2MTLA

Solution nmr structure of de novo designed fr55, northeast structural genomics consortium (nesg) target or109
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
88
structure length
88
Chain Sequence
MGEMDIRFRGDDLEALEKALKEMIRQARKFAGTVTYTLDGNDLEIRITGVPEQVRKELAKEAERLAKEFNITVTYTIRGSLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords De novo designed protein FR55 OR109
publication title Solution NMR Structure of De novo designed FR55, Northeast Structural Genomics Consortium (NESG) Target OR109
rcsb
source organism Artificial gene
molecule tags De novo protein
total genus 26
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2014-08-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 2mtlA00
4JI6J 3T1YJ 4LF4J 4LF7J 4X64J 1IBKJ 2UXBJ 2MEWA 3D3BJ 1XNQJ 4DUZJ 2F4VJ 1IBMJ 4GKKJ 4DR3J 5LM7E 1XNRJ 3W1YC 2VQEJ 4DV7J 1XMOJ 4DR6J 5AJ3J 4DR4J 4DV4J 4NXMJ 2MTLA 1N32J 4JYAJ 3OTOJ 4B3SJ 3J80U 3R2CJ 2UUBJ 4K0KJ 5A2QU 4DV0J 4LF9J 4B3RJ 2KL8A 4DR2J 4OX9J 4LFAJ 4JV5J 1N34J 1HNXJ 2UU9J 3IMQJ 4LFBJ 2KVQE 4DV3J 2ZM6J 4X62J 4JI8J 4NEZA 4PWWA 4AQYJ 4DR1J 3JAMU 4NXNJ 4JI0J 4JI2J 1N36J 5IT9U 3R2DJ 1J5EJ 2HHHJ 4X66J 2UUAJ 1IBLJ 5LMUJ 4NEYA 4B3TJ 2UXDJ 4X65J 4DV1J 4YY3J 2UUCJ 4DV6J 4KY3A 4JI5J 4DR7J 4JI1J 1FJGJ 4RJVA 4LF5J 4DUYJ 2MQ8A 4DV2J 4YHHJ 2E5LJ 5LMNJ 3D3CJ 4B3MJ 2UXCJ 4DV5J 1I94J 3J81U 4GKJJ 1HNWJ 1N33J 4LF6J 4V1Ak 1HR0J 4JI4J 4JI7J 4LF8J 4KHPJ 1HNZJ 3T1HJ 4LFCJ 4KYZA 4DR5J 2VQFJ 5BR8J 5IWAJ 3J7AN 5FLXU 1XMQJ 4HHUA 4JI3J
chains in the Genus database with same CATH superfamily
4RW7A 3OT9A 3W2WB 3TZXA 7FD1A 4DL4A 2MEWA 3OFFA 1E6YB 4Q43A 2ZH5A 2XNRA 3SQGA 2IRUA 2A6OA 3DI6B 1S97A 1R0AA 2KU7A 1B0VA 2J76E 1GNKA 4EZ9A 5KFYA 4JV2A 1S49A 4OX9J 3FBCA 4PWDA 4PG5A 1ZH5A 2LQ5A 3KMQA 1T02A 3C6UA 2W8LA 2E1RA 1VQOS 2GMHA 1IKXA 1H73A 2OEJA 4J9NA 1S48A 5F8JA 4DV2F 4IKAA 4ZHRB 1HI1A 4TYAA 9ATCB 2AMCB 1KNZA 2HZVA 1JLCA 1E6VB 3ZZTA 5F3TA 3BF4A 4ECYA 3Q2SC 4WKYA 1SL0A 4OHWA 4ZPDA 2HAIA 1W2BR 1IJEB 3QGPA 3ZNUA 1VQ8S 3OLBA 2CXEA 3RW7A 5KFSA 1R8CA 1KTVA 1R7IA 3JSMB 4DZDA 2WW4A 2WVFA 1WHYA 1P1LA 4WU3A 1NK8A 2QYGA 4CLSA 2MTLA 2H65B 2V63A 1G2EA 4M5DB 4LJMA 1YITS 2W24A 2OPPA 3HHLC 3TJ8A 1A9NB 1N5QA 3IS9A 3VGUA 3VGTA 2I5JA 2VBZA 3G8SA 4NXNJ 3D6HB 4F0KA 3I32A 2WB1D 3FZBA 3M2UB 2BVZA 3BGOP 4OYIA 5I4MA 3IWLA 3ICLA 1LW2B 5D4NA 3BDPA 4TYBA 1WOSA 2K06A 4CWBA 2HHTA 2M5YA 1ACMB 1FT8A 4BC9A 3VQSA 3QGIA 2VH7A 5B0BA 2BJ1A 3HJFA 1UAWA 3B4DA 4FF4A 1O0PA 1XR7A 1U6FA 4OZ5A 3UE2A 3MM6A 4CYUA 1CJVB 1YK9A 3FEXB 2IAJB 2MQOA 3MPDA 3UN5A 6FD1A 1Z1ZA 1EKRA 1KBRA 5F8LA 5E33A 2XSFA 1O6XA 2PGCA 2IA6A 2HURA 1TK8A 2AP6A 3L7UA 4YEAA 4G1IA 4NLGA 1UPMB 4F0MA 2DR7A 2DNGA 2VOPA 4IDKA 2G13A 3SCLE 3TAMA 5KFPA 2P5VA 2E5IA 4HHJA 4G1QA 4QQBA 4Y3CA 3IGNA 5D4PA 3FCVA 1FE0A 3OSPA 7FDRA 5J2MB 1U0HA 5KFMA 4MJKA 4BS2A 5IC4B 3ADAC 4HVZA 1UTAA 1JLQB 3W5YA 1WSRA 4DI6A 3V5RA 5KG6A 2LDYA 1RT6B 1CEZA 2BM1A 4MT1A 1KEKA 3X1LB 5FLXU 3PZPA 2YNIA 4N7TA 3UD4P 1OPZA 4F3OA 2Z2YB 2XLKA 3M8WA 3WIUA 3SI8A 2CPZA 3DRSA 1T9XA 3T1AA 4UQGA 2VFSA 1ZTWA 2W8KA 1JJ4A 3LWLA 2OI2A 1Q82T 4P74A 4DQQA 2N3LA 3GFZA 2D7SA 1XERA 1OY8A 4QR1A 4HI2A 3SYZA 4ETZA 3NGUA 4YB5A 4CQ1A 4WK3A 3G8QA 2HYIB 3PHEA 4UW2A 3R3TA 4BLGA 2JEIA 4JI2J 4N8NA 2WVCA 3HSDA 1XN9A 4QWDA 2JEFA 3OFGA 2XS5A 1PILA 4X4SA 5F8HA 4QU7A 3W5ZA 2R4FA 1Q7LB 1A7GE 2ZHAA 1IBCB 3K5NA 1DTQA 1SUQA 1DQAA 2DR6A 2MXYA 1VISA 3V6HA 2BE9B 1T9WA 3I9ZA 3LGNA 5GADI 4Y6IA 2ILZA 4I6AA 3CC7S 5DM7Q 1RHMB 1PC5A 3LPEA 1RWVB 1JLGB 4J7CA 2ZOMA 1ZOTA 4OHXA 1CG2A 3UCGA 4I69A 3ET6B 2QA4G 1MSWD 1PBUA 4L74A 2BMBA 4ANEA 2XULA 3NY0A 1CPZA 4X4TA 2B6AA 4O3PA 3DDNA 4O3SA 3TYTA 4CNZA 3MOJB 1FKAF 3OTBA 3D66A 5D0RA 1EETA 2NXCA 4CO4A 3RB0A 2NLWA 4IG3B 2PFFB 1VQKS 4YN3B 1NHKL 4KC5A 1RSCA 3QIDA 2F1FA 1ZTTA 5H9FJ 4U67Q 5HP1A 1FRMA 3HD2A 1RAHB 2G4BA 1CJUB 2FD2A 1P9YA 3Q8PB 5KG3A 1YRUA 4LRDA 5KFVA 2H48B 2W4PA 3PTWA 2EKYA 4J37A 2XS2A 4A8QA 3J81U 2MKKA 1WDDA 3B78A 1KSPA 3IO1A 1YKWA 2MGZA 2FJVA 5LMNF 1QD1A 3EXCX 3E01B 5J2NA 3DHXA 3MM9B 4QWCA 1RT4B 3DOKA 5AE1A 4J9SA 3PVXA 2I38A 3LP1B 2ZBRA 1UFWA 3MEEB 3DOLA 3D68A 3M4XA 3OTOF 1RT3B 2WCXA 3G87A 3F0NA 1IXKA 2KKHA 1T03B 1U8SA 4DX8H 3B6BA 4ELTA 2YKNB 1VC5A 1N52B 3C16B 4A8SA 2HS0A 4KV8A 2HLUA 3V4IB 2QSWA 1F9HA 3CJTA 1JJHA 3CDUA 2R2UA 1WELA 4K0KF 3EDQB 4FVMA 2VODA 1W2IA 1OYEA 1NJYA 2BKOA 5E7OB 3OL6A 3CCWA 2DIUA 5D77A 3BSNA 5EUHA 1U47A 4BWMA 4DFPA 2DVIA 1C0TB 4OYMA 3O8WA 4AE5A 4DV5J 2KDOA 1HNWJ 4JI6F 4OIXA 2P2CB 2BANA 4LF8J 4DF8A 3ENAA 3HJVA 3GWCA 1K1SA 1HKAA 2DKOB 4Q44A 2YX4A 1R3NA 3EDRB 4X4OA 1U1MA 3QLHA 3AA9A 1YJVA 2F8MA 1FRJA 1H2TZ 3VHQA 4FXVA 1S9FA 2CQIA 2AEJA 4C8MA 2CJ9A 3P96A 4H4OA 1REVB 5KG2A 3BO4A 2IPOB 5IV4A 4O4GA 1KKHA 2B4OA 1BHNA 1S1UB 1HBNB 2MKYA 2QT7A 1YQHA 1PYOB 1RISA 4DV3J 2GAGC 2BRKA 5B0GA 4OX9F 1T94A 3DLKA 5A8WA 2NYHA 3OQ2A 2HHHJ 4K4WA 1FRKA 4RW6A 4YR2A 4C8YA 1UVKA 1S6PA 3PRBA 4NCAA 1N5VA 2DHAA 4UQTA 5I3UA 2Y8WA 1JLFA 3SBMA 3G82A 3KTQA 3W64A 3MURP 5KT4A 1DQ8A 5FDLB 2ZUGA 1Q8LA 3JAMY 1U4BA 3PYDA 4JI7J 1TL1B 4K4XA 1FD8A 4CT9A 5HMXA 1RKJA 1HPZA 2AZ1A 4ICLB 2V5HG 1UZDA 2O01C 2FHOB 2BJ8A 3DOMA 3W3SA 3DXSX 1SKWA 4ERDA 4DL6A 1YJ9S 1RTJB 4EZ6A 3CMQA 5C24A 4DR4J 2YVSA 5A0YA 4ZIWA 2XO6A 4X4PA 2XNQA 4EFAC 1XIQA 2OPRB 3CW2C 5DG9A 4ANDA 3G6XA 3KLIA 4NCGA 2OEKA 3D0IE 1NJIT 5HLFB 3PEJA 3OR2B 1YJRA 2HGNA 3TNVA 4OYBA 4MIBA 1YVFA 1PYTA 3PJWA 3VZHA 1N36J 3UPFA 5LXYA 5C5JA 1RK8A 1VFJA 1S1WA 2X1AA 3BKUA 3M30A 1Q5VA 4NXNF 2BE2B 3RAXA 4UY85 1T3OA 4IO9Q 2AZ3A 1N4LA 2OMLA 4KHPF 3CC2S 1VQ9S 1L3KA 1HQEA 1MNEA 2DNMA 5HBMA 3MCSA 1HR0J 4LUBA 3CCZA 3DRYA 3R5DA 4R0JA 2C3YA 1NK6A 2YH0A 4P75A 1C2PA 4RWXA 3QMQA 4ILLA 1QJHA 4TY8B 2HMIA 2PMWA 4UTGA 4O3RA 1FVQA 3CD0A 4XPCA 1T0TV 3FSXA 5FJ4A 3UVJB 3W62A 3K58A 1TAUA 3J80U 1PG5B 4IFYA 3C66A 2HQGA 3MD3A 2FY8A 2RQ4A 4BCAA 5EGYA 3FRZA 3W60A 4XK8C 4P52A 1A0OB 4ZP7A 5GAEU 4B3TF 3P8BB 3FBEA 2EEYA 4O44A 2B9WA 4CDIA 4EO6A 2QA4S 3GSIA 1C0UB 2ALYB 2DR8A 3LALA 3JTNA 3HFKA 3O2IA 4B3MF 3B8HA 5JMNA 1P27B 2LYVA 1L3SA 3R6LB 1EHWA 5LJ5Y 3UCUP 3CD7A 3AODA 1U1PA 1T9YA 4YB6A 2VC1A 4IFVB 5IC6B 2VQFJ 3AQOA 2MQPA 3VTIA 1KP6A 1U6ZA 2ZD1B 4X64J 2DNRA 3M2RB 3IM8A 1N32F 2QLXA 2GNKA 3QRPA 3C19A 5I42A 4P2MA 2MLYA 4DR6J 1KTQA 1F9FA 3DRRA 1SBRA 1U1KA 2FPHX 4P7TA 3JSRA 1O8BA 3VAHA 1FK9B 1UZHA 3HK2A 2XI2A 1V5IB 3H5UA 2PN6A 2M3DA 3SCIE 4PWUA 3E2EA 1RJJA 2JVRA 4I6YA 4WFAQ 4LBHA 3LUYA 4K4YA 5LMUJ 3CO0P 4JI2F 4W92B 2FJWA 2G2ZA 3PRVA 4QU6A 3RBDA 4B3OB 5ETKA 5F8IA 3GIIA 4LQ3A 4A46A 2PE8A 4KGZB 3ENWA 2IIHA 4JI3J 2O1PA 1RI7A 2KG0A 5F8NA 1JJ2R 3L3CA 2R7SA 4PKDB 2Y0SD 4IH6A 2VBXA 2E9TA 3LP2B 3T5LA 4ED2A 2K1RA 2CPIA 4DFJA 4ECXA 5IS2A 3PEHA 1EP4B 4JV5J 3LF0A 3BN4A 3SXLA 4CLZA 3HM9A 4K4TA 3KLFB 4TVAB 2VG7A 3S7RA 3KK1B 1Q5YA 1RTDA 2JL9A 2HQIA 3OR1A 2ZUAA 2Q3PA 4NYOA 3D1QA 2DIVA 2O3DA 3CO9A 3H4DA 1Y00A 3DFEA 1F3VA 2VFUA 4M5LA 2BR0A 1QVFR 5ETMA 2A1BA 3E3XA 4IH5A 3MZIA 2ZEJA 3CD6S 5E0OA 1NB2A 2C2ZB 2IJRA 5HATA 4ZCLA 1Y11A 4F67A 1G7CB 1KLMB 4KJIA 4FNIA 4DR3J 2R7UA 4C0BA 4A8WA 3HVWA 2HS3A 2RS2A 2ZVSA 2GFFA 4LF2A 1FXRA 3AH6A 3BV8A 5HROA 3THVA 1HHSA 4OYXA 2LQJA 4RW8B 1HFEL 2JEGA 2QSFA 4F26A 3IG1A 2GJFA 3LTOA 1BQMB 2HAFA 4X62J 2DNYA 4ZLJA 3CWJA 5K8MA 3TAPA 3A1YG 2XMTA 5AXNA 4HH1A 1QTNB 4K5RA 4FF2A 3MAAA 4ZLNA 1S10A 2ILYA 4DEZA 2C2NA 2AU0A 5CABA 5JVGQ 2WBRA 2JH3A 3CCJS 4ELVA 4U6PA 5F3ZA 3F73A 4LF6J 3DDKA 3MPVA 2ZH9A 4OJ1A 4AD6A 3CCTA 3DC2A 1X9SA 4WP3A 3M9OB 4DV5F 3MEDA 3ULHA 1UJ5A 4LF8F 2YWHA 1URNA 2D3ZA 4NZ6A 1TL3B 1XMOJ 4DV7J 5HO4A 5HQMA 4OJHA 2B3TB 1I1GA 1X4DA 4NLTA 2MZSA 4F3MA 5I3QA 4QBUA 4PRFA 4M5KA 4U7UK 2YXLA 3VVTA 1CVJA 3HSGA 3MF5A 2Y1JA 2YY3A 1S72S 2OH2A 2V69A 3RBEA 1GQEA 2J7WA 4RW4B 4DQRA 4QYZK 1NAQA 4DV3F 3Q0AA 1SKUB 2OSRA 3I4HX 4USUA 2E5HA 1S1TA 1XQIA 1X4FA 3DYAA 3QGHA 3RR8A 1DY3A 1YJUA 2E9RX 1UFKA 4XAKA 4MKBA 3EUNA 1XWLA 4FYYB 4XDDA 4M8LA 2XHWA 1TK5A 3D5MA 2WHOA 2ADCA 2JX2A 2WOMA 4JI7F 3C6TA 5D0GA 2V2KA 3KJVB 1VJWA 1RLDA 1H7WA 3WHIA 1RAIB 4I2PA 3ZZOA 3BGRA 2NSCA 1MU2B 4AXIA 3CDWA 3GJQB 4DWIA 3CIZA 1PKUA 1WC3A 1RCOB 5D4OA 4TNOA 4NXMJ 3W9HA 1FRXA 4G65A 5GAGU 3NNHA 2VOOA 2RVJA 3RU0A 2DHHA 3PHTA 2HIQA 3BJYA 1VGYA 3FMBA 1U2RA 2GVZA 2C2RA 3GZ7A 3EPGA 4AL6A 3Q83A 3WDOA 2N3OA 2L9NA 3MM8B 2NQPA 3OD2A 4P2SA 2HHVA 3AT1B 3GJRB 5LXRA 2W9AA 1N36F 4Z7YA 2HNDA 2F4FA 1I94F 3MDFA 3CJ3A 4ECSA 4UY8T 4DUYJ 2VPXB 2ZC3A 3DKDA 4OZ1A 3I55S 2X1GA 4EBDA 2V50A 1S7IA 4C8KA 4QR2A 2FZCB 4Q5VA 4I1TA 1JQGA 1MMDA 3A8IA 1WC0A 2HBZB 3TX8A 5IM0A 2E44A 2IJNA 1KOOA 1HR0F 4U7UD 3MPUB 1IBKJ 2UXBJ 5T7LA 1NO8A 2YWWA 1L3VA 2IJFA 3GIKA 3BKFA 2M2BA 3R9LA 2DH9A 1Q4RA 4LSLB 4C2MA 4DS5A 2ATLA 1CULB 5L1IA 3I6PA 3J80Y 2WK4A 4K2JA 3BH6B 2DNOA 3V6DA 1WHWA 5C25A 2UUAF 3JQJA 4DFKA 4YS2A 1RTIB 1FHTA 3CSKA 1TAQA 1NJWA 5F9NA 3ILOA 2J0SD 4FKYA 4X66J 4CTAA 3KHRA 4CT8A 3Q89A 4EI2A 1VQ4S 3MGJA 4FXWA 3KJFB 2VFVA 2C3OA 2PC6A 4HEA9 4FBUA 1T7PA 4DX5A 2MLZA 4OHVA 2E1AA 3HT0A 4RNHA 4OZ3A 5IZHA 1RQ0A 1M5OC 4TXSA 2XLIA 3CCUS 4NA1A 2LU1A 1VQMS 5HVGA 3IAM9 5ITHA 5JVHQ 2I9SA 3PW2A 2VQFF 2E1CA 1N6QA 5LSLA 4FYXB 4I7FA 2JFKA 3JQKA 2ZNZA 1X60A 3M7VA 4X64F 3TVYA 1NJZA 1NSKL 1CJKA 5SUHA 4Z2XA 1BQXA 2HHWA 4DR6F 4DLGA 5CQGA 2XGPA 1R0CB 2FJDB 3FNNA 3CCLS 4J9RA 2R9LA 3PRDA 3FUYA 3BREA 3ZXWA 3BH7B 4JI8J 1FRIA 2WVBA 2WAQD 3QIPA 4MK8A 2FJAB 3MCMA 2EG2A 4F3QA 1B7YB 1HWKA 3HX9A 2R7QA 5KG5A 4ZJLA 3UW1A 3SMZA 4IOCQ 2QIFA 4RZRA 3AHPA 4N8OA 2Y1RI 2LVWA 4DR7J 4YDDB 1WJ9A 3N9UC 2DYAA 5AT1B 4OYOA 2XCAA 1R31A 2B9YA 4ILMA 5CYJA 2ROGA 4CLPA 2PI5A 3J7AN 1Q8BA 4F4AA 1FDNA 1M1GA 3F44A 4OZJA 1O51A 3ITHA 4LF7J 4OI4A 1TVRA 5B08A 4LQ9A 3OVAA 1IR1A 4JI3F 5A8KB 5EX0A 5KTQA 1TL5A 4C8OA 1VQYA 2W7AA 4C98A 3ETMA 5HQ8A 3HHLD 3M6UA 4F4WA 1NDCA 3KK3A 2ZH1A 1KDNA 4ZITA 2K7KA 5B0FA 2G0JA 2AYMA 2IYGA 1TV6B 1N5SA 1SQEA 1TKTB 3OXGA 3MM5B 4F4ZA 3RTVA 3KUGA 4WFXA 1GH8A 1RWWB 3C2PA 4JV5F 3M8SA 2VG5A 3U7JA 4ER8A 3RR7A 3DGPA 2IVFB 5CD4H 5L8RC 4DV6J 2RRAA 4F8RA 4RR5A 3DU5A 1N5YA 1WF2A 1WG1A 1N0UA 2R42A 4BBYA 1SH2A 4OFZA 2D74B 1XC9A 4B9MA 4CZCA 3OUYB 2OD6A 5DLFA 3ISZA 1R0AB 1SQFA 3FKBA 2SXLA 4ED3A 2CADA 4OX6A 3TANA 4ZA1A 5IXUA 3JQMA 3MFHA 3NGSA 1LWXA 2GHVC 1PAEX 1X4GA 1IKXB 3QAUA 1LWFB 2C2DA 4CCHA 1YBTA 4H4MA 1NK0A 4LF9J 1ZZFA 1HWIA 2YQ1A 4ZVHA 3DNCA 1JLCB 4F36A 1VC6A 2UVWA 4DL3A 4I0WA 5C42A 3D0HE 3SDEA 4M63A 4DUTA 5AE2A 4X62F 3HVAA 2R7TA 2H5EA 5EWGA 4MFBA 1IM6A 4PZVA 4HTJA 4USTA 3POTB 1ZM9A 3OFHA 3FCHA 4ED1A 3FZ2A 1HD1A 2F8HA 1YRXA 3PX0A 2EFPA 2OP5A 4U8VA 5BR8J 3DRPB 4F02A 4LF6F 3I0RB 2GVDB 4YR3A 2B8QA 5K14B 4L76A 2F4VJ 4B9VA 1PSDA 1TQLA 4WZQA 3IS9B 2Q1LA 2HZAA 2Y1IA 1SV5A 2CPFA 2I5JB 3UN3A 1D3WA 4DV7F 1XMOF 1OMSA 1FRLA 3OJSA 3MR2A 3R2CJ 2MJNA 2JLEA 2QRRA 2DCUB 3AD9C 2CA9A 3DN9A 1IM4A 4B17A 2MHEA 1SJ1A 1KRPA 3RRGA 4YDXA 5KFBA 1P8GA 4C11B 4URGA 3QZ7A 2RKIB 2C2KB 2V8PA 1Q78A 1LEOA 3W66A 1OQ6A 2RMLA 4RBUA 4E98A 3MM6B 3CJ8A 3CCQS 1B3TA 2YTCA 2VKRA 1IKYA 1NNDA 4ZJQA 2XYPB 3IR6B 4PABA 2NXUA 3GLJA 3UQSA 3T1HJ 4J9VA 5ETNA 4NLRA 4ZVUB 3LH2S 4NLYA 2HW3A 2CQDA 3FSYA 4LSNA 3PW5A 1Z2LA 2ZNYA 3G96A 1KONA 4IDKB 1BWEA 4K4SA 3TAMB 2IDEA 1D0EA 1X5TA 4WZMA 3DLEA 4DV4J 2AV5A 1RTHB 4N56A 3QO9A 5ETVA 4NLWA 2HNZB 4Q2MA 3FK4A 2U2FA 4G1PA 1ZETA 4DCPB 4KIAA 4DR2J 5KFDA 4GC7A 3H59A 1UW9A 5CH7B 2F9JA 2J8AA 1N8RT 3MUMP 4USJC 4FNHA 3KNAA 2ZVIA 3LP0A 3CCRS 1LKZA 1OPIA 4ID5B 1EAYC 4DV1F 3PV8A 3PM9A 3GU0A 4CP5A 4DPTA 1H74A 4CLUA 2YNIB 3RZAA 2B9XA 3EVWA 2PO4A 1VJQA 2MZTA 3FBFA 3K5LA 1FX2A 1LWEA 1WI8A 5IWAF 3DRSB 4WBFA 4Q8EA 4DUYF 4Z7CA 3CC4S 4Y2MA 1MN7A 3SEOA 3GYNA 4DR5J 3HI9A 3RB3A 1Y10A 3I0SA 2XB2D 4W90B 2PD1A 4Q0BA 3UCZP 4R5PB 3IRWP 3CULA 2J9EA 3K5OA 2UUBF 1IBKF 3PACA 4WTOB 1BE4A 1PJ5A 1RAFB 2OELA 1NHUA 4B3RJ 5DETA 4NLOA 1M1KT 2CZ9A 1HNXJ 1SUQB 4DF4A 4DPWA 3TX0A 2J6TA 2EBEA 2X1BA 2KB2A 1RGVA 4I64A 2D69A 2KO1A 1XJWB 1TU0B 3R27A 5L46A 3TRGA 2FHJA 2O5DA 4X66F 3IC1A 1SL1A 2VF3A 4IRCA 5MLCV 4USHA 2JEJA 3CCSS 3SV3A 5KFLA 2HNYA 4H4KA 2DRDA 4KRWA 4LIRA 5CAAA 4QWBA 4EUVA 2Z2MA 1VRUA 2CWKA 1VBXA 3W9IA 2B6AB 3RAMA 2DHSA 1JNRB 2GC8A 5GAEI 1L5UA 4U7CA 1RKIA 2N82B 3S01A 3T5JA 3FCWA 4KH0B 5ETLA 4ZHRA 4C3KA 3HHEA 1MWQA 3GP9A 1NZAA 4WKRA 2HHUA 1E6VA 5HP1B 1I51B 3CJRA 4HT5A 3DGVA 4Y0FA 3TQ1A 3T3FA 2YKMA 1UCNA 2BRLA 3TR5A 4H4KC 4TU7A 1MN9A 3GV7B 3V81B 4NASA 1QE1B 2YBVA 4MKAA 1HW9A 5AXMA 3LA0A 2KTQA 3R2DJ 5LSOA 2MGZB 4C6AA 1X9MA 3P6YC 1FXLA 4JI5J 4Y2AA 3DOKB 1UWBB 4ZJOA 2WTFA 5E3PA 1Q16B 5D4LA 3DOLB 4DR7F 4KKOB 1B70B 4GKJJ 4M5DA 1LW0B 2GAHC 2B4PA 2F8EX 3MOZA 4RW9B 1NDLA 1IUJA 1FO1A 1WF0A 3P5TL 2YX7A 1T95A 5HVFA 4UT4A 3T1YJ 4KV8B 4EMDA 1MROB 2OD4A 4F4KA 2YQ0A 4FZVA 2KRRA 3W8GA 5DDQC 4B9UA 1NK7A 4LF7F 2DR9A 1PJ7A 3SFGA 3PO5A 1JXVA 2RIJA 3ZZPA 2KT5A 5KFTA 3M6VA 3G6YA 3KLHA 3BGUA 2QL9B 2VHGA 3QSIA 1VC0A 3D9BA 3QNWB 3WQPA 3R7NB 2W9BB 4RUCA 4MIAA 3DU6A 4L75A 5DDPC 2ALZA 1SB6A 2W2MP 2CNOB 3KKFA 5M2PA 2BANB 2J6SA 2XWYA 3NS7B 2FHMA 3A8KA 3IRXA 3TVKA 3F56A 4YFUA 4RPFA 4OV1A 2EK6A 5A2QY 4IRDA 1SJFA 2DEIA 4S0MA 1LQ9A 5J1PA 1FD2A 2BKNA 1X0PA 3QLHB 2E5LJ 2GO8A 2HG4A 2PFDA 4DV6F 3ZTSA 2YPYA 1VLOA 2PSZA 1FKPB 2DPIA 1KVKA 5GMKa 4MKVA 4WTYA 2EXUA 2CIMA 4CLFA 2GA7A 3IGVA 4O4GB 3QJLA 3NP5A 1RB0A 3EE3A 1EARA 1XNRJ 5H9EK 2ZE2B 3DLKB 5A8WB 1EZZB 1Q8IA 5M2RA 3OTCA 2RUGA 4DX6A 4NZ0A 3GYGA 2AYGA 1U25A 3TOQA 1S6PB 3K2YA 3MFIA 3QFWA 1U49A 4K2XA 1C4CA 3D6FB 4O3QA 3HT3A 4LF9F 3A12A 4DDFA 5J1EA 1RT6A 5I3UB 1JLFB 4JI0J 2DGWA 3MAHA 2BV3A 4GVBA 1VS3A 3OLAA 1NDPA 2JNJA 1HPZB 1IBLJ 2Z30B 2AIRB 1S6OA 1S6QA 3RW6A 2ROEA 4KBIA 1HLWA 3KHHA 3DOMB 4D3HA 4ZVPB 1GAOA 3T19A 2GJ2A 4USMA 3TWZA 1SCJB 3ZFVA 5C24B 2H3EB 1SC6A 2EVZA 4NI2B 2B8PA 4CRJA 1FF2A 4KGMA 3NCPA 3GCWP 4HTIA 2LCWA 3OHBA 4ZLPA 1U2CA 3GR0A 3CT9A 3L95X 3I82A 2Y8YA 2OLWA 3HFVA 4KO0B 2BJEA 3JYTA 4NA3A 4OI0A 1Y5LB 2LLZA 2F4VF 1TTHB 3CXCR 4C3MA 3UD3P 4HACA 4KHMA 4CO2A 3HLUA 3UI3A 1NPKA 3PX6A 1M5SA 1HQEB 3HKWA 2YQ3A 2QC3A 3FVYA 5HBMB 1FNMA 3BYPA 1HBUA 2ZBCA 4ED4A 2AGQA 4D3GA 1VRTA 2HBYB 4Z37A 4ED5A 1NK4A 2UVUA 2GO9A 3PNIA 3G6VA 1W7WA 2FLLA 2QX0A 2UUTA 4DN9A 1TUGB 4NWBA 4UUXA 2BOPA 3KFWX 3TA2A 3SSRA 2ZH7A 2E1MC 2EFNA 1T8EA 3NG8A 4C8LA 3R8YA 3T9NA 3R5GA 1ZZNA 4EBCA 1XEZA 1YWXA 2LMIA 2CPXA 2DPJA 4IFYB 3ETOA 3DLLQ 4IG3A 2AF6A 2V2QA 2GIQA 1RT1A 3MM7A 3KK2A 5EWEA 1NKCA 2F3JA 1GMUA 1JMTA 1S12A 4TQSA 3LO3A 4O44B 4XDCA 5KFJA 2WVEA 2DNQA 4IR1A 4M5IA 4B9LA 2DR5A 5I3PA 1LXNA 4ZCKA 3NGRA 2R8KA 3WX4A 3MTKA 3IA0A 4K4UA 4DQPA 4QW8A 1RP5A 4DR2F 3FC9A 2HKEA 4AQYJ 3PR4A 2I1RA 2DH7A 3EM1A 2FJXA 2CPJA 1RABB 4NEYA 3PG9A 4Y2KA 3LP1A 1HQ2A 2CZ4A 2C28A 3Q8UA 1YBUA 2FQQB 4OZ2A 2C3UA 3ONQA 4B08A 1T03A 1GFWB 5KFXA 1RWPB 5I42B 4QYZJ 2NR0A 2F40A 1KN6A 3W7BA 1YTYA 4LRFA 2HFUA 5HL7Q 3DRRB 3V4IA 2HS4A 1QAYA 3PX4A 1NHVA 4LR9A 3H20A 4DR5F 1DTTA 4GKKJ 4YB7A 1WKKA 4LBIA 2BDPA 2J6UA 3PW0A 2BW2A 4DHVA 4I68A 2W1BA 2UVRA 3D67A 2AJ0A 2RT3A 1N34J 1B0PA 1ZPVA 3TZZA 4JB8B 3T5KA 4B3RF 2VZ9A 4I2QB 3FGVA 4CH1A 4LT6A 2YNGA 4ZN1A 1HNXF 4WYWA 4O0NA 2C3MA 3MR5A 3A4TA 2BJ7A 1JNZB 2IM1A 1FKOA 7AT1B 1KQSR 2RH3A 1LK7A 1FWPA 5HSPA 1AT1B 4KR0B 5B0CA 3H5YA 4TLQA 4AFFA 1F5AA 1UEVA 2V0NA 3R5AA 1JK9B 2DNKA 2DGQA 3IWNC 3D2WA 2OSQA 3A3OB 1HWUA 2K1RB 1S1UA 3M8ZA 4TY9A 2QFJA 1Y5IB 5KT2A 3Q8RB 1N54B 1VHIA 2AX1A 1NPRA 2FY1A 3BR8A 3OVSA 3T9ZA 2CQCA 4EU0A 2KG1A 2L48A 1CC7A 2OO4A 4IOBA 3GIJA 1XR5A 3GQCA 5ETPA 3D6TB 1EB0A 2EC0A 1RTDB 3FFIA 2FGCA 3OR1B 2VB6A 5FDLA 1JXLA 2QLJB 4DSEA 1X9WA 4ICLA 4I56A 3JAMU 2HFSA 2MHNA 1QVGR 3HHLA 5IFMA 4NYZA 3HKZD 2L41A 2V67A 1KVIA 3VZIA 3GFXA 3BGLA 4WE1B 5EDWA 1RBOB 2CJAA 4QIEA 3RJMB 3RG6A 1FWLA 1AA1B 4FP9A 3BO2A 2HHSA 1BQNA 1ITPA 2FVRA 4YUDA 2OPRA 3CJSA 1N33J 3D7SB 1GEHA 4N76A 4KSEB 5AE3A 4GKJF 3OR2A 2W4CA 3RAQA 3LGHA 5HROB 2ZC4A 1F2HA 2DXEA 1ZPWX 2FJBB 1GMWA 4AT1B 2BE2A 3OSNA 3QAEA 4UOGA 2UU9F 1MWZA 2HIYA 2ZM6F 3EVMA 4WJBA 2Q6CA 2BW7A 1YJTA 2MY8A 2XC9A 2D3O1 8ATCB 3PW7A 3H2UB 4L3KA 1SXLA 2KJWA 5IT9U 1VQSA 3GB0A 1DLOB 1UJ4A 3NAIA 3NGKA 1QLNA 1RT7B 3N4WA 3MEDB 4KY3A 3JTOA 1UETA 2KYZA 4Y00A 3SFUA 1WC4A 1QUVA 3D3CJ 3NBPB 3Q23A 3UVJA 4JP8A 3UR0A 4KTQA 1EQMA 2RS8A 2H1YA 2QL7B 3DLJA 3PIPQ 2HK3A 1HNVA 1XMBA 3UDVA 4BHQA 2VL1A 2JLGA 2B5JA 2QZ8A 5CZXA 4OI2A 2HFNA 3GV8B 1Q86T 5AXLA 4P10A 1B4SA 1C0UA 4WU2A 4PQAA 3QWPA 3DLGA 3OPKA 4JYAJ 3RUBL 4F25A 1NSAA 4HKQA 1YRTA 3KLEA 3NRBA 1FESA 3DYAB 1MWYA 5DGAA 1Q79A 5HQLA 2XYGB 3VAFA 2VC0A 3OBIA 2XMKA 3MXHP 5FD1A 4DCOB 4DSJA 3MTJA 4OX8A 1U1RA 2BQ3A 3CNQP 4NRTA 1S0NA 4JI0F 2XZWA 2WOMB 3M8PA 2B7CB 2FIUA 1VQLS 2OAUA 4DSKA 1IBLF 4QPTA 4I2PB 2LFVA 1H2UX 4FPRA 3BGRB 2L9DA 2LXUA 3PJXA 5E3AA 3C3LA 4RUHA 2Q79A 1Y3KA 2LXFA 3BEGB 2RQKA 3TQEA 4J9MA 4L3NA 1NKBA 4RNNA 1GT8A 1XNQJ 1NSPA 3QATA 2XM3A 1RWNB 1GX6A 2RSQA 2VPZB 3E8OA 1C1CA 4WFBQ 1RE1B 2KFZA 2CJQA 3NMAA 2YKQA 3H5SA 5F0WA 4DJBA 1UP1A 5KOXA 1ZBTA 4KFBB 2Z4PA 3ZTQA 4RWWA 4B3OA 3W5XA 3N01A 4PWWA 2ATCB 3CJ5A 3VAMA 4DR1J 3HF5A 4LRAA 4ZPBA 3N5FA 4H54A 1W26A 5GMDA 4IR9A 5CHCB 2E9ZA 2R8IA 2AWZA 2OJ3A 3VQTA 5IM0B 2QV6A 2CG4A 1QAXA 3FEZA 3PJ9A 2A0FB 3LP2A 1Z2ZA 3MHYA 1S99A 5T7LB 1F5CA 1R43A 2E7VA 5KFNA 1U1NA 2DXFA 5CCLA 1Y5NB 5L38A 4X4QA 1X31C 2BUNA 4OZNA 5M2UA 2MQMA 1UA0A 3MWBA 2GGPA 2G2YA 3M8YA 1K0TA 2NUHA 4USIA 3ELHA 3KLFA 4ECWA 1TL4A 2LDIA 5D0EA 3CCMS 1OSDA 5C25B 3KK1A 2CQ3A 1T9UA 1FJCA 1VQPS 3BSOA 5BYSA 3LAMA 2B51A 3X3UA 1SIWB 2VIHA 2XMAA 1YZ6A 4OYAA 3EMTA 1CC8A 2PA8D 1RT5B 4Y28C 3MECB 3QJJA 1CJTA 2E66A 3VGSA 5BJRA 2G2OA 2J7UA 2UUCF 4B02A 3BB5A 2GV1A 2ABYA 3BYRA 3M1VB 4AQYF 1S9EA 4KPCA 4WIQA 3MMBA 3ISNC 3NOGA 1R8HA 2RRBA 4DV2J 1N6QB 2ZH6A 1FDAA 4I7FB 3DMJB 2CQ0A 4J9QA 4FF3A 4ZN3A 6AT1B 2C1EB 3OXFA 3GFHA 4RW8A 4WXWA 1WNEA 2DGVA 3U27A 4RUBA 4OX7A 2MZRA 4FDFA 4GMKA 1HMVB 1BQMA 5KFHA 3M8QA 3CVKA 3UDLA 2IM0A 5A8RB 1SI9A 4EEYA 3TO8A 1W25A 1FFGB 3GR1A 1VMBA 1U26A 1KQKA 1VBKA 1J5OA 2B0GA 4QIVA 3QGGA 2ZJPQ 3D0GE 1BLUA 1DJ0A 2QA2A 4O3NA 1Q7YT 3MUVP 1X8DA 3H8YA 5D8HB 3FRYA 2K7JA 1X4EA 1Q8KA 1HBOA 4QIWD 2W2PP 4PR6A 4C3LA 2R2TA 3SSSA 5B0DA 1N34F 2J0QD 3BS9A 2KYXA 4M5NA 3PFOA 1WUUA 4NMLA 4IQMA 2CQ1A 1RU2A 3ITHB 2UXCF 2IC3A 3H5XA 1TVRB 5D0HA 3R97A 3IBWA 2WRMA 2OUGA 1T05A 3IN5A 5DG7A 3NWRA 3D1OA 4ZP6A 4CO5A 2ROPA 2CKWA 5E5NA 3KK3B 4DX7A 4F2SA 3EVOA 2CVIA 1HQUB 3OHAA 4CO0A 4Q2LA 4LF4J 4RW4A 3BSCA 1KC8T 2XY6A 3CTRA 1YJWS 1WEXA 2BKPA 1YSJA 1IQTA 4QW9A 1VQ6S 4IOAQ 1U02A 4DV0J 3NGDA 1S1VA 3MMCA 3IMQJ 2RU3A 5IT0A 4PPDA 2CNLB 3OL8A 3W8PA 3AFGA 3B4MA 2KFYA 2Z56B 2C42A 1SKSA 2NREA 1J2VA 2ASDA 1S5ZA 4OZLA 3KJVA 2ZZTA 2UXDJ 4JV0A 4CLLA 4ZVOB 1TZ0A 1UWAA 1JLEB 3AY0A 1D8YA 2Q43A 2YWEA 3SZ2A 3K17A 3BN7A 3V2UC 5RUBA 1D1UA 4KAIA 3IM9A 1OJ4A 4HHUA 4H4MB 2Y9HA 1N33F 1WKJA 3HZGA 1X7VA 4PG7A 4P71A 5CYMA 2A6MA 1XBWA 1DARA 2QO3A 1J27A 4NLUA 5C42B 3MM8A 3SDEB 4C7QA 2EG1A 4UF4A 4XIUA 1NM2A 4CI0B 2HWHA 1FCAA 3TEHB 2KL8A 2KZZA 2V2VA 2APOA 3R1HA 3NOCA 1R6VA 2MKSA 4J91A 3AXKA 4NCBA 2VASA 2WSCC 2V6AA 2PEHA 3W63A 1R8PA 4OYPA 1IKVB 2DJWA 3TUPA 1KQFB 5IT9Y 2BBEA 1YG0A 5D78A 5JUMA 4WP8A 3NNAA 3T41A 1OO0B 3H2LA 1U7LA 5D15A 4LSLA 3P5BP 3HSJA 3IBCB 1EQ0A 2DNLA 1GXLA 2DO0A 1SV5B 1CULA 2AYBA 4R8UA 3ILIA 5DZ6A 2XI3A 2OTLS 1AFJA 2X1FA 1LWCA 2EWHA 1IVZA 2HBQB 3JS9A 4F2RA 4K7QA 1RTIA 2KT3A 4CH7A 1OY9A 2DNHA 4ZP8A 3CCVS 4QR0A 3TAQA 3CCES 2IM3A 3N28A 1K0VA 2X3DA 2B7BB 5DDRC 2R2RA 2V34A 4O3OA 1ZS6A 4USWA 4EYIB 2MMYA 5ETSA 3VGVA 1DURA 3GPAA 1JLBA 4IRKA 1FEHA 1IKYB 3D28A 3TARA 2JOQA 4C9DA 4MAKA 2JVOA 4FF1A 4ED7A 2M4MA 4YY3J 3WZ0A 2Z57B 3K7RA 1NB7A 3HO1A 2MKCA 3P4UB 5F0UA 1DFDA 1NRKA 1WEZA 2R8HA 1RHQB 1TUVA 4WIIA 2VDHA 2LEBA 5KFZA 1JLAA 3PY8A 3QO9B 2J0WA 1T9VA 1BUXA 2YPZA 1M5VC 1RWUA 2FHJD 1JKHB 1S9GA 5MAOA 2NUUG 2FVSA 4OYZA 2VICA 2G0CA 1OQ3A 3LP0B 1WOOA 5B0AA 3J7A1 1XNQF 3KUHA 2V9WA 2E29A 3OTOJ 2XS7A 3J7Z5 3MEKA 3M32A 2J9DA 2OHDA 1PAUB 3RBZA 2Y3YA 5H9EJ 1LWEB 4WWSA 2HSEB 2KT2A 3VAKA 2VFTA 3EGWB 1J5EJ 5LSRA 4GO5X 2BA9A 2ACMA 4DCJB 1HIYA 1KOHA 3I0SB 2G1DA 4Q0BB 4CM2A 3VVUA 4MKYA 4RBVA 1OWXA 3CJ0A 1G6BA 1LK5A 2EFVA 3DM2A 5HVHA 1UJ6A 2W2OP 1DAXA 1TKTA 3OXLA 1XMQJ 3MM5A 2ZBIA 4JI6J 4NPOA 1NH7A 2IBOA 2QN6B 3I56S 3NL0A 2MZQA 5J2PB 5DS7A 2E5GA 3N0VA 2G0IA 3P45B 4DL2A 5E2QA 5LJ3Y 4DPUA 4MH8A 4O0IA 1M5KC 3PW4A 2KHDA 2NXJA 3O1LA 5KFQA 4ITSA 2PI4A 3H7HB 4ZMMA 4PXCA 3AJ1A 2XGQA 1N48A 4BC7A 3N5BA 4ZVRB 1UVNA 3OUYA 1S4EA 1S6UA 2HNYB 4WYLA 2DNPA 1P6TA 3CPWR 2DY1A 3SIPB 1VRUB 1QAIA 1RAGB 2WBMA 5HI7A 4EBEA 4ZP9A 5IQ6A 3I87A 3N79A 2XMJA 4E8UA 1T3NA 1RYSA 2YNFA 2WONB 1VBYA 3AB2B 3NMRA 1LWFA 4ZLLA 3DLBA 2YWKA 3UWTA 4J90A 2FVCA 2C2MB 3KLGB 3V6KA 4K4VA 1RWOB 2OFHX 2YKMB 3HXMA 2JWNA 5LM7E 1U48A 4DOZA 1VI7A 3NWGA 5A6PA 3K5MA 2I0XA 2W7OA 4F4YA 2EKNA 4OHZA 2OPQA 2M52A 3JXOA 4PPZA 5B09A 3POTA 1OSCA 4DN0A 4ZVEA 4A8XA 4NYPA 3VWSA 3IWXA 2XBPA 1PJ6A 2AX0A 1YX2A 3ENQA 3RYLA 3UD5A 3DRPA 3BBBA 1DHMA 3I0RA 4Y34A 2GVDA 2XZDB 3LAKA 2ZWOA 5K14A 2HVIA 2P9CA 1IR2A 2P9GA 4ES2A 3SQOP 2XO7A 3ZZYA 5AXKA 1HNWF 2LEAA 5CD4A 1FERA 1FNXH 2HQCA 1YJNS 3PYFA 3THPA 3A3NB 3RB6A 3VV2B 1VHFA 1ULRA 2Q6BA 1VYAA 4LF1A 5ETQA 4KHPJ 4LFCJ 1UMJA 4UOFA 4EK2A 2CAJA 1YIJS 1S59A 3KLHB 4EGLA 2QLFB 2BE7D 3KJNB 2CWXA 2OGUA 3BR9A 1L3TA 4C11A 4GO7X 2RKIA 4USVA 4LF4F 3L09A 4PUOB 3VAGA 5DJBA 2J9DE 1F3FA 1FDDA 1UKUA 5D3GA 3IRXB 1Z4UA 2CJXB 3KLVA 5CCMA 3EZUA 1PBAA 2CPEA 4PEOA 3MAQA 4DV0F 2HHHF 1EKSA 3PDNA 3MEGB 2OPSA 2AKWB 1WORA 4YR0A 2CJKA 2DEJA 2RU9A 1X4CA 3GTYX 4ELUA 2CNNB 4B3TJ 4PG6A 2ADBA 4ZS6A 2OKQA 4YP3A 2BOAA 1SL2A 2UXDF 5KFCA 3CJKB 4TQRA 1RTHA 4B3MJ 2HNZA 3L7OA 2N7YA 4A8FA 3Q8YA 3QPIA 2V4RA 2XG8A 4NZ7A 2JSXA 4C0OC 1ICEB 2HRUA 3BGFA 2A10A 4DR4F 4RX6A 4I67A 4J9LA 4ID5A 2FLNA 1HNIB 3M9MB 3R6GB 2YWFA 5J1EB 4Y65A 1G3OA 1C1BA 1N32J 4GVBB 3PIOQ 4CNYA 3CIMA 3J7YU 1YZ7A 2UUWA 5CYQA 4A8KA 1S6QB 4EYHB 1RT2B 1QDUB 2YKOA 2LEPA 4A8YA 2DNNA 3GJSB 2ZJRQ 3TJAA 2MKHA 3M2VA 1SC3B 3AJDA 4LMZA 3TA1A 2BJ3A 4KGXB 2WZ1A 5K5MA 4R5PA 2XSJB 2ZH4A 2AD9A 2Y0BB 2NCKL 5HAOA 3OL9A 3JYTB 1IQZA 2FVPA 1S1XA 1H3DA 2V4JA 4HACB 2BZ2A 3AA8A 4FPIA 2Q66A 2GIFA 5GAHU 1Y3JA 5E41A 3TUZC 1S4FA 5KG0A 3QRRA 2A2DA 4ANCA 1V6HA 1ZM4A 3H98A 2FVQA 1OS5A 3MMAA 4KPYA 4ECVA 1HBUB 3Q8SB 4DSIA 2HFVA 1WDTA 2POKA 2KFNA 3LPYA 1WG4A 1VRTB 1RHKB 1NEEA 3HVTA 2D3UA 4P2FA 4W4MA 4NL5A 3EX7B 2MLXA 3F41A 1YBAA 1Q81T 3H4BA 4A8MP 5J2QB 5JJBA 4DLEA 3VAIA 5EHHA 2B43A 4YOEA 4X65J 2P9EA 2VG6B 1JJCB 2ZKUA 3ZZ0A 1IWAA 5F41A 4DG1A 3I5AA 2ZBQA 3P3DA 1U2FA 4LBPA 2FC8A 3MPYA 2J9CA 4YY3F 5DZ7A 1RT1B 5EWFA 2HVDA 2JLFA 3NLCA 2ZZNA 5K8PA 3MM7B 3KK2B 1T9TA 2CYYA 3N6MA 3SV4A 1AZSA 4OI6A 5IOLA 5CA5A 3J81j 3O5TB 1SJQA 3V81A 4U8YA 3SCKE 5KOWA 4ZVFA 1QE1A 1HBMA 1N5TA 3CJ4A 3GE9A 4LR8A 3PFEA 4IG0B 1AUDA 3HFZB 3KXDA 2IA0A 4RO0A 1UWBA 2HFZA 1HHQA 3LW5C 4YQWA 3C14A 5K8NA 1HYSB 3J7ZT 4KKOA 1LW0A 1RU1A 5LMUF 4URSA 2GJIA 1PC4A 2HVZA 2BYCA 1WWHA 4RW9A 2OTJS 1EX8A 2HFOA 4TLRA 3IFEA 2RHSB 1MROA 3MR6A 2EFQA 2XQCA 4OV6A 1ZA1B 2QFIA 4FYWB 2XHCA 3JB9k 1T11A 4XTTA 1J5EF 1CBKA 4U95A 1KQGB 3H40A 3EPIA 2FC9A 1DTTB 3ILLA 3L4BC 4P72A 2ASLA 4UOCA 1X5SA 2GQ2A 3GYXB 1RCXB 2CDQA 3WX8A 3JSBA 1V3ZA 1UEKA 2W9BA 2DNZA 1XMQF 4DSFA 2MKJA 3HCXA 2DK2A 2MQQA 2XMMA 2YNGB 3UN2A 1HARA 5KT5A 1U1LA 1Q53A 2K3IA 3TP2A 3W2VA 3QWUA 1FKOB 5A2QU 3TUIC 1S79A 4RW7B 2AGOA 4ES3A 3NNCA 1FKPA 4NEZA 1Q95G 3CGIA 2DGSA 1CQNA 1HL6A 1P9QC 1GMWD 2H54B 2OMOA 2YH1A 3SQGB 2AQ4A 2UP1A 4ZPCA 4XO0A 4WCEQ 5G4DA 1GTEA 3ZTPA 3M9NB 2YNHA 3TJ9A 4JI1J 1FJGJ 3A3PB 2ZE2A 4LF5J 2C2OB 2VKZG 4PWDB 2BACA 2R7VA 4EO8A 1V5VA 1CS4A 4RLEA 1TR0A 5T41A 3C6UB 3EICA 1AYEA 4DR3F 2NXNA 1YHQS 1X5OA 2QMXA 3FFIB 2RQCA 2P8IA 1X4BA 1JIHA 1WC5A 2CVEA 3WBZA 3KMSA 3GJTB 3IXQA 3HHLB 3C15A 3CB4A 5HN0A 4L72B 4CO1A 1SH0A 1K8AT 2GMJA 3ZTOA 4NI2A 3D54A 1BQNB 4F04B 2BQRA 3MR3A 2VPYB 1HD0A 3KWMA 4WFYA 2DRAA 3MPWA 1VDHA 2P6TA 1KWMA 2CDRB 1V3RA 4KO0A 2QEXS 1TMMA 4PAAA 3Q86A 2OPPB 2VA2A 3VR1A 4C4WA 1I94J 2K8GA 4JI4J 2CQBA 1ZAXA 1S0MA 2LXIA 1I3OB 2GHWA 3THTA 3BQ1A 2XY5A 1M5HA 1NUEA 2H9ZA 3GILA 1U45A 3K0JA 1HA1A 3IP0A 4LFCF 4NLSA 4DUZJ 2KJVA 2XY7A 4CH0S 1F1BB 2XLJA 2ZZMA 3MCOA 1TKXA 2EFGA 3QT7A 2MJUA 1SVDA 2Z2LA 2X7IA 4LIWA 1L3UA 5KAKA 1UA1A 4P9SA 1B99A 4ETXA 5KFKA 2XZTB 3NKYA 2KM8C 3OV7A 4LFBJ 4FBTA 4CYUB 2H4YB 1S57A 2VU5A 1NSQA 3I9V9 2W9CA 4IH7A 3QSYB 4OJ3A 3OFEA 4QIGA 2DGXA 5GVQA 1NZ8A 1U24A 1M0SA 2UUAJ 3C8YA 2F63A 5ADZA 1HNVB 5F8GA 2ZHOA 4KQZA 2B5JB 4RU2A 2K3KA 4TU9A 2R7OA 3G9CA 4FN5A 4V1Ak 1IR0A 2QL5B 4LR7A 1Y0HA 1WTFA 1B0TA 4G1QB 4B9NA 3DLGB 3QT8A 3GIMA 1IKWA 3GG1A 3L7PA 2DB1A 3KLEB 3PR5B 2J5AA 4NXMF 3EZ5A 1U0HB 2QE5A 1TL7A 2CJYB 5G0RA 4OMFG 1D9AA 2IBKA 1TELA 2GQQA 3CDAA 2DTJA 5DGBA 5FLXY 4M5JA 2QJ3A 4QWEA 1TUWA 3M8PB 2WSEC 4MYTA 1MMLA 4FS1A 2L3MA 5DRKA 1CQMA 1IJFB 2KRBA 2DO4A 3ISND 4OJGA 4PQUA 1WF1A 4R25A 1KHVA 4F7VA 2AEMA 2NXEA 2CQPA 5T14A 5KFOA 4ZPVR 2RUSA 2QA1A 4X84A 2NPFA 2RF2A 1K44A 1C1CB 2UXBF 4WP9A 4KYZA 2GZOA 3TI0A 4PXDA 4ED6A 4V19J 2LA4A 3EXYA 3NXZA 4I2QA 5IQQA 2NPIA 4WFNQ 3W1YC 1KD1T 1DTQB 5J1NA 5B7WA 1TKZA 4NLVA 2EI5A 5U47A 1KHWA 3I4PA 3W2WA 1F6TA 2CZVC 1GXUA 5FIIA 2MPUA 1QSSA 1Y4ZB 1E6YA 3KG4A 4Y2CA 2HZCA 3LANA 2N7CA 3VALA 2I6WA 3T6BA 2EC2A 4IO1A 3DI6A 4F0HA 1BGXT 2NSBA 2IFXA 1FJEB 4I4BA 1SPBP 3R1LA 1RBLA 1NXIA 2GGPB 3I31A 2NZ4A 2B56A 2HHPA 1R6YA 2U1AA 4UZBA 4X65F 1UPPA 3A8JA 3SSQA 1EETB 2K2PA 4DU8A 2ZH2A 2YKPA 5C2GA 2HPUA 3AOAA 3R7SB 2HQDA 1LFWA 2KHCA 1JXEA 2COLA 3O44A 2VV5A 1U1QA 4K5SA 2IRYA 2Z0GA 4ZVQB 1CJTB 1X4HA 3J81Y 1FA0A 4WE1A 4ZVGA 1AW0A 2W7PA 3TA0A 3NGTA 2HK2A 8AT1B 1S9EB 4USKA 4JI8F 2F9DA 3MMBB 3BBCA 4J9UE 4CO3A 2VBYA 5J2NB 2MZJA 3JSMA 3HVRA 2OIHA 2XTJP 2RDIA 4DBQA 3IAS9 3CMAS 2GQCA 4NLXA 2EFOA 2YKAA 1RAAB 3ZTRA 2M8HA 1UVMA 3AOCA 4C8ZA 3M8QB 4ENOA 5ETRA 1RWMB 2BABA 2GMLA 1BC6A 2J0XA 3S8SA 4NMXA 2WSFC 1J5OB 5KFRA 3RBXA 4K59A 3M2UA 1S7HA 1RWXB 4GC6A 2DGUA 5D6GA 3EJMA 4R0EA 1UL3A 3PYEA 1LW2A 1RA7A 5KG1A 4DL0C 4C48A 1HBOB 3FMWA 3U02A 1VQNS 1FX4A 1DLOA 2DBBA 2CUYA 1WTBA 2ASYA 1U6BA 1RT7A 2ZITA 3CF5Q 1NK9A 3PYGA 1CJVA 4ZPAA 2IAJA 4GRSA 3G71S 1WSVA 1RWKB 4QWAA 1H72C 1YDLA 3N6LA 3NBPA 2IC3B 1GX5A 1Q0NA 4WK1A 5E3RA 1P1TA 3W65A 2Z2ZA 1VLYA 3UR3C 1T05B 1D9DA 2NZCA 4AUKA 2Z58B 2AJ4A 5K9FA 3CDEA 4H4OB 2IY5B 5L9XA 4TN2A 4K4ZA 2D3OR 3ENVA 4QIFA 2HWIA 1VBZA 4RU9A 3KUEA 4JI1F 1S77D 1FJGF 4LF5F 1FRHA 1PGZA 2CRLA 3K59A 1PO6A 2VJVA 4KHRA 5J2MA 1ROFA 4RW6B 1S1VB 1WC1A 2R8GA 2V2ZA 3O6QA 3MMCB 3KYLA 4WXOA 1GK8A 5DG8A 2F5GA 4RNFA 3T5HA 1U0SA 2DY9A 1JLQA 4P2XA 1R0BG 5BYRA 2MYFA 2HHXA 3GONA 3SCJE 3G82B 2OFGX 3T6JA 2FTRA 1VK8A 4NLDA 1U1OA 4HI1A 1ZM3A 1N0VC 1ELOA 2W01A 1MLAA 4FXDA 3QYYA 1FE4A 5E3CA 2EK1A 2FLOA 2ZOFA 3S6EA 4FS2A 5HK4A 2C2EA 5A0YB 3CJ2A 2UV8A 5DM6Q 4DV1J 4QOTA 4WPAA 2IMOA 2ZH3A 4RJVA 5KFEA 1LFPA 5CYMB 4W98A 5BR8F 3KLIB 4NCGB 4K8RA 4J9OA 2Y1LB 4EWTA 1UVLA 4KH1B 4LVOP 3BBFA 2X51A 1HNZJ 2RD5C 3UFCX 5IWAJ 4OLPA 4E0DA 4B9SA 3Q8QB 3HP6A 3GMGA 5JXSA 4KFBA 4OQJA 1RTZA 4JI4F 1APSA 1S1WB 3BDEA 4RKUC 4ZPTR 2VDIA 3M30B 1H38A 1AB8A 1K47A 1IBMJ 1S76D 1I5OB 4N77A 1R8AA 4DUZF 1SC1B 4CLKA 1WEYA 8RUCA 2RAQA 1JLGA 4DSLA 2UUBJ 2MY7A 1QTMA 4JOUA 4YMEA 2DT9A 1SJ4P 1TFWA 9RUBA 1C4AA 4CM0A 1RHUB 3OL7A 3ET6A 1U09A 3A8EA 4M95A 2HMIB 3CE8A 4LFBF 4NE9C 4TKTA 1RA6A 2KXNB 4CLYA 1TMJA 3FBBA 4R8UB 2HLTA 4B9TA 4FKXA 4OYWA 3UDCA 3EGZA 1LWCB 3AQPA 3M8RA 3V4MA 3T1HF 3NAHA 3RB4A 3K8VA 2EBGA 1CJUA 2ZWPA 1RT5A 4MMOA 2C22A 3MECA 4O4RA 4DV4F 4IYQA 2O67A 4BDPA 4M94A 2CPHA 3OVBA 4G6VB 4IUFA 2QTWA 4KGKA 1JLBB 2V94A 4Y2IA 3M1VA 3US5A 4L6V3 2HWTA 3E01A 3ZC4A 3MM9A 4ZOSA 1NPPA 3DLHA 2PEBA 1RT4A 2LP4A 4LFAJ 3DMJA 3TEGA 3MEEA 2JZ5A 1RT3A 2JC0A 2PA3A 1M1HA 5LL6d 2KXFA 1HMVA 2YKNA 4LVNP 3C16A 1JLAB 2AEFA 1KFSA 2CPYA 1WD6A 5A8RA 1UVJA 3HDSA 3MCNA 2PMZD 2KVIA 1F2GA 1BMQB 1X0FA 1S9GB 2VUGA 3J7YI 4ECRA 4C0HA 1RDRA 3UNYA 3JSYA 4RUAA 1I6JA 4DQIA 4HDGA 1A6LA 1RBAA 4NRUA 1M90T 2IM2A 2AJ1A 1WACA 5HJYA 4LRCA 3M6WA 1HI0P 1DRZA 3M32B 2BX6A 3HPOA 4ECZA 1LNQA 1C0TA 3TVZA 3I5BA 2VQEJ 3BPDA 1HI8A 3KG1A 1KR4A 3BSAA 5KFFA 2VD3A 2GW8A 3EGNA 3BQ0A 2GX8A 1BXNA 2AJQA 5K8OA 3DHWC 4AL7A 3CJQA 4I6WA 3W61A 2VBWA 1N88A 3FSIA 4X4UA 1NJXA 3QT6A 2ASJA 3K57A 3U1NA 2D9OA 4UOHA 3DM2B 3H90A 2YX1A 1MMNA 3LGMA 1HQUA 1SC4B 1REVA 4BWJA 5GAHI 2AW0A 4ZKAA 5DLGA 4DPOA 3OTDA 3NCRA 1HBNA 1D8ZA 4ED0A 3GFYA 2LQ9A 3G2XA 3KJQB 1G4CA 2G1HA 4QZVB 5HMWA 2JC1A 3WC0A 1AUSL 2ZHBA 2JDJA 1O5JA 4HHHA 3UO0A 2DGOA 2V8HA 5LOQA 1ZYQA 2G9OA 2B4VA 1NH8A 3CMES 2FZGB 2VG7B 2MKIA 5KG4A 1VK3A 1YI2S 3AAWB 4M5GA 4OL8A 3G4SS 4FVCA 2AT1B 2JHEA 5HJXA 4OI1A 2B9EA 2P6SA 2ZBPA 2HGLA 1TL1A 3K89A 5HMYA 1NDKA 2M7SA 4A47A 1RLCL 3D1HA 2BM0A 4DL5A 1JLEA 3G86A 1HHTP 2DRBA 2FJEB 1BD6A 1RTJA 1SIZA 1FTRA 2YNFB 2VJUA 4IQXA 3Q24A 4PXBA 1WKLA 3KHLA 1OY6A 4JI5F 1UW4A 1JWWA 2YWGA 1FXDA 3NCQA 3L9ZA 2D9PA 1K1QA 5HLFA 5BYQA 1SH3A 2MQ8A 4NLPA 1H2VZ 1X5PA 3IR5B 2R7RA 3I96A 3IG1B 2CFXA 3T1YF 4QYRA 2DHGA 2M88A 1QAJA 2OPQB 5ETTA 2VPWB 2F65A 4CIOA 4P73A 3MAAB 5KFGA 1FDBA 2RE1A 1TP7A 3G8TA 5AJ3J 2DCLA 3RGIA 1IKVA 1VRQC 1QY7A 3TZYA 4Q8FA 5EN1A 3LQVA 5H9FK 1WI6A 4OI3A 5GADU 3E51A 4HLBA 4TY8A 4ID8A 1AROP 2VFRA 3H2VE 2L08A 3PKMA 3W9JA 3DXBA 4HL9A 3AB4B 1SJRA 2HQFA 3VF0B 3CDBA 1QSLA 2FUG9 2E5LF 1GXTA 2RQMA 5THWA 5B0EA 1KVJA 1K9MT 2FYXA 4WF9Q 5ETOA 1S0VA 5E3QA 2N4DA 3EGVA 3VCDA 2FDNA 3HULA 1FEEA 3BZQA 3GSDA 3H42A 5L1KA 2DITA 4L73A 3V6JA 3A13A 2JRSA 2MB0B 1FNOA 3NS6A 1X4AA 2KXHA 1XNRF 3HZEA 1KS2A 5D3GB 2IVMA 1LXJA 3UNGC 4DU7A 5SZTA 2FLPA 4DFMA 4NX9A 1NK5A 1NLKL 1S1TB 4RBTA 3QJPA 3EZOA 2CQ2A 3DDIA 4DZ6A 2OPSB 4IFVA 2DISA 4JBCA 1WC6A 3H0PA 2CG8A 2W25A 1VQ7S 2ZD1A 5L39A 4XPEA 2R7XA 3K8WA 3TUJC 1Y7PA 3M2RA 4V19X 4HH0A 3D4JA 1IN0A 1SKRA 5GMEA 3C6TB 1N56A 1U8WA 1WHXA 2BJDA 5K20B 3AOBA 2PIIA 1GMVA 1FFWB 1HWJA 1QUPA 4A8OA 1FK9A 2M8DB 1TK0A 2A18A 4UZCA 5KFWA 1JKHA 2XYHB 4AL5A 4O23A 1WOPA 3CD5A 2QG9B 1H7XA 3R7BB 4YHHJ 2RHQB 4AXJA 3R5BA 1REGX 3MI7X 2GHPA 3FEYB 2M70A 3ZZRA 1C1BB 5LT5A 4PXEA 4X4RA 2GVZB 4FYDA 3KNGA 5DO2A 5CYQB 1HNZF 2FGOA 4PG8A 1XK8A 1V9OA 3KG0A 2HNDB 2N4CA 4DXLA 4ZVSB 5KFAA 5L1LA 3HD1A 5CZVA 2UZAA 6FDRA 3M2VB 4RL1A 2QLBB 1IBMF 3MD1A 5HANA 4B3SJ 1QSYA 3JTPA 1VR6A 3GG0A 5KFIA 4ATNA 4PYDA 2KVQE 4DL7A 1CLFA 4U96A 1RHJB 2Z8QA 3G6ES 2H4WB 4M5HA 4TU8A 2NYIA 2W2NP 2CJBA 3AXMA 3B54A 1S1XB 5J2PA 1EP4A 2V4JB 4JUZA 3RRHA 4PCQA 3AJ2A 4YB1P 5F8MA 3FQKA 5KG7A 4P7VA 4M1KA 2FHKA 2VONA 2GIRA 2GS8A 3V6DB 3MMAB 1D9FA 2IRXA 3HMJG 2QMWA 2X3GA 5A6WA 4URQU 1VCTA 1UEUA 1ZAWA 4CTAB 4N41A 2L9WA 2F7VA 5KT6A 2CQGA 5KFUA 1JX4A 3HVTB 4KB7A 2HHQA 2PT0A 3TW0A 1H98A 2MQLA 2AYEA 5EX3A 2W2QP 4MIWA 3HHNB 2JFDA 2LQ8A 2BQUA 3QT5A 4QPXA 2V8GA 2WONA 4QCLA 1KLMA 1MG7A 1RUSA 3QQCD 4DG1B 2FB0A 2ZFHA 3GIRA 4MTPA 4NOHA 2HEKA 4LFAF 2QYCA 3Q8VA 4UUWA 3ZZZA 4ZCMA 4G3IA 1LV5A 5KT3A 3KLGA 3IR7B 2XMVA 2ZH8A 1SJ3P 1F9EB 4MK9A 1GTHA 1AZSB 1CJKB 1F0XA 4NA2A 1V3SA 2HQ3A 1FWKA 2XEXA 3PCOB 3MR7A 1YLXA 4PYAA 5C7PA 1HBMB 3H25A 4GVLA 3S1TA 3QIPB 4MK7A 4HDHA 1B7FA 2LQBA 5BXIA 4ED8A 4GKKF 3KDOA 1PYSB 1MW7A 3C14B 4C8NA 2O66A 4OZ0A 2HGMA 2PDAA 4C97A 1KFDA 5DQGA 2XCPA 3N6NA 3EYZA 1ZAVA 1PIEA 2W4DA 1NU4A 3P49B 2VQEF 5KT7A 4ZCIA 3ZZUA 2E7WA 1RAEB 2CQHA 4MYUA 2UU9J 1TL3A 2MSTA 4FYVB 2ZM6J 1VIXA 2IDLA 3HHDA 1URRA 1XTZA 2LECA 1H6KX 1YJ7A 3BKTA 1IWGA 3QFHA 2V9KA 4CLWA 2QMUB 3R5JB 2BXJA 4PUOA 4DS4A 2I8EA 2WB4A 2V4QA 3GV5B 2EW9A 3IBFB 4ECUA 2ERRA 4ZIVA 3VAJA 1ZA2B 2IHR1 2KH9A 3UDEA 4DQSA 2VG5B 3W2VB 1WG5A 5L1JA 1TFYA 4P6QA 3DGPB 3MEGA 3QZ8A 2RILA 1CSJA 1S0OA 5IT4A 1H0HB 1N5YB 5A76A 1NKEA 2H51B 2R7WA 2MQNA 3PXGa 2QGFB 1NCLA 1DZ5A 1RYRA 1OYDA 3PKYA 3Q22A 4ZVTB 1ZM2A 1XR6A 1B64A 3CJKA 1YGYA 3PO4A 2D41A 3KHGA 2H5JB 2YNHB 1R27B 1MU2A 4RNOA 5DDOC 2WVDA 3ZNJ1 2MZ1A 2ZJQQ 4KE5A 2RJZA 4X2BA 2IYIA 1RXOB 4NLQA 1G1XA 1CS4B 3KDNA 4ALZA 5DQHA 2V68A 4X4NA 2NS1B 3C46A 3LWMA 1RAOA 3MMJA 2J7KA 1RZMA 5CXTA 1HNIA 2DXDA 3CUNA 5C2CA 4K50A 4ILRA 3Q2TC 2AJ2A 1SQGA 4M5MA 2IMWP 3LOUA 4N47A 1EIYB 3FDSA 3QBCA 3ILJA 2AJFE 3U1LA 3O3LA 2AHOB 4AYBD 3I5CA 2CNKB 2B4UA 2RDDA 4LRBA 4CLTA 1RT2A 3C15B 4J9PA 4JV1A 1TKDA 2UVVA 3ZO7A 1EJ7L 2J8SA 1VIOA 3D3BJ 4MFBB 3AD7C 2V8VA 1FJ7A 2C3PA 4Q45A 2KZMA 1F5BA 2ZDOA 1Q1KA 1VQ5S 3BPSP 2EPIA 1BWVA 1RAJA 2XSJA 3D6MB 4ES1A 5AJ3F 2OEMA 4QJVA 4ZPWR 1OIAA 2ZKTA 1RHRB 2PMHA 2XMUA 3DRXA 1UFLA 1RADB 2KM8B 2RB7A 1AFIA 2ZDPA 3AD8C 2R8JA 3EWGA 2DD8S 1FI4A 1DQ9A 4PG4A 1FVSA 1HW8A 2BEFA 2LU2A 2ZOGA 2FZKB 1BY9A 2I2YA 2A3JA 1R89A 1TKXB 3FQLA 1LOUA 2HBRB 5L9NA 2RNEA 3RRKA 2D1CA 2E5JA 4OLOA 3OJUA 4X4VA 3WIVA 3KOAA 2DGTA 5IV3A 4JYAF 5J2QA 1PCAA 4A4JA 5F9LA 2W9CB 2CQ4A 1RACB 1VOMA 1KLNA 4DPXA 2VG6A 3MUTP 2UV8G 2M9KA 3BM7A 4DMZA 2E7XA 3FJ2A 2GCFA 2DH8A 1AXQA 2R3VA 4LSNB 4LSZB 2HRTA 1FTCA 2HVHA 2A2CA 2BJ9A 2HVEA 2QLWA 4DPYA 3DLEB 2HRYA 1IKWB 5DQIA 2IVYA 2UUCJ 2LKZA 4J9KA 4F50A 5LMNJ 3NEKA 4IG0A 2MDAA 5H1SV 1TL7B 5G0RB 1WHVA 1K73T 3DCAA 3M6XA 2JJ4D 4ECQA 4YHHF 2KN4A 3WC2A 1HYSA 2XWXA 2LA6A 1DBDA 2E1PA 3R5CA 1QM9A 2V8DA 3OTEA 1Y9OA 4A48A 2AGPA 5GAGI 3B82A 1R8BA 2RRNA 4LREA 1JB0C 4F4XA 3HHKA 4Q7AA 3GCXP 4PQUB 1FFSB 2DHXA 2ACYA 2RDJA 2XMWA 4KGVB 4K0KJ 4U9RA 4WFZA 3CEDA 2R2SA 3HSZA 4DR1F 2WW8A 1M5PC 4ZDNA 4HYKA 4B3SF 5A8KA 3NS5A 1F60B 4ECTA 1NBEB 4ZK7M 3K5PA 2H5IB 3TZWA 2CPDA 1UVIA 3BQ2A 3BO3A 2M0GB 1D09B 2RF2B 3M05A 1NMEB 4RNMA 5HMZA 1TV6A 3OW2R 4HT7A 2MSSA 3QRQA 1HWLA 4OHYA 2UXCJ 4HR2A 4N5SA 4KT0C 4J5OA 1TKZB 3U1MA 2KI2A 4E2FB 2VA3A
chains in the Genus database with same CATH topology
4JI6J 3T1YJ 4LF4J 4LF7J 4X64J 1IBKJ 2UXBJ 2MEWA 3D3BJ 1XNQJ 4DUZJ 2F4VJ 1IBMJ 4GKKJ 4DR3J 5LM7E 1XNRJ 3W1YC 2VQEJ 4DV7J 1XMOJ 4DR6J 5AJ3J 4DR4J 4DV4J 4NXMJ 2MTLA 1N32J 4JYAJ 3OTOJ 4B3SJ 3J80U 3R2CJ 2UUBJ 4K0KJ 5A2QU 4DV0J 4LF9J 4B3RJ 2KL8A 4DR2J 4OX9J 4LFAJ 4JV5J 1N34J 1HNXJ 2UU9J 3IMQJ 4LFBJ 2KVQE 4DV3J 2ZM6J 4X62J 4JI8J 4NEZA 4PWWA 4AQYJ 4DR1J 3JAMU 4NXNJ 4JI0J 4JI2J 1N36J 5IT9U 3R2DJ 1J5EJ 2HHHJ 4X66J 2UUAJ 1IBLJ 5LMUJ 4NEYA 4B3TJ 2UXDJ 4X65J 4DV1J 4YY3J 2UUCJ 4DV6J 4KY3A 4JI5J 4DR7J 4JI1J 1FJGJ 4RJVA 4LF5J 4DUYJ 2MQ8A 4DV2J 4YHHJ 2E5LJ 5LMNJ 3D3CJ 4B3MJ 2UXCJ 4DV5J 1I94J 3J81U 4GKJJ 1HNWJ 1N33J 4LF6J 4V1Ak 1HR0J 4JI4J 4JI7J 4LF8J 4KHPJ 1HNZJ 3T1HJ 4LFCJ 4KYZA 4DR5J 2VQFJ 5BR8J 5IWAJ 3J7AN 5FLXU 1XMQJ 4HHUA 4JI3J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI6 J;  3T1Y J;  4LF4 J;  4LF7 J;  4X64 J;  1IBK J;  2UXB J;  2MEW A;  3D3B J;  1XNQ J;  4DUZ J;  2F4V J;  1IBM J;  4GKK J;  4DR3 J;  5LM7 E;  1XNR J;  3W1Y C;  2VQE J;  4DV7 J;  1XMO J;  4DR6 J;  5AJ3 J;  4DR4 J;  4DV4 J;  4NXM J;  2MTL A;  1N32 J;  4JYA J;  3OTO J;  4B3S J;  3J80 U;  3R2C J;  2UUB J;  4K0K J;  5A2Q U;  4DV0 J;  4LF9 J;  4B3R J;  2KL8 A;  4DR2 J;  4OX9 J;  4LFA J;  4JV5 J;  1N34 J;  1HNX J;  2UU9 J;  3IMQ J;  4LFB J;  2KVQ E;  4DV3 J;  2ZM6 J;  4X62 J;  4JI8 J;  4NEZ A;  4PWW A;  4AQY J;  4DR1 J;  3JAM U;  4NXN J;  4JI0 J;  4JI2 J;  1N36 J;  5IT9 U;  3R2D J;  1J5E J;  2HHH J;  4X66 J;  2UUA J;  1IBL J;  5LMU J;  4NEY A;  4B3T J;  2UXD J;  4X65 J;  4DV1 J;  4YY3 J;  2UUC J;  4DV6 J;  4KY3 A;  4JI5 J;  4DR7 J;  4JI1 J;  1FJG J;  4RJV A;  4LF5 J;  4DUY J;  2MQ8 A;  4DV2 J;  4YHH J;  2E5L J;  5LMN J;  3D3C J;  4B3M J;  2UXC J;  4DV5 J;  1I94 J;  3J81 U;  4GKJ J;  1HNW J;  1N33 J;  4LF6 J;  4V1A k;  1HR0 J;  4JI4 J;  4JI7 J;  4LF8 J;  4KHP J;  1HNZ J;  3T1H J;  4LFC J;  4KYZ A;  4DR5 J;  2VQF J;  5BR8 J;  5IWA J;  3J7A N;  5FLX U;  1XMQ J;  4HHU A;  4JI3 J; 
#chains in the Genus database with same CATH topology
 4RW7 A;  3OT9 A;  3W2W B;  3TZX A;  7FD1 A;  4DL4 A;  2MEW A;  3OFF A;  1E6Y B;  4Q43 A;  2ZH5 A;  2XNR A;  3SQG A;  2IRU A;  2A6O A;  3DI6 B;  1S97 A;  1R0A A;  2KU7 A;  1B0V A;  2J76 E;  1GNK A;  4EZ9 A;  5KFY A;  4JV2 A;  1S49 A;  4OX9 J;  3FBC A;  4PWD A;  4PG5 A;  1ZH5 A;  2LQ5 A;  3KMQ A;  1T02 A;  3C6U A;  2W8L A;  2E1R A;  1VQO S;  2GMH A;  1IKX A;  1H73 A;  2OEJ A;  4J9N A;  1S48 A;  5F8J A;  4DV2 F;  4IKA A;  4ZHR B;  1HI1 A;  4TYA A;  9ATC B;  2AMC B;  1KNZ A;  2HZV A;  1JLC A;  1E6V B;  3ZZT A;  5F3T A;  3BF4 A;  4ECY A;  3Q2S C;  4WKY A;  1SL0 A;  4OHW A;  4ZPD A;  2HAI A;  1W2B R;  1IJE B;  3QGP A;  3ZNU A;  1VQ8 S;  3OLB A;  2CXE A;  3RW7 A;  5KFS A;  1R8C A;  1KTV A;  1R7I A;  3JSM B;  4DZD A;  2WW4 A;  2WVF A;  1WHY A;  1P1L A;  4WU3 A;  1NK8 A;  2QYG A;  4CLS A;  2MTL A;  2H65 B;  2V63 A;  1G2E A;  4M5D B;  4LJM A;  1YIT S;  2W24 A;  2OPP A;  3HHL C;  3TJ8 A;  1A9N B;  1N5Q A;  3IS9 A;  3VGU A;  3VGT A;  2I5J A;  2VBZ A;  3G8S A;  4NXN J;  3D6H B;  4F0K A;  3I32 A;  2WB1 D;  3FZB A;  3M2U B;  2BVZ A;  3BGO P;  4OYI A;  5I4M A;  3IWL A;  3ICL A;  1LW2 B;  5D4N A;  3BDP A;  4TYB A;  1WOS A;  2K06 A;  4CWB A;  2HHT A;  2M5Y A;  1ACM B;  1FT8 A;  4BC9 A;  3VQS A;  3QGI A;  2VH7 A;  5B0B A;  2BJ1 A;  3HJF A;  1UAW A;  3B4D A;  4FF4 A;  1O0P A;  1XR7 A;  1U6F A;  4OZ5 A;  3UE2 A;  3MM6 A;  4CYU A;  1CJV B;  1YK9 A;  3FEX B;  2IAJ B;  2MQO A;  3MPD A;  3UN5 A;  6FD1 A;  1Z1Z A;  1EKR A;  1KBR A;  5F8L A;  5E33 A;  2XSF A;  1O6X A;  2PGC A;  2IA6 A;  2HUR A;  1TK8 A;  2AP6 A;  3L7U A;  4YEA A;  4G1I A;  4NLG A;  1UPM B;  4F0M A;  2DR7 A;  2DNG A;  2VOP A;  4IDK A;  2G13 A;  3SCL E;  3TAM A;  5KFP A;  2P5V A;  2E5I A;  4HHJ A;  4G1Q A;  4QQB A;  4Y3C A;  3IGN A;  5D4P A;  3FCV A;  1FE0 A;  3OSP A;  7FDR A;  5J2M B;  1U0H A;  5KFM A;  4MJK A;  4BS2 A;  5IC4 B;  3ADA C;  4HVZ A;  1UTA A;  1JLQ B;  3W5Y A;  1WSR A;  4DI6 A;  3V5R A;  5KG6 A;  2LDY A;  1RT6 B;  1CEZ A;  2BM1 A;  4MT1 A;  1KEK A;  3X1L B;  5FLX U;  3PZP A;  2YNI A;  4N7T A;  3UD4 P;  1OPZ A;  4F3O A;  2Z2Y B;  2XLK A;  3M8W A;  3WIU A;  3SI8 A;  2CPZ A;  3DRS A;  1T9X A;  3T1A A;  4UQG A;  2VFS A;  1ZTW A;  2W8K A;  1JJ4 A;  3LWL A;  2OI2 A;  1Q82 T;  4P74 A;  4DQQ A;  2N3L A;  3GFZ A;  2D7S A;  1XER A;  1OY8 A;  4QR1 A;  4HI2 A;  3SYZ A;  4ETZ A;  3NGU A;  4YB5 A;  4CQ1 A;  4WK3 A;  3G8Q A;  2HYI B;  3PHE A;  4UW2 A;  3R3T A;  4BLG A;  2JEI A;  4JI2 J;  4N8N A;  2WVC A;  3HSD A;  1XN9 A;  4QWD A;  2JEF A;  3OFG A;  2XS5 A;  1PIL A;  4X4S A;  5F8H A;  4QU7 A;  3W5Z A;  2R4F A;  1Q7L B;  1A7G E;  2ZHA A;  1IBC B;  3K5N A;  1DTQ A;  1SUQ A;  1DQA A;  2DR6 A;  2MXY A;  1VIS A;  3V6H A;  2BE9 B;  1T9W A;  3I9Z A;  3LGN A;  5GAD I;  4Y6I A;  2ILZ A;  4I6A A;  3CC7 S;  5DM7 Q;  1RHM B;  1PC5 A;  3LPE A;  1RWV B;  1JLG B;  4J7C A;  2ZOM A;  1ZOT A;  4OHX A;  1CG2 A;  3UCG A;  4I69 A;  3ET6 B;  2QA4 G;  1MSW D;  1PBU A;  4L74 A;  2BMB A;  4ANE A;  2XUL A;  3NY0 A;  1CPZ A;  4X4T A;  2B6A A;  4O3P A;  3DDN A;  4O3S A;  3TYT A;  4CNZ A;  3MOJ B;  1FKA F;  3OTB A;  3D66 A;  5D0R A;  1EET A;  2NXC A;  4CO4 A;  3RB0 A;  2NLW A;  4IG3 B;  2PFF B;  1VQK S;  4YN3 B;  1NHK L;  4KC5 A;  1RSC A;  3QID A;  2F1F A;  1ZTT A;  5H9F J;  4U67 Q;  5HP1 A;  1FRM A;  3HD2 A;  1RAH B;  2G4B A;  1CJU B;  2FD2 A;  1P9Y A;  3Q8P B;  5KG3 A;  1YRU A;  4LRD A;  5KFV A;  2H48 B;  2W4P A;  3PTW A;  2EKY A;  4J37 A;  2XS2 A;  4A8Q A;  3J81 U;  2MKK A;  1WDD A;  3B78 A;  1KSP A;  3IO1 A;  1YKW A;  2MGZ A;  2FJV A;  5LMN F;  1QD1 A;  3EXC X;  3E01 B;  5J2N A;  3DHX A;  3MM9 B;  4QWC A;  1RT4 B;  3DOK A;  5AE1 A;  4J9S A;  3PVX A;  2I38 A;  3LP1 B;  2ZBR A;  1UFW A;  3MEE B;  3DOL A;  3D68 A;  3M4X A;  3OTO F;  1RT3 B;  2WCX A;  3G87 A;  3F0N A;  1IXK A;  2KKH A;  1T03 B;  1U8S A;  4DX8 H;  3B6B A;  4ELT A;  2YKN B;  1VC5 A;  1N52 B;  3C16 B;  4A8S A;  2HS0 A;  4KV8 A;  2HLU A;  3V4I B;  2QSW A;  1F9H A;  3CJT A;  1JJH A;  3CDU A;  2R2U A;  1WEL A;  4K0K F;  3EDQ B;  4FVM A;  2VOD A;  1W2I A;  1OYE A;  1NJY A;  2BKO A;  5E7O B;  3OL6 A;  3CCW A;  2DIU A;  5D77 A;  3BSN A;  5EUH A;  1U47 A;  4BWM A;  4DFP A;  2DVI A;  1C0T B;  4OYM A;  3O8W A;  4AE5 A;  4DV5 J;  2KDO A;  1HNW J;  4JI6 F;  4OIX A;  2P2C B;  2BAN A;  4LF8 J;  4DF8 A;  3ENA A;  3HJV A;  3GWC A;  1K1S A;  1HKA A;  2DKO B;  4Q44 A;  2YX4 A;  1R3N A;  3EDR B;  4X4O A;  1U1M A;  3QLH A;  3AA9 A;  1YJV A;  2F8M A;  1FRJ A;  1H2T Z;  3VHQ A;  4FXV A;  1S9F A;  2CQI A;  2AEJ A;  4C8M A;  2CJ9 A;  3P96 A;  4H4O A;  1REV B;  5KG2 A;  3BO4 A;  2IPO B;  5IV4 A;  4O4G A;  1KKH A;  2B4O A;  1BHN A;  1S1U B;  1HBN B;  2MKY A;  2QT7 A;  1YQH A;  1PYO B;  1RIS A;  4DV3 J;  2GAG C;  2BRK A;  5B0G A;  4OX9 F;  1T94 A;  3DLK A;  5A8W A;  2NYH A;  3OQ2 A;  2HHH J;  4K4W A;  1FRK A;  4RW6 A;  4YR2 A;  4C8Y A;  1UVK A;  1S6P A;  3PRB A;  4NCA A;  1N5V A;  2DHA A;  4UQT A;  5I3U A;  2Y8W A;  1JLF A;  3SBM A;  3G82 A;  3KTQ A;  3W64 A;  3MUR P;  5KT4 A;  1DQ8 A;  5FDL B;  2ZUG A;  1Q8L A;  3JAM Y;  1U4B A;  3PYD A;  4JI7 J;  1TL1 B;  4K4X A;  1FD8 A;  4CT9 A;  5HMX A;  1RKJ A;  1HPZ A;  2AZ1 A;  4ICL B;  2V5H G;  1UZD A;  2O01 C;  2FHO B;  2BJ8 A;  3DOM A;  3W3S A;  3DXS X;  1SKW A;  4ERD A;  4DL6 A;  1YJ9 S;  1RTJ B;  4EZ6 A;  3CMQ A;  5C24 A;  4DR4 J;  2YVS A;  5A0Y A;  4ZIW A;  2XO6 A;  4X4P A;  2XNQ A;  4EFA C;  1XIQ A;  2OPR B;  3CW2 C;  5DG9 A;  4AND A;  3G6X A;  3KLI A;  4NCG A;  2OEK A;  3D0I E;  1NJI T;  5HLF B;  3PEJ A;  3OR2 B;  1YJR A;  2HGN A;  3TNV A;  4OYB A;  4MIB A;  1YVF A;  1PYT A;  3PJW A;  3VZH A;  1N36 J;  3UPF A;  5LXY A;  5C5J A;  1RK8 A;  1VFJ A;  1S1W A;  2X1A A;  3BKU A;  3M30 A;  1Q5V A;  4NXN F;  2BE2 B;  3RAX A;  4UY8 5;  1T3O A;  4IO9 Q;  2AZ3 A;  1N4L A;  2OML A;  4KHP F;  3CC2 S;  1VQ9 S;  1L3K A;  1HQE A;  1MNE A;  2DNM A;  5HBM A;  3MCS A;  1HR0 J;  4LUB A;  3CCZ A;  3DRY A;  3R5D A;  4R0J A;  2C3Y A;  1NK6 A;  2YH0 A;  4P75 A;  1C2P A;  4RWX A;  3QMQ A;  4ILL A;  1QJH A;  4TY8 B;  2HMI A;  2PMW A;  4UTG A;  4O3R A;  1FVQ A;  3CD0 A;  4XPC A;  1T0T V;  3FSX A;  5FJ4 A;  3UVJ B;  3W62 A;  3K58 A;  1TAU A;  3J80 U;  1PG5 B;  4IFY A;  3C66 A;  2HQG A;  3MD3 A;  2FY8 A;  2RQ4 A;  4BCA A;  5EGY A;  3FRZ A;  3W60 A;  4XK8 C;  4P52 A;  1A0O B;  4ZP7 A;  5GAE U;  4B3T F;  3P8B B;  3FBE A;  2EEY A;  4O44 A;  2B9W A;  4CDI A;  4EO6 A;  2QA4 S;  3GSI A;  1C0U B;  2ALY B;  2DR8 A;  3LAL A;  3JTN A;  3HFK A;  3O2I A;  4B3M F;  3B8H A;  5JMN A;  1P27 B;  2LYV A;  1L3S A;  3R6L B;  1EHW A;  5LJ5 Y;  3UCU P;  3CD7 A;  3AOD A;  1U1P A;  1T9Y A;  4YB6 A;  2VC1 A;  4IFV B;  5IC6 B;  2VQF J;  3AQO A;  2MQP A;  3VTI A;  1KP6 A;  1U6Z A;  2ZD1 B;  4X64 J;  2DNR A;  3M2R B;  3IM8 A;  1N32 F;  2QLX A;  2GNK A;  3QRP A;  3C19 A;  5I42 A;  4P2M A;  2MLY A;  4DR6 J;  1KTQ A;  1F9F A;  3DRR A;  1SBR A;  1U1K A;  2FPH X;  4P7T A;  3JSR A;  1O8B A;  3VAH A;  1FK9 B;  1UZH A;  3HK2 A;  2XI2 A;  1V5I B;  3H5U A;  2PN6 A;  2M3D A;  3SCI E;  4PWU A;  3E2E A;  1RJJ A;  2JVR A;  4I6Y A;  4WFA Q;  4LBH A;  3LUY A;  4K4Y A;  5LMU J;  3CO0 P;  4JI2 F;  4W92 B;  2FJW A;  2G2Z A;  3PRV A;  4QU6 A;  3RBD A;  4B3O B;  5ETK A;  5F8I A;  3GII A;  4LQ3 A;  4A46 A;  2PE8 A;  4KGZ B;  3ENW A;  2IIH A;  4JI3 J;  2O1P A;  1RI7 A;  2KG0 A;  5F8N A;  1JJ2 R;  3L3C A;  2R7S A;  4PKD B;  2Y0S D;  4IH6 A;  2VBX A;  2E9T A;  3LP2 B;  3T5L A;  4ED2 A;  2K1R A;  2CPI A;  4DFJ A;  4ECX A;  5IS2 A;  3PEH A;  1EP4 B;  4JV5 J;  3LF0 A;  3BN4 A;  3SXL A;  4CLZ A;  3HM9 A;  4K4T A;  3KLF B;  4TVA B;  2VG7 A;  3S7R A;  3KK1 B;  1Q5Y A;  1RTD A;  2JL9 A;  2HQI A;  3OR1 A;  2ZUA A;  2Q3P A;  4NYO A;  3D1Q A;  2DIV A;  2O3D A;  3CO9 A;  3H4D A;  1Y00 A;  3DFE A;  1F3V A;  2VFU A;  4M5L A;  2BR0 A;  1QVF R;  5ETM A;  2A1B A;  3E3X A;  4IH5 A;  3MZI A;  2ZEJ A;  3CD6 S;  5E0O A;  1NB2 A;  2C2Z B;  2IJR A;  5HAT A;  4ZCL A;  1Y11 A;  4F67 A;  1G7C B;  1KLM B;  4KJI A;  4FNI A;  4DR3 J;  2R7U A;  4C0B A;  4A8W A;  3HVW A;  2HS3 A;  2RS2 A;  2ZVS A;  2GFF A;  4LF2 A;  1FXR A;  3AH6 A;  3BV8 A;  5HRO A;  3THV A;  1HHS A;  4OYX A;  2LQJ A;  4RW8 B;  1HFE L;  2JEG A;  2QSF A;  4F26 A;  3IG1 A;  2GJF A;  3LTO A;  1BQM B;  2HAF A;  4X62 J;  2DNY A;  4ZLJ A;  3CWJ A;  5K8M A;  3TAP A;  3A1Y G;  2XMT A;  5AXN A;  4HH1 A;  1QTN B;  4K5R A;  4FF2 A;  3MAA A;  4ZLN A;  1S10 A;  2ILY A;  4DEZ A;  2C2N A;  2AU0 A;  5CAB A;  5JVG Q;  2WBR A;  2JH3 A;  3CCJ S;  4ELV A;  4U6P A;  5F3Z A;  3F73 A;  4LF6 J;  3DDK A;  3MPV A;  2ZH9 A;  4OJ1 A;  4AD6 A;  3CCT A;  3DC2 A;  1X9S A;  4WP3 A;  3M9O B;  4DV5 F;  3MED A;  3ULH A;  1UJ5 A;  4LF8 F;  2YWH A;  1URN A;  2D3Z A;  4NZ6 A;  1TL3 B;  1XMO J;  4DV7 J;  5HO4 A;  5HQM A;  4OJH A;  2B3T B;  1I1G A;  1X4D A;  4NLT A;  2MZS A;  4F3M A;  5I3Q A;  4QBU A;  4PRF A;  4M5K A;  4U7U K;  2YXL A;  3VVT A;  1CVJ A;  3HSG A;  3MF5 A;  2Y1J A;  2YY3 A;  1S72 S;  2OH2 A;  2V69 A;  3RBE A;  1GQE A;  2J7W A;  4RW4 B;  4DQR A;  4QYZ K;  1NAQ A;  4DV3 F;  3Q0A A;  1SKU B;  2OSR A;  3I4H X;  4USU A;  2E5H A;  1S1T A;  1XQI A;  1X4F A;  3DYA A;  3QGH A;  3RR8 A;  1DY3 A;  1YJU A;  2E9R X;  1UFK A;  4XAK A;  4MKB A;  3EUN A;  1XWL A;  4FYY B;  4XDD A;  4M8L A;  2XHW A;  1TK5 A;  3D5M A;  2WHO A;  2ADC A;  2JX2 A;  2WOM A;  4JI7 F;  3C6T A;  5D0G A;  2V2K A;  3KJV B;  1VJW A;  1RLD A;  1H7W A;  3WHI A;  1RAI B;  4I2P A;  3ZZO A;  3BGR A;  2NSC A;  1MU2 B;  4AXI A;  3CDW A;  3GJQ B;  4DWI A;  3CIZ A;  1PKU A;  1WC3 A;  1RCO B;  5D4O A;  4TNO A;  4NXM J;  3W9H A;  1FRX A;  4G65 A;  5GAG U;  3NNH A;  2VOO A;  2RVJ A;  3RU0 A;  2DHH A;  3PHT A;  2HIQ A;  3BJY A;  1VGY A;  3FMB A;  1U2R A;  2GVZ A;  2C2R A;  3GZ7 A;  3EPG A;  4AL6 A;  3Q83 A;  3WDO A;  2N3O A;  2L9N A;  3MM8 B;  2NQP A;  3OD2 A;  4P2S A;  2HHV A;  3AT1 B;  3GJR B;  5LXR A;  2W9A A;  1N36 F;  4Z7Y A;  2HND A;  2F4F A;  1I94 F;  3MDF A;  3CJ3 A;  4ECS A;  4UY8 T;  4DUY J;  2VPX B;  2ZC3 A;  3DKD A;  4OZ1 A;  3I55 S;  2X1G A;  4EBD A;  2V50 A;  1S7I A;  4C8K A;  4QR2 A;  2FZC B;  4Q5V A;  4I1T A;  1JQG A;  1MMD A;  3A8I A;  1WC0 A;  2HBZ B;  3TX8 A;  5IM0 A;  2E44 A;  2IJN A;  1KOO A;  1HR0 F;  4U7U D;  3MPU B;  1IBK J;  2UXB J;  5T7L A;  1NO8 A;  2YWW A;  1L3V A;  2IJF A;  3GIK A;  3BKF A;  2M2B A;  3R9L A;  2DH9 A;  1Q4R A;  4LSL B;  4C2M A;  4DS5 A;  2ATL A;  1CUL B;  5L1I A;  3I6P A;  3J80 Y;  2WK4 A;  4K2J A;  3BH6 B;  2DNO A;  3V6D A;  1WHW A;  5C25 A;  2UUA F;  3JQJ A;  4DFK A;  4YS2 A;  1RTI B;  1FHT A;  3CSK A;  1TAQ A;  1NJW A;  5F9N A;  3ILO A;  2J0S D;  4FKY A;  4X66 J;  4CTA A;  3KHR A;  4CT8 A;  3Q89 A;  4EI2 A;  1VQ4 S;  3MGJ A;  4FXW A;  3KJF B;  2VFV A;  2C3O A;  2PC6 A;  4HEA 9;  4FBU A;  1T7P A;  4DX5 A;  2MLZ A;  4OHV A;  2E1A A;  3HT0 A;  4RNH A;  4OZ3 A;  5IZH A;  1RQ0 A;  1M5O C;  4TXS A;  2XLI A;  3CCU S;  4NA1 A;  2LU1 A;  1VQM S;  5HVG A;  3IAM 9;  5ITH A;  5JVH Q;  2I9S A;  3PW2 A;  2VQF F;  2E1C A;  1N6Q A;  5LSL A;  4FYX B;  4I7F A;  2JFK A;  3JQK A;  2ZNZ A;  1X60 A;  3M7V A;  4X64 F;  3TVY A;  1NJZ A;  1NSK L;  1CJK A;  5SUH A;  4Z2X A;  1BQX A;  2HHW A;  4DR6 F;  4DLG A;  5CQG A;  2XGP A;  1R0C B;  2FJD B;  3FNN A;  3CCL S;  4J9R A;  2R9L A;  3PRD A;  3FUY A;  3BRE A;  3ZXW A;  3BH7 B;  4JI8 J;  1FRI A;  2WVB A;  2WAQ D;  3QIP A;  4MK8 A;  2FJA B;  3MCM A;  2EG2 A;  4F3Q A;  1B7Y B;  1HWK A;  3HX9 A;  2R7Q A;  5KG5 A;  4ZJL A;  3UW1 A;  3SMZ A;  4IOC Q;  2QIF A;  4RZR A;  3AHP A;  4N8O A;  2Y1R I;  2LVW A;  4DR7 J;  4YDD B;  1WJ9 A;  3N9U C;  2DYA A;  5AT1 B;  4OYO A;  2XCA A;  1R31 A;  2B9Y A;  4ILM A;  5CYJ A;  2ROG A;  4CLP A;  2PI5 A;  3J7A N;  1Q8B A;  4F4A A;  1FDN A;  1M1G A;  3F44 A;  4OZJ A;  1O51 A;  3ITH A;  4LF7 J;  4OI4 A;  1TVR A;  5B08 A;  4LQ9 A;  3OVA A;  1IR1 A;  4JI3 F;  5A8K B;  5EX0 A;  5KTQ A;  1TL5 A;  4C8O A;  1VQY A;  2W7A A;  4C98 A;  3ETM A;  5HQ8 A;  3HHL D;  3M6U A;  4F4W A;  1NDC A;  3KK3 A;  2ZH1 A;  1KDN A;  4ZIT A;  2K7K A;  5B0F A;  2G0J A;  2AYM A;  2IYG A;  1TV6 B;  1N5S A;  1SQE A;  1TKT B;  3OXG A;  3MM5 B;  4F4Z A;  3RTV A;  3KUG A;  4WFX A;  1GH8 A;  1RWW B;  3C2P A;  4JV5 F;  3M8S A;  2VG5 A;  3U7J A;  4ER8 A;  3RR7 A;  3DGP A;  2IVF B;  5CD4 H;  5L8R C;  4DV6 J;  2RRA A;  4F8R A;  4RR5 A;  3DU5 A;  1N5Y A;  1WF2 A;  1WG1 A;  1N0U A;  2R42 A;  4BBY A;  1SH2 A;  4OFZ A;  2D74 B;  1XC9 A;  4B9M A;  4CZC A;  3OUY B;  2OD6 A;  5DLF A;  3ISZ A;  1R0A B;  1SQF A;  3FKB A;  2SXL A;  4ED3 A;  2CAD A;  4OX6 A;  3TAN A;  4ZA1 A;  5IXU A;  3JQM A;  3MFH A;  3NGS A;  1LWX A;  2GHV C;  1PAE X;  1X4G A;  1IKX B;  3QAU A;  1LWF B;  2C2D A;  4CCH A;  1YBT A;  4H4M A;  1NK0 A;  4LF9 J;  1ZZF A;  1HWI A;  2YQ1 A;  4ZVH A;  3DNC A;  1JLC B;  4F36 A;  1VC6 A;  2UVW A;  4DL3 A;  4I0W A;  5C42 A;  3D0H E;  3SDE A;  4M63 A;  4DUT A;  5AE2 A;  4X62 F;  3HVA A;  2R7T A;  2H5E A;  5EWG A;  4MFB A;  1IM6 A;  4PZV A;  4HTJ A;  4UST A;  3POT B;  1ZM9 A;  3OFH A;  3FCH A;  4ED1 A;  3FZ2 A;  1HD1 A;  2F8H A;  1YRX A;  3PX0 A;  2EFP A;  2OP5 A;  4U8V A;  5BR8 J;  3DRP B;  4F02 A;  4LF6 F;  3I0R B;  2GVD B;  4YR3 A;  2B8Q A;  5K14 B;  4L76 A;  2F4V J;  4B9V A;  1PSD A;  1TQL A;  4WZQ A;  3IS9 B;  2Q1L A;  2HZA A;  2Y1I A;  1SV5 A;  2CPF A;  2I5J B;  3UN3 A;  1D3W A;  4DV7 F;  1XMO F;  1OMS A;  1FRL A;  3OJS A;  3MR2 A;  3R2C J;  2MJN A;  2JLE A;  2QRR A;  2DCU B;  3AD9 C;  2CA9 A;  3DN9 A;  1IM4 A;  4B17 A;  2MHE A;  1SJ1 A;  1KRP A;  3RRG A;  4YDX A;  5KFB A;  1P8G A;  4C11 B;  4URG A;  3QZ7 A;  2RKI B;  2C2K B;  2V8P A;  1Q78 A;  1LEO A;  3W66 A;  1OQ6 A;  2RML A;  4RBU A;  4E98 A;  3MM6 B;  3CJ8 A;  3CCQ S;  1B3T A;  2YTC A;  2VKR A;  1IKY A;  1NND A;  4ZJQ A;  2XYP B;  3IR6 B;  4PAB A;  2NXU A;  3GLJ A;  3UQS A;  3T1H J;  4J9V A;  5ETN A;  4NLR A;  4ZVU B;  3LH2 S;  4NLY A;  2HW3 A;  2CQD A;  3FSY A;  4LSN A;  3PW5 A;  1Z2L A;  2ZNY A;  3G96 A;  1KON A;  4IDK B;  1BWE A;  4K4S A;  3TAM B;  2IDE A;  1D0E A;  1X5T A;  4WZM A;  3DLE A;  4DV4 J;  2AV5 A;  1RTH B;  4N56 A;  3QO9 A;  5ETV A;  4NLW A;  2HNZ B;  4Q2M A;  3FK4 A;  2U2F A;  4G1P A;  1ZET A;  4DCP B;  4KIA A;  4DR2 J;  5KFD A;  4GC7 A;  3H59 A;  1UW9 A;  5CH7 B;  2F9J A;  2J8A A;  1N8R T;  3MUM P;  4USJ C;  4FNH A;  3KNA A;  2ZVI A;  3LP0 A;  3CCR S;  1LKZ A;  1OPI A;  4ID5 B;  1EAY C;  4DV1 F;  3PV8 A;  3PM9 A;  3GU0 A;  4CP5 A;  4DPT A;  1H74 A;  4CLU A;  2YNI B;  3RZA A;  2B9X A;  3EVW A;  2PO4 A;  1VJQ A;  2MZT A;  3FBF A;  3K5L A;  1FX2 A;  1LWE A;  1WI8 A;  5IWA F;  3DRS B;  4WBF A;  4Q8E A;  4DUY F;  4Z7C A;  3CC4 S;  4Y2M A;  1MN7 A;  3SEO A;  3GYN A;  4DR5 J;  3HI9 A;  3RB3 A;  1Y10 A;  3I0S A;  2XB2 D;  4W90 B;  2PD1 A;  4Q0B A;  3UCZ P;  4R5P B;  3IRW P;  3CUL A;  2J9E A;  3K5O A;  2UUB F;  1IBK F;  3PAC A;  4WTO B;  1BE4 A;  1PJ5 A;  1RAF B;  2OEL A;  1NHU A;  4B3R J;  5DET A;  4NLO A;  1M1K T;  2CZ9 A;  1HNX J;  1SUQ B;  4DF4 A;  4DPW A;  3TX0 A;  2J6T A;  2EBE A;  2X1B A;  2KB2 A;  1RGV A;  4I64 A;  2D69 A;  2KO1 A;  1XJW B;  1TU0 B;  3R27 A;  5L46 A;  3TRG A;  2FHJ A;  2O5D A;  4X66 F;  3IC1 A;  1SL1 A;  2VF3 A;  4IRC A;  5MLC V;  4USH A;  2JEJ A;  3CCS S;  3SV3 A;  5KFL A;  2HNY A;  4H4K A;  2DRD A;  4KRW A;  4LIR A;  5CAA A;  4QWB A;  4EUV A;  2Z2M A;  1VRU A;  2CWK A;  1VBX A;  3W9I A;  2B6A B;  3RAM A;  2DHS A;  1JNR B;  2GC8 A;  5GAE I;  1L5U A;  4U7C A;  1RKI A;  2N82 B;  3S01 A;  3T5J A;  3FCW A;  4KH0 B;  5ETL A;  4ZHR A;  4C3K A;  3HHE A;  1MWQ A;  3GP9 A;  1NZA A;  4WKR A;  2HHU A;  1E6V A;  5HP1 B;  1I51 B;  3CJR A;  4HT5 A;  3DGV A;  4Y0F A;  3TQ1 A;  3T3F A;  2YKM A;  1UCN A;  2BRL A;  3TR5 A;  4H4K C;  4TU7 A;  1MN9 A;  3GV7 B;  3V81 B;  4NAS A;  1QE1 B;  2YBV A;  4MKA A;  1HW9 A;  5AXM A;  3LA0 A;  2KTQ A;  3R2D J;  5LSO A;  2MGZ B;  4C6A A;  1X9M A;  3P6Y C;  1FXL A;  4JI5 J;  4Y2A A;  3DOK B;  1UWB B;  4ZJO A;  2WTF A;  5E3P A;  1Q16 B;  5D4L A;  3DOL B;  4DR7 F;  4KKO B;  1B70 B;  4GKJ J;  4M5D A;  1LW0 B;  2GAH C;  2B4P A;  2F8E X;  3MOZ A;  4RW9 B;  1NDL A;  1IUJ A;  1FO1 A;  1WF0 A;  3P5T L;  2YX7 A;  1T95 A;  5HVF A;  4UT4 A;  3T1Y J;  4KV8 B;  4EMD A;  1MRO B;  2OD4 A;  4F4K A;  2YQ0 A;  4FZV A;  2KRR A;  3W8G A;  5DDQ C;  4B9U A;  1NK7 A;  4LF7 F;  2DR9 A;  1PJ7 A;  3SFG A;  3PO5 A;  1JXV A;  2RIJ A;  3ZZP A;  2KT5 A;  5KFT A;  3M6V A;  3G6Y A;  3KLH A;  3BGU A;  2QL9 B;  2VHG A;  3QSI A;  1VC0 A;  3D9B A;  3QNW B;  3WQP A;  3R7N B;  2W9B B;  4RUC A;  4MIA A;  3DU6 A;  4L75 A;  5DDP C;  2ALZ A;  1SB6 A;  2W2M P;  2CNO B;  3KKF A;  5M2P A;  2BAN B;  2J6S A;  2XWY A;  3NS7 B;  2FHM A;  3A8K A;  3IRX A;  3TVK A;  3F56 A;  4YFU A;  4RPF A;  4OV1 A;  2EK6 A;  5A2Q Y;  4IRD A;  1SJF A;  2DEI A;  4S0M A;  1LQ9 A;  5J1P A;  1FD2 A;  2BKN A;  1X0P A;  3QLH B;  2E5L J;  2GO8 A;  2HG4 A;  2PFD A;  4DV6 F;  3ZTS A;  2YPY A;  1VLO A;  2PSZ A;  1FKP B;  2DPI A;  1KVK A;  5GMK a;  4MKV A;  4WTY A;  2EXU A;  2CIM A;  4CLF A;  2GA7 A;  3IGV A;  4O4G B;  3QJL A;  3NP5 A;  1RB0 A;  3EE3 A;  1EAR A;  1XNR J;  5H9E K;  2ZE2 B;  3DLK B;  5A8W B;  1EZZ B;  1Q8I A;  5M2R A;  3OTC A;  2RUG A;  4DX6 A;  4NZ0 A;  3GYG A;  2AYG A;  1U25 A;  3TOQ A;  1S6P B;  3K2Y A;  3MFI A;  3QFW A;  1U49 A;  4K2X A;  1C4C A;  3D6F B;  4O3Q A;  3HT3 A;  4LF9 F;  3A12 A;  4DDF A;  5J1E A;  1RT6 A;  5I3U B;  1JLF B;  4JI0 J;  2DGW A;  3MAH A;  2BV3 A;  4GVB A;  1VS3 A;  3OLA A;  1NDP A;  2JNJ A;  1HPZ B;  1IBL J;  2Z30 B;  2AIR B;  1S6O A;  1S6Q A;  3RW6 A;  2ROE A;  4KBI A;  1HLW A;  3KHH A;  3DOM B;  4D3H A;  4ZVP B;  1GAO A;  3T19 A;  2GJ2 A;  4USM A;  3TWZ A;  1SCJ B;  3ZFV A;  5C24 B;  2H3E B;  1SC6 A;  2EVZ A;  4NI2 B;  2B8P A;  4CRJ A;  1FF2 A;  4KGM A;  3NCP A;  3GCW P;  4HTI A;  2LCW A;  3OHB A;  4ZLP A;  1U2C A;  3GR0 A;  3CT9 A;  3L95 X;  3I82 A;  2Y8Y A;  2OLW A;  3HFV A;  4KO0 B;  2BJE A;  3JYT A;  4NA3 A;  4OI0 A;  1Y5L B;  2LLZ A;  2F4V F;  1TTH B;  3CXC R;  4C3M A;  3UD3 P;  4HAC A;  4KHM A;  4CO2 A;  3HLU A;  3UI3 A;  1NPK A;  3PX6 A;  1M5S A;  1HQE B;  3HKW A;  2YQ3 A;  2QC3 A;  3FVY A;  5HBM B;  1FNM A;  3BYP A;  1HBU A;  2ZBC A;  4ED4 A;  2AGQ A;  4D3G A;  1VRT A;  2HBY B;  4Z37 A;  4ED5 A;  1NK4 A;  2UVU A;  2GO9 A;  3PNI A;  3G6V A;  1W7W A;  2FLL A;  2QX0 A;  2UUT A;  4DN9 A;  1TUG B;  4NWB A;  4UUX A;  2BOP A;  3KFW X;  3TA2 A;  3SSR A;  2ZH7 A;  2E1M C;  2EFN A;  1T8E A;  3NG8 A;  4C8L A;  3R8Y A;  3T9N A;  3R5G A;  1ZZN A;  4EBC A;  1XEZ A;  1YWX A;  2LMI A;  2CPX A;  2DPJ A;  4IFY B;  3ETO A;  3DLL Q;  4IG3 A;  2AF6 A;  2V2Q A;  2GIQ A;  1RT1 A;  3MM7 A;  3KK2 A;  5EWE A;  1NKC A;  2F3J A;  1GMU A;  1JMT A;  1S12 A;  4TQS A;  3LO3 A;  4O44 B;  4XDC A;  5KFJ A;  2WVE A;  2DNQ A;  4IR1 A;  4M5I A;  4B9L A;  2DR5 A;  5I3P A;  1LXN A;  4ZCK A;  3NGR A;  2R8K A;  3WX4 A;  3MTK A;  3IA0 A;  4K4U A;  4DQP A;  4QW8 A;  1RP5 A;  4DR2 F;  3FC9 A;  2HKE A;  4AQY J;  3PR4 A;  2I1R A;  2DH7 A;  3EM1 A;  2FJX A;  2CPJ A;  1RAB B;  4NEY A;  3PG9 A;  4Y2K A;  3LP1 A;  1HQ2 A;  2CZ4 A;  2C28 A;  3Q8U A;  1YBU A;  2FQQ B;  4OZ2 A;  2C3U A;  3ONQ A;  4B08 A;  1T03 A;  1GFW B;  5KFX A;  1RWP B;  5I42 B;  4QYZ J;  2NR0 A;  2F40 A;  1KN6 A;  3W7B A;  1YTY A;  4LRF A;  2HFU A;  5HL7 Q;  3DRR B;  3V4I A;  2HS4 A;  1QAY A;  3PX4 A;  1NHV A;  4LR9 A;  3H20 A;  4DR5 F;  1DTT A;  4GKK J;  4YB7 A;  1WKK A;  4LBI A;  2BDP A;  2J6U A;  3PW0 A;  2BW2 A;  4DHV A;  4I68 A;  2W1B A;  2UVR A;  3D67 A;  2AJ0 A;  2RT3 A;  1N34 J;  1B0P A;  1ZPV A;  3TZZ A;  4JB8 B;  3T5K A;  4B3R F;  2VZ9 A;  4I2Q B;  3FGV A;  4CH1 A;  4LT6 A;  2YNG A;  4ZN1 A;  1HNX F;  4WYW A;  4O0N A;  2C3M A;  3MR5 A;  3A4T A;  2BJ7 A;  1JNZ B;  2IM1 A;  1FKO A;  7AT1 B;  1KQS R;  2RH3 A;  1LK7 A;  1FWP A;  5HSP A;  1AT1 B;  4KR0 B;  5B0C A;  3H5Y A;  4TLQ A;  4AFF A;  1F5A A;  1UEV A;  2V0N A;  3R5A A;  1JK9 B;  2DNK A;  2DGQ A;  3IWN C;  3D2W A;  2OSQ A;  3A3O B;  1HWU A;  2K1R B;  1S1U A;  3M8Z A;  4TY9 A;  2QFJ A;  1Y5I B;  5KT2 A;  3Q8R B;  1N54 B;  1VHI A;  2AX1 A;  1NPR A;  2FY1 A;  3BR8 A;  3OVS A;  3T9Z A;  2CQC A;  4EU0 A;  2KG1 A;  2L48 A;  1CC7 A;  2OO4 A;  4IOB A;  3GIJ A;  1XR5 A;  3GQC A;  5ETP A;  3D6T B;  1EB0 A;  2EC0 A;  1RTD B;  3FFI A;  2FGC A;  3OR1 B;  2VB6 A;  5FDL A;  1JXL A;  2QLJ B;  4DSE A;  1X9W A;  4ICL A;  4I56 A;  3JAM U;  2HFS A;  2MHN A;  1QVG R;  3HHL A;  5IFM A;  4NYZ A;  3HKZ D;  2L41 A;  2V67 A;  1KVI A;  3VZI A;  3GFX A;  3BGL A;  4WE1 B;  5EDW A;  1RBO B;  2CJA A;  4QIE A;  3RJM B;  3RG6 A;  1FWL A;  1AA1 B;  4FP9 A;  3BO2 A;  2HHS A;  1BQN A;  1ITP A;  2FVR A;  4YUD A;  2OPR A;  3CJS A;  1N33 J;  3D7S B;  1GEH A;  4N76 A;  4KSE B;  5AE3 A;  4GKJ F;  3OR2 A;  2W4C A;  3RAQ A;  3LGH A;  5HRO B;  2ZC4 A;  1F2H A;  2DXE A;  1ZPW X;  2FJB B;  1GMW A;  4AT1 B;  2BE2 A;  3OSN A;  3QAE A;  4UOG A;  2UU9 F;  1MWZ A;  2HIY A;  2ZM6 F;  3EVM A;  4WJB A;  2Q6C A;  2BW7 A;  1YJT A;  2MY8 A;  2XC9 A;  2D3O 1;  8ATC B;  3PW7 A;  3H2U B;  4L3K A;  1SXL A;  2KJW A;  5IT9 U;  1VQS A;  3GB0 A;  1DLO B;  1UJ4 A;  3NAI A;  3NGK A;  1QLN A;  1RT7 B;  3N4W A;  3MED B;  4KY3 A;  3JTO A;  1UET A;  2KYZ A;  4Y00 A;  3SFU A;  1WC4 A;  1QUV A;  3D3C J;  3NBP B;  3Q23 A;  3UVJ A;  4JP8 A;  3UR0 A;  4KTQ A;  1EQM A;  2RS8 A;  2H1Y A;  2QL7 B;  3DLJ A;  3PIP Q;  2HK3 A;  1HNV A;  1XMB A;  3UDV A;  4BHQ A;  2VL1 A;  2JLG A;  2B5J A;  2QZ8 A;  5CZX A;  4OI2 A;  2HFN A;  3GV8 B;  1Q86 T;  5AXL A;  4P10 A;  1B4S A;  1C0U A;  4WU2 A;  4PQA A;  3QWP A;  3DLG A;  3OPK A;  4JYA J;  3RUB L;  4F25 A;  1NSA A;  4HKQ A;  1YRT A;  3KLE A;  3NRB A;  1FES A;  3DYA B;  1MWY A;  5DGA A;  1Q79 A;  5HQL A;  2XYG B;  3VAF A;  2VC0 A;  3OBI A;  2XMK A;  3MXH P;  5FD1 A;  4DCO B;  4DSJ A;  3MTJ A;  4OX8 A;  1U1R A;  2BQ3 A;  3CNQ P;  4NRT A;  1S0N A;  4JI0 F;  2XZW A;  2WOM B;  3M8P A;  2B7C B;  2FIU A;  1VQL S;  2OAU A;  4DSK A;  1IBL F;  4QPT A;  4I2P B;  2LFV A;  1H2U X;  4FPR A;  3BGR B;  2L9D A;  2LXU A;  3PJX A;  5E3A A;  3C3L A;  4RUH A;  2Q79 A;  1Y3K A;  2LXF A;  3BEG B;  2RQK A;  3TQE A;  4J9M A;  4L3N A;  1NKB A;  4RNN A;  1GT8 A;  1XNQ J;  1NSP A;  3QAT A;  2XM3 A;  1RWN B;  1GX6 A;  2RSQ A;  2VPZ B;  3E8O A;  1C1C A;  4WFB Q;  1RE1 B;  2KFZ A;  2CJQ A;  3NMA A;  2YKQ A;  3H5S A;  5F0W A;  4DJB A;  1UP1 A;  5KOX A;  1ZBT A;  4KFB B;  2Z4P A;  3ZTQ A;  4RWW A;  4B3O A;  3W5X A;  3N01 A;  4PWW A;  2ATC B;  3CJ5 A;  3VAM A;  4DR1 J;  3HF5 A;  4LRA A;  4ZPB A;  3N5F A;  4H54 A;  1W26 A;  5GMD A;  4IR9 A;  5CHC B;  2E9Z A;  2R8I A;  2AWZ A;  2OJ3 A;  3VQT A;  5IM0 B;  2QV6 A;  2CG4 A;  1QAX A;  3FEZ A;  3PJ9 A;  2A0F B;  3LP2 A;  1Z2Z A;  3MHY A;  1S99 A;  5T7L B;  1F5C A;  1R43 A;  2E7V A;  5KFN A;  1U1N A;  2DXF A;  5CCL A;  1Y5N B;  5L38 A;  4X4Q A;  1X31 C;  2BUN A;  4OZN A;  5M2U A;  2MQM A;  1UA0 A;  3MWB A;  2GGP A;  2G2Y A;  3M8Y A;  1K0T A;  2NUH A;  4USI A;  3ELH A;  3KLF A;  4ECW A;  1TL4 A;  2LDI A;  5D0E A;  3CCM S;  1OSD A;  5C25 B;  3KK1 A;  2CQ3 A;  1T9U A;  1FJC A;  1VQP S;  3BSO A;  5BYS A;  3LAM A;  2B51 A;  3X3U A;  1SIW B;  2VIH A;  2XMA A;  1YZ6 A;  4OYA A;  3EMT A;  1CC8 A;  2PA8 D;  1RT5 B;  4Y28 C;  3MEC B;  3QJJ A;  1CJT A;  2E66 A;  3VGS A;  5BJR A;  2G2O A;  2J7U A;  2UUC F;  4B02 A;  3BB5 A;  2GV1 A;  2ABY A;  3BYR A;  3M1V B;  4AQY F;  1S9E A;  4KPC A;  4WIQ A;  3MMB A;  3ISN C;  3NOG A;  1R8H A;  2RRB A;  4DV2 J;  1N6Q B;  2ZH6 A;  1FDA A;  4I7F B;  3DMJ B;  2CQ0 A;  4J9Q A;  4FF3 A;  4ZN3 A;  6AT1 B;  2C1E B;  3OXF A;  3GFH A;  4RW8 A;  4WXW A;  1WNE A;  2DGV A;  3U27 A;  4RUB A;  4OX7 A;  2MZR A;  4FDF A;  4GMK A;  1HMV B;  1BQM A;  5KFH A;  3M8Q A;  3CVK A;  3UDL A;  2IM0 A;  5A8R B;  1SI9 A;  4EEY A;  3TO8 A;  1W25 A;  1FFG B;  3GR1 A;  1VMB A;  1U26 A;  1KQK A;  1VBK A;  1J5O A;  2B0G A;  4QIV A;  3QGG A;  2ZJP Q;  3D0G E;  1BLU A;  1DJ0 A;  2QA2 A;  4O3N A;  1Q7Y T;  3MUV P;  1X8D A;  3H8Y A;  5D8H B;  3FRY A;  2K7J A;  1X4E A;  1Q8K A;  1HBO A;  4QIW D;  2W2P P;  4PR6 A;  4C3L A;  2R2T A;  3SSS A;  5B0D A;  1N34 F;  2J0Q D;  3BS9 A;  2KYX A;  4M5N A;  3PFO A;  1WUU A;  4NML A;  4IQM A;  2CQ1 A;  1RU2 A;  3ITH B;  2UXC F;  2IC3 A;  3H5X A;  1TVR B;  5D0H A;  3R97 A;  3IBW A;  2WRM A;  2OUG A;  1T05 A;  3IN5 A;  5DG7 A;  3NWR A;  3D1O A;  4ZP6 A;  4CO5 A;  2ROP A;  2CKW A;  5E5N A;  3KK3 B;  4DX7 A;  4F2S A;  3EVO A;  2CVI A;  1HQU B;  3OHA A;  4CO0 A;  4Q2L A;  4LF4 J;  4RW4 A;  3BSC A;  1KC8 T;  2XY6 A;  3CTR A;  1YJW S;  1WEX A;  2BKP A;  1YSJ A;  1IQT A;  4QW9 A;  1VQ6 S;  4IOA Q;  1U02 A;  4DV0 J;  3NGD A;  1S1V A;  3MMC A;  3IMQ J;  2RU3 A;  5IT0 A;  4PPD A;  2CNL B;  3OL8 A;  3W8P A;  3AFG A;  3B4M A;  2KFY A;  2Z56 B;  2C42 A;  1SKS A;  2NRE A;  1J2V A;  2ASD A;  1S5Z A;  4OZL A;  3KJV A;  2ZZT A;  2UXD J;  4JV0 A;  4CLL A;  4ZVO B;  1TZ0 A;  1UWA A;  1JLE B;  3AY0 A;  1D8Y A;  2Q43 A;  2YWE A;  3SZ2 A;  3K17 A;  3BN7 A;  3V2U C;  5RUB A;  1D1U A;  4KAI A;  3IM9 A;  1OJ4 A;  4HHU A;  4H4M B;  2Y9H A;  1N33 F;  1WKJ A;  3HZG A;  1X7V A;  4PG7 A;  4P71 A;  5CYM A;  2A6M A;  1XBW A;  1DAR A;  2QO3 A;  1J27 A;  4NLU A;  5C42 B;  3MM8 A;  3SDE B;  4C7Q A;  2EG1 A;  4UF4 A;  4XIU A;  1NM2 A;  4CI0 B;  2HWH A;  1FCA A;  3TEH B;  2KL8 A;  2KZZ A;  2V2V A;  2APO A;  3R1H A;  3NOC A;  1R6V A;  2MKS A;  4J91 A;  3AXK A;  4NCB A;  2VAS A;  2WSC C;  2V6A A;  2PEH A;  3W63 A;  1R8P A;  4OYP A;  1IKV B;  2DJW A;  3TUP A;  1KQF B;  5IT9 Y;  2BBE A;  1YG0 A;  5D78 A;  5JUM A;  4WP8 A;  3NNA A;  3T41 A;  1OO0 B;  3H2L A;  1U7L A;  5D15 A;  4LSL A;  3P5B P;  3HSJ A;  3IBC B;  1EQ0 A;  2DNL A;  1GXL A;  2DO0 A;  1SV5 B;  1CUL A;  2AYB A;  4R8U A;  3ILI A;  5DZ6 A;  2XI3 A;  2OTL S;  1AFJ A;  2X1F A;  1LWC A;  2EWH A;  1IVZ A;  2HBQ B;  3JS9 A;  4F2R A;  4K7Q A;  1RTI A;  2KT3 A;  4CH7 A;  1OY9 A;  2DNH A;  4ZP8 A;  3CCV S;  4QR0 A;  3TAQ A;  3CCE S;  2IM3 A;  3N28 A;  1K0V A;  2X3D A;  2B7B B;  5DDR C;  2R2R A;  2V34 A;  4O3O A;  1ZS6 A;  4USW A;  4EYI B;  2MMY A;  5ETS A;  3VGV A;  1DUR A;  3GPA A;  1JLB A;  4IRK A;  1FEH A;  1IKY B;  3D28 A;  3TAR A;  2JOQ A;  4C9D A;  4MAK A;  2JVO A;  4FF1 A;  4ED7 A;  2M4M A;  4YY3 J;  3WZ0 A;  2Z57 B;  3K7R A;  1NB7 A;  3HO1 A;  2MKC A;  3P4U B;  5F0U A;  1DFD A;  1NRK A;  1WEZ A;  2R8H A;  1RHQ B;  1TUV A;  4WII A;  2VDH A;  2LEB A;  5KFZ A;  1JLA A;  3PY8 A;  3QO9 B;  2J0W A;  1T9V A;  1BUX A;  2YPZ A;  1M5V C;  1RWU A;  2FHJ D;  1JKH B;  1S9G A;  5MAO A;  2NUU G;  2FVS A;  4OYZ A;  2VIC A;  2G0C A;  1OQ3 A;  3LP0 B;  1WOO A;  5B0A A;  3J7A 1;  1XNQ F;  3KUH A;  2V9W A;  2E29 A;  3OTO J;  2XS7 A;  3J7Z 5;  3MEK A;  3M32 A;  2J9D A;  2OHD A;  1PAU B;  3RBZ A;  2Y3Y A;  5H9E J;  1LWE B;  4WWS A;  2HSE B;  2KT2 A;  3VAK A;  2VFT A;  3EGW B;  1J5E J;  5LSR A;  4GO5 X;  2BA9 A;  2ACM A;  4DCJ B;  1HIY A;  1KOH A;  3I0S B;  2G1D A;  4Q0B B;  4CM2 A;  3VVU A;  4MKY A;  4RBV A;  1OWX A;  3CJ0 A;  1G6B A;  1LK5 A;  2EFV A;  3DM2 A;  5HVH A;  1UJ6 A;  2W2O P;  1DAX A;  1TKT A;  3OXL A;  1XMQ J;  3MM5 A;  2ZBI A;  4JI6 J;  4NPO A;  1NH7 A;  2IBO A;  2QN6 B;  3I56 S;  3NL0 A;  2MZQ A;  5J2P B;  5DS7 A;  2E5G A;  3N0V A;  2G0I A;  3P45 B;  4DL2 A;  5E2Q A;  5LJ3 Y;  4DPU A;  4MH8 A;  4O0I A;  1M5K C;  3PW4 A;  2KHD A;  2NXJ A;  3O1L A;  5KFQ A;  4ITS A;  2PI4 A;  3H7H B;  4ZMM A;  4PXC A;  3AJ1 A;  2XGQ A;  1N48 A;  4BC7 A;  3N5B A;  4ZVR B;  1UVN A;  3OUY A;  1S4E A;  1S6U A;  2HNY B;  4WYL A;  2DNP A;  1P6T A;  3CPW R;  2DY1 A;  3SIP B;  1VRU B;  1QAI A;  1RAG B;  2WBM A;  5HI7 A;  4EBE A;  4ZP9 A;  5IQ6 A;  3I87 A;  3N79 A;  2XMJ A;  4E8U A;  1T3N A;  1RYS A;  2YNF A;  2WON B;  1VBY A;  3AB2 B;  3NMR A;  1LWF A;  4ZLL A;  3DLB A;  2YWK A;  3UWT A;  4J90 A;  2FVC A;  2C2M B;  3KLG B;  3V6K A;  4K4V A;  1RWO B;  2OFH X;  2YKM B;  3HXM A;  2JWN A;  5LM7 E;  1U48 A;  4DOZ A;  1VI7 A;  3NWG A;  5A6P A;  3K5M A;  2I0X A;  2W7O A;  4F4Y A;  2EKN A;  4OHZ A;  2OPQ A;  2M52 A;  3JXO A;  4PPZ A;  5B09 A;  3POT A;  1OSC A;  4DN0 A;  4ZVE A;  4A8X A;  4NYP A;  3VWS A;  3IWX A;  2XBP A;  1PJ6 A;  2AX0 A;  1YX2 A;  3ENQ A;  3RYL A;  3UD5 A;  3DRP A;  3BBB A;  1DHM A;  3I0R A;  4Y34 A;  2GVD A;  2XZD B;  3LAK A;  2ZWO A;  5K14 A;  2HVI A;  2P9C A;  1IR2 A;  2P9G A;  4ES2 A;  3SQO P;  2XO7 A;  3ZZY A;  5AXK A;  1HNW F;  2LEA A;  5CD4 A;  1FER A;  1FNX H;  2HQC A;  1YJN S;  3PYF A;  3THP A;  3A3N B;  3RB6 A;  3VV2 B;  1VHF A;  1ULR A;  2Q6B A;  1VYA A;  4LF1 A;  5ETQ A;  4KHP J;  4LFC J;  1UMJ A;  4UOF A;  4EK2 A;  2CAJ A;  1YIJ S;  1S59 A;  3KLH B;  4EGL A;  2QLF B;  2BE7 D;  3KJN B;  2CWX A;  2OGU A;  3BR9 A;  1L3T A;  4C11 A;  4GO7 X;  2RKI A;  4USV A;  4LF4 F;  3L09 A;  4PUO B;  3VAG A;  5DJB A;  2J9D E;  1F3F A;  1FDD A;  1UKU A;  5D3G A;  3IRX B;  1Z4U A;  2CJX B;  3KLV A;  5CCM A;  3EZU A;  1PBA A;  2CPE A;  4PEO A;  3MAQ A;  4DV0 F;  2HHH F;  1EKS A;  3PDN A;  3MEG B;  2OPS A;  2AKW B;  1WOR A;  4YR0 A;  2CJK A;  2DEJ A;  2RU9 A;  1X4C A;  3GTY X;  4ELU A;  2CNN B;  4B3T J;  4PG6 A;  2ADB A;  4ZS6 A;  2OKQ A;  4YP3 A;  2BOA A;  1SL2 A;  2UXD F;  5KFC A;  3CJK B;  4TQR A;  1RTH A;  4B3M J;  2HNZ A;  3L7O A;  2N7Y A;  4A8F A;  3Q8Y A;  3QPI A;  2V4R A;  2XG8 A;  4NZ7 A;  2JSX A;  4C0O C;  1ICE B;  2HRU A;  3BGF A;  2A10 A;  4DR4 F;  4RX6 A;  4I67 A;  4J9L A;  4ID5 A;  2FLN A;  1HNI B;  3M9M B;  3R6G B;  2YWF A;  5J1E B;  4Y65 A;  1G3O A;  1C1B A;  1N32 J;  4GVB B;  3PIO Q;  4CNY A;  3CIM A;  3J7Y U;  1YZ7 A;  2UUW A;  5CYQ A;  4A8K A;  1S6Q B;  4EYH B;  1RT2 B;  1QDU B;  2YKO A;  2LEP A;  4A8Y A;  2DNN A;  3GJS B;  2ZJR Q;  3TJA A;  2MKH A;  3M2V A;  1SC3 B;  3AJD A;  4LMZ A;  3TA1 A;  2BJ3 A;  4KGX B;  2WZ1 A;  5K5M A;  4R5P A;  2XSJ B;  2ZH4 A;  2AD9 A;  2Y0B B;  2NCK L;  5HAO A;  3OL9 A;  3JYT B;  1IQZ A;  2FVP A;  1S1X A;  1H3D A;  2V4J A;  4HAC B;  2BZ2 A;  3AA8 A;  4FPI A;  2Q66 A;  2GIF A;  5GAH U;  1Y3J A;  5E41 A;  3TUZ C;  1S4F A;  5KG0 A;  3QRR A;  2A2D A;  4ANC A;  1V6H A;  1ZM4 A;  3H98 A;  2FVQ A;  1OS5 A;  3MMA A;  4KPY A;  4ECV A;  1HBU B;  3Q8S B;  4DSI A;  2HFV A;  1WDT A;  2POK A;  2KFN A;  3LPY A;  1WG4 A;  1VRT B;  1RHK B;  1NEE A;  3HVT A;  2D3U A;  4P2F A;  4W4M A;  4NL5 A;  3EX7 B;  2MLX A;  3F41 A;  1YBA A;  1Q81 T;  3H4B A;  4A8M P;  5J2Q B;  5JJB A;  4DLE A;  3VAI A;  5EHH A;  2B43 A;  4YOE A;  4X65 J;  2P9E A;  2VG6 B;  1JJC B;  2ZKU A;  3ZZ0 A;  1IWA A;  5F41 A;  4DG1 A;  3I5A A;  2ZBQ A;  3P3D A;  1U2F A;  4LBP A;  2FC8 A;  3MPY A;  2J9C A;  4YY3 F;  5DZ7 A;  1RT1 B;  5EWF A;  2HVD A;  2JLF A;  3NLC A;  2ZZN A;  5K8P A;  3MM7 B;  3KK2 B;  1T9T A;  2CYY A;  3N6M A;  3SV4 A;  1AZS A;  4OI6 A;  5IOL A;  5CA5 A;  3J81 j;  3O5T B;  1SJQ A;  3V81 A;  4U8Y A;  3SCK E;  5KOW A;  4ZVF A;  1QE1 A;  1HBM A;  1N5T A;  3CJ4 A;  3GE9 A;  4LR8 A;  3PFE A;  4IG0 B;  1AUD A;  3HFZ B;  3KXD A;  2IA0 A;  4RO0 A;  1UWB A;  2HFZ A;  1HHQ A;  3LW5 C;  4YQW A;  3C14 A;  5K8N A;  1HYS B;  3J7Z T;  4KKO A;  1LW0 A;  1RU1 A;  5LMU F;  4URS A;  2GJI A;  1PC4 A;  2HVZ A;  2BYC A;  1WWH A;  4RW9 A;  2OTJ S;  1EX8 A;  2HFO A;  4TLR A;  3IFE A;  2RHS B;  1MRO A;  3MR6 A;  2EFQ A;  2XQC A;  4OV6 A;  1ZA1 B;  2QFI A;  4FYW B;  2XHC A;  3JB9 k;  1T11 A;  4XTT A;  1J5E F;  1CBK A;  4U95 A;  1KQG B;  3H40 A;  3EPI A;  2FC9 A;  1DTT B;  3ILL A;  3L4B C;  4P72 A;  2ASL A;  4UOC A;  1X5S A;  2GQ2 A;  3GYX B;  1RCX B;  2CDQ A;  3WX8 A;  3JSB A;  1V3Z A;  1UEK A;  2W9B A;  2DNZ A;  1XMQ F;  4DSF A;  2MKJ A;  3HCX A;  2DK2 A;  2MQQ A;  2XMM A;  2YNG B;  3UN2 A;  1HAR A;  5KT5 A;  1U1L A;  1Q53 A;  2K3I A;  3TP2 A;  3W2V A;  3QWU A;  1FKO B;  5A2Q U;  3TUI C;  1S79 A;  4RW7 B;  2AGO A;  4ES3 A;  3NNC A;  1FKP A;  4NEZ A;  1Q95 G;  3CGI A;  2DGS A;  1CQN A;  1HL6 A;  1P9Q C;  1GMW D;  2H54 B;  2OMO A;  2YH1 A;  3SQG B;  2AQ4 A;  2UP1 A;  4ZPC A;  4XO0 A;  4WCE Q;  5G4D A;  1GTE A;  3ZTP A;  3M9N B;  2YNH A;  3TJ9 A;  4JI1 J;  1FJG J;  3A3P B;  2ZE2 A;  4LF5 J;  2C2O B;  2VKZ G;  4PWD B;  2BAC A;  2R7V A;  4EO8 A;  1V5V A;  1CS4 A;  4RLE A;  1TR0 A;  5T41 A;  3C6U B;  3EIC A;  1AYE A;  4DR3 F;  2NXN A;  1YHQ S;  1X5O A;  2QMX A;  3FFI B;  2RQC A;  2P8I A;  1X4B A;  1JIH A;  1WC5 A;  2CVE A;  3WBZ A;  3KMS A;  3GJT B;  3IXQ A;  3HHL B;  3C15 A;  3CB4 A;  5HN0 A;  4L72 B;  4CO1 A;  1SH0 A;  1K8A T;  2GMJ A;  3ZTO A;  4NI2 A;  3D54 A;  1BQN B;  4F04 B;  2BQR A;  3MR3 A;  2VPY B;  1HD0 A;  3KWM A;  4WFY A;  2DRA A;  3MPW A;  1VDH A;  2P6T A;  1KWM A;  2CDR B;  1V3R A;  4KO0 A;  2QEX S;  1TMM A;  4PAA A;  3Q86 A;  2OPP B;  2VA2 A;  3VR1 A;  4C4W A;  1I94 J;  2K8G A;  4JI4 J;  2CQB A;  1ZAX A;  1S0M A;  2LXI A;  1I3O B;  2GHW A;  3THT A;  3BQ1 A;  2XY5 A;  1M5H A;  1NUE A;  2H9Z A;  3GIL A;  1U45 A;  3K0J A;  1HA1 A;  3IP0 A;  4LFC F;  4NLS A;  4DUZ J;  2KJV A;  2XY7 A;  4CH0 S;  1F1B B;  2XLJ A;  2ZZM A;  3MCO A;  1TKX A;  2EFG A;  3QT7 A;  2MJU A;  1SVD A;  2Z2L A;  2X7I A;  4LIW A;  1L3U A;  5KAK A;  1UA1 A;  4P9S A;  1B99 A;  4ETX A;  5KFK A;  2XZT B;  3NKY A;  2KM8 C;  3OV7 A;  4LFB J;  4FBT A;  4CYU B;  2H4Y B;  1S57 A;  2VU5 A;  1NSQ A;  3I9V 9;  2W9C A;  4IH7 A;  3QSY B;  4OJ3 A;  3OFE A;  4QIG A;  2DGX A;  5GVQ A;  1NZ8 A;  1U24 A;  1M0S A;  2UUA J;  3C8Y A;  2F63 A;  5ADZ A;  1HNV B;  5F8G A;  2ZHO A;  4KQZ A;  2B5J B;  4RU2 A;  2K3K A;  4TU9 A;  2R7O A;  3G9C A;  4FN5 A;  4V1A k;  1IR0 A;  2QL5 B;  4LR7 A;  1Y0H A;  1WTF A;  1B0T A;  4G1Q B;  4B9N A;  3DLG B;  3QT8 A;  3GIM A;  1IKW A;  3GG1 A;  3L7P A;  2DB1 A;  3KLE B;  3PR5 B;  2J5A A;  4NXM F;  3EZ5 A;  1U0H B;  2QE5 A;  1TL7 A;  2CJY B;  5G0R A;  4OMF G;  1D9A A;  2IBK A;  1TEL A;  2GQQ A;  3CDA A;  2DTJ A;  5DGB A;  5FLX Y;  4M5J A;  2QJ3 A;  4QWE A;  1TUW A;  3M8P B;  2WSE C;  4MYT A;  1MML A;  4FS1 A;  2L3M A;  5DRK A;  1CQM A;  1IJF B;  2KRB A;  2DO4 A;  3ISN D;  4OJG A;  4PQU A;  1WF1 A;  4R25 A;  1KHV A;  4F7V A;  2AEM A;  2NXE A;  2CQP A;  5T14 A;  5KFO A;  4ZPV R;  2RUS A;  2QA1 A;  4X84 A;  2NPF A;  2RF2 A;  1K44 A;  1C1C B;  2UXB F;  4WP9 A;  4KYZ A;  2GZO A;  3TI0 A;  4PXD A;  4ED6 A;  4V19 J;  2LA4 A;  3EXY A;  3NXZ A;  4I2Q A;  5IQQ A;  2NPI A;  4WFN Q;  3W1Y C;  1KD1 T;  1DTQ B;  5J1N A;  5B7W A;  1TKZ A;  4NLV A;  2EI5 A;  5U47 A;  1KHW A;  3I4P A;  3W2W A;  1F6T A;  2CZV C;  1GXU A;  5FII A;  2MPU A;  1QSS A;  1Y4Z B;  1E6Y A;  3KG4 A;  4Y2C A;  2HZC A;  3LAN A;  2N7C A;  3VAL A;  2I6W A;  3T6B A;  2EC2 A;  4IO1 A;  3DI6 A;  4F0H A;  1BGX T;  2NSB A;  2IFX A;  1FJE B;  4I4B A;  1SPB P;  3R1L A;  1RBL A;  1NXI A;  2GGP B;  3I31 A;  2NZ4 A;  2B56 A;  2HHP A;  1R6Y A;  2U1A A;  4UZB A;  4X65 F;  1UPP A;  3A8J A;  3SSQ A;  1EET B;  2K2P A;  4DU8 A;  2ZH2 A;  2YKP A;  5C2G A;  2HPU A;  3AOA A;  3R7S B;  2HQD A;  1LFW A;  2KHC A;  1JXE A;  2COL A;  3O44 A;  2VV5 A;  1U1Q A;  4K5S A;  2IRY A;  2Z0G A;  4ZVQ B;  1CJT B;  1X4H A;  3J81 Y;  1FA0 A;  4WE1 A;  4ZVG A;  1AW0 A;  2W7P A;  3TA0 A;  3NGT A;  2HK2 A;  8AT1 B;  1S9E B;  4USK A;  4JI8 F;  2F9D A;  3MMB B;  3BBC A;  4J9U E;  4CO3 A;  2VBY A;  5J2N B;  2MZJ A;  3JSM A;  3HVR A;  2OIH A;  2XTJ P;  2RDI A;  4DBQ A;  3IAS 9;  3CMA S;  2GQC A;  4NLX A;  2EFO A;  2YKA A;  1RAA B;  3ZTR A;  2M8H A;  1UVM A;  3AOC A;  4C8Z A;  3M8Q B;  4ENO A;  5ETR A;  1RWM B;  2BAB A;  2GML A;  1BC6 A;  2J0X A;  3S8S A;  4NMX A;  2WSF C;  1J5O B;  5KFR A;  3RBX A;  4K59 A;  3M2U A;  1S7H A;  1RWX B;  4GC6 A;  2DGU A;  5D6G A;  3EJM A;  4R0E A;  1UL3 A;  3PYE A;  1LW2 A;  1RA7 A;  5KG1 A;  4DL0 C;  4C48 A;  1HBO B;  3FMW A;  3U02 A;  1VQN S;  1FX4 A;  1DLO A;  2DBB A;  2CUY A;  1WTB A;  2ASY A;  1U6B A;  1RT7 A;  2ZIT A;  3CF5 Q;  1NK9 A;  3PYG A;  1CJV A;  4ZPA A;  2IAJ A;  4GRS A;  3G71 S;  1WSV A;  1RWK B;  4QWA A;  1H72 C;  1YDL A;  3N6L A;  3NBP A;  2IC3 B;  1GX5 A;  1Q0N A;  4WK1 A;  5E3R A;  1P1T A;  3W65 A;  2Z2Z A;  1VLY A;  3UR3 C;  1T05 B;  1D9D A;  2NZC A;  4AUK A;  2Z58 B;  2AJ4 A;  5K9F A;  3CDE A;  4H4O B;  2IY5 B;  5L9X A;  4TN2 A;  4K4Z A;  2D3O R;  3ENV A;  4QIF A;  2HWI A;  1VBZ A;  4RU9 A;  3KUE A;  4JI1 F;  1S77 D;  1FJG F;  4LF5 F;  1FRH A;  1PGZ A;  2CRL A;  3K59 A;  1PO6 A;  2VJV A;  4KHR A;  5J2M A;  1ROF A;  4RW6 B;  1S1V B;  1WC1 A;  2R8G A;  2V2Z A;  3O6Q A;  3MMC B;  3KYL A;  4WXO A;  1GK8 A;  5DG8 A;  2F5G A;  4RNF A;  3T5H A;  1U0S A;  2DY9 A;  1JLQ A;  4P2X A;  1R0B G;  5BYR A;  2MYF A;  2HHX A;  3GON A;  3SCJ E;  3G82 B;  2OFG X;  3T6J A;  2FTR A;  1VK8 A;  4NLD A;  1U1O A;  4HI1 A;  1ZM3 A;  1N0V C;  1ELO A;  2W01 A;  1MLA A;  4FXD A;  3QYY A;  1FE4 A;  5E3C A;  2EK1 A;  2FLO A;  2ZOF A;  3S6E A;  4FS2 A;  5HK4 A;  2C2E A;  5A0Y B;  3CJ2 A;  2UV8 A;  5DM6 Q;  4DV1 J;  4QOT A;  4WPA A;  2IMO A;  2ZH3 A;  4RJV A;  5KFE A;  1LFP A;  5CYM B;  4W98 A;  5BR8 F;  3KLI B;  4NCG B;  4K8R A;  4J9O A;  2Y1L B;  4EWT A;  1UVL A;  4KH1 B;  4LVO P;  3BBF A;  2X51 A;  1HNZ J;  2RD5 C;  3UFC X;  5IWA J;  4OLP A;  4E0D A;  4B9S A;  3Q8Q B;  3HP6 A;  3GMG A;  5JXS A;  4KFB A;  4OQJ A;  1RTZ A;  4JI4 F;  1APS A;  1S1W B;  3BDE A;  4RKU C;  4ZPT R;  2VDI A;  3M30 B;  1H38 A;  1AB8 A;  1K47 A;  1IBM J;  1S76 D;  1I5O B;  4N77 A;  1R8A A;  4DUZ F;  1SC1 B;  4CLK A;  1WEY A;  8RUC A;  2RAQ A;  1JLG A;  4DSL A;  2UUB J;  2MY7 A;  1QTM A;  4JOU A;  4YME A;  2DT9 A;  1SJ4 P;  1TFW A;  9RUB A;  1C4A A;  4CM0 A;  1RHU B;  3OL7 A;  3ET6 A;  1U09 A;  3A8E A;  4M95 A;  2HMI B;  3CE8 A;  4LFB F;  4NE9 C;  4TKT A;  1RA6 A;  2KXN B;  4CLY A;  1TMJ A;  3FBB A;  4R8U B;  2HLT A;  4B9T A;  4FKX A;  4OYW A;  3UDC A;  3EGZ A;  1LWC B;  3AQP A;  3M8R A;  3V4M A;  3T1H F;  3NAH A;  3RB4 A;  3K8V A;  2EBG A;  1CJU A;  2ZWP A;  1RT5 A;  4MMO A;  2C22 A;  3MEC A;  4O4R A;  4DV4 F;  4IYQ A;  2O67 A;  4BDP A;  4M94 A;  2CPH A;  3OVB A;  4G6V B;  4IUF A;  2QTW A;  4KGK A;  1JLB B;  2V94 A;  4Y2I A;  3M1V A;  3US5 A;  4L6V 3;  2HWT A;  3E01 A;  3ZC4 A;  3MM9 A;  4ZOS A;  1NPP A;  3DLH A;  2PEB A;  1RT4 A;  2LP4 A;  4LFA J;  3DMJ A;  3TEG A;  3MEE A;  2JZ5 A;  1RT3 A;  2JC0 A;  2PA3 A;  1M1H A;  5LL6 d;  2KXF A;  1HMV A;  2YKN A;  4LVN P;  3C16 A;  1JLA B;  2AEF A;  1KFS A;  2CPY A;  1WD6 A;  5A8R A;  1UVJ A;  3HDS A;  3MCN A;  2PMZ D;  2KVI A;  1F2G A;  1BMQ B;  1X0F A;  1S9G B;  2VUG A;  3J7Y I;  4ECR A;  4C0H A;  1RDR A;  3UNY A;  3JSY A;  4RUA A;  1I6J A;  4DQI A;  4HDG A;  1A6L A;  1RBA A;  4NRU A;  1M90 T;  2IM2 A;  2AJ1 A;  1WAC A;  5HJY A;  4LRC A;  3M6W A;  1HI0 P;  1DRZ A;  3M32 B;  2BX6 A;  3HPO A;  4ECZ A;  1LNQ A;  1C0T A;  3TVZ A;  3I5B A;  2VQE J;  3BPD A;  1HI8 A;  3KG1 A;  1KR4 A;  3BSA A;  5KFF A;  2VD3 A;  2GW8 A;  3EGN A;  3BQ0 A;  2GX8 A;  1BXN A;  2AJQ A;  5K8O A;  3DHW C;  4AL7 A;  3CJQ A;  4I6W A;  3W61 A;  2VBW A;  1N88 A;  3FSI A;  4X4U A;  1NJX A;  3QT6 A;  2ASJ A;  3K57 A;  3U1N A;  2D9O A;  4UOH A;  3DM2 B;  3H90 A;  2YX1 A;  1MMN A;  3LGM A;  1HQU A;  1SC4 B;  1REV A;  4BWJ A;  5GAH I;  2AW0 A;  4ZKA A;  5DLG A;  4DPO A;  3OTD A;  3NCR A;  1HBN A;  1D8Z A;  4ED0 A;  3GFY A;  2LQ9 A;  3G2X A;  3KJQ B;  1G4C A;  2G1H A;  4QZV B;  5HMW A;  2JC1 A;  3WC0 A;  1AUS L;  2ZHB A;  2JDJ A;  1O5J A;  4HHH A;  3UO0 A;  2DGO A;  2V8H A;  5LOQ A;  1ZYQ A;  2G9O A;  2B4V A;  1NH8 A;  3CME S;  2FZG B;  2VG7 B;  2MKI A;  5KG4 A;  1VK3 A;  1YI2 S;  3AAW B;  4M5G A;  4OL8 A;  3G4S S;  4FVC A;  2AT1 B;  2JHE A;  5HJX A;  4OI1 A;  2B9E A;  2P6S A;  2ZBP A;  2HGL A;  1TL1 A;  3K89 A;  5HMY A;  1NDK A;  2M7S A;  4A47 A;  1RLC L;  3D1H A;  2BM0 A;  4DL5 A;  1JLE A;  3G86 A;  1HHT P;  2DRB A;  2FJE B;  1BD6 A;  1RTJ A;  1SIZ A;  1FTR A;  2YNF B;  2VJU A;  4IQX A;  3Q24 A;  4PXB A;  1WKL A;  3KHL A;  1OY6 A;  4JI5 F;  1UW4 A;  1JWW A;  2YWG A;  1FXD A;  3NCQ A;  3L9Z A;  2D9P A;  1K1Q A;  5HLF A;  5BYQ A;  1SH3 A;  2MQ8 A;  4NLP A;  1H2V Z;  1X5P A;  3IR5 B;  2R7R A;  3I96 A;  3IG1 B;  2CFX A;  3T1Y F;  4QYR A;  2DHG A;  2M88 A;  1QAJ A;  2OPQ B;  5ETT A;  2VPW B;  2F65 A;  4CIO A;  4P73 A;  3MAA B;  5KFG A;  1FDB A;  2RE1 A;  1TP7 A;  3G8T A;  5AJ3 J;  2DCL A;  3RGI A;  1IKV A;  1VRQ C;  1QY7 A;  3TZY A;  4Q8F A;  5EN1 A;  3LQV A;  5H9F K;  1WI6 A;  4OI3 A;  5GAD U;  3E51 A;  4HLB A;  4TY8 A;  4ID8 A;  1ARO P;  2VFR A;  3H2V E;  2L08 A;  3PKM A;  3W9J A;  3DXB A;  4HL9 A;  3AB4 B;  1SJR A;  2HQF A;  3VF0 B;  3CDB A;  1QSL A;  2FUG 9;  2E5L F;  1GXT A;  2RQM A;  5THW A;  5B0E A;  1KVJ A;  1K9M T;  2FYX A;  4WF9 Q;  5ETO A;  1S0V A;  5E3Q A;  2N4D A;  3EGV A;  3VCD A;  2FDN A;  3HUL A;  1FEE A;  3BZQ A;  3GSD A;  3H42 A;  5L1K A;  2DIT A;  4L73 A;  3V6J A;  3A13 A;  2JRS A;  2MB0 B;  1FNO A;  3NS6 A;  1X4A A;  2KXH A;  1XNR F;  3HZE A;  1KS2 A;  5D3G B;  2IVM A;  1LXJ A;  3UNG C;  4DU7 A;  5SZT A;  2FLP A;  4DFM A;  4NX9 A;  1NK5 A;  1NLK L;  1S1T B;  4RBT A;  3QJP A;  3EZO A;  2CQ2 A;  3DDI A;  4DZ6 A;  2OPS B;  4IFV A;  2DIS A;  4JBC A;  1WC6 A;  3H0P A;  2CG8 A;  2W25 A;  1VQ7 S;  2ZD1 A;  5L39 A;  4XPE A;  2R7X A;  3K8W A;  3TUJ C;  1Y7P A;  3M2R A;  4V19 X;  4HH0 A;  3D4J A;  1IN0 A;  1SKR A;  5GME A;  3C6T B;  1N56 A;  1U8W A;  1WHX A;  2BJD A;  5K20 B;  3AOB A;  2PII A;  1GMV A;  1FFW B;  1HWJ A;  1QUP A;  4A8O A;  1FK9 A;  2M8D B;  1TK0 A;  2A18 A;  4UZC A;  5KFW A;  1JKH A;  2XYH B;  4AL5 A;  4O23 A;  1WOP A;  3CD5 A;  2QG9 B;  1H7X A;  3R7B B;  4YHH J;  2RHQ B;  4AXJ A;  3R5B A;  1REG X;  3MI7 X;  2GHP A;  3FEY B;  2M70 A;  3ZZR A;  1C1B B;  5LT5 A;  4PXE A;  4X4R A;  2GVZ B;  4FYD A;  3KNG A;  5DO2 A;  5CYQ B;  1HNZ F;  2FGO A;  4PG8 A;  1XK8 A;  1V9O A;  3KG0 A;  2HND B;  2N4C A;  4DXL A;  4ZVS B;  5KFA A;  5L1L A;  3HD1 A;  5CZV A;  2UZA A;  6FDR A;  3M2V B;  4RL1 A;  2QLB B;  1IBM F;  3MD1 A;  5HAN A;  4B3S J;  1QSY A;  3JTP A;  1VR6 A;  3GG0 A;  5KFI A;  4ATN A;  4PYD A;  2KVQ E;  4DL7 A;  1CLF A;  4U96 A;  1RHJ B;  2Z8Q A;  3G6E S;  2H4W B;  4M5H A;  4TU8 A;  2NYI A;  2W2N P;  2CJB A;  3AXM A;  3B54 A;  1S1X B;  5J2P A;  1EP4 A;  2V4J B;  4JUZ A;  3RRH A;  4PCQ A;  3AJ2 A;  4YB1 P;  5F8M A;  3FQK A;  5KG7 A;  4P7V A;  4M1K A;  2FHK A;  2VON A;  2GIR A;  2GS8 A;  3V6D B;  3MMA B;  1D9F A;  2IRX A;  3HMJ G;  2QMW A;  2X3G A;  5A6W A;  4URQ U;  1VCT A;  1UEU A;  1ZAW A;  4CTA B;  4N41 A;  2L9W A;  2F7V A;  5KT6 A;  2CQG A;  5KFU A;  1JX4 A;  3HVT B;  4KB7 A;  2HHQ A;  2PT0 A;  3TW0 A;  1H98 A;  2MQL A;  2AYE A;  5EX3 A;  2W2Q P;  4MIW A;  3HHN B;  2JFD A;  2LQ8 A;  2BQU A;  3QT5 A;  4QPX A;  2V8G A;  2WON A;  4QCL A;  1KLM A;  1MG7 A;  1RUS A;  3QQC D;  4DG1 B;  2FB0 A;  2ZFH A;  3GIR A;  4MTP A;  4NOH A;  2HEK A;  4LFA F;  2QYC A;  3Q8V A;  4UUW A;  3ZZZ A;  4ZCM A;  4G3I A;  1LV5 A;  5KT3 A;  3KLG A;  3IR7 B;  2XMV A;  2ZH8 A;  1SJ3 P;  1F9E B;  4MK9 A;  1GTH A;  1AZS B;  1CJK B;  1F0X A;  4NA2 A;  1V3S A;  2HQ3 A;  1FWK A;  2XEX A;  3PCO B;  3MR7 A;  1YLX A;  4PYA A;  5C7P A;  1HBM B;  3H25 A;  4GVL A;  3S1T A;  3QIP B;  4MK7 A;  4HDH A;  1B7F A;  2LQB A;  5BXI A;  4ED8 A;  4GKK F;  3KDO A;  1PYS B;  1MW7 A;  3C14 B;  4C8N A;  2O66 A;  4OZ0 A;  2HGM A;  2PDA A;  4C97 A;  1KFD A;  5DQG A;  2XCP A;  3N6N A;  3EYZ A;  1ZAV A;  1PIE A;  2W4D A;  1NU4 A;  3P49 B;  2VQE F;  5KT7 A;  4ZCI A;  3ZZU A;  2E7W A;  1RAE B;  2CQH A;  4MYU A;  2UU9 J;  1TL3 A;  2MST A;  4FYV B;  2ZM6 J;  1VIX A;  2IDL A;  3HHD A;  1URR A;  1XTZ A;  2LEC A;  1H6K X;  1YJ7 A;  3BKT A;  1IWG A;  3QFH A;  2V9K A;  4CLW A;  2QMU B;  3R5J B;  2BXJ A;  4PUO A;  4DS4 A;  2I8E A;  2WB4 A;  2V4Q A;  3GV5 B;  2EW9 A;  3IBF B;  4ECU A;  2ERR A;  4ZIV A;  3VAJ A;  1ZA2 B;  2IHR 1;  2KH9 A;  3UDE A;  4DQS A;  2VG5 B;  3W2V B;  1WG5 A;  5L1J A;  1TFY A;  4P6Q A;  3DGP B;  3MEG A;  3QZ8 A;  2RIL A;  1CSJ A;  1S0O A;  5IT4 A;  1H0H B;  1N5Y B;  5A76 A;  1NKE A;  2H51 B;  2R7W A;  2MQN A;  3PXG a;  2QGF B;  1NCL A;  1DZ5 A;  1RYR A;  1OYD A;  3PKY A;  3Q22 A;  4ZVT B;  1ZM2 A;  1XR6 A;  1B64 A;  3CJK A;  1YGY A;  3PO4 A;  2D41 A;  3KHG A;  2H5J B;  2YNH B;  1R27 B;  1MU2 A;  4RNO A;  5DDO C;  2WVD A;  3ZNJ 1;  2MZ1 A;  2ZJQ Q;  4KE5 A;  2RJZ A;  4X2B A;  2IYI A;  1RXO B;  4NLQ A;  1G1X A;  1CS4 B;  3KDN A;  4ALZ A;  5DQH A;  2V68 A;  4X4N A;  2NS1 B;  3C46 A;  3LWM A;  1RAO A;  3MMJ A;  2J7K A;  1RZM A;  5CXT A;  1HNI A;  2DXD A;  3CUN A;  5C2C A;  4K50 A;  4ILR A;  3Q2T C;  2AJ2 A;  1SQG A;  4M5M A;  2IMW P;  3LOU A;  4N47 A;  1EIY B;  3FDS A;  3QBC A;  3ILJ A;  2AJF E;  3U1L A;  3O3L A;  2AHO B;  4AYB D;  3I5C A;  2CNK B;  2B4U A;  2RDD A;  4LRB A;  4CLT A;  1RT2 A;  3C15 B;  4J9P A;  4JV1 A;  1TKD A;  2UVV A;  3ZO7 A;  1EJ7 L;  2J8S A;  1VIO A;  3D3B J;  4MFB B;  3AD7 C;  2V8V A;  1FJ7 A;  2C3P A;  4Q45 A;  2KZM A;  1F5B A;  2ZDO A;  1Q1K A;  1VQ5 S;  3BPS P;  2EPI A;  1BWV A;  1RAJ A;  2XSJ A;  3D6M B;  4ES1 A;  5AJ3 F;  2OEM A;  4QJV A;  4ZPW R;  1OIA A;  2ZKT A;  1RHR B;  2PMH A;  2XMU A;  3DRX A;  1UFL A;  1RAD B;  2KM8 B;  2RB7 A;  1AFI A;  2ZDP A;  3AD8 C;  2R8J A;  3EWG A;  2DD8 S;  1FI4 A;  1DQ9 A;  4PG4 A;  1FVS A;  1HW8 A;  2BEF A;  2LU2 A;  2ZOG A;  2FZK B;  1BY9 A;  2I2Y A;  2A3J A;  1R89 A;  1TKX B;  3FQL A;  1LOU A;  2HBR B;  5L9N A;  2RNE A;  3RRK A;  2D1C A;  2E5J A;  4OLO A;  3OJU A;  4X4V A;  3WIV A;  3KOA A;  2DGT A;  5IV3 A;  4JYA F;  5J2Q A;  1PCA A;  4A4J A;  5F9L A;  2W9C B;  2CQ4 A;  1RAC B;  1VOM A;  1KLN A;  4DPX A;  2VG6 A;  3MUT P;  2UV8 G;  2M9K A;  3BM7 A;  4DMZ A;  2E7X A;  3FJ2 A;  2GCF A;  2DH8 A;  1AXQ A;  2R3V A;  4LSN B;  4LSZ B;  2HRT A;  1FTC A;  2HVH A;  2A2C A;  2BJ9 A;  2HVE A;  2QLW A;  4DPY A;  3DLE B;  2HRY A;  1IKW B;  5DQI A;  2IVY A;  2UUC J;  2LKZ A;  4J9K A;  4F50 A;  5LMN J;  3NEK A;  4IG0 A;  2MDA A;  5H1S V;  1TL7 B;  5G0R B;  1WHV A;  1K73 T;  3DCA A;  3M6X A;  2JJ4 D;  4ECQ A;  4YHH F;  2KN4 A;  3WC2 A;  1HYS A;  2XWX A;  2LA6 A;  1DBD A;  2E1P A;  3R5C A;  1QM9 A;  2V8D A;  3OTE A;  1Y9O A;  4A48 A;  2AGP A;  5GAG I;  3B82 A;  1R8B A;  2RRN A;  4LRE A;  1JB0 C;  4F4X A;  3HHK A;  4Q7A A;  3GCX P;  4PQU B;  1FFS B;  2DHX A;  2ACY A;  2RDJ A;  2XMW A;  4KGV B;  4K0K J;  4U9R A;  4WFZ A;  3CED A;  2R2S A;  3HSZ A;  4DR1 F;  2WW8 A;  1M5P C;  4ZDN A;  4HYK A;  4B3S F;  5A8K A;  3NS5 A;  1F60 B;  4ECT A;  1NBE B;  4ZK7 M;  3K5P A;  2H5I B;  3TZW A;  2CPD A;  1UVI A;  3BQ2 A;  3BO3 A;  2M0G B;  1D09 B;  2RF2 B;  3M05 A;  1NME B;  4RNM A;  5HMZ A;  1TV6 A;  3OW2 R;  4HT7 A;  2MSS A;  3QRQ A;  1HWL A;  4OHY A;  2UXC J;  4HR2 A;  4N5S A;  4KT0 C;  4J5O A;  1TKZ B;  3U1M A;  2KI2 A;  4E2F B;  2VA3 A; 
#chains in the Genus database with same CATH homology
 4JI6 J;  3T1Y J;  4LF4 J;  4LF7 J;  4X64 J;  1IBK J;  2UXB J;  2MEW A;  3D3B J;  1XNQ J;  4DUZ J;  2F4V J;  1IBM J;  4GKK J;  4DR3 J;  5LM7 E;  1XNR J;  3W1Y C;  2VQE J;  4DV7 J;  1XMO J;  4DR6 J;  5AJ3 J;  4DR4 J;  4DV4 J;  4NXM J;  2MTL A;  1N32 J;  4JYA J;  3OTO J;  4B3S J;  3J80 U;  3R2C J;  2UUB J;  4K0K J;  5A2Q U;  4DV0 J;  4LF9 J;  4B3R J;  2KL8 A;  4DR2 J;  4OX9 J;  4LFA J;  4JV5 J;  1N34 J;  1HNX J;  2UU9 J;  3IMQ J;  4LFB J;  2KVQ E;  4DV3 J;  2ZM6 J;  4X62 J;  4JI8 J;  4NEZ A;  4PWW A;  4AQY J;  4DR1 J;  3JAM U;  4NXN J;  4JI0 J;  4JI2 J;  1N36 J;  5IT9 U;  3R2D J;  1J5E J;  2HHH J;  4X66 J;  2UUA J;  1IBL J;  5LMU J;  4NEY A;  4B3T J;  2UXD J;  4X65 J;  4DV1 J;  4YY3 J;  2UUC J;  4DV6 J;  4KY3 A;  4JI5 J;  4DR7 J;  4JI1 J;  1FJG J;  4RJV A;  4LF5 J;  4DUY J;  2MQ8 A;  4DV2 J;  4YHH J;  2E5L J;  5LMN J;  3D3C J;  4B3M J;  2UXC J;  4DV5 J;  1I94 J;  3J81 U;  4GKJ J;  1HNW J;  1N33 J;  4LF6 J;  4V1A k;  1HR0 J;  4JI4 J;  4JI7 J;  4LF8 J;  4KHP J;  1HNZ J;  3T1H J;  4LFC J;  4KYZ A;  4DR5 J;  2VQF J;  5BR8 J;  5IWA J;  3J7A N;  5FLX U;  1XMQ J;  4HHU A;  4JI3 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...