  4ITS A;  4JI2 J;  1D9A A;  1I94 F;  2DHS A;  4F50 A;  4JI1 J;  2CVI A;  4WYW A;  2R7S A;  3MHY A;  3QLH B;  4WKR A;  2NXE A;  2V50 A;  5BR8 J;  2QG9 B;  1AA1 B;  4CT8 A;  3OVB A;  2HRT A;  3IRX A;  4IG0 B;  4ECV A;  1RKJ A;  1VOM A;  2IHR 1;  5KG4 A;  4C8K A;  2U1A A;  4ZLP A;  4YHH J;  2WVC A;  1AUS L;  2ZE2 A;  5JJB A;  1ZTT A;  5FJ4 A;  4ETZ A;  1SI9 A;  2COL A;  4JI5 J;  3TO8 A;  2B7B B;  4V19 X;  2L9N A;  2XYH B;  2CQI A;  4AFF A;  3EXY A;  3DYA B;  2I5J B;  3I5B A;  4XTT A;  5F41 A;  4C0H A;  4O4G A;  3FKB A;  3D6T B;  2A10 A;  5DM6 Q;  1X9W A;  4YB7 A;  2QL5 B;  1Q8K A;  1SV5 A;  2Y3Y A;  5SUH A;  3KUH A;  4DV2 F;  4MK8 A;  1NZA A;  2KT3 A;  2B6A B;  5KFO A;  5A76 A;  3UNY A;  1GTE A;  2MQ8 A;  1PAU B;  2FLO A;  3D6F B;  4YN3 B;  4CH1 A;  1UJ6 A;  3KLE A;  4I6Y A;  4RKU C;  2FVS A;  4JI1 F;  3E8O A;  2AX1 A;  3LF0 A;  2YKN A;  3KLF B;  2HVE A;  3KLG A;  1HQ2 A;  1RHR B;  3JTP A;  4MT1 A;  3GIJ A;  2AYM A;  3SV3 A;  1FKP B;  2UUB J;  1CG2 A;  2L48 A;  4TU7 A;  1X4H A;  2N3L A;  4I2Q A;  1FNX H;  4G1I A;  4ECY A;  4ZVP B;  2O5D A;  1XBW A;  1QAJ A;  2DHH A;  2WBM A;  2JSX A;  1HBU B;  2GHV C;  4EFA C;  2H4W B;  3OL7 A;  3GV8 B;  1QVG R;  1YJU A;  2BVZ A;  2DH7 A;  2OEM A;  3R2C J;  3HF5 A;  4XO0 A;  3TAQ A;  3B82 A;  4IG3 B;  1LWE B;  2VBZ A;  1NME B;  3BGR B;  5IV3 A;  2RRA A;  2DR9 A;  1CUL A;  3CDE A;  3QGI A;  4R0E A;  3J7Y I;  3KJV A;  3FBE A;  4LRD A;  2ZC4 A;  4L73 A;  3U27 A;  3OJU A;  3PZP A;  1NK6 A;  2FHK A;  3MOJ B;  1N4L A;  4ZCI A;  1C4C A;  2O1P A;  2BE2 B;  3C16 A;  2BKO A;  1Z2L A;  3HVT A;  5T7L B;  4X4N A;  3BSA A;  5E0O A;  1TVR A;  1X5P A;  3MFH A;  5HVH A;  3C6T B;  3K59 A;  3V5R A;  4ELT A;  1O51 A;  2DNQ A;  4RR5 A;  3G6V A;  4N76 A;  4P6Q A;  2IAJ B;  2R4F A;  2XTJ P;  2FJX A;  1Q82 T;  2R2R A;  3EUN A;  2BQ3 A;  3R27 A;  1ZS6 A;  2XB2 D;  2IYI A;  1NHU A;  5AT1 B;  2FVR A;  3VF0 B;  2NYH A;  1NDK A;  2Z30 B;  1Q8L A;  2GJF A;  4ZPV R;  3HFV A;  2GS8 A;  1R89 A;  3BPS P;  4K4X A;  2CJQ A;  3J7A N;  2FQQ B;  3AJ2 A;  5DQI A;  4ECZ A;  3MWB A;  1X4F A;  2RS8 A;  1N5Q A;  3TRG A;  3DNC A;  1U1P A;  2HYI B;  3FZB A;  4DV7 F;  1FI4 A;  2R42 A;  2R2U A;  2BA9 A;  3GP9 A;  2CWX A;  5ETO A;  1C0U B;  4NYZ A;  5DDR C;  2H48 B;  4FS2 A;  2OP5 A;  5KG3 A;  2CQ4 A;  3U1N A;  3T1Y F;  2DNH A;  1RT3 B;  2XMK A;  4OI2 A;  5KT2 A;  2MZ1 A;  1IWG A;  3DMJ B;  3DRY A;  3MR5 A;  5I4M A;  3Q8U A;  2W25 A;  5KG2 A;  4DR2 F;  2CQ2 A;  3IBC B;  1MMN A;  1MRO A;  4Y3C A;  2ZJR Q;  2B3T B;  4MFB B;  1YQH A;  2W1B A;  1YJR A;  4ID8 A;  5DRK A;  1VQY A;  4NMX A;  2X1B A;  5JXS A;  4K4S A;  2IFX A;  2KN4 A;  4LBH A;  4I69 A;  3G8T A;  4FBU A;  5IOL A;  2P9E A;  4ZVQ B;  3RB3 A;  3MUT P;  1K1Q A;  1BXN A;  1S9G B;  2MQM A;  1QDU B;  2QZ8 A;  3FMW A;  3IG1 A;  3BH7 B;  4I0W A;  3UDE A;  3VZH A;  4NZ0 A;  4F7V A;  1NJX A;  3ENW A;  3R5B A;  4B9S A;  5EWF A;  3Q24 A;  3BQ2 A;  4ZDN A;  2ZNY A;  5A2Q Y;  4FPI A;  4X64 F;  1PG5 B;  3B4M A;  1QUP A;  4ZVU B;  2PI5 A;  1TL7 B;  2OMO A;  1VI7 A;  3QIP A;  2YX7 A;  3AA8 A;  5K8N A;  3IG1 B;  5KFE A;  2V4J B;  2UXC J;  5BYS A;  4MKY A;  3M2R A;  3QID A;  4FXV A;  1GMW D;  1B70 B;  4DG1 B;  3OVS A;  3NMR A;  3VR1 A;  4BLG A;  4CLY A;  5J1E A;  3KNG A;  2HND A;  4NA3 A;  4X65 J;  1D3W A;  3IWL A;  3PTW A;  3VAH A;  2V9K A;  1L3T A;  3MR6 A;  2D1C A;  1F1B B;  4KR0 B;  1SUQ B;  4RW6 B;  3OXG A;  3JQM A;  4DPU A;  5GAD I;  2FJV A;  3SZ2 A;  3UWT A;  5B0D A;  3H42 A;  3T6J A;  3OTD A;  2AV5 A;  4IOA Q;  5H9F J;  3ZTP A;  1T05 B;  1WI6 A;  3P5T L;  2CG4 A;  2HS3 A;  1XJW B;  2MQN A;  1DAR A;  3FCW A;  1V3S A;  1H98 A;  4RW4 B;  4QW9 A;  1HAR A;  4QR2 A;  3ZZR A;  1XMB A;  4ILL A;  1WDD A;  3CJS A;  2L41 A;  2JLG A;  3MPY A;  2ASL A;  1HA1 A;  4DPX A;  2C2Z B;  5B09 A;  2G4B A;  3D5M A;  2CJ9 A;  4PG4 A;  4USJ C;  1M5V C;  3K5L A;  3UN5 A;  2AP6 A;  5EDW A;  1RXO B;  1XNR J;  2G0J A;  4DV4 J;  4RW4 A;  3T1H J;  2LVW A;  1TV6 A;  2O66 A;  4OYB A;  2C2M B;  1G1X A;  1RAD B;  1RTI B;  1S6P B;  5KFT A;  2KFY A;  3KK2 B;  3DRX A;  5J2N B;  4ZLJ A;  4ZPC A;  3UDL A;  5KT7 A;  5F8H A;  2HNY A;  5EN1 A;  4F0K A;  5G0R A;  2V8H A;  4MIB A;  4YEA A;  4C6A A;  1LXJ A;  2UXB J;  4Y34 A;  3TAM A;  3L9Z A;  4CTA A;  2JL9 A;  4PEO A;  2CQH A;  4DG1 A;  3RG6 A;  2G1H A;  2KRB A;  2Z56 B;  4HDH A;  4NXN J;  2WOM A;  3HX9 A;  2BM1 A;  3MEE B;  4C3L A;  2ZKU A;  3R5C A;  4I64 A;  1FDD A;  3G6E S;  1LWE A;  4USV A;  4D3G A;  3B6B A;  3PEH A;  1RBA A;  3T19 A;  1VIO A;  3THT A;  5CCL A;  3O6Q A;  1A9N B;  1Y9O A;  4XAK A;  4RNM A;  4DV0 F;  5K9F A;  4J5O A;  3M1V A;  3ETM A;  3MEE A;  4OX9 F;  4A48 A;  1HMV A;  2FVP A;  2FY1 A;  2R8H A;  4DV1 J;  3BS9 A;  4B3T J;  1TL5 A;  2CQ0 A;  3QPI A;  3MF5 A;  3HPO A;  4C9D A;  2R7V A;  2MZT A;  1S48 A;  5FD1 A;  1K0T A;  1QUV A;  2XGQ A;  1SC3 B;  3V6K A;  1OQ3 A;  2HIY A;  3QT5 A;  1UVI A;  1X7V A;  3K58 A;  4M5J A;  5F9N A;  1RWW B;  4ED1 A;  1FDA A;  4NI2 A;  1JLE B;  4Q0B B;  3EDQ B;  1OIA A;  2WTF A;  1QJH A;  1Y5N B;  3WDO A;  4EGL A;  4QPX A;  2JEJ A;  4C0O C;  1FJG F;  1N32 J;  8ATC B;  4KC5 A;  5HMY A;  5KFI A;  1ZZN A;  2JDJ A;  3TEG A;  4NLO A;  4NXM J;  1V5V A;  1KRP A;  5CAA A;  1KQG B;  1NDC A;  1V5I B;  4QWB A;  2ZHA A;  3NWR A;  2E1A A;  3SXL A;  4HVZ A;  1BQM A;  2FHM A;  2WSE C;  3PHT A;  3TQE A;  3O44 A;  1T9T A;  4OYA A;  1VBZ A;  1VQL S;  4DWI A;  2R7U A;  2OHD A;  4WPA A;  4BDP A;  2BW7 A;  3HZE A;  3CJ3 A;  2NUH A;  4O4G B;  1T0T V;  4DR4 F;  4ZIW A;  4U8Y A;  3UW1 A;  4PXB A;  2W4D A;  4ALZ A;  2CPH A;  5LSO A;  3I9Z A;  2GVD A;  4LRC A;  2AF6 A;  2QFI A;  2FHJ A;  4QIF A;  5G0R B;  3OTC A;  4LBP A;  3VHQ A;  2ATC B;  2J0W A;  2UXB F;  1GQE A;  4B3M J;  3ONQ A;  3MAQ A;  1ZA2 B;  1U1Q A;  1NKE A;  1HHS A;  2CQB A;  1LFW A;  4ZIV A;  5GMD A;  4DPT A;  2MQO A;  1KOO A;  2JNJ A;  3NP5 A;  4OJG A;  5H1S V;  2VA2 A;  1Y3K A;  3TUI C;  1M5O C;  1BQX A;  1GXL A;  1S97 A;  3THV A;  4QU7 A;  1HBM A;  4PWU A;  2ZHO A;  4O3O A;  4ECQ A;  1NH8 A;  3OVA A;  1WUU A;  1S1T B;  2CZ4 A;  4Q2L A;  4DR1 J;  2V6A A;  3BGR A;  3D0H E;  3ISN D;  4ID5 B;  3MMB A;  4CO3 A;  3QAU A;  1BUX A;  5RUB A;  2WB4 A;  3A3P B;  3DGV A;  1VBY A;  1QLN A;  3JSM A;  3CC2 S;  4F26 A;  4X4P A;  1GFW B;  1VRT B;  4UZC A;  4ZJL A;  1WTF A;  2Y9H A;  2BAC A;  2JWN A;  4FYV B;  3PR5 B;  2DIS A;  2HAF A;  1WD6 A;  2VJU A;  1U2R A;  2CJB A;  4KFB A;  4NCA A;  4Q0B A;  5KFN A;  1JLQ B;  2YTC A;  4EBE A;  1Q8I A;  2MKK A;  3AD9 C;  1CC7 A;  1B64 A;  4Y00 A;  4CO5 A;  4TY8 A;  3V81 A;  3U1L A;  4YUD A;  1PO6 A;  3KJQ B;  1ZM9 A;  4RPF A;  2EFV A;  4DV4 F;  3DOL B;  4AE5 A;  3OUY A;  2VKR A;  1XWL A;  2VJV A;  3PW2 A;  1C1B B;  2A0F B;  4HHH A;  3KG4 A;  4AXI A;  2MMY A;  3A8E A;  1RBL A;  2EWH A;  5F9L A;  2VPW B;  3BH6 B;  3ISN C;  1X5S A;  4TQS A;  2DNP A;  1L5U A;  2DR6 A;  2A2D A;  4UZB A;  5LSR A;  1MMD A;  2FHJ D;  2J0X A;  4KGV B;  4G6V B;  5CYM B;  3SQO P;  1X0P A;  2DBB A;  4CWB A;  1ZBT A;  3SV4 A;  4R5P B;  4EU0 A;  1SKW A;  2HK2 A;  4OX8 A;  1FDB A;  4DS4 A;  3MM9 B;  2GFF A;  3GYN A;  1SKS A;  3FFI B;  3PG9 A;  4NXM F;  1JLG A;  1SJ1 A;  2AW0 A;  2Z4P A;  4WIQ A;  3D9B A;  3HHN B;  2JOQ A;  2WBR A;  2N7Y A;  3LP0 A;  3CC7 S;  1HBO A;  1NO8 A;  3PRD A;  3MR2 A;  4QYZ J;  3M8S A;  2ZD1 B;  3F56 A;  4CYU A;  3LQV A;  2DNG A;  1YJV A;  5KFY A;  1N33 J;  4LFA F;  5L39 A;  2H5J B;  3PW0 A;  3T1A A;  2V34 A;  2F8E X;  1EQ0 A;  3QWU A;  3H0P A;  3Q86 A;  4DDF A;  5ITH A;  5I3U A;  2BDP A;  4DX8 H;  2KTQ A;  3CJ4 A;  4Y2M A;  1A0O B;  2HBY B;  3KHR A;  2BXJ A;  2VQF J;  1DJ0 A;  2F1F A;  1JLB B;  1TAQ A;  4NI2 B;  3EGV A;  2HFV A;  2ZBR A;  2HZC A;  1OY9 A;  2BV3 A;  2DEI A;  2MZJ A;  3P45 B;  2DNK A;  4ZPT R;  5IT9 Y;  4L74 A;  2NS1 B;  4ZPD A;  1DHM A;  2CPE A;  4LF8 J;  1HHQ A;  3GE9 A;  3MAA B;  3TEH B;  2AEJ A;  1JX4 A;  3HXM A;  2P5V A;  2UUA J;  2GV1 A;  2ALZ A;  3QZ8 A;  3NEK A;  2K2P A;  2MTL A;  4RO0 A;  4X84 A;  3OHB A;  2K8G A;  1UEV A;  2PSZ A;  4WE1 A;  2K3I A;  3MUR P;  1VQS A;  2E66 A;  1JK9 B;  2CA9 A;  1FNM A;  1TU0 B;  3NAH A;  2MJU A;  3I56 S;  3KLH B;  3H7H B;  3B54 A;  4Z7Y A;  4DV6 J;  1OY6 A;  1H2U X;  2R3V A;  2ZBI A;  2AQ4 A;  1HW8 A;  4NLT A;  3GTY X;  3CTR A;  2M8D B;  3EVW A;  4YOE A;  1O6X A;  2BW2 A;  4OV6 A;  4ZLL A;  4K4W A;  4UQG A;  2R7O A;  5CH7 B;  4DPO A;  3ZZO A;  2X3D A;  3DOK A;  2J7W A;  3C6U A;  3AXK A;  1JIH A;  2PA8 D;  2ASD A;  1JMT A;  2HMI A;  2AGO A;  4ZP6 A;  4U6P A;  1P6T A;  1SIZ A;  4PRF A;  1N33 F;  2M0G B;  1NU4 A;  2M88 A;  4EYI B;  2IA6 A;  1N0V C;  2NCK L;  2ZZT A;  3J81 j;  3V4I A;  4IRK A;  2QTW A;  2HVI A;  3LP2 A;  4CRJ A;  4AD6 A;  4ED3 A;  4DSF A;  5GAH U;  3JYT A;  2GIQ A;  2G2Y A;  5M2R A;  1HBO B;  1FTR A;  1WJ9 A;  1EZZ B;  3A13 A;  4GC7 A;  1D8Y A;  1HIY A;  2GO9 A;  1S0V A;  3MMJ A;  1U1L A;  1KDN A;  1HPZ A;  2IMO A;  3KG0 A;  1FK9 B;  1RT7 B;  3OR2 A;  3FEZ A;  5ETM A;  2MY8 A;  2VPY B;  5GMK a;  3TAM B;  2KJV A;  1RT5 A;  1BD6 A;  2NR0 A;  3OR1 B;  4X4V A;  4ED6 A;  1LFP A;  2V2Q A;  3VGT A;  1FT8 A;  1LV5 A;  1I6J A;  2OPP B;  3D66 A;  4A8W A;  5B0C A;  5HVG A;  4A8X A;  1AYE A;  1S9F A;  3L7O A;  1VQ5 S;  1U47 A;  1VQ6 S;  2A1B A;  3IXQ A;  4WBF A;  5B08 A;  2Z2M A;  3HHL D;  2ABY A;  2BJ3 A;  3HHE A;  1GAO A;  3IM8 A;  5EHH A;  2WW4 A;  4KKO A;  1TK5 A;  3N6M A;  4ZCL A;  2DT9 A;  3EXC X;  2MST A;  2CUY A;  4LSN B;  2Z58 B;  2BKP A;  2OTL S;  2VF3 A;  4CNZ A;  2PEB A;  4FYX B;  5C24 A;  2MHE A;  2OD4 A;  2VG6 A;  3BSC A;  3IRW P;  4DN0 A;  2DXE A;  4OHY A;  1WHV A;  4PPZ A;  3UQS A;  3MR7 A;  2N82 B;  4DV2 J;  3V4I B;  5LL6 d;  3MUV P;  2ROP A;  5D4O A;  1TAU A;  2EG2 A;  3O3L A;  1T9V A;  2D74 B;  3N4W A;  1ZM4 A;  9ATC B;  1VLO A;  2WCX A;  4XDC A;  4ZVF A;  3BSN A;  4OZ2 A;  2YKP A;  2CYY A;  1EET A;  1LW2 B;  1SH0 A;  2QRR A;  5JVG Q;  4J9P A;  1TZ0 A;  1CVJ A;  3KUG A;  3W61 A;  1B99 A;  1WC3 A;  2O01 C;  4UOH A;  4CLL A;  2XUL A;  1FEH A;  3GJR B;  4LT6 A;  1Z1Z A;  2K3K A;  4PYD A;  3WQP A;  4PZV A;  3DOM A;  1RK8 A;  4LSL A;  4LRA A;  2A18 A;  4PG7 A;  5ETQ A;  1NK5 A;  4YR2 A;  3AD7 C;  4ICL A;  5D4P A;  3TYT A;  2HQ3 A;  3KLV A;  1M5K C;  1HBU A;  3J7Z T;  1R8H A;  3LAK A;  2Z8Q A;  2DRB A;  2UVU A;  2ZBQ A;  1EHW A;  2N4D A;  1XQI A;  4NYO A;  3RBZ A;  2UVW A;  4KB7 A;  1YJN S;  3X1L B;  1T94 A;  1UJ5 A;  1U0H A;  3B4D A;  2LEB A;  2UV8 G;  4R25 A;  3DLG A;  3PFO A;  4P72 A;  2WK4 A;  4PUO A;  4P73 A;  5HAO A;  3BKF A;  4K50 A;  3D6H B;  3LGH A;  2HKE A;  2AJ0 A;  2VH7 A;  3CDU A;  3E3X A;  4Y2C A;  3RRH A;  3QSI A;  2HIQ A;  1EX8 A;  2FIU A;  2W2O P;  4WYL A;  3M8R A;  3D7S B;  2L08 A;  3L7U A;  3BQ1 A;  1Q8B A;  2D3O R;  2CG8 A;  5E7O B;  2V4R A;  3V6J A;  3HK2 A;  1Y00 A;  5GVQ A;  3CCM S;  1WC6 A;  1NK0 A;  5L1J A;  1NK7 A;  4ANC A;  3ZFV A;  1S12 A;  2IVY A;  1Q16 B;  2D9O A;  3DM2 B;  4OI6 A;  4C98 A;  3R3T A;  1IKY A;  1KWM A;  1U1K A;  4DSJ A;  3M2V A;  5KFH A;  1BHN A;  2WHO A;  5HBM B;  5E41 A;  2YNI A;  1NJY A;  1J5O B;  4F2S A;  4JI0 J;  3U1M A;  4F2R A;  3QT6 A;  1ELO A;  2OEL A;  4LR8 A;  2G9O A;  5K20 B;  2FJE B;  4OX9 J;  3QYY A;  1HYS A;  3PRB A;  2GGP B;  1P27 B;  3GCW P;  2K1R A;  1RA6 A;  4AT1 B;  5CYM A;  2V5H G;  3JYT B;  1VQM S;  2E7V A;  2FLP A;  5DGA A;  2K7K A;  1YJ7 A;  2ZVI A;  2UXD J;  2VB6 A;  2RML A;  4XDD A;  3OLB A;  2YPZ A;  2FB0 A;  3UVJ B;  3OLA A;  1KOH A;  4P7T A;  5IXU A;  2VDI A;  1RTH A;  1S1U B;  2QLW A;  2WW8 A;  4HAC B;  3SCJ E;  3DOM B;  4KT0 C;  5MAO A;  2J9D A;  3CD5 A;  2DCU B;  5KFM A;  2CVE A;  5HLF A;  4N41 A;  1HNI B;  1WHX A;  2PDA A;  4QYZ K;  1DLO A;  3DRS B;  3TUP A;  3E51 A;  4RW7 B;  3C46 A;  4K4Y A;  2ZKT A;  2FLN A;  4PXD A;  1YLX A;  1H3D A;  2MQL A;  2DR8 A;  4DUT A;  1SC1 B;  1DFD A;  3A8I A;  4WTO B;  5CD4 H;  2R7T A;  1TUV A;  2GIR A;  2AJF E;  5LMU F;  4CLK A;  3SIP B;  1B7Y B;  4M63 A;  3R5J B;  2XS2 A;  4JUZ A;  2W9B A;  4LUB A;  2KB2 A;  4OHZ A;  3OTO F;  1VQ7 S;  1NM2 A;  3V6H A;  3OT9 A;  1NJW A;  2VON A;  5J1N A;  1EP4 A;  2F8H A;  3I31 A;  2YKO A;  4U96 A;  2N3O A;  5DLF A;  1VC0 A;  3DLH A;  3Q83 A;  3H5U A;  1RWX B;  2PE8 A;  1FJC A;  1WC0 A;  3D0G E;  4OHV A;  3TVK A;  2VG6 B;  1L3V A;  1RE1 B;  2RNE A;  2RSQ A;  3F44 A;  2JEI A;  4FNH A;  1AW0 A;  2LU2 A;  4FYW B;  2PFF B;  2DNR A;  1RYR A;  3JQJ A;  4HI2 A;  2GVZ A;  1UWA A;  1IBC B;  2GQQ A;  2HHW A;  2WB1 D;  4RBV A;  2FD2 A;  3VVT A;  3L3C A;  2Z2L A;  5U47 A;  3DLK B;  4KKO B;  4N56 A;  3AJD A;  1ZYQ A;  1C0T B;  3RB0 A;  1K47 A;  2OFG X;  3ADA C;  4YP3 A;  2UUC J;  5KFV A;  2X7I A;  3WZ0 A;  2OPR A;  2OML A;  4OLO A;  3R9L A;  2VG5 B;  4X65 F;  2W7P A;  1TL3 A;  5J2Q B;  1HI0 P;  2W4P A;  2KYX A;  4KE5 A;  4N8O A;  5BYQ A;  5DDO C;  1UW4 A;  3LP2 B;  3P6Y C;  3VAL A;  3CCW A;  2UXD F;  3KK3 B;  1WWH A;  4NLD A;  3TWZ A;  2UVR A;  3GIM A;  4JI6 J;  4FZV A;  3MEC A;  1DTT B;  3EGW B;  2AT1 B;  4LF8 F;  2F63 A;  2Q3P A;  2GMJ A;  2V8D A;  2D9P A;  3JSY A;  2W7O A;  4DSK A;  1N54 B;  4C48 A;  2B5J A;  3OQ2 A;  3SDE B;  1QVF R;  2KRR A;  4ZP7 A;  1G2E A;  3M9O B;  2HGL A;  2PC6 A;  4DV5 F;  4FF1 A;  3G8Q A;  4URS A;  2Y1J A;  2Q43 A;  2BAB A;  2FVC A;  1NK8 A;  5D3G A;  1RWV B;  3CIM A;  3H90 A;  2LMI A;  2QMW A;  3NBP A;  3US5 A;  5EX0 A;  2OD6 A;  4J9L A;  1R8C A;  1NB7 A;  1CS4 B;  1UFW A;  3PKY A;  3IN5 A;  1QSS A;  2CPD A;  4JI4 J;  4B3R J;  4F25 A;  5KFJ A;  2KT5 A;  1S77 D;  1JLC A;  4ZCK A;  2CNO B;  4ZVE A;  4LMZ A;  2MSS A;  4USW A;  2V4Q A;  2XNQ A;  3I0S B;  3FQL A;  5IWA F;  3CF5 Q;  1UMJ A;  3ZNJ 1;  4RBT A;  4ZVH A;  5KG1 A;  4DR6 J;  2ZFH A;  1HD1 A;  4PWD A;  5G4D A;  1T9X A;  5K5M A;  3FEX B;  1HMV B;  4DFP A;  3ZZY A;  4F4A A;  4AND A;  2E44 A;  4EI2 A;  4Y28 C;  1REG X;  3BYR A;  1S9E A;  4MK9 A;  5KG0 A;  5KFR A;  1YIJ S;  4OYP A;  2BRK A;  4BWJ A;  1SL2 A;  1BC6 A;  1WEX A;  2XZW A;  1ZH5 A;  1FCA A;  2MPU A;  4FF4 A;  2LFV A;  4LFB J;  4LF6 F;  2W9C B;  2HK3 A;  3GFY A;  2FC9 A;  1YHQ S;  2BAN A;  5LM7 E;  1NK4 A;  5HRO B;  4I67 A;  4ELV A;  1FX4 A;  2IYG A;  4ED8 A;  4G65 A;  2A6O A;  2HRY A;  2L9W A;  1S72 S;  1VR6 A;  1RHU B;  1S1V B;  2Y0S D;  2UV8 A;  4GVL A;  2EVZ A;  2DR7 A;  3PYG A;  4ECR A;  2R8J A;  3LP1 A;  2LDI A;  2XEX A;  4H4M A;  3PYD A;  2OAU A;  3KK2 A;  9RUB A;  4USM A;  1UWB B;  5LXR A;  2ASY A;  3KK3 A;  4DR3 F;  1U25 A;  2ADB A;  1SJF A;  2JH3 A;  3KUE A;  2MLY A;  5HAT A;  3BO3 A;  2PI4 A;  2V8G A;  4HT5 A;  2FDN A;  3R97 A;  3N79 A;  2R8G A;  1L3K A;  3Q23 A;  3LP1 B;  2HNY B;  2OPQ A;  1RT6 B;  2DGV A;  1N5S A;  4QQB A;  1RWU A;  5CZV A;  4ZHR A;  1MNE A;  1XR7 A;  4DF4 A;  3BO2 A;  2G2O A;  3VAF A;  1E6V B;  2DO4 A;  1CJT B;  3N9U C;  1FWP A;  1NAQ A;  2O67 A;  4QW8 A;  5J2P B;  1EQM A;  4K8R A;  1TMJ A;  3RJM B;  3ZZT A;  1WTB A;  1S9E B;  2MXY A;  5KT4 A;  5AE2 A;  3BKT A;  5L8R C;  4OZJ A;  1S0M A;  1D9D A;  2FJB B;  4X4O A;  4KBI A;  4E2F B;  3K5M A;  1SUQ A;  1EKS A;  1R8P A;  3MDF A;  4KAI A;  4ZPW R;  4DXL A;  2LQ9 A;  1FER A;  1OQ6 A;  4QPT A;  3OHA A;  4LF5 J;  3M9N B;  1S57 A;  1U0H B;  2RF2 A;  4K2J A;  3NGD A;  3M2R B;  1F6T A;  4LFC F;  1H2V Z;  2JFD A;  3GMG A;  1JLE A;  4LIW A;  3DOL A;  2RKI A;  2V68 A;  3OUY B;  3K5N A;  2W24 A;  3NS6 A;  5EUH A;  4C11 A;  1FTC A;  1VRT A;  3SFG A;  2QT7 A;  4DX6 A;  5IM0 A;  1ZAV A;  2KKH A;  2QMX A;  1MG7 A;  1UKU A;  4Y2K A;  3R6G B;  2E5L J;  2RDJ A;  3T9Z A;  3CT9 A;  3GR1 A;  3T5J A;  3P96 A;  1M5S A;  2CZV C;  1SL0 A;  4IR9 A;  3ENA A;  1ULR A;  4J9Q A;  2EW9 A;  1LQ9 A;  2W2P P;  3CO0 P;  3MED B;  4IFV B;  2FJA B;  4LR7 A;  2E29 A;  4U7U K;  2XCP A;  2YH1 A;  3UCZ P;  3ZZZ A;  4Y65 A;  1SH3 A;  2ZD1 A;  4IR1 A;  2CAJ A;  2VZ9 A;  4GMK A;  2EFP A;  2ZNZ A;  1XC9 A;  4DR7 J;  3CO9 A;  3FK4 A;  1R0C B;  2HFZ A;  4FNI A;  5D0G A;  4EWT A;  1VQK S;  1X8D A;  5K8O A;  3W3S A;  1F0X A;  1Z2Z A;  2DTJ A;  2HQD A;  3QRR A;  1W25 A;  1S10 A;  3IGN A;  3IS9 A;  4E98 A;  3PX0 A;  2DIU A;  1J5O A;  5H9F K;  2M70 A;  3M8P A;  4WFN Q;  1RAF B;  4MFB A;  4Q2M A;  3TZZ A;  3GFX A;  1UL3 A;  2LA6 A;  4LF5 F;  3G2X A;  2YWE A;  3HVA A;  1X9M A;  4QYR A;  2OFH X;  4DR5 J;  2B8Q A;  3FFI A;  4A8Y A;  3BO4 A;  2WON B;  1VQ4 S;  4F4K A;  1N36 F;  2ZJQ Q;  1IJE B;  1H7X A;  1NXI A;  2HFU A;  1WHY A;  2YNG B;  3I0R B;  3NLC A;  4WFZ A;  5AXM A;  3SSR A;  4X4S A;  3PX4 A;  3G9C A;  4UUW A;  4MKA A;  3C19 A;  1RCX B;  1FRK A;  4P10 A;  3HVR A;  3EDR B;  3C14 A;  4O44 A;  2VBW A;  2IM0 A;  2SXL A;  4OYM A;  4K7Q A;  1RWP B;  1U48 A;  1R31 A;  4DSL A;  4Y2A A;  3HFZ B;  3OFH A;  3J7Y U;  2GHW A;  4C3K A;  3ENQ A;  1FX2 A;  1VLY A;  2KU7 A;  4OHW A;  4N47 A;  1ZPV A;  4M5D B;  2HS4 A;  2VOO A;  2QFJ A;  5KFQ A;  3SSS A;  5E33 A;  1WOS A;  4R8U A;  1YIT S;  3ZO7 A;  2VPZ B;  2ZUA A;  4JP8 A;  5HN0 A;  1S1X B;  4RL1 A;  2PMZ D;  1RBO B;  2VC0 A;  3MGJ A;  4EUV A;  2OEK A;  1N56 A;  1I1G A;  4UOC A;  4CLU A;  3CWJ A;  2HLT A;  4GKJ J;  1SPB P;  1FRL A;  1YBT A;  2OEJ A;  2RHS B;  3I5C A;  2IVF B;  3D1H A;  3CJK A;  4CP5 A;  4DUY J;  5DG7 A;  3W62 A;  2DHA A;  2H9Z A;  3R5A A;  2GJ2 A;  1TKT A;  3W2V A;  3EYZ A;  1Q81 T;  2B4U A;  4KHP F;  1XER A;  1R7I A;  3M8Q A;  2E5H A;  4I4B A;  5LMN F;  1Q5Y A;  4EYH B;  2BBE A;  2Z2Y B;  4OIX A;  5I42 A;  4AQY F;  8AT1 B;  2QYC A;  1B4S A;  5D0E A;  2QLF B;  2B56 A;  2I1R A;  3I32 A;  5HK4 A;  5KOW A;  1PKU A;  2KVI A;  3ZZU A;  3PX6 A;  2DXF A;  2JVR A;  2QGF B;  5KFA A;  1RHM B;  2C2O B;  4O4R A;  3ZTR A;  5EWE A;  4DLE A;  4B9V A;  2MKI A;  2DRA A;  2E9Z A;  4B3O B;  3HKZ D;  3KLF A;  2BOA A;  3KDO A;  2QC3 A;  4HTJ A;  5KFG A;  1S9G A;  2HVZ A;  4JI3 F;  3FCV A;  1HWJ A;  2HBZ B;  4OYI A;  3PXG a;  4IRC A;  4C8M A;  1X5O A;  3KNA A;  3BKU A;  1S6U A;  3T5L A;  2QA4 G;  3CCZ A;  1NPK A;  4NRU A;  4P74 A;  2GHP A;  2Q6C A;  3KLG B;  3LP0 B;  5THW A;  4O3N A;  1U02 A;  1UAW A;  1PYO B;  1VBK A;  5EX3 A;  1N34 F;  2MDA A;  2MB0 B;  2DVI A;  1S7H A;  1KS2 A;  4FVC A;  3GJQ B;  5D6G A;  4F36 A;  2YWF A;  4ECS A;  3SQG A;  3EZO A;  1HW9 A;  1UET A;  2GO8 A;  4PWW A;  4ZOS A;  4XIU A;  5DS7 A;  1HKA A;  2QA2 A;  4P2M A;  1E6V A;  2YQ0 A;  1YTY A;  3W66 A;  3ET6 A;  3PVX A;  1K0V A;  4PG8 A;  2EC0 A;  4FYD A;  4DQR A;  2CKW A;  3PAC A;  5ETT A;  4ILR A;  1PIL A;  3P4U B;  3KJN B;  2AHO B;  1MU2 B;  3P3D A;  1OY8 A;  4BHQ A;  2Y8Y A;  1F9H A;  1G3O A;  1PBA A;  3PIO Q;  2IRU A;  2XBP A;  4ZPA A;  2ZH4 A;  3PYE A;  4TY8 B;  4WF9 Q;  1UTA A;  2DGS A;  4MJK A;  2HPU A;  3EJM A;  3PJW A;  4M5N A;  1KTQ A;  1SJ4 P;  3UNG C;  3MM8 B;  4DZ6 A;  2UUA F;  1ZZF A;  3BQ0 A;  1VC5 A;  1WDT A;  5FLX U;  1FRJ A;  2LEA A;  3KK1 B;  4B3S J;  2DH9 A;  4DEZ A;  2UUW A;  4MAK A;  5J1P A;  2QV6 A;  8RUC A;  4XPC A;  3T3F A;  2PII A;  4TLR A;  1PC4 A;  1TK0 A;  2LKZ A;  2QLB B;  1O0P A;  1X5T A;  4F3Q A;  2AGQ A;  3MXH P;  4KJI A;  1Y5I B;  1RU1 A;  2WSC C;  2FJW A;  2MZS A;  3OTB A;  4JB8 B;  3QRP A;  2PEH A;  3C66 A;  1W26 A;  2CPF A;  4I6A A;  3DOK B;  1B0T A;  1PBU A;  1V6H A;  2W8K A;  2POK A;  3K5P A;  2LXU A;  1QTN B;  4Q8F A;  1X4B A;  1FJ7 A;  2V2K A;  2CPY A;  4C8Y A;  2W7A A;  2FUG 9;  1VQO S;  3VAM A;  2XSJ B;  1RAI B;  3QT8 A;  3HD1 A;  2BJ7 A;  3DMJ A;  3RTV A;  3QFH A;  3M6W A;  1F3V A;  3H59 A;  2AYB A;  2J9E A;  4FF2 A;  2V2Z A;  4NA2 A;  3PKM A;  1XMQ F;  1R8A A;  4TNO A;  5K14 B;  4RUC A;  1KBR A;  3Q8P B;  3M9M B;  1LOU A;  2BQR A;  3K7R A;  3L7P A;  4ZLN A;  1U8S A;  2HSE B;  2ZH2 A;  3N01 A;  4WU2 A;  2U2F A;  2B9Y A;  4FVM A;  1IBM F;  3LA0 A;  1T9W A;  2CRL A;  3OBI A;  4ZN1 A;  4TXS A;  1UEK A;  1JXV A;  3DN9 A;  4NE9 C;  4J9S A;  3QJJ A;  3M6X A;  1HNX F;  4URG A;  3W9I A;  1N32 F;  4WZQ A;  3M6V A;  1FF2 A;  5KT6 A;  2C28 A;  3LAN A;  1TUW A;  5CHC B;  2UXC F;  3IR5 B;  3CDB A;  1APS A;  3AQO A;  2NPI A;  1LEO A;  1CJV A;  1OO0 B;  4YDX A;  3VGS A;  4ECT A;  2IJN A;  3PR4 A;  4BC9 A;  2O3D A;  3BBC A;  4NLG A;  3FVY A;  2JEF A;  2KFN A;  1SXL A;  2YWW A;  4Y0F A;  4Q45 A;  4EBC A;  3HHK A;  1GEH A;  4HLB A;  1S99 A;  1U7L A;  1Y7P A;  4KV8 A;  4H4K A;  2MHN A;  4L72 B;  1AZS B;  1RTJ B;  4ECU A;  1KD1 T;  5C5J A;  5M2P A;  1IBK F;  1Q7Y T;  3PDN A;  4UW2 A;  4Y6I A;  5GAE U;  1D0E A;  4W92 B;  1RTD A;  3R1H A;  5KTQ A;  1LWF A;  4GKK F;  1JLG B;  2W9A A;  4JV0 A;  1WKK A;  3AOA A;  2VDH A;  4DR1 F;  4JI8 J;  3W9J A;  3NL0 A;  1RTH B;  3DFE A;  1FJE B;  4DL6 A;  2Z2Z A;  2DNY A;  2HAI A;  1EJ7 L;  3SCI E;  3MD1 A;  4WJB A;  2RH3 A;  4F8R A;  4L76 A;  3MED A;  2LEP A;  1EIY B;  3R5D A;  3OL8 A;  2RD5 C;  2HVH A;  2XM3 A;  1N36 J;  1VYA A;  1C1C A;  2KH9 A;  3D2W A;  2LDY A;  1WC1 A;  5T41 A;  1RHQ B;  2HMI B;  1DTQ A;  1AT1 B;  1GXU A;  3NGU A;  4GO5 X;  2JC0 A;  2V63 A;  2AX0 A;  2OI2 A;  4B3M F;  3BN4 A;  3ICL A;  5IV4 A;  4LQ9 A;  7AT1 B;  3MTK A;  2I38 A;  3F41 A;  3VGU A;  3TOQ A;  2XI2 A;  4PAA A;  3MEG B;  4JOU A;  1YBU A;  2IJF A;  3D1O A;  4MK7 A;  3WHI A;  1N8R T;  4AL5 A;  5CA5 A;  3FNN A;  5HLF B;  2OUG A;  4R8U B;  2XY7 A;  3RAM A;  5GAH I;  2D7S A;  2W2M P;  3M05 A;  4DU8 A;  1YX2 A;  3JSM B;  4JV5 J;  1JXE A;  4O44 B;  3MUM P;  1VQN S;  2WSF C;  4ED5 A;  3I4P A;  1DRZ A;  2IM1 A;  4CI0 B;  4HDG A;  2KXF A;  2BZ2 A;  2M9K A;  2VKZ G;  4OZ1 A;  2YWK A;  3S7R A;  3DYA A;  1MLA A;  2KT2 A;  2V8P A;  1VK8 A;  2H51 B;  2V94 A;  1S6Q A;  2X1G A;  1UP1 A;  2VFR A;  2J76 E;  2DXD A;  4KO0 B;  3TAR A;  1SV5 B;  4A4J A;  4M5I A;  4DR6 F;  3M2U A;  4F02 A;  2XS7 A;  1TVR B;  1UW9 A;  1HNV A;  3KDN A;  2IMW P;  1CJK B;  2IC3 B;  1VQ9 S;  2E9R X;  4QU6 A;  3GSD A;  2IAJ A;  5D78 A;  4RNF A;  2B5J B;  2H54 B;  3SDE A;  5L38 A;  2FVQ A;  3DDI A;  4JV1 A;  4LFC J;  2HHX A;  2WVE A;  3A12 A;  5L1I A;  2GAH C;  1FXR A;  3AHP A;  3AY0 A;  3HLU A;  3I9V 9;  1IKV B;  3ILL A;  3MEC B;  4GVB B;  3PCO B;  2AYG A;  4B3T F;  1F9E B;  1GMV A;  1UZH A;  2OO4 A;  4OYW A;  5E3Q A;  5EWG A;  3G6X A;  4X66 F;  2XMM A;  3FEY B;  4NCG A;  4R5P A;  2VG7 B;  1P8G A;  1ZM2 A;  2YWH A;  2HGN A;  5HQM A;  5DQH A;  3I96 A;  1TKT B;  2X3G A;  3G82 A;  3AJ1 A;  4NOH A;  1XMO J;  4JI7 F;  3BGO P;  4YR3 A;  4J9K A;  2BE9 B;  3Q8R B;  2F4V J;  2QJ3 A;  3GFH A;  1FKP A;  3WC0 A;  4C97 A;  1PJ6 A;  3IFE A;  1M1K T;  2B4P A;  1KR4 A;  1GT8 A;  2AKW B;  1SCJ B;  3CD0 A;  2FZK B;  4RW8 A;  4QCL A;  4J9M A;  4R0J A;  4UOG A;  4DFK A;  3M32 B;  2KZM A;  1RAE B;  1HD0 A;  3GPA A;  1T03 B;  3RW6 A;  1U09 A;  1YWX A;  1LWC A;  2CDR B;  3I55 S;  2M8H A;  1S5Z A;  2XC9 A;  1KNZ A;  3A1Y G;  3NBP B;  1YRX A;  2ZC3 A;  5M2U A;  2DNN A;  2ILY A;  3M1V B;  3NOC A;  1PYT A;  5A8W B;  3MCM A;  4JI2 F;  2VFU A;  3RW7 A;  2J8S A;  2PO4 A;  3UDC A;  2ZBC A;  5ETV A;  1ZAW A;  1JLQ A;  1XNR F;  1FXD A;  3T5H A;  1AB8 A;  2ZBP A;  4IG0 A;  3MAA A;  1TL7 A;  1RTZ A;  4NLU A;  4IYQ A;  4QR0 A;  4DS5 A;  1U1O A;  4OI0 A;  4UST A;  4LFB F;  1DY3 A;  3MCS A;  4MMO A;  1WC4 A;  2M7S A;  4ZVS B;  2VBY A;  4KPC A;  3DXB A;  3GIR A;  2J0S D;  1RTD B;  4RW9 A;  1YBA A;  2E7X A;  2VG7 A;  4OJH A;  2WVF A;  2ZOG A;  2RIJ A;  3DRR B;  4UY8 5;  2QIF A;  1H7W A;  1ITP A;  4DV6 F;  2FJD B;  3MCO A;  5E3R A;  1GMW A;  2NXN A;  1FFW B;  1LWF B;  3GJS B;  2QE5 A;  1TL3 B;  1M1H A;  4B08 A;  5HP1 A;  1D9F A;  4QIV A;  2K1R B;  3D54 A;  5T14 A;  4V19 J;  1DQ8 A;  1FE4 A;  1P1T A;  4I56 A;  2FTR A;  3LAL A;  3GQC A;  3DHX A;  3VGV A;  2MGZ A;  3GON A;  3IS9 B;  4P9S A;  2KI2 A;  4AL7 A;  1O8B A;  2HVD A;  4HHU A;  1OYE A;  4YY3 J;  5CYQ A;  2KDO A;  1N5V A;  4RWW A;  1YKW A;  1WEL A;  5DDQ C;  1TKD A;  5IT4 A;  2XQC A;  3JXO A;  3MM9 A;  3MZI A;  1X4C A;  2QO3 A;  4NLP A;  1XNQ F;  4OX7 A;  3DKD A;  4QIE A;  1M1G A;  2DGT A;  5AXK A;  3BGU A;  2UP1 A;  4M5G A;  4DR4 J;  1CSJ A;  2I8E A;  3KTQ A;  3V4M A;  1U1R A;  1WF2 A;  1FRM A;  2YH0 A;  1RT2 B;  1Q5V A;  4TY9 A;  2XY5 A;  1VRU B;  2NUU G;  4OQJ A;  2HND B;  3O5T B;  2FGO A;  2VL1 A;  3KHG A;  3OFG A;  3EX7 B;  3L4B C;  2IBO A;  4CO0 A;  3SYZ A;  3RRK A;  3D1Q A;  3CGI A;  3W63 A;  1UVN A;  3KHH A;  4LFA J;  1JNZ B;  2W9B B;  1QE1 B;  3DRP B;  2MKS A;  3I0S A;  3MEG A;  1R6V A;  1MSW D;  3QIP B;  4F04 B;  5CCM A;  3H98 A;  2QX0 A;  3TJ8 A;  4PWD B;  1BWE A;  2GJI A;  4J9N A;  4DL5 A;  2WVB A;  5A8R A;  4ZK7 M;  1IQT A;  4OHX A;  2RAQ A;  3EM1 A;  3IP0 A;  3KXD A;  3RGI A;  4O3S A;  4DV7 J;  1NBE B;  1B7F A;  2ZUG A;  3W65 A;  2RE1 A;  2ZH5 A;  2F8M A;  4KHR A;  1F3F A;  4M5L A;  1QSL A;  1K9M T;  4PCQ A;  2C3O A;  5J2M A;  1U8W A;  6FD1 A;  3CCT A;  2MYF A;  2P9G A;  3FQK A;  3Q89 A;  2MY7 A;  2PFD A;  4KTQ A;  3E2E A;  3LO3 A;  4GRS A;  4K4U A;  2ZE2 B;  1S4F A;  4NRT A;  2A6M A;  3AT1 B;  4AQY J;  2NQP A;  2GX8 A;  2E1P A;  2CJX B;  5ETS A;  1S6P A;  3OV7 A;  3ILO A;  2BQU A;  3HMJ G;  3BR9 A;  3K2Y A;  4GVB A;  5LMU J;  1RAO A;  4URQ U;  1CC8 A;  3PIP Q;  5HBM A;  4UF4 A;  3NCR A;  1NK9 A;  4GKJ F;  2GQ2 A;  2V8V A;  1PCA A;  2HQI A;  3RYL A;  3PW7 A;  5L9X A;  3IR6 B;  1FNO A;  2DPI A;  1WSR A;  4TVA B;  1UWB A;  1KFD A;  5AXL A;  4D3H A;  2YX1 A;  2DIV A;  5C25 A;  1NJZ A;  2DPJ A;  2XHC A;  1A7G E;  1QD1 A;  1XN9 A;  2IM3 A;  3DXS X;  3H8Y A;  1S79 A;  3R8Y A;  5DDP C;  2RQ4 A;  2ZH9 A;  3I6P A;  3H20 A;  1S1W B;  2QYG A;  2JFK A;  4PAB A;  2EPI A;  5HVF A;  4P2F A;  3PM9 A;  3BV8 A;  2ZEJ A;  3N0V A;  3OR1 A;  5C7P A;  4FBT A;  3NOG A;  1QAY A;  3IMQ J;  4RUB A;  4BWM A;  3IRX B;  3OJS A;  1SB6 A;  3KHL A;  2R7R A;  2HHU A;  1URR A;  2FZG B;  3H5S A;  3V2U C;  2V9W A;  1KQF B;  1RA7 A;  3LGN A;  3MMA A;  2E1R A;  3BB5 A;  4M5M A;  3S8S A;  2C22 A;  4C8Z A;  4WII A;  1RIS A;  3BPD A;  4H54 A;  3A8J A;  3HVW A;  1RT5 B;  4ZP8 A;  5F0W A;  3UCU P;  4X2B A;  4MH8 A;  4KH1 B;  4WTY A;  4DL0 C;  1FRH A;  2HGM A;  1RT4 A;  4OZ3 A;  1VIS A;  3Q8Y A;  4NYP A;  2D3U A;  3MPD A;  1JLF A;  2MKJ A;  3O2I A;  1S76 D;  4OFZ A;  3W9H A;  3CIZ A;  4B3O A;  2GA7 A;  3MM6 B;  2KM8 B;  2YNF A;  2JC1 A;  4ES3 A;  2HBR B;  3TVZ A;  2AGP A;  4K4V A;  1NPR A;  3IGV A;  1H0H B;  2XLJ A;  4X66 J;  2KXN B;  4IO1 A;  4OJ3 A;  2GGP A;  4C8N A;  1EET B;  2R9L A;  2OJ3 A;  1VDH A;  1I94 J;  4IH7 A;  5CQG A;  3BGL A;  1IR0 A;  3GWC A;  4CTA B;  4CLT A;  2HLU A;  1W7W A;  3PJ9 A;  1SQG A;  1HWU A;  1IKV A;  3OFE A;  2N7C A;  1F5C A;  2C3M A;  2PT0 A;  1HQE B;  1XR6 A;  1R0A B;  3K8V A;  4W98 A;  3CED A;  1NB2 A;  2WOM B;  1SC4 B;  3OD2 A;  3AAW B;  3D0I E;  3KWM A;  2HHV A;  4PPD A;  4L75 A;  4C8L A;  4HL9 A;  1DQ9 A;  4HTI A;  4ECW A;  2E5J A;  5SZT A;  2VAS A;  1PGZ A;  4HKQ A;  1WG5 A;  2ADC A;  4PXC A;  3F0N A;  1ACM B;  4P2X A;  2JLE A;  1VQP S;  1R43 A;  4TYB A;  1GX6 A;  3UD3 P;  4K0K J;  4EO6 A;  3I0R A;  1Q1K A;  1C4A A;  3R7S B;  1FES A;  4B17 A;  2HG4 A;  1GXT A;  1KKH A;  4NLS A;  1JJC B;  3M30 A;  5JVH Q;  2CJY B;  4DCO B;  3OFF A;  2DHG A;  4EMD A;  3LUY A;  1RWN B;  3CJ0 A;  2ZHB A;  4B9L A;  1EP4 B;  1Q86 T;  2JJ4 D;  1BWV A;  4NLQ A;  4WU3 A;  4NEY A;  3DLB A;  2B9X A;  1WAC A;  3CJ5 A;  4XK8 C;  2BM0 A;  2FPH X;  2HUR A;  2OLW A;  3NKY A;  4MIA A;  5DG9 A;  4FPR A;  4WCE Q;  3TAP A;  3BDP A;  4PG6 A;  3LGM A;  2DH8 A;  1K73 T;  1T7P A;  2VOP A;  4TU8 A;  4IO9 Q;  4ECX A;  1DQA A;  4U8V A;  1FE0 A;  3D28 A;  2DGW A;  3UD4 P;  5E3P A;  1M0S A;  2CIM A;  4RW6 A;  2VIC A;  2XMU A;  4ZVO B;  3QJL A;  1HQE A;  2IVM A;  5LT5 A;  3GII A;  1R0A A;  3J7Z 5;  4KH0 B;  2KHC A;  2ZVS A;  5E3A A;  5C42 A;  5IQQ A;  3CJK B;  4P75 A;  3T1H F;  1C2P A;  3HI9 A;  3QMQ A;  1LKZ A;  4ZMM A;  4C11 B;  5J2M B;  5F3Z A;  5I42 B;  3KG1 A;  3KK1 A;  4OMF G;  3KFW X;  4LJM A;  2LXF A;  4QZV B;  2E7W A;  3G86 A;  1OS5 A;  1R6Y A;  2BJD A;  3UCG A;  3IWX A;  3CDW A;  5IC6 B;  2ZM6 J;  1X9S A;  2YKM A;  3MCN A;  2VFT A;  4P2S A;  1IJF B;  5KFU A;  4F4X A;  3CMA S;  5HI7 A;  2E5G A;  3CCL S;  4DMZ A;  2QN6 B;  4WE1 B;  4S0M A;  3K17 A;  3M2V B;  4DOZ A;  2W8L A;  2LXI A;  4NCB A;  1KHV A;  1H2T Z;  3UDV A;  3KLH A;  3LWM A;  2J7K A;  2B51 A;  3D4J A;  3LH2 S;  3CCJ S;  1XMQ J;  1IBL F;  1Y11 A;  1MN9 A;  1WNE A;  1BQN A;  3Q0A A;  1CS4 A;  2XMV A;  3KLI A;  2W01 A;  4DI6 A;  4CLS A;  2ZDP A;  1GK8 A;  2ATL A;  2E5I A;  4M5K A;  3K89 A;  4N7T A;  1RAB B;  3QFW A;  4NLR A;  3THP A;  1H6K X;  2DIT A;  2I2Y A;  2BJ9 A;  2OGU A;  5I3P A;  3SBM A;  4C4W A;  2LQJ A;  1JLC B;  1ZM3 A;  3RZA A;  5F8I A;  1XEZ A;  4DU7 A;  2RU3 A;  1QY7 A;  2ZH7 A;  5A8K A;  4U67 Q;  5H9E J;  2R2S A;  1VRU A;  5D77 A;  4RBU A;  4ANE A;  4ZKA A;  4QOT A;  3UE2 A;  3BGF A;  5CYJ A;  4PR6 A;  1UPM B;  1PIE A;  3BF4 A;  5L46 A;  5I3U B;  4DV1 F;  1IBM J;  1Z4U A;  5KG5 A;  1T05 A;  1NSK L;  2LQ8 A;  2J6T A;  4DUZ J;  1UJ4 A;  1WI8 A;  2CNN B;  3ULH A;  3M7V A;  2EKY A;  3JAM U;  1HPZ B;  3MOZ A;  3TZW A;  1U6Z A;  1VRQ C;  4NLW A;  2VV5 A;  3N5F A;  1T3O A;  3NGK A;  3AH6 A;  4OYO A;  5F8G A;  4X62 F;  1FD2 A;  4LF9 J;  2HWT A;  1ARO P;  1ZAX A;  3V6D B;  1TP7 A;  3KJF B;  4ATN A;  3N6N A;  3OXL A;  1LW0 B;  2UUT A;  1SBR A;  3MAH A;  3MD3 A;  4CM0 A;  1U1N A;  4N77 A;  4KGX B;  1FJG J;  1UA0 A;  2C2N A;  3M8Q B;  4KGM A;  3QAE A;  1S1V A;  2J7U A;  2DCL A;  2OPR B;  3ETO A;  2P8I A;  4I68 A;  3RBE A;  2CWK A;  3HO1 A;  3MM6 A;  2MJN A;  4IDK A;  5KG6 A;  4F0H A;  2C2E A;  2RJZ A;  2V2V A;  1HI1 A;  1YJW S;  3C2P A;  1N5T A;  1V3Z A;  5A2Q U;  3R5G A;  3HHL A;  3W2V B;  1R0B G;  4IOB A;  3K8W A;  4YB6 A;  2YX4 A;  4Q5V A;  4ZA1 A;  2DB1 A;  1N5Y B;  1UPP A;  1XTZ A;  1GTH A;  3FDS A;  4OI1 A;  3T41 A;  1RWK B;  3H25 A;  1VHI A;  3GU0 A;  2IDL A;  3TX0 A;  2EEY A;  2XG8 A;  5HMZ A;  2QA4 S;  3GIK A;  5A0Y A;  4B9N A;  1Q0N A;  2EFO A;  4RX6 A;  5F8N A;  1WKJ A;  3TAN A;  3AD8 C;  1OSC A;  4TKT A;  1WOR A;  3MEK A;  1YVF A;  2ZWO A;  4OI4 A;  3SSQ A;  4A8S A;  3F73 A;  2ZZM A;  3AOB A;  3A8K A;  4CNY A;  2YNG A;  4Q7A A;  5B7W A;  4I6W A;  3GG0 A;  5EGY A;  3CXC R;  1NKB A;  3FBB A;  3MPW A;  3N28 A;  4DSI A;  2EG1 A;  3L95 X;  1CQM A;  4LRB A;  3V6D A;  3PJX A;  3KMS A;  2HHT A;  2KM8 C;  5E2Q A;  1CEZ A;  3KOA A;  5B0F A;  3QT7 A;  2C2D A;  2VD3 A;  1JLA A;  3NXZ A;  1FEE A;  2E1M C;  2BR0 A;  3HJF A;  3MMC B;  4RUA A;  1CJK A;  4Z2X A;  2Q79 A;  1IM4 A;  4HI1 A;  1K1S A;  3ZNU A;  2BOP A;  1E6Y A;  1IKX A;  1U26 A;  2HNZ B;  2VPX B;  2YBV A;  1TEL A;  3MMA B;  4K4Z A;  1IBL J;  1NZ8 A;  3PW5 A;  3QGH A;  5DQG A;  1LW0 A;  1SVD A;  1S6Q B;  4N8N A;  2BYC A;  1RT3 A;  1S0N A;  1VK3 A;  1NSA A;  3PNI A;  4H4M B;  3W5Y A;  1KP6 A;  2EKN A;  2CNK B;  2HWH A;  5AE3 A;  4DV0 J;  1KTV A;  1IKX B;  4DL4 A;  5HP1 B;  1UCN A;  4ER8 A;  3CNQ P;  3QGG A;  4ES1 A;  3VAJ A;  2BX6 A;  3CMQ A;  1OWX A;  2KO1 A;  2A3J A;  1QAI A;  1NHK L;  1SIW B;  4U9R A;  2C42 A;  2ZM6 F;  4DR2 J;  1G7C B;  3NAI A;  2XWX A;  2NPF A;  2WRM A;  5ETK A;  5LMN J;  1N88 A;  3B8H A;  2D3O 1;  3RRG A;  4CLW A;  5DGB A;  1EB0 A;  3RR7 A;  3ZTS A;  4OZL A;  4JI5 F;  2P2C B;  3C6U B;  4RLE A;  4I2Q B;  3KLI B;  1UVK A;  3M8Z A;  2HS0 A;  3CSK A;  4LRF A;  1SQE A;  1IN0 A;  2J9C A;  5B0G A;  3TW0 A;  5A8W A;  4HHJ A;  2X1A A;  4DL3 A;  4DR5 F;  2CZ9 A;  3DU5 A;  2ZH3 A;  1I3O B;  1Q79 A;  4YQW A;  2MQP A;  1RYS A;  2F4V F;  2F3J A;  2MKH A;  1PJ5 A;  5D0H A;  3RUB L;  3Q22 A;  2P6S A;  1FDN A;  4PUO B;  2EC2 A;  2BE2 A;  3L09 A;  5J1E B;  5FLX Y;  1LWX A;  4C8O A;  2EXU A;  1KEK A;  2BRL A;  2VFS A;  2F7V A;  4ID5 A;  3NCQ A;  4LBI A;  1J5E J;  4K2X A;  1YSJ A;  4IG3 A;  1EKR A;  1YK9 A;  1LWC B;  2OPS A;  4FP9 A;  5JMN A;  3CCR S;  1U1M A;  4DQS A;  1JKH A;  2QEX S;  1HNZ J;  2XY6 A;  3FZ2 A;  2YKQ A;  2KL8 A;  1CJT A;  1NEE A;  2N4C A;  3E01 A;  2FY8 A;  2H3E B;  3I5A A;  1N6Q B;  4X4R A;  4CLP A;  4JYA F;  1AFJ A;  2CNL B;  1SC6 A;  4RNH A;  2UU9 F;  1H74 A;  2XYG B;  1TTH B;  4K0K F;  5C42 B;  4A8K A;  4OV1 A;  3EVO A;  5B0E A;  1YRU A;  2G1D A;  2LCW A;  1H38 A;  3PYF A;  3CJT A;  2VIH A;  4B9T A;  1MWQ A;  2DRD A;  4LQ3 A;  3EGZ A;  3BBB A;  3Q2T C;  3SI8 A;  4LIR A;  1U6B A;  1W2I A;  2IIH A;  2VU5 A;  4JBC A;  2IC3 A;  3JSB A;  3AXM A;  5HJX A;  3U7J A;  2W4C A;  1UFK A;  2CJA A;  5ETN A;  3UI3 A;  4ZS6 A;  2LU1 A;  2D3Z A;  1KON A;  1IKY B;  1YZ7 A;  2ALY B;  4F3M A;  1KC8 T;  3MM7 B;  2PN6 A;  4WFB Q;  5LXY A;  2BKN A;  3MM5 A;  4NWB A;  3CCU S;  2HW3 A;  3SCL E;  2VUG A;  1DZ5 A;  1XNQ J;  1Q4R A;  4ZP9 A;  1REV B;  5F3T A;  2CPI A;  4NLY A;  3G96 A;  4FS1 A;  4PQU B;  3AA9 A;  3DDK A;  5D4L A;  5GME A;  3W5X A;  5A8K B;  4YY3 F;  3FMB A;  1S1W A;  3DLE B;  4JI6 F;  1M5P C;  2MKY A;  4F4Y A;  4FYY B;  3NWG A;  4M8L A;  2M2B A;  2MLX A;  1H72 C;  4DF8 A;  3JAM Y;  4HEA 9;  1RQ0 A;  3IBF B;  3TA2 A;  4I7F B;  3VQT A;  1NDL A;  1NDP A;  1WHW A;  2GNK A;  4AUK A;  4MYU A;  2DGO A;  1B0P A;  1JJ2 R;  1KLN A;  5A0Y B;  1HBN B;  3MTJ A;  2B7C B;  1DTQ B;  3CCS S;  4DR3 J;  2UUC F;  5IT0 A;  4IRD A;  2FGC A;  2IM2 A;  1HNW F;  3TJ9 A;  4WFY A;  3NNA A;  4TQR A;  3C15 B;  1DLO B;  2NXC A;  3DRS A;  4W4M A;  1LXN A;  2PMH A;  3R7N B;  3C6T A;  3GYG A;  2XI3 A;  4USH A;  5DM7 Q;  2NZC A;  3BN7 A;  4O0I A;  1FD8 A;  4M94 A;  1D1U A;  4H4O A;  4OL8 A;  4L6V 3;  5D15 A;  4P52 A;  4O3Q A;  3SMZ A;  1RHK B;  4DLG A;  2ZJP Q;  2F9D A;  4HR2 A;  3QO9 A;  1RLC L;  2ZIT A;  4PXE A;  1RHJ B;  1X4A A;  2VA3 A;  4LF2 A;  1RDR A;  3R7B B;  1WC5 A;  1KVJ A;  2YNF B;  2KZZ A;  1IM6 A;  5FII A;  2APO A;  1X4D A;  1W2B R;  5E5N A;  1IKW B;  2DJW A;  2KHD A;  2VG5 A;  4LF4 F;  4M5D A;  1F60 B;  1NH7 A;  4TU9 A;  1CQN A;  1IWA A;  4MKV A;  2HEK A;  4WFX A;  2MZQ A;  4WXO A;  4CIO A;  1LK5 A;  1O5J A;  1MWZ A;  1RTI A;  3AQP A;  3H2V E;  5IC4 B;  4OZ0 A;  4EEY A;  1NPP A;  1FWK A;  3RU0 A;  2NLW A;  3KYL A;  1WEZ A;  1Q95 G;  5KFK A;  5C24 B;  3HM9 A;  3RR8 A;  3W5Z A;  3WC2 A;  3ZZP A;  4IH6 A;  1Y5L B;  5DJB A;  4PQA A;  2R8I A;  3Q8Q B;  1F2G A;  3WX8 A;  4OI3 A;  1TKX B;  4WKY A;  2B6A A;  4LF6 J;  2AJQ A;  2BAN B;  3VZI A;  1V9O A;  4QWD A;  4I2P A;  3T6B A;  3FRZ A;  4I1T A;  5KFP A;  2JRS A;  5I3Q A;  3GJT B;  5KFF A;  4CCH A;  5F8J A;  2KFZ A;  4DZD A;  4RUH A;  3HSD A;  4FXD A;  3IO1 A;  5IQ6 A;  2ZDO A;  3DGP B;  1VC6 A;  2XHW A;  5HMX A;  4DCP B;  4Q8E A;  3UN3 A;  2RIL A;  2OSQ A;  2LP4 A;  5HSP A;  2XLK A;  3H5X A;  3MMC A;  5HQL A;  7FDR A;  4N5S A;  2C2R A;  4BS2 A;  1TFW A;  1FK9 A;  1RT7 A;  3OR2 B;  2QA1 A;  1PJ7 A;  3HD2 A;  2MKC A;  3POT B;  4CO1 A;  3BSO A;  3M2U B;  2V4J A;  4K59 A;  4L3N A;  1TUG B;  2HNZ A;  2HBQ B;  3JTO A;  3K5O A;  5IFM A;  3T1Y J;  1CUL B;  1OYD A;  4BC7 A;  3TUZ C;  1K8A T;  2HFO A;  4NLX A;  2C3P A;  1NJI T;  2QLJ B;  4H4O B;  3DLG B;  3D3C J;  5A8R B;  4ELU A;  4UOF A;  2UUB F;  4M95 A;  1JLA B;  4DFM A;  1X4E A;  1HQU A;  2L3M A;  1S59 A;  3QO9 B;  4G1P A;  4HT7 A;  2W9C A;  3RB4 A;  3CD7 A;  5KFD A;  1FKA F;  3DLJ A;  4OYX A;  2R8K A;  1KVK A;  3E01 B;  1HWL A;  1IR2 A;  2PMW A;  1N6Q A;  3FCH A;  2CQ3 A;  1D09 B;  1Y4Z B;  4ERD A;  3EPG A;  3VAI A;  2LQB A;  4JV5 F;  1KN6 A;  2AJ2 A;  2DO0 A;  2NZ4 A;  1F5B A;  4LF1 A;  4ZJO A;  2G2Z A;  5JUM A;  4XPE A;  2V0N A;  3CPW R;  2IBK A;  1FKO A;  3DI6 A;  4LR9 A;  1N48 A;  4F67 A;  4ENO A;  2HHS A;  2R7X A;  1FFS B;  1RAC B;  4ZVG A;  3SEO A;  2E5L F;  5J2Q A;  3D6M B;  1JQG A;  4YME A;  2ZZN A;  6FDR A;  1SJR A;  4NA1 A;  4DV3 J;  1AUD A;  1RSC A;  5J2N A;  3GV7 B;  4DX5 A;  4F0M A;  3DLE A;  1JJH A;  3AOD A;  1L3U A;  4ZHR B;  3HHL C;  4JV2 A;  4CM2 A;  4YS2 A;  1TK8 A;  2DK2 A;  4LF4 J;  4LVO P;  1RAJ A;  2HWI A;  3GZ7 A;  3NCP A;  4CO4 A;  4DJB A;  5LSL A;  2OPP A;  5AJ3 F;  2PA3 A;  3ITH B;  1G4C A;  3H40 A;  2FHO B;  3I82 A;  2V67 A;  3CME S;  4ES2 A;  3BJY A;  3RAQ A;  1B3T A;  2Y8W A;  1PC5 A;  1J5E F;  2RT3 A;  1HBM B;  1AFI A;  4QIG A;  2JLF A;  2EI5 A;  3W2W A;  3GSI A;  2A2C A;  2YNH A;  5L1K A;  5K14 A;  2Q66 A;  3TZX A;  3W60 A;  2HRU A;  3N5B A;  4C7Q A;  3NG8 A;  2NRE A;  1R8B A;  2CQP A;  3AOC A;  4USI A;  2EK1 A;  3C16 B;  3HVT B;  3VVU A;  2IRY A;  1M90 T;  3D3B J;  2PGC A;  2J6S A;  2B43 A;  1TL1 B;  1BGX T;  3JSR A;  2RUG A;  3ENV A;  1NCL A;  3OL6 A;  2FYX A;  3PFE A;  3HSG A;  1RB0 A;  3G8S A;  1YJT A;  4IFY A;  1NKC A;  2OH2 A;  1CLF A;  2AEM A;  4O23 A;  2D41 A;  1ZOT A;  2MZR A;  2VQE J;  3GV5 B;  2OPS B;  1M5H A;  2JVO A;  2OTJ S;  1HNV B;  1I5O B;  2DKO B;  4WP3 A;  3OW2 R;  1PSD A;  1VQ8 S;  3TI0 A;  2DEJ A;  4PG5 A;  4FKX A;  3W7B A;  2XYP B;  4U7C A;  3DLL Q;  5F8L A;  1WSV A;  1XMO F;  2UZA A;  4JI7 J;  2NXU A;  4GKK J;  2XMJ A;  3W1Y C;  4YHH F;  3M4X A;  3ILI A;  3H5Y A;  3JTN A;  2HZV A;  1S4E A;  4ZJQ A;  1QAX A;  2L9D A;  5IM0 B;  1AXQ A;  3EVM A;  4USU A;  2VOD A;  4EBD A;  3CJR A;  3GB0 A;  4ED0 A;  3QQC D;  3TA1 A;  3I87 A;  1MW7 A;  1S1X A;  4J9V A;  4IQX A;  5D0R A;  5BYR A;  3W64 A;  4CZC A;  4KGK A;  4DPY A;  3QGP A;  5KAK A;  4WFA Q;  3C8Y A;  1IXK A;  2H4Y B;  3FGV A;  2AIR B;  1RAA B;  5CZX A;  3ZTQ A;  3HT3 A;  1U49 A;  5D8H B;  1RT2 A;  2D69 A;  3T5K A;  2CPJ A;  2HHH J;  2Q6B A;  4DSE A;  2MEW A;  1RJJ A;  4J9R A;  1CJU B;  2IY5 B;  1RWM B;  2ROE A;  2LQ5 A;  1DUR A;  3MM7 A;  4K4T A;  1X0F A;  1T03 A;  2X1F A;  3T9N A;  3K0J A;  4PQU A;  1RT6 A;  4DHV A;  3J81 Y;  1RGV A;  2J8A A;  1T95 A;  4I2P B;  1NND A;  1TL1 A;  2X51 A;  3SFU A;  5C25 B;  1NLK L;  3TZY A;  3HUL A;  2AD9 A;  5C2G A;  3R2D J;  2HHQ A;  4WZM A;  4ZPB A;  2K7J A;  1JB0 C;  3ZZ0 A;  4YR0 A;  4MYT A;  2RB7 A;  2AJ4 A;  5KOX A;  5KFW A;  2XO7 A;  5J2P A;  2DGU A;  4CYU B;  5A6P A;  2CQ1 A;  4B9U A;  3K57 A;  3RB6 A;  4FDF A;  1TMM A;  1JXL A;  5ADZ A;  4MTP A;  4B3S F;  2XO6 A;  2GZO A;  1OPZ A;  1X60 A;  2LA4 A;  4RJV A;  2XZT B;  3PV8 A;  1CBK A;  2DR5 A;  4ILM A;  3A3N B;  1LK7 A;  1ICE B;  1NSP A;  2GQC A;  4FXW A;  2PD1 A;  1UEU A;  3JQK A;  1K44 A;  3S6E A;  3ZXW A;  5HL7 Q;  3VAK A;  3OSP A;  2FLL A;  4DR7 F;  2AZ1 A;  4RW9 B;  1I51 B;  3HT0 A;  4CQ1 A;  1C0T A;  2G0I A;  3NNH A;  2P6T A;  3HZG A;  1CJV B;  5HAN A;  3DHW C;  3QJP A;  3FSI A;  4KV8 B;  2F5G A;  2XLI A;  4CT9 A;  5HRO A;  4B9M A;  2I6W A;  1HNW J;  1SJ3 P;  4V1A k;  1WOO A;  2ACM A;  4YDD B;  2NSC A;  1VS3 A;  3BRE A;  5DET A;  2DNM A;  4ZIT A;  3EWG A;  4DL2 A;  1U24 A;  4QR1 A;  2Y0B B;  2AZ3 A;  4X4Q A;  1PYS B;  2DNO A;  3VAG A;  2FZC B;  4J91 A;  5IS2 A;  2LEC A;  4A8F A;  1WOP A;  2UVV A;  3RBD A;  1TQL A;  4EZ9 A;  5C2C A;  2RU9 A;  4HH1 A;  3EGN A;  1GNK A;  2B4O A;  3IR7 B;  1D8Z A;  4ZN3 A;  1TFY A;  1H73 A;  3DCA A;  5IZH A;  4YB1 P;  3HHL B;  4CH0 S;  2RUS A;  3MR3 A;  2Y1R I;  4A47 A;  4A8Q A;  4PKD B;  1SQF A;  5ETL A;  3S01 A;  4TYA A;  2LLZ A;  4C3M A;  1FFG B;  4LSL B;  2ZH1 A;  1UZD A;  1F2H A;  3D68 A;  1VJW A;  4DL7 A;  1FXL A;  2EK6 A;  5ETR A;  5GAD U;  3FUY A;  4RW8 B;  1C1C B;  4KRW A;  1DBD A;  1S1T A;  3CCV S;  3NGT A;  3LTO A;  3UPF A;  2XSF A;  4QIW D;  3UR0 A;  4CO2 A;  1T8E A;  3CUL A;  1HNX J;  5A6W A;  3NGR A;  2F65 A;  2BE7 D;  4K5R A;  5K8M A;  4Z7C A;  1ROF A;  1KLM A;  1TKZ B;  2YNH B;  4UQT A;  3POT A;  2BJ8 A;  3QBC A;  4QBU A;  4KGZ B;  1VMB A;  5DLG A;  2QL7 B;  5B0B A;  4JI3 J;  3QAT A;  4YB5 A;  3GR0 A;  3DRR A;  1P1L A;  5KT3 A;  3AB4 B;  3CJQ A;  3HKW A;  1KLM B;  1TKZ A;  2DD8 S;  2RDI A;  3PW4 A;  1NUE A;  1Y10 A;  3FBF A;  2BJE A;  1MML A;  3UN2 A;  2JZ5 A;  4LSN A;  1NHV A;  5DZ6 A;  4LF7 F;  2B4V A;  2R7Q A;  2DHX A;  2YY3 A;  1RT1 A;  2B9W A;  2KG0 A;  4WK1 A;  3LOU A;  3G6Y A;  2Y1I A;  1YDL A;  2MLZ A;  4DUY F;  1OMS A;  2AJ1 A;  3IM9 A;  5CAB A;  1JWW A;  2GVD B;  1F9F A;  4IQM A;  4LSZ B;  3U02 A;  3S1T A;  4YFU A;  3MM5 B;  2BJ1 A;  3AB2 B;  3W8P A;  4FN5 A;  2QL9 B;  3ZTO A;  2R2T A;  2GIF A;  3NRB A;  1VIX A;  3ITH A;  4C0B A;  1OPI A;  1WG1 A;  4G3I A;  3MFI A;  1WF1 A;  2YQ1 A;  3VWS A;  3PO5 A;  3TA0 A;  3M8P B;  2K06 A;  2DY1 A;  2GMH A;  1FKO B;  3DI6 B;  1Q53 A;  5HMW A;  2ASJ A;  2JX2 A;  5LJ3 Y;  1YG0 A;  1N52 B;  4TN2 A;  3GG1 A;  4IKA A;  2EFQ A;  1P9Y A;  2J5A A;  3FSY A;  1VFJ A;  1LW2 A;  2ACY A;  4LF9 F;  3PRV A;  3PY8 A;  4M1K A;  2XMW A;  1FWL A;  3MMB B;  4KPY A;  4WWS A;  1ZPW X;  3KJV B;  3MPV A;  2VQF F;  1XK8 A;  1JLB A;  1V3R A;  5KFB A;  2AU0 A;  4NL5 A;  5LOQ A;  2XGP A;  3EZ5 A;  3CW2 C;  1YRT A;  3CVK A;  3N6L A;  4E8U A;  1DAX A;  3VQS A;  4IUF A;  4WP9 A;  2J6U A;  4QWE A;  1T9U A;  1VHF A;  2JHE A;  2VFV A;  1NSQ A;  2EBG A;  5BXI A;  2C2K B;  4LRE A;  4OLP A;  4QJV A;  4QWC A;  2P9C A;  1HI8 A;  4NML A;  4M5H A;  3UR3 C;  1N34 J;  2HHH F;  2CXE A;  3CDA A;  2GC8 A;  4UT4 A;  1Y3J A;  3MPU B;  4MIW A;  3BZQ A;  4RNO A;  1E6Y B;  2EFG A;  1BMQ B;  1J2V A;  2C3Y A;  2VC1 A;  1FRI A;  1RKI A;  3GFZ A;  4J9U E;  1HYS B;  3HSJ A;  5ETP A;  1YZ6 A;  2QSW A;  3DLK A;  3OXF A;  4UUX A;  2UU9 J;  1BQM B;  1TL4 A;  2YWG A;  3ISZ A;  1N0U A;  4J90 A;  1EAY C;  1T9Y A;  2RS2 A;  4WXW A;  1EAR A;  1XR5 A;  5KG7 A;  3NGS A;  1RP5 A;  4AL6 A;  1HNZ F;  4OZ5 A;  3JS9 A;  4EO8 A;  2YKA A;  4J7C A;  2CPZ A;  6AT1 B;  1BQN B;  3D67 A;  4PYA A;  3J80 Y;  4KY3 A;  3R1L A;  2RVJ A;  3HCX A;  4KHM A;  4DQI A;  2AYE A;  2HZA A;  2MGZ B;  4IH5 A;  4W90 B;  1WEY A;  3CCE S;  1WF0 A;  4A46 A;  1TV6 B;  1HL6 A;  5KFX A;  2WAQ D;  3DC2 A;  5MLC V;  3H4B A;  3DU6 A;  2E1C A;  3NNC A;  1VCT A;  5CYQ B;  1VBX A;  3WBZ A;  2ZH8 A;  1IR1 A;  1OJ4 A;  3M8W A;  4KIA A;  5FDL B;  1SJQ A;  3J80 U;  3WIU A;  2B9E A;  2CDQ A;  2XSJ A;  1KQS R;  5CXT A;  3HHD A;  3QWP A;  4A8M P;  4RW7 A;  1MN7 A;  4MKB A;  5AXN A;  1X31 C;  5LJ5 Y;  1U0S A;  4ICL B;  2MQQ A;  1QSY A;  2GW8 A;  2RHQ B;  2ZWP A;  3A3O B;  2IRX A;  5F8M A;  2H65 B;  2IPO B;  3TR5 A;  4X4U A;  4RNN A;  3BR8 A;  2GML A;  2NYI A;  2XWY A;  4JI8 F;  2HHP A;  4NAS A;  3IBW A;  2BEF A;  5L9N A;  3CUN A;  3LW5 C;  4F4W A;  1BLU A;  1RT4 B;  3R6L B;  1RLD A;  2Z57 B;  4FKY A;  1HBN A;  3BM7 A;  5IT9 U;  1VJQ A;  4ZCM A;  4GC6 A;  1JKH B;  2OSR A;  3O8W A;  1SKU B;  1IBK J;  4IFV A;  3FJ2 A;  3C15 A;  2KXH A;  1XIQ A;  4U95 A;  3G71 S;  1QE1 A;  2NXJ A;  3DRP A;  3B78 A;  3EMT A;  3NS5 A;  4OX6 A;  5KFL A;  3O1L A;  3TNV A;  4DBQ A;  3MM8 A;  4DUZ F;  3Q8V A;  1U45 A;  1TR0 A;  2HFN A;  3VTI A;  3FC9 A;  5B0A A;  4NX9 A;  2RQC A;  2CPX A;  2M5Y A;  1F5A A;  1JLF B;  3GCX P;  1KVI A;  2M52 A;  1AZS A;  1PAE X;  1R27 B;  1RT1 B;  1RTJ A;  2F40 A;  1Q7L B;  3DM2 A;  2RRB A;  3GIL A;  4E0D A;  5DG8 A;  2E9T A;  4Z37 A;  2YNI B;  2GVZ B;  2F4F A;  4HYK A;  4Y2I A;  1B0V A;  3P49 B;  3A4T A;  1RZM A;  2DNZ A;  1RI7 A;  2ZH6 A;  1X4G A;  2C3U A;  1QTM A;  4H4K C;  2B0G A;  2CQC A;  4IDK B;  7FD1 A;  2J0Q D;  2VBX A;  2XMT A;  4ED4 A;  1T3N A;  3W8G A;  1FHT A;  2AWZ A;  2H5E A;  2IA0 A;  3C14 B;  1U6F A;  3GYX B;  2QMU B;  4AYB D;  4ED7 A;  3M6U A;  4DFJ A;  1UFL A;  2CQG A;  2XNR A;  1Q78 A;  1REV A;  2BUN A;  2RQK A;  1LNQ A;  3OTE A;  4ZVT B;  3IAS 9;  1YJ9 S;  3OL9 A;  3VV2 B;  1T02 A;  2CQD A;  3CE8 A;  2GCF A;  2KYZ A;  3UFC X;  5IWA J;  1RUS A;  3TJA A;  5HQ8 A;  4O0N A;  2YVS A;  5KFS A;  4QWA A;  3HJV A;  2VQE F;  3TQ1 A;  3X3U A;  1HFE L;  4UY8 T;  2EFN A;  2XMA A;  2XZD B;  2M4M A;  4O3P A;  4RU2 A;  1T11 A;  1HNI A;  3VCD A;  4B3R F;  3G4S S;  1SL1 A;  1HR0 J;  4NZ7 A;  1CPZ A;  1R3N A;  3UO0 A;  2YXL A;  3Q2S C;  4NZ6 A;  2ZOM A;  2HFS A;  2CFX A;  4OJ1 A;  2DY9 A;  3EE3 A;  3QZ7 A;  5L1L A;  2AMC B;  4JYA J;  5HJY A;  1HQU B;  1RAG B;  4DCJ B;  2FC8 A;  4IOC Q;  1FO1 A;  4P71 A;  5GAG U;  2IJR A;  5HO4 A;  1L3S A;  3I4H X;  5D4N A;  5CD4 A;  2W2Q P;  4NXN F;  1ZA1 B;  4LF7 J;  2RKI B;  4LVN P;  4RU9 A;  4Q44 A;  3GLJ A;  1S6O A;  3UD5 A;  2AEF A;  4DX7 A;  2WZ1 A;  2VHG A;  1FVS A;  1G6B A;  1SH2 A;  4X62 J;  3MI7 X;  5AJ3 J;  4O3R A;  3IA0 A;  3IWN C;  4AXJ A;  2DYA A;  4EZ6 A;  3EZU A;  1QM9 A;  4A8O A;  1MRO B;  2DGX A;  2YKN B;  2ROG A;  3H2L A;  2V69 A;  4OZN A;  4J9O A;  2CJK A;  1JNR B;  3LWL A;  3TVY A;  5KFZ A;  4C2M A;  1N5Y A;  2HQG A;  4DV3 F;  4J37 A;  3G82 B;  3HDS A;  2Z0G A;  3LPE A;  1FRX A;  1OSD A;  4RZR A;  1ZET A;  4ED2 A;  1U2C A;  2YKM B;  2QSF A;  3KKF A;  2I9S A;  4DQP A;  2YQ3 A;  3Q8S B;  2BMB A;  5H9E K;  3J7A 1;  4EK2 A;  1HWI A;  1C0U A;  2Q1L A;  3EIC A;  4OYZ A;  1HHT P;  3KLE B;  3OPK A;  1S7I A;  3UVJ A;  4WK3 A;  3SQG B;  4UTG A;  4NCG B;  1TKX A;  2OKQ A;  1U2F A;  1ZTW A;  2KJW A;  1S49 A;  3RBX A;  3ELH A;  1RAH B;  3H2U B;  3LAM A;  4ZVR B;  4X64 J;  3ET6 B;  1BY9 A;  4DQQ A;  3M8Y A;  4CDI A;  2DGQ A;  4X4T A;  3C3L A;  4BCA A;  3CJ2 A;  3H4D A;  1HWK A;  3IAM 9;  2F9J A;  3WX4 A;  1RCO B;  5T7L A;  3EPI A;  3JB9 k;  2H5I B;  1YI2 S;  1URN A;  5DO2 A;  2Y1L B;  1JJ4 A;  2JEG A;  1IVZ A;  2EBE A;  2RDD A;  2G0C A;  1J27 A;  3BYP A;  4IFY B;  2J9D E;  3CJ8 A;  3LPY A;  5AE1 A;  2DNL A;  3DGP A;  1HR0 F;  1IUJ A;  4FF3 A;  1UVL A;  3CC4 S;  3OSN A;  3NY0 A;  3QNW B;  3W2W B;  4CH7 A;  3QRQ A;  2ILZ A;  1RU2 A;  2KG1 A;  3BEG B;  3IC1 A;  3CB4 A;  2C1E B;  1SKR A;  1BE4 A;  3PO4 A;  4NPO A;  4KHP J;  5GAE I;  3M30 B;  3TX8 A;  4JI4 F;  3CCQ S;  3QSY B;  4TLQ A;  4KO0 A;  3P8B B;  4F4Z A;  4G1Q B;  3RAX A;  1UA1 A;  1A6L A;  2HQC A;  2KVQ E;  2CAD A;  2W2N P; 
#chains in the Genus database with same CATH homology
 4KYZ A;  4DV5 J;  3J7A N;  1XMQ J;  4DR6 J;  4LF8 J;  1N32 J;  4LF6 J;  2UUA J;  4NXM J;  2HHH J;  2MTL A;  2MEW A;  3J81 U;  3IMQ J;  4NEZ A;  4LFB J;  4DV6 J;  1J5E J;  1IBM J;  3R2D J;  5LM7 E;  4GKJ J;  4JI0 J;  4DUZ J;  1HNZ J;  5IWA J;  4DUY J;  3JAM U;  4OX9 J;  2KL8 A;  3T1Y J;  4LF9 J;  4B3M J;  4RJV A;  1HR0 J;  3OTO J;  3D3C J;  2UXD J;  4JI8 J;  4X66 J;  4JI2 J;  2UXC J;  1I94 J;  4JI1 J;  1N34 J;  5BR8 J;  4X65 J;  4HHU A;  4YY3 J;  1HNW J;  4YHH J;  4V1A k;  5A2Q U;  4DR1 J;  1N36 J;  4LF7 J;  4JI5 J;  4X62 J;  2UU9 J;  5AJ3 J;  1XNQ J;  4PWW A;  4DV3 J;  4K0K J;  4LF5 J;  4KY3 A;  4LF4 J;  2MQ8 A;  4JV5 J;  1XNR J;  4DV4 J;  4LFA J;  3T1H J;  3J80 U;  4DV2 J;  2UUB J;  2E5L J;  4DR3 J;  4X64 J;  2UUC J;  4DV7 J;  4NEY A;  5FLX U;  4B3S J;  2UXB J;  3R2C J;  1HNX J;  3D3B J;  4LFC J;  4JI6 J;  4DR7 J;  4NXN J;  1FJG J;  4AQY J;  1IBL J;  4JYA J;  5IT9 U;  1N33 J;  4JI3 J;  2VQE J;  1IBK J;  5LMU J;  4DV0 J;  4KHP J;  4B3T J;  4DV1 J;  2ZM6 J;  1XMO J;  4DR4 J;  4DR5 J;  4JI7 J;  4DR2 J;  2F4V J;  4B3R J;  4GKK J;  4JI4 J;  3W1Y C;  5LMN J;  2KVQ E;  2VQF J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...