2GVDA

Complex of gs- with the catalytic domains of mammalian adenylyl cyclase: complex with tnp-atp and mn
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
190
structure length
190
Chain Sequence
b'DMMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVEMGMDMIEAISLVREMTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGKAGRIHITKATLSYLNGDYEVEPGCGGERNAYLKEHSIETFLIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Adenylate cyclase type 5
publication title Broad specificity of Mammalian adenylyl cyclase for interaction with 2',3'-substituted purine- and pyrimidine nucleotide inhibitors.
pubmed doi rcsb
source organism Canis lupus familiaris
molecule tags Lyase
total genus 48
structure length 190
sequence length 190
ec nomenclature ec 4.6.1.1: Adenylate cyclase.
pdb deposition date 2006-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1230 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleotide cyclase 2gvdA00
4OYBA 4CLPA 1Y11A 2WZ1A 3C14B 2W01A 1Y10A 4NI2B 1CJUB 3ET6A 4OYIA 1CJKA 1WC6A 1U0HA 4P2MA 1CJVA 2GVDB 3MR7A 4OYWA 3ET6B 4CLTA 1CJKB 5IV4A 3G82B 1U0HB 1CJVB 1WC4A 4OYPA 1TL7B 2GVZA 3C15A 4CLSA 3C16A 1AZSA 4CLYA 4WP8A 4OYXA 4WPAA 4USWA 4OYAA 1CJTA 1CULA 5IV3A 4CLFA 4P2XA 1AZSB 1CS4A 1FX2A 1WC5A 4WP9A 3UVJA 1FX4A 4USTA 4OZ2A 4USUA 5D0HA 3C14A 5D0GA 4CM2A 4WP3A 4CM0A 4OYMA 3R5GA 4CLLA 1WC0A 1WC3A 1YBTA 1YK9A 5D0RA 4NI2A 4CLKA 1CJUA 2GVZB 4USVA 3C15B 5D15A 1AB8A 2GVDA 4CLUA 2BW7A 3MAAA 3C16B 5D0EA 4CLWA 4OYZA 2QV6A 4OZ3A 4OYOA 3G82A 4P2FA 1CJTB 1CULB 1YBUA 1TL7A 1WC1A 3MAAB 4CLZA 1CS4B 3UVJB
chains in the Genus database with same CATH superfamily
5F8IA 4WF9Q 3CPWR 2DVIA 3C46A 3FRZA 4M5DB 2ZH2A 3UCZP 3ET6A 3C8YA 2UXCJ 4RKUC 1XR5A 4M5GA 4LF1A 1WKKA 3GFXA 5HAOA 1FK9B 2AIRB 2C2DA 3CF5Q 3CJ3A 1UFWA 2RDIA 1ROFA 4ECUA 2AD9A 5DZ7A 4WP8A 4RO0A 2AEFA 3ONQA 3DYAB 3CIZA 1HHTP 1QAJA 3HVRA 1W26A 3A13A 1CS4A 2EBGA 2VG6A 1KQKA 2RDDA 4DZDA 2ASYA 4WU3A 3PYEA 3H5YA 3CCJS 2HRTA 2A2CA 4F2SA 4NXMJ 2DGVA 4DPYA 3G2XA 4QIWD 1RJJA 4JV2A 4CCHA 2B6AA 1T3NA 2GQQA 1IKWA 4F36A 2PI5A 1U2RA 4RW7A 4PYDA 4KO0B 4FNIA 4LF7F 4CLZA 1M5KC 5CABA 1HFEL 3IXQA 4DJBA 1HWJA 1J5EF 3PZPA 1SQGA 2DITA 4JYAF 5IT0A 3UDVA 4A46A 1NJYA 4EU0A 1HYSA 4USIA 1CVJA 3UR0A 1RTJA 1UEVA 2ZH3A 4URGA 2VF3A 2OPPA 3TUIC 1HWLA 2YKNA 4CNZA 4W4MA 3SIPB 3MTJA 1V3SA 5KFVA 4H4OA 1IM6A 4LFAJ 4OZ2A 3GB0A 2AYEA 3AD7C 5JMNA 4GO7X 3WBZA 3NAHA 4PCQA 3OUYB 3R1LA 3D68A 5J2MA 4X4OA 1M1HA 3T9NA 3GIIA 5A2QY 2UUCJ 2CRLA 5ETMA 3AD8C 1WKJA 3IA0A 4NMXA 4IDKA 3DM2A 4IFYA 5LSOA 2AGQA 2UV8G 2ZJPQ 3A8IA 2XZTB 2W7PA 1N5VA 4D3GA 1VRTA 3A3NB 3SV4A 1JB0C 1XR6A 3DGPA 1CJVB 3T6JA 5KFSA 4MJKA 2WVEA 5G0RA 2KH9A 4BDPA 4B9LA 2L3MA 1NJZA 1B0TA 2MKCA 1S48A 3J7AN 2LVWA 1RYRA 4JV0A 1C0TA 1Y3JA 1HI8A 2E1PA 1YX2A 4B17A 2FQQB 3SQGB 2UXDF 2HQ3A 4LR9A 1IXKA 3CIMA 4KKOA 4OLOA 3HVTB 1PCAA 4K50A 1NSPA 4X4QA 2ZD1B 4TXSA 2PMHA 3KK3B 5HP1B 3J7YU 4CO3A 4LF6F 2CQ3A 5GVQA 4I7FA 4Y6IA 1RKIA 1U4BA 2CPIA 2NPFA 2KYXA 5I42A 1SC1B 3KMSA 3JTPA 5KFPA 2AP6A 1IBLF 3MWBA 4KT0C 3L09A 4FBUA 1L3TA 1HNIA 2HG4A 4CO1A 1C1CA 4Z2XA 2MZ1A 4E0DA 3G86A 2DCUB 4OJGA 5C7PA 4DLGA 2B8PA 3OXGA 2V50A 3OFEA 4RW4A 2FLNA 4ZVFA 1TELA 2YKMB 2V2KA 8ATCB 4ZJLA 3QMQA 4QR0A 4I1TA 1RHUB 2JWNA 2OGUA 2CJAA 3KK1A 4N56A 1FX4A 4NXNJ 2DXEA 2HMIB 5AXKA 3POTB 4ZIWA 2CQ1A 1HNVA 3V81B 4RW6B 4WZQA 4P73A 4GMKA 2VICA 4AXJA 2LCWA 3D1HA 4QJVA 3QRPA 1IQZA 2CJQA 5DS7A 1S1TB 3H20A 4WFXA 2RUSA 3BZQA 4S0MA 1Q4RA 1RACB 2RRBA 1EP4A 5L46A 2B4PA 3MMJA 4C2MA 3R5DA 1OJ4A 2YNFA 4Y2CA 1S6PA 2H51B 1HBMB 2D74B 2RD5C 2MTLA 2FHJA 2Y1IA 2RKIB 2B9XA 4DV7F 2FVQA 3NGUA 1ZS6A 4UY85 4ZVGA 4UOCA 3EICA 2U1AA 3L9ZA 4J9SA 4ZHRB 1WEYA 3N4WA 3N01A 2ALYB 3B4MA 2XLKA 1XNRF 2MLZA 2IDLA 1HNXF 3BGRB 1J5EJ 2ZOMA 4JOUA 1APSA 3LP0A 2JOQA 2IC3B 2KXNB 2XS7A 4C8KA 2W9CA 5EWFA 3RB6A 4IOCQ 2ZHAA 2DH7A 4YR2A 4DL4A 1ZA2B 3UPFA 1S6QA 1N34F 2RB7A 1K1QA 2IPOB 4X65J 3ICLA 2HLUA 4CDIA 2FTRA 2CQ4A 1BY9A 2OPSB 1PJ6A 1FWLA 5FLXY 1SJQA 2C3PA 3BH7B 4P2MA 1XWLA 3KXDA 2B0GA 2F9DA 2DCLA 3W66A 3MAQA 1QSSA 1DTQB 3ILLA 5LJ5Y 1ZETA 1MROA 5F3ZA 1RABB 4TLQA 2B43A 1I94J 2YQ3A 1IR1A 3GJTB 4ZPTR 2DGXA 4ZCLA 4WFAQ 2UUAJ 2A2DA 2OKQA 3JQJA 3QIPB 1Q82T 1YTYA 4X66J 2DH9A 3R2DJ 2D69A 2FHJD 2V9KA 4ATNA 3B8HA 4RW8A 5KFEA 2HHTA 5IOLA 5ETQA 1VIOA 4WTYA 4DF4A 2ZKUA 4UUXA 1K44A 3H2LA 4FKXA 3SFGA 1Q8BA 3CUNA 1HR0F 1QUVA 4C48A 1TZ0A 3T1HJ 2QX0A 2MJUA 3KYLA 4PG8A 3D4JA 4ZP8A 2DH8A 3VCDA 1D09B 4GC7A 5GAGI 4K8RA 3JSMA 4JI2F 2OEKA 2YWHA 2XGQA 2V2ZA 1M0SA 3A4TA 3FVYA 1N32J 4WU2A 3IBCB 2GA7A 1CG2A 1KEKA 4DL7A 4DV2F 2ZBRA 3Q86A 1S1WB 3A8KA 1CLFA 1RWMB 3I4PA 1N54B 1NSQA 1ZPWX 5F8NA 3HD2A 5D77A 2QL5B 1YSJA 4QU7A 4FYDA 1NUEA 3GIKA 1V3ZA 2J6UA 1AROP 2V4RA 3DI6A 2J76E 4DUTA 5IM0A 2SXLA 4L72B 2DXDA 3PJ9A 1N33F 1QTMA 5B0BA 5KT4A 2QMWA 3MECA 2XMTA 3VGUA 3LPEA 1F5CA 1S1XA 2RJZA 1WOOA 4JI8F 1UZHA 5BYRA 2L9WA 4PKDB 3OVBA 1KWMA 3P49B 5HVHA 3VAHA 1AA1B 2XMWA 4DV5F 3R9LA 2DHSA 3L3CA 2QLJB 1S7IA 1CS4B 1EKRA 2VG6B 4K4ZA 4OYBA 2J7UA 4OLPA 3ZZOA 3RR7A 1Q1KA 4DFJA 3NGKA 1FKOA 5LMNJ 3IN5A 4BC7A 2GCFA 2G1DA 3TYTA 5GAHU 3CJKA 1PC4A 4JI6F 1IKWB 5CCLA 2OPQA 3MM5B 5J2NB 1NK7A 4UOGA 4RW7B 3JTOA 4DQQA 4CLSA 2JLGA 2U2FA 4BHQA 3TAMA 3PYFA 3GPAA 4UZCA 4B3RF 2HNYA 3M8PA 2VBWA 3RRHA 5F9LA 2DO0A 4CQ1A 1RTJB 2PIIA 4DV7J 1RTHA 2I0XA 2RUGA 5D6GA 2VL1A 1RCXB 1B99A 3OL9A 3CMAS 1U1LA 4ELVA 3T1YF 1MNEA 2JC0A 2C1EB 4PUOA 2RNEA 2ASDA 2B3TB 3DLBA 4K4SA 3M2UA 5F41A 2BW2A 2E5LF 1OY9A 3PR4A 3MCMA 5CH7B 3Q23A 1XJWB 4ED0A 4HH1A 4MK8A 3K58A 3NNHA 2DNZA 3NCRA 1TL1B 2IVYA 2LEBA 2JH3A 1N34J 2DRDA 2QMUB 3P45B 1JX4A 4Q43A 1U09A 4UW2A 1D9FA 4WXWA 4Y2IA 3KUHA 2XULA 4CO2A 3DM2B 3C6UB 2O3DA 3TVYA 2JLEA 3H4BA 5HROB 1I6JA 4DR3F 2QFIA 1KFDA 4U6PA 4P2SA 5BYSA 1UFLA 2ZBIA 3NOGA 3AT1B 2CG4A 4ZVPB 5AT1B 3LTOA 4ZN1A 3MR6A 4ZIVA 1FERA 4CP5A 3CJTA 1AXQA 3P96A 4AQYJ 4DCOB 2XSJA 3DRPA 4HHJA 1WG4A 1RAGB 1C0TB 5BXIA 2IRXA 4EYHB 3OJUA 1TL7A 4DX5A 2NZCA 3PW7A 2W4CA 3AB4B 1DZ5A 3NRBA 5HN0A 4KKOB 1Z1ZA 2E5HA 4AUKA 2APOA 4DLEA 4I2QA 5C25B 3SQOP 2VFUA 3OXLA 2BQRA 2KTQA 2HK2A 2HWIA 4BC9A 4I7FB 2CQ0A 4GVBA 4MT1A 4G1IA 5F8HA 4ID5A 5I42B 1U0HB 3UR3C 3OVSA 2AJFE 1SC4B 2WW4A 2DR9A 1K9MT 5KFDA 2ACYA 1HR0J 4OQJA 3MM9A 1DTTA 3AY0A 4NZ6A 2CQCA 1CEZA 2K7JA 1VC0A 1HNIB 1NM2A 1C1CB 3HF5A 2GO9A 4WP9A 3OHAA 3M1VB 3SXLA 5KG7A 2IY5B 2VBZA 3FFIA 4DR2J 1F60B 3R5GA 1MU2A 1Q81T 1XK8A 4J9MA 2BM1A 1H73A 5ITHA 4DV2J 2OHDA 2EEYA 3CMQA 1XNQJ 3ZTPA 2N7CA 2FC8A 3IM9A 4DQIA 3R6LB 5HJYA 1JNZB 2KKHA 2EW9A 1ICEB 4L76A 5ETLA 4PWDA 3DRYA 3KK1B 3I96A 1HW8A 2CQDA 3D0GE 1U45A 2EFNA 2N3LA 2W01A 3NAIA 2GNKA 3H59A 2DNMA 5ETOA 5K20B 1QJHA 1ZOTA 4PWWA 4EZ9A 2J8AA 4O4GA 3K17A 1T9YA 4KGKA 1SVDA 4J7CA 3J7Z5 2MQLA 4DUYF 4L74A 1VQ7S 4TU7A 2QG9B 2QRRA 3VVUA 4UTGA 4ZVUB 5EDWA 4OHVA 4PEOA 1LOUA 3F44A 1U0SA 1HQ2A 3ZNUA 5DGBA 3UNGC 1VQ6S 1LFPA 3MM6A 3LANA 4RLEA 4OYXA 2YNFB 2WSEC 1S6PB 2DEJA 4IH5A 4NA1A 3K5PA 5AXMA 2M2BA 1HBUA 1RA6A 1N36F 5KG0A 1J27A 2L48A 4LR8A 4RX6A 2EVZA 1R31A 4NOHA 1HNWF 3MD1A 1PG5B 4G1PA 4MIWA 2AZ3A 2FPHX 1B7FA 5CYMA 5D15A 2CG8A 4FPRA 2KFZA 3CC4S 5D0EA 3EGZA 3FC9A 2ZUGA 1SL0A 1O51A 3PG9A 4KV8A 2EBEA 1FJCA 5LL6d 3GQCA 2ATCB 3ILIA 4B3RJ 5G4DA 4H54A 2GHVC 1X0FA 1T9TA 4DSEA 3B4DA 1WELA 2W9CB 4LIWA 3WIVA 4LF9F 2HFNA 1KRPA 5DG9A 5DM6Q 5F0UA 4K4WA 3Q2SC 2PA8D 3HP6A 1S6QB 3A12A 1FJGF 4YN3B 3HHLA 2KDOA 3HKWA 5GMDA 2PMZD 2XNQA 2BZ2A 1F9FA 4Q5VA 2UP1A 3W2VA 4HR2A 3VGVA 2W2NP 4FYVB 2YQ0A 1V6HA 2UZAA 1AUDA 2E5LJ 2KU7A 2E7VA 1TL5A 3PRBA 5J1EB 1N0VC 3KHLA 3TUPA 1SV5B 3ULHA 1V3RA 4KJIA 3JS9A 4F7VA 3RB3A 2B8QA 2V4QA 3V5RA 1T3OA 4I2PA 3QJLA 3PW5A 3RBZA 1RHRB 2BVZA 4NLOA 1NCLA 2LMIA 4IUFA 1PIEA 4TN2A 1ZM3A 4OMFG 1JXVA 1TVRB 4MK7A 1SJ3P 3K8WA 1N5TA 2CNLB 4RW8B 1F9EB 4DV6J 4EO8A 2XO7A 5JXSA 4ES1A 3EDQB 5L1JA 2AEJA 2BE2B 1KSPA 3S7RA 1EJ7L 1EQ0A 4LF5F 1XEZA 3TUZC 3HJVA 4QU6A 2CPFA 4FVCA 1B0PA 2GS8A 2QFJA 2D3O1 4JI5F 3RB0A 1S1VB 1KQGB 3GG1A 5M2UA 3CWJA 3D6MB 1ZAVA 3JSMB 5KFTA 3H40A 1C4CA 4NPOA 8AT1B 3UN5A 2MKYA 1VBXA 4DR5F 4MYUA 2MZJA 2H3EB 4IG0B 4QR1A 3B6BA 2ZKTA 1G3OA 2KFNA 1XN9A 1DFDA 1S9GA 2IAJA 3FCHA 2V68A 3DNCA 3OR2B 2HIQA 4OX9J 1FO1A 5IM0B 2YWEA 3KKFA 4NYZA 3QFHA 2MZQA 3SSRA 3FSYA 4U8VA 3HKZD 3EXYA 3SCJE 3BBBA 1GK8A 3DRRA 2M52A 3BKUA 2HQGA 1NNDA 2KM8B 4OI4A 1LWEB 2V63A 4YFUA 3KLIB 4F4XA 1SH3A 1MWZA 1NJWA 3DFEA 3IR6B 2XC9A 1S1XB 1EETA 3LW5C 3RB4A 4AD6A 3GIJA 5B0CA 4RW9A 4LREA 3KK2A 4NLUA 5JVGQ 2J9DE 4O0NA 2OSRA 3M7VA 3N5FA 3NWRA 3GLJA 3OTOJ 3TRGA 2DGQA 2H9ZA 1RKJA 1NPPA 4AFFA 1J2VA 2ZBPA 4PG4A 3O44A 1YRTA 1QY7A 5D0HA 3IG1A 3CJKB 3K8VA 3QZ8A 3HZEA 3OFHA 2OPQB 3G6ES 3MPUB 1MLAA 2NUHA 5DG7A 2BOPA 4DUYJ 3ZZPA 2BW7A 2UVVA 3CCUS 3FMBA 4F3QA 5A76A 1U26A 4HEA9 3BQ0A 4JBCA 2JL9A 1UL3A 3ZO7A 3ENQA 2HNYB 3M8PB 3ZTQA 2F1FA 2W8LA 1MW7A 3M2RA 1RGVA 1EKSA 2M3DA 2Z58B 3CJ4A 1N36J 5DG8A 4ZVEA 1S1UA 1RTHB 1K0VA 2WBRA 1HNWJ 3VAMA 2HHSA 2PA3A 2C2RA 1B7YB 4HLBA 4OX8A 4IO1A 2ZC3A 3EWGA 4ZPAA 2AWZA 4NLGA 3HFZB 3I6PA 5U47A 2GJFA 2G9OA 4FNHA 2OEJA 4IFVA 3GV8B 2NREA 3MUMP 2GVZA 3ZNJ1 4ANEA 2BXJA 1KONA 3M2UB 3HVAA 2R7SA 4P74A 2NLWA 1M1KT 4U7UD 2R7VA 4LF2A 2KN4A 4XDDA 4V1Ak 4YP3A 2F3JA 4BWMA 4KC5A 2CIMA 4R5PA 3R7SB 3RRGA 1ZBTA 3OR1A 3VV2B 5DJBA 3KG1A 1FEEA 3LF0A 2H5JB 4FXVA 1FDBA 5B0AA 3KHHA 3CMES 2DNYA 4DU7A 2ZBCA 1KNZA 2OSQA 4C8OA 3EUNA 5DZ6A 3MEGA 2XI3A 3CSKA 2H5EA 1RT7B 3JSRA 1QAYA 1Q8LA 2E66A 1LWCA 5KG6A 1OYDA 3CC7S 1VQPS 2HVDA 2H54B 3WC0A 4ECYA 1S9FA 2KHCA 1CBKA 4OYIA 4JUZA 3R27A 1RT5A 3M2VB 2KG0A 2K06A 2XSJB 1FFGB 2RQCA 3BPSP 1JLQB 4OYWA 4QIEA 1S77D 2HHUA 2BJ9A 4DWIA 4NA3A 1U1OA 1JMTA 1TL7B 4R8UB 2OMOA 4CT9A 4B3SF 4D3HA 4PG6A 3PYDA 1F6TA 2CPDA 2R7TA 1C1BA 2FVPA 3FSIA 2H48B 2HFVA 3NGDA 5GAEI 2Z0GA 4A8KA 2ZE2A 3JYTA 4ID5B 2CZVC 1S4FA 1UKUA 4LF5J 4JI1F 3OTEA 2BANA 2MKSA 4LRBA 2EFOA 3M30A 1RWXB 2IDEA 1WTFA 4ANCA 4JI5J 5I3QA 1DTTB 1Y5IB 7AT1B 3WZ0A 1G7CB 4WTOB 2IJNA 2UU9J 4LSLA 4P2FA 4PZVA 2OMLA 4C3KA 5CXTA 5LXRA 1E6YA 1ULRA 1S0NA 5EWEA 3HULA 2F7VA 2N4DA 2DR5A 2GHWA 1MU2B 3EX7B 4EYIB 1FWPA 2PFDA 1LK7A 1ZPVA 3H2VE 1G1XA 1AT1B 3BR9A 3OTBA 1FXDA 3VZIA 4MH8A 1VRUA 4C8NA 4UUWA 2VZ9A 1X4AA 4DI6A 4EBCA 4PWDB 3GG0A 3AA8A 4FXDA 2X1AA 3T5KA 3M8ZA 3D2WA 3SSQA 4I0WA 1HD0A 1WI8A 1G6BA 3IAS9 5MLCV 4O4GB 1P6TA 3SI8A 3BGUA 5DQHA 3HSJA 3BV8A 4CLLA 1UVNA 3CD0A 1JKHA 5DQGA 2GVDA 3BGFA 3PKYA 4F2RA 1R0AB 1LKZA 1AW0A 2J6TA 1S5ZA 1RU1A 1JLEB 3C2PA 5KTQA 4XO0A 4MIBA 4IG3B 1IQTA 2OPRB 4OI2A 1HQUA 2ZDOA 2RIJA 5CYMB 3ZXWA 4K4VA 3H5SA 3NBPA 1QE1A 3P6YC 4ECRA 3MCSA 1KC8T 2E7XA 5K9FA 2IM0A 3GJSB 2VPWB 3X1LB 2XY7A 3DOMA 3IFEA 1FA0A 4OI3A 1BMQB 4L75A 3BO3A 1WC4A 3KFWX 4ERDA 3KLFB 2QT7A 3JXOA 2DYAA 3DHWC 4HYKA 3DLHA 4ICLA 3DC2A 1P8GA 3GFHA 2OJ3A 3FEYB 1RT2B 1NSKL 3SCLE 4JI4J 4YHHJ 2HURA 3AODA 3NP5A 1SKRA 2FHOB 4QCLA 2XEXA 3UDCA 5D4NA 3ISNC 5E41A 3WHIA 2ZH6A 4JV1A 4U8YA 5LOQA 1TUVA 3RZAA 3W2VB 1JNRB 4OYZA 4DV0F 2NCKL 4UQGA 3CEDA 3I0SA 4DMZA 3TA0A 3SDEA 2VPXB 3MPWA 4O0IA 4YB7A 4HH0A 3NS6A 1ZA1B 1P9QC 2DHAA 1TU0B 2Q1LA 2RU9A 2PT0A 2B5JA 2FVCA 3PIPQ 2RAQA 4TY8A 2NS1B 4ZVRB 3IRXA 2ZH9A 5HQMA 5E5NA 3BQ1A 3T9ZA 1CJKB 1WSRA 2KL8A 4IOBA 5IT9Y 2MKHA 2NR0A 2FGOA 2R2RA 3KUEA 3NS7B 1VDHA 4NCAA 3OFGA 2UVWA 1U6ZA 2WRMA 1RCOB 2IJFA 2BR0A 3JTNA 3N9UC 2WVBA 2V4JA 2DISA 3E01B 1SL1A 2VH7A 3W8GA 4G3IA 2K3KA 3GE9A 4CTAA 2HYIB 5A8RA 4MKVA 3V6KA 3M6XA 4UOHA 5B0FA 1PJ5A 4GRSA 1FTCA 3LGMA 5LMUF 1T94A 4OI0A 3R5JB 4LBIA 5BYQA 1S9GB 2IAJB 4QW8A 3VR1A 2ZVIA 5THWA 3BBCA 2VQFF 2YXLA 3N5BA 3TI0A 4RZRA 3J81Y 2CPXA 5HMXA 4X4VA 2ZH4A 5E33A 5B09A 3DRRB 2F4VJ 4KR0B 3Q8SB 2ZOFA 1YJTA 3R5BA 3CO0P 5DGAA 1NJXA 1ZTTA 2LU1A 2ZC4A 3BSOA 1RWOB 5KFUA 2OD6A 1IKVA 4F02A 1CJUA 4DG1A 3IWNC 2ZITA 3QNWB 3TQ1A 4DBQA 5LM7E 4FVMA 2ILZA 5KFAA 1VMBA 1TKTA 1WG5A 4I6AA 3WC2A 3QWPA 3UD3P 1HBNB 4MFBA 2I5JA 2RMLA 4WWSA 4WKRA 3ZZ0A 1RBOB 5DQIA 4IR9A 4J9VA 2XS5A 4WJBA 2N7YA 2HRYA 1X9MA 3KG0A 5HL7Q 4FYXB 4EWTA 3M2RB 2DNOA 3CCRS 4YDXA 4KGMA 1DLOA 2UVRA 5KFWA 2W9BB 5IQ6A 1S59A 3DXBA 5F8GA 2DNNA 1S49A 3K7RA 3C14A 2EPIA 1K73T 1JLCA 4IKAA 3IS9A 4IFVB 3K59A 2GVZB 2DGUA 2G1HA 3TEHB 2VBXA 1T03A 3LP2A 1U24A 2WB1D 2CVIA 1V5VA 2JDJA 5DLGA 1VC5A 3G71S 4AL5A 1FRKA 4C0HA 5CYJA 3FEZA 4OI1A 3OR1B 3DXSX 1DQ9A 1Y3KA 2DNRA 3QO9A 1PGZA 2HRUA 1D3WA 1TK8A 2CJBA 9RUBA 3GZ7A 2R8IA 1M5VC 4WIQA 3TNVA 3DRSA 4R25A 2DPIA 3BKTA 2UXBF 1SJ4P 3HDSA 3J7YI 5LT5A 1YG0A 1ZM9A 4A8FA 1MG7A 3R7BB 1LWCB 4O3OA 4NLVA 3AA9A 5KT6A 4O23A 2RQ4A 2BDPA 3PKMA 5H9FK 3QQCD 1KKHA 1D1UA 2PD1A 1KQFB 1RT5B 3EGVA 1FRLA 1GMUA 5ETNA 3EZUA 4YR3A 2DGOA 3IMQJ 1HARA 1RYSA 4FF1A 4UF4A 2DNKA 4ZOSA 4QWAA 4Q0BB 2J6SA 3EE3A 2D3OR 4OHWA 4C97A 1GFWB 1PAEX 4Q8EA 3GYNA 1S7HA 1OQ6A 4NCGA 1TR0A 3DU5A 3MD3A 2OP5A 5HBMA 2KXHA 3VTIA 3MURP 1RT1B 2P8IA 3THPA 3FZ2A 3JSYA 4OHZA 4E98A 1Y9OA 4FKYA 1BXNA 2VG5A 3JYTB 3KTQA 1KOHA 1MMNA 4OV6A 4J9PA 4HACB 3I32A 3UD4P 2WHOA 2IMOA 1Q53A 2A3JA 2ASJA 4DPOA 1VLOA 1H6KX 4CYUB 2MPUA 4NRUA 2C2EA 5AXNA 3ILJA 1P9YA 5AE1A 2WSFC 3W61A 2ASLA 1SKSA 4KSEB 1BQXA 1NLKL 3PEHA 2PN6A 4W90B 2M0GB 1JIHA 3AOCA 1NKEA 2BKOA 1YRXA 1VRUB 3R8YA 1XC9A 1WKLA 4NX9A 2ZH7A 3HXMA 2XMAA 3PTWA 2M88A 3HO1A 3EZ5A 4Y2AA 4WFBQ 2FJVA 3O2IA 4OFZA 2YWKA 2NSBA 4U7CA 4DV1F 2HGMA 1HQEA 3BKFA 2CYYA 2Z30B 1W2BR 3PVXA 4WKYA 1JXLA 5KG3A 5GMEA 4C8LA 4WFZA 2C3UA 1HI0P 4LQ9A 3MXHP 2A10A 1LXJA 3CC2S 1KOOA 3MFHA 1JKHB 1NDPA 2CXEA 2GVDB 4ES3A 1VC6A 4YS2A 2HAIA 5EGYA 1EAYC 1TL3A 1FRXA 1DJ0A 1VQNS 1DARA 3R2CJ 3EMTA 2W7AA 3T1AA 1IR2A 2VJVA 2QTWA 2W9AA 2HVEA 1OY8A 2F8EX 4F3OA 4IOAQ 4DR7J 1RWWB 4DV4F 1FCAA 1ELOA 1FT8A 4GKKF 3KJVB 3M32B 2F9JA 3ITHA 3MDFA 2JLFA 2VFVA 5D4LA 3QPIA 2VOPA 4N7TA 1TMMA 5EN1A 2MZSA 5D0RA 2P2CB 3KNGA 3EPIA 3C66A 3GFYA 4B3TJ 1RTIB 5GAEU 3G82A 3ZC4A 2HNZA 1JLBA 1OMSA 4GKJJ 4MKYA 2MSSA 1RWUA 3AXKA 4F4AA 4QYRA 1Y11A 5K5MA 4F67A 4JI0J 2YNHA 3KLHA 1H2TZ 4PWUA 3GFZA 2QIFA 4F0MA 4X4TA 1Q86T 2CUYA 3I0SB 4QWEA 2XYPB 4LVNP 3HMJG 3SV3A 4WFNQ 1X5TA 1UVMA 1TFYA 3OVAA 3C16A 1QUPA 1R6YA 3HPOA 4DUZJ 3NCPA 3E51A 1N6QA 3UN2A 2XZDB 2Q3PA 2OD4A 3IRXB 1RSCA 4OIXA 1QAIA 2W2MP 1IUJA 5BJRA 2AYGA 4ZCKA 1T0TV 1TUWA 3QT7A 3AQPA 2KRRA 4NASA 2AJ0A 2HHHJ 4Z7CA 1JJCB 2CQIA 2ZUAA 4A8YA 4ZLNA 3KWMA 3UN3A 3FBFA 3NLCA 3W9HA 2HLTA 1N5YB 2V34A 4RR5A 3Q24A 1EZZB 5KT3A 3CDEA 2NXJA 4Q7AA 5FD1A 2O1PA 1RWNB 2ZHOA 2VA3A 1NK9A 3K2YA 3M8YA 2XMKA 1RE1B 3S6EA 3QBCA 3HJFA 3QZ7A 1H0HB 2QO3A 5HSPA 1RP5A 2B7BB 1SKWA 3AOAA 4DFKA 2GGPA 4ED5A 2Z2MA 1O5JA 3DLEA 3SCIE 4ED6A 3ZFVA 2DD8S 1VQ5S 1GTHA 5KFIA 4CT8A 2YPZA 4LSNA 2MXYA 2DNPA 4I6WA 3UCUP 2RF2A 4C11B 2VHGA 4Q44A 1UJ5A 4L3NA 3OD2A 3VQSA 2O67A 2FZCB 5A8WA 2UUBJ 3RYLA 2B51A 5GAHI 1BD6A 2QYCA 2HVHA 3R5CA 2CAJA 1WNEA 5D4OA 5DDQC 2YVSA 4LF4J 4O44A 5IWAF 5I4MA 1SQFA 2R7QA 2Q6BA 2NYHA 1QSLA 4HHUA 5L1IA 5AXLA 3BGOP 1HW9A 2LDIA 4KH1B 1IKVB 2DHXA 3TUJC 1CJUB 2R3VA 4DXLA 1F2GA 1M5PC 4H4MA 1VOMA 4C3MA 4FYWB 1VS3A 2O66A 5B0GA 3X3UA 3G87A 4F25A 4DR1F 1NJIT 3LAMA 1Y7PA 1TKTB 1N56A 4BS2A 4MK9A 1RTDA 3I4HX 2BKPA 1QSYA 2LKZA 4M63A 4DL2A 4C9DA 3P3DA 3CCES 2M7SA 5IT9U 4MFBB 2I5JB 4HHHA 2QA4G 1JLFA 1W25A 3MEDA 2YX7A 3BJYA 4USVA 1XMQF 3DLKB 3CDWA 3MGJA 1RLDA 3HD1A 4XTTA 2EG1A 1DLOB 5H9EJ 1VCTA 2IM2A 1N5SA 5DRKA 1WC1A 2BOAA 4X4RA 2RE1A 4NEYA 3IBWA 3W5ZA 4OZ1A 3C14B 1Q8IA 2WONA 1JLCB 2ZZTA 1WHYA 1TQLA 1FI4A 1NHVA 3TX8A 3TW0A 4Y2KA 4K4YA 3LP2B 2BV3A 3NGTA 3HT3A 3NKYA 3QGHA 3I55S 5CZVA 4NWBA 4PABA 2OTLS 3M05A 4FDFA 1IKXA 2RU3A 1L3UA 1T05A 3BB5A 4K5SA 5KFQA 1GH8A 5E3RA 4P9SA 1RBAA 1U1QA 2VQEF 3HHNB 1RT4B 3FDSA 3J81U 4OL8A 2CA9A 1LW2A 3UVJA 1KVJA 3BF4A 1M5OC 1BLUA 5C24A 5EUHA 2MY8A 5T41A 2ZHBA 1GT8A 3MZIA 2POKA 5HANA 3PV8A 4AL6A 4X62J 3MPYA 2F5GA 2K1RB 2YNIA 1IJEB 4ZVQB 1LW0B 4XAKA 1FKAF 2CADA 3KLGA 2DJWA 3MEEB 5FDLB 4PQAA 2FJDB 3Q8PB 2MQOA 2H65B 2CFXA 1S0VA 1VLYA 1Y10A 1JLAB 3FQLA 1F2HA 1PC5A 3TO8A 3HT0A 4Y3CA 5KFFA 3Q8YA 3QIDA 5IV4A 1X4EA 3EVWA 2LDYA 5BR8F 5HBMB 1R8HA 3I56S 2BJ3A 4XDCA 5EX0A 2GQCA 2HK3A 1C0UA 2B9EA 2R7WA 3FCWA 2VFTA 5D3GA 3MM8B 2LECA 4OV1A 4ALZA 3D9BA 1AFIA 3IWXA 3PJXA 4Q8FA 5FIIA 5MAOA 1V5IB 1IBKF 4AE5A 3DRXA 4ZPBA 4M95A 4LFBF 3B78A 3SFUA 4IO9Q 1X5SA 1S6OA 1WJ9A 2UV8A 3KLEB 5AJ3F 4HL9A 4M5MA 4LQ3A 4CO4A 1IKYA 3WQPA 3GYXB 4ES2A 3UE2A 3U1NA 3B82A 2KM8C 2EI5A 3FBBA 1FE4A 1EQMA 5KFHA 3PW2A 4BCAA 4ENOA 2Y0BB 3PO4A 1Z2LA 3TEGA 1X5OA 4M5HA 3LA0A 3FSXA 2BJDA 2XCAA 2V2QA 1BWEA 2OTJS 1FXLA 1LEOA 3QSIA 3T6BA 3UFCX 3I0RA 4MKAA 4FS1A 4JI7F 4LRDA 1C2PA 4N8OA 4DR4J 3OTCA 3DOLB 4Y0FA 3UO0A 2YNGA 3ZZTA 4O3QA 1RHMB 2HAFA 3L7PA 4ZN3A 2CDRB 1REVA 3AQOA 1TL3B 2R7RA 4ZPVR 4K7QA 3L7UA 1PO6A 2JRSA 5IZHA 5K14A 5L39A 4PPDA 4OZ3A 4KFBA 1UWBA 5J2PB 4CO5A 4YY3J 2M5YA 3MAAB 2VG7A 2WVFA 4Y65A 4DV3J 2CPEA 1TKZB 1TP7A 3R1HA 3H25A 3BREA 1TV6A 2QA2A 1NO8A 1KTQA 2GHPA 2EXUA 3LO3A 1LWFB 2VDHA 4ZCIA 3IWLA 2NXNA 3E3XA 1RAEB 1AYEA 4PPZA 4CZCA 4ZP7A 2P9EA 3LWLA 3G82B 1RAHB 2HNZB 1JLBB 4ED4A 4ZVHA 2WVDA 4M8LA 1TKXB 4HDHA 4KB7A 3AH6A 1AZSA 5CYQB 1RADB 3MR5A 3W3SA 3EYZA 4LF8F 3KLHB 2IIHA 3PX0A 4P2XA 1S79A 1FDDA 1WF0A 3UDEA 1VK8A 2KVQE 4DFMA 4B9SA 3M9NB 4K0KF 1YK9A 3OSPA 4LT6A 4DX6A 2RVJA 2AJ2A 3K57A 5HI7A 4JB8B 4NZ0A 3C16B 2ZM6F 2QV6A 4NA2A 2H5IB 1D8ZA 5T14A 1YJNS 1N6QB 1IBMF 3CE8A 2CNKB 3DOKA 2J8SA 2VQEJ 2BJ7A 4TYBA 1RBLA 1NKBA 1RLCL 2EKYA 2RH3A 2B4VA 1X9SA 5KFMA 2QLWA 3PW0A 1MMLA 1BC6A 4U9RA 1FK9A 4ILRA 4LF7J 4TQRA 3MTKA 3MMAB 2XYGB 3UWTA 3H2UB 3OPKA 3HCXA 3BEGB 1P1LA 4JYAJ 3RAXA 4K4UA 1NDCA 4DSKA 3TAQA 3BYPA 2HHXA 3SYZA 4AL7A 4OYAA 3CNQP 2QLXA 3CW2C 3KDNA 3KOAA 3MOZA 2YH0A 2QMXA 1OPZA 2GX8A 4C3LA 1UP1A 5C2CA 2OELA 4R0EA 2CQHA 4DPUA 1YGYA 1W7WA 1EHWA 3DLEB 1RB0A 4X64F 3TARA 5A0YB 2UUWA 4KO0A 5BR8J 3EM1A 5E3PA 3H4DA 4C4WA 4F0KA 2DR7A 4OYOA 2LXFA 4DR6F 3K89A 1GXLA 2XY5A 1JJ2R 3RUBL 1SBRA 2RF2B 5E2QA 4CLPA 1AFJA 3ZZRA 3O8WA 1HD1A 2V67A 4P75A 3QLHB 1NB7A 5A8WB 1RT6A 5KFKA 4OHYA 3S8SA 1O6XA 4LFCF 2QN6B 3DLJA 1B3TA 2XLJA 1LXNA 1TMJA 5AJ3J 2DGWA 3QT5A 5DLFA 4DF8A 1VFJA 4UY8T 2Q6CA 1SC3B 4LVOP 4HKQA 2MEWA 2O5DA 3MCNA 4ZDNA 2G0IA 3CDAA 1CULA 1JJHA 2R42A 2V0NA 1RT3B 3TA2A 3OUYA 2ZNYA 4PXEA 1HWKA 5JJBA 4JV5F 4WK1A 1NHKL 2UXDJ 4CLWA 1F3FA 3I5CA 1NPRA 1RTDB 1S0OA 3GP9A 1YJ7A 2B4UA 1PILA 1XIQA 3VQTA 1VK3A 3MPDA 2FJXA 1ZH5A 2I38A 4CRJA 3AOBA 4LF6J 2D1CA 2K8GA 1T11A 2DR6A 3MEDB 1SJ1A 2IA0A 3O1LA 2XCPA 1CJVA 2VJUA 4IQXA 4NE9C 1TFWA 1IBLJ 3PRVA 1EARA 3ET6B 4L3KA 4KYZA 4FF4A 5DDRC 1RXOB 2GMJA 2N4CA 2IYIA 1VQKS 4M5JA 2BE9B 4NLRA 1SCJB 2F65A 1R8AA 2H4YB 1S0MA 3GMGA 1M5HA 3HVTA 2BABA 2ZH5A 4U7UK 2KZMA 3HHLC 3KK3A 4RWXA 3TA1A 1UVJA 3DN9A 1IKXB 4LRCA 3U7JA 3D67A 2CNNB 4QWBA 3D1OA 3D3BJ 2GIQA 1Q8KA 1YZ7A 3GILA 3WIUA 5KFJA 3IM8A 1SC6A 2OEMA 1UCNA 5H9EK 2UXCF 3OHBA 3P4UB 3PEJA 2CKWA 2B6AB 3UVJB 2WK4A 4RNNA 2B56A 4LF8J 4ITSA 3R5AA 3ISND 1T9UA 3RTVA 3OXFA 1X0PA 1TKDA 4N47A 1OIAA 5CZXA 3G6YA 3RU0A 2Y3YA 4QPXA 2ZJQQ 2I1RA 1VYAA 2VFSA 3LWMA 3TZWA 4DN0A 1HYSB 2CWXA 2ZM6J 3RBDA 3MF5A 1P27B 1PAUB 1U49A 4MTPA 4J37A 3A8JA 1JXEA 2E29A 2OPPB 4WPAA 4NXMF 2FDNA 2YKNB 4M5LA 2FZKB 4WYWA 3V81A 1KS2A 2XLIA 2XY6A 4PR6A 1R0CB 1OYEA 4LBPA 4I56A 2HQCA 2RSQA 3VGSA 4USUA 2OUGA 1Z4UA 3FEXB 5DM7Q 4KQZA 3D0IE 4H4OB 4QBUA 3LAKA 1XNRJ 4KH0B 1HNXJ 1E6VA 3DHXA 5LSRA 2HVZA 4G65A 1C0UB 4C8YA 2DGSA 2NSCA 5KAKA 1RWPB 2QL9B 4RBUA 2W2OP 5J2MB 3G4SS 2BE7D 2CQGA 2RS2A 1DQ8A 1HBMA 3NOCA 3LUYA 3AHPA 3CJ5A 2VDIA 1GNKA 1B4SA 2E5IA 4LR7A 2J0QD 2CZ9A 3PYGA 5KFOA 2GV1A 5KT5A 4P72A 4IDKB 4ZHRA 4IFYB 4DS5A 1JLGA 1IKYB 3KHGA 4QIVA 4CH7A 1XQIA 5ADZA 2PMWA 4OX6A 1VRTB 2E44A 2J0WA 4QQBA 2D3UA 2ZWPA 3BGRA 2ACMA 3DGPB 2JHEA 2C3MA 3CJRA 2BJ8A 4ETZA 1CC8A 3U1LA 4PRFA 5G0RB 2IC3A 3OSNA 4RBVA 2ROGA 3I87A 4XIUA 1F1BB 1HHSA 4C98A 3CO9A 1QM9A 2AJQA 3A3PB 1MWYA 5F8JA 3T5HA 1T8EA 3DLGA 2XM3A 5I3UA 5E7OB 3CDBA 2V6AA 4TKTA 1S9EA 2OPSA 4PG7A 2D9OA 2GAHC 3ELHA 3EJMA 1Z2ZA 1KN6A 2F63A 2YNGB 3G96A 4OX7A 3AJ2A 3KHRA 2A1BA 4H4KA 1U1RA 5K8OA 1VRQC 2R7XA 3MEKA 4J9RA 2YKOA 4ECQA 2Z2YB 1MWQA 5K14B 4JI2J 2XMJA 3MM7A 4DCJB 1MN7A 4KFBB 1UWBB 2KVIA 5CQGA 2HEKA 2G13A 1QDUB 1X4HA 2W2QP 1K8AT 1FVQA 1BUXA 3FMWA 4DSIA 2X1FA 3QIPA 2E5JA 3VAIA 1TV6B 2MKJA 1GX5A 1BE4A 1KHWA 4ECWA 4NLTA 4RW4B 3H42A 3VHQA 3M8RA 4X4UA 3OL7A 4K4TA 4IYQA 1HPZA 2EWHA 5AE2A 1JWWA 4MMOA 1S97A 2JEIA 2Q43A 2VODA 2HBZB 1N33J 2BX6A 6FD1A 1HNVB 3K5NA 2Z56B 2GAGC 1PJ7A 2MYFA 3PR5B 2DNLA 2C3YA 5A2QU 1UWAA 5JVHQ 4NL5A 2FD2A 4JI8J 2HBQB 4Q45A 1WUUA 4NLXA 2QYGA 2DPJA 1S1WA 4DV5J 1EP4B 2DKOB 3TJ8A 1W2IA 5IS2A 4M5NA 4F0HA 5DO2A 4RBTA 3Q0AA 2FVRA 1OPIA 2QZ8A 4DOZA 5ETKA 3DOKB 2CWKA 2LA6A 1YVFA 4NXNF 5K8MA 2CJ9A 1L5UA 4DZ6A 4JI6J 1I3OB 4DQPA 1NXIA 4RUBA 4HI1A 2DEIA 4TY9A 1NZ8A 3I5BA 4KPCA 3C6TA 3LP0B 4O3SA 1SH2A 3N6NA 3THTA 3L4BC 2R7OA 4KHMA 2HHPA 2HVIA 3CJ0A 2ZJRQ 1QTNB 4NLSA 1MMDA 3HHEA 2IVFB 4M5KA 2OI2A 1PBUA 3NNCA 2V5HG 1IWAA 4ELTA 3FQKA 3V4MA 2NYIA 3T1YJ 1UMJA 2HZVA 2DNQA 2P6TA 4JI3F 3MM5A 4PAAA 5J2NA 3UD5A 2ATLA 1EIYB 4PYAA 1FNOA 3H0PA 1SUQA 2PC6A 3CCSS 3J7ZT 1YJUA 1IVZA 5GMKa 2AV5A 1WI6A 2E9RX 2IA6A 2AJ1A 4WFYA 5GADU 2LFVA 3H98A 1NK0A 2GZOA 1MROB 1RT6B 2KI2A 1QLNA 4HT5A 2MSTA 1VJWA 5B08A 1IBCB 3HSGA 5LSLA 5F9NA 4OJ3A 3CXCR 2RRNA 4K5RA 4X65F 4RUHA 1VQMS 5A6PA 5IXUA 4FXWA 1S12A 3BPDA 4USKA 3GSIA 3R7NB 4IRCA 1LV5A 1WWHA 4DR3J 8RUCA 4ZMMA 3RR8A 2V8DA 4RNHA 1CULB 3O3LA 3KDOA 4OZNA 4W92B 1R0BG 5L9XA 2XS2A 1YJRA 6AT1B 2WZ1A 4A8SA 2C2ZB 2OLWA 5B0DA 4N41A 2D41A 5CAAA 2HQIA 3TQEA 1TL1A 1HMVA 1GMVA 3CCTA 1I94F 3WDOA 3GV7B 2VC0A 2JNJA 2PSZA 2ABYA 3RBXA 2CDQA 2YKQA 2UUAF 5KFZA 3D6TB 3CD5A 3C6UA 4X66F 1H72C 5HROA 2DXFA 2MHNA 5LXYA 1VQYA 1D0EA 4USWA 4KIAA 2HFZA 4Y00A 3VAJA 3DI6B 2VUGA 4F4WA 2AX0A 2X3GA 2ROEA 2NPIA 3L95X 2QGFB 3T1HF 3D7SB 4ZK7M 2L9NA 3MECB 2BACA 4IQMA 3CJSA 5C5JA 2FLOA 2B4OA 4OJHA 1D9AA 3CGIA 1TK5A 5L1KA 1N32F 4B3MF 2DR8A 4TYAA 1I51B 4USJC 5C25A 3HSZA 3KJFB 5FLXU 2VPYB 3I31A 4BWJA 3G6XA 2CJKA 2QEXS 2IJRA 1VBYA 1WC6A 2A6MA 1U0HA 4ZP9A 4J9OA 1FRHA 4DSFA 1FKOB 3WX4A 2EKNA 2HHVA 3FGVA 4BLGA 2WOMA 4UOFA 4ZVTB 3DDIA 1GQEA 1NRKA 3M6WA 3NMRA 3QGGA 5C42A 3V2UC 2G2ZA 2AGPA 1NPKA 3M1VA 4WIIA 2D9PA 4FF2A 3LPYA 2FYXA 1ZM4A 2C28A 3TAMB 1U48A 3BDEA 1WHVA 3PIOQ 3OFFA 4X4NA 2PDAA 1ZAWA 2WBMA 5CHCB 4F4YA 3OBIA 3E8OA 3HHDA 4LSZB 1WOSA 5LMNF 1RAIB 3PW4A 2L41A 1JQGA 1F5BA 3RGIA 3MUTP 1YRUA 3VAFA 3N79A 4PUOB 3PX6A 5E3AA 1E6VB 4PQUA 5H9FJ 1IN0A 1Y0HA 5HO4A 2W1BA 1YDLA 1Q78A 2AYMA 1U8SA 1NDKA 4ZP6A 3KNAA 2OO4A 3QJPA 1UJ6A 4LF9J 3BM7A 4XK8C 3IR7B 4KGZB 3NL0A 3GCWP 1FJGJ 1DBDA 4DCPB 4Z7YA 3V6DA 4QPTA 1Y5NB 2A6OA 4ECVA 5K8NA 3SZ2A 2DBBA 1FHTA 3ZZYA 1JLGB 2K3IA 3ETOA 1Q5YA 4JI3J 1YJ9S 1SJRA 1L3SA 3GTYX 1B0VA 2HQDA 2K7KA 1R43A 1QVGR 1N88A 4WE1A 3JAMY 5DETA 4DL5A 2Z4PA 2Q79A 3DRPB 4ZA1A 1RHJB 2EG2A 3IRWP 1HKAA 2DY1A 3IP0A 4WK3A 1UPMB 1NK6A 1NK8A 4NLPA 4YMEA 2YPYA 3EDRB 1Q95G 3F56A 3DLGB 2MQQA 1OQ3A 2BEFA 2WCXA 5I3UB 4E2FB 5M2PA 2ZVSA 1S9EB 4I2QB 2GC8A 2BYCA 2Z2ZA 2R8JA 4LBHA 1VQ8S 4GO5X 1U2FA 3CT9A 4GVBB 4EBDA 4DN9A 2DHHA 1RHKB 1WEXA 5E0OA 1XMOF 1UZDA 1UEKA 2XO6A 5J1EA 4N8NA 1KBRA 2MMYA 5J2QA 1SV5A 2HKEA 3PO5A 2XQCA 2NQPA 4B9VA 3MM9B 4AQYF 1K47A 1FX2A 3CVKA 2V8GA 1Q7YT 5D0GA 4LIRA 1QD1A 3MM7B 1WHWA 4DR5J 2MKKA 2YWWA 1SL2A 3FFIB 4USHA 3H5XA 4A8MP 1TVRA 2P5VA 5KT7A 4DPXA 2ZEJA 3N6LA 2RQMA 3VZHA 3D3CJ 4KE5A 1DAXA 4F3MA 2HGLA 4Z37A 1HPZB 2BE2A 4U96A 3W9IA 1N8RT 1FF2A 3R6GB 4WCEQ 3UNYA 5HJXA 4QWDA 1S1VA 3AD9C 2XWYA 3W5XA 3U1MA 3Q2TC 4B3OA 1G4CA 1R89A 2Y8WA 3GWCA 4FS2A 5B7WA 4IG0A 4DR2F 2KRBA 4CWBA 1AUSL 2XI2A 4B3MJ 2UUTA 3DLLQ 2QL7B 3AXMA 3Q8UA 3MM6B 1XNQF 4ZKAA 3M8WA 2AGOA 1GMWA 1NZAA 2W2PP 2LU2A 4ECSA 1GAOA 2ADCA 3OR2A 1SB6A 4ED8A 1HBUB 2VKZG 4DDFA 3IO1A 1NK4A 5IFMA 4OHXA 1KVKA 4HT7A 3W1YC 4YDDB 1UVLA 1LWEA 5D78A 4Y34A 3KLIA 2DTJA 2PE8A 2F8MA 2Y1RI 2XMVA 4KV8B 1RK8A 3C6TB 4QZVB 3MUVP 3T19A 2R8KA 2ZOGA 3QGIA 4EGLA 3GIRA 2EK1A 3MMCA 3OL8A 3W62A 1XR7A 4ZPCA 4U67Q 1HL6A 4R0JA 4NLWA 4B02A 3LALA 3J7A1 1UVKA 3ISZA 1VR6A 3HHLB 3TJAA 1BGXT 1GX6A 1A0OB 1NDLA 3SMZA 2RQKA 4RU9A 4UZBA 2F8HA 2LQ5A 2D3ZA 2KO1A 2ZNZA 3QSYB 1X60A 2DIVA 4KY3A 2XNRA 2X1GA 1ZAXA 4NYPA 2HFSA 2FHKA 2V2VA 1SUQB 2AJ4A 2XB2D 1N0UA 2M9KA 1C4AA 3F41A 2EFVA 3ILOA 4C6AA 2BMBA 4I2PB 2HHQA 2EC2A 4YB5A 2XTJP 5E3CA 3DDNA 3D1QA 4I67A 4HTIA 3GSDA 1GMWD 3QYYA 1BHNA 2Z2LA 4ED7A 1OSCA 3PHEA 5HVFA 3V6JA 5EWGA 1HWIA 3AB2B 1GEHA 3Q89A 2FC9A 1IR0A 2MJNA 5F8MA 4KGVB 2FUG9 5HVGA 2H4WB 4I4BA 3W5YA 1EX8A 4HI2A 3NWGA 3B54A 2COLA 3UCGA 2E1AA 3W64A 3ENWA 1V9OA 2QLBB 5DDPC 1HMVB 2JFDA 2IBKA 4B3SJ 1FE0A 2CPHA 1YITS 1X7VA 4KHPF 2PO4A 1VJQA 1YBTA 2XBPA 2X51A 3FCVA 4X4SA 4M94A 2CPZA 4CLKA 1RT7A 4ZITA 3CTRA 2LXUA 3D6HB 1FNMA 2HZAA 2MQPA 2C2KB 1Q16B 2YWFA 4P6QA 1Y00A 4J90A 4DV6F 4RUCA 1H2UX 1FD2A 2LA4A 4JI1J 1XMOJ 5KG5A 1UW9A 2P9GA 2B7CB 2IYGA 3ZZZA 3M2VA 3SEOA 3FKBA 1JLQA 2MGZA 4KTQA 3G8TA 4R8UA 2HFUA 1UVIA 2A18A 3IBFB 4GC6A 1SH0A 2XHWA 4PG5A 1R8PA 2AMCB 1EETB 2ILYA 1WDTA 3W63A 4RW9B 2WW8A 3KK2B 3HLUA 3EGWB 1LQ9A 2DO4A 4C0OC 4A8OA 2RT3A 2F40A 1DQAA 1X4CA 4OX9F 3KJQB 1URRA 3RBEA 2RILA 4DX8H 2WOMB 2JEGA 1HWUA 2CQPA 3MR3A 2XWXA 3D66A 3NY0A 4K2JA 2R7UA 3KUGA 1H7WA 4P52A 3IG1B 5C42B 5K8PA 1YI2S 4OZ5A 2WSCC 2GMHA 2GMLA 2P6SA 3TR5A 2KHDA 1FESA 2FLLA 4MAKA 3QJJA 4NLQA 2Y0SD 4LUBA 2X3DA 3CCLS 2DRAA 3NCQA 3RRKA 3ENVA 1I1GA 1M5SA 1S1UB 3OTOF 2OH2A 4ZLPA 4TVAB 3CULA 2PI4A 1R27B 2JC1A 4USMA 1K1SA 4DL6A 1URNA 3QAUA 3W7BA 2F4FA 1F0XA 4RL1A 3VGTA 1U6BA 5KFCA 4EK2A 2CVEA 5IV3A 4JP8A 4PQUB 2E7WA 1UTAA 2PEHA 3ZTRA 2R2TA 1JJ4A 4R5PB 5IC6B 5HK4A 4KGXB 2I9SA 4QYZJ 2AX1A 1R0AA 4C7QA 5F8LA 5L8RC 2DRBA 2BRLA 1JLEA 2LQJA 3MEGB 4IG3A 3V6DB 2HS0A 2OPRA 3I9V9 3PCOB 2B9WA 1U7LA 3Q22A 3M9OB 4K59A 2AKWB 3BN4A 4AXIA 2XZWA 1N4LA 4YQWA 2AQ4A 4DV0J 2Y1LB 2B9YA 1KFSA 3S01A 1X4BA 3KLFA 1CSJA 4WE1B 2WB4A 1VGYA 1NKCA 5HLFA 1RISA 4IR1A 1VQ9S 2KFYA 4CI0B 1N52B 3I9ZA 4ANDA 2BUNA 1BQNA 1RT2A 3HVWA 5T7LA 3JSBA 4ZLJA 2Y1JA 3GJQB 2FHMA 3PRDA 1FFWB 1UEUA 4USTA 1C1BB 1WD6A 2WTFA 2DY9A 4N76A 2ZE2B 5L9NA 4F50A 1O8BA 2BANB 1FDNA 4NMLA 2QJ3A 5J2QB 3DMJA 3M30B 1RTZA 4P7VA 4B9NA 4ELUA 3TZYA 4LSLB 1VBZA 3CCMS 3VAKA 3O6QA 3F0NA 3EVMA 2V8VA 1OWXA 2R9LA 2E9ZA 1S10A 1E6YB 4KHPJ 3F73A 1CJKA 1P1TA 5LMUJ 3QT6A 2HGNA 5EHHA 4TNOA 2MB0B 5HQLA 4RUAA 3D0HE 4EMDA 3GCXP 3EVOA 1U1MA 3OW2R 2JJ4D 1PYTA 3E01A 2LQ9A 4P7TA 2VQFJ 1WORA 3G8SA 4E8UA 4O3PA 3BSNA 1N5QA 3BO4A 3N6MA 3OLAA 1KLMA 1HNZF 3W2WA 2AW0A 2UU9F 4LJMA 1UJ4A 4B3OB 3G8QA 2VV5A 3AFGA 1LWXA 1UPPA 3FJ2A 1A7GE 1IM4A 3Q83A 1YBAA 4DSLA 2W7OA 2JZ5A 2MZRA 2J9DA 3M6VA 2JEJA 4J9QA 1FXRA 2JFKA 3HHLD 2CJYB 3CB4A 3W65A 1LFWA 3JAMU 4B9UA 1N48A 1RWKB 2D7SA 1R3NA 4ZPWR 5EX3A 4DFPA 3UQSA 1HI1A 2NXUA 1HQUB 4I68A 1R8BA 3NBPB 1QE1B 5SUHA 1H2VZ 4YR0A 2BKNA 1MSWD 2XG8A 4B08A 3C15A 3TZZA 1WACA 2C22A 1U1PA 1S76D 3DOMB 3HHKA 2JVRA 2W25A 3PHTA 4DPTA 1WSVA 3HK2A 1WOPA 2QA4S 3QT8A 3VVTA 4ICLB 4LRFA 1U47A 1RHQB 3MMCB 2FB0A 2FY1A 1T9WA 3M8SA 2HSEB 2V8HA 2IBOA 2X1BA 2EC0A 2JEFA 5E3QA 5J1PA 4FN5A 2E1RA 2VKRA 4KRWA 1UFKA 1QVFR 2DT9A 1YIJS 2QSWA 3MPVA 2O01C 1HBNA 3A3OB 1I5OB 1DRZA 4C8ZA 1WHXA 3CJQA 3NGRA 3SDEB 3QATA 3P5TL 1VQ4S 1TL4A 4ZVSB 4EO6A 1VHFA 3BSAA 2QA1A 1TAUA 1RAAB 2B5JB 5HMWA 4CNYA 1ZZFA 4TY8B 2MY7A 4JI4F 4YHHF 4W98A 1SKUB 2W9BA 1ZZNA 5KG2A 2UXBJ 2AYBA 1PYOB 2AHOB 5GAGU 4DX7A 3VALA 3PFEA 1H3DA 3MCOA 3MR2A 5ETRA 2V4JB 2VC1A 1KHVA 1X4DA 4IH6A 4CTAB 2Z57B 5A8RB 5A8KA 2J7KA 2HPUA 2HNDA 3ADAC 2YY3A 3BQ2A 4X2BA 3W9JA 2R2SA 2E9TA 2J7WA 2KZZA 4EI2A 4ID8A 2HWTA 3FRYA 5KFYA 1KR4A 1VQSA 3CD6S 2CQ2A 1S57A 1U1KA 3PY8A 2VU5A 4FP9A 2BJ1A 1FDAA 1TUGB 3H8YA 3OQ2A 1KP6A 5M2RA 2J5AA 3CD7A 4NLYA 1KVIA 2IHR1 5IT4A 4RPFA 2HW3A 3J80Y 3BR8A 3NXZA 3MMBA 3IGVA 5CA5A 3OV7A 2BRKA 3R97A 1ACMB 2Z8QA 1NEEA 1NSAA 4NCBA 4J91A 4CLYA 2G2YA 3D6FB 2IVMA 4A8XA 2MGZB 3CCQS 4FZVA 3EXCX 5KFNA 2KT2A 4Q0BA 4URSA 2ZH8A 1HA1A 3CJ8A 3KG4A 2G0JA 4YUDA 3H90A 2MQNA 3IAM9 2V69A 2HBYB 2V9WA 1REGX 5AE3A 3P8BB 1RWVB 5KFRA 2C2NA 1K0TA 1RT1A 4WXOA 4F4ZA 3T5LA 1FTRA 1NU4A 3EPGA 1A6LA 4DG1B 1O0PA 1HLWA 3CCVS 3OL6A 2V94A 4HACA 1HBOA 3CDUA 4G1QA 1HNZJ 3HI9A 4X84A 1S6UA 4IH7A 1FVSA 3PFOA 1RDRA 4CYUA 4DV1J 2F4VF 2VD3A 2UVUA 5HATA 1DHMA 4Y2MA 4YOEA 1T9XA 4NLDA 3RJMB 1FKPA 2M8HA 4LRAA 2EFPA 1Q0NA 4A4JA 1FRIA 2AEMA 3C19A 1RAOA 2RDJA 3BO2A 4KAIA 4OYMA 3BSCA 1WC3A 2HFOA 1PKUA 1KD1T 4DL0C 4NI2A 4DV4J 3D54A 2XMUA 4GKKJ 3LP1A 3TWZA 3HX9A 2YQ1A 4GVLA 3IS9B 4CLUA 1UA0A 2R8GA 4ED1A 2ADBA 1S72S 3GYGA 3FUYA 1T03B 1ZM2A 3EGNA 3NGSA 1U6FA 4N5SA 2I8EA 1WDDA 2VB6A 1R8CA 3IGNA 3H7HB 4O4RA 3EZOA 2ROPA 1KQSR 3QO9B 4NZ7A 1UETA 4DHVA 4V19J 3DRSB 4YEAA 3P5BP 4OYPA 5F3TA 4CH1A 3KJVA 3DU6A 2BJEA 2FJEB 3M32A 1X4GA 5JUMA 4RJVA 1X4FA 2EFQA 4L73A 2AT1B 1RQ0A 3TAPA 3D28A 4EEYA 1VBKA 1ZYQA 3ZTOA 4DU8A 1NB2A 3CJ2A 2V8PA 5HLFB 2IMWP 1ITPA 3UW1A 3V4IA 1OY6A 3O5TB 1RTIA 1TAQA 4ER8A 3ENAA 1AB8A 2E1CA 1BQNB 4QYZK 4ZVOB 2CZ4A 1SPBP 2ZDPA 5KFBA 5T7LB 1M1GA 2ZFHA 3FNNA 4YB1P 5HMZA 3GONA 5DDOC 2M4MA 2R8HA 1VISA 4KHRA 3LGNA 1B64A 2FY8A 3OTDA 3BH6B 4NCGB 3PNIA 1S99A 3DCAA 2NXCA 1TK0A 4TU9A 4UQTA 2XSFA 3OJSA 2M70A 2VG5B 2KG1A 4PXBA 3BS9A 2MLXA 3PJWA 3DMJB 1X31C 2OFGX 2ZZNA 3OT9A 2M8DB 4PXDA 7FD1A 3RAQA 3K0JA 4DS4A 4M5IA 1J5OA 3SSSA 2BQUA 2ALZA 5ETSA 2PEBA 3FBCA 5J1NA 2IM3A 2DK2A 5C2GA 4NEZA 2JX2A 1BQMA 2DGTA 2NZ4A 1DURA 1SI9A 3QRRA 1UA1A 1GXUA 4K2XA 1N5YA 2E5GA 2IRYA 4TLRA 2VA2A 1H74A 6FDRA 4ZLLA 3A1YG 1KLMB 2YBVA 4Y28C 3ZZUA 4EUVA 2DNHA 3W2WB 1WF1A 5H1SV 2LEPA 3THVA 1XBWA 1HQEB 4ILLA 5IWAJ 5ETPA 4J9UE 1FRMA 4F04B 4F26A 3TVKA 3D5MA 4ECXA 1VQLS 2GJ2A 3M9MB 2HZCA 3SBMA 2X7IA 2VASA 2KJWA 2H1YA 3M8QA 1RZMA 4ZJOA 3KJNB 1CQMA 4C11A 2R4FA 3UI3A 1L3VA 1YJVA 1FD8A 5F0WA 1CC7A 5KG4A 4CLFA 3PDNA 3VAGA 4DR1J 1FJ7A 1PSDA 3NNAA 3HSDA 3LGHA 5KFGA 3ITHB 1F3VA 3RG6A 2WAQD 3A8EA 3JQMA 4P71A 3C15B 4F4KA 2AF6A 5KFLA 5D4PA 1FWKA 3TVZA 1U1NA 2FVSA 5HQ8A 5GADI 5SZTA 1XTZA 4OZ0A 2KT3A 5L1LA 1XMQJ 2CJXB 3RW6A 4ECTA 3TZXA 3GR1A 4TU8A 2FLPA 2XHCA 1WF2A 4NYOA 4MYTA 2YNHB 4DR7F 2GIRA 4CLTA 2GQ2A 1T02A 2EFGA 3OLBA 2N3OA 1F5AA 3LH2S 2NUUG 4X4PA 2VFRA 2VIHA 2GIFA 4J9KA 1RU2A 1CJTA 2FJAB 2MKIA 4B3TF 4HVZA 2I2YA 3DLKA 5KOXA 4CM0A 1R7IA 4RU2A 3AJDA 4M5DA 4GKJF 2AU0A 2HQFA 2MHEA 1PBAA 2IM1A 4JI0F 1UW4A 1SIWB 1Y4ZB 2GO8A 5B0EA 1VHIA 4RNFA 1MN9A 2C3OA 3ETMA 4Q2LA 3GIMA 2QC3A 1HHQA 1JK9B 4FYYB 1YLXA 2GJIA 3DYAA 1WTBA 4OJ1A 2RRAA 3TOQA 4QWCA 5A8KB 5CCMA 3I82A 2HNDB 5IC4B 2OIHA 4DUZF 2MLYA 1XERA 7FDRA 2J0SD 1CQNA 2YX4A 2Q66A 4QIGA 1RT4A 4O3NA 2G2OA 1FFSB 3MHYA 5LJ3Y 4H4KC 2C2OB 2GGPB 2NXEA 3BN7A 2HIYA 2YKPA 1X5PA 4FBTA 1NBEB 3PACA 4UT4A 3NG8A 4O3RA 2HHHF 3MAHA 2K1RA 4LSNB 3MI7X 1LW0A 2N82B 3MMBB 3H5UA 3HZGA 2VBYA 2W8KA 4B9MA 1RI7A 2HS4A 3TANA 1Y5LB 3QRQA 1EB0A 1T9VA 1XMBA 3MEEA 2KT5A 5FDLA 1IBKJ 4DQSA 4BBYA 2MQMA 2ERRA 4LFBJ 3Q8RB 2YTCA 4YB6A 1JLAA 1CPZA 4XPEA 1NH8A 5KG1A 4O44B 3MOJB 3IC1A 2LEAA 4KPYA 4KBIA 1NK5A 3BDPA 4CO0A 2FZGB 4FF3A 1D9DA 2GFFA 1OO0B 1PYSB 3S1TA 3MM8A 1U8WA 3I5AA 4H4MB 4MIAA 2LLZA 2YKAA 4URQU 1HBOB 1H38A 4G1QB 3W8PA 2UUBF 4C8MA 2I6WA 4PXCA 2FJWA 3FBEA 3U02A 1L3KA 2RHQB 2J9CA 5KFXA 4LF4F 1WEZA 4WP3A 3KLEA 2OFHX 4ZS6A 4JI7J 1SXLA 2DHGA 1FKPB 5CD4H 3V6HA 3DKDA 4DQRA 1X8DA 2EK6A 1JLFB 4K4XA 2P9CA 1OSDA 2GW8A 3GR0A 3GJRB 4Q2MA 1S4EA 1YKWA 4IRKA 1LNQA 4DL3A 3CCWA 5I3PA 4EBEA 2K2PA 4DPWA 5HMYA 1VI7A 2IRUA 4QIFA 2L08A 4NI2B 2LQ8A 1T95A 3SQGA 3PX4A 3LP1B 2G4BA 4L6V3 4ETXA 2WONB 3BYRA 1YJWS 2DIUA 3BGLA 4A47A 3MFIA 1FJEB 3NEKA 4ZPDA 4B9TA 4OZLA 2WVCA 2C2MB 2ZD1A 4LMZA 4ECZA 5HP1A 3DOLA 2QE5A 2LP4A 1KTVA 2BBEA 2KB2A 3J80U 4QOTA 4J9LA 1GTEA 1T05B 1YHQS 1LK5A 1G2EA 5ETVA 4DEZA 1RA7A 2W24A 1YWXA 2IFXA 1VQOS 1A9NB 1T7PA 1WC0A 1LW2B 4RNOA 2R2UA 2XGPA 1KLNA 3C3LA 5C24B 5J2PA 3MAAA 3US5A 3M4XA 1TKZA 2PFFB 4TQSA 2CPYA 1FEHA 2FIUA 4K0KJ 3QFWA 2YNIB 3IR5B 2YWGA 1VIXA 3M6UA 4EZ6A 2BA9A 5KOWA 1RUSA 4NRTA 1LWFA 4FPIA 5A6WA 2YKMA 3KLGB 2MQ8A 4A48A 3PM9A 3R3TA 3V4IB 4HTJA 2VONA 1IBMJ 3VWSA 3LOUA 3MR7A 2MDAA 3N0VA 2CNOB 1NHUA 2HMIA 1TKXA 3POTA 4G6VB 3UDLA 1NMEB 4RW6A 5CYQA 1NH7A 2A0FB 3JB9k 3FZBA 3TX0A 4MKBA 2QLFB 4EFAC 1YQHA 3QAEA 1S1TA 4X62F 1DY3A 1WC5A 5D3GB 1HIYA 1U25A 2HHWA 3ZTSA 3HFKA 2QSFA 3FK4A 1QAXA 3K5OA 3U27A 3DDKA 3LQVA 2RKIA 2G0CA 2ZBQA 3HFVA 2LXIA 1F9HA 4ZJQA 3QGPA 1TTHB 4AT1B 1J5OB 2J9EA 4IRDA 5CD4A 5IQQA 2VPZB 4ED3A 4WBFA 3Q8VA 2AZ1A 4X64J 2KXFA 2ZWOA 4LFAF 1BQMB 2DNGA 4RWWA 3MMAA 4I64A 3PXGa 4DR6J 2C42A 2HBRB 1FRJA 2JSXA 3T41A 4QR2A 2L9DA 3NS5A 9ATCB 1WG1A 1GXTA 1U2CA 5RUBA 3SCKE 2W4PA 3RW7A 3AAWB 4LFCJ 3Q8QB 2HS3A 3T5JA 1M90T 2UUCF 3AJ1A 3NMAA 1ZTWA 2XMMA 4DSJA 4OZJA 3I0RB 1D8YA 2JVOA 2Y8YA 4CM2A 4A8WA 2XYHB 5A0YA 3K5MA 2MZTA 4M1KA 2Y9HA 3WX8A 3RAMA 3TJ9A 4OI6A 4J9NA 4J5OA 2RS8A 1REVB 3M8QB 4ILMA 3QWUA 3J81j 3BBFA 2FJBB 4XPCA 2HWHA 1R6VA 1H98A 4RNMA 4I6YA 1DTQA 2DB1A 1YBUA 3QLHA 4HDGA 4JV5J 2RHSB 5L38A 4QW9A 1SQEA 1IJFB 1U02A 3VF0B 4WYLA 2W4DA 3KLVA 2VG7B 4AYBD 3JQKA 2FGCA 1BWVA 1Q7LB 2YX1A 3GV5B 3KMQA 2BQ3A 3HM9A 3GU0A 4A8QA 2CQBA 4DR4F 1NAQA 5D8HB 2BM0A 4WZMA 2ZZMA 2LYVA 1B70B 5KT2A 1FNXH 2PGCA 1YZ6A 5FJ4A 4F8RA 1SIZA 1RT3A 3TP2A 1OS5A 2OAUA 3K5LA 2KYZA 4C0BA 4CH0S 1RAJA 1X9WA 2E1MC 1AZSB 5ETTA 4ED2A 1KDNA 2KJVA 2VOOA 1IWGA 3E2EA 4I69A 3W60A 2LQBA 1SJFA 4V19X 3N28A 4YY3F 4DV3F 4U95A 4CIOA 1Q5VA 3L7OA 1H7XA 3T3FA 2J0XA 4ZCMA 4P10A 1CJTB 1Q79A 3G6VA 3CCZA 2YH1A 2ZH1A 3DGVA 2CPJA 3G9CA 4N77A 1RAFB 1UAWA
chains in the Genus database with same CATH topology
4OYBA 4CLPA 1Y11A 2WZ1A 3C14B 2W01A 1Y10A 4NI2B 1CJUB 3ET6A 4OYIA 1CJKA 1WC6A 1U0HA 4P2MA 1CJVA 2GVDB 3MR7A 4OYWA 3ET6B 4CLTA 1CJKB 5IV4A 3G82B 1U0HB 1CJVB 1WC4A 4OYPA 1TL7B 2GVZA 3C15A 4CLSA 3C16A 1AZSA 4CLYA 4WP8A 4OYXA 4WPAA 4USWA 4OYAA 1CJTA 1CULA 5IV3A 4CLFA 4P2XA 1AZSB 1CS4A 1FX2A 1WC5A 4WP9A 3UVJA 1FX4A 4USTA 4OZ2A 4USUA 5D0HA 3C14A 5D0GA 4CM2A 4WP3A 4CM0A 4OYMA 3R5GA 4CLLA 1WC0A 1WC3A 1YBTA 1YK9A 5D0RA 4NI2A 4CLKA 1CJUA 2GVZB 4USVA 3C15B 5D15A 1AB8A 2GVDA 4CLUA 2BW7A 3MAAA 3C16B 5D0EA 4CLWA 4OYZA 2QV6A 4OZ3A 4OYOA 3G82A 4P2FA 1CJTB 1CULB 1YBUA 1TL7A 1WC1A 3MAAB 4CLZA 1CS4B 3UVJB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OYB A;  4CLP A;  1Y11 A;  2WZ1 A;  3C14 B;  2W01 A;  1Y10 A;  4NI2 B;  1CJU B;  3ET6 A;  4OYI A;  1CJK A;  1WC6 A;  1U0H A;  4P2M A;  1CJV A;  2GVD B;  3MR7 A;  4OYW A;  3ET6 B;  4CLT A;  1CJK B;  5IV4 A;  3G82 B;  1U0H B;  1CJV B;  1WC4 A;  4OYP A;  1TL7 B;  2GVZ A;  3C15 A;  4CLS A;  3C16 A;  1AZS A;  4CLY A;  4WP8 A;  4OYX A;  4WPA A;  4USW A;  4OYA A;  1CJT A;  1CUL A;  5IV3 A;  4CLF A;  4P2X A;  1AZS B;  1CS4 A;  1FX2 A;  1WC5 A;  4WP9 A;  3UVJ A;  1FX4 A;  4UST A;  4OZ2 A;  4USU A;  5D0H A;  3C14 A;  5D0G A;  4CM2 A;  4WP3 A;  4CM0 A;  4OYM A;  3R5G A;  4CLL A;  1WC0 A;  1WC3 A;  1YBT A;  1YK9 A;  5D0R A;  4NI2 A;  4CLK A;  1CJU A;  2GVZ B;  4USV A;  3C15 B;  5D15 A;  1AB8 A;  2GVD A;  4CLU A;  2BW7 A;  3MAA A;  3C16 B;  5D0E A;  4CLW A;  4OYZ A;  2QV6 A;  4OZ3 A;  4OYO A;  3G82 A;  4P2F A;  1CJT B;  1CUL B;  1YBU A;  1TL7 A;  1WC1 A;  3MAA B;  4CLZ A;  1CS4 B;  3UVJ B; 
#chains in the Genus database with same CATH topology
 5F8I A;  4WF9 Q;  3CPW R;  2DVI A;  3C46 A;  3FRZ A;  4M5D B;  2ZH2 A;  3UCZ P;  3ET6 A;  3C8Y A;  2UXC J;  4RKU C;  1XR5 A;  4M5G A;  4LF1 A;  1WKK A;  3GFX A;  5HAO A;  1FK9 B;  2AIR B;  2C2D A;  3CF5 Q;  3CJ3 A;  1UFW A;  2RDI A;  1ROF A;  4ECU A;  2AD9 A;  5DZ7 A;  4WP8 A;  4RO0 A;  2AEF A;  3ONQ A;  3DYA B;  3CIZ A;  1HHT P;  1QAJ A;  3HVR A;  1W26 A;  3A13 A;  1CS4 A;  2EBG A;  2VG6 A;  1KQK A;  2RDD A;  4DZD A;  2ASY A;  4WU3 A;  3PYE A;  3H5Y A;  3CCJ S;  2HRT A;  2A2C A;  4F2S A;  4NXM J;  2DGV A;  4DPY A;  3G2X A;  4QIW D;  1RJJ A;  4JV2 A;  4CCH A;  2B6A A;  1T3N A;  2GQQ A;  1IKW A;  4F36 A;  2PI5 A;  1U2R A;  4RW7 A;  4PYD A;  4KO0 B;  4FNI A;  4LF7 F;  4CLZ A;  1M5K C;  5CAB A;  1HFE L;  3IXQ A;  4DJB A;  1HWJ A;  1J5E F;  3PZP A;  1SQG A;  2DIT A;  4JYA F;  5IT0 A;  3UDV A;  4A46 A;  1NJY A;  4EU0 A;  1HYS A;  4USI A;  1CVJ A;  3UR0 A;  1RTJ A;  1UEV A;  2ZH3 A;  4URG A;  2VF3 A;  2OPP A;  3TUI C;  1HWL A;  2YKN A;  4CNZ A;  4W4M A;  3SIP B;  3MTJ A;  1V3S A;  5KFV A;  4H4O A;  1IM6 A;  4LFA J;  4OZ2 A;  3GB0 A;  2AYE A;  3AD7 C;  5JMN A;  4GO7 X;  3WBZ A;  3NAH A;  4PCQ A;  3OUY B;  3R1L A;  3D68 A;  5J2M A;  4X4O A;  1M1H A;  3T9N A;  3GII A;  5A2Q Y;  2UUC J;  2CRL A;  5ETM A;  3AD8 C;  1WKJ A;  3IA0 A;  4NMX A;  4IDK A;  3DM2 A;  4IFY A;  5LSO A;  2AGQ A;  2UV8 G;  2ZJP Q;  3A8I A;  2XZT B;  2W7P A;  1N5V A;  4D3G A;  1VRT A;  3A3N B;  3SV4 A;  1JB0 C;  1XR6 A;  3DGP A;  1CJV B;  3T6J A;  5KFS A;  4MJK A;  2WVE A;  5G0R A;  2KH9 A;  4BDP A;  4B9L A;  2L3M A;  1NJZ A;  1B0T A;  2MKC A;  1S48 A;  3J7A N;  2LVW A;  1RYR A;  4JV0 A;  1C0T A;  1Y3J A;  1HI8 A;  2E1P A;  1YX2 A;  4B17 A;  2FQQ B;  3SQG B;  2UXD F;  2HQ3 A;  4LR9 A;  1IXK A;  3CIM A;  4KKO A;  4OLO A;  3HVT B;  1PCA A;  4K50 A;  1NSP A;  4X4Q A;  2ZD1 B;  4TXS A;  2PMH A;  3KK3 B;  5HP1 B;  3J7Y U;  4CO3 A;  4LF6 F;  2CQ3 A;  5GVQ A;  4I7F A;  4Y6I A;  1RKI A;  1U4B A;  2CPI A;  2NPF A;  2KYX A;  5I42 A;  1SC1 B;  3KMS A;  3JTP A;  5KFP A;  2AP6 A;  1IBL F;  3MWB A;  4KT0 C;  3L09 A;  4FBU A;  1L3T A;  1HNI A;  2HG4 A;  4CO1 A;  1C1C A;  4Z2X A;  2MZ1 A;  4E0D A;  3G86 A;  2DCU B;  4OJG A;  5C7P A;  4DLG A;  2B8P A;  3OXG A;  2V50 A;  3OFE A;  4RW4 A;  2FLN A;  4ZVF A;  1TEL A;  2YKM B;  2V2K A;  8ATC B;  4ZJL A;  3QMQ A;  4QR0 A;  4I1T A;  1RHU B;  2JWN A;  2OGU A;  2CJA A;  3KK1 A;  4N56 A;  1FX4 A;  4NXN J;  2DXE A;  2HMI B;  5AXK A;  3POT B;  4ZIW A;  2CQ1 A;  1HNV A;  3V81 B;  4RW6 B;  4WZQ A;  4P73 A;  4GMK A;  2VIC A;  4AXJ A;  2LCW A;  3D1H A;  4QJV A;  3QRP A;  1IQZ A;  2CJQ A;  5DS7 A;  1S1T B;  3H20 A;  4WFX A;  2RUS A;  3BZQ A;  4S0M A;  1Q4R A;  1RAC B;  2RRB A;  1EP4 A;  5L46 A;  2B4P A;  3MMJ A;  4C2M A;  3R5D A;  1OJ4 A;  2YNF A;  4Y2C A;  1S6P A;  2H51 B;  1HBM B;  2D74 B;  2RD5 C;  2MTL A;  2FHJ A;  2Y1I A;  2RKI B;  2B9X A;  4DV7 F;  2FVQ A;  3NGU A;  1ZS6 A;  4UY8 5;  4ZVG A;  4UOC A;  3EIC A;  2U1A A;  3L9Z A;  4J9S A;  4ZHR B;  1WEY A;  3N4W A;  3N01 A;  2ALY B;  3B4M A;  2XLK A;  1XNR F;  2MLZ A;  2IDL A;  1HNX F;  3BGR B;  1J5E J;  2ZOM A;  4JOU A;  1APS A;  3LP0 A;  2JOQ A;  2IC3 B;  2KXN B;  2XS7 A;  4C8K A;  2W9C A;  5EWF A;  3RB6 A;  4IOC Q;  2ZHA A;  2DH7 A;  4YR2 A;  4DL4 A;  1ZA2 B;  3UPF A;  1S6Q A;  1N34 F;  2RB7 A;  1K1Q A;  2IPO B;  4X65 J;  3ICL A;  2HLU A;  4CDI A;  2FTR A;  2CQ4 A;  1BY9 A;  2OPS B;  1PJ6 A;  1FWL A;  5FLX Y;  1SJQ A;  2C3P A;  3BH7 B;  4P2M A;  1XWL A;  3KXD A;  2B0G A;  2F9D A;  2DCL A;  3W66 A;  3MAQ A;  1QSS A;  1DTQ B;  3ILL A;  5LJ5 Y;  1ZET A;  1MRO A;  5F3Z A;  1RAB B;  4TLQ A;  2B43 A;  1I94 J;  2YQ3 A;  1IR1 A;  3GJT B;  4ZPT R;  2DGX A;  4ZCL A;  4WFA Q;  2UUA J;  2A2D A;  2OKQ A;  3JQJ A;  3QIP B;  1Q82 T;  1YTY A;  4X66 J;  2DH9 A;  3R2D J;  2D69 A;  2FHJ D;  2V9K A;  4ATN A;  3B8H A;  4RW8 A;  5KFE A;  2HHT A;  5IOL A;  5ETQ A;  1VIO A;  4WTY A;  4DF4 A;  2ZKU A;  4UUX A;  1K44 A;  3H2L A;  4FKX A;  3SFG A;  1Q8B A;  3CUN A;  1HR0 F;  1QUV A;  4C48 A;  1TZ0 A;  3T1H J;  2QX0 A;  2MJU A;  3KYL A;  4PG8 A;  3D4J A;  4ZP8 A;  2DH8 A;  3VCD A;  1D09 B;  4GC7 A;  5GAG I;  4K8R A;  3JSM A;  4JI2 F;  2OEK A;  2YWH A;  2XGQ A;  2V2Z A;  1M0S A;  3A4T A;  3FVY A;  1N32 J;  4WU2 A;  3IBC B;  2GA7 A;  1CG2 A;  1KEK A;  4DL7 A;  4DV2 F;  2ZBR A;  3Q86 A;  1S1W B;  3A8K A;  1CLF A;  1RWM B;  3I4P A;  1N54 B;  1NSQ A;  1ZPW X;  5F8N A;  3HD2 A;  5D77 A;  2QL5 B;  1YSJ A;  4QU7 A;  4FYD A;  1NUE A;  3GIK A;  1V3Z A;  2J6U A;  1ARO P;  2V4R A;  3DI6 A;  2J76 E;  4DUT A;  5IM0 A;  2SXL A;  4L72 B;  2DXD A;  3PJ9 A;  1N33 F;  1QTM A;  5B0B A;  5KT4 A;  2QMW A;  3MEC A;  2XMT A;  3VGU A;  3LPE A;  1F5C A;  1S1X A;  2RJZ A;  1WOO A;  4JI8 F;  1UZH A;  5BYR A;  2L9W A;  4PKD B;  3OVB A;  1KWM A;  3P49 B;  5HVH A;  3VAH A;  1AA1 B;  2XMW A;  4DV5 F;  3R9L A;  2DHS A;  3L3C A;  2QLJ B;  1S7I A;  1CS4 B;  1EKR A;  2VG6 B;  4K4Z A;  4OYB A;  2J7U A;  4OLP A;  3ZZO A;  3RR7 A;  1Q1K A;  4DFJ A;  3NGK A;  1FKO A;  5LMN J;  3IN5 A;  4BC7 A;  2GCF A;  2G1D A;  3TYT A;  5GAH U;  3CJK A;  1PC4 A;  4JI6 F;  1IKW B;  5CCL A;  2OPQ A;  3MM5 B;  5J2N B;  1NK7 A;  4UOG A;  4RW7 B;  3JTO A;  4DQQ A;  4CLS A;  2JLG A;  2U2F A;  4BHQ A;  3TAM A;  3PYF A;  3GPA A;  4UZC A;  4B3R F;  2HNY A;  3M8P A;  2VBW A;  3RRH A;  5F9L A;  2DO0 A;  4CQ1 A;  1RTJ B;  2PII A;  4DV7 J;  1RTH A;  2I0X A;  2RUG A;  5D6G A;  2VL1 A;  1RCX B;  1B99 A;  3OL9 A;  3CMA S;  1U1L A;  4ELV A;  3T1Y F;  1MNE A;  2JC0 A;  2C1E B;  4PUO A;  2RNE A;  2ASD A;  2B3T B;  3DLB A;  4K4S A;  3M2U A;  5F41 A;  2BW2 A;  2E5L F;  1OY9 A;  3PR4 A;  3MCM A;  5CH7 B;  3Q23 A;  1XJW B;  4ED0 A;  4HH1 A;  4MK8 A;  3K58 A;  3NNH A;  2DNZ A;  3NCR A;  1TL1 B;  2IVY A;  2LEB A;  2JH3 A;  1N34 J;  2DRD A;  2QMU B;  3P45 B;  1JX4 A;  4Q43 A;  1U09 A;  4UW2 A;  1D9F A;  4WXW A;  4Y2I A;  3KUH A;  2XUL A;  4CO2 A;  3DM2 B;  3C6U B;  2O3D A;  3TVY A;  2JLE A;  3H4B A;  5HRO B;  1I6J A;  4DR3 F;  2QFI A;  1KFD A;  4U6P A;  4P2S A;  5BYS A;  1UFL A;  2ZBI A;  3NOG A;  3AT1 B;  2CG4 A;  4ZVP B;  5AT1 B;  3LTO A;  4ZN1 A;  3MR6 A;  4ZIV A;  1FER A;  4CP5 A;  3CJT A;  1AXQ A;  3P96 A;  4AQY J;  4DCO B;  2XSJ A;  3DRP A;  4HHJ A;  1WG4 A;  1RAG B;  1C0T B;  5BXI A;  2IRX A;  4EYH B;  3OJU A;  1TL7 A;  4DX5 A;  2NZC A;  3PW7 A;  2W4C A;  3AB4 B;  1DZ5 A;  3NRB A;  5HN0 A;  4KKO B;  1Z1Z A;  2E5H A;  4AUK A;  2APO A;  4DLE A;  4I2Q A;  5C25 B;  3SQO P;  2VFU A;  3OXL A;  2BQR A;  2KTQ A;  2HK2 A;  2HWI A;  4BC9 A;  4I7F B;  2CQ0 A;  4GVB A;  4MT1 A;  4G1I A;  5F8H A;  4ID5 A;  5I42 B;  1U0H B;  3UR3 C;  3OVS A;  2AJF E;  1SC4 B;  2WW4 A;  2DR9 A;  1K9M T;  5KFD A;  2ACY A;  1HR0 J;  4OQJ A;  3MM9 A;  1DTT A;  3AY0 A;  4NZ6 A;  2CQC A;  1CEZ A;  2K7J A;  1VC0 A;  1HNI B;  1NM2 A;  1C1C B;  3HF5 A;  2GO9 A;  4WP9 A;  3OHA A;  3M1V B;  3SXL A;  5KG7 A;  2IY5 B;  2VBZ A;  3FFI A;  4DR2 J;  1F60 B;  3R5G A;  1MU2 A;  1Q81 T;  1XK8 A;  4J9M A;  2BM1 A;  1H73 A;  5ITH A;  4DV2 J;  2OHD A;  2EEY A;  3CMQ A;  1XNQ J;  3ZTP A;  2N7C A;  2FC8 A;  3IM9 A;  4DQI A;  3R6L B;  5HJY A;  1JNZ B;  2KKH A;  2EW9 A;  1ICE B;  4L76 A;  5ETL A;  4PWD A;  3DRY A;  3KK1 B;  3I96 A;  1HW8 A;  2CQD A;  3D0G E;  1U45 A;  2EFN A;  2N3L A;  2W01 A;  3NAI A;  2GNK A;  3H59 A;  2DNM A;  5ETO A;  5K20 B;  1QJH A;  1ZOT A;  4PWW A;  4EZ9 A;  2J8A A;  4O4G A;  3K17 A;  1T9Y A;  4KGK A;  1SVD A;  4J7C A;  3J7Z 5;  2MQL A;  4DUY F;  4L74 A;  1VQ7 S;  4TU7 A;  2QG9 B;  2QRR A;  3VVU A;  4UTG A;  4ZVU B;  5EDW A;  4OHV A;  4PEO A;  1LOU A;  3F44 A;  1U0S A;  1HQ2 A;  3ZNU A;  5DGB A;  3UNG C;  1VQ6 S;  1LFP A;  3MM6 A;  3LAN A;  4RLE A;  4OYX A;  2YNF B;  2WSE C;  1S6P B;  2DEJ A;  4IH5 A;  4NA1 A;  3K5P A;  5AXM A;  2M2B A;  1HBU A;  1RA6 A;  1N36 F;  5KG0 A;  1J27 A;  2L48 A;  4LR8 A;  4RX6 A;  2EVZ A;  1R31 A;  4NOH A;  1HNW F;  3MD1 A;  1PG5 B;  4G1P A;  4MIW A;  2AZ3 A;  2FPH X;  1B7F A;  5CYM A;  5D15 A;  2CG8 A;  4FPR A;  2KFZ A;  3CC4 S;  5D0E A;  3EGZ A;  3FC9 A;  2ZUG A;  1SL0 A;  1O51 A;  3PG9 A;  4KV8 A;  2EBE A;  1FJC A;  5LL6 d;  3GQC A;  2ATC B;  3ILI A;  4B3R J;  5G4D A;  4H54 A;  2GHV C;  1X0F A;  1T9T A;  4DSE A;  3B4D A;  1WEL A;  2W9C B;  4LIW A;  3WIV A;  4LF9 F;  2HFN A;  1KRP A;  5DG9 A;  5DM6 Q;  5F0U A;  4K4W A;  3Q2S C;  2PA8 D;  3HP6 A;  1S6Q B;  3A12 A;  1FJG F;  4YN3 B;  3HHL A;  2KDO A;  3HKW A;  5GMD A;  2PMZ D;  2XNQ A;  2BZ2 A;  1F9F A;  4Q5V A;  2UP1 A;  3W2V A;  4HR2 A;  3VGV A;  2W2N P;  4FYV B;  2YQ0 A;  1V6H A;  2UZA A;  1AUD A;  2E5L J;  2KU7 A;  2E7V A;  1TL5 A;  3PRB A;  5J1E B;  1N0V C;  3KHL A;  3TUP A;  1SV5 B;  3ULH A;  1V3R A;  4KJI A;  3JS9 A;  4F7V A;  3RB3 A;  2B8Q A;  2V4Q A;  3V5R A;  1T3O A;  4I2P A;  3QJL A;  3PW5 A;  3RBZ A;  1RHR B;  2BVZ A;  4NLO A;  1NCL A;  2LMI A;  4IUF A;  1PIE A;  4TN2 A;  1ZM3 A;  4OMF G;  1JXV A;  1TVR B;  4MK7 A;  1SJ3 P;  3K8W A;  1N5T A;  2CNL B;  4RW8 B;  1F9E B;  4DV6 J;  4EO8 A;  2XO7 A;  5JXS A;  4ES1 A;  3EDQ B;  5L1J A;  2AEJ A;  2BE2 B;  1KSP A;  3S7R A;  1EJ7 L;  1EQ0 A;  4LF5 F;  1XEZ A;  3TUZ C;  3HJV A;  4QU6 A;  2CPF A;  4FVC A;  1B0P A;  2GS8 A;  2QFJ A;  2D3O 1;  4JI5 F;  3RB0 A;  1S1V B;  1KQG B;  3GG1 A;  5M2U A;  3CWJ A;  3D6M B;  1ZAV A;  3JSM B;  5KFT A;  3H40 A;  1C4C A;  4NPO A;  8AT1 B;  3UN5 A;  2MKY A;  1VBX A;  4DR5 F;  4MYU A;  2MZJ A;  2H3E B;  4IG0 B;  4QR1 A;  3B6B A;  2ZKT A;  1G3O A;  2KFN A;  1XN9 A;  1DFD A;  1S9G A;  2IAJ A;  3FCH A;  2V68 A;  3DNC A;  3OR2 B;  2HIQ A;  4OX9 J;  1FO1 A;  5IM0 B;  2YWE A;  3KKF A;  4NYZ A;  3QFH A;  2MZQ A;  3SSR A;  3FSY A;  4U8V A;  3HKZ D;  3EXY A;  3SCJ E;  3BBB A;  1GK8 A;  3DRR A;  2M52 A;  3BKU A;  2HQG A;  1NND A;  2KM8 B;  4OI4 A;  1LWE B;  2V63 A;  4YFU A;  3KLI B;  4F4X A;  1SH3 A;  1MWZ A;  1NJW A;  3DFE A;  3IR6 B;  2XC9 A;  1S1X B;  1EET A;  3LW5 C;  3RB4 A;  4AD6 A;  3GIJ A;  5B0C A;  4RW9 A;  4LRE A;  3KK2 A;  4NLU A;  5JVG Q;  2J9D E;  4O0N A;  2OSR A;  3M7V A;  3N5F A;  3NWR A;  3GLJ A;  3OTO J;  3TRG A;  2DGQ A;  2H9Z A;  1RKJ A;  1NPP A;  4AFF A;  1J2V A;  2ZBP A;  4PG4 A;  3O44 A;  1YRT A;  1QY7 A;  5D0H A;  3IG1 A;  3CJK B;  3K8V A;  3QZ8 A;  3HZE A;  3OFH A;  2OPQ B;  3G6E S;  3MPU B;  1MLA A;  2NUH A;  5DG7 A;  2BOP A;  4DUY J;  3ZZP A;  2BW7 A;  2UVV A;  3CCU S;  3FMB A;  4F3Q A;  5A76 A;  1U26 A;  4HEA 9;  3BQ0 A;  4JBC A;  2JL9 A;  1UL3 A;  3ZO7 A;  3ENQ A;  2HNY B;  3M8P B;  3ZTQ A;  2F1F A;  2W8L A;  1MW7 A;  3M2R A;  1RGV A;  1EKS A;  2M3D A;  2Z58 B;  3CJ4 A;  1N36 J;  5DG8 A;  4ZVE A;  1S1U A;  1RTH B;  1K0V A;  2WBR A;  1HNW J;  3VAM A;  2HHS A;  2PA3 A;  2C2R A;  1B7Y B;  4HLB A;  4OX8 A;  4IO1 A;  2ZC3 A;  3EWG A;  4ZPA A;  2AWZ A;  4NLG A;  3HFZ B;  3I6P A;  5U47 A;  2GJF A;  2G9O A;  4FNH A;  2OEJ A;  4IFV A;  3GV8 B;  2NRE A;  3MUM P;  2GVZ A;  3ZNJ 1;  4ANE A;  2BXJ A;  1KON A;  3M2U B;  3HVA A;  2R7S A;  4P74 A;  2NLW A;  1M1K T;  4U7U D;  2R7V A;  4LF2 A;  2KN4 A;  4XDD A;  4V1A k;  4YP3 A;  2F3J A;  4BWM A;  4KC5 A;  2CIM A;  4R5P A;  3R7S B;  3RRG A;  1ZBT A;  3OR1 A;  3VV2 B;  5DJB A;  3KG1 A;  1FEE A;  3LF0 A;  2H5J B;  4FXV A;  1FDB A;  5B0A A;  3KHH A;  3CME S;  2DNY A;  4DU7 A;  2ZBC A;  1KNZ A;  2OSQ A;  4C8O A;  3EUN A;  5DZ6 A;  3MEG A;  2XI3 A;  3CSK A;  2H5E A;  1RT7 B;  3JSR A;  1QAY A;  1Q8L A;  2E66 A;  1LWC A;  5KG6 A;  1OYD A;  3CC7 S;  1VQP S;  2HVD A;  2H54 B;  3WC0 A;  4ECY A;  1S9F A;  2KHC A;  1CBK A;  4OYI A;  4JUZ A;  3R27 A;  1RT5 A;  3M2V B;  2KG0 A;  2K06 A;  2XSJ B;  1FFG B;  2RQC A;  3BPS P;  1JLQ B;  4OYW A;  4QIE A;  1S77 D;  2HHU A;  2BJ9 A;  4DWI A;  4NA3 A;  1U1O A;  1JMT A;  1TL7 B;  4R8U B;  2OMO A;  4CT9 A;  4B3S F;  4D3H A;  4PG6 A;  3PYD A;  1F6T A;  2CPD A;  2R7T A;  1C1B A;  2FVP A;  3FSI A;  2H48 B;  2HFV A;  3NGD A;  5GAE I;  2Z0G A;  4A8K A;  2ZE2 A;  3JYT A;  4ID5 B;  2CZV C;  1S4F A;  1UKU A;  4LF5 J;  4JI1 F;  3OTE A;  2BAN A;  2MKS A;  4LRB A;  2EFO A;  3M30 A;  1RWX B;  2IDE A;  1WTF A;  4ANC A;  4JI5 J;  5I3Q A;  1DTT B;  1Y5I B;  7AT1 B;  3WZ0 A;  1G7C B;  4WTO B;  2IJN A;  2UU9 J;  4LSL A;  4P2F A;  4PZV A;  2OML A;  4C3K A;  5CXT A;  5LXR A;  1E6Y A;  1ULR A;  1S0N A;  5EWE A;  3HUL A;  2F7V A;  2N4D A;  2DR5 A;  2GHW A;  1MU2 B;  3EX7 B;  4EYI B;  1FWP A;  2PFD A;  1LK7 A;  1ZPV A;  3H2V E;  1G1X A;  1AT1 B;  3BR9 A;  3OTB A;  1FXD A;  3VZI A;  4MH8 A;  1VRU A;  4C8N A;  4UUW A;  2VZ9 A;  1X4A A;  4DI6 A;  4EBC A;  4PWD B;  3GG0 A;  3AA8 A;  4FXD A;  2X1A A;  3T5K A;  3M8Z A;  3D2W A;  3SSQ A;  4I0W A;  1HD0 A;  1WI8 A;  1G6B A;  3IAS 9;  5MLC V;  4O4G B;  1P6T A;  3SI8 A;  3BGU A;  5DQH A;  3HSJ A;  3BV8 A;  4CLL A;  1UVN A;  3CD0 A;  1JKH A;  5DQG A;  2GVD A;  3BGF A;  3PKY A;  4F2R A;  1R0A B;  1LKZ A;  1AW0 A;  2J6T A;  1S5Z A;  1RU1 A;  1JLE B;  3C2P A;  5KTQ A;  4XO0 A;  4MIB A;  4IG3 B;  1IQT A;  2OPR B;  4OI2 A;  1HQU A;  2ZDO A;  2RIJ A;  5CYM B;  3ZXW A;  4K4V A;  3H5S A;  3NBP A;  1QE1 A;  3P6Y C;  4ECR A;  3MCS A;  1KC8 T;  2E7X A;  5K9F A;  2IM0 A;  3GJS B;  2VPW B;  3X1L B;  2XY7 A;  3DOM A;  3IFE A;  1FA0 A;  4OI3 A;  1BMQ B;  4L75 A;  3BO3 A;  1WC4 A;  3KFW X;  4ERD A;  3KLF B;  2QT7 A;  3JXO A;  2DYA A;  3DHW C;  4HYK A;  3DLH A;  4ICL A;  3DC2 A;  1P8G A;  3GFH A;  2OJ3 A;  3FEY B;  1RT2 B;  1NSK L;  3SCL E;  4JI4 J;  4YHH J;  2HUR A;  3AOD A;  3NP5 A;  1SKR A;  2FHO B;  4QCL A;  2XEX A;  3UDC A;  5D4N A;  3ISN C;  5E41 A;  3WHI A;  2ZH6 A;  4JV1 A;  4U8Y A;  5LOQ A;  1TUV A;  3RZA A;  3W2V B;  1JNR B;  4OYZ A;  4DV0 F;  2NCK L;  4UQG A;  3CED A;  3I0S A;  4DMZ A;  3TA0 A;  3SDE A;  2VPX B;  3MPW A;  4O0I A;  4YB7 A;  4HH0 A;  3NS6 A;  1ZA1 B;  1P9Q C;  2DHA A;  1TU0 B;  2Q1L A;  2RU9 A;  2PT0 A;  2B5J A;  2FVC A;  3PIP Q;  2RAQ A;  4TY8 A;  2NS1 B;  4ZVR B;  3IRX A;  2ZH9 A;  5HQM A;  5E5N A;  3BQ1 A;  3T9Z A;  1CJK B;  1WSR A;  2KL8 A;  4IOB A;  5IT9 Y;  2MKH A;  2NR0 A;  2FGO A;  2R2R A;  3KUE A;  3NS7 B;  1VDH A;  4NCA A;  3OFG A;  2UVW A;  1U6Z A;  2WRM A;  1RCO B;  2IJF A;  2BR0 A;  3JTN A;  3N9U C;  2WVB A;  2V4J A;  2DIS A;  3E01 B;  1SL1 A;  2VH7 A;  3W8G A;  4G3I A;  2K3K A;  3GE9 A;  4CTA A;  2HYI B;  5A8R A;  4MKV A;  3V6K A;  3M6X A;  4UOH A;  5B0F A;  1PJ5 A;  4GRS A;  1FTC A;  3LGM A;  5LMU F;  1T94 A;  4OI0 A;  3R5J B;  4LBI A;  5BYQ A;  1S9G B;  2IAJ B;  4QW8 A;  3VR1 A;  2ZVI A;  5THW A;  3BBC A;  2VQF F;  2YXL A;  3N5B A;  3TI0 A;  4RZR A;  3J81 Y;  2CPX A;  5HMX A;  4X4V A;  2ZH4 A;  5E33 A;  5B09 A;  3DRR B;  2F4V J;  4KR0 B;  3Q8S B;  2ZOF A;  1YJT A;  3R5B A;  3CO0 P;  5DGA A;  1NJX A;  1ZTT A;  2LU1 A;  2ZC4 A;  3BSO A;  1RWO B;  5KFU A;  2OD6 A;  1IKV A;  4F02 A;  1CJU A;  4DG1 A;  3IWN C;  2ZIT A;  3QNW B;  3TQ1 A;  4DBQ A;  5LM7 E;  4FVM A;  2ILZ A;  5KFA A;  1VMB A;  1TKT A;  1WG5 A;  4I6A A;  3WC2 A;  3QWP A;  3UD3 P;  1HBN B;  4MFB A;  2I5J A;  2RML A;  4WWS A;  4WKR A;  3ZZ0 A;  1RBO B;  5DQI A;  4IR9 A;  4J9V A;  2XS5 A;  4WJB A;  2N7Y A;  2HRY A;  1X9M A;  3KG0 A;  5HL7 Q;  4FYX B;  4EWT A;  3M2R B;  2DNO A;  3CCR S;  4YDX A;  4KGM A;  1DLO A;  2UVR A;  5KFW A;  2W9B B;  5IQ6 A;  1S59 A;  3DXB A;  5F8G A;  2DNN A;  1S49 A;  3K7R A;  3C14 A;  2EPI A;  1K73 T;  1JLC A;  4IKA A;  3IS9 A;  4IFV B;  3K59 A;  2GVZ B;  2DGU A;  2G1H A;  3TEH B;  2VBX A;  1T03 A;  3LP2 A;  1U24 A;  2WB1 D;  2CVI A;  1V5V A;  2JDJ A;  5DLG A;  1VC5 A;  3G71 S;  4AL5 A;  1FRK A;  4C0H A;  5CYJ A;  3FEZ A;  4OI1 A;  3OR1 B;  3DXS X;  1DQ9 A;  1Y3K A;  2DNR A;  3QO9 A;  1PGZ A;  2HRU A;  1D3W A;  1TK8 A;  2CJB A;  9RUB A;  3GZ7 A;  2R8I A;  1M5V C;  4WIQ A;  3TNV A;  3DRS A;  4R25 A;  2DPI A;  3BKT A;  2UXB F;  1SJ4 P;  3HDS A;  3J7Y I;  5LT5 A;  1YG0 A;  1ZM9 A;  4A8F A;  1MG7 A;  3R7B B;  1LWC B;  4O3O A;  4NLV A;  3AA9 A;  5KT6 A;  4O23 A;  2RQ4 A;  2BDP A;  3PKM A;  5H9F K;  3QQC D;  1KKH A;  1D1U A;  2PD1 A;  1KQF B;  1RT5 B;  3EGV A;  1FRL A;  1GMU A;  5ETN A;  3EZU A;  4YR3 A;  2DGO A;  3IMQ J;  1HAR A;  1RYS A;  4FF1 A;  4UF4 A;  2DNK A;  4ZOS A;  4QWA A;  4Q0B B;  2J6S A;  3EE3 A;  2D3O R;  4OHW A;  4C97 A;  1GFW B;  1PAE X;  4Q8E A;  3GYN A;  1S7H A;  1OQ6 A;  4NCG A;  1TR0 A;  3DU5 A;  3MD3 A;  2OP5 A;  5HBM A;  2KXH A;  3VTI A;  3MUR P;  1RT1 B;  2P8I A;  3THP A;  3FZ2 A;  3JSY A;  4OHZ A;  4E98 A;  1Y9O A;  4FKY A;  1BXN A;  2VG5 A;  3JYT B;  3KTQ A;  1KOH A;  1MMN A;  4OV6 A;  4J9P A;  4HAC B;  3I32 A;  3UD4 P;  2WHO A;  2IMO A;  1Q53 A;  2A3J A;  2ASJ A;  4DPO A;  1VLO A;  1H6K X;  4CYU B;  2MPU A;  4NRU A;  2C2E A;  5AXN A;  3ILJ A;  1P9Y A;  5AE1 A;  2WSF C;  3W61 A;  2ASL A;  1SKS A;  4KSE B;  1BQX A;  1NLK L;  3PEH A;  2PN6 A;  4W90 B;  2M0G B;  1JIH A;  3AOC A;  1NKE A;  2BKO A;  1YRX A;  1VRU B;  3R8Y A;  1XC9 A;  1WKL A;  4NX9 A;  2ZH7 A;  3HXM A;  2XMA A;  3PTW A;  2M88 A;  3HO1 A;  3EZ5 A;  4Y2A A;  4WFB Q;  2FJV A;  3O2I A;  4OFZ A;  2YWK A;  2NSB A;  4U7C A;  4DV1 F;  2HGM A;  1HQE A;  3BKF A;  2CYY A;  2Z30 B;  1W2B R;  3PVX A;  4WKY A;  1JXL A;  5KG3 A;  5GME A;  4C8L A;  4WFZ A;  2C3U A;  1HI0 P;  4LQ9 A;  3MXH P;  2A10 A;  1LXJ A;  3CC2 S;  1KOO A;  3MFH A;  1JKH B;  1NDP A;  2CXE A;  2GVD B;  4ES3 A;  1VC6 A;  4YS2 A;  2HAI A;  5EGY A;  1EAY C;  1TL3 A;  1FRX A;  1DJ0 A;  1VQN S;  1DAR A;  3R2C J;  3EMT A;  2W7A A;  3T1A A;  1IR2 A;  2VJV A;  2QTW A;  2W9A A;  2HVE A;  1OY8 A;  2F8E X;  4F3O A;  4IOA Q;  4DR7 J;  1RWW B;  4DV4 F;  1FCA A;  1ELO A;  1FT8 A;  4GKK F;  3KJV B;  3M32 B;  2F9J A;  3ITH A;  3MDF A;  2JLF A;  2VFV A;  5D4L A;  3QPI A;  2VOP A;  4N7T A;  1TMM A;  5EN1 A;  2MZS A;  5D0R A;  2P2C B;  3KNG A;  3EPI A;  3C66 A;  3GFY A;  4B3T J;  1RTI B;  5GAE U;  3G82 A;  3ZC4 A;  2HNZ A;  1JLB A;  1OMS A;  4GKJ J;  4MKY A;  2MSS A;  1RWU A;  3AXK A;  4F4A A;  4QYR A;  1Y11 A;  5K5M A;  4F67 A;  4JI0 J;  2YNH A;  3KLH A;  1H2T Z;  4PWU A;  3GFZ A;  2QIF A;  4F0M A;  4X4T A;  1Q86 T;  2CUY A;  3I0S B;  4QWE A;  2XYP B;  4LVN P;  3HMJ G;  3SV3 A;  4WFN Q;  1X5T A;  1UVM A;  1TFY A;  3OVA A;  3C16 A;  1QUP A;  1R6Y A;  3HPO A;  4DUZ J;  3NCP A;  3E51 A;  1N6Q A;  3UN2 A;  2XZD B;  2Q3P A;  2OD4 A;  3IRX B;  1RSC A;  4OIX A;  1QAI A;  2W2M P;  1IUJ A;  5BJR A;  2AYG A;  4ZCK A;  1T0T V;  1TUW A;  3QT7 A;  3AQP A;  2KRR A;  4NAS A;  2AJ0 A;  2HHH J;  4Z7C A;  1JJC B;  2CQI A;  2ZUA A;  4A8Y A;  4ZLN A;  3KWM A;  3UN3 A;  3FBF A;  3NLC A;  3W9H A;  2HLT A;  1N5Y B;  2V34 A;  4RR5 A;  3Q24 A;  1EZZ B;  5KT3 A;  3CDE A;  2NXJ A;  4Q7A A;  5FD1 A;  2O1P A;  1RWN B;  2ZHO A;  2VA3 A;  1NK9 A;  3K2Y A;  3M8Y A;  2XMK A;  1RE1 B;  3S6E A;  3QBC A;  3HJF A;  3QZ7 A;  1H0H B;  2QO3 A;  5HSP A;  1RP5 A;  2B7B B;  1SKW A;  3AOA A;  4DFK A;  2GGP A;  4ED5 A;  2Z2M A;  1O5J A;  3DLE A;  3SCI E;  4ED6 A;  3ZFV A;  2DD8 S;  1VQ5 S;  1GTH A;  5KFI A;  4CT8 A;  2YPZ A;  4LSN A;  2MXY A;  2DNP A;  4I6W A;  3UCU P;  2RF2 A;  4C11 B;  2VHG A;  4Q44 A;  1UJ5 A;  4L3N A;  3OD2 A;  3VQS A;  2O67 A;  2FZC B;  5A8W A;  2UUB J;  3RYL A;  2B51 A;  5GAH I;  1BD6 A;  2QYC A;  2HVH A;  3R5C A;  2CAJ A;  1WNE A;  5D4O A;  5DDQ C;  2YVS A;  4LF4 J;  4O44 A;  5IWA F;  5I4M A;  1SQF A;  2R7Q A;  2Q6B A;  2NYH A;  1QSL A;  4HHU A;  5L1I A;  5AXL A;  3BGO P;  1HW9 A;  2LDI A;  4KH1 B;  1IKV B;  2DHX A;  3TUJ C;  1CJU B;  2R3V A;  4DXL A;  1F2G A;  1M5P C;  4H4M A;  1VOM A;  4C3M A;  4FYW B;  1VS3 A;  2O66 A;  5B0G A;  3X3U A;  3G87 A;  4F25 A;  4DR1 F;  1NJI T;  3LAM A;  1Y7P A;  1TKT B;  1N56 A;  4BS2 A;  4MK9 A;  1RTD A;  3I4H X;  2BKP A;  1QSY A;  2LKZ A;  4M63 A;  4DL2 A;  4C9D A;  3P3D A;  3CCE S;  2M7S A;  5IT9 U;  4MFB B;  2I5J B;  4HHH A;  2QA4 G;  1JLF A;  1W25 A;  3MED A;  2YX7 A;  3BJY A;  4USV A;  1XMQ F;  3DLK B;  3CDW A;  3MGJ A;  1RLD A;  3HD1 A;  4XTT A;  2EG1 A;  1DLO B;  5H9E J;  1VCT A;  2IM2 A;  1N5S A;  5DRK A;  1WC1 A;  2BOA A;  4X4R A;  2RE1 A;  4NEY A;  3IBW A;  3W5Z A;  4OZ1 A;  3C14 B;  1Q8I A;  2WON A;  1JLC B;  2ZZT A;  1WHY A;  1TQL A;  1FI4 A;  1NHV A;  3TX8 A;  3TW0 A;  4Y2K A;  4K4Y A;  3LP2 B;  2BV3 A;  3NGT A;  3HT3 A;  3NKY A;  3QGH A;  3I55 S;  5CZV A;  4NWB A;  4PAB A;  2OTL S;  3M05 A;  4FDF A;  1IKX A;  2RU3 A;  1L3U A;  1T05 A;  3BB5 A;  4K5S A;  5KFQ A;  1GH8 A;  5E3R A;  4P9S A;  1RBA A;  1U1Q A;  2VQE F;  3HHN B;  1RT4 B;  3FDS A;  3J81 U;  4OL8 A;  2CA9 A;  1LW2 A;  3UVJ A;  1KVJ A;  3BF4 A;  1M5O C;  1BLU A;  5C24 A;  5EUH A;  2MY8 A;  5T41 A;  2ZHB A;  1GT8 A;  3MZI A;  2POK A;  5HAN A;  3PV8 A;  4AL6 A;  4X62 J;  3MPY A;  2F5G A;  2K1R B;  2YNI A;  1IJE B;  4ZVQ B;  1LW0 B;  4XAK A;  1FKA F;  2CAD A;  3KLG A;  2DJW A;  3MEE B;  5FDL B;  4PQA A;  2FJD B;  3Q8P B;  2MQO A;  2H65 B;  2CFX A;  1S0V A;  1VLY A;  1Y10 A;  1JLA B;  3FQL A;  1F2H A;  1PC5 A;  3TO8 A;  3HT0 A;  4Y3C A;  5KFF A;  3Q8Y A;  3QID A;  5IV4 A;  1X4E A;  3EVW A;  2LDY A;  5BR8 F;  5HBM B;  1R8H A;  3I56 S;  2BJ3 A;  4XDC A;  5EX0 A;  2GQC A;  2HK3 A;  1C0U A;  2B9E A;  2R7W A;  3FCW A;  2VFT A;  5D3G A;  3MM8 B;  2LEC A;  4OV1 A;  4ALZ A;  3D9B A;  1AFI A;  3IWX A;  3PJX A;  4Q8F A;  5FII A;  5MAO A;  1V5I B;  1IBK F;  4AE5 A;  3DRX A;  4ZPB A;  4M95 A;  4LFB F;  3B78 A;  3SFU A;  4IO9 Q;  1X5S A;  1S6O A;  1WJ9 A;  2UV8 A;  3KLE B;  5AJ3 F;  4HL9 A;  4M5M A;  4LQ3 A;  4CO4 A;  1IKY A;  3WQP A;  3GYX B;  4ES2 A;  3UE2 A;  3U1N A;  3B82 A;  2KM8 C;  2EI5 A;  3FBB A;  1FE4 A;  1EQM A;  5KFH A;  3PW2 A;  4BCA A;  4ENO A;  2Y0B B;  3PO4 A;  1Z2L A;  3TEG A;  1X5O A;  4M5H A;  3LA0 A;  3FSX A;  2BJD A;  2XCA A;  2V2Q A;  1BWE A;  2OTJ S;  1FXL A;  1LEO A;  3QSI A;  3T6B A;  3UFC X;  3I0R A;  4MKA A;  4FS1 A;  4JI7 F;  4LRD A;  1C2P A;  4N8O A;  4DR4 J;  3OTC A;  3DOL B;  4Y0F A;  3UO0 A;  2YNG A;  3ZZT A;  4O3Q A;  1RHM B;  2HAF A;  3L7P A;  4ZN3 A;  2CDR B;  1REV A;  3AQO A;  1TL3 B;  2R7R A;  4ZPV R;  4K7Q A;  3L7U A;  1PO6 A;  2JRS A;  5IZH A;  5K14 A;  5L39 A;  4PPD A;  4OZ3 A;  4KFB A;  1UWB A;  5J2P B;  4CO5 A;  4YY3 J;  2M5Y A;  3MAA B;  2VG7 A;  2WVF A;  4Y65 A;  4DV3 J;  2CPE A;  1TKZ B;  1TP7 A;  3R1H A;  3H25 A;  3BRE A;  1TV6 A;  2QA2 A;  1NO8 A;  1KTQ A;  2GHP A;  2EXU A;  3LO3 A;  1LWF B;  2VDH A;  4ZCI A;  3IWL A;  2NXN A;  3E3X A;  1RAE B;  1AYE A;  4PPZ A;  4CZC A;  4ZP7 A;  2P9E A;  3LWL A;  3G82 B;  1RAH B;  2HNZ B;  1JLB B;  4ED4 A;  4ZVH A;  2WVD A;  4M8L A;  1TKX B;  4HDH A;  4KB7 A;  3AH6 A;  1AZS A;  5CYQ B;  1RAD B;  3MR5 A;  3W3S A;  3EYZ A;  4LF8 F;  3KLH B;  2IIH A;  3PX0 A;  4P2X A;  1S79 A;  1FDD A;  1WF0 A;  3UDE A;  1VK8 A;  2KVQ E;  4DFM A;  4B9S A;  3M9N B;  4K0K F;  1YK9 A;  3OSP A;  4LT6 A;  4DX6 A;  2RVJ A;  2AJ2 A;  3K57 A;  5HI7 A;  4JB8 B;  4NZ0 A;  3C16 B;  2ZM6 F;  2QV6 A;  4NA2 A;  2H5I B;  1D8Z A;  5T14 A;  1YJN S;  1N6Q B;  1IBM F;  3CE8 A;  2CNK B;  3DOK A;  2J8S A;  2VQE J;  2BJ7 A;  4TYB A;  1RBL A;  1NKB A;  1RLC L;  2EKY A;  2RH3 A;  2B4V A;  1X9S A;  5KFM A;  2QLW A;  3PW0 A;  1MML A;  1BC6 A;  4U9R A;  1FK9 A;  4ILR A;  4LF7 J;  4TQR A;  3MTK A;  3MMA B;  2XYG B;  3UWT A;  3H2U B;  3OPK A;  3HCX A;  3BEG B;  1P1L A;  4JYA J;  3RAX A;  4K4U A;  1NDC A;  4DSK A;  3TAQ A;  3BYP A;  2HHX A;  3SYZ A;  4AL7 A;  4OYA A;  3CNQ P;  2QLX A;  3CW2 C;  3KDN A;  3KOA A;  3MOZ A;  2YH0 A;  2QMX A;  1OPZ A;  2GX8 A;  4C3L A;  1UP1 A;  5C2C A;  2OEL A;  4R0E A;  2CQH A;  4DPU A;  1YGY A;  1W7W A;  1EHW A;  3DLE B;  1RB0 A;  4X64 F;  3TAR A;  5A0Y B;  2UUW A;  4KO0 A;  5BR8 J;  3EM1 A;  5E3P A;  3H4D A;  4C4W A;  4F0K A;  2DR7 A;  4OYO A;  2LXF A;  4DR6 F;  3K89 A;  1GXL A;  2XY5 A;  1JJ2 R;  3RUB L;  1SBR A;  2RF2 B;  5E2Q A;  4CLP A;  1AFJ A;  3ZZR A;  3O8W A;  1HD1 A;  2V67 A;  4P75 A;  3QLH B;  1NB7 A;  5A8W B;  1RT6 A;  5KFK A;  4OHY A;  3S8S A;  1O6X A;  4LFC F;  2QN6 B;  3DLJ A;  1B3T A;  2XLJ A;  1LXN A;  1TMJ A;  5AJ3 J;  2DGW A;  3QT5 A;  5DLF A;  4DF8 A;  1VFJ A;  4UY8 T;  2Q6C A;  1SC3 B;  4LVO P;  4HKQ A;  2MEW A;  2O5D A;  3MCN A;  4ZDN A;  2G0I A;  3CDA A;  1CUL A;  1JJH A;  2R42 A;  2V0N A;  1RT3 B;  3TA2 A;  3OUY A;  2ZNY A;  4PXE A;  1HWK A;  5JJB A;  4JV5 F;  4WK1 A;  1NHK L;  2UXD J;  4CLW A;  1F3F A;  3I5C A;  1NPR A;  1RTD B;  1S0O A;  3GP9 A;  1YJ7 A;  2B4U A;  1PIL A;  1XIQ A;  3VQT A;  1VK3 A;  3MPD A;  2FJX A;  1ZH5 A;  2I38 A;  4CRJ A;  3AOB A;  4LF6 J;  2D1C A;  2K8G A;  1T11 A;  2DR6 A;  3MED B;  1SJ1 A;  2IA0 A;  3O1L A;  2XCP A;  1CJV A;  2VJU A;  4IQX A;  4NE9 C;  1TFW A;  1IBL J;  3PRV A;  1EAR A;  3ET6 B;  4L3K A;  4KYZ A;  4FF4 A;  5DDR C;  1RXO B;  2GMJ A;  2N4C A;  2IYI A;  1VQK S;  4M5J A;  2BE9 B;  4NLR A;  1SCJ B;  2F65 A;  1R8A A;  2H4Y B;  1S0M A;  3GMG A;  1M5H A;  3HVT A;  2BAB A;  2ZH5 A;  4U7U K;  2KZM A;  3HHL C;  3KK3 A;  4RWX A;  3TA1 A;  1UVJ A;  3DN9 A;  1IKX B;  4LRC A;  3U7J A;  3D67 A;  2CNN B;  4QWB A;  3D1O A;  3D3B J;  2GIQ A;  1Q8K A;  1YZ7 A;  3GIL A;  3WIU A;  5KFJ A;  3IM8 A;  1SC6 A;  2OEM A;  1UCN A;  5H9E K;  2UXC F;  3OHB A;  3P4U B;  3PEJ A;  2CKW A;  2B6A B;  3UVJ B;  2WK4 A;  4RNN A;  2B56 A;  4LF8 J;  4ITS A;  3R5A A;  3ISN D;  1T9U A;  3RTV A;  3OXF A;  1X0P A;  1TKD A;  4N47 A;  1OIA A;  5CZX A;  3G6Y A;  3RU0 A;  2Y3Y A;  4QPX A;  2ZJQ Q;  2I1R A;  1VYA A;  2VFS A;  3LWM A;  3TZW A;  4DN0 A;  1HYS B;  2CWX A;  2ZM6 J;  3RBD A;  3MF5 A;  1P27 B;  1PAU B;  1U49 A;  4MTP A;  4J37 A;  3A8J A;  1JXE A;  2E29 A;  2OPP B;  4WPA A;  4NXM F;  2FDN A;  2YKN B;  4M5L A;  2FZK B;  4WYW A;  3V81 A;  1KS2 A;  2XLI A;  2XY6 A;  4PR6 A;  1R0C B;  1OYE A;  4LBP A;  4I56 A;  2HQC A;  2RSQ A;  3VGS A;  4USU A;  2OUG A;  1Z4U A;  3FEX B;  5DM7 Q;  4KQZ A;  3D0I E;  4H4O B;  4QBU A;  3LAK A;  1XNR J;  4KH0 B;  1HNX J;  1E6V A;  3DHX A;  5LSR A;  2HVZ A;  4G65 A;  1C0U B;  4C8Y A;  2DGS A;  2NSC A;  5KAK A;  1RWP B;  2QL9 B;  4RBU A;  2W2O P;  5J2M B;  3G4S S;  2BE7 D;  2CQG A;  2RS2 A;  1DQ8 A;  1HBM A;  3NOC A;  3LUY A;  3AHP A;  3CJ5 A;  2VDI A;  1GNK A;  1B4S A;  2E5I A;  4LR7 A;  2J0Q D;  2CZ9 A;  3PYG A;  5KFO A;  2GV1 A;  5KT5 A;  4P72 A;  4IDK B;  4ZHR A;  4IFY B;  4DS5 A;  1JLG A;  1IKY B;  3KHG A;  4QIV A;  4CH7 A;  1XQI A;  5ADZ A;  2PMW A;  4OX6 A;  1VRT B;  2E44 A;  2J0W A;  4QQB A;  2D3U A;  2ZWP A;  3BGR A;  2ACM A;  3DGP B;  2JHE A;  2C3M A;  3CJR A;  2BJ8 A;  4ETZ A;  1CC8 A;  3U1L A;  4PRF A;  5G0R B;  2IC3 A;  3OSN A;  4RBV A;  2ROG A;  3I87 A;  4XIU A;  1F1B B;  1HHS A;  4C98 A;  3CO9 A;  1QM9 A;  2AJQ A;  3A3P B;  1MWY A;  5F8J A;  3T5H A;  1T8E A;  3DLG A;  2XM3 A;  5I3U A;  5E7O B;  3CDB A;  2V6A A;  4TKT A;  1S9E A;  2OPS A;  4PG7 A;  2D9O A;  2GAH C;  3ELH A;  3EJM A;  1Z2Z A;  1KN6 A;  2F63 A;  2YNG B;  3G96 A;  4OX7 A;  3AJ2 A;  3KHR A;  2A1B A;  4H4K A;  1U1R A;  5K8O A;  1VRQ C;  2R7X A;  3MEK A;  4J9R A;  2YKO A;  4ECQ A;  2Z2Y B;  1MWQ A;  5K14 B;  4JI2 J;  2XMJ A;  3MM7 A;  4DCJ B;  1MN7 A;  4KFB B;  1UWB B;  2KVI A;  5CQG A;  2HEK A;  2G13 A;  1QDU B;  1X4H A;  2W2Q P;  1K8A T;  1FVQ A;  1BUX A;  3FMW A;  4DSI A;  2X1F A;  3QIP A;  2E5J A;  3VAI A;  1TV6 B;  2MKJ A;  1GX5 A;  1BE4 A;  1KHW A;  4ECW A;  4NLT A;  4RW4 B;  3H42 A;  3VHQ A;  3M8R A;  4X4U A;  3OL7 A;  4K4T A;  4IYQ A;  1HPZ A;  2EWH A;  5AE2 A;  1JWW A;  4MMO A;  1S97 A;  2JEI A;  2Q43 A;  2VOD A;  2HBZ B;  1N33 J;  2BX6 A;  6FD1 A;  1HNV B;  3K5N A;  2Z56 B;  2GAG C;  1PJ7 A;  2MYF A;  3PR5 B;  2DNL A;  2C3Y A;  5A2Q U;  1UWA A;  5JVH Q;  4NL5 A;  2FD2 A;  4JI8 J;  2HBQ B;  4Q45 A;  1WUU A;  4NLX A;  2QYG A;  2DPJ A;  1S1W A;  4DV5 J;  1EP4 B;  2DKO B;  3TJ8 A;  1W2I A;  5IS2 A;  4M5N A;  4F0H A;  5DO2 A;  4RBT A;  3Q0A A;  2FVR A;  1OPI A;  2QZ8 A;  4DOZ A;  5ETK A;  3DOK B;  2CWK A;  2LA6 A;  1YVF A;  4NXN F;  5K8M A;  2CJ9 A;  1L5U A;  4DZ6 A;  4JI6 J;  1I3O B;  4DQP A;  1NXI A;  4RUB A;  4HI1 A;  2DEI A;  4TY9 A;  1NZ8 A;  3I5B A;  4KPC A;  3C6T A;  3LP0 B;  4O3S A;  1SH2 A;  3N6N A;  3THT A;  3L4B C;  2R7O A;  4KHM A;  2HHP A;  2HVI A;  3CJ0 A;  2ZJR Q;  1QTN B;  4NLS A;  1MMD A;  3HHE A;  2IVF B;  4M5K A;  2OI2 A;  1PBU A;  3NNC A;  2V5H G;  1IWA A;  4ELT A;  3FQK A;  3V4M A;  2NYI A;  3T1Y J;  1UMJ A;  2HZV A;  2DNQ A;  2P6T A;  4JI3 F;  3MM5 A;  4PAA A;  5J2N A;  3UD5 A;  2ATL A;  1EIY B;  4PYA A;  1FNO A;  3H0P A;  1SUQ A;  2PC6 A;  3CCS S;  3J7Z T;  1YJU A;  1IVZ A;  5GMK a;  2AV5 A;  1WI6 A;  2E9R X;  2IA6 A;  2AJ1 A;  4WFY A;  5GAD U;  2LFV A;  3H98 A;  1NK0 A;  2GZO A;  1MRO B;  1RT6 B;  2KI2 A;  1QLN A;  4HT5 A;  2MST A;  1VJW A;  5B08 A;  1IBC B;  3HSG A;  5LSL A;  5F9N A;  4OJ3 A;  3CXC R;  2RRN A;  4K5R A;  4X65 F;  4RUH A;  1VQM S;  5A6P A;  5IXU A;  4FXW A;  1S12 A;  3BPD A;  4USK A;  3GSI A;  3R7N B;  4IRC A;  1LV5 A;  1WWH A;  4DR3 J;  8RUC A;  4ZMM A;  3RR8 A;  2V8D A;  4RNH A;  1CUL B;  3O3L A;  3KDO A;  4OZN A;  4W92 B;  1R0B G;  5L9X A;  2XS2 A;  1YJR A;  6AT1 B;  2WZ1 A;  4A8S A;  2C2Z B;  2OLW A;  5B0D A;  4N41 A;  2D41 A;  5CAA A;  2HQI A;  3TQE A;  1TL1 A;  1HMV A;  1GMV A;  3CCT A;  1I94 F;  3WDO A;  3GV7 B;  2VC0 A;  2JNJ A;  2PSZ A;  2ABY A;  3RBX A;  2CDQ A;  2YKQ A;  2UUA F;  5KFZ A;  3D6T B;  3CD5 A;  3C6U A;  4X66 F;  1H72 C;  5HRO A;  2DXF A;  2MHN A;  5LXY A;  1VQY A;  1D0E A;  4USW A;  4KIA A;  2HFZ A;  4Y00 A;  3VAJ A;  3DI6 B;  2VUG A;  4F4W A;  2AX0 A;  2X3G A;  2ROE A;  2NPI A;  3L95 X;  2QGF B;  3T1H F;  3D7S B;  4ZK7 M;  2L9N A;  3MEC B;  2BAC A;  4IQM A;  3CJS A;  5C5J A;  2FLO A;  2B4O A;  4OJH A;  1D9A A;  3CGI A;  1TK5 A;  5L1K A;  1N32 F;  4B3M F;  2DR8 A;  4TYA A;  1I51 B;  4USJ C;  5C25 A;  3HSZ A;  3KJF B;  5FLX U;  2VPY B;  3I31 A;  4BWJ A;  3G6X A;  2CJK A;  2QEX S;  2IJR A;  1VBY A;  1WC6 A;  2A6M A;  1U0H A;  4ZP9 A;  4J9O A;  1FRH A;  4DSF A;  1FKO B;  3WX4 A;  2EKN A;  2HHV A;  3FGV A;  4BLG A;  2WOM A;  4UOF A;  4ZVT B;  3DDI A;  1GQE A;  1NRK A;  3M6W A;  3NMR A;  3QGG A;  5C42 A;  3V2U C;  2G2Z A;  2AGP A;  1NPK A;  3M1V A;  4WII A;  2D9P A;  4FF2 A;  3LPY A;  2FYX A;  1ZM4 A;  2C28 A;  3TAM B;  1U48 A;  3BDE A;  1WHV A;  3PIO Q;  3OFF A;  4X4N A;  2PDA A;  1ZAW A;  2WBM A;  5CHC B;  4F4Y A;  3OBI A;  3E8O A;  3HHD A;  4LSZ B;  1WOS A;  5LMN F;  1RAI B;  3PW4 A;  2L41 A;  1JQG A;  1F5B A;  3RGI A;  3MUT P;  1YRU A;  3VAF A;  3N79 A;  4PUO B;  3PX6 A;  5E3A A;  1E6V B;  4PQU A;  5H9F J;  1IN0 A;  1Y0H A;  5HO4 A;  2W1B A;  1YDL A;  1Q78 A;  2AYM A;  1U8S A;  1NDK A;  4ZP6 A;  3KNA A;  2OO4 A;  3QJP A;  1UJ6 A;  4LF9 J;  3BM7 A;  4XK8 C;  3IR7 B;  4KGZ B;  3NL0 A;  3GCW P;  1FJG J;  1DBD A;  4DCP B;  4Z7Y A;  3V6D A;  4QPT A;  1Y5N B;  2A6O A;  4ECV A;  5K8N A;  3SZ2 A;  2DBB A;  1FHT A;  3ZZY A;  1JLG B;  2K3I A;  3ETO A;  1Q5Y A;  4JI3 J;  1YJ9 S;  1SJR A;  1L3S A;  3GTY X;  1B0V A;  2HQD A;  2K7K A;  1R43 A;  1QVG R;  1N88 A;  4WE1 A;  3JAM Y;  5DET A;  4DL5 A;  2Z4P A;  2Q79 A;  3DRP B;  4ZA1 A;  1RHJ B;  2EG2 A;  3IRW P;  1HKA A;  2DY1 A;  3IP0 A;  4WK3 A;  1UPM B;  1NK6 A;  1NK8 A;  4NLP A;  4YME A;  2YPY A;  3EDR B;  1Q95 G;  3F56 A;  3DLG B;  2MQQ A;  1OQ3 A;  2BEF A;  2WCX A;  5I3U B;  4E2F B;  5M2P A;  2ZVS A;  1S9E B;  4I2Q B;  2GC8 A;  2BYC A;  2Z2Z A;  2R8J A;  4LBH A;  1VQ8 S;  4GO5 X;  1U2F A;  3CT9 A;  4GVB B;  4EBD A;  4DN9 A;  2DHH A;  1RHK B;  1WEX A;  5E0O A;  1XMO F;  1UZD A;  1UEK A;  2XO6 A;  5J1E A;  4N8N A;  1KBR A;  2MMY A;  5J2Q A;  1SV5 A;  2HKE A;  3PO5 A;  2XQC A;  2NQP A;  4B9V A;  3MM9 B;  4AQY F;  1K47 A;  1FX2 A;  3CVK A;  2V8G A;  1Q7Y T;  5D0G A;  4LIR A;  1QD1 A;  3MM7 B;  1WHW A;  4DR5 J;  2MKK A;  2YWW A;  1SL2 A;  3FFI B;  4USH A;  3H5X A;  4A8M P;  1TVR A;  2P5V A;  5KT7 A;  4DPX A;  2ZEJ A;  3N6L A;  2RQM A;  3VZH A;  3D3C J;  4KE5 A;  1DAX A;  4F3M A;  2HGL A;  4Z37 A;  1HPZ B;  2BE2 A;  4U96 A;  3W9I A;  1N8R T;  1FF2 A;  3R6G B;  4WCE Q;  3UNY A;  5HJX A;  4QWD A;  1S1V A;  3AD9 C;  2XWY A;  3W5X A;  3U1M A;  3Q2T C;  4B3O A;  1G4C A;  1R89 A;  2Y8W A;  3GWC A;  4FS2 A;  5B7W A;  4IG0 A;  4DR2 F;  2KRB A;  4CWB A;  1AUS L;  2XI2 A;  4B3M J;  2UUT A;  3DLL Q;  2QL7 B;  3AXM A;  3Q8U A;  3MM6 B;  1XNQ F;  4ZKA A;  3M8W A;  2AGO A;  1GMW A;  1NZA A;  2W2P P;  2LU2 A;  4ECS A;  1GAO A;  2ADC A;  3OR2 A;  1SB6 A;  4ED8 A;  1HBU B;  2VKZ G;  4DDF A;  3IO1 A;  1NK4 A;  5IFM A;  4OHX A;  1KVK A;  4HT7 A;  3W1Y C;  4YDD B;  1UVL A;  1LWE A;  5D78 A;  4Y34 A;  3KLI A;  2DTJ A;  2PE8 A;  2F8M A;  2Y1R I;  2XMV A;  4KV8 B;  1RK8 A;  3C6T B;  4QZV B;  3MUV P;  3T19 A;  2R8K A;  2ZOG A;  3QGI A;  4EGL A;  3GIR A;  2EK1 A;  3MMC A;  3OL8 A;  3W62 A;  1XR7 A;  4ZPC A;  4U67 Q;  1HL6 A;  4R0J A;  4NLW A;  4B02 A;  3LAL A;  3J7A 1;  1UVK A;  3ISZ A;  1VR6 A;  3HHL B;  3TJA A;  1BGX T;  1GX6 A;  1A0O B;  1NDL A;  3SMZ A;  2RQK A;  4RU9 A;  4UZB A;  2F8H A;  2LQ5 A;  2D3Z A;  2KO1 A;  2ZNZ A;  3QSY B;  1X60 A;  2DIV A;  4KY3 A;  2XNR A;  2X1G A;  1ZAX A;  4NYP A;  2HFS A;  2FHK A;  2V2V A;  1SUQ B;  2AJ4 A;  2XB2 D;  1N0U A;  2M9K A;  1C4A A;  3F41 A;  2EFV A;  3ILO A;  4C6A A;  2BMB A;  4I2P B;  2HHQ A;  2EC2 A;  4YB5 A;  2XTJ P;  5E3C A;  3DDN A;  3D1Q A;  4I67 A;  4HTI A;  3GSD A;  1GMW D;  3QYY A;  1BHN A;  2Z2L A;  4ED7 A;  1OSC A;  3PHE A;  5HVF A;  3V6J A;  5EWG A;  1HWI A;  3AB2 B;  1GEH A;  3Q89 A;  2FC9 A;  1IR0 A;  2MJN A;  5F8M A;  4KGV B;  2FUG 9;  5HVG A;  2H4W B;  4I4B A;  3W5Y A;  1EX8 A;  4HI2 A;  3NWG A;  3B54 A;  2COL A;  3UCG A;  2E1A A;  3W64 A;  3ENW A;  1V9O A;  2QLB B;  5DDP C;  1HMV B;  2JFD A;  2IBK A;  4B3S J;  1FE0 A;  2CPH A;  1YIT S;  1X7V A;  4KHP F;  2PO4 A;  1VJQ A;  1YBT A;  2XBP A;  2X51 A;  3FCV A;  4X4S A;  4M94 A;  2CPZ A;  4CLK A;  1RT7 A;  4ZIT A;  3CTR A;  2LXU A;  3D6H B;  1FNM A;  2HZA A;  2MQP A;  2C2K B;  1Q16 B;  2YWF A;  4P6Q A;  1Y00 A;  4J90 A;  4DV6 F;  4RUC A;  1H2U X;  1FD2 A;  2LA4 A;  4JI1 J;  1XMO J;  5KG5 A;  1UW9 A;  2P9G A;  2B7C B;  2IYG A;  3ZZZ A;  3M2V A;  3SEO A;  3FKB A;  1JLQ A;  2MGZ A;  4KTQ A;  3G8T A;  4R8U A;  2HFU A;  1UVI A;  2A18 A;  3IBF B;  4GC6 A;  1SH0 A;  2XHW A;  4PG5 A;  1R8P A;  2AMC B;  1EET B;  2ILY A;  1WDT A;  3W63 A;  4RW9 B;  2WW8 A;  3KK2 B;  3HLU A;  3EGW B;  1LQ9 A;  2DO4 A;  4C0O C;  4A8O A;  2RT3 A;  2F40 A;  1DQA A;  1X4C A;  4OX9 F;  3KJQ B;  1URR A;  3RBE A;  2RIL A;  4DX8 H;  2WOM B;  2JEG A;  1HWU A;  2CQP A;  3MR3 A;  2XWX A;  3D66 A;  3NY0 A;  4K2J A;  2R7U A;  3KUG A;  1H7W A;  4P52 A;  3IG1 B;  5C42 B;  5K8P A;  1YI2 S;  4OZ5 A;  2WSC C;  2GMH A;  2GML A;  2P6S A;  3TR5 A;  2KHD A;  1FES A;  2FLL A;  4MAK A;  3QJJ A;  4NLQ A;  2Y0S D;  4LUB A;  2X3D A;  3CCL S;  2DRA A;  3NCQ A;  3RRK A;  3ENV A;  1I1G A;  1M5S A;  1S1U B;  3OTO F;  2OH2 A;  4ZLP A;  4TVA B;  3CUL A;  2PI4 A;  1R27 B;  2JC1 A;  4USM A;  1K1S A;  4DL6 A;  1URN A;  3QAU A;  3W7B A;  2F4F A;  1F0X A;  4RL1 A;  3VGT A;  1U6B A;  5KFC A;  4EK2 A;  2CVE A;  5IV3 A;  4JP8 A;  4PQU B;  2E7W A;  1UTA A;  2PEH A;  3ZTR A;  2R2T A;  1JJ4 A;  4R5P B;  5IC6 B;  5HK4 A;  4KGX B;  2I9S A;  4QYZ J;  2AX1 A;  1R0A A;  4C7Q A;  5F8L A;  5L8R C;  2DRB A;  2BRL A;  1JLE A;  2LQJ A;  3MEG B;  4IG3 A;  3V6D B;  2HS0 A;  2OPR A;  3I9V 9;  3PCO B;  2B9W A;  1U7L A;  3Q22 A;  3M9O B;  4K59 A;  2AKW B;  3BN4 A;  4AXI A;  2XZW A;  1N4L A;  4YQW A;  2AQ4 A;  4DV0 J;  2Y1L B;  2B9Y A;  1KFS A;  3S01 A;  1X4B A;  3KLF A;  1CSJ A;  4WE1 B;  2WB4 A;  1VGY A;  1NKC A;  5HLF A;  1RIS A;  4IR1 A;  1VQ9 S;  2KFY A;  4CI0 B;  1N52 B;  3I9Z A;  4AND A;  2BUN A;  1BQN A;  1RT2 A;  3HVW A;  5T7L A;  3JSB A;  4ZLJ A;  2Y1J A;  3GJQ B;  2FHM A;  3PRD A;  1FFW B;  1UEU A;  4UST A;  1C1B B;  1WD6 A;  2WTF A;  2DY9 A;  4N76 A;  2ZE2 B;  5L9N A;  4F50 A;  1O8B A;  2BAN B;  1FDN A;  4NML A;  2QJ3 A;  5J2Q B;  3DMJ A;  3M30 B;  1RTZ A;  4P7V A;  4B9N A;  4ELU A;  3TZY A;  4LSL B;  1VBZ A;  3CCM S;  3VAK A;  3O6Q A;  3F0N A;  3EVM A;  2V8V A;  1OWX A;  2R9L A;  2E9Z A;  1S10 A;  1E6Y B;  4KHP J;  3F73 A;  1CJK A;  1P1T A;  5LMU J;  3QT6 A;  2HGN A;  5EHH A;  4TNO A;  2MB0 B;  5HQL A;  4RUA A;  3D0H E;  4EMD A;  3GCX P;  3EVO A;  1U1M A;  3OW2 R;  2JJ4 D;  1PYT A;  3E01 A;  2LQ9 A;  4P7T A;  2VQF J;  1WOR A;  3G8S A;  4E8U A;  4O3P A;  3BSN A;  1N5Q A;  3BO4 A;  3N6M A;  3OLA A;  1KLM A;  1HNZ F;  3W2W A;  2AW0 A;  2UU9 F;  4LJM A;  1UJ4 A;  4B3O B;  3G8Q A;  2VV5 A;  3AFG A;  1LWX A;  1UPP A;  3FJ2 A;  1A7G E;  1IM4 A;  3Q83 A;  1YBA A;  4DSL A;  2W7O A;  2JZ5 A;  2MZR A;  2J9D A;  3M6V A;  2JEJ A;  4J9Q A;  1FXR A;  2JFK A;  3HHL D;  2CJY B;  3CB4 A;  3W65 A;  1LFW A;  3JAM U;  4B9U A;  1N48 A;  1RWK B;  2D7S A;  1R3N A;  4ZPW R;  5EX3 A;  4DFP A;  3UQS A;  1HI1 A;  2NXU A;  1HQU B;  4I68 A;  1R8B A;  3NBP B;  1QE1 B;  5SUH A;  1H2V Z;  4YR0 A;  2BKN A;  1MSW D;  2XG8 A;  4B08 A;  3C15 A;  3TZZ A;  1WAC A;  2C22 A;  1U1P A;  1S76 D;  3DOM B;  3HHK A;  2JVR A;  2W25 A;  3PHT A;  4DPT A;  1WSV A;  3HK2 A;  1WOP A;  2QA4 S;  3QT8 A;  3VVT A;  4ICL B;  4LRF A;  1U47 A;  1RHQ B;  3MMC B;  2FB0 A;  2FY1 A;  1T9W A;  3M8S A;  2HSE B;  2V8H A;  2IBO A;  2X1B A;  2EC0 A;  2JEF A;  5E3Q A;  5J1P A;  4FN5 A;  2E1R A;  2VKR A;  4KRW A;  1UFK A;  1QVF R;  2DT9 A;  1YIJ S;  2QSW A;  3MPV A;  2O01 C;  1HBN A;  3A3O B;  1I5O B;  1DRZ A;  4C8Z A;  1WHX A;  3CJQ A;  3NGR A;  3SDE B;  3QAT A;  3P5T L;  1VQ4 S;  1TL4 A;  4ZVS B;  4EO6 A;  1VHF A;  3BSA A;  2QA1 A;  1TAU A;  1RAA B;  2B5J B;  5HMW A;  4CNY A;  1ZZF A;  4TY8 B;  2MY7 A;  4JI4 F;  4YHH F;  4W98 A;  1SKU B;  2W9B A;  1ZZN A;  5KG2 A;  2UXB J;  2AYB A;  1PYO B;  2AHO B;  5GAG U;  4DX7 A;  3VAL A;  3PFE A;  1H3D A;  3MCO A;  3MR2 A;  5ETR A;  2V4J B;  2VC1 A;  1KHV A;  1X4D A;  4IH6 A;  4CTA B;  2Z57 B;  5A8R B;  5A8K A;  2J7K A;  2HPU A;  2HND A;  3ADA C;  2YY3 A;  3BQ2 A;  4X2B A;  3W9J A;  2R2S A;  2E9T A;  2J7W A;  2KZZ A;  4EI2 A;  4ID8 A;  2HWT A;  3FRY A;  5KFY A;  1KR4 A;  1VQS A;  3CD6 S;  2CQ2 A;  1S57 A;  1U1K A;  3PY8 A;  2VU5 A;  4FP9 A;  2BJ1 A;  1FDA A;  1TUG B;  3H8Y A;  3OQ2 A;  1KP6 A;  5M2R A;  2J5A A;  3CD7 A;  4NLY A;  1KVI A;  2IHR 1;  5IT4 A;  4RPF A;  2HW3 A;  3J80 Y;  3BR8 A;  3NXZ A;  3MMB A;  3IGV A;  5CA5 A;  3OV7 A;  2BRK A;  3R97 A;  1ACM B;  2Z8Q A;  1NEE A;  1NSA A;  4NCB A;  4J91 A;  4CLY A;  2G2Y A;  3D6F B;  2IVM A;  4A8X A;  2MGZ B;  3CCQ S;  4FZV A;  3EXC X;  5KFN A;  2KT2 A;  4Q0B A;  4URS A;  2ZH8 A;  1HA1 A;  3CJ8 A;  3KG4 A;  2G0J A;  4YUD A;  3H90 A;  2MQN A;  3IAM 9;  2V69 A;  2HBY B;  2V9W A;  1REG X;  5AE3 A;  3P8B B;  1RWV B;  5KFR A;  2C2N A;  1K0T A;  1RT1 A;  4WXO A;  4F4Z A;  3T5L A;  1FTR A;  1NU4 A;  3EPG A;  1A6L A;  4DG1 B;  1O0P A;  1HLW A;  3CCV S;  3OL6 A;  2V94 A;  4HAC A;  1HBO A;  3CDU A;  4G1Q A;  1HNZ J;  3HI9 A;  4X84 A;  1S6U A;  4IH7 A;  1FVS A;  3PFO A;  1RDR A;  4CYU A;  4DV1 J;  2F4V F;  2VD3 A;  2UVU A;  5HAT A;  1DHM A;  4Y2M A;  4YOE A;  1T9X A;  4NLD A;  3RJM B;  1FKP A;  2M8H A;  4LRA A;  2EFP A;  1Q0N A;  4A4J A;  1FRI A;  2AEM A;  3C19 A;  1RAO A;  2RDJ A;  3BO2 A;  4KAI A;  4OYM A;  3BSC A;  1WC3 A;  2HFO A;  1PKU A;  1KD1 T;  4DL0 C;  4NI2 A;  4DV4 J;  3D54 A;  2XMU A;  4GKK J;  3LP1 A;  3TWZ A;  3HX9 A;  2YQ1 A;  4GVL A;  3IS9 B;  4CLU A;  1UA0 A;  2R8G A;  4ED1 A;  2ADB A;  1S72 S;  3GYG A;  3FUY A;  1T03 B;  1ZM2 A;  3EGN A;  3NGS A;  1U6F A;  4N5S A;  2I8E A;  1WDD A;  2VB6 A;  1R8C A;  3IGN A;  3H7H B;  4O4R A;  3EZO A;  2ROP A;  1KQS R;  3QO9 B;  4NZ7 A;  1UET A;  4DHV A;  4V19 J;  3DRS B;  4YEA A;  3P5B P;  4OYP A;  5F3T A;  4CH1 A;  3KJV A;  3DU6 A;  2BJE A;  2FJE B;  3M32 A;  1X4G A;  5JUM A;  4RJV A;  1X4F A;  2EFQ A;  4L73 A;  2AT1 B;  1RQ0 A;  3TAP A;  3D28 A;  4EEY A;  1VBK A;  1ZYQ A;  3ZTO A;  4DU8 A;  1NB2 A;  3CJ2 A;  2V8P A;  5HLF B;  2IMW P;  1ITP A;  3UW1 A;  3V4I A;  1OY6 A;  3O5T B;  1RTI A;  1TAQ A;  4ER8 A;  3ENA A;  1AB8 A;  2E1C A;  1BQN B;  4QYZ K;  4ZVO B;  2CZ4 A;  1SPB P;  2ZDP A;  5KFB A;  5T7L B;  1M1G A;  2ZFH A;  3FNN A;  4YB1 P;  5HMZ A;  3GON A;  5DDO C;  2M4M A;  2R8H A;  1VIS A;  4KHR A;  3LGN A;  1B64 A;  2FY8 A;  3OTD A;  3BH6 B;  4NCG B;  3PNI A;  1S99 A;  3DCA A;  2NXC A;  1TK0 A;  4TU9 A;  4UQT A;  2XSF A;  3OJS A;  2M70 A;  2VG5 B;  2KG1 A;  4PXB A;  3BS9 A;  2MLX A;  3PJW A;  3DMJ B;  1X31 C;  2OFG X;  2ZZN A;  3OT9 A;  2M8D B;  4PXD A;  7FD1 A;  3RAQ A;  3K0J A;  4DS4 A;  4M5I A;  1J5O A;  3SSS A;  2BQU A;  2ALZ A;  5ETS A;  2PEB A;  3FBC A;  5J1N A;  2IM3 A;  2DK2 A;  5C2G A;  4NEZ A;  2JX2 A;  1BQM A;  2DGT A;  2NZ4 A;  1DUR A;  1SI9 A;  3QRR A;  1UA1 A;  1GXU A;  4K2X A;  1N5Y A;  2E5G A;  2IRY A;  4TLR A;  2VA2 A;  1H74 A;  6FDR A;  4ZLL A;  3A1Y G;  1KLM B;  2YBV A;  4Y28 C;  3ZZU A;  4EUV A;  2DNH A;  3W2W B;  1WF1 A;  5H1S V;  2LEP A;  3THV A;  1XBW A;  1HQE B;  4ILL A;  5IWA J;  5ETP A;  4J9U E;  1FRM A;  4F04 B;  4F26 A;  3TVK A;  3D5M A;  4ECX A;  1VQL S;  2GJ2 A;  3M9M B;  2HZC A;  3SBM A;  2X7I A;  2VAS A;  2KJW A;  2H1Y A;  3M8Q A;  1RZM A;  4ZJO A;  3KJN B;  1CQM A;  4C11 A;  2R4F A;  3UI3 A;  1L3V A;  1YJV A;  1FD8 A;  5F0W A;  1CC7 A;  5KG4 A;  4CLF A;  3PDN A;  3VAG A;  4DR1 J;  1FJ7 A;  1PSD A;  3NNA A;  3HSD A;  3LGH A;  5KFG A;  3ITH B;  1F3V A;  3RG6 A;  2WAQ D;  3A8E A;  3JQM A;  4P71 A;  3C15 B;  4F4K A;  2AF6 A;  5KFL A;  5D4P A;  1FWK A;  3TVZ A;  1U1N A;  2FVS A;  5HQ8 A;  5GAD I;  5SZT A;  1XTZ A;  4OZ0 A;  2KT3 A;  5L1L A;  1XMQ J;  2CJX B;  3RW6 A;  4ECT A;  3TZX A;  3GR1 A;  4TU8 A;  2FLP A;  2XHC A;  1WF2 A;  4NYO A;  4MYT A;  2YNH B;  4DR7 F;  2GIR A;  4CLT A;  2GQ2 A;  1T02 A;  2EFG A;  3OLB A;  2N3O A;  1F5A A;  3LH2 S;  2NUU G;  4X4P A;  2VFR A;  2VIH A;  2GIF A;  4J9K A;  1RU2 A;  1CJT A;  2FJA B;  2MKI A;  4B3T F;  4HVZ A;  2I2Y A;  3DLK A;  5KOX A;  4CM0 A;  1R7I A;  4RU2 A;  3AJD A;  4M5D A;  4GKJ F;  2AU0 A;  2HQF A;  2MHE A;  1PBA A;  2IM1 A;  4JI0 F;  1UW4 A;  1SIW B;  1Y4Z B;  2GO8 A;  5B0E A;  1VHI A;  4RNF A;  1MN9 A;  2C3O A;  3ETM A;  4Q2L A;  3GIM A;  2QC3 A;  1HHQ A;  1JK9 B;  4FYY B;  1YLX A;  2GJI A;  3DYA A;  1WTB A;  4OJ1 A;  2RRA A;  3TOQ A;  4QWC A;  5A8K B;  5CCM A;  3I82 A;  2HND B;  5IC4 B;  2OIH A;  4DUZ F;  2MLY A;  1XER A;  7FDR A;  2J0S D;  1CQN A;  2YX4 A;  2Q66 A;  4QIG A;  1RT4 A;  4O3N A;  2G2O A;  1FFS B;  3MHY A;  5LJ3 Y;  4H4K C;  2C2O B;  2GGP B;  2NXE A;  3BN7 A;  2HIY A;  2YKP A;  1X5P A;  4FBT A;  1NBE B;  3PAC A;  4UT4 A;  3NG8 A;  4O3R A;  2HHH F;  3MAH A;  2K1R A;  4LSN B;  3MI7 X;  1LW0 A;  2N82 B;  3MMB B;  3H5U A;  3HZG A;  2VBY A;  2W8K A;  4B9M A;  1RI7 A;  2HS4 A;  3TAN A;  1Y5L B;  3QRQ A;  1EB0 A;  1T9V A;  1XMB A;  3MEE A;  2KT5 A;  5FDL A;  1IBK J;  4DQS A;  4BBY A;  2MQM A;  2ERR A;  4LFB J;  3Q8R B;  2YTC A;  4YB6 A;  1JLA A;  1CPZ A;  4XPE A;  1NH8 A;  5KG1 A;  4O44 B;  3MOJ B;  3IC1 A;  2LEA A;  4KPY A;  4KBI A;  1NK5 A;  3BDP A;  4CO0 A;  2FZG B;  4FF3 A;  1D9D A;  2GFF A;  1OO0 B;  1PYS B;  3S1T A;  3MM8 A;  1U8W A;  3I5A A;  4H4M B;  4MIA A;  2LLZ A;  2YKA A;  4URQ U;  1HBO B;  1H38 A;  4G1Q B;  3W8P A;  2UUB F;  4C8M A;  2I6W A;  4PXC A;  2FJW A;  3FBE A;  3U02 A;  1L3K A;  2RHQ B;  2J9C A;  5KFX A;  4LF4 F;  1WEZ A;  4WP3 A;  3KLE A;  2OFH X;  4ZS6 A;  4JI7 J;  1SXL A;  2DHG A;  1FKP B;  5CD4 H;  3V6H A;  3DKD A;  4DQR A;  1X8D A;  2EK6 A;  1JLF B;  4K4X A;  2P9C A;  1OSD A;  2GW8 A;  3GR0 A;  3GJR B;  4Q2M A;  1S4E A;  1YKW A;  4IRK A;  1LNQ A;  4DL3 A;  3CCW A;  5I3P A;  4EBE A;  2K2P A;  4DPW A;  5HMY A;  1VI7 A;  2IRU A;  4QIF A;  2L08 A;  4NI2 B;  2LQ8 A;  1T95 A;  3SQG A;  3PX4 A;  3LP1 B;  2G4B A;  4L6V 3;  4ETX A;  2WON B;  3BYR A;  1YJW S;  2DIU A;  3BGL A;  4A47 A;  3MFI A;  1FJE B;  3NEK A;  4ZPD A;  4B9T A;  4OZL A;  2WVC A;  2C2M B;  2ZD1 A;  4LMZ A;  4ECZ A;  5HP1 A;  3DOL A;  2QE5 A;  2LP4 A;  1KTV A;  2BBE A;  2KB2 A;  3J80 U;  4QOT A;  4J9L A;  1GTE A;  1T05 B;  1YHQ S;  1LK5 A;  1G2E A;  5ETV A;  4DEZ A;  1RA7 A;  2W24 A;  1YWX A;  2IFX A;  1VQO S;  1A9N B;  1T7P A;  1WC0 A;  1LW2 B;  4RNO A;  2R2U A;  2XGP A;  1KLN A;  3C3L A;  5C24 B;  5J2P A;  3MAA A;  3US5 A;  3M4X A;  1TKZ A;  2PFF B;  4TQS A;  2CPY A;  1FEH A;  2FIU A;  4K0K J;  3QFW A;  2YNI B;  3IR5 B;  2YWG A;  1VIX A;  3M6U A;  4EZ6 A;  2BA9 A;  5KOW A;  1RUS A;  4NRT A;  1LWF A;  4FPI A;  5A6W A;  2YKM A;  3KLG B;  2MQ8 A;  4A48 A;  3PM9 A;  3R3T A;  3V4I B;  4HTJ A;  2VON A;  1IBM J;  3VWS A;  3LOU A;  3MR7 A;  2MDA A;  3N0V A;  2CNO B;  1NHU A;  2HMI A;  1TKX A;  3POT A;  4G6V B;  3UDL A;  1NME B;  4RW6 A;  5CYQ A;  1NH7 A;  2A0F B;  3JB9 k;  3FZB A;  3TX0 A;  4MKB A;  2QLF B;  4EFA C;  1YQH A;  3QAE A;  1S1T A;  4X62 F;  1DY3 A;  1WC5 A;  5D3G B;  1HIY A;  1U25 A;  2HHW A;  3ZTS A;  3HFK A;  2QSF A;  3FK4 A;  1QAX A;  3K5O A;  3U27 A;  3DDK A;  3LQV A;  2RKI A;  2G0C A;  2ZBQ A;  3HFV A;  2LXI A;  1F9H A;  4ZJQ A;  3QGP A;  1TTH B;  4AT1 B;  1J5O B;  2J9E A;  4IRD A;  5CD4 A;  5IQQ A;  2VPZ B;  4ED3 A;  4WBF A;  3Q8V A;  2AZ1 A;  4X64 J;  2KXF A;  2ZWO A;  4LFA F;  1BQM B;  2DNG A;  4RWW A;  3MMA A;  4I64 A;  3PXG a;  4DR6 J;  2C42 A;  2HBR B;  1FRJ A;  2JSX A;  3T41 A;  4QR2 A;  2L9D A;  3NS5 A;  9ATC B;  1WG1 A;  1GXT A;  1U2C A;  5RUB A;  3SCK E;  2W4P A;  3RW7 A;  3AAW B;  4LFC J;  3Q8Q B;  2HS3 A;  3T5J A;  1M90 T;  2UUC F;  3AJ1 A;  3NMA A;  1ZTW A;  2XMM A;  4DSJ A;  4OZJ A;  3I0R B;  1D8Y A;  2JVO A;  2Y8Y A;  4CM2 A;  4A8W A;  2XYH B;  5A0Y A;  3K5M A;  2MZT A;  4M1K A;  2Y9H A;  3WX8 A;  3RAM A;  3TJ9 A;  4OI6 A;  4J9N A;  4J5O A;  2RS8 A;  1REV B;  3M8Q B;  4ILM A;  3QWU A;  3J81 j;  3BBF A;  2FJB B;  4XPC A;  2HWH A;  1R6V A;  1H98 A;  4RNM A;  4I6Y A;  1DTQ A;  2DB1 A;  1YBU A;  3QLH A;  4HDG A;  4JV5 J;  2RHS B;  5L38 A;  4QW9 A;  1SQE A;  1IJF B;  1U02 A;  3VF0 B;  4WYL A;  2W4D A;  3KLV A;  2VG7 B;  4AYB D;  3JQK A;  2FGC A;  1BWV A;  1Q7L B;  2YX1 A;  3GV5 B;  3KMQ A;  2BQ3 A;  3HM9 A;  3GU0 A;  4A8Q A;  2CQB A;  4DR4 F;  1NAQ A;  5D8H B;  2BM0 A;  4WZM A;  2ZZM A;  2LYV A;  1B70 B;  5KT2 A;  1FNX H;  2PGC A;  1YZ6 A;  5FJ4 A;  4F8R A;  1SIZ A;  1RT3 A;  3TP2 A;  1OS5 A;  2OAU A;  3K5L A;  2KYZ A;  4C0B A;  4CH0 S;  1RAJ A;  1X9W A;  2E1M C;  1AZS B;  5ETT A;  4ED2 A;  1KDN A;  2KJV A;  2VOO A;  1IWG A;  3E2E A;  4I69 A;  3W60 A;  2LQB A;  1SJF A;  4V19 X;  3N28 A;  4YY3 F;  4DV3 F;  4U95 A;  4CIO A;  1Q5V A;  3L7O A;  1H7X A;  3T3F A;  2J0X A;  4ZCM A;  4P10 A;  1CJT B;  1Q79 A;  3G6V A;  3CCZ A;  2YH1 A;  2ZH1 A;  3DGV A;  2CPJ A;  3G9C A;  4N77 A;  1RAF B;  1UAW A; 
#chains in the Genus database with same CATH homology
 4OYB A;  4CLP A;  1Y11 A;  2WZ1 A;  3C14 B;  2W01 A;  1Y10 A;  4NI2 B;  1CJU B;  3ET6 A;  4OYI A;  1CJK A;  1WC6 A;  1U0H A;  4P2M A;  1CJV A;  2GVD B;  3MR7 A;  4OYW A;  3ET6 B;  4CLT A;  1CJK B;  5IV4 A;  3G82 B;  1U0H B;  1CJV B;  1WC4 A;  4OYP A;  1TL7 B;  2GVZ A;  3C15 A;  4CLS A;  3C16 A;  1AZS A;  4CLY A;  4WP8 A;  4OYX A;  4WPA A;  4USW A;  4OYA A;  1CJT A;  1CUL A;  5IV3 A;  4CLF A;  4P2X A;  1AZS B;  1CS4 A;  1FX2 A;  1WC5 A;  4WP9 A;  3UVJ A;  1FX4 A;  4UST A;  4OZ2 A;  4USU A;  5D0H A;  3C14 A;  5D0G A;  4CM2 A;  4WP3 A;  4CM0 A;  4OYM A;  3R5G A;  4CLL A;  1WC0 A;  1WC3 A;  1YBT A;  1YK9 A;  5D0R A;  4NI2 A;  4CLK A;  1CJU A;  2GVZ B;  4USV A;  3C15 B;  5D15 A;  1AB8 A;  2GVD A;  4CLU A;  2BW7 A;  3MAA A;  3C16 B;  5D0E A;  4CLW A;  4OYZ A;  2QV6 A;  4OZ3 A;  4OYO A;  3G82 A;  4P2F A;  1CJT B;  1CUL B;  1YBU A;  1TL7 A;  1WC1 A;  3MAA B;  4CLZ A;  1CS4 B;  3UVJ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...