4RX6A

Structure of b. subtilis glnk-atp complex to 2.6 angstrom
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
117
structure length
109
Chain Sequence
AMSGQMFKVEIVTRPANFEKLKQELGKIGVTSLTFSNVHGCGLQKAKIESNVYERLKIEIVVSKVPVDQVTETAKRVLKTGSPGDGKIFVYEISNTINIRTGEEGPEAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of regulatory machinery reveal novel molecular mechanisms controlling B. subtilis nitrogen homeostasis.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Transcription
molecule keywords Nitrogen regulatory PII-like protein
total genus 19
structure length 109
sequence length 117
chains with identical sequence B, D
ec nomenclature
pdb deposition date 2014-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rx6A00
1O51A 3DFEA 3HLUA 5DRKA 1XK8A 4RLEA 1VHFA 4CO4A 1V6HA 1V3SA 2E66A 2VD3A 2J9DE 3AA9A 4D3GA 1NZAA 3T9ZA 5D4LA 4D3HA 2Z0GA 2O66A 5D4OA 3MHYA 3O5TB 2GX8A 4USIA 4WK1A 4CO1A 2XBPA 2RD5C 1Q1KA 2EG1A 4YB6A 3TA0A 2EG2A 2XULA 2GNKA 1VFJA 2J9DA 3CE8A 2XZWA 4R25A 4CNZA 1OSCA 3M05A 4OZNA 3BZQA 1NH7A 5DS7A 1O5JA 4RWWA 3TA2A 1UFLA 4RWXA 1GNKA 2NS1B 2O67A 3AH6A 3GSDA 4OZJA 1H3DA 4NYPA 1V9OA 5D4NA 4CO2A 1UMJA 2ZFHA 3N5BA 1P1LA 4NYOA 2NUHA 4CO5A 2XG8A 2ZOMA 3OPKA 4E98A 4USHA 3O8WA 4C3KA 4Y65A 3AA8A 3L7PA 2PIIA 4CNYA 1J2VA 2V5HG 5D4PA 3NCQA 1KR4A 2GW8A 1NH8A 2CZ4A 1HWUA 1NAQA 1V3RA 2DCLA 4Y6IA 4WK3A 4AFFA 4C3LA 3X3UA 5L9NA 4CO0A 2J9EA 2JJ4D 3TA1A 4CO3A 4YB5A 3NCPA 2J9CA 4RX6A 4OZLA 4C3MA 3NCRA 4USJC 1PILA 1QY7A 3LF0A 1UL3A 4YB7A 4IYQA 3AHPA 4ZK7M 1UKUA 2NUUG
chains in the Genus database with same CATH superfamily
1NB2A 1S99A 2WB1D 3DFEA 5F3TA 4PXBA 5C42A 2E5IA 1VHFA 1ZM2A 4CO4A 5J2QA 2RQ4A 5KG0A 1VJQA 4RJVA 2PN6A 5A2QY 1UVJA 4IDKB 4DPXA 1OPIA 2G0JA 4JI3F 2D9OA 1R27B 2MQQA 2B43A 3DOMB 4C4WA 2D3UA 3MXHP 3T9ZA 3DMJA 2CPFA 3T5KA 2GJIA 2BYCA 4NE9C 4DI6A 2VV5A 1NU4A 2HRUA 4CDIA 4JYAF 4X2BA 3BGOP 2V6AA 2IM3A 2RRNA 3W8GA 3OSNA 3OUYA 1TKDA 1S1XB 4LQ3A 2BKPA 2QA2A 2W2OP 2R2SA 4YDDB 1B0PA 5AE2A 3R5CA 3MURP 3ISNC 2EG1A 3R27A 1M1GA 4ED4A 4F3MA 5C24B 3BKTA 4EBDA 1M5OC 5IT4A 1YITS 1U6BA 3DGVA 3ITHA 1KQKA 3OTCA 4LF9J 3CIZA 4FXWA 1TKZA 4KKOB 5A0YA 3BH7B 3IBWA 3GFZA 1M1HA 4RKUC 4ID8A 5HMZA 4HR2A 4IFVA 4CTAB 1ZA1B 2BKNA 2KM8B 3E2EA 2MQMA 2FQQB 1HPZA 3G6XA 1Y4ZB 2LQBA 2BXJA 2LU2A 3W60A 3EVOA 3UW1A 1ZM4A 5DS7A 3TRGA 4DPWA 2OMOA 1GQEA 4XTTA 4GO5X 3G82A 4RWWA 2YNGB 4PG4A 2RSQA 3DLGA 3NBPB 3GJTB 2UU9F 2AZ3A 4DCPB 3VQSA 4DV4F 1KTVA 4Z7YA 3VCDA 4NMLA 1VRQC 2VIHA 1J5OA 2JL9A 4ANDA 3NP5A 1XNRF 4RW4B 3CCTA 4LFBJ 1EJ7L 3OTOJ 2OPPB 4ZLNA 4QIVA 3FFIB 2MDAA 3MGJA 2KKHA 3FSYA 1B64A 3CNQP 2ZUGA 4ECSA 2FHMA 3C14B 1D9AA 4KPCA 2EC2A 2H4YB 4QOTA 1S7IA 2G2YA 4CO2A 5F8MA 5I3UB 4ECVA 1P1LA 1WC6A 3NLCA 5E3AA 4K7QA 2W9BA 4LR8A 2JOQA 4OYWA 3GIMA 1TQLA 2M8DB 4X62J 1UAWA 1U1OA 3IXQA 3DRPA 4PG6A 4F0MA 1VOMA 5D8HB 2B7CB 3SDEB 3IG1B 5C24A 3MECB 4M5JA 1DURA 1HBOA 3E51A 1IBCB 3J81Y 3OL7A 3G8SA 4M63A 1JLCB 2BEFA 3HX9A 3DRRB 4CNYA 4DPUA 1S57A 1U2FA 2HHTA 1IR2A 1XMQJ 1VQ5S 4RU2A 5D4PA 1LV5A 5IXUA 1TUVA 3UCGA 4MFBA 4HH0A 2VG7A 1K1SA 4JI7F 2RF2B 2YWGA 1H74A 2CWXA 4DR7F 2RIJA 2UP1A 4C11B 1YJRA 2MZTA 5HP1A 1U2CA 3GFXA 2W01A 3PIPQ 1NAQA 2WCXA 3LQVA 2J6UA 1L3UA 4YP3A 1JJHA 5LXRA 2BDPA 3WC2A 2K7KA 3LP2B 1FKOB 5KFXA 2BX6A 2QRRA 4KB7A 2VFRA 1S7HA 1ZH5A 2DY9A 1WORA 2UUBF 4DCOB 3UCZP 3PNIA 3PW0A 4MK7A 2X51A 2QN6B 1RT7B 3ULHA 2V8HA 2YPYA 1FT8A 1NK4A 2JEGA 4O44A 3D6HB 1RAEB 4FF2A 1Y00A 2C2MB 4OJGA 1F2HA 2QMUB 1H7WA 2FHJD 4B3SF 4Y0FA 3OFEA 2UV8A 2I2YA 1M5SA 2NR0A 3D67A 2HMIB 4QWCA 1WHWA 4A48A 4GKKF 4NWBA 4TU9A 3DKDA 1M5HA 9RUBA 2G2OA 4LRCA 4DV3J 2PT0A 2KFNA 3C15A 3KJFB 1VGYA 1SL0A 2OPSB 1TL1A 1XC9A 2WVCA 4L72B 1H2TZ 1OJ4A 1U7LA 3ZTOA 1JLGA 5BJRA 4O0IA 5HMXA 1UWBB 4O3PA 4LF2A 2P8IA 4IH6A 1KQGB 2H1YA 5KT6A 2MQPA 2MKIA 4DV5F 3DCAA 3CEDA 3PHTA 2HHQA 1SC4B 2GV1A 4M5MA 4C98A 5I42B 3TAMB 2CPEA 2DY1A 3QT7A 2MQOA 3JXOA 2XBPA 2YXLA 4FYVB 4LSLB 5MLCV 3UDLA 3BEGB 4WE1A 3CJKB 3TJAA 1UVLA 1LK5A 3CJ0A 1FE0A 3PRDA 2BV3A 2G13A 2X7IA 3KHLA 2GC8A 4QWDA 2PI4A 1FJGF 1K0TA 4L74A 4K5RA 2NZ4A 3LO3A 4QU7A 2CNOB 3DOLA 2VJUA 2ZD1B 2MJUA 2EFNA 1JB0C 3SMZA 3EPGA 4CM0A 3HULA 3W9JA 4LF6F 2Y8WA 2XI2A 4WXOA 3W5YA 5KG2A 2GIRA 4LVNP 2EKYA 2G0IA 2HQDA 2R4FA 4GRSA 4UF4A 4DJBA 2CJXB 1I5OB 3FSIA 2XMUA 2AYBA 1AA1B 2KRBA 4M5IA 3KMQA 3GSDA 3W1YC 1X9MA 3AD9C 2FJVA 5KG5A 2GMLA 1R8BA 5A6WA 2JX2A 2OPQA 1TL1B 1E6VB 2KT2A 5B0FA 3SCJE 3MM8B 2KG0A 3RG6A 3FBFA 2Z2LA 1X5TA 4IKAA 3PIOQ 1NZ8A 1PJ7A 2E1AA 3MR5A 3D1HA 4OI2A 2J6SA 4NCAA 3W3SA 3CF5Q 2OFGX 4LFAJ 4IG0B 4F7VA 1MWQA 2ZNZA 2XO7A 4J9QA 1FKAF 1IBLJ 2Q6CA 1DTQA 4P2XA 4TY8A 2D9PA 2FLPA 1QVFR 4I2PB 3J7AN 4OZ1A 4YOEA 1ZTTA 2ZOMA 4J37A 3UD5A 2AX1A 2RDJA 1NJZA 4GKKJ 1XBWA 3MCNA 2HFVA 4AD6A 4YR2A 4TXSA 2N4CA 1R7IA 4W4MA 3ZZTA 4DZ6A 3CJ8A 1URNA 1KD1T 1FNXH 4IH5A 2V4JB 2HEKA 3GMGA 2IFXA 3ICLA 3MAAA 4RUCA 2MKCA 4UTGA 2YH0A 1J2VA 1LWFB 4KC5A 5CH7B 3RB3A 5D3GB 2RQKA 2F5GA 2P9GA 4I64A 1RYSA 1SV5A 3TWZA 3QT5A 2W7AA 1S0VA 1NUEA 5J2NA 5F8IA 2QYGA 2KRRA 4LRFA 2EI5A 4CRJA 2L08A 4NASA 2DR8A 3KHRA 3NOGA 2CPXA 2YKMB 1NKBA 1RACB 3D28A 4Y6IA 2QT7A 4O3OA 4C8LA 2FJEB 1X7VA 3AY0A 2WW8A 2AKWB 1MROB 1HMVA 5FIIA 1AFIA 2QTWA 1JX4A 4ZP9A 1RT4A 2K7JA 2VICA 2NPFA 5F9LA 3KJVA 2IYGA 2AJQA 2HK3A 3GILA 3WIVA 1WHYA 3FBCA 1G3OA 1YDLA 5CYJA 1N5YA 1UL3A 2RT3A 3V6DA 1HBMA 1U1NA 1VISA 1WC0A 3KNGA 3QJJA 4EYHB 3PM9A 2QLWA 1UVKA 5CYQA 5DQIA 2CJAA 4IO1A 2XMVA 5CCLA 2PD1A 3D0GE 2OH2A 4OZ0A 1ULRA 2J7WA 3DM2B 3MM6B 5DG9A 1UKUA 2EWHA 2VDHA 4Y3CA 4DSEA 3R1HA 4Q0BB 3OVAA 4DR6F 4ZPCA 3HLUA 5DRKA 2DNZA 4RLEA 4C0BA 3IRXA 3BYRA 3SCKE 3ZTSA 2VOOA 4ER8A 3HHLC 1EP4B 5C7PA 4YY3J 4K4SA 3NAHA 3TO8A 2B56A 1KWMA 3GQCA 3EWGA 2M88A 3TJ9A 1F6TA 3LW5C 4ZIVA 5KOXA 3CXCR 2HWHA 3OR2B 4M5DB 1O8BA 4F4ZA 1U02A 3R3TA 4B9UA 3I0SA 1HBUA 3R9LA 3R7NB 2XNRA 3WDOA 3ILOA 2GHPA 2WVDA 1CJUB 5A8KB 1QAXA 1YJVA 1ZOTA 2RUSA 1KQSR 2J7KA 3WHIA 3ZO7A 1F3VA 4N41A 3TANA 4LF4J 1VC5A 4PQAA 1TL5A 5D6GA 1I6JA 3HI9A 5H9FJ 1RAGB 1F1BB 1OMSA 4QPTA 2HRTA 4G1IA 2ZKTA 5KFUA 3OJUA 3HXMA 2OUGA 2XNQA 3VGUA 2KG1A 4ZP7A 4DV6F 2AWZA 1S1TA 1RWVB 1UFWA 4HI2A 1KQFB 4F25A 1WOPA 4DR4J 4B17A 5U47A 2DRAA 2WVEA 3EICA 4JI6J 2VODA 3L4BC 1U1PA 3THTA 1T11A 4PXCA 1YTYA 1D9DA 4N77A 2P6SA 4UZBA 3H2LA 1Q4RA 3CJRA 2PFFB 3PFOA 1HQEB 1W2BR 5ETMA 1HLWA 2J0XA 3V6KA 1ZA2B 1ZAXA 2FJDB 2HS3A 2CPHA 1VLOA 2GO8A 4UUWA 1WF0A 2XZTB 3W2WA 3BKFA 4DUYF 4ZVTB 3D6FB 1RDRA 1VQ9S 3UN3A 3MCSA 3BGRB 4BBYA 4J7CA 5L1KA 4X4PA 4LBPA 1ZPWX 2JSXA 5CABA 2HVZA 2ZJPQ 2CG4A 4WP8A 4F4XA 1S0NA 1PO6A 2E9TA 2E29A 2RKIA 3I32A 3SFUA 1U0HA 1HIYA 1DARA 2MKSA 3NBPA 4F3QA 2MZ1A 3TUPA 4USKA 2CFXA 4U6PA 2ZH1A 5KFWA 1F5BA 1T9UA 3EGNA 2W4CA 2NUHA 3GFYA 2AGPA 3UE2A 3GJRB 2ZH2A 2JEFA 4DS4A 4M5HA 4FBUA 1ZM3A 2ZE2A 3M1VA 4CH0S 1HW9A 3MD1A 3UDCA 2RB7A 2I9SA 9ATCB 3VQTA 1JLFB 1W7WA 2OI2A 4DUZJ 1QSSA 4I2PA 1IJFB 4F4WA 2CZ9A 1U0SA 5GAEI 3CCRS 4BC7A 1ZYQA 1SC3B 3DYAB 4B02A 2ASDA 2GAGC 4DMZA 2HKEA 1NBEB 1PG5B 1R6YA 2E5GA 2MZQA 1PKUA 3QGHA 2MQLA 1CG2A 3NCQA 3QQCD 3QPIA 1M5KC 1ELOA 2EVZA 2BQ3A 5SUHA 2CPZA 3LA0A 5E2QA 3TUJC 4KGVB 4A8KA 1BD6A 4WFXA 2CKWA 5M2RA 2CQBA 2P5VA 2WOMA 1MW7A 1TKZB 1PAEX 1WDDA 3FZBA 3IA0A 4P10A 4AE5A 3UDVA 4C3LA 4C97A 1C1BA 5IZHA 3DOMA 1WDTA 3WX8A 2AJFE 3BPDA 3Q8PB 5IC6B 2AV5A 2DR6A 1PC4A 3ZNUA 3KLGA 1XMQF 2OEJA 2VFSA 1E6YB 2FJWA 1NSPA 1MLAA 2HNDB 4OHXA 2UXDJ 2VQFJ 2Y0BB 2VF3A 2IY5B 2KB2A 3FUYA 1ACMB 4C2MA 3TAPA 3C3LA 1BUXA 3MZIA 3OFGA 1NHUA 4LQ9A 2QFJA 1U0HB 1BQNA 1FFWB 1I51B 1T95A 2BJ8A 3IBCB 2WSCC 4LF1A 2GVZA 4DFMA 2F4VJ 4X4OA 3GU0A 1AUSL 5BYQA 4A8XA 1LWCA 2F7VA 4I4BA 4PCQA 3KDNA 4HACB 1XR7A 3CJQA 3JQJA 4ITSA 4YN3B 4PKDB 1TUGB 3D0IE 2QA1A 3V5RA 4QPXA 1HNXF 2FZCB 1V6HA 4NEYA 4KHMA 4CH1A 3H20A 1R31A 4QYRA 3GV8B 5KFPA 1HWLA 1SUQB 2Y1LB 1FEEA 3I6PA 3JSMA 1X4HA 4LFCF 2ROPA 3ENAA 3FC9A 3PX0A 2GO9A 4FS2A 2JC1A 1RT1A 2Z2YB 3OVBA 3OL8A 4CLKA 4RZRA 2LECA 2XS2A 5KG4A 4GO7X 5K8PA 1MWYA 1GFWB 1V5IB 1HBNB 2DGXA 2U1AA 1RUSA 4HTIA 3PR4A 4ZDNA 1HBUB 1XJWB 3R97A 4LRDA 5LJ3Y 2J9DA 4C9DA 3FEXB 1JJCB 2EFPA 3RUBL 3TQEA 1D0EA 2BJDA 1UPMB 3TARA 3RR7A 3E3XA 1F5CA 2XSJA 4C11A 5I42A 1C0TA 4PEOA 3EPIA 2R42A 2GQQA 3KK3A 3J80U 3BSNA 1BQMB 2FDNA 4LBHA 1FJEB 2XLJA 3FCHA 2UUAF 3NY0A 1PYSB 2DEIA 3N6LA 2XGPA 1JLCA 1SJ4P 1S9EB 2AMCB 2E9RX 4TU8A 1XMOJ 1JJ2R 2DO4A 2ZKUA 3KHHA 5KT7A 1LOUA 2O67A 1TU0B 4LF5F 1R8PA 2C3MA 2MMYA 3AXMA 1KOHA 3BF4A 3MI7X 4OHWA 1HWJA 3AD7C 1KDNA 2VQFF 1AZSB 1X4FA 1Z2LA 2I1RA 3K5NA 2N7CA 2DNLA 1P9QC 1RWMB 2GIQA 5F3ZA 3ENQA 5JXSA 2COLA 1DQ8A 1LWEB 4G6VB 2D74B 2ILYA 3KLEA 1H0HB 3HHKA 3HFZB 1LFWA 4RW7A 4WXWA 3B6BA 4QQBA 5ETLA 3BKUA 4PUOA 3RZAA 4CI0B 4B08A 3M32B 1KSPA 5E33A 4LR9A 5B0GA 1S49A 3O1LA 3SQGB 4PG5A 3Q22A 4C8ZA 4B3OA 1FTCA 2XMWA 5E3PA 4Y34A 4ANEA 4NLSA 3HT3A 4ZOSA 5KFNA 1SKSA 1SV5B 2DR5A 3NMRA 5FLXU 5F8LA 1Y3JA 1CJVA 3EXYA 1IKYB 2GMJA 2IM2A 2Z30B 2YWFA 3C16A 4FVMA 3OTEA 3PJWA 4KKOA 3B54A 5ETKA 1EB0A 1UETA 2KHCA 3LP1A 3GV5B 2B7BB 1YVFA 5F8GA 4DV7F 1N54B 3HT0A 2FHKA 2C28A 4F8RA 3CJKA 4IFVB 4FYXB 1NH8A 4H4MB 3CULA 1BQMA 2VL1A 1N5SA 4Q7AA 2HHXA 3FGVA 4JI1F 4C8YA 2B9WA 2NXCA 3NGDA 2R3VA 4NLTA 1S9EA 2W24A 1BHNA 3HHNB 3FMWA 1GMWD 1F9FA 2AEFA 2MZRA 3A3OB 3TEHB 3FRYA 4B3TF 4NA2A 4YS2A 1LQ9A 3I5CA 4FDFA 1HNWF 2AGQA 2ZC3A 4N7TA 3I55S 1D1UA 4PXEA 4DQSA 1T8EA 2BW7A 3RGIA 4ZCIA 3CCSS 5T7LB 3QBCA 3VAMA 4RUBA 2LCWA 2Q6BA 4MT1A 4QYZK 1GMVA 3QLHB 5HVFA 3UVJB 4O3RA 1YHQS 1R0BG 4RUAA 3SBMA 2I5JB 5B0BA 5GMDA 4U9RA 4LF7F 2HNYA 2DGTA 3RU0A 3Q8QB 3DLHA 3LPYA 4S0MA 2RMLA 1TVRA 2CNKB 2HWIA 2YQ1A 3QT8A 3CDWA 4LIRA 3T1HJ 2CJQA 5EWFA 2ACMA 2B4OA 2CIMA 2VD3A 3O3LA 3JYTB 4W90B 4JB8B 1KVKA 4M5DA 2B5JA 5E41A 1NB7A 1WHXA 1S48A 1IKWB 2GFFA 2HHPA 4P7TA 3KTQA 3HO1A 2HFOA 2L41A 4Q0BA 5KFMA 5D77A 5DDQC 4WFAQ 5D0EA 4DV0F 1B3TA 4BLGA 3IC1A 1M0SA 2WONB 5LJ5Y 1Q7LB 3IM8A 5KG7A 1X8DA 4U7UD 2W9BB 4MIBA 3MD3A 2XCPA 2QE5A 5CHCB 1DQ9A 2B9XA 3GSIA 4K4TA 1X5SA 6AT1B 5HL7Q 1TL4A 3OHAA 2DNPA 4KFBB 2VG6A 2IBOA 5DDPC 2DR9A 2Z2MA 2XWXA 2V94A 1VDHA 2ROEA 1YWXA 3BZQA 2I0XA 4CP5A 2VOPA 4JI0F 2QSFA 4X66F 1REGX 3V6HA 4DF4A 4V19X 2YNHB 3G71S 5DM6Q 1U45A 2FTRA 1QD1A 2WBRA 2XMJA 1SBRA 3RBZA 2ZJQQ 2XEXA 4RUHA 1RT6B 1VC6A 3OHBA 2CAJA 1T94A 1X4BA 3ETMA 1UTAA 3ILLA 2QA4G 1WG5A 1YBUA 2HNYB 2LVWA 3OLBA 1N36F 3U1MA 2KO1A 1REVB 1T03B 2E5LF 4DR5F 2PEBA 1HYSB 1HD1A 2DXDA 3C15B 3DRSB 1KLMA 4JI0J 3EDRB 2HBQB 4NYPA 2NYHA 4F36A 4DL7A 4PPZA 1B7FA 2UUWA 3PRVA 7FD1A 4UQGA 4EZ9A 5FJ4A 1L5UA 1NPKA 1XEZA 2X1FA 1V3ZA 2XHCA 4ZVOB 1SIWB 5AE3A 1TMMA 2PI5A 4B3MF 4ICLA 4NLVA 2DD8S 2MLXA 2VBZA 1RZMA 2DGVA 4USHA 3G4SS 1K1QA 1NEEA 2BMBA 4HTJA 3KJVB 3AJ2A 2HMIA 3UQSA 2KTQA 2E1CA 4ED2A 4YR3A 4PUOB 2C3PA 2JFKA 2E1MC 2EXUA 3O2IA 2EEYA 2BJEA 1OSDA 1LXJA 2YX7A 1R0AB 4ERDA 1ROFA 2CPDA 1S4EA 2CWKA 3P3DA 4A8YA 2ZZMA 2DYAA 1SQFA 3L3CA 3MM9A 4I0WA 4URQU 2KZMA 1NJYA 1KN6A 4ID5A 1DFDA 5DZ7A 3KK2A 3D3BJ 4A8OA 4X64J 1JJ4A 3ZZPA 4ZJOA 2AHOB 2DK2A 1IR0A 2ZJRQ 3R5AA 4O4GA 3LAMA 1V3RA 3GB0A 3PG9A 4DEZA 2YKPA 3P4UB 1URRA 1NK0A 2OO4A 2ZBCA 2DITA 2XMAA 3HVRA 3NCPA 3MECA 2VPYB 3I31A 2ADCA 2ILZA 1VI7A 2GMHA 1IWGA 4N5SA 5A8KA 5HBMB 1EETB 2AEMA 1NJIT 1SH2A 4GVLA 2OPQB 4CLLA 2ZH9A 4WIQA 1JMTA 1HQEA 4K2XA 4P9SA 1LNQA 2E7WA 2V2ZA 2MLYA 3CJTA 4O0NA 3H7HB 3RAMA 4DHVA 4QBUA 5K20B 4IYQA 2D41A 4ES3A 4M95A 2EPIA 2R2TA 2HHVA 2WTFA 1RTHA 3R2DJ 2C2EA 1UEVA 5GAEU 2KT3A 2FZGB 1OQ6A 4C48A 4NXMJ 1OY6A 2HNZA 4FKXA 1O6XA 2HGNA 4DUYJ 2RRAA 1HWIA 3H25A 3HCXA 3T41A 3DXSX 5A8RB 2A0FB 3T1YJ 3DNCA 1NZAA 1VQOS 2CJBA 2IPOB 4ZPWR 3H5SA 2MKYA 2R7QA 2AU0A 4X4TA 1TK5A 4M5GA 4NLRA 2XMKA 1VBKA 3MM5A 4DUTA 4NLUA 2MGZB 1T05B 4G1PA 4E8UA 1X5PA 1CPZA 2G1DA 2M3DA 4WP3A 3HSZA 2RH3A 4WK1A 3UNGC 3KG1A 4DFKA 3HPOA 2PMWA 1KTQA 4C0OC 4DDFA 3I56S 1UJ6A 3MEDB 3GIIA 1WTBA 3OTOF 1NPPA 5KFKA 2EG2A 4WBFA 1NK9A 3UPFA 2XHWA 4LJMA 1DTTB 3T5HA 3T1YF 1H7XA 2P9CA 1CVJA 3M8ZA 1Z2ZA 4CYUA 2UUCF 2OKQA 1KEKA 4QCLA 4AXJA 1OSCA 1RAHB 5EWEA 1VQ4S 4FBTA 4WP9A 1C4AA 5IS2A 2HSEB 4KGKA 3CDEA 5K5MA 4DQRA 4ETXA 4QWAA 1GAOA 3PACA 1EETA 1NH7A 4YR0A 2DEJA 3Q23A 4J9SA 1GXUA 2R7WA 1JLAB 4QYZJ 3ETOA 2KYZA 1FERA 3SEOA 5BR8J 1FX4A 4IG3B 1RU1A 4C8NA 5DDRC 4DS5A 1RAJA 5J2NB 4DSLA 3MEGA 4ETZA 5B09A 2ZH3A 2UV8G 1Q8IA 3R5DA 2IA6A 2EFOA 2JEIA 2CJKA 2A1BA 1CJKA 2YKMA 4HT5A 4WJBA 5J2MA 2HFSA 3N6MA 3I0RA 2FIUA 1J5EF 2MSSA 1C0TB 2PA8D 5BYRA 4OZJA 3L95X 3S7RA 2OTLS 1N88A 2IJNA 1RTJA 1B7YB 3D68A 3QO9B 3MUMP 3UI3A 3MR2A 1D8ZA 4HHJA 5L8RC 1QLNA 2GVZB 3G6ES 2HVIA 3QJPA 2KFZA 4Y2IA 1ZAVA 2DRBA 1S59A 1N33F 2Y1RI 1T9TA 5HK4A 2NCKL 3JS9A 5ITHA 1FEHA 3AFGA 3ZXWA 4DLEA 1ZETA 4Q2LA 4P74A 2ATLA 1RKJA 4ZPAA 4OLOA 3NNHA 3MTJA 2CUYA 2VA3A 2EFVA 2FVRA 1B4SA 2M70A 4AYBD 1EARA 2K1RB 1RHQB 1WF2A 4Y65A 3AA8A 2PIIA 4ZPTR 3V6JA 4DSIA 2VPZB 2NXNA 3BBCA 2AJ1A 3DI6B 3IR6B 3KLEB 1YGYA 1QVGR 1UEKA 4DR5J 4DQQA 2C3UA 2NREA 2HQIA 2YNIA 3Q8SB 1S6PA 1TL3A 3HVTB 4OJ3A 4P2SA 1FWLA 3DRXA 5JJBA 5E3RA 4DX5A 5KAKA 2VQEF 1G4CA 2IDEA 3W7BA 2CZ4A 3TI0A 2PGCA 3H5UA 5KFLA 2L48A 2DPJA 2FJAB 3VTIA 1OY8A 1JXEA 2B4UA 4LRBA 5HN0A 5L39A 3RJMB 3IGVA 3M8YA 4ZPBA 1CJVB 3WX4A 4R5PA 3GR1A 2HHSA 4I68A 4QJVA 2Q79A 2CXEA 2G0CA 3TA1A 4DU8A 4NLPA 5K9FA 4PABA 1HARA 1KP6A 4GC6A 1RHUB 2E44A 4WIIA 3PV8A 4P7VA 2V4RA 2UVUA 3OFHA 4KR0B 2J76E 5HMWA 3M2RB 2ALZA 1NXIA 1RLDA 4NRUA 3X1LB 3QGGA 2BBEA 4P2MA 1S1XA 4ED0A 2JDJA 2MLZA 1TELA 1DRZA 3LWMA 3CD0A 4J9VA 3OR1B 3W5ZA 4IH7A 1I94F 5KFJA 3PR5B 4EBEA 3FK4A 3M6VA 3VVTA 1CJTA 1BGXT 1O51A 1AZSA 2BQUA 3HHLB 4KBIA 4A4JA 2W9AA 1H6KX 3AA9A 1RTIB 2OP5A 2DH8A 3PCOB 3V2UC 1SC6A 4IFYB 3OW2R 3AT1B 4WU2A 4MIWA 3QMQA 4UT4A 3BGRA 3PO4A 4TQRA 1F3FA 2XI3A 4GMKA 4KRWA 5HROA 2FLLA 4DQIA 2FYXA 2LQ9A 4KV8B 1KVJA 3DGPB 5ETVA 1TL7A 3KYLA 1P27B 5LSRA 3RBDA 1FDAA 3PX6A 2BUNA 2EBGA 1H72C 5IV3A 4K8RA 1RBOB 3CSKA 4XK8C 2XO6A 2DGOA 2ZE2B 3DRRA 3M1VB 4F4YA 2D3O1 4J9MA 3WBZA 1Y3KA 1T3OA 5K14B 2Q66A 3BDPA 4OX6A 3FQLA 4FZVA 5AXNA 1RGVA 2C2OB 4H4OA 4OIXA 4FS1A 2ROGA 2RF2A 2CADA 1S1TB 1D8YA 2HNDA 2KDOA 2ZZTA 1T9VA 1FRLA 3Q89A 3QFWA 3D3CJ 5IFMA 4DV5J 5HP1B 1K0VA 2HPUA 3I87A 3M9OB 1L3SA 3DHXA 4RW9B 1WKKA 4R0JA 3BN7A 2BQRA 4QWEA 2WOMB 3CJ3A 2V0NA 3DRSA 4FVCA 4BDPA 4IG3A 4KH1B 1M90T 4ED5A 4HACA 2RNEA 4ZVUB 2ZH8A 1RTDA 4OL8A 2MQNA 3IR7B 2CPYA 3D1QA 4RU9A 1XNQF 2VC1A 2GJFA 3EUNA 1Q5VA 2MJNA 5HQ8A 4ELVA 3I0RB 3QRRA 1SJQA 3N5BA 2E1PA 2GAHC 2FVPA 1FTRA 4B3MJ 1RP5A 2FY8A 6FD1A 4NYOA 3I82A 1PIEA 2DHAA 3U27A 1FA0A 2ZHOA 1WI8A 2AZ1A 2JEJA 3MEKA 3IWLA 1WC3A 3NAIA 4TLRA 4ZCLA 4OI0A 2ZOGA 2B51A 5E5NA 4EEYA 2OPSA 1RAIB 2AJ4A 1X4EA 1DBDA 3GIJA 3K57A 1Q78A 3MEEB 2OPRA 2W2PP 2ZBQA 2E7VA 3BS9A 1UVIA 3OVSA 4DR1F 2FGOA 4FNHA 2IRUA 2X1GA 3EVMA 4ICLB 2CG8A 1GK8A 3TNVA 4X64F 3K5MA 2QA4S 3BO3A 4KO0A 2ERRA 4F26A 1BLUA 1OS5A 2GW8A 2P2CB 2VPWB 4LSLA 3JTOA 1J5OB 3W9IA 3KK3B 2OSRA 1VCTA 3CB4A 4C0HA 2LQJA 2BOAA 2E5JA 2CQ3A 1QJHA 4PYDA 3VWSA 2FVSA 1RKIA 2B5JB 3C66A 2VG5B 2Z56B 4QIEA 3MUVP 2NPIA 4I7FB 3CCZA 4MH8A 4OMFG 4CO3A 2MQ8A 5CD4H 4DX7A 2AYMA 3BO2A 1VQ7S 2YWHA 2AQ4A 3KLHB 2BJ1A 4USWA 2HHUA 1XIQA 4I2QB 4NLQA 4F50A 1UVMA 2ZWPA 3OXLA 1ZZNA 1ZS6A 3CJSA 2Y0SD 4B3SJ 4V19J 4PWUA 2BANB 3LGHA 1Y5IB 2IC3B 2LFVA 2MY8A 2VPXB 2ZBIA 3FQKA 3PJ9A 2UXBJ 3GJQB 2VA2A 3Q0AA 2V2QA 3D7SB 1A7GE 3DDKA 3UR3C 4CLTA 1Y5LB 4A8QA 1CS4A 2X1BA 1LW0A 5KT5A 3W62A 2GGPB 4OX9J 2EK6A 3R7SB 1IR1A 2OMLA 1S1UB 3PEJA 4Y2CA 1RCOB 4Z7CA 4J9NA 5D4LA 2FB0A 3OXFA 5EWGA 4I1TA 5IC4B 2OAUA 3G2XA 3MAQA 3PW4A 4Q2MA 3H4BA 1EIYB 4J91A 2R7VA 1BQNB 1JK9B 4I6AA 1XQIA 1KOOA 1RB0A 3DLLQ 4CYUB 3TA0A 1S4FA 1SH0A 1RSCA 4URSA 3T1AA 1LEOA 5HROB 3EYZA 1AUDA 2H3EB 3POTB 3N4WA 4EMDA 4HYKA 2RQCA 1EQMA 3D1OA 1S1WB 1DZ5A 5CQGA 1HNWJ 4I7FA 2FPHX 1NJXA 5AJ3F 2KXFA 4OZ2A 1P8GA 4CT9A 1FFSB 2F8EX 3KK2B 3FKBA 5HANA 1IBKJ 4NA3A 4F2RA 3VZIA 2WHOA 4I2QA 3BB5A 3MM7A 1QM9A 3JSBA 1YZ6A 1WJ9A 1IQZA 3DRYA 2NLWA 4AL6A 2VU5A 1AB8A 1RT1B 2QO3A 4O3SA 2VDIA 2HURA 2ZH5A 3CD6S 2CQHA 3MOZA 2PA3A 5ETNA 1G1XA 3PYEA 3HHEA 4ZHRB 2HVEA 2RDIA 2WB4A 3RB0A 4Y28C 1RT5B 3MMAA 2LP4A 2KXHA 3G82B 4W98A 4IR1A 5I4MA 3DLGB 3MAHA 5T14A 4KAIA 4Q8FA 1WD6A 2W2NP 4BCAA 4WYLA 1VQMS 4XAKA 2X3GA 1JLAA 3UR0A 5CZVA 1RT2B 3KFWX 3EE3A 3DLEB 4DL3A 3UD3P 1UW9A 3EX7B 3HHDA 2A2CA 3BR8A 1YJTA 5CYQB 1CULA 4ZVHA 2GHVC 4WPAA 1SVDA 2ZH4A 1Q7YT 3VV2B 5CAAA 2LA4A 2DXFA 2HZCA 2KT5A 4N76A 3D2WA 1DQAA 2OLWA 2B9YA 1N6QB 2ABYA 1NHKL 3DLJA 3FRZA 3IP0A 3BGUA 4ZCKA 3KLFB 3TZZA 5A2QU 3THPA 1AXQA 2ZD1A 1AFJA 2YNIB 2ASYA 4IR9A 1KHVA 2JH3A 2V50A 2BVZA 4CM2A 4ATNA 1RTHB 4EWTA 2H65B 1FRIA 1TMJA 4DN9A 1WACA 4J5OA 2P9EA 4ZN1A 3DDIA 3MPVA 4ZVEA 4K0KF 3ONQA 2O3DA 5KTQA 1JKHB 2GVDA 4ECZA 4ED7A 3BREA 2PDAA 2C3OA 1IBMF 1Q95G 2CRLA 1MG7A 4USVA 2YNFB 3BBFA 3TVKA 4CLYA 3J81U 3K5PA 2YH1A 2YKQA 4M5NA 3A8KA 2D3OR 1U1KA 3H90A 2ZBRA 1RWWB 2ZEJA 2KHDA 3B4DA 1VYAA 4OYZA 2M9KA 1TL3B 3D6MB 3HVTA 3MMAB 4YB5A 4JV5F 1VQNS 3VAIA 1EKRA 5KFFA 2OJ3A 2DBBA 3NCRA 5KFZA 4BHQA 2W9CA 2HBRB 2OD6A 4NMXA 4IUFA 4TVAB 1HR0J 3R8YA 1SH3A 3KG4A 4TY8B 1RA7A 4DU7A 5ADZA 3IGNA 1RADB 3DC2A 4ECXA 4FKYA 1HNVA 5J1EB 2NZCA 4YB1P 5BR8F 3W64A 1APSA 1I94J 3T19A 3IS9A 4N8NA 2AJ2A 2FUG9 3THVA 3EZUA 2Q1LA 4XIUA 5T7LA 3QIDA 5GADI 2N7YA 4DL4A 3CD7A 4CLZA 3TQ1A 2V69A 1RA6A 2YKNB 5I3PA 2DCUB 2IVFB 3QO9A 5IWAJ 2HW3A 1WNEA 3V4IA 5KFDA 2F63A 2I5JA 1V3SA 2IM0A 1QAIA 4LF7J 3M8RA 2C2ZB 2B6AA 2CQGA 2MHNA 3Q24A 4GC7A 2B4VA 1FK9A 2OEKA 1N48A 2ZWOA 1TK0A 4HKQA 2R2RA 2KXNB 3MEGB 4ZJLA 2M5YA 3KMSA 1OWXA 3DGPA 4H54A 4J9RA 4DV1J 2MB0B 1C2PA 5BXIA 3VF0B 2VBXA 5ETQA 5F0WA 3DXBA 5CCMA 3EGWB 2QLXA 3LAKA 4CTAA 4B9LA 1FX2A 4KGXB 1S76D 1QDUB 4I6WA 1YRUA 4ZP8A 2RD5C 3S6EA 1VRTA 3ZZOA 2MEWA 2V4QA 3TP2A 3JQMA 1RTIA 1PYTA 2D7SA 3L9ZA 3MMJA 4ZS6A 4X65J 2WZ1A 3JTPA 3UN2A 1SQGA 2AW0A 2LQ5A 3F44A 1B70B 4LF8J 3MDFA 3F73A 5RUBA 3E01A 2HVDA 3V6DB 4ES1A 3OUYB 1Z4UA 3AOCA 4JI8F 4ZP6A 2CNNB 2HQ3A 3NL0A 2RVJA 4OYAA 1FRJA 3CJ5A 3EJMA 4KHRA 2LA6A 1IKWA 2V34A 2W8LA 4AL7A 5DLFA 2FY1A 4JP8A 1NDPA 4LF4F 2ZBPA 4FYDA 4X4VA 4U7UK 4HH1A 2PE8A 3ZZYA 3BPSP 5HJXA 1S6QB 3QNWB 2NXUA 1X0PA 4KGMA 3U1LA 4X4RA 2DHHA 4DSJA 2H4WB 1YRTA 1CLFA 3CMES 3IBFB 4ED8A 3PVXA 3LTOA 4MKYA 1JLQA 4RNHA 1H3DA 3VALA 1G2EA 4HT7A 5L1IA 4KPYA 1HR0F 2BJ9A 2B6AB 5EX0A 2BE7D 1T03A 5B0AA 4A46A 4DV2J 4IRDA 1TKTA 1VBYA 2N4DA 1T7PA 5A8RA 2M4MA 2Q3PA 1KNZA 5B0CA 2EC0A 4RBUA 2ZDOA 2GCFA 4HI1A 4P72A 1RT3A 4PPDA 4J9UE 2CQIA 2XWYA 2R8KA 1GX5A 3MCOA 6FDRA 3Q2TC 4F04B 3DN9A 1T05A 4MAKA 4B3TJ 1GH8A 3ENVA 2HRYA 3H59A 3LH2S 4F67A 2IIHA 4KTQA 3V81B 3I5BA 5IV4A 2N3OA 1GMUA 2AT1B 4I69A 2FLOA 2MXYA 1G7CB 1F5AA 1UFKA 4I56A 2FJBB 4F2SA 5LL6d 3M8SA 4IRKA 1AROP 5KT2A 1QTNB 4OHYA 4ZITA 3F0NA 2V4JA 2QL7B 5JMNA 4FF3A 1DJ0A 1Y10A 1HL6A 3MM8A 4UOCA 4DZDA 2BOPA 1IM6A 2DNYA 2HQCA 1M5PC 2IVMA 3OBIA 1HBNA 2NXEA 3OD2A 5K8NA 4J9OA 2CPJA 2W2MP 1QUVA 2UXBF 2AP6A 4AFFA 1XMOF 2UU9J 2GA7A 1H38A 2XQCA 3AJ1A 1FD8A 4CO0A 5M2UA 1JLBA 1N0UA 1JKHA 1Y7PA 2GVDB 3DMJB 4O23A 4CQ1A 3S8SA 2U2FA 3JSMB 1X9SA 4UUXA 3JB9k 3J7ZT 4IQXA 4XPEA 1IJEB 3BM7A 2IC3A 3NGKA 4O3QA 2LLZA 1EQ0A 3I9ZA 3LF0A 4L6V3 4JUZA 1RLCL 4X4QA 3NS6A 3P5TL 2XZDB 1UZHA 1FKPA 2BJ7A 1GMWA 1PBUA 3H4DA 4B9SA 2V8GA 1T9YA 5DJBA 2MKKA 4BWJA 5J1EA 1VC0A 4BS2A 1FD2A 3KKFA 3HFVA 3BR9A 4PWDB 5GAHU 4NEZA 5EHHA 2G9OA 3TOQA 2E66A 4A8WA 2BRKA 3PW5A 3MM6A 2J9DE 3ET6B 3Q8UA 5IOLA 3SSQA 4M5KA 4ILLA 1VK3A 5H9FK 3BH6B 2V67A 1N0VC 3JAMY 1TK8A 2OSQA 3BSAA 2HS0A 3ELHA 3VHQA 4TU7A 1Q5YA 2GQ2A 3QRQA 2EKNA 2O66A 1ICEB 1N34J 1TUWA 2UVRA 3GCWP 4JV1A 4DV3F 1ZZFA 2OTJS 5EN1A 2DKOB 1CS4B 4ELUA 4FXDA 3PKYA 5DG8A 2LEBA 2ZVSA 2KJWA 4JI1J 4NXNJ 3W65A 1T02A 2M0GB 2JWNA 3LPEA 3MPDA 4MTPA 2KFYA 4M94A 3DOKB 2OPRB 5E3QA 1YZ7A 3SXLA 1EX8A 2QX0A 2HIYA 3OLAA 1J27A 3JSRA 2VZ9A 5H9EK 3GZ7A 3PKMA 1UWBA 2QLFB 3NXZA 3BBBA 2DPIA 2K1RA 2UUTA 3PYDA 4FYWB 3C19A 1TV6B 2VFTA 4CH7A 5F8HA 1SXLA 2VBYA 2W4DA 4OYIA 2OIHA 3CCMS 3W5XA 2L9WA 3FEYB 5D0RA 3ZFVA 3BV8A 5LOQA 2XYHB 3MM5B 2MGZA 3MUTP 2RDDA 2VG5A 3P5BP 5KFYA 1NKEA 4IG0A 1S6OA 2UUAJ 1MU2B 2IDLA 3CCUS 1S1WA 1N5QA 1WC4A 4UQTA 2DT9A 1HQUA 1WG4A 2XTJP 4ZPVR 5C25A 3J7YU 3PJXA 4ECUA 5AJ3J 4R5PB 1S12A 2ZZNA 3E8OA 3VGTA 5LMUJ 4KO0B 3PY8A 4LMZA 3SI8A 2C2RA 3SCIE 4DX6A 5M2PA 3PZPA 3K5OA 3CMAS 3K8VA 5D4NA 1OYEA 5C2CA 3T6BA 5IM0A 2XLKA 2UXCJ 1MMDA 1RHKB 2DIVA 2H48B 2YWEA 2BABA 3QLHA 4LSNB 4DBQA 5KFCA 3KUGA 2R7TA 4NLXA 3QIPB 4CO5A 2BR0A 4ZN3A 2G1HA 2ZUAA 5D0GA 4K0KJ 5CYMB 3R5BA 3H2VE 3F41A 3PXGa 2W7PA 4HVZA 1S9GA 1VIOA 2EFGA 2LU1A 2AGOA 1RAFB 1TL7B 2Y1JA 4ZVQB 2DXEA 4OX9F 4X65F 1R89A 3HP6A 4WZQA 1GXLA 1UP1A 3AB2B 2LXIA 1MSWD 2HG4A 4TNOA 3SV4A 4ECRA 3R5GA 2YX1A 3UDEA 1DY3A 2HZVA 1Q8BA 3NOCA 2YTCA 3SIPB 3T9NA 3A3PB 5HVGA 4IFYA 2B9EA 1UJ5A 1XTZA 2ZVIA 4XDCA 3UFCX 2J5AA 2OD4A 2XY5A 1RYRA 4H4OB 1N6QA 5FDLA 3HJVA 1U47A 4JI2J 2WRMA 3DHWC 5E7OB 5F9NA 3BO4A 1TZ0A 4M5LA 3PO5A 2GGPA 1FWPA 5KFEA 1HNIA 4OV1A 4KV8A 4OX7A 5IQQA 4L76A 3MWBA 4NCGB 5JVHQ 1BMQB 3HJFA 3IAM9 2DIUA 1X4DA 2V8PA 3DM2A 2W25A 4KFBA 2DNMA 1D9FA 2VJVA 1Q8KA 1WHVA 4F4AA 3KWMA 4OZLA 3ITHB 3LOUA 5JVGQ 3RRHA 1S1VA 3TAMA 1HHQA 3OL9A 4GKJJ 2HGMA 1WSVA 4P6QA 4QWBA 2OHDA 4OZ5A 1Q81T 2APOA 3DYAA 4OYBA 1U4BA 3IN5A 4E0DA 1CEZA 3CCQS 1E6YA 3Q2SC 2RS2A 2R7UA 3POTA 2MKHA 2WSFC 5KFSA 1F0XA 3WC0A 1VRUB 2H51B 4QR2A 5ETOA 4ZK7M 3EZ5A 1PJ5A 4NRTA 4ECTA 4WZMA 4K4WA 1RHRB 2EBEA 2GS8A 4L3NA 2JC0A 3KDOA 4RL1A 5A6PA 1S9GB 1REVA 3NGUA 5AT1B 3GV7B 1X9WA 3HKWA 3DLEA 1U6FA 4JOUA 1RAAB 2QFIA 2DGSA 4LF9F 1UA0A 4N8OA 2CQ4A 4JI3J 2F8HA 2R7SA 1HFEL 4ZIWA 2C2DA 2LEAA 3BGFA 5J1PA 4OYXA 1RTDB 4LIWA 1X0FA 5D4OA 1RXOB 2XM3A 3MHYA 4RNOA 3MF5A 4CT8A 3DLKA 4H4KA 5MAOA 2NQPA 4NA1A 3V4MA 4X4UA 4EO8A 2KN4A 3V4IB 2CA9A 1FJCA 5IWAF 2YWKA 3MMCA 3PYGA 3ZZZA 4TYAA 1FXLA 4KSEB 4F0HA 2HQFA 5KG6A 1VJWA 4U8YA 4DFPA 3H98A 2C2KB 4LRAA 4PAAA 1O0PA 2D3ZA 3M30A 1RE1B 1HNXJ 2CQ1A 1WI6A 3D66A 1U24A 2JVRA 4NX9A 1NCLA 1NMEB 3G87A 1TAQA 5I3QA 4FF4A 3KLHA 3HZEA 1U1MA 4ILRA 1TKXB 4OQJA 2GQCA 1SUQA 1H73A 4XDDA 2PFDA 2F4VF 3CCWA 1LKZA 2RHSB 2DNRA 4QR0A 4LF6J 3MR3A 1UFLA 2M2BA 3KG0A 3NKYA 3L7OA 3VVUA 1GNKA 2KZZA 3AQOA 4HDHA 5F8NA 4BC9A 2ALYB 4P2FA 2J0QD 1FXDA 3C46A 3IFEA 4RW8B 4N56A 1RWUA 3BJYA 2ATCB 1XNQJ 2F8MA 2O1PA 2IAJB 4B9MA 1WSRA 1NSQA 1V9OA 2J6TA 5DQHA 1YI2S 3M2UA 3P8BB 3P96A 4TY9A 4ES2A 5GVQA 3NEKA 3L7UA 5FLXY 2BE2A 2V68A 1Q8LA 3N9UC 1B0TA 4WFZA 4DCJB 2FD2A 3AB4B 4K2JA 2B3TB 4RO0A 1IKXA 1HQ2A 1WC1A 1FVQA 2QG9B 2YY3A 3LGMA 5HLFB 1VQPS 3LP0A 3NGSA 4RBVA 1N36J 2W9CB 3NNAA 5DG7A 2D1CA 4KY3A 4Y2AA 4DL2A 4DPYA 4MKBA 3QIPA 4L73A 1T0TV 2BE9B 2CQ0A 1AYEA 1QE1B 4DUZF 1NK6A 1B0VA 2XS5A 2V5HG 1HHSA 1YKWA 1RWNB 3SQGA 4EUVA 1VMBA 5IQ6A 5AXLA 3KLGB 4HEA9 2H54B 1JLGB 2DISA 2ZC4A 2KVIA 3PDNA 5SZTA 4JI7J 1K44A 1F9EB 1F9HA 2LYVA 3MPUB 4UZCA 3Q8RB 1OY9A 1FDDA 1X4GA 3TZWA 2ASJA 1P6TA 2XYPB 3MM7B 1RT4B 4QW8A 4R0EA 2B8QA 1GX6A 5C2GA 1DTTA 1S6UA 4RW7B 1U1QA 4CLSA 1VBXA 3T1HF 1YIJS 1HYSA 1N5YB 5FDLB 3AOAA 3BN4A 5J2PB 1GT8A 1RAOA 4NI2A 1XMBA 3D9BA 3GWCA 3ZTRA 4R8UB 1NK7A 1KLNA 2EW9A 4C3MA 5LMUF 3D4JA 5EGYA 2UZAA 4ENOA 1SCJB 1KS2A 1WKJA 2JVOA 2Z4PA 1FVSA 4N47A 5KT4A 4OHVA 2QGFB 3VAGA 1VRTB 3H40A 3DLBA 3P49B 2QSWA 2BM1A 3M2UB 1CC8A 2XLIA 1CSJA 1NK8A 3KOAA 4MK9A 1NRKA 1KONA 2RUGA 2HAIA 3PHEA 4FPIA 4EO6A 1RHJB 3ZTQA 1GTEA 4CLFA 3CC2S 2F1FA 3J81j 4AXIA 3ENWA 3QWPA 4Q45A 1X4AA 3KLIB 5AXMA 5HJYA 2LXFA 1C1CA 3GIKA 3CCES 1L3KA 3GE9A 1U49A 1QE1A 3MM9B 5L38A 2VBWA 1VLYA 4ID5B 4X66J 1E6VA 2OFHX 2Z0GA 2RE1A 3H5XA 1WEZA 1LWCB 4V1Ak 2FC8A 3HZGA 3FBBA 4J90A 5GMEA 2G2ZA 3W63A 4DV7J 3FMBA 1MMNA 3N01A 3TZXA 4USIA 1JIHA 4CO1A 4K4VA 3GFHA 1PJ6A 1Q1KA 4UW2A 4UOGA 4KHPJ 4NCBA 1WF1A 2POKA 2CVEA 2V8VA 3FSXA 3GR0A 4YB6A 5EUHA 3TR5A 3DU6A 3EDQB 1FKOA 2GNKA 4ED3A 2RKIB 3RRGA 3RTVA 5CZXA 1M1KT 4OI1A 4IRCA 1LW0B 3RB4A 3QZ7A 2XYGB 2IVYA 3W9HA 2WVBA 3KLFA 1R6VA 3FCWA 1JQGA 1FNMA 4ZJQA 4ZLJA 3K59A 3HHLD 2DNHA 4ZVFA 5LMNJ 1TFWA 2HWTA 1LWXA 2J0WA 2H9ZA 1WELA 1MU2A 2EFQA 2Z2ZA 3I96A 1O5JA 2CQPA 3KUEA 4MK8A 2CDQA 2YPZA 3DOKA 4C6AA 3AOBA 1PSDA 1RTZA 4CLWA 5GAHI 2R9LA 4DR3J 2JLGA 1VQYA 1KVIA 1TR0A 1D09B 3KUHA 1VQ8S 5HSPA 2HK2A 2ZDPA 4ZMMA 5H9EJ 2R8GA 4RR5A 3OSPA 4NLWA 4UOHA 4LF5J 3ZTPA 1C1CB 2FGCA 1KC8T 4MYUA 2XY6A 1FRMA 1Y11A 3OT9A 5FD1A 4YY3F 2L9NA 3QGPA 3PFEA 3GYNA 3RYLA 4MKVA 2WVFA 1EAYC 1RU2A 1YJ7A 4WFBQ 4L75A 3T5JA 4DX8H 2UXCF 3A8IA 2ZFHA 1L3TA 1FESA 3BSOA 2FVQA 4IO9Q 3MPYA 3M6XA 2VKRA 2RRBA 3QGIA 4K50A 1RT2A 2KVQE 4DR3F 5CXTA 2K3KA 1N33J 2DHGA 1KLMB 2MPUA 4QU6A 1HBMB 2HGLA 2XG8A 3LP1B 5L1LA 4AQYF 3HM9A 3HSDA 3SZ2A 2A6MA 4QR1A 3Q86A 5B0DA 1AW0A 2YNHA 4IQMA 3TUIC 3ZZRA 1KRPA 2Z8QA 1JLEB 4KE5A 4WF9Q 2VKZG 1M5VC 1LXNA 1IM4A 3MPWA 2AIRB 1WWHA 3AODA 4LBIA 2SXLA 1XR5A 3Q8YA 2GZOA 4FN5A 1L3VA 2LDIA 1Z1ZA 3LP0B 1FKPB 2BJ3A 4RW6B 2DH9A 4MYTA 1DLOA 1UEUA 2KU7A 1K8AT 4IOAQ 2FHOB 4U8VA 1FK9B 2YQ0A 4TKTA 2QMWA 4DG1B 1ITPA 3VGVA 1ZPVA 3CTRA 4PWWA 1MN9A 3J7YI 4QW9A 3RAQA 3O6QA 1IBMJ 4JI4F 1VBZA 2C2NA 4F02A 3QFHA 2FHJA 2VFVA 1QAYA 1U26A 5J2MB 5CD4A 2XY7A 3FVYA 1S5ZA 3X3UA 1HI0P 1G6BA 1SJ1A 4URGA 2J9EA 4UY85 2VFUA 4Q5VA 2IM1A 2R7XA 4DSFA 4CWBA 2Y9HA 4TN2A 2YKOA 2J9CA 4RX6A 4DFJA 4O4GB 3GP9A 5B0EA 2A18A 1BC6A 2KYXA 4GVBB 4Q8EA 1QY7A 4OLPA 3E01B 1MWZA 1YK9A 2KH9A 1YLXA 2FVCA 1HNVB 2QLBB 2RS8A 3EZOA 1RBAA 5HI7A 1NO8A 1Q0NA 2CQDA 1NPRA 2JRSA 3IS9B 3P45B 4P73A 4DN0A 5KG1A 5B08A 3TZYA 5J2QB 4FNIA 2IRXA 2Y3YA 4PQUA 2A3JA 2WONA 4PZVA 4JV2A 4NLOA 2JFDA 4YEAA 5IM0B 4ZKAA 3GPAA 5J2PA 2YVSA 1P9YA 3BQ0A 5GMKa 2RQMA 4D3GA 2JNJA 1ZBTA 3PW7A 1U1RA 1IBKF 2BA9A 1CQMA 1RWXB 3QT6A 4G1QB 4UOFA 5D3GA 1TTHB 2Q43A 3V81A 3N5FA 2XCAA 3C8YA 1VRUA 2DNGA 3HD2A 4FP9A 2IA0A 3QWUA 1OQ3A 5KFTA 1XR6A 5L46A 1TKTB 3O5TB 3K89A 4YDXA 4ZLPA 2YQ3A 7FDRA 1IVZA 2PMHA 1FNOA 3GONA 3FCVA 3RW6A 2L9DA 4H4KC 4ANCA 2OPPA 4USUA 2DJWA 3QSIA 3G96A 3HDSA 2WK4A 3CE8A 3KK1B 1HI1A 1YSJA 2NSBA 1NHVA 4L3KA 1V5VA 3C6TA 3GG1A 1HPZB 1JLFA 2VC0A 3UCUP 2F3JA 3A3NB 4DR2F 3BYPA 3MEDA 2DH7A 2ZNYA 1U8SA 4C8OA 4Q44A 4DQPA 2HIQA 3A1YG 3TVYA 2J0SD 2WBMA 1D3WA 4K4ZA 3OR1A 4LFCJ 2C3YA 3J7Z5 2XMMA 4OJHA 1X5OA 5HQMA 4WKRA 3J80Y 2IYIA 4P71A 3UD4P 1SI9A 3ZNJ1 4OX8A 1K47A 4PR6A 2EK1A 2CQ2A 2PEHA 5HVHA 2NS1B 4G65A 3JSYA 5GADU 3IMQJ 2I6WA 3MTKA 1VR6A 4HDGA 2VHGA 1PYOB 1RWPB 2RAQA 2CZVC 3CCJS 1YJ9S 1FRHA 5KFGA 4ZVGA 3EMTA 2WW4A 3C6UB 3HD1A 3K2YA 4MFBB 1RISA 4Z2XA 1PAUB 2BE2B 2PSZA 2DNQA 2HBYB 3ET6A 2W2QP 3EXCX 2I38A 4TYBA 4DV2F 4DL5A 4JI5F 3UWTA 1IKVB 3H8YA 4W92B 3SSSA 1N8RT 5C42B 1WUUA 2JHEA 4DV4J 2IHR1 2HAFA 2MY7A 3SDEA 1NLKL 1Q53A 2F65A 2OGUA 1PC5A 4RW8A 3W2VB 3IR5B 1TAUA 1UA1A 1CBKA 2NXJA 1UZDA 5K14A 1N32F 1WG1A 2W7OA 1UWAA 3M8QB 4C3KA 1U25A 3L7PA 3U1NA 5KFBA 1UVNA 3FJ2A 1ZM9A 3GTYX 3W2WB 2PO4A 1N52B 3BQ1A 4DR1J 4DF8A 3C6TB 1NK5A 4B9VA 1CJKB 5KFQA 3UVJA 3QYYA 4NZ7A 3EVWA 4Y00A 1N56A 1B99A 1VS3A 1BWVA 4ZPDA 3UN5A 4YHHJ 2ZHAA 5ETRA 1VQLS 3A12A 1PGZA 3L09A 1UCNA 2N3LA 3AAWB 4FYYB 3LP2A 2IJRA 5G4DA 2QC3A 5KFIA 2L3MA 1HWUA 4ZLLA 4CCHA 2MKJA 3T6JA 3BDEA 1K9MT 4EZ6A 1S6PB 2CYYA 2DCLA 3OTBA 3TX8A 2MYFA 4CLPA 4LUBA 3A8EA 4MKAA 2ZM6F 2IRYA 3ADAC 2VASA 2HLUA 3TEGA 4U95A 1FE4A 1A9NB 2XSFA 3EGVA 3VAHA 3G8QA 1SQEA 2JLEA 2UUBJ 1FRKA 2UXDF 4ALZA 3NMAA 1N5TA 2XGQA 1HI8A 3CDBA 1YQHA 2Z58B 3B8HA 5H1SV 4EU0A 4DV1F 4DR4F 2C42A 1LFPA 3NWGA 2RJZA 1YG0A 4TLQA 1YJWS 1HWKA 4RPFA 1IBLF 1KKHA 2HQGA 3RR8A 3DRPB 3KJQB 2QMXA 3OJSA 2M8HA 1N4LA 3Q8VA 1H98A 4WU3A 2F9JA 1DAXA 2M7SA 5KFVA 3W2VA 4FXVA 1RT5A 3Q83A 3T5LA 2DTJA 2K2PA 1XK8A 1NSAA 2HFUA 2V63A 4NL5A 1Q79A 2R8HA 1U2RA 5ETTA 5E3CA 3CDAA 3GJSB 5I3UA 3P6YC 1OIAA 4DR2J 2DNNA 4PWDA 1SJ3P 1RK8A 2NSCA 5CA5A 1IQTA 2MZSA 1CJTB 1YJUA 2F9DA 4A8SA 1HNZF 3G9CA 4JV0A 3M9MB 1RT6A 4RBTA 4J9LA 4OYOA 1BY9A 2DNKA 2OELA 3CWJA 4CLUA 1F2GA 3LWLA 3HSJA 1SL2A 3GIRA 3M2VB 4WE1B 1S0MA 4C8KA 1UW4A 3KLIA 1S10A 4ZHRA 2VG6B 1YBAA 2VH7A 1NKCA 2XB2D 4QIWD 1F60B 2QL9B 2XULA 5THWA 3M32A 1C1BB 5LM7E 1VFJA 2KI2A 2AYGA 1NDLA 3LUYA 5ETSA 1HNIB 4BWMA 4DPOA 1Y9OA 2BM0A 4R25A 4CNZA 1I3OB 4CIOA 4DL0C 1K73T 3QRPA 4WFYA 1RJJA 2WSEC 3BSCA 1NDCA 5D78A 5HQLA 7AT1B 1T9WA 2F4FA 2ZH6A 5HO4A 5LMNF 2DGWA 1JWWA 3H2UB 5KT3A 2DNOA 1W25A 3OXGA 4WTOB 2QLJB 1TP7A 4M8LA 3IRWP 4NXNF 3AQPA 3CO0P 4OHZA 2Y1IA 4F3OA 4U67Q 5GAGU 1FWKA 4MJKA 4ECQA 1FJ7A 1NNDA 3D5MA 2G4BA 2CJYB 2LKZA 3PRBA 4AQYJ 1SJRA 5LSLA 4DR6J 4RWXA 4USMA 1PCAA 3S1TA 1HW8A 2B8PA 3AH6A 3CCLS 3QJLA 3M7VA 2HS4A 1R8HA 4A8FA 2ZH7A 2DGQA 4RW9A 3R2CJ 2CDRB 4Z37A 1C0UB 5J1NA 1SC1B 5KFOA 4DV6J 3SQOP 2VONA 5EDWA 4I6YA 4DPTA 2RU3A 1SB6A 4ZVRB 3QAUA 2XSJB 3DI6A 3R6GB 4JI8J 5DETA 2CNLB 5F41A 2LMIA 5C5JA 1YRXA 5GAGI 1QSLA 4UY8T 4B3RF 2OEMA 3MCMA 3I9V9 2YNFA 4B3RJ 4PG7A 4KQZA 3R6LB 2W4PA 1JLEA 1KFDA 3OPKA 4LSNA 3SFGA 5KFRA 2W8KA 3NS7B 3OL6A 2RILA 5F0UA 4ELTA 3SSRA 3ZZUA 3FBEA 3HKZD 1LWFA 1YBTA 3OQ2A 3O8WA 2WAQD 4NLYA 4NZ6A 4QIGA 3CJ4A 3MMCB 3WZ0A 1U1LA 5G0RB 2JZ5A 4RW6A 4KIAA 4B9NA 1FCAA 2ADBA 4U96A 4C8MA 1PBAA 2QJ3A 4M1KA 3TJ8A 3U02A 4LFAF 2RHQB 1LW2B 3MMBA 4DL6A 1RQ0A 2UVWA 2RU9A 1MNEA 1OYDA 2YX4A 3VAJA 3NNCA 1Q82T 1FHTA 4ED1A 4MIAA 3OTDA 4JI5J 4ZVPB 4JBCA 5L9XA 1R8AA 3HF5A 1N5VA 3HMJG 1P1TA 2HFZA 3DLKB 1QUPA 1RWOB 3IWNC 1MN7A 4RNMA 4PRFA 3TW0A 5LXYA 2J8SA 5DGAA 1XNRJ 2R7RA 1EP4A 2JJ4D 3AJDA 4USTA 4NCGA 1DLOB 2V8DA 1VQ6S 4DXLA 3R1LA 1C4CA 4K59A 1JXLA 2AX0A 5A8WA 3B78A 5KFHA 4A8MP 1RBLA 3CIMA 3FFIA 1IKYA 1PILA 3C16B 3D54A 3I0SB 3VAFA 3PW2A 1S1VB 4P52A 1NSKL 1LWEA 2D69A 2O5DA 3K8WA 4F4KA 5K8OA 3U7JA 2X1AA 3KJNB 2J7UA 4RNNA 2IMOA 3FZ2A 2MTLA 1SPBP 4H4MA 8AT1B 4J9KA 4KGZB 2ACYA 4U7CA 3LGNA 2BW2A 3M6WA 4HHHA 2BANA 3NGTA 2E9ZA 3G6VA 2P6TA 1FDNA 1R8CA 2MZJA 2V2VA 3OV7A 1JLQB 4NXMF 1HHTP 3D6TB 1YJNS 3M6UA 3EM1A 3F56A 3M8PA 3CPWR 3OR2A 3I4HX 3MOJB 3CVKA 2HZAA 3DU5A 1KBRA 4K5SA 5DZ6A 4EYIB 1Q16B 2B0GA 3CD5A 3HSGA 2AEJA 3PX4A 2IAJA 3NGRA 4JYAJ 4ILMA 3MMBB 4NLDA 4YHHF 1RABB 3HFKA 4NZ0A 1NJWA 4K4UA 1S97A 3M8WA 5IT9U 1R43A 4AUKA 2CPIA 2DB1A 4KH0B 2GX8A 4ZVSB 3HHLA 2A2DA 1SKWA 2VG7B 3MAAB 3K17A 3GG0A 1HMVB 1RI7A 4OYMA 4B3OB 2XMTA 3MFIA 5DM7Q 1IKXB 5HLFA 3GCXP 4WCEQ 4AL5A 3PEHA 3R5JB 2GHWA 3SV3A 3D0HE 1W2IA 3DDNA 2R7OA 3VGSA 4LF8F 2AF6A 3NRBA 3CC7S 3M05A 4P75A 4OZNA 2QV6A 1BQXA 1FF2A 2BACA 2E7XA 1HNZJ 3WQPA 4B9TA 2H5IB 1RT3B 1Y5NB 1WEXA 4JI2F 5DO2A 2CJ9A 3FDSA 4EBCA 3CO9A 8ATCB 3NG8A 1VK8A 4PXDA 3ZZ0A 3BQ2A 3W8PA 3SYZA 2HHWA 2V2KA 2HLTA 4O4RA 1QTMA 2ZOFA 1EZZB 2YWWA 3FNNA 1TVRB 4GVBA 4DWIA 4NOHA 4LFBF 5B7WA 5ETPA 4RW4A 4FPRA 3M30B 1X60A 2MSTA 3M8PB 1TFYA 1IKVA 2YKAA 3AXKA 3HVWA 4OV6A 3GYXB 3CCVS 3VAKA 3QSYB 4LREA 1BWEA 5LSOA 3ZC4A 2MHEA 4YQWA 3W66A 4JI4J 3QAEA 2BRLA 2HFNA 3C14A 3NWRA 4LSZB 3N0VA 3DOLB 3I4PA 1GTHA 3SCLE 1C0UA 1WOOA 1IUJA 3N79A 1FRXA 1BE4A 1U8WA 3CUNA 3TAQA 1KFSA 5AXKA 3JAMU 4LVOP 3K5LA 5D0HA 1N32J 1S77D 4WWSA 3C6UA 2AYEA 3G6YA 2QIFA 2HNZB 2E1RA 4IOCQ 1T3NA 2IBKA 4OI4A 1WC5A 3IG1A 4CZCA 5IT0A 2K8GA 2HHHJ 2BZ2A 5AE1A 3BGLA 3KLVA 3JQKA 4LT6A 1DHMA 4NYZA 1KR4A 5BYSA 3K58A 4QZVB 4EFAC 1FO1A 5KFAA 3ISZA 1VQKS 4WKYA 3GLJA 2K3IA 4E2FB 2Y8YA 3IAS9 3RB6A 1UPPA 4XPCA 2X3DA 2C1EB 4NLGA 2R8IA 4OI6A 3KK1A 2H5JB 4OJ1A 1YX2A 4HL9A 5EX3A 1CULB 3HVAA 4G1QA 3MEEA 5L9NA 2QEXS 1XERA 4HHUA 3MR7A 2XC9A 3CGIA 4KYZA 5LT5A 3LANA 1Q86T 3TX0A 2PMZD 1IWAA 1QAJA 4USJC 5DGBA 4NI2B 4R8UA 4ED6A 4Q43A 3M4XA 1HKAA 1XN9A 4O44B 1MMLA 1SKUB 1ZAWA 3ISND 3AHPA 5A8WB 2DGUA 1OO0B 2B4PA 4IOBA 3VZHA 2UVVA 3I5AA 5L1JA 4IDKA 4ECYA 2NUUG 2IJFA 5A0YB 2Z57B 1NM2A 4WTYA 5K8MA 2PC6A 3QZ8A 2KM8C 4YMEA 2DHXA 3J7A1 3KNAA 2DRDA 2DVIA 3T3FA 3FEZA 4PYAA 1A6LA 2XS7A 2DR7A 4XO0A 4WFNQ 4OZ3A 8RUCA 1LK7A 2KJVA 3S01A 2FZKB 1WTFA 1R3NA 2IMWP 3B4MA 1MROA 4D3HA 1R0AA 1WKLA 2GJ2A 1CQNA 3K0JA 4Y2MA 3AD8C 2ZITA 5D15A 3TYTA 2ASLA 5DDOC 2BKOA 1JNZB 1GXTA 4ZCMA 4X62F 1WEYA 1HQUB 5C25B 3M8QA 1SL1A 5KG3A 3RBEA 2QL5B 2YBVA 3C2PA 3IM9A 3ILJA 1S1UA 2GIFA 2UUCJ 4OYPA 3H0PA 3NS5A 2CVIA 2HHHF 2XZWA 1J5EJ 2QYCA 3WIUA 2FJXA 2YKNA 2A10A 2YNGA 3G86A 1W26A 1N34F 3M2VA 2HYIB 1U09A 5HBMA 3CMQA 1S79A 4G3IA 2HVHA 1X4CA 3QATA 2JLFA 4KJIA 5HMYA 3CW2C 3EGZA 3H42A 2DO0A 5CYMA 4C7QA 3KHGA 3N6NA 3TA2A 4KHPF 1I1GA 5T41A 4DG1A 1FDBA 1IN0A 4DV0J 2VB6A 1S9FA 1EHWA 3TUZC 1HD0A 1DTQB 4K4XA 1KHWA 2J8AA 2C22A 5KOWA 3CJ2A 3UNYA 1CJUA 4J9PA 4K4YA 4KT0C 3CC4S 2ZHBA 2KL8A 3CDUA 2AJ0A 1VIXA 2F40A 3PTWA 3G8TA 4OFZA 1UJ4A 2O01C 3GYGA 1S0OA 4OI3A 4HLBA 4ECWA 2E5HA 1NDKA 2DHSA 2HBZB 3IRXB 3RBXA 1UMJA 3OFFA 4AT1B 3W61A 3TVZA 1BXNA 3M2RA 4JI6F 5DLGA 1CC7A 1HBOB 3HK2A 5IT9Y 4LR7A 2LQ8A 1ZTWA 4E98A 1RWKB 5JUMA 2FLNA 3RAXA 5HAOA 2A6OA 4WYWA 1S72S 1RCXB 4A47A 5A76A 2K06A 3ILIA 2AD9A 1TV6A 4YFUA 1S6QA 1FI4A 3VR1A 4PQUB 2V9WA 2H5EA 3H5YA 4EI2A 1WOSA 1A0OB 3IWXA 2FC9A 1X31C 4QIFA 5HATA 3M9NB 1FXRA 1RHMB 2M52A 3A13A 3B82A 4X84A 4YUDA 4DSKA 4GKJF 3R7BB 4I67A 1R0CB 1HA1A 1VQSA 1SKRA 3K7RA 3JTNA 1AT1B 3MR6A 4RNFA 1T9XA 4EGLA 2I8EA 4TQSA 3A8JA 1RT7A 3PYFA 3RW7A 5G0RA 4WK3A 1FFGB 3KXDA 2ZM6J 3CT9A 3US5A 1U6ZA 1U48A 1OPZA 1IXKA 1JNRB 1SIZA 4ZA1A 1FJGJ 5DQGA 3JYTA 4JV5J 1LW2A 4DOZA 4Y2KA 1GEHA 2E5LJ 1SJFA 2R2UA 1RTJB 3UO0A 1EKSA 2W1BA 4X4SA 4MMOA 5F8JA 2VQEJ 5E0OA 4PG8A 2LDYA 1JLBB 1Y0HA 2V9KA 4FF1A 1QSYA 1XWLA 2N82B 3O44A 2R8JA 4X4NA 1TKXA 4YB7A 1H2UX 2LEPA 3A4TA 3RRKA 2CQCA 4DLGA 3LALA 2VUGA 4EK2A 4F0KA 4DR7J 3IO1A 2LXUA 1VHIA 1JXVA 2QZ8A 3N28A 3MFHA 4NPOA 2NYIA 1H2VZ 4O3NA
chains in the Genus database with same CATH topology
1S99A 2WB1D 3DFEA 5F3TA 4PXBA 5C42A 2E5IA 1VHFA 1ZM2A 4CO4A 5J2QA 2RQ4A 5KG0A 5A2QY 2PN6A 1UVJA 4IDKB 4JI3F 1OPIA 2D9OA 1R27B 2MQQA 2B43A 4C4WA 2D3UA 3MXHP 3T9ZA 3DMJA 2CPFA 3T5KA 2GJIA 2BYCA 4X2BA 2VV5A 1NU4A 2HRUA 4JYAF 3OUYA 2IM3A 2RRNA 3OSNA 1TKDA 1S1XB 4LQ3A 2QA2A 2R2SA 4YDDB 1B0PA 5AE2A 3R5CA 3MURP 3ISNC 2EG1A 3R27A 4F3MA 5C24B 4EBDA 1M5OC 5IT4A 1YITS 1U6BA 1KQKA 3ITHA 3OTCA 3CIZA 4FXWA 1TKZA 4KKOB 5A0YA 3IBWA 3GFZA 4RKUC 4ID8A 5HMZA 4IFVA 4CTAB 2KM8B 3E2EA 2MQMA 1HPZA 3G6XA 1Y4ZB 2LQBA 2BXJA 2LU2A 3UW1A 1ZM4A 5DS7A 3TRGA 2OMOA 1GQEA 4GO5X 4RWWA 2YNGB 4PG4A 2RSQA 3DLGA 3NBPB 3VQSA 4DV4F 1KTVA 3VCDA 4NMLA 1XNRF 1J5OA 2JL9A 3NP5A 4RW4B 3CCTA 2OPPB 4QIVA 3FFIB 2MDAA 3MGJA 2KKHA 3FSYA 1B64A 2ZUGA 4ECSA 2FHMA 1D9AA 4QOTA 5I3UB 4ECVA 4CO2A 5F8MA 1P1LA 3NLCA 5E3AA 2W9BA 2JOQA 3GIMA 1TQLA 2M8DB 1UAWA 1U1OA 3IXQA 3DRPA 4PG6A 1VOMA 5D8HB 2B7CB 3SDEB 3IG1B 5C24A 3MECB 1DURA 1HBOA 3E51A 3J81Y 3OL7A 3G8SA 4M63A 1JLCB 3HX9A 3DRRB 4CNYA 1U2FA 2HHTA 1VQ5S 4RU2A 5D4PA 1LV5A 5IXUA 1TUVA 3UCGA 4MFBA 4HH0A 2VG7A 1K1SA 4JI7F 2RF2B 2YWGA 4DR7F 2RIJA 2UP1A 4C11B 1YJRA 2MZTA 5HP1A 3GFXA 3PIPQ 1NAQA 2WCXA 3LQVA 2J6UA 1L3UA 4YP3A 1JJHA 5LXRA 2BDPA 3WC2A 2K7KA 3LP2B 1FKOB 5KFXA 4KB7A 2QRRA 1ZH5A 2VFRA 1S7HA 2UUBF 3UCZP 3PNIA 3PW0A 4MK7A 2X51A 1RT7B 3ULHA 2V8HA 1FT8A 1NK4A 2JEGA 4O44A 4FF2A 1Y00A 4OJGA 1H7WA 2FHJD 4B3SF 4Y0FA 3OFEA 2UV8A 2I2YA 1M5SA 2NR0A 2HMIB 4QWCA 1WHWA 4A48A 4GKKF 4NWBA 4TU9A 1M5HA 2PT0A 2KFNA 1VGYA 1SL0A 2OPSB 1TL1A 1XC9A 4L72B 1H2TZ 1U7LA 5BJRA 1JLGA 4O0IA 5HMXA 1UWBB 4O3PA 4IH6A 1KQGB 5KT6A 2MQPA 2MKIA 4DV5F 3DCAA 3CEDA 2GV1A 4C98A 5I42B 3TAMB 2CPEA 2MQOA 2XBPA 4LSLB 5MLCV 3UDLA 3BEGB 4WE1A 3CJKB 1UVLA 1LK5A 3CJ0A 1FE0A 3PRDA 2BV3A 2G13A 3KHLA 2GC8A 4QWDA 2PI4A 1FJGF 1K0TA 4K5RA 3LO3A 4QU7A 3DOLA 2ZD1B 2MJUA 2EFNA 1JB0C 3SMZA 3EPGA 4LF6F 2XI2A 4WXOA 5KG2A 2GIRA 4LVNP 2EKYA 2R4FA 4DJBA 3FSIA 2XMUA 2KRBA 3KMQA 3GSDA 1X9MA 2FJVA 5KG5A 2GMLA 1R8BA 5A6WA 2JX2A 2OPQA 1TL1B 1E6VB 2KT2A 5B0FA 3SCJE 3MM8B 2KG0A 4IKAA 2Z2LA 1X5TA 3PIOQ 3MR5A 1D9FA 2E1AA 4NCAA 3W3SA 3D1HA 4OI2A 2J6SA 3CF5Q 2OFGX 4IG0B 1FKAF 2ZNZA 2XO7A 4J9QA 2Q6CA 1DTQA 4TY8A 2D9PA 2FLPA 1QVFR 4I2PB 4OZ1A 4YOEA 1ZTTA 2ZOMA 4J37A 2RDJA 2AX1A 1NJZA 1XBWA 4YR2A 4TXSA 2N4CA 1R7IA 3ZZTA 1URNA 1KD1T 1FNXH 4IH5A 2V4JB 3GMGA 2IFXA 3ICLA 4RUCA 2MKCA 2YH0A 1J2VA 1LWFB 4KC5A 5CH7B 3RB3A 5D3GB 2RQKA 2P9GA 4I64A 1RYSA 1SV5A 2W7AA 1S0VA 5J2NA 5F8IA 2KRRA 2EI5A 2L08A 2DR8A 3KHRA 2CPXA 2YKMB 1NKBA 3D28A 4Y6IA 2QT7A 4O3OA 4C8LA 2FJEB 1X7VA 3AY0A 2WW8A 1MROB 1HMVA 5FIIA 1AFIA 1JX4A 4ZP9A 1RT4A 2K7JA 2NPFA 5F9LA 3KJVA 2IYGA 2AJQA 3GILA 1WHYA 5CYJA 1G3OA 1N5YA 1UL3A 2RT3A 3V6DA 1HBMA 1U1NA 3KNGA 3QJJA 4EYHB 3PM9A 2QLWA 1UVKA 5CYQA 2CJAA 4IO1A 2XMVA 5CCLA 2PD1A 3D0GE 2OH2A 4OZ0A 1ULRA 2J7WA 3DM2B 3MM6B 5DG9A 1UKUA 2EWHA 4Y3CA 4DSEA 3R1HA 2AYBA 4Q0BB 3OVAA 4DR6F 4ZPCA 3HLUA 5DRKA 2DNZA 4RLEA 4C0BA 3IRXA 3SCKE 2VOOA 3HHLC 1EP4B 4K4SA 3NAHA 3TO8A 2B56A 3GQCA 2M88A 3LW5C 5KOXA 3CXCR 4F4ZA 5J2PA 2HWHA 3OR2B 4M5DB 1O8BA 2XS7A 3R3TA 4B9UA 2XNRA 3I0SA 1HBUA 3WDOA 2GHPA 5A8KB 1QAXA 1YJVA 1ZOTA 1KQSR 2J7KA 4N41A 3TANA 1VC5A 4PQAA 1TL5A 5D6GA 1I6JA 3HI9A 5H9FJ 4QPTA 5KFUA 4G1IA 2ZKTA 3OJUA 3HXMA 2XNQA 4DV6F 4ZP7A 2AWZA 1S1TA 1UFWA 4HI2A 1KQFB 4F25A 4B17A 5U47A 2DRAA 2VODA 1U1PA 3THTA 4PXCA 1YTYA 1D9DA 4N77A 2P6SA 3H2LA 1Q4RA 2PFFB 3PFOA 1HQEB 1W2BR 2J0XA 3V6KA 1ZAXA 2FJDB 2HS3A 2CPHA 2GO8A 4UUWA 1WF0A 3W2WA 4DUYF 1RDRA 3MCSA 3BGRB 4BBYA 5L1KA 4X4PA 1S0NA 1ZPWX 2JSXA 2HVZA 2ZJPQ 2CG4A 4F4XA 2E9TA 1PO6A 2E29A 2RKIA 3I32A 3SFUA 4F3QA 2MKSA 1DARA 3NBPA 2MZ1A 2CFXA 4U6PA 2ZH1A 5KFWA 1F5BA 3EGNA 2W4CA 2NUHA 3GFYA 2AGPA 3UE2A 2ZH2A 2JEFA 4DS4A 4FBUA 1ZM3A 2ZE2A 3M1VA 4CH0S 1HW9A 3MD1A 3UDCA 2RB7A 2I9SA 3VQTA 1JLFB 1QSSA 4I2PA 1IJFB 4F4WA 5GAEI 3CCRS 4BC7A 1ZYQA 3DYAB 4B02A 2ASDA 4DMZA 5DQIA 2E5GA 1R6YA 2MZQA 3QGHA 3QPIA 2MQLA 1CG2A 3NCQA 1M5KC 1ELOA 2EVZA 2BQ3A 5SUHA 2CPZA 5E2QA 3TUJC 4A8KA 1BD6A 4WFXA 2CKWA 5M2RA 2CQBA 2P5VA 2WOMA 1MW7A 1TKZB 3IA0A 3FZBA 5A0YB 2KM8C 4AE5A 5IZHA 4C3LA 4C97A 1C1BA 3DOMA 2AJFE 1XMQF 3Q8PB 2AV5A 1PC4A 3KLGA 2FJWA 2VFSA 1E6YB 4OHXA 2HNDB 2KB2A 4C2MA 3TAPA 3C3LA 3MZIA 3OFGA 1NHUA 4LQ9A 2QFJA 1BQNA 1T95A 2WSCC 4DFMA 4X4OA 5BYQA 4A8XA 1LWCA 2F7VA 4I4BA 4PCQA 1XR7A 4ITSA 4PKDB 3D0IE 2QA1A 3V5RA 4QPXA 1HNXF 1V6HA 4KHMA 4CH1A 3H20A 1R31A 4QYRA 3GV8B 5KFPA 1HWLA 1SUQB 3I6PA 1FEEA 3JSMA 4LFCF 1X4HA 2ROPA 3PX0A 2GO9A 4FS2A 2JC1A 1RT1A 3OVBA 3OL8A 4RZRA 2LECA 2XS2A 5KG4A 4GO7X 5K8PA 1MWYA 2DGXA 1HBNB 2U1AA 4HTIA 3PR4A 4ZDNA 1HBUB 5LJ3Y 2J9DA 4C9DA 3FEXB 2EFPA 1D0EA 2BJDA 3TARA 3RR7A 3E3XA 1F5CA 2XSJA 4C11A 5I42A 1C0TA 3EPIA 2GQQA 3KK3A 3BSNA 1BQMB 2FDNA 1FJEB 2XLJA 3FCHA 2UUAF 3N6LA 1JLCA 1SJ4P 1S9EB 2E9RX 4TU8A 1JJ2R 2DO4A 2ZKUA 3KHHA 5KT7A 1LOUA 2O67A 4LF5F 1R8PA 2C3MA 2MMYA 1KOHA 3BF4A 3MI7X 4OHWA 1HWJA 2VQFF 1X4FA 1Z2LA 2I1RA 3K5NA 2N7CA 2DNLA 1P9QC 2GIQA 5F3ZA 3ENQA 5JXSA 2COLA 1DQ8A 1LWEB 4G6VB 2D74B 2ILYA 3KLEA 1H0HB 3HHKA 1LFWA 4RW7A 4WXWA 4QQBA 4PUOA 3RZAA 4CI0B 4B08A 3M32B 1KSPA 5E33A 5B0GA 1S49A 3O1LA 3SQGB 4PG5A 3Q22A 4C8ZA 4B3OA 1FTCA 2XMWA 5E3PA 4Y34A 3HT3A 4NLSA 2NZ4A 4ZOSA 5KFNA 1SKSA 1SV5B 2DR5A 3NMRA 5F8LA 1Y3JA 4FVMA 3EXYA 1IKYB 2GMJA 2IM2A 4R5PB 2YWFA 4E0DA 3OTEA 3PJWA 4KKOA 1UETA 2KHCA 3LP1A 3GV5B 2C28A 2B7BB 1YVFA 5F8GA 4DV7F 1N54B 4F8RA 2FHKA 3CJKA 4IFVB 3CULA 1NH8A 4H4MB 1BQMA 2VL1A 1N5SA 4Q7AA 2HHXA 3FGVA 4JI1F 4C8YA 2B9WA 3NGDA 4NLTA 1S9EA 2W24A 3HHNB 3FMWA 1F9FA 4B3TF 2MZRA 3FRYA 4NA2A 1LQ9A 3I5CA 1HNWF 2AGQA 2ZC3A 3I55S 1D1UA 4PXEA 4DQSA 1T8EA 4ZCIA 3CCSS 5T7LB 3VAMA 2LCWA 2Q6BA 3QLHB 4O3RA 1YHQS 4RUAA 5B0BA 2I5JB 4U9RA 4LF7F 2HNYA 2DGTA 3RU0A 3Q8QB 3DLHA 3LPYA 2RMLA 1TVRA 2HWIA 3CDWA 4LIRA 2CJQA 5EWFA 2B4OA 2CIMA 2VD3A 3O3LA 3JYTB 4W90B 4M5DA 2B5JA 5E41A 1NB7A 1WHXA 1S48A 1IKWB 2GFFA 2HHPA 4P7TA 3KTQA 3HO1A 2HFOA 2L41A 4Q0BA 5D77A 5DDQC 4WFAQ 4DV0F 3IC1A 1M0SA 2WONB 5LJ5Y 1Q7LB 5KG7A 1X8DA 2W9BB 4MIBA 3MD3A 2XCPA 2QE5A 5CHCB 1DQ9A 2B9XA 4K4TA 1X5SA 5HL7Q 1TL4A 3OHAA 2DNPA 4KFBB 2VG6A 2IBOA 5DDPC 2DR9A 2Z2MA 2XWXA 2V94A 2ROEA 1YWXA 3BZQA 2I0XA 2VOPA 4JI0F 2QSFA 4X66F 3V6HA 4V19X 4DF4A 2YNHB 3G71S 5DM6Q 1U45A 2FTRA 2WBRA 2XMJA 1SBRA 2ZJQQ 2XEXA 4RUHA 1RT6B 1VC6A 3OHBA 1T94A 1X4BA 2QA4G 1WG5A 2HNYB 2LVWA 3OLBA 1N36F 3U1MA 2KO1A 1REVB 1T03B 2E5LF 4DR5F 1HYSB 1HD1A 3DRSB 1KLMA 4NYPA 4DL7A 4PPZA 1B7FA 2UUWA 7FD1A 4EZ9A 5FJ4A 1L5UA 1XEZA 2X1FA 1V3ZA 1SIWB 5AE3A 2PI5A 4B3MF 4ICLA 4NLVA 2DD8S 2VBZA 2DGVA 4USHA 3G4SS 1K1QA 1NEEA 4HTJA 3KJVB 2HMIA 3AJ2A 3UQSA 2KTQA 2E1CA 4ED2A 4YR3A 4PUOB 2C3PA 2JFKA 2E1MC 3O2IA 2BJEA 1OSDA 1LXJA 2YX7A 1R0AB 4ERDA 1ROFA 2CPDA 3P3DA 4A8YA 2ZZMA 3L3CA 2KZMA 3MM9A 4I0WA 4URQU 1KN6A 1NJYA 4ID5A 1DFDA 3KK2A 4A8OA 1JJ4A 3ZZPA 2DK2A 1IR0A 2ZJRQ 3R5AA 4O4GA 3LAMA 1V3RA 3GB0A 4DEZA 2YKPA 1URRA 1NK0A 2OO4A 2ZBCA 2DITA 3HVRA 3NCPA 3MECA 2VPYB 3I31A 2ADCA 2ILZA 1VI7A 2GMHA 4N5SA 5A8KA 5HBMB 1EETB 1NJIT 1SH2A 2OPQB 2ZH9A 1JMTA 1HQEA 4K2XA 4DL6A 2E7WA 3RAMA 4DHVA 4QBUA 4M95A 4IYQA 2D41A 4ES3A 2HHVA 2EPIA 2R2TA 2WTFA 1RTHA 2C2EA 1UEVA 5GAEU 2KT3A 1OQ6A 2HNZA 2HGNA 2RRAA 1HWIA 3H25A 3DXSX 5A8RB 3DNCA 1NZAA 1VQOS 2CJBA 4ZPWR 2AU0A 3H5SA 2R7QA 1TK5A 4X4TA 4NLRA 2XMKA 3MM5A 2MGZB 4NLUA 1T05B 4G1PA 4E8UA 1X5PA 1CPZA 2G1DA 2M3DA 3UNGC 4DFKA 2RH3A 4WK1A 3CMES 3KG1A 3HPOA 1KTQA 4C0OC 4DDFA 3I56S 1UJ6A 3MEDB 3GIIA 1WTBA 3OTOF 1NK9A 5KFKA 2EG2A 3UPFA 2XHWA 4LJMA 1DTTB 3T5HA 3T1YF 1H7XA 2P9CA 1CVJA 1Z2ZA 2UUCF 2OKQA 1KEKA 4QCLA 4AXJA 1OSCA 4FBTA 5EWEA 1VQ4S 1C4AA 5IS2A 4KGKA 3CDEA 5K5MA 4DQRA 4ETXA 4QWAA 1GAOA 3PACA 1EETA 1NH7A 4YR0A 3Q23A 4J9SA 1GXUA 2R7WA 1JLAB 4QYZJ 3ETOA 2KYZA 1FERA 3SEOA 4IG3B 4C8NA 5DDRC 4DS5A 1RAJA 5J2NB 4DSLA 3MEGA 4ETZA 5B09A 2ZH3A 2UV8G 1Q8IA 3R5DA 2IA6A 2EFOA 2JEIA 2CJKA 2A1BA 4HT5A 2YKMA 4WJBA 5J2MA 1J5EF 3N6MA 3I0RA 2FIUA 2MSSA 1C0TB 2PA8D 5BYRA 4OZJA 3