2VU5A

Crystal structure of pndk from bacillus anthracis
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
148
structure length
148
Chain Sequence
MEKTFLMVKPDGVQRAFIGEIVARFEKKGFQLVGAKLMQVTPEIAGQHYAEHEEKPFFGELVDFITSGPVFAMVWQGEGVVDTARNMMGKTRPHEAAPGTIRGDFGVTVAKNIIHGSDSLESAEREIGIFFKEEELVDYSKLMNEWIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords NUCLEOSIDE DIPHOSPHATE KINASE
publication title Crystal Structure of the Bacillus Anthracis Nucleoside Diphosphate Kinase and its Characterization Reveals an Enzyme Adapted to Perform Under Stress Conditions.
pubmed doi rcsb
source organism Bacillus anthracis
total genus 43
structure length 148
sequence length 148
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2008-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 2vu5A00
2NCKL 2VU5A 3DDIA 4WBFA 1W7WA 3ZTRA 3VVTA 3VGTA 3NGUA 1JXVA 3L7UA 4ANDA 3BH6B 3FBEA 2CWKA 4W98A 5CABA 3VVUA 2DXDA 3DKDA 1NDCA 2ZUAA 3BBBA 2DXFA 1UCNA 1F6TA 1HLWA 1S5ZA 3G2XA 1WKKA 1U8WA 3Q8UA 1NDKA 1NUEA 1B4SA 1WKLA 3ELHA 1K44A 3ZTSA 4KPCA 3R9LA 3Q8VA 4ANCA 3PRVA 2HURA 4UOHA 1NB2A 3ENAA 2HVDA 2B8PA 1ZS6A 1HHQA 3Q86A 3EVOA 1NDPA 4S0MA 5IOLA 3WX8A 5BXIA 2DYAA 1NLKL 3FC9A 1MN7A 3JS9A 1F3FA 1EHWA 2AZ1A 3FBBA 3Q8YA 2B8QA 3NGRA 1BHNA 1NSPA 3GP9A 2BEFA 3PJ9A 3VGVA 5C7PA 3NGSA 3ZTOA 1S57A 4HR2A 4F4AA 1B99A 3FCWA 4ANEA 2DY9A 4DI6A 3FKBA 4C6AA 1PKUA 2DXEA 3B54A 4EK2A 1NHKL 1KDNA 3EVMA 4DUTA 3EMTA 1NCLA 3MPDA 1WKJA 3B6BA 3Q89A 1NPKA 3Q83A 4FKXA 1NSQA 3VGSA 3FBCA 1LWXA 3EJMA 3ETMA 4F36A 1NDLA 1MN9A 3EVWA 3VGUA 4CP5A 2BX6A 1XIQA 2AZ3A 3EICA 3GPAA 1S59A 1HIYA 4UOGA 1BUXA 4UOFA 5CAAA 3FCVA 4O0NA 3BBFA 4DZ6A 3BBCA 1BE4A 1PAEX 1NSKL 3BH7B 1XQIA 2HVEA 3ZTPA 3EM1A 4FKYA 1VYAA 3ZTQA 3EE3A 3FBFA 1LEOA 4ENOA 3NGTA
chains in the Genus database with same CATH superfamily
1YDLA 4DR3J 2KDOA 3DI6B 3LP2A 2FY8A 3P6YC 4LF6J 2DXDA 3VAFA 4IR9A 1NRKA 2PDAA 3HVTB 1UPPA 2IBOA 1TL7B 5B0GA 2X3GA 5KG7A 3BDEA 2DRBA 2BA9A 2AYBA 1ZA2B 2HG4A 3KWMA 1NZ8A 4DEZA 3HVTA 3JYTA 1U0SA 1TL7A 3OTEA 4ICLA 3IN5A 2DCLA 2MKHA 1NXIA 4MH8A 2W2NP 3W2VA 4UY8T 2JSXA 2O67A 2CQGA 2CQ4A 3KLGB 3R5CA 2LXFA 3EZUA 4CM0A 1YZ6A 3W63A 1BWVA 6FDRA 4PQUA 5KFSA 3KMQA 2AF6A 3HT3A 3DYAB 2RUSA 5KFHA 2DNYA 5FIIA 4C8OA 4Y2KA 4QYRA 2CQCA 3A12A 2YNIB 3MMCB 1IBKF 2JEFA 1H2TZ 4NWBA 1H74A 1RAGB 2E5JA 3HP6A 4OYIA 1CS4B 5L1IA 3VGTA 4LF9J 2YNIA 2XS7A 1YJTA 1RT4B 5GAEU 4GVLA 1IM6A 1CS4A 2C2NA 4ELTA 4YDXA 3NCPA 1HD0A 4YN3B 4O3OA 4DL4A 2XLJA 1WDDA 4RWWA 2MXYA 3VR1A 3DU6A 4DR5J 3M8QB 1NLKL 3R7BB 1YHQS 3GIRA 3TVYA 1T03B 3HJVA 4RPFA 4CO3A 1N33F 2WHOA 4IO1A 1HMVA 2PSZA 3FFIA 2MYFA 1SKRA 4QJVA 1JLBB 3WZ0A 2M8DB 1S4FA 1ZYQA 4GO5X 2YWFA 1FKPB 1QAYA 1FRIA 2YKNB 2KFZA 4KHPF 1JK9B 2R8JA 4M5JA 3LAKA 3VAIA 3H5XA 2FJXA 4QIGA 2WB1D 2DNKA 2CPDA 2YKNA 4C8KA 3MXHP 2QA1A 1D1UA 4X4NA 3K59A 2XMKA 1S48A 1FE0A 1NZAA 2M52A 2B9XA 1N56A 3D7SB 3CJ4A 3MOZA 3O3LA 1SIZA 3T41A 2J9DA 2GQCA 5DM6Q 1IWGA 3PO5A 4FS2A 3VWSA 2QSFA 1XN9A 4OZ1A 3IM9A 2JLFA 4CH0S 1RYRA 3UO0A 2VOPA 2UP1A 3ENQA 2F4VF 3H98A 2HBRB 4YMEA 4WZMA 2YNGB 1RHKB 1NHKL 5KFQA 2KYXA 1AZSA 4K4XA 1CJKB 2U2FA 3IWLA 3NS7B 3AD9C 2XCPA 2WK4A 2LDYA 5KFRA 4EYHB 5KT2A 3CVKA 2EFOA 2YX4A 1FEHA 3PXGa 1K9MT 4QYZJ 1YQHA 2ZJRQ 1CJKA 3MDFA 5C25B 3D0GE 1Q82T 1U45A 2QLWA 3LQVA 4GVBB 4G1QB 3L95X 2HVZA 2C1EB 2YVSA 2EC0A 4KHRA 2P2CB 3R1HA 3G6ES 1W7WA 3CJ8A 2B9WA 2LA6A 4ECQA 2F63A 1WOSA 4QPXA 2FC9A 5EN1A 4DBQA 3IM8A 4JI5J 4Y65A 2KXHA 1NU4A 3MAHA 3DOLB 1AB8A 8ATCB 2ZM6J 5EGYA 4CLPA 3O8WA 3IWNC 4ZLJA 3LGMA 4PUOB 3QLHA 2AJ4A 5DJBA 2XMTA 4OIXA 2RIJA 1NKBA 1RGVA 3TUZC 4OQJA 1U1LA 5KFDA 1QSSA 4PUOA 1JLGB 2ZUGA 5ETSA 4HL9A 1S79A 1S1XB 2H65B 3TEGA 2QTWA 5KG5A 4I68A 1FHTA 3QFWA 1FXRA 4UOGA 3ILJA 4JI4J 2KHDA 4J91A 1F1BB 2QV6A 3BSCA 1SVDA 2CJQA 1PCAA 1S1XA 3T5HA 5J2NA 1HNIA 4OI2A 1KRPA 2NYIA 4DV3J 2W4DA 2VFRA 5IZHA 1LK7A 3U1MA 2HFSA 3MD1A 5C2CA 5L9NA 4ER8A 2BOAA 1B7YB 1NDCA 1K47A 5HROB 5CA5A 4DSIA 4CI0B 1RZMA 3MUVP 2JZ5A 4DR3F 1ZPVA 1RE1B 4LF6F 1YZ7A 2FC8A 4P74A 3PZPA 4RW9B 4C8YA 4I6WA 4OJGA 2ZDOA 3Q8YA 1H2VZ 1W26A 1UEVA 2V4JA 4WFNQ 2AIRB 4RW9A 5LM7E 5FDLB 1IJFB 2UUAJ 1YBAA 2VBWA 1C1BB 1MWQA 4LRAA 3TQEA 4FKXA 4L74A 1SJFA 4EEYA 4DV7J 4TU9A 4ES2A 3GV5B 3HVWA 1C1BA 2B9EA 1S12A 2OUGA 4USMA 4ZIVA 2CPEA 4DX7A 1ZZFA 1VMBA 2KVIA 1K8AT 5IXUA 1X4DA 4FNIA 4DZDA 1MWZA 2I9SA 2A1BA 4NE9C 3KG4A 1RAHB 3W1YC 5GADU 3MR5A 3HCXA 2ASYA 4PXBA 2DH7A 3BN7A 2HVDA 1JKHB 4M5MA 5J1PA 3N01A 5JUMA 1HFEL 4RNNA 4B9UA 2VONA 4YR3A 2CIMA 3IP0A 3MD3A 1YJUA 3OLAA 2QMXA 3PJ9A 3F44A 1VBYA 5KFKA 5AXLA 4F3OA 2DXEA 2LQJA 1W25A 4FF3A 4DR5F 2N4DA 3KYLA 5A8KB 2VFSA 5L8RC 4X62J 4A8YA 2E1MC 2MQMA 2H4YB 3JAMU 4OV1A 4L3KA 2DRDA 2OAUA 1TL4A 4OJ1A 3OFGA 2IA0A 1T9XA 1N34J 4K4TA 1NNDA 2YQ0A 1SB6A 4UZCA 4F3QA 3H4DA 4NZ6A 3PM9A 5CQGA 3W8PA 4U7CA 2D7SA 1Q7YT 1OJ4A 2ZBQA 3OVAA 3K8VA 2M7SA 2FJWA 5EX0A 4ETZA 1HLWA 5DQIA 4DV2J 1EKRA 4EBCA 4M5HA 3WBZA 3P8BB 2JLGA 1SC4B 4UOHA 2V5HG 1NB2A 1CULA 1HHQA 3NNHA 1IR2A 5EWEA 4LF5J 2KHCA 2UUBJ 3UWTA 2M4MA 1VRQC 4B9SA 3NGRA 1TL3B 3F73A 3BJYA 1QSYA 2PFFB 3CMES 5I3UB 3MPUB 3F56A 3I87A 1LXNA 4B02A 3EMTA 4JP8A 1SH3A 3CJRA 8RUCA 1RTHB 3HFKA 5I3UA 3M6UA 4J9UE 2FPHX 4CT8A 3DLGB 2IDEA 1RBOB 2XI2A 1CLFA 2ZNZA 4JI8F 4E98A 3D1QA 1Q4RA 1HBUB 4U8YA 4A8MP 4WYWA 4OX6A 4WP3A 3CJ5A 1S9GA 1IWAA 1NSKL 3DLGA 3OV7A 3JQMA 5SZTA 1A9NB 1QUPA 1JLFB 2VFVA 2J9DE 2ZH2A 3SSQA 3NAIA 2CJ9A 7FD1A 1U24A 3VQTA 4ZLPA 1UP1A 4Y28C 2GJIA 2YNFA 1RWOB 5ETNA 2DHAA 4RW7B 5HP1A 1HBOA 1N5SA 1NDKA 2EFVA 1B4SA 1FX2A 3NXZA 2V68A 4RNOA 3D2WA 4F0MA 4A8XA 1YBTA 5KFOA 3PR5B 4RW7A 1O6XA 1HWLA 2HSEB 3ZZTA 2KJWA 3CDBA 2ZM6F 1Y7PA 2GAHC 4CZCA 4Q0BB 3GLJA 3N28A 2VUGA 5HAOA 1TZ0A 4U9RA 2NUUG 3W9JA 2HGNA 3H59A 4Q0BA 4PYDA 1JJ2R 3V5RA 4BHQA 3MCMA 2KFNA 2DT9A 2YWGA 1SKUB 3GJRB 4ZJQA 5HO4A 2W25A 5B09A 3FK4A 4DSEA 3TAMB 1RT2B 3RW6A 4UUXA 1GTHA 4QR1A 4LRFA 3GE9A 3VALA 3BBBA 2BZ2A 1A6LA 3DCAA 3LANA 4DV3F 3OJUA 1IN0A 2C2OB 1WUUA 3D1OA 4IQXA 4ZOSA 1PYSB 3GR0A 4IH7A 3CCSS 2WSCC 3SMZA 4UY85 1PBAA 2HQCA 3KNAA 3Q2SC 3E3XA 1VFJA 4AD6A 4EMDA 2YKOA 3G4SS 4J37A 2DY9A 4C3MA 1FWPA 1YWXA 3NY0A 1UW9A 1EJ7L 2KXFA 4F2SA 2UUAF 2NR0A 1S6UA 1H6KX 4N7TA 1FFGB 2F8HA 1R3NA 4DV7F 1TL1B 3TNVA 3KK2B 3OTCA 4ZVEA 2YKMB 4V19J 4P2MA 4FZVA 2E66A 2ZITA 4KQZA 4IUFA 1BD6A 1TAUA 4DSJA 2XLKA 4DL6A 2V9KA 3KK2A 2MDAA 1QAIA 2ZBRA 2R2RA 2E1AA 2MKKA 3R2CJ 4X4OA 4MMOA 1VK3A 3TARA 4CNYA 4H4MB 5KTQA 3AQOA 2BKNA 3BGRB 3BN4A 2B8PA 4B3MJ 3TUIC 2GIFA 4MK9A 2F7VA 4A48A 4A8QA 1MN7A 2ZJQQ 3SFUA 4OI1A 1YITS 4B3RJ 1IKVB 3FQLA 2MKIA 1SC1B 4CT9A 3TUJC 1VQOS 2JWNA 4CM2A 3CCES 1RB0A 4J90A 1NDLA 2BE7D 1IKVA 1IKYA 3G71S 1CQMA 4J9SA 1RAFB 2V9WA 3MPVA 3PFOA 4CO4A 2GMHA 1S9EB 3JTPA 4DLGA 2H5IB 3KLFB 2VQEJ 2IY5B 4X62F 4MK7A 3MWBA 5KT5A 2RB7A 1LWFB 1S9EA 3I0SA 1TAQA 2CVIA 3NP5A 4ENOA 5F3ZA 4RNMA 3QT7A 3TZWA 2BRLA 1R89A 2U1AA 1UZDA 5H9EJ 3VF0B 4TNOA 3ILLA 2DHHA 3DFEA 2ZZTA 2YBVA 2MLYA 1CJUB 4PG5A 4U7UD 3H2LA 1IR0A 5B0DA 3K8WA 4M95A 3GMGA 3G8TA 3HSJA 2PN6A 4WF9Q 4DV2F 3A8JA 2N4CA 2RU3A 1SQEA 3MZIA 4NMXA 3CXCR 3WC0A 4LF5F 2CPZA 1NK7A 4HACB 2UUBF 1RT5B 3KTQA 2GFFA 3W8GA 3MM6B 3ZFVA 3BV8A 2HZAA 4K4SA 1R27B 3W5XA 5I3QA 1DTTB 1BUXA 4Y2CA 1RT5A 2JLEA 1VQPS 3I96A 2JFKA 1IJEB 2OI2A 1KTVA 3MM6A 4C3KA 1HNZJ 1PAEX 2ALYB 3BH7B 1RWNB 1DTTA 1NMEB 3BKFA 3GR1A 3PCOB 2O01C 1R8CA 4IO9Q 2QL5B 4ZK7M 4E8UA 3ADAC 3W61A 2VQFJ 1VQ4S 3I9V9 3RRHA 2BV3A 2NUHA 1YIJS 4DV0J 2DGWA 4J9NA 1W2IA 3R7NB 2RKIA 3OHAA 5F8LA 3J80Y 3HFVA 3IC1A 4G3IA 2ZE2B 4FYWB 3WC2A 2P9CA 1U2FA 5KFBA 2V63A 1RTIB 2AV5A 2J5AA 1APSA 3THVA 1UVNA 1GMVA 2H5JB 2CRLA 2ZE2A 4DPUA 3IR5B 3CIZA 3HZGA 4DSKA 2JEIA 1RTIA 1LFWA 6AT1B 2JL9A 1C4AA 4YP3A 3EGNA 3G6YA 2QA4S 5JJBA 4IRCA 2M9KA 4DS5A 2HQIA 2AGPA 2HK3A 4OYZA 1X4GA 2D3ZA 2CQDA 3DLKB 1VGYA 3NCRA 4TLQA 3W66A 2CPHA 3D9BA 2LLZA 2P9EA 3D66A 1P27B 2GGPA 2HMIB 1PC5A 4M1KA 1IKXB 2L9DA 2PGCA 2EKNA 3GB0A 2HWHA 1NB7A 3RB4A 4O23A 3QGGA 2KM8C 1WC4A 4I7FB 3ZTRA 3OL8A 4LF2A 3GFYA 4NLOA 2AW0A 1FDBA 1EIYB 1J5EF 4I7FA 4O44B 4P52A 4FVMA 2C3UA 1R6YA 3UW1A 3HHEA 4P2XA 1HKAA 2EK1A 3M6VA 1WTFA 4W92B 4FF4A 1V3ZA 3P49B 2HLTA 1OQ6A 1AA1B 4F50A 4U6PA 1U48A 4QIWD 1UVJA 5GAHU 4PEOA 3CUNA 4BC7A 4IFVB 5HVGA 1RAIB 4C8NA 2OH2A 5KG6A 2BX6A 5H9FJ 4LR8A 1KC8T 4AFFA 2MLXA 2O5DA 4ILRA 3CNQP 4KYZA 4BC9A 3J7AN 3RGIA 5B0EA 2RU9A 2XHCA 1D3WA 4QWCA 3FMWA 2QLXA 2MQPA 4OZLA 4WIQA 2R2SA 4NLRA 2HHHJ 1FRKA 2VU5A 2YQ3A 1UA0A 1N48A 2V6AA 1EETA 3KK3A 2V8HA 2L3MA 5J2MB 1ZAVA 2W2OP 4WFYA 4CNZA 1I94F 4DV4J 2XGPA 2H3EB 2YPYA 2W4CA 4CLSA 1HBMB 5KG2A 5J2MA 3T1YF 4WYLA 5IQ6A 3CC4S 2QO3A 2LEAA 1BMQB 1BHNA 1HBMA 4PWDA 2ZH7A 3A3OB 3R27A 3M8WA 4B3MF 4K5SA 1N5TA 1CJVA 3R5BA 1EKSA 3KKFA 2IM3A 4X4SA 3QGIA 5H9FK 3CJSA 4OZ0A 2LU1A 4B3RF 1WHVA 3RZAA 4WWSA 2XMWA 2AZ3A 2IVYA 3MCOA 2XNRA 3KJVB 6FD1A 4Y34A 2B7CB 1J27A 1Q1KA 3BQ1A 1TV6B 1RTZA 3NNAA 1RWPB 1TK5A 3KJVA 2RD5C 2QEXS 4PG6A 3BYRA 4DCOB 1HA1A 3EDQB 1LW2A 1GMWD 1NKEA 4JYAJ 1TV6A 3N6MA 1JXVA 3R6LB 2MHEA 1DRZA 4NYOA 2Q43A 3AJ2A 4C97A 2C3MA 1TUGB 2YNHB 2CZ4A 1LK5A 2AX1A 1RHQB 2KKHA 1X31C 4ECYA 2FUG9 5A6PA 3GYGA 2ROEA 5JXSA 2KZZA 1H73A 4S0MA 3OL9A 1WACA 1ZETA 1AW0A 2P6SA 4LSNB 4HH0A 3NWGA 1X4FA 4JI2J 3I0RB 2VICA 3OTDA 3DGVA 1T95A 4PWUA 4UF4A 4DR2J 4ZMMA 2VF3A 2R8KA 3V81A 2WVBA 2RSQA 4R8UB 1PILA 4PRFA 1UFLA 3I0RA 3H25A 2POKA 4DFJA 4Q8EA 1XC9A 3PKMA 4R8UA 4G65A 2BJ8A 3THPA 3MECA 4KH1B 1JLQA 4K2XA 1UVKA 5LJ5Y 1AROP 2E1PA 5AE3A 1HQUB 1C0UB 4DQQA 5T41A 2KT3A 2D1CA 3RU0A 2BW2A 2FLLA 1HNZF 3NGDA 2VODA 1M1GA 2ZUAA 1HQUA 1VQLS 2ZZNA 2XQCA 1C0UA 3C6UA 4LUBA 3P3DA 5GMEA 5K8OA 1FE4A 3DOKB 2R7XA 4DPYA 3ZTSA 1PGZA 1EX8A 4K4WA 4W90B 1WHXA 5IWAJ 1CBKA 2VQFF 3H8YA 4DPOA 3BZQA 4RW8B 3DOKA 4IG0B 2KI2A 2AZ1A 3T6JA 4YUDA 2RDDA 1MG7A 5IC4B 3LPYA 4DV0F 2CZ9A 2ZNYA 3OLBA 4RW8A 2Y1JA 3ET6B 3US5A 3HKZD 1KONA 2DGTA 2EC2A 2F40A 2VBYA 3P96A 2DGUA 4DFPA 1TR0A 2ZWPA 3C6TB 3CGIA 4USVA 3ET6A 5L9XA 3FCVA 4LF7J 2NLWA 4DZ6A 1VLOA 2EEYA 4ELUA 3I56S 3GJTB 2DGSA 2Q3PA 3IG1A 3I9ZA 3OR1B 4QWBA 3VVTA 3D68A 2D41A 3QO9A 5HMZA 3HDSA 4ES3A 1T9VA 2RHQB 3M9NB 4LJMA 4ZVUB 3CJ0A 1I1GA 3M30B 3OVSA 3B82A 5IV3A 2AP6A 4DV1J 5DLFA 3PIOQ 4NCAA 3CO0P 1S1VB 2XSJA 3M8YA 1JB0C 4C2MA 4EBDA 2ZH5A 3M30A 2CADA 4DN9A 2LECA 4K8RA 4XDDA 4MKYA 3IWXA 1Y5LB 3M1VB 5B08A 2CUYA 2GNKA 3KUEA 1TKXA 1EQMA 3CCQS 1C2PA 1SQGA 3IAM9 1JJCB 2IC3B 3M1VA 4ZITA 1RWWB 3V4MA 1S1WB 3MFIA 1QDUB 1HI1A 4LIWA 1FRLA 4DR6J 4X64J 1RYSA 1VYAA 4N47A 1OMSA 1J2VA 1SJRA 1S1WA 2LA4A 5T14A 1DFDA 3K89A 4WBFA 2OPRB 1P9QC 1DQ9A 3UE2A 5CZVA 2V8PA 4USHA 4M5DB 2IDLA 1SKSA 2FIUA 2VBZA 1FDAA 2HHHF 1UWAA 1IBLF 5I4MA 3GG1A 2OPRA 3WIUA 4ANCA 2C28A 2DPIA 2V2KA 4BDPA 4A4JA 2ZKTA 1YKWA 3QATA 4DV4F 1WJ9A 2HZCA 1VR6A 3B8HA 1X5SA 1V9OA 2HS3A 5J1EB 2ZBPA 5HLFB 3EVMA 3ISNC 4KV8A 2MQOA 4LF8J 1VQSA 4Y6IA 4WE1B 1TKZB 2H9ZA 3I31A 5C24B 3PRBA 1JLCA 5HMYA 2LXUA 1U26A 2FB0A 1RT3B 1UW4A 4WE1A 1UETA 2KRBA 5LT5A 2K8GA 1D9AA 1TVRA 1WSVA 3PDNA 3IO1A 3LA0A 1WHWA 2CQIA 2K3IA 4NA3A 4KFBB 2ROPA 2F9JA 4FS1A 2GO9A 4B3TJ 1FDNA 4KFBA 1WKKA 4IFYB 4JYAF 2H54B 5ETMA 1VBKA 4YOEA 3PJXA 1RSCA 4EU0A 4NXNJ 2NPIA 3J81U 3BPDA 2D3O1 2OTJS 1L5UA 1Y00A 2XMUA 2E5GA 2BE2A 1X9MA 5F8HA 9RUBA 5CD4H 1RTJB 1E6VA 1NPKA 2CA9A 3DN9A 1R0CB 2RJZA 4DPTA 1H3DA 4CLLA 3DM2B 1OSDA 4FVCA 4JI2F 4DR2F 3LW5C 1RTJA 3G82A 4AL7A 1NK4A 1NK6A 2GHVC 3GYXB 4NYZA 4PG7A 1JLEA 2L9NA 4KTQA 2FLNA 1BQMA 2FJBB 3H4BA 2OPSA 2IYIA 4Z2XA 2XO7A 2GS8A 5DG9A 4DG1B 2B6AB 1XMQJ 3M9OB 2B5JB 2WCXA 2C2MB 2OTLS 1T7PA 2BACA 5A8RB 3LUYA 2VPYB 4DG1A 2B6AA 3OPKA 2BUNA 2DR8A 5KFWA 3H5SA 5F0WA 2XMMA 5MLCV 2IHR1 3AJ1A 2WTFA 3MEGA 5A8RA 3M8ZA 3MUMP 3W2WB 1S10A 5IT9U 3LO3A 4ED0A 3ZZPA 1QTNB 3K57A 1S1TA 5IWAF 3MEKA 3LOUA 4CH1A 3W2WA 3DLEB 4TXSA 2QFJA 3FBCA 3CCWA 3HVAA 4CLWA 2YX1A 4H4KC 2GIRA 3HT0A 4EGLA 3DLEA 3IRXB 2XBPA 1RLCL 3A13A 2BJDA 4PXDA 3CPWR 1WG5A 3HD2A 4Y2IA 3WHIA 3MURP 3E01B 3QRRA 2AEMA 2G0CA 3IRXA 3CCUS 1MW7A 1WELA 3AD8C 4F25A 3ZNUA 2UUWA 2NS1B 1KHWA 2AEFA 2OMLA 1FRJA 2HRTA 1VBXA 3ULHA 4K4VA 4BBYA 1F3VA 1XNQJ 5M2RA 3LWMA 2X1FA 1T3NA 2NPFA 4LSLB 2BEFA 3L4BC 3HI9A 4QU6A 2NXNA 2B4VA 4DI6A 2E9ZA 4OMFG 1OYDA 4LSLA 3Q2TC 4ID5A 3N5FA 3UVJA 1HWIA 3AAWB 1N0VC 4B3SJ 2PE8A 2HS0A 1HIYA 3TWZA 1AYEA 1GX6A 3R97A 2KN4A 1GTEA 4OHYA 1RWUA 3BF4A 1BE4A 2WW8A 3QRQA 1T94A 1XQIA 3UCUP 5L46A 3C19A 1B7FA 1K0TA 4ATNA 3TYTA 1FK9A 3HHLC 4K4UA 4JV2A 2J76E 5JVHQ 4QR0A 3DRXA 5KFJA 5KG3A 4GKKF 4KGVB 2G2ZA 4XPEA 1SJ3P 2AMCB 1U47A 4ZPBA 1XR7A 4C7QA 5CCMA 2E5LJ 1OS5A 2FQQB 1RCOB 4IH6A 2ZJPQ 1RISA 4YY3F 1VRUB 4N76A 1ZAXA 5BR8F 5F8MA 3JQKA 2GQQA 1B99A 4RW6B 1HBNB 1OIAA 4F67A 1EP4B 1VRUA 4N5SA 1AUSL 4RW6A 2MTLA 4OI6A 4Z37A 4R0EA 3BREA 3CMAS 4Q5VA 1U02A 3M6XA 1RLDA 2FHKA 4LF8F 3RR7A 4I67A 5A2QY 3PYDA 1E6YB 4MAKA 5KFXA 2NCKL 2J0SD 4DUZF 2QMUB 2BQRA 2FD2A 4A8OA 1TUVA 1J5OA 4F0HA 2R9LA 5KFNA 4UOCA 3ZZYA 3A8IA 3DNCA 1U1QA 3JB9k 2AJFE 2WSEC 5DLGA 2F65A 3OSPA 3VAKA 3QSIA 2ZC4A 1DAXA 1YRTA 3KG0A 1N6QA 1S7IA 4JOUA 1L3SA 4NXNF 1MMNA 2CJYB 4JI1J 1FKOB 3UDLA 4J9OA 3ZZZA 3NL0A 3BO4A 5D4LA 4HHJA 2R3VA 2AJ0A 2ABYA 1FKOA 2LVWA 2W24A 4B9LA 4ZVGA 3SEOA 2DISA 4TLRA 2LXIA 3LP1B 2OIHA 4EZ6A 2I5JA 1X60A 3KK1A 3V4IA 3T1HJ 2Z2LA 2V4QA 1HI0P 4WXOA 1KLNA 1IXKA 4Q2MA 3E2EA 1Q5VA 1AFJA 1RA7A 3OT9A 4MIWA 2K1RB 2WSFC 4FXVA 4DPXA 5BJRA 4U96A 1XERA 1FCAA 4KE5A 2GV1A 2I1RA 3JTNA 3P5BP 5HI7A 2DH9A 1HHTP 4QWAA 3FRYA 1SC6A 5D3GB 3O6QA 4GKJJ 5G0RA 2HNZB 3SXLA 4ZKAA 5L1KA 2ZHAA 2ZVSA 2ASLA 4X4RA 2KT5A 2B4PA 5E33A 3OD2A 3HVRA 3V6HA 5D3GA 2CDRB 4B3OB 1Y3JA 1RBAA 3QIPA 3K5MA 1U6FA 2HQGA 3PYFA 4NLDA 2VG6A 4ED6A 1X9SA 2IFXA 4H4OB 1ROFA 2GJ2A 3EZ5A 3HX9A 4B3OA 3HFZB 2N7YA 4KHMA 5RUBA 2OHDA 1X4CA 2Z0GA 4H4OA 3CDAA 4DSFA 3O5TB 3LH2S 2AJ2A 3QZ7A 2MKYA 4RBUA 4J9RA 1VIXA 2PEHA 2QC3A 4R25A 3V6DA 3SCKE 1FD2A 2CXEA 1S4EA 3DMJB 5K9FA 3BO2A 2V8DA 4KIAA 3RB6A 2WBRA 3DMJA 1X0PA 2PIIA 4I2PB 3A3NB 5LMUJ 3AT1B 4DR4J 1FVQA 3CIMA 2LMIA 4WCEQ 1XMOF 3OSNA 3KJQB 1MWYA 3U27A 3S8SA 2RT3A 1KLMB 1IBMJ 1BGXT 1KHVA 2QYCA 4I2PA 2OEKA 2C2KB 2HHTA 2XMVA 2HNYA 3C2PA 3CJKB 1XNQF 2BABA 4F3MA 5GADI 2AT1B 4HT7A 2ZH8A 2BJ7A 4YR2A 2HIQA 4CQ1A 3CJKA 4ZPDA 2XCAA 2AU0A 4ZJOA 3HHDA 5K20B 4XPCA 3BS9A 3OW2R 2XB2D 3DRRB 2DHGA 1F5BA 1ZM4A 1G3OA 1VS3A 4DDFA 4KJIA 1Q78A 2YKAA 2WAQD 3CDEA 3BO3A 1R0AB 1MROB 3DRRA 1A7GE 2R7QA 4KR0B 3MAAA 4N8NA 1R0AA 3UNYA 2JFDA 4ECSA 3GIMA 4YHHJ 3PEHA 2I6WA 2DNMA 4OZNA 3OR2B 3W64A 3S01A 2YH1A 2HFZA 2V69A 2RF2A 1U6BA 1ULRA 1MU2B 5U47A 3OUYA 1FESA 4USTA 1Q8BA 2E5LF 4MFBB 3EGVA 3PYGA 2W1BA 2IM0A 5A8WA 1MU2A 2Y8YA 1JXLA 4ED7A 4Y3CA 3U1NA 1RACB 3GCWP 1OYEA 2CPYA 4MFBA 1MN9A 1S7HA 3GFXA 1XIQA 2DPJA 1U09A 2Y0BB 1RT1B 3U7JA 1TK0A 3RYLA 1RAJA 1WC6A 4KB7A 4K0KJ 4GC7A 5DQHA 1HNWF 3RBXA 3GJQB 3IBWA 3O1LA 3NCQA 1WC5A 1Q0NA 4ZA1A 3LP0B 1RT1A 3SQGB 2VG5B 2IBKA 3MPWA 1SL0A 2CQ3A 5E3RA 3DDIA 3MM8A 3MI7X 1N54B 3PVXA 4W98A 1HNVA 3WIVA 4ZVSB 2IMWP 3UN3A 3FRZA 3SQGA 2VG5A 3SIPB 2IVMA 2J7KA 2XMJA 3HXMA 3G2XA 1PBUA 2MMYA 4RNFA 4P7TA 4PG8A 2EKYA 2JNJA 2HS4A 3Q8QB 5ETKA 1CJTA 1R31A 1RABB 4HHHA 5GMKa 2HRUA 2Z2ZA 3CCTA 4KAIA 4FYYB 4XK8C 5K14A 4UQGA 3IR7B 3KG1A 2VC1A 3UD3P 2Z57B 3POTB 3AXMA 2QLFB 5DM7Q 3PG9A 3PW2A 3MEDB 3PHTA 1KSPA 1UFWA 2RH3A 2DO4A 3TAQA 3POTA 5AXNA 3KLEB 4JI1F 3PV8A 3K5LA 2RDJA 3RG6A 3N79A 1M0SA 1XMBA 3MEDA 1PYOB 1QAXA 3MM7B 1V5VA 2EG1A 1JMTA 3KLEA 3DI6A 1GT8A 4DU8A 3NGTA 1OQ3A 3TO8A 3SCJE 3OBIA 5D78A 3MM7A 4USKA 1VHIA 4Q44A 2R8IA 4M94A 2VZ9A 2NXCA 4K7QA 3T1HF 1KBRA 3PW0A 1LW0B 4OZ2A 5HVHA 2CYYA 3C8YA 3JQJA 2DR7A 5E3PA 2RQ4A 4C0BA 5D0RA 4NXMJ 1LW0A 1SKWA 2QRRA 1QAJA 1VQ6S 3SV3A 3N6NA 4KGKA 3LAMA 2H1YA 2GAGC 3VQSA 3KLGA 2MZQA 2FJAB 2VG7B 2CNKB 2HBQB 3VZHA 4RBTA 2R4FA 3DYAA 3D6FB 2F1FA 2VG7A 1HQEB 3BSOA 1S49A 2CDQA 2JVRA 3RAQA 4ED8A 4M5NA 2HHSA 4TN2A 3D3BJ 4RUAA 3MMCA 2Z56B 1WI8A 3EXYA 1B0PA 3J7YI 5KFPA 2XGQA 4L6V3 1S76D 5HATA 2RE1A 4DL5A 2W4PA 1S6PB 3IFEA 3G86A 4M8LA 3HPOA 1Q16B 4ZVOB 5D4OA 2JJ4D 3TX0A 1RT4A 2P6TA 4O4GB 3H42A 4F0KA 3G8SA 2A10A 1S6PA 3QAUA 2QSWA 4JI6F 1MNEA 5J2QB 3PEJA 1WI6A 3M8QA 2CWXA 4L72B 3HM9A 1T03A 2PI5A 4OFZA 3D1HA 1FD8A 1VLYA 3CO9A 3G6VA 4LF4F 2LEPA 5LMUF 1V3RA 1SI9A 4K4YA 4DR4F 1JLBA 2XS5A 2F9DA 3FKBA 5AJ3J 3DHWC 2V2ZA 1FKPA 2UV8G 1IBMF 5KFTA 3K5OA 2Z58B 3UN5A 3LTOA 3VTIA 1M5VC 1ITPA 2JDJA 4DUYJ 2ACYA 1ZBTA 5BYSA 1RBLA 2RUGA 4YB1P 5CAAA 2Z8QA 5HQLA 2DTJA 3SI8A 3OHBA 2UU9J 3GILA 1BC6A 3BGFA 3A1YG 3ZTQA 4KO0B 1I6JA 3FBFA 1KQSR 4Q8FA 4PG4A 1UL3A 4OHVA 3HSZA 5KFAA 4WU2A 4KO0A 1FEEA 2BR0A 1IM4A 3PNIA 2E7XA 3FEYB 4CDIA 1FI4A 3JSYA 4DL0C 4YHHF 3AFGA 2OD4A 2HAIA 4USWA 2DRAA 5AXKA 1CQNA 1L3UA 2DEJA 2HIYA 4J9QA 1R8BA 2YNGA 4BWMA 1S97A 3B54A 1PJ5A 1VCTA 3NOGA 2MHNA 1HYSB 4L73A 1T11A 4NASA 3AQPA 3DC2A 5C25A 4A8WA 3RUBL 2L08A 1PO6A 5KFGA 4GVBA 4G1QA 1MMLA 3MCSA 2MSTA 5IT4A 4ED2A 3CC7S 4FKYA 3NMAA 3LALA 1UEUA 3NAHA 3R8YA 3D0IE 2PT0A 2UVRA 2ZBIA 4G6VB 4NRTA 4I56A 4K0KF 4HTIA 2YWWA 1ZTWA 2OPPB 3DOLA 5KT7A 4B9NA 3V2UC 3IR6B 4NRUA 1KQKA 3CJTA 2BBEA 3QSYB 5DRKA 3MAQA 2YKPA 3DRPB 2J7UA 2HURA 3HZEA 2I38A 4RX6A 2OPPA 1JNRB 1FJGF 2DNNA 1Y10A 2RMLA 3DRPA 4X4TA 4LFAJ 3OXFA 1JLGA 3CCZA 4O3PA 2W7OA 1SH0A 2BDPA 1NSQA 3BB5A 4ECXA 1S77D 1UJ5A 4OV6A 2J6UA 2FY1A 2QL7B 3VGUA 5C2GA 3PW4A 1ZM2A 1UVMA 3SBMA 2MKJA 2OO4A 1WEXA 3EWGA 1U7LA 1SJ4P 1TK8A 3OTOF 3AHPA 5LL6d 2DY1A 3U1LA 2EBEA 3P4UB 2Q79A 1T9TA 1RKJA 1IQZA 1NH7A 2HNDB 5HROA 4LQ3A 1YI2S 1XJWB 1TQLA 2HNDA 2Q6BA 1R0BG 4DX5A 5J2PB 3Q22A 3QNWB 4DU7A 2XO6A 2W7AA 1YJ9S 4UUWA 4I4BA 5KFLA 4FF1A 4FPRA 4K2JA 4LR7A 5FDLA 4OYAA 3DRSB 3ZTOA 4F4AA 1VRTB 2CJXB 4LRCA 5IT9Y 1U2CA 5DO2A 4A8FA 3BR9A 4NXMF 1P1TA 3O2IA 4DUTA 4AUKA 1S6QB 4P2SA 4HTJA 2QFIA 3G6XA 3TZZA 1VRTA 5ETVA 2JRSA 1WDTA 1SPBP 3QT5A 2MY7A 2ZVIA 3GSDA 5KT4A 4IG3B 4C9DA 3EM1A 2VD3A 4K59A 4NA2A 1P1LA 1B70B 3AOBA 5KG4A 4LF9F 2OP5A 4NLYA 1LV5A 1G6BA 3TP2A 4WPAA 1OPIA 1RHMB 2HFOA 4IG3A 2YXLA 2DXFA 5LMNJ 2DB1A 2R7VA 1K1SA 1N36J 1WTBA 1LKZA 1JKHA 2XLIA 3PJWA 3D67A 3VCDA 3ZZ0A 3MTKA 3DLHA 2H51B 4O4RA 1FFWB 3TZYA 3L7OA 5EX3A 4QWEA 5FLXY 3SCIE 4E0DA 4CWBA 1KVIA 1N5QA 4DN0A 1BQNB 3PIPQ 4DF8A 5A8KA 2BJ1A 2XNQA 4MTPA 2W8KA 2B7BB 2FVSA 1NAQA 1BQNA 2E1CA 4N56A 2DHXA 4NZ7A 2XULA 4CP5A 1ZM3A 2I0XA 3I5BA 5IM0B 1T0TV 2HHPA 2V94A 3EUNA 4W4MA 2ADBA 5LJ3Y 3QJLA 2ZWOA 3ZNJ1 4OI3A 5IM0A 2VFUA 1KKHA 3TJ9A 4DUYF 2ILZA 3Q24A 4J9VA 1S6OA 4HVZA 3GTYX 1IVZA 3OFHA 2NZCA 4NYPA 4KKOB 4CO2A 2BVZA 4ZPCA 3ITHB 4RL1A 4ECZA 3G87A 1RT6B 3M9MB 2AQ4A 4C4WA 2JVOA 3MHYA 1SXLA 1U8WA 2D74B 2DNQA 2V2VA 1B64A 1HPZB 1SCJB 1GXLA 1RT6A 1TMJA 1RI7A 3IXQA 1TL3A 4OHWA 5F9NA 5CYMB 3A8KA 2HRYA 1HPZA 5KFCA 4PR6A 4IKAA 3EXCX 3W3SA 2MGZB 1RTHA 5DDQC 4NLXA 4HHUA 5CYMA 2WB4A 5HANA 2IM1A 2EI5A 5EWFA 1CVJA 1HBUA 5ETPA 1M1KT 2BRKA 2E1RA 2FVRA 3BKUA 2KTQA 1RU2A 1T9WA 1ZZNA 4UQTA 2QL9B 2ASDA 1PJ7A 1JLFA 2OGUA 3MEEB 4QW9A 4ZP6A 1X4BA 4DS4A 1KR4A 3W9IA 2M0GB 5JMNA 5E3QA 4JI5F 4DWIA 3MEEA 3ZXWA 3Q8PB 2VOOA 1XBWA 2DH8A 5E5NA 1KD1T 7AT1B 1U1KA 2KYZA 4F4WA 4ZHRB 1O0PA 3QZ8A 2CJKA 3FSIA 3PX4A 2RS8A 4NLUA 2BYCA 4O3SA 1F9HA 3TA1A 1LNQA 4P2FA 4DOZA 1ICEB 3ETOA 4ANEA 3A4TA 3S7RA 2IRYA 3LGNA 4A8KA 2UUCJ 4V1Ak 4NLQA 1TTHB 4JI4F 1RTDB 2MPUA 4KGMA 2DEIA 2LU2A 3KLIB 3KUGA 2XS2A 1KS2A 3KDNA 4HI2A 5ETTA 4KHPJ 1FRMA 1KNZA 3AA9A 3R5AA 1S1UB 3TAMA 1RTDA 2DNZA 1RT2A 1I3OB 3KLIA 2MKCA 1NSAA 3M05A 2KL8A 3QPIA 2WVCA 1G4CA 3OXLA 3RRGA 3CCJS 2M3DA 4C8MA 2VC0A 3K5PA 4TY8B 2NSCA 2MQLA 3EGZA 1FTRA 2ZZMA 4DPWA 2AGOA 4KBIA 3HMJG 5IT0A 3K0JA 2V67A 3JSRA 2HQ3A 1TKTB 1NK5A 2ZBCA 2KZMA 2V50A 4LBPA 2XZDB 3CULA 4NEZA 1GXTA 3TANA 2RHSB 1DLOB 3CEDA 5E3CA 2E7WA 1FNMA 3H40A 4DL3A 4TU8A 1TKTA 1X5OA 4AXJA 4NI2B 1Z2LA 1BLUA 5L39A 2MB0B 4NLTA 2F4VJ 3L3CA 1VJWA 1ZM9A 1VISA 2W9BB 3GV8B 3SCLE 2R7SA 2LQBA 4NI2A 2OEJA 4RO0A 4ED5A 4PWWA 3D0HE 2J0XA 2W9BA 4LMZA 3BQ0A 3N6LA 1TL1A 3B78A 1Y4ZB 4WP8A 2YKMA 1AUDA 1IUJA 2XSFA 4DMZA 1CC7A 3CD0A 2GIQA 1SV5B 4DV5J 2BOPA 5KFMA 8AT1B 2IVFB 1HW9A 1C0TB 1SV5A 2CWKA 4EZ9A 4H4MA 2IIHA 2W9AA 4EUVA 3BGRA 5B0BA 4JV1A 1RAOA 3DXSX 3ZC4A 5SUHA 1C0TA 1D9FA 2A3JA 3HJFA 4OHXA 1ZS6A 3PTWA 2ROGA 3FCHA 3Q86A 4C11B 5LMNF 1XTZA 3CJ3A 3WX8A 3LGHA 4WFAQ 3MMAB 1RHJB 3NG8A 4O3RA 1SH2A 2DNLA 3BQ2A 3J80U 4C11A 1U1NA 4NMLA 5KAKA 2QYGA 1XNRJ 3MMAA 2FHMA 2ZKUA 2FVPA 2A6OA 1HQ2A 2R7RA 1EB0A 1N34F 2C3YA 3UR0A 4YB7A 3KLFA 3TI0A 1DJ0A 1V5IB 3P45B 4HKQA 4WU3A 1LWFA 4QIFA 5CD4A 4Y0FA 2AJQA 1FDDA 2MQNA 1SL1A 2KO1A 4IOCQ 2GVDB 2HLUA 1R43A 2G1DA 3CCVS 3PO4A 5ETOA 2PC6A 3FBEA 1CJUA 4AXIA 2EVZA 4I6AA 3LP2B 5DDPC 3DRYA 5CCLA 2FDNA 5DZ7A 3SDEB 3IS9B 1R6VA 4AT1B 1P8GA 4OJHA 1WHYA 2JH3A 4Q7AA 1O5JA 4TQSA 2AYGA 2DGQA 4J9LA 1CC8A 2QLJB 1Q5YA 3SDEA 3IS9A 5KG0A 3M8PB 3JYTB 1L3VA 4HACA 3FNNA 3RW7A 2WRMA 2AYMA 4LSZB 1EARA 2E7VA 4IYQA 1T9YA 4ICLB 3QWUA 4LVNP 1WG1A 4ETXA 2J8SA 3M8PA 3W2VB 5CYQB 5KT6A 2X7IA 2RRBA 3DDKA 2XY7A 2VPWB 1F9EB 5CYQA 3Q8SB 4PQUB 4YDDB 3UI3A 2UUTA 1NK9A 2W7PA 3TR5A 4WFXA 4NLWA 1IQTA 1RP5A 3R7SB 1X8DA 2MEWA 4ED4A 2N82B 2I2YA 2C2RA 4N77A 4OX8A 2P8IA 1GXUA 2HYIB 1NJYA 4CLKA 1NUEA 1F0XA 4ZPAA 3IAS9 1H72C 3TVKA 1FJCA 1DZ5A 2DBBA 2FLOA 1TELA 3KOAA 5EHHA 1UTAA 1EHWA 3KHLA 4USUA 3F0NA 3T6BA 4OL8A 2B8QA 1YJNS 3TJAA 1SIWB 5LXRA 4ILLA 3MR6A 1M5HA 1JIHA 1CG2A 4WK3A 5D0GA 3NWRA 1ZA1B 1HMVB 3FFIB 2R42A 5DDOC 2DVIA 4LFCJ 4ECWA 3ETMA 2YWHA 5F8NA 4MT1A 1UPMB 3DLKA 3EPIA 1NPRA 2DJWA 4FXDA 2CG8A 2RS2A 3C15B 2M2BA 3IMQJ 4ZVQB 2DHSA 4O3NA 2HMIA 5D6GA 1IKXA 2APOA 2UUCF 3H2VE 3C15A 1ZTTA 1GAOA 2GHWA 2DO0A 1SBRA 2W2PP 2OELA 1VK8A 3KJFB 1M5PC 1WOPA 1UCNA 3K17A 4O44A 2CJAA 2CPIA 4CO0A 3GFZA 4OLPA 2K7JA 4NA1A 2X1BA 4CLUA 3FGVA 4DJBA 1D09B 2CPFA 5KFVA 1Q79A 4TYBA 4X4QA 3PACA 4DCPB 4X2BA 1NSPA 1NJXA 2AX0A 3IBCB 4HR2A 4GO7X 2IRUA 3I82A 3OFEA 4IFVA 4J9PA 4V19X 1FX4A 3OXGA 2WVFA 2XM3A 2V8VA 4GC6A 1L3TA 1QY7A 1AZSB 1X7VA 4ZCLA 4JI8J 3HSDA 2DNOA 2ZEJA 2LCWA 3T5LA 1DY3A 2B4UA 4FBUA 4KT0C 3GFHA 3M2VB 3D6MB 3K58A 4P72A 3WQPA 1H98A 4DV5F 3CJQA 4ZVTB 3M2VA 4EYIB 3FVYA 4EO6A 3KXDA 2EBGA 2G0IA 4HH1A 3KHHA 3GV7B 2M5YA 3KHRA 4WK1A 1OSCA 3F41A 1Y0HA 4ALZA 3IBFB 3ZZRA 5F0UA 1F60B 3QLHB 5LSOA 1XEZA 2OSQA 3QRPA 1QSLA 1X4AA 4RUBA 1XK8A 4DCJB 4USIA 3EJMA 3CCRS 4IRDA 3M8SA 1XNRF 2M8HA 2VQEF 3W7BA 2E5IA 2RRNA 4CO1A 4QZVB 2F4FA 1CSJA 1URNA 4WTYA 2GZOA 3CF5Q 1FVSA 1FFSB 1QJHA 3L09A 1RKIA 5J2NB 2PO4A 3MUTP 1HNIB 3G8QA 3GG0A 2DNGA 1T05B 4QYZK 1X4HA 2IPOB 2KRRA 3EX7B 3NGUA 3KFWX 3H20A 3GWCA 2B4OA 2YNHA 4YS2A 3UQSA 5CYJA 1T05A 4URSA 3HHKA 3Q8UA 3UCGA 3ELHA 4IDKB 1VDHA 3KMSA 1V6HA 4LSNA 2K3KA 2QMWA 4X65J 3I4PA 5L1LA 1UJ6A 2Q1LA 5ETRA 2DR6A 4ZIWA 1WC0A 4IDKA 5G4DA 3WX4A 3JSMB 2V4JB 4AL6A 3QJJA 2CNOB 4LREA 4L75A 2J9EA 2LQ8A 3Q89A 2HGMA 1U25A 2HHUA 3PW7A 3MPYA 1U1OA 2R8HA 2RVJA 3JSMA 3RB3A 2IYGA 1HARA 4DL2A 2CKWA 1RWVB 3A3PB 2L41A 3BBFA 3ISND 5C5JA 4UTGA 2KG0A 3FZBA 4CRJA 2J9CA 2OFGX 1GQEA 2X1AA 4ERDA 3L7PA 2ZH6A 5BYQA 2C2ZB 2HBZB 3DOMB 1GK8A 3NGKA 2C3PA 1YTYA 3QFHA 2VBXA 2HW3A 2ZHOA 3TQ1A 4IG0A 2OKQA 4GMKA 3DOMA 3IA0A 4RW4B 1X5TA 2CQPA 4DR1J 3R1LA 4HEA9 2B0GA 1VJQA 1B3TA 2G1HA 1YVFA 3QAEA 4RW4A 4CLFA 3DGPB 5GAGU 1LWEB 1KWMA 3C6TA 3OL7A 4CLYA 3HF5A 2ZDPA 1S0NA 1F9FA 4XDCA 2HKEA 3DGPA 3GPAA 2CAJA 1LWEA 1PYTA 1TKDA 3T5KA 2Z30B 1AXQA 4LFCF 2R2TA 4LIRA 2V0NA 3H0PA 2OFHX 3OR1A 2DCUB 4FNHA 2YPZA 2A6MA 1Q8IA 3W5YA 3D6TB 1IBCB 3I4HX 4OYWA 3D54A 1R8HA 4FF2A 1S9FA 2W2MP 3L7UA 4DX8H 1REGX 4RJVA 4ZPVR 1OPZA 3RBZA 3IRWP 3GZ7A 2OMOA 3BEGB 2VHGA 1U49A 3PRVA 2ADCA 1S1VA 1HI8A 3ZO7A 4FYVB 4ELVA 1RK8A 4OYBA 1CULB 5HMXA 3DXBA 4A8SA 5A6WA 4MYTA 4JV5J 2EPIA 4C8LA 4WFBQ 4F02A 1NCLA 3JTOA 5F41A 5FJ4A 2IC3A 1UMJA 2ATCB 2PMHA 1LWXA 1QLNA 3D6HB 1NJWA 1TU0B 1DURA 4R0JA 1BXNA 1DQ8A 1FWLA 1YLXA 3ZZUA 4P6QA 2NXEA 1UA1A 3QYYA 3NEKA 2XC9A 3J7ZT 1LOUA 4TKTA 1NHVA 2SXLA 4P10A 3MR2A 1S9GB 3R2DJ 4ZS6A 2MZTA 4KH0B 4M5DA 4IRKA 3FJ2A 5I42B 1YX2A 1X5PA 1FRHA 4ZLNA 2BKPA 3H5UA 5E2QA 2FZKB 3QQCD 4UT4A 2EXUA 2VJVA 4NCBA 5I42A 3RB0A 1Y5IB 4KPCA 1PC4A 2YNFB 3DDNA 2BKOA 2W01A 5HP1B 1HBOB 3WDOA 1FA0A 4B9TA 2J0QD 3CE8A 4N8OA 4WTOB 1M5OC 2COLA 5J1EA 3JAMY 3Q23A 5C7PA 5HLFA 3VGVA 2Z2YB 1URRA 3EZOA 2ZH9A 4I64A 4CYUB 4C3LA 2EFGA 4C0OC 1UWBB 3H90A 3KUHA 2CG4A 1RADB 1TKZA 5C24A 2V4RA 3C66A 4CYUA 2AGQA 4ECVA 1RT3A 2XYPB 1UWBA 4X4VA 5J1NA 1U1RA 4LFBJ 2UXDJ 3OFFA 2EFQA 3PYEA 4NPOA 2HFVA 5ADZA 2E44A 1MMDA 4ZPTR 4BCAA 3C3LA 2MZRA 5LSLA 2UZAA 3VVUA 4WFZA 1FERA 4IFYA 4HT5A 2N7CA 3EYZA 4E2FB 1GEHA 2CPXA 3HHLD 4ZN3A 2FLPA 1YRUA 3UDVA 4U7UK 1J5EJ 4G1IA 3ISZA 3MF5A 1L3KA 4F4ZA 1D8YA 4PQAA 2KJVA 3H5YA 2UXCJ 2A2DA 1Z1ZA 2K7KA 4Y00A 5LXYA 4X65F 1PKUA 2ZC3A 3FMBA 4OZ3A 1Z2ZA 4M5IA 3DM2A 2BMBA 4J9KA 2DR9A 2DGVA 3G96A 4LRDA 1WG4A 3J7YU 2YX7A 4PPDA 2HGLA 3PKYA 1O8BA 3M32B 4L76A 2IA6A 5GVQA 1WORA 2DIVA 3N4WA 2JC1A 2B5JA 2CQ2A 2G2OA 4ZVRB 2PEBA 1Q86T 1CPZA 3M32A 3HK2A 3PX0A 4OYOA 3W60A 2E9RX 1KOHA 2IM2A 2MLZA 2CQ0A 3R9LA 1G1XA 1I94J 4DFMA 3ENAA 3MOJB 1W2BR 3T1YJ 3HLUA 3TA0A 4DQRA 4RR5A 1LQ9A 1VQ8S 2H48B 3GU0A 2YWEA 3B4DA 3BKTA 3B4MA 5D8HB 2CPJA 3LWLA 5GMDA 1EQ0A 2MSSA 3UFCX 5DGAA 1NH8A 1WKJA 2YQ1A 3VGSA 1UZHA 2VA2A 4DR1F 3M6WA 2B56A 3TEHB 2XZTB 3EDRB 3U02A 2X1GA 3UD5A 4ITSA 4LF7F 1IKYB 4BWJA 1KQGB 1U8SA 4ZVFA 4MKBA 3E01A 4RBVA 2NZ4A 2J8AA 5ETQA 2CVEA 1DBDA 4EWTA 5B0CA 4LR9A 1WNEA 2IAJB 2DITA 3I0SB 3GIJA 1M5SA 3W5ZA 1JJHA 2QLBB 5A2QU 2XWXA 5HJXA 3DKDA 4NEYA 5CZXA 3QWPA 3W62A 4MIBA 2IAJA 3HULA 2OLWA 4DV1F 2L9WA 1LXJA 1ZOTA 5GAEI 1PIEA 1AFIA 2I8EA 3FEZA 1DARA 4TU7A 2M88A 1SL2A 2VKZG 2HK2A 1N5VA 3PR4A 4NLGA 2CQBA 3RRKA 2ALZA 3R5GA 2F5GA 3CD6S 1JXEA 3PRDA 2ZOFA 3R5JB 2KM8B 4JV5F 2HZVA 1KEKA 3A8EA 4PKDB 4QW8A 4DR6F 4X64F 3AOCA 3ZZOA 4O0IA 1VIOA 4DSLA 3TVZA 4WP9A 3ILIA 4RUCA 3DLBA 2MQ8A 3VZIA 4P71A 2J7WA 4MKAA 2AKWB 5F8IA 2GQ2A 2Y8WA 1X0FA 4K50A 1Q53A 4FBTA 1K0VA 2LYVA 2O3DA 1YG0A 3JXOA 3OVBA 5H9EK 1PJ6A 1RWMB 1MSWD 3MM9B 2UVUA 3TUPA 3EVOA 2VKRA 2A2CA 2QG9B 2YH0A 4ES1A 2RKIB 3FC9A 4EI2A 1FRXA 5KG1A 1O51A 2R7TA 1HBNA 4K4ZA 2YKQA 4EBEA 1EP4A 5K8NA 3MM9A 1JWWA 2RAQA 1FTCA 4I69A 4C6AA 3MMJA 1NPPA 3BGLA 3FUYA 3MPDA 1SJ1A 1FXDA 1T8EA 3I5AA 2DNHA 4KC5A 2XMAA 2IRXA 2JX2A 1CEZA 1Q8LA 2DKOB 4KGXB 4RLEA 1DTQB 3VAJA 1Z4UA 1E6YA 1EAYC 2B51A 3GIIA 2JOQA 4KGZB 2WBMA 4PZVA 2GGPB 3N9UC 2NSBA 1U6ZA 3CB4A 4QR2A 3QJPA 2C42A 4LFBF 2UXDF 1DTQA 1VQ9S 1QUVA 1N4LA 4Y2MA 2HWIA 3KLHB 3NLCA 4B3TF 2IJRA 4JUZA 4OZJA 4OHZA 1GH8A 1Q7LB 1TFWA 4AE5A 5KFFA 3KLHA 2MJNA 4DR7J 3SSSA 3NNCA 5IOLA 2DR5A 4TQRA 5D0HA 9ATCB 1ZH5A 1KN6A 2XYHB 5BYRA 2VH7A 1DHMA 2KVQE 3HKWA 2XZWA 2HVIA 1WEZA 2FHJD 2AHOB 2ZOMA 1T3OA 4URGA 1TL5A 2VL1A 5IFMA 2FJEB 3QT8A 3UPFA 2UXCF 1XWLA 4UOFA 2RDIA 3LP1A 2MJUA 2VDIA 2HVEA 2QIFA 3MR3A 3HO1A 3TZXA 1LEOA 1S0MA 3RBEA 2W9CB 2Y1LB 1XMQF 4FN5A 2K1RA 1I5OB 3SYZA 3M8RA 1EETB 4FYXB 3KK3B 3M2RB 2W9CA 3ICLA 3H2UB 3CSKA 3T1AA 3W9HA 1IBLJ 2HNZA 4J7CA 3BSNA 5ETLA 3M2RA 4X84A 5E41A 3THTA 5FD1A 2VIHA 3QBCA 4OX9J 5EDWA 4IOAQ 3T9ZA 1WOOA 4F7VA 4KSEB 2LEBA 4M5LA 3CD7A 2HAFA 2D9PA 4PWDB 2VB6A 2XEXA 2Y9HA 1HWKA 1CJVB 4Q2LA 4JB8B 1VC6A 3EVWA 2MZSA 4X4UA 4M63A 1KVJA 3NS6A 2PMWA 4FPIA 2MKSA 3CDWA 2ERRA 1HR0J 5DS7A 2ZH4A 3VAMA 4XTTA 1JX4A 3UNGC 3TRGA 2R8GA 2C3OA 1KFSA 1LW2B 3RTVA 2NXUA 4PPZA 2P5VA 1S5ZA 3I55S 2CZVC 2VFTA 3GONA 7FDRA 3V6JA 2G13A 4ED1A 1R8AA 1KLMA 2D69A 5K8MA 3FEXB 1QE1B 3BDPA 1HWJA 3BYPA 2W2QP 5F8GA 3NGSA 2JEJA 5LOQA 5HMWA 2MZ1A 3FDSA 4FDFA 1NEEA 1NBEB 2WVDA 1QE1A 3FQKA 2N3OA 1TFYA 2YY3A 3J7Z5 1RWKB 4B3SF 1HNXJ 4OYMA 1YJVA 3V81B 2EFNA 3SZ2A 2HHWA 4QU7A 4ZPWR 2IJFA 1RCXB 1MROA 4ECRA 1FO1A 1JLAB 3M7VA 3MECB 4MYUA 2HQFA 1LWCB 1JLQB 2KB2A 2G9OA 1RA6A 3NOCA 3Q0AA 2WVEA 1JLAA 3CWJA 1I51B 2EK6A 1Y3KA 3EGWB 1LWCA 3OR2A 2V34A 2YWKA 4QOTA 2QE5A 2AYEA 1FNOA 1U0HB 1WEYA 3C6UB 2Y1IA 3RR8A 2D3UA 3UDEA 2P9GA 3K2YA 1UJ4A 1GMWA 5KFIA 3D5MA 1VHFA 4PXCA 2GJFA 2JEGA 1KFDA 3I32A 4LVOP 3FBBA 1U0HA 5HK4A 3UDCA 1VBZA 5HQ8A 3S1TA 2XYGB 1BY9A 2OSRA 1QVGR 3BSAA 1FWKA 2RNEA 2QZ8A 3CDUA 1H38A 3OQ2A 3TA2A 2BQ3A 4F36A 5HQMA 2AEJA 3X1LB 2ZH3A 2HPUA 2G2YA 4JI7J 3MTJA 2Q66A 4WZQA 1FKAF 1ACMB 4KY3A 4F4XA 3LP0A 1WD6A 2R2UA 1OO0B 1U4BA 2G4BA 3EE3A 1D8ZA 4FYDA 5D15A 2KU7A 2PFDA 3NKYA 4NCGB 3IG1B 4TVAB 4KPYA 1RQ0A 5D4NA 5E3AA 4NLVA 3QO9B 3UD4P 4ZVHA 3BR8A 2EWHA 4NCGA 1K44A 4RZRA 1BQXA 1RWXB 2RILA 4ZCKA 5AE1A 2QA4G 2LP4A 3QIDA 4XAKA 1F3FA 2H4WB 4CO5A 3AOAA 4K5RA 2XSJB 5HBMB 1M5KC 1JNZB 1FJEB 4DR7F 1SJQA 2KG1A 1VC5A 1YJWS 1RXOB 2O66A 5HBMA 1H7WA 3BGUA 1M90T 1TKXB 2O1PA 3TW0A 3OL6A 2D9OA 3VAHA 1S0OA 4YQWA 3FSXA 1NM2A 4U67Q 2PA8D 2FZCB 3S6EA 4D3HA 3M4XA 1V3SA 4CH7A 1FXLA 1X4EA 2KT2A 1RJJA 1ZAWA 2E5HA 2FZGB 1M1HA 3M2UB 4BLGA 3OJSA 2OD6A 2UVVA 2C22A 5AE2A 4GKKJ 2NXJA 1VC0A 4C8ZA 5MAOA 4OI4A 4H54A 4GKJF 5B0AA 1N0UA 3M2UA 2GMJA 1GX5A 3QT6A 4HDHA 2B43A 2J6TA 2W8LA 2JC0A 4QIEA 4TYAA 4YY3J 3AB2B 3GP9A 2GX8A 1H2UX 5D77A 2DD8S 5BR8J 2XY5A 1F2HA 4X4PA 1KDNA 4DQSA 2DNPA 2AD9A 3GQCA 5F9LA 4OX9F 1GNKA 4JI0J 5KFUA 1MLAA 2FGOA 4B08A 1HQEA 4ZJLA 4KV8B 1WF1A 4F4YA 2Y1RI 1SQFA 1T02A 5K8PA 1JJ4A 1JLCB 2FTRA 1NJZA 2RQMA 1OY6A 2WZ1A 4PYAA 3ENVA 4D3GA 1TVRB 4ZP9A 4NOHA 4WJBA 4PAAA 3QGHA 4ED3A 2R7OA 3QGPA 4O4GA 1HR0F 4X66J 5AT1B 4DUZJ 3K5NA 1QVFR 5J2QA 4LBIA 4LF1A 1WKLA 2VASA 5A76A 2HHVA 2RRAA 4YB5A 1NDPA 3NS5A 2Z2MA 1KVKA 4RNHA 4CCHA 2HVHA 1WC3A 5M2UA 3CC2S 2WW4A 3FSYA 4QIVA 4QWDA 4H4KA 2R7WA 2FJVA 1G2EA 1S0VA 5HSPA 2BE2B 3R6GB 4WKRA 4DXLA 1KTQA 3AJDA 1E6VB 1N52B 1WC1A 2Z4PA 4G1PA 3C46A 1OY8A 2GVZB 4HYKA 1U1PA 3K7RA 3MM5B 2UXBJ 3G82B 4DQPA 1Q81T 1HNXF 3AY0A 4PCQA 2OPQB 2JHEA 5DZ6A 2FJDB 2FGCA 3SV4A 2LFVA 2GVZA 2HFUA 2AWZA 3MM5A 1JLEB 3IGVA 3GJSB 4Y2AA 4MK8A 1BQMB 3BPSP 1DQAA 2BXJA 2OPSB 5HL7Q 4WXWA 2OPQA 1NO8A 1X9WA 3PX6A 4B9MA 1F6TA 3RJMB 3BM7A 1R8PA 1T9UA 2ZHBA 1GMUA 4Q45A 1RUSA 4OZ5A 1WF0A 4MJKA 2CNLB 5DG7A 2ATLA 1QTMA 4WIIA 2QA2A 4U8VA 5E7OB 3MEGB 2BJEA 3SFGA 1JQGA 1TMMA 2V2QA 2ZFHA 2DK2A 4ECUA 3CD5A 4DQIA 1HYSA 1IKWB 3DHXA 2C2EA 4HDGA 1S1TB 3HHLB 1HHSA 4EFAC 4LBHA 1IKWA 2B3TB 4ZP8A 1TUWA 4TY9A 4JI3J 4DLEA 1UFKA 3HHLA 1S99A 1RHUB 2ZOGA 2OEMA 3RBDA 1Y11A 3OTBA 1F2GA 1YGYA 5B0FA 2HHQA 3T3FA 4M5GA 4JI7F 2FVCA 4I2QB 1YK9A 4OI0A 3R3TA 4LT6A 2CFXA 2J0WA 1VI7A 4OX7A 5DQGA 2GMLA 1ZPWX 2BE9B 2QJ3A 4QBUA 2UV8A 3AH6A 4NL5A 4I2QA 3J81Y 2BW7A 4HI1A 3RAXA 2EG2A 2IJNA 2IMOA 2ZD1B 2FHOB 5BXIA 1XMOJ 2BM0A 2VV5A 4U95A 2VA3A 4F2RA 2DGXA 3J81j 2ZD1A 4ILMA 3AB4B 1D9DA 2XY6A 4URQU 5FLXU 2CNNB 3KLVA 3T9NA 2OJ3A 2CQ1A 2ACMA 1NK0A 1RT7B 2PMZD 2BJ9A 1K1QA 1IR1A 3JSBA 1D0EA 4ID5B 3EICA 2HWTA 3UVJB 1KQFB 4HLBA 2PA3A 4DV6J 3R5DA 4ZP7A 5KFYA 1RT7A 3I6PA 4ECTA 2A0FB 5M2PA 4ZN1A 1VQNS 5KOWA 1UKUA 3D4JA 4NX9A 1PG5B 5HN0A 2GHPA 5F8JA 1FK9B 1UVIA 1N32J 5DETA 5D4PA 2QT7A 5J2PA 2F8MA 5JVGQ 4RWXA 3UCZP 2ZH1A 1BWEA 1SUQB 4ZVPB 3DRSA 2WOMB 3GYNA 2GA7A 2BANB 1SUQA 2KH9A 3N0VA 3QMQA 1S6QA 1YJRA 4ID8A 2A18A 2WOMA 1FJ7A 1UVLA 3C16B 3B6BA 5E0OA 1QD1A 3L9ZA 2VDHA 2BANA 2E9TA 2G0JA 3AD7C 4OYXA 5GAHI 1HD1A 3C16A 2XI3A 5KFEA 2NREA 2FVQA 3DU5A 5HJYA 2LQ9A 2HHXA 1NHUA 3BGOP 4JI0F 4P75A 3N5BA 2LDIA 3AXKA 3VV2B 5B7WA 4MKVA 1HNWJ 4WKYA 3GSIA 3LF0A 1REVB 5L38A 2KXNB 2K06A 4JBCA 4AQYJ 4CIOA 1N5YB 4R5PB 3BH6B 1H0HB 5A0YB 2GO8A 3TX8A 5DG8A 1REVA 4NLSA 1J5OB 1N5YA 4R5PA 4NLPA 5A0YA 3T5JA 2N3LA 4QPTA 4X66F 3KJNB 1XR6A 3IGNA 1U1MA 2HBYB 4C98A 3G9CA 5DGBA 5K5MA 4PXEA 2RQCA 5H1SV 1RAAB 4GRSA 5AJ3F 5CHCB 3NRBA 1N6QB 5D0EA 4BS2A 2DIUA 1VQ7S 2MY8A 4P73A 2BJ3A 4RKUC 5KT3A 4IH5A 3I5CA 4C48A 5LSRA 3GCXP 2UU9F 1P9YA 3BBCA 4PABA 4Q43A 4OJ3A 3CCMS 2EFPA 4KKOA 1KP6A 1HWUA 2K2PA 3ITHA 3EPGA 1HL6A 2I5JB 3PY8A 2UXBF 3KK1B 3T19A 3V4IB 4MIAA 2E29A 5THWA 1WF2A 1SC3B 4I6YA 4XIUA 2NYHA 3AA8A 3MFHA 4QCLA 3GIKA 5L1JA 2CQHA 1XR5A 2J6SA 4F4KA 1OY9A 4QQBA 2NQPA 3CJ2A 4J9MA 2MGZA 3E8OA 5G0RB 2ASJA 5KOXA 4IQMA 4LQ9A 3TJ8A 2B9YA 3KHGA 4I1TA 3FCWA 1VQYA 4A47A 3ILOA 4EK2A 4DHVA 3QIPB 1C4CA 4IOBA 2YTCA 4DL7A 4DFKA 2VG6B 3P5TL 4YR0A 3O44A 3NBPB 1IBKJ 1Y9OA 4B17A 4YB6A 1YSJA 4Z7CA 1PSDA 3E51A 5EWGA 5C42B 2XTJP 3CTRA 4UZBA 3NBPA 3CCLS 1N8RT 3TOQA 1RDRA 4JI3F 2XWYA 3V6DB 5C42A 3D28A 4KRWA 4M5KA 4JV0A 1Q8KA 4OYPA 4RUHA 3MGJA 2X3DA 1YBUA 3HHNB 5IV4A 5F3TA 2FHJA 3UR3C 2QX0A 3CW2C 4F26A 1P6TA 1WSRA 4FXWA 1YJ7A 3D3CJ 4ZHRA 3AODA 1RHRB 1N33J 4JI6J 2F3JA 2MQQA 3J7A1 3VAGA 3JS9A 4LFAF 1R7IA 4B9VA 2HFNA 4RU9A 2H5EA 1NKCA 1RAEB 4LF4J 5KFZA 1Q95G 2HNYB 1H7XA 1PAUB 4F04B 4XO0A 1QM9A 5CH7B 1A0OB 2BM1A 2KFYA 1S1UA 3LPEA 3PW5A 4ZCMA 1FNXH 5EUHA 4C0HA 2ILYA 1ELOA 3MCNA 1YRXA 5GAGI 4Z7YA 2D3OR 4CLTA 4N41A 4DV6F 2R7UA 4TY8A 4A46A 3DLJA 1S72S 2X51A 3PHEA 4ZLLA 4LRBA 2F8EX 4DX6A 5CABA 3SQOP 2LKZA 3MAAB 3ONQA 3VHQA 4OLOA 2QGFB 1DLOA 3KDOA 2QN6B 1F5CA 3RAMA 1K73T 4IR1A 1N32F 3V6KA 4P9SA 1G7CB 4I0WA 5I3PA 5CXTA 2VPZB 3NMRA 4CLZA 2CJBA 1VOMA 4EO8A 3HSGA 2FYXA 2RF2B 2Y0SD 3UN2A 2EW9A 5AXMA 3OUYB 2L48A 2M70A 3KNGA 1HW8A 2HEKA 5IQQA 2HQDA 2MZJA 2Q6CA 1NJIT 3Q83A 5A8WB 3MMBB 4UW2A 1B0VA 1AT1B 4AL5A 3C14B 1S59A 3TAPA 4YEAA 1B0TA 3Q8RB 3FZ2A 4O3QA 1C1CB 1EZZB 1WWHA 1TP7A 3MMBA 4USJC 3CMQA 2UVWA 4J5OA 3C14A 1Y5NB 4CTAB 1C1CA 5ITHA 4L3NA 1VQKS 4ANDA 2Y3YA 2V8GA 2BQUA 4CTAA 3MM8B 3MR7A 2AJ1A 1N36F 3W65A 3ENWA 1OWXA 2WONB 1HNVB 4F8RA 3HD1A 4AQYF 3Q8VA 2PD1A 2PI4A 4FP9A 2RQKA 4NZ0A 1RU1A 2VPXB 2WONA 2XHWA 1N88A 2DYAA 1FJGJ 3SSRA 1FT8A 4RU2A 1CJTB 4ZDNA 5T7LB 1S57A 2C2DA 1VQ5S 3X3UA 2XG8A 1UEKA 1FF2A 1U2RA 2GCFA 1VQMS 2GC8A 5K14B 3CT9A 5T7LA 2GW8A 1NK8A 5DDRC 5HVFA 2DNRA 5IS2A 3DLLQ 4O0NA 4ZCIA 1UAWA 2LQ5A 2DGOA 2GVDA 4P7VA 4AYBD 1KOOA 3OTOJ 3ZTPA 5IC6B 3H7HB 1GFWB 4DF4A 1F5AA 1LFPA 3PFEA 4YFUA 2VJUA
chains in the Genus database with same CATH topology
2NCKL 2VU5A 3DDIA 4WBFA 1W7WA 3ZTRA 3VVTA 3VGTA 3NGUA 1JXVA 3L7UA 4ANDA 3BH6B 3FBEA 2CWKA 4W98A 5CABA 3VVUA 2DXDA 3DKDA 1NDCA 2ZUAA 3BBBA 2DXFA 1UCNA 1F6TA 1HLWA 1S5ZA 3G2XA 1WKKA 1U8WA 3Q8UA 1NDKA 1NUEA 1B4SA 1WKLA 3ELHA 1K44A 3ZTSA 4KPCA 3R9LA 3Q8VA 4ANCA 3PRVA 2HURA 4UOHA 1NB2A 3ENAA 2HVDA 2B8PA 1ZS6A 1HHQA 3Q86A 3EVOA 1NDPA 4S0MA 5IOLA 3WX8A 5BXIA 2DYAA 1NLKL 3FC9A 1MN7A 3JS9A 1F3FA 1EHWA 2AZ1A 3FBBA 3Q8YA 2B8QA 3NGRA 1BHNA 1NSPA 3GP9A 2BEFA 3PJ9A 3VGVA 5C7PA 3NGSA 3ZTOA 1S57A 4HR2A 4F4AA 1B99A 3FCWA 4ANEA 2DY9A 4DI6A 3FKBA 4C6AA 1PKUA 2DXEA 3B54A 4EK2A 1NHKL 1KDNA 3EVMA 4DUTA 3EMTA 1NCLA 3MPDA 1WKJA 3B6BA 3Q89A 1NPKA 3Q83A 4FKXA 1NSQA 3VGSA 3FBCA 1LWXA 3EJMA 3ETMA 4F36A 1NDLA 1MN9A 3EVWA 3VGUA 4CP5A 2BX6A 1XIQA 2AZ3A 3EICA 3GPAA 1S59A 1HIYA 4UOGA 1BUXA 4UOFA 5CAAA 3FCVA 4O0NA 3BBFA 4DZ6A 3BBCA 1BE4A 1PAEX 1NSKL 3BH7B 1XQIA 2HVEA 3ZTPA 3EM1A 4FKYA 1VYAA 3ZTQA 3EE3A 3FBFA 1LEOA 4ENOA 3NGTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NCK L;  2VU5 A;  3DDI A;  4WBF A;  1W7W A;  3ZTR A;  3VVT A;  3VGT A;  3NGU A;  1JXV A;  3L7U A;  4AND A;  3BH6 B;  3FBE A;  2CWK A;  4W98 A;  5CAB A;  3VVU A;  2DXD A;  3DKD A;  1NDC A;  2ZUA A;  3BBB A;  2DXF A;  1UCN A;  1F6T A;  1HLW A;  1S5Z A;  3G2X A;  1WKK A;  1U8W A;  3Q8U A;  1NDK A;  1NUE A;  1B4S A;  1WKL A;  3ELH A;  1K44 A;  3ZTS A;  4KPC A;  3R9L A;  3Q8V A;  4ANC A;  3PRV A;  2HUR A;  4UOH A;  1NB2 A;  3ENA A;  2HVD A;  2B8P A;  1ZS6 A;  1HHQ A;  3Q86 A;  3EVO A;  1NDP A;  4S0M A;  5IOL A;  3WX8 A;  5BXI A;  2DYA A;  1NLK L;  3FC9 A;  1MN7 A;  3JS9 A;  1F3F A;  1EHW A;  2AZ1 A;  3FBB A;  3Q8Y A;  2B8Q A;  3NGR A;  1BHN A;  1NSP A;  3GP9 A;  2BEF A;  3PJ9 A;  3VGV A;  5C7P A;  3NGS A;  3ZTO A;  1S57 A;  4HR2 A;  4F4A A;  1B99 A;  3FCW A;  4ANE A;  2DY9 A;  4DI6 A;  3FKB A;  4C6A A;  1PKU A;  2DXE A;  3B54 A;  4EK2 A;  1NHK L;  1KDN A;  3EVM A;  4DUT A;  3EMT A;  1NCL A;  3MPD A;  1WKJ A;  3B6B A;  3Q89 A;  1NPK A;  3Q83 A;  4FKX A;  1NSQ A;  3VGS A;  3FBC A;  1LWX A;  3EJM A;  3ETM A;  4F36 A;  1NDL A;  1MN9 A;  3EVW A;  3VGU A;  4CP5 A;  2BX6 A;  1XIQ A;  2AZ3 A;  3EIC A;  3GPA A;  1S59 A;  1HIY A;  4UOG A;  1BUX A;  4UOF A;  5CAA A;  3FCV A;  4O0N A;  3BBF A;  4DZ6 A;  3BBC A;  1BE4 A;  1PAE X;  1NSK L;  3BH7 B;  1XQI A;  2HVE A;  3ZTP A;  3EM1 A;  4FKY A;  1VYA A;  3ZTQ A;  3EE3 A;  3FBF A;  1LEO A;  4ENO A;  3NGT A; 
#chains in the Genus database with same CATH topology
 1YDL A;  4DR3 J;  2KDO A;  3DI6 B;  3LP2 A;  2FY8 A;  3P6Y C;  4LF6 J;  2DXD A;  3VAF A;  4IR9 A;  1NRK A;  2PDA A;  3HVT B;  1UPP A;  2IBO A;  1TL7 B;  5B0G A;  2X3G A;  5KG7 A;  3BDE A;  2DRB A;  2BA9 A;  2AYB A;  1ZA2 B;  2HG4 A;  3KWM A;  1NZ8 A;  4DEZ A;  3HVT A;  3JYT A;  1U0S A;  1TL7 A;  3OTE A;  4ICL A;  3IN5 A;  2DCL A;  2MKH A;  1NXI A;  4MH8 A;  2W2N P;  3W2V A;  4UY8 T;  2JSX A;  2O67 A;  2CQG A;  2CQ4 A;  3KLG B;  3R5C A;  2LXF A;  3EZU A;  4CM0 A;  1YZ6 A;  3W63 A;  1BWV A;  6FDR A;  4PQU A;  5KFS A;  3KMQ A;  2AF6 A;  3HT3 A;  3DYA B;  2RUS A;  5KFH A;  2DNY A;  5FII A;  4C8O A;  4Y2K A;  4QYR A;  2CQC A;  3A12 A;  2YNI B;  3MMC B;  1IBK F;  2JEF A;  1H2T Z;  4NWB A;  1H74 A;  1RAG B;  2E5J A;  3HP6 A;  4OYI A;  1CS4 B;  5L1I A;  3VGT A;  4LF9 J;  2YNI A;  2XS7 A;  1YJT A;  1RT4 B;  5GAE U;  4GVL A;  1IM6 A;  1CS4 A;  2C2N A;  4ELT A;  4YDX A;  3NCP A;  1HD0 A;  4YN3 B;  4O3O A;  4DL4 A;  2XLJ A;  1WDD A;  4RWW A;  2MXY A;  3VR1 A;  3DU6 A;  4DR5 J;  3M8Q B;  1NLK L;  3R7B B;  1YHQ S;  3GIR A;  3TVY A;  1T03 B;  3HJV A;  4RPF A;  4CO3 A;  1N33 F;  2WHO A;  4IO1 A;  1HMV A;  2PSZ A;  3FFI A;  2MYF A;  1SKR A;  4QJV A;  1JLB B;  3WZ0 A;  2M8D B;  1S4F A;  1ZYQ A;  4GO5 X;  2YWF A;  1FKP B;  1QAY A;  1FRI A;  2YKN B;  2KFZ A;  4KHP F;  1JK9 B;  2R8J A;  4M5J A;  3LAK A;  3VAI A;  3H5X A;  2FJX A;  4QIG A;  2WB1 D;  2DNK A;  2CPD A;  2YKN A;  4C8K A;  3MXH P;  2QA1 A;  1D1U A;  4X4N A;  3K59 A;  2XMK A;  1S48 A;  1FE0 A;  1NZA A;  2M52 A;  2B9X A;  1N56 A;  3D7S B;  3CJ4 A;  3MOZ A;  3O3L A;  1SIZ A;  3T41 A;  2J9D A;  2GQC A;  5DM6 Q;  1IWG A;  3PO5 A;  4FS2 A;  3VWS A;  2QSF A;  1XN9 A;  4OZ1 A;  3IM9 A;  2JLF A;  4CH0 S;  1RYR A;  3UO0 A;  2VOP A;  2UP1 A;  3ENQ A;  2F4V F;  3H98 A;  2HBR B;  4YME A;  4WZM A;  2YNG B;  1RHK B;  1NHK L;  5KFQ A;  2KYX A;  1AZS A;  4K4X A;  1CJK B;  2U2F A;  3IWL A;  3NS7 B;  3AD9 C;  2XCP A;  2WK4 A;  2LDY A;  5KFR A;  4EYH B;  5KT2 A;  3CVK A;  2EFO A;  2YX4 A;  1FEH A;  3PXG a;  1K9M T;  4QYZ J;  1YQH A;  2ZJR Q;  1CJK A;  3MDF A;  5C25 B;  3D0G E;  1Q82 T;  1U45 A;  2QLW A;  3LQV A;  4GVB B;  4G1Q B;  3L95 X;  2HVZ A;  2C1E B;  2YVS A;  2EC0 A;  4KHR A;  2P2C B;  3R1H A;  3G6E S;  1W7W A;  3CJ8 A;  2B9W A;  2LA6 A;  4ECQ A;  2F63 A;  1WOS A;  4QPX A;  2FC9 A;  5EN1 A;  4DBQ A;  3IM8 A;  4JI5 J;  4Y65 A;  2KXH A;  1NU4 A;  3MAH A;  3DOL B;  1AB8 A;  8ATC B;  2ZM6 J;  5EGY A;  4CLP A;  3O8W A;  3IWN C;  4ZLJ A;  3LGM A;  4PUO B;  3QLH A;  2AJ4 A;  5DJB A;  2XMT A;  4OIX A;  2RIJ A;  1NKB A;  1RGV A;  3TUZ C;  4OQJ A;  1U1L A;  5KFD A;  1QSS A;  4PUO A;  1JLG B;  2ZUG A;  5ETS A;  4HL9 A;  1S79 A;  1S1X B;  2H65 B;  3TEG A;  2QTW A;  5KG5 A;  4I68 A;  1FHT A;  3QFW A;  1FXR A;  4UOG A;  3ILJ A;  4JI4 J;  2KHD A;  4J91 A;  1F1B B;  2QV6 A;  3BSC A;  1SVD A;  2CJQ A;  1PCA A;  1S1X A;  3T5H A;  5J2N A;  1HNI A;  4OI2 A;  1KRP A;  2NYI A;  4DV3 J;  2W4D A;  2VFR A;  5IZH A;  1LK7 A;  3U1M A;  2HFS A;  3MD1 A;  5C2C A;  5L9N A;  4ER8 A;  2BOA A;  1B7Y B;  1NDC A;  1K47 A;  5HRO B;  5CA5 A;  4DSI A;  4CI0 B;  1RZM A;  3MUV P;  2JZ5 A;  4DR3 F;  1ZPV A;  1RE1 B;  4LF6 F;  1YZ7 A;  2FC8 A;  4P74 A;  3PZP A;  4RW9 B;  4C8Y A;  4I6W A;  4OJG A;  2ZDO A;  3Q8Y A;  1H2V Z;  1W26 A;  1UEV A;  2V4J A;  4WFN Q;  2AIR B;  4RW9 A;  5LM7 E;  5FDL B;  1IJF B;  2UUA J;  1YBA A;  2VBW A;  1C1B B;  1MWQ A;  4LRA A;  3TQE A;  4FKX A;  4L74 A;  1SJF A;  4EEY A;  4DV7 J;  4TU9 A;  4ES2 A;  3GV5 B;  3HVW A;  1C1B A;  2B9E A;  1S12 A;  2OUG A;  4USM A;  4ZIV A;  2CPE A;  4DX7 A;  1ZZF A;  1VMB A;  2KVI A;  1K8A T;  5IXU A;  1X4D A;  4FNI A;  4DZD A;  1MWZ A;  2I9S A;  2A1B A;  4NE9 C;  3KG4 A;  1RAH B;  3W1Y C;  5GAD U;  3MR5 A;  3HCX A;  2ASY A;  4PXB A;  2DH7 A;  3BN7 A;  2HVD A;  1JKH B;  4M5M A;  5J1P A;  3N01 A;  5JUM A;  1HFE L;  4RNN A;  4B9U A;  2VON A;  4YR3 A;  2CIM A;  3IP0 A;  3MD3 A;  1YJU A;  3OLA A;  2QMX A;  3PJ9 A;  3F44 A;  1VBY A;  5KFK A;  5AXL A;  4F3O A;  2DXE A;  2LQJ A;  1W25 A;  4FF3 A;  4DR5 F;  2N4D A;  3KYL A;  5A8K B;  2VFS A;  5L8R C;  4X62 J;  4A8Y A;  2E1M C;  2MQM A;  2H4Y B;  3JAM U;  4OV1 A;  4L3K A;  2DRD A;  2OAU A;  1TL4 A;  4OJ1 A;  3OFG A;  2IA0 A;  1T9X A;  1N34 J;  4K4T A;  1NND A;  2YQ0 A;  1SB6 A;  4UZC A;  4F3Q A;  3H4D A;  4NZ6 A;  3PM9 A;  5CQG A;  3W8P A;  4U7C A;  2D7S A;  1Q7Y T;  1OJ4 A;  2ZBQ A;  3OVA A;  3K8V A;  2M7S A;  2FJW A;  5EX0 A;  4ETZ A;  1HLW A;  5DQI A;  4DV2 J;  1EKR A;  4EBC A;  4M5H A;  3WBZ A;  3P8B B;  2JLG A;  1SC4 B;  4UOH A;  2V5H G;  1NB2 A;  1CUL A;  1HHQ A;  3NNH A;  1IR2 A;  5EWE A;  4LF5 J;  2KHC A;  2UUB J;  3UWT A;  2M4M A;  1VRQ C;  4B9S A;  3NGR A;  1TL3 B;  3F73 A;  3BJY A;  1QSY A;  2PFF B;  3CME S;  5I3U B;  3MPU B;  3F56 A;  3I87 A;  1LXN A;  4B02 A;  3EMT A;  4JP8 A;  1SH3 A;  3CJR A;  8RUC A;  1RTH B;  3HFK A;  5I3U A;  3M6U A;  4J9U E;  2FPH X;  4CT8 A;  3DLG B;  2IDE A;  1RBO B;  2XI2 A;  1CLF A;  2ZNZ A;  4JI8 F;  4E98 A;  3D1Q A;  1Q4R A;  1HBU B;  4U8Y A;  4A8M P;  4WYW A;  4OX6 A;  4WP3 A;  3CJ5 A;  1S9G A;  1IWA A;  1NSK L;  3DLG A;  3OV7 A;  3JQM A;  5SZT A;  1A9N B;  1QUP A;  1JLF B;  2VFV A;  2J9D E;  2ZH2 A;  3SSQ A;  3NAI A;  2CJ9 A;  7FD1 A;  1U24 A;  3VQT A;  4ZLP A;  1UP1 A;  4Y28 C;  2GJI A;  2YNF A;  1RWO B;  5ETN A;  2DHA A;  4RW7 B;  5HP1 A;  1HBO A;  1N5S A;  1NDK A;  2EFV A;  1B4S A;  1FX2 A;  3NXZ A;  2V68 A;  4RNO A;  3D2W A;  4F0M A;  4A8X A;  1YBT A;  5KFO A;  3PR5 B;  4RW7 A;  1O6X A;  1HWL A;  2HSE B;  3ZZT A;  2KJW A;  3CDB A;  2ZM6 F;  1Y7P A;  2GAH C;  4CZC A;  4Q0B B;  3GLJ A;  3N28 A;  2VUG A;  5HAO A;  1TZ0 A;  4U9R A;  2NUU G;  3W9J A;  2HGN A;  3H59 A;  4Q0B A;  4PYD A;  1JJ2 R;  3V5R A;  4BHQ A;  3MCM A;  2KFN A;  2DT9 A;  2YWG A;  1SKU B;  3GJR B;  4ZJQ A;  5HO4 A;  2W25 A;  5B09 A;  3FK4 A;  4DSE A;  3TAM B;  1RT2 B;  3RW6 A;  4UUX A;  1GTH A;  4QR1 A;  4LRF A;  3GE9 A;  3VAL A;  3BBB A;  2BZ2 A;  1A6L A;  3DCA A;  3LAN A;  4DV3 F;  3OJU A;  1IN0 A;  2C2O B;  1WUU A;  3D1O A;  4IQX A;  4ZOS A;  1PYS B;  3GR0 A;  4IH7 A;  3CCS S;  2WSC C;  3SMZ A;  4UY8 5;  1PBA A;  2HQC A;  3KNA A;  3Q2S C;  3E3X A;  1VFJ A;  4AD6 A;  4EMD A;  2YKO A;  3G4S S;  4J37 A;  2DY9 A;  4C3M A;  1FWP A;  1YWX A;  3NY0 A;  1UW9 A;  1EJ7 L;  2KXF A;  4F2S A;  2UUA F;  2NR0 A;  1S6U A;  1H6K X;  4N7T A;  1FFG B;  2F8H A;  1R3N A;  4DV7 F;  1TL1 B;  3TNV A;  3KK2 B;  3OTC A;  4ZVE A;  2YKM B;  4V19 J;  4P2M A;  4FZV A;  2E66 A;  2ZIT A;  4KQZ A;  4IUF A;  1BD6 A;  1TAU A;  4DSJ A;  2XLK A;  4DL6 A;  2V9K A;  3KK2 A;  2MDA A;  1QAI A;  2ZBR A;  2R2R A;  2E1A A;  2MKK A;  3R2C J;  4X4O A;  4MMO A;  1VK3 A;  3TAR A;  4CNY A;  4H4M B;  5KTQ A;  3AQO A;  2BKN A;  3BGR B;  3BN4 A;  2B8P A;  4B3M J;  3TUI C;  2GIF A;  4MK9 A;  2F7V A;  4A48 A;  4A8Q A;  1MN7 A;  2ZJQ Q;  3SFU A;  4OI1 A;  1YIT S;  4B3R J;  1IKV B;  3FQL A;  2MKI A;  1SC1 B;  4CT9 A;  3TUJ C;  1VQO S;  2JWN A;  4CM2 A;  3CCE S;  1RB0 A;  4J90 A;  1NDL A;  2BE7 D;  1IKV A;  1IKY A;  3G71 S;  1CQM A;  4J9S A;  1RAF B;  2V9W A;  3MPV A;  3PFO A;  4CO4 A;  2GMH A;  1S9E B;  3JTP A;  4DLG A;  2H5I B;  3KLF B;  2VQE J;  2IY5 B;  4X62 F;  4MK7 A;  3MWB A;  5KT5 A;  2RB7 A;  1LWF B;  1S9E A;  3I0S A;  1TAQ A;  2CVI A;  3NP5 A;  4ENO A;  5F3Z A;  4RNM A;  3QT7 A;  3TZW A;  2BRL A;  1R89 A;  2U1A A;  1UZD A;  5H9E J;  3VF0 B;  4TNO A;  3ILL A;  2DHH A;  3DFE A;  2ZZT A;  2YBV A;  2MLY A;  1CJU B;  4PG5 A;  4U7U D;  3H2L A;  1IR0 A;  5B0D A;  3K8W A;  4M95 A;  3GMG A;  3G8T A;  3HSJ A;  2PN6 A;  4WF9 Q;  4DV2 F;  3A8J A;  2N4C A;  2RU3 A;  1SQE A;  3MZI A;  4NMX A;  3CXC R;  3WC0 A;  4LF5 F;  2CPZ A;  1NK7 A;  4HAC B;  2UUB F;  1RT5 B;  3KTQ A;  2GFF A;  3W8G A;  3MM6 B;  3ZFV A;  3BV8 A;  2HZA A;  4K4S A;  1R27 B;  3W5X A;  5I3Q A;  1DTT B;  1BUX A;  4Y2C A;  1RT5 A;  2JLE A;  1VQP S;  3I96 A;  2JFK A;  1IJE B;  2OI2 A;  1KTV A;  3MM6 A;  4C3K A;  1HNZ J;  1PAE X;  2ALY B;  3BH7 B;  1RWN B;  1DTT A;  1NME B;  3BKF A;  3GR1 A;  3PCO B;  2O01 C;  1R8C A;  4IO9 Q;  2QL5 B;  4ZK7 M;  4E8U A;  3ADA C;  3W61 A;  2VQF J;  1VQ4 S;  3I9V 9;  3RRH A;  2BV3 A;  2NUH A;  1YIJ S;  4DV0 J;  2DGW A;  4J9N A;  1W2I A;  3R7N B;  2RKI A;  3OHA A;  5F8L A;  3J80 Y;  3HFV A;  3IC1 A;  4G3I A;  2ZE2 B;  4FYW B;  3WC2 A;  2P9C A;  1U2F A;  5KFB A;  2V63 A;  1RTI B;  2AV5 A;  2J5A A;  1APS A;  3THV A;  1UVN A;  1GMV A;  2H5J B;  2CRL A;  2ZE2 A;  4DPU A;  3IR5 B;  3CIZ A;  3HZG A;  4DSK A;  2JEI A;  1RTI A;  1LFW A;  6AT1 B;  2JL9 A;  1C4A A;  4YP3 A;  3EGN A;  3G6Y A;  2QA4 S;  5JJB A;  4IRC A;  2M9K A;  4DS5 A;  2HQI A;  2AGP A;  2HK3 A;  4OYZ A;  1X4G A;  2D3Z A;  2CQD A;  3DLK B;  1VGY A;  3NCR A;  4TLQ A;  3W66 A;  2CPH A;  3D9B A;  2LLZ A;  2P9E A;  3D66 A;  1P27 B;  2GGP A;  2HMI B;  1PC5 A;  4M1K A;  1IKX B;  2L9D A;  2PGC A;  2EKN A;  3GB0 A;  2HWH A;  1NB7 A;  3RB4 A;  4O23 A;  3QGG A;  2KM8 C;  1WC4 A;  4I7F B;  3ZTR A;  3OL8 A;  4LF2 A;  3GFY A;  4NLO A;  2AW0 A;  1FDB A;  1EIY B;  1J5E F;  4I7F A;  4O44 B;  4P52 A;  4FVM A;  2C3U A;  1R6Y A;  3UW1 A;  3HHE A;  4P2X A;  1HKA A;  2EK1 A;  3M6V A;  1WTF A;  4W92 B;  4FF4 A;  1V3Z A;  3P49 B;  2HLT A;  1OQ6 A;  1AA1 B;  4F50 A;  4U6P A;  1U48 A;  4QIW D;  1UVJ A;  5GAH U;  4PEO A;  3CUN A;  4BC7 A;  4IFV B;  5HVG A;  1RAI B;  4C8N A;  2OH2 A;  5KG6 A;  2BX6 A;  5H9F J;  4LR8 A;  1KC8 T;  4AFF A;  2MLX A;  2O5D A;  4ILR A;  3CNQ P;  4KYZ A;  4BC9 A;  3J7A N;  3RGI A;  5B0E A;  2RU9 A;  2XHC A;  1D3W A;  4QWC A;  3FMW A;  2QLX A;  2MQP A;  4OZL A;  4WIQ A;  2R2S A;  4NLR A;  2HHH J;  1FRK A;  2VU5 A;  2YQ3 A;  1UA0 A;  1N48 A;  2V6A A;  1EET A;  3KK3 A;  2V8H A;  2L3M A;  5J2M B;  1ZAV A;  2W2O P;  4WFY A;  4CNZ A;  1I94 F;  4DV4 J;  2XGP A;  2H3E B;  2YPY A;  2W4C A;  4CLS A;  1HBM B;  5KG2 A;  5J2M A;  3T1Y F;  4WYL A;  5IQ6 A;  3CC4 S;  2QO3 A;  2LEA A;  1BMQ B;  1BHN A;  1HBM A;  4PWD A;  2ZH7 A;  3A3O B;  3R27 A;  3M8W A;  4B3M F;  4K5S A;  1N5T A;  1CJV A;  3R5B A;  1EKS A;  3KKF A;  2IM3 A;  4X4S A;  3QGI A;  5H9F K;  3CJS A;  4OZ0 A;  2LU1 A;  4B3R F;  1WHV A;  3RZA A;  4WWS A;  2XMW A;  2AZ3 A;  2IVY A;  3MCO A;  2XNR A;  3KJV B;  6FD1 A;  4Y34 A;  2B7C B;  1J27 A;  1Q1K A;  3BQ1 A;  1TV6 B;  1RTZ A;  3NNA A;  1RWP B;  1TK5 A;  3KJV A;  2RD5 C;  2QEX S;  4PG6 A;  3BYR A;  4DCO B;  1HA1 A;  3EDQ B;  1LW2 A;  1GMW D;  1NKE A;  4JYA J;  1TV6 A;  3N6M A;  1JXV A;  3R6L B;  2MHE A;  1DRZ A;  4NYO A;  2Q43 A;  3AJ2 A;  4C97 A;  2C3M A;  1TUG B;  2YNH B;  2CZ4 A;  1LK5 A;  2AX1 A;  1RHQ B;  2KKH A;  1X31 C;  4ECY A;  2FUG 9;  5A6P A;  3GYG A;  2ROE A;  5JXS A;  2KZZ A;  1H73 A;  4S0M A;  3OL9 A;  1WAC A;  1ZET A;  1AW0 A;  2P6S A;  4LSN B;  4HH0 A;  3NWG A;  1X4F A;  4JI2 J;  3I0R B;  2VIC A;  3OTD A;  3DGV A;  1T95 A;  4PWU A;  4UF4 A;  4DR2 J;  4ZMM A;  2VF3 A;  2R8K A;  3V81 A;  2WVB A;  2RSQ A;  4R8U B;  1PIL A;  4PRF A;  1UFL A;  3I0R A;  3H25 A;  2POK A;  4DFJ A;  4Q8E A;  1XC9 A;  3PKM A;  4R8U A;  4G65 A;  2BJ8 A;  3THP A;  3MEC A;  4KH1 B;  1JLQ A;  4K2X A;  1UVK A;  5LJ5 Y;  1ARO P;  2E1P A;  5AE3 A;  1HQU B;  1C0U B;  4DQQ A;  5T41 A;  2KT3 A;  2D1C A;  3RU0 A;  2BW2 A;  2FLL A;  1HNZ F;  3NGD A;  2VOD A;  1M1G A;  2ZUA A;  1HQU A;  1VQL S;  2ZZN A;  2XQC A;  1C0U A;  3C6U A;  4LUB A;  3P3D A;  5GME A;  5K8O A;  1FE4 A;  3DOK B;  2R7X A;  4DPY A;  3ZTS A;  1PGZ A;  1EX8 A;  4K4W A;  4W90 B;  1WHX A;  5IWA J;  1CBK A;  2VQF F;  3H8Y A;  4DPO A;  3BZQ A;  4RW8 B;  3DOK A;  4IG0 B;  2KI2 A;  2AZ1 A;  3T6J A;  4YUD A;  2RDD A;  1MG7 A;  5IC4 B;  3LPY A;  4DV0 F;  2CZ9 A;  2ZNY A;  3OLB A;  4RW8 A;  2Y1J A;  3ET6 B;  3US5 A;  3HKZ D;  1KON A;  2DGT A;  2EC2 A;  2F40 A;  2VBY A;  3P96 A;  2DGU A;  4DFP A;  1TR0 A;  2ZWP A;  3C6T B;  3CGI A;  4USV A;  3ET6 A;  5L9X A;  3FCV A;  4LF7 J;  2NLW A;  4DZ6 A;  1VLO A;  2EEY A;  4ELU A;  3I56 S;  3GJT B;  2DGS A;  2Q3P A;  3IG1 A;  3I9Z A;  3OR1 B;  4QWB A;  3VVT A;  3D68 A;  2D41 A;  3QO9 A;  5HMZ A;  3HDS A;  4ES3 A;  1T9V A;  2RHQ B;  3M9N B;  4LJM A;  4ZVU B;  3CJ0 A;  1I1G A;  3M30 B;  3OVS A;  3B82 A;  5IV3 A;  2AP6 A;  4DV1 J;  5DLF A;  3PIO Q;  4NCA A;  3CO0 P;  1S1V B;  2XSJ A;  3M8Y A;  1JB0 C;  4C2M A;  4EBD A;  2ZH5 A;  3M30 A;  2CAD A;  4DN9 A;  2LEC A;  4K8R A;  4XDD A;  4MKY A;  3IWX A;  1Y5L B;  3M1V B;  5B08 A;  2CUY A;  2GNK A;  3KUE A;  1TKX A;  1EQM A;  3CCQ S;  1C2P A;  1SQG A;  3IAM 9;  1JJC B;  2IC3 B;  3M1V A;  4ZIT A;  1RWW B;  3V4M A;  1S1W B;  3MFI A;  1QDU B;  1HI1 A;  4LIW A;  1FRL A;  4DR6 J;  4X64 J;  1RYS A;  1VYA A;  4N47 A;  1OMS A;  1J2V A;  1SJR A;  1S1W A;  2LA4 A;  5T14 A;  1DFD A;  3K89 A;  4WBF A;  2OPR B;  1P9Q C;  1DQ9 A;  3UE2 A;  5CZV A;  2V8P A;  4USH A;  4M5D B;  2IDL A;  1SKS A;  2FIU A;  2VBZ A;  1FDA A;  2HHH F;  1UWA A;  1IBL F;  5I4M A;  3GG1 A;  2OPR A;  3WIU A;  4ANC A;  2C28 A;  2DPI A;  2V2K A;  4BDP A;  4A4J A;  2ZKT A;  1YKW A;  3QAT A;  4DV4 F;  1WJ9 A;  2HZC A;  1VR6 A;  3B8H A;  1X5S A;  1V9O A;  2HS3 A;  5J1E B;  2ZBP A;  5HLF B;  3EVM A;  3ISN C;  4KV8 A;  2MQO A;  4LF8 J;  1VQS A;  4Y6I A;  4WE1 B;  1TKZ B;  2H9Z A;  3I31 A;  5C24 B;  3PRB A;  1JLC A;  5HMY A;  2LXU A;  1U26 A;  2FB0 A;  1RT3 B;  1UW4 A;  4WE1 A;  1UET A;  2KRB A;  5LT5 A;  2K8G A;  1D9A A;  1TVR A;  1WSV A;  3PDN A;  3IO1 A;  3LA0 A;  1WHW A;  2CQI A;  2K3I A;  4NA3 A;  4KFB B;  2ROP A;  2F9J A;  4FS1 A;  2GO9 A;  4B3T J;  1FDN A;  4KFB A;  1WKK A;  4IFY B;  4JYA F;  2H54 B;  5ETM A;  1VBK A;  4YOE A;  3PJX A;  1RSC A;  4EU0 A;  4NXN J;  2NPI A;  3J81 U;  3BPD A;  2D3O 1;  2OTJ S;  1L5U A;  1Y00 A;  2XMU A;  2E5G A;  2BE2 A;  1X9M A;  5F8H A;  9RUB A;  5CD4 H;  1RTJ B;  1E6V A;  1NPK A;  2CA9 A;  3DN9 A;  1R0C B;  2RJZ A;  4DPT A;  1H3D A;  4CLL A;  3DM2 B;  1OSD A;  4FVC A;  4JI2 F;  4DR2 F;  3LW5 C;  1RTJ A;  3G82 A;  4AL7 A;  1NK4 A;  1NK6 A;  2GHV C;  3GYX B;  4NYZ A;  4PG7 A;  1JLE A;  2L9N A;  4KTQ A;  2FLN A;  1BQM A;  2FJB B;  3H4B A;  2OPS A;  2IYI A;  4Z2X A;  2XO7 A;  2GS8 A;  5DG9 A;  4DG1 B;  2B6A B;  1XMQ J;  3M9O B;  2B5J B;  2WCX A;  2C2M B;  2OTL S;  1T7P A;  2BAC A;  5A8R B;  3LUY A;  2VPY B;  4DG1 A;  2B6A A;  3OPK A;  2BUN A;  2DR8 A;  5KFW A;  3H5S A;  5F0W A;  2XMM A;  5MLC V;  2IHR 1;  3AJ1 A;  2WTF A;  3MEG A;  5A8R A;  3M8Z A;  3MUM P;  3W2W B;  1S10 A;  5IT9 U;  3LO3 A;  4ED0 A;  3ZZP A;  1QTN B;  3K57 A;  1S1T A;  5IWA F;  3MEK A;  3LOU A;  4CH1 A;  3W2W A;  3DLE B;  4TXS A;  2QFJ A;  3FBC A;  3CCW A;  3HVA A;  4CLW A;  2YX1 A;  4H4K C;  2GIR A;  3HT0 A;  4EGL A;  3DLE A;  3IRX B;  2XBP A;  1RLC L;  3A13 A;  2BJD A;  4PXD A;  3CPW R;  1WG5 A;  3HD2 A;  4Y2I A;  3WHI A;  3MUR P;  3E01 B;  3QRR A;  2AEM A;  2G0C A;  3IRX A;  3CCU S;  1MW7 A;  1WEL A;  3AD8 C;  4F25 A;  3ZNU A;  2UUW A;  2NS1 B;  1KHW A;  2AEF A;  2OML A;  1FRJ A;  2HRT A;  1VBX A;  3ULH A;  4K4V A;  4BBY A;  1F3V A;  1XNQ J;  5M2R A;  3LWM A;  2X1F A;  1T3N A;  2NPF A;  4LSL B;  2BEF A;  3L4B C;  3HI9 A;  4QU6 A;  2NXN A;  2B4V A;  4DI6 A;  2E9Z A;  4OMF G;  1OYD A;  4LSL A;  3Q2T C;  4ID5 A;  3N5F A;  3UVJ A;  1HWI A;  3AAW B;  1N0V C;  4B3S J;  2PE8 A;  2HS0 A;  1HIY A;  3TWZ A;  1AYE A;  1GX6 A;  3R97 A;  2KN4 A;  1GTE A;  4OHY A;  1RWU A;  3BF4 A;  1BE4 A;  2WW8 A;  3QRQ A;  1T94 A;  1XQI A;  3UCU P;  5L46 A;  3C19 A;  1B7F A;  1K0T A;  4ATN A;  3TYT A;  1FK9 A;  3HHL C;  4K4U A;  4JV2 A;  2J76 E;  5JVH Q;  4QR0 A;  3DRX A;  5KFJ A;  5KG3 A;  4GKK F;  4KGV B;  2G2Z A;  4XPE A;  1SJ3 P;  2AMC B;  1U47 A;  4ZPB A;  1XR7 A;  4C7Q A;  5CCM A;  2E5L J;  1OS5 A;  2FQQ B;  1RCO B;  4IH6 A;  2ZJP Q;  1RIS A;  4YY3 F;  1VRU B;  4N76 A;  1ZAX A;  5BR8 F;  5F8M A;  3JQK A;  2GQQ A;  1B99 A;  4RW6 B;  1HBN B;  1OIA A;  4F67 A;  1EP4 B;  1VRU A;  4N5S A;  1AUS L;  4RW6 A;  2MTL A;  4OI6 A;  4Z37 A;  4R0E A;  3BRE A;  3CMA S;  4Q5V A;  1U02 A;  3M6X A;  1RLD A;  2FHK A;  4LF8 F;  3RR7 A;  4I67 A;  5A2Q Y;  3PYD A;  1E6Y B;  4MAK A;  5KFX A;  2NCK L;  2J0S D;  4DUZ F;  2QMU B;  2BQR A;  2FD2 A;  4A8O A;  1TUV A;  1J5O A;  4F0H A;  2R9L A;  5KFN A;  4UOC A;  3ZZY A;  3A8I A;  3DNC A;  1U1Q A;  3JB9 k;  2AJF E;  2WSE C;  5DLG A;  2F65 A;  3OSP A;  3VAK A;  3QSI A;  2ZC4 A;  1DAX A;  1YRT A;  3KG0 A;  1N6Q A;  1S7I A;  4JOU A;  1L3S A;  4NXN F;  1MMN A;  2CJY B;  4JI1 J;  1FKO B;  3UDL A;  4J9O A;  3ZZZ A;  3NL0 A;  3BO4 A;  5D4L A;  4HHJ A;  2R3V A;  2AJ0 A;  2ABY A;  1FKO A;  2LVW A;  2W24 A;  4B9L A;  4ZVG A;  3SEO A;  2DIS A;  4TLR A;  2LXI A;  3LP1 B;  2OIH A;  4EZ6 A;  2I5J A;  1X60 A;  3KK1 A;  3V4I A;  3T1H J;  2Z2L A;  2V4Q A;  1HI0 P;  4WXO A;  1KLN A;  1IXK A;  4Q2M A;  3E2E A;  1Q5V A;  1AFJ A;  1RA7 A;  3OT9 A;  4MIW A;  2K1R B;  2WSF C;  4FXV A;  4DPX A;  5BJR A;  4U96 A;  1XER A;  1FCA A;  4KE5 A;  2GV1 A;  2I1R A;  3JTN A;  3P5B P;  5HI7 A;  2DH9 A;  1HHT P;  4QWA A;  3FRY A;  1SC6 A;  5D3G B;  3O6Q A;  4GKJ J;  5G0R A;  2HNZ B;  3SXL A;  4ZKA A;  5L1K A;  2ZHA A;  2ZVS A;  2ASL A;  4X4R A;  2KT5 A;  2B4P A;  5E33 A;  3OD2 A;  3HVR A;  3V6H A;  5D3G A;  2CDR B;  4B3O B;  1Y3J A;  1RBA A;  3QIP A;  3K5M A;  1U6F A;  2HQG A;  3PYF A;  4NLD A;  2VG6 A;  4ED6 A;  1X9S A;  2IFX A;  4H4O B;  1ROF A;  2GJ2 A;  3EZ5 A;  3HX9 A;  4B3O A;  3HFZ B;  2N7Y A;  4KHM A;  5RUB A;  2OHD A;  1X4C A;  2Z0G A;  4H4O A;  3CDA A;  4DSF A;  3O5T B;  3LH2 S;  2AJ2 A;  3QZ7 A;  2MKY A;  4RBU A;  4J9R A;  1VIX A;  2PEH A;  2QC3 A;  4R25 A;  3V6D A;  3SCK E;  1FD2 A;  2CXE A;  1S4E A;  3DMJ B;  5K9F A;  3BO2 A;  2V8D A;  4KIA A;  3RB6 A;  2WBR A;  3DMJ A;  1X0P A;  2PII A;  4I2P B;  3A3N B;  5LMU J;  3AT1 B;  4DR4 J;  1FVQ A;  3CIM A;  2LMI A;  4WCE Q;  1XMO F;  3OSN A;  3KJQ B;  1MWY A;  3U27 A;  3S8S A;  2RT3 A;  1KLM B;  1IBM J;  1BGX T;  1KHV A;  2QYC A;  4I2P A;  2OEK A;  2C2K B;  2HHT A;  2XMV A;  2HNY A;  3C2P A;  3CJK B;  1XNQ F;  2BAB A;  4F3M A;  5GAD I;  2AT1 B;  4HT7 A;  2ZH8 A;  2BJ7 A;  4YR2 A;  2HIQ A;  4CQ1 A;  3CJK A;  4ZPD A;  2XCA A;  2AU0 A;  4ZJO A;  3HHD A;  5K20 B;  4XPC A;  3BS9 A;  3OW2 R;  2XB2 D;  3DRR B;  2DHG A;  1F5B A;  1ZM4 A;  1G3O A;  1VS3 A;  4DDF A;  4KJI A;  1Q78 A;  2YKA A;  2WAQ D;  3CDE A;  3BO3 A;  1R0A B;  1MRO B;  3DRR A;  1A7G E;  2R7Q A;  4KR0 B;  3MAA A;  4N8N A;  1R0A A;  3UNY A;  2JFD A;  4ECS A;  3GIM A;  4YHH J;  3PEH A;  2I6W A;  2DNM A;  4OZN A;  3OR2 B;  3W64 A;  3S01 A;  2YH1 A;  2HFZ A;  2V69 A;  2RF2 A;  1U6B A;  1ULR A;  1MU2 B;  5U47 A;  3OUY A;  1FES A;  4UST A;  1Q8B A;  2E5L F;  4MFB B;  3EGV A;  3PYG A;  2W1B A;  2IM0 A;  5A8W A;  1MU2 A;  2Y8Y A;  1JXL A;  4ED7 A;  4Y3C A;  3U1N A;  1RAC B;  3GCW P;  1OYE A;  2CPY A;  4MFB A;  1MN9 A;  1S7H A;  3GFX A;  1XIQ A;  2DPJ A;  1U09 A;  2Y0B B;  1RT1 B;  3U7J A;  1TK0 A;  3RYL A;  1RAJ A;  1WC6 A;  4KB7 A;  4K0K J;  4GC7 A;  5DQH A;  1HNW F;  3RBX A;  3GJQ B;  3IBW A;  3O1L A;  3NCQ A;  1WC5 A;  1Q0N A;  4ZA1 A;  3LP0 B;  1RT1 A;  3SQG B;  2VG5 B;  2IBK A;  3MPW A;  1SL0 A;  2CQ3 A;  5E3R A;  3DDI A;  3MM8 A;  3MI7 X;  1N54 B;  3PVX A;  4W98 A;  1HNV A;  3WIV A;  4ZVS B;  2IMW P;  3UN3 A;  3FRZ A;  3SQG A;  2VG5 A;  3SIP B;  2IVM A;  2J7K A;  2XMJ A;  3HXM A;  3G2X A;  1PBU A;  2MMY A;  4RNF A;  4P7T A;  4PG8 A;  2EKY A;  2JNJ A;  2HS4 A;  3Q8Q B;  5ETK A;  1CJT A;  1R31 A;  1RAB B;  4HHH A;  5GMK a;  2HRU A;  2Z2Z A;  3CCT A;  4KAI A;  4FYY B;  4XK8 C;  5K14 A;  4UQG A;  3IR7 B;  3KG1 A;  2VC1 A;  3UD3 P;  2Z57 B;  3POT B;  3AXM A;  2QLF B;  5DM7 Q;  3PG9 A;  3PW2 A;  3MED B;  3PHT A;  1KSP A;  1UFW A;  2RH3 A;  2DO4 A;  3TAQ A;  3POT A;  5AXN A;  3KLE B;  4JI1 F;  3PV8 A;  3K5L A;  2RDJ A;  3RG6 A;  3N79 A;  1M0S A;  1XMB A;  3MED A;  1PYO B;  1QAX A;  3MM7 B;  1V5V A;  2EG1 A;  1JMT A;  3KLE A;  3DI6 A;  1GT8 A;  4DU8 A;  3NGT A;  1OQ3 A;  3TO8 A;  3SCJ E;  3OBI A;  5D78 A;  3MM7 A;  4USK A;  1VHI A;  4Q44 A;  2R8I A;  4M94 A;  2VZ9 A;  2NXC A;  4K7Q A;  3T1H F;  1KBR A;  3PW0 A;  1LW0 B;  4OZ2 A;  5HVH A;  2CYY A;  3C8Y A;  3JQJ A;  2DR7 A;  5E3P A;  2RQ4 A;  4C0B A;  5D0R A;  4NXM J;  1LW0 A;  1SKW A;  2QRR A;  1QAJ A;  1VQ6 S;  3SV3 A;  3N6N A;  4KGK A;  3LAM A;  2H1Y A;  2GAG C;  3VQS A;  3KLG A;  2MZQ A;  2FJA B;  2VG7 B;  2CNK B;  2HBQ B;  3VZH A;  4RBT A;  2R4F A;  3DYA A;  3D6F B;  2F1F A;  2VG7 A;  1HQE B;  3BSO A;  1S49 A;  2CDQ A;  2JVR A;  3RAQ A;  4ED8 A;  4M5N A;  2HHS A;  4TN2 A;  3D3B J;  4RUA A;  3MMC A;  2Z56 B;  1WI8 A;  3EXY A;  1B0P A;  3J7Y I;  5KFP A;  2XGQ A;  4L6V 3;  1S76 D;  5HAT A;  2RE1 A;  4DL5 A;  2W4P A;  1S6P B;  3IFE A;  3G86 A;  4M8L A;  3HPO A;  1Q16 B;  4ZVO B;  5D4O A;  2JJ4 D;  3TX0 A;  1RT4 A;  2P6T A;  4O4G B;  3H42 A;  4F0K A;  3G8S A;  2A10 A;  1S6P A;  3QAU A;  2QSW A;  4JI6 F;  1MNE A;  5J2Q B;  3PEJ A;  1WI6 A;  3M8Q A;  2CWX A;  4L72 B;  3HM9 A;  1T03 A;  2PI5 A;  4OFZ A;  3D1H A;  1FD8 A;  1VLY A;  3CO9 A;  3G6V A;  4LF4 F;  2LEP A;  5LMU F;  1V3R A;  1SI9 A;  4K4Y A;  4DR4 F;  1JLB A;  2XS5 A;  2F9D A;  3FKB A;  5AJ3 J;  3DHW C;  2V2Z A;  1FKP A;  2UV8 G;  1IBM F;  5KFT A;  3K5O A;  2Z58 B;  3UN5 A;  3LTO A;  3VTI A;  1M5V C;  1ITP A;  2JDJ A;  4DUY J;  2ACY A;  1ZBT A;  5BYS A;  1RBL A;  2RUG A;  4YB1 P;  5CAA A;  2Z8Q A;  5HQL A;  2DTJ A;  3SI8 A;  3OHB A;  2UU9 J;  3GIL A;  1BC6 A;  3BGF A;  3A1Y G;  3ZTQ A;  4KO0 B;  1I6J A;  3FBF A;  1KQS R;  4Q8F A;  4PG4 A;  1UL3 A;  4OHV A;  3HSZ A;  5KFA A;  4WU2 A;  4KO0 A;  1FEE A;  2BR0 A;  1IM4 A;  3PNI A;  2E7X A;  3FEY B;  4CDI A;  1FI4 A;  3JSY A;  4DL0 C;  4YHH F;  3AFG A;  2OD4 A;  2HAI A;  4USW A;  2DRA A;  5AXK A;  1CQN A;  1L3U A;  2DEJ A;  2HIY A;  4J9Q A;  1R8B A;  2YNG A;  4BWM A;  1S97 A;  3B54 A;  1PJ5 A;  1VCT A;  3NOG A;  2MHN A;  1HYS B;  4L73 A;  1T11 A;  4NAS A;  3AQP A;  3DC2 A;  5C25 A;  4A8W A;  3RUB L;  2L08 A;  1PO6 A;  5KFG A;  4GVB A;  4G1Q A;  1MML A;  3MCS A;  2MST A;  5IT4 A;  4ED2 A;  3CC7 S;  4FKY A;  3NMA A;  3LAL A;  1UEU A;  3NAH A;  3R8Y A;  3D0I E;  2PT0 A;  2UVR A;  2ZBI A;  4G6V B;  4NRT A;  4I56 A;  4K0K F;  4HTI A;  2YWW A;  1ZTW A;  2OPP B;  3DOL A;  5KT7 A;  4B9N A;  3V2U C;  3IR6 B;  4NRU A;  1KQK A;  3CJT A;  2BBE A;  3QSY B;  5DRK A;  3MAQ A;  2YKP A;  3DRP B;  2J7U A;  2HUR A;  3HZE A;  2I38 A;  4RX6 A;  2OPP A;  1JNR B;  1FJG F;  2DNN A;  1Y10 A;  2RML A;  3DRP A;  4X4T A;  4LFA J;  3OXF A;  1JLG A;  3CCZ A;  4O3P A;  2W7O A;  1SH0 A;  2BDP A;  1NSQ A;  3BB5 A;  4ECX A;  1S77 D;  1UJ5 A;  4OV6 A;  2J6U A;  2FY1 A;  2QL7 B;  3VGU A;  5C2G A;  3PW4 A;  1ZM2 A;  1UVM A;  3SBM A;  2MKJ A;  2OO4 A;  1WEX A;  3EWG A;  1U7L A;  1SJ4 P;  1TK8 A;  3OTO F;  3AHP A;  5LL6 d;  2DY1 A;  3U1L A;  2EBE A;  3P4U B;  2Q79 A;  1T9T A;  1RKJ A;  1IQZ A;  1NH7 A;  2HND B;  5HRO A;  4LQ3 A;  1YI2 S;  1XJW B;  1TQL A;  2HND A;  2Q6B A;  1R0B G;  4DX5 A;  5J2P B;  3Q22 A;  3QNW B;  4DU7 A;  2XO6 A;  2W7A A;  1YJ9 S;  4UUW A;  4I4B A;  5KFL A;  4FF1 A;  4FPR A;  4K2J A;  4LR7 A;  5FDL A;  4OYA A;  3DRS B;  3ZTO A;  4F4A A;  1VRT B;  2CJX B;  4LRC A;  5IT9 Y;  1U2C A;  5DO2 A;  4A8F A;  3BR9 A;  4NXM F;  1P1T A;  3O2I A;  4DUT A;  4AUK A;  1S6Q B;  4P2S A;  4HTJ A;  2QFI A;  3G6X A;  3TZZ A;  1VRT A;  5ETV A;  2JRS A;  1WDT A;  1SPB P;  3QT5 A;  2MY7 A;  2ZVI A;  3GSD A;  5KT4 A;  4IG3 B;  4C9D A;  3EM1 A;  2VD3 A;  4K59 A;  4NA2 A;  1P1L A;  1B70 B;  3AOB A;  5KG4 A;  4LF9 F;  2OP5 A;  4NLY A;  1LV5 A;  1G6B A;  3TP2 A;  4WPA A;  1OPI A;  1RHM B;  2HFO A;  4IG3 A;  2YXL A;  2DXF A;  5LMN J;  2DB1 A;  2R7V A;  1K1S A;  1N36 J;  1WTB A;  1LKZ A;  1JKH A;  2XLI A;  3PJW A;  3D67 A;  3VCD A;  3ZZ0 A;  3MTK A;  3DLH A;  2H51 B;  4O4R A;  1FFW B;  3TZY A;  3L7O A;  5EX3 A;  4QWE A;  5FLX Y;  3SCI E;  4E0D A;  4CWB A;  1KVI A;  1N5Q A;  4DN0 A;  1BQN B;  3PIP Q;  4DF8 A;  5A8K A;  2BJ1 A;  2XNQ A;  4MTP A;  2W8K A;  2B7B B;  2FVS A;  1NAQ A;  1BQN A;  2E1C A;  4N56 A;  2DHX A;  4NZ7 A;  2XUL A;  4CP5 A;  1ZM3 A;  2I0X A;  3I5B A;  5IM0 B;  1T0T V;  2HHP A;  2V94 A;  3EUN A;  4W4M A;  2ADB A;  5LJ3 Y;  3QJL A;  2ZWO A;  3ZNJ 1;  4OI3 A;  5IM0 A;  2VFU A;  1KKH A;  3TJ9 A;  4DUY F;  2ILZ A;  3Q24 A;  4J9V A;  1S6O A;  4HVZ A;  3GTY X;  1IVZ A;  3OFH A;  2NZC A;  4NYP A;  4KKO B;  4CO2 A;  2BVZ A;  4ZPC A;  3ITH B;  4RL1 A;  4ECZ A;  3G87 A;  1RT6 B;  3M9M B;  2AQ4 A;  4C4W A;  2JVO A;  3MHY A;  1SXL A;  1U8W A;  2D74 B;  2DNQ A;  2V2V A;  1B64 A;  1HPZ B;  1SCJ B;  1GXL A;  1RT6 A;  1TMJ A;  1RI7 A;  3IXQ A;  1TL3 A;  4OHW A;  5F9N A;  5CYM B;  3A8K A;  2HRY A;  1HPZ A;  5KFC A;  4PR6 A;  4IKA A;  3EXC X;  3W3S A;  2MGZ B;  1RTH A;  5DDQ C;  4NLX A;  4HHU A;  5CYM A;  2WB4 A;  5HAN A;  2IM1 A;  2EI5 A;  5EWF A;  1CVJ A;  1HBU A;  5ETP A;  1M1K T;  2BRK A;  2E1R A;  2FVR A;  3BKU A;  2KTQ A;  1RU2 A;  1T9W A;  1ZZN A;  4UQT A;  2QL9 B;  2ASD A;  1PJ7 A;  1JLF A;  2OGU A;  3MEE B;  4QW9 A;  4ZP6 A;  1X4B A;  4DS4 A;  1KR4 A;  3W9I A;  2M0G B;  5JMN A;  5E3Q A;  4JI5 F;  4DWI A;  3MEE A;  3ZXW A;  3Q8P B;  2VOO A;  1XBW A;  2DH8 A;  5E5N A;  1KD1 T;  7AT1 B;  1U1K A;  2KYZ A;  4F4W A;  4ZHR B;  1O0P A;  3QZ8 A;  2CJK A;  3FSI A;  3PX4 A;  2RS8 A;  4NLU A;  2BYC A;  4O3S A;  1F9H A;  3TA1 A;  1LNQ A;  4P2F A;  4DOZ A;  1ICE B;  3ETO A;  4ANE A;  3A4T A;  3S7R A;  2IRY A;  3LGN A;  4A8K A;  2UUC J;  4V1A k;  4NLQ A;  1TTH B;  4JI4 F;  1RTD B;  2MPU A;  4KGM A;  2DEI A;  2LU2 A;  3KLI B;  3KUG A;  2XS2 A;  1KS2 A;  3KDN A;  4HI2 A;  5ETT A;  4KHP J;  1FRM A;  1KNZ A;  3AA9 A;  3R5A A;  1S1U B;  3TAM A;  1RTD A;  2DNZ A;  1RT2 A;  1I3O B;  3KLI A;  2MKC A;  1NSA A;  3M05 A;  2KL8 A;  3QPI A;  2WVC A;  1G4C A;  3OXL A;  3RRG A;  3CCJ S;  2M3D A;  4C8M A;  2VC0 A;  3K5P A;  4TY8 B;  2NSC A;  2MQL A;  3EGZ A;  1FTR A;  2ZZM A;  4DPW A;  2AGO A;  4KBI A;  3HMJ G;  5IT0 A;  3K0J A;  2V67 A;  3JSR A;  2HQ3 A;  1TKT B;  1NK5 A;  2ZBC A;  2KZM A;  2V50 A;  4LBP A;  2XZD B;  3CUL A;  4NEZ A;  1GXT A;  3TAN A;  2RHS B;  1DLO B;  3CED A;  5E3C A;  2E7W A;  1FNM A;  3H40 A;  4DL3 A;  4TU8 A;  1TKT A;  1X5O A;  4AXJ A;  4NI2 B;  1Z2L A;  1BLU A;  5L39 A;  2MB0 B;  4NLT A;  2F4V J;  3L3C A;  1VJW A;  1ZM9 A;  1VIS A;  2W9B B;  3GV8 B;  3SCL E;  2R7S A;  2LQB A;  4NI2 A;  2OEJ A;  4RO0 A;  4ED5 A;  4PWW A;  3D0H E;  2J0X A;  2W9B A;  4LMZ A;  3BQ0 A;  3N6L A;  1TL1 A;  3B78 A;  1Y4Z B;  4WP8 A;  2YKM A;  1AUD A;  1IUJ A;  2XSF A;  4DMZ A;  1CC7 A;  3CD0 A;  2GIQ A;  1SV5 B;  4DV5 J;  2BOP A;  5KFM A;  8AT1 B;  2IVF B;  1HW9 A;  1C0T B;  1SV5 A;  2CWK A;  4EZ9 A;  4H4M A;  2IIH A;  2W9A A;  4EUV A;  3BGR A;  5B0B A;  4JV1 A;  1RAO A;  3DXS X;  3ZC4 A;  5SUH A;  1C0T A;  1D9F A;  2A3J A;  3HJF A;  4OHX A;  1ZS6 A;  3PTW A;  2ROG A;  3FCH A;  3Q86 A;  4C11 B;  5LMN F;  1XTZ A;  3CJ3 A;  3WX8 A;  3LGH A;  4WFA Q;  3MMA B;  1RHJ B;  3NG8 A;  4O3R A;  1SH2 A;  2DNL A;  3BQ2 A;  3J80 U;  4C11 A;  1U1N A;  4NML A;  5KAK A;  2QYG A;  1XNR J;  3MMA A;  2FHM A;  2ZKU A;  2FVP A;  2A6O A;  1HQ2 A;  2R7R A;  1EB0 A;  1N34 F;  2C3Y A;  3UR0 A;  4YB7 A;  3KLF A;  3TI0 A;  1DJ0 A;  1V5I B;  3P45 B;  4HKQ A;  4WU3 A;  1LWF A;  4QIF A;  5CD4 A;  4Y0F A;  2AJQ A;  1FDD A;  2MQN A;  1SL1 A;  2KO1 A;  4IOC Q;  2GVD B;  2HLU A;  1R43 A;  2G1D A;  3CCV S;  3PO4 A;  5ETO A;  2PC6 A;  3FBE A;  1CJU A;  4AXI A;  2EVZ A;  4I6A A;  3LP2 B;  5DDP C;  3DRY A;  5CCL A;  2FDN A;  5DZ7 A;  3SDE B;  3IS9 B;  1R6V A;  4AT1 B;  1P8G A;  4OJH A;  1WHY A;  2JH3 A;  4Q7A A;  1O5J A;  4TQS A;  2AYG A;  2DGQ A;  4J9L A;  1CC8 A;  2QLJ B;  1Q5Y A;  3SDE A;  3IS9 A;  5KG0 A;  3M8P B;  3JYT B;  1L3V A;  4HAC A;  3FNN A;  3RW7 A;  2WRM A;  2AYM A;  4LSZ B;  1EAR A;  2E7V A;  4IYQ A;  1T9Y A;  4ICL B;  3QWU A;  4LVN P;  1WG1 A;  4ETX A;  2J8S A;  3M8P A;  3W2V B;  5CYQ B;  5KT6 A;  2X7I A;  2RRB A;  3DDK A;  2XY7 A;  2VPW B;  1F9E B;  5CYQ A;  3Q8S B;  4PQU B;  4YDD B;  3UI3 A;  2UUT A;  1NK9 A;  2W7P A;  3TR5 A;  4WFX A;  4NLW A;  1IQT A;  1RP5 A;  3R7S B;  1X8D A;  2MEW A;  4ED4 A;  2N82 B;  2I2Y A;  2C2R A;  4N77 A;  4OX8 A;  2P8I A;  1GXU A;  2HYI B;  1NJY A;  4CLK A;  1NUE A;  1F0X A;  4ZPA A;  3IAS 9;  1H72 C;  3TVK A;  1FJC A;  1DZ5 A;  2DBB A;  2FLO A;  1TEL A;  3KOA A;  5EHH A;  1UTA A;  1EHW A;  3KHL A;  4USU A;  3F0N A;  3T6B A;  4OL8 A;  2B8Q A;  1YJN S;  3TJA A;  1SIW B;  5LXR A;  4ILL A;  3MR6 A;  1M5H A;  1JIH A;  1CG2 A;  4WK3 A;  5D0G A;  3NWR A;  1ZA1 B;  1HMV B;  3FFI B;  2R42 A;  5DDO C;  2DVI A;  4LFC J;  4ECW A;  3ETM A;  2YWH A;  5F8N A;  4MT1 A;  1UPM B;  3DLK A;  3EPI A;  1NPR A;  2DJW A;  4FXD A;  2CG8 A;  2RS2 A;  3C15 B;  2M2B A;  3IMQ J;  4ZVQ B;  2DHS A;  4O3N A;  2HMI A;  5D6G A;  1IKX A;  2APO A;  2UUC F;  3H2V E;  3C15 A;  1ZTT A;  1GAO A;  2GHW A;  2DO0 A;  1SBR A;  2W2P P;  2OEL A;  1VK8 A;  3KJF B;  1M5P C;  1WOP A;  1UCN A;  3K17 A;  4O44 A;  2CJA A;  2CPI A;  4CO0 A;  3GFZ A;  4OLP A;  2K7J A;  4NA1 A;  2X1B A;  4CLU A;  3FGV A;  4DJB A;  1D09 B;  2CPF A;  5KFV A;  1Q79 A;  4TYB A;  4X4Q A;  3PAC A;  4DCP B;  4X2B A;  1NSP A;  1NJX A;  2AX0 A;  3IBC B;  4HR2 A;  4GO7 X;  2IRU A;  3I82 A;  3OFE A;  4IFV A;  4J9P A;  4V19 X;  1FX4 A;  3OXG A;  2WVF A;  2XM3 A;  2V8V A;  4GC6 A;  1L3T A;  1QY7 A;  1AZS B;  1X7V A;  4ZCL A;  4JI8 J;  3HSD A;  2DNO A;  2ZEJ A;  2LCW A;  3T5L A;  1DY3 A;  2B4U A;  4FBU A;  4KT0 C;  3GFH A;  3M2V B;  3D6M B;  3K58 A;  4P72 A;  3WQP A;  1H98 A;  4DV5 F;  3CJQ A;  4ZVT B;  3M2V A;  4EYI B;  3FVY A;  4EO6 A;  3KXD A;  2EBG A;  2G0I A;  4HH1 A;  3KHH A;  3GV7 B;  2M5Y A;  3KHR A;  4WK1 A;  1OSC A;  3F41 A;  1Y0H A;  4ALZ A;  3IBF B;  3ZZR A;  5F0U A;  1F60 B;  3QLH B;  5LSO A;  1XEZ A;  2OSQ A;  3QRP A;  1QSL A;  1X4A A;  4RUB A;  1XK8 A;  4DCJ B;  4USI A;  3EJM A;  3CCR S;  4IRD A;  3M8S A;  1XNR F;  2M8H A;  2VQE F;  3W7B A;  2E5I A;  2RRN A;  4CO1 A;  4QZV B;  2F4F A;  1CSJ A;  1URN A;  4WTY A;  2GZO A;  3CF5 Q;  1FVS A;  1FFS B;  1QJH A;  3L09 A;  1RKI A;  5J2N B;  2PO4 A;  3MUT P;  1HNI B;  3G8Q A;  3GG0 A;  2DNG A;  1T05 B;  4QYZ K;  1X4H A;  2IPO B;  2KRR A;  3EX7 B;  3NGU A;  3KFW X;  3H20 A;  3GWC A;  2B4O A;  2YNH A;  4YS2 A;  3UQS A;  5CYJ A;  1T05 A;  4URS A;  3HHK A;  3Q8U A;  3UCG A;  3ELH A;  4IDK B;  1VDH A;  3KMS A;  1V6H A;  4LSN A;  2K3K A;  2QMW A;  4X65 J;  3I4P A;  5L1L A;  1UJ6 A;  2Q1L A;  5ETR A;  2DR6 A;  4ZIW A;  1WC0 A;  4IDK A;  5G4D A;  3WX4 A;  3JSM B;  2V4J B;  4AL6 A;  3QJJ A;  2CNO B;  4LRE A;  4L75 A;  2J9E A;  2LQ8 A;  3Q89 A;  2HGM A;  1U25 A;  2HHU A;  3PW7 A;  3MPY A;  1U1O A;  2R8H A;  2RVJ A;  3JSM A;  3RB3 A;  2IYG A;  1HAR A;  4DL2 A;  2CKW A;  1RWV B;  3A3P B;  2L41 A;  3BBF A;  3ISN D;  5C5J A;  4UTG A;  2KG0 A;  3FZB A;  4CRJ A;  2J9C A;  2OFG X;  1GQE A;  2X1A A;  4ERD A;  3L7P A;  2ZH6 A;  5BYQ A;  2C2Z B;  2HBZ B;  3DOM B;  1GK8 A;  3NGK A;  2C3P A;  1YTY A;  3QFH A;  2VBX A;  2HW3 A;  2ZHO A;  3TQ1 A;  4IG0 A;  2OKQ A;  4GMK A;  3DOM A;  3IA0 A;  4RW4 B;  1X5T A;  2CQP A;  4DR1 J;  3R1L A;  4HEA 9;  2B0G A;  1VJQ A;  1B3T A;  2G1H A;  1YVF A;  3QAE A;  4RW4 A;  4CLF A;  3DGP B;  5GAG U;  1LWE B;  1KWM A;  3C6T A;  3OL7 A;  4CLY A;  3HF5 A;  2ZDP A;  1S0N A;  1F9F A;  4XDC A;  2HKE A;  3DGP A;  3GPA A;  2CAJ A;  1LWE A;  1PYT A;  1TKD A;  3T5K A;  2Z30 B;  1AXQ A;  4LFC F;  2R2T A;  4LIR A;  2V0N A;  3H0P A;  2OFH X;  3OR1 A;  2DCU B;  4FNH A;  2YPZ A;  2A6M A;  1Q8I A;  3W5Y A;  3D6T B;  1IBC B;  3I4H X;  4OYW A;  3D54 A;  1R8H A;  4FF2 A;  1S9F A;  2W2M P;  3L7U A;  4DX8 H;  1REG X;  4RJV A;  4ZPV R;  1OPZ A;  3RBZ A;  3IRW P;  3GZ7 A;  2OMO A;  3BEG B;  2VHG A;  1U49 A;  3PRV A;  2ADC A;  1S1V A;  1HI8 A;  3ZO7 A;  4FYV B;  4ELV A;  1RK8 A;  4OYB A;  1CUL B;  5HMX A;  3DXB A;  4A8S A;  5A6W A;  4MYT A;  4JV5 J;  2EPI A;  4C8L A;  4WFB Q;  4F02 A;  1NCL A;  3JTO A;  5F41 A;  5FJ4 A;  2IC3 A;  1UMJ A;  2ATC B;  2PMH A;  1LWX A;  1QLN A;  3D6H B;  1NJW A;  1TU0 B;  1DUR A;  4R0J A;  1BXN A;  1DQ8 A;  1FWL A;  1YLX A;  3ZZU A;  4P6Q A;  2NXE A;  1UA1 A;  3QYY A;  3NEK A;  2XC9 A;  3J7Z T;  1LOU A;  4TKT A;  1NHV A;  2SXL A;  4P10 A;  3MR2 A;  1S9G B;  3R2D J;  4ZS6 A;  2MZT A;  4KH0 B;  4M5D A;  4IRK A;  3FJ2 A;  5I42 B;  1YX2 A;  1X5P A;  1FRH A;  4ZLN A;  2BKP A;  3H5U A;  5E2Q A;  2FZK B;  3QQC D;  4UT4 A;  2EXU A;  2VJV A;  4NCB A;  5I42 A;  3RB0 A;  1Y5I B;  4KPC A;  1PC4 A;  2YNF B;  3DDN A;  2BKO A;  2W01 A;  5HP1 B;  1HBO B;  3WDO A;  1FA0 A;  4B9T A;  2J0Q D;  3CE8 A;  4N8O A;  4WTO B;  1M5O C;  2COL A;  5J1E A;  3JAM Y;  3Q23 A;  5C7P A;  5HLF A;  3VGV A;  2Z2Y B;  1URR A;  3EZO A;  2ZH9 A;  4I64 A;  4CYU B;  4C3L A;  2EFG A;  4C0O C;  1UWB B;  3H90 A;  3KUH A;  2CG4 A;  1RAD B;  1TKZ A;  5C24 A;  2V4R A;  3C66 A;  4CYU A;  2AGQ A;  4ECV A;  1RT3 A;  2XYP B;  1UWB A;  4X4V A;  5J1N A;  1U1R A;  4LFB J;  2UXD J;  3OFF A;  2EFQ A;  3PYE A;  4NPO A;  2HFV A;  5ADZ A;  2E44 A;  1MMD A;  4ZPT R;  4BCA A;  3C3L A;  2MZR A;  5LSL A;  2UZA A;  3VVU A;  4WFZ A;  1FER A;  4IFY A;  4HT5 A;  2N7C A;  3EYZ A;  4E2F B;  1GEH A;  2CPX A;  3HHL D;  4ZN3 A;  2FLP A;  1YRU A;  3UDV A;  4U7U K;  1J5E J;  4G1I A;  3ISZ A;  3MF5 A;  1L3K A;  4F4Z A;  1D8Y A;  4PQA A;  2KJV A;  3H5Y A;  2UXC J;  2A2D A;  1Z1Z A;  2K7K A;  4Y00 A;  5LXY A;  4X65 F;  1PKU A;  2ZC3 A;  3FMB A;  4OZ3 A;  1Z2Z A;  4M5I A;  3DM2 A;  2BMB A;  4J9K A;  2DR9 A;  2DGV A;  3G96 A;  4LRD A;  1WG4 A;  3J7Y U;  2YX7 A;  4PPD A;  2HGL A;  3PKY A;  1O8B A;  3M32 B;  4L76 A;  2IA6 A;  5GVQ A;  1WOR A;  2DIV A;  3N4W A;  2JC1 A;  2B5J A;  2CQ2 A;  2G2O A;  4ZVR B;  2PEB A;  1Q86 T;  1CPZ A;  3M32 A;  3HK2 A;  3PX0 A;  4OYO A;  3W60 A;  2E9R X;  1KOH A;  2IM2 A;  2MLZ A;  2CQ0 A;  3R9L A;  1G1X A;  1I94 J;  4DFM A;  3ENA A;  3MOJ B;  1W2B R;  3T1Y J;  3HLU A;  3TA0 A;  4DQR A;  4RR5 A;  1LQ9 A;  1VQ8 S;  2H48 B;  3GU0 A;  2YWE A;  3B4D A;  3BKT A;  3B4M A;  5D8H B;  2CPJ A;  3LWL A;  5GMD A;  1EQ0 A;  2MSS A;  3UFC X;  5DGA A;  1NH8 A;  1WKJ A;  2YQ1 A;  3VGS A;  1UZH A;  2VA2 A;  4DR1 F;  3M6W A;  2B56 A;  3TEH B;  2XZT B;  3EDR B;  3U02 A;  2X1G A;  3UD5 A;  4ITS A;  4LF7 F;  1IKY B;  4BWJ A;  1KQG B;  1U8S A;  4ZVF A;  4MKB A;  3E01 A;  4RBV A;  2NZ4 A;  2J8A A;  5ETQ A;  2CVE A;  1DBD A;  4EWT A;  5B0C A;  4LR9 A;  1WNE A;  2IAJ B;  2DIT A;  3I0S B;  3GIJ A;  1M5S A;  3W5Z A;  1JJH A;  2QLB B;  5A2Q U;  2XWX A;  5HJX A;  3DKD A;  4NEY A;  5CZX A;  3QWP A;  3W62 A;  4MIB A;  2IAJ A;  3HUL A;  2OLW A;  4DV1 F;  2L9W A;  1LXJ A;  1ZOT A;  5GAE I;  1PIE A;  1AFI A;  2I8E A;  3FEZ A;  1DAR A;  4TU7 A;  2M88 A;  1SL2 A;  2VKZ G;  2HK2 A;  1N5V A;  3PR4 A;  4NLG A;  2CQB A;  3RRK A;  2ALZ A;  3R5G A;  2F5G A;  3CD6 S;  1JXE A;  3PRD A;  2ZOF A;  3R5J B;  2KM8 B;  4JV5 F;  2HZV A;  1KEK A;  3A8E A;  4PKD B;  4QW8 A;  4DR6 F;  4X64 F;  3AOC A;  3ZZO A;  4O0I A;  1VIO A;  4DSL A;  3TVZ A;  4WP9 A;  3ILI A;  4RUC A;  3DLB A;  2MQ8 A;  3VZI A;  4P71 A;  2J7W A;  4MKA A;  2AKW B;  5F8I A;  2GQ2 A;  2Y8W A;  1X0F A;  4K50 A;  1Q53 A;  4FBT A;  1K0V A;  2LYV A;  2O3D A;  1YG0 A;  3JXO A;  3OVB A;  5H9E K;  1PJ6 A;  1RWM B;  1MSW D;  3MM9 B;  2UVU A;  3TUP A;  3EVO A;  2VKR A;  2A2C A;  2QG9 B;  2YH0 A;  4ES1 A;  2RKI B;  3FC9 A;  4EI2 A;  1FRX A;  5KG1 A;  1O51 A;  2R7T A;  1HBN A;  4K4Z A;  2YKQ A;  4EBE A;  1EP4 A;  5K8N A;  3MM9 A;  1JWW A;  2RAQ A;  1FTC A;  4I69 A;  4C6A A;  3MMJ A;  1NPP A;  3BGL A;  3FUY A;  3MPD A;  1SJ1 A;  1FXD A;  1T8E A;  3I5A A;  2DNH A;  4KC5 A;  2XMA A;  2IRX A;  2JX2 A;  1CEZ A;  1Q8L A;  2DKO B;  4KGX B;  4RLE A;  1DTQ B;  3VAJ A;  1Z4U A;  1E6Y A;  1EAY C;  2B51 A;  3GII A;  2JOQ A;  4KGZ B;  2WBM A;  4PZV A;  2GGP B;  3N9U C;  2NSB A;  1U6Z A;  3CB4 A;  4QR2 A;  3QJP A;  2C42 A;  4LFB F;  2UXD F;  1DTQ A;  1VQ9 S;  1QUV A;  1N4L A;  4Y2M A;  2HWI A;  3KLH B;  3NLC A;  4B3T F;  2IJR A;  4JUZ A;  4OZJ A;  4OHZ A;  1GH8 A;  1Q7L B;  1TFW A;  4AE5 A;  5KFF A;  3KLH A;  2MJN A;  4DR7 J;  3SSS A;  3NNC A;  5IOL A;  2DR5 A;  4TQR A;  5D0H A;  9ATC B;  1ZH5 A;  1KN6 A;  2XYH B;  5BYR A;  2VH7 A;  1DHM A;  2KVQ E;  3HKW A;  2XZW A;  2HVI A;  1WEZ A;  2FHJ D;  2AHO B;  2ZOM A;  1T3O A;  4URG A;  1TL5 A;  2VL1 A;  5IFM A;  2FJE B;  3QT8 A;  3UPF A;  2UXC F;  1XWL A;  4UOF A;  2RDI A;  3LP1 A;  2MJU A;  2VDI A;  2HVE A;  2QIF A;  3MR3 A;  3HO1 A;  3TZX A;  1LEO A;  1S0M A;  3RBE A;  2W9C B;  2Y1L B;  1XMQ F;  4FN5 A;  2K1R A;  1I5O B;  3SYZ A;  3M8R A;  1EET B;  4FYX B;  3KK3 B;  3M2R B;  2W9C A;  3ICL A;  3H2U B;  3CSK A;  3T1A A;  3W9H A;  1IBL J;  2HNZ A;  4J7C A;  3BSN A;  5ETL A;  3M2R A;  4X84 A;  5E41 A;  3THT A;  5FD1 A;  2VIH A;  3QBC A;  4OX9 J;  5EDW A;  4IOA Q;  3T9Z A;  1WOO A;  4F7V A;  4KSE B;  2LEB A;  4M5L A;  3CD7 A;  2HAF A;  2D9P A;  4PWD B;  2VB6 A;  2XEX A;  2Y9H A;  1HWK A;  1CJV B;  4Q2L A;  4JB8 B;  1VC6 A;  3EVW A;  2MZS A;  4X4U A;  4M63 A;  1KVJ A;  3NS6 A;  2PMW A;  4FPI A;  2MKS A;  3CDW A;  2ERR A;  1HR0 J;  5DS7 A;  2ZH4 A;  3VAM A;  4XTT A;  1JX4 A;  3UNG C;  3TRG A;  2R8G A;  2C3O A;  1KFS A;  1LW2 B;  3RTV A;  2NXU A;  4PPZ A;  2P5V A;  1S5Z A;  3I55 S;  2CZV C;  2VFT A;  3GON A;  7FDR A;  3V6J A;  2G13 A;  4ED1 A;  1R8A A;  1KLM A;  2D69 A;  5K8M A;  3FEX B;  1QE1 B;  3BDP A;  1HWJ A;  3BYP A;  2W2Q P;  5F8G A;  3NGS A;  2JEJ A;  5LOQ A;  5HMW A;  2MZ1 A;  3FDS A;  4FDF A;  1NEE A;  1NBE B;  2WVD A;  1QE1 A;  3FQK A;  2N3O A;  1TFY A;  2YY3 A;  3J7Z 5;  1RWK B;  4B3S F;  1HNX J;  4OYM A;  1YJV A;  3V81 B;  2EFN A;  3SZ2 A;  2HHW A;  4QU7 A;  4ZPW R;  2IJF A;  1RCX B;  1MRO A;  4ECR A;  1FO1 A;  1JLA B;  3M7V A;  3MEC B;  4MYU A;  2HQF A;  1LWC B;  1JLQ B;  2KB2 A;  2G9O A;  1RA6 A;  3NOC A;  3Q0A A;  2WVE A;  1JLA A;  3CWJ A;  1I51 B;  2EK6 A;  1Y3K A;  3EGW B;  1LWC A;  3OR2 A;  2V34 A;  2YWK A;  4QOT A;  2QE5 A;  2AYE A;  1FNO A;  1U0H B;  1WEY A;  3C6U B;  2Y1I A;  3RR8 A;  2D3U A;  3UDE A;  2P9G A;  3K2Y A;  1UJ4 A;  1GMW A;  5KFI A;  3D5M A;  1VHF A;  4PXC A;  2GJF A;  2JEG A;  1KFD A;  3I32 A;  4LVO P;  3FBB A;  1U0H A;  5HK4 A;  3UDC A;  1VBZ A;  5HQ8 A;  3S1T A;  2XYG B;  1BY9 A;  2OSR A;  1QVG R;  3BSA A;  1FWK A;  2RNE A;  2QZ8 A;  3CDU A;  1H38 A;  3OQ2 A;  3TA2 A;  2BQ3 A;  4F36 A;  5HQM A;  2AEJ A;  3X1L B;  2ZH3 A;  2HPU A;  2G2Y A;  4JI7 J;  3MTJ A;  2Q66 A;  4WZQ A;  1FKA F;  1ACM B;  4KY3 A;  4F4X A;  3LP0 A;  1WD6 A;  2R2U A;  1OO0 B;  1U4B A;  2G4B A;  3EE3 A;  1D8Z A;  4FYD A;  5D15 A;  2KU7 A;  2PFD A;  3NKY A;  4NCG B;  3IG1 B;  4TVA B;  4KPY A;  1RQ0 A;  5D4N A;  5E3A A;  4NLV A;  3QO9 B;  3UD4 P;  4ZVH A;  3BR8 A;  2EWH A;  4NCG A;  1K44 A;  4RZR A;  1BQX A;  1RWX B;  2RIL A;  4ZCK A;  5AE1 A;  2QA4 G;  2LP4 A;  3QID A;  4XAK A;  1F3F A;  2H4W B;  4CO5 A;  3AOA A;  4K5R A;  2XSJ B;  5HBM B;  1M5K C;  1JNZ B;  1FJE B;  4DR7 F;  1SJQ A;  2KG1 A;  1VC5 A;  1YJW S;  1RXO B;  2O66 A;  5HBM A;  1H7W A;  3BGU A;  1M90 T;  1TKX B;  2O1P A;  3TW0 A;  3OL6 A;  2D9O A;  3VAH A;  1S0O A;  4YQW A;  3FSX A;  1NM2 A;  4U67 Q;  2PA8 D;  2FZC B;  3S6E A;  4D3H A;  3M4X A;  1V3S A;  4CH7 A;  1FXL A;  1X4E A;  2KT2 A;  1RJJ A;  1ZAW A;  2E5H A;  2FZG B;  1M1H A;  3M2U B;  4BLG A;  3OJS A;  2OD6 A;  2UVV A;  2C22 A;  5AE2 A;  4GKK J;  2NXJ A;  1VC0 A;  4C8Z A;  5MAO A;  4OI4 A;  4H54 A;  4GKJ F;  5B0A A;  1N0U A;  3M2U A;  2GMJ A;  1GX5 A;  3QT6 A;  4HDH A;  2B43 A;  2J6T A;  2W8L A;  2JC0 A;  4QIE A;  4TYA A;  4YY3 J;  3AB2 B;  3GP9 A;  2GX8 A;  1H2U X;  5D77 A;  2DD8 S;  5BR8 J;  2XY5 A;  1F2H A;  4X4P A;  1KDN A;  4DQS A;  2DNP A;  2AD9 A;  3GQC A;  5F9L A;  4OX9 F;  1GNK A;  4JI0 J;  5KFU A;  1MLA A;  2FGO A;  4B08 A;  1HQE A;  4ZJL A;  4KV8 B;  1WF1 A;  4F4Y A;  2Y1R I;  1SQF A;  1T02 A;  5K8P A;  1JJ4 A;  1JLC B;  2FTR A;  1NJZ A;  2RQM A;  1OY6 A;  2WZ1 A;  4PYA A;  3ENV A;  4D3G A;  1TVR B;  4ZP9 A;  4NOH A;  4WJB A;  4PAA A;  3QGH A;  4ED3 A;  2R7O A;  3QGP A;  4O4G A;  1HR0 F;  4X66 J;  5AT1 B;  4DUZ J;  3K5N A;  1QVF R;  5J2Q A;  4LBI A;  4LF1 A;  1WKL A;  2VAS A;  5A76 A;  2HHV A;  2RRA A;  4YB5 A;  1NDP A;  3NS5 A;  2Z2M A;  1KVK A;  4RNH A;  4CCH A;  2HVH A;  1WC3 A;  5M2U A;  3CC2 S;  2WW4 A;  3FSY A;  4QIV A;  4QWD A;  4H4K A;  2R7W A;  2FJV A;  1G2E A;  1S0V A;  5HSP A;  2BE2 B;  3R6G B;  4WKR A;  4DXL A;  1KTQ A;  3AJD A;  1E6V B;  1N52 B;  1WC1 A;  2Z4P A;  4G1P A;  3C46 A;  1OY8 A;  2GVZ B;  4HYK A;  1U1P A;  3K7R A;  3MM5 B;  2UXB J;  3G82 B;  4DQP A;  1Q81 T;  1HNX F;  3AY0 A;  4PCQ A;  2OPQ B;  2JHE A;  5DZ6 A;  2FJD B;  2FGC A;  3SV4 A;  2LFV A;  2GVZ A;  2HFU A;  2AWZ A;  3MM5 A;  1JLE B;  3IGV A;  3GJS B;  4Y2A A;  4MK8 A;  1BQM B;  3BPS P;  1DQA A;  2BXJ A;  2OPS B;  5HL7 Q;  4WXW A;  2OPQ A;  1NO8 A;  1X9W A;  3PX6 A;  4B9M A;  1F6T A;  3RJM B;  3BM7 A;  1R8P A;  1T9U A;  2ZHB A;  1GMU A;  4Q45 A;  1RUS A;  4OZ5 A;  1WF0 A;  4MJK A;  2CNL B;  5DG7 A;  2ATL A;  1QTM A;  4WII A;  2QA2 A;  4U8V A;  5E7O B;  3MEG B;  2BJE A;  3SFG A;  1JQG A;  1TMM A;  2V2Q A;  2ZFH A;  2DK2 A;  4ECU A;  3CD5 A;  4DQI A;  1HYS A;  1IKW B;  3DHX A;  2C2E A;  4HDG A;  1S1T B;  3HHL B;  1HHS A;  4EFA C;  4LBH A;  1IKW A;  2B3T B;  4ZP8 A;  1TUW A;  4TY9 A;  4JI3 J;  4DLE A;  1UFK A;  3HHL A;  1S99 A;  1RHU B;  2ZOG A;  2OEM A;  3RBD A;  1Y11 A;  3OTB A;  1F2G A;  1YGY A;  5B0F A;  2HHQ A;  3T3F A;  4M5G A;  4JI7 F;  2FVC A;  4I2Q B;  1YK9 A;  4OI0 A;  3R3T A;  4LT6 A;  2CFX A;  2J0W A;  1VI7 A;  4OX7 A;  5DQG A;  2GML A;  1ZPW X;  2BE9 B;  2QJ3 A;  4QBU A;  2UV8 A;  3AH6 A;  4NL5 A;  4I2Q A;  3J81 Y;  2BW7 A;  4HI1 A;  3RAX A;  2EG2 A;  2IJN A;  2IMO A;  2ZD1 B;  2FHO B;  5BXI A;  1XMO J;  2BM0 A;  2VV5 A;  4U95 A;  2VA3 A;  4F2R A;  2DGX A;  3J81 j;  2ZD1 A;  4ILM A;  3AB4 B;  1D9D A;  2XY6 A;  4URQ U;  5FLX U;  2CNN B;  3KLV A;  3T9N A;  2OJ3 A;  2CQ1 A;  2ACM A;  1NK0 A;  1RT7 B;  2PMZ D;  2BJ9 A;  1K1Q A;  1IR1 A;  3JSB A;  1D0E A;  4ID5 B;  3EIC A;  2HWT A;  3UVJ B;  1KQF B;  4HLB A;  2PA3 A;  4DV6 J;  3R5D A;  4ZP7 A;  5KFY A;  1RT7 A;  3I6P A;  4ECT A;  2A0F B;  5M2P A;  4ZN1 A;  1VQN S;  5KOW A;  1UKU A;  3D4J A;  4NX9 A;  1PG5 B;  5HN0 A;  2GHP A;  5F8J A;  1FK9 B;  1UVI A;  1N32 J;  5DET A;  5D4P A;  2QT7 A;  5J2P A;  2F8M A;  5JVG Q;  4RWX A;  3UCZ P;  2ZH1 A;  1BWE A;  1SUQ B;  4ZVP B;  3DRS A;  2WOM B;  3GYN A;  2GA7 A;  2BAN B;  1SUQ A;  2KH9 A;  3N0V A;  3QMQ A;  1S6Q A;  1YJR A;  4ID8 A;  2A18 A;  2WOM A;  1FJ7 A;  1UVL A;  3C16 B;  3B6B A;  5E0O A;  1QD1 A;  3L9Z A;  2VDH A;  2BAN A;  2E9T A;  2G0J A;  3AD7 C;  4OYX A;  5GAH I;  1HD1 A;  3C16 A;  2XI3 A;  5KFE A;  2NRE A;  2FVQ A;  3DU5 A;  5HJY A;  2LQ9 A;  2HHX A;  1NHU A;  3BGO P;  4JI0 F;  4P75 A;  3N5B A;  2LDI A;  3AXK A;  3VV2 B;  5B7W A;  4MKV A;  1HNW J;  4WKY A;  3GSI A;  3LF0 A;  1REV B;  5L38 A;  2KXN B;  2K06 A;  4JBC A;  4AQY J;  4CIO A;  1N5Y B;  4R5P B;  3BH6 B;  1H0H B;  5A0Y B;  2GO8 A;  3TX8 A;  5DG8 A;  1REV A;  4NLS A;  1J5O B;  1N5Y A;  4R5P A;  4NLP A;  5A0Y A;  3T5J A;  2N3L A;  4QPT A;  4X66 F;  3KJN B;  1XR6 A;  3IGN A;  1U1M A;  2HBY B;  4C98 A;  3G9C A;  5DGB A;  5K5M A;  4PXE A;  2RQC A;  5H1S V;  1RAA B;  4GRS A;  5AJ3 F;  5CHC B;  3NRB A;  1N6Q B;  5D0E A;  4BS2 A;  2DIU A;  1VQ7 S;  2MY8 A;  4P73 A;  2BJ3 A;  4RKU C;  5KT3 A;  4IH5 A;  3I5C A;  4C48 A;  5LSR A;  3GCX P;  2UU9 F;  1P9Y A;  3BBC A;  4PAB A;  4Q43 A;  4OJ3 A;  3CCM S;  2EFP A;  4KKO A;  1KP6 A;  1HWU A;  2K2P A;  3ITH A;  3EPG A;  1HL6 A;  2I5J B;  3PY8 A;  2UXB F;  3KK1 B;  3T19 A;  3V4I B;  4MIA A;  2E29 A;  5THW A;  1WF2 A;  1SC3 B;  4I6Y A;  4XIU A;  2NYH A;  3AA8 A;  3MFH A;  4QCL A;  3GIK A;  5L1J A;  2CQH A;  1XR5 A;  2J6S A;  4F4K A;  1OY9 A;  4QQB A;  2NQP A;  3CJ2 A;  4J9M A;  2MGZ A;  3E8O A;  5G0R B;  2ASJ A;  5KOX A;  4IQM A;  4LQ9 A;  3TJ8 A;  2B9Y A;  3KHG A;  4I1T A;  3FCW A;  1VQY A;  4A47 A;  3ILO A;  4EK2 A;  4DHV A;  3QIP B;  1C4C A;  4IOB A;  2YTC A;  4DL7 A;  4DFK A;  2VG6 B;  3P5T L;  4YR0 A;  3O44 A;  3NBP B;  1IBK J;  1Y9O A;  4B17 A;  4YB6 A;  1YSJ A;  4Z7C A;  1PSD A;  3E51 A;  5EWG A;  5C42 B;  2XTJ P;  3CTR A;  4UZB A;  3NBP A;  3CCL S;  1N8R T;  3TOQ A;  1RDR A;  4JI3 F;  2XWY A;  3V6D B;  5C42 A;  3D28 A;  4KRW A;  4M5K A;  4JV0 A;  1Q8K A;  4OYP A;  4RUH A;  3MGJ A;  2X3D A;  1YBU A;  3HHN B;  5IV4 A;  5F3T A;  2FHJ A;  3UR3 C;  2QX0 A;  3CW2 C;  4F26 A;  1P6T A;  1WSR A;  4FXW A;  1YJ7 A;  3D3C J;  4ZHR A;  3AOD A;  1RHR B;  1N33 J;  4JI6 J;  2F3J A;  2MQQ A;  3J7A 1;  3VAG A;  3JS9 A;  4LFA F;  1R7I A;  4B9V A;  2HFN A;  4RU9 A;  2H5E A;  1NKC A;  1RAE B;  4LF4 J;  5KFZ A;  1Q95 G;  2HNY B;  1H7X A;  1PAU B;  4F04 B;  4XO0 A;  1QM9 A;  5CH7 B;  1A0O B;  2BM1 A;  2KFY A;  1S1U A;  3LPE A;  3PW5 A;  4ZCM A;  1FNX H;  5EUH A;  4C0H A;  2ILY A;  1ELO A;  3MCN A;  1YRX A;  5GAG I;  4Z7Y A;  2D3O R;  4CLT A;  4N41 A;  4DV6 F;  2R7U A;  4TY8 A;  4A46 A;  3DLJ A;  1S72 S;  2X51 A;  3PHE A;  4ZLL A;  4LRB A;  2F8E X;  4DX6 A;  5CAB A;  3SQO P;  2LKZ A;  3MAA B;  3ONQ A;  3VHQ A;  4OLO A;  2QGF B;  1DLO A;  3KDO A;  2QN6 B;  1F5C A;  3RAM A;  1K73 T;  4IR1 A;  1N32 F;  3V6K A;  4P9S A;  1G7C B;  4I0W A;  5I3P A;  5CXT A;  2VPZ B;  3NMR A;  4CLZ A;  2CJB A;  1VOM A;  4EO8 A;  3HSG A;  2FYX A;  2RF2 B;  2Y0S D;  3UN2 A;  2EW9 A;  5AXM A;  3OUY B;  2L48 A;  2M70 A;  3KNG A;  1HW8 A;  2HEK A;  5IQQ A;  2HQD A;  2MZJ A;  2Q6C A;  1NJI T;  3Q83 A;  5A8W B;  3MMB B;  4UW2 A;  1B0V A;  1AT1 B;  4AL5 A;  3C14 B;  1S59 A;  3TAP A;  4YEA A;  1B0T A;  3Q8R B;  3FZ2 A;  4O3Q A;  1C1C B;  1EZZ B;  1WWH A;  1TP7 A;  3MMB A;  4USJ C;  3CMQ A;  2UVW A;  4J5O A;  3C14 A;  1Y5N B;  4CTA B;  1C1C A;  5ITH A;  4L3N A;  1VQK S;  4AND A;  2Y3Y A;  2V8G A;  2BQU A;  4CTA A;  3MM8 B;  3MR7 A;  2AJ1 A;  1N36 F;  3W65 A;  3ENW A;  1OWX A;  2WON B;  1HNV B;  4F8R A;  3HD1 A;  4AQY F;  3Q8V A;  2PD1 A;  2PI4 A;  4FP9 A;  2RQK A;  4NZ0 A;  1RU1 A;  2VPX B;  2WON A;  2XHW A;  1N88 A;  2DYA A;  1FJG J;  3SSR A;  1FT8 A;  4RU2 A;  1CJT B;  4ZDN A;  5T7L B;  1S57 A;  2C2D A;  1VQ5 S;  3X3U A;  2XG8 A;  1UEK A;  1FF2 A;  1U2R A;  2GCF A;  1VQM S;  2GC8 A;  5K14 B;  3CT9 A;  5T7L A;  2GW8 A;  1NK8 A;  5DDR C;  5HVF A;  2DNR A;  5IS2 A;  3DLL Q;  4O0N A;  4ZCI A;  1UAW A;  2LQ5 A;  2DGO A;  2GVD A;  4P7V A;  4AYB D;  1KOO A;  3OTO J;  3ZTP A;  5IC6 B;  3H7H B;  1GFW B;  4DF4 A;  1F5A A;  1LFP A;  3PFE A;  4YFU A;  2VJU A; 
#chains in the Genus database with same CATH homology
 2NCK L;  2VU5 A;  3DDI A;  4WBF A;  1W7W A;  3ZTR A;  3VVT A;  3VGT A;  3NGU A;  1JXV A;  3L7U A;  4AND A;  3BH6 B;  3FBE A;  2CWK A;  4W98 A;  5CAB A;  3VVU A;  2DXD A;  3DKD A;  1NDC A;  2ZUA A;  3BBB A;  2DXF A;  1UCN A;  1F6T A;  1HLW A;  1S5Z A;  3G2X A;  1WKK A;  1U8W A;  3Q8U A;  1NDK A;  1NUE A;  1B4S A;  1WKL A;  3ELH A;  1K44 A;  3ZTS A;  4KPC A;  3R9L A;  3Q8V A;  4ANC A;  3PRV A;  2HUR A;  4UOH A;  1NB2 A;  3ENA A;  2HVD A;  2B8P A;  1ZS6 A;  1HHQ A;  3Q86 A;  3EVO A;  1NDP A;  4S0M A;  5IOL A;  3WX8 A;  5BXI A;  2DYA A;  1NLK L;  3FC9 A;  1MN7 A;  3JS9 A;  1F3F A;  1EHW A;  2AZ1 A;  3FBB A;  3Q8Y A;  2B8Q A;  3NGR A;  1BHN A;  1NSP A;  3GP9 A;  2BEF A;  3PJ9 A;  3VGV A;  5C7P A;  3NGS A;  3ZTO A;  1S57 A;  4HR2 A;  4F4A A;  1B99 A;  3FCW A;  4ANE A;  2DY9 A;  4DI6 A;  3FKB A;  4C6A A;  1PKU A;  2DXE A;  3B54 A;  4EK2 A;  1NHK L;  1KDN A;  3EVM A;  4DUT A;  3EMT A;  1NCL A;  3MPD A;  1WKJ A;  3B6B A;  3Q89 A;  1NPK A;  3Q83 A;  4FKX A;  1NSQ A;  3VGS A;  3FBC A;  1LWX A;  3EJM A;  3ETM A;  4F36 A;  1NDL A;  1MN9 A;  3EVW A;  3VGU A;  4CP5 A;  2BX6 A;  1XIQ A;  2AZ3 A;  3EIC A;  3GPA A;  1S59 A;  1HIY A;  4UOG A;  1BUX A;  4UOF A;  5CAA A;  3FCV A;  4O0N A;  3BBF A;  4DZ6 A;  3BBC A;  1BE4 A;  1PAE X;  1NSK L;  3BH7 B;  1XQI A;  2HVE A;  3ZTP A;  3EM1 A;  4FKY A;  1VYA A;  3ZTQ A;  3EE3 A;  3FBF A;  1LEO A;  4ENO A;  3NGT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...