4RX6A

Structure of b. subtilis glnk-atp complex to 2.6 angstrom
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
117
structure length
109
Chain Sequence
AMSGQMFKVEIVTRPANFEKLKQELGKIGVTSLTFSNVHGCGLQKAKIESNVYERLKIEIVVSKVPVDQVTETAKRVLKTGSPGDGKIFVYEISNTINIRTGEEGPEAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of regulatory machinery reveal novel molecular mechanisms controlling B. subtilis nitrogen homeostasis.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Transcription
molecule keywords Nitrogen regulatory PII-like protein
total genus 19
structure length 109
sequence length 117
chains with identical sequence B, D
ec nomenclature
pdb deposition date 2014-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rx6A00
3M05A 2JJ4D 1VFJA 3T9ZA 1UL3A 2XULA 4USIA 2GNKA 3AA8A 4C3MA 1VHFA 2NS1B 3O5TB 1O5JA 2Z0GA 2NUUG 4AFFA 2ZOMA 1XK8A 3DFEA 3HLUA 4R25A 3NCQA 4ZK7M 4C3KA 4NYPA 5D4OA 2GW8A 3X3UA 3NCRA 4E98A 4D3HA 1UMJA 4C3LA 4OZJA 2ZFHA 1NZAA 3O8WA 2J9CA 3AA9A 2XBPA 1NH7A 1UFLA 2E66A 4YB6A 4CO5A 4CO2A 1GNKA 4CNZA 4USHA 4CO3A 4WK3A 4RWWA 1O51A 4NYOA 2O66A 2NUHA 1Q1KA 1V9OA 3AHPA 4Y6IA 4RWXA 5D4NA 1V3RA 2CZ4A 1NAQA 1V3SA 3GSDA 3LF0A 4RX6A 1QY7A 3N5BA 4WK1A 4YB7A 4Y65A 1UKUA 5DS7A 3AH6A 4D3GA 4RLEA 1V6HA 5L9NA 2V5HG 2J9DA 3OPKA 1OSCA 2XZWA 1PILA 1H3DA 2PIIA 2DCLA 2VD3A 5D4PA 2RD5C 4OZNA 2GX8A 1J2VA 3NCPA 3MHYA 1HWUA 1P1LA 3TA2A 3TA0A 5D4LA 4CO4A 2J9EA 3TA1A 2EG1A 4USJC 2XG8A 4IYQA 3CE8A 4YB5A 4CNYA 4OZLA 2O67A 2J9DE 4CO0A 5DRKA 3L7PA 2EG2A 1NH8A 1KR4A 3BZQA 4CO1A
chains in the Genus database with same CATH superfamily
5F8MA 3M05A 1FWLA 2U2FA 4G6VB 4ER8A 3FGVA 1S7HA 2BMBA 4F26A 4HHHA 2J6TA 1B0TA 3OL9A 1H2TZ 4EZ6A 4W98A 1HQUB 3FBFA 3C66A 3K2YA 1SQEA 2IVFB 3NG8A 4X64J 1S72S 4I67A 4BHQA 2CPYA 3K17A 3KJFB 4B3RF 3G4SS 2YKNA 3MUMP 2HK3A 2J76E 1LFWA 4RBVA 1UZHA 4C6AA 4R5PA 4F4ZA 3MTJA 4B3SJ 1JLQA 2P9CA 4P2MA 1K0TA 2R2TA 4BS2A 3ADAC 1JNZB 1WKKA 3M6XA 3QBCA 1RBLA 1NDLA 1VQSA 2ROPA 3DLEA 4LRDA 4PQAA 5ETRA 5KFEA 3ZTSA 4PWDB 2W7AA 4OZJA 4JI8J 4I6YA 3TYTA 4AD6A 4I68A 2RDIA 3H4BA 1CBKA 2MZ1A 3KLEB 4QU7A 1Q8BA 4WKRA 2AYGA 3H5YA 3HK2A 4ZPDA 2MKYA 3RUBL 3OTOJ 4OZ3A 4DLEA 1S9GB 4JI1J 4X4UA 2BA9A 3ILLA 3G96A 4OYBA 1UWBB 3AD8C 3KLGB 2OELA 1T95A 4FBTA 3D0GE 4OYXA 4F0KA 4URGA 2IVYA 4ITSA 2ZH2A 1S1WA 1VYAA 2MDAA 4RW6A 2C28A 2YQ1A 3KUEA 3EPIA 5F8HA 4NXNF 3IM8A 4DV0F 3H5UA 3VGSA 4EO8A 1J5OA 1NEEA 2YWHA 1Q1KA 4QR2A 2QFJA 1FJEB 1HI0P 1UTAA 2XMUA 4DPXA 4NXMF 1RT2B 1X5SA 1X4DA 1Q4RA 3GPAA 2ZM6F 2CZ4A 4G1QB 4LF8J 4LF9F 1TU0B 2CJXB 3ENQA 5CHCB 5I3PA 3J80Y 2E5GA 4IFVB 4ED2A 1NKCA 4ZPWR 1VBYA 4F67A 2MGZA 2UUAJ 4C48A 4X65J 1W26A 1KLMA 3UR3C 5KT6A 1K9MT 3HCXA 3A8EA 4OX9F 5KT2A 4C11A 3GU0A 3MR5A 2B51A 1MU2A 3M30A 3GSIA 3SXLA 4EYIB 2HHQA 2FJDB 2K7JA 2W9CA 2H5IB 2JEJA 1IKXB 3HSZA 4OZ0A 4UTGA 5FDLB 3WDOA 2E1CA 3EDRB 2GQQA 2RB7A 4YY3J 1KEKA 2DGWA 2XMMA 3KLFA 4I56A 4B9LA 1EIYB 4OZ2A 3I6PA 4QIGA 3C14A 3E01B 4J5OA 2H9ZA 4WYWA 4OI1A 5JUMA 3HXMA 1Y3JA 2HWHA 3R5AA 3B4DA 2RD5C 3R6LB 1O0PA 2H65B 3CUNA 2GX8A 4DQQA 1FD2A 3G8QA 1P9QC 2VFVA 2PFFB 4MIAA 2EK1A 4OHVA 4WKYA 2KU7A 2NXCA 3MAAA 3HFZB 2OPSB 1NRKA 4RW8B 3W2VB 4K4ZA 2KG1A 5DETA 3CC4S 2OI2A 1RADB 1RAOA 2NSBA 4YMEA 1FEHA 1Q81T 4MIBA 4A8KA 4B9SA 3HVAA 2C2RA 2XY7A 1DJ0A 4B3RJ 2M70A 4DR2J 3PW0A 3G6ES 4IYQA 3PR4A 4NCGA 1HW8A 2HBQB 5E0OA 4CNYA 3GQCA 1KSPA 1UW4A 4RNNA 2MEWA 3CF5Q 2C2DA 4DX7A 1VRQC 2AYBA 2DH7A 3OR2B 3G8TA 2IRUA 4LFBJ 1GK8A 1QTNB 3BZQA 1U7LA 3DOKB 3E8OA 3G82A 4NRTA 4EBCA 4WU2A 5J1NA 2GCFA 5A8WA 4B9UA 3RRHA 2HHXA 1G6BA 1RSCA 1MMDA 3ELHA 2M8HA 1JLGB 4CLUA 1EAYC 3KLEA 5KG3A 3JQKA 3ZZYA 2IMWP 4ZHRA 3NWRA 4LR8A 5LSLA 1R8PA 2JHEA 2IA6A 2J6UA 2VBZA 3CMES 1WSRA 1Y9OA 2V94A 2QG9B 1RTIB 1AUDA 3DLEB 1YRTA 3SCLE 5DGAA 3BYPA 3JYTB 2KM8C 3BB5A 2DITA 1XK8A 4DOZA 2W7OA 4FXWA 1SI9A 2Y8YA 4WXWA 4XO0A 2AP6A 1CQNA 4O44B 1WF0A 2AGQA 2P6SA 1X4FA 1YRUA 5BXIA 2WONB 1C0TA 4XPCA 2DRAA 3DC2A 3LOUA 1R0CB 2I5JA 1JKHA 4DPWA 3HVTA 3OV7A 2ASJA 3E2EA 2ZNYA 4O4RA 4FKYA 3WQPA 1VC0A 2B4UA 3EXYA 3R7BB 1YG0A 3KK3A 2CPDA 1PG5B 3L4BC 3ZFVA 4UZBA 4QYZJ 1CC8A 2WBRA 5ETTA 5C42B 5IV4A 1TQLA 2ZD1B 1YBTA 2V2ZA 3IBFB 1WKJA 5IV3A 3NGTA 4I7FB 3PACA 2UUAF 2KZMA 2VHGA 5K8NA 1OY8A 1S6PA 1FT8A 2J5AA 3Q8UA 1HWKA 2C2ZB 3OR1A 4JI2F 2HLTA 1RYSA 3A13A 4FXDA 2UXBJ 2BM0A 1HNZF 3QAUA 2RU9A 5THWA 2JH3A 2N82B 2R7RA 1S59A 1U1LA 2DK2A 2A3JA 4TXSA 4JI6F 2W9BB 2YTCA 4FF3A 1YBUA 3I4PA 2W25A 3KLFB 1OWXA 3HI9A 1Q82T 2E9TA 3Q83A 4WIIA 3TAMB 2XS2A 3TQEA 3ULHA 4LF4J 3NP5A 1J27A 1Z4UA 4USTA 3M30B 1B99A 2HHPA 5DDQC 5DLFA 2V9KA 4KV8B 2VOOA 2DD8S 4J9UE 1V3SA 2HBZB 2HSEB 1RXOB 1MMLA 1XWLA 2KJVA 5CQGA 5J2NA 4NZ7A 2ZDOA 7FD1A 5LMUJ 3T1HJ 3MPDA 3MMCB 2E7XA 2VG5B 5HP1B 3M8QB 3AJDA 2VDHA 2C2OB 2W8KA 5KFFA 4FXVA 3KMQA 4ICLA 4WE1B 2PD1A 5ETLA 8RUCA 2Q6BA 4UZCA 4ES3A 4HTJA 5G0RA 1SL0A 1J5OB 4QR1A 4DFJA 4F2SA 1X5TA 1XNQJ 3O1LA 1WF2A 3N01A 2VG5A 3H0PA 1WD6A 2EC2A 3UWTA 3PJXA 3SYZA 1N34F 4IR1A 3EYZA 1TKTB 3KK2A 1ZH5A 2AJQA 1FE0A 1TV6B 2ADCA 4M94A 3DCAA 3QRRA 3ZC4A 4QCLA 2ZKTA 3LWLA 3PW5A 4C2MA 3BGLA 2OEMA 2M0GB 2WHOA 4PZVA 5D4PA 2BDPA 3W8PA 2DO0A 2V8HA 4F50A 2F40A 2Z2MA 3UDVA 3CO0P 1SVDA 2G2YA 1LWCA 4LSLB 3W60A 5J2QA 3CT9A 1YJNS 4DR7F 2R7XA 1S1XB 4NEZA 2D1CA 3P49B 3MEGA 5KFJA 2DGVA 4CH0S 1RT6A 3R7SB 1RAJA 2VBYA 2EI5A 2XMTA 3MEEB 5IQ6A 4ED3A 1DY3A 1HA1A 4FS2A 1VBXA 4DQIA 2L3MA 5AE1A 4U7CA 3CCUS 4X65F 3AT1B 3CMQA 1S6PB 3MR2A 2ZJQQ 5KFCA 2KI2A 3M9NB 5DRKA 3L7PA 1S7IA 2D74B 2EG2A 5LM7E 2HQCA 2JNJA 4WFNQ 4O3SA 4XDCA 2PE8A 2HNZA 3BKTA 2H4YB 2BX6A 2ZHOA 3DLJA 2J0XA 4JUZA 1NSAA 5HVGA 5M2PA 3MCOA 1FCAA 2B4PA 1BQMB 3GZ7A 5AJ3F 1K8AT 1RWWB 5KG7A 1U49A 2PDAA 1XMQJ 2NS1B 1HARA 5KG0A 2CZ9A 5KT3A 4BCAA 2AD9A 3R5DA 3GYXB 1YWXA 1U24A 2CJYB 4AFFA 2RRNA 2QEXS 4G3IA 4RBUA 5DDOC 1RT6B 2EKNA 4KGXB 4DV1J 3H25A 1P8GA 1RTIA 1S1UB 3BO4A 2HHUA 2K2PA 4HH0A 4K2JA 1WUUA 1H7XA 3OXFA 1RTDA 1REGX 2C2KB 2GW8A 2KKHA 2IM0A 2OPPA 3X3UA 4JV5F 2OPQA 2VPXB 3TO8A 4E8UA 1S1TB 1VISA 5DGBA 2Z30B 4CRJA 1SQGA 3MCSA 4DU7A 2XMAA 2ASLA 3G6VA 3RAMA 1BQNA 3C16B 2YNHB 3DOKA 3HF5A 1D9DA 4DEZA 4KHPF 3WIVA 4TY8A 1ZPWX 1H2UX 1LFPA 1OPZA 2KVIA 3MOZA 3IWXA 5K5MA 2LVWA 1RWUA 1DURA 1ELOA 1GNKA 1JLFB 1U25A 2I8EA 2AZ3A 4TU9A 1WELA 4UY85 3CCLS 3IRXB 2ERRA 2CFXA 3FFIA 3MMCA 4P2SA 3KHHA 3V2UC 1CJUA 4FNHA 4PXDA 5RUBA 3ISNC 3G8SA 2DBBA 3Q2SC 4HT5A 1R0BG 4JYAF 1KONA 3NNAA 1ICEB 1TR0A 2GZOA 4C97A 2UXCJ 1KRPA 3GSDA 3CXCR 5BYSA 4MK8A 1L3KA 3HHLB 8ATCB 3T19A 1GAOA 2E5HA 1NCLA 2GJFA 4IOBA 5HAOA 4RUAA 1QTMA 1M5KC 3W2WA 3CCJS 4DL2A 1FVQA 2QA2A 1KFDA 1BUXA 4LQ9A 3C6TB 4OYPA 3MR3A 4KFBA 3UPFA 2QN6B 5A8KA 3RBEA 5K8MA 1APSA 3SQGB 3TX0A 1TAQA 3CDUA 1KFSA 3QT7A 3M32B 4DCOB 1EKSA 2WK4A 1GT8A 3W61A 3V6KA 4KHPJ 2DNRA 4P10A 4A8XA 1VQPS 1FDAA 1JJHA 1LW2A 3PJ9A 3U1LA 3MM7A 3BPDA 3DLGB 2KT2A 1YKWA 4OI3A 5C42A 3MM6A 4FP9A 3LH2S 2NREA 1RTZA 2VD3A 5LSOA 1HBUB 1S0MA 3WX4A 4KO0A 4PPDA 3K8WA 2DNGA 4MIWA 1UCNA 1VI7A 1QE1B 1X4BA 3CJRA 2VQEJ 4F7VA 2ZBCA 4XPEA 2HVEA 3LP1A 4Q45A 2XCAA 1IXKA 1U1RA 5KFRA 2OSQA 3BREA 3BR9A 4LUBA 1EKRA 3PYGA 3TEHB 3TZWA 2CQ3A 3BBFA 1U8SA 3CE8A 2CA9A 2FHOB 4R0JA 4WP3A 4LF4F 4DSJA 1NNDA 2FJBB 1WSVA 1QM9A 3DGPB 2KXHA 3IBWA 3I32A 3UCUP 3JAMU 5CXTA 1VRUA 1K1QA 3DM2B 4ZN1A 1NKEA 2FD2A 3VAJA 1HMVB 4PG4A 4HYKA 2HRTA 5A76A 4WFYA 3K5MA 3BH7B 4WXOA 1K44A 3PHTA 2C42A 2Z57B 2WW8A 1CJKB 3JTOA 2BQUA 3H7HB 5F8JA 4HH1A 3Q23A 3I96A 5BR8J 1NHKL 1HD0A 3GYGA 3PHEA 4K4SA 2X3GA 2JFKA 2MLXA 2Z0GA 2YKQA 4XK8C 5AE2A 3LGMA 2C3PA 3P8BB 3M8WA 1ZPVA 5KFOA 5L1LA 3EGWB 2ZE2B 3TUIC 2VC1A 2VICA 2HMIB 4KPCA 4NMXA 5LSRA 2XLKA 3TWZA 3FRZA 2WAQD 4DX6A 4IOCQ 3TVYA 1WOOA 4TNOA 3ZZUA 2K06A 2CQCA 3FZBA 1S9EB 2MZTA 1VC6A 4NYPA 2DNPA 3TAQA 2OPSA 4F4YA 4Q44A 1FRXA 1WC3A 1OMSA 3HJFA 3UCGA 3DRPB 1Q8LA 1D8YA 2FTRA 2KB2A 2ZC3A 2HHTA 1H72C 5KFBA 4CH1A 1M5VC 2QLFB 3GJTB 2R3VA 1C0UB 3BS9A 3MEDB 2IBOA 2DNYA 4NOHA 3WIUA 3TZYA 3Q8PB 1RHQB 1ZETA 1R8HA 1FE4A 5BJRA 4F4XA 3BGFA 1CJKA 2GGPA 3MAQA 2VA2A 5D3GA 3TVZA 1LV5A 2VF3A 3V6DA 1C4AA 1RAGB 1T9WA 3I5AA 2KL8A 3H5XA 2YY3A 1UVMA 2CNNB 5GAEI 4NLQA 5SUHA 2FZGB 4DX8H 2PA8D 1TVRA 3CJ8A 4DFKA 2YPYA 2YNIB 3ILOA 4MFBA 1GTHA 3THPA 3FCHA 1TFWA 2BANA 3MUVP 2PGCA 2M4MA 2VB6A 3DXSX 5I3UB 4DUYF 2CPJA 5LOQA 4FF2A 3NBPB 1JXVA 4DR6J 3RAQA 2XZTB 3CD6S 1I94F 3QJPA 3TJAA 1QE1A 2G0CA 3KJQB 1GMWD 4G1QA 3PDNA 1IKWA 5KFVA 3VVUA 5GAEU 4A8MP 4O3OA 1PGZA 1PO6A 2UXDF 3IXQA 2YKOA 3TRGA 1RBOB 2LXFA 1T9TA 3TW0A 4AQYF 1NAQA 3HDSA 1FJGJ 2DHHA 1Z1ZA 1RHMB 2WSEC 2EVZA 5EDWA 1SJ4P 2YQ3A 2JEIA 3K89A 4UF4A 4ZPCA 1UETA 2CJAA 2ATLA 3A8KA 4Y65A 2R8KA 1R0AB 4OQJA 4M5JA 3ZTOA 1KNZA 4QYZK 2LQBA 2Z2ZA 4QIEA 3MM6B 1WHVA 3DGVA 4OI6A 1C1CB 3SQGA 4OX7A 1FNOA 2QRRA 3GMGA 1S9GA 1ACMB 3ENVA 1H6KX 3MDFA 1GMVA 4RKUC 4QQBA 4ECYA 1WC1A 2C3OA 4NLVA 3M6WA 4AE5A 2J9DA 4H4KC 2JX2A 2YNIA 3JSYA 1AFJA 4UOCA 3QIPA 5F8LA 4NLGA 3BQ2A 1R6YA 4YR2A 3J7YI 1NJIT 1S0VA 3IO1A 4Q43A 3JSMA 3W2WB 1SV5B 3POTA 1HBMB 4ED1A 4C8ZA 1YTYA 2XMJA 1GX6A 3P4UB 4MK9A 4O0NA 3ZTPA 3M6UA 3IM9A 4V1Ak 1C2PA 4ES2A 2UUBJ 4NLOA 4LREA 2XSFA 5F0WA 2G4BA 2VDIA 2B8QA 2R8GA 3UDLA 4NXMJ 4YFUA 1WHWA 4KT0C 1IWGA 4DN9A 2WW4A 1SL2A 1OYEA 3DRPA 3UDCA 4J9MA 3A3PB 1NJXA 4I4BA 4MKAA 4CLPA 3WX8A 1SBRA 1TKXA 3FNNA 3KNGA 1HR0F 4IOAQ 4DL5A 4O23A 2I1RA 3QJJA 3CNQP 3ET6A 4K0KJ 1FX4A 5ETMA 2QJ3A 2V67A 3LQVA 3T1HF 1ULRA 4OJGA 3U1NA 3P3DA 1YZ7A 1SKRA 1AA1B 5HMYA 1FDDA 4CQ1A 3OHBA 2CJ9A 2JL9A 3GJQB 5E3QA 5KFDA 1FTCA 3NGKA 1PYOB 3D6MB 2NXEA 2YX4A 4PYAA 4ZIWA 1RTDB 4B9MA 4ILLA 2UU9F 1HBNA 1NK6A 4OX6A 2OFHX 4Y2CA 2HQIA 1VHFA 1S5ZA 4K59A 4UUWA 1B0VA 1DQ8A 1UFWA 5DG8A 3KK1B 2CNLB 2V63A 5CD4H 3NXZA 4IDKA 3DHXA 1YJWS 3ISND 3MUTP 1QUVA 2XMVA 1IBCB 2KT3A 3DM2A 3VZIA 1MWQA 2AT1B 2B5JB 1X60A 2EK6A 3FEZA 3D5MA 1WC0A 3CJ2A 4UOHA 1D9FA 3OJUA 4YUDA 4WP8A 3MPUB 4U7UK 1CSJA 1X0FA 4DR6F 3LGHA 3BV8A 4NLXA 3RBDA 3CC2S 5KOWA 1S76D 1SXLA 1BQMA 3I31A 2E7WA 2HGMA 3ZZZA 2ACYA 3VAIA 3J81Y 2XGQA 4HTIA 4C0HA 5KFUA 4RNOA 3EICA 3HHDA 1HWIA 1HD1A 3RZAA 3OVAA 2B4VA 4M1KA 1S0NA 5KFGA 2R2UA 3CJ0A 4ZPTR 2QMUB 4DR1F 1WOPA 4X4TA 4KO0B 4P75A 2GJ2A 3GWCA 2PMZD 3J7A1 2DHXA 2F8EX 4LVNP 4N5SA 1SQFA 2HNZB 4C8NA 3IAM9 4HHJA 3MOJB 1ZM4A 2WRMA 2LYVA 1N5TA 2JVOA 3EJMA 3DLGA 3HZEA 2NLWA 4LF6J 4NA2A 2WB1D 3UW1A 1YITS 2FHJA 5E7OB 2R9LA 4RWWA 4DUZF 5L1KA 2WCXA 3TUZC 3W65A 4B08A 4PG8A 3EZUA 4NLRA 3JTPA 1XNRJ 1NPKA 1RWKB 1TUVA 1XNQF 1WDTA 1AROP 2WBMA 3KYLA 2NXJA 4EK2A 4EEYA 3KLHB 2RKIB 3GP9A 1TK8A 1DBDA 2ZNZA 3IS9A 2HVDA 1IBKF 3ZNUA 2QSWA 3SSSA 4DHVA 4XTTA 1UA1A 3VF0B 1TKTA 3CJ5A 3KK2B 1PSDA 1OQ3A 5KT4A 1E6VB 1FDBA 2BJ8A 3CB4A 3Q8SB 3DRXA 2YWKA 4D3GA 3PW4A 1YJRA 1NK4A 4PUOB 2ZUAA 3I0RB 2G2OA 3GV5B 3TARA 1V6HA 3UVJB 3NOGA 3R7NB 2XY6A 1IBMF 2WOMA 4USVA 4K0KF 4NMLA 5F3TA 4ZVSB 2ZBRA 3MMAA 4Y2IA 5IWAF 3RB6A 3ZTRA 1NJYA 2FLNA 5GADI 4I0WA 5DDPC 4RZRA 2JSXA 4A8WA 3UNYA 4JI0J 1WHXA 3R2CJ 1JLFA 5D0RA 3BQ0A 1H3DA 3LAKA 4ID8A 4UT4A 2C3YA 4ECUA 2IBKA 1IR1A 1RT3A 4OZNA 5D77A 3W66A 1VIXA 3H4DA 2RE1A 2RU3A 1N5YB 2XB2D 4NLWA 2DEJA 1P27B 2G9OA 4C8YA 1CPZA 4OHWA 2XM3A 4FDFA 2CNOB 1DTTB 3AY0A 4LF5J 3T5LA 5I3QA 1FKPB 2IMOA 2UVRA 3IP0A 2NYIA 5LXYA 2VUGA 3CCWA 2CAJA 3RRGA 4WU3A 5B08A 1HI8A 2FPHX 2CQBA 3TAPA 3OW2R 2YWEA 3BF4A 3C6UB 1RA6A 1F6TA 3I56S 3NY0A 1EX8A 2IC3A 1T9YA 4N8NA 2WVFA 4F3MA 1D1UA 3R2DJ 1NU4A 2IFXA 1PJ5A 4OZLA 1U4BA 1FVSA 2QTWA 1FXDA 8AT1B 1UPPA 2DR6A 2H4WB 2MLYA 1KN6A 2ALYB 3GLJA 4U95A 2VODA 3J81U 1VRTB 3NAIA 3Q22A 1VFJA 1XR5A 3BGUA 4EU0A 2G2ZA 5IS2A 2XYPB 3NOCA 3Q8QB 3DRRA 2GNKA 1T9VA 3VTIA 2RIJA 4C3MA 2MKIA 1F5BA 2UUCJ 3FVYA 1DARA 1AT1B 4IRCA 4GKKF 5LJ5Y 1B7YB 1YBAA 4DV7J 2DNQA 4IO1A 5DQGA 2ZOGA 3MD3A 1WC5A 5GAGU 1Q7LB 2HKEA 3GIIA 3EMTA 3QGGA 1Y0HA 3FEYB 2CJQA 2DB1A 4H54A 6FD1A 1R8CA 2R42A 1KTVA 2RVJA 3HVTB 3CJKB 1MNEA 3DOMA 3N5FA 3T1YJ 1RWXB 1VLOA 2MTLA 5D0HA 4QW8A 2J7UA 3HHKA 2EWHA 2CQ1A 1WTBA 5D4OA 2VG6A 2X3DA 1EJ7L 2IJNA 2QMXA 4Q5VA 2MQOA 3VAGA 2Q66A 4WF9Q 2V2VA 3W9HA 1W2BR 1M1GA 4QPTA 1S1XA 2BE7D 4YB1P 2ZBQA 1EETB 1FDNA 3D68A 3IG1B 4JOUA 4DR7J 2GO8A 2DT9A 2Y1JA 4DUTA 2VBXA 3GJRB 5T7LA 3GYNA 5A8RB 2AZ1A 4P9SA 2MY8A 4KSEB 2ASDA 1Q95G 4DL7A 1RHJB 1H98A 4CO5A 2GIFA 3N4WA 2VQFF 5G0RB 2IM1A 3JQJA 4LVOP 1XR7A 4URSA 4WE1A 7FDRA 4QWCA 1WDDA 3QGHA 1G4CA 4RBTA 1HHQA 1VLYA 3M8QA 4ZLJA 1QLNA 4GKJF 5T14A 4WFAQ 1JWWA 2DO4A 4LF2A 4Q2LA 4RW8A 1O51A 4K2XA 1FNMA 3Q24A 4TLQA 1MN9A 1IM6A 3ZZPA 4J37A 3CDEA 3SFUA 4PUOA 1RHKB 2HZAA 4LFBF 1SJ3P 2DPIA 1UVIA 3BYRA 4ZMMA 4ECVA 1RI7A 2C2EA 4AL5A 1RKJA 2Y1IA 3SBMA 1U6ZA 2V8PA 5ETOA 2IM2A 3J7Z5 2HQ3A 4QZVB 1R43A 2ZH4A 4V19X 1MMNA 1TL7A 3B82A 3D2WA 3SV4A 2OMLA 3EGNA 4PAAA 1MU2B 1T3NA 2OJ3A 2EKYA 2L9NA 1YSJA 3MXHP 1NKBA 1K73T 1WACA 2N4DA 4N8OA 3A3OB 1T02A 2AWZA 2YNGB 4M8LA 5DZ6A 3ISZA 2FUG9 5HI7A 3DU6A 4J91A 1XMBA 1EZZB 2MY7A 5CYMB 1E6YB 2YKMB 1ZS6A 3CJ3A 3EGZA 3A8IA 4C11B 2DGUA 1GXLA 3KK3B 5HQ8A 4J9RA 3OR1B 2UVVA 1FD8A 1BWEA 3CD0A 4B9NA 3Q2TC 2AJ0A 3MM9B 5KTQA 3OLBA 3UD3P 2DNOA 1JKHB 2CZVC 2RSQA 5GMKa 1P1LA 2ZD1A 5D78A 3TA2A 2CPFA 5EWGA 4E0DA 3FSYA 3BBCA 4JI7F 3DKDA 1RT2A 5A2QY 2F4VF 4DL0C 4TU8A 4OZ1A 2VU5A 4G1IA 2CXEA 3DLKA 4DMZA 1VOMA 3PW2A 5L9XA 5A6WA 3VV2B 4OYZA 1UA0A 4FVMA 4KGVB 2BM1A 2H3EB 3BQ1A 3DNCA 2UP1A 4OHXA 4CTAA 2ZM6J 3MMBA 1L3UA 1LKZA 1G1XA 3IG1A 1RU1A 4A8OA 4QIFA 3U02A 1HNXJ 5KG6A 2MYFA 3PX0A 2WVBA 2MKJA 2BE2B 2BE2A 1SH2A 2CG8A 6FDRA 5J1EA 3A3NB 1R27B 2DRDA 3R5GA 4RW7A 2CQ4A 5IC4B 5F41A 1PAEX 1OYDA 5LJ3Y 3GCWP 2IRXA 2WVCA 3TJ8A 2VH7A 2KRRA 2E9RX 1WI8A 4DS4A 1CVJA 1AYEA 4OJ1A 4NZ6A 1F2GA 3WHIA 2MZRA 3BO2A 1C0UA 3MEDA 3PG9A 1S9FA 2Y0BB 4JYAJ 3VWSA 2FLOA 1I1GA 2EC0A 2IJFA 2VV5A 1XJWB 2V4JB 3QWPA 2ZH5A 2B9WA 2DIVA 3DFEA 1KS2A 3DLKB 1N88A 1WTFA 4M5KA 4ZLNA 1J5EF 1AUSL 3FKBA 4WZQA 4LBHA 1RE1B 1H7WA 4CLSA 3MAAB 3MD1A 2RJZA 3AOCA 1JLCB 4NCGB 1U2RA 4UUXA 5DDRC 3DRRB 1SPBP 5GAGI 4TU7A 4ECTA 4OYIA 3R8YA 1Y00A 4JI6J 2V8VA 3R5CA 1W25A 3RG6A 1AB8A 2BJ7A 2ZFHA 5EGYA 4QYRA 3H42A 4I2PB 2GC8A 3KXDA 5K8PA 2HFUA 2HLUA 2PA3A 3H59A 1NH7A 3KG1A 1UPMB 2Q6CA 4RR5A 4Z7YA 5DO2A 2VFUA 5AXNA 2BQRA 4ZVPB 4FS1A 1R89A 5FDLA 2KRBA 4O3NA 3V4IB 1U45A 3FCVA 4ECZA 4EUVA 1SB6A 3IR6B 1T05B 2F5GA 4Z2XA 4H4MB 4IG3A 4C8KA 2V69A 3OXLA 3C46A 1QSSA 2GQ2A 2AW0A 5HMZA 1FHTA 3CJSA 4P7VA 4QW9A 2NPIA 3GONA 3PTWA 4ZS6A 5AXKA 4ZCLA 3W7BA 4A8YA 2AGOA 4F3QA 3K58A 1C1CA 1ROFA 1XN9A 3IGVA 3H40A 2A0FB 5I4MA 4MK7A 5J1PA 5KFQA 4JI4F 1RT5A 3FK4A 3GFHA 4DR2F 2CQ0A 1RAFB 4RPFA 4R8UA 2KFZA 1U1QA 4U96A 5DS7A 4C0BA 6AT1B 2QLXA 4Q7AA 4TN2A 1HBUA 5E3PA 1Q5YA 4C0OC 4DPOA 2HVHA 1IQTA 4PG5A 2LEBA 3QRPA 1CG2A 2AJFE 3FC9A 3CD5A 4Y3CA 2JDJA 4LBPA 4USMA 2AJ2A 3KLGA 2LEAA 2P6TA 3W9IA 3UI3A 3MURP 3B78A 2Z56B 4KKOA 5IFMA 3VVTA 2Z8QA 1FRHA 1XEZA 3IC1A 4HDGA 2BZ2A 2EXUA 2V5HG 4IKAA 1WC6A 1DQAA 2HS4A 3H90A 2W1BA 4ZOSA 3UD5A 5C5JA 5LMNF 1SH0A 1X31C 3PM9A 4EMDA 2PIIA 2KTQA 3QT6A 2IYGA 4NASA 2ZWPA 3Q0AA 1AZSA 4RW9B 1KQKA 2LQ8A 2RHSB 4GRSA 2R8JA 3U7JA 1N0UA 1IJEB 2HURA 3QT8A 4F0HA 5LXRA 3GV7B 1IBLJ 3ITHB 4AYBD 4IUFA 1LNQA 1S77D 4F36A 4EGLA 4L73A 4ELTA 2W2QP 2YWFA 3NS6A 3CEDA 3TA1A 2MSTA 4S0MA 5FLXY 4RUCA 2HIQA 4FYWB 2R7VA 4QWAA 1SC3B 1FJ7A 4Z7CA 3KLVA 2XZDB 3D6TB 1N6QA 1U8WA 2DNHA 3FZ2A 3IRXA 4P74A 4C8MA 2ZVSA 2R2SA 4JI1F 2FHJD 2PO4A 2HMIA 2B43A 4ED5A 3I4HX 2ZE2A 2RHQB 4PXCA 5HN0A 4PEOA 5KFYA 2FHMA 3M2RA 4A8SA 2ZH8A 2JLFA 2MQMA 4DV1F 2OPRB 4JBCA 1ZZNA 2QLJB 3U1MA 4OI0A 3QJLA 5BR8F 4UQGA 2Y3YA 5LMUF 4OYOA 3GIRA 4TY8B 1D3WA 4USIA 4X62J 1Y5IB 2XGPA 2OD6A 1UVJA 1MSWD 1PAUB 2DVIA 1CEZA 2HAIA 3KMSA 3SCKE 2IAJA 2K1RA 3KHGA 3KJNB 1VQ9S 2E5LJ 3RU0A 1FO1A 1WHYA 4BWJA 4LF9J 4FF4A 3QGPA 4LFCJ 3OL6A 4ILRA 2KFNA 1MROB 1O6XA 4WPAA 4PCQA 4Y2KA 3MPWA 1SJQA 5AE3A 1BXNA 5DQHA 3DOLB 4HDHA 4WTOB 3PX4A 4YHHF 5B0FA 1C1BA 3LAMA 5C25A 2DNLA 2EFGA 2W01A 2LECA 5CCMA 4DV3J 2CUYA 1Q7YT 4TLRA 4NEYA 2L9WA 2RF2B 1QDUB 2HHVA 2NSCA 3NGSA 4K5SA 4NI2B 4RL1A 5EX3A 4LSZB 3QPIA 4A48A 3W8GA 4HACB 3PZPA 2OTJS 3D6FB 4E98A 4DV4J 1UMJA 2BKPA 1D8ZA 1N4LA 2AEFA 4I2QA 4ZPAA 1ZTWA 1U1NA 1NHVA 3AAWB 3QIDA 2YPZA 3V4MA 1XMOJ 3LPEA 4KPYA 2CDQA 1CULB 4MKVA 1OPIA 2MJNA 1N52B 5H1SV 2N7CA 3T6JA 2H5EA 3V81B 1TUWA 1QUPA 2AYMA 2F63A 3CDBA 4U67Q 5HLFA 3BDPA 2JOQA 1JJCB 2B9XA 3FEXB 1CJVB 1PC5A 4CT8A 1KC8T 4FKXA 1M5SA 2MJUA 4LF5F 2RUSA 3MM7B 1UVLA 2ILZA 4DV6F 2KHCA 3BSNA 2ABYA 3T41A 1N54B 1HBOA 2HWIA 4FN5A 2A10A 4KH0B 4L6V3 4ZVRB 3CIMA 3CDAA 2RKIA 3M9MB 4RW9A 1HI1A 1QAXA 3JSMB 4OYMA 2ZZMA 1KVIA 2XMKA 4KGZB 4PWWA 2PMWA 2IDEA 3LF0A 3QIPB 2L08A 3UQSA 1X9WA 4MKYA 2CQDA 1X4CA 2XO6A 2DISA 1NB2A 1QAIA 2CPZA 3BGRB 2ZH3A 1SKUB 2GQCA 4DXLA 4ERDA 4FYXB 4ID5A 4RUHA 3PEHA 4ZVUB 2G13A 1HYSA 1XR6A 2MMYA 5K8OA 4B3TF 1YJTA 2GFFA 2PSZA 2RNEA 5B0GA 5HLFB 3D28A 3KUGA 2A1BA 1RT1B 3MM8B 2ZH1A 2KYZA 4WYLA 1N8RT 3IBCB 5KFKA 4F0MA 4Y00A 1A7GE 1IJFB 1ZA1B 3M6VA 3S6EA 2HW3A 2B6AB 2HK2A 2ZVIA 3DLLQ 2FC9A 4YHHJ 2MQPA 4ICLB 1TKZA 2XEXA 3L7OA 4DF8A 1PYTA 3H2UB 2JEFA 4BDPA 3OLAA 4OHYA 1U0HB 3K5LA 3ENWA 3BR8A 4B3MJ 4Q2MA 3RR8A 1NLKL 4CYUA 4LR7A 4I64A 3N9UC 4ECWA 4NCBA 3TVKA 2KXFA 3MHYA 5C2GA 4AXIA 1A9NB 2CJKA 2E5LF 3MMJA 5B0CA 1QVFR 2DNKA 3PVXA 4ANEA 1O8BA 2HQDA 3GR1A 2JLGA 2IY5B 1N5QA 3L09A 3FBEA 1HQEA 3EZOA 4X2BA 4X64F 4Y2AA 4C8LA 4N76A 2D9OA 5F0UA 3A1YG 1TVRB 2W4DA 3SMZA 4YB5A 1Y4ZB 2JZ5A 3W9JA 2HS0A 4O3QA 4ZN3A 2CRLA 3J81j 2FY1A 3V6DB 5CZVA 2W9AA 2V34A 2O67A 1HBNB 3AQOA 1RP5A 1VHIA 2HIYA 2HNYA 2EPIA 2QLWA 2DGXA 4ZVQB 4DR3J 1YI2S 1M5OC 5GAHU 1IR0A 3K59A 4F02A 1ZAXA 1SC4B 1LK7A 4CO1A 1TAUA 3V4IA 4DX5A 1K1SA 2ACMA 3BO3A 2VFTA 1SC6A 2R8IA 1RU2A 1HNVB 3Q8RB 1HNWJ 2P9EA 4I2PA 2G1HA 3H5SA 4MTPA 4OI4A 2LA6A 3M2UB 1XBWA 2C2MB 4IFYB 4PYDA 4C7QA 3T5JA 3PX6A 2V0NA 4NE9C 1NDKA 1RUSA 2VOPA 2X1AA 1YJUA 1FRKA 1YJVA 2GIQA 1P6TA 1SIZA 2A2DA 3MR6A 3EX7B 2ZBIA 1KQGB 4IO9Q 1VQMS 1OO0B 4DV5F 3EPGA 1R8AA 3UN2A 3D1QA 1CS4A 2QX0A 2K3KA 3BKFA 5DG9A 3KNAA 4B3TJ 1L5UA 3EE3A 4KRWA 4YQWA 4R0EA 3EDQB 2OLWA 3JB9k 1X9MA 2YVSA 2C1EB 4AL7A 2E1RA 5F8NA 3A8JA 3M8RA 3PY8A 2FJAB 1F2HA 5EWFA 1U02A 4MYTA 2HFVA 1VBZA 2XWXA 1HMVA 2G1DA 4PPZA 4ZP8A 1JX4A 1X9SA 2M88A 2W4CA 4H4OB 4ELUA 3PO5A 2GAHC 3HP6A 4USWA 3PW7A 3T5HA 5EHHA 5HBMB 3PIOQ 1NK5A 1AZSB 4WFZA 1NK0A 2XSJB 2ZKUA 1RAEB 3K8VA 1FWPA 4G65A 3CCES 5J2MA 3KG4A 2V4QA 4M5IA 5DJBA 4FPRA 3VQTA 3PKMA 4QPXA 2OEJA 5ETSA 2HNDB 4CTAB 5IZHA 4ECQA 1N48A 2F4VJ 4PRFA 1ZA2B 1BGXT 4RW4A 3OUYA 1IBLF 1OQ6A 1LWXA 3RTVA 2M9KA 2ADBA 1YJ9S 1NDCA 4YY3F 3DYAA 5MAOA 3TZZA 1WF1A 5ETVA 2UVWA 1Q0NA 2H48B 4OI2A 1X4EA 2HBRB 2GVDA 2YWGA 5LMNJ 3SI8A 4PG6A 4YS2A 4Y28C 3I0SB 2HFNA 2L9DA 4KGMA 4KC5A 4EBDA 1NZ8A 2V9WA 5CYMA 4IG0A 2JC1A 4JV2A 2BJ9A 1H2VZ 4F04B 4MYUA 2AGPA 2F8MA 3NBPA 4WK1A 2Y9HA 2QL9B 1NSPA 1RT5B 4ZP9A 2FYXA 3ZO7A 3DRSA 2B56A 3G2XA 5F9NA 2EFNA 4ATNA 2KO1A 3JTNA 4ZA1A 1KOHA 5IXUA 1QSLA 4NWBA 3C3LA 4HHUA 3C6TA 3VR1A 2DPJA 2U1AA 2O5DA 3F0NA 1S4FA 1SC1B 1N5SA 2RMLA 3O3LA 4TYAA 2E29A 3VGVA 2GGPB 2OGUA 5K9FA 2HVIA 1SJFA 5KFNA 3L3CA 1K0VA 2XZWA 2F8HA 1PILA 3CCTA 1I94J 2IVMA 1MWZA 1RT7B 2FB0A 2O3DA 2RQCA 1J2VA 2ROEA 5HSPA 4TQRA 1Y5LB 3GFXA 3J7ZT 4A8QA 1VQOS 4L76A 2NPFA 3CMAS 1ITPA 1NSQA 2I0XA 4L75A 4GKJJ 1RWMB 1MN7A 2L48A 4BC7A 2HHHF 4F2RA 2J8SA 3KTQA 3Q8YA 5A0YA 5BYRA 4NCAA 1LW0A 2DXFA 1U48A 1YK9A 4CDIA 2FJVA 4TQSA 4ZP7A 3BH6B 4YOEA 4B9TA 1F9HA 1KVJA 1Z2ZA 3DDNA 3OHAA 1WORA 2V4JA 3C16A 3UN5A 1UWBA 4RW7B 3CCZA 3GR0A 3VGTA 2RRBA 2XSJA 1NPPA 4M5GA 5HBMA 2FY8A 2XC9A 2Z58B 2CQGA 1JNRB 2F7VA 3MWBA 5A8RA 1DHMA 4EI2A 1RAAB 1RQ0A 2UXCF 2QZ8A 1T0TV 3NMRA 3U27A 3W64A 2NUUG 1CC7A 2YKPA 1RABB 3PEJA 4DL3A 2B4OA 1FK9A 2LXIA 4HVZA 1YRXA 4CLLA 2PMHA 4O3PA 2IIHA 2H1YA 3FCWA 5B7WA 2FHKA 4DI6A 1DZ5A 4Q0BA 4C3KA 2JWNA 2VPWB 2ZOFA 4M5HA 2AF6A 5DM6Q 1B3TA 4CLKA 1U2FA 3MM5A 5AJ3J 1VC5A 4NLUA 3FSXA 4TYBA 5C2CA 1YVFA 3FQKA 3FSIA 1RT4B 1RYRA 1VDHA 3KG0A 1NK7A 3W2VA 1KP6A 1A6LA 4PABA 3AB2B 3R27A 4MT1A 2OAUA 3AA9A 5I42B 3D1HA 3QO9A 1JLBA 4YN3B 2YXLA 2GVZB 2UU9J 5FIIA 4ZVHA 3HHNB 4YB6A 3IGNA 1UEVA 4ZCIA 4LRCA 3Q8VA 2XYGB 1HQ2A 3PXGa 1FXRA 2KM8B 5M2UA 1REVB 2HNYB 4P72A 4ZP6A 5J2PA 4B3OA 3D9BA 3CULA 3TNVA 1UZDA 2J7WA 4OHZA 2E7VA 1M5HA 3HD2A 1SCJB 4LSLA 1NBEB 4A4JA 5KFMA 2V50A 3JAMY 2BYCA 2Q43A 2CJBA 4J9OA 1TFYA 5D0GA 3PV8A 2E5IA 4KY3A 3D3BJ 3H8YA 2MGZB 1DTTA 2BVZA 3SCJE 3SIPB 3OBIA 4FBUA 2FQQB 5HMXA 1YIJS 1U1PA 4W92B 4P71A 2NXNA 2HQFA 3PCOB 4YB7A 3FDSA 4ETZA 1ZM9A 2CG4A 2RDJA 1N5YA 2W4PA 2ZUGA 3EVMA 4BWMA 1NK9A 2JFDA 4JI3F 4GVLA 2M2BA 3I0RA 2V2QA 3DYAB 1EQ0A 1WOSA 4CT9A 1BD6A 1QJHA 3I9ZA 5HMWA 2HFOA 5L38A 2VIHA 4DS5A 4OLOA 3MMAB 1WI6A 3UE2A 4YP3A 3VAFA 1H38A 2GMHA 1Y5NB 5L46A 2WTFA 1HYSB 1GMWA 3FMWA 2SXLA 2V6AA 4F25A 2ZHBA 2XI2A 1SJ1A 3T1AA 4X4QA 2DCLA 3MF5A 4ZCMA 3R97A 5HJYA 3LA0A 3CCSS 3TZXA 3BGRA 4DV4F 3AD7C 4RU2A 2DCUB 5AXMA 4H4OA 3M4XA 1W7WA 3W1YC 3IN5A 2AX0A 2LCWA 3IS9B 5FD1A 3G6XA 1EETA 1KDNA 3AOAA 3IFEA 4OYWA 4U8YA 5SZTA 3KLHA 2FGCA 3HVRA 3G6YA 2RS8A 2W2MP 3QYYA 2HHSA 5IT9U 1VBKA 2HEKA 1M1KT 4JI3J 2DGQA 3BBBA 5FLXU 2PI5A 4LF6F 5IM0A 1WWHA 1YX2A 3ETMA 3ZNJ1 2FDNA 3PYFA 1CJTB 4B17A 2UV8G 5B0DA 1FKOB 1HBOB 5KT5A 2DR5A 2QLBB 2D69A 2B7CB 1OS5A 1RTHA 3SDEB 1T94A 1JLBB 2D3UA 3CJKA 2W9BA 1UEUA 2UUWA 4A8FA 4DUYJ 2DR8A 3OTEA 1JXEA 3G9CA 3AJ2A 2ZITA 2DHGA 4RNMA 5F3ZA 1B64A 3HSDA 2MQQA 4DSFA 3R5JB 2J7KA 1BWVA 4H4KA 4N77A 4DSEA 3CW2C 4J9SA 1OY6A 4FPIA 2LXUA 3GCXP 3MM5B 3ETOA 3L95X 1XIQA 2D9PA 1G2EA 1A0OB 2FJEB 1S57A 3W3SA 4K5RA 2CKWA 3Q89A 2UV8A 1O5JA 4HLBA 5HJXA 4O4GB 3SV3A 1WNEA 4LSNA 4URQU 3MEEA 1FK9B 2POKA 2EEYA 5IM0B 1VGYA 3OL7A 2RF2A 3HLUA 5JXSA 2OHDA 3H2LA 4GVBB 5CZXA 3S1TA 2JVRA 5KFPA 2ZH9A 2BKOA 4L72B 3EM1A 2P5VA 1C1BB 2RH3A 3MR7A 1RHRB 2IC3B 1NDPA 1LWCB 3LO3A 4JI0F 4BLGA 5J2QB 1FWKA 4WTYA 3C6UA 1N56A 3IAS9 1N0VC 2ZWOA 4ZLPA 2UXDJ 4KHRA 1GFWB 4YR3A 2DEIA 5A8WB 1TK0A 4USKA 4OV6A 2V2KA 5KFLA 2IAJB 2K1RB 5HROB 2PC6A 3D1OA 3NGUA 3ENAA 2QSFA 4CP5A 2QC3A 1AFIA 1N36J 5KG1A 2IRYA 1RTJB 2YNFA 1TV6A 2R7SA 3JSBA 1QAJA 1TL5A 2BXJA 3ZZRA 4PG7A 5KG4A 1R3NA 4TKTA 1L3SA 2D7SA 2E66A 2B9YA 3CGIA 3F56A 2EFVA 3QZ8A 1QVGR 1N36F 3ZZ0A 1WEZA 1FRJA 1FTRA 2BW2A 2HFZA 4CM2A 4DBQA 1SH3A 3CCVS 4F3OA 4BBYA 1N33J 3LW5C 4M5MA 1K47A 3JXOA 3HKZD 3L9ZA 4CO3A 5C24B 2VJUA 4NYZA 1KQFB 1H74A 3LWMA 2FIUA 2OKQA 2DNNA 4ANCA 4DWIA 1Z2LA 4CLFA 3P6YC 2DHSA 4RUBA 5F8GA 1SIWB 1F3VA 4ID5B 3H20A 5C7PA 5LT5A 3PYEA 1WC4A 5D4NA 5HQLA 2CNKB 2BJ1A 1E6VA 3DXBA 3F41A 1FNXH 5CYQB 2JC0A 3B54A 1Q5VA 4DU8A 4EO6A 5IT0A 1F1BB 2WSCC 3KJVA 2XHWA 4DF4A 3ITHA 4KQZA 1KLNA 2H51B 4KBIA 4ZJLA 1ZAVA 1M90T 3NL0A 4HKQA 3N5BA 4C98A 4DR1J 2IA0A 5JVGQ 1HBMA 2GA7A 3TAMA 4BC9A 3LP0B 2QMWA 3CCQS 3OD2A 2ZZTA 3CC7S 2XNRA 2MHNA 5F8IA 4JI5F 2Q79A 3AH6A 3HKWA 2VFSA 2HHHJ 2DGTA 3BN4A 3V5RA 3QMQA 4CWBA 4FZVA 3PR5B 5FJ4A 1H73A 3DRSB 4OX9J 4X4PA 5B0AA 4DDFA 4NLTA 2FC8A 3SFGA 3KLIB 5ETQA 1WKLA 1Q8IA 3GIMA 1RZMA 2CVIA 5I42A 4IQXA 2MKHA 1RCXB 1MWYA 1OSCA 3MCMA 4ZJOA 5HVHA 1S99A 2A18A 2BJEA 4LJMA 1VJQA 4UOFA 4DG1A 9ATCB 1FERA 2HGNA 5KFXA 2GVDB 3HHLC 2ATCB 2RUGA 2D3ZA 5CCLA 2XCPA 1R0AA 1RAIB 1VJWA 2FVRA 1FX2A 2ZBPA 2X1GA 2OSRA 2XNQA 2E9ZA 5HO4A 3ILIA 1LWEA 2F1FA 2F3JA 2F9JA 2BUNA 2I5JB 3DI6B 2A6MA 4ZIVA 1DLOB 2HS3A 4LRBA 2LU1A 3BKUA 2J8AA 4MAKA 4RW4B 2BANB 3TA0A 2HNDA 3HJVA 2AIRB 2J9EA 2PEHA 2HVZA 5ETPA 4C4WA 2LMIA 3LP2B 2YQ0A 1T03A 2V68A 2HRYA 9RUBA 2QV6A 1UJ6A 2WVDA 4HR2A 3EVOA 1GMUA 3QATA 3R5BA 2M5YA 2MZQA 3PRDA 4PXEA 3MPYA 3S01A 4ZHRB 2J9DE 1X0PA 2KHDA 3P5TL 3D0IE 5EX0A 2MKKA 1LQ9A 5EWEA 3R1HA 3QNWB 4J9NA 2JRSA 3RRKA 2BQ3A 5D6GA 1B0PA 5DZ7A 3FJ2A 2NR0A 2Z2YB 3PFEA 1G3OA 1FF2A 1U2CA 1TL1A 1Y11A 2DYAA 4X66F 3T5KA 4Q8EA 1U6BA 2X1FA 5KFAA 2A6OA 3LUYA 4FF1A 4WFBQ 4U9RA 4RNFA 1Q53A 1TKXB 1X4GA 4X66J 1IKVA 1N34J 2XS7A 2I9SA 2LDIA 5CA5A 1LW0B 4ED7A 2CWXA 5HANA 3IA0A 4ZDNA 1AXQA 1NXIA 5KT7A 1JLCA 4WIQA 2DHAA 3EZ5A 4B9VA 2LP4A 1HQUA 4KH1B 4Y34A 3O2IA 2EBEA 2LKZA 3M2VA 4AT1B 4KIAA 4PQUB 4PQUA 1FFGB 3LALA 3CVKA 3G71S 2WSFC 3THTA 3POTB 4RJVA 2AMCB 1HKAA 1JJ4A 4DSIA 1PBUA 3IMQJ 3OTDA 4C3LA 3TOQA 2IHR1 3NLCA 2XHCA 2ZJRQ 3LTOA 4WWSA 2HPUA 1KBRA 4YEAA 4J9PA 4AUKA 3WBZA 3I55S 2R2RA 1TL1B 2BE9B 2W2PP 1NMEB 1RLDA 4XIUA 1BE4A 4QBUA 4K8RA 1UFKA 5J1EB 2M7SA 4GMKA 1GH8A 3OL8A 1VK8A 3VCDA 2W9CB 1FEEA 4JI4J 4YDDB 1U09A 2DY9A 2ZZNA 5E5NA 1OSDA 4MKBA 1Y10A 3AD9C 2UXBF 4HL9A 3DI6A 4RU9A 1TK5A 4IFVA 2MLZA 3D6HB 2DKOB 1F9EB 2XYHB 3QLHB 2WB4A 1S6OA 3M7VA 5ETKA 4IH5A 4K4UA 4DPUA 1D09B 3E51A 3AHPA 1NJWA 1VIOA 2Z2LA 4IH6A 4QJVA 1V3RA 2MKCA 3P45B 3RBZA 1SKWA 1DLOA 2W7PA 2IM3A 3DMJB 3CSKA 2O01C 4DR5F 4OX8A 3T1YF 2QL5B 1EQMA 5AT1B 4OJ3A 1PBAA 1VQ4S 3W62A 4KE5A 3KLIA 3L7UA 4XDDA 4NL5A 3SCIE 3RW6A 1FESA 5D15A 3KHRA 1YHQS 1F3FA 2B0GA 4PXBA 3M1VA 4DV7F 4J90A 5A8KB 4GKKJ 1I51B 2BKNA 3QLHA 4W4MA 3CWJA 5HQMA 1S97A 2XY5A 1D9AA 4DJBA 3HPOA 5D8HB 2YNGA 4AXJA 2VJVA 5KFZA 2AJ4A 1DQ9A 4L3NA 4LF8F 5D3GB 4K7QA 4J9KA 2CPEA 4IG3B 2MZJA 4EWTA 2OP5A 2G0JA 2HQGA 4IRDA 1TL7B 2QL7B 3J7AN 5EN1A 2XWYA 1VMBA 4ZVFA 1U26A 4ZPVR 1TELA 4USUA 4KJIA 1FA0A 4N56A 3AXKA 5KG5A 2MKSA 3FBCA 3D0HE 2BJ3A 2FVQA 4LIWA 4K50A 1H0HB 1U0SA 2IDLA 5H9FK 4I69A 5CYQA 2PT0A 1FRMA 3KJVB 4NA3A 1UVNA 1JK9B 2YKNB 4ENOA 1LWFB 2PEBA 3OFHA 3KKFA 2EG1A 4EBEA 2RILA 4ED8A 1HHTP 1LEOA 1DFDA 1IKVB 4ECSA 2Y0SD 3FFIB 5CYJA 4B02A 1U1KA 3HO1A 4IR9A 1SUQB 1SJRA 4O0IA 4B3MF 1UWAA 3C8YA 3ZZTA 1HNVA 4WFXA 5DLGA 1AW0A 2LA4A 3GTYX 3PRVA 5IT4A 4X84A 2LQ9A 3P5BP 4DLGA 4I2QB 5E2QA 1C4CA 2HHWA 3GILA 5KAKA 3H2VE 2XULA 3C15A 1HLWA 1HNZJ 1PCAA 2DR7A 1EP4B 2UUBF 2D3OR 2NCKL 5L8RC 4LF1A 4K4YA 1T8EA 3NGDA 3OXGA 5JVHQ 3HM9A 1HFEL 3K0JA 1F60B 3O5TB 3EGVA 2Y1LB 3MEKA 4DR5J 2B9EA 3VQSA 2ZHAA 2DIUA 2OPQB 1MROA 3G86A 4KYZA 3FMBA 3TP2A 3KWMA 3MMBB 1VRUB 4ED0A 2RQKA 2QO3A 4O4GA 1ZBTA 2HGLA 2MZSA 3MPVA 1W2IA 4ZK7M 1S1UA 4M63A 3T9NA 5GMEA 1RJJA 1Q86T 2AHOB 1IBKJ 1B7FA 3NGRA 1LWEB 4GVBA 4L3KA 2Y8WA 3HSGA 3HVWA 3NWGA 1FKAF 1WG1A 3EWGA 5IQQA 1IM4A 1XNRF 1S1VB 2AJ1A 1U0HA 2YKAA 3HZGA 4U7UD 1TL3B 2E5JA 3M2RB 1X5OA 3OFFA 2R7UA 1RWPB 1F9FA 3CDWA 2R7TA 2KN4A 2PN6A 1NZAA 3LP1B 3O8WA 4NLYA 2IYIA 3MM9A 4QIWD 1HL6A 2CPHA 3I87A 1LW2B 5E3AA 3ZTQA 1UFLA 4I6AA 5K14A 3W5XA 2YX7A 1RISA 4WBFA 3Q86A 2N7YA 3CPWR 3K5NA 2YBVA 2LFVA 3HFKA 4DL6A 4LFAJ 2HWTA 2WZ1A 2QA4G 2KXNB 2V8DA 1J5EJ 3DLBA 4C8OA 3X1LB 2GO9A 2V8GA 3M8PA 3QZ7A 2DNMA 2DH9A 4M5DB 4OYAA 1GXUA 3LP0A 3AOBA 2DNZA 2F65A 2A2CA 2FVCA 4NYOA 1JQGA 2OUGA 2GMLA 1Q8KA 3MFHA 4DQRA 2HYIB 1YZ6A 2VPYB 3C19A 1VK3A 3HHLA 1EARA 4FVCA 5B0BA 5U47A 3TANA 4Y6IA 4I1TA 2VL1A 4RWXA 4M5LA 4TY9A 5H9EK 1ZOTA 4ANDA 4CH7A 4J9VA 3VAHA 1XQIA 2JEGA 1IKYB 2KVQE 2QYGA 5H9FJ 3VHQA 4ALZA 5CAAA 1VQKS 1YQHA 4RX6A 2R7QA 2FVPA 1CJUB 2CVEA 1MW7A 1IUJA 1Y7PA 3LANA 3BSCA 1TMMA 2GAGC 3NKYA 1RT3B 4X4RA 1G7CB 2BOPA 1HW9A 1Q78A 2VASA 1F5AA 1I5OB 4FYYB 2BV3A 5E41A 4DPYA 2KH9A 3ICLA 3IR7B 4CLWA 4LF7J 5CABA 4LBIA 1UVKA 3M9OB 3QSYB 1P9YA 3D66A 2XI3A 3DHWC 7AT1B 3TI0A 3DN9A 4U6PA 4DZDA 1UW9A 2W8LA 3OFGA 2KT5A 3OVBA 2CADA 2FJWA 3WC2A 2F4FA 1UJ4A 3EXCX 4LT6A 1KQSR 4IQMA 2W24A 3W63A 2ZH7A 5E3RA 3IRWP 1MLAA 1X4HA 5L39A 1VQ5S 2COLA 5BYQA 3NCPA 2B7BB 4KHMA 4ZVEA 5T7LB 3OTBA 3VAMA 1NB7A 2J0QD 1TUGB 2YNHA 1NUEA 1VCTA 4DV3F 2APOA 1DTQA 3SZ2A 1RLCL 1IN0A 4MMOA 5HROA 3NNCA 3QWUA 4C9DA 1S1TA 1NPRA 4N41A 2VG7B 2VG6B 3KUHA 3TX8A 2OPPB 1PKUA 4CIOA 1T05A 4LSNB 2K8GA 1XTZA 1BC6A 2N3LA 2CDRB 4Y2MA 2HZVA 3SSRA 3QO9B 2DRBA 2E44A 1T11A 2F9DA 4I7FA 5J2PB 4B3OB 4NXNJ 4ECXA 4OV1A 3N6MA 2C22A 4CLTA 2CPXA 2BW7A 3UO0A 3RB4A 2OPRA 3LPYA 3HX9A 4HI2A 2QA4S 2RAQA 1GTEA 3E3XA 3HHLD 4I6WA 5K14B 3NMAA 5GVQA 1BY9A 3UCZP 4GO5X 3QGIA 2J0WA 1R6VA 2GHVC 2LLZA 3FQLA 2E1AA 1S0OA 3LGNA 2EFPA 1TP7A 2XLJA 3MCNA 1FI4A 2C3MA 4Q0BB 1RT4A 4FNIA 1S1VA 5E33A 1KOOA 3DU5A 3J7YU 1CJTA 1S48A 2FGOA 4JI8F 2P9GA 4DPTA 3DRYA 3PKYA 4ED6A 2ILYA 4LF7F 3PFOA 2PFDA 3NCQA 4R25A 2H5JB 4CLYA 3PNIA 3RYLA 3AFGA 2AU0A 1C0TB 1VQNS 1FKOA 1M0SA 2M3DA 2OD4A 3HMJG 1NHUA 3R3TA 5IWAJ 2DGSA 3NS7B 4ZLLA 4ILMA 3PRBA 3JYTA 4IDKB 1WG5A 3GFZA 1SKSA 4QOTA 3UN3A 2YX1A 4NZ0A 4AL6A 1NK8A 4DQPA 1S6QB 3C2PA 4DV0J 2EBGA 4K4TA 1VQLS 4UY8T 1TTHB 4WJBA 1JLGA 2KDOA 3OFEA 3J80U 2KYXA 1IVZA 4QWBA 4F8RA 2QT7A 1B70B 2X51A 1KKHA 3F44A 1KTQA 1R31A 3P96A 4QIVA 1FRIA 2OFGX 1JB0C 4CNZA 4Y0FA 3K5OA 2KG0A 4USHA 5A0YB 4Q8FA 5KFHA 1SUQA 3VAKA 5AXLA 4DQSA 2DY1A 4HI1A 4N7TA 1ZYQA 2X1BA 4IRKA 4OL8A 3RBXA 1GX5A 1PJ6A 1RAHB 3FUYA 4PR6A 1GQEA 3BSAA 1XC9A 4ELVA 1Q79A 3FRYA 3ILJA 4ES1A 5G4DA 3BGOP 5B09A 1LWFA 2MHEA 2J0SD 4OLPA 1KWMA 2ZJPQ 4DN0A 3QSIA 2MPUA 2OH2A 3C14B 3E01A 5B0EA 5J2NB 4DZ6A 3BSOA 1PIEA 1QY7A 1Y3KA 2C3UA 4WCEQ 1V3ZA 3D3CJ 1N32F 1SV5A 3QFHA 4XAKA 1BQXA 2BR0A 1HIYA 4KV8A 1IKXA 1T9UA 4RLEA 1S49A 3A12A 4NX9A 5IC6B 3D4JA 2GMJA 4LR9A 3WC0A 5ETNA 2P8IA 1ZTTA 1JLAA 3GG1A 4HEA9 2HZCA 2E1PA 2GVZA 4GC6A 4M5DA 5L9NA 3TEGA 4X4SA 1SL1A 3DDKA 3M8PB 3IWNC 1REVA 3GB0A 2ZEJA 3NRBA 3O44A 1WEXA 4UOGA 5L1JA 3RAXA 3PO4A 2MXYA 1U6FA 1LK5A 4Z37A 3M8SA 1QAYA 4CZCA 2XO7A 5H9EJ 1V5IB 2LEPA 3VZHA 1B4SA 2AX1A 1URNA 3O6QA 1HWUA 2QIFA 4DR4F 1NSKL 5M2RA 1OJ4A 3I0SA 2MQ8A 2WONA 1TL3A 4JB8B 1FRLA 4UQTA 1RBAA 1S1WB 1NO8A 4O44A 4RW6B 3S8SA 2R7WA 3QQCD 4N47A 4JV0A 4JI2J 1HWJA 1TZ0A 4USJC 5J2MB 1BHNA 3ONQA 2KFYA 2GHWA 1BMQB 2AV5A 2NZ4A 2RRAA 3RGIA 1LOUA 3OSNA 1WEYA 3DDIA 3MZIA 5I3UA 1OIAA 4JP8A 3KFWX 5A6PA 4QWDA 1VQYA 2B5JA 2OMOA 5JMNA 3NS5A 2ZC4A 4NLDA 3T6BA 1S6QA 4P2FA 3GV8B 3N6NA 2QA1A 2FJXA 1OY9A 2HFSA 4WZMA 1UL3A 3KK1A 4CCHA 2I38A 1RK8A 1JLQB 5T41A 1PC4A 5GADU 5KOXA 3OR2A 1QSYA 4WP9A 1Q16B 3CTRA 2MB0B 3DOMB 1HNWF 2IJRA 2W2NP 3CJQA 3GFYA 1I3OB 2D41A 4YR0A 2UVUA 2DGOA 3G82B 1P1TA 3MGJA 2ZOMA 1V5VA 1T03B 2Z4PA 1NJZA 3QRQA 4IFYA 3GIKA 1S9EA 2BRLA 1CS4B 3RB3A 3M2VB 1KD1T 2BRKA 4CLZA 4DL4A 1M5PC 1X5PA 5HVFA 3AJ1A 3UD4P 2VQEF 2ZH6A 1RCOB 2RQMA 3EVWA 1RT7A 4P7TA 5KFSA 3FBBA 1U1MA 1ZM2A 4ZVGA 2OIHA 3RJMB 1E6YA 2YKMA 2R4FA 2Q3PA 4ZPBA 2QYCA 3VALA 5KG2A 2H54B 1EHWA 4F4AA 1JLAB 1IWAA 1U47A 3I5CA 2MQNA 3TJ9A 4LIRA 1L3VA 2AEMA 1HWLA 1WJ9A 3EUNA 4AQYJ 1FJGF 2KZZA 4DFPA 5HL7Q 2L41A 1RWNB 1X4AA 1X8DA 3BPSP 1FFSB 1JMTA 2NYHA 3K57A 1KLMB 1MG7A 3NEKA 2I6WA 3BJYA 1WG4A 5F9LA 3UR0A 2XQCA 3R1LA 2NUHA 3RR7A 4IG0B 4F4KA 1DRZA 3CIZA 4L74A 3M1VB 5CH7B 4X62F 1V9OA 2EW9A 1S79A 2DXDA 2HG4A 2P2CB 2YH0A 3GE9A 4CI0B 2EFQA 3UFCX 4JI7J 4LQ3A 2CIMA 4DR3F 1JIHA 2LQJA 4DV2J 2DXEA 2XS5A 2BJDA 1HNIB 2IPOB 2RQ4A 2VKRA 2HRUA 4ZKAA 3OSPA 2NQPA 4OZ5A 2K3IA 3UNGC 2GHPA 2RDDA 3DMJA 3V6HA 4CYUB 3F73A 1UKUA 1RGVA 4DSKA 4RO0A 2MSSA 4HT7A 3GIJA 5KFWA 2HBYB 3OTCA 2GIRA 2WOMB 2VZ9A 4U8VA 1IKWB 4LRAA 5E3CA 1TKZB 3SSQA 5GAHI 4GC7A 1BLUA 4X4NA 3WZ0A 1XMQF 5CD4A 1KVKA 1RWVB 3HD1A 2B8PA 2R7OA 3BM7A 1XERA 4OIXA 5ITHA 5HATA 3JSRA 1HNXF 1NM2A 1RT1A 3MM8A 3US5A 3VGUA 2DJWA 2E1MC 3OUYB 3TQ1A 1S10A 2GJIA 3CJ4A 4MFBB 3HSJA 3I5BA 1JJ2R 3G87A 4CM0A 1FXLA 3W5YA 4KFBB 2EFOA 2G0IA 4TVAB 4DV6J 1R8BA 3I82A 2C2NA 4ETXA 5KFTA 4ZITA 5DQIA 1U1OA 3N6LA 2O1PA 1CQMA 4J7CA 1RB0A 4ZVTB 1X7VA 1RKIA 3HHEA 4JV5J 4P73A 5A2QU 1QD1A 1N5VA 4ECRA 3DLHA 3AXMA 2CWKA 5EUHA 1HPZB 3MTKA 2R8HA 2JLEA 3D67A 3I9V9 4G1PA 5D4LA 1TL4A 5IOLA 4CO4A 1JXLA 4OMFG 2Q1LA 1RWOB 1VS3A 2VONA 3OTOF 2QFIA 3MFIA 1F5CA 4X4OA 5JJBA 4R5PB 3N0VA 2DR9A 2FVSA 3M2UA 1DAXA 3RW7A 2QGFB 2VA3A 2XLIA 4DR4J 5GMDA 4LRFA 3BEGB 2LU2A 2RT3A 4PKDB 1YLXA 2PI4A 1R7IA 1T7PA 1EB0A 1VRTA 1ZAWA 2JJ4D 3SEOA 3T9ZA 3MECB 3HT0A 3N28A 4M95A 3W5ZA 2AYEA 3AA8A 3CD7A 3HULA 3K5PA 4PWDA 4K4VA 5MLCV 2ROGA 4X4VA 2NZCA 4ED4A 3B6BA 3BDEA 3TUJC 4J9LA 1UJ5A 3KDNA 2CQHA 1RDRA 4FYVB 2BOAA 4DFMA 1UAWA 3THVA 1T3OA 4NPOA 4LMZA 2K7KA 1RA7A 1UEKA 1JLEA 1UP1A 2VC0A 2VG7A 3ZXWA 3SQOP 3OT9A 3HT3A 3D54A 3CCMS 1CLFA 2WVEA 1FKPA 4JI5J 3DGPA 1ZZFA 3R9LA 1DTQB 2CQPA 3OQ2A 4DV2F 3DOLA 1T9XA 2YWWA 3PJWA 3QFWA 5C25B 3LP2A 3AB4B 1EP4A 2VBWA 4LFAF 5D0EA 3NCRA 1S6UA 4UW2A 1HQEB 4KGKA 4D3HA 4ZJQA 3CCRS 2KJWA 2FZKB 2W2OP 3IR5B 2BEFA 4MJKA 1YJ7A 1LXNA 1TMJA 3AODA 5K20B 2B6AA 2UUCF 4M5NA 2GS8A 3M8ZA 1LXJA 2J9CA 3D7SB 2XBPA 3GG0A 4QWEA 4F4WA 2NXUA 3ET6B 3TR5A 1VQ6S 1I6JA 3MECA 2CPIA 3QT5A 3PIPQ 3NNHA 1N6QB 3IWLA 4DG1B 4A46A 4DCJB 4LFCF 3UVJA 4CO2A 4EYHB 3CJTA 2BBEA 1S12A 1IBMJ 2M8DB 3JQMA 2OTLS 3BN7A 5IT9Y 1IR2A 4PWUA 1RTHB 4WK3A 3SDEA 3M32A 1YDLA 2AKWB 2N4CA 3JS9A 3K7RA 1FJCA 3HFVA 2O66A 3GJSB 2BACA 2CQ2A 5KFIA 2QE5A 4A47A 3CO9A 1IKYA 1S4EA 2LQ5A 3B4MA 2VKZG 3QAEA 3KHLA 2Y1RI 3MEGB 1GXTA 4DV5J 3ZZOA 2AEJA 3A4TA 2FLLA 1YGYA 4W90B 1HPZA 2XMWA 3KOAA 2V4RA 1URRA 2I2YA 1FFWB 2FZCB 1HR0J 4FYDA 2UZAA 2MQLA 5HK4A 2XTJP 4EFAC 1HHSA 2CQIA 3T3FA 2GV1A 3MAHA 4E2FB 4J9QA 2FLPA 4KKOB 3MI7X 2VQFJ 2ASYA 3RB0A 3N79A 1KHWA 1RHUB 1PJ7A 2ALZA 4B3SF 2HAFA 4KTQA 2RS2A 4OFZA 5ADZA 2YH1A 4QU6A 4K4WA 1VQ7S 4R8UB 5L1IA 3V81A 2D3O1 5C24A 2AQ4A 3OPKA 1M1HA 1CULA 1N33F 3B8HA 4KB7A 4DSLA 4ZCKA 1CJVA 4MH8A 4P52A 5HP1A 4ZVOB 4O3RA 1TKDA 4KAIA 1PYSB 4HACA 1KHVA 2B3TB 2N3OA 5DG7A 3H98A 3S7RA 4NI2A 1VQ8S 1RTJA 2YNFB 2VFRA 4P6QA 4OJHA 1HNIA 2DH8A 2DTJA 2BABA 3V6JA 1XMOF 1BQNB 4EZ9A 4V19J 1N32J 4DCPB 1D0EA 3AQPA 4KR0B 5DM7Q 2UUTA 1JLEB 1GEHA 4RNHA 4H4MA 4QR0A 3UDEA 2CYYA 1IQZA 2XG8A 2LDYA 4NLSA 4NA1A 4K4XA 3OJSA 2M52A 2VPZB 4DUZJ 2OO4A 3M8YA 1L3TA 2J6SA 4GO7X 1VR6A 3KDOA 4JV1A 2X7IA 3PYDA 3OVSA 3TUPA 4CO0A 1F0XA 4NRUA 2OEKA 1NH8A 1KR4A 3NAHA 4P2XA 4YDXA 4NLPA 3C15B 3R6GB 4IH7A 5LL6d 1ZM3A 2ZDPA 1RACB
chains in the Genus database with same CATH topology
5F8MA 3M05A 2U2FA 4G6VB 3FGVA 1S7HA 4F26A 2J6TA 1B0TA 3OL9A 1H2TZ 4EZ6A 1HQUB 3C66A 3K2YA 1SQEA 2IVFB 3NG8A 4I67A 4BHQA 2CPYA 4B3RF 3G4SS 2YKNA 3MUMP 2J76E 1LFWA 4RBVA 4R5PA 4F4ZA 3MTJA 1JLQA 2P9CA 1K0TA 2R2TA 4BS2A 1JNZB 3M6XA 1VQSA 2ROPA 4PQAA 3DLEA 5KFEA 2W7AA 4OZJA 4I6YA 3TYTA 4I68A 2RDIA 3H4BA 2MZ1A 3KLEB 4QU7A 1Q8BA 2AYGA 3H5YA 3HK2A 4ZPDA 4DLEA 1S9GB 4X4UA 2BA9A 3G96A 1UWBB 3KLGB 4FBTA 1T95A 3D0GE 4URGA 2IVYA 4ITSA 2ZH2A 1S1WA 2MDAA 4RW6A 2C28A 3EPIA 5F8HA 4NXNF 4DV0F 3H5UA 4EO8A 1J5OA 1NEEA 2YWHA 1Q1KA 4QR2A 2QFJA 1FJEB 1HI0P 2XMUA 4NXMF 1RT2B 1X5SA 1X4DA 1Q4RA 2ZM6F 2CZ4A 4G1QB 4LF9F 5I3PA 5CHCB 3ENQA 3J80Y 2E5GA 4IFVB 4ED2A 1NKCA 4ZPWR 1VBYA 4F67A 2MGZA 5KT6A 1KLMA 3UR3C 1K9MT 2VODA 4OX9F 3A8EA 5KT2A 3MR5A 4C11A 2B51A 1MU2A 3M30A 3SXLA 4EYIB 2HHQA 2FJDB 2K7JA 2W9CA 1IKXB 4OZ0A 5FDLB 3WDOA 2E1CA 2GQQA 2RB7A 3KLFA 1KEKA 2DGWA 2XMMA 4B9LA 4I56A 5JUMA 3I6PA 4QIGA 3E01B 4OI1A 4J5OA 2H9ZA 4WYWA 3HXMA 1Y3JA 2HWHA 3R5AA 3B4DA 2RD5C 1O0PA 3CUNA 2GX8A 4DQQA 1FD2A 3G8QA 1P9QC 2VFVA 2PFFB 4MIAA 2EK1A 4OHVA 4WKYA 2KU7A 2OPSB 1NRKA 4RW8B 3W2VB 4K4ZA 2KG1A 5DETA 3CC4S 4B9SA 4YMEA 2NSBA 1Q81T 1FEHA 4MIBA 4A8KA 3HVAA 2C2RA 2XY7A 1DJ0A 2M70A 3PW0A 3G6ES 4IYQA 3PR4A 4NCGA 1HW8A 5E0OA 4CNYA 3GQCA 1KSPA 1UW4A 4RNNA 3CF5Q 2C2DA 2AYBA 2DH7A 3OR2B 3G8TA 2IRUA 3BZQA 3DOKB 1U7LA 3E8OA 4NRTA 4EBCA 4WU2A 5J1NA 2GCFA 5A8WA 4B9UA 3RRHA 2HHXA 1G6BA 1MMDA 3KLEA 2M8HA 1JLGB 1SJFA 3HJFA 5KG3A 2IMWP 3ZZYA 4ZHRA 5LSLA 1R8PA 2JHEA 2IA6A 2J6UA 2VBZA 1Y9OA 2V94A 1AUDA 1RTIB 3DLEB 1YRTA 3SCLE 5DGAA 3JYTB 2KM8C 3BB5A 2DITA 1XK8A 4DOZA 2W7OA 4FXWA 1SI9A 4WXWA 4XO0A 2AP6A 1CQNA 4O44B 1WF0A 2AGQA 2P6SA 1X4FA 1YRUA 4XPCA 2WONB 1C0TA 2DRAA 3DC2A 3LOUA 2I5JA 1JKHA 3OV7A 3HVTA 2ASJA 3E2EA 2ZNYA 4O4RA 1VC0A 2B4UA 3EXYA 1YG0A 3KK3A 2CPDA 4QYZJ 3ZFVA 1CC8A 2WBRA 5C42B 1TQLA 2ZD1B 4I7FB 2UUAF 3PACA 2KZMA 5K8NA 1S6PA 1FT8A 2J5AA 1HWKA 3OR1A 1RYSA 4JI2F 2HLTA 4FXDA 2BM0A 1HNZF 3QAUA 2RU9A 5THWA 2JH3A 2N82B 2R7RA 1U1LA 1UA0A 2DK2A 2A3JA 4TXSA 4JI6F 4FF3A 2YTCA 3I4PA 2W25A 3KLFB 1OWXA 3HI9A 1Q82T 2E9TA 3TAMB 4WIIA 2XS2A 3ULHA 3NP5A 1Z4UA 3M30B 2HHPA 5DDQC 5DLFA 2V9KA 4KV8B 2VOOA 2DD8S 1V3SA 1MMLA 1XWLA 2KJVA 5CQGA 5J2NA 4NZ7A 2ZDOA 7FD1A 3MMCB 2E7XA 2VG5B 5HP1B 3M8QB 2W8KA 5KFFA 4FXVA 3KMQA 4ICLA 4WE1B 2PD1A 2JEJA 2XLKA 2Q6BA 1SL0A 4ES3A 4HTJA 5G0RA 1J5OB 4F2SA 4QR1A 4DFJA 1X5TA 3O1LA 1WF2A 3N01A 2VG5A 1N34F 1WD6A 3UWTA 3SYZA 3PJXA 4IR1A 1ZH5A 3EYZA 1TKTB 3KK2A 1FE0A 1TV6B 2ADCA 4M94A 3DCAA 3ZC4A 4QCLA 2ZKTA 3LWLA 3PW5A 4C2MA 3BGLA 2M0GB 2WHOA 5D4PA 2BDPA 2DO0A 2V8HA 4F50A 2F40A 2Z2MA 4DR7F 1LWCA 4LSLB 5J2QA 1YJNS 3CT9A 2R7XA 1S1XB 2D1CA 3P49B 3MEGA 5KFJA 2DGVA 4CH0S 1RT6A 1RAJA 2VBYA 2EI5A 2XMTA 3MEEB 5IQ6A 4ED3A 1HA1A 4FS2A 1VBXA 4DQIA 2L3MA 5AE1A 4U7CA 3CCUS 4X65F 1S6PB 3MR2A 2ZJQQ 5KFCA 2KI2A 3M9NB 5DRKA 3L7PA 2D74B 2EG2A 4WFNQ 4O3SA 4XDCA 2PE8A 2HNZA 3DLJA 2ZHOA 2UXDF 2J0XA 4JUZA 5M2PA 1FCAA 2B4PA 1BQMB 3GZ7A 5AJ3F 1K8AT 5KG7A 1U49A 2PDAA 2NS1B 1HARA 5KG0A 5KT3A 4BCAA 2AD9A 3R5DA 3GYXB 1YWXA 1U24A 4AFFA 2QEXS 2RRNA 4G3IA 4RBUA 5DDOC 1RT6B 3H25A 1P8GA 1RTIA 1S1UB 3BO4A 2HHUA 2K2PA 4HH0A 1QSYA 3CMES 1H7XA 3OXFA 1RTDA 2KKHA 2GW8A 2OPPA 2IM0A 3X3UA 4JV5F 2OPQA 2VPXB 3TO8A 4E8UA 1S1TB 5DGBA 3MCSA 2ASLA 3G6VA 3RAMA 1BQNA 2YNHB 3DOKA 3HF5A 1D9DA 4DEZA 4KHPF 4TY8A 1ZPWX 1H2UX 1LFPA 1OPZA 2KVIA 3MOZA 3IWXA 5K5MA 2LVWA 1RWUA 1DURA 1ELOA 1GNKA 1JLFB 1U25A 2I8EA 4TU9A 1WELA 4UY85 3CCLS 3IRXB 2ERRA 2CFXA 3FFIA 3MMCA 4P2SA 3KHHA 3V2UC 4FNHA 4PXDA 3G8SA 3ISNC 2DBBA 3Q2SC 4HT5A 4JYAF 1KONA 3NNAA 1TR0A 4C97A 1KRPA 3GSDA 3CXCR 5BYSA 4MK8A 1L3KA 3HHLB 3T19A 1GAOA 2E5HA 4IOBA 1M5KC 4RUAA 1QTMA 3W2WA 3CCJS 4DL2A 1FVQA 2QA2A 1KFDA 4LQ9A 3C6TB 3MR3A 4KFBA 3UPFA 5A8KA 3RBEA 1APSA 5K8MA 3SQGB 1TAQA 3CDUA 1KFSA 3M32B 2WK4A 1GT8A 3V6KA 2DNRA 4A8XA 1VQPS 1FDAA 1JJHA 1LW2A 3U1LA 3MM7A 3DLGB 2KT2A 4OI3A 5C42A 3MM6A 4FP9A 3LH2S 2NREA 5LSOA 2VD3A 1HBUB 1S0MA 3WX4A 4KO0A 4PPDA 3K8WA 2DNGA 4MIWA 1VI7A 1QE1B 1X4BA 2ZBCA 4XPEA 3LP1A 4Q45A 2XCAA 1IXKA 1U1RA 5KFRA 2OSQA 3BREA 3BR9A 4LUBA 2CQ3A 1U8SA 3CE8A 4LF4F 2FHOB 4R0JA 4DSJA 1NNDA 2FJBB 1QM9A 3IBWA 2KXHA 3UCUP 3I32A 5CXTA 1VRUA 1K1QA 3DM2B 1NKEA 2FD2A 3VAJA 1HMVB 4PG4A 4HYKA 4WFYA 3K5MA 4WXOA 2C42A 2WW8A 2BQUA 3JTOA 5F8JA 4HH1A 3Q23A 3I96A 1HD0A 3PHEA 4K4SA 2X3GA 2JFKA 2Z0GA 2YKQA 4XK8C 5AE2A 3LGMA 2C3PA 1ZPVA 5KFOA 5L1LA 3EGWB 2ZE2B 3TUIC 2VC1A 2HMIB 5LSRA 3FRZA 2WAQD 4IOCQ 3TVYA 4TNOA 3ZZUA 2CQCA 3FZBA 1S9EB 2MZTA 1VC6A 4NYPA 2DNPA 3TAQA 2OPSA 4F4YA 4Q44A 1FRXA 3UCGA 3DRPB 1Q8LA 1D8YA 2FTRA 2KB2A 2ZC3A 4CH1A 5KFBA 1M5VC 4NOHA 2DR5A 1C0UB 3BS9A 3MEDB 2IBOA 2DNYA 3Q8PB 1ZETA 1R8HA 1FE4A 5BJRA 4F4XA 3BGFA 2GGPA 3MAQA 2VA2A 5D3GA 3TVZA 1LV5A 3V6DA 1C4AA 3I5AA 3H5XA 2YY3A 1UVMA 5GAEI 4NLQA 5SUHA 4DX8H 2PA8D 1TVRA 4DFKA 2YNIB 4MFBA 1GTHA 3THPA 3FCHA 1TFWA 2BANA 3MUVP 2PGCA 2M4MA 2VB6A 3DXSX 5I3UB 4DUYF 2CPJA 4FF2A 3NBPB 3RAQA 3CD6S 3QJPA 1I94F 1QE1A 2G0CA 4A8MP 5KFVA 4G1QA 3PDNA 1IKWA 5GAEU 1PGZA 4O3OA 1PO6A 3IXQA 2YKOA 3TRGA 3TW0A 2LXFA 4AQYF 1NAQA 3HDSA 1Z1ZA 2WSEC 2EVZA 5EDWA 1SJ4P 2YQ3A 4ZPCA 2ATLA 1UETA 2CJAA 2R8KA 4Y65A 1R0AB 4OQJA 1KNZA 2LQBA 4QIEA 3MM6B 1WHVA 4OI6A 1C1CB 3SQGA 4OX7A 1FNOA 2QRRA 3GMGA 1S9GA 3MDFA 3ENVA 1H6KX 4RKUC 4QQBA 2C3OA 4NLVA 3M6WA 4AE5A 2J9DA 4H4KC 2JX2A 2YNIA 3JSYA 1AFJA 4UOCA 3QIPA 5F8LA 4NLGA 3BQ2A 1R6YA 4YR2A 3J7YI 1NJIT 1S0VA 3IO1A 4Q43A 3JSMA 3W2WB 1SV5B 3POTA 1HBMB 4ED1A 4C8ZA 1YTYA 2XMJA 1GX6A 4MK9A 3M6UA 1C2PA 4ES2A 4NLOA 5F0WA 2XSFA 2G4BA 2R8GA 3UDLA 4YFUA 1WHWA 4KT0C 4DN9A 1SL2A 3DRPA 3UDCA 4J9MA 1NJXA 4I4BA 4MKAA 1SBRA 1TKXA 3FNNA 3KNGA 1HR0F 4IOAQ 4DL5A 4O23A 2I1RA 3QJJA 3T1HF 3LQVA 1ULRA 4OJGA 3U1NA 3P3DA 1SKRA 5HMYA 1FDDA 4CQ1A 3OHBA 2CJ9A 2JL9A 5E3QA 5KFDA 1FTCA 3NGKA 2YX4A 4B9MA 1RTDB 4ILLA 2UU9F 1HBNA 1NK6A 4OX6A 2OFHX 4Y2CA 2HQIA 1VHFA 4K59A 4UUWA 5DG8A 1B0VA 1DQ8A 1UFWA 3KK1B 4J9NA 5CD4H 4IDKA 1YJWS 3DHXA 3ISND 3MUTP 1QUVA 2XMVA 2KT3A 3DM2A 3VZIA 2B5JB 2EK6A 3FEZA 3D5MA 3CJ2A 1D9FA 3OJUA 4YUDA 4DR6F 4U7UK 1CSJA 1X0FA 4NLXA 3RBDA 3CC2S 5KOWA 1S76D 1SXLA 1BQMA 3I31A 2E7WA 2HGMA 3ZZZA 2ACYA 3VAIA 3J81Y 2XGQA 4HTIA 4C0HA 5KFUA 4RNOA 3HHDA 1HWIA 1HD1A 3RZAA 3OVAA 2B4VA 4M1KA 1S0NA 5KFGA 2R2UA 3CJ0A 4ZPTR 4DR1F 4X4TA 4KO0B 2GJ2A 3GWCA 2PMZD 3J7A1 2DHXA 2F8EX 4LVNP 4N5SA 2HNZB 4C8NA 3MOJB 3IAM9 4HHJA 1ZM4A 2WRMA 2LYVA 1N5TA 2JVOA 3DLGA 3HZEA 2NLWA 4NA2A 2WB1D 3UW1A 1YITS 2FHJA 5E7OB 2R9LA 4RWWA 4DUZF 5L1KA 2WCXA 3TUZC 4B08A 4PG8A 3EZUA 4NLRA 3JTPA 1TUVA 1XNQF 1AROP 2WBMA 3KYLA 4EEYA 3KLHB 2RKIB 1TK8A 1DBDA 2ZNZA 3IS9A 1IBKF 1UA1A 2QSWA 3SSSA 4DHVA 3VF0B 1TKTA 3CJ5A 3KK2B 1PSDA 1OQ3A 5KT4A 1E6VB 1FDBA 3CB4A 3Q8SB 3DRXA 2YWKA 4D3GA 3PW4A 1YJRA 1NK4A 4PUOB 2AJQA 3I0RB 3GV5B 3TARA 1V6HA 1IBMF 2XY6A 2WOMA 4K0KF 4NMLA 5F3TA 3MMAA 4Y2IA 5IWAF 3RB6A 1NJYA 2FLNA 5GADI 4I0WA 5DDPC 4RZRA 2JSXA 4A8WA 1WHXA 1JLFA 3BQ0A 1H3DA 3LAKA 4ID8A 4ECUA 2C3YA 2IBKA 1RT3A 4OZNA 5D77A 1VIXA 3H4DA 2RE1A 2RU3A 1N5YB 2XB2D 4NLWA 1P27B 2G9OA 4C8YA 1CPZA 4OHWA 3AY0A 1DTTB 3T5LA 5I3QA 1FKPB 2IMOA 2UVRA 5LXYA 2NYIA 2VUGA 3CCWA 3RRGA 4WU3A 5B08A 1HI8A 2FPHX 2CQBA 3TAPA 3OW2R 2YWEA 3BF4A 3C6UB 1RA6A 3I56S 2IC3A 4N8NA 4F3MA 1D1UA 1NU4A 2IFXA 4OZLA 1U4BA 1FVSA 1FXDA 1KN6A 1VRTB 3NAIA 3Q22A 1VFJA 1XR5A 3BGUA 4EU0A 5IS2A 3Q8QB 3DRRA 2GNKA 3VTIA 2RIJA 4C3MA 2MKIA 1F5BA 3FVYA 1DARA 4IRCA 4GKKF 5LJ5Y 1YBAA 2DNQA 4IO1A 5DQGA 2ZOGA 3MD3A 5GAGU 1Q7LB 3GIIA 3QGGA 1Y0HA 3FEYB 2CJQA 2DB1A 4H54A 6FD1A 1R8CA 2RVJA 1KTVA 3HVTB 3CJKB 1MNEA 3DOMA 3N5FA 4QW8A 2J7UA 3HHKA 2EWHA 2CQ1A 1WTBA 5D4OA 2VG6A 4Q5VA 2IJNA 2QMXA 3VAGA 2MQOA 2Q66A 4WF9Q 1W2BR 4QPTA 1S1XA 4YB1P 3IG1B 1EETB 1FDNA 4JOUA 2GO8A 2DT9A 2Y1JA 2VBXA 5T7LA 3GYNA 5A8RB 2MY8A 4KSEB 2ASDA 4DL7A 1H98A 4CO5A 3N4WA 2VQFF 5G0RB 2IM1A 4LVOP 4URSA 1XR7A 4WE1A 7FDRA 4QWCA 3QGHA 4RBTA 1VLYA 3M8QA 4GKJF 1QLNA 5T14A 4WFAQ 2DO4A 4Q2LA 4