2MTLA

Solution nmr structure of de novo designed fr55, northeast structural genomics consortium (nesg) target or109
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
88
structure length
88
Chain Sequence
MGEMDIRFRGDDLEALEKALKEMIRQARKFAGTVTYTLDGNDLEIRITGVPEQVRKELAKEAERLAKEFNITVTYTIRGSLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein
molecule keywords De novo designed protein FR55 OR109
publication title Solution NMR Structure of De novo designed FR55, Northeast Structural Genomics Consortium (NESG) Target OR109
rcsb
source organism Artificial gene
total genus 26
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2014-08-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 2mtlA00
2KVQE 2MTLA 2MQ8A 4LFCJ 2VQEJ 1XMOJ 4DUYJ 4B3RJ 1XNRJ 1IBLJ 4KYZA 4DV1J 2UUAJ 1N32J 5IWAJ 3OTOJ 3T1HJ 4K0KJ 1HNZJ 1IBMJ 5A2QU 4X62J 4OX9J 4NXNJ 2ZM6J 1XNQJ 4V1Ak 4LFAJ 1N34J 2KL8A 2UUCJ 4JI0J 4NEYA 4B3MJ 5AJ3J 4AQYJ 4X66J 4DR6J 4LF7J 1HNXJ 4KY3A 4LF9J 4JI3J 2UXDJ 4LFBJ 5IT9U 3D3BJ 4JI2J 4YHHJ 4NEZA 1FJGJ 4DR7J 3J80U 4DV2J 2F4VJ 4JI5J 3R2DJ 4NXMJ 3R2CJ 2UU9J 4JI7J 4JI6J 4DR3J 2HHHJ 3T1YJ 2UXBJ 4DV3J 4LF5J 4LF8J 2E5LJ 3J7AN 2MEWA 4DR2J 3IMQJ 4YY3J 4RJVA 3JAMU 4DV5J 4DR5J 3J81U 5BR8J 1N36J 4B3TJ 1HNWJ 4JI1J 4DV6J 4DR4J 2UXCJ 1XMQJ 4PWWA 4DV0J 5LM7E 3D3CJ 4KHPJ 4DUZJ 4DV7J 1J5EJ 4LF4J 1IBKJ 4GKKJ 4HHUA 4LF6J 1I94J 2UUBJ 4DV4J 4X65J 5LMNJ 4X64J 4B3SJ 1HR0J 4JI4J 4DR1J 1N33J 4JV5J 3W1YC 5FLXU 4JI8J 4GKJJ 2VQFJ 5LMUJ 4JYAJ
chains in the Genus database with same CATH superfamily
3SFGA 2OKQA 3M2VA 5LXRA 4I2QB 1S9EB 2A6OA 2YWHA 6FD1A 3C46A 5H9EJ 2HNYB 4OZLA 4OZJA 1X0PA 3T1YF 3BQ1A 1JJHA 1TKTA 4ETXA 2M52A 4Z37A 5J2MB 1ELOA 1OWXA 5D78A 3EGVA 2FYXA 3TUJC 3AOBA 3QJJA 1F9HA 1D8YA 2EPIA 1QSLA 3VVTA 3MEGB 1TL5A 2K2PA 2JL9A 2FQQB 2MLZA 2PD1A 3C14B 4C8KA 3W65A 5HL7Q 2BYCA 3Q8YA 3FVYA 4J9UE 1RKIA 4DV6J 1MNEA 1JLQB 4X84A 2YWEA 2MZ1A 4NXNF 2MJNA 1SPBP 1G3OA 4IFYB 4OLPA 2V9WA 4CDIA 1VBZA 4QYZJ 4RUBA 4RW6A 4EZ6A 1P1TA 1DTTA 3BREA 4LSNB 5GMKa 2F65A 2WVEA 1N0VC 1JJ4A 2HRUA 2H9ZA 4EGLA 1VR6A 1SC1B 4EK2A 3IP0A 4P10A 2U1AA 4L3KA 1F1BB 2LP4A 2OD6A 3TAMB 1EAYC 2RD5C 1I3OB 3J7Z5 3R9LA 2FVCA 1S1VA 2NSCA 2HS3A 1YJVA 2PGCA 3QAEA 1VBKA 1NB7A 1NBEB 3QPIA 1YG0A 1AA1B 4DPWA 4NCBA 2WRMA 4KE5A 1N5YB 1RT5A 3HULA 3BQ0A 4WJBA 4EO8A 5RUBA 3MMCB 2XI2A 3UN2A 2VPZB 2Q3PA 3NGRA 3RZAA 1S97A 1HYSA 4M5DB 3FCVA 2K8GA 3Q8UA 4B3SJ 4J9VA 3R8YA 2GVZB 1S6QA 1DLOB 1WSRA 4B08A 3CJ4A 1B7FA 1VMBA 3DOMB 1FKOB 4G1PA 2W7AA 3OD2A 1XMOJ 1YQHA 3D68A 3FMWA 3D4JA 2W1BA 3ZTRA 4N76A 2OH2A 1X8DA 3CD7A 2ZH6A 2F40A 2WB1D 1IUJA 1XIQA 3EM1A 3I31A 2AMCB 3OHBA 2D3ZA 1SBRA 1SJFA 2GO9A 2PC6A 3GB0A 3UDEA 4MFBB 2NXUA 3CCRS 5HVFA 5EUHA 4TLRA 3T5LA 2BDPA 1X31C 3P8BB 3M6VA 5HVHA 1XTZA 4DSJA 1UVJA 4F3MA 5GMDA 4C0BA 1NJWA 2D3OR 2R2SA 3M8PA 2XY6A 3S6EA 2I9SA 3K5LA 2GW8A 1YJRA 3KLIB 1S12A 5FLXU 4XDDA 3W2VA 2VG6A 5CA5A 1T11A 1Y00A 1VQ6S 1V3ZA 4OI0A 4LRBA 1KONA 1JKHB 3TZXA 1MROA 3CJ2A 3X3UA 3BR8A 2R7OA 5K8NA 2ZZNA 4HTJA 2MKYA 4A47A 2UZAA 1IN0A 5HANA 4ZHRA 1R89A 2Z2MA 1S0NA 2F63A 4PWDB 2MQOA 3AOAA 3GV5B 1NH8A 4KV8B 2M5YA 3FKBA 4LVOP 2CPXA 4FF2A 4PXBA 1TVRA 4H4KC 3BS9A 4CLLA 1UWAA 2QC3A 2V8GA 4P73A 2FVQA 2PI5A 4J9LA 1NLKL 3JS9A 3HDSA 4I56A 2VPXB 1AFIA 3WC2A 3D7SB 2MKIA 3V4MA 1QUVA 4OYZA 4I6AA 2CJYB 5GAHU 3LOUA 1H3DA 2RHSB 2IDLA 2Q43A 2E9ZA 3HVTA 1WELA 3I0RA 1PILA 2HBRB 5HP1B 2E5IA 4KFBB 2F7VA 2WW4A 2CJKA 3B6BA 3WHIA 4ZCIA 2MZSA 1RT7A 3GZ7A 1DJ0A 5H9FK 2AJ0A 1H73A 2PA3A 2OPQA 1MN9A 2MZQA 1IKXA 1C4AA 4NI2A 1BE4A 3ZTOA 3DMJB 4I2PA 5KFZA 2CQHA 4JI2J 1IM6A 3CCWA 4U8YA 2KG0A 5F0UA 3O1LA 1RCOB 4DF8A 2DNQA 3MECA 5MAOA 4IQXA 5G4DA 3DLBA 2CPIA 4GO7X 2ADCA 5DLGA 2AGQA 1WEYA 3CC2S 3M9NB 5F8HA 2HSEB 1LWCA 1NUEA 5KG4A 5HMWA 5KT3A 2IC3B 1GX6A 2FD2A 2QA2A 2W9CA 2DH9A 3W1YC 4ZP9A 5L1KA 1F9EB 4ES1A 3CCMS 3D1HA 3M30B 3CPWR 1O6XA 2J8AA 3S01A 1JLEA 2DK2A 2DJWA 2HMIB 5DZ7A 1SL2A 5AE2A 3LP2B 3DRRA 2R2TA 3NG8A 2IRXA 3CIMA 3JB9k 2ZEJA 1TL3A 4JI0J 2AJ4A 3NMAA 4X4VA 2LU2A 3W9IA 3IR6B 3A8JA 3QLHB 2UV8G 3DYAB 2HHWA 4YHHJ 3EJMA 3MMBA 5DJBA 5DS7A 3PV8A 4TY9A 2KJVA 4BLGA 3ETOA 4JI5J 1TMJA 4ZPAA 1FWPA 1CJKB 5IQQA 5J2PB 4OJ1A 3MEGA 4J9KA 1NSKL 1VJQA 4JUZA 1U49A 4B17A 4I6YA 2DITA 2RKIB 2WONA 3GIMA 4NPOA 1HNZF 3RB0A 1RWNB 1NKCA 2VG5A 2XZDB 1RTHA 3G96A 1N34F 3PJXA 5HMZA 1WKJA 1X7VA 3UR0A 1JIHA 4XDCA 1YX2A 2YX4A 4USUA 5CYQB 4I69A 3K5OA 3CD0A 5LSLA 2OELA 4RNHA 5KOWA 4ZP8A 1U2RA 2ZE2A 3KK1B 4NLDA 2XULA 1CEZA 4NCAA 3PKYA 3UNGC 4PPDA 4MIWA 2KRRA 3TJ9A 1FTRA 4ZJQA 3IWNC 2Y8WA 4LSLA 1JLBB 5CH7B 1UPMB 2IA0A 1S1TB 4DSLA 4OV1A 2BKPA 4Q0BB 2G2ZA 1N0UA 2G9OA 1C4CA 4WIIA 2G4BA 1BWEA 1HL6A 1U6ZA 2AP6A 4IOCQ 4Q8FA 5IWAF 3KMQA 2E1CA 4O0IA 2X1GA 4NZ0A 4Y6IA 3H4DA 1HA1A 2Y1RI 1UMJA 2CNNB 3AFGA 1JLFA 2J76E 3OSNA 2MGZB 1NHUA 2RSQA 4A4JA 4PG8A 3NGKA 4LRDA 3SXLA 1S9GA 3RB3A 4HH0A 1FJEB 4OYWA 1DLOA 5AXKA 2YH0A 1Q7YT 2D9OA 3C6TB 3I9V9 3BKTA 4ZITA 2AJ2A 3OTCA 3D5MA 3FZ2A 3GLJA 1J5OB 4M5MA 3THPA 3EZ5A 1IVZA 2OPRB 1N5SA 4CP5A 1M1HA 5BR8F 3HZEA 2KDOA 4FN5A 3VF0B 4F4KA 1Q79A 4UOFA 2VB6A 1RWWB 2APOA 3CJ5A 4WP9A 1RISA 2JWNA 1W2IA 3GR0A 2WB4A 2BOAA 3T3FA 4DX6A 4HEA9 1VCTA 4CLUA 4RWWA 4DLGA 2P6TA 1N56A 2BJ3A 2IYIA 5MLCV 1OSCA 3OHAA 5C5JA 1NPPA 1TKZB 3P6YC 4GKKJ 3CT9A 4IFVB 2CIMA 1LNQA 1PJ6A 3G4SS 3CCES 3TQ1A 1HBUB 1GMWA 2C2EA 2MY7A 4EBCA 4C97A 4TQRA 5HJYA 4RW7A 3G82A 4MYTA 1RCXB 3EICA 3ZNUA 4DUZF 3ZTSA 1LXNA 4DR2F 1D9AA 2EK6A 2LEBA 1KRPA 5HQLA 1XBWA 5FJ4A 3HVWA 4KR0B 3DRYA 3V6DB 3NNAA 2KZZA 3NGTA 1NSQA 1FVQA 4OX9F 2KU7A 4FYYB 4CLYA 3OXFA 4RW9B 2LXIA 4PCQA 5CYMA 1N48A 1N88A 4AQYF 5D8HB 2R3VA 2CZ9A 3DLKB 1VLYA 3CXCR 5KFPA 1FXRA 3LP0B 3NS6A 2KFNA 2GA7A 2UUCF 1Q8BA 2QYGA 3MF5A 4PUOB 1GMVA 4QIVA 1BC6A 1TAUA 1RP5A 4DV5F 3H4BA 2V50A 4CQ1A 5K8OA 2EFGA 1CQMA 3UCZP 4ZVOB 2LA4A 5KT5A 2HHHF 3D28A 2Y0SD 4M63A 3K5PA 1X5SA 3CVKA 3M2RB 4L75A 4O4GB 2M70A 2V2QA 2QL7B 3LGMA 1HMVA 3QATA 2WOMA 4M1KA 4LQ9A 2HRYA 1JMTA 2HQDA 1KFDA 2OO4A 1RWVB 2JLGA 3NS7B 2XLKA 3DI6A 5JMNA 1Q81T 4E2FB 3CJ3A 3NKYA 2HHUA 1U8SA 2QT7A 2R2UA 4OYAA 3CJKB 3A8EA 5KFAA 2RT3A 2J7KA 3OPKA 2C3UA 1H2TZ 5B0BA 1GXUA 1RAGB 2BJ1A 4ZVHA 3NBPB 1Q5YA 2DIUA 1HIYA 4X66F 1VQMS 3D6HB 2WVCA 2VQFJ 1RABB 1EB0A 1PGZA 3NY0A 2VF3A 1NB2A 4DR4F 3SEOA 2CQDA 1FNMA 1YWXA 3VHQA 3HD2A 1K8AT 4ITSA 5KT6A 2G0CA 5A0YB 2V2ZA 4OYIA 2D7SA 2J9EA 3PVXA 3DU5A 1APSA 1RA7A 5HN0A 5KFXA 2MQQA 3N01A 2XCPA 3BGFA 2H5IB 1K47A 1V9OA 4EI2A 2V0NA 4RBTA 4JI4F 2DR7A 3PW5A 3CSKA 3JAMU 5A76A 2UUWA 2LEAA 4KO0B 1IM4A 1FK9B 4PABA 1N36J 2N3LA 3MM6B 2W9BB 2FHKA 5HBMA 2AKWB 4B9NA 3GONA 3FNNA 3R6GB 5C25B 2DB1A 3I96A 4F7VA 5L38A 1R31A 3ZZTA 2XS2A 8ATCB 4PEOA 5K20B 1C1BB 4K2JA 5JVHQ 2VFRA 4EO6A 1C0TA 3PFEA 3IAS9 1C1CA 4HTIA 2WAQD 2OHDA 3DRPA 3QO9B 5EN1A 3V6HA 1WTBA 1REVA 2LQJA 5IV4A 2GMHA 3W5XA 1TAQA 5KAKA 5HK4A 3HFVA 4DPYA 2Y0BB 4DFKA 2W8LA 2IMWP 4RL1A 3NP5A 4F0KA 1T9XA 2ZH9A 2BQUA 2Y8YA 4DSKA 4NA3A 4ICLB 1RBOB 4DG1A 3JYTB 2OMOA 1IBKF 1BQNA 1QTMA 4OYPA 1Z4UA 5T14A 1EARA 2W9AA 1B0PA 2ZVSA 1UETA 4DQRA 3NNHA 1N4LA 4Y2CA 1VC6A 4B3RF 5KT7A 4RW8A 2BJ8A 3RBZA 3T1AA 2O67A 4OLOA 4C8OA 4A8WA 1PYTA 1WDTA 4FS1A 4KHRA 1XNQF 5ETKA 2QEXS 5ETTA 1PKUA 1SB6A 3FBFA 2MKKA 3TAPA 1CULB 1IKYB 2BABA 1WC1A 4CLZA 2DR6A 4O3NA 4PKDB 2KFZA 4ZA1A 3T9NA 2DKOB 3C6UB 2HHQA 3L7OA 1T9UA 4LR9A 4O3QA 2R42A 3ENQA 4DZ6A 2B4VA 1WF2A 2K1RB 4XIUA 2CDRB 3W7BA 4CTAA 3THVA 4WFYA 3BH7B 2YX1A 3EGNA 5E3RA 4MIAA 3KOAA 4JI7J 5L1IA 1YZ6A 2KTQA 5GMEA 2CJ9A 2PIIA 4KSEB 3P5BP 3PKMA 3C16B 4OYMA 2VD3A 3MEEB 2ZNZA 1XWLA 5F41A 2RQKA 2ZWOA 2AD9A 1FD2A 5B09A 1ZM4A 3FQLA 2PMZD 5LM7E 2GQQA 1H0HB 3ITHA 4U9RA 4DV4J 4ZVRB 2XHWA 1NNDA 1L3TA 4FVCA 4G3IA 1HI8A 2CQ4A 2NPIA 3QWPA 2VU5A 4DFMA 4M5HA 1FRLA 2FIUA 3SDEA 2UU9F 4HHJA 2W8KA 3FC9A 1HHSA 4DI6A 1FWKA 1GXLA 2WVBA 5DG7A 1DURA 2R8KA 4LF9J 2GVDA 3HO1A 1EIYB 1F6TA 1C0UB 1FJGJ 1TUVA 3SBMA 1RT2A 2NLWA 2QMXA 1KP6A 4M94A 2N4DA 2RDIA 4I67A 3HMJG 1B99A 3WC0A 1N8RT 4CO5A 1GH8A 3QIDA 3KUGA 1X4CA 3BYRA 2FHJD 4Q7AA 5A8KA 3CD6S 4X2BA 1NMEB 2FC9A 3GFHA 1IBLF 4DL7A 2HQGA 3HX9A 2KO1A 1H6KX 2KFYA 4XPEA 1CVJA 2ALYB 4FBTA 3O8WA 1XQIA 4LF7F 1FT8A 3H2UB 2VFVA 4KTQA 1AT1B 3UDLA 3OR2A 1DY3A 3FCHA 5G0RA 3M2UB 2B0GA 1S76D 1Y10A 4MK8A 4I64A 3DLJA 4TN2A 2CVEA 4QOTA 2UUBF 4QWAA 1NZAA 4FYDA 4PQUA 1F5AA 4WFZA 3M2RA 1S10A 2RU9A 4DCJB 4UF4A 4QWDA 1RAFB 2XI3A 3R2CJ 3K2YA 3FMBA 4ED1A 2FZGB 4ZPVR 5ETPA 3PYEA 1R6VA 3PEHA 2ROPA 3FGVA 4PXEA 3MR6A 4CT9A 3SFUA 2J9CA 4KGXB 4NOHA 3UNYA 4A8MP 3FSYA 3QGHA 4U95A 3MFHA 3HM9A 1NAQA 3V6JA 3CULA 5GAGU 4DCPB 2ZBRA 2HVZA 3W3SA 4KHMA 2I2YA 3MM7B 3L7UA 2EBGA 3R5BA 2L41A 3ZZOA 1M1KT 1HNIB 4LFBF 3BO3A 3E2EA 1N5TA 1X4FA 2W2MP 3CD5A 1TK0A 3H42A 4C0OC 3CO0P 1JLAA 2HFNA 3GSIA 3T6JA 2QFIA 2LFVA 2DPIA 1LXJA 1VQ9S 3IO1A 2RF2B 4NA2A 3BDPA 4MH8A 2BE9B 5JXSA 1O5JA 3ISND 1OJ4A 1JXLA 1S6UA 4KHPF 4Q43A 4OHVA 3LW5C 3E01B 3DXBA 1WJ9A 3IM8A 3C15B 4F4YA 3BGUA 4TKTA 4EU0A 3W2WB 4MK7A 3IA0A 2R7TA 3UVJB 2E5LJ 3FZBA 2B9YA 5EGYA 3FQKA 3MAAA 3OVBA 4HHHA 4HACB 4OJ3A 1U0HB 4P7VA 4L72B 3UD3P 1TUWA 4WP8A 4DV0J 1RAIB 3KG1A 4WFNQ 4B9MA 4NMLA 3W60A 4ATNA 3CDEA 3MM6A 4QYRA 1KDNA 4WCEQ 2I5JB 1WG4A 3EVMA 2VODA 4ER8A 1VIOA 2OP5A 3H2LA 2VICA 3TJAA 3CO9A 2XNRA 4RWXA 2VJVA 2UUAJ 3CCVS 2J6SA 1WHXA 2GMLA 1IKWA 3NWRA 4R0EA 4DV3F 2OPSB 3PX4A 2HK3A 2AIRB 3N79A 1UW9A 4R5PA 2J7UA 3D3BJ 2YPZA 4BC7A 3L09A 4NEZA 1O8BA 2Y1LB 5SZTA 4J9PA 3MEKA 1EX8A 3BF4A 2Y1JA 3O5TB 1LOUA 3K59A 4JI8F 1YRUA 1Y11A 2AX0A 2C2RA 3BSCA 3FEYB 2FY8A 1A7GE 1VQLS 4WWSA 2P5VA 3PCOB 3OR1A 4UY8T 2B7BB 4DL6A 2C2ZB 4DS5A 3TX0A 2F4VF 4DUZJ 1QTNB 4QPTA 1XEZA 2R2RA 1S1XB 2ZBCA 4N7TA 3NL0A 3D0IE 4RNOA 3BBCA 3IBWA 3BBBA 3SZ2A 2H65B 5T7LA 4N41A 3MWBA 5IT0A 1Y3KA 2E7XA 5HLFB 2CQ1A 4KQZA 1OPIA 1VQ4S 2HVIA 2UXCF 1CS4B 3R5CA 4CO2A 3DRSB 4OX9J 3B78A 1U1MA 5KFFA 2AEFA 2K7KA 1VRTB 2JFKA 4YR0A 4AQYJ 1TKXA 1D09B 2VOPA 2OTJS 3MCOA 1LWFB 3CC4S 2DTJA 2FJAB 3VCDA 4LF8J 3VWSA 2DGOA 1L5UA 3KLEB 5FDLA 3CF5Q 4DV5J 4A8SA 5KFIA 3N5FA 4KGZB 3ILOA 3Q8QB 2J6TA 2MKCA 1XJWB 4ECZA 3CJSA 3MUTP 4Y2KA 3RW7A 3DOKB 3KHRA 1QUPA 4LVNP 2FJVA 1AUDA 3KK2B 3QQCD 3O2IA 3KDOA 2VKZG 1RTIA 1T05A 4HLBA 3DLGB 4RW4B 1SIZA 4DUYJ 5AXLA 5C42A 2NXJA 4ED8A 4IOAQ 1LWEA 5BXIA 4ILLA 2KKHA 4YDDB 2EFNA 4NWBA 3R1LA 3NNCA 5F9NA 2ILYA 2AQ4A 1HQEB 2CG4A 5K5MA 1YK9A 2OD4A 1Q4RA 4YB5A 4DR7J 2WSFC 3GIKA 4FYWB 4ED2A 1PO6A 1VQPS 4USHA 4AUKA 1VFJA 4CT8A 1B0VA 4USWA 1MMNA 2HNZA 5EX0A 2PE8A 2VIHA 3W5ZA 4C98A 2HEKA 2RNEA 2HWHA 2ZKUA 3I82A 2A3JA 1K44A 4N8NA 3ZZYA 2HGLA 4Q45A 4DR4J 3IC1A 2GHVC 2HWTA 3L7PA 3M6XA 1DQ8A 4DQSA 4B9VA 1UVIA 2NUHA 3OSPA 5ADZA 2BKNA 1RHUB 2NZCA 3M1VB 5A6PA 5E5NA 1M5PC 4P2SA 3BBFA 2ZVIA 3QGGA 4DFPA 2B9EA 3I32A 1QD1A 2OGUA 2ALZA 3TA1A 2HLTA 2QYCA 2RIJA 4TY8B 2DHAA 4NRTA 4CLTA 3Q8VA 4KKOB 4ED5A 2CG8A 3UCUP 4E98A 4LF6F 2IAJA 4B3OB 1FEHA 5K14B 4C7QA 2QLFB 4DX5A 2YKAA 1N52B 3KJNB 3KLGA 3FRYA 2FVPA 4CRJA 3TZYA 1RE1B 1L3VA 1VK8A 1SQFA 1R0AA 4P52A 4ZJOA 3MCSA 1NCLA 2M8DB 1SC3B 4ED0A 2GGPB 2DNZA 2JJ4D 4USIA 5J1EB 5D4LA 2Z2LA 3N28A 3M6WA 2XQCA 5DDQC 2VBZA 1P9QC 2CJBA 4DV7J 2VDHA 5A8RA 2F8MA 4C48A 4NLRA 2R7WA 1FKAF 4X65J 2UVWA 3NLCA 4X4SA 1IR1A 3RBEA 3OUYA 2IY5B 2MQ8A 4HR2A 3QSIA 2RJZA 3PIOQ 4QQBA 2AYBA 2W25A 3T1HJ 1VHIA 1VQ5S 2HAFA 3GYXB 4F0MA 2YKNA 4PZVA 1RAHB 3KNGA 1RAEB 4BHQA 1UCNA 4KY3A 3PM9A 4LR8A 3BSAA 3OVAA 4JYAF 2F9DA 3KYLA 2CQGA 1CC8A 4N47A 2E1MC 3EWGA 5HROA 4FZVA 3OTBA 3H98A 1TELA 1TL7B 3R5JB 2F8HA 4F02A 4LF5J 3TX8A 4DU7A 3BN7A 4DR5J 4LBIA 4WKYA 1VISA 3JQJA 4OIXA 1Q82T 1KHWA 3ETMA 2C22A 3H40A 1Q8KA 1RWUA 5IM0B 2F5GA 2ZM6F 3SQGA 1HQUB 1UA1A 3VGVA 1RTDA 1Q86T 4OYOA 2JZ5A 4HYKA 1LK7A 1K0TA 3KLFB 3A3NB 2QE5A 5B0AA 4NX9A 4JB8B 3OJSA 2QTWA 3MPUB 1N32J 2BEFA 3AD7C 1WF1A 1PSDA 3NRBA 4WF9Q 4C8ZA 2I0XA 3H25A 1TKDA 4OQJA 2DNPA 1MLAA 5KG7A 4NCGB 3TR5A 2ZC4A 3VAFA 5C7PA 2RQMA 9ATCB 4IRKA 2YXLA 2W01A 3DXSX 5KFGA 4YEAA 4ZN3A 2UVUA 1FJ7A 3QYYA 2KYZA 1FKPB 2P9GA 4AL5A 1HQ2A 2RUGA 1GT8A 2MZRA 2IVMA 1LKZA 3PR4A 5CD4H 2I8EA 1WC3A 1CG2A 3G8QA 3M2VB 2MZJA 4DXLA 3KTQA 1S48A 3SV4A 1G6BA 5KTQA 4LF4J 4ERDA 1TKTB 2VUGA 1F2GA 1VI7A 2AF6A 3LP1A 2D3O1 1VRUA 2G0IA 1Y0HA 4XPCA 4PG4A 3M8YA 3FRZA 3RAXA 3PRDA 2ASYA 4IR1A 2W2OP 3BPDA 1D8ZA 5KG3A 4DR3F 4UT4A 4OV6A 3RRHA 1M5OC 2HHVA 2HBYB 4GVBA 5D4NA 3MR2A 4C3MA 4LBPA 2AW0A 3J80Y 2RE1A 3T9ZA 5KFEA 3TANA 3RB4A 3GU0A 4RW6B 3DRXA 1DTTB 1CJVA 2ILZA 3J81U 1RLCL 1M90T 3KKFA 3WDOA 5FLXY 1DFDA 3DOLB 2IJFA 5I3UA 1J5EJ 1VOMA 2NS1B 1TUGB 1CBKA 2UUBJ 4LRFA 3TJ8A 4UQTA 3IS9A 3G86A 3THTA 3TP2A 2RU3A 4MIBA 1WG5A 4LIWA 2LCWA 2N3OA 2H5JB 2FJDB 2LLZA 3W9JA 2JSXA 4U67Q 3VAGA 1S1VB 2YNGB 1XR7A 4RW4A 1RT6B 3PFOA 1QAXA 3RBXA 2QO3A 2PMWA 1OY8A 4RPFA 4U8VA 2A18A 1RT5B 4H4OA 4EYHB 4XAKA 3G8SA 5D3GA 4M5GA 3OXLA 1OY9A 2N4CA 5KOXA 1HYSB 3K58A 3LGNA 4MMOA 1WKLA 4I1TA 1YJTA 1S6QB 2HFOA 5CCMA 2DGWA 2OI2A 2KG1A 2VQEF 1WKKA 4OHXA 1D9DA 1U25A 1JX4A 3NOGA 2CWKA 1Y4ZB 4K4VA 4B9LA 3N6LA 5LJ5Y 2XWXA 5ETMA 2W2PP 3ICLA 2FZCB 4ZPBA 2VPYB 2IFXA 4X64J 1ZPWX 1HBMA 3PX0A 2CPYA 1YJ7A 2J0SD 4U6PA 2KVQE 4E0DA 3M8QA 4QW8A 3SYZA 4QCLA 2YBVA 4DV2F 2XY7A 4F25A 2NXNA 4J7CA 5L1LA 1UVMA 1TTHB 2AU0A 1KVIA 3ILIA 4MK9A 3AA9A 5F8MA 2A2DA 4B3MJ 4M5KA 1QAYA 2CQ2A 2WSCC 1FRJA 1ZZNA 5L8RC 2BM1A 4C0HA 2XYPB 2DRAA 3M8PB 3CWJA 2XMTA 1MWZA 3DNCA 3EDQB 4NLUA 1ZM2A 2Z2ZA 4B9UA 1T03A 1EQ0A 3W2VB 2VG6B 5BJRA 1LW2A 2KRBA 3HHLD 5A8WA 4KAIA 2VASA 3MZIA 2PA8D 2BM0A 1T9VA 5K9FA 3D9BA 1MROB 3VZIA 1W7WA 4ZHRB 4C8YA 4J9QA 4X4RA 1ZA2B 3TUPA 2RS8A 4YY3F 1RQ0A 1BMQB 4RO0A 2VFSA 3A1YG 2V68A 4MKYA 5HQMA 1SL1A 4P2MA 1AUSL 3POTA 1Q16B 4QR1A 2ZJQQ 2XSFA 2H3EB 1EP4A 4WE1A 3G2XA 1XMQF 2F4VJ 3L95X 4ZLNA 4FYVB 2ASLA 5J1PA 3GV8B 1JLGA 2H48B 4NASA 1AZSB 3CUNA 3R6LB 3HVTB 3LGHA 3I0RB 4U7UD 2DCUB 1S1WA 1FFGB 3IRXA 2LU1A 1ZTTA 2QX0A 4OZ0A 2HGNA 4G6VB 3D0GE 2VONA 1DARA 1RT7B 2UXCJ 4LJMA 3PO4A 2K7JA 2I38A 3QSYB 2ZH8A 3BO2A 2XO6A 1FE0A 2OPQB 4BBYA 1IKXB 4G1IA 3HSZA 1ZM3A 4NI2B 1HR0J 4X4PA 3G87A 4FDFA 3H5XA 3LWLA 4I2PB 4P72A 2FGCA 4ZP7A 4OHWA 4ZP6A 1KOOA 2DISA 2ZJPQ 2VL1A 2NYHA 3VGSA 1ACMB 5KFRA 3MECB 3KLFA 2XSJA 3GFYA 3RB6A 4K4XA 2C2MB 1KSPA 2F3JA 4IRCA 5LMNF 4U96A 2L9NA 4Z2XA 3UWTA 4OZ3A 1KHVA 4ANDA 2NXEA 3IWXA 1LWCB 1RHKB 1EQMA 3A8KA 5C24A 1S1UA 2CNLB 1MU2A 2MQNA 1SQEA 1UAWA 4ZK7M 2V8PA 2Y1IA 2MMYA 5ETSA 2KT2A 1ZA1B 1X4EA 2W9CB 3NGUA 3H8YA 3M4XA 1JLEB 2OFHX 5F9LA 1Z2ZA 5KG0A 3PTWA 4K5SA 2V63A 3DRRB 1SV5A 1O51A 4B9SA 4QBUA 1TL3B 3J7YU 1VQ8S 1UEUA 2ABYA 2BJ9A 4CZCA 3MMBB 4DJBA 1ZH5A 2VG7A 2WK4A 4P71A 1NSPA 1IBMJ 2CUYA 5KFYA 2IM1A 1A9NB 3MHYA 2FGOA 3TEHB 4X62J 3UDVA 2FVRA 1TFWA 3CMES 1XN9A 1B7YB 5KFOA 2GCFA 2V67A 4Z7YA 4ECRA 2E7WA 4URQU 3GCXP 5IV3A 2B9XA 4DR6J 3KMSA 5GAEI 2WONB 2ZD1A 2VBYA 3R3TA 4X4UA 4ZN1A 3MUMP 2RAQA 1U02A 1XNRF 4Q44A 1MN7A 2VG5B 2V4JA 2YKPA 4IR9A 4Q2LA 5ETQA 1RTHB 1CLFA 1IKVA 4ZLPA 3N9UC 2EG2A 3EVOA 4BDPA 1X5TA 3IG1A 1WC0A 2LVWA 5E41A 3HHLC 4GKJF 4BWMA 4DFJA 3MAHA 4WYLA 3PACA 3TO8A 3WIUA 3KLVA 1RDRA 4USMA 4DV1F 3BZQA 3HI9A 5ETRA 1BXNA 2W4PA 3VAJA 5F8IA 2ZE2B 2H54B 4LF6J 4QU7A 3DOLA 5HQ8A 2QIFA 3DM2A 2C2OB 3PRBA 4LMZA 2FJWA 4ECVA 5D77A 4YOEA 1GMWD 1YTYA 4LSLB 1VQKS 3RAQA 4KIAA 4OI2A 4RBUA 3EZUA 2XZWA 3OJUA 2DO0A 1P1LA 4K50A 2VBXA 2YKOA 2PEBA 4I4BA 2BX6A 3AY0A 4Y3CA 2YNGA 2XC9A 2HYIB 1RT6A 4OZNA 3PW4A 2KN4A 2MDAA 3S8SA 4EYIB 2OFGX 5CD4A 1KFSA 3ZZZA 5DRKA 4FNIA 1FTCA 2MHNA 1ZPVA 4NXMJ 1H72C 3VVUA 3K8VA 2ZZMA 1JLFB 1MMLA 1XR6A 2R8JA 1RJJA 2F9JA 2DRBA 3F0NA 4OHZA 1S9GB 2AYEA 3LPYA 1ZOTA 1U09A 3MTJA 4C4WA 3US5A 5CCLA 2YNHA 1JXVA 4NYPA 3JSMA 4V19J 3GYNA 2R8HA 1H74A 3W8PA 1U1KA 1WC6A 2CAJA 2MJUA 4DZDA 1FERA 4ZKAA 4JYAJ 3UPFA 2WZ1A 2G0JA 2EC2A 1L3KA 2DHXA 2ADBA 3DDKA 2HQCA 2Q6BA 4FYXB 4DF4A 2ZH7A 1HNWF 3BSOA 2AZ3A 4P74A 2WVDA 1U7LA 2B43A 1UJ6A 4NLWA 1U1LA 3VV2B 2B8PA 2FLNA 2W24A 2V34A 4MKVA 3TUZC 1RT1A 5DDPC 3J80U 1D9FA 1SUQA 2GJIA 4K4TA 1ZYQA 5EWEA 1RWOB 3T5JA 4F67A 3KK3A 2I6WA 1HWLA 2ZHAA 1LEOA 1MWYA 4DPTA 4JV2A 4F50A 5J2NA 1RYRA 4RW7B 3G82B 4P2XA 3V2UC 4NLTA 5GAHI 5LJ3Y 4LSZB 1JJ2R 4DPUA 3QNWB 1HLWA 1SVDA 8AT1B 4I6WA 3NCRA 2IA6A 3HP6A 2RH3A 3G6XA 4EEYA 4GRSA 2BRKA 2VH7A 1YHQS 3OFEA 3JSYA 1R6YA 3D1OA 1NK6A 2GNKA 3EPIA 5CYMB 1RU1A 3GCWP 1NHVA 5M2UA 2DNHA 4EFAC 3PG9A 3BH6B 4AXIA 4ZCMA 1UPPA 2PDAA 3JAMY 4EWTA 4PG5A 5LL6d 1VQNS 1SKSA 3B54A 4B3SF 3UI3A 1RWPB 4ECYA 5AE3A 2ERRA 2VJUA 2B7CB 4MKBA 1B4SA 4DL4A 1AZSA 4RJVA 1SIWB 2YQ0A 1XMOF 1U6BA 2HS4A 4ED4A 1WNEA 2HAIA 2ZITA 3LAMA 3Q0AA 2B51A 4F4ZA 4K7QA 1U8WA 4DR1J 2FHJA 1L3SA 1HBOA 2R7UA 2YNFA 4YB6A 3BR9A 2ZUAA 3OFHA 3MM9A 1HMVB 2WOMB 2ZZTA 3C8YA 5BYRA 4WIQA 4W4MA 3IAM9 3U1MA 3DI6B 3VR1A 2KL8A 2KT3A 1HWUA 4NEYA 3CDWA 1E6YA 4ID8A 3W64A 3UQSA 1WC5A 3BQ2A 1AXQA 4HT5A 4KRWA 1KLNA 1Y3JA 3GTYX 5CAAA 4PR6A 4YQWA 2XS7A 2IPOB 3LA0A 5D0EA 4HT7A 5I42A 3Q22A 4ECXA 1G2EA 1IR2A 4DSEA 3NEKA 4J9OA 2BZ2A 4NLQA 1IWAA 2XB2D 1BQXA 3CTRA 3FSXA 3OL8A 1HD0A 2DGSA 4PAAA 5M2PA 1FX4A 1KQKA 5DGAA 4JI1J 4KH0B 2BVZA 1QY7A 3EDRB 1BY9A 5H1SV 1ZS6A 5IC6B 5ETVA 4TLQA 3ZTQA 1Z1ZA 2W7PA 2ZBPA 1DZ5A 2HS0A 1RB0A 3C2PA 4HH1A 3KXDA 1CJTA 1XC9A 2JEJA 4QIEA 4ZVSB 2FZKB 3GG1A 1FRHA 2C28A 1XMBA 3PW0A 2DEJA 5DDOC 3QAUA 4CYUA 3OL7A 2CQ3A 5DG9A 1VC0A 2ZBQA 2RRBA 4LRAA 3MEDA 1NK7A 4R8UA 2HZVA 2Z4PA 1D1UA 1S0VA 5AT1B 2DVIA 5HBMB 2LQ5A 2RQCA 2ASDA 2YH1A 2RHQB 2KZMA 3LH2S 2UXBJ 4IRDA 3CCZA 1KTQA 2L9DA 4E8UA 3QBCA 3TNVA 4LFAF 2M9KA 1C0TB 2YNIA 4WFBQ 2QLWA 1C1CB 2B5JA 3DHWC 2M0GB 3BM7A 4ECSA 3DRPB 1S72S 3A13A 2M4MA 2XM3A 1X0FA 4DU8A 1REVB 3R5AA 4DUTA 1RXOB 4AL7A 4CLSA 1K1SA 2YKMA 5KFHA 3G8TA 4JV5J 1OYEA 1FHTA 1QSSA 1U48A 4QWCA 4OX7A 3P96A 2IDEA 4LF2A 4WZQA 3FEZA 1JLCA 4DG1B 7FD1A 1RU2A 2E5JA 1BQNB 3V6KA 4I7FA 4QWBA 2BKOA 1E6VB 3JTPA 1I1GA 2XTJP 3GWCA 2CFXA 2QN6B 2ZOGA 1NKEA 1CC7A 3CB4A 4IQMA 4L3NA 2ZH5A 4CLPA 4RW8B 5I3PA 1V5IB 4C8MA 1RT4A 3CCJS 2I1RA 4CLWA 5D0HA 1XERA 2E29A 3D2WA 1WOSA 1P6TA 2BRLA 2DNLA 1GAOA 3WX8A 5I4MA 2QA1A 2JEGA 4ED6A 1URNA 3CC7S 2FB0A 5E7OB 3V81A 4YY3J 2XMWA 1V5VA 3JTNA 3FBBA 4F3QA 1LFPA 3C3LA 3ET6A 2VFUA 2FDNA 1HBNA 1RBLA 2A0FB 3W8GA 1FXLA 1ROFA 1T3OA 2EVZA 2X1FA 1HI1A 4Q5VA 4DL2A 3QMQA 3KLHA 4YR2A 2DR5A 5KFQA 2HVHA 5DZ6A 1T95A 4YHHF 1LW0A 4NZ6A 4F0HA 4CTAB 1JXEA 5KFMA 1EKSA 5KFDA 1GNKA 1R0BG 2AV5A 3U27A 3M9MB 1H7XA 4K4WA 2PMHA 1WHWA 2DHSA 3K5MA 4FF4A 5LSOA 4K4ZA 4G1QA 2C3OA 2B4OA 4RR5A 4CH0S 3ITHB 3ISZA 3I9ZA 3AH6A 3OTOF 4DEZA 2AJQA 4IG0A 3K8WA 2DGUA 4LQ3A 3UR3C 3PW2A 4IH7A 1U1PA 1YBTA 4J9MA 2HIYA 1AW0A 1A6LA 3SDEB 3SQOP 1IQTA 3Q89A 4ZOSA 2B8QA 2GQ2A 3PRVA 5LMNJ 4QIWD 2GVDB 1FWLA 2Y9HA 2VOOA 1GK8A 2HFZA 3ADAC 6FDRA 7AT1B 3CDUA 3P4UB 1RI7A 1RT2B 4DPXA 4W90B 1YLXA 1SJ3P 3TW0A 3E8OA 2OJ3A 3BO4A 4K2XA 3IRWP 4ZVPB 2IM0A 1HPZA 2CPEA 1J27A 4OI3A 3GJRB 3PYGA 4X4OA 2YQ1A 2LKZA 1HNXJ 5A8KB 5ITHA 4FXWA 1Q8IA 4YUDA 2CDQA 4NRUA 5KFVA 3DGVA 2J9DE 2CKWA 1ZETA 2X51A 1LWXA 1VQ7S 1P27B 1M1GA 2B4UA 1HKAA 1YRXA 3QFHA 4NA1A 2LQ9A 3T1YJ 1TFYA 1VQOS 4Q2MA 1MW7A 1FRKA 3OR2B 1BQMA 3EMTA 3GP9A 2P6SA 5G0RB 2QLJB 3GFXA 5AXNA 1FRXA 4DQQA 1RAJA 3ZNJ1 1IJEB 4YS2A 3HHDA 3K17A 3MOJB 3BB5A 1RTJA 3L9ZA 3AA8A 4PQUB 1FD8A 3V4IA 1TK8A 3NOCA 3AD9C 3PO5A 5B7WA 9RUBA 4ZVFA 2AZ1A 2FC8A 1XNRJ 5HAOA 1ICEB 2OAUA 3GPAA 3F41A 4EZ9A 4NXNJ 3DLEA 3J7ZT 1PAEX 3NGSA 3QT7A 2EI5A 1Q1KA 2OPPA 4H4MA 1U2CA 1NK5A 1RAOA 1WI8A 3PJ9A 2R7SA 1U4BA 4N56A 4GKKF 4B9TA 4XTTA 1OPZA 3KJVA 1KLMA 4JOUA 4ANEA 4DLEA 2DO4A 1NPRA 1EKRA 2DD8S 3RU0A 1JLAB 1YGYA 2DH8A 3DHXA 3NCPA 4ECQA 4ZCKA 2NUUG 2ATCB 3BDEA 2GQCA 2IMOA 2FJBB 1NO8A 2MYFA 2ZH2A 4DPOA 1PC5A 1KC8T 1YIJS 2DH7A 1X9SA 5E3AA 5JJBA 4A46A 2BE7D 2GJ2A 2AHOB 1BGXT 2DHHA 3HHKA 4EBDA 2NCKL 1YDLA 3IM9A 4K4UA 1F0XA 4WPAA 3MAAB 2KT5A 2EG1A 2QL9B 2DGQA 3FDSA 3WX4A 4A8QA 5F8JA 5BYQA 1N5QA 4NLPA 1FESA 2E1PA 1DTQA 2ZJRQ 2IM3A 2L9WA 1M0SA 2E5HA 1ULRA 2X1AA 4P6QA 1V3RA 2YKQA 2WBMA 3RR8A 3BGRA 2EXUA 3I87A 2IIHA 4ED3A 1HNWJ 3HXMA 1AROP 2E1AA 2HNDA 1KQSR 1IKWB 2EBEA 4MKAA 2LDYA 2HRTA 3MPVA 5HJXA 2AX1A 4R5PB 2J0WA 2K3KA 5J2QA 4RBVA 3VQSA 1S49A 2LQ8A 3T19A 3ZZ0A 4ZLLA 4OI6A 3QRRA 4K4SA 3DGPA 3H2VE 2ZHBA 2LQBA 4A8YA 5D4OA 1TV6A 4C2MA 3B82A 3CMQA 2E1RA 1EETA 3HJFA 4L76A 1E6VA 2J0XA 4OZ2A 4IG3A 4CNYA 2X1BA 1QLNA 5IT9U 1MMDA 3WQPA 3MCMA 1T9WA 3OR1B 3HHEA 1AFJA 3NAIA 3FBEA 2GHWA 5F8NA 1S6PA 3ONQA 1VGYA 3MGJA 3ULHA 1GX5A 4NE9C 2DGVA 4TYAA 1DQAA 4CLFA 3CW2C 3UDCA 5T7LB 1Z2LA 5THWA 4DN0A 3J7AN 5SUHA 3DDNA 2VQFF 1RK8A 2DCLA 3MD1A 4IDKA 4Y2IA 2BE2A 6AT1B 2C42A 2Z2YB 3M8ZA 2OSRA 5GAEU 3OFFA 1H2UX 3IBCB 3SSQA 1TKXB 1R8AA 2V9KA 1R8HA 2DR9A 3B4DA 3PY8A 3N5BA 3RYLA 3KWMA 3MM8A 2QMWA 2NR0A 3KG0A 3AB4B 1FVSA 1RWMB 5FDLB 2O01C 2QSFA 4YP3A 1N33F 4WU3A 1N36F 3GR1A 1UEKA 2Z30B 2Q66A 3EPGA 3PHEA 2DR8A 1PG5B 1H7WA 4NLVA 4RKUC 2IVFB 1F60B 1RTIB 2BR0A 4ZDNA 1T05B 4ILMA 2R7XA 2VA3A 2XLJA 1H38A 5C42B 5HVGA 1X4GA 3TEGA 1GTEA 3Q86A 2OLWA 1LWEB 2UVRA 4ENOA 4WXOA 1CJUB 2AWZA 3UN3A 3VZHA 3GJTB 2Z56B 2DNRA 2YX7A 1UEVA 4WFXA 2B6AA 2CQCA 4Y00A 2MKSA 2KVIA 1HNVB 2R8GA 4Y28C 2DGXA 4QZVB 1NRKA 2HNZB 2YWGA 3K7RA 5LT5A 1PJ7A 3AODA 5KG1A 4OYXA 5CXTA 1F5CA 4OX6A 5FIIA 3GMGA 5IT4A 1FFSB 4TU7A 4UUXA 3UFCX 3JQMA 4J9SA 3VTIA 4UTGA 1LFWA 4C11A 3GE9A 3G71S 1TL1A 2CJXB 2JLEA 1V6HA 2GAHC 5GAGI 1U0SA 1JB0C 2DXDA 2GC8A 2GIQA 4XO0A 4ELUA 1URRA 3VAMA 2DNNA 3ZTPA 4K4YA 3MUVP 1R8CA 3M32A 3QGIA 2FHOB 2DBBA 2IAJB 3MPDA 4EUVA 1KNZA 1Q0NA 1QE1A 3KLGB 4ID5A 5IZHA 1DHMA 1NDCA 1R0AB 2X3GA 3C19A 2EFOA 3R7NB 3ZZPA 3M9OB 2U2FA 2CVIA 1HNZJ 4O3SA 2VFTA 3HSGA 4JI7F 4JV0A 3TVZA 2CPHA 2BANA 3QIPB 4LFAJ 1N34J 4ZIVA 1QJHA 1RT3A 2X3DA 3FFIA 2VC0A 3IBFB 5LMUF 1B70B 2DNGA 5A8RB 3WZ0A 3PYFA 3OL6A 2J5AA 4RNNA 1YVFA 4DV4F 4Q8EA 4NLXA 3VQTA 2UUTA 2MSTA 3OXGA 5L1JA 1P8GA 3OUYB 2Z57B 2WSEC 3CJTA 3L3CA 2DEIA 2QG9B 1OIAA 3JTOA 3RR7A 1OMSA 1N5VA 2YKNB 2V8VA 4Z7CA 2ATLA 3VGUA 2FLPA 2RDJA 2NXCA 2XEXA 3HHLA 4LF9F 3HKZD 2CQBA 1HWKA 1FJGF 2QA4G 1ZTWA 3I0SA 5HROB 3W61A 2DNOA 2ACMA 4MYUA 4KYZA 2D74B 5IWAJ 1FRIA 1VS3A 2CA9A 3EVWA 3OVSA 5DM6Q 1HI0P 3A3OB 4UOGA 5KFWA 2ZFHA 2OUGA 4OI1A 3RG6A 3PZPA 2C3PA 4KT0C 2J0QD 1WDDA 3HD1A 1UVLA 1RWKB 5KFBA 1TZ0A 3WBZA 2EC0A 3MR7A 1Q78A 4CIOA 3J81Y 1GXTA 4I2QA 1IQZA 1S9EA 2HVDA 3SQGB 4PG6A 5KT4A 2HNYA 1RTDB 2DY1A 4QU6A 2RMLA 2O3DA 5J2MA 5BR8J 3ZFVA 4DSIA 2WCXA 3NS5A 2MLYA 3KUEA 4YMEA 2GMJA 3GIIA 1VQSA 4GVLA 4RUAA 3KJQB 2DRDA 2CZ4A 4LIRA 3C14A 4V19X 2BW2A 4WK1A 5DLFA 2KB2A 4AFFA 2UVVA 3T5KA 5E3PA 4J90A 1F5BA 4B3TF 5IXUA 4WTOB 5IS2A 3OTOJ 3N6MA 2HHXA 4IO9Q 3ZO7A 1JLQA 2G1HA 3FEXB 4HDGA 2CXEA 3KHHA 4IFYA 2RRNA 3HVAA 3H0PA 5IQ6A 1UTAA 1PBAA 4ZPCA 4MAKA 4LFCF 3UW1A 5B0DA 2D69A 4LSNA 5HO4A 4UW2A 3UD5A 2VV5A 1S77D 3D6MB 3LP1B 3A12A 3NWGA 2GIRA 1VRUB 4O23A 1UA0A 2ZUGA 4DR2J 1RHMB 4YB7A 3UCGA 3BYPA 1KS2A 3DCAA 2GZOA 4WYWA 3TA0A 3TAMA 4ANCA 3PDNA 2V69A 2CQPA 5E33A 4DX8H 4BWJA 2B4PA 4HHUA 3HT0A 4D3HA 3SV3A 3AOCA 4GVBB 3PJWA 1NJYA 3GJSB 1HWIA 3CCTA 4KPYA 2HFVA 4EMDA 2HW3A 1N5YA 2KHCA 4HDHA 1UFKA 1QAJA 3I5AA 3MMCA 1FXDA 2FJEB 1F2HA 3I4PA 2GHPA 4USVA 2E5LF 1CJVB 4M5DA 2UUCJ 5IOLA 2LA6A 2GVZA 3R7SB 1SH2A 3S7RA 5KFUA 3DOMA 1FKOA 1U1OA 2CPZA 2PN6A 3FBCA 1AB8A 1HWJA 4KGVB 5AE1A 4DV0F 5I3UB 1Q53A 2J6UA 3SMZA 4M8LA 1PAUB 1KQFB 4CM2A 1FJCA 2HHHJ 3IS9B 5B0EA 4PPZA 1KOHA 2AGPA 2BUNA 2JLFA 3K5NA 1VQYA 3DC2A 2H51B 1W25A 3MURP 4H4KA 3OV7A 3D6TB 2UUAF 4CO3A 2RQ4A 2PEHA 2PSZA 1SJQA 2N7CA 2MHEA 3HT3A 2K06A 4MFBA 3VALA 4XK8C 1JNRB 4H4OB 1IXKA 1CJUA 2E5GA 3ZZUA 4MJKA 1UFWA 5D3GB 2MTLA 2H4WB 1VC5A 1R3NA 3U1LA 1VK3A 5M2RA 2W4DA 3K89A 1H98A 1UW4A 4K8RA 3AHPA 5L46A 4UUWA 1HNVA 2VHGA 4WXWA 4J5OA 4X66J 3HJVA 2EK1A 3ENVA 4N5SA 3KLIA 2CADA 1S59A 5LSRA 4PXDA 3FK4A 4HKQA 2E9TA 1OSDA 4CH1A 2AGOA 1KR4A 3MPYA 3TVKA 1SH0A 1HBMB 1JKHA 4UOCA 1D3WA 4L74A 1JK9B 4RNFA 2CPFA 2PT0A 4JV1A 3M8QB 2QRRA 3D67A 5BYSA 1UFLA 5E2QA 2P2CB 3TAQA 3P49B 4A8OA 3ZZRA 4PWDA 4WFAQ 4KV8A 1U47A 4JI4J 2E7VA 1O0PA 2M8HA 4USJC 4TU9A 4UY85 2MPUA 4YB1P 3U02A 2AJ1A 2V8HA 5L9NA 1KVJA 2LXUA 4LUBA 4Y2MA 4ELTA 1FNXH 1T03B 2L3MA 4LF8F 3F56A 1UZDA 1I94F 2JX2A 3G6VA 1LW2B 5A8WB 4U7UK 8RUCA 3C66A 3QIPA 3EX7B 5HP1A 2FVSA 4KFBA 2SXLA 4BC9A 4Y0FA 3R2DJ 1WHVA 2KYXA 4ZPWR 4K0KF 4RUHA 4ZVEA 4ES3A 4ZVQB 1I5OB 3O6QA 4RUCA 5CHCB 3CMAS 3TUIC 4WZMA 4O3RA 5HATA 4TVAB 2K3IA 5AJ3F 4DUYF 3QJPA 3DMJA 3O44A 4IOBA 1YZ7A 5D6GA 3TI0A 4O3PA 1IBKJ 4WBFA 1LK5A 4CI0B 4X4QA 1F3VA 2LEPA 1NPKA 3POTB 1GTHA 3MCNA 1NJXA 1X5PA 1B3TA 1EP4B 3QWUA 4WE1B 4DR7F 4B3RJ 1S0MA 4P2FA 4HVZA 1JLGB 1S7IA 2H5EA 3PEJA 4AL6A 3MDFA 2HFSA 3MR5A 1S1WB 1XNQJ 3IRXB 2IC3A 1WC4A 3SIPB 5H9EK 4M5NA 3CJQA 3M30A 2ZC3A 5JUMA 5U47A 4DL0C 5D15A 5B0CA 1VJWA 2HMIA 3FSIA 2Y3YA 2ZBIA 3LP2A 1VRQC 1N54B 1WWHA 1UVNA 3Q2TC 3W62A 1U6FA 3IMQJ 3M8WA 2BQ3A 3QLHA 3DFEA 5H9FJ 1GEHA 1Q8LA 3P3DA 3DYAA 4O4RA 3ENWA 3TA2A 2XSJB 3Q83A 4FKXA 1HFEL 4NYZA 4URSA 1CJKA 2C2NA 1NEEA 5J2PA 2HIQA 2Q1LA 1N33J 2NSBA 3D6FB 4J91A 4QIGA 1SJRA 4FS2A 2FTRA 5K8PA 1MWQA 5C24B 1S1UB 4DHVA 2XZTB 1MU2B 1FDBA 2GAGC 2RKIA 1SKUB 4QYZK 4ZPTR 1R8BA 3AJDA 3KDNA 2MQLA 1FRMA 1VLOA 4YDXA 3MMAB 2CNOB 5A6WA 3KNAA 3OLBA 1AYEA 1DAXA 4NZ7A 3CDBA 5CYQA 1SV5B 3RAMA 3A8IA 2HPUA 4KH1B 4DV7F 4HL9A 2W2QP 5DGBA 1FNOA 2UU9J 2NZ4A 2FHMA 4KGMA 4X65F 1JQGA 2AT1B 3KJFB 2CQ0A 4OI4A 4CM0A 2HKEA 3KK1A 1S4EA 4RLEA 4PRFA 3JSRA 2XMKA 3SSRA 1SC4B 1FEEA 2VG7B 1JLBA 3T1HF 3EXYA 5HMXA 1ITPA 3EUNA 3N4WA 3MFIA 3DKDA 1TMMA 1S1TA 3QRQA 1Y9OA 3BKUA 4JI6F 4IKAA 4Q0BA 1QVFR 3IFEA 3QFWA 1RAAB 2ZD1B 4A48A 2C3YA 4CO4A 5D0RA 1T94A 2XO7A 1T7PA 1S57A 1IBLJ 4IH5A 2V4JB 3Q24A 1QSYA 1IKVB 2HGMA 1FI4A 4LR7A 1BUXA 4FPRA 4CO0A 3ILJA 3IG1B 2C2KB 4O0NA 4AXJA 5F0WA 2Z0GA 4LF5F 5A2QY 2BJEA 2DY9A 2RDDA 2MGZA 4DR5F 4LF7J 4Y34A 3GQCA 2CZVC 2VBWA 7FDRA 3RW6A 2XY5A 2L48A 4FKYA 3H90A 5GADI 4A8XA 4USKA 3HLUA 2OEJA 2WBRA 2F1FA 3C6TA 3DM2B 5EWFA 2OMLA 3LAKA 5E3QA 2D1CA 1X9WA 2YPYA 2XYHB 1J5OA 4HI2A 1WG1A 2O5DA 1SH3A 4LREA 3BJYA 2OPRA 5CABA 1T9TA 1NM2A 1UWBB 2W2NP 1N32F 3CIZA 4J9NA 3PIPQ 5ETNA 1YBAA 1WD6A 1SXLA 4K5RA 1B64A 4K59A 5L39A 3EXCX 1U1RA 5LMUJ 3G6YA 1I6JA 3H20A 2W4CA 2ZWPA 5JVGQ 3CNQP 4C8LA 3MXHP 4LF1A 4WU2A 1OO0B 4L73A 2EWHA 2C3MA 1H2VZ 2BA9A 3UO0A 3J81j 1TKZA 2CPDA 3BPSP 2HVEA 2JVOA 3WIVA 2AYMA 4IFVA 5HMYA 3AJ2A 2JDJA 2HQ3A 1U2FA 2YNHB 4PG7A 3SI8A 2R7QA 2BACA 4LFBJ 3JSMB 1HBUA 5E3CA 3HVRA 1OS5A 1Q7LB 3M8SA 1S6OA 1EZZB 4ELVA 1KEKA 3BGLA 1NHKL 4NLSA 4LF4F 4C8NA 3D0HE 3IGVA 1RYSA 1U1QA 1RHQB 4OJGA 1PYSB 3JQKA 3I5BA 5KFNA 4O44B 3KHGA 2NPFA 4DBQA 3S1TA 3L4BC 3RRGA 4KHPJ 1S0OA 4OHYA 3CCLS 3RJMB 3V6DA 4QW9A 2HG4A 1XK8A 3AD8C 1KKHA 2P9EA 3N6NA 3I56S 1WOPA 1EHWA 3UD4P 3NMRA 2KJWA 2FLLA 2MQPA 1QDUB 4RW9A 1RT1B 4CCHA 1ZAXA 3OLAA 1X4HA 3DLKA 1SUQB 1W2BR 3KK3B 3TRGA 3LP0A 4QR2A 1HHQA 3CEDA 1RSCA 4AE5A 2HBZB 2V5HG 3GYGA 5J2NB 1WEXA 2AJFE 1KWMA 3D66A 2IYGA 1WSVA 4PUOA 3EE3A 1RWXB 4ZMMA 1ZZFA 3P45B 3B8HA 4DSFA 1J5EF 5KFSA 1M5VC 5J1NA 3R5DA 2A1BA 4DV3J 5DQHA 3TOQA 3PX6A 1UJ4A 1W26A 2AEJA 4UOHA 3U1NA 4O4GA 4B3TJ 3I55S 1NK0A 2GX8A 1X60A 2FPHX 1FE4A 3HZGA 4ZVTB 2ZDOA 3K57A 3OT9A 2QGFB 4FP9A 2AYGA 1S7HA 1L3UA 3GG0A 3FJ2A 4JI8J 2BMBA 1R8PA 4FNHA 4LFCJ 2KI2A 3HFZB 4FBUA 1WORA 4OMFG 3CJKA 2ZDPA 3VAHA 1JJCB 3OL9A 1RADB 2XMUA 2JVRA 2M3DA 1PC4A 1YI2S 3NBPA 1BD6A 3F73A 2WHOA 3H5UA 1IBCB 3BN4A 2DHGA 1A0OB 4MT1A 3G6ES 1NH7A 2Z58B 3TZWA 1U45A 4M95A 2HBQB 1SKWA 4X64F 1OQ3A 1RKJA 2DGTA 3PHTA 3SCJE 1WUUA 1HBOB 3Q2SC 2YNFB 3ENAA 3HKWA 5A0YA 3IN5A 3TVYA 3MM9B 1KBRA 3UN5A 3J7YI 2XG8A 2OSQA 2XMAA 5DDRC 3AAWB 5HI7A 1G7CB 5F8LA 5B0FA 4TU8A 3D54A 1RHJB 1E6YB 3W66A 1NJZA 3A4TA 4B3MF 4QIFA 1G1XA 1U1NA 1NKBA 2JRSA 3TZZA 3BGOP 2Q79A 4KO0A 4N8OA 1FK9A 1VBYA 2LECA 1SKRA 4CH7A 3GFZA 5I42B 2W9BA 2XMJA 1UJ5A 5C25A 2QZ8A 4QPXA 3AQOA 4R25A 3U7JA 5EDWA 3H7HB 3HFKA 2R8IA 2IJNA 2D41A 5GVQA 1C1BA 3MMAA 2CPJA 4DDFA 2RILA 1IWGA 3Q8SB 1OY6A 1VYAA 1IR0A 1WI6A 3QO9A 2BOPA 3TARA 3AQPA 2ZH1A 1CJTB 1YKWA 4FXDA 2MSSA 3CCSS 2P8IA 3NAHA 3EGWB 5KG6A 4ZIWA 1N6QB 2DNMA 1TQLA 1X4DA 2VPWB 4ICLA 4M5JA 3RTVA 3JYTA 4CYUB 1TL4A 5F8GA 5D4PA 2PFDA 2GFFA 3MM5B 1RGVA 3MEDB 2HZCA 2V2VA 1ZAWA 1M5HA 2NQPA 4R8UB 3QT5A 2A10A 2EW9A 2B3TB 3OTDA 1JWWA 1UVKA 4OX8A 2EKYA 4DQPA 4ECUA 4C3KA 5ETLA 2MQMA 2JH3A 2HHPA 3N0VA 4ED7A 3W5YA 1IJFB 2YNIB 1QM9A 4CLKA 2B5JB 4GO5X 1KD1T 1CULA 1IKYA 1NDKA 2DXFA 3GIJA 4NMXA 2QSWA 2H1YA 1FF2A 3R27A 3LTOA 3NXZA 4EBEA 2JC1A 4F4XA 2YKMB 4ZVGA 3C6UA 2YY3A 2BBEA 3T5HA 1SI9A 1X9MA 2QA4S 1HR0F 4F36A 3ZXWA 5DM7Q 2MEWA 2XHCA 2JC0A 3HSDA 3OQ2A 4U7CA 1S9FA 3M6UA 2VC1A 2BJDA 2RRAA 1JLCB 2K1RA 2UXDF 4JI3F 1NDPA 2OEKA 2QV6A 2YWFA 4FF3A 4DCOB 1SCJB 5KFLA 1X5OA 4I7FB 2MB0B 1LV5A 3W63A 2C1EB 2XNQA 1HHTP 4I0WA 1ZAVA 1UWBA 1I94J 2HURA 3P5TL 3OBIA 3TQEA 2QMUB 2N82B 2OIHA 3LPEA 4R0JA 2YVSA 4GMKA 1RT4B 3TYTA 3C16A 4YN3B 1K73T 3MEEA 4K0KJ 2H4YB 2P9CA 4H54A 2JEFA 2PFFB 2KXHA 2JFDA 3ZC4A 4KGKA 2WVFA 3V81B 3TWZA 2V4QA 2V2KA 5AJ3J 1R7IA 5EX3A 3ET6B 1YSJA 3CGIA 4QJVA 1HBNB 3PR5B 4JP8A 4DWIA 1TK5A 2G13A 2MLXA 5C2GA 2ASJA 4HI1A 3E51A 3EZOA 3ISNC 1S99A 3KLHB 2DIVA 1XR5A 3VGTA 1I51B 3FCWA 1BLUA 3QRPA 4CO1A 1REGX 2V94A 1LW0B 2YTCA 2XBPA 5E0OA 4O44A 1C0UA 2WW8A 1IBMF 4NLGA 2BV3A 4X62F 3JXOA 1B0TA 5DQIA 4USTA 2IM2A 4DR6F 4G1QB 2M2BA 2N7YA 2EFPA 2WTFA 1TR0A 4ES2A 4LBHA 1FX2A 2HQIA 4DMZA 2JHEA 3MI7X 4DV6F 3MTKA 5A2QU 4IG0B 1Y5LB 1OYDA 5I3QA 3T6BA 2IVYA 2POKA 2ZM6J 3QT6A 2A6MA 2GS8A 4FXVA 1K0VA 4ZPDA 3HSJA 1FA0A 5KFTA 2KM8B 4Y65A 4OL8A 1BWVA 4KPCA 2XMVA 1F9FA 3M2UA 3HHNB 2CQIA 2HWIA 2COLA 5B0GA 2R7RA 4PYAA 5ETOA 3RBDA 4ALZA 4TNOA 2Z8QA 4B02A 5B08A 1U26A 4YR3A 4BS2A 3GV7B 3AT1B 4A8FA 2GIFA 1TP7A 3QZ8A 4F4AA 4GC7A 5IC4B 3OTEA 1HPZB 1Q5VA 3IWLA 2LYVA 2QL5B 1VBXA 2J7WA 1GQEA 3BKFA 2DNYA 3H59A 3GSDA 2IHR1 4OFZA 1WF0A 4FPIA 2ZHOA 1HD1A 3ILLA 2LXFA 2QJ3A 4NXMF 1Q95G 2V4RA 3R5GA 2HQFA 1NK9A 3GILA 3H5YA 3MM7A 1BQMB 2M7SA 1MG7A 2ZNYA 1HNIA 1X4AA 5CYJA 4PWUA 4IO1A 4OZ5A 3X1LB 2A2CA 4OYBA 2G2OA 1T3NA 1RTJB 4M5IA 3CDAA 4M5LA 1YJUA 4JI6J 2KXNB 2GJFA 4DR3J 3SSSA 1SJ4P 1FDNA 1R27B 4TXSA 2BQRA 3V4IB 4F2SA 3V5RA 2RF2A 2KM8C 2JEIA 4ECWA 2GV1A 4BCAA 5K8MA 3D3CJ 3DU6A 1KQGB 3DLEB 3E01A 3C15A 4RU9A 2ZH3A 3LUYA 1YJWS 5C2CA 3R97A 3W2WA 3UVJA 3HK2A 4H4MB 2OPPB 2IJRA 4TQSA 2BW7A 4C6AA 4HACA 1U0HA 1QVGR 3MPWA 4QWEA 5IT9Y 1T8EA 4KC5A 3KJVB 1KLMB 2CYYA 1KN6A 1M5KC 3KG4A 4WK3A 4TYBA 1CSJA 2AEMA 4I68A 2I5JA 1KTVA 1BHNA 4F3OA 1YBUA 1NU4A 2Q6CA 2NREA 3MOZA 4KBIA 1C2PA 4IUFA 1FDDA 4ETZA 4F8RA 5L9XA 2KH9A 3Q8PB 2LDIA 4AT1B 2DNKA 3LANA 1UZHA 3KFWX 4KJIA 2OPSA 2QLXA 2FY1A 3BEGB 5KG5A 4WTYA 1VIXA 3IXQA 4MTPA 5CZXA 2FJXA 1HARA 3Q23A 5KFJA 2B56A 5KFKA 2XS5A 4PWWA 4OZ1A 3CE8A 1RBAA 4JBCA 5AXMA 1N6QA 2HHTA 1NK4A 1Y5IB 1PBUA 5DETA 2ROGA 5EWGA 1NDLA 3LWMA 2MKHA 2V6AA 1TU0B 3MM5A 4PYDA 3NGDA 2VQEJ 2XWYA 3IR5B 1DRZA 4NLYA 1T9YA 3HCXA 3MR3A 1DTQB 3CJ8A 4LT6A 2XGQA 2M88A 1RA6A 1WTFA 3E3XA 1YJNS 1S1XA 2XLIA 5DG8A 3SCKE 4N77A 4PXCA 3AJ1A 4ZS6A 2J9DA 3BGRB 1ZBTA 4G65A 1YRTA 3R7BB 1VHFA 4NLOA 2IRUA 5HLFA 1WACA 2HNDB 2RUSA 4DV2J 3KUHA 4UZCA 2MZTA 2ROEA 1DBDA 1CS4A 3DLLQ 3I4HX 3DRSA 4DR1F 5J2QB 4D3GA 4A8KA 1VRTA 4WP3A 1DQ9A 1SQGA 1EJ7L 4ZCLA 3NCQA 2L08A 3DGPB 1Y7PA 4JI2F 3QGPA 4DX7A 2PI4A 2YWWA 4Y2AA 1TV6B 3R1HA 1RUSA 1V3SA 3QJLA 1LWFA 1PCAA 1EETB 2FUG9 2QFJA 2KXFA 2XCAA 3MAQA 2MXYA 4DOZA 1D0EA 4IG3B 1FO1A 2R4FA 3PXGa 4L6V3 2XGPA 1UL3A 3KLEA 4W98A 3IR7B 2O1PA 4ZJLA 1S6PB 3W9HA 3OFGA 3I6PA 3AXMA 3DOKA 5KT2A 5DQGA 1SL0A 2VZ9A 1PYOB 3CCUS 5FD1A 1T0TV 3KK2A 4IDKB 2BE2B 3D1QA 2LMIA 2HHSA 2DYAA 4JI1F 2IRYA 3DLGA 1QAIA 2VDIA 3EYZA 2CJAA 2IBKA 1CPZA 2ZOFA 3T41A 2RB7A 1GFWB 4CWBA 2FLOA 2QLBB 3GJQB 4X4NA 4JI0F 1HQEA 4DS4A 3SCIE 3MMJA 2BJ7A 3MM8B 1XMQJ 3MD3A 3OW2R 4AYBD 4UZBA 3PW7A 5F3TA 5KG2A 4JI5F 4P9SA 3HPOA 3FUYA 3RGIA 5GADU 3J7A1 3EGZA 1K1QA 3AXKA 4DN9A 4RZRA 1NXIA 4F2RA 1G4CA 2CNKB 2VA2A 1T02A 4GC6A 3AB2B 1PIEA 1UKUA 1HW8A 4LRCA 3VAIA 2BXJA 2R9LA 4DL3A 2E9RX 2F4FA 2ZH4A 3DN9A 1SC6A 1YJ9S 1R43A 4OJHA 2UXBF 2MY8A 5DO2A 1RHRB 2ZKTA 3M1VA 4P7TA 2JOQA 4J37A 3GIRA 1U24A 2VKRA 3Q8RB 2HFUA 2CJQA 2E44A 1OQ6A 1FCAA 4RNMA 2NYIA 1UP1A 3SCLE 1VDHA 2HLUA 4TY8A 4JV5F 4KKOA 2CRLA 2B6AB 1NSAA 1NZ8A 4B3OA 3I5CA 3JSBA 5K14A 4NYOA 1RZMA 3BSNA 1CQNA 2RVJA 1K9MT 4RX6A 3LQVA 2DPJA 3O3LA 4QR0A 3CCQS 3RUBL 4ZLJA 1FDAA 2B9WA 2GGPA 3H5SA 1X4BA 5J1EA 4F26A 5CZVA 1LQ9A 2G1DA 1R0CB 3LF0A 4KB7A 4ZVUB 2EFVA 4C11B 2XYGB 3BV8A 1HW9A 3M8RA 4IH6A 1TL1B 3PNIA 2KHDA 3QZ7A 1JNZB 2EEYA 2X7IA 1S5ZA 4F04B 3LALA 4V1Ak 5T41A 4DL5A 1MSWD 2W7OA 4CNZA 4ECTA 3DLHA 2V8DA 2CWXA 4S0MA 2O66A 2DXEA 3M32B 4C3LA 1ZM9A 2UP1A 2OEMA 4FF1A 1FFWB 4X4TA 1TVRB 1NK8A 1J2VA 4UQGA 1F3FA 2UV8A 2RS2A 2JNJA 2E66A 2R7VA 1QE1B 1RACB 4ID5B 1S4FA 2J8SA 2C2DA 1GMUA 5HSPA 1KVKA 2GO8A 4YFUA 4J9RA 4C9DA 2HK2A 5CQGA 2BANB 2EFQA 1PJ5A 1RT3B 1TL7A 2ZOMA 1SJ1A 2ACYA 3FFIB 1WEZA 4PQAA 3CJRA 4GKJJ 1RLDA 1Y5NB 2YQ3A 2MKJA 3F44A 2G2YA 3A3PB 5F3ZA 2PO4A 5EHHA 4DV1J 5LXYA 3UE2A 2DT9A 3ELHA 5IM0A 4ILRA 3K0JA 3IGNA 4NL5A 1HQUA 2UXDJ 4JI3J 2XMMA 3LO3A 1WHYA 4WKRA 2D9PA 4FVMA 4F4WA 2IBOA 3RRKA 1WOOA 1RTZA 4URGA 3M7VA 1P9YA 1YITS 3M05A 3B4MA 2OTLS 3HHLB 3HF5A 4NCGA 4O3OA 3I0SB 2YWKA 3KHLA 3G9CA 2F8EX 4W92B 3VAKA 1NJIT 5IFMA 3DDIA 5KFCA 2EKNA 4IYQA 3CJ0A 5D0GA 1FKPA 4RU2A 4P75A 3PYDA 1S79A 2HZAA 5LOQA 4DQIA 1HNXF 3QT8A 1M5SA 2D3UA 4AD6A
chains in the Genus database with same CATH topology
2KVQE 2MTLA 2MQ8A 4LFCJ 2VQEJ 1XMOJ 4DUYJ 4B3RJ 1XNRJ 1IBLJ 4KYZA 4DV1J 2UUAJ 1N32J 5IWAJ 3OTOJ 3T1HJ 4K0KJ 1HNZJ 1IBMJ 5A2QU 4X62J 4OX9J 4NXNJ 2ZM6J 1XNQJ 4V1Ak 4LFAJ 1N34J 2KL8A 2UUCJ 4JI0J 4NEYA 4B3MJ 5AJ3J 4AQYJ 4X66J 4DR6J 4LF7J 1HNXJ 4KY3A 4LF9J 4JI3J 2UXDJ 4LFBJ 5IT9U 3D3BJ 4JI2J 4YHHJ 4NEZA 1FJGJ 4DR7J 3J80U 4DV2J 2F4VJ 4JI5J 3R2DJ 4NXMJ 3R2CJ 2UU9J 4JI7J 4JI6J 4DR3J 2HHHJ 3T1YJ 2UXBJ 4DV3J 4LF5J 4LF8J 2E5LJ 3J7AN 2MEWA 4DR2J 3IMQJ 4YY3J 4RJVA 3JAMU 4DV5J 4DR5J 3J81U 5BR8J 1N36J 4B3TJ 1HNWJ 4JI1J 4DV6J 4DR4J 2UXCJ 1XMQJ 4PWWA 4DV0J 5LM7E 3D3CJ 4KHPJ 4DUZJ 4DV7J 1J5EJ 4LF4J 1IBKJ 4GKKJ 4HHUA 4LF6J 1I94J 2UUBJ 4DV4J 4X65J 5LMNJ 4X64J 4B3SJ 1HR0J 4JI4J 4DR1J 1N33J 4JV5J 3W1YC 5FLXU 4JI8J 4GKJJ 2VQFJ 5LMUJ 4JYAJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KVQ E;  2MTL A;  2MQ8 A;  4LFC J;  2VQE J;  1XMO J;  4DUY J;  4B3R J;  1XNR J;  1IBL J;  4KYZ A;  4DV1 J;  2UUA J;  1N32 J;  5IWA J;  3OTO J;  3T1H J;  4K0K J;  1HNZ J;  1IBM J;  5A2Q U;  4X62 J;  4OX9 J;  4NXN J;  2ZM6 J;  1XNQ J;  4V1A k;  4LFA J;  1N34 J;  2KL8 A;  2UUC J;  4JI0 J;  4NEY A;  4B3M J;  5AJ3 J;  4AQY J;  4X66 J;  4DR6 J;  4LF7 J;  1HNX J;  4KY3 A;  4LF9 J;  4JI3 J;  2UXD J;  4LFB J;  5IT9 U;  3D3B J;  4JI2 J;  4YHH J;  4NEZ A;  1FJG J;  4DR7 J;  3J80 U;  4DV2 J;  2F4V J;  4JI5 J;  3R2D J;  4NXM J;  3R2C J;  2UU9 J;  4JI7 J;  4JI6 J;  4DR3 J;  2HHH J;  3T1Y J;  2UXB J;  4DV3 J;  4LF5 J;  4LF8 J;  2E5L J;  3J7A N;  2MEW A;  4DR2 J;  3IMQ J;  4YY3 J;  4RJV A;  3JAM U;  4DV5 J;  4DR5 J;  3J81 U;  5BR8 J;  1N36 J;  4B3T J;  1HNW J;  4JI1 J;  4DV6 J;  4DR4 J;  2UXC J;  1XMQ J;  4PWW A;  4DV0 J;  5LM7 E;  3D3C J;  4KHP J;  4DUZ J;  4DV7 J;  1J5E J;  4LF4 J;  1IBK J;  4GKK J;  4HHU A;  4LF6 J;  1I94 J;  2UUB J;  4DV4 J;  4X65 J;  5LMN J;  4X64 J;  4B3S J;  1HR0 J;  4JI4 J;  4DR1 J;  1N33 J;  4JV5 J;  3W1Y C;  5FLX U;  4JI8 J;  4GKJ J;  2VQF J;  5LMU J;  4JYA J; 
#chains in the Genus database with same CATH topology
 3SFG A;  2OKQ A;  3M2V A;  5LXR A;  4I2Q B;  1S9E B;  2A6O A;  2YWH A;  6FD1 A;  3C46 A;  5H9E J;  2HNY B;  4OZL A;  4OZJ A;  1X0P A;  3T1Y F;  3BQ1 A;  1JJH A;  1TKT A;  4ETX A;  2M52 A;  4Z37 A;  5J2M B;  1ELO A;  1OWX A;  5D78 A;  3EGV A;  2FYX A;  3TUJ C;  3AOB A;  3QJJ A;  1F9H A;  1D8Y A;  2EPI A;  1QSL A;  3VVT A;  3MEG B;  1TL5 A;  2K2P A;  2JL9 A;  2FQQ B;  2MLZ A;  2PD1 A;  3C14 B;  4C8K A;  3W65 A;  5HL7 Q;  2BYC A;  3Q8Y A;  3FVY A;  4J9U E;  1RKI A;  4DV6 J;  1MNE A;  1JLQ B;  4X84 A;  2YWE A;  2MZ1 A;  4NXN F;  2MJN A;  1SPB P;  1G3O A;  4IFY B;  4OLP A;  2V9W A;  4CDI A;  1VBZ A;  4QYZ J;  4RUB A;  4RW6 A;  4EZ6 A;  1P1T A;  1DTT A;  3BRE A;  4LSN B;  5GMK a;  2F65 A;  2WVE A;  1N0V C;  1JJ4 A;  2HRU A;  2H9Z A;  4EGL A;  1VR6 A;  1SC1 B;  4EK2 A;  3IP0 A;  4P10 A;  2U1A A;  4L3K A;  1F1B B;  2LP4 A;  2OD6 A;  3TAM B;  1EAY C;  2RD5 C;  1I3O B;  3J7Z 5;  3R9L A;  2FVC A;  1S1V A;  2NSC A;  2HS3 A;  1YJV A;  2PGC A;  3QAE A;  1VBK A;  1NB7 A;  1NBE B;  3QPI A;  1YG0 A;  1AA1 B;  4DPW A;  4NCB A;  2WRM A;  4KE5 A;  1N5Y B;  1RT5 A;  3HUL A;  3BQ0 A;  4WJB A;  4EO8 A;  5RUB A;  3MMC B;  2XI2 A;  3UN2 A;  2VPZ B;  2Q3P A;  3NGR A;  3RZA A;  1S97 A;  1HYS A;  4M5D B;  3FCV A;  2K8G A;  3Q8U A;  4B3S J;  4J9V A;  3R8Y A;  2GVZ B;  1S6Q A;  1DLO B;  1WSR A;  4B08 A;  3CJ4 A;  1B7F A;  1VMB A;  3DOM B;  1FKO B;  4G1P A;  2W7A A;  3OD2 A;  1XMO J;  1YQH A;  3D68 A;  3FMW A;  3D4J A;  2W1B A;  3ZTR A;  4N76 A;  2OH2 A;  1X8D A;  3CD7 A;  2ZH6 A;  2F40 A;  2WB1 D;  1IUJ A;  1XIQ A;  3EM1 A;  3I31 A;  2AMC B;  3OHB A;  2D3Z A;  1SBR A;  1SJF A;  2GO9 A;  2PC6 A;  3GB0 A;  3UDE A;  4MFB B;  2NXU A;  3CCR S;  5HVF A;  5EUH A;  4TLR A;  3T5L A;  2BDP A;  1X31 C;  3P8B B;  3M6V A;  5HVH A;  1XTZ A;  4DSJ A;  1UVJ A;  4F3M A;  5GMD A;  4C0B A;  1NJW A;  2D3O R;  2R2S A;  3M8P A;  2XY6 A;  3S6E A;  2I9S A;  3K5L A;  2GW8 A;  1YJR A;  3KLI B;  1S12 A;  5FLX U;  4XDD A;  3W2V A;  2VG6 A;  5CA5 A;  1T11 A;  1Y00 A;  1VQ6 S;  1V3Z A;  4OI0 A;  4LRB A;  1KON A;  1JKH B;  3TZX A;  1MRO A;  3CJ2 A;  3X3U A;  3BR8 A;  2R7O A;  5K8N A;  2ZZN A;  4HTJ A;  2MKY A;  4A47 A;  2UZA A;  1IN0 A;  5HAN A;  4ZHR A;  1R89 A;  2Z2M A;  1S0N A;  2F63 A;  4PWD B;  2MQO A;  3AOA A;  3GV5 B;  1NH8 A;  4KV8 B;  2M5Y A;  3FKB A;  4LVO P;  2CPX A;  4FF2 A;  4PXB A;  1TVR A;  4H4K C;  3BS9 A;  4CLL A;  1UWA A;  2QC3 A;  2V8G A;  4P73 A;  2FVQ A;  2PI5 A;  4J9L A;  1NLK L;  3JS9 A;  3HDS A;  4I56 A;  2VPX B;  1AFI A;  3WC2 A;  3D7S B;  2MKI A;  3V4M A;  1QUV A;  4OYZ A;  4I6A A;  2CJY B;  5GAH U;  3LOU A;  1H3D A;  2RHS B;  2IDL A;  2Q43 A;  2E9Z A;  3HVT A;  1WEL A;  3I0R A;  1PIL A;  2HBR B;  5HP1 B;  2E5I A;  4KFB B;  2F7V A;  2WW4 A;  2CJK A;  3B6B A;  3WHI A;  4ZCI A;  2MZS A;  1RT7 A;  3GZ7 A;  1DJ0 A;  5H9F K;  2AJ0 A;  1H73 A;  2PA3 A;  2OPQ A;  1MN9 A;  2MZQ A;  1IKX A;  1C4A A;  4NI2 A;  1BE4 A;  3ZTO A;  3DMJ B;  4I2P A;  5KFZ A;  2CQH A;  4JI2 J;  1IM6 A;  3CCW A;  4U8Y A;  2KG0 A;  5F0U A;  3O1L A;  1RCO B;  4DF8 A;  2DNQ A;  3MEC A;  5MAO A;  4IQX A;  5G4D A;  3DLB A;  2CPI A;  4GO7 X;  2ADC A;  5DLG A;  2AGQ A;  1WEY A;  3CC2 S;  3M9N B;  5F8H A;  2HSE B;  1LWC A;  1NUE A;  5KG4 A;  5HMW A;  5KT3 A;  2IC3 B;  1GX6 A;  2FD2 A;  2QA2 A;  2W9C A;  2DH9 A;  3W1Y C;  4ZP9 A;  5L1K A;  1F9E B;  4ES1 A;  3CCM S;  3D1H A;  3M30 B;  3CPW R;  1O6X A;  2J8A A;  3S01 A;  1JLE A;  2DK2 A;  2DJW A;  2HMI B;  5DZ7 A;  1SL2 A;  5AE2 A;  3LP2 B;  3DRR A;  2R2T A;  3NG8 A;  2IRX A;  3CIM A;  3JB9 k;  2ZEJ A;  1TL3 A;  4JI0 J;  2AJ4 A;  3NMA A;  4X4V A;  2LU2 A;  3W9I A;  3IR6 B;  3A8J A;  3QLH B;  2UV8 G;  3DYA B;  2HHW A;  4YHH J;  3EJM A;  3MMB A;  5DJB A;  5DS7 A;  3PV8 A;  4TY9 A;  2KJV A;  4BLG A;  3ETO A;  4JI5 J;  1TMJ A;  4ZPA A;  1FWP A;  1CJK B;  5IQQ A;  5J2P B;  4OJ1 A;  3MEG A;  4J9K A;  1NSK L;  1VJQ A;  4JUZ A;  1U49 A;  4B17 A;  4I6Y A;  2DIT A;  2RKI B;  2WON A;  3GIM A;  4NPO A;  1HNZ F;  3RB0 A;  1RWN B;  1NKC A;  2VG5 A;  2XZD B;  1RTH A;  3G96 A;  1N34 F;  3PJX A;  5HMZ A;  1WKJ A;  1X7V A;  3UR0 A;  1JIH A;  4XDC A;  1YX2 A;  2YX4 A;  4USU A;  5CYQ B;  4I69 A;  3K5O A;  3CD0 A;  5LSL A;  2OEL A;  4RNH A;  5KOW A;  4ZP8 A;  1U2R A;  2ZE2 A;  3KK1 B;  4NLD A;  2XUL A;  1CEZ A;  4NCA A;  3PKY A;  3UNG C;  4PPD A;  4MIW A;  2KRR A;  3TJ9 A;  1FTR A;  4ZJQ A;  3IWN C;  2Y8W A;  4LSL A;  1JLB B;  5CH7 B;  1UPM B;  2IA0 A;  1S1T B;  4DSL A;  4OV1 A;  2BKP A;  4Q0B B;  2G2Z A;  1N0U A;  2G9O A;  1C4C A;  4WII A;  2G4B A;  1BWE A;  1HL6 A;  1U6Z A;  2AP6 A;  4IOC Q;  4Q8F A;  5IWA F;  3KMQ A;  2E1C A;  4O0I A;  2X1G A;  4NZ0 A;  4Y6I A;  3H4D A;  1HA1 A;  2Y1R I;  1UMJ A;  2CNN B;  3AFG A;  1JLF A;  2J76 E;  3OSN A;  2MGZ B;  1NHU A;  2RSQ A;  4A4J A;  4PG8 A;  3NGK A;  4LRD A;  3SXL A;  1S9G A;  3RB3 A;  4HH0 A;  1FJE B;  4OYW A;  1DLO A;  5AXK A;  2YH0 A;  1Q7Y T;  2D9O A;  3C6T B;  3I9V 9;  3BKT A;  4ZIT A;  2AJ2 A;  3OTC A;  3D5M A;  3FZ2 A;  3GLJ A;  1J5O B;  4M5M A;  3THP A;  3EZ5 A;  1IVZ A;  2OPR B;  1N5S A;  4CP5 A;  1M1H A;  5BR8 F;  3HZE A;  2KDO A;  4FN5 A;  3VF0 B;  4F4K A;  1Q79 A;  4UOF A;  2VB6 A;  1RWW B;  2APO A;  3CJ5 A;  4WP9 A;  1RIS A;  2JWN A;  1W2I A;  3GR0 A;  2WB4 A;  2BOA A;  3T3F A;  4DX6 A;  4HEA 9;  1VCT A;  4CLU A;  4RWW A;  4DLG A;  2P6T A;  1N56 A;  2BJ3 A;  2IYI A;  5MLC V;  1OSC A;  3OHA A;  5C5J A;  1NPP A;  1TKZ B;  3P6Y C;  4GKK J;  3CT9 A;  4IFV B;  2CIM A;  1LNQ A;  1PJ6 A;  3G4S S;  3CCE S;  3TQ1 A;  1HBU B;  1GMW A;  2C2E A;  2MY7 A;  4EBC A;  4C97 A;  4TQR A;  5HJY A;  4RW7 A;  3G82 A;  4MYT A;  1RCX B;  3EIC A;  3ZNU A;  4DUZ F;  3ZTS A;  1LXN A;  4DR2 F;  1D9A A;  2EK6 A;  2LEB A;  1KRP A;  5HQL A;  1XBW A;  5FJ4 A;  3HVW A;  4KR0 B;  3DRY A;  3V6D B;  3NNA A;  2KZZ A;  3NGT A;  1NSQ A;  1FVQ A;  4OX9 F;  2KU7 A;  4FYY B;  4CLY A;  3OXF A;  4RW9 B;  2LXI A;  4PCQ A;  5CYM A;  1N48 A;  1N88 A;  4AQY F;  5D8H B;  2R3V A;  2CZ9 A;  3DLK B;  1VLY A;  3CXC R;  5KFP A;  1FXR A;  3LP0 B;  3NS6 A;  2KFN A;  2GA7 A;  2UUC F;  1Q8B A;  2QYG A;  3MF5 A;  4PUO B;  1GMV A;  4QIV A;  1BC6 A;  1TAU A;  1RP5 A;  4DV5 F;  3H4B A;  2V50 A;  4CQ1 A;  5K8O A;  2EFG A;  1CQM A;  3UCZ P;  4ZVO B;  2LA4 A;  5KT5 A;  2HHH F;  3D28 A;  2Y0S D;  4M63 A;  3K5P A;  1X5S A;  3CVK A;  3M2R B;  4L75 A;  4O4G B;  2M70 A;  2V2Q A;  2QL7 B;  3LGM A;  1HMV A;  3QAT A;  2WOM A;  4M1K A;  4LQ9 A;  2HRY A;  1JMT A;  2HQD A;  1KFD A;  2OO4 A;  1RWV B;  2JLG A;  3NS7 B;  2XLK A;  3DI6 A;  5JMN A;  1Q81 T;  4E2F B;  3CJ3 A;  3NKY A;  2HHU A;  1U8S A;  2QT7 A;  2R2U A;  4OYA A;  3CJK B;  3A8E A;  5KFA A;  2RT3 A;  2J7K A;  3OPK A;  2C3U A;  1H2T Z;  5B0B A;  1GXU A;  1RAG B;  2BJ1 A;  4ZVH A;  3NBP B;  1Q5Y A;  2DIU A;  1HIY A;  4X66 F;  1VQM S;  3D6H B;  2WVC A;  2VQF J;  1RAB B;  1EB0 A;  1PGZ A;  3NY0 A;  2VF3 A;  1NB2 A;  4DR4 F;  3SEO A;  2CQD A;  1FNM A;  1YWX A;  3VHQ A;  3HD2 A;  1K8A T;  4ITS A;  5KT6 A;  2G0C A;  5A0Y B;  2V2Z A;  4OYI A;  2D7S A;  2J9E A;  3PVX A;  3DU5 A;  1APS A;  1RA7 A;  5HN0 A;  5KFX A;  2MQQ A;  3N01 A;  2XCP A;  3BGF A;  2H5I B;  1K47 A;  1V9O A;  4EI2 A;  2V0N A;  4RBT A;  4JI4 F;  2DR7 A;  3PW5 A;  3CSK A;  3JAM U;  5A76 A;  2UUW A;  2LEA A;  4KO0 B;  1IM4 A;  1FK9 B;  4PAB A;  1N36 J;  2N3L A;  3MM6 B;  2W9B B;  2FHK A;  5HBM A;  2AKW B;  4B9N A;  3GON A;  3FNN A;  3R6G B;  5C25 B;  2DB1 A;  3I96 A;  4F7V A;  5L38 A;  1R31 A;  3ZZT A;  2XS2 A;  8ATC B;  4PEO A;  5K20 B;  1C1B B;  4K2J A;  5JVH Q;  2VFR A;  4EO6 A;  1C0T A;  3PFE A;  3IAS 9;  1C1C A;  4HTI A;  2WAQ D;  2OHD A;  3DRP A;  3QO9 B;  5EN1 A;  3V6H A;  1WTB A;  1REV A;  2LQJ A;  5IV4 A;  2GMH A;  3W5X A;  1TAQ A;  5KAK A;  5HK4 A;  3HFV A;  4DPY A;  2Y0B B;  4DFK A;  2W8L A;  2IMW P;  4RL1 A;  3NP5 A;  4F0K A;  1T9X A;  2ZH9 A;  2BQU A;  2Y8Y A;  4DSK A;  4NA3 A;  4ICL B;  1RBO B;  4DG1 A;  3JYT B;  2OMO A;  1IBK F;  1BQN A;  1QTM A;  4OYP A;  1Z4U A;  5T14 A;  1EAR A;  2W9A A;  1B0P A;  2ZVS A;  1UET A;  4DQR A;  3NNH A;  1N4L A;  4Y2C A;  1VC6 A;  4B3R F;  5KT7 A;  4RW8 A;  2BJ8 A;  3RBZ A;  3T1A A;  2O67 A;  4OLO A;  4C8O A;  4A8W A;  1PYT A;  1WDT A;  4FS1 A;  4KHR A;  1XNQ F;  5ETK A;  2QEX S;  5ETT A;  1PKU A;  1SB6 A;  3FBF A;  2MKK A;  3TAP A;  1CUL B;  1IKY B;  2BAB A;  1WC1 A;  4CLZ A;  2DR6 A;  4O3N A;  4PKD B;  2KFZ A;  4ZA1 A;  3T9N A;  2DKO B;  3C6U B;  2HHQ A;  3L7O A;  1T9U A;  4LR9 A;  4O3Q A;  2R42 A;  3ENQ A;  4DZ6 A;  2B4V A;  1WF2 A;  2K1R B;  4XIU A;  2CDR B;  3W7B A;  4CTA A;  3THV A;  4WFY A;  3BH7 B;  2YX1 A;  3EGN A;  5E3R A;  4MIA A;  3KOA A;  4JI7 J;  5L1I A;  1YZ6 A;  2KTQ A;  5GME A;  2CJ9 A;  2PII A;  4KSE B;  3P5B P;  3PKM A;  3C16 B;  4OYM A;  2VD3 A;  3MEE B;  2ZNZ A;  1XWL A;  5F41 A;  2RQK A;  2ZWO A;  2AD9 A;  1FD2 A;  5B09 A;  1ZM4 A;  3FQL A;  2PMZ D;  5LM7 E;  2GQQ A;  1H0H B;  3ITH A;  4U9R A;  4DV4 J;  4ZVR B;  2XHW A;  1NND A;  1L3T A;  4FVC A;  4G3I A;  1HI8 A;  2CQ4 A;  2NPI A;  3QWP A;  2VU5 A;  4DFM A;  4M5H A;  1FRL A;  2FIU A;  3SDE A;  2UU9 F;  4HHJ A;  2W8K A;  3FC9 A;  1HHS A;  4DI6 A;  1FWK A;  1GXL A;  2WVB A;  5DG7 A;  1DUR A;  2R8K A;  4LF9 J;  2GVD A;  3HO1 A;  1EIY B;  1F6T A;  1C0U B;  1FJG J;  1TUV A;  3SBM A;  1RT2 A;  2NLW A;  2QMX A;  1KP6 A;  4M94 A;  2N4D A;  2RDI A;  4I67 A;  3HMJ G;  1B99 A;  3WC0 A;  1N8R T;  4CO5 A;  1GH8 A;  3QID A;  3KUG A;  1X4C A;  3BYR A;  2FHJ D;  4Q7A A;  5A8K A;  3CD6 S;  4X2B A;  1NME B;  2FC9 A;  3GFH A;  1IBL F;  4DL7 A;  2HQG A;  3HX9 A;  2KO1 A;  1H6K X;  2KFY A;  4XPE A;  1CVJ A;  2ALY B;  4FBT A;  3O8W A;  1XQI A;  4LF7 F;  1FT8 A;  3H2U B;  2VFV A;  4KTQ A;  1AT1 B;  3UDL A;  3OR2 A;  1DY3 A;  3FCH A;  5G0R A;  3M2U B;  2B0G A;  1S76 D;  1Y10 A;  4MK8 A;  4I64 A;  3DLJ A;  4TN2 A;  2CVE A;  4QOT A;  2UUB F;  4QWA A;  1NZA A;  4FYD A;  4PQU A;  1F5A A;  4WFZ A;  3M2R A;  1S10 A;  2RU9 A;  4DCJ B;  4UF4 A;  4QWD A;  1RAF B;  2XI3 A;  3R2C J;  3K2Y A;  3FMB A;  4ED1 A;  2FZG B;  4ZPV R;  5ETP A;  3PYE A;  1R6V A;  3PEH A;  2ROP A;  3FGV A;  4PXE A;  3MR6 A;  4CT9 A;  3SFU A;  2J9C A;  4KGX B;  4NOH A;  3UNY A;  4A8M P;  3FSY A;  3QGH A;  4U95 A;  3MFH A;  3HM9 A;  1NAQ A;  3V6J A;  3CUL A;  5GAG U;  4DCP B;  2ZBR A;  2HVZ A;  3W3S A;  4KHM A;  2I2Y A;  3MM7 B;  3L7U A;  2EBG A;  3R5B A;  2L41 A;  3ZZO A;  1M1K T;  1HNI B;  4LFB F;  3BO3 A;  3E2E A;  1N5T A;  1X4F A;  2W2M P;  3CD5 A;  1TK0 A;  3H42 A;  4C0O C;  3CO0 P;  1JLA A;  2HFN A;  3GSI A;  3T6J A;  2QFI A;  2LFV A;  2DPI A;  1LXJ A;  1VQ9 S;  3IO1 A;  2RF2 B;  4NA2 A;  3BDP A;  4MH8 A;  2BE9 B;  5JXS A;  1O5J A;  3ISN D;  1OJ4 A;  1JXL A;  1S6U A;  4KHP F;  4Q43 A;  4OHV A;  3LW5 C;  3E01 B;  3DXB A;  1WJ9 A;  3IM8 A;  3C15 B;  4F4Y A;  3BGU A;  4TKT A;  4EU0 A;  3W2W B;  4MK7 A;  3IA0 A;  2R7T A;  3UVJ B;  2E5L J;  3FZB A;  2B9Y A;  5EGY A;  3FQK A;  3MAA A;  3OVB A;  4HHH A;  4HAC B;  4OJ3 A;  1U0H B;  4P7V A;  4L72 B;  3UD3 P;  1TUW A;  4WP8 A;  4DV0 J;  1RAI B;  3KG1 A;  4WFN Q;  4B9M A;  4NML A;  3W60 A;  4ATN A;  3CDE A;  3MM6 A;  4QYR A;  1KDN A;  4WCE Q;  2I5J B;  1WG4 A;  3EVM A;  2VOD A;  4ER8 A;  1VIO A;  2OP5 A;  3H2L A;  2VIC A;  3TJA A;  3CO9 A;  2XNR A;  4RWX A;  2VJV A;  2UUA J;  3CCV S;  2J6S A;  1WHX A;  2GML A;  1IKW A;  3NWR A;  4R0E A;  4DV3 F;  2OPS B;  3PX4 A;  2HK3 A;  2AIR B;  3N79 A;  1UW9 A;  4R5P A;  2J7U A;  3D3B J;  2YPZ A;  4BC7 A;  3L09 A;  4NEZ A;  1O8B A;  2Y1L B;  5SZT A;  4J9P A;  3MEK A;  1EX8 A;  3BF4 A;  2Y1J A;  3O5T B;  1LOU A;  3K59 A;  4JI8 F;  1YRU A;  1Y11 A;  2AX0 A;  2C2R A;  3BSC A;  3FEY B;  2FY8 A;  1A7G E;  1VQL S;  4WWS A;  2P5V A;  3PCO B;  3OR1 A;  4UY8 T;  2B7B B;  4DL6 A;  2C2Z B;  4DS5 A;  3TX0 A;  2F4V F;  4DUZ J;  1QTN B;  4QPT A;  1XEZ A;  2R2R A;  1S1X B;  2ZBC A;  4N7T A;  3NL0 A;  3D0I E;  4RNO A;  3BBC A;  3IBW A;  3BBB A;  3SZ2 A;  2H65 B;  5T7L A;  4N41 A;  3MWB A;  5IT0 A;  1Y3K A;  2E7X A;  5HLF B;  2CQ1 A;  4KQZ A;  1OPI A;  1VQ4 S;  2HVI A;  2UXC F;  1CS4 B;  3R5C A;  4CO2 A;  3DRS B;  4OX9 J;  3B78 A;  1U1M A;  5KFF A;  2AEF A;  2K7K A;  1VRT B;  2JFK A;  4YR0 A;  4AQY J;  1TKX A;  1D09 B;  2VOP A;  2OTJ S;  3MCO A;  1LWF B;  3CC4 S;  2DTJ A;  2FJA B;  3VCD A;  4LF8 J;  3VWS A;  2DGO A;  1L5U A;  3KLE B;  5FDL A;  3CF5 Q;  4DV5 J;  4A8S A;  5KFI A;  3N5F A;  4KGZ B;  3ILO A;  3Q8Q B;  2J6T A;  2MKC A;  1XJW B;  4ECZ A;  3CJS A;  3MUT P;  4Y2K A;  3RW7 A;  3DOK B;  3KHR A;  1QUP A;  4LVN P;  2FJV A;  1AUD A;  3KK2 B;  3QQC D;  3O2I A;  3KDO A;  2VKZ G;  1RTI A;  1T05 A;  4HLB A;  3DLG B;  4RW4 B;  1SIZ A;  4DUY J;  5AXL A;  5C42 A;  2NXJ A;  4ED8 A;  4IOA Q;  1LWE A;  5BXI A;  4ILL A;  2KKH A;  4YDD B;  2EFN A;  4NWB A;  3R1L A;  3NNC A;  5F9N A;  2ILY A;  2AQ4 A;  1HQE B;  2CG4 A;  5K5M A;  1YK9 A;  2OD4 A;  1Q4R A;  4YB5 A;  4DR7 J;  2WSF C;  3GIK A;  4FYW B;  4ED2 A;  1PO6 A;  1VQP S;  4USH A;  4AUK A;  1VFJ A;  4CT8 A;  1B0V A;  4USW A;  1MMN A;  2HNZ A;  5EX0 A;  2PE8 A;  2VIH A;  3W5Z A;  4C98 A;  2HEK A;  2RNE A;  2HWH A;  2ZKU A;  3I82 A;  2A3J A;  1K44 A;  4N8N A;  3ZZY A;  2HGL A;  4Q45 A;  4DR4 J;  3IC1 A;  2GHV C;  2HWT A;  3L7P A;  3M6X A;  1DQ8 A;  4DQS A;  4B9V A;  1UVI A;  2NUH A;  3OSP A;  5ADZ A;  2BKN A;  1RHU B;  2NZC A;  3M1V B;  5A6P A;  5E5N A;  1M5P C;  4P2S A;  3BBF A;  2ZVI A;  3QGG A;  4DFP A;  2B9E A;  3I32 A;  1QD1 A;  2OGU A;  2ALZ A;  3TA1 A;  2HLT A;  2QYC A;  2RIJ A;  4TY8 B;  2DHA A;  4NRT A;  4CLT A;  3Q8V A;  4KKO B;  4ED5 A;  2CG8 A;  3UCU P;  4E98 A;  4LF6 F;  2IAJ A;  4B3O B;  1FEH A;  5K14 B;  4C7Q A;  2QLF B;  4DX5 A;  2YKA A;  1N52 B;  3KJN B;  3KLG A;  3FRY A;  2FVP A;  4CRJ A;  3TZY A;  1RE1 B;  1L3V A;  1VK8 A;  1SQF A;  1R0A A;  4P52 A;  4ZJO A;  3MCS A;  1NCL A;  2M8D B;  1SC3 B;  4ED0 A;  2GGP B;  2DNZ A;  2JJ4 D;  4USI A;  5J1E B;  5D4L A;  2Z2L A;  3N28 A;  3M6W A;  2XQC A;  5DDQ C;  2VBZ A;  1P9Q C;  2CJB A;  4DV7 J;  2VDH A;  5A8R A;  2F8M A;  4C48 A;  4NLR A;  2R7W A;  1FKA F;  4X65 J;  2UVW A;  3NLC A;  4X4S A;  1IR1 A;  3RBE A;  3OUY A;  2IY5 B;  2MQ8 A;  4HR2 A;  3QSI A;  2RJZ A;  3PIO Q;  4QQB A;  2AYB A;  2W25 A;  3T1H J;  1VHI A;  1VQ5 S;  2HAF A;  3GYX B;  4F0M A;  2YKN A;  4PZV A;  1RAH B;  3KNG A;  1RAE B;  4BHQ A;  1UCN A;  4KY3 A;  3PM9 A;  4LR8 A;  3BSA A;  3OVA A;  4JYA F;  2F9D A;  3KYL A;  2CQG A;  1CC8 A;  4N47 A;  2E1M C;  3EWG A;  5HRO A;  4FZV A;  3OTB A;  3H98 A;  1TEL A;  1TL7 B;  3R5J B;  2F8H A;  4F02 A;  4LF5 J;  3TX8 A;  4DU7 A;  3BN7 A;  4DR5 J;  4LBI A;  4WKY A;  1VIS A;  3JQJ A;  4OIX A;  1Q82 T;  1KHW A;  3ETM A;  2C22 A;  3H40 A;  1Q8K A;  1RWU A;  5IM0 B;  2F5G A;  2ZM6 F;  3SQG A;  1HQU B;  1UA1 A;  3VGV A;  1RTD A;  1Q86 T;  4OYO A;  2JZ5 A;  4HYK A;  1LK7 A;  1K0T A;  3KLF B;  3A3N B;  2QE5 A;  5B0A A;  4NX9 A;  4JB8 B;  3OJS A;  2QTW A;  3MPU B;  1N32 J;  2BEF A;  3AD7 C;  1WF1 A;  1PSD A;  3NRB A;  4WF9 Q;  4C8Z A;  2I0X A;  3H25 A;  1TKD A;  4OQJ A;  2DNP A;  1MLA A;  5KG7 A;  4NCG B;  3TR5 A;  2ZC4 A;  3VAF A;  5C7P A;  2RQM A;  9ATC B;  4IRK A;  2YXL A;  2W01 A;  3DXS X;  5KFG A;  4YEA A;  4ZN3 A;  2UVU A;  1FJ7 A;  3QYY A;  2KYZ A;  1FKP B;  2P9G A;  4AL5 A;  1HQ2 A;  2RUG A;  1GT8 A;  2MZR A;  2IVM A;  1LKZ A;  3PR4 A;  5CD4 H;  2I8E A;  1WC3 A;  1CG2 A;  3G8Q A;  3M2V B;  2MZJ A;  4DXL A;  3KTQ A;  1S48 A;  3SV4 A;  1G6B A;  5KTQ A;  4LF4 J;  4ERD A;  1TKT B;  2VUG A;  1F2G A;  1VI7 A;  2AF6 A;  3LP1 A;  2D3O 1;  1VRU A;  2G0I A;  1Y0H A;  4XPC A;  4PG4 A;  3M8Y A;  3FRZ A;  3RAX A;  3PRD A;  2ASY A;  4IR1 A;  2W2O P;  3BPD A;  1D8Z A;  5KG3 A;  4DR3 F;  4UT4 A;  4OV6 A;  3RRH A;  1M5O C;  2HHV A;  2HBY B;  4GVB A;  5D4N A;  3MR2 A;  4C3M A;  4LBP A;  2AW0 A;  3J80 Y;  2RE1 A;  3T9Z A;  5KFE A;  3TAN A;  3RB4 A;  3GU0 A;  4RW6 B;  3DRX A;  1DTT B;  1CJV A;  2ILZ A;  3J81 U;  1RLC L;  1M90 T;  3KKF A;  3WDO A;  5FLX Y;  1DFD A;  3DOL B;  2IJF A;  5I3U A;  1J5E J;  1VOM A;  2NS1 B;  1TUG B;  1CBK A;  2UUB J;  4LRF A;  3TJ8 A;  4UQT A;  3IS9 A;  3G86 A;  3THT A;  3TP2 A;  2RU3 A;  4MIB A;  1WG5 A;  4LIW A;  2LCW A;  2N3O A;  2H5J B;  2FJD B;  2LLZ A;  3W9J A;  2JSX A;  4U67 Q;  3VAG A;  1S1V B;  2YNG B;  1XR7 A;  4RW4 A;  1RT6 B;  3PFO A;  1QAX A;  3RBX A;  2QO3 A;  2PMW A;  1OY8 A;  4RPF A;  4U8V A;  2A18 A;  1RT5 B;  4H4O A;  4EYH B;  4XAK A;  3G8S A;  5D3G A;  4M5G A;  3OXL A;  1OY9 A;  2N4C A;  5KOX A;  1HYS B;  3K58 A;  3LGN A;  4MMO A;  1WKL A;  4I1T A;  1YJT A;  1S6Q B;  2HFO A;  5CCM A;  2DGW A;  2OI2 A;  2KG1 A;  2VQE F;  1WKK A;  4OHX A;  1D9D A;  1U25 A;  1JX4 A;  3NOG A;  2CWK A;  1Y4Z B;  4K4V A;  4B9L A;  3N6L A;  5LJ5 Y;  2XWX A;  5ETM A;  2W2P P;  3ICL A;  2FZC B;  4ZPB A;  2VPY B;  2IFX A;  4X64 J;  1ZPW X;  1HBM A;  3PX0 A;  2CPY A;  1YJ7 A;  2J0S D;  4U6P A;  2KVQ E;  4E0D A;  3M8Q A;  4QW8 A;  3SYZ A;  4QCL A;  2YBV A;  4DV2 F;  2XY7 A;  4F25 A;  2NXN A;  4J7C A;  5L1L A;  1UVM A;  1TTH B;  2AU0 A;  1KVI A;  3ILI A;  4MK9 A;  3AA9 A;  5F8M A;  2A2D A;  4B3M J;  4M5K A;  1QAY A;  2CQ2 A;  2WSC C;  1FRJ A;  1ZZN A;  5L8R C;  2BM1 A;  4C0H A;  2XYP B;  2DRA A;  3M8P B;  3CWJ A;  2XMT A;  1MWZ A;  3DNC A;  3EDQ B;  4NLU A;  1ZM2 A;  2Z2Z A;  4B9U A;  1T03 A;  1EQ0 A;  3W2V B;  2VG6 B;  5BJR A;  1LW2 A;  2KRB A;  3HHL D;  5A8W A;  4KAI A;  2VAS A;  3MZI A;  2PA8 D;  2BM0 A;  1T9V A;  5K9F A;  3D9B A;  1MRO B;  3VZI A;  1W7W A;  4ZHR B;  4C8Y A;  4J9Q A;  4X4R A;  1ZA2 B;  3TUP A;  2RS8 A;  4YY3 F;  1RQ0 A;  1BMQ B;  4RO0 A;  2VFS A;  3A1Y G;  2V68 A;  4MKY A;  5HQM A;  1SL1 A;  4P2M A;  1AUS L;  3POT A;  1Q16 B;  4QR1 A;  2ZJQ Q;  2XSF A;  2H3E B;  1EP4 A;  4WE1 A;  3G2X A;  1XMQ F;  2F4V J;  3L95 X;  4ZLN A;  4FYV B;  2ASL A;  5J1P A;  3GV8 B;  1JLG A;  2H48 B;  4NAS A;  1AZS B;  3CUN A;  3R6L B;  3HVT B;  3LGH A;  3I0R B;  4U7U D;  2DCU B;  1S1W A;  1FFG B;  3IRX A;  2LU1 A;  1ZTT A;  2QX0 A;  4OZ0 A;  2HGN A;  4G6V B;  3D0G E;  2VON A;  1DAR A;  1RT7 B;  2UXC J;  4LJM A;  3PO4 A;  2K7J A;  2I38 A;  3QSY B;  2ZH8 A;  3BO2 A;  2XO6 A;  1FE0 A;  2OPQ B;  4BBY A;  1IKX B;  4G1I A;  3HSZ A;  1ZM3 A;  4NI2 B;  1HR0 J;  4X4P A;  3G87 A;  4FDF A;  3H5X A;  3LWL A;  4I2P B;  4P72 A;  2FGC A;  4ZP7 A;  4OHW A;  4ZP6 A;  1KOO A;  2DIS A;  2ZJP Q;  2VL1 A;  2NYH A;  3VGS A;  1ACM B;  5KFR A;  3MEC B;  3KLF A;  2XSJ A;  3GFY A;  3RB6 A;  4K4X A;  2C2M B;  1KSP A;  2F3J A;  4IRC A;  5LMN F;  4U96 A;  2L9N A;  4Z2X A;  3UWT A;  4OZ3 A;  1KHV A;  4AND A;  2NXE A;  3IWX A;  1LWC B;  1RHK B;  1EQM A;  3A8K A;  5C24 A;  1S1U A;  2CNL B;  1MU2 A;  2MQN A;  1SQE A;  1UAW A;  4ZK7 M;  2V8P A;  2Y1I A;  2MMY A;  5ETS A;  2KT2 A;  1ZA1 B;  1X4E A;  2W9C B;  3NGU A;  3H8Y A;  3M4X A;  1JLE B;  2OFH X;  5F9L A;  1Z2Z A;  5KG0 A;  3PTW A;  4K5S A;  2V63 A;  3DRR B;  1SV5 A;  1O51 A;  4B9S A;  4QBU A;  1TL3 B;  3J7Y U;  1VQ8 S;  1UEU A;  2ABY A;  2BJ9 A;  4CZC A;  3MMB B;  4DJB A;  1ZH5 A;  2VG7 A;  2WK4 A;  4P71 A;  1NSP A;  1IBM J;  2CUY A;  5KFY A;  2IM1 A;  1A9N B;  3MHY A;  2FGO A;  3TEH B;  4X62 J;  3UDV A;  2FVR A;  1TFW A;  3CME S;  1XN9 A;  1B7Y B;  5KFO A;  2GCF A;  2V67 A;  4Z7Y A;  4ECR A;  2E7W A;  4URQ U;  3GCX P;  5IV3 A;  2B9X A;  4DR6 J;  3KMS A;  5GAE I;  2WON B;  2ZD1 A;  2VBY A;  3R3T A;  4X4U A;  4ZN1 A;  3MUM P;  2RAQ A;  1U02 A;  1XNR F;  4Q44 A;  1MN7 A;  2VG5 B;  2V4J A;  2YKP A;  4IR9 A;  4Q2L A;  5ETQ A;  1RTH B;  1CLF A;  1IKV A;  4ZLP A;  3N9U C;  2EG2 A;  3EVO A;  4BDP A;  1X5T A;  3IG1 A;  1WC0 A;  2LVW A;  5E41 A;  3HHL C;  4GKJ F;  4BWM A;  4DFJ A;  3MAH A;  4WYL A;  3PAC A;  3TO8 A;  3WIU A;  3KLV A;  1RDR A;  4USM A;  4DV1 F;  3BZQ A;  3HI9 A;  5ETR A;  1BXN A;  2W4P A;  3VAJ A;  5F8I A;  2ZE2 B;  2H54 B;  4LF6 J;  4QU7 A;  3DOL A;  5HQ8 A;  2QIF A;  3DM2 A;  2C2O B;  3PRB A;  4LMZ A;  2FJW A;  4ECV A;  5D77 A;  4YOE A;  1GMW D;  1YTY A;  4LSL B;  1VQK S;  3RAQ A;  4KIA A;  4OI2 A;  4RBU A;  3EZU A;  2XZW A;  3OJU A;  2DO0 A;  1P1L A;  4K50 A;  2VBX A;  2YKO A;  2PEB A;  4I4B A;  2BX6 A;  3AY0 A;  4Y3C A;  2YNG A;  2XC9 A;  2HYI B;  1RT6 A;  4OZN A;  3PW4 A;  2KN4 A;  2MDA A;  3S8S A;  4EYI B;  2OFG X;  5CD4 A;  1KFS A;  3ZZZ A;  5DRK A;  4FNI A;  1FTC A;  2MHN A;  1ZPV A;  4NXM J;  1H72 C;  3VVU A;  3K8V A;  2ZZM A;  1JLF B;  1MML A;  1XR6 A;  2R8J A;  1RJJ A;  2F9J A;  2DRB A;  3F0N A;  4OHZ A;  1S9G B;  2AYE A;  3LPY A;  1ZOT A;  1U09 A;  3MTJ A;  4C4W A;  3US5 A;  5CCL A;  2YNH A;  1JXV A;  4NYP A;  3JSM A;  4V19 J;  3GYN A;  2R8H A;  1H74 A;  3W8P A;  1U1K A;  1WC6 A;  2CAJ A;  2MJU A;  4DZD A;  1FER A;  4ZKA A;  4JYA J;  3UPF A;  2WZ1 A;  2G0J A;  2EC2 A;  1L3K A;  2DHX A;  2ADB A;  3DDK A;  2HQC A;  2Q6B A;  4FYX B;  4DF4 A;  2ZH7 A;  1HNW F;  3BSO A;  2AZ3 A;  4P74 A;  2WVD A;  1U7L A;  2B43 A;  1UJ6 A;  4NLW A;  1U1L A;  3VV2 B;  2B8P A;  2FLN A;  2W24 A;  2V34 A;  4MKV A;  3TUZ C;  1RT1 A;  5DDP C;  3J80 U;  1D9F A;  1SUQ A;  2GJI A;  4K4T A;  1ZYQ A;  5EWE A;  1RWO B;  3T5J A;  4F67 A;  3KK3 A;  2I6W A;  1HWL A;  2ZHA A;  1LEO A;  1MWY A;  4DPT A;  4JV2 A;  4F50 A;  5J2N A;  1RYR A;  4RW7 B;  3G82 B;  4P2X A;  3V2U C;  4NLT A;  5GAH I;  5LJ3 Y;  4LSZ B;  1JJ2 R;  4DPU A;  3QNW B;  1HLW A;  1SVD A;  8AT1 B;  4I6W A;  3NCR A;  2IA6 A;  3HP6 A;  2RH3 A;  3G6X A;  4EEY A;  4GRS A;  2BRK A;  2VH7 A;  1YHQ S;  3OFE A;  3JSY A;  1R6Y A;  3D1O A;  1NK6 A;  2GNK A;  3EPI A;  5CYM B;  1RU1 A;  3GCW P;  1NHV A;  5M2U A;  2DNH A;  4EFA C;  3PG9 A;  3BH6 B;  4AXI A;  4ZCM A;  1UPP A;  2PDA A;  3JAM Y;  4EWT A;  4PG5 A;  5LL6 d;  1VQN S;  1SKS A;  3B54 A;  4B3S F;  3UI3 A;  1RWP B;  4ECY A;  5AE3 A;  2ERR A;  2VJU A;  2B7C B;  4MKB A;  1B4S A;  4DL4 A;  1AZS A;  4RJV A;  1SIW B;  2YQ0 A;  1XMO F;  1U6B A;  2HS4 A;  4ED4 A;  1WNE A;  2HAI A;  2ZIT A;  3LAM A;  3Q0A A;  2B51 A;  4F4Z A;  4K7Q A;  1U8W A;  4DR1 J;  2FHJ A;  1L3S A;  1HBO A;  2R7U A;  2YNF A;  4YB6 A;  3BR9 A;  2ZUA A;  3OFH A;  3MM9 A;  1HMV B;  2WOM B;  2ZZT A;  3C8Y A;  5BYR A;  4WIQ A;  4W4M A;  3IAM 9;  3U1M A;  3DI6 B;  3VR1 A;  2KL8 A;  2KT3 A;  1HWU A;  4NEY A;  3CDW A;  1E6Y A;  4ID8 A;  3W64 A;  3UQS A;  1WC5 A;  3BQ2 A;  1AXQ A;  4HT5 A;  4KRW A;  1KLN A;  1Y3J A;  3GTY X;  5CAA A;  4PR6 A;  4YQW A;  2XS7 A;  2IPO B;  3LA0 A;  5D0E A;  4HT7 A;  5I42 A;  3Q22 A;  4ECX A;  1G2E A;  1IR2 A;  4DSE A;  3NEK A;  4J9O A;  2BZ2 A;  4NLQ A;  1IWA A;  2XB2 D;  1BQX A;  3CTR A;  3FSX A;  3OL8 A;  1HD0 A;  2DGS A;  4PAA A;  5M2P A;  1FX4 A;  1KQK A;  5DGA A;  4JI1 J;  4KH0 B;  2BVZ A;  1QY7 A;  3EDR B;  1BY9 A;  5H1S V;  1ZS6 A;  5IC6 B;  5ETV A;  4TLQ A;  3ZTQ A;  1Z1Z A;  2W7P A;  2ZBP A;  1DZ5 A;  2HS0 A;  1RB0 A;  3C2P A;  4HH1 A;  3KXD A;  1CJT A;  1XC9 A;  2JEJ A;  4QIE A;  4ZVS B;  2FZK B;  3GG1 A;  1FRH A;  2C28 A;  1XMB A;  3PW0 A;  2DEJ A;  5DDO C;  3QAU A;  4CYU A;  3OL7 A;  2CQ3 A;  5DG9 A;  1VC0 A;  2ZBQ A;  2RRB A;  4LRA A;  3MED A;  1NK7 A;  4R8U A;  2HZV A;  2Z4P A;  1D1U A;  1S0V A;  5AT1 B;  2DVI A;  5HBM B;  2LQ5 A;  2RQC A;  2ASD A;  2YH1 A;  2RHQ B;  2KZM A;  3LH2 S;  2UXB J;  4IRD A;  3CCZ A;  1KTQ A;  2L9D A;  4E8U A;  3QBC A;  3TNV A;  4LFA F;  2M9K A;  1C0T B;  2YNI A;  4WFB Q;  2QLW A;  1C1C B;  2B5J A;  3DHW C;  2M0G B;  3BM7 A;  4ECS A;  3DRP B;  1S72 S;  3A13 A;  2M4M A;  2XM3 A;  1X0F A;  4DU8 A;  1REV B;  3R5A A;  4DUT A;  1RXO B;  4AL7 A;  4CLS A;  1K1S A;  2YKM A;  5KFH A;  3G8T A;  4JV5 J;  1OYE A;  1FHT A;  1QSS A;  1U48 A;  4QWC A;  4OX7 A;  3P96 A;  2IDE A;  4LF2 A;  4WZQ A;  3FEZ A;  1JLC A;  4DG1 B;  7FD1 A;  1RU2 A;  2E5J A;  1BQN B;  3V6K A;  4I7F A;  4QWB A;  2BKO A;  1E6V B;  3JTP A;  1I1G A;  2XTJ P;  3GWC A;  2CFX A;  2QN6 B;  2ZOG A;  1NKE A;  1CC7 A;  3CB4 A;  4IQM A;  4L3N A;  2ZH5 A;  4CLP A;  4RW8 B;  5I3P A;  1V5I B;  4C8M A;  1RT4 A;  3CCJ S;  2I1R A;  4CLW A;  5D0H A;  1XER A;  2E29 A;  3D2W A;  1WOS A;  1P6T A;  2BRL A;  2DNL A;  1GAO A;  3WX8 A;  5I4M A;  2QA1 A;  2JEG A;  4ED6 A;  1URN A;  3CC7 S;  2FB0 A;  5E7O B;  3V81 A;  4YY3 J;  2XMW A;  1V5V A;  3JTN A;  3FBB A;  4F3Q A;  1LFP A;  3C3L A;  3ET6 A;  2VFU A;  2FDN A;  1HBN A;  1RBL A;  2A0F B;  3W8G A;  1FXL A;  1ROF A;  1T3O A;  2EVZ A;  2X1F A;  1HI1 A;  4Q5V A;  4DL2 A;  3QMQ A;  3KLH A;  4YR2 A;  2DR5 A;  5KFQ A;  2HVH A;  5DZ6 A;  1T95 A;  4YHH F;  1LW0 A;  4NZ6 A;  4F0H A;  4CTA B;  1JXE A;  5KFM A;  1EKS A;  5KFD A;  1GNK A;  1R0B G;  2AV5 A;  3U27 A;  3M9M B;  1H7X A;  4K4W A;  2PMH A;  1WHW A;  2DHS A;  3K5M A;  4FF4 A;  5LSO A;  4K4Z A;  4G1Q A;  2C3O A;  2B4O A;  4RR5 A;  4CH0 S;  3ITH B;  3ISZ A;  3I9Z A;  3AH6 A;  3OTO F;  4DEZ A;  2AJQ A;  4IG0 A;  3K8W A;  2DGU A;  4LQ3 A;  3UR3 C;  3PW2 A;  4IH7 A;  1U1P A;  1YBT A;  4J9M A;  2HIY A;  1AW0 A;  1A6L A;  3SDE B;  3SQO P;  1IQT A;  3Q89 A;  4ZOS A;  2B8Q A;  2GQ2 A;  3PRV A;  5LMN J;  4QIW D;  2GVD B;  1FWL A;  2Y9H A;  2VOO A;  1GK8 A;  2HFZ A;  3ADA C;  6FDR A;  7AT1 B;  3CDU A;  3P4U B;  1RI7 A;  1RT2 B;  4DPX A;  4W90 B;  1YLX A;  1SJ3 P;  3TW0 A;  3E8O A;  2OJ3 A;  3BO4 A;  4K2X A;  3IRW P;  4ZVP B;  2IM0 A;  1HPZ A;  2CPE A;  1J27 A;  4OI3 A;  3GJR B;  3PYG A;  4X4O A;  2YQ1 A;  2LKZ A;  1HNX J;  5A8K B;  5ITH A;  4FXW A;  1Q8I A;  4YUD A;  2CDQ A;  4NRU A;  5KFV A;  3DGV A;  2J9D E;  2CKW A;  1ZET A;  2X51 A;  1LWX A;  1VQ7 S;  1P27 B;  1M1G A;  2B4U A;  1HKA A;  1YRX A;  3QFH A;  4NA1 A;  2LQ9 A;  3T1Y J;  1TFY A;  1VQO S;  4Q2M A;  1MW7 A;  1FRK A;  3OR2 B;  1BQM A;  3EMT A;  3GP9 A;  2P6S A;  5G0R B;  2QLJ B;  3GFX A;  5AXN A;  1FRX A;  4DQQ A;  1RAJ A;  3ZNJ 1;  1IJE B;  4YS2 A;  3HHD A;  3K17 A;  3MOJ B;  3BB5 A;  1RTJ A;  3L9Z A;  3AA8 A;  4PQU B;  1FD8 A;  3V4I A;  1TK8 A;  3NOC A;  3AD9 C;  3PO5 A;  5B7W A;  9RUB A;  4ZVF A;  2AZ1 A;  2FC8 A;  1XNR J;  5HAO A;  1ICE B;  2OAU A;  3GPA A;  3F41 A;  4EZ9 A;  4NXN J;  3DLE A;  3J7Z T;  1PAE X;  3NGS A;  3QT7 A;  2EI5 A;  1Q1K A;  2OPP A;  4H4M A;  1U2C A;  1NK5 A;  1RAO A;  1WI8 A;  3PJ9 A;  2R7S A;  1U4B A;  4N56 A;  4GKK F;  4B9T A;  4XTT A;  1OPZ A;  3KJV A;  1KLM A;  4JOU A;  4ANE A;  4DLE A;  2DO4 A;  1NPR A;  1EKR A;  2DD8 S;  3RU0 A;  1JLA B;  1YGY A;  2DH8 A;  3DHX A;  3NCP A;  4ECQ A;  4ZCK A;  2NUU G;  2ATC B;  3BDE A;  2GQC A;  2IMO A;  2FJB B;  1NO8 A;  2MYF A;  2ZH2 A;  4DPO A;  1PC5 A;  1KC8 T;  1YIJ S;  2DH7 A;  1X9S A;  5E3A A;  5JJB A;  4A46 A;  2BE7 D;  2GJ2 A;  2AHO B;  1BGX T;  2DHH A;  3HHK A;  4EBD A;  2NCK L;  1YDL A;  3IM9 A;  4K4U A;  1F0X A;  4WPA A;  3MAA B;  2KT5 A;  2EG1 A;  2QL9 B;  2DGQ A;  3FDS A;  3WX4 A;  4A8Q A;  5F8J A;  5BYQ A;  1N5Q A;  4NLP A;  1FES A;  2E1P A;  1DTQ A;  2ZJR Q;  2IM3 A;  2L9W A;  1M0S A;  2E5H A;  1ULR A;  2X1A A;  4P6Q A;  1V3R A;  2YKQ A;  2WBM A;  3RR8 A;  3BGR A;  2EXU A;  3I87 A;  2IIH A;  4ED3 A;  1HNW J;  3HXM A;  1ARO P;  2E1A A;  2HND A;  1KQS R;  1IKW B;  2EBE A;  4MKA A;  2LDY A;  2HRT A;  3MPV A;  5HJX A;  2AX1 A;  4R5P B;  2J0W A;  2K3K A;  5J2Q A;  4RBV A;  3VQS A;  1S49 A;  2LQ8 A;  3T19 A;  3ZZ0 A;  4ZLL A;  4OI6 A;  3QRR A;  4K4S A;  3DGP A;  3H2V E;  2ZHB A;  2LQB A;  4A8Y A;  5D4O A;  1TV6 A;  4C2M A;  3B82 A;  3CMQ A;  2E1R A;  1EET A;  3HJF A;  4L76 A;  1E6V A;  2J0X A;  4OZ2 A;  4IG3 A;  4CNY A;  2X1B A;  1QLN A;  5IT9 U;  1MMD A;  3WQP A;  3MCM A;  1T9W A;  3OR1 B;  3HHE A;  1AFJ A;  3NAI A;  3FBE A;  2GHW A;  5F8N A;  1S6P A;  3ONQ A;  1VGY A;  3MGJ A;  3ULH A;  1GX5 A;  4NE9 C;  2DGV A;  4TYA A;  1DQA A;  4CLF A;  3CW2 C;  3UDC A;  5T7L B;  1Z2L A;  5THW A;  4DN0 A;  3J7A N;  5SUH A;  3DDN A;  2VQF F;  1RK8 A;  2DCL A;  3MD1 A;  4IDK A;  4Y2I A;  2BE2 A;  6AT1 B;  2C42 A;  2Z2Y B;  3M8Z A;  2OSR A;  5GAE U;  3OFF A;  1H2U X;  3IBC B;  3SSQ A;  1TKX B;  1R8A A;  2V9K A;  1R8H A;  2DR9 A;  3B4D A;  3PY8 A;  3N5B A;  3RYL A;  3KWM A;  3MM8 A;  2QMW A;  2NR0 A;  3KG0 A;  3AB4 B;  1FVS A;  1RWM B;  5FDL B;  2O01 C;  2QSF A;  4YP3 A;  1N33 F;  4WU3 A;  1N36 F;  3GR1 A;  1UEK A;  2Z30 B;  2Q66 A;  3EPG A;  3PHE A;  2DR8 A;  1PG5 B;  1H7W A;  4NLV A;  4RKU C;  2IVF B;  1F60 B;  1RTI B;  2BR0 A;  4ZDN A;  1T05 B;  4ILM A;  2R7X A;  2VA3 A;  2XLJ A;  1H38 A;  5C42 B;  5HVG A;  1X4G A;  3TEG A;  1GTE A;  3Q86 A;  2OLW A;  1LWE B;  2UVR A;  4ENO A;  4WXO A;  1CJU B;  2AWZ A;  3UN3 A;  3VZH A;  3GJT B;  2Z56 B;  2DNR A;  2YX7 A;  1UEV A;  4WFX A;  2B6A A;  2CQC A;  4Y00 A;  2MKS A;  2KVI A;  1HNV B;  2R8G A;  4Y28 C;  2DGX A;  4QZV B;  1NRK A;  2HNZ B;  2YWG A;  3K7R A;  5LT5 A;  1PJ7 A;  3AOD A;  5KG1 A;  4OYX A;  5CXT A;  1F5C A;  4OX6 A;  5FII A;  3GMG A;  5IT4 A;  1FFS B;  4TU7 A;  4UUX A;  3UFC X;  3JQM A;  4J9S A;  3VTI A;  4UTG A;  1LFW A;  4C11 A;  3GE9 A;  3G71 S;  1TL1 A;  2CJX B;  2JLE A;  1V6H A;  2GAH C;  5GAG I;  1U0S A;  1JB0 C;  2DXD A;  2GC8 A;  2GIQ A;  4XO0 A;  4ELU A;  1URR A;  3VAM A;  2DNN A;  3ZTP A;  4K4Y A;  3MUV P;  1R8C A;  3M32 A;  3QGI A;  2FHO B;  2DBB A;  2IAJ B;  3MPD A;  4EUV A;  1KNZ A;  1Q0N A;  1QE1 A;  3KLG B;  4ID5 A;  5IZH A;  1DHM A;  1NDC A;  1R0A B;  2X3G A;  3C19 A;  2EFO A;  3R7N B;  3ZZP A;  3M9O B;  2U2F A;  2CVI A;  1HNZ J;  4O3S A;  2VFT A;  3HSG A;  4JI7 F;  4JV0 A;  3TVZ A;  2CPH A;  2BAN A;  3QIP B;  4LFA J;  1N34 J;  4ZIV A;  1QJH A;  1RT3 A;  2X3D A;  3FFI A;  2VC0 A;  3IBF B;  5LMU F;  1B70 B;  2DNG A;  5A8R B;  3WZ0 A;  3PYF A;  3OL6 A;  2J5A A;  4RNN A;  1YVF A;  4DV4 F;  4Q8E A;  4NLX A;  3VQT A;  2UUT A;  2MST A;  3OXG A;  5L1J A;  1P8G A;  3OUY B;  2Z57 B;  2WSE C;  3CJT A;  3L3C A;  2DEI A;  2QG9 B;  1OIA A;  3JTO A;  3RR7 A;  1OMS A;  1N5V A;  2YKN B;  2V8V A;  4Z7C A;  2ATL A;  3VGU A;  2FLP A;  2RDJ A;  2NXC A;  2XEX A;  3HHL A;  4LF9 F;  3HKZ D;  2CQB A;  1HWK A;  1FJG F;  2QA4 G;  1ZTW A;  3I0S A;  5HRO B;  3W61 A;  2DNO A;  2ACM A;  4MYU A;  4KYZ A;  2D74 B;  5IWA J;  1FRI A;  1VS3 A;  2CA9 A;  3EVW A;  3OVS A;  5DM6 Q;  1HI0 P;  3A3O B;  4UOG A;  5KFW A;  2ZFH A;  2OUG A;  4OI1 A;  3RG6 A;  3PZP A;  2C3P A;  4KT0 C;  2J0Q D;  1WDD A;  3HD1 A;  1UVL A;  1RWK B;  5KFB A;  1TZ0 A;  3WBZ A;  2EC0 A;  3MR7 A;  1Q78 A;  4CIO A;  3J81 Y;  1GXT A;  4I2Q A;  1IQZ A;  1S9E A;  2HVD A;  3SQG B;  4PG6 A;  5KT4 A;  2HNY A;  1RTD B;  2DY1 A;  4QU6 A;  2RML A;  2O3D A;  5J2M A;  5BR8 J;  3ZFV A;  4DSI A;  2WCX A;  3NS5 A;  2MLY A;  3KUE A;  4YME A;  2GMJ A;  3GII A;  1VQS A;  4GVL A;  4RUA A;  3KJQ B;  2DRD A;  2CZ4 A;  4LIR A;  3C14 A;  4V19 X;  2BW2 A;  4WK1 A;  5DLF A;  2KB2 A;  4AFF A;  2UVV A;  3T5K A;  5E3P A;  4J90 A;  1F5B A;  4B3T F;  5IXU A;  4WTO B;  5IS2 A;  3OTO J;  3N6M A;  2HHX A;  4IO9 Q;  3ZO7 A;  1JLQ A;  2G1H A;  3FEX B;  4HDG A;  2CXE A;  3KHH A;  4IFY A;  2RRN A;  3HVA A;  3H0P A;  5IQ6 A;  1UTA A;  1PBA A;  4ZPC A;  4MAK A;  4LFC F;  3UW1 A;  5B0D A;  2D69 A;  4LSN A;  5HO4 A;  4UW2 A;  3UD5 A;  2VV5 A;  1S77 D;  3D6M B;  3LP1 B;  3A12 A;  3NWG A;  2GIR A;  1VRU B;  4O23 A;  1UA0 A;  2ZUG A;  4DR2 J;  1RHM B;  4YB7 A;  3UCG A;  3BYP A;  1KS2 A;  3DCA A;  2GZO A;  4WYW A;  3TA0 A;  3TAM A;  4ANC A;  3PDN A;  2V69 A;  2CQP A;  5E33 A;  4DX8 H;  4BWJ A;  2B4P A;  4HHU A;  3HT0 A;  4D3H A;  3SV3 A;  3AOC A;  4GVB B;  3PJW A;  1NJY A;  3GJS B;  1HWI A;  3CCT A;  4KPY A;  2HFV A;  4EMD A;  2HW3 A;  1N5Y A;  2KHC A;  4HDH A;  1UFK A;  1QAJ A;  3I5A A;  3MMC A;  1FXD A;  2FJE B;  1F2H A;  3I4P A;  2GHP A;  4USV A;  2E5L F;  1CJV B;  4M5D A;  2UUC J;  5IOL A;  2LA6 A;  2GVZ A;  3R7S B;  1SH2 A;  3S7R A;  5KFU A;  3DOM A;  1FKO A;  1U1O A;  2CPZ A;  2PN6 A;  3FBC A;  1AB8 A;  1HWJ A;  4KGV B;  5AE1 A;  4DV0 F;  5I3U B;  1Q53 A;  2J6U A;  3SMZ A;  4M8L A;  1PAU B;  1KQF B;  4CM2 A;  1FJC A;  2HHH J;  3IS9 B;  5B0E A;  4PPZ A;  1KOH A;  2AGP A;  2BUN A;  2JLF A;  3K5N A;  1VQY A;  3DC2 A;  2H51 B;  1W25 A;  3MUR P;  4H4K A;  3OV7 A;  3D6T B;  2UUA F;  4CO3 A;  2RQ4 A;  2PEH A;  2PSZ A;  1SJQ A;  2N7C A;  2MHE A;  3HT3 A;  2K06 A;  4MFB A;  3VAL A;  4XK8 C;  1JNR B;  4H4O B;  1IXK A;  1CJU A;  2E5G A;  3ZZU A;  4MJK A;  1UFW A;  5D3G B;  2MTL A;  2H4W B;  1VC5 A;  1R3N A;  3U1L A;  1VK3 A;  5M2R A;  2W4D A;  3K89 A;  1H98 A;  1UW4 A;  4K8R A;  3AHP A;  5L46 A;  4UUW A;  1HNV A;  2VHG A;  4WXW A;  4J5O A;  4X66 J;  3HJV A;  2EK1 A;  3ENV A;  4N5S A;  3KLI A;  2CAD A;  1S59 A;  5LSR A;  4PXD A;  3FK4 A;  4HKQ A;  2E9T A;  1OSD A;  4CH1 A;  2AGO A;  1KR4 A;  3MPY A;  3TVK A;  1SH0 A;  1HBM B;  1JKH A;  4UOC A;  1D3W A;  4L74 A;  1JK9 B;  4RNF A;  2CPF A;  2PT0 A;  4JV1 A;  3M8Q B;  2QRR A;  3D67 A;  5BYS A;  1UFL A;  5E2Q A;  2P2C B;  3TAQ A;  3P49 B;  4A8O A;  3ZZR A;  4PWD A;  4WFA Q;  4KV8 A;  1U47 A;  4JI4 J;  2E7V A;  1O0P A;  2M8H A;  4USJ C;  4TU9 A;  4UY8 5;  2MPU A;  4YB1 P;  3U02 A;  2AJ1 A;  2V8H A;  5L9N A;  1KVJ A;  2LXU A;  4LUB A;  4Y2M A;  4ELT A;  1FNX H;  1T03 B;  2L3M A;  4LF8 F;  3F56 A;  1UZD A;  1I94 F;  2JX2 A;  3G6V A;  1LW2 B;  5A8W B;  4U7U K;  8RUC A;  3C66 A;  3QIP A;  3EX7 B;  5HP1 A;  2FVS A;  4KFB A;  2SXL A;  4BC9 A;  4Y0F A;  3R2D J;  1WHV A;  2KYX A;  4ZPW R;  4K0K F;  4RUH A;  4ZVE A;  4ES3 A;  4ZVQ B;  1I5O B;  3O6Q A;  4RUC A;  5CHC B;  3CMA S;  3TUI C;  4WZM A;  4O3R A;  5HAT A;  4TVA B;  2K3I A;  5AJ3 F;  4DUY F;  3QJP A;  3DMJ A;  3O44 A;  4IOB A;  1YZ7 A;  5D6G A;  3TI0 A;  4O3P A;  1IBK J;  4WBF A;  1LK5 A;  4CI0 B;  4X4Q A;  1F3V A;  2LEP A;  1NPK A;  3POT B;  1GTH A;  3MCN A;  1NJX A;  1X5P A;  1B3T A;  1EP4 B;  3QWU A;  4WE1 B;  4DR7 F;  4B3R J;  1S0M A;  4P2F A;  4HVZ A;  1JLG B;  1S7I A;  2H5E A;  3PEJ A;  4AL6 A;  3MDF A;  2HFS A;  3MR5 A;  1S1W B;  1XNQ J;  3IRX B;  2IC3 A;  1WC4 A;  3SIP B;  5H9E K;  4M5N A;  3CJQ A;  3M30 A;  2ZC3 A;  5JUM A;  5U47 A;  4DL0 C;  5D15 A;  5B0C A;  1VJW A;  2HMI A;  3FSI A;  2Y3Y A;  2ZBI A;  3LP2 A;  1VRQ C;  1N54 B;  1WWH A;  1UVN A;  3Q2T C;  3W62 A;  1U6F A;  3IMQ J;  3M8W A;  2BQ3 A;  3QLH A;  3DFE A;  5H9F J;  1GEH A;  1Q8L A;  3P3D A;  3DYA A;  4O4R A;  3ENW A;  3TA2 A;  2XSJ B;  3Q83 A;  4FKX A;  1HFE L;  4NYZ A;  4URS A;  1CJK A;  2C2N A;  1NEE A;  5J2P A;  2HIQ A;  2Q1L A;  1N33 J;  2NSB A;  3D6F B;  4J91 A;  4QIG A;  1SJR A;  4FS2 A;  2FTR A;  5K8P A;  1MWQ A;  5C24 B;  1S1U B;  4DHV A;  2XZT B;  1MU2 B;  1FDB A;  2GAG C;  2RKI A;  1SKU B;  4QYZ K;  4ZPT R;  1R8B A;  3AJD A;  3KDN A;  2MQL A;  1FRM A;  1VLO A;  4YDX A;  3MMA B;  2CNO B;  5A6W A;  3KNA A;  3OLB A;  1AYE A;  1DAX A;  4NZ7 A;  3CDB A;  5CYQ A;  1SV5 B;  3RAM A;  3A8I A;  2HPU A;  4KH1 B;  4DV7 F;  4HL9 A;  2W2Q P;  5DGB A;  1FNO A;  2UU9 J;  2NZ4 A;  2FHM A;  4KGM A;  4X65 F;  1JQG A;  2AT1 B;  3KJF B;  2CQ0 A;  4OI4 A;  4CM0 A;  2HKE A;  3KK1 A;  1S4E A;  4RLE A;  4PRF A;  3JSR A;  2XMK A;  3SSR A;  1SC4 B;  1FEE A;  2VG7 B;  1JLB A;  3T1H F;  3EXY A;  5HMX A;  1ITP A;  3EUN A;  3N4W A;  3MFI A;  3DKD A;  1TMM A;  1S1T A;  3QRQ A;  1Y9O A;  3BKU A;  4JI6 F;  4IKA A;  4Q0B A;  1QVF R;  3IFE A;  3QFW A;  1RAA B;  2ZD1 B;  4A48 A;  2C3Y A;  4CO4 A;  5D0R A;  1T94 A;  2XO7 A;  1T7P A;  1S57 A;  1IBL J;  4IH5 A;  2V4J B;  3Q24 A;  1QSY A;  1IKV B;  2HGM A;  1FI4 A;  4LR7 A;  1BUX A;  4FPR A;  4CO0 A;  3ILJ A;  3IG1 B;  2C2K B;  4O0N A;  4AXJ A;  5F0W A;  2Z0G A;  4LF5 F;  5A2Q Y;  2BJE A;  2DY9 A;  2RDD A;  2MGZ A;  4DR5 F;  4LF7 J;  4Y34 A;  3GQC A;  2CZV C;  2VBW A;  7FDR A;  3RW6 A;  2XY5 A;  2L48 A;  4FKY A;  3H90 A;  5GAD I;  4A8X A;  4USK A;  3HLU A;  2OEJ A;  2WBR A;  2F1F A;  3C6T A;  3DM2 B;  5EWF A;  2OML A;  3LAK A;  5E3Q A;  2D1C A;  1X9W A;  2YPY A;  2XYH B;  1J5O A;  4HI2 A;  1WG1 A;  2O5D A;  1SH3 A;  4LRE A;  3BJY A;  2OPR A;  5CAB A;  1T9T A;  1NM2 A;  1UWB B;  2W2N P;  1N32 F;  3CIZ A;  4J9N A;  3PIP Q;  5ETN A;  1YBA A;  1WD6 A;  1SXL A;  4K5R A;  1B64 A;  4K59 A;  5L39 A;  3EXC X;  1U1R A;  5LMU J;  3G6Y A;  1I6J A;  3H20 A;  2W4C A;  2ZWP A;  5JVG Q;  3CNQ P;  4C8L A;  3MXH P;  4LF1 A;  4WU2 A;  1OO0 B;  4L73 A;  2EWH A;  2C3M A;  1H2V Z;  2BA9 A;  3UO0 A;  3J81 j;  1TKZ A;  2CPD A;  3BPS P;  2HVE A;  2JVO A;  3WIV A;  2AYM A;  4IFV A;  5HMY A;  3AJ2 A;  2JDJ A;  2HQ3 A;  1U2F A;  2YNH B;  4PG7 A;  3SI8 A;  2R7Q A;  2BAC A;  4LFB J;  3JSM B;  1HBU A;  5E3C A;  3HVR A;  1OS5 A;  1Q7L B;  3M8S A;  1S6O A;  1EZZ B;  4ELV A;  1KEK A;  3BGL A;  1NHK L;  4NLS A;  4LF4 F;  4C8N A;  3D0H E;  3IGV A;  1RYS A;  1U1Q A;  1RHQ B;  4OJG A;  1PYS B;  3JQK A;  3I5B A;  5KFN A;  4O44 B;  3KHG A;  2NPF A;  4DBQ A;  3S1T A;  3L4B C;  3RRG A;  4KHP J;  1S0O A;  4OHY A;  3CCL S;  3RJM B;  3V6D A;  4QW9 A;  2HG4 A;  1XK8 A;  3AD8 C;  1KKH A;  2P9E A;  3N6N A;  3I56 S;  1WOP A;  1EHW A;  3UD4 P;  3NMR A;  2KJW A;  2FLL A;  2MQP A;  1QDU B;  4RW9 A;  1RT1 B;  4CCH A;  1ZAX A;  3OLA A;  1X4H A;  3DLK A;  1SUQ B;  1W2B R;  3KK3 B;  3TRG A;  3LP0 A;  4QR2 A;  1HHQ A;  3CED A;  1RSC A;  4AE5 A;  2HBZ B;  2V5H G;  3GYG A;  5J2N B;  1WEX A;  2AJF E;  1KWM A;  3D66 A;  2IYG A;  1WSV A;  4PUO A;  3EE3 A;  1RWX B;  4ZMM A;  1ZZF A;  3P45 B;  3B8H A;  4DSF A;  1J5E F;  5KFS A;  1M5V C;  5J1N A;  3R5D A;  2A1B A;  4DV3 J;  5DQH A;  3TOQ A;  3PX6 A;  1UJ4 A;  1W26 A;  2AEJ A;  4UOH A;  3U1N A;  4O4G A;  4B3T J;  3I55 S;  1NK0 A;  2GX8 A;  1X60 A;  2FPH X;  1FE4 A;  3HZG A;  4ZVT B;  2ZDO A;  3K57 A;  3OT9 A;  2QGF B;  4FP9 A;  2AYG A;  1S7H A;  1L3U A;  3GG0 A;  3FJ2 A;  4JI8 J;  2BMB A;  1R8P A;  4FNH A;  4LFC J;  2KI2 A;  3HFZ B;  4FBU A;  1WOR A;  4OMF G;  3CJK A;  2ZDP A;  3VAH A;  1JJC B;  3OL9 A;  1RAD B;  2XMU A;  2JVR A;  2M3D A;  1PC4 A;  1YI2 S;  3NBP A;  1BD6 A;  3F73 A;  2WHO A;  3H5U A;  1IBC B;  3BN4 A;  2DHG A;  1A0O B;  4MT1 A;  3G6E S;  1NH7 A;  2Z58 B;  3TZW A;  1U45 A;  4M95 A;  2HBQ B;  1SKW A;  4X64 F;  1OQ3 A;  1RKJ A;  2DGT A;  3PHT A;  3SCJ E;  1WUU A;  1HBO B;  3Q2S C;  2YNF B;  3ENA A;  3HKW A;  5A0Y A;  3IN5 A;  3TVY A;  3MM9 B;  1KBR A;  3UN5 A;  3J7Y I;  2XG8 A;  2OSQ A;  2XMA A;  5DDR C;  3AAW B;  5HI7 A;  1G7C B;  5F8L A;  5B0F A;  4TU8 A;  3D54 A;  1RHJ B;  1E6Y B;  3W66 A;  1NJZ A;  3A4T A;  4B3M F;  4QIF A;  1G1X A;  1U1N A;  1NKB A;  2JRS A;  3TZZ A;  3BGO P;  2Q79 A;  4KO0 A;  4N8O A;  1FK9 A;  1VBY A;  2LEC A;  1SKR A;  4CH7 A;  3GFZ A;  5I42 B;  2W9B A;  2XMJ A;  1UJ5 A;  5C25 A;  2QZ8 A;  4QPX A;  3AQO A;  4R25 A;  3U7J A;  5EDW A;  3H7H B;  3HFK A;  2R8I A;  2IJN A;  2D41 A;  5GVQ A;  1C1B A;  3MMA A;  2CPJ A;  4DDF A;  2RIL A;  1IWG A;  3Q8S B;  1OY6 A;  1VYA A;  1IR0 A;  1WI6 A;  3QO9 A;  2BOP A;  3TAR A;  3AQP A;  2ZH1 A;  1CJT B;  1YKW A;  4FXD A;  2MSS A;  3CCS S;  2P8I A;  3NAH A;  3EGW B;  5KG6 A;  4ZIW A;  1N6Q B;  2DNM A;  1TQL A;  1X4D A;  2VPW B;  4ICL A;  4M5J A;  3RTV A;  3JYT A;  4CYU B;  1TL4 A;  5F8G A;  5D4P A;  2PFD A;  2GFF A;  3MM5 B;  1RGV A;  3MED B;  2HZC A;  2V2V A;  1ZAW A;  1M5H A;  2NQP A;  4R8U B;  3QT5 A;  2A10 A;  2EW9 A;  2B3T B;  3OTD A;  1JWW A;  1UVK A;  4OX8 A;  2EKY A;  4DQP A;  4ECU A;  4C3K A;  5ETL A;  2MQM A;  2JH3 A;  2HHP A;  3N0V A;  4ED7 A;  3W5Y A;  1IJF B;  2YNI B;  1QM9 A;  4CLK A;  2B5J B;  4GO5 X;  1KD1 T;  1CUL A;  1IKY A;  1NDK A;  2DXF A;  3GIJ A;  4NMX A;  2QSW A;  2H1Y A;  1FF2 A;  3R27 A;  3LTO A;  3NXZ A;  4EBE A;  2JC1 A;  4F4X A;  2YKM B;  4ZVG A;  3C6U A;  2YY3 A;  2BBE A;  3T5H A;  1SI9 A;  1X9M A;  2QA4 S;  1HR0 F;  4F36 A;  3ZXW A;  5DM7 Q;  2MEW A;  2XHC A;  2JC0 A;  3HSD A;  3OQ2 A;  4U7C A;  1S9F A;  3M6U A;  2VC1 A;  2BJD A;  2RRA A;  1JLC B;  2K1R A;  2UXD F;  4JI3 F;  1NDP A;  2OEK A;  2QV6 A;  2YWF A;  4FF3 A;  4DCO B;  1SCJ B;  5KFL A;  1X5O A;  4I7F B;  2MB0 B;  1LV5 A;  3W63 A;  2C1E B;  2XNQ A;  1HHT P;  4I0W A;  1ZAV A;  1UWB A;  1I94 J;  2HUR A;  3P5T L;  3OBI A;  3TQE A;  2QMU B;  2N82 B;  2OIH A;  3LPE A;  4R0J A;  2YVS A;  4GMK A;  1RT4 B;  3TYT A;  3C16 A;  4YN3 B;  1K73 T;  3MEE A;  4K0K J;  2H4Y B;  2P9C A;  4H54 A;  2JEF A;  2PFF B;  2KXH A;  2JFD A;  3ZC4 A;  4KGK A;  2WVF A;  3V81 B;  3TWZ A;  2V4Q A;  2V2K A;  5AJ3 J;  1R7I A;  5EX3 A;  3ET6 B;  1YSJ A;  3CGI A;  4QJV A;  1HBN B;  3PR5 B;  4JP8 A;  4DWI A;  1TK5 A;  2G13 A;  2MLX A;  5C2G A;  2ASJ A;  4HI1 A;  3E51 A;  3EZO A;  3ISN C;  1S99 A;  3KLH B;  2DIV A;  1XR5 A;  3VGT A;  1I51 B;  3FCW A;  1BLU A;  3QRP A;  4CO1 A;  1REG X;  2V94 A;  1LW0 B;  2YTC A;  2XBP A;  5E0O A;  4O44 A;  1C0U A;  2WW8 A;  1IBM F;  4NLG A;  2BV3 A;  4X62 F;  3JXO A;  1B0T A;  5DQI A;  4UST A;  2IM2 A;  4DR6 F;  4G1Q B;  2M2B A;  2N7Y A;  2EFP A;  2WTF A;  1TR0 A;  4ES2 A;  4LBH A;  1FX2 A;  2HQI A;  4DMZ A;  2JHE A;  3MI7 X;  4DV6 F;  3MTK A;  5A2Q U;  4IG0 B;  1Y5L B;  1OYD A;  5I3Q A;  3T6B A;  2IVY A;  2POK A;  2ZM6 J;  3QT6 A;  2A6M A;  2GS8 A;  4FXV A;  1K0V A;  4ZPD A;  3HSJ A;  1FA0 A;  5KFT A;  2KM8 B;  4Y65 A;  4OL8 A;  1BWV A;  4KPC A;  2XMV A;  1F9F A;  3M2U A;  3HHN B;  2CQI A;  2HWI A;  2COL A;  5B0G A;  2R7R A;  4PYA A;  5ETO A;  3RBD A;  4ALZ A;  4TNO A;  2Z8Q A;  4B02 A;  5B08 A;  1U26 A;  4YR3 A;  4BS2 A;  3GV7 B;  3AT1 B;  4A8F A;  2GIF A;  1TP7 A;  3QZ8 A;  4F4A A;  4GC7 A;  5IC4 B;  3OTE A;  1HPZ B;  1Q5V A;  3IWL A;  2LYV A;  2QL5 B;  1VBX A;  2J7W A;  1GQE A;  3BKF A;  2DNY A;  3H59 A;  3GSD A;  2IHR 1;  4OFZ A;  1WF0 A;  4FPI A;  2ZHO A;  1HD1 A;  3ILL A;  2LXF A;  2QJ3 A;  4NXM F;  1Q95 G;  2V4R A;  3R5G A;  2HQF A;  1NK9 A;  3GIL A;  3H5Y A;  3MM7 A;  1BQM B;  2M7S A;  1MG7 A;  2ZNY A;  1HNI A;  1X4A A;  5CYJ A;  4PWU A;  4IO1 A;  4OZ5 A;  3X1L B;  2A2C A;  4OYB A;  2G2O A;  1T3N A;  1RTJ B;  4M5I A;  3CDA A;  4M5L A;  1YJU A;  4JI6 J;  2KXN B;  2GJF A;  4DR3 J;  3SSS A;  1SJ4 P;  1FDN A;  1R27 B;  4TXS A;  2BQR A;  3V4I B;  4F2S A;  3V5R A;  2RF2 A;  2KM8 C;  2JEI A;  4ECW A;  2GV1 A;  4BCA A;  5K8M A;  3D3C J;  3DU6 A;  1KQG B;  3DLE B;  3E01 A;  3C15 A;  4RU9 A;  2ZH3 A;  3LUY A;  1YJW S;  5C2C A;  3R97 A;  3W2W A;  3UVJ A;  3HK2 A;  4H4M B;  2OPP B;  2IJR A;  4TQS A;  2BW7 A;  4C6A A;  4HAC A;  1U0H A;  1QVG R;  3MPW A;  4QWE A;  5IT9 Y;  1T8E A;  4KC5 A;  3KJV B;  1KLM B;  2CYY A;  1KN6 A;  1M5K C;  3KG4 A;  4WK3 A;  4TYB A;  1CSJ A;  2AEM A;  4I68 A;  2I5J A;  1KTV A;  1BHN A;  4F3O A;  1YBU A;  1NU4 A;  2Q6C A;  2NRE A;  3MOZ A;  4KBI A;  1C2P A;  4IUF A;  1FDD A;  4ETZ A;  4F8R A;  5L9X A;  2KH9 A;  3Q8P B;  2LDI A;  4AT1 B;  2DNK A;  3LAN A;  1UZH A;  3KFW X;  4KJI A;  2OPS A;  2QLX A;  2FY1 A;  3BEG B;  5KG5 A;  4WTY A;  1VIX A;  3IXQ A;  4MTP A;  5CZX A;  2FJX A;  1HAR A;  3Q23 A;  5KFJ A;  2B56 A;  5KFK A;  2XS5 A;  4PWW A;  4OZ1 A;  3CE8 A;  1RBA A;  4JBC A;  5AXM A;  1N6Q A;  2HHT A;  1NK4 A;  1Y5I B;  1PBU A;  5DET A;  2ROG A;  5EWG A;  1NDL A;  3LWM A;  2MKH A;  2V6A A;  1TU0 B;  3MM5 A;  4PYD A;  3NGD A;  2VQE J;  2XWY A;  3IR5 B;  1DRZ A;  4NLY A;  1T9Y A;  3HCX A;  3MR3 A;  1DTQ B;  3CJ8 A;  4LT6 A;  2XGQ A;  2M88 A;  1RA6 A;  1WTF A;  3E3X A;  1YJN S;  1S1X A;  2XLI A;  5DG8 A;  3SCK E;  4N77 A;  4PXC A;  3AJ1 A;  4ZS6 A;  2J9D A;  3BGR B;  1ZBT A;  4G65 A;  1YRT A;  3R7B B;  1VHF A;  4NLO A;  2IRU A;  5HLF A;  1WAC A;  2HND B;  2RUS A;  4DV2 J;  3KUH A;  4UZC A;  2MZT A;  2ROE A;  1DBD A;  1CS4 A;  3DLL Q;  3I4H X;  3DRS A;  4DR1 F;  5J2Q B;  4D3G A;  4A8K A;  1VRT A;  4WP3 A;  1DQ9 A;  1SQG A;  1EJ7 L;  4ZCL A;  3NCQ A;  2L08 A;  3DGP B;  1Y7P A;  4JI2 F;  3QGP A;  4DX7 A;  2PI4 A;  2YWW A;  4Y2A A;  1TV6 B;  3R1H A;  1RUS A;  1V3S A;  3QJL A;  1LWF A;  1PCA A;  1EET B;  2FUG 9;  2QFJ A;  2KXF A;  2XCA A;  3MAQ A;  2MXY A;  4DOZ A;  1D0E A;  4IG3 B;  1FO1 A;  2R4F A;  3PXG a;  4L6V 3;  2XGP A;  1UL3 A;  3KLE A;  4W98 A;  3IR7 B;  2O1P A;  4ZJL A;  1S6P B;  3W9H A;  3OFG A;  3I6P A;  3AXM A;  3DOK A;  5KT2 A;  5DQG A;  1SL0 A;  2VZ9 A;  1PYO B;  3CCU S;  5FD1 A;  1T0T V;  3KK2 A;  4IDK B;  2BE2 B;  3D1Q A;  2LMI A;  2HHS A;  2DYA A;  4JI1 F;  2IRY A;  3DLG A;  1QAI A;  2VDI A;  3EYZ A;  2CJA A;  2IBK A;  1CPZ A;  2ZOF A;  3T41 A;  2RB7 A;  1GFW B;  4CWB A;  2FLO A;  2QLB B;  3GJQ B;  4X4N A;  4JI0 F;  1HQE A;  4DS4 A;  3SCI E;  3MMJ A;  2BJ7 A;  3MM8 B;  1XMQ J;  3MD3 A;  3OW2 R;  4AYB D;  4UZB A;  3PW7 A;  5F3T A;  5KG2 A;  4JI5 F;  4P9S A;  3HPO A;  3FUY A;  3RGI A;  5GAD U;  3J7A 1;  3EGZ A;  1K1Q A;  3AXK A;  4DN9 A;  4RZR A;  1NXI A;  4F2R A;  1G4C A;  2CNK B;  2VA2 A;  1T02 A;  4GC6 A;  3AB2 B;  1PIE A;  1UKU A;  1HW8 A;  4LRC A;  3VAI A;  2BXJ A;  2R9L A;  4DL3 A;  2E9R X;  2F4F A;  2ZH4 A;  3DN9 A;  1SC6 A;  1YJ9 S;  1R43 A;  4OJH A;  2UXB F;  2MY8 A;  5DO2 A;  1RHR B;  2ZKT A;  3M1V A;  4P7T A;  2JOQ A;  4J37 A;  3GIR A;  1U24 A;  2VKR A;  3Q8R B;  2HFU A;  2CJQ A;  2E44 A;  1OQ6 A;  1FCA A;  4RNM A;  2NYI A;  1UP1 A;  3SCL E;  1VDH A;  2HLU A;  4TY8 A;  4JV5 F;  4KKO A;  2CRL A;  2B6A B;  1NSA A;  1NZ8 A;  4B3O A;  3I5C A;  3JSB A;  5K14 A;  4NYO A;  1RZM A;  3BSN A;  1CQN A;  2RVJ A;  1K9M T;  4RX6 A;  3LQV A;  2DPJ A;  3O3L A;  4QR0 A;  3CCQ S;  3RUB L;  4ZLJ A;  1FDA A;  2B9W A;  2GGP A;  3H5S A;  1X4B A;  5J1E A;  4F26 A;  5CZV A;  1LQ9 A;  2G1D A;  1R0C B;  3LF0 A;  4KB7 A;  4ZVU B;  2EFV A;  4C11 B;  2XYG B;  3BV8 A;  1HW9 A;  3M8R A;  4IH6 A;  1TL1 B;  3PNI A;  2KHD A;  3QZ7 A;  1JNZ B;  2EEY A;  2X7I A;  1S5Z A;  4F04 B;  3LAL A;  4V1A k;  5T41 A;  4DL5 A;  1MSW D;  2W7O A;  4CNZ A;  4ECT A;  3DLH A;  2V8D A;  2CWX A;  4S0M A;  2O66 A;  2DXE A;  3M32 B;  4C3L A;  1ZM9 A;  2UP1 A;  2OEM A;  4FF1 A;  1FFW B;  4X4T A;  1TVR B;  1NK8 A;  1J2V A;  4UQG A;  1F3F A;  2UV8 A;  2RS2 A;  2JNJ A;  2E66 A;  2R7V A;  1QE1 B;  1RAC B;  4ID5 B;  1S4F A;  2J8S A;  2C2D A;  1GMU A;  5HSP A;  1KVK A;  2GO8 A;  4YFU A;  4J9R A;  4C9D A;  2HK2 A;  5CQG A;  2BAN B;  2EFQ A;  1PJ5 A;  1RT3 B;  1TL7 A;  2ZOM A;  1SJ1 A;  2ACY A;  3FFI B;  1WEZ A;  4PQA A;  3CJR A;  4GKJ J;  1RLD A;  1Y5N B;  2YQ3 A;  2MKJ A;  3F44 A;  2G2Y A;  3A3P B;  5F3Z A;  2PO4 A;  5EHH A;  4DV1 J;  5LXY A;  3UE2 A;  2DT9 A;  3ELH A;  5IM0 A;  4ILR A;  3K0J A;  3IGN A;  4NL5 A;  1HQU A;  2UXD J;  4JI3 J;  2XMM A;  3LO3 A;  1WHY A;  4WKR A;  2D9P A;  4FVM A;  4F4W A;  2IBO A;  3RRK A;  1WOO A;  1RTZ A;  4URG A;  3M7V A;  1P9Y A;  1YIT S;  3M05 A;  3B4M A;  2OTL S;  3HHL B;  3HF5 A;  4NCG A;  4O3O A;  3I0S B;  2YWK A;  3KHL A;  3G9C A;  2F8E X;  4W92 B;  3VAK A;  1NJI T;  5IFM A;  3DDI A;  5KFC A;  2EKN A;  4IYQ A;  3CJ0 A;  5D0G A;  1FKP A;  4RU2 A;  4P75 A;  3PYD A;  1S79 A;  2HZA A;  5LOQ A;  4DQI A;  1HNX F;  3QT8 A;  1M5S A;  2D3U A;  4AD6 A; 
#chains in the Genus database with same CATH homology
 2KVQ E;  2MTL A;  2MQ8 A;  4LFC J;  2VQE J;  1XMO J;  4DUY J;  4B3R J;  1XNR J;  1IBL J;  4KYZ A;  4DV1 J;  2UUA J;  1N32 J;  5IWA J;  3OTO J;  3T1H J;  4K0K J;  1HNZ J;  1IBM J;  5A2Q U;  4X62 J;  4OX9 J;  4NXN J;  2ZM6 J;  1XNQ J;  4V1A k;  4LFA J;  1N34 J;  2KL8 A;  2UUC J;  4JI0 J;  4NEY A;  4B3M J;  5AJ3 J;  4AQY J;  4X66 J;  4DR6 J;  4LF7 J;  1HNX J;  4KY3 A;  4LF9 J;  4JI3 J;  2UXD J;  4LFB J;  5IT9 U;  3D3B J;  4JI2 J;  4YHH J;  4NEZ A;  1FJG J;  4DR7 J;  3J80 U;  4DV2 J;  2F4V J;  4JI5 J;  3R2D J;  4NXM J;  3R2C J;  2UU9 J;  4JI7 J;  4JI6 J;  4DR3 J;  2HHH J;  3T1Y J;  2UXB J;  4DV3 J;  4LF5 J;  4LF8 J;  2E5L J;  3J7A N;  2MEW A;  4DR2 J;  3IMQ J;  4YY3 J;  4RJV A;  3JAM U;  4DV5 J;  4DR5 J;  3J81 U;  5BR8 J;  1N36 J;  4B3T J;  1HNW J;  4JI1 J;  4DV6 J;  4DR4 J;  2UXC J;  1XMQ J;  4PWW A;  4DV0 J;  5LM7 E;  3D3C J;  4KHP J;  4DUZ J;  4DV7 J;  1J5E J;  4LF4 J;  1IBK J;  4GKK J;  4HHU A;  4LF6 J;  1I94 J;  2UUB J;  4DV4 J;  4X65 J;  5LMN J;  4X64 J;  4B3S J;  1HR0 J;  4JI4 J;  4DR1 J;  1N33 J;  4JV5 J;  3W1Y C;  5FLX U;  4JI8 J;  4GKJ J;  2VQF J;  5LMU J;  4JYA J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...