2E66A

Crystal structure of cuta1 from pyrococcus horikoshii ot3, mutation d60a
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
102
structure length
102
Chain Sequence
MIIVYTTFPDWESAEKVVKTLLKERLIACANLREHRAFYWWEGKIEEDKEVGAILKTREALWEELKERIKELHPYDVPAIIRIDVDDVNEDYLKWLIEETKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Divalent-cation tolerance protein cutA
publication title Structural basis of the hyper-thermostability of CutA1
rcsb
source organism Pyrococcus horikoshii
total genus 30
structure length 102
sequence length 102
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-12-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03091 CutA1 CutA1 divalent ion tolerance protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2e66A00
4CO0A 3AHPA 4RWXA 1XK8A 2XBPA 4C3KA 3NCQA 4R25A 3O8WA 3DFEA 1V6HA 2VD3A 2J9EA 5L9NA 1PILA 1QY7A 5D4PA 2J9DE 1UMJA 1V3SA 2V5HG 4IYQA 2O67A 2DCLA 1H3DA 3LF0A 2Z0GA 1V9OA 4YB6A 4RX6A 3CE8A 1KR4A 4NYPA 5DS7A 4C3LA 1J2VA 4USIA 1OSCA 4Y65A 4RWWA 4AFFA 3X3UA 1O5JA 3AH6A 3NCPA 4C3MA 4YB5A 3OPKA 3AA9A 2J9CA 1O51A 2NUUG 1HWUA 3NCRA 1VFJA 3MHYA 5D4OA 3TA1A 3O5TB 2CZ4A 4CNZA 4ZK7M 2GNKA 2PIIA 3AA8A 4WK3A 2EG1A 3TA0A 1NH7A 2NUHA 3GSDA 4WK1A 3L7PA 4NYOA 2XULA 2JJ4D 4RLEA 1P1LA 3N5BA 4USJC 4CO3A 4OZJA 1V3RA 2XG8A 2E66A 2EG2A 3T9ZA 4E98A 2XZWA 2ZFHA 4Y6IA 4OZLA 1VHFA 5D4NA 2RD5C 5D4LA 2NS1B 3HLUA 5DRKA 1NZAA 1Q1KA 2ZOMA 4D3HA 4CO2A 4D3GA 2J9DA 1UL3A 4OZNA 4YB7A 4USHA 1UFLA 3BZQA 4CO5A 3TA2A 2O66A 1NH8A 1NAQA 1GNKA 1UKUA 2GX8A 3M05A 4CNYA 2GW8A 4CO1A 4CO4A
chains in the Genus database with same CATH superfamily
3PKMA 1FEEA 1WKJA 2QN6B 2UUWA 1XK8A 3TRGA 4DV3F 4Y2IA 4OIXA 4FVCA 2C2EA 1NKBA 2UXDJ 4WZMA 1Q95G 5L1JA 2IA6A 4ZVPB 3OTEA 2KYXA 1JLBB 1U1QA 2ASDA 3FRZA 2FC9A 1WUUA 2JLGA 4LFBF 2QT7A 3LPYA 2MTLA 5F8HA 1YJRA 4Q7AA 5EWEA 1D9AA 4AL6A 1FHTA 4ZPAA 3MOZA 4L76A 2ROEA 4RL1A 3DRSA 3CCJS 2JZ5A 2IJFA 2EFQA 3TA1A 4ZVSB 3LP2A 3S6EA 1IVZA 1NJZA 2YQ3A 1RLCL 2W01A 3N9UC 4ZPCA 4NEYA 3L7PA 4TY9A 2AQ4A 1UA0A 1SKRA 3LTOA 4IFVB 2ZM6F 1WC6A 1RCOB 1CG2A 1S1TA 1UVIA 3B4DA 3DLHA 1FE0A 4RJVA 2A6MA 1EIYB 1T0TV 3AQPA 5BYQA 2KRRA 1T05A 3MPYA 3THTA 2BYCA 1CBKA 1MU2A 2MZTA 1X4HA 1B99A 3T3FA 5JUMA 2GAHC 5C5JA 3GPAA 4J9PA 2Q6CA 1V6HA 2P2CB 1T95A 2IJNA 4QR2A 4XTTA 2ZBIA 4DMZA 4WFZA 1R8PA 5K8MA 2YNHB 3OVBA 3FCWA 2HQ3A 2LQ9A 4KHPF 3OFGA 1J5EJ 1LK5A 2U1AA 1RAAB 2X1BA 3AA9A 1S59A 3OSPA 3CCRS 4R8UA 2MY7A 1JLEB 2M3DA 3V4IA 2BQ3A 1Q0NA 2OPRA 3DMJB 1CVJA 3KLIB 4DN9A 4P72A 1MN9A 5KFXA 1CQNA 3QJLA 5D0GA 2QIFA 1NB7A 1U2RA 2XCAA 4DBQA 3B54A 2XGQA 2ZH9A 4UY85 4LR8A 2AMCB 1IUJA 3RR7A 1NNDA 2XMJA 3IG1A 4QPTA 3EZUA 3H2LA 5KFYA 3POTB 3M6UA 2EBEA 2M4MA 1X4DA 1KSPA 2ZOFA 3VALA 4HKQA 4BWMA 3KG0A 1VDHA 3H2VE 1RQ0A 2ZH2A 3IR7B 3DU6A 1DZ5A 2QL9B 4DHVA 3H0PA 1QE1B 2GIRA 4PYAA 1NZ8A 4C8MA 4UUWA 5FDLA 4S0MA 2R7OA 5D15A 2V2QA 3VGUA 4K4SA 3TUJC 2EFNA 4EK2A 3H5SA 1MSWD 4ZJOA 4LIWA 2UUAF 4LMZA 1U02A 1NUEA 2ILYA 2PA8D 1MLAA 4R5PA 4NLGA 4I7FA 1I51B 4I2QB 5D4NA 1K9MT 3TEHB 2AJ1A 3MUVP 1Q1KA 4FF4A 2J9DA 5F0UA 2Z30B 3AT1B 3C16A 2CKWA 2F8HA 4DR2J 5I3UA 1KHWA 1XWLA 1N32F 2W9BA 5CHCB 2QC3A 1F1BB 2CJQA 4CO0A 5GAEI 4NLTA 2L41A 3PNIA 2IM0A 3N01A 2VFTA 2BE7D 2XMUA 3W5XA 3T6JA 2WVCA 4ZIVA 3J7YI 2DRBA 1IR0A 2CYYA 4GKJF 2NXCA 2YKMB 3TEGA 4GO7X 4C3LA 5LSRA 4L6V3 2HBYB 1RWNB 1NJYA 2HZVA 3A13A 2V2KA 1N36F 1NJWA 4HHJA 4DV6J 3SIPB 2D7SA 2VIHA 2DNZA 3D66A 3LUYA 3Q89A 4X4TA 3DLLQ 4JP8A 1RT7A 5GADI 2JJ4D 3HXMA 1JXVA 4HI2A 2HNDB 4CI0B 4PUOB 2P5VA 4OX9F 3DLGB 3FMBA 1Q7LB 3FMWA 2D9PA 3TA2A 3QZ8A 3CCQS 2JVRA 5KFUA 1NDKA 3IRWP 2UVUA 2L9WA 1URNA 3P3DA 1BE4A 2I5JB 3G6XA 2XYHB 1UPMB 4QU7A 4XIUA 2RUGA 2YWWA 2GVZA 4JV5J 2VJVA 3R7NB 1XJWB 4P2MA 3CJ3A 4O0NA 2J8SA 2H65B 2MZ1A 1DY3A 3T5JA 5G0RA 1GXLA 4DOZA 1RTHA 3NGDA 1WEZA 2HAIA 2AZ1A 4Q8FA 2H5EA 4XO0A 2W1BA 2D69A 4DWIA 4K2XA 1JLFA 4ZPBA 4DV7J 4A8WA 3MM6A 2IM2A 1C4AA 1LW2B 2YX1A 4QZVB 4F04B 4UY8T 2XMMA 5K8NA 3J7A1 4LF2A 2CJYB 3CC2S 1W26A 1PYTA 3A8JA 2FPHX 3T1HF 1BQXA 1VBKA 3PR5B 3NNHA 2D3O1 4JBCA 2VQFF 2VG7A 3GJTB 3SSQA 3AB2B 3MI7X 1VQKS 2OI2A 2HKEA 3DGVA 2JNJA 2Y9HA 1HBOB 4YHHF 3CJ8A 3E51A 4NMXA 1KOOA 4NLYA 4LQ9A 3OV7A 1R3NA 2BV3A 4NI2B 2WCXA 4DCOB 4A4JA 2WK4A 5F8NA 1JLBA 4GC7A 3OLAA 2VICA 4JI7J 3TX8A 4P7TA 2VFRA 3HDSA 2CQ2A 5M2RA 5F3TA 3MZIA 1NK9A 3F56A 5DZ7A 1HI8A 5GMKa 3LAMA 2B9WA 3KDOA 3HHLD 3HJFA 1N52B 4FZVA 4G65A 5IT4A 2WBMA 4QPXA 4X84A 3SDEB 1KTQA 2N3OA 2WSFC 3J80Y 1HI0P 4LFCJ 1S1UB 5DQHA 3THPA 1MNEA 2XYPB 2YXLA 4IFVA 1JJHA 2LXFA 1G2EA 2DHAA 5CCLA 1WHXA 2DNHA 3R5AA 5HANA 4ZVRB 2V8DA 1FDNA 4HHHA 5LXRA 2QMXA 1WJ9A 2C2DA 1Q5VA 1NK4A 4F50A 4USMA 3LGHA 2OAUA 3CE8A 5K9FA 4QCLA 4LBPA 2HBQB 1VIOA 2BJ3A 3VAKA 3ISND 2VOPA 1VQ6S 3R9LA 2MKKA 1ZZFA 4PWWA 1RHJB 1T9UA 2E5LF 4BC7A 1EETB 4RUAA 2EFVA 3BREA 4PR6A 4UQGA 2YNHA 1WI8A 1H38A 1N5QA 1V5IB 3I31A 2N7CA 3F0NA 1U4BA 4OX8A 2YNGB 3Q8YA 3GG1A 1N34J 1JLEA 4DR3J 2KO1A 3CVKA 3QRQA 3G9CA 3DMJA 5HQ8A 5JMNA 2ADBA 1UEUA 3KLIA 4DR7F 1F2HA 1FJ7A 4UUXA 4JI4J 2CJ9A 1FX4A 2PEHA 2EW9A 2B43A 3LWMA 2E44A 2M7SA 2R8HA 4LJMA 4DSIA 4NASA 5D6GA 1T03B 3POTA 1RE1B 3VAGA 3LGMA 1WELA 4X4VA 5BJRA 2HHUA 3MM9B 3GB0A 1H7XA 4Q0BB 5C2GA 1FCAA 1AW0A 3KOAA 2QSWA 2HAFA 3F41A 1R0AB 3GCXP 4NLXA 2DGSA 1SV5B 1X4BA 3QSIA 3CCZA 3CEDA 5A8KB 1RJJA 4PPDA 4PCQA 1N0VC 3RRGA 4ATNA 4DQQA 2IVYA 1BD6A 4HL9A 3J81j 3FKBA 2MHNA 9ATCB 2F63A 3TVYA 1T7PA 5HP1B 3AJ2A 2ZBQA 3CWJA 1S5ZA 1RABB 2W7PA 3JYTB 2FJBB 1APSA 4I2QA 3GONA 3MEEB 1ZAVA 3QFHA 3G8TA 4DR5F 2D74B 2CQCA 3BBFA 5F9NA 4OYBA 1TK8A 4DX7A 2HFOA 4W90B 3KJVB 1OQ3A 4N41A 4IRKA 3JQKA 4YB1P 2QGFB 4J9MA 1U6FA 4DV3J 3MAHA 4ETZA 2EVZA 2CQIA 4CDIA 3CD0A 4RW9B 3PFEA 2CWKA 4DPWA 1IN0A 2N7YA 2A6OA 3MMBB 2G0JA 2JLEA 2YKMA 3D54A 2QA1A 5IT9U 3NGSA 1WACA 4YUDA 2W4PA 4OZNA 4ECRA 3RRKA 1S72S 1RCXB 1RI7A 3BKFA 2VBZA 4AL5A 2M2BA 3TZWA 3GP9A 2NPIA 3SI8A 2J8AA 1I94F 5H9EJ 1HNIB 2F4VF 2ZM6J 4RW4B 4USWA 2V9WA 3VQTA 3H8YA 1TKXB 1QTNB 4PQUA 2HNDA 1JKHB 4F36A 4LRDA 4PUOA 1R6YA 1FFGB 3DLGA 2C2NA 4F4KA 5IM0B 5J2NB 4A8QA 2RDDA 2JEGA 1DLOB 3VAIA 2HQIA 2LKZA 3UDVA 3R1HA 3TUIC 1RB0A 3PIOQ 4WIQA 5LMUF 2FY8A 2I5JA 3HVRA 2G1DA 1D0EA 1B7YB 2HLUA 4X64F 1N0UA 4WP3A 4TNOA 1B3TA 2C2MB 3PCOB 1HPZB 3U7JA 4QW8A 4DX5A 2NSCA 4L72B 4MK8A 1REGX 1SUQB 1JLGB 3DDNA 1VQSA 4X4QA 2HVIA 1LK7A 3AY0A 4AL7A 2VDHA 1XNRF 2UVVA 1L3SA 4OZ1A 2D3UA 2DR5A 4QW9A 1S6PA 2ABYA 2KXFA 1YHQS 4EBDA 1FNMA 3AODA 1ZM3A 2P6SA 1LW2A 3O6QA 3IWXA 3PG9A 3W8GA 2W4CA 2K3IA 3M8ZA 3A12A 4WF9Q 3SSRA 1DHMA 1NXIA 1Q79A 2I9SA 1PIEA 4RKUC 1RWOB 2NUUG 2OSRA 1L5UA 3HHLB 1HI1A 2HQCA 2FLPA 3E01B 2PIIA 2JC0A 3K5PA 4TQSA 1Q82T 4DUZJ 1H0HB 4WK1A 4YDXA 5EN1A 2OJ3A 3CO9A 2ZWOA 4DEZA 3MPWA 1TTHB 3FDSA 1HBOA 1RWPB 1VQYA 2FLOA 2W2PP 2B7BB 5KTQA 1JLAB 1UFKA 4NI2A 4DV4F 3VGSA 2CNLB 3PW5A 1VCTA 3S01A 1RKJA 2BRLA 2UUAJ 4NPOA 2X1FA 5KG3A 5EUHA 1WC5A 5DG9A 3D7SB 3DDKA 4I1TA 4N76A 4O3QA 2L9DA 2UZAA 2WBRA 1RSCA 5J1EA 2HW3A 4WP8A 1VJWA 4NYZA 2DITA 4M5LA 3UD5A 1QUVA 1RAGB 3CC4S 2VFVA 4YOEA 2RDJA 3SDEA 2DR8A 2APOA 4Q5VA 4OHYA 2MKCA 4RWWA 1FFWB 1N32J 2QLXA 1KTVA 3GSIA 1FKAF 4IRDA 1S1UA 2RVJA 3VGVA 3MFIA 4MKYA 1GMVA 4CTAB 1UVMA 2IRYA 1SL1A 2DVIA 3SCLE 4C8OA 2FVRA 3FBBA 4ILLA 5IQ6A 1NK5A 2M88A 3QGPA 4CLKA 1J27A 2MSTA 3G6VA 3R8YA 4DSJA 4GKJJ 1VS3A 1FDDA 1F9HA 3MUTP 3K5NA 1FD8A 2C3PA 4F26A 4CIOA 1N36J 3PEJA 3PHTA 4F67A 5IC6B 4WFXA 3KXDA 1G7CB 3ZXWA 1JK9B 1EETA 2ZVIA 1PJ5A 5M2PA 3AHPA 3QAEA 4DL5A 2RE1A 3CJSA 1HIYA 1CPZA 3NWGA 4FPRA 3KJQB 3WC0A 2DNPA 1TUVA 3RYLA 2KB2A 1ZS6A 2YNGA 4B3OB 4RNHA 3U1NA 1EKRA 1FVSA 1VK8A 4EI2A 4B9TA 1NSPA 5B0EA 2KT3A 3T1YF 1FRXA 3J81Y 3JQMA 1B0VA 2E9TA 2Y0SD 4FNHA 4X4SA 1S48A 5C24B 4QIVA 2H4YB 4TKTA 3WDOA 3H42A 4J9UE 3SCJE 4X62J 3W8PA 1T03A 2DNNA 1NK7A 1TL4A 4MKBA 4G1QA 2DNYA 2AJQA 4KGZB 3MM9A 3C3LA 4P2SA 3KMSA 4Q0BA 2YWEA 3V81B 3NL0A 3Q8QB 1RTZA 2AT1B 5GVQA 4YY3F 1P9YA 4B9LA 2B4OA 4DV2J 1R0AA 3CD6S 5E3CA 1SV5A 4WTOB 1T11A 1NHVA 3OR1B 2HS0A 5A8KA 4BBYA 3MEKA 4RUBA 3K17A 4OYMA 2PGCA 3CB4A 3O8WA 3TW0A 3FBCA 5DG7A 3B6BA 4Y28C 4RPFA 4V19X 1Z2ZA 4M5JA 5HP1A 3TUZC 5HI7A 5J2PA 2C3OA 3O3LA 1QSSA 3QSYB 2QLWA 2FHKA 2DXEA 5D4OA 3MEEA 3O44A 1TUWA 1HLWA 4CLZA 2CAJA 1PBUA 2N82B 5HSPA 1VMBA 1T9XA 4QYZJ 1GXUA 1DBDA 2NR0A 4HT5A 2ZH4A 4Z37A 2OPPB 3K5OA 1Q7YT 3KJVA 5KFRA 1QAXA 4LBIA 4D3HA 1LNQA 2ZH1A 1PSDA 1TUGB 3H20A 4ECVA 3FSYA 2VKRA 1WEYA 4KV8B 1YVFA 2FTRA 2OIHA 3E2EA 2MEWA 2O66A 3EJMA 1RWMB 3ENQA 2W9CB 1D9FA 5HBMB 4QIEA 3M05A 3V6KA 4K8RA 3I56S 4NLPA 2CJXB 3T6BA 3MMBA 4JI1F 2M70A 4C0HA 1M5KC 1IKYB 1TFWA 4QU6A 1FJGF 2CZ9A 2BABA 2H51B 1JNZB 3VZIA 4QWBA 1M1HA 4UOGA 3KHLA 4WBFA 4YFUA 1HNIA 2UV8G 2DEIA 1HBMB 2JEJA 4RW4A 3AXMA 3EDQB 3FZBA 4C2MA 5JVHQ 1TKXA 1JKHA 5K14A 2MKHA 2OD6A 1U09A 2X7IA 2C2ZB 5IM0A 5J2NA 4P2FA 4QBUA 1URRA 1DLOA 2ZBCA 1C4CA 1KQKA 1IM4A 3NS7B 6FDRA 2XLKA 4B9UA 1OYDA 4OX6A 4C8KA 2KDOA 4OQJA 1S0OA 2IPOB 2CUYA 3CIZA 2K06A 2CQDA 5G4DA 2PMHA 2V34A 1EQ0A 1HA1A 1IQTA 2E5LJ 3KK3B 3ILJA 1K0TA 2YQ1A 1HPZA 2KZZA 1Y00A 4B02A 2ZC3A 3KLHB 4LF8F 1WOPA 2O5DA 3M2RB 4TYBA 3J7AN 2KFNA 1SUQA 1E6YB 4AD6A 2GJIA 3JAMY 5E0OA 1JLGA 2NZCA 3RUBL 2LQBA 4K4VA 1OY9A 2R7XA 2BACA 1IBKF 4CLTA 2CQ4A 2RHQB 1BXNA 3Q8PB 2P9CA 4ZJQA 3DLKB 4YN3B 1KKHA 2AKWB 4DR7J 3OR2B 2M0GB 4F02A 2DNOA 4F4XA 4CLWA 4DPYA 3HHLC 1EP4B 3P6YC 3PX6A 3T41A 3V6JA 4ZVGA 3M8WA 3R2CJ 4GMKA 3N28A 1NZAA 4WU2A 3GE9A 1HQUB 5DETA 4PEOA 2EWHA 4EZ9A 3HHLA 3FK4A 3RZAA 3E01A 4MK9A 4RU9A 3FZ2A 4G6VB 3P4UB 3MOJB 3RBEA 2Q1LA 1PGZA 5A2QY 4URGA 2BOAA 4EUVA 4CP5A 2LDYA 4DFMA 5A0YB 4PWUA 1S76D 1KHVA 5J1NA 2C3YA 5HJXA 2LP4A 1JLAA 1HR0J 3ISNC 2IBKA 2F3JA 1Q4RA 4LFAF 4NZ0A 4YP3A 2CXEA 3JSBA 5KFVA 1MW7A 1U1MA 4A8FA 4FF1A 5ETOA 3CCLS 2J9CA 1SJ1A 2IYIA 1SJ4P 1VC0A 4DR5J 2OTLS 4XAKA 3D1OA 2NUHA 3OBIA 5F41A 3FEYB 2LYVA 2J7KA 3HP6A 1Y3KA 4GRSA 2ASYA 5F9LA 1MWYA 2BJDA 2G9OA 1RKIA 2BR0A 3HZEA 1R7IA 3TVZA 2AEFA 4CTAA 5GMDA 3US5A 4JYAF 2YKQA 2XS7A 2F65A 3LQVA 1YZ7A 4A8XA 2IMOA 1U1NA 2YKOA 2GMHA 1PO6A 1SVDA 1K0VA 1N8RT 3UPFA 3CJTA 3NRBA 1GT8A 4WFBQ 3VZHA 3AJ1A 2V5HG 4QWDA 2UVWA 1XR5A 2IDLA 4XDCA 4OYAA 3HHDA 3HM9A 4ECYA 1KS2A 2G2YA 1WF2A 4C3MA 3Q23A 1I94J 1SJRA 2MZQA 2VQEJ 5AXLA 2F4VJ 1SQFA 1WOOA 4GKKF 3V5RA 2W7OA 2HFSA 2YKNA 4KQZA 4KTQA 5F8MA 4B3OA 3W5ZA 4ED7A 1F5AA 4DCJB 2PFFB 1IBMF 2ZITA 3ZTQA 3VAFA 2RSQA 3ZTRA 4KGKA 4OJHA 5GAGI 5LMUJ 4JI2J 2HQGA 2GFFA 2VKZG 1F3FA 5C24A 3I6PA 3JTPA 4X64J 5HO4A 2ATLA 1UETA 3G6ES 5AE2A 3NXZA 1I5OB 1S1XB 2KG1A 4IH6A 3V81A 1M5OC 4J91A 1HBUB 4DX6A 2DH7A 1PBAA 4O4GB 4LRBA 4EMDA 1Y3JA 2HK2A 1H72C 3IP0A 5ITHA 1RU2A 4DL6A 3OR1A 3HSZA 3KWMA 1M1GA 1XNRJ 3MDFA 2V8HA 1QTMA 1HWUA 1NM2A 3PW4A 2HBZB 1TELA 3CJ0A 3OVSA 4ZK7M 3IAM9 3P96A 2H5IB 4EBEA 1UJ5A 4DF4A 2LU1A 4B08A 2K1RA 5E7OB 2IMWP 2AYEA 2ZH8A 2KM8B 3CCSS 2ADCA 1HNZF 3M9OB 1OS5A 1X5SA 2V4QA 4U8VA 1FRJA 3QPIA 3CTRA 3OXFA 3IS9A 1YJVA 4IQMA 1FRKA 4HLBA 3I4HX 1GNKA 2FVCA 1UKUA 4ZS6A 2HLTA 5E33A 5DGAA 1LWEB 3L9ZA 5LT5A 2Z4PA 3DI6B 2OPPA 3TZXA 3BYPA 1CC8A 1KWMA 2IRUA 1V5VA 3ENWA 1SXLA 1R27B 4KV8A 3UCGA 3HT3A 1M5HA 4YB6A 4NLQA 2C28A 4DV4J 1H2UX 2W9CA 5HBMA 4BS2A 2VC0A 1J2VA 3ZTOA 5E3QA 1WC1A 4AXIA 4ID5B 5DGBA 3MTJA 2FC8A 4AUKA 2BVZA 4P71A 3R7BB 1JXEA 2BM1A 3GIRA 3RB3A 2B0GA 4FYXB 2R2UA 3RW6A 2ZC4A 4C8LA 1B0TA 3H2UB 2CJAA 2GHWA 2R42A 3R5DA 1B64A 1F60B 4U6PA 2XCPA 4CLUA 2P9EA 1U45A 1LFPA 3UR0A 3UD4P 1ZM9A 4P73A 1HBMA 2J0WA 4F0MA 1NH8A 4KT0C 4EO8A 1R0BG 3RG6A 1TKDA 4RW6B 1S6QB 1C1BB 2Y0BB 4HTIA 1D8YA 1UZDA 2Z2YB 3HT0A 3M7VA 3CXCR 2XYGB 2GCFA 3KLFB 3LF0A 3KK2B 4ZP8A 1HYSB 2GO8A 2MKSA 3I0RB 3W9IA 3KK3A 3WHIA 2QA2A 2GS8A 2HHXA 2JWNA 4KAIA 1HW8A 3GFZA 3KLHA 1D3WA 3M2RA 4ECQA 3QATA 3W66A 1E6YA 4B3TF 4DPUA 5HROB 3MGJA 2VG5B 3VQSA 3KYLA 3A1YG 2G13A 2RB7A 5EWFA 3DLKA 1KQGB 3HHNB 3CDWA 5JJBA 2DISA 3Q2TC 1LW0B 1RAIB 3OR2A 5F3ZA 4IO1A 4LUBA 4ZVTB 1ZBTA 3MWBA 3RGIA 3HSJA 1VI7A 4ED3A 3GR1A 4I4BA 1VBYA 1D1UA 3QGGA 2R7WA 4NE9C 2F7VA 3NMAA 3AFGA 3U27A 4DR2F 5LOQA 2QYCA 1U7LA 4YY3J 2B6AA 3HPOA 1YRUA 3S7RA 3SYZA 2KRBA 2R8JA 4PKDB 5C7PA 1AB8A 3HFZB 3M8PA 5CCMA 4FN5A 1JWWA 2HMIB 1HNXF 1H2TZ 2AGOA 2ZJRQ 5A0YA 3ELHA 1G4CA 5C25B 4Y3CA 1TVRB 5I3PA 5D3GB 1WG5A 1UPPA 3I5AA 1B70B 3QNWB 2GGPB 2ILZA 2PN6A 4O3PA 4KPYA 2BQRA 3IA0A 4R0EA 3BM7A 4I56A 2LVWA 4MIAA 3OFFA 3MCSA 1RISA 4OHWA 4EFAC 2AU0A 3AD9C 4NXMJ 2JVOA 4DQPA 2EPIA 1GTEA 3UN5A 3TZYA 4N7TA 1NHUA 4FYYB 5KT2A 2G1HA 2EFOA 4C3KA 1SIZA 1FWPA 1M1KT 5KG4A 5CYQB 3OJUA 1LWCB 3SV4A 4PG5A 1IR1A 1UMJA 4FNIA 3WBZA 3OTDA 3UD3P 4B9NA 3PJ9A 1VHIA 1KVKA 5B09A 1YG0A 1HARA 1OSCA 3NBPB 3U1MA 2BZ2A 3MFHA 3HVTB 3LPEA 1QAIA 2FVQA 2BW7A 4YR0A 3M32B 1RAFB 3HFKA 4ES1A 3I82A 4JI1J 9RUBA 3AAWB 1DAXA 1FEHA 3LANA 2VHGA 2YQ0A 2LU2A 4NLSA 3G6YA 4FKYA 3PFOA 5IFMA 3CF5Q 3FRYA 3J7YU 4LREA 2D41A 2RUSA 3MCOA 1X4EA 1VQ7S 4IR9A 4CLLA 3ZO7A 4WKYA 2G2OA 1WG4A 4ZVFA 4M5NA 2Y1RI 2NXEA 3R1LA 4NRTA 2OGUA 3R2DJ 4X2BA 2XBPA 3Q83A 5DDPC 2IC3B 1ROFA 2D3OR 2HNYB 4ZOSA 5DDOC 2J76E 2OPSB 1V9OA 4JI0F 4KRWA 3SCKE 1YDLA 2OP5A 2JFKA 2PI4A 4U8YA 1BWEA 1PG5B 3RJMB 1P27B 2B4VA 2AX1A 2AEMA 4WJBA 1TMMA 1S1XA 1T94A 3CJ5A 2YX7A 4TXSA 1HBUA 1F5CA 5U47A 1WHWA 2H4WB 3UVJB 4FF3A 3GJRB 4O4GA 4DLEA 4U95A 4JI3F 2VODA 2FUG9 1F0XA 3BR9A 3D6FB 1IBKJ 2LMIA 3JSMB 4QR1A 2HRUA 2KM8C 2FHJD 2I0XA 2CA9A 1YBTA 1F9EB 3SBMA 3V6DB 1IR2A 2M8HA 4ITSA 1X4GA 3RR8A 4DS4A 2HHTA 5L1KA 2CQ0A 4M8LA 1Q16B 1UVKA 1RHUB 3LAKA 1FNXH 2LEBA 3PKYA 4PXBA 2RU3A 3FCVA 4GVLA 1RGVA 3MXHP 1Q8IA 1LWEA 5KFKA 3THVA 3ADAC 3DI6A 5ETSA 2H3EB 3G8QA 2NQPA 3ET6A 2VBXA 4EWTA 4OHXA 5LJ3Y 2XS5A 2E7WA 2HBRB 2I6WA 1I6JA 2ZNZA 4A8SA 4FS1A 5HATA 1VIXA 1L3VA 4NLRA 5KG1A 3DCAA 2IM3A 1UVJA 4LFAJ 2FLNA 3HKWA 1MROB 4ID5A 3MMJA 2HS3A 2YVSA 2XTJP 2MQQA 3KG4A 4B3MJ 4B9SA 1ZH5A 3LA0A 3M2UB 1CJVB 1S7IA 3WC2A 1YJNS 5HN0A 4RWXA 3EUNA 5IXUA 3EM1A 5KFIA 4HYKA 1YJWS 1KBRA 4NXNF 5K8OA 5D8HB 3MR6A 2YNIB 3MAAB 1KN6A 3ZZYA 1FRIA 3OL7A 4ALZA 3T1AA 2DCLA 5L1IA 4ZN3A 3ZNJ1 5KT3A 1RUSA 2C22A 2CPXA 4JYAJ 2COLA 4HI1A 2GO9A 1LWXA 4MYTA 4RW6A 3QJPA 1S6QA 5D0HA 1C1BA 1U26A 2WW4A 2HRTA 5IT9Y 5BXIA 5E3PA 1X60A 5GAHU 2E7XA 1IM6A 1S9EB 4K4WA 1M5SA 3C66A 1HD0A 3TAQA 4I0WA 3KLFA 5BYSA 5LM7E 1HHSA 1ZM4A 3KK2A 5T14A 5KFZA 2HFVA 2QYGA 4W98A 3UWTA 2FVPA 4QIGA 5KFNA 4ED2A 1V3RA 1HYSA 4C8NA 2RD5C 3AOCA 4JV2A 5FD1A 1JJ4A 2EC0A 3K7RA 2GA7A 2HFNA 4GKKJ 2J6TA 1JXLA 1WF1A 2V8VA 5HROA 4FS2A 1HWKA 3Q2SC 3PRDA 3R5CA 3FJ2A 5A6PA 4ZPDA 2VG5A 4G1PA 3DFEA 1TL1B 1NPPA 1IBMJ 4FXWA 3IGVA 2HHQA 5FLXU 4YEAA 3GV8B 1LW0A 4OI1A 5CQGA 2NPFA 2R3VA 1AYEA 3CNQP 3PYGA 3M1VB 7FD1A 1YRXA 3B4MA 2FJEB 3CIMA 4DUYF 2QMUB 3BDPA 4CNZA 3A8IA 1CULB 2PT0A 3BGFA 1RT2B 3VWSA 2PI5A 4C6AA 2LQ8A 2IAJB 2W2MP 5D78A 5J2QB 1N5SA 2A3JA 2D9OA 4N8OA 2R8KA 1FE4A 2MQNA 2XMWA 4ZVHA 3QWUA 3VR1A 4I6YA 1JLQB 4F0HA 1UFWA 2R8IA 2HMIA 4Q8EA 4CYUB 3I4PA 2MKIA 3TJ9A 2WHOA 1CS4B 4LF1A 1K8AT 2MZJA 2KZMA 4HHUA 5C25A 3W5YA 5D0EA 2V9KA 3PW0A 1TVRA 1RT6A 5D3GA 1T9WA 2FZGB 1X9SA 2GGPA 3QT7A 2DNGA 3B82A 3OTCA 4UF4A 3AD8C 1HNZJ 1SH2A 5KG2A 1MWZA 1IJEB 4ZMMA 1WSVA 5IV3A 1S0MA 4MIWA 3LP0B 3NCPA 2FJVA 3Q8SB 1VLYA 2HGMA 2JX2A 5CYQA 1KFDA 1T3NA 1XERA 2MXYA 1LWCA 1ZA2B 4DV0F 2KHDA 1NEEA 1RAEB 4OZ5A 3QT6A 1C1CB 2CQ3A 4ZCKA 4M5KA 3NBPA 1Z2LA 3HVTA 3JSRA 1HFEL 1IKVA 4W4MA 3M32A 3DRXA 4CT8A 1IKWB 2QO3A 1FFSB 1P9QC 1DTTB 2GW8A 3ILLA 4J90A 2F9DA 4K4ZA 1TV6B 3VCDA 1T02A 2B4PA 1AXQA 2AP6A 3N5FA 1DTQB 2Q3PA 2R4FA 3R27A 2P9GA 3EGWB 4ENOA 4OYXA 5HMWA 3HD2A 2XLIA 4F2RA 1U48A 3D0HE 1L3UA 1VFJA 5KT4A 3E8OA 3KUHA 2MY8A 4ES3A 1FRMA 4QIFA 1VQ5S 2AIRB 1KEKA 2IC3A 3Q8VA 4RUCA 4RBUA 2HNYA 4RNMA 2XSFA 2AJ2A 4DG1B 2OPSA 2ZBRA 4LF9F 3UE2A 2A0FB 3OTOF 3NGUA 3CCUS 3M9MB 2E1RA 5K8PA 4NA3A 4H54A 3EX7B 1RU1A 4TVAB 2VBYA 2E5GA 3SMZA 4CT9A 2ZZTA 1WORA 2UXCF 4DUZF 3OUYB 3HD1A 4G3IA 3MEGB 4LF4F 1U0SA 1HQ2A 3TQEA 4B3TJ 1GFWB 3UVJA 1LWFB 2VDIA 3JSMA 5L8RC 2DCUB 3MTKA 3OD2A 2DBBA 2DGTA 2Y3YA 1DFDA 2ZHBA 5ETTA 2HZAA 4N47A 4KO0B 3BKTA 2FHOB 4FVMA 4E2FB 4DL4A 4I2PB 3V6DA 3KG1A 4LRFA 4B9VA 4ED5A 2YBVA 4F3MA 4YB5A 1S12A 3MMAB 5K5MA 3ZTPA 4K4YA 3UCUP 4HR2A 4Y00A 1SC6A 3Q0AA 5CA5A 2NXUA 1U1PA 4ECZA 3VV2B 3ZZRA 3QAUA 3M2VB 1IQZA 1PJ6A 1QAYA 4DL7A 1WOSA 3HLUA 2ZZMA 1WI6A 2V50A 4V1Ak 2O3DA 3FGVA 3UN3A 1HNXJ 3UNYA 1N4LA 3CJQA 3M8SA 2ATCB 2CIMA 1NPKA 3VVUA 1NDPA 2DJWA 1O8BA 4NLDA 2RIJA 4UTGA 4OI6A 5E2QA 3OFEA 4WFAQ 5DDQC 3MPUB 1M90T 1Q8KA 3GYXB 3T5HA 3HJVA 3FVYA 1MROA 2ZWPA 1T9TA 2DR7A 4LSLB 4M94A 4GO5X 1FXDA 4DI6A 2F4FA 1YJ9S 1JMTA 1KVJA 4EU0A 5B0GA 3UCZP 3M2UA 1PKUA 2CQHA 1CJVA 1X9WA 5H9FK 3EMTA 4CRJA 2L08A 4C8YA 4F8RA 2BKOA 1UAWA 2QZ8A 4LF5F 1GMWD 1YKWA 4PQUB 1KP6A 3MUMP 2YNIA 3MAAA 2DRAA 2VFUA 2VOOA 3ETMA 2HG4A 5BYRA 4NZ7A 1RAHB 4UZCA 2EG2A 2E66A 4TYAA 2CPYA 1NB2A 1Y5LB 3H59A 2XQCA 3BSNA 1GX6A 3NP5A 3PVXA 1U1LA 1OQ6A 3CCMS 3KNAA 4YB7A 5KT7A 3SFUA 4B3RF 1YBAA 3DU5A 2J7UA 3NKYA 1BQNB 1RT3A 1S9EA 2XO6A 2WSEC 3BEGB 1Q81T 4LF7J 2BKNA 3OQ2A 4X62F 1WC0A 4L73A 3D1HA 1WHVA 2XNQA 2O1PA 4O23A 2WOMA 2Z2MA 2QA4G 3QRPA 1U8SA 2W2OP 5EX3A 4HDGA 5KFWA 3PR4A 4WU3A 3NGKA 4ZPTR 2XHCA 3W65A 4DV2F 2JC1A 1YTYA 2JH3A 5KFBA 4P9SA 1UVLA 3HCXA 4M5MA 3RAQA 1FVQA 4DR6F 2KL8A 3TAPA 2EEYA 1J5OB 4L75A 1S6PB 5KFLA 3NOGA 3M30B 2CNNB 2WW8A 2DNRA 4Y2MA 2AEJA 1TL1A 2VB6A 1S57A 5MAOA 2UU9F 1DJ0A 3MCMA 5KFFA 5JXSA 3QJJA 4DQIA 4JI0J 4OJ3A 3JTOA 4ZLJA 1YX2A 1XQIA 1MMLA 5ETMA 4MTPA 5CZVA 1BMQB 3M1VA 4FPIA 3H7HB 2VUGA 2E9RX 2HS4A 2DHXA 2MLYA 4P2XA 1S6UA 3KUEA 1CULA 4USUA 1R43A 3A4TA 2HIQA 4L74A 3KTQA 1RT2A 2HVEA 2IAJA 3OLBA 1Z4UA 5J2QA 4RO0A 3RW7A 1QVFR 5KFHA 3RB0A 4JI3J 2AJ4A 1FI4A 1JLQA 3F44A 4USVA 2J9DE 2QTWA 2KT5A 5KFJA 3G4SS 4CYUA 2HHPA 4ECTA 5HAOA 5HL7Q 1CS4A 4H4MB 3W3SA 4LRAA 2E7VA 2EKNA 2W25A 5CXTA 1RYRA 3E3XA 1WTFA 5J1EB 1FXRA 2V8PA 2DGVA 2QLBB 1HHQA 2VPYB 2KXNB 4CM2A 4DSKA 2E29A 1SJ3P 4TQRA 3CJKB 2POKA 4PRFA 2ZOGA 3MCNA 2XZWA 1NK6A 2NLWA 5GAHI 2BX6A 2XMKA 5THWA 2JL9A 3LP0A 2YX4A 3PYEA 2RMLA 4LT6A 4DSLA 1TU0B 3ZTSA 2KN4A 5IOLA 2OTJS 1KQFB 3I5CA 2DB1A 2ZUAA 3WIUA 3GTYX 4DXLA 3CCWA 1JX4A 1LXNA 1C1CA 4FYDA 3QT5A 4ZIWA 2E5IA 3UR3C 3JSYA 1YITS 3PV8A 1IKWA 3W9JA 1LV5A 4JI6F 4BWJA 1DTTA 1X7VA 2IY5B 4OYZA 1S99A 2Q6BA 2J0XA 2HGNA 4O3RA 4RZRA 1TV6A 4NXNJ 2RH3A 2DNKA 3V2UC 1XNQF 3P8BB 1DTQA 1R8BA 1KOHA 4NA2A 2KJWA 1F6TA 3A3OB 3BO4A 3TR5A 4OZ2A 4KC5A 2XB2D 4O44B 1S97A 3PW2A 4EO6A 5IZHA 3I9ZA 2VA2A 2VV5A 2OO4A 1UWAA 2X51A 2ZOMA 3VTIA 4ED8A 2OFGX 2H5JB 1IBCB 1U2FA 4RNNA 1GQEA 3PM9A 4MKVA 2FHJA 2FLLA 3K58A 1U1OA 5KFGA 4E0DA 1U6BA 1A0OB 3CDEA 2E5JA 1UJ4A 3UDLA 4DG1A 4G1QB 3C46A 3IWNC 3OFHA 4KR0B 2JEIA 2AGQA 4KHMA 4C0OC 2F8EX 2B8QA 4J9OA 1QLNA 2PD1A 1U0HB 3ZFVA 1RTIB 4IG0B 4DX8H 1MMDA 4TU7A 4HDHA 1FK9B 1FF2A 1GK8A 4K59A 2FIUA 4RX6A 3WX4A 3OUYA 1LOUA 3MEGA 2BXJA 4USIA 4HT7A 1DRZA 2YY3A 4P52A 1TKZB 2CPZA 2I2YA 5KAKA 1X4FA 1OO0B 2L48A 2AYBA 4JI5J 1LWFA 2ZD1B 3EPGA 2XY7A 4K4XA 3TA0A 4KFBB 2XLJA 5KT6A 1HR0F 5E5NA 4ZVUB 3TOQA 5J2PB 4KE5A 1FKOB 3BYRA 4KO0A 1SCJB 4I2PA 3IM9A 2DIVA 4CO2A 3G87A 3D3BJ 5I3QA 2XSJB 4EBCA 1XR6A 3MMAA 4TU8A 2VL1A 5E41A 5H1SV 2OD4A 1I3OB 1KC8T 4DUYJ 2HQDA 2Y1LB 3MR5A 2RQ4A 4PG6A 2LCWA 1Y10A 2DO0A 5IV4A 1WD6A 4UQTA 3Q24A 1PAEX 3TO8A 3M2VA 2IRXA 1SJQA 2VBWA 3DLBA 1VQOS 4K5RA 3ONQA 5LSLA 4ZP9A 3H90A 4M63A 3FSIA 4X65J 4IH5A 2B5JA 1YWXA 1X4AA 3CT9A 3AH6A 2B51A 4WPAA 5F0WA 4HVZA 2R7SA 4DR4F 3O1LA 1G1XA 2X3DA 2Z2ZA 5LXYA 4CM0A 7AT1B 4LSLA 2AHOB 5KT5A 2E9ZA 2N4CA 2WZ1A 1YZ6A 1NO8A 2C2KB 4OI0A 3MEDB 4WFYA 5CD4H 3I87A 5B0BA 2VQEF 5IT0A 5HQMA 4O3NA 1RHMB 2DR9A 4K0KJ 5K14B 4IOCQ 3P5BP 3KLEB 3TI0A 4I64A 1RBOB 2FQQB 4DV0J 2DGOA 4WCEQ 4KGVB 3L7OA 4M5GA 1PJ7A 4Q2LA 4XPCA 2AV5A 3TWZA 4CLYA 4H4OB 4JI2F 1U8WA 3PDNA 4IYQA 4DSEA 2GQ2A 1BQNA 4HEA9 2CVEA 4ZLLA 2RHSB 5IS2A 1FESA 3OL6A 2F8MA 4ELUA 3KHHA 3TJ8A 4DS5A 4K50A 2G2ZA 1FXLA 4ZN1A 3CJ4A 3TARA 3EZOA 3KUGA 3SV3A 3K0JA 4P7VA 3QRRA 2CQ1A 4F4WA 4F3QA 3CDAA 4CQ1A 2B7CB 4NL5A 3R5BA 3W1YC 2KU7A 1DARA 5HVFA 1FD2A 1J5OA 3KK1B 3DLEB 2DXDA 3M30A 1EQMA 2OLWA 3FNNA 4I67A 1YJTA 2FYXA 2RRBA 1NHKL 1KONA 4IH7A 2NXNA 2KT2A 3FBFA 4LF9J 3EVWA 3OTOJ 1XBWA 4V19J 4C97A 1HNWF 1R8HA 4BCAA 2GIQA 1Y5NB 2RQMA 3IGNA 4E8UA 4Q43A 2MQ8A 3SXLA 4OL8A 3U02A 1Y4ZB 2X3GA 5KFTA 2UXCJ 5GAGU 2F5GA 4LF4J 1EZZB 4ZDNA 4NA1A 1FRHA 3HHEA 3O5TB 2AGPA 1IJFB 3EXYA 3QMQA 1FERA 2BMBA 4ES2A 4DV5F 3MM7B 1VQ9S 4NYOA 2RF2B 1Q8BA 2HVZA 2N3LA 1Q53A 3M9NB 4H4MA 2ZFHA 3KLVA 4DR1J 4OLOA 3IC1A 2Z57B 1KVIA 3DM2A 2DR6A 3CSKA 3GR0A 2XZTB 1TP7A 2ZE2B 4CZCA 4MIBA 1X5PA 2DEJA 2RU9A 2B9XA 2AWZA 4C7QA 5C42B 3SFGA 1B7FA 4C0BA 3CJKA 1WSRA 3PZPA 3QO9B 1YI2S 3TUPA 1DQAA 4USTA 1S0NA 1V3ZA 3EVOA 1UWBB 5DZ6A 5B0AA 2LA4A 4U7UD 3EGVA 3DLJA 5DS7A 4PABA 1TK5A 2V6AA 3BQ0A 1NKCA 2HHVA 4ZLNA 2CQBA 2I8EA 2A10A 3MPDA 2J0SD 1ELOA 3CW2C 4P6QA 3Q22A 2XY5A 4OJ1A 2C2RA 1TKTB 2GJFA 3R97A 5ADZA 3PY8A 2ZJQQ 3GJSB 4KSEB 2ZEJA 2VFSA 1OPIA 2CDQA 3IWLA 2CFXA 1P1LA 2CPHA 3OSNA 3I9V9 5J2MB 3KJNB 5AXMA 2RT3A 3IXQA 2HFUA 4LF5J 1Y7PA 1XC9A 3FSXA 2V94A 2DO4A 2V69A 2YKNB 2DNLA 1TMJA 1X8DA 4HH1A 4F2SA 1SJFA 4G1IA 3LALA 3CO0P 4O44A 1ZA1B 2QG9B 1D8ZA 2EC2A 5ETPA 4NCBA 2MLZA 1OY8A 3R5JB 1ITPA 3PYDA 5A8WB 4Y2CA 3N79A 1K44A 4ZCIA 1S77D 4BDPA 3JQJA 4B3RJ 3GWCA 1S9GB 1N33J 2WVBA 2QL7B 5KFOA 2CRLA 4L3KA 2NCKL 4X66F 3FFIB 4O4RA 3QYYA 1QSYA 4K7QA 4CLFA 3D6MB 1U0HA 3UN2A 1RTIA 4IG0A 2KYZA 1U49A 4YR2A 1FK9A 1C0TB 5F8JA 1WG1A 1YRTA 2HWHA 3MECB 2VA3A 1IWAA 3ENVA 1TKZA 2NZ4A 3A8KA 4DR6J 1NDCA 1NBEB 2LDIA 3RRHA 2Q79A 2MGZB 1VC5A 3DXSX 2H54B 2ZD1A 2K1RB 4KFBA 1EARA 2X1AA 4QOTA 1XTZA 2UU9J 1T8EA 1AUDA 4Z2XA 1FKOA 3X1LB 2DNQA 3IR6B 2PE8A 4A8KA 3AD7C 1GMUA 2HEKA 2F9JA 3NAHA 2WTFA 3IS9B 2CQPA 2PDAA 2HWTA 2XSJA 4NXMF 1R31A 5KFMA 4RW7B 1VR6A 2A2DA 2RDIA 1SKWA 1JJCB 4OYIA 3LP1B 2R7RA 3B8HA 2PMZD 4KKOB 1GMWA 1BQMB 4UOHA 4DZDA 3O2IA 4J9LA 1WC3A 3MR3A 1YLXA 2V68A 2B4UA 4MFBB 4K4TA 3PHEA 4I6AA 3KHRA 4J9RA 2ZNYA 2GQQA 2XWXA 3ITHB 1VRQC 4AT1B 4QJVA 4X4PA 2DIUA 2EI5A 1CJKB 5LMNJ 3QWPA 4CO1A 1T9YA 3DOLB 2Q66A 1WKKA 4XPEA 2Y1IA 3UFCX 3MEDA 2VJUA 4FP9A 3CJRA 1K47A 2WB1D 4ED0A 3D68A 2V0NA 4LQ3A 4EGLA 3KLEA 3EGNA 3X3UA 2GC8A 2KHCA 1OWXA 3NGTA 2BANB 1YQHA 4YDDB 4RW8B 3W64A 4F25A 3BBCA 4H4OA 2KTQA 3NNAA 1SQEA 4CLSA 2IJRA 3D2WA 5EGYA 1CJTB 1QJHA 2BW2A 2CPIA 4WP9A 1FX2A 4KPCA 2F40A 4JI6J 2Z56B 4YMEA 4LIRA 2G0CA 2UVRA 2J6UA 3M8QB 5B08A 5B0FA 1S0VA 3IMQJ 3ISZA 1XNQJ 4DJBA 2VASA 3N6MA 2OEJA 1RA7A 1H7WA 2RRNA 2CDRB 1HL6A 3CCTA 5ETKA 3SQGB 3G96A 1JJ2R 2J9EA 4PG8A 3K8VA 1PILA 4Q2MA 3KK1A 3GYGA 3DLEA 2ZH6A 3IRXB 3RBXA 5DLGA 4I68A 2YKPA 2QV6A 1N54B 2KKHA 2R7TA 3HSGA 2W2QP 2J6SA 2BBEA 4NOHA 1S1VB 1W2BR 3CC7S 1RTDB 4F4ZA 2DY9A 2GNKA 1ZTWA 4PPZA 1VRUB 1VBZA 1RP5A 1SB6A 3MM8A 1PAUB 1MG7A 5F8LA 1ICEB 3OHAA 2B6AB 1FDBA 4OYPA 4IO9Q 2OEMA 2VG6B 3TQ1A 3UO0A 4OZLA 2D1CA 3IBCB 3M8PB 1ZAWA 2M8DB 4C98A 2ZUGA 1X4CA 2QX0A 3L7UA 4TY8B 5E3RA 5FLXY 2ZKUA 2BM0A 4LSNB 2J5AA 2YPZA 3R3TA 3MM7A 2RF2A 2GQCA 2BKPA 4TLRA 2FZKB 3NCQA 1VLOA 2OUGA 3GIKA 1SH0A 5L9NA 1XEZA 3OXLA 4ELVA 3UDCA 2AD9A 2DH8A 2XNRA 4B3MF 3M8YA 2ZE2A 2LXIA 3WX8A 4I69A 5L46A 4F4AA 5C42A 2IHR1 4KY3A 4U7CA 3CPWR 1ZPVA 1ULRA 4LR9A 3C15B 4DPXA 3D6TB 3G86A 3QO9A 3DYAB 1LKZA 1C0UB 4DU7A 4Z7YA 3TAMB 1UWBA 5M2UA 1RT5B 1VBXA 2BQUA 3N0VA 1KFSA 3QLHB 2JSXA 1VHFA 2DRDA 1BLUA 2HGLA 3NGRA 5KFSA 2BDPA 3BSAA 4USHA 3AJDA 5HK4A 2K2PA 2CADA 4M95A 1TKTA 3CULA 4DR4J 3EE3A 2Y8WA 2B9EA 1NJIT 3K57A 3IFEA 2ACYA 1JB0C 2H1YA 3AQOA 3DKDA 1ZTTA 2ZJPQ 3KLGB 2A18A 3A8EA 2QA4S 2ASJA 5J2MA 1NSAA 2LXUA 3K8WA 1RWKB 3NLCA 3ZZUA 4PG4A 3BPDA 3BJYA 2R2TA 3BB5A 1CSJA 1KDNA 2UV8A 5T7LB 1LXJA 1AZSB 3HULA 2FJDB 4DFPA 3PO5A 4JV0A 3VAHA 4IQXA 5A8WA 3OHBA 3BKUA 2ZDOA 3EICA 3BH7B 2MZRA 3KMQA 1S9GA 1IKXB 1D9DA 5KFPA 4J37A 5L1LA 2UP1A 3BN7A 3FFIA 1NDLA 1QE1A 3AOAA 4ED6A 4NRUA 3BPSP 2DPIA 3D4JA 1NAQA 2HRYA 1CEZA 1F3VA 3FCHA 1AFIA 1S1WB 4U7UK 4IG3B 2GV1A 2YWGA 1C0TA 3GZ7A 4H4KC 3C14B 1FKPB 2VF3A 3MECA 4OLPA 3KHGA 1SL0A 3VGTA 1Q86T 1N5YB 3S1TA 1LQ9A 3LGNA 4RU2A 2HHSA 2WVEA 2MGZA 3PYFA 1KD1T 3LW5C 4H4KA 4OMFG 4AFFA 1CJUB 1ZPWX 1HWJA 2ZHOA 4A8YA 3CDUA 3GJQB 3H5YA 1RWUA 1YGYA 1HNWJ 1SI9A 2XGPA 4OHVA 2QFIA 3GIMA 3I96A 4CWBA 2ALZA 2IA0A 4RW7A 3AB4B 3CGIA 3ETOA 1KNZA 4IFYB 5HLFB 3IN5A 3BS9A 5KFDA 2V2VA 3LP1A 3HZGA 3ET6B 1N6QB 1K1SA 5CD4A 2FJXA 2GJ2A 4AE5A 2BJ8A 3SSSA 4KKOA 3L09A 2ZBPA 2M52A 3V4MA 4LFBJ 2V4JB 1YIJS 1BQMA 3AOBA 4NZ6A 3BR8A 4YS2A 5DQGA 4DV5J 1RLDA 4PYDA 4MFBA 5HVGA 2BE9B 2ACMA 3D5MA 4ETXA 1G3OA 3OJSA 4LSZB 4CH1A 1DQ8A 2QMWA 2O67A 3ITHA 1O0PA 2Z0GA 4URQU 2BJ9A 4RBVA 1CJKA 6AT1B 1VK3A 3PX0A 4C48A 2GHVC 2OHDA 3DOLA 2IFXA 3LH2S 3DRPB 5CYMB 1NMEB 5DDRC 2E1PA 3TP2A 3H5XA 1M5VC 4WE1B 2Z58B 1EKSA 4OYOA 4XDDA 1ZYQA 4AQYF 2KFYA 3DRRB 1QDUB 1FTCA 4EYHB 3D0IE 2BANA 1HNVB 3NY0A 4RW8A 5FIIA 2FD2A 2FB0A 1WF0A 5KG0A 3UQSA 3KJFB 3MF5A 4KHPJ 1CJTA 1U24A 4B9MA 1U2CA 1NPRA 2IVFB 2DHHA 3TVKA 2LQ5A 4J9SA 3GLJA 1AUSL 1VQLS 3NWRA 4OX7A 3M8QA 4OYWA 3M6WA 2LFVA 1JIHA 1BGXT 4FXVA 1IBLF 2A2CA 2EK6A 8AT1B 1FJCA 1FWLA 2MPUA 4B3SF 3EWGA 4WK3A 3SQGA 2C3MA 2MYFA 3RBZA 4KGXB 1WHYA 2XULA 1Y11A 2FGCA 2ZKTA 1SC1B 2XS2A 1S49A 1K1QA 3IRXA 2EFGA 3RAMA 1S1VA 4ZVEA 3JS9A 1RTDA 4C8ZA 3PACA 4WYLA 4X66J 1AT1B 2DYAA 2R2SA 1BWVA 2MSSA 1NSQA 4DCPB 1N56A 1VRUA 5A8RB 3WIVA 3HKZD 2FDNA 3QIDA 2V8GA 3DDIA 2VG6A 1FT8A 7FDRA 3N6LA 1C2PA 2CVIA 2DGUA 3DHXA 4DSFA 5RUBA 5HMZA 2IIHA 2R2RA 2C3UA 2Y1JA 4TY8A 1Q5YA 1FWKA 4X4RA 4I6WA 3T5LA 3QBCA 3MMCB 4LSNA 2CPDA 2HVDA 1RT6B 4X4NA 1NSKL 2L9NA 3DC2A 4ANCA 3MHYA 1EX8A 1RYSA 5A6WA 1TAQA 5CABA 4IDKB 5L9XA 2LQJA 5AXKA 2UUBF 4ANDA 4AXJA 4ZVOB 3NS5A 2FJWA 4DN0A 4FF2A 1UCNA 4WTYA 3AXKA 3UNGC 2G4BA 1SQGA 1TL7B 2K8GA 3C15A 3CMQA 2UXBF 3SCIE 4CCHA 5F8IA 2HVHA 4OV1A 3DYAA 3ZZTA 1C0UA 2BEFA 2DTJA 3VAJA 1XMBA 6FD1A 3DGPB 4MH8A 3FBEA 3TAMA 2FVSA 2KFZA 1RT5A 2BUNA 1HW9A 4Q45A 3QLHA 1GTHA 1ACMB 4URSA 3PJXA 2AF6A 3BDEA 1IKVB 4C4WA 2V4RA 1U25A 3D28A 4LF7F 1QSLA 1WC4A 2NSBA 2WVFA 1NK0A 1HWLA 3DOMB 4MJKA 1HBNB 3VAMA 1TR0A 2VPWB 3JB9k 4C11B 4OX9J 1NKEA 3HVAA 1WDTA 3KLGA 4CH7A 3BGRB 1BHNA 4PG7A 3R7SB 4NCAA 4A8MP 5F8GA 4RUHA 2RQKA 3BO2A 4E98A 4ED4A 1WDDA 5T7LA 4A8OA 1E6VB 1TQLA 2XY6A 1AZSA 1HKAA 1FO1A 1XMQF 4UT4A 2CZVC 4JV1A 4LVOP 3C6TB 3BGOP 1RT4B 1RZMA 1IKXA 2OEKA 2XZDB 1GX5A 4IRCA 5CAAA 5KOXA 4MK7A 2XEXA 1JLCB 2U2FA 4K4UA 3B78A 3GILA 2CWXA 5K20B 1P8GA 3UDEA 2HHHF 1SPBP 4ID8A 2D3ZA 1PC5A 1UA1A 1S1WA 4IG3A 3JTNA 1OJ4A 3DOKB 1N5TA 1R0CB 3C14A 2RRAA 1FKPA 5KOWA 1RTJB 1SKSA 3GSDA 5H9EK 2C42A 1N5YA 2OFHX 2XI2A 3DN9A 1FTRA 3JYTA 1K73T 3T1HJ 4CO3A 1B4SA 2XI3A 1JQGA 4OI3A 4Y34A 1CJUA 2ZH3A 2VQFJ 3DRYA 2RNEA 8ATCB 1RAJA 1NRKA 1UEKA 3I5BA 3MPVA 1BY9A 1U1KA 3BGUA 2MQPA 5B0DA 2CPJA 2AJFE 4PXDA 1VRTB 5CYJA 1X31C 4YHHJ 3BSOA 3QIPB 4M5HA 4WZQA 5GMEA 3H4BA 4OZ0A 4OV6A 1N5VA 4ZKAA 4IFYA 4F4YA 2OH2A 5HLFA 2VPXB 4BC9A 4RBTA 2MZSA 1IWGA 4RW9A 2KJVA 4UW2A 1N6QA 2A1BA 2M9KA 1Y5IB 2UUTA 5DLFA 2QSFA 2HSEB 2BOPA 4PWDB 5AJ3F 5HVHA 2FGOA 1KR4A 3BN4A 2V4JA 2GIFA 3L95X 5KG5A 1GEHA 1YJUA 1UTAA 3W9HA 2ROGA 4IOAQ 3QGHA 3NMRA 4KJIA 3GFHA 2P8IA 2MQLA 5ETVA 3I0SB 1R6VA 4J9QA 1IXKA 4DLGA 2PSZA 3ZZ0A 2LA6A 4O3OA 1P1TA 3P49B 4YQWA 4IOBA 1EAYC 2AW0A 1X0FA 3BQ2A 2W9AA 4GVBB 1VJQA 2E1AA 5I4MA 4LF6F 3DRPA 4Y2KA 5CYMA 5ETNA 2YH0A 4EYIB 4ZHRB 2GX8A 4BLGA 3MAQA 1CLFA 1R8CA 2YWKA 4WE1A 1ZZNA 4LR7A 2VU5A 4DFJA 1VQMS 3DRRA 4JI8F 5I42B 2ZDPA 1RT3B 4MMOA 4ELTA 1HNVA 2XO7A 3EXCX 1S4FA 1X9MA 3SZ2A 4MKAA 5KFQA 3HX9A 2WOMB 2K7KA 4A47A 4M5DB 1FRLA 2VC1A 5CZXA 3FC9A 2PC6A 3NNCA 2N4DA 2UUCF 1NK8A 4FKXA 4DF8A 1Q8LA 3FEZA 3DNCA 3HF5A 2Y8YA 1CQMA 3ZC4A 3CUNA 5DM6Q 3N5BA 4USJC 4ZPVR 1PCAA 4X4UA 3GU0A 1RAOA 3D3CJ 2BE2B 2DPJA 1Y0HA 5D4LA 3G8SA 4JI5F 2FY1A 2HFZA 5H9FJ 3UI3A 2MKJA 2JFDA 2FHMA 4O0IA 1M5PC 3ENAA 3NAIA 2OMOA 3H40A 1X5OA 2QEXS 1TFYA 3GIJA 2IYGA 3H25A 1REVB 2IDEA 4ZLPA 3W2VB 5SZTA 2JLFA 4HACB 2J0QD 2B3TB 3IO1A 2YNFB 5D4PA 2O01C 2YH1A 3CD5A 3J80U 3P5TL 3C6UB 1KQSR 4FDFA 1QM9A 5EHHA 4NYPA 3W7BA 4DV1F 3CD7A 5A8RA 2MDAA 2XC9A 4A48A 2JOQA 4K2JA 2HK3A 3NCRA 5HJYA 2PA3A 4X4OA 2HIYA 1OMSA 3AA8A 3IAS9 2BJEA 4EEYA 5IC4B 1S6OA 3I55S 4X65F 3ILIA 2RILA 3J7Z5 3DXBA 3ICLA 2EKYA 4RLEA 3N4WA 4N56A 4RNFA 2WB4A 2VONA 2E1CA 2RQCA 2WVDA 3MMCA 5DJBA 4KH0B 3RB6A 1KLMB 2W8LA 3W2WB 5LL6d 1SC4B 2QLFB 3R5GA 1VISA 3U1LA 3EVMA 2IVMA 1HQEB 5HMYA 4ZPWR 4P75A 4IDKA 2EXUA 3CMES 2XHWA 1RBAA 2JRSA 2YWHA 1RHRB 4NLVA 4KBIA 2KH9A 1D09B 2ZH7A 2CQGA 1SL2A 4U9RA 4K0KF 2CJBA 1TL7A 3ZZZA 4ER8A 4PQAA 1S9FA 4M1KA 4WXOA 2AX0A 3DGPA 1XMOF 2RJZA 3FQLA 3RBDA 5LSOA 3IR5B 2MJUA 2OKQA 4WWSA 2BA9A 2EG1A 1F9FA 2M5YA 1RDRA 4ZA1A 1RBLA 1TL3B 5A76A 4OZJA 3BO3A 3H98A 3DOMA 4UOFA 2RS2A 1HBNA 5IWAF 3LWLA 4GC6A 3TZZA 5AE1A 4D3GA 3HI9A 2VPZB 1PC4A 4NX9A 2E5HA 4C11A 3G71S 3BV8A 3W63A 4DQRA 1SKUB 1CC7A 4EZ6A 1WTBA 2WAQD 3A3NB 3BGRA 3DHWC 3Q8RB 5BR8F 2ASLA 2R7UA 4PAAA 1EB0A 4DQSA 1NU4A 1VYAA 2AJ0A 1QD1A 2QRRA 1UEVA 1S79A 3M6XA 2XMTA 2BRKA 1UP1A 1NLKL 1Y9OA 4AQYJ 4ICLB 4QYZK 3PIPQ 1E6VA 1S10A 3OL9A 4ECXA 3GFYA 2V63A 4J9VA 3C6TA 2XMVA 4F3OA 4NLUA 4ECSA 3BF4A 1RT4A 4NCGB 2X1GA 3W61A 1JNRB 2HWIA 3OXGA 5KFCA 4DZ6A 2H48B 2WONB 1RK8A 3GG0A 2KVIA 1HMVB 2ROPA 4NEZA 4ANEA 1JLCA 2UXDF 3OVAA 3PRVA 2QLJB 3KNGA 4J9KA 2NS1B 3HK2A 2B8PA 1H74A 1IBLJ 1UVNA 1OY6A 3PW7A 2QJ3A 3CJ2A 3EYZA 2MJNA 4OI4A 3QQCD 1TK0A 3BZQA 1HWIA 2ERRA 2PMWA 2PFDA 3DOKA 3HHKA 1GXTA 4B3SJ 2R7VA 1RTJA 2DGXA 2SXLA 2YWFA 2LLZA 3QT8A 1UW4A 3EDRB 2V2ZA 1RADB 4DR1F 3PRBA 3K59A 3MM5B 3GCWP 2LEPA 3LOUA 1S4EA 1RACB 1RWVB 1VC6A 4DFKA 2VD3A 5ETRA 1OIAA 2MLXA 3MURP 2JDJA 3BH6B 4ZCMA 2KG0A 2HNZB 2B56A 1PYSB 1Q78A 2HURA 4HH0A 4NLWA 1O6XA 2DK2A 4FXDA 2KXHA 1VRTA 5JVGQ 5ETLA 4KB7A 5EX0A 3PTWA 1A9NB 1AROP 3QIPA 2OPQB 5C2CA 3T9NA 5AXNA 2LECA 2V67A 3Q86A 1NH7A 4NLOA 3M4XA 2RKIB 1UJ6A 4DPTA 2B5JB 2B9YA 4JB8B 4A46A 4PWDA 1H6KX 3J7ZT 2BJ7A 5DRKA 4BHQA 1IKYA 2R9LA 8RUCA 4FBTA 2HHWA 3I0SA 1J5EF 2Q43A 3WZ0A 4CO4A 1PYOB 3HMJG 2GVDB 1A7GE 4NWBA 3M8RA 2P6TA 2UUBJ 3GIIA 2DGWA 1I1GA 4YR3A 1WEXA 2HPUA 4R25A 3HFVA 4GVBA 2JHEA 4KIAA 1RHQB 1QY7A 1TL5A 3NEKA 4ZP7A 4USKA 3VHQA 2UXBJ 3PJWA 2VH7A 2CNKB 2DNMA 4ZHRA 1OPZA 4F7VA 3CDBA 2DHGA 3GV5B 5B0CA 1SH3A 4OHZA 1YK9A 2EFPA 5DQIA 2ZZNA 1MN7A 5EWGA 5B7WA 1YJ7A 5I42A 1RT1B 4ILMA 1U6ZA 1N33F 2YKAA 5KFEA 1ZAXA 3LO3A 1TZ0A 1FDAA 4DDFA 5KFAA 2ZH5A 4Z7CA 2MB0B 1UL3A 3ULHA 1WKLA 1VQNS 2FJAB 3RAXA 3VVTA 4M5DA 2YPYA 4Y2AA 3SEOA 4LVNP 4WKRA 4J9NA 4MYUA 4LBHA 5E3AA 3S8SA 3BGLA 5EDWA 3NG8A 3GV7B 5DG8A 2EBGA 1FNOA 3EZ5A 4PZVA 3T19A 3T1YJ 2BE2A 4QWAA 1QVGR 5HMXA 3G82B 5T41A 2I38A 1T9VA 5MLCV 4UOCA 2AZ3A 4ZVQB 1EP4A 4FYWB 1XMQJ 1AFJA 2GHPA 3MD3A 4N8NA 5ETQA 2NYIA 1REVA 1HQUA 1ZETA 3W2VA 1HD1A 4HACA 3PX4A 1RXOB 2YNFA 3TNVA 4N5SA 2OSQA 4R0JA 3BBBA 3R6LB 1QUPA 3GQCA 3H5UA 3P45B 2DT9A 3C6UA 3PO4A 3IBWA 1KLNA 2HHHJ 2PEBA 2MHEA 4LRCA 1XIQA 1Z1ZA 4PXEA 1WWHA 3DRSB 4KGMA 4DV6F 2MQMA 3EPIA 5DM7Q 2E1MC 3LP2B 4B17A 3OL8A 1VQPS 4P74A 1KRPA 3DM2B 3KKFA 2CJKA 3UW1A 2DD8S 1GH8A 1KLMA 4XK8C 4ZITA 3KDNA 3M6VA 3W2WA 4QWCA 1V3SA 5LMNF 3T5KA 2QE5A 4DL3A 4ECUA 4ZCLA 1S1TB 1HQEA 1YSJA 4NMLA 3QFWA 4WFNQ 2Z2LA 4Y65A 4CLPA 4ERDA 3CMAS 1UZHA 3D9BA 1FJEB 1WNEA 2CZ4A 1T05B 3D0GE 4ZJLA 3L4BC 3KFWX 3Q8UA 3NOCA 1MU2B 1AA1B 2XG8A 1VGYA 1GAOA 5GAEU 5AJ3J 2YTCA 1OSDA 4QIWD 4Q44A 1XR7A 3C2PA 3J81U 3D6HB 4C9DA 2DXFA 5FJ4A 5KG6A 4JV5F 2MMYA 1H98A 3GYNA 4CNYA 2FZCB 1FJGJ 2KI2A 2ALYB 1TL3A 4R8UB 3V4IB 3N6NA 4QQBA 2OPRB 3FQKA 2L3MA 4F0KA 3PEHA 1H3DA 4W92B 2XWYA 3V6HA 4LF6J 2NYHA 4DV7F 5AT1B 3PXGa 5GADU 2GMJA 1R8AA 3ZNUA 1LFWA 4ILRA 1RHKB 2VZ9A 3IG1B 2CPFA 1RWXB 4J5OA 4DUTA 1G6BA 4OZ3A 4ICLA 3L3CA 3VF0B 3QGIA 4JI8J 5DO2A 3HVWA 4FYVB 4ECWA 2CG4A 3K89A 3F73A 3A3PB 3T9ZA 3R6GB 1X5TA 4U67Q 2W7AA 2IM1A 3TANA 4HTJA 2OELA 2HQFA 4LF8J 4NCGA 3SQOP 1F2GA 1UFLA 5L39A 4CO5A 2W24A 4N77A 4KH1B 4WYWA 4TN2A 1W25A 1NJXA 5FDLB 2UUCJ 4JOUA 3TJAA 1R89A 2WONA 5LJ5Y 1HMVA 4P10A 1NCLA 4DU8A 4ED1A 4FBUA 5D0RA 3K5LA 3RB4A 3QZ7A 1SBRA 3HSDA 4JI7F 4R5PB 1HHTP 3TX0A 4I7FB 2H9ZA 2K3KA 3GMGA 3H4DA 2C1EB 3K2YA 4TLQA 3CCES 4WIIA 4DPOA 4L3NA 3OPKA 3FUYA 3OTBA 3C16B 1MWQA 3MM5A 3BQ1A 1LEOA 3WQPA 1P6TA 5AE3A 5I3UB 3ZZPA 2W9BB 4LFCF 4K5SA 2HNZA 2NXJA 1UW9A 4JUZA 1F5BA 2ZHAA 2J7WA 3MR2A 1U47A 4DV1J 1EHWA 4OJGA 1W7WA 5SUHA 1N88A 2OPQA 4AYBD 3NS6A 4KYZA 2DH9A 2K7JA 3HO1A 1TAUA 2RKIA 3ILOA 2WRMA 1BC6A 2HYIB 2EK1A 1B0PA 2BJ1A 3W60A 2OMLA 1L3KA 3D1QA 4Y0FA 3RTVA 2KVQE 2CNOB 4IR1A 2NREA 1U1RA 4IKAA 1OYEA 2G0IA 4IUFA 1RT7B 3D67A 2W4DA 2MQOA 2AYMA 1DQ9A 3ZZOA 3TYTA 3IM8A 2GVDA 1VQ8S 1N34F 2GZOA 2AYGA 3BSCA 4RR5A 4DR3F 1QAJA 4PXCA 1YBUA 2GMLA 1T3OA 3JAMU 2XM3A 4QYRA 2CG8A 2C2OB 2QL5B 2RS8A 1FA0A 3EGZA 2R8GA 3IBFB 1N48A 4JI4F 2DGQA 2W2NP 1ZOTA 2R7QA 3OW2R 2CPEA 4TU9A 3C19A 5D77A 1MMNA 1XMOJ 2PO4A 3MD1A 3C8YA 4OFZA 1H73A 4QWEA 2GVZB 4M5IA 2LEAA 1VQ4S 5J1PA 1X0PA 5KG7A 5HQLA 1RT1A 4DL0C 3I0RA 3K5MA 2DHSA 4QR0A 3I32A 2XMAA 4UZBA 4OI2A 1S7HA 5CH7B 1RA6A 1BUXA 2F1FA 2I1RA 5G0RB 3W62A 1L3TA 1RTHB 5IWAJ 4MAKA 2QFJA 3JXOA 1H2VZ 3GFXA 1JLFB 1W2IA 5A2QU 2GAGC 1RWWB 1DURA 4J7CA 4CH0S 3MM6B 3RU0A 5BR8J 1O5JA 2JEFA 1O51A 2W8KA 4ZP6A 1ZM2A 4WXWA 2MKYA 5IQQA 1A6LA 2DKOB 4MT1A 1EJ7L 3OT9A 3G82A 4DL2A 1VOMA 1SC3B 5L38A 4Y6IA 3MR7A 4KHRA 3FEXB 3CCVS 2DY1A 1XN9A 2VG7B 2IBOA 3G2XA 2HZCA 2Z8QA 4RNOA 4U96A 2ZVSA 3MM8B 2WSCC 2RAQA 1M0SA 4O3SA 1SIWB
chains in the Genus database with same CATH topology
4URGA 2FDNA 3PKMA 3QIDA 2V8GA 1FEEA 2UUWA 4EUVA 1XK8A 2IAJA 3OLBA 3TRGA 4DV3F 2LDYA 1Z4UA 4OIXA 4FVCA 4Y2IA 4DFMA 5J2QA 2VG6A 1FT8A 3RW7A 2C2EA 1QVFR 1NKBA 7FDRA 5KFHA 4WZMA 3N6LA 3RB0A 1C2PA 5A0YB 5L1JA 2CVIA 4PWUA 2IA6A 2DGUA 3DHXA 3OTEA 1S76D 1KHVA 2KYXA 2AJ4A 1JLBB 5J1NA 4DSFA 1U1QA 1JLQA 2C3YA 3F44A 5HMZA 2ASDA 2J9DE 3FRZA 2R2RA 2KT5A 2FC9A 2C3UA 5KFJA 3G4SS 2JLGA 2Y1JA 4LFBF 4TY8A 1JLAA 2HHPA 2QT7A 3LPYA 4ECTA 3ISNC 2IBKA 5HL7Q 5F8HA 4X4RA 2F3JA 4I6WA 1YJRA 4Q7AA 4H4MB 3W3SA 3T5LA 5EWEA 1D9AA 4AL6A 1Q4RA 4LFAF 4NZ0A 4YP3A 1FHTA 3MMCB 4LSNA 3MOZA 4ZPAA 2ROEA 2W25A 2CPDA 3JSBA 5KFVA 1RT6B 1MW7A 3DRSA 1U1MA 4A8FA 4FF1A 4X4NA 3CCJS 2JZ5A 2L9NA 3CCLS 2IJFA 2J9CA 5CXTA 1RYRA 3DC2A 3E3XA 1SJ1A 1WTFA 2EFQA 3MHYA 3TA1A 5J1EB 2IYIA 3LP2A 3S6EA 1RYSA 5A6WA 1FXRA 1NJZA 1SJ4P 1TAQA 2DGVA 2YQ3A 1VC0A 2VPYB 2OTLS 3N9UC 4ZPCA 2KXNB 4XAKA 3D1OA 2NUHA 3OBIA 4IDKB 5L9XA 2LQJA 4DSKA 3L7PA 4TY9A 2E29A 5AXKA 2AQ4A 2UUBF 1UA0A 1SJ3P 1SKRA 5F41A 3CJKB 4TQRA 2POKA 4AXJA 3FEYB 2LYVA 2J7KA 4IFVB 3HP6A 2ZM6F 1Y3KA 3NS5A 2ASYA 5F9LA 2FJWA 4PRFA 2ZOGA 1CG2A 1S1TA 2XZWA 1UVIA 4DN0A 3B4DA 1NK6A 4FF2A 4WTYA 2NLWA 3DLHA 5GAHI 1MWYA 3UNGC 2BJDA 2XMKA 1FE0A 2G4BA 2G9OA 5THWA 5I3UA 2JL9A 3LP0A 2YX4A 1RKIA 2K8GA 2BR0A 3HZEA 1R7IA 3TVZA 2UXBF 3AQPA 3SCIE 5BYQA 4CCHA 2KRRA 5F8IA 2HVHA 4OV1A 3DYAA 2RMLA 4CTAA 3US5A 4LT6A 4JYAF 3ZZTA 1T05A 3MPYA 4DSLA 1C0UA 2YKQA 2DTJA 3THTA 2BYCA 3VAJA 1XMBA 2XS7A 6FD1A 4MH8A 3LQVA 3TAMA 4A8XA 2KN4A 2IMOA 1U1NA 2OTJS 2YKOA 2FVSA 2KFZA 1MU2A 1RT5A 2MZTA 1X4HA 2BUNA 1KQFB 3I5CA 1HW9A 2GMHA 4Q45A 3T3FA 2DB1A 5JUMA 3QLHA 1PO6A 3CCWA 5C5JA 1JX4A 1GTHA 1C1CA 1LXNA 4URSA 4J9PA 1K0VA 2Q6CA 1N8RT 3PJXA 1V6HA 2AF6A 3BDEA 1IKVB 3UPFA 4FYDA 4C4WA 2V4RA 3NRBA 1GT8A 4WFBQ 1T95A 2E5IA 1U25A 2IJNA 3D28A 3JSYA 4QR2A 3UR3C 3AJ1A 2V5HG 3VZHA 4QWDA 1QSLA 2ZBIA 4DMZA 2UVWA 1YITS 4WFZA 1R8PA 5K8MA 3PV8A 1XR5A 2NSBA 2YNHB 1IKWA 1NK0A 1HWLA 4XDCA 3OVBA 4MJKA 3HHDA 1LV5A 1HBNB 2HQ3A 2LQ9A 4JI6F 4BWJA 3HM9A 1DTTA 4KHPF 1X7VA 3OFGA 4ECYA 1KS2A 1LK5A 1WF2A 2U1AA 3VAMA 1S99A 2X1BA 4C3MA 3Q23A 3AA9A 1TR0A 2Q6BA 2J0XA 2HGNA 1SJRA 2VPWB 3JB9k 4O3RA 2MZQA 4C11B 4RZRA 1TV6A 3OSPA 5AXLA 3CCRS 1NKEA 4R8UA 3HVAA 2MY7A 3KLGA 1JLEB 2M3DA 3V4IA 2RH3A 4CH7A 2BQ3A 3BGRB 4GKKF 3V5RA 2DNKA 3V2UC 1XNQF 2OPRA 2W7OA 1DTQA 3DMJB 1R8BA 4PG7A 4NCAA 1KOHA 2YKNA 4NA2A 4A8MP 2KJWA 5F8GA 1CVJA 3KLIB 4KQZA 4DN9A 4KTQA 4RUHA 3BO4A 3TR5A 2RQKA 5F8MA 4B3OA 4KC5A 5KFXA 1CQNA 4ED7A 2XB2D 4O44B 3QJLA 2QIFA 1NB7A 1U2RA 1F5AA 2XCAA 1S97A 3BO2A 4E98A 4DBQA 3PW2A 4EO6A 5IZHA 2XGQA 2PFFB 3I9ZA 2VA2A 2VV5A 2OO4A 1IBMF 2ZH9A 2ZITA 4UY85 2X51A 5T7LA 2ZOMA 3VAFA 2RSQA 3VTIA 4ED8A 2OFGX 1IUJA 3RR7A 1NNDA 4A8OA 1E6VB 2XMJA 3IG1A 4QPTA 1TQLA 2XY6A 1U2FA 3EZUA 4KGKA 4RNNA 1GQEA 3H2LA 4OJHA 3PM9A 5KFYA 1FO1A 3POTB 5GAGI 3M6UA 1XMQF 2FHJA 2FLLA 3K58A 2EBEA 2M4MA 1U1OA 1X4DA 2GFFA 2CZVC 1KSPA 4JV1A 2VKZG 5KFGA 4E0DA 1U6BA 4LVOP 3C6TB 5C24A 3I6PA 3CDEA 2E5JA 3JTPA 2ZOFA 3VALA 1UJ4A 4HKQA 5HO4A 3UDLA 1RT4B 4DG1A 2ATLA 4G1QB 4BWMA 3C46A 3IWNC 3OFHA 3KG0A 4KR0B 1UETA 1IKXA 3H2VE 1RQ0A 3G6ES 2AGQA 2JEIA 5AE2A 4KHMA 1S1XB 4C0OC 1GX5A 2ZH2A 4IRCA 2F8EX 2KG1A 3IR7B 4IH6A 3V81A 3DU6A 1M5OC 4J9OA 1QLNA 1DZ5A 4DHVA 1HBUB 1QE1B 5KOXA 2PD1A 2DH7A 4MK7A 3ZFVA 1RTIB 2XEXA 4IG0B 4DX8H 1JLCB 1MMDA 2GIRA 2U2FA 3B78A 4TU7A 4K4UA 4HDHA 1FK9B 4O4GB 1FF2A 3GILA 4K59A 2FIUA 4RX6A 4C8MA 3WX4A 3OUYA 4UUWA 1LOUA 1Y3JA 3MEGA 1P8GA 5ITHA 2BXJA 5FDLA 4USIA 4DL6A 2HHHF 2R7OA 4HT7A 1DRZA 2YY3A 4ID8A 3OR1A 3KWMA 2D3ZA 1PC5A 1TKZB 1UA1A 3MDFA 1S1WA 2CPZA 2V8HA 2I2YA 5KAKA 1X4FA 1OO0B 4K4SA 4IG3A 1QTMA 3JTNA 1HWUA 2L48A 3PW4A 3TUJC 2AYBA 2EFNA 3CJ0A 3OVSA 3DOKB 1LWFA 4ZK7M 3H5SA 1N5TA 2RRAA 2ZD1B 1MSWD 3IAM9 1FKPA 5KOWA 3EPGA 2XY7A 4K4XA 3P96A 4LIWA 1RTJB 4KFBB 3TA0A 2XLJA 2UUAF 4LMZA 1SKSA 3GSDA 5KT6A 4EBEA 1UJ5A 1HR0F 2C42A 5E5NA 4DF4A 1N5YA 2LU1A 3TOQA 2ILYA 2K1RA 2PA8D 5E7OB 4B08A 2IMWP 2AYEA 2OFHX 4R5PA 2XI2A 4NLGA 3DN9A 1FTRA 4I7FA 2ZH8A 5J2PB 3JYTA 1K73T 4KE5A 2KM8B 4I2QB 4CO3A 1FKOB 3CCSS 2XI3A 4KO0A 4I2PA 5D4NA 2ADCA 2DIVA 1HNZF 1K9MT 3M9OB 2AJ1A 3MUVP 1OS5A 1Q1KA 4FF4A 4OI3A 4CO2A 4Y34A 2ZH3A 1X5SA 2V4QA 2J9DA 1FRJA 5F0UA 3DRYA 3QPIA 5I3QA 3CTRA 2RNEA 2XSJB 4EBCA 2CKWA 2F8HA 3OXFA 1XR6A 1RAJA 1NRKA 3IS9A 3MMAA 4TU8A 3I5BA 3MPVA 1YJVA 2VL1A 5E41A 2OD4A 5H1SV 1KC8T 4IQMA 1FRKA 4HLBA 3I4HX 1BY9A 1U1KA 3BGUA 1GNKA 2MQPA 3MR5A 2FVCA 1UKUA 5B0DA 4ZS6A 1KHWA 1XWLA 2AJFE 2CPJA 2HLTA 1VRTB 2RQ4A 4PG6A 4PXDA 5E33A 1LWEB 2LCWA 2W9BA 5DGAA 2DO0A 5CHCB 5CYJA 2CJQA 1WD6A 4UQTA 4CO0A 5GAEI 3Q24A 3BSOA 4NLTA 3QIPB 2L41A 3TO8A 3M2VA 5LT5A 4WZQA 3H4BA 2Z4PA 3DI6B 4OZ0A 2OPPA 2IRXA 1CC8A 1SJQA 3PNIA 2IM0A 2VBWA 3DLBA 1N5VA 3N01A 2VFTA 4ZKAA 2IRUA 2XMUA 4IFYA 1VQOS 4F4YA 2OH2A 3ENWA 1SXLA 5HLFA 3T6JA 2VPXB 4BC9A 4K5RA 4RBTA 2MZSA 3ONQA 5LSLA 1R27B 3J7YI 4ZP9A 4KV8A 2DRBA 4RW9A 1IR0A 3UCGA 2KJVA 2CYYA 4UW2A 4M63A 1N6QA 4GKJF 3HT3A 2A1BA 2M9KA 1M5HA 1Y5IB 2UUTA 4YB6A 3FSIA 2QSFA 5DLFA 4NLQA 2BOPA 2YKMB 4PWDB 5AJ3F 4IH5A 2C28A 1H2UX 2FGOA 2B5JA 4GO7X 1KR4A 1YWXA 5HBMA 3BN4A 4C3LA 5LSRA 2VC0A 2W9CA 1J2VA 1X4AA 2V4JA 4BS2A 3L95X 4L6V3 5E3QA 5KG5A 1NJYA 3CT9A 3AH6A 2B51A 4AXIA 1YJUA 5F0WA 4ID5B 5DGBA 2V2KA 4HVZA 2ROGA 1N36F 4IOAQ 2R7SA 3MTJA 2FC8A 3QGHA 1NJWA 5A8RB 4HHJA 3NMRA 4AUKA 4KJIA 3GFHA 2D7SA 2MQLA 4DR4F 2BVZA 3I0SB 3O1LA 2DNZA 1JXEA 1G1XA 2BM1A 3LUYA 4J9QA 1IXKA 3RB3A 4X4TA 2B0GA 4DLGA 2PSZA 5LXYA 2R2UA 3RW6A 2ZC4A 3ZZ0A 2LA6A 4O3OA 3DLLQ 1RT7A 5GADI 2JJ4D 4C8LA 1P1TA 4LSLA 3P49B 4YQWA 3HXMA 5KT5A 4IOBA 2E9ZA 2N4CA 1B0TA 4HI2A 3H2UB 2CJAA 2GHWA 1NO8A 2AW0A 1X0FA 3BQ2A 3MEDB 4WFYA 4OI0A 3R5DA 2W9AA 2HNDB 5CD4H 1B64A 3I87A 1F60B 4CI0B 4U6PA 5B0BA 2VQEF 4PUOB 2P5VA 2XCPA 5IT0A 2E1AA 4OX9F 2P9EA 3DLGB 1U45A 4O3NA 1LFPA 3UR0A 3UD4P 3FMBA 1Q7LB 3FMWA 1ZM9A 5I4MA 2DR9A 4LF6F 3DRPA 2D9PA 1HBMA 4Y2KA 5CYMA 3TA2A 3QZ8A 2J0WA 5K14B 4IOCQ 2YH0A 1NH8A 4KT0C 3CCQS 2JVRA 4EYIB 5KFUA 4ZHRB 4EO8A 2GX8A 3KLEB 1TKDA 4RW6B 3MAQA 3TI0A 1S6QB 4I64A 1C1BB 1CLFA 1R8CA 3IRWP 2UVUA 4HTIA 2L9WA 2DGOA 1URNA 1D8YA 4WCEQ 2YWKA 3P3DA 4WE1A 3L7OA 4Q2LA 3CXCR 4XPCA 1ZZNA 2GCFA 2AV5A 2I5JB 3G6XA 4DFJA 1VQMS 3KLFB 3DRRA 4JI8F 4H4OB 5I42B 4QU7A 4JI2F 2ZDPA 3PDNA 1RT3B 4XIUA 4IYQA 4DSEA 4MMOA 2GQ2A 3LF0A 3KK2B 4ELTA 1HNVA 1BQNA 2RUGA 4HEA9 2CVEA 4ZP8A 2XO7A 5IS2A 1HYSB 2GO8A 1FESA 2MKSA 3EXCX 1S4FA 1X9MA 3SZ2A 4MKAA 3I0RB 3OL6A 5KFQA 2F8MA 3HX9A 2WOMB 3KK3A 2QA2A 4ELUA 3KHHA 3CJ3A 2K7KA 4A47A 4DS5A 4K50A 2HHXA 2JWNA 4KAIA 4M5DB 2MZ1A 1FRLA 2VC1A 3T5JA 5CZXA 1HW8A 2PC6A 3GFZA 3NNCA 2N4DA 1FXLA 3KLHA 2UUCF 3CJ4A 1NK8A 1D3WA 5G0RA 4DF8A 1GXLA 1Q8LA 3M2RA 3TARA 3FEZA 4ECQA 3DNCA 3HF5A 1RTHA 4DOZA 3SV3A 1CQMA 1E6YA 3NGDA 1WEZA 2HAIA 4B3TF 3K0JA 3ZC4A 4Q8FA 2H5EA 3CUNA 4XO0A 4P7VA 5DM6Q 4DWIA 2CQ1A 5HROB 3N5BA 4USJC 4ZPVR 4K2XA 3MGJA 4F4WA 4X4UA 1JLFA 4F3QA 3CDAA 2VG5B 4CQ1A 3VQSA 4ZPBA 2B7CB 4NL5A 3KYLA 2BE2B 3A1YG 3R5BA 1Y0HA 5D4LA 2DPJA 4A8WA 3MM6A 3G8SA 2G13A 2KU7A 2RB7A 4JI5F 5EWFA 3DLKA 1KQGB 2FY1A 2HFZA 3HHNB 2IM2A 1C4AA 1LW2B 1DARA 3CDWA 5H9FJ 5JJBA 2YX1A 4QZVB 3UI3A 1FD2A 1J5OA 2MKJA 4UY8T 2DISA 2JFDA 2XMMA 2FHMA 3KK1B 3Q2TC 1LW0B 3DLEB 5K8NA 4O0IA 3M30A 1M5PC 3J7A1 3OR2A 2OLWA 3FNNA 3CC2S 4I67A 1YJTA 3NAIA 2OMOA 5F3ZA 2RRBA 3H40A 2FPHX 4IO1A 3T1HF 1X5OA 4LUBA 2QEXS 1KONA 1TFYA 3GIJA 1BQXA 4IH7A 2IYGA 3H25A 1ZBTA 3MWBA 2KT2A 3PR5B 1VI7A 1REVB 3NNHA 4ED3A 4ZLPA 3GR1A 4I4BA 1VBYA 1XBWA 3W2VB 5SZTA 1D1UA 4JBCA 4V19J 3QGGA 4C97A 2VQFF 1R8HA 1HNWF 2JLFA 2R7WA 2VG7A 2J0QD 3SSQA 2F7VA 3NMAA 4BCAA 3AB2B 2B3TB 3MI7X 2GIQA 3U27A 3IO1A 1Y5NB 2YNFB 4DR2F 2RQMA 3IGNA 5D4PA 4E8UA 1VQKS 2QYCA 2O01C 2YH1A 4Q43A 3SXLA 4OL8A 1U7LA 3CD5A 3U02A 1Y4ZB 2X3GA 2B6AA 5KFTA 3P5TL 3C6UB 5GAGU 1KQSR 1QM9A 5EHHA 1HBOB 4YHHF 3HPOA 4NYPA 3W7BA 1YRUA 3S7RA 4DV1F 3SYZA 3E51A 3CD7A 5A8RA 2KRBA 2R8JA 4ZDNA 4NA1A 4PKDB 2MDAA 3M8PA 1KOOA 4NLYA 5CCMA