2VU5A

Crystal structure of pndk from bacillus anthracis
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
148
structure length
148
Chain Sequence
MEKTFLMVKPDGVQRAFIGEIVARFEKKGFQLVGAKLMQVTPEIAGQHYAEHEEKPFFGELVDFITSGPVFAMVWQGEGVVDTARNMMGKTRPHEAAPGTIRGDFGVTVAKNIIHGSDSLESAEREIGIFFKEEELVDYSKLMNEWIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NUCLEOSIDE DIPHOSPHATE KINASE
publication title Crystal Structure of the Bacillus Anthracis Nucleoside Diphosphate Kinase and its Characterization Reveals an Enzyme Adapted to Perform Under Stress Conditions.
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Transferase
total genus 43
structure length 148
sequence length 148
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2008-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 2vu5A00
3FBEA 2VU5A 1NHKL 2ZUAA 1XIQA 3NGUA 1NSKL 1NUEA 4ANDA 3WX8A 4DZ6A 2DXEA 4FKYA 3BH6B 2B8QA 1WKLA 1U8WA 4KPCA 1HLWA 3FC9A 1BE4A 2DXDA 4DUTA 3Q8UA 1PKUA 3EJMA 3B54A 1EHWA 1LWXA 1W7WA 2BEFA 1K44A 1NCLA 3ZTOA 4FKXA 3ZTRA 2HURA 3FBCA 1BHNA 1WKJA 1MN9A 3Q8YA 4UOGA 3ETMA 3VVUA 2B8PA 3G2XA 2BX6A 3MPDA 3FKBA 3BBFA 1WKKA 2HVDA 4ANCA 1PAEX 4EK2A 4DI6A 3DKDA 3NGTA 1NSPA 3ELHA 3VGSA 1NDPA 1VYAA 5BXIA 4F36A 3EVMA 3VGVA 1HIYA 1NDKA 1BUXA 3FBFA 4C6AA 3VGUA 3DDIA 3VVTA 4HR2A 4O0NA 3BH7B 4UOFA 2DXFA 3PJ9A 3R9LA 3FCWA 4WBFA 1B4SA 2HVEA 3ZTPA 3NGRA 4S0MA 3ZTQA 5IOLA 4ANEA 2CWKA 1NSQA 1HHQA 1NB2A 5CAAA 3GP9A 3B6BA 1NDLA 1B99A 3BBBA 1MN7A 3EMTA 3Q83A 3GPAA 3EVOA 3JS9A 3ZTSA 3EM1A 3Q86A 4F4AA 1F6TA 1S59A 1NPKA 4CP5A 3PRVA 2AZ1A 3FBBA 2DYAA 1F3FA 3EE3A 1S5ZA 2AZ3A 3ENAA 3NGSA 5CABA 1XQIA 3EVWA 1UCNA 1LEOA 2DY9A 3BBCA 4W98A 3VGTA 1S57A 3Q8VA 2NCKL 5C7PA 3L7UA 1ZS6A 1JXVA 3Q89A 3FCVA 1KDNA 1NDCA 4ENOA 4UOHA 3EICA 1NLKL
chains in the Genus database with same CATH superfamily
3QT6A 3W9HA 3IFEA 4TU8A 3KLVA 2E7WA 2WONB 1TK0A 1LWCB 3KK3A 2ZBPA 3WQPA 3HT3A 1RHJB 4NLTA 2HHQA 1HNZF 2VF3A 3NS7B 2NYIA 4OX9J 1OQ3A 4ANCA 2Z58B 1V3SA 4Y2MA 5HLFB 4DL3A 4QOTA 2ROPA 3TZZA 3QIPB 2LECA 1N33F 4RJVA 4B17A 2OELA 1NNDA 2Y1IA 2HVEA 1WHVA 4JUZA 3A12A 2DGSA 3K89A 2HGLA 1SVDA 4O3OA 3EVOA 1T03A 4YDDB 3QAEA 2ZJRQ 2VG5A 1SQGA 2GAHC 4ED3A 4ZJLA 2CIMA 2UUBF 2LU1A 1DTTA 3MM8A 3OSPA 4EYIB 4M5IA 1TV6A 4JI0F 1HD0A 2LXIA 2ATCB 2FLLA 2VBXA 2PI5A 2YX1A 4M5NA 4CCHA 2W2NP 2VHGA 1HD1A 2QE5A 2FY1A 2VICA 2DEIA 4KFBA 2G9OA 1FJ7A 1IXKA 2H1YA 3JSRA 5A6PA 4NMXA 1Q78A 4Y3CA 2YQ1A 2R7OA 2HHTA 1YVFA 1TMMA 4CO4A 3FK4A 3MR7A 1WF1A 3FKBA 2ABYA 3B8HA 2YKNB 3SQOP 5D3GA 5LSLA 1SL0A 4LIRA 1VOMA 3NNHA 2AGQA 4WFZA 4YY3F 3ZZRA 1Q7YT 4YUDA 2O3DA 4DCJB 2CRLA 1XNQJ 4NLWA 5CQGA 4RX6A 3T3FA 2ZWOA 3GSDA 2CG4A 2DISA 2PDAA 2ZNYA 1YLXA 4DFKA 4OJGA 5KFGA 1L3KA 2HVZA 3IR5B 3H25A 4KY3A 1MG7A 4TU9A 5C5JA 3MEEA 3HMJG 4Y0FA 3EICA 4TLQA 3ZNUA 1M1HA 4QJVA 2YQ0A 2HG4A 3KYLA 2W2PP 2AT1B 2MGZA 3W7BA 3V4MA 2DNQA 3O5TB 3P4UB 1UJ4A 2Z0GA 2X1GA 5HVHA 3CXCR 3MECA 1X4HA 4MK8A 3KHLA 2BKPA 2OFGX 1BLUA 1ZH5A 3TAQA 4UOFA 3MM7B 3PJ9A 2OP5A 5CZXA 4H4OB 2QSWA 1ICEB 3E2EA 4PXCA 4B3TJ 4LBPA 1CC7A 3CO9A 2CJAA 5J2PA 3T5KA 3D1QA 4EBDA 3GJRB 3OQ2A 3OR2B 3PIOQ 2HBYB 2NUUG 4JV5J 2RKIA 2HWIA 2GA7A 3L7UA 4I2QB 4HDHA 3BSCA 4CNZA 2EFOA 4F4WA 3HT0A 4LFBF 1B0PA 3MEGA 3OVAA 4PXBA 4IOCQ 4NI2A 1N6QB 3WHIA 4ZCIA 5J1NA 2QA4S 4XO0A 2MJNA 4TYBA 1C2PA 3GJTB 3DRPB 3UD4P 2GVDB 1U1MA 2W9BA 4IOAQ 4C0BA 1AA1B 5M2RA 3HHLA 2PGCA 1FE4A 1X4BA 4YOEA 3CDBA 4ALZA 1IBCB 3I0RB 1ZPVA 5F8MA 2CDRB 3EYZA 2W4DA 3DMJA 4PABA 4ANEA 3J7AN 2V63A 4ZCLA 2Q43A 3GG1A 4M5DB 4AT1B 2BANB 4X4TA 3LH2S 4ES3A 2VA2A 1U1RA 3DLLQ 3D0GE 2XY5A 1PJ6A 2K3KA 4B9NA 2N7YA 2QFJA 2RHQB 4I68A 1N52B 1EARA 2VODA 4AL6A 2CNNB 3EUNA 4FF4A 1NLKL 2GC8A 3R6GB 3P45B 3Q2TC 1FJCA 4J5OA 2ZJPQ 2HFSA 1ZA2B 1YWXA 3FC9A 1HFEL 4QU6A 1K73T 2PEBA 2ATLA 3A8EA 1HNIA 3BDEA 3FEXB 3K0JA 2HAIA 1D3WA 2HFUA 3PVXA 3T5JA 5B0BA 4MMOA 1Y7PA 2HNZB 1HIYA 2CNOB 4WCEQ 1RT5B 4HR2A 5MLCV 4WBFA 1CULA 1HQUA 4IG3A 4LQ3A 5IT9U 2WAQD 3DM2A 2KVQE 3BBBA 1LK7A 3OL7A 2F5GA 3NGDA 1J5EJ 3NBPA 4ZP7A 5KG4A 4J9KA 1HW8A 1TVRA 3CB4A 4WXOA 1RHRB 2AX1A 2CZVC 1LQ9A 1X31C 1LXJA 4DR4F 2L3MA 2V4JA 5KFSA 2HHHJ 4CLWA 1VQ9S 1RTHB 2J8SA 4DR1F 2VONA 5DM7Q 2VG7A 1HBNB 2KO1A 2PMZD 3D66A 5C25B 5HMXA 4ZPBA 1JKHA 4M5JA 4MIWA 2R2UA 4CO1A 4YQWA 4R8UA 1HBMB 4E2FB 4U67Q 5L1KA 2M0GB 4EBCA 1F5CA 1NK0A 1NK4A 2KZZA 4F4ZA 3EXYA 5KG3A 2ALYB 3K59A 2VC0A 1M5OC 1FERA 3ZTPA 4WU3A 2ZFHA 5IOLA 2XLJA 4DQRA 5LT5A 4RW9A 3MD1A 2Z2LA 2M70A 2CQ1A 4K4SA 1HR0J 2DRDA 2K3IA 4B9UA 4ID5B 2JLEA 3KG4A 3KK1B 3FSIA 5E3RA 5DG9A 3RZAA 2XCAA 3P5TL 4F4XA 1FDDA 1S59A 1NPKA 2NS1B 4Y34A 1XMBA 4U8YA 3I5CA 4QWAA 1XQIA 3SYZA 4X4RA 1WC5A 4L75A 2ZE2B 1Q5VA 1BQNB 4H4MA 1U45A 3N9UC 1RWKB 2U2FA 4ZIVA 1H2TZ 1Q5YA 4DV7J 3GV8B 5ETMA 2J7WA 1IJFB 3HVTA 4OI2A 2MKYA 2DITA 5AXMA 2RQKA 1JJHA 2J5AA 4G65A 4P71A 2D9OA 5T7LB 5KFNA 3CNQP 4C9DA 2MDAA 3NAHA 1LWCA 3MXHP 3KLFA 3N28A 2VL1A 1N5VA 4J7CA 2DEJA 3SCKE 2DTJA 3EGNA 1YSJA 4LF4F 4RBTA 4HHJA 4USJC 1S72S 3MAAA 3NG8A 4CH7A 1VQKS 3EMTA 2FVCA 2R7VA 3RRGA 3VAMA 2PIIA 2OKQA 2RSQA 1N33J 3BF4A 1O51A 4DPWA 3HHLD 1DLOB 1NAQA 4WK1A 3M8QA 1Q8KA 1H74A 4WYWA 1WG5A 2IM1A 1FJGF 1REGX 3T9ZA 1EZZB 1V3ZA 2FB0A 3MPYA 1RXOB 1AXQA 2HYIB 1X4CA 1Y10A 4ELUA 2IPOB 2UUBJ 4DQIA 5ETRA 4JI0J 3DHXA 1RADB 1D1UA 2LEAA 2HNDA 2XY7A 1U6FA 4M95A 3OHBA 3G82A 4MTPA 3IG1B 4WU2A 3THVA 2VOOA 1XBWA 5DDRC 3B4MA 4LRFA 2BMBA 2HAFA 5AXLA 2JZ5A 3LUYA 1PYOB 1RWMB 4ICLA 4BHQA 2W25A 4ZITA 3CUNA 2HIYA 2C3UA 3VAGA 2HHWA 4K4WA 8AT1B 3GLJA 1WD6A 4YY3J 2YX7A 3GMGA 1ACMB 4LFAF 1S76D 3RW7A 1HWIA 3ADAC 1WI6A 1ZS6A 1RP5A 1TKXB 2KKHA 6AT1B 3GILA 4L76A 2W7PA 4AYBD 1P1TA 3DCAA 2MQLA 2RU9A 2NXCA 1W26A 2L9DA 4HACB 3K5NA 4DSLA 4DS5A 4NLGA 1U8WA 3H20A 4KE5A 1JLGA 4QW8A 3Q8UA 4L74A 4KSEB 1U7LA 2E1AA 3QJLA 1WNEA 3QMQA 4K59A 2AWZA 3DC2A 4QR2A 3UE2A 1S1WB 4CDIA 2AYEA 2V8VA 3TW0A 3NKYA 2GQCA 3VQTA 3MM5B 2LXFA 5DG7A 1GMUA 3EGWB 2H54B 5HROB 2FJBB 1Z2ZA 2YKMB 5LJ3Y 4LF8J 1RBAA 5EHHA 4RNNA 3HHNB 4H4OA 3X3UA 2XMUA 2XS7A 1SQFA 4EBEA 1XJWB 2HGMA 4ZOSA 2BDPA 1BC6A 1S57A 1D8ZA 4ZCMA 1PGZA 2G0CA 5ETPA 3TNVA 1FD8A 4UOHA 4RW4B 4QIEA 3FMWA 2R2RA 2KJWA 1RT1A 3SIPB 4ER8A 4FKYA 2DD8S 2RUSA 2X7IA 3HCXA 3MR6A 4LFBJ 4RUHA 3H98A 3R7SB 1D0EA 2VG6B 2J6SA 4DG1A 1U1LA 4RWWA 5KFEA 2Z2ZA 3UD5A 3DRPA 1U26A 1M5KC 4K4VA 2DHGA 2GVDA 2QYCA 2BE2B 3TZWA 3M2RB 3U02A 3DDIA 3CD7A 2XNRA 4DUZF 3AQOA 1Q16B 4ECQA 3KMQA 4LF6J 1S0OA 4KC5A 4NXNF 4RL1A 3JYTA 1QSSA 2VKZG 2JLGA 4FS2A 4QWBA 2BANA 3M6VA 2G2YA 4XDDA 2C2DA 2BOAA 3BBCA 5A2QU 2FUG9 3CJRA 2DNZA 3K7RA 4X65F 3HKZD 4F26A 1S77D 3HPOA 2IFXA 4IG0A 2AYGA 1TL5A 5KG1A 4CLUA 3HSZA 2GW8A 2V8DA 2G0JA 2JX2A 2ASDA 2IAJA 1R7IA 2MEWA 1UJ5A 4YFUA 2WVEA 5I3PA 3R27A 2B4OA 1JLCB 2MKSA 3LALA 1RB0A 4HT7A 3V2UC 5KFQA 2DK2A 1NXIA 2YY3A 3MF5A 1C1BA 2O01C 4IRDA 1U6ZA 2HQFA 4QW9A 1J27A 5DQIA 2ZOFA 2QLXA 1NSAA 1JLQA 1YQHA 4HL9A 1CPZA 1SIZA 3CJ3A 1N5TA 2MQ8A 1P9YA 1R43A 3M9OB 1TMJA 2DO4A 1QVGR 4Q2LA 3CJ0A 2WVCA 2RRAA 1S9EB 2LQ8A 1B99A 1PG5B 3KLIA 3KDOA 3ET6A 1B0VA 4ZPCA 3U1MA 3TR5A 1VQNS 1Y4ZB 3V6DA 1BMQB 5CABA 3CMQA 3AXMA 3BO3A 3KJVB 4UTGA 2C2RA 1FKOA 1RISA 2HQCA 3LP1A 4KR0B 4ZA1A 4DR7F 5HN0A 3AOBA 4M5HA 1S1UB 4Z7YA 1KRPA 5CZVA 1BXNA 4CI0B 2IDLA 1EB0A 4ZIWA 3PEJA 3IBFB 5ADZA 1FRJA 5I3UB 4DPOA 1TL1A 4DR4J 4Q8FA 2NQPA 1AYEA 2V5HG 5GAEU 4MYTA 1K0VA 5JMNA 2WBMA 4KAIA 4UOGA 4OYIA 4F0KA 5C25A 3BBFA 3A8KA 1DBDA 4ED6A 3HLUA 4JI5J 5BXIA 4J9OA 4UZBA 2ADCA 2BQRA 3CJQA 2IJFA 4AE5A 4V19J 1NPPA 2J7KA 4ZVGA 3QBCA 4C4WA 4DS4A 1QD1A 2Y8YA 5F0WA 4MFBA 4TQRA 4OHXA 3C19A 3PJXA 1T8EA 5G4DA 1OQ6A 2HK3A 4WJBA 2GO8A 5EX3A 2HWHA 3NGSA 3KK1A 3QIDA 4NZ7A 1UMJA 2E1CA 2G1HA 2OO4A 5L8RC 3GFYA 2D9PA 2ZE2A 4C97A 1BQNA 5AE2A 4ECVA 5HJXA 2GZOA 3J80Y 4C3LA 3RB0A 2G0IA 2ZH2A 5GVQA 3D0HE 4EO6A 2KI2A 2GJIA 1HI1A 1DY3A 1WSVA 4DWIA 3CCQS 2RQ4A 1R0CB 4J9LA 5CYQA 3QATA 1HW9A 3WIVA 2HNYB 4B9SA 4WPAA 2YWKA 3NMAA 1TAQA 2DXFA 2EBGA 1SV5A 2K1RA 4KGVB 4N8OA 3TI0A 1NH7A 3NGKA 3DU5A 5C42A 4DV5F 3QNWB 5F8JA 2LYVA 2WRMA 2M5YA 4LF4J 5SZTA 4ZMMA 3DGVA 1YGYA 2J7UA 4L3KA 2HGNA 3M2VA 1HNWF 3IC1A 2XMVA 3A4TA 2VJUA 1DLOA 3OPKA 4QIWD 1I94J 4V19X 3UDVA 4WTYA 1KOOA 3KLEB 2VU5A 2DGQA 3QSYB 2LQ9A 1W2BR 3FNNA 5HVGA 2F1FA 2CAJA 1MNEA 4B3MF 3HXMA 1FJGJ 4CIOA 4JOUA 4ZLJA 4N76A 5D8HB 1LWFA 3DLGB 3FMBA 2ZNZA 1YBAA 4LSZB 3R7BB 2POKA 4HH1A 5GAEI 2Y9HA 5HI7A 5DJBA 2B6AB 2FD2A 3MUVP 3CC4S 5GAGU 2PE8A 4Q44A 1JJCB 1DAXA 5DGAA 2HBRB 4P6QA 1RLCL 2B43A 1RAHB 3FFIB 5E41A 3AJ2A 2QSFA 4ZVUB 1QLNA 5A8KB 3BGLA 3H59A 2GAGC 3POTB 4WP9A 4W90B 4CLPA 1LKZA 3IWLA 4JI4F 2JDJA 1X9WA 2NREA 3GB0A 4KV8B 4N47A 4M94A 3CCRS 2BE7D 5F3ZA 2WZ1A 3EVWA 4A8XA 1UEVA 2MSSA 2ZZTA 2EFPA 3IO1A 4X4OA 2IDEA 3SCIE 1UWBA 4XPCA 2OJ3A 5KFYA 1U24A 5I42A 2AIRB 1CJKA 4LFAJ 3Q22A 4OI1A 3CJ8A 2WVFA 4ZPTR 8RUCA 4DOZA 4AL5A 3FEZA 4CNYA 3KDNA 4NA2A 3DDKA 1SL2A 3WBZA 2E44A 1O8BA 2XMTA 4HACA 5E3PA 2ZOMA 3IBCB 4QWCA 3I9ZA 2YWFA 2GS8A 1NDPA 3TARA 3D3CJ 2B0GA 3E01B 1H2UX 1N5SA 2BRKA 4P10A 4XTTA 5B0AA 4UUXA 1Q8IA 1PAUB 2AD9A 3NOCA 2RDIA 4U7UD 5L9NA 3AH6A 1N48A 2WW4A 3G4SS 1M5VC 3O1LA 3RRKA 1FWKA 2AZ1A 2A18A 2VASA 1YBUA 2VB6A 2OMLA 2EG1A 4FYXB 4I67A 2DNLA 2CVEA 1N34F 2BJ1A 3PX6A 2K8GA 1JLBB 4KJIA 4F3QA 2YNFA 1T9UA 1SH2A 1C0TA 1F9FA 2EFNA 5HO4A 3OJSA 4LUBA 4RW4A 3T5HA 1YJ7A 5D15A 3DRRB 3TEGA 3M1VB 2XCPA 2AJ1A 2Q6BA 4X4PA 5B7WA 4JV1A 2ROEA 3QFWA 1U49A 1RAJA 3DKDA 3NGTA 4DN9A 1T9YA 2DIUA 4OZ2A 4R5PB 3NWRA 3HFZB 2I5JB 1R6VA 3MCSA 4IOBA 1U0HA 3QT5A 3SXLA 4Q2MA 4I56A 3IAM9 2LKZA 1VDHA 5J2NB 4AL7A 1MMLA 5IZHA 4F3OA 3KLGB 4DUZJ 4P2XA 3PEHA 1F6TA 1URRA 2B56A 1WDDA 1R3NA 2BQ3A 1Y5IB 4OZ3A 2A10A 3BQ1A 2DY9A 4NXNJ 2KG1A 1S0VA 3V6KA 1S1TB 4ITSA 2MZJA 5B0DA 4OYBA 3GFZA 3DLJA 2ZVIA 3KXDA 5GMKa 2GV1A 4ZN3A 5JVHQ 2UUAJ 3BM7A 5IT0A 1XTZA 5I3QA 4GO7X 2YTCA 5L1IA 3R2DJ 2YKPA 3CDUA 2DXEA 3GR1A 4P2SA 3JSYA 4X65J 1EKRA 3I32A 4E0DA 3WC2A 2CPFA 3VV2B 1MN9A 3UO0A 1CEZA 2YKQA 3BDPA 5I4MA 1UA0A 3AB4B 1S6QB 5CYJA 1BWVA 3UCGA 1VQYA 1HWLA 1J2VA 1L3TA 4PG4A 1DRZA 3A8IA 1IQTA 4LMZA 2HRTA 4DSKA 1FWPA 3DLKB 2JC1A 3W2WB 1RTIA 3TYTA 2H5EA 1HBUA 3BGRB 5B08A 3UPFA 4MK9A 1KP6A 2HVIA 2UXDF 3HX9A 5M2UA 4Y00A 3R5GA 4ED1A 5GAHI 5KFCA 4TY8B 4JV2A 3QLHA 1VRTB 1E6YB 2XHWA 4J90A 1QAXA 2WW8A 1S49A 3LP2A 3PW0A 3H8YA 2G4BA 1JB0C 3FEYB 2R4FA 2HQ3A 3H2UB 4ETZA 2I1RA 3JAMY 1WKLA 3KTQA 1RHMB 2IYGA 2Y8WA 5HP1B 1VQPS 1LWXA 1W7WA 3FDSA 4ZCKA 1VHIA 3MR3A 4EMDA 3OFFA 4OYXA 2V8GA 3KHGA 2OSQA 5EDWA 2HIQA 1RE1B 1VBYA 4NLSA 4O3QA 2XGQA 1WHYA 1KLNA 4OYZA 2F8HA 1WEZA 1KVJA 4C48A 3JSMB 5LMNF 2RJZA 4N7TA 2M88A 1KONA 4AUKA 1NJXA 4S0MA 2QLBB 1TK8A 3LPYA 3PDNA 1UFWA 2VKRA 2GIRA 4QR0A 1R8CA 3KJNB 1Q86T 1GMVA 2Y1LB 2ZM6F 4IH7A 4MK7A 4TQSA 3H5YA 1GTEA 1H0HB 4J9VA 1EIYB 4WE1B 4RNHA 4KGXB 5CD4H 2BBEA 3M9NB 1KTQA 3M30A 1XIQA 4OYPA 2VFSA 1VR6A 1PYTA 3QT7A 1Z1ZA 1IM6A 2AW0A 1TK5A 3J7A1 5AJ3F 2MKIA 2E5LF 5D4PA 4YP3A 3G87A 4ED2A 1CVJA 3ILJA 2R7UA 5D0HA 2W9CB 1Q0NA 2OGUA 1R8AA 3IAS9 3TO8A 4PZVA 4QIFA 1TKZB 1EX8A 2OTLS 4I7FA 2ZD1B 5FJ4A 1H2VZ 4IO1A 1DJ0A 2M52A 3DYAA 2WSCC 5F8GA 3OLAA 4ZK7M 3BSOA 4HI2A 4O4GB 4NLYA 4PKDB 2V8HA 2EK6A 1RT2A 4F67A 1CJVB 1H3DA 1FRIA 3BEGB 1VBZA 5KFBA 3LPEA 4DV5J 5BYRA 1C1CB 1KR4A 3H5SA 4ZVTB 3ICLA 3VTIA 3NGUA 3D67A 3RJMB 1KSPA 1HNWJ 4IFVB 4G1PA 4U7UK 1UPMB 1RHKB 2N3OA 3RB4A 2V69A 1VRQC 4IKAA 2NPFA 2UUTA 4IFYA 4B3MJ 2E5GA 1CBKA 1NEEA 4CM0A 4P52A 3CCWA 2MQOA 2KT2A 4DR3F 3C6TB 3BJYA 3QJPA 4HI1A 2XMAA 4FPIA 1R8PA 3OXFA 2XSJB 2B6AA 3WZ0A 4YB1P 1SJFA 2CJXB 2RDJA 3FFIA 1KQFB 3S6EA 3TJ9A 1UW4A 3Q83A 2Z8QA 3G8QA 3POTA 2ZH9A 4KRWA 2N4CA 3C15A 3HSDA 1IWAA 5DM6Q 3F56A 3JB9k 3ONQA 1CJUB 4LSLB 4FNIA 3MCMA 2DY1A 1SUQA 4JI4J 3RUBL 2R7RA 3CTRA 4C0HA 5K8PA 2Q6CA 4RLEA 3N6LA 3NLCA 5LL6d 1U6BA 3M6WA 5B0EA 1DARA 4B9LA 2YKAA 3LOUA 1IKXA 2QLFB 4QU7A 5FDLB 3F73A 2BEFA 1S7HA 2LEPA 3CVKA 1FDNA 2AJFE 3MGJA 1HNVA 4NLPA 4B9MA 1X4AA 1UP1A 2IRYA 1TL4A 1G4CA 2GVZB 4NLQA 2NZCA 4FZVA 4RNFA 2LXUA 3ZZZA 2RRNA 3LP0B 2EI5A 3L9ZA 2ZH8A 2HS3A 3DLEA 1F0XA 2RDDA 4CYUB 2KL8A 4DU7A 3GP9A 1SPBP 3LA0A 5J2MB 1JIHA 2J6TA 1YZ7A 2B9XA 2OPPB 4YR2A 3RU0A 4Y28C 2J9CA 3V5RA 1RT4A 1RTDA 2LQBA 3V81A 4LR8A 1XEZA 4A8YA 3MMBA 4J91A 4RBUA 2PMWA 4RR5A 2BKOA 5KFOA 4ZS6A 2IHR1 4A4JA 2E9TA 3M9MB 5KFHA 3K57A 1JX4A 2P5VA 2DB1A 2JEJA 3R8YA 2MKJA 2MY7A 3GYNA 3MTJA 2NXEA 3I5BA 2E9ZA 4FBTA 1GAOA 4U7CA 4OL8A 3BREA 5IT4A 3UVJB 1IVZA 2RF2B 4GVBB 4DL6A 2GIFA 4CQ1A 2CUYA 3VGVA 1PSDA 6FD1A 3Q8QB 3O44A 1VGYA 2WSEC 1V5IB 4HTJA 4I69A 2DIVA 1OYEA 2OPQB 5HQLA 1EJ7L 2I9SA 5HANA 2UUCF 4O3SA 3NEKA 4Q43A 2AYMA 1NMEB 5HK4A 3RYLA 3M2UB 5J2NA 1VLYA 1SCJB 3BQ0A 4B3SF 1WHWA 3KLGA 4DV6F 3M8PB 3MR2A 1AW0A 1S97A 3K5OA 1AZSB 3JTNA 2GGPB 1J5OA 3BS9A 2AU0A 3BSNA 4HVZA 1S1VB 3S7RA 1NJIT 4LSNB 4MKVA 3HI9A 3KHRA 4MIAA 1A0OB 1I1GA 4OZ0A 2E1RA 3QWPA 3GSIA 5KT4A 1TFWA 1MSWD 1ROFA 2VOPA 3OUYB 3KK2A 4IRCA 2AGOA 2CZ9A 3CJ4A 2XS2A 3R5AA 4ERDA 3MMCA 2CQ2A 3HD1A 3RR8A 5A0YA 2K2PA 1B0TA 3UNGC 3NL0A 2Q1LA 4OLOA 3R7NB 5KT7A 2H51B 3JSBA 2J0WA 3DGPB 1S6QA 1LK5A 1P27B 1DFDA 2AJQA 3GWCA 4KTQA 4UOCA 1FTRA 2GJFA 1FE0A 3NS6A 4UQGA 2D41A 1GT8A 1U1NA 4GVLA 4JP8A 4DSIA 1BQXA 4OQJA 4HYKA 2HRUA 3QRRA 1KC8T 3W2WA 1RTZA 4I0WA 1ZM3A 3MHYA 2Z57B 3EX7B 1H7XA 2DNMA 2UXDJ 1U0SA 3M8ZA 5IFMA 1S0MA 1S10A 1D8YA 4FVMA 3SFGA 5D0RA 4WZQA 4AFFA 3D9BA 3MFIA 4D3GA 4ES1A 2BR0A 2DNGA 5LJ5Y 5C2GA 3GU0A 4C3KA 2HLTA 1QM9A 2I0XA 1AUSL 2YNHA 3P8BB 1VRUB 2UUWA 1FJEB 6FDRA 1ZTTA 3TAMB 3Q23A 1FT8A 5CXTA 4IDKB 2ZH5A 1VYAA 3EVMA 2G2OA 4OZ5A 1FA0A 5ETNA 4CLFA 3R1LA 3PX0A 1VQ6S 2E5IA 2ZUGA 5KOXA 3I56S 4R25A 1QTNB 3DOMB 3BQ2A 3ITHA 4K8RA 4FS1A 4WYLA 3DRXA 5IC4B 4DDFA 4PQUA 1C0UA 1YJRA 1DQAA 1KQGB 2IYIA 2VBYA 5LMNJ 2KRBA 2F4VF 1IUJA 4K2XA 4C7QA 1YK9A 5F0UA 2LCWA 2YVSA 1SJ4P 4ED7A 1FCAA 1RK8A 4QCLA 1KKHA 5EGYA 2ZM6J 2ZH6A 1WI8A 5F8LA 5D0GA 3TUIC 1EETA 2ZVSA 3SSQA 2BE9B 5LXYA 1T11A 2HZCA 4ECXA 4RW7B 2OPSB 2ROGA 2BJ3A 2R2TA 2FGCA 1WELA 3I4HX 1YTYA 4M5MA 2XLKA 2BV3A 5AJ3J 3R5CA 1RT6B 2L9WA 2B5JB 4QPXA 3W1YC 3RAMA 2HQGA 3LANA 2FC8A 2YPZA 4JV0A 2JL9A 1FKPB 1TKZA 3OFHA 4O0IA 1Y00A 4DMZA 2OFHX 1NB2A 2VIHA 4F50A 2ZD1A 4RUBA 3THTA 2CPDA 4NA1A 2PEHA 2QLWA 4C8OA 2KN4A 1F9HA 1IBMF 3W62A 4ES2A 3TUZC 1UEKA 4UY8T 3W3SA 1F9EB 1CC8A 1U1QA 1JWWA 4PEOA 1M0SA 1E6VA 3WIUA 4AXIA 3EZOA 1KN6A 5J2QA 1MWZA 2VUGA 1U1PA 2DO0A 1SB6A 1NHVA 4CWBA 1FXDA 4RW6A 1X0FA 3UNYA 4A48A 3K8VA 1BQMB 1NJWA 3UD3P 1IKWB 1J5EF 3HVWA 2AEJA 1RU2A 3FJ2A 1OO0B 5KG7A 3D68A 1CS4A 2DR5A 4LF2A 1T3OA 4WZMA 3FBFA 4O0NA 2EFQA 4DR6F 2B51A 4ECZA 2YWHA 5D4LA 4ECYA 2X51A 1NK5A 2AP6A 1NSQA 3TZXA 4WFNQ 3KMSA 1RQ0A 2XSJA 3TP2A 4DR3J 4J37A 3MM9A 5ETVA 1T9TA 3THPA 3BV8A 1XK8A 4P2FA 1RTJB 3C14B 3HVRA 1SKSA 2CWXA 2IJRA 3Q8VA 2FJEB 2ZHAA 2F63A 2ZOGA 2FDNA 3ENQA 3W5ZA 2OIHA 4RU9A 5JUMA 3HSGA 3TX0A 2QL5B 3DN9A 4X4SA 1T7PA 2IC3A 3BO4A 5HMYA 4QIVA 2DXDA 4IH5A 3R6LB 2U1AA 1OYDA 3J81j 3KLHA 5G0RB 4FKXA 2ACMA 4ZP9A 4X4NA 2HMIA 3KG0A 2MQPA 1JNRB 3GIMA 2CPZA 4UUWA 4DSEA 1RYRA 4ZVRB 3FVYA 4OHYA 1KNZA 1LWEA 1K1SA 2XG8A 3BPSP 4KH1B 3MI7X 3DRSA 1JLFB 2VV5A 2ZBIA 2VBWA 2GVZA 2XMJA 5H9FK 3CCUS 2V2ZA 5IT9Y 1N0VC 1S79A 4NWBA 2H5JB 2OPRA 5KFUA 1RWVB 3HULA 1YI2S 2LQ5A 2NYHA 5L39A 5KT3A 2FLPA 2KVIA 5A8WB 4GKJF 5EUHA 4WXWA 2NXNA 3I4PA 1QE1B 4KO0B 1DURA 2Q66A 3LWMA 4ZN1A 2XY6A 2V9KA 3W63A 1JQGA 1K47A 2MKKA 5EX0A 2M4MA 1SIWB 1ELOA 3DNCA 4KPCA 3I5AA 4TY9A 4LF7F 1PKUA 5AT1B 4X64F 5K5MA 2CPHA 3K5LA 2H4YB 2QV6A 4ZLLA 1QVFR 2BJ8A 2FVPA 2CQ0A 2HQDA 4QYZK 2G2ZA 1S1XA 1OSDA 2RF2A 5DETA 2J8AA 1MROB 5KT5A 3F44A 4Q45A 2PFFB 5KTQA 2HZVA 3E51A 2ZDPA 4P2MA 5KG6A 1FX2A 2RS8A 3W2VB 3HJVA 3B78A 1L3UA 5J1PA 1REVB 3GR0A 1NJYA 2CJKA 4NLXA 3BKTA 1VS3A 1VMBA 2YNGA 3DI6A 4PCQA 1RWUA 3GJQB 2NUHA 2MQMA 4EZ9A 1EQ0A 1VLOA 3MAQA 1B7FA 3J7Z5 2FJWA 2C28A 3MCOA 2UUCJ 1RAGB 2ZH7A 4V1Ak 2GMLA 4R0JA 4IQMA 5ETTA 1T9WA 1SC3B 1X0PA 1A7GE 4B3SJ 2SXLA 5EWEA 2EG2A 3GCWP 4DV6J 3N5BA 2ERRA 1AZSA 2QMWA 1R0AA 2Y1JA 1YJ9S 2ZH3A 3SDEB 2V2QA 2PN6A 3FZBA 4DUYF 4LSNA 1MU2B 3G96A 4RW8A 2JVRA 4DF4A 1QAIA 3Q8YA 2C2MB 3ISNC 5BR8F 2L08A 2QMUB 2VPZB 3PACA 2X3DA 1XN9A 4O44B 4OI4A 1HHSA 3N6NA 3G6VA 2KFYA 3MDFA 1FO1A 3ZTQA 3QWUA 2FLNA 2R42A 4DX5A 2VBZA 4QWDA 4LREA 3CCSS 3CDEA 2A6MA 2LLZA 1N5YB 4DJBA 2UZAA 4B3OA 4ZPWR 2EWHA 1MMNA 2ZBCA 4DF8A 1XR5A 3IRWP 5CD4A 4HH0A 3I0SA 1RAOA 3CD0A 3W65A 4KQZA 4YEAA 2Z2MA 2VDHA 3BYPA 1WACA 1DTQB 4F7VA 3AJDA 2ZH1A 1ZPWX 1RKJA 2VD3A 4LF8F 4MIBA 2EK1A 4N77A 4DSFA 3CF5Q 5K20B 3IM8A 1N4LA 2RHSB 1KLMB 3HKWA 2ZZMA 2VZ9A 1LXNA 2P2CB 4A8QA 1B7YB 4DPUA 1RWWB 4LIWA 1R8HA 3DOLA 4BCAA 2F8MA 2V4QA 2K7JA 2DH7A 4IDKA 1KTVA 3D0IE 1XR6A 2VPXB 4DHVA 1PILA 4GC7A 2YH1A 2FHOB 1HPZB 1YJVA 1U1KA 5L1JA 3SSSA 1WHXA 3T1HF 2CXEA 4A8SA 4H4KC 1OWXA 2QRRA 3NS5A 5T14A 2DYAA 2MHEA 4J9MA 2DHXA 1KEKA 3P96A 1FFSB 2C3PA 3PR5B 2UV8G 2IRUA 1S4EA 4PWDB 3OTEA 5FIIA 2F4VJ 3HK2A 1MMDA 2VA3A 4O23A 1HARA 4ECUA 4LF6F 2N4DA 2IMWP 1VC5A 3CJKA 2B9YA 3QAUA 2M8DB 1IKVA 2W8LA 2EC0A 5KFFA 1A9NB 1RCXB 5K8OA 1H72C 3PHTA 2ZWPA 2CYYA 3DU6A 2QT7A 2QL9B 4Y2IA 4DR2F 1GNKA 2KHCA 3AXKA 2XYGB 1KQSR 5ETOA 3FUYA 2R7QA 3FZ2A 3K2YA 4RW7A 2OPSA 2E5JA 3M05A 1IR0A 4IYQA 2LDIA 3BN7A 2JSXA 4KKOA 4LR7A 1LW0B 2B5JA 4EYHB 1NKEA 2KFZA 3KFWX 4E8UA 4M1KA 4K4XA 4CO3A 1FNXH 1I5OB 5KFTA 1RLDA 3NNAA 4QR1A 4PG7A 4NCBA 1ZYQA 4CM2A 2HKEA 2J0XA 3IS9A 2OLWA 4Q5VA 3G86A 2IM2A 2BUNA 4ECWA 1BY9A 1RAFB 1X5OA 1IBMJ 2W4CA 4NYZA 5K14B 4P72A 2CJBA 4RUCA 3BGOP 4DEZA 4LBIA 5L1LA 2NSBA 2KT3A 2CQBA 1VC0A 3IR7B 4DUTA 1OY8A 3BR9A 2Z4PA 5J1EA 3HO1A 4C8NA 2JH3A 3J81U 2P9CA 2BM1A 2COLA 5H1SV 2N3LA 3ETMA 1TZ0A 2KXNB 3KK3B 3OTOJ 4RUAA 1BQMA 2O67A 5HMZA 3CPWR 2NZ4A 1QAYA 1S12A 1TL7A 1GXTA 2XI2A 3OVBA 1BUXA 3MAHA 1RWNB 2AF6A 2R8HA 2PA8D 5HBMA 4IRKA 4NEZA 4URQU 3D6HB 1CJTA 2QA1A 3LGHA 2H48B 3I96A 1U02A 1AUDA 4DR6J 4HDGA 5AXNA 1R8BA 3MUMP 3RGIA 5A2QY 3MZIA 3LF0A 3VGTA 2RIJA 2JLFA 4NX9A 1T03B 2VG5B 2QA4G 4KHMA 4JI5F 2V4RA 5AE3A 3DOKA 3MM8B 3OL8A 3A8JA 1RAEB 3V4IA 2J9DA 4YB5A 1TV6B 4NE9C 3I6PA 5H9EJ 2IM3A 3N01A 5HL7Q 4UT4A 3BH6B 4PUOA 4GMKA 5LM7E 1RBLA 2CQGA 3PO5A 4BS2A 3AOAA 4A8WA 4N41A 4KFBB 4OJ1A 1IBLF 4ZPDA 3VVUA 3L95X 4DX8H 5DZ7A 4EZ6A 1EQMA 1ZBTA 1M1GA 2XGPA 2KYXA 3PW4A 1HYSB 4O3NA 1AB8A 1IR1A 4PG6A 1U2CA 2ZHOA 3BZQA 3UDEA 2J0SD 5D3GB 4C8ZA 1UVKA 1GX6A 1L3SA 1LW2A 1R0BG 4NLUA 4NEYA 5DQGA 4JI6F 3E3XA 1YG0A 2RVJA 1N8RT 4KYZA 4DL4A 5KFJA 1KVKA 5A76A 4KGKA 4ILLA 1HHTP 2XZWA 3H40A 3SV3A 1VI7A 1OJ4A 3GQCA 4BBYA 4D3HA 4AQYF 3VR1A 4Q0BB 2WONA 4G1QB 4GKJJ 2RQMA 5FD1A 1HI8A 2CFXA 4LFCF 5KG0A 4CLKA 2HHPA 2B4VA 4DL2A 1VQLS 2XWXA 1PO6A 3PW5A 4TXSA 3VF0B 3W60A 2IMOA 5HLFA 2MGZB 1JXLA 1P1LA 2MXYA 3QIPA 4MJKA 3MFHA 4FBUA 4J9NA 4C3MA 4DV2F 4FPRA 4LF7J 4X64J 2P9GA 1I94F 5CA5A 3LGNA 4X2BA 3MECB 3WC0A 4DLGA 5KFWA 3FCWA 3GCXP 1ZETA 2FGOA 1VFJA 1XNRJ 4F25A 1RJJA 2N82B 3ZTSA 3Q86A 2HWTA 3W2VA 2GO9A 2XM3A 4CLTA 3UCZP 2R9LA 2H65B 1REVA 1FFGB 3DDNA 2VQEF 2CKWA 2QJ3A 4ID8A 5C7PA 2X1FA 2VPWB 1EAYC 2RKIB 4URGA 5K8NA 2OAUA 3IGNA 4DV1F 2V2KA 1S48A 2Z56B 1S6OA 3C16B 3ZZ0A 2JFDA 4NI2B 3GIRA 1SL1A 3CULA 3AD9C 2YKNA 4DX7A 3N79A 1FI4A 1FX4A 3NOGA 1RACB 2RRBA 3TQEA 1PC4A 1QTMA 4A8MP 4IR9A 4KBIA 3JQKA 1RUSA 2CG8A 1QSYA 1VQ7S 4DUYJ 2W9BB 1WC1A 3M6UA 2OD4A 4FN5A 3HHLB 2AEMA 1RSCA 1K0TA 5KFVA 5BR8J 2F9JA 1UVLA 4DV4F 2FJXA 1UJ6A 3D4JA 4OYWA 2KB2A 3A3PB 3BO2A 2RB7A 1SKWA 3KJQB 2C2EA 2KHDA 1UCNA 2XMWA 1R31A 3MR5A 1JK9B 3C46A 4P74A 4LRBA 3AJ1A 1I3OB 3ZFVA 1QUPA 1IJEB 5THWA 4O3RA 3UR3C 2DCUB 2AJ0A 3ZZPA 4PR6A 4NYOA 1KFDA 1NO8A 1WUUA 2EFVA 5LSOA 1YJUA 3RBZA 1Q81T 5HAOA 1UAWA 2GCFA 2HFNA 4RWXA 4DV3F 1T0TV 3MM7A 1V3RA 2D3ZA 3OL9A 1HNIB 3CT9A 1B3TA 4M5LA 3GFHA 2XO6A 4CTAB 3SEOA 2MYFA 3SV4A 3H4DA 2WTFA 3AA9A 4CH0S 3OR2A 3D1OA 1VQ5S 1YKWA 2LFVA 2VQFF 1X5TA 1TP7A 1CULB 2WHOA 3W66A 2UVVA 4FF1A 3D5MA 4IG3B 1QSLA 3DLHA 5DDOC 2DGUA 3X1LB 4I2QA 3DM2B 4WF9Q 3ZZYA 1T95A 4FF3A 3T1HJ 1RU1A 2A2DA 1N6QA 3R3TA 5BJRA 1TVRB 4YHHF 1P6TA 1DHMA 4RZRA 3QYYA 1NK9A 2V4JB 2DRBA 1MLAA 3FQLA 1OY9A 2GQ2A 2F4FA 1S6PB 5E3AA 1T9VA 2VG7B 2P9EA 4Y65A 1JKHB 1IBKJ 3OFGA 3I0RA 2DGWA 2DR6A 4TNOA 3L7PA 3MM6B 4R8UB 1S9FA 5MAOA 3TVYA 3EXCX 4M5DA 4PXDA 2UUAF 4PWUA 4DR2J 1WTFA 1FRMA 1FD2A 3SBMA 3TEHB 4USMA 4RW9B 1JLEB 2LU2A 5ETLA 2IRXA 5KAKA 4ZDNA 2I8EA 2A6OA 3MMJA 1YZ6A 1VJWA 3C2PA 3IRXB 2XB2D 1UVMA 1QUVA 4OX8A 3RBDA 4DQPA 3NWGA 3TZYA 2HS0A 1T9XA 1Q53A 4OX6A 4YB7A 3BYRA 2QYGA 3TUPA 3PKYA 1LV5A 4NCGB 2LA4A 3HJFA 3HVTB 1H6KX 2HNZA 1RT5A 2WVDA 2CQHA 4G3IA 2RQCA 1PJ7A 1BWEA 2RNEA 3VGUA 3KLFB 3QO9B 3MCNA 3VVTA 3H5XA 3RG6A 1ZM9A 4U8VA 1APSA 4USHA 2VPYB 3K5PA 3TA1A 3PM9A 1F5AA 2IJNA 3ZXWA 2KDOA 2WVBA 5FLXU 3CD5A 3MAAB 2HEKA 4NCAA 3Q0AA 2D3O1 2EFGA 3ETOA 4OMFG 2BJEA 4XAKA 3ZNJ1 4XPEA 2DR8A 3QGPA 4EFAC 4AXJA 3K8WA 1RTHA 1B70B 3M8QB 2RE1A 2W2QP 3AD8C 5A8RB 3NRBA 5HQMA 1HBNA 3VWSA 2MTLA 2C22A 1YITS 3AD7C 5IC6B 3IGVA 4G6VB 1VBXA 1HBMA 5D6GA 5EWFA 2FQQB 4W92B 1SJQA 4R0EA 3D6MB 3PIPQ 3VALA 1WKKA 2HNDB 1YJTA 5DG8A 2P6SA 3G82B 1IBLJ 3SZ2A 3RBXA 1RABB 2KG0A 2JFKA 4ID5A 3GYXB 1HYSA 2OD6A 5CAAA 1OPIA 2Z2YB 1YBTA 3IMQJ 2JEGA 1NPRA 2AV5A 4C11B 4FVCA 4ICLB 2Q79A 1WC4A 3D6TB 1T02A 1PC5A 2HK2A 2ZHBA 4Z7CA 3FBBA 5KT2A 1Y5NB 3ENAA 1OIAA 3US5A 4JI6J 2ZH4A 4P7VA 3QQCD 1X4EA 1FEHA 4CLSA 3NCQA 1NDCA 2BRLA 1Q7LB 1NUEA 2HPUA 2MSTA 5LOQA 2OEJA 4OJ3A 2WB4A 5T7LA 4Q0BA 4RBVA 4G1QA 1CSJA 1RWPB 4DV0J 4AQYJ 2DGTA 1JLGB 4ILMA 3E8OA 4LFCJ 4K4ZA 2R8IA 1U25A 2E5HA 3FRYA 1P9QC 3HF5A 1U48A 1K8AT 2HHUA 3G8SA 4XDCA 3PNIA 4JI1J 4WKRA 1RGVA 3IXQA 3R9LA 3I31A 2DNOA 3OTBA 2ACYA 1NK8A 2HZAA 5CCLA 5HQ8A 2GFFA 2D74B 3O6QA 3UFCX 4DV2J 4WIIA 1UPPA 1VBKA 4OYMA 2D1CA 5IM0B 3OBIA 4NXMF 1N32F 1F5BA 4Y6IA 4GO5X 1OPZA 2C2OB 3N6MA 5GMDA 3LO3A 4W98A 3DLBA 4C8YA 4ZVPB 4DZDA 4ZVQB 4M8LA 2X3GA 4CZCA 1LOUA 3Q89A 2VFVA 3M8RA 3IWXA 5KFDA 4OI0A 4WWSA 3W9IA 2VQEJ 3N0VA 1ZTWA 4Z37A 4ZHRB 1RT1B 4DV1J 3C16A 3IG1A 5F9LA 1N5QA 1SXLA 4C98A 2CADA 3U27A 2V9WA 5IQQA 4ZKAA 5D0EA 4LVOP 7FD1A 3GONA 4DG1B 4EU0A 3AT1B 5E7OB 2EVZA 3UN5A 3GIJA 1S6UA 2F9DA 2B3TB 2R3VA 2FPHX 1V5VA 3AOCA 1NDLA 3D28A 4TLRA 1LFPA 3R5BA 2PMHA 2FVSA 3JYTB 3O3LA 3Q8SB 1NHUA 2KZMA 1C4CA 1TKXA 2NCKL 4DV4J 2DHSA 3UW1A 2MLXA 2WCXA 5C24B 4CT8A 4CLYA 2MZTA 2OEKA 3RR7A 3KKFA 3PR4A 3OTDA 1FDBA 3ZZOA 2HQIA 2PSZA 3CJSA 4IG0B 2V34A 4ANDA 4GKKJ 5D4NA 5DS7A 2YWWA 1WEYA 1DQ8A 4N5SA 5E3CA 1Y5LB 2IAJB 4ILRA 1UL3A 4PG5A 1NCLA 8ATCB 3OHAA 3S01A 1S1WA 1RZMA 2CNKB 4I1TA 1V6HA 3MM5A 4I6AA 1RT3B 5HROA 1C1BB 4NLOA 5CYMB 3ZZTA 4J9UE 5F8NA 1X4GA 2YKMA 1TUVA 4F4YA 4RPFA 4DQSA 3LW5C 1QY7A 3W61A 3I82A 1JLQB 4DV3J 4CTAA 1KD1T 3T1YF 3JQJA 2UXBF 1S99A 5IWAJ 2J76E 3V6JA 5HVFA 1XMOF 1D9AA 3OSNA 1WWHA 3KLIB 4Q7AA 2HHXA 3ET6B 3V6HA 1KS2A 3BB5A 2VQFJ 2L9NA 1U47A 1TUGB 1WTBA 3V6DB 2JVOA 3NNCA 1FKOB 3LP1B 4EWTA 4PPZA 2R8KA 1PBAA 3J7YU 4OHZA 4KHPF 1VIXA 4OFZA 4C8KA 2VG6A 3VHQA 4PYAA 3SQGB 2NXJA 2KTQA 1XWLA 5GAGI 4YHHJ 4TU7A 1JNZB 4JBCA 1TL1B 4X84A 2D3UA 3T5LA 2BE2A 1S6PA 3M2RA 1R27B 3R2CJ 1WC6A 4DI6A 4OX7A 4K7QA 3H0PA 4J9QA 4IO9Q 1NU4A 3LGMA 3CWJA 2FY8A 5KT6A 4LR9A 2FJAB 2MZSA 3EWGA 2NPIA 3RB6A 5HATA 2CQCA 2V0NA 2IVFB 3MM6A 3OJUA 4C8MA 1Q8BA 5KFZA 2BOPA 2YPYA 3ENWA 2M8HA 4ZVFA 4MFBB 1S5ZA 1VQ4S 1JLEA 1G6BA 4CLLA 1GQEA 4RKUC 1N56A 5U47A 3W8GA 1NM2A 3PYDA 2GHVC 2CPJA 5KFAA 5DDQC 1T94A 3GV5B 4QBUA 2FZKB 3CCVS 1U1OA 2DNNA 1JLCA 2DPJA 3IRXA 3O8WA 3WDOA 2O5DA 4UQTA 3AODA 2BJ7A 3QGIA 1KQKA 3DXBA 1H73A 3G2XA 2BX6A 2W01A 5KFPA 1SKRA 4NCGA 1WJ9A 1F3VA 3S8SA 1X9SA 2RUGA 3I55S 5CYQB 1S4FA 1S9EA 1Q8LA 3A13A 4OIXA 1U4BA 2AX0A 3QO9A 1YRXA 2J6UA 1SV5B 2K1RB 1RWXB 4FF2A 1L5UA 4OI3A 3KJVA 1OS5A 5C42B 4F4KA 4FXVA 1HNZJ 1MW7A 2AZ3A 4F0HA 1S1UA 1X9MA 2MQQA 2JEIA 2HSEB 2QC3A 5CHCB 1Q4RA 4A47A 1SH0A 3M2VB 3QPIA 5I3UA 1UETA 4HKQA 3CJ5A 1VIOA 1UEUA 5A8RA 1RAAB 3J7YI 2HRYA 4DFMA 3GZ7A 1LWFB 1ZAVA 2DGVA 3MPDA 1UW9A 2HFOA 3VGSA 2EBEA 1GFWB 4JI3F 2IBOA 1SI9A 3KG1A 3AHPA 3GE9A 3KOAA 3TRGA 3LTOA 2YBVA 2FYXA 2VFUA 5D77A 4NRUA 5K9FA 3VZIA 2BZ2A 2R7SA 2HBZB 3BKFA 4CRJA 3C8YA 3H2VE 2V67A 4DPTA 3UN2A 3CMES 1H38A 2EKNA 1NBEB 1KFSA 2C3OA 4MKAA 1XMQF 3IWNC 4C11A 4DL0C 4LRDA 2JEFA 3F41A 3L3CA 2JRSA 1HMVB 1X4FA 3QZ7A 4B9TA 1EP4B 2PD1A 3CJ2A 4ED0A 1A6LA 2HLUA 2CJ9A 3GJSB 1SC1B 1UWBB 4CH1A 2GMJA 2A1BA 2DR7A 4Y2CA 1FNMA 5B09A 5I42B 1CJKB 3TANA 3EJMA 3TUJC 1AFIA 3B54A 4HLBA 2MLZA 3NAIA 1G3OA 2HNYA 1WG4A 2OMOA 3H4BA 2R8JA 5M2PA 2UXCF 1CLFA 4B08A 2AEFA 4OYAA 1BGXT 4Y2AA 3EGZA 4USTA 2HHSA 5LMUF 2I38A 1FKAF 4KIAA 3LAKA 1TFYA 2PT0A 3HDSA 1FWLA 2XZDB 2UVUA 4KH0B 3UDCA 1PJ5A 2PO4A 2LMIA 2LEBA 1TKDA 4KGZB 2MQNA 5SUHA 2J0QD 1KBRA 5IM0A 4EGLA 3C3LA 3TVZA 3KLEA 1M5PC 3SCLE 2CPXA 1O0PA 3PRDA 3EZ5A 4A8FA 1S7IA 4NXMJ 3Q8PB 1N32J 1NHKL 1X7VA 2RILA 3EDQB 3L7OA 3DLGA 2JJ4D 2MPUA 1FHTA 2YNFB 4K4YA 2CQ4A 2KU7A 1FESA 1F2HA 1UTAA 1C0TB 2FHKA 4DLEA 3GYGA 1YRUA 2CNLB 1WKJA 1FDAA 3UQSA 3HHKA 4ZHRA 3HHDA 3DFEA 2UVWA 4LBHA 2XWYA 3ILLA 1HNXF 2QX0A 2DNYA 3RAQA 5A8KA 2M9KA 3CDWA 5ETQA 1RBOB 2H3EB 2YKOA 2XS5A 4C0OC 5ITHA 1AFJA 4WIQA 3NGRA 1GX5A 3MEKA 4JI2F 3TVKA 1K9MT 4KV8A 1WC0A 4WFXA 1U0HB 2JC0A 2E1MC 4ECTA 4LF1A 2DNRA 3CCES 1FK9B 5HJYA 3ENVA 3UN3A 3TA0A 3HHLC 5L9XA 1TQLA 1WSRA 2HFZA 3P3DA 4O3PA 2EPIA 4BLGA 4ZLPA 1RI7A 5C24A 3AA8A 3K5MA 2BQUA 1SJRA 4F2RA 3QFHA 4NZ0A 1EKSA 2WSFC 1ZM4A 3KUHA 2BJ9A 3RBEA 2DNKA 1K44A 4Z2XA 3ZC4A 1HWJA 5KFRA 5KFLA 1IN0A 1KWMA 4WKYA 3PW2A 2KXHA 3E01A 4EK2A 1HQ2A 3ELHA 1FRXA 3P49B 1ZOTA 9ATCB 4DPYA 2GHWA 1NDKA 5RUBA 3TJ8A 3L09A 4I6YA 2FVQA 4X62F 3BH7B 1ZAWA 4KT0C 1B4SA 1RT3A 1RHUB 5CYMA 3OVSA 4PAAA 3W9JA 1NRKA 3A3NB 3EPIA 3U1NA 1G1XA 1MWQA 3OR1B 4K4UA 4PQAA 1RTIB 3EM1A 1HBUB 3ULHA 2KH9A 3MPVA 4ZP8A 2KM8B 1HWKA 2CQIA 3T1YJ 2VH7A 1JLBA 3T6BA 2JOQA 2RT3A 2F7VA 2RMLA 2UXBJ 5IV3A 3NXZA 2V50A 3RW6A 2DT9A 4FYYB 4YR3A 3QLHB 1GEHA 2IA6A 3KUEA 1XMOJ 1Y0HA 5ETKA 1FEEA 3R5DA 3DRRA 2KRRA 3LP2B 2ZDOA 3M1VA 4PRFA 4U96A 2XTJP 1VISA 3PG9A 1NH8A 4NASA 1YIJS 4LVNP 3FQKA 3FBCA 5B0CA 1Y11A 1BHNA 2X1BA 4EUVA 2D3OR 3SQGA 3CJTA 4FXWA 4KHPJ 4R5PA 4CT9A 2I5JA 2L41A 4MYUA 1VCTA 1DQ9A 3KJFB 5ETSA 2C2KB 3ZZUA 2DH8A 3PHEA 4DR1J 4I64A 4USUA 2NLWA 3OL6A 1Y3JA 3G6XA 3NCRA 3T1AA 1BD6A 3KUGA 3GPAA 1NZAA 3SI8A 2E66A 3CMAS 4B3RF 1K1QA 1S1TA 3JTOA 3KNGA 2BM0A 1QJHA 4ED8A 3NMRA 4CO5A 3VAFA 3OXLA 1RHQB 2QZ8A 3PTWA 1PYSB 2DNHA 2HVHA 1SQEA 4DR5F 1HWUA 1P8GA 4OV6A 2BABA 5HSPA 3M30B 2AQ4A 2GHPA 3BPDA 1HLWA 4OHWA 4FDFA 3CCTA 3QGHA 2AJ4A 2MKHA 4WFYA 2MJUA 3PYFA 1GXLA 4ZVSB 3QZ8A 4QYRA 2J9DE 3I9V9 2XBPA 1SC6A 5DLFA 2XLIA 2X1AA 3M32B 1IQZA 3MUTP 1O5JA 4LRCA 1XC9A 1U2RA 3SMZA 2B4PA 2BKNA 3DLKA 4OZ1A 4A46A 2OEMA 4HTIA 4A8OA 2W9AA 3PX4A 3ILIA 3BGRA 5BYQA 1RKIA 1R89A 4I6WA 2CWKA 1O6XA 1SKUB 4I7FB 2AMCB 3A3OB 2DJWA 3MMAB 3DYAB 2LQJA 5KOWA 4TY8A 2QIFA 2B9EA 1VRTA 1E6YA 2RS2A 2OSRA 2ASYA 1RT2B 3CCZA 2D7SA 1WF0A 3PRBA 3AFGA 1JXVA 2G1DA 4OV1A 4C8LA 1CG2A 4ZVOB 4OLPA 2YWEA 5HP1A 5LXRA 4I2PB 2QGFB 2DGOA 1EHWA 1VQOS 1CQNA 4H4KA 2O1PA 1MWYA 2K7KA 4ELTA 3JSMA 2V8PA 2YNIB 1ZM2A 2UU9F 4IFYB 4C6AA 2AKWB 1GH8A 4P9SA 7FDRA 1I51B 2H5IB 3IM9A 2VDIA 3B6BA 4JI3J 4MAKA 5D4OA 3PJWA 2XQCA 3VCDA 4WE1A 3CIZA 3FSYA 3R97A 1X60A 2V68A 4NLVA 2R7WA 2F40A 2DH9A 3DHWC 4OZLA 3ILOA 3MD3A 3MOZA 1PBUA 2YX4A 3C15B 4TN2A 3TOQA 4OI6A 3CW2C 2FHMA 3O2IA 1XMQJ 4F02A 2L48A 2ASLA 1HMVA 4FYDA 1SUQB 1EP4A 2UP1A 4JI7F 2E7VA 5KFMA 4M5GA 5JXSA 4LF5F 2W9CA 2VJVA 2C42A 3AB2B 4HT5A 1IKXB 4I4BA 1DZ5A 1KHVA 4MT1A 1X5SA 4EEYA 4ZJQA 2FJDB 1M1KT 4ED4A 1PIEA 1HNVB 1D9DA 2C1EB 1NJZA 5DO2A 1YJWS 1ZZFA 4O4GA 2UXCJ 1G7CB 1TKTB 2CZ4A 4OJHA 1WORA 1CJVA 2RH3A 1XERA 5LMUJ 3DLEB 3M6XA 2KFNA 3M8WA 9RUBA 4C2MA 1FXRA 4DQQA 1FRLA 3OTOF 3PFEA 3S1TA 1C1CA 1TR0A 3QRQA 1RT4B 1RTDB 1X8DA 3C6UB 3CCJS 1U2FA 4LQ9A 2ZKUA 3V81B 1S9GB 4YB6A 5GAHU 1RT7B 2ASJA 4IFVA 4L6V3 4M63A 2J9EA 3MMBB 3K17A 2PI4A 2ZC3A 5L46A 4PXEA 3RB3A 1YX2A 2DHHA 2I6WA 5T41A 4X66F 4DN0A 4FP9A 1WF2A 1BE4A 1RWOB 1TUWA 3ISND 4LF9F 3CC7S 4KHRA 2MLYA 3JTPA 3BGFA 4F8RA 2CJQA 3C6TA 2M2BA 1OY6A 2A0FB 5E2QA 1HL6A 3CD6S 4ZLNA 1FTCA 1ITPA 2P6TA 2H4WB 1ZAXA 2GJ2A 5F3TA 4ECSA 1Q1KA 3CIMA 1HHQA 3L4BC 1HNXJ 1NKCA 4YS2A 4LJMA 1N88A 4XIUA 4UW2A 4ZVEA 1HI0P 1CJUA 1UVJA 4LSLA 2IY5B 2OTJS 2YWGA 4JI2J 4ELVA 3G6YA 1T05B 3VAHA 2CQ3A 1FK9A 3M8YA 3TJAA 3PY8A 1UKUA 4DL7A 1RAIB 2XULA 1SBRA 4E98A 1VJQA 3G71S 5FDLA 3QRPA 1D09B 1QAJA 2XO7A 3OLBA 1J5OB 1Q82T 1ZA1B 2EKYA 3J81Y 3TA2A 2DGXA 1W2IA 3Q8RB 4J9PA 1UVIA 2CJYB 2XYPB 2LP4A 3KK2B 2B4UA 2QMXA 4DCOB 3LP0A 1GXUA 3MMCB 2OUGA 5A0YB 4CYUA 2QEXS 2OH2A 3LQVA 2PFDA 5J2MA 3QJJA 3D7SB 3P5BP 1URNA 2OPPA 2GNKA 4ETXA 3BSAA 1MN7A 3J7ZT 3DXSX 3HFVA 2IM0A 5E3QA 4X62J 4L72B 4QWEA 3EE3A 5F9NA 3OR1A 4K4TA 5LSRA 4CO0A 2XMMA 3MPWA 1HBOB 4OHVA 5JJBA 2UV8A 4AD6A 4BC9A 4IQXA 2XYHB 1HQEB 3FCVA 1LNQA 3UCUP 3BN4A 4GRSA 2B7CB 4MKBA 4JB8B 4LT6A 3OFEA 1TELA 2I2YA 4FYWB 4EO8A 4WTOB 1XNRF 5GADU 2RD5C 3HHEA 5F8HA 3J80U 3UVJA 2F8EX 4GVBA 1WOSA 2WOMB 3HM9A 1UZDA 4HEA9 3CCLS 2YNHB 1T3NA 2Y0SD 4DR7J 4KPYA 3CC2S 2OPQA 4O4RA 3FCHA 1OMSA 3D6FB 1VHFA 2XZTB 1Q95G 4RNMA 3ITHB 2W24A 3M2UA 4WP8A 4F3MA 1N0UA 2XMKA 3RRHA 3ISZA 3PCOB 4YDXA 1YDLA 3M8PA 2QFIA 4RNOA 4L73A 4PQUB 2GX8A 1C0UB 1F3FA 3PZPA 4J9SA 2RAQA 1LEOA 2V94A 2ZC4A 2GGPA 4TVAB 2V6AA 2R7XA 2LA6A 1S1VA 4YR0A 2XI3A 4B3RJ 3IP0A 3FGVA 2KT5A 3OUYA 4K50A 2H9ZA 1QDUB 4XK8C 1IKYB 2PA3A 5AXKA 1UA1A 1EETB 1X4DA 1SJ3P 4KB7A 2ALZA 5DGBA 3Q24A 2HURA 2APOA 4DR5J 2WB1D 1TL3B 4ECRA 1SJ1A 3DGPA 2QL7B 2K06A 4ZJOA 4DL5A 2BYCA 3M7VA 1SC4B 4PWWA 1H98A 3M32A 3HSJA 1FXLA 4A8KA 3M4XA 2O66A 1L3VA 2Z30B 5A6WA 5HMWA 1TTHB 5E33A 1AROP 1UZHA 2F65A 3D3BJ 4DCPB 3DRYA 4PG8A 4MKYA 2XNQA 1WDTA 2KXFA 2CPYA 4K0KF 1Q79A 3MMAA 2HBQB 1N36F 3NCPA 2W4PA 7AT1B 3W5YA 1HA1A 3UWTA 4QIGA 1V9OA 2A2CA 1E6VB 3C66A 3F0NA 2M3DA 2ZBRA 4FYVB 5J2QB 3FSXA 5AE1A 2VC1A 2W2MP 1VRUA 1VQ8S 3EGVA 4RU2A 3G9CA 4HHHA 5GADI 3OT9A 4I2PA 4RW6B 3TAMA 4IUFA 4GC6A 3PXGa 3OTCA 2ZKTA 4JI8F 3DOMA 3TX8A 2P8IA 2DRAA 4PYDA 3G6ES 1CS4B 4NPOA 1FVSA 3VAJA 2YNIA 2HS4A 4PPDA 3CGIA 1TU0B 4WP3A 2XC9A 3K58A 3HVAA 2QLJB 1I6JA 4B9VA 5BYSA 4JYAF 2UU9J 3W8PA 2A3JA 2HW3A 4BWMA 4TKTA 3TQ1A 3HP6A 2ZITA 3D54A 1IBKF 2NXUA 3MM9B 2AHOB 2OI2A 4ED5A 1WOOA 1VQSA 4X4VA 1IM4A 3IBWA 3D2WA 2WK4A 2FC9A 3MEDB 2C2NA 2BVZA 3QT8A 1Y3KA 4DX6A 3H5UA 5IV4A 2QA2A 2B7BB 2R2SA 2IC3B 4YMEA 2QO3A 3ZTOA 2IBKA 2W8KA 2FTRA 3GG0A 5KG5A 1RYSA 1CQMA 1RT6A 2MZRA 2NSCA 3KLHB 4JI7J 1F60B 2HMIB 4HHUA 4LF5J 5E0OA 1FKPA 4LRAA 4K5SA 1JLAB 4USVA 1FF2A 3JQMA 2WBRA 1LWEB 1UFKA 4FNHA 5C2CA 4WFBQ 3U1LA 4UZCA 2GQQA 3DRSB 2OHDA 4ATNA 1IR2A 3I87A 1WOPA 1TKTA 2OPRB 5DLGA 5KFIA 3PRVA 2YH0A 2IA0A 1RCOB 3C6UA 1NSKL 2M7SA 2JNJA 4DBQA 2MZ1A 3H2LA 1S9GA 4OX9F 3WX8A 4NA3A 1IKWA 1RT7A 1F1BB 2NR0A 3U7JA 1OSCA 2RU3A 5DZ6A 2FVRA 2EW9A 1N54B 1GK8A 4X66J 1PAEX 2C3YA 3G8TA 3SFUA 1N34J 4LF9J 2ILYA 3UR0A 5GMEA 4CO2A 4DXLA 4OYOA 1S1XB 2GIQA 2Y0BB 1JXEA 5IQ6A 2BXJA 3CEDA 1RTJA 1JJ2R 1DTTB 3C14A 3PV8A 3IA0A 1C4AA 4F4AA 2IIHA 4N8NA 2IVMA 4ZP6A 2FLOA 4U6PA 3UDLA 2E29A 2YNGB 3DI6B 3EPGA 3JXOA 2ADBA 3FBEA 1KHWA 2JWNA 3BR8A 1T05A 2C3MA 3QGGA 2CVIA 3PYGA 2D69A 5G0RA 3GFXA 3QSIA 5CCMA 2DNPA 1JJ4A 3JAMU 3R1HA 4X4QA 1TAUA 1Z4UA 1GMWA 2FHJA 3GIKA 1R0AB 2XEXA 5H9FJ 3T19A 4P75A 1XNQF 3SSRA 2EXUA 4QQBA 4RW8B 5B0FA 3VAKA 3PW7A 4B02A 3KNAA 3GIIA 1JLFA 4NLDA 2CA9A 1NK7A 1YJNS 3WX4A 1UFLA 2Q3PA 3EDRB 1D9FA 2LDYA 4ZVHA 2AGPA 2ZZNA 5FLXY 4DFPA 4ZPAA 2QN6B 3CCMS 5IXUA 5A8WA 3M8SA 4DV0F 3W64A 3OXGA 5JVGQ 4M5KA 1FVQA 1QE1A 1H7WA 3MEEB 3N5FA 4KO0A 5F41A 1U8SA 3D1HA 3T9NA 3B82A 1R6YA 2VFRA 4B3OB 5DRKA 5E5NA 4NMLA 3W5XA 5K8MA 2F3JA 4JI1F 1HBOA 3PFOA 2ZEJA 3GV7B 3MOJB 4J9RA 3PO4A 3TAPA 3EZUA 3I0SB 1HQEA 4QYZJ 1F2GA 2B8QA 3MWBA 2KM8C 2XHCA 1UVNA 4UF4A 1GTHA 1KOHA 4Q8EA 4DPXA 3T41A 2N7CA 4DSJA 5CH7B 2LVWA 2CPIA 3NP5A 4NYPA 4B3TF 4NLRA 1U09A 1ULRA 3A1YG 2W7OA 1MROA 3UI3A 2WOMA 3BGUA 1M5SA 4TYAA 5J2PB 1NB7A 3R5JB 4BC7A 4JV5F 3DOLB 4KGMA 4F0MA 3MURP 4QPTA 5DDPC 1ZZNA 3CDAA 4DU8A 3JS9A 2BJDA 4WK3A 1RA7A 3PKMA 5KG2A 3HZEA 2R7TA 1FRKA 1VK3A 3MEGB 4NZ6A 1M5HA 2BW2A 2KYZA 5KFXA 3T6JA 2ZBQA 2ZUAA 1FFWB 1NK6A 3SDEA 4OZJA 4RO0A 4N56A 4MH8A 1MU2A 3AQPA 2ILZA 4L3NA 4BWJA 2W2OP 3KWMA 3NY0A 2QG9B 3CJKB 3AY0A 1IKYA 1IKVB 2DCLA 1PCAA 2BA9A 4P7TA 4O44A 2DHAA 3OW2R 3CE8A 4USIA 3DMJB 2BACA 2XSFA 1VQMS 2UVRA 1TL3A 1RA6A 3HZGA 4W4MA 5L38A 5IS2A 3IN5A 1FRHA 4GKKF 2DKOB 3H42A 1KVIA 1N5YA 2E9RX 3LWLA 3MTKA 4Y2KA 5F8IA 4KKOB 2E5LJ 3CSKA 4X4UA 5D78A 3RTVA 2FJVA 4FXDA 3H7HB 2R8GA 2CQPA 2YQ3A 5KFKA 1NZ8A 2ZJQQ 2MB0B 2DR9A 3VQSA 4CLZA 1DTQA 1KDNA 4U9RA 3IS9B 1RDRA 4K0KJ 2AJ2A 2W1BA 1N36J 4K2JA 4USKA 2CDQA 3B4DA 2Y3YA 4U95A 3KHHA 3Q2SC 4DZ6A 5IWAF 2MZQA 3BKUA 2CPEA 1KLMA 1LFWA 1G2EA 3ZTRA 5B0GA 2C2ZB 3MPUB 2FZGB 5J1EB 5EN1A 3CO0P 4ZPVR 3OD2A 4NRTA 4F36A 2JHEA 1HQUB 1HKAA 4P73A 1HPZA 4IR1A 4H54A 3VAIA 2E1PA 2KJVA 1TL7B 3OV7A 4IH6A 1GMWD 4JI8J 2FHJD 4OZNA 1XR7A 4BDPA 3NBPB 2CQDA 5HBMB 2E7XA 4NL5A 2G13A 2HHHF 4K5RA 1NKBA 3P6YC 4WFAQ 1SH3A 3RAXA 4USWA 3ZO7A 3SCJE 1CJTB 3AAWB 4PWDA 4JYAJ 2HFVA 2AYBA 3H90A 4UY85 1S0NA 3HD2A 3DOKB 4F2SA 3V4IB 3MEDA 3LAMA 1YHQS 4QZVB 2EEYA 2B9WA 2MMYA 2MY8A 1M90T 3FRZA 4PUOB 3N4WA 2HHVA 2B8PA 2BW7A 3GTYX 5H9EK 2HVDA 3VZHA 1NSPA 2FIUA 1HR0F 2GMHA 2MHNA 1LW0A 1IWGA 2V2VA 4EI2A 2QTWA 2VFTA 2DPIA 2W7AA 1UWAA 1VK8A 2EC2A 1X5PA 3TWZA 1FNOA 4URSA 1JLAA 1Z2LA 4F04B 3PYEA 1LW2B 1AT1B 1VC6A 4NOHA 1YRTA 1WEXA 2IVYA 1WC3A 4G1IA 1WG1A 5DQHA 4CP5A 2MKCA 1Y9OA 1JMTA 4H4MB 3HFKA 2DVIA 5K14A 2FZCB 2PC6A 4DV7F 2YXLA 1B64A 4YN3B 5EWGA 2DBBA 4ENOA 3IR6B 2Y1RI 1W25A 4DFJA
chains in the Genus database with same CATH topology
3FBEA 2VU5A 1NHKL 2ZUAA 1XIQA 3NGUA 1NSKL 1NUEA 4ANDA 3WX8A 4DZ6A 2DXEA 4FKYA 3BH6B 2B8QA 1WKLA 1U8WA 4KPCA 1HLWA 3FC9A 1BE4A 2DXDA 4DUTA 3Q8UA 1PKUA 3EJMA 3B54A 1EHWA 1LWXA 1W7WA 2BEFA 1K44A 1NCLA 3ZTOA 4FKXA 3ZTRA 2HURA 3FBCA 1BHNA 1WKJA 1MN9A 3Q8YA 4UOGA 3ETMA 3VVUA 2B8PA 3G2XA 2BX6A 3MPDA 3FKBA 3BBFA 1WKKA 2HVDA 4ANCA 1PAEX 4EK2A 4DI6A 3DKDA 3NGTA 1NSPA 3ELHA 3VGSA 1NDPA 1VYAA 5BXIA 4F36A 3EVMA 3VGVA 1HIYA 1NDKA 1BUXA 3FBFA 4C6AA 3VGUA 3DDIA 3VVTA 4HR2A 4O0NA 3BH7B 4UOFA 2DXFA 3PJ9A 3R9LA 3FCWA 4WBFA 1B4SA 2HVEA 3ZTPA 3NGRA 4S0MA 3ZTQA 5IOLA 4ANEA 2CWKA 1NSQA 1HHQA 1NB2A 5CAAA 3GP9A 3B6BA 1NDLA 1B99A 3BBBA 1MN7A 3EMTA 3Q83A 3GPAA 3EVOA 3JS9A 3ZTSA 3EM1A 3Q86A 4F4AA 1F6TA 1S59A 1NPKA 4CP5A 3PRVA 2AZ1A 3FBBA 2DYAA 1F3FA 3EE3A 1S5ZA 2AZ3A 3ENAA 3NGSA 5CABA 1XQIA 3EVWA 1UCNA 1LEOA 2DY9A 3BBCA 4W98A 3VGTA 1S57A 3Q8VA 2NCKL 5C7PA 3L7UA 1ZS6A 1JXVA 3Q89A 3FCVA 1KDNA 1NDCA 4ENOA 4UOHA 3EICA 1NLKL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FBE A;  2VU5 A;  1NHK L;  2ZUA A;  1XIQ A;  3NGU A;  1NSK L;  1NUE A;  4AND A;  3WX8 A;  4DZ6 A;  2DXE A;  4FKY A;  3BH6 B;  2B8Q A;  1WKL A;  1U8W A;  4KPC A;  1HLW A;  3FC9 A;  1BE4 A;  2DXD A;  4DUT A;  3Q8U A;  1PKU A;  3EJM A;  3B54 A;  1EHW A;  1LWX A;  1W7W A;  2BEF A;  1K44 A;  1NCL A;  3ZTO A;  4FKX A;  3ZTR A;  2HUR A;  3FBC A;  1BHN A;  1WKJ A;  1MN9 A;  3Q8Y A;  4UOG A;  3ETM A;  3VVU A;  2B8P A;  3G2X A;  2BX6 A;  3MPD A;  3FKB A;  3BBF A;  1WKK A;  2HVD A;  4ANC A;  1PAE X;  4EK2 A;  4DI6 A;  3DKD A;  3NGT A;  1NSP A;  3ELH A;  3VGS A;  1NDP A;  1VYA A;  5BXI A;  4F36 A;  3EVM A;  3VGV A;  1HIY A;  1NDK A;  1BUX A;  3FBF A;  4C6A A;  3VGU A;  3DDI A;  3VVT A;  4HR2 A;  4O0N A;  3BH7 B;  4UOF A;  2DXF A;  3PJ9 A;  3R9L A;  3FCW A;  4WBF A;  1B4S A;  2HVE A;  3ZTP A;  3NGR A;  4S0M A;  3ZTQ A;  5IOL A;  4ANE A;  2CWK A;  1NSQ A;  1HHQ A;  1NB2 A;  5CAA A;  3GP9 A;  3B6B A;  1NDL A;  1B99 A;  3BBB A;  1MN7 A;  3EMT A;  3Q83 A;  3GPA A;  3EVO A;  3JS9 A;  3ZTS A;  3EM1 A;  3Q86 A;  4F4A A;  1F6T A;  1S59 A;  1NPK A;  4CP5 A;  3PRV A;  2AZ1 A;  3FBB A;  2DYA A;  1F3F A;  3EE3 A;  1S5Z A;  2AZ3 A;  3ENA A;  3NGS A;  5CAB A;  1XQI A;  3EVW A;  1UCN A;  1LEO A;  2DY9 A;  3BBC A;  4W98 A;  3VGT A;  1S57 A;  3Q8V A;  2NCK L;  5C7P A;  3L7U A;  1ZS6 A;  1JXV A;  3Q89 A;  3FCV A;  1KDN A;  1NDC A;  4ENO A;  4UOH A;  3EIC A;  1NLK L; 
#chains in the Genus database with same CATH topology
 3QT6 A;  3W9H A;  3IFE A;  4TU8 A;  3KLV A;  2E7W A;  2WON B;  1TK0 A;  1LWC B;  3KK3 A;  2ZBP A;  3WQP A;  3HT3 A;  1RHJ B;  4NLT A;  2HHQ A;  1HNZ F;  2VF3 A;  3NS7 B;  2NYI A;  4OX9 J;  1OQ3 A;  4ANC A;  2Z58 B;  1V3S A;  4Y2M A;  5HLF B;  4DL3 A;  4QOT A;  2ROP A;  3TZZ A;  3QIP B;  2LEC A;  1N33 F;  4RJV A;  4B17 A;  2OEL A;  1NND A;  2Y1I A;  2HVE A;  1WHV A;  4JUZ A;  3A12 A;  2DGS A;  3K89 A;  2HGL A;  1SVD A;  4O3O A;  3EVO A;  1T03 A;  4YDD B;  3QAE A;  2ZJR Q;  2VG5 A;  1SQG A;  2GAH C;  4ED3 A;  4ZJL A;  2CIM A;  2UUB F;  2LU1 A;  1DTT A;  3MM8 A;  3OSP A;  4EYI B;  4M5I A;  1TV6 A;  4JI0 F;  1HD0 A;  2LXI A;  2ATC B;  2FLL A;  2VBX A;  2PI5 A;  2YX1 A;  4M5N A;  4CCH A;  2W2N P;  2VHG A;  1HD1 A;  2QE5 A;  2FY1 A;  2VIC A;  2DEI A;  4KFB A;  2G9O A;  1FJ7 A;  1IXK A;  2H1Y A;  3JSR A;  5A6P A;  4NMX A;  1Q78 A;  4Y3C A;  2YQ1 A;  2R7O A;  2HHT A;  1YVF A;  1TMM A;  4CO4 A;  3FK4 A;  3MR7 A;  1WF1 A;  3FKB A;  2ABY A;  3B8H A;  2YKN B;  3SQO P;  5D3G A;  5LSL A;  1SL0 A;  4LIR A;  1VOM A;  3NNH A;  2AGQ A;  4WFZ A;  4YY3 F;  3ZZR A;  1Q7Y T;  4YUD A;  2O3D A;  4DCJ B;  2CRL A;  1XNQ J;  4NLW A;  5CQG A;  4RX6 A;  3T3F A;  2ZWO A;  3GSD A;  2CG4 A;  2DIS A;  2PDA A;  2ZNY A;  1YLX A;  4DFK A;  4OJG A;  5KFG A;  1L3K A;  2HVZ A;  3IR5 B;  3H25 A;  4KY3 A;  1MG7 A;  4TU9 A;  5C5J A;  3MEE A;  3HMJ G;  4Y0F A;  3EIC A;  4TLQ A;  3ZNU A;  1M1H A;  4QJV A;  2YQ0 A;  2HG4 A;  3KYL A;  2W2P P;  2AT1 B;  2MGZ A;  3W7B A;  3V4M A;  2DNQ A;  3O5T B;  3P4U B;  1UJ4 A;  2Z0G A;  2X1G A;  5HVH A;  3CXC R;  3MEC A;  1X4H A;  4MK8 A;  3KHL A;  2BKP A;  2OFG X;  1BLU A;  1ZH5 A;  3TAQ A;  4UOF A;  3MM7 B;  3PJ9 A;  2OP5 A;  5CZX A;  4H4O B;  2QSW A;  1ICE B;  3E2E A;  4PXC A;  4B3T J;  4LBP A;  1CC7 A;  3CO9 A;  2CJA A;  5J2P A;  3T5K A;  3D1Q A;  4EBD A;  3GJR B;  3OQ2 A;  3OR2 B;  3PIO Q;  2HBY B;  2NUU G;  4JV5 J;  2RKI A;  2HWI A;  2GA7 A;  3L7U A;  4I2Q B;  4HDH A;  3BSC A;  4CNZ A;  2EFO A;  4F4W A;  3HT0 A;  4LFB F;  1B0P A;  3MEG A;  3OVA A;  4PXB A;  4IOC Q;  4NI2 A;  1N6Q B;  3WHI A;  4ZCI A;  5J1N A;  2QA4 S;  4XO0 A;  2MJN A;  4TYB A;  1C2P A;  3GJT B;  3DRP B;  3UD4 P;  2GVD B;  1U1M A;  2W9B A;  4IOA Q;  4C0B A;  1AA1 B;  5M2R A;  3HHL A;  2PGC A;  1FE4 A;  1X4B A;  4YOE A;  3CDB A;  4ALZ A;  1IBC B;  3I0R B;  1ZPV A;  5F8M A;  2CDR B;  3EYZ A;  2W4D A;  3DMJ A;  4PAB A;  4ANE A;  3J7A N;  2V63 A;  4ZCL A;  2Q43 A;  3GG1 A;  4M5D B;  4AT1 B;  2BAN B;  4X4T A;  3LH2 S;  4ES3 A;  2VA2 A;  1U1R A;  3DLL Q;  3D0G E;  2XY5 A;  1PJ6 A;  2K3K A;  4B9N A;  2N7Y A;  2QFJ A;  2RHQ B;  4I68 A;  1N52 B;  1EAR A;  2VOD A;  4AL6 A;  2CNN B;  3EUN A;  4FF4 A;  1NLK L;  2GC8 A;  3R6G B;  3P45 B;  3Q2T C;  1FJC A;  4J5O A;  2ZJP Q;  2HFS A;  1ZA2 B;  1YWX A;  3FC9 A;  1HFE L;  4QU6 A;  1K73 T;  2PEB A;  2ATL A;  3A8E A;  1HNI A;  3BDE A;  3FEX B;  3K0J A;  2HAI A;  1D3W A;  2HFU A;  3PVX A;  3T5J A;  5B0B A;  4MMO A;  1Y7P A;  2HNZ B;  1HIY A;  2CNO B;  4WCE Q;  1RT5 B;  4HR2 A;  5MLC V;  4WBF A;  1CUL A;  1HQU A;  4IG3 A;  4LQ3 A;  5IT9 U;  2WAQ D;  3DM2 A;  2KVQ E;  3BBB A;  1LK7 A;  3OL7 A;  2F5G A;  3NGD A;  1J5E J;  3NBP A;  4ZP7 A;  5KG4 A;  4J9K A;  1HW8 A;  1TVR A;  3CB4 A;  4WXO A;  1RHR B;  2AX1 A;  2CZV C;  1LQ9 A;  1X31 C;  1LXJ A;  4DR4 F;  2L3M A;  2V4J A;  5KFS A;  2HHH J;  4CLW A;  1VQ9 S;  1RTH B;  2J8S A;  4DR1 F;  2VON A;  5DM7 Q;  2VG7 A;  1HBN B;  2KO1 A;  2PMZ D;  3D66 A;  5C25 B;  5HMX A;  4ZPB A;  1JKH A;  4M5J A;  4MIW A;  2R2U A;  4CO1 A;  4YQW A;  4R8U A;  1HBM B;  4E2F B;  4U67 Q;  5L1K A;  2M0G B;  4EBC A;  1F5C A;  1NK0 A;  1NK4 A;  2KZZ A;  4F4Z A;  3EXY A;  5KG3 A;  2ALY B;  3K59 A;  2VC0 A;  1M5O C;  1FER A;  3ZTP A;  4WU3 A;  2ZFH A;  5IOL A;  2XLJ A;  4DQR A;  5LT5 A;  4RW9 A;  3MD1 A;  2Z2L A;  2M70 A;  2CQ1 A;  4K4S A;  1HR0 J;  2DRD A;  2K3I A;  4B9U A;  4ID5 B;  2JLE A;  3KG4 A;  3KK1 B;  3FSI A;  5E3R A;  5DG9 A;  3RZA A;  2XCA A;  3P5T L;  4F4X A;  1FDD A;  1S59 A;  1NPK A;  2NS1 B;  4Y34 A;  1XMB A;  4U8Y A;  3I5C A;  4QWA A;  1XQI A;  3SYZ A;  4X4R A;  1WC5 A;  4L75 A;  2ZE2 B;  1Q5V A;  1BQN B;  4H4M A;  1U45 A;  3N9U C;  1RWK B;  2U2F A;  4ZIV A;  1H2T Z;  1Q5Y A;  4DV7 J;  3GV8 B;  5ETM A;  2J7W A;  1IJF B;  3HVT A;  4OI2 A;  2MKY A;  2DIT A;  5AXM A;  2RQK A;  1JJH A;  2J5A A;  4G65 A;  4P71 A;  2D9O A;  5T7L B;  5KFN A;  3CNQ P;  4C9D A;  2MDA A;  3NAH A;  1LWC A;  3MXH P;  3KLF A;  3N28 A;  2VL1 A;  1N5V A;  4J7C A;  2DEJ A;  3SCK E;  2DTJ A;  3EGN A;  1YSJ A;  4LF4 F;  4RBT A;  4HHJ A;  4USJ C;  1S72 S;  3MAA A;  3NG8 A;  4CH7 A;  1VQK S;  3EMT A;  2FVC A;  2R7V A;  3RRG A;  3VAM A;  2PII A;  2OKQ A;  2RSQ A;  1N33 J;  3BF4 A;  1O51 A;  4DPW A;  3HHL D;  1DLO B;  1NAQ A;  4WK1 A;  3M8Q A;  1Q8K A;  1H74 A;  4WYW A;  1WG5 A;  2IM1 A;  1FJG F;  1REG X;  3T9Z A;  1EZZ B;  1V3Z A;  2FB0 A;  3MPY A;  1RXO B;  1AXQ A;  2HYI B;  1X4C A;  1Y10 A;  4ELU A;  2IPO B;  2UUB J;  4DQI A;  5ETR A;  4JI0 J;  3DHX A;  1RAD B;  1D1U A;  2LEA A;  2HND A;  2XY7 A;  1U6F A;  4M95 A;  3OHB A;  3G82 A;  4MTP A;  3IG1 B;  4WU2 A;  3THV A;  2VOO A;  1XBW A;  5DDR C;  3B4M A;  4LRF A;  2BMB A;  2HAF A;  5AXL A;  2JZ5 A;  3LUY A;  1PYO B;  1RWM B;  4ICL A;  4BHQ A;  2W25 A;  4ZIT A;  3CUN A;  2HIY A;  2C3U A;  3VAG A;  2HHW A;  4K4W A;  8AT1 B;  3GLJ A;  1WD6 A;  4YY3 J;  2YX7 A;  3GMG A;  1ACM B;  4LFA F;  1S76 D;  3RW7 A;  1HWI A;  3ADA C;  1WI6 A;  1ZS6 A;  1RP5 A;  1TKX B;  2KKH A;  6AT1 B;  3GIL A;  4L76 A;  2W7P A;  4AYB D;  1P1T A;  3DCA A;  2MQL A;  2RU9 A;  2NXC A;  1W26 A;  2L9D A;  4HAC B;  3K5N A;  4DSL A;  4DS5 A;  4NLG A;  1U8W A;  3H20 A;  4KE5 A;  1JLG A;  4QW8 A;  3Q8U A;  4L74 A;  4KSE B;  1U7L A;  2E1A A;  3QJL A;  1WNE A;  3QMQ A;  4K59 A;  2AWZ A;  3DC2 A;  4QR2 A;  3UE2 A;  1S1W B;  4CDI A;  2AYE A;  2V8V A;  3TW0 A;  3NKY A;  2GQC A;  3VQT A;  3MM5 B;  2LXF A;  5DG7 A;  1GMU A;  3EGW B;  2H54 B;  5HRO B;  2FJB B;  1Z2Z A;  2YKM B;  5LJ3 Y;  4LF8 J;  1RBA A;  5EHH A;  4RNN A;  3HHN B;  4H4O A;  3X3U A;  2XMU A;  2XS7 A;  1SQF A;  4EBE A;  1XJW B;  2HGM A;  4ZOS A;  2BDP A;  1BC6 A;  1S57 A;  1D8Z A;  4ZCM A;  1PGZ A;  2G0C A;  5ETP A;  3TNV A;  1FD8 A;  4UOH A;  4RW4 B;  4QIE A;  3FMW A;  2R2R A;  2KJW A;  1RT1 A;  3SIP B;  4ER8 A;  4FKY A;  2DD8 S;  2RUS A;  2X7I A;  3HCX A;  3MR6 A;  4LFB J;  4RUH A;  3H98 A;  3R7S B;  1D0E A;  2VG6 B;  2J6S A;  4DG1 A;  1U1L A;  4RWW A;  5KFE A;  2Z2Z A;  3UD5 A;  3DRP A;  1U26 A;  1M5K C;  4K4V A;  2DHG A;  2GVD A;  2QYC A;  2BE2 B;  3TZW A;  3M2R B;  3U02 A;  3DDI A;  3CD7 A;  2XNR A;  4DUZ F;  3AQO A;  1Q16 B;  4ECQ A;  3KMQ A;  4LF6 J;  1S0O A;  4KC5 A;  4NXN F;  4RL1 A;  3JYT A;  1QSS A;  2VKZ G;  2JLG A;  4FS2 A;  4QWB A;  2BAN A;  3M6V A;  2G2Y A;  4XDD A;  2C2D A;  2BOA A;  3BBC A;  5A2Q U;  2FUG 9;  3CJR A;  2DNZ A;  3K7R A;  4X65 F;  3HKZ D;  4F26 A;  1S77 D;  3HPO A;  2IFX A;  4IG0 A;  2AYG A;  1TL5 A;  5KG1 A;  4CLU A;  3HSZ A;  2GW8 A;  2V8D A;  2G0J A;  2JX2 A;  2ASD A;  2IAJ A;  1R7I A;  2MEW A;  1UJ5 A;  4YFU A;  2WVE A;  5I3P A;  3R27 A;  2B4O A;  1JLC B;  2MKS A;  3LAL A;  1RB0 A;  4HT7 A;  3V2U C;  5KFQ A;  2DK2 A;  1NXI A;  2YY3 A;  3MF5 A;  1C1B A;  2O01 C;  4IRD A;  1U6Z A;  2HQF A;  4QW9 A;  1J27 A;  5DQI A;  2ZOF A;  2QLX A;  1NSA A;  1JLQ A;  1YQH A;  4HL9 A;  1CPZ A;  1SIZ A;  3CJ3 A;  1N5T A;  2MQ8 A;  1P9Y A;  1R43 A;  3M9O B;  1TMJ A;  2DO4 A;  1QVG R;  4Q2L A;  3CJ0 A;  2WVC A;  2RRA A;  1S9E B;  2LQ8 A;  1B99 A;  1PG5 B;  3KLI A;  3KDO A;  3ET6 A;  1B0V A;  4ZPC A;  3U1M A;  3TR5 A;  1VQN S;  1Y4Z B;  3V6D A;  1BMQ B;  5CAB A;  3CMQ A;  3AXM A;  3BO3 A;  3KJV B;  4UTG A;  2C2R A;  1FKO A;  1RIS A;  2HQC A;  3LP1 A;  4KR0 B;  4ZA1 A;  4DR7 F;  5HN0 A;  3AOB A;  4M5H A;  1S1U B;  4Z7Y A;  1KRP A;  5CZV A;  1BXN A;  4CI0 B;  2IDL A;  1EB0 A;  4ZIW A;  3PEJ A;  3IBF B;  5ADZ A;  1FRJ A;  5I3U B;  4DPO A;  1TL1 A;  4DR4 J;  4Q8F A;  2NQP A;  1AYE A;  2V5H G;  5GAE U;  4MYT A;  1K0V A;  5JMN A;  2WBM A;  4KAI A;  4UOG A;  4OYI A;  4F0K A;  5C25 A;  3BBF A;  3A8K A;  1DBD A;  4ED6 A;  3HLU A;  4JI5 J;  5BXI A;  4J9O A;  4UZB A;  2ADC A;  2BQR A;  3CJQ A;  2IJF A;  4AE5 A;  4V19 J;  1NPP A;  2J7K A;  4ZVG A;  3QBC A;  4C4W A;  4DS4 A;  1QD1 A;  2Y8Y A;  5F0W A;  4MFB A;  4TQR A;  4OHX A;  3C19 A;  3PJX A;  1T8E A;  5G4D A;  1OQ6 A;  2HK3 A;  4WJB A;  2GO8 A;  5EX3 A;  2HWH A;  3NGS A;  3KK1 A;  3QID A;  4NZ7 A;  1UMJ A;  2E1C A;  2G1H A;  2OO4 A;  5L8R C;  3GFY A;  2D9P A;  2ZE2 A;  4C97 A;  1BQN A;  5AE2 A;  4ECV A;  5HJX A;  2GZO A;  3J80 Y;  4C3L A;  3RB0 A;  2G0I A;  2ZH2 A;  5GVQ A;  3D0H E;  4EO6 A;  2KI2 A;  2GJI A;  1HI1 A;  1DY3 A;  1WSV A;  4DWI A;  3CCQ S;  2RQ4 A;  1R0C B;  4J9L A;  5CYQ A;  3QAT A;  1HW9 A;  3WIV A;  2HNY B;  4B9S A;  4WPA A;  2YWK A;  3NMA A;  1TAQ A;  2DXF A;  2EBG A;  1SV5 A;  2K1R A;  4KGV B;  4N8O A;  3TI0 A;  1NH7 A;  3NGK A;  3DU5 A;  5C42 A;  4DV5 F;  3QNW B;  5F8J A;  2LYV A;  2WRM A;  2M5Y A;  4LF4 J;  5SZT A;  4ZMM A;  3DGV A;  1YGY A;  2J7U A;  4L3K A;  2HGN A;  3M2V A;  1HNW F;  3IC1 A;  2XMV A;  3A4T A;  2VJU A;  1DLO A;  3OPK A;  4QIW D;  1I94 J;  4V19 X;  3UDV A;  4WTY A;  1KOO A;  3KLE B;  2VU5 A;  2DGQ A;  3QSY B;  2LQ9 A;  1W2B R;  3FNN A;  5HVG A;  2F1F A;  2CAJ A;  1MNE A;  4B3M F;  3HXM A;  1FJG J;  4CIO A;  4JOU A;  4ZLJ A;  4N76 A;  5D8H B;  1LWF A;  3DLG B;  3FMB A;  2ZNZ A;  1YBA A;  4LSZ B;  3R7B B;  2POK A;  4HH1 A;  5GAE I;  2Y9H A;  5HI7 A;  5DJB A;  2B6A B;  2FD2 A;  3MUV P;  3CC4 S;  5GAG U;  2PE8 A;  4Q44 A;  1JJC B;  1DAX A;  5DGA A;  2HBR B;  4P6Q A;  1RLC L;  2B43 A;  1RAH B;  3FFI B;  5E41 A;  3AJ2 A;  2QSF A;  4ZVU B;  1QLN A;  5A8K B;  3BGL A;  3H59 A;  2GAG C;  3POT B;  4WP9 A;  4W90 B;  4CLP A;  1LKZ A;  3IWL A;  4JI4 F;  2JDJ A;  1X9W A;  2NRE A;  3GB0 A;  4KV8 B;  4N47 A;  4M94 A;  3CCR S;  2BE7 D;  5F3Z A;  2WZ1 A;  3EVW A;  4A8X A;  1UEV A;  2MSS A;  2ZZT A;  2EFP A;  3IO1 A;  4X4O A;  2IDE A;  3SCI E;  1UWB A;  4XPC A;  2OJ3 A;  5KFY A;  1U24 A;  5I42 A;  2AIR B;  1CJK A;  4LFA J;  3Q22 A;  4OI1 A;  3CJ8 A;  2WVF A;  4ZPT R;  8RUC A;  4DOZ A;  4AL5 A;  3FEZ A;  4CNY A;  3KDN A;  4NA2 A;  3DDK A;  1SL2 A;  3WBZ A;  2E44 A;  1O8B A;  2XMT A;  4HAC A;  5E3P A;  2ZOM A;  3IBC B;  4QWC A;  3I9Z A;  2YWF A;  2GS8 A;  1NDP A;  3TAR A;  3D3C J;  2B0G A;  3E01 B;  1H2U X;  1N5S A;  2BRK A;  4P10 A;  4XTT A;  5B0A A;  4UUX A;  1Q8I A;  1PAU B;  2AD9 A;  3NOC A;  2RDI A;  4U7U D;  5L9N A;  3AH6 A;  1N48 A;  2WW4 A;  3G4S S;  1M5V C;  3O1L A;  3RRK A;  1FWK A;  2AZ1 A;  2A18 A;  2VAS A;  1YBU A;  2VB6 A;  2OML A;  2EG1 A;  4FYX B;  4I67 A;  2DNL A;  2CVE A;  1N34 F;  2BJ1 A;  3PX6 A;  2K8G A;  1JLB B;  4KJI A;  4F3Q A;  2YNF A;  1T9U A;  1SH2 A;  1C0T A;  1F9F A;  2EFN A;  5HO4 A;  3OJS A;  4LUB A;  4RW4 A;  3T5H A;  1YJ7 A;  5D15 A;  3DRR B;  3TEG A;  3M1V B;  2XCP A;  2AJ1 A;  2Q6B A;  4X4P A;  5B7W A;  4JV1 A;  2ROE A;  3QFW A;  1U49 A;  1RAJ A;  3DKD A;  3NGT A;  4DN9 A;  1T9Y A;  2DIU A;  4OZ2 A;  4R5P B;  3NWR A;  3HFZ B;  2I5J B;  1R6V A;  3MCS A;  4IOB A;  1U0H A;  3QT5 A;  3SXL A;  4Q2M A;  4I56 A;  3IAM 9;  2LKZ A;  1VDH A;  5J2N B;  4AL7 A;  1MML A;  5IZH A;  4F3O A;  3KLG B;  4DUZ J;  4P2X A;  3PEH A;  1F6T A;  1URR A;  2B56 A;  1WDD A;  1R3N A;  2BQ3 A;  1Y5I B;  4OZ3 A;  2A10 A;  3BQ1 A;  2DY9 A;  4NXN J;  2KG1 A;  1S0V A;  3V6K A;  1S1T B;  4ITS A;  2MZJ A;  5B0D A;  4OYB A;  3GFZ A;  3DLJ A;  2ZVI A;  3KXD A;  5GMK a;  2GV1 A;  4ZN3 A;  5JVH Q;  2UUA J;  3BM7 A;  5IT0 A;  1XTZ A;  5I3Q A;  4GO7 X;  2YTC A;  5L1I A;  3R2D J;  2YKP A;  3CDU A;  2DXE A;  3GR1 A;  4P2S A;  3JSY A;  4X65 J;  1EKR A;  3I32 A;  4E0D A;  3WC2 A;  2CPF A;  3VV2 B;  1MN9 A;  3UO0 A;  1CEZ A;  2YKQ A;  3BDP A;  5I4M A;  1UA0 A;  3AB4 B;  1S6Q B;  5CYJ A;  1BWV A;  3UCG A;  1VQY A;  1HWL A;  1J2V A;  1L3T A;  4PG4 A;  1DRZ A;  3A8I A;  1IQT A;  4LMZ A;  2HRT A;  4DSK A;  1FWP A;  3DLK B;  2JC1 A;  3W2W B;  1RTI A;  3TYT A;  2H5E A;  1HBU A;  3BGR B;  5B08 A;  3UPF A;  4MK9 A;  1KP6 A;  2HVI A;  2UXD F;  3HX9 A;  5M2U A;  4Y00 A;  3R5G A;  4ED1 A;  5GAH I;  5KFC A;  4TY8 B;  4JV2 A;  3QLH A;  1VRT B;  1E6Y B;  2XHW A;  4J90 A;  1QAX A;  2WW8 A;  1S49 A;  3LP2 A;  3PW0 A;  3H8Y A;  2G4B A;  1JB0 C;  3FEY B;  2R4F A;  2HQ3 A;  3H2U B;  4ETZ A;  2I1R A;  3JAM Y;  1WKL A;  3KTQ A;  1RHM B;  2IYG A;  2Y8W A;  5HP1 B;  1VQP S;  1LWX A;  1W7W A;  3FDS A;  4ZCK A;  1VHI A;  3MR3 A;  4EMD A;  3OFF A;  4OYX A;  2V8G A;  3KHG A;  2OSQ A;  5EDW A;  2HIQ A;  1RE1 B;  1VBY A;  4NLS A;  4O3Q A;  2XGQ A;  1WHY A;  1KLN A;  4OYZ A;  2F8H A;  1WEZ A;  1KVJ A;  4C48 A;  3JSM B;  5LMN F;  2RJZ A;  4N7T A;  2M88 A;  1KON A;  4AUK A;  1NJX A;  4S0M A;  2QLB B;  1TK8 A;  3LPY A;  3PDN A;  1UFW A;  2VKR A;  2GIR A;  4QR0 A;  1R8C A;  3KJN B;  1Q86 T;  1GMV A;  2Y1L B;  2ZM6 F;  4IH7 A;  4MK7 A;  4TQS A;  3H5Y A;  1GTE A;  1H0H B;  4J9V A;  1EIY B;  4WE1 B;  4RNH A;  4KGX B;  5CD4 H;  2BBE A;  3M9N B;  1KTQ A;  3M30 A;  1XIQ A;  4OYP A;  2VFS A;  1VR6 A;  1PYT A;  3QT7 A;  1Z1Z A;  1IM6 A;  2AW0 A;  1TK5 A;  3J7A 1;  5AJ3 F;  2MKI A;  2E5L F;  5D4P A;  4YP3 A;  3G87 A;  4ED2 A;  1CVJ A;  3ILJ A;  2R7U A;  5D0H A;  2W9C B;  1Q0N A;  2OGU A;  1R8A A;  3IAS 9;  3TO8 A;  4PZV A;  4QIF A;  1TKZ B;  1EX8 A;  2OTL S;  4I7F A;  2ZD1 B;  5FJ4 A;  1H2V Z;  4IO1 A;  1DJ0 A;  2M52 A;  3DYA A;  2WSC C;  5F8G A;  3OLA A;  4ZK7 M;  3BSO A;  4HI2 A;  4O4G B;  4NLY A;  4PKD B;  2V8H A;  2EK6 A;  1RT2 A;  4F67 A;  1CJV B;  1H3D A;  1FRI A;  3BEG B;  1VBZ A;  5KFB A;  3LPE A;  4DV5 J;  5BYR A;  1C1C B;  1KR4 A;  3H5S A;  4ZVT B;  3ICL A;  3VTI A;  3NGU A;  3D67 A;  3RJM B;  1KSP A;  1HNW J;  4IFV B;  4G1P A;  4U7U K;  1UPM B;  1RHK B;  2N3O A;  3RB4 A;  2V69 A;  1VRQ C;  4IKA A;  2NPF A;  2UUT A;  4IFY A;  4B3M J;  2E5G A;  1CBK A;  1NEE A;  4CM0 A;  4P52 A;  3CCW A;  2MQO A;  2KT2 A;  4DR3 F;  3C6T B;  3BJY A;  3QJP A;  4HI1 A;  2XMA A;  4FPI A;  1R8P A;  3OXF A;  2XSJ B;  2B6A A;  3WZ0 A;  4YB1 P;  1SJF A;  2CJX B;  2RDJ A;  3FFI A;  1KQF B;  3S6E A;  3TJ9 A;  1UW4 A;  3Q83 A;  2Z8Q A;  3G8Q A;  3POT A;  2ZH9 A;  4KRW A;  2N4C A;  3C15 A;  3HSD A;  1IWA A;  5DM6 Q;  3F56 A;  3JB9 k;  3ONQ A;  1CJU B;  4LSL B;  4FNI A;  3MCM A;  2DY1 A;  1SUQ A;  4JI4 J;  3RUB L;  2R7R A;  3CTR A;  4C0H A;  5K8P A;  2Q6C A;  4RLE A;  3N6L A;  3NLC A;  5LL6 d;  1U6B A;  3M6W A;  5B0E A;  1DAR A;  4B9L A;  2YKA A;  3LOU A;  1IKX A;  2QLF B;  4QU7 A;  5FDL B;  3F73 A;  2BEF A;  1S7H A;  2LEP A;  3CVK A;  1FDN A;  2AJF E;  3MGJ A;  1HNV A;  4NLP A;  4B9M A;  1X4A A;  1UP1 A;  2IRY A;  1TL4 A;  1G4C A;  2GVZ B;  4NLQ A;  2NZC A;  4FZV A;  4RNF A;  2LXU A;  3ZZZ A;  2RRN A;  3LP0 B;  2EI5 A;  3L9Z A;  2ZH8 A;  2HS3 A;  3DLE A;  1F0X A;  2RDD A;  4CYU B;  2KL8 A;  4DU7 A;  3GP9 A;  1SPB P;  3LA0 A;  5J2M B;  1JIH A;  2J6T A;  1YZ7 A;  2B9X A;  2OPP B;  4YR2 A;  3RU0 A;  4Y28 C;  2J9C A;  3V5R A;  1RT4 A;  1RTD A;  2LQB A;  3V81 A;  4LR8 A;  1XEZ A;  4A8Y A;  3MMB A;  4J91 A;  4RBU A;  2PMW A;  4RR5 A;  2BKO A;  5KFO A;  4ZS6 A;  2IHR 1;  4A4J A;  2E9T A;  3M9M B;  5KFH A;  3K57 A;  1JX4 A;  2P5V A;  2DB1 A;  2JEJ A;  3R8Y A;  2MKJ A;  2MY7 A;  3GYN A;  3MTJ A;  2NXE A;  3I5B A;  2E9Z A;  4FBT A;  1GAO A;  4U7C A;  4OL8 A;  3BRE A;  5IT4 A;  3UVJ B;  1IVZ A;  2RF2 B;  4GVB B;  4DL6 A;  2GIF A;  4CQ1 A;  2CUY A;  3VGV A;  1PSD A;  6FD1 A;  3Q8Q B;  3O44 A;  1VGY A;  2WSE C;  1V5I B;  4HTJ A;  4I69 A;  2DIV A;  1OYE A;  2OPQ B;  5HQL A;  1EJ7 L;  2I9S A;  5HAN A;  2UUC F;  4O3S A;  3NEK A;  4Q43 A;  2AYM A;  1NME B;  5HK4 A;  3RYL A;  3M2U B;  5J2N A;  1VLY A;  1SCJ B;  3BQ0 A;  4B3S F;  1WHW A;  3KLG A;  4DV6 F;  3M8P B;  3MR2 A;  1AW0 A;  1S97 A;  3K5O A;  1AZS B;  3JTN A;  2GGP B;  1J5O A;  3BS9 A;  2AU0 A;  3BSN A;  4HVZ A;  1S1V B;  3S7R A;  1NJI T;  4LSN B;  4MKV A;  3HI9 A;  3KHR A;  4MIA A;  1A0O B;  1I1G A;  4OZ0 A;  2E1R A;  3QWP A;  3GSI A;  5KT4 A;  1TFW A;  1MSW D;  1ROF A;  2VOP A;  3OUY B;  3KK2 A;  4IRC A;  2AGO A;  2CZ9 A;  3CJ4 A;  2XS2 A;  3R5A A;  4ERD A;  3MMC A;  2CQ2 A;  3HD1 A;  3RR8 A;  5A0Y A;  2K2P A;  1B0T A;  3UNG C;  3NL0 A;  2Q1L A;  4OLO A;  3R7N B;  5KT7 A;  2H51 B;  3JSB A;  2J0W A;  3DGP B;  1S6Q A;  1LK5 A;  1P27 B;  1DFD A;  2AJQ A;  3GWC A;  4KTQ A;  4UOC A;  1FTR A;  2GJF A;  1FE0 A;  3NS6 A;  4UQG A;  2D41 A;  1GT8 A;  1U1N A;  4GVL A;  4JP8 A;  4DSI A;  1BQX A;  4OQJ A;  4HYK A;  2HRU A;  3QRR A;  1KC8 T;  3W2W A;  1RTZ A;  4I0W A;  1ZM3 A;  3MHY A;  2Z57 B;  3EX7 B;  1H7X A;  2DNM A;  2UXD J;  1U0S A;  3M8Z A;  5IFM A;  1S0M A;  1S10 A;  1D8Y A;  4FVM A;  3SFG A;  5D0R A;  4WZQ A;  4AFF A;  3D9B A;  3MFI A;  4D3G A;  4ES1 A;  2BR0 A;  2DNG A;  5LJ5 Y;  5C2G A;  3GU0 A;  4C3K A;  2HLT A;  1QM9 A;  2I0X A;  1AUS L;  2YNH A;  3P8B B;  1VRU B;  2UUW A;  1FJE B;  6FDR A;  1ZTT A;  3TAM B;  3Q23 A;  1FT8 A;  5CXT A;  4IDK B;  2ZH5 A;  1VYA A;  3EVM A;  2G2O A;  4OZ5 A;  1FA0 A;  5ETN A;  4CLF A;  3R1L A;  3PX0 A;  1VQ6 S;  2E5I A;  2ZUG A;  5KOX A;  3I56 S;  4R25 A;  1QTN B;  3DOM B;  3BQ2 A;  3ITH A;  4K8R A;  4FS1 A;  4WYL A;  3DRX A;  5IC4 B;  4DDF A;  4PQU A;  1C0U A;  1YJR A;  1DQA A;  1KQG B;  2IYI A;  2VBY A;  5LMN J;  2KRB A;  2F4V F;  1IUJ A;  4K2X A;  4C7Q A;  1YK9 A;  5F0U A;  2LCW A;  2YVS A;  1SJ4 P;  4ED7 A;  1FCA A;  1RK8 A;  4QCL A;  1KKH A;  5EGY A;  2ZM6 J;  2ZH6 A;  1WI8 A;  5F8L A;  5D0G A;  3TUI C;  1EET A;  2ZVS A;  3SSQ A;  2BE9 B;  5LXY A;  1T11 A;  2HZC A;  4ECX A;  4RW7 B;  2OPS B;  2ROG A;  2BJ3 A;  2R2T A;  2FGC A;  1WEL A;  3I4H X;  1YTY A;  4M5M A;  2XLK A;  2BV3 A;  5AJ3 J;  3R5C A;  1RT6 B;  2L9W A;  2B5J B;  4QPX A;  3W1Y C;  3RAM A;  2HQG A;  3LAN A;  2FC8 A;  2YPZ A;  4JV0 A;  2JL9 A;  1FKP B;  1TKZ A;  3OFH A;  4O0I A;  1Y00 A;  4DMZ A;  2OFH X;  1NB2 A;  2VIH A;  4F50 A;  2ZD1 A;  4RUB A;  3THT A;  2CPD A;  4NA1 A;  2PEH A;  2QLW A;  4C8O A;  2KN4 A;  1F9H A;  1IBM F;  3W62 A;  4ES2 A;  3TUZ C;  1UEK A;  4UY8 T;  3W3S A;  1F9E B;  1CC8 A;  1U1Q A;  1JWW A;  4PEO A;  1M0S A;  1E6V A;  3WIU A;  4AXI A;  3EZO A;  1KN6 A;  5J2Q A;  1MWZ A;  2VUG A;  1U1P A;  2DO0 A;  1SB6 A;  1NHV A;  4CWB A;  1FXD A;  4RW6 A;  1X0F A;  3UNY A;  4A48 A;  3K8V A;  1BQM B;  1NJW A;  3UD3 P;  1IKW B;  1J5E F;  3HVW A;  2AEJ A;  1RU2 A;  3FJ2 A;  1OO0 B;  5KG7 A;  3D68 A;  1CS4 A;  2DR5 A;  4LF2 A;  1T3O A;  4WZM A;  3FBF A;  4O0N A;  2EFQ A;  4DR6 F;  2B51 A;  4ECZ A;  2YWH A;  5D4L A;  4ECY A;  2X51 A;  1NK5 A;  2AP6 A;  1NSQ A;  3TZX A;  4WFN Q;  3KMS A;  1RQ0 A;  2XSJ A;  3TP2 A;  4DR3 J;  4J37 A;  3MM9 A;  5ETV A;  1T9T A;  3THP A;  3BV8 A;  1XK8 A;  4P2F A;  1RTJ B;  3C14 B;  3HVR A;  1SKS A;  2CWX A;  2IJR A;  3Q8V A;  2FJE B;  2ZHA A;  2F63 A;  2ZOG A;  2FDN A;  3ENQ A;  3W5Z A;  2OIH A;  4RU9 A;  5JUM A;  3HSG A;  3TX0 A;  2QL5 B;  3DN9 A;  4X4S A;  1T7P A;  2IC3 A;  3BO4 A;  5HMY A;  4QIV A;  2DXD A;  4IH5 A;  3R6L B;  2U1A A;  1OYD A;  3J81 j;  3KLH A;  5G0R B;  4FKX A;  2ACM A;  4ZP9 A;  4X4N A;  2HMI A;  3KG0 A;  2MQP A;  1JNR B;  3GIM A;  2CPZ A;  4UUW A;  4DSE A;  1RYR A;  4ZVR B;  3FVY A;  4OHY A;  1KNZ A;  1LWE A;  1K1S A;  2XG8 A;  3BPS P;  4KH1 B;  3MI7 X;  3DRS A;  1JLF B;  2VV5 A;  2ZBI A;  2VBW A;  2GVZ A;  2XMJ A;  5H9F K;  3CCU S;  2V2Z A;  5IT9 Y;  1N0V C;  1S79 A;  4NWB A;  2H5J B;  2OPR A;  5KFU A;  1RWV B;  3HUL A;  1YI2 S;  2LQ5 A;  2NYH A;  5L39 A;  5KT3 A;  2FLP A;  2KVI A;  5A8W B;  4GKJ F;  5EUH A;  4WXW A;  2NXN A;  3I4P A;  1QE1 B;  4KO0 B;  1DUR A;  2Q66 A;  3LWM A;  4ZN1 A;  2XY6 A;  2V9K A;  3W63 A;  1JQG A;  1K47 A;  2MKK A;  5EX0 A;  2M4M A;  1SIW B;  1ELO A;  3DNC A;  4KPC A;  3I5A A;  4TY9 A;  4LF7 F;  1PKU A;  5AT1 B;  4X64 F;  5K5M A;  2CPH A;  3K5L A;  2H4Y B;  2QV6 A;  4ZLL A;  1QVF R;  2BJ8 A;  2FVP A;  2CQ0 A;  2HQD A;  4QYZ K;  2G2Z A;  1S1X A;  1OSD A;  2RF2 A;  5DET A;  2J8A A;  1MRO B;  5KT5 A;  3F44 A;  4Q45 A;  2PFF B;  5KTQ A;  2HZV A;  3E51 A;  2ZDP A;  4P2M A;  5KG6 A;  1FX2 A;  2RS8 A;  3W2V B;  3HJV A;  3B78 A;  1L3U A;  5J1P A;  1REV B;  3GR0 A;  1NJY A;  2CJK A;  4NLX A;  3BKT A;  1VS3 A;  1VMB A;  2YNG A;  3DI6 A;  4PCQ A;  1RWU A;  3GJQ B;  2NUH A;  2MQM A;  4EZ9 A;  1EQ0 A;  1VLO A;  3MAQ A;  1B7F A;  3J7Z 5;  2FJW A;  2C28 A;  3MCO A;  2UUC J;  1RAG B;  2ZH7 A;  4V1A k;  2GML A;  4R0J A;  4IQM A;  5ETT A;  1T9W A;  1SC3 B;  1X0P A;  1A7G E;  4B3S J;  2SXL A;  5EWE A;  2EG2 A;  3GCW P;  4DV6 J;  3N5B A;  2ERR A;  1AZS A;  2QMW A;  1R0A A;  2Y1J A;  1YJ9 S;  2ZH3 A;  3SDE B;  2V2Q A;  2PN6 A;  3FZB A;  4DUY F;  4LSN A;  1MU2 B;  3G96 A;  4RW8 A;  2JVR A;  4DF4 A;  1QAI A;  3Q8Y A;  2C2M B;  3ISN C;  5BR8 F;  2L08 A;  2QMU B;  2VPZ B;  3PAC A;  2X3D A;  1XN9 A;  4O44 B;  4OI4 A;  1HHS A;  3N6N A;  3G6V A;  2KFY A;  3MDF A;  1FO1 A;  3ZTQ A;  3QWU A;  2FLN A;  2R42 A;  4DX5 A;  2VBZ A;  4QWD A;  4LRE A;  3CCS S;  3CDE A;  2A6M A;  2LLZ A;  1N5Y B;  4DJB A;  2UZA A;  4B3O A;  4ZPW R;  2EWH A;  1MMN A;  2ZBC A;  4DF8 A;  1XR5 A;  3IRW P;  5CD4 A;  4HH0 A;  3I0S A;  1RAO A;  3CD0 A;  3W65 A;  4KQZ A;  4YEA A;  2Z2M A;  2VDH A;  3BYP A;  1WAC A;  1DTQ B;  4F7V A;  3AJD A;  2ZH1 A;  1ZPW X;  1RKJ A;  2VD3 A;  4LF8 F;  4MIB A;  2EK1 A;  4N77 A;  4DSF A;  3CF5 Q;  5K20 B;  3IM8 A;  1N4L A;  2RHS B;  1KLM B;  3HKW A;  2ZZM A;  2VZ9 A;  1LXN A;  2P2C B;  4A8Q A;  1B7Y B;  4DPU A;  1RWW B;  4LIW A;  1R8H A;  3DOL A;  4BCA A;  2F8M A;  2V4Q A;  2K7J A;  2DH7 A;  4IDK A;  1KTV A;  3D0I E;  1XR6 A;  2VPX B;  4DHV A;  1PIL A;  4GC7 A;  2YH1 A;  2FHO B;  1HPZ B;  1YJV A;  1U1K A;  5L1J A;  3SSS A;  1WHX A;  3T1H F;  2CXE A;  4A8S A;  4H4K C;  1OWX A;  2QRR A;  3NS5 A;  5T14 A;  2DYA A;  2MHE A;  4J9M A;  2DHX A;  1KEK A;  3P96 A;  1FFS B;  2C3P A;  3PR5 B;  2UV8 G;  2IRU A;  1S4E A;  4PWD B;  3OTE A;  5FII A;  2F4V J;  3HK2 A;  1MMD A;  2VA3 A;  4O23 A;  1HAR A;  4ECU A;  4LF6 F;  2N4D A;  2IMW P;  1VC5 A;  3CJK A;  2B9Y A;  3QAU A;  2M8D B;  1IKV A;  2W8L A;  2EC0 A;  5KFF A;  1A9N B;  1RCX B;  5K8O A;  1H72 C;  3PHT A;  2ZWP A;  2CYY A;  3DU6 A;  2QT7 A;  2QL9 B;  4Y2I A;  4DR2 F;  1GNK A;  2KHC A;  3AXK A;  2XYG B;  1KQS R;  5ETO A;  3FUY A;  2R7Q A;  3FZ2 A;  3K2Y A;  4RW7 A;  2OPS A;  2E5J A;  3M05 A;  1IR0 A;  4IYQ A;  2LDI A;  3BN7 A;  2JSX A;  4KKO A;  4LR7 A;  1LW0 B;  2B5J A;  4EYH B;  1NKE A;  2KFZ A;  3KFW X;  4E8U A;  4M1K A;  4K4X A;  4CO3 A;  1FNX H;  1I5O B;  5KFT A;  1RLD A;  3NNA A;  4QR1 A;  4PG7 A;  4NCB A;  1ZYQ A;  4CM2 A;  2HKE A;  2J0X A;  3IS9 A;  2OLW A;  4Q5V A;  3G86 A;  2IM2 A;  2BUN A;  4ECW A;  1BY9 A;  1RAF B;  1X5O A;  1IBM J;  2W4C A;  4NYZ A;  5K14 B;  4P72 A;  2CJB A;  4RUC A;  3BGO P;  4DEZ A;  4LBI A;  5L1L A;  2NSB A;  2KT3 A;  2CQB A;  1VC0 A;  3IR7 B;  4DUT A;  1OY8 A;  3BR9 A;  2Z4P A;  5J1E A;  3HO1 A;  4C8N A;  2JH3 A;  3J81 U;  2P9C A;  2BM1 A;  2COL A;  5H1S V;  2N3L A;  3ETM A;  1TZ0 A;  2KXN B;  3KK3 B;  3OTO J;  4RUA A;  1BQM A;  2O67 A;  5HMZ A;  3CPW R;  2NZ4 A;  1QAY A;  1S12 A;  1TL7 A;  1GXT A;  2XI2 A;  3OVB A;  1BUX A;  3MAH A;  1RWN B;  2AF6 A;  2R8H A;  2PA8 D;  5HBM A;  4IRK A;  4NEZ A;  4URQ U;  3D6H B;  1CJT A;  2QA1 A;  3LGH A;  2H48 B;  3I96 A;  1U02 A;  1AUD A;  4DR6 J;  4HDG A;  5AXN A;  1R8B A;  3MUM P;  3RGI A;  5A2Q Y;  3MZI A;  3LF0 A;  3VGT A;  2RIJ A;  2JLF A;  4NX9 A;  1T03 B;  2VG5 B;  2QA4 G;  4KHM A;  4JI5 F;  2V4R A;  5AE3 A;  3DOK A;  3MM8 B;  3OL8 A;  3A8J A;  1RAE B;  3V4I A;  2J9D A;  4YB5 A;  1TV6 B;  4NE9 C;  3I6P A;  5H9E J;  2IM3 A;  3N01 A;  5HL7 Q;  4UT4 A;  3BH6 B;  4PUO A;  4GMK A;  5LM7 E;  1RBL A;  2CQG A;  3PO5 A;  4BS2 A;  3AOA A;  4A8W A;  4N41 A;  4KFB B;  4OJ1 A;  1IBL F;  4ZPD A;  3VVU A;  3L95 X;  4DX8 H;  5DZ7 A;  4EZ6 A;  1EQM A;  1ZBT A;  1M1G A;  2XGP A;  2KYX A;  3PW4 A;  1HYS B;  4O3N A;  1AB8 A;  1IR1 A;  4PG6 A;  1U2C A;  2ZHO A;  3BZQ A;  3UDE A;  2J0S D;  5D3G B;  4C8Z A;  1UVK A;  1GX6 A;  1L3S A;  1LW2 A;  1R0B G;  4NLU A;  4NEY A;  5DQG A;  4JI6 F;  3E3X A;  1YG0 A;  2RVJ A;  1N8R T;  4KYZ A;  4DL4 A;  5KFJ A;  1KVK A;  5A76 A;  4KGK A;  4ILL A;  1HHT P;  2XZW A;  3H40 A;  3SV3 A;  1VI7 A;  1OJ4 A;  3GQC A;  4BBY A;  4D3H A;  4AQY F;  3VR1 A;  4Q0B B;  2WON A;  4G1Q B;  4GKJ J;  2RQM A;  5FD1 A;  1HI8 A;  2CFX A;  4LFC F;  5KG0 A;  4CLK A;  2HHP A;  2B4V A;  4DL2 A;  1VQL S;  2XWX A;  1PO6 A;  3PW5 A;  4TXS A;  3VF0 B;  3W60 A;  2IMO A;  5HLF A;  2MGZ B;  1JXL A;  1P1L A;  2MXY A;  3QIP A;  4MJK A;  3MFH A;  4FBU A;  4J9N A;  4C3M A;  4DV2 F;  4FPR A;  4LF7 J;  4X64 J;  2P9G A;  1I94 F;  5CA5 A;  3LGN A;  4X2B A;  3MEC B;  3WC0 A;  4DLG A;  5KFW A;  3FCW A;  3GCX P;  1ZET A;  2FGO A;  1VFJ A;  1XNR J;  4F25 A;  1RJJ A;  2N82 B;  3ZTS A;  3Q86 A;  2HWT A;  3W2V A;  2GO9 A;  2XM3 A;  4CLT A;  3UCZ P;  2R9L A;  2H65 B;  1REV A;  1FFG B;  3DDN A;  2VQE F;  2CKW A;  2QJ3 A;  4ID8 A;  5C7P A;  2X1F A;  2VPW B;  1EAY C;  2RKI B;  4URG A;  5K8N A;  2OAU A;  3IGN A;  4DV1 F;  2V2K A;  1S48 A;  2Z56 B;  1S6O A;  3C16 B;  3ZZ0 A;  2JFD A;  4NI2 B;  3GIR A;  1SL1 A;  3CUL A;  3AD9 C;  2YKN A;  4DX7 A;  3N79 A;  1FI4 A;  1FX4 A;  3NOG A;  1RAC B;  2RRB A;  3TQE A;  1PC4 A;  1QTM A;  4A8M P;  4IR9 A;  4KBI A;  3JQK A;  1RUS A;  2CG8 A;  1QSY A;  1VQ7 S;  4DUY J;  2W9B B;  1WC1 A;  3M6U A;  2OD4 A;  4FN5 A;  3HHL B;  2AEM A;  1RSC A;  1K0T A;  5KFV A;  5BR8 J;  2F9J A;  1UVL A;  4DV4 F;  2FJX A;  1UJ6 A;  3D4J A;  4OYW A;  2KB2 A;  3A3P B;  3BO2 A;  2RB7 A;  1SKW A;  3KJQ B;  2C2E A;  2KHD A;  1UCN A;  2XMW A;  1R31 A;  3MR5 A;  1JK9 B;  3C46 A;  4P74 A;  4LRB A;  3AJ1 A;  1I3O B;  3ZFV A;  1QUP A;  1IJE B;  5THW A;  4O3R A;  3UR3 C;  2DCU B;  2AJ0 A;  3ZZP A;  4PR6 A;  4NYO A;  1KFD A;  1NO8 A;  1WUU A;  2EFV A;  5LSO A;  1YJU A;  3RBZ A;  1Q81 T;  5HAO A;  1UAW A;  2GCF A;  2HFN A;  4RWX A;  4DV3 F;  1T0T V;  3MM7 A;  1V3R A;  2D3Z A;  3OL9 A;  1HNI B;  3CT9 A;  1B3T A;  4M5L A;  3GFH A;  2XO6 A;  4CTA B;  3SEO A;  2MYF A;  3SV4 A;  3H4D A;  2WTF A;  3AA9 A;  4CH0 S;  3OR2 A;  3D1O A;  1VQ5 S;  1YKW A;  2LFV A;  2VQF F;  1X5T A;  1TP7 A;  1CUL B;  2WHO A;  3W66 A;  2UVV A;  4FF1 A;  3D5M A;  4IG3 B;  1QSL A;  3DLH A;  5DDO C;  2DGU A;  3X1L B;  4I2Q A;  3DM2 B;  4WF9 Q;  3ZZY A;  1T95 A;  4FF3 A;  3T1H J;  1RU1 A;  2A2D A;  1N6Q A;  3R3T A;  5BJR A;  1TVR B;  4YHH F;  1P6T A;  1DHM A;  4RZR A;  3QYY A;  1NK9 A;  2V4J B;  2DRB A;  1MLA A;  3FQL A;  1OY9 A;  2GQ2 A;  2F4F A;  1S6P B;  5E3A A;  1T9V A;  2VG7 B;  2P9E A;  4Y65 A;  1JKH B;  1IBK J;  3OFG A;  3I0R A;  2DGW A;  2DR6 A;  4TNO A;  3L7P A;  3MM6 B;  4R8U B;  1S9F A;  5MAO A;  3TVY A;  3EXC X;  4M5D A;  4PXD A;  2UUA F;  4PWU A;  4DR2 J;  1WTF A;  1FRM A;  1FD2 A;  3SBM A;  3TEH B;  4USM A;  4RW9 B;  1JLE B;  2LU2 A;  5ETL A;  2IRX A;  5KAK A;  4ZDN A;  2I8E A;  2A6O A;  3MMJ A;  1YZ6 A;  1VJW A;  3C2P A;  3IRX B;  2XB2 D;  1UVM A;  1QUV A;  4OX8 A;  3RBD A;  4DQP A;  3NWG A;  3TZY A;  2HS0 A;  1T9X A;  1Q53 A;  4OX6 A;  4YB7 A;  3BYR A;  2QYG A;  3TUP A;  3PKY A;  1LV5 A;  4NCG B;  2LA4 A;  3HJF A;  3HVT B;  1H6K X;  2HNZ A;  1RT5 A;  2WVD A;  2CQH A;  4G3I A;  2RQC A;  1PJ7 A;  1BWE A;  2RNE A;  3VGU A;  3KLF B;  3QO9 B;  3MCN A;  3VVT A;  3H5X A;  3RG6 A;  1ZM9 A;  4U8V A;  1APS A;  4USH A;  2VPY B;  3K5P A;  3TA1 A;  3PM9 A;  1F5A A;  2IJN A;  3ZXW A;  2KDO A;  2WVB A;  5FLX U;  3CD5 A;  3MAA B;  2HEK A;  4NCA A;  3Q0A A;  2D3O 1;  2EFG A;  3ETO A;  4OMF G;  2BJE A;  4XAK A;  3ZNJ 1;  4XPE A;  2DR8 A;  3QGP A;  4EFA C;  4AXJ A;  3K8W A;  1RTH A;  1B70 B;  3M8Q B;  2RE1 A;  2W2Q P;  3AD8 C;  5A8R B;  3NRB A;  5HQM A;  1HBN A;  3VWS A;  2MTL A;  2C22 A;  1YIT S;  3AD7 C;  5IC6 B;  3IGV A;  4G6V B;  1VBX A;  1HBM A;  5D6G A;  5EWF A;  2FQQ B;  4W92 B;  1SJQ A;  4R0E A;  3D6M B;  3PIP Q;  3VAL A;  1WKK A;  2HND B;  1YJT A;  5DG8 A;  2P6S A;  3G82 B;  1IBL J;  3SZ2 A;  3RBX A;  1RAB B;  2KG0 A;  2JFK A;  4ID5 A;  3GYX B;  1HYS A;  2OD6 A;  5CAA A;  1OPI A;  2Z2Y B;  1YBT A;  3IMQ J;  2JEG A;  1NPR A;  2AV5 A;  4C11 B;  4FVC A;  4ICL B;  2Q79 A;  1WC4 A;  3D6T B;  1T02 A;  1PC5 A;  2HK2 A;  2ZHB A;  4Z7C A;  3FBB A;  5KT2 A;  1Y5N B;  3ENA A;  1OIA A;  3US5 A;  4JI6 J;  2ZH4 A;  4P7V A;  3QQC D;  1X4E A;  1FEH A;  4CLS A;  3NCQ A;  1NDC A;  2BRL A;  1Q7L B;  1NUE A;  2HPU A;  2MST A;  5LOQ A;  2OEJ A;  4OJ3 A;  2WB4 A;  5T7L A;  4Q0B A;  4RBV A;  4G1Q A;  1CSJ A;  1RWP B;  4DV0 J;  4AQY J;  2DGT A;  1JLG B;  4ILM A;  3E8O A;  4LFC J;  4K4Z A;  2R8I A;  1U25 A;  2E5H A;  3FRY A;  1P9Q C;  3HF5 A;  1U48 A;  1K8A T;  2HHU A;  3G8S A;  4XDC A;  3PNI A;  4JI1 J;  4WKR A;  1RGV A;  3IXQ A;  3R9L A;  3I31 A;  2DNO A;  3OTB A;  2ACY A;  1NK8 A;  2HZA A;  5CCL A;  5HQ8 A;  2GFF A;  2D74 B;  3O6Q A;  3UFC X;  4DV2 J;  4WII A;  1UPP A;  1VBK A;  4OYM A;  2D1C A;  5IM0 B;  3OBI A;  4NXM F;  1N32 F;  1F5B A;  4Y6I A;  4GO5 X;  1OPZ A;  2C2O B;  3N6M A;  5GMD A;  3LO3 A;  4W98 A;  3DLB A;  4C8Y A;  4ZVP B;  4DZD A;  4ZVQ B;  4M8L A;  2X3G A;  4CZC A;  1LOU A;  3Q89 A;  2VFV A;  3M8R A;  3IWX A;  5KFD A;  4OI0 A;  4WWS A;  3W9I A;  2VQE J;  3N0V A;  1ZTW A;  4Z37 A;  4ZHR B;  1RT1 B;  4DV1 J;  3C16 A;  3IG1 A;  5F9L A;  1N5Q A;  1SXL A;  4C98 A;  2CAD A;  3U27 A;  2V9W A;  5IQQ A;  4ZKA A;  5D0E A;  4LVO P;  7FD1 A;  3GON A;  4DG1 B;  4EU0 A;  3AT1 B;  5E7O B;  2EVZ A;  3UN5 A;  3GIJ A;  1S6U A;  2F9D A;  2B3T B;  2R3V A;  2FPH X;  1V5V A;  3AOC A;  1NDL A;  3D28 A;  4TLR A;  1LFP A;  3R5B A;  2PMH A;  2FVS A;  3JYT B;  3O3L A;  3Q8S B;  1NHU A;  2KZM A;  1C4C A;  1TKX A;  2NCK L;  4DV4 J;  2DHS A;  3UW1 A;  2MLX A;  2WCX A;  5C24 B;  4CT8 A;  4CLY A;  2MZT A;  2OEK A;  3RR7 A;  3KKF A;  3PR4 A;  3OTD A;  1FDB A;  3ZZO A;  2HQI A;  2PSZ A;  3CJS A;  4IG0 B;  2V34 A;  4AND A;  4GKK J;  5D4N A;  5DS7 A;  2YWW A;  1WEY A;  1DQ8 A;  4N5S A;  5E3C A;  1Y5L B;  2IAJ B;  4ILR A;  1UL3 A;  4PG5 A;  1NCL A;  8ATC B;  3OHA A;  3S01 A;  1S1W A;  1RZM A;  2CNK B;  4I1T A;  1V6H A;  3MM5 A;  4I6A A;  1RT3 B;  5HRO A;  1C1B B;  4NLO A;  5CYM B;  3ZZT A;  4J9U E;  5F8N A;  1X4G A;  2YKM A;  1TUV A;  4F4Y A;  4RPF A;  4DQS A;  3LW5 C;  1QY7 A;  3W61 A;  3I82 A;  1JLQ B;  4DV3 J;  4CTA A;  1KD1 T;  3T1Y F;  3JQJ A;  2UXB F;  1S99 A;  5IWA J;  2J76 E;  3V6J A;  5HVF A;  1XMO F;  1D9A A;  3OSN A;  1WWH A;  3KLI B;  4Q7A A;  2HHX A;  3ET6 B;  3V6H A;  1KS2 A;  3BB5 A;  2VQF J;  2L9N A;  1U47 A;  1TUG B;  1WTB A;  3V6D B;  2JVO A;  3NNC A;  1FKO B;  3LP1 B;  4EWT A;  4PPZ A;  2R8K A;  1PBA A;  3J7Y U;  4OHZ A;  4KHP F;  1VIX A;  4OFZ A;  4C8K A;  2VG6 A;  3VHQ A;  4PYA A;  3SQG B;  2NXJ A;  2KTQ A;  1XWL A;  5GAG I;  4YHH J;  4TU7 A;  1JNZ B;  4JBC A;  1TL1 B;  4X84 A;  2D3U A;  3T5L A;  2BE2 A;  1S6P A;  3M2R A;  1R27 B;  3R2C J;  1WC6 A;  4DI6 A;  4OX7 A;  4K7Q A;  3H0P A;  4J9Q A;  4IO9 Q;  1NU4 A;  3LGM A;  3CWJ A;  2FY8 A;  5KT6 A;  4LR9 A;  2FJA B;  2MZS A;  3EWG A;  2NPI A;  3RB6 A;  5HAT A;  2CQC A;  2V0N A;  2IVF B;  3MM6 A;  3OJU A;  4C8M A;  1Q8B A;  5KFZ A;  2BOP A;  2YPY A;  3ENW A;  2M8H A;  4ZVF A;  4MFB B;  1S5Z A;  1VQ4 S;  1JLE A;  1G6B A;  4CLL A;  1GQE A;  4RKU C;  1N56 A;  5U47 A;  3W8G A;  1NM2 A;  3PYD A;  2GHV C;  2CPJ A;  5KFA A;  5DDQ C;  1T94 A;  3GV5 B;  4QBU A;  2FZK B;  3CCV S;  1U1O A;  2DNN A;  1JLC A;  2DPJ A;  3IRX A;  3O8W A;  3WDO A;  2O5D A;  4UQT A;  3AOD A;  2BJ7 A;  3QGI A;  1KQK A;  3DXB A;  1H73 A;  3G2X A;  2BX6 A;  2W01 A;  5KFP A;  1SKR A;  4NCG A;  1WJ9 A;  1F3V A;  3S8S A;  1X9S A;  2RUG A;  3I55 S;  5CYQ B;  1S4F A;  1S9E A;  1Q8L A;  3A13 A;  4OIX A;  1U4B A;  2AX0 A;  3QO9 A;  1YRX A;  2J6U A;  1SV5 B;  2K1R B;  1RWX B;  4FF2 A;  1L5U A;  4OI3 A;  3KJV A;  1OS5 A;  5C42 B;  4F4K A;  4FXV A;  1HNZ J;  1MW7 A;  2AZ3 A;  4F0H A;  1S1U A;  1X9M A;  2MQQ A;  2JEI A;  2HSE B;  2QC3 A;  5CHC B;  1Q4R A;  4A47 A;  1SH0 A;  3M2V B;  3QPI A;  5I3U A;  1UET A;  4HKQ A;  3CJ5 A;  1VIO A;  1UEU A;  5A8R A;  1RAA B;  3J7Y I;  2HRY A;  4DFM A;  3GZ7 A;  1LWF B;  1ZAV A;  2DGV A;  3MPD A;  1UW9 A;  2HFO A;  3VGS A;  2EBE A;  1GFW B;  4JI3 F;  2IBO A;  1SI9 A;  3KG1 A;  3AHP A;  3GE9 A;  3KOA A;  3TRG A;  3LTO A;  2YBV A;  2FYX A;  2VFU A;  5D77 A;  4NRU A;  5K9F A;  3VZI A;  2BZ2 A;  2R7S A;  2HBZ B;  3BKF A;  4CRJ A;  3C8Y A;  3H2V E;  2V67 A;  4DPT A;  3UN2 A;  3CME S;  1H38 A;  2EKN A;  1NBE B;  1KFS A;  2C3O A;  4MKA A;  1XMQ F;  3IWN C;  4C11 A;  4DL0 C;  4LRD A;  2JEF A;  3F41 A;  3L3C A;  2JRS A;  1HMV B;  1X4F A;  3QZ7 A;  4B9T A;  1EP4 B;  2PD1 A;  3CJ2 A;  4ED0 A;  1A6L A;  2HLU A;  2CJ9 A;  3GJS B;  1SC1 B;  1UWB B;  4CH1 A;  2GMJ A;  2A1B A;  2DR7 A;  4Y2C A;  1FNM A;  5B09 A;  5I42 B;  1CJK B;  3TAN A;  3EJM A;  3TUJ C;  1AFI A;  3B54 A;  4HLB A;  2MLZ A;  3NAI A;  1G3O A;  2HNY A;  1WG4 A;  2OMO A;  3H4B A;  2R8J A;  5M2P A;  2UXC F;  1CLF A;  4B08 A;  2AEF A;  4OYA A;  1BGX T;  4Y2A A;  3EGZ A;  4UST A;  2HHS A;  5LMU F;  2I38 A;  1FKA F;  4KIA A;  3LAK A;  1TFY A;  2PT0 A;  3HDS A;  1FWL A;  2XZD B;  2UVU A;  4KH0 B;  3UDC A;  1PJ5 A;  2PO4 A;  2LMI A;  2LEB A;  1TKD A;  4KGZ B;  2MQN A;  5SUH A;  2J0Q D;  1KBR A;  5IM0 A;  4EGL A;  3C3L A;  3TVZ A;  3KLE A;  1M5P C;  3SCL E;  2CPX A;  1O0P A;  3PRD A;  3EZ5 A;  4A8F A;  1S7I A;  4NXM J;  3Q8P B;  1N32 J;  1NHK L;  1X7V A;  2RIL A;  3EDQ B;  3L7O A;  3DLG A;  2JJ4 D;  2MPU A;  1FHT A;  2YNF B;  4K4Y A;  2CQ4 A;  2KU7 A;  1FES A;  1F2H A;  1UTA A;  1C0T B;  2FHK A;  4DLE A;  3GYG A;  1YRU A;  2CNL B;  1WKJ A;  1FDA A;  3UQS A;  3HHK A;  4ZHR A;  3HHD A;  3DFE A;  2UVW A;  4LBH A;  2XWY A;  3ILL A;  1HNX F;  2QX0 A;  2DNY A;  3RAQ A;  5A8K A;  2M9K A;  3CDW A;  5ETQ A;  1RBO B;  2H3E B;  2YKO A;  2XS5 A;  4C0O C;  5ITH A;  1AFJ A;  4WIQ A;  3NGR A;  1GX5 A;  3MEK A;  4JI2 F;  3TVK A;  1K9M T;  4KV8 A;  1WC0 A;  4WFX A;  1U0H B;  2JC0 A;  2E1M C;  4ECT A;  4LF1 A;  2DNR A;  3CCE S;  1FK9 B;  5HJY A;  3ENV A;  3UN3 A;  3TA0 A;  3HHL C;  5L9X A;  1TQL A;  1WSR A;  2HFZ A;  3P3D A;  4O3P A;  2EPI A;  4BLG A;  4ZLP A;  1RI7 A;  5C24 A;  3AA8 A;  3K5M A;  2BQU A;  1SJR A;  4F2R A;  3QFH A;  4NZ0 A;  1EKS A;  2WSF C;  1ZM4 A;  3KUH A;  2BJ9 A;  3RBE A;  2DNK A;  1K44 A;  4Z2X A;  3ZC4 A;  1HWJ A;  5KFR A;  5KFL A;  1IN0 A;  1KWM A;  4WKY A;  3PW2 A;  2KXH A;  3E01 A;  4EK2 A;  1HQ2 A;  3ELH A;  1FRX A;  3P49 B;  1ZOT A;  9ATC B;  4DPY A;  2GHW A;  1NDK A;  5RUB A;  3TJ8 A;  3L09 A;  4I6Y A;  2FVQ A;  4X62 F;  3BH7 B;  1ZAW A;  4KT0 C;  1B4S A;  1RT3 A;  1RHU B;  5CYM A;  3OVS A;  4PAA A;  3W9J A;  1NRK A;  3A3N B;  3EPI A;  3U1N A;  1G1X A;  1MWQ A;  3OR1 B;  4K4U A;  4PQA A;  1RTI B;  3EM1 A;  1HBU B;  3ULH A;  2KH9 A;  3MPV A;  4ZP8 A;  2KM8 B;  1HWK A;  2CQI A;  3T1Y J;  2VH7 A;  1JLB A;  3T6B A;  2JOQ A;  2RT3 A;  2F7V A;  2RML A;  2UXB J;  5IV3 A;  3NXZ A;  2V50 A;  3RW6 A;  2DT9 A;  4FYY B;  4YR3 A;  3QLH B;  1GEH A;  2IA6 A;  3KUE A;  1XMO J;  1Y0H A;  5ETK A;  1FEE A;  3R5D A;  3DRR A;  2KRR A;  3LP2 B;  2ZDO A;  3M1V A;  4PRF A;  4U96 A;  2XTJ P;  1VIS A;  3PG9 A;  1NH8 A;  4NAS A;  1YIJ S;  4LVN P;  3FQK A;  3FBC A;  5B0C A;  1Y11 A;  1BHN A;  2X1B A;  4EUV A;  2D3O R;  3SQG A;  3CJT A;  4FXW A;  4KHP J;  4R5P A;  4CT9 A;  2I5J A;  2L41 A;  4MYU A;  1VCT A;  1DQ9 A;  3KJF B;  5ETS A;  2C2K B;  3ZZU A;  2DH8 A;  3PHE A;  4DR1 J;  4I64 A;  4USU A;  2NLW A;  3OL6 A;  1Y3J A;  3G6X A;  3NCR A;  3T1A A;  1BD6 A;  3KUG A;  3GPA A;  1NZA A;  3SI8 A;  2E66 A;  3CMA S;  4B3R F;  1K1Q A;  1S1T A;  3JTO A;  3KNG A;  2BM0 A;  1QJH A;  4ED8 A;  3NMR A;  4CO5 A;  3VAF A;  3OXL A;  1RHQ B;  2QZ8 A;  3PTW A;  1PYS B;  2DNH A;  2HVH A;  1SQE A;  4DR5 F;  1HWU A;  1P8G A;  4OV6 A;  2BAB A;  5HSP A;  3M30 B;  2AQ4 A;  2GHP A;  3BPD A;  1HLW A;  4OHW A;  4FDF A;  3CCT A;  3QGH A;  2AJ4 A;  2MKH A;  4WFY A;  2MJU A;  3PYF A;  1GXL A;  4ZVS B;  3QZ8 A;  4QYR A;  2J9D E;  3I9V 9;  2XBP A;  1SC6 A;  5DLF A;  2XLI A;  2X1A A;  3M32 B;  1IQZ A;  3MUT P;  1O5J A;  4LRC A;  1XC9 A;  1U2R A;  3SMZ A;  2B4P A;  2BKN A;  3DLK A;  4OZ1 A;  4A46 A;  2OEM A;  4HTI A;  4A8O A;  2W9A A;  3PX4 A;  3ILI A;  3BGR A;  5BYQ A;  1RKI A;  1R89 A;  4I6W A;  2CWK A;  1O6X A;  1SKU B;  4I7F B;  2AMC B;  3A3O B;  2DJW A;  3MMA B;  3DYA B;  2LQJ A;  5KOW A;  4TY8 A;  2QIF A;  2B9E A;  1VRT A;  1E6Y A;  2RS2 A;  2OSR A;  2ASY A;  1RT2 B;  3CCZ A;  2D7S A;  1WF0 A;  3PRB A;  3AFG A;  1JXV A;  2G1D A;  4OV1 A;  4C8L A;  1CG2 A;  4ZVO B;  4OLP A;  2YWE A;  5HP1 A;  5LXR A;  4I2P B;  2QGF B;  2DGO A;  1EHW A;  1VQO S;  1CQN A;  4H4K A;  2O1P A;  1MWY A;  2K7K A;  4ELT A;  3JSM A;  2V8P A;  2YNI B;  1ZM2 A;  2UU9 F;  4IFY B;  4C6A A;  2AKW B;  1GH8 A;  4P9S A;  7FDR A;  1I51 B;  2H5I B;  3IM9 A;  2VDI A;  3B6B A;  4JI3 J;  4MAK A;  5D4O A;  3PJW A;  2XQC A;  3VCD A;  4WE1 A;  3CIZ A;  3FSY A;  3R97 A;  1X60 A;  2V68 A;  4NLV A;  2R7W A;  2F40 A;  2DH9 A;  3DHW C;  4OZL A;  3ILO A;  3MD3 A;  3MOZ A;  1PBU A;  2YX4 A;  3C15 B;  4TN2 A;  3TOQ A;  4OI6 A;  3CW2 C;  2FHM A;  3O2I A;  1XMQ J;  4F02 A;  2L48 A;  2ASL A;  1HMV A;  4FYD A;  1SUQ B;  1EP4 A;  2UP1 A;  4JI7 F;  2E7V A;  5KFM A;  4M5G A;  5JXS A;  4LF5 F;  2W9C A;  2VJV A;  2C42 A;  3AB2 B;  4HT5 A;  1IKX B;  4I4B A;  1DZ5 A;  1KHV A;  4MT1 A;  1X5S A;  4EEY A;  4ZJQ A;  2FJD B;  1M1K T;  4ED4 A;  1PIE A;  1HNV B;  1D9D A;  2C1E B;  1NJZ A;  5DO2 A;  1YJW S;  1ZZF A;  4O4G A;  2UXC J;  1G7C B;  1TKT B;  2CZ4 A;  4OJH A;  1WOR A;  1CJV A;  2RH3 A;  1XER A;  5LMU J;  3DLE B;  3M6X A;  2KFN A;  3M8W A;  9RUB A;  4C2M A;  1FXR A;  4DQQ A;  1FRL A;  3OTO F;  3PFE A;  3S1T A;  1C1C A;  1TR0 A;  3QRQ A;  1RT4 B;  1RTD B;  1X8D A;  3C6U B;  3CCJ S;  1U2F A;  4LQ9 A;  2ZKU A;  3V81 B;  1S9G B;  4YB6 A;  5GAH U;  1RT7 B;  2ASJ A;  4IFV A;  4L6V 3;  4M63 A;  2J9E A;  3MMB B;  3K17 A;  2PI4 A;  2ZC3 A;  5L46 A;  4PXE A;  3RB3 A;  1YX2 A;  2DHH A;  2I6W A;  5T41 A;  4X66 F;  4DN0 A;  4FP9 A;  1WF2 A;  1BE4 A;  1RWO B;  1TUW A;  3ISN D;  4LF9 F;  3CC7 S;  4KHR A;  2MLY A;  3JTP A;  3BGF A;  4F8R A;  2CJQ A;  3C6T A;  2M2B A;  1OY6 A;  2A0F B;  5E2Q A;  1HL6 A;  3CD6 S;  4ZLN A;  1FTC A;  1ITP A;  2P6T A;  2H4W B;  1ZAX A;  2GJ2 A;  5F3T A;  4ECS A;  1Q1K A;  3CIM A;  1HHQ A;  3L4B C;  1HNX J;  1NKC A;  4YS2 A;  4LJM A;  1N88 A;  4XIU A;  4UW2 A;  4ZVE A;  1HI0 P;  1CJU A;  1UVJ A;  4LSL A;  2IY5 B;  2OTJ S;  2YWG A;  4JI2 J;  4ELV A;  3G6Y A;  1T05 B;  3VAH A;  2CQ3 A;  1FK9 A;  3M8Y A;  3TJA A;  3PY8 A;  1UKU A;  4DL7 A;  1RAI B;  2XUL A;  1SBR A;  4E98 A;  1VJQ A;  3G71 S;  5FDL A;  3QRP A;  1D09 B;  1QAJ A;  2XO7 A;  3OLB A;  1J5O B;  1Q82 T;  1ZA1 B;  2EKY A;  3J81 Y;  3TA2 A;  2DGX A;  1W2I A;  3Q8R B;  4J9P A;  1UVI A;  2CJY B;  2XYP B;  2LP4 A;  3KK2 B;  2B4U A;  2QMX A;  4DCO B;  3LP0 A;  1GXU A;  3MMC B;  2OUG A;  5A0Y B;  4CYU A;  2QEX S;  2OH2 A;  3LQV A;  2PFD A;  5J2M A;  3QJJ A;  3D7S B;  3P5B P;  1URN A;  2OPP A;  2GNK A;  4ETX A;  3BSA A;  1MN7 A;  3J7Z T;  3DXS X;  3HFV A;  2IM0 A;  5E3Q A;  4X62 J;  4L72 B;  4QWE A;  3EE3 A;  5F9N A;  3OR1 A;  4K4T A;  5LSR A;  4CO0 A;  2XMM A;  3MPW A;  1HBO B;  4OHV A;  5JJB A;  2UV8 A;  4AD6 A;  4BC9 A;  4IQX A;  2XYH B;  1HQE B;  3FCV A;  1LNQ A;  3UCU P;  3BN4 A;  4GRS A;  2B7C B;  4MKB A;  4JB8 B;  4LT6 A;  3OFE A;  1TEL A;  2I2Y A;  4FYW B;  4EO8 A;  4WTO B;  1XNR F;  5GAD U;  2RD5 C;  3HHE A;  5F8H A;  3J80 U;  3UVJ A;  2F8E X;  4GVB A;  1WOS A;  2WOM B;  3HM9 A;  1UZD A;  4HEA 9;  3CCL S;  2YNH B;  1T3N A;  2Y0S D;  4DR7 J;  4KPY A;  3CC2 S;  2OPQ A;  4O4R A;  3FCH A;  1OMS A;  3D6F B;  1VHF A;  2XZT B;  1Q95 G;  4RNM A;  3ITH B;  2W24 A;  3M2U A;  4WP8 A;  4F3M A;  1N0U A;  2XMK A;  3RRH A;  3ISZ A;  3PCO B;  4YDX A;  1YDL A;  3M8P A;  2QFI A;  4RNO A;  4L73 A;  4PQU B;  2GX8 A;  1C0U B;  1F3F A;  3PZP A;  4J9S A;  2RAQ A;  1LEO A;  2V94 A;  2ZC4 A;  2GGP A;  4TVA B;  2V6A A;  2R7X A;  2LA6 A;  1S1V A;  4YR0 A;  2XI3 A;  4B3R J;  3IP0 A;  3FGV A;  2KT5 A;  3OUY A;  4K50 A;  2H9Z A;  1QDU B;  4XK8 C;  1IKY B;  2PA3 A;  5AXK A;  1UA1 A;  1EET B;  1X4D A;  1SJ3 P;  4KB7 A;  2ALZ A;  5DGB A;  3Q24 A;  2HUR A;  2APO A;  4DR5 J;  2WB1 D;  1TL3 B;  4ECR A;  1SJ1 A;  3DGP A;  2QL7 B;  2K06 A;  4ZJO A;  4DL5 A;  2BYC A;  3M7V A;  1SC4 B;  4PWW A;  1H98 A;  3M32 A;  3HSJ A;  1FXL A;  4A8K A;  3M4X A;  2O66 A;  1L3V A;  2Z30 B;  5A6W A;  5HMW A;  1TTH B;  5E33 A;  1ARO P;  1UZH A;  2F65 A;  3D3B J;  4DCP B;  3DRY A;  4PG8 A;  4MKY A;  2XNQ A;  1WDT A;  2KXF A;  2CPY A;  4K0K F;  1Q79 A;  3MMA A;  2HBQ B;  1N36 F;  3NCP A;  2W4P A;  7AT1 B;  3W5Y A;  1HA1 A;  3UWT A;  4QIG A;  1V9O A;  2A2C A;  1E6V B;  3C66 A;  3F0N A;  2M3D A;  2ZBR A;  4FYV B;  5J2Q B;  3FSX A;  5AE1 A;  2VC1 A;  2W2M P;  1VRU A;  1VQ8 S;  3EGV A;  4RU2 A;  3G9C A;  4HHH A;  5GAD I;  3OT9 A;  4I2P A;  4RW6 B;  3TAM A;  4IUF A;  4GC6 A;  3PXG a;  3OTC A;  2ZKT A;  4JI8 F;  3DOM A;  3TX8 A;  2P8I A;  2DRA A;  4PYD A;  3G6E S;  1CS4 B;  4NPO A;  1FVS A;  3VAJ A;  2YNI A;  2HS4 A;  4PPD A;  3CGI A;  1TU0 B;  4WP3 A;  2XC9 A;  3K58 A;  3HVA A;  2QLJ B;  1I6J A;  4B9V A;  5BYS A;  4JYA F;  2UU9 J;  3W8P A;  2A3J A;  2HW3 A;  4BWM A;  4TKT A;  3TQ1 A;  3HP6 A;  2ZIT A;  3D54 A;  1IBK F;  2NXU A;  3MM9 B;  2AHO B;  2OI2 A;  4ED5 A;  1WOO A;  1VQS A;  4X4V A;  1IM4 A;  3IBW A;  3D2W A;  2WK4 A;  2FC9 A;  3MED B;  2C2N A;  2BVZ A;  3QT8 A;  1Y3K A;  4DX6 A;  3H5U A;  5IV4 A;  2QA2 A;  2B7B B;  2R2S A;  2IC3 B;  4YME A;  2QO3 A;  3ZTO A;  2IBK A;  2W8K A;  2FTR A;  3GG0 A;  5KG5 A;  1RYS A;  1CQM A;  1RT6 A;  2MZR A;  2NSC A;  3KLH B;  4JI7 J;  1F60 B;  2HMI B;  4HHU A;  4LF5 J;  5E0O A;  1FKP A;  4LRA A;  4K5S A;  1JLA B;  4USV A;  1FF2 A;  3JQM A;  2WBR A;  1LWE B;  1UFK A;  4FNH A;  5C2C A;  4WFB Q;  3U1L A;  4UZC A;  2GQQ A;  3DRS B;  2OHD A;  4ATN A;  1IR2 A;  3I87 A;  1WOP A;  1TKT A;  2OPR B;  5DLG A;  5KFI A;  3PRV A;  2YH0 A;  2IA0 A;  1RCO B;  3C6U A;  1NSK L;  2M7S A;  2JNJ A;  4DBQ A;  2MZ1 A;  3H2L A;  1S9G A;  4OX9 F;  3WX8 A;  4NA3 A;  1IKW A;  1RT7 A;  1F1B B;  2NR0 A;  3U7J A;  1OSC A;  2RU3 A;  5DZ6 A;  2FVR A;  2EW9 A;  1N54 B;  1GK8 A;  4X66 J;  1PAE X;  2C3Y A;  3G8T A;  3SFU A;  1N34 J;  4LF9 J;  2ILY A;  3UR0 A;  5GME A;  4CO2 A;  4DXL A;  4OYO A;  1S1X B;  2GIQ A;  2Y0B B;  1JXE A;  5IQ6 A;  2BXJ A;  3CED A;  1RTJ A;  1JJ2 R;  1DTT B;  3C14 A;  3PV8 A;  3IA0 A;  1C4A A;  4F4A A;  2IIH A;  4N8N A;  2IVM A;  4ZP6 A;  2FLO A;  4U6P A;  3UDL A;  2E29 A;  2YNG B;  3DI6 B;  3EPG A;  3JXO A;  2ADB A;  3FBE A;  1KHW A;  2JWN A;  3BR8 A;  1T05 A;  2C3M A;  3QGG A;  2CVI A;  3PYG A;  2D69 A;  5G0R A;  3GFX A;  3QSI A;  5CCM A;  2DNP A;  1JJ4 A;  3JAM U;  3R1H A;  4X4Q A;  1TAU A;  1Z4U A;  1GMW A;  2FHJ A;  3GIK A;  1R0A B;  2XEX A;  5H9F J;  3T19 A;  4P75 A;  1XNQ F;  3SSR A;  2EXU A;  4QQB A;  4RW8 B;  5B0F A;  3VAK A;  3PW7 A;  4B02 A;  3KNA A;  3GII A;  1JLF A;  4NLD A;  2CA9 A;  1NK7 A;  1YJN S;  3WX4 A;  1UFL A;  2Q3P A;  3EDR B;  1D9F A;  2LDY A;  4ZVH A;  2AGP A;  2ZZN A;  5FLX Y;  4DFP A;  4ZPA A;  2QN6 B;  3CCM S;  5IXU A;  5A8W A;  3M8S A;  4DV0 F;  3W64 A;  3OXG A;  5JVG Q;  4M5K A;  1FVQ A;  1QE1 A;  1H7W A;  3MEE B;  3N5F A;  4KO0 A;  5F41 A;  1U8S A;  3D1H A;  3T9N A;  3B82 A;  1R6Y A;  2VFR A;  4B3O B;  5DRK A;  5E5N A;  4NML A;  3W5X A;  5K8M A;  2F3J A;  4JI1 F;  1HBO A;  3PFO A;  2ZEJ A;  3GV7 B;  3MOJ B;  4J9R A;  3PO4 A;  3TAP A;  3EZU A;  3I0S B;  1HQE A;  4QYZ J;  1F2G A;  2B8Q A;  3MWB A;  2KM8 C;  2XHC A;  1UVN A;  4UF4 A;  1GTH A;  1KOH A;  4Q8E A;  4DPX A;  3T41 A;  2N7C A;  4DSJ A;  5CH7 B;  2LVW A;  2CPI A;  3NP5 A;  4NYP A;  4B3T F;  4NLR A;  1U09 A;  1ULR A;  3A1Y G;  2W7O A;  1MRO A;  3UI3 A;  2WOM A;  3BGU A;  1M5S A;  4TYA A;  5J2P B;  1NB7 A;  3R5J B;  4BC7 A;  4JV5 F;  3DOL B;  4KGM A;  4F0M A;  3MUR P;  4QPT A;  5DDP C;  1ZZN A;  3CDA A;  4DU8 A;  3JS9 A;  2BJD A;  4WK3 A;  1RA7 A;  3PKM A;  5KG2 A;  3HZE A;  2R7T A;  1FRK A;  1VK3 A;  3MEG B;  4NZ6 A;  1M5H A;  2BW2 A;  2KYZ A;  5KFX A;  3T6J A;  2ZBQ A;  2ZUA A;  1FFW B;  1NK6 A;  3SDE A;  4OZJ A;  4RO0 A;  4N56 A;  4MH8 A;  1MU2 A;  3AQP A;  2ILZ A;  4L3N A;  4BWJ A;  2W2O P;  3KWM A;  3NY0 A;  2QG9 B;  3CJK B;  3AY0 A;  1IKY A;  1IKV B;  2DCL A;  1PCA A;  2BA9 A;  4P7T A;  4O44 A;  2DHA A;  3OW2 R;  3CE8 A;  4USI A;  3DMJ B;  2BAC A;  2XSF A;  1VQM S;  2UVR A;  1TL3 A;  1RA6 A;  3HZG A;  4W4M A;  5L38 A;  5IS2 A;  3IN5 A;  1FRH A;  4GKK F;  2DKO B;  3H42 A;  1KVI A;  1N5Y A;  2E9R X;  3LWL A;  3MTK A;  4Y2K A;  5F8I A;  4KKO B;  2E5L J;  3CSK A;  4X4U A;  5D78 A;  3RTV A;  2FJV A;  4FXD A;  3H7H B;  2R8G A;  2CQP A;  2YQ3 A;  5KFK A;  1NZ8 A;  2ZJQ Q;  2MB0 B;  2DR9 A;  3VQS A;  4CLZ A;  1DTQ A;  1KDN A;  4U9R A;  3IS9 B;  1RDR A;  4K0K J;  2AJ2 A;  2W1B A;  1N36 J;  4K2J A;  4USK A;  2CDQ A;  3B4D A;  2Y3Y A;  4U95 A;  3KHH A;  3Q2S C;  4DZ6 A;  5IWA F;  2MZQ A;  3BKU A;  2CPE A;  1KLM A;  1LFW A;  1G2E A;  3ZTR A;  5B0G A;  2C2Z B;  3MPU B;  2FZG B;  5J1E B;  5EN1 A;  3CO0 P;  4ZPV R;  3OD2 A;  4NRT A;  4F36 A;  2JHE A;  1HQU B;  1HKA A;  4P73 A;  1HPZ A;  4IR1 A;  4H54 A;  3VAI A;  2E1P A;  2KJV A;  1TL7 B;  3OV7 A;  4IH6 A;  1GMW D;  4JI8 J;  2FHJ D;  4OZN A;  1XR7 A;  4BDP A;  3NBP B;  2CQD A;  5HBM B;  2E7X A;  4NL5 A;  2G13 A;  2HHH F;  4K5R A;  1NKB A;  3P6Y C;  4WFA Q;  1SH3 A;  3RAX A;  4USW A;  3ZO7 A;  3SCJ E;  1CJT B;  3AAW B;  4PWD A;  4JYA J;  2HFV A;  2AYB A;  3H90 A;  4UY8 5;  1S0N A;  3HD2 A;  3DOK B;  4F2S A;  3V4I B;  3MED A;  3LAM A;  1YHQ S;  4QZV B;  2EEY A;  2B9W A;  2MMY A;  2MY8 A;  1M90 T;  3FRZ A;  4PUO B;  3N4W A;  2HHV A;  2B8P A;  2BW7 A;  3GTY X;  5H9E K;  2HVD A;  3VZH A;  1NSP A;  2FIU A;  1HR0 F;  2GMH A;  2MHN A;  1LW0 A;  1IWG A;  2V2V A;  4EI2 A;  2QTW A;  2VFT A;  2DPI A;  2W7A A;  1UWA A;  1VK8 A;  2EC2 A;  1X5P A;  3TWZ A;  1FNO A;  4URS A;  1JLA A;  1Z2L A;  4F04 B;  3PYE A;  1LW2 B;  1AT1 B;  1VC6 A;  4NOH A;  1YRT A;  1WEX A;  2IVY A;  1WC3 A;  4G1I A;  1WG1 A;  5DQH A;  4CP5 A;  2MKC A;  1Y9O A;  1JMT A;  4H4M B;  3HFK A;  2DVI A;  5K14 A;  2FZC B;  2PC6 A;  4DV7 F;  2YXL A;  1B64 A;  4YN3 B;  5EWG A;  2DBB A;  4ENO A;  3IR6 B;  2Y1R I;  1W25 A;  4DFJ A; 
#chains in the Genus database with same CATH homology
 3FBE A;  2VU5 A;  1NHK L;  2ZUA A;  1XIQ A;  3NGU A;  1NSK L;  1NUE A;  4AND A;  3WX8 A;  4DZ6 A;  2DXE A;  4FKY A;  3BH6 B;  2B8Q A;  1WKL A;  1U8W A;  4KPC A;  1HLW A;  3FC9 A;  1BE4 A;  2DXD A;  4DUT A;  3Q8U A;  1PKU A;  3EJM A;  3B54 A;  1EHW A;  1LWX A;  1W7W A;  2BEF A;  1K44 A;  1NCL A;  3ZTO A;  4FKX A;  3ZTR A;  2HUR A;  3FBC A;  1BHN A;  1WKJ A;  1MN9 A;  3Q8Y A;  4UOG A;  3ETM A;  3VVU A;  2B8P A;  3G2X A;  2BX6 A;  3MPD A;  3FKB A;  3BBF A;  1WKK A;  2HVD A;  4ANC A;  1PAE X;  4EK2 A;  4DI6 A;  3DKD A;  3NGT A;  1NSP A;  3ELH A;  3VGS A;  1NDP A;  1VYA A;  5BXI A;  4F36 A;  3EVM A;  3VGV A;  1HIY A;  1NDK A;  1BUX A;  3FBF A;  4C6A A;  3VGU A;  3DDI A;  3VVT A;  4HR2 A;  4O0N A;  3BH7 B;  4UOF A;  2DXF A;  3PJ9 A;  3R9L A;  3FCW A;  4WBF A;  1B4S A;  2HVE A;  3ZTP A;  3NGR A;  4S0M A;  3ZTQ A;  5IOL A;  4ANE A;  2CWK A;  1NSQ A;  1HHQ A;  1NB2 A;  5CAA A;  3GP9 A;  3B6B A;  1NDL A;  1B99 A;  3BBB A;  1MN7 A;  3EMT A;  3Q83 A;  3GPA A;  3EVO A;  3JS9 A;  3ZTS A;  3EM1 A;  3Q86 A;  4F4A A;  1F6T A;  1S59 A;  1NPK A;  4CP5 A;  3PRV A;  2AZ1 A;  3FBB A;  2DYA A;  1F3F A;  3EE3 A;  1S5Z A;  2AZ3 A;  3ENA A;  3NGS A;  5CAB A;  1XQI A;  3EVW A;  1UCN A;  1LEO A;  2DY9 A;  3BBC A;  4W98 A;  3VGT A;  1S57 A;  3Q8V A;  2NCK L;  5C7P A;  3L7U A;  1ZS6 A;  1JXV A;  3Q89 A;  3FCV A;  1KDN A;  1NDC A;  4ENO A;  4UOH A;  3EIC A;  1NLK L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...