4RX6A

Structure of b. subtilis glnk-atp complex to 2.6 angstrom
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
117
structure length
109
Chain Sequence
AMSGQMFKVEIVTRPANFEKLKQELGKIGVTSLTFSNVHGCGLQKAKIESNVYERLKIEIVVSKVPVDQVTETAKRVLKTGSPGDGKIFVYEISNTINIRTGEEGPEAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Nitrogen regulatory PII-like protein
publication title Structures of regulatory machinery reveal novel molecular mechanisms controlling B. subtilis nitrogen homeostasis.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
total genus 19
structure length 109
sequence length 117
chains with identical sequence B, D
ec nomenclature
pdb deposition date 2014-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rx6A00
4WK3A 4WK1A 1NZAA 4E98A 4CO0A 2J9EA 2GNKA 4OZLA 4CO3A 4YB7A 1VHFA 2RD5C 1V3SA 2J9DE 3AA8A 1NH7A 3AHPA 1HWUA 2NUUG 1UKUA 5D4OA 4RX6A 2XBPA 1UFLA 1J2VA 2V5HG 3NCPA 1Q1KA 2DCLA 4Y6IA 2VD3A 4USHA 4USJC 3NCRA 4CNZA 2XG8A 2JJ4D 4ZK7M 1OSCA 2CZ4A 1P1LA 2EG1A 4YB5A 1UMJA 3AH6A 3O5TB 3N5BA 2Z0GA 2EG2A 1QY7A 2J9CA 1KR4A 3LF0A 5DRKA 1V6HA 1H3DA 4RWWA 1NH8A 4Y65A 3HLUA 3TA2A 2GX8A 4IYQA 4CO4A 3MHYA 4D3HA 3OPKA 3TA0A 1VFJA 2O67A 4CO2A 1PILA 3O8WA 2O66A 3AA9A 3M05A 3T9ZA 4AFFA 4CNYA 1GNKA 4YB6A 1O51A 4RWXA 2XULA 5D4PA 2ZOMA 4USIA 3TA1A 2NS1B 4C3KA 4RLEA 2PIIA 2ZFHA 1V3RA 4NYPA 2GW8A 1UL3A 5D4LA 1O5JA 5DS7A 1NAQA 3DFEA 3X3UA 4OZNA 3CE8A 1V9OA 4CO1A 5D4NA 2J9DA 1XK8A 3NCQA 3BZQA 4NYOA 4OZJA 2E66A 4R25A 5L9NA 4D3GA 2XZWA 3GSDA 4C3MA 4C3LA 4CO5A 2NUHA 3L7PA
chains in the Genus database with same CATH superfamily
1N88A 2WSCC 1S1TA 4CP5A 5CYMB 4OMFG 4WFYA 1IKWA 3N0VA 4YN3B 4WBFA 3VAJA 2J0QD 1XTZA 1J2VA 3MAAB 3D6MB 4PG4A 3GFYA 2M9KA 4RUBA 2HWIA 1JKHB 2HHQA 1YGYA 2OEMA 3OW2R 4QWDA 1QUVA 1KOHA 3T5HA 1RT5B 3MM9A 1JLBA 4DR5F 1YKWA 1TKTB 4HT5A 2DY9A 4K4TA 3LALA 3OTDA 1Q95G 2NS1B 2XGQA 2FHJD 4C3KA 1NB2A 1S9FA 5T14A 2KH9A 2KYXA 4NLXA 2RDJA 2KXFA 2VDHA 4DV0F 2DTJA 4OV6A 3N01A 3GSDA 3VAHA 3Q89A 2IBKA 2BE2A 1PYTA 2C2RA 1FXLA 2V8HA 4DX7A 4USKA 2MJNA 3SZ2A 2I1RA 1VQPS 2IVMA 2BV3A 5D15A 2ASJA 4WIQA 4WTOB 3GU0A 2VOPA 1RQ0A 3QGIA 4FKYA 1E6VB 3OR1A 3M30B 3CO0P 4O23A 4F7VA 4FF3A 3TEHB 2LP4A 4QYZK 4ALZA 2MTLA 3W5ZA 3MEEB 5DG9A 1U47A 3M2RB 3BO2A 1M5PC 1RAIB 4AXJA 2JFDA 3UI3A 5D0HA 2FJBB 5KT2A 3EZOA 5KOXA 1PAUB 4HHHA 2GA7A 3QQCD 1WOPA 4LFBF 2J6UA 1WI6A 4I56A 3GQCA 4DUZF 3KMSA 2E7WA 2RRNA 1M5OC 3ONQA 1JLEB 2M8DB 3GFHA 1J5EF 4OL8A 3BQ0A 3ZTPA 1IXKA 1SVDA 5KFTA 3JAMY 3MM5A 2VZ9A 4KGXB 3HX9A 2CUYA 1ZTTA 2CQGA 3ENVA 2PO4A 2CQ4A 4RW9B 2DO4A 2LXFA 2GO8A 1GTHA 4LF2A 3CCSS 1KS2A 3AD9C 4GC6A 2FZKB 1AW0A 2AQ4A 3OTEA 3R1HA 1NSKL 2BBEA 2AP6A 4LQ3A 1VCTA 1M1GA 2OTJS 2W25A 2QEXS 2VA2A 3D6FB 2JZ5A 2JL9A 1XMBA 4DV2J 1S9EB 3SCKE 1YRXA 3PIPQ 3FFIB 2KG1A 2NYIA 2OO4A 1XERA 3NWGA 3C6TB 3MEGB 3E8OA 3MWBA 4DU7A 3DOKA 3DDNA 4ZPVR 4JI7F 4QWEA 4HYKA 1UVKA 4FYDA 3W61A 3PW4A 1X60A 4DV5J 4DR3F 2QJ3A 3N6MA 3LP0B 3MECA 2YNIB 2E9ZA 1XWLA 4NLRA 2HGLA 1NK7A 2ZE2B 2K3KA 3GTYX 1KFDA 1QTMA 2D69A 1UEUA 3PX4A 3HJFA 4OX8A 4OV1A 1WTBA 4ED4A 3CD7A 1K1QA 3CJTA 3M2VA 3AAWB 4L6V3 3OVBA 2YNHB 3M9MB 4I7FB 4R8UA 2APOA 3HT3A 2J7WA 3ILOA 2KXNB 1HBUB 4WCEQ 1VHFA 1CPZA 3PYDA 1M90T 2OPSB 4YP3A 2CJYB 3CMQA 2CAJA 2RIJA 4I2QA 1JJHA 4YB5A 2LA4A 1I6JA 1Q8BA 3IA0A 1VBYA 1L3TA 3AXKA 1PAEX 2J9CA 2QLBB 3ZZRA 1GXTA 3DGPA 1SQEA 3RG6A 3QZ7A 4X66F 2NPFA 3TAMA 1N48A 2BABA 2MLZA 2BZ2A 4CLFA 4FS2A 4NX9A 3M6XA 2AJ0A 2E1CA 2B0GA 2BACA 2AV5A 4QWCA 2VONA 2R8IA 4DS5A 3IRWP 4TNOA 4LRAA 1WC6A 3I0RB 2G13A 2ILYA 4Y34A 2R7OA 2FD2A 4ECWA 1H6KX 2LVWA 5DG8A 2DGSA 1JXVA 3OXLA 2MZQA 4PXDA 3R5BA 1QDUB 1VK8A 3I5AA 4IG0A 4X2BA 2CPIA 3MI7X 1FNMA 2XG8A 1WG4A 1SJRA 1WOSA 2B6AA 2I9SA 4JI5F 5E3CA 1UMJA 3FC9A 1SQFA 2IA0A 2OI2A 3MPVA 3LW5C 3MZIA 1UA0A 1R6VA 1RT2A 3JAMU 2D3UA 1H3DA 3QPIA 2DXEA 3K5PA 1W25A 3A8JA 1X5OA 1M1KT 2NZ4A 1FJGJ 1X4DA 5L1IA 2UVUA 1YLXA 1KFSA 2OELA 4X4PA 1U1QA 4LT6A 3AJDA 4NLPA 3FRYA 2XS2A 3PW0A 3UCGA 2WONA 3DOLB 1KDNA 4ECZA 4NCBA 3BBBA 1RACB 4X64F 3FK4A 3BDEA 2UVWA 1PCAA 2AJ2A 2DPJA 1A0OB 5KFNA 5IOLA 2ZD1A 1GX6A 3TEGA 4JBCA 2RS8A 5ETMA 4JI1J 5GVQA 1XMQJ 3P3DA 2HS3A 1NB7A 3GIKA 1EETA 2F1FA 4DZ6A 2DRDA 2FVRA 1OPZA 1V5VA 4ZVOB 3O5TB 1IBMF 3QT8A 2BUNA 2FGOA 1NHKL 1YSJA 4X65J 2CQDA 3OSNA 1DQ9A 2R7UA 3ISZA 3AY0A 1VQKS 1PILA 2IY5B 1O8BA 3O8WA 1HQUA 2LXUA 3VQSA 2R2TA 4YFUA 3R27A 2V8DA 4E8UA 1B99A 3VV2B 1RGVA 1NK0A 2D74B 1TL7A 4TVAB 2LU1A 4OJGA 2BW2A 4N5SA 2MQQA 2RQKA 4HT7A 1PJ7A 2RRBA 1HWJA 4FYVB 3RB6A 2IJRA 4XTTA 4Q0BA 3DI6A 3PJXA 2QFIA 3J80U 4EMDA 5CABA 4DQQA 2XTJP 2XHWA 2MY8A 4J9UE 5L38A 2FVPA 4RX6A 1VBZA 1KLMA 2R8HA 2VD3A 3RB4A 2VASA 3M1VB 1WD6A 3G8QA 1RWVB 2GGPA 3RBDA 3HXMA 2F7VA 3VAKA 1XIQA 4DL5A 4DJBA 1DY3A 2R7XA 2WVFA 4IRDA 3CC7S 2Z58B 4PEOA 3EZUA 4WP9A 3K17A 3SDEB 4AQYF 4PG8A 4NASA 4B3SJ 1D09B 1VJQA 1HWLA 1TQLA 1Q81T 2QZ8A 2ZHOA 2KT2A 2QA2A 2JNJA 4PWDA 1OIAA 1UWAA 5A0YB 4PRFA 1VYAA 5LJ5Y 1FK9B 2KHDA 1TKXA 1U1MA 1MWQA 1JLGB 1SH0A 2V34A 3D67A 5K8NA 1U6ZA 1DQAA 3T1HF 3WBZA 4PQAA 1KOOA 1WHVA 2UXBJ 3TVZA 3LGMA 2I38A 4W98A 2N3LA 2XYPB 2ALZA 4JV0A 1YITS 2OP5A 3POTB 3ISND 2HBZB 4MKAA 3DRRB 5KFAA 5K14A 3D54A 5C25B 4DR7F 3NGRA 4USMA 1X9WA 1M5HA 2Z2ZA 1IKXB 4NLSA 1FXDA 2VG6A 1ZBTA 1UW4A 2F63A 3MPYA 4ZN3A 2HVHA 2E1AA 1FESA 2VIHA 1RKIA 4G1QA 1FVQA 3OT9A 2CG4A 1HNVB 4OFZA 2HVEA 2PN6A 1HL6A 3JQKA 3ETMA 4ES3A 1F9EB 3DYAA 1HYSA 3MMJA 2BM0A 4LF8F 2FC8A 3SEOA 2B8PA 4O3SA 1GT8A 1RT4A 4OHZA 2YWWA 3TUIC 1RAFB 4WFXA 2RILA 5DZ6A 2VQFF 1SB6A 5A2QU 5G4DA 3CJ3A 3M2UB 2QT7A 3QRQA 3DRSA 1F2GA 1DLOA 4NEZA 1IN0A 3M8RA 5IXUA 3VGUA 2F5GA 4LRDA 4P2MA 2VV5A 1AT1B 2HHSA 2ZH5A 3SQOP 3EUNA 4CLYA 4YDDB 5BR8J 3CMES 1N5TA 1WI8A 2KYZA 4HHJA 4PR6A 4LBPA 4ZJLA 1FD2A 3DLKA 3J81Y 2VQEJ 3X1LB 3N79A 1B0PA 4TY8A 1EQMA 4UTGA 1IBLJ 4ICLA 1RAOA 4WP8A 3UDVA 4ECQA 4UOCA 2V50A 1MU2B 3DRPB 4HACA 1YJ7A 2BKOA 3UD5A 2CPYA 2CQBA 5EWFA 3O6QA 3M4XA 2WVCA 4O44A 2OUGA 2UXDJ 7FD1A 4NL5A 2FY1A 4BS2A 5DGBA 3NS7B 4NPOA 2J0SD 3HFKA 2MSTA 2FJVA 5DDRC 4WF9Q 3KDNA 1SKUB 2YX7A 2RD5C 4DR1J 4DR4F 3DLJA 2KVIA 1OQ6A 4ZCKA 1CVJA 4X62J 4I2PB 2Q66A 2XEXA 1S48A 3P5TL 2CQCA 5HVHA 3MAQA 5IV4A 1HA1A 3CUNA 3GYXB 1OY6A 2QLJB 1J27A 1CULB 3Q8VA 2JC1A 2XCPA 5IC6B 4D3HA 3EGWB 2ZDOA 3KG4A 4LF4F 2PMZD 2CWKA 1JLFA 2OPQB 3UD3P 2M4MA 2BXJA 4L72B 2ZH6A 3CT9A 3KJVA 2YNFB 3OJUA 3FEZA 5LMUJ 3CE8A 2K1RB 5J2MA 2C2EA 3MUMP 3PKYA 5I3UA 5IFMA 4MFBB 3ZO7A 1MWZA 2ZBIA 1Q7YT 3U7JA 2HAIA 2BE7D 5J2NB 3W65A 3OQ2A 2N82B 2XNRA 5HVGA 3OTOF 3AQOA 4OZ1A 4OQJA 4PPDA 2VICA 5E3AA 4M1KA 5IT9Y 3MGJA 2IC3A 3TRGA 3US5A 2Q6BA 5DRKA 5HN0A 4QWBA 2HNZB 4X4QA 4OZ5A 3AOBA 5KFXA 1JLAB 1RP5A 1JJCB 2FLOA 5HAOA 5C5JA 1IKYA 1QVFR 1RAJA 4KR0B 2ADCA 5L46A 2UZAA 4KYZA 6FD1A 4NA1A 2FUG9 3Q83A 3R5AA 3LWMA 4C4WA 2AMCB 5J1EA 4WXWA 3VAGA 1FEHA 1E6YB 1U8WA 2C42A 1S6QB 3G8TA 2DNMA 2CPEA 2RSQA 5HMYA 2JWNA 2KM8C 4WZQA 2E1RA 4QIVA 2K2PA 5FIIA 2W24A 3CSKA 3TUPA 5F8HA 2CJXB 4CO0A 2KKHA 3J81U 1N36F 1L3KA 3IG1A 5IM0B 1RU1A 4X4OA 2Y3YA 4LF7F 1ACMB 1ZYQA 1DTQB 1RTJB 3UW1A 2GS8A 3N28A 3VGVA 2O3DA 3SBMA 5M2UA 1RTIB 3PKMA 1RTDA 3ILJA 5J2QB 2KTQA 5F3ZA 3MD1A 1BHNA 2RT3A 2K3IA 4MKYA 2D3O1 2HQDA 1UP1A 3TA0A 4C8LA 3CO9A 4KAIA 3ZZOA 2R9LA 1SJQA 1UW9A 4CH1A 1SQGA 4JI8F 2YBVA 3CJRA 3ZZYA 2W2MP 1T02A 2Z2MA 3B78A 3TYTA 5DO2A 3QAEA 2F4FA 4K5SA 1S6PA 2HK3A 4XPCA 2HQGA 4IFYA 2HNYB 2LYVA 1FDBA 1FTCA 3LP2B 1FJEB 1TK5A 4S0MA 2MZRA 2ZUAA 2MKSA 2HQFA 3UNYA 5E33A 4TY9A 1YJRA 1LXNA 4ER8A 2DNHA 5LXYA 1NJWA 3CIMA 1SL0A 5CD4A 4EUVA 1JWWA 3K57A 4YR2A 4ZS6A 3HZGA 3M6UA 1TK0A 4Y2CA 5GADU 2J8AA 2EFGA 3OHBA 2FQQB 2WB1D 1Y10A 2XY7A 2WOMA 2YKMA 2RAQA 4P2XA 4OYXA 1CJUA 3SXLA 5DETA 4NI2A 1EARA 5BYRA 2W7OA 2EWHA 1X4CA 1VC0A 4FBUA 4FVCA 4H4OA 2GHVC 3IS9B 1HARA 4NXNF 3C15A 2XZTB 3M8PA 3DLHA 4DQRA 3G2XA 3N6NA 3CULA 4CLWA 1X9MA 3DKDA 2I5JB 1KNZA 4F36A 1IQTA 4DBQA 1N5SA 5KTQA 3KLVA 2QGFB 1VK3A 3AJ1A 2G4BA 1NMEB 2HPUA 3QT5A 3TX8A 3H42A 4RNNA 1G6BA 2RF2B 3D0HE 3FQLA 4I69A 3IM8A 1NUEA 1WNEA 3G8SA 1D1UA 1YBAA 4CNYA 1N33J 1YIJS 4YB6A 1S1TB 3K59A 2XULA 3I56S 1PG5B 1IBKF 1IKWB 3EGZA 4A8XA 2C2DA 4C8OA 4JI3F 4MIWA 5L1LA 1OQ3A 3RRHA 1IR0A 3AQPA 2OH2A 3PRBA 4J9MA 2HHVA 2VPYB 3T3FA 3KHLA 1UFKA 1LW0B 3FSIA 1TMJA 2HRYA 1U2CA 3IBCB 3NP5A 4MIAA 2YX1A 4FF4A 1SPBP 4W4MA 1CJTA 2M3DA 1ITPA 3HP6A 1WTFA 1NK5A 1X4AA 4B17A 1K9MT 4CO3A 1OS5A 3RAXA 3FZ2A 2FLLA 2DIUA 3CJSA 4B9SA 1SKWA 2VU5A 3OVSA 2B9YA 3BSOA 4MK9A 1TMMA 4YY3J 2YWHA 3TZYA 3KKFA 5I3QA 3TA2A 2G1DA 3M30A 1OYDA 2VC0A 3KHGA 4HDGA 2BE2B 4DV2F 2JRSA 2QMWA 1R8BA 2VPXB 2QFJA 3R5CA 3KJFB 1TKZB 2JOQA 1FI4A 5DS7A 2LXIA 1I3OB 4DLGA 3C46A 5B09A 2CJAA 3OR1B 2H1YA 3DNCA 4F3MA 8RUCA 1U1LA 4ZOSA 2CFXA 3NLCA 1FRXA 2IFXA 4QW8A 4C2MA 2J9DE 4DG1A 2NREA 1P8GA 1LWCB 3KYLA 2CG8A 1NKBA 4BBYA 1KVJA 2FVQA 4RW9A 2AYBA 3VGSA 1X7VA 3IR6B 4P71A 4P2FA 2ZH4A 3R1LA 1UVNA 2H4YB 1RWKB 1BE4A 3L3CA 3MM5B 4OYOA 3MHYA 4KO0A 1KRPA 4F04B 1VRTB 3PW5A 2CIMA 7FDRA 1S9EA 1NPPA 1XNQJ 3FFIA 3ILIA 2GAHC 2UV8G 4IUFA 3I32A 3C6TA 4CLUA 2Y1IA 2KG0A 2ZKUA 2GIFA 2KDOA 2BQ3A 1SL2A 5DM7Q 4Q43A 4LSNB 3CXCR 3N9UC 3G6YA 3E51A 2XMVA 3QFWA 5ADZA 4FF2A 3DGVA 2AZ3A 2YQ3A 2MKJA 3CCWA 3I5BA 3TAQA 3EXCX 3OFEA 4ZCIA 1U1OA 4A47A 3PYGA 2NQPA 1WSVA 2O1PA 1F9HA 3DOKB 1S0OA 1WHXA 2YNHA 4YB1P 1MSWD 4CH0S 4I7FA 1EZZB 4JV2A 1WHYA 4X84A 4WE1B 2HHUA 4USTA 4P7VA 5CZXA 4UQGA 3AH6A 3KTQA 1S1WB 1QSYA 4LFBJ 1QY7A 4DUZJ 4KT0C 4B02A 1QE1A 4YMEA 3H2UB 1F5CA 1FJ7A 5B7WA 4DLEA 2X7IA 3IBWA 2BA9A 3M2VB 1VI7A 1K0VA 1U24A 3CCVS 1VQSA 2LCWA 2G0CA 5E3PA 4R8UB 4NLYA 2JLEA 5I42B 2K8GA 2CJKA 2AWZA 5AE3A 1FJGF 2HIYA 3MFHA 1H72C 1TR0A 3VHQA 1TL5A 2B8QA 5D4NA 4NMLA 3UDCA 3UCZP 4LR9A 2PEBA 2HRTA 3HHLC 3H98A 3FDSA 4TXSA 3K7RA 4XAKA 4I64A 1D0EA 3L7PA 3HVAA 1S1XA 2PT0A 3OTBA 2UXCJ 4O3QA 3DGPB 1K44A 2W2PP 5A76A 1BQNA 4H54A 5A6PA 3K5MA 5JJBA 3MR5A 2YWFA 4DUYF 3TAMB 4ZP7A 2ZOGA 4JI1F 4ES2A 4JI7J 1XMQF 4YHHF 4DQIA 5K8MA 5F9LA 4J9NA 3P45B 1AFIA 4FN5A 3UWTA 1U2RA 1RDRA 4K4WA 3U27A 1EX8A 3JTNA 5DZ7A 3GMGA 4HLBA 1BGXT 2CPJA 3EWGA 2HGMA 3HHKA 3PM9A 5JVHQ 3FSXA 2WBMA 3LAKA 1FKPB 4ITSA 1Q79A 3U1LA 1ELOA 2BANA 3CJ8A 2GVZA 2IPOB 3I0SA 1S0MA 4ZMMA 4C9DA 1T0TV 2XSJA 4RW7B 2J5AA 1FEEA 3BREA 4BHQA 1KLNA 3CB4A 2B6AB 3OL7A 2PE8A 4Z2XA 4AL5A 1SKSA 2R42A 3DOLA 3RYLA 3KK2A 5DGAA 3S6EA 5GMEA 3AT1B 3H4BA 4UT4A 2ZNZA 1FRMA 5EX3A 3HVWA 1X5TA 5H1SV 4M5LA 1TUWA 1D8YA 4K4YA 4URQU 2YKQA 4M8LA 4X66J 2HHWA 3NNAA 1VIOA 3I5CA 3V6DA 2KXHA 2C28A 3FZBA 1S4EA 2WONB 5GMKa 2HAFA 1QAJA 5DDPC 3W2VB 2DNZA 2XI3A 3VVTA 3LF0A 3WIUA 4W92B 1WG5A 2OPPB 3PR4A 3PX0A 4CO4A 5HL7Q 3CEDA 3IGNA 3H0PA 2V2ZA 1FKOB 2DB1A 3JQMA 3D9BA 3NMAA 2F3JA 4EBEA 1V3RA 4NYPA 2AF6A 2V0NA 1D9AA 4NXMJ 4NA2A 3W64A 5HJYA 1MN7A 3IAM9 1RT1A 4G65A 3UVJA 3RR7A 1GMVA 4NCGB 1MG7A 1I94J 1RT3A 5LJ3Y 3CGIA 1XR7A 3LUYA 2KT3A 4F67A 3Q8PB 4RW8A 2I8EA 4J7CA 1QAIA 1WSRA 1RADB 2QLWA 4DFPA 1HQUB 3S1TA 1NHUA 3MFIA 2AJFE 2EVZA 1TUVA 2YWGA 2MZTA 4EYIB 1C0TA 5AXLA 4J9PA 2RVJA 4MYTA 1TL7B 4Q7AA 4X64J 3Q2TC 5IT0A 5F41A 5KG4A 3M1VA 1VQMS 3SV3A 5KFKA 4QWAA 2ASLA 1M1HA 4NZ7A 3BSNA 3EICA 4BWJA 3DI6B 3IO1A 4KGMA 2M5YA 2E5LF 1WC1A 4KPCA 3KUGA 3B8HA 2R8JA 4CLPA 3BGFA 1KLMB 2V9WA 3ULHA 1TKDA 1K47A 2QA1A 3WQPA 4ECTA 4J9KA 1GXUA 5KG5A 2E66A 4C7QA 2GGPB 1N34J 4URGA 3QGPA 1S0VA 2DGOA 3WHIA 4LBHA 1GQEA 2OLWA 4IOBA 4ERDA 2DXFA 1JLGA 2V4JB 1S59A 2VFTA 1BWVA 4YDXA 4RBTA 2V69A 3ENWA 1NRKA 3PEJA 3F0NA 4DPWA 3BSCA 3OR2A 3EE3A 4J9VA 2RS2A 2E7VA 2CNNB 4RUHA 4PWDB 4GVLA 3POTA 4KV8B 5FJ4A 3DRRA 5CYJA 3SQGB 1X31C 3C16B 3TJAA 2HS0A 3WX4A 4LBIA 3HKWA 3JS9A 4DMZA 2Y8WA 3BGRA 4Q5VA 3GE9A 4ZVTB 3R5DA 4DX8H 3R2DJ 2QTWA 4L3NA 4JYAF 5BR8F 3THTA 5KG1A 3MCNA 5D77A 3SI8A 4B3MF 3CD6S 4BDPA 3F41A 3W5XA 4PXBA 3QFHA 4GMKA 3UFCX 1NHVA 2CQ3A 4M5HA 1B0TA 1HI1A 2X1GA 2AD9A 5J1PA 2P6TA 1ZZFA 1NDCA 2YQ0A 1X4GA 4C98A 2FZGB 4DS4A 5EGYA 3NGDA 3JB9k 3OXGA 2LA6A 1FFWB 2UXDF 2BKNA 1GXLA 4HL9A 3I96A 2IYIA 1GMWA 1HI0P 4K8RA 1BC6A 2XMTA 4Q45A 3FMWA 1T9YA 5HP1B 4P7TA 2BYCA 3CJ2A 1FFSB 5IS2A 4X62F 1L3SA 4KE5A 2L9NA 2H5EA 3DYAB 2DIVA 3A8EA 1HYSB 4ZHRA 1RT4B 2CNLB 2ROEA 1RWMB 2ZNYA 1FTRA 4UQTA 3DC2A 2QG9B 5ETPA 4HEA9 2ZZNA 1W7WA 4DPTA 3B6BA 2MGZB 3VR1A 4R0EA 2HVIA 2C3OA 5B0DA 5HMXA 3DRSB 2C3YA 4MIBA 1DLOB 3QSYB 1R6YA 5H9FK 2D1CA 4ECXA 4JV1A 3RZAA 1M5SA 1CLFA 5LMUF 4CO5A 1MU2A 3LGNA 2JC0A 3DRPA 2PD1A 3LPEA 4E98A 4CT9A 1TAQA 2NXNA 3GIMA 2W4DA 1R8AA 3RW6A 1UKUA 1Y9OA 1WEZA 2KI2A 2R4FA 3DLKB 3RRKA 1HIYA 2VODA 3FBEA 2MQNA 3W7BA 5KFLA 1N56A 1YJ9S 1OSCA 2HLUA 4ICLB 5IT4A 4OX6A 3N4WA 4HR2A 1NSAA 4I2PA 1AZSB 1KQSR 4HACB 3TWZA 3EZ5A 4LF8J 3K5OA 2VF3A 3TZZA 2HNDB 3AB4B 4DXLA 2VQFJ 4DUTA 4O44B 3RAQA 2O66A 1CULA 1DTTA 2XCAA 2V4RA 4OYZA 3K58A 4QQBA 1O5JA 3Q8QB 4K0KJ 4HKQA 2ZJPQ 3C66A 1YRUA 2B7BB 5DQIA 1TP7A 4B3TF 4WFAQ 1IQZA 2DGTA 2MHEA 4MKBA 4ELTA 2CJ9A 3BF4A 4DPUA 3T41A 3MMBA 2G2YA 3PJWA 2ACYA 3GIJA 4KSEB 4KHMA 3MOJB 2QE5A 2HW3A 1FHTA 1KVKA 2Q1LA 4DR6F 1JLCA 1H0HB 3LTOA 1Q86T 1JLFB 2WHOA 4C8MA 2GVDB 1H38A 4CDIA 2FGCA 3UCUP 4F4AA 1RLDA 4UZCA 4K4UA 3RTVA 2F9DA 2G1HA 4QCLA 3GYGA 2ATLA 3MCOA 3AOAA 3K5NA 2FHKA 4HVZA 4F50A 4V19J 2JEGA 1YHQS 1PBUA 3W5YA 1NNDA 3FCVA 3NAHA 2O67A 3BM7A 3G87A 4DI6A 1NK6A 5H9FJ 4NYZA 2Y9HA 1RJJA 3QATA 4RUCA 4DR4J 1Y3KA 4F4YA 1MN9A 2HZCA 1HPZA 4N76A 4LQ9A 3UDLA 2BRKA 4IH7A 2MZSA 2KO1A 5A8KA 2IC3B 3L9ZA 3DU5A 1B0VA 1E6YA 1FX2A 1S6QA 1IM6A 4ZLJA 4CM2A 1Z2LA 4C11B 3MPWA 4LUBA 2CPFA 1IKYB 1HWUA 3RBXA 4MKVA 1R0BG 3U02A 1ZA2B 3M9NB 1VRUA 5KFPA 3V6KA 2EG1A 5J1EB 1XBWA 2VKRA 2GC8A 4OX7A 4QBUA 1ZH5A 1QAYA 4HDHA 1U7LA 4F3QA 4IR9A 2MQOA 1Q5VA 4XO0A 4FPRA 1Y4ZB 1SI9A 2VL1A 5J2QA 3MM7A 3M9OB 3PO5A 2PGCA 2EFQA 2I2YA 1T03A 3OTOJ 3IG1B 5CH7B 3OBIA 4DV3J 3VGTA 2WZ1A 1CJVA 2MQLA 5FDLA 4LREA 4PPZA 1J5OB 5LT5A 1RTDB 3T5LA 2Z4PA 2XLJA 4R5PA 1IWAA 4U9RA 2OIHA 5KFQA 1H2UX 2JFKA 2VG7B 1AB8A 3PCOB 3BQ2A 5LM7E 4UOFA 4CLSA 2CJBA 4ZPWR 2GCFA 3CJQA 4FYWB 3QMQA 1UEKA 2DISA 4LRCA 2BJ8A 3AA8A 3ZXWA 1PO6A 4DV1J 1CQMA 5CXTA 3LP2A 2XC9A 3PEHA 4N56A 1BUXA 1U2FA 4CI0B 4DX6A 1LW2B 5DLGA 2AX1A 4NLOA 1RHRB 2DNPA 2CPDA 3NEKA 1S6PB 4KKOB 5SUHA 4U7UD 2B56A 3BPSP 4IFYB 1BD6A 4U96A 2QN6B 4WPAA 3PHEA 5HI7A 3ELHA 2M2BA 3Q86A 5KFCA 3MXHP 4LVNP 4MK7A 2MKCA 3GCXP 3MR3A 2K7KA 1N33F 2HHHF 3DRXA 4K4ZA 4LF7J 4UUWA 2IHR1 2FJAB 2R2SA 4DPYA 3WIVA 4Z37A 2HZVA 5EDWA 3G4SS 1LEOA 1QSSA 1FNOA 3KUEA 2W2OP 3BKFA 3UPFA 2ZJQQ 4LRFA 5EWGA 1TZ0A 1X5PA 3HO1A 4IQXA 1EKRA 3P49B 1HMVB 3CNQP 5F3TA 4Y2KA 4DDFA 1SXLA 3SSRA 2WRMA 4C0BA 2SXLA 1OSDA 1WOOA 4ZK7M 5D3GA 2YKMB 4C97A 2I5JA 4K2XA 2MLXA 3H2VE 4NLWA 5HK4A 1HNIA 2B3TB 3JTPA 5CQGA 2QMUB 4RU9A 3DLEB 1HQ2A 4B9MA 5B0GA 2UUWA 2AJQA 3IN5A 4YY3F 4Q2MA 3M8PB 5GADI 3PX6A 1OY9A 2HRUA 4ED3A 1IR2A 4MJKA 2ZBPA 2LMIA 1T9UA 1R31A 1U0SA 1V9OA 3D3CJ 4AD6A 1VQLS 4YEAA 2CZ9A 4PXCA 4C3MA 4Y3CA 2DNYA 2A3JA 1LW0A 2LLZA 3GZ7A 2H4WB 2KN4A 3CD5A 5JMNA 5KFDA 4K50A 1MWYA 3VZHA 3H90A 4K59A 4NZ0A 2QYGA 3A13A 2C2OB 1XR5A 2B5JA 2IAJB 4F4KA 1CBKA 1TK8A 3DU6A 4ZKAA 2CDQA 2QSWA 3P5BP 1RBOB 2DBBA 2MXYA 3E3XA 8ATCB 4ZVFA 3GJRB 2V8PA 2OPRA 4YUDA 2QL7B 1WORA 1CJTB 4K7QA 4NXNJ 1LQ9A 4N77A 1P9YA 3TO8A 4DL3A 1LFWA 4MK8A 1RHKB 2G0IA 1R7IA 4WYWA 1AA1B 5C42A 4JP8A 1NAQA 3QIDA 2CADA 2DVIA 2JSXA 3CPWR 1XNQF 3MR2A 3CCZA 2FYXA 1TKZA 4DV7J 4O0IA 1NJXA 5A8RA 1Q0NA 1H74A 1U02A 4AYBD 3TR5A 3T5KA 4M5GA 2F8EX 3D6TB 4CH7A 3NRBA 4P52A 3M7VA 1R27B 3ET6B 1H7WA 2HFNA 1IBKJ 1HNXF 2GV1A 4ED2A 3H7HB 3PNIA 4JI3J 2QSFA 3BN4A 4XIUA 1WACA 1LWCA 2WVBA 2DGWA 4EO6A 5KFMA 3IGVA 1HBOA 1V6HA 1JK9B 1IBCB 4WTYA 2XMAA 4X4SA 4V1Ak 2PA3A 4FXDA 1ZA1B 4L76A 2HKEA 4N47A 1NK9A 1S0NA 1PYOB 2ZH7A 4DG1B 3HSZA 1N0UA 1PKUA 3EDQB 1VRTA 3QYYA 2W7AA 1YVFA 2DR6A 1ZPWX 1DBDA 3W8PA 4KBIA 2YH1A 1VC5A 3TAPA 3OL9A 5B0BA 2RMLA 2KVQE 1YI2S 4MH8A 2N7CA 1I5OB 2WW4A 4LSNA 4EZ9A 3D0IE 4CCHA 2AJ4A 5JXSA 1NPRA 2D9PA 4KO0B 4B3RF 2UXCF 2VFVA 4UW2A 1ZM3A 1UPMB 4DQSA 4G1IA 5J2PB 5L1KA 2CQ0A 4UOGA 4ED0A 1N5YB 3TJ9A 1DARA 1KKHA 1SBRA 4R0JA 3PYFA 2Z0GA 4DCPB 2UUBJ 3K5LA 1HW9A 2J0WA 1NH8A 1FA0A 1JQGA 4WE1A 4I68A 2BMBA 1S1WA 2CQHA 3VAFA 3AA9A 2RRAA 3Q8UA 2V94A 4QR0A 1BXNA 3FMBA 3VTIA 1VGYA 1YBUA 2GO9A 3CC2S 1LWEB 3X3UA 3LPYA 3JYTA 4Y00A 2ZDPA 2DGUA 1EP4A 4G1PA 5I42A 2A6MA 2C2NA 1VISA 2DRAA 2DR8A 4QYZJ 4TYBA 4JB8B 1CJKB 1KQFB 1QE1B 2NUHA 2HBRB 3JSBA 1HBNB 3QO9B 3GG1A 2VA3A 4ID8A 1UZHA 2BOAA 2MDAA 4TU9A 2ZVSA 4UZBA 3M6WA 3J7AN 4ED5A 1VS3A 3B4MA 2KRRA 5C2CA 3G6XA 1N54B 2DRBA 4K4XA 2FJDB 4IR1A 4B08A 1T11A 5KFWA 1UA1A 3DLBA 4C0HA 1KR4A 3W2WA 1GFWB 3CJ4A 3R6GB 1RWPB 2AEJA 2FHOB 1RA6A 3HHEA 4J9RA 5KFYA 4A8WA 4XDDA 4DZDA 1S1XB 2QA4G 2BJ9A 2GQQA 2R3VA 1BQNB 4H4KC 1H2TZ 1XMOJ 2IYGA 3RBEA 2XLKA 1UWBA 1BY9A 2B4PA 4ETXA 1R8PA 5I3PA 1FKPA 2NR0A 1DQ8A 4NXMF 3QIPA 4RW7A 4OJHA 4DCOB 3TI0A 1XNRJ 3PR5B 2IMWP 3EVMA 3O3LA 3MR7A 1U6BA 1S97A 1KD1T 4YB7A 4DFMA 3H5UA 3QWUA 1CC7A 3PIOQ 2D9OA 1H98A 1I94F 2ZM6F 3QJLA 3BR8A 1X4EA 3OFFA 4H4MB 2Q43A 2BANB 3PACA 4DFKA 2PC6A 5F8MA 2GVZB 2DT9A 3I0SB 4LJMA 4ZDNA 4JI4J 4YR3A 4DFJA 2XSJB 2NZCA 2JLFA 4P75A 4MTPA 1V5IB 4W90B 2VH7A 1VQ7S 2L41A 1TL1A 3KK2B 3UDEA 4KH0B 4LFCF 3OVAA 4NMXA 3W2VA 1OWXA 4YS2A 4AT1B 4C8YA 2KT5A 3EX7B 5F8LA 2W01A 3K2YA 3D7SB 2OPPA 3MEDA 4P73A 5EWEA 4OLOA 2L9WA 4DUYJ 1FKOA 1UVIA 3V6DB 3KLEA 3P8BB 4OJ3A 4OZNA 4YHHJ 3EJMA 1S77D 2R7RA 1Y5LB 3S01A 3I82A 3E2EA 4EZ6A 3BGOP 1NO8A 1NSQA 2KU7A 1N34F 4NCGA 1WDTA 4GC7A 2DH9A 4NLUA 1U8SA 3Q8YA 3LAMA 2JVRA 2GMLA 1U1RA 5F8IA 3BR9A 3QT6A 2ADBA 5ETVA 1CQNA 3V4IB 2QL9B 1GTEA 4OHYA 2AYMA 4PXEA 3W9JA 3IM9A 1RT1B 3UVJB 4NOHA 1FXRA 3C2PA 2IVFB 3TARA 2BRLA 3JXOA 2NPIA 2MKYA 2EFNA 3HD1A 5CAAA 4M5DA 4F0MA 3OHAA 1WKLA 4CO2A 1RT3B 2COLA 2QV6A 1BWEA 4PUOA 1B3TA 1Z4UA 2MZ1A 3SYZA 4PYAA 3MMCA 1UTAA 4RW8B 2ZEJA 3GB0A 3W9HA 5A6WA 1N5QA 2DNQA 2UUAF 3A12A 4O4GA 4MT1A 4Y28C 4F4XA 1C0TB 3O2IA 2DNGA 2HK2A 4UF4A 2NXJA 3HJVA 2VKZG 3UR3C 4JOUA 5M2RA 2D3ZA 2J0XA 1IUJA 1RAHB 4OZ2A 5U47A 2YKAA 3RAMA 2YTCA 2FJEB 1T9XA 2HVDA 1NPKA 1WC3A 3HPOA 1X0PA 2DHSA 2V4JA 1G7CB 4QJVA 1Q82T 4G3IA 3O1LA 5K8PA 2EG2A 2A2CA 4C0OC 1U1NA 2LQJA 3V4MA 4RWWA 2VOOA 2ZZMA 4ELUA 4WXOA 5EN1A 4YOEA 1S5ZA 3HD2A 4KV8A 3BGLA 4RNMA 1N8RT 3SQGA 2F65A 3C16A 5LXRA 3KLFB 2KFNA 4A8SA 2MSSA 1TL3A 3HT0A 1FO1A 3MM8A 1HHQA 5MLCV 1YZ7A 2HFVA 3W63A 4CRJA 2XYHB 2Z30B 1WF0A 5C24A 3OR2B 2XSFA 2RU3A 3ZNJ1 4J9QA 1W2BR 1HW8A 5B0FA 1ROFA 1HD0A 3BYPA 1KP6A 2ZVIA 2IJNA 4FPIA 3UE2A 3KHHA 4WU2A 2RKIA 4JUZA 1URRA 3PG9A 1T94A 3IRXB 2GJ2A 1UVLA 3BGRB 3T9NA 3CCMS 1B7FA 4HTJA 2E5LJ 1RT7A 2DR7A 4KGVB 2ZOFA 1P1LA 2MKKA 1MMNA 1FDDA 3UQSA 2Z2YB 4ID5A 5HP1A 2LQ9A 4Y0FA 4CLZA 2B43A 5KFJA 3HI9A 4DEZA 4NA3A 4GVBA 1QD1A 1IR1A 1S1VA 3QWPA 4WWSA 2MGZA 2OEKA 2GQCA 2GMHA 4DN9A 4DPXA 4ECRA 1JLQB 4K0KF 2L9DA 3OJSA 1Y7PA 1ZAVA 2IVYA 3FKBA 4PQUA 3NNCA 1EHWA 4ZHRB 1G4CA 3C14A 4A8KA 2WSFC 3FBCA 1SIWB 3TZXA 4B9LA 5DG7A 2PI5A 3IP0A 2CVIA 1NH7A 2NUUG 2WAQD 1N0VC 4MMOA 2NSCA 4Y2IA 2B4OA 1SC3B 2DGVA 2PA8D 2KFZA 4JYAJ 1RAGB 2KM8B 2YWKA 1SUQB 3AB2B 1C2PA 2B9WA 1VQ6S 3DLLQ 4B3MJ 3ZC4A 4ED8A 1X8DA 5C2GA 2VUGA 2ZC3A 3R7SB 4N41A 1RWUA 3CDEA 4ZLNA 4EEYA 3TNVA 4F8RA 1DHMA 3HM9A 1AZSA 2LEAA 1FERA 1EIYB 2H3EB 3D28A 2HNDA 1FE0A 2W8LA 2V8VA 3PVXA 1RI7A 3GJTB 2RUSA 2EKYA 2C3UA 2R8KA 1L3UA 2YXLA 4F4ZA 3O44A 2JEIA 4KFBA 2H9ZA 2CVEA 4C3LA 2ZBQA 2QRRA 4ZVPB 1FRIA 3MTJA 4F2RA 3VQTA 3ENAA 2QA4S 2XLIA 2OMLA 2AEMA 3DXBA 4I4BA 2V2KA 1RYSA 1DTTB 1TFWA 3Q2SC 3V5RA 4EWTA 1ZM2A 2VJVA 2DGQA 1IKVB 1OMSA 2JH3A 2CZ4A 3QGHA 2VHGA 4O4RA 3H25A 2W9BA 2GVDA 2A0FB 3OL8A 2E5GA 2ROGA 3H5SA 5F8NA 3R5JB 2NLWA 3QRPA 1K73T 1M5VC 4I6AA 4F3OA 4Q44A 4K5RA 3MMBB 3K8VA 2ATCB 2FVSA 2UP1A 3IC1A 2A6OA 4KGZB 2J8SA 4OI2A 3HMJG 4OYWA 3LP1A 2LU2A 1JLCB 2GZOA 4ZLLA 1RUSA 1FE4A 3OL6A 4ETZA 2W2QP 1EAYC 3R7NB 5IQ6A 2CKWA 4A8MP 4IH6A 4M63A 1IM4A 4DV3F 5CA5A 2XZWA 4L75A 2ZUGA 2HWTA 2MYFA 3D4JA 3R2CJ 3PDNA 2EXUA 2X51A 2E29A 2CPXA 2KZMA 1SJ1A 4J9SA 3EVOA 1R0CB 5E2QA 2BEFA 3Q8RB 1HNZJ 2LDYA 1DFDA 1WHWA 1UFLA 3IFEA 1VLOA 5F0UA 3NCPA 5B0AA 5EUHA 4J5OA 1S72S 1VC6A 3FJ2A 4C11A 2QL5B 5GAEU 3PXGa 1HPZB 5E41A 2DHAA 4DV1F 4B3TJ 5A8KB 5K5MA 3I6PA 4O3RA 2NYHA 3T6JA 3KK1A 2JLGA 4P9SA 2G2ZA 1G2EA 5KFRA 5KG0A 4B3OA 1O51A 2LKZA 5L1JA 4F2SA 2OAUA 1X4FA 4ZVHA 4DR6J 4M5KA 3MAHA 5IWAJ 3L09A 4TLRA 1VRUB 1JXLA 2FZCB 3GR0A 3TX0A 2Q6CA 3W60A 3ZZPA 4RL1A 2BJ7A 1RZMA 3OFHA 5L9NA 3NOGA 2KL8A 2CPZA 2LDIA 3DCAA 2MKIA 1J5OA 1JMTA 2HQ3A 3R7BB 4CT8A 2BW7A 3ZTRA 2MZJA 3FQKA 4RBUA 4TU8A 1QUPA 2H65B 3MM7B 5GAGU 1C0UB 2B4VA 1TL4A 2VG7A 1BLUA 5HLFA 2N4CA 1T03B 2RH3A 1EKSA 4ECSA 3ISNC 1AYEA 2HBYB 2C2ZB 1Q7LB 4V19X 1WEXA 1SC6A 1CJVB 1UETA 5FDLB 4RUAA 2D3OR 1BMQB 5H9EK 5KT4A 4R5PB 1RBLA 2ZH9A 3OPKA 5L8RC 3VF0B 5KT7A 1LW2A 1U26A 3MEKA 2JHEA 1RTHA 4KB7A 4F25A 4KKOA 3SSQA 3FVYA 5LL6d 4ZPTR 4LSZB 1S6OA 5ETLA 3KLHB 1NZ8A 4XDCA 3MPUB 4M5IA 3C6UB 1KC8T 4NYOA 1JJ2R 1VMBA 2DCUB 4IRCA 4ZP8A 3MDFA 4IH5A 3D0GE 1TV6B 4Y2AA 3GV7B 2CPHA 4ILLA 1PJ6A 3FNNA 4FXVA 3W9IA 3A8KA 2W9AA 4FBTA 4O0NA 1UCNA 2EC2A 3CJ0A 1T95A 3UO0A 2CQ1A 2WW8A 4CTAA 2G9OA 1HMVA 2XI2A 3K89A 4M95A 2R7VA 2WVEA 2QLFB 6FDRA 2QYCA 4M5NA 3H20A 3SFUA 4DWIA 2BJ3A 3G96A 1K8AT 3UNGC 4LF6J 5IT9U 1SIZA 3HULA 4OZ0A 2RDIA 3EGNA 3BGUA 2V63A 5E3RA 3DLEA 3H4DA 2UUCJ 1UL3A 5D4LA 1PBAA 4E2FB 1HD1A 5D3GB 2EBGA 4O3PA 1DRZA 3C3LA 2FVCA 2WK4A 5KFIA 3DDIA 2GAGC 3ZNUA 1S12A 1HNIB 3PRVA 2GMJA 5GAHU 2C22A 4KH1B 4DV7F 3Q23A 3QAUA 4U95A 3CCUS 1RSCA 4UY8T 1MLAA 3V81B 2V6AA 3CCLS 1WEYA 1S9GB 1X9SA 1B64A 5H9EJ 3AD7C 3CC4S 4IFVB 5D0GA 4GO7X 3DHXA 4I6YA 2Q79A 3JSRA 2CRLA 5M2PA 3OXFA 2GHPA 2HHHJ 3CCRS 2YVSA 2IAJA 4X4VA 1T9TA 4FKXA 2HGNA 4IYQA 2GIQA 1RABB 5E5NA 5HVFA 4ZN1A 2DNNA 3TOQA 4PCQA 3TVKA 2FC9A 4QW9A 4ZCLA 1VBXA 1GNKA 2PFFB 2MHNA 4I0WA 3HVTB 2F8MA 2R2UA 1FCAA 4ANDA 3I9ZA 1A9NB 2BE9B 2CDRB 2GJFA 4JI2J 3KOAA 3BKTA 1QVGR 2FHMA 2B5JB 3J80Y 4TLQA 4RO0A 3CCES 1R89A 1WWHA 4C8KA 2V9KA 2V2VA 4USUA 3CD0A 2HS4A 3J7Z5 1YG0A 2OPRB 2G0JA 3HDSA 5KFOA 4CIOA 3MUVP 3H5YA 3H59A 2CWXA 2X3DA 3BBFA 2ASDA 2OFGX 4J90A 3K0JA 2HLTA 5KFFA 4M94A 5C42B 3QT7A 4QZVB 4LR8A 1RT6A 5D8HB 3HHLB 3GR1A 3ET6A 1H73A 2BQUA 3OLBA 2AIRB 3ZZUA 5A8RB 4U67Q 4H4KA 1VBKA 4ZJQA 2W8KA 2KZZA 2VBZA 3PHTA 5EHHA 2YY3A 2UUBF 2IDLA 2ZH1A 2CQIA 1KBRA 1NDLA 4ZVRB 3M32A 4B9VA 1UFWA 2XMJA 3BYRA 1TVRB 1Y5IB 4LSLA 2GW8A 2MQ8A 3EPGA 2MPUA 1UJ6A 4PG6A 1HBMB 5K9FA 5KT6A 5HBMA 5HMZA 1AUSL 5KT3A 3BQ1A 3ZZ0A 1RCOB 1ULRA 1UJ4A 4JI6J 3G6VA 4FF1A 4TU7A 1HBOB 2IM1A 2M70A 3FUYA 2DNKA 2KB2A 2YNGA 1N32J 4Z7CA 1VDHA 1R0AA 2HSEB 1RB0A 2RQMA 4CNZA 4ZPAA 2W7PA 2DNLA 1L5UA 1X5SA 2NCKL 3W62A 4LR7A 2RJZA 3R6LB 1S1UA 1FDNA 1FNXH 5J2PA 1U4BA 1N5YA 3FBFA 1LNQA 4PG5A 2E44A 2YKNA 5A8WB 3ZFVA 2YKOA 3QGGA 4DSJA 4QU6A 3HCXA 3ZTOA 1VFJA 2RQCA 1HQEA 1QSLA 2FHJA 4IDKA 2Z56B 3N5FA 2YH0A 2XMMA 3T1YF 4DHVA 4RW4B 2H5JB 1F3VA 2PI4A 3KLIA 5KFBA 4J9OA 5A2QY 4I1TA 3KNAA 1XMOF 1HNXJ 4OHWA 3NCQA 4OX9F 2UU9J 4A8FA 3RUBL 4D3GA 1LWEA 4CZCA 2HG4A 1K1SA 2XS5A 4URSA 4G6VB 2XS7A 4QIWD 4WK1A 2ZZTA 3MF5A 4DSFA 3WX8A 1CJKA 5HSPA 4OZ3A 1KQKA 1XNRF 2CYYA 3AFGA 4B9TA 1HBNA 1OO0B 2FTRA 3QO9A 2CXEA 3CDWA 2E5HA 2FB0A 1GMWD 1XR6A 1U48A 2YQ1A 3VWSA 3DHWC 1R43A 3JYTB 3EMTA 2ASYA 1EP4B 4ATNA 4NLVA 1C1CA 2GFFA 1LWXA 1RYRA 1NBEB 3HSDA 4JI4F 1SH2A 4ZITA 3A3NB 5KG2A 3B54A 3DM2B 4QYRA 4NE9C 5AXMA 1LK7A 3MTKA 2V67A 2DNRA 5HROB 4HI2A 1T8EA 3QSIA 3IWNC 1D9DA 3NS5A 1RXOB 3ZTSA 4LF5F 2MY7A 3TW0A 3G71S 4X4TA 3DDKA 1NK4A 4B3RJ 3GWCA 2MJUA 3MR6A 3CCTA 4QIEA 1VQ4S 4K4VA 2J9DA 3NGTA 4Q8EA 4NEYA 1T7PA 2LQBA 1Q53A 2A2DA 3E01B 1HR0J 3W2WB 1MROA 3TQEA 4JV5F 1CC8A 2VG5A 2XNQA 2NXEA 2PEHA 2ZBCA 5HJXA 5SZTA 1F2HA 4TQSA 5AJ3J 2R7TA 3I87A 3OUYB 2P2CB 3W3SA 1KN6A 4USHA 5B0CA 5DQHA 1UWBB 4FP9A 4GKKJ 1CG2A 4FXWA 4ANCA 3KXDA 2Y1RI 2V8GA 4H4MA 2VPZB 2F8HA 3BN7A 5I4MA 3IXQA 1TTHB 2HFSA 2V4QA 4MYUA 3QIPB 4O3OA 2B51A 5E7OB 5RUBA 3GV5B 4Q2LA 2B9XA 3DLGB 4DV4J 3S8SA 2EFPA 2M52A 2N4DA 3OFGA 3KG1A 1CEZA 1Q8KA 3MM6B 4LFAJ 3KWMA 1ZM9A 1XC9A 4IOAQ 3BBCA 3MPDA 1UVJA 3EVWA 2OKQA 4OI4A 2R8GA 1HI8A 2XY6A 3GP9A 2F4VF 4WK3A 1TL1B 4GRSA 2YWEA 3G86A 4HH1A 5CZVA 2V5HG 3NGSA 3MEDB 1RTZA 5JUMA 1JJ4A 2X3GA 1YK9A 2EEYA 3KLEB 2ZKTA 2QX0A 2P6SA 1DJ0A 2Q3PA 4QR2A 4ZLPA 1OY8A 1RHQB 3V4IA 3TJ8A 1EB0A 1L3VA 4WKYA 3QRRA 1VQ8S 3LQVA 1F60B 5KFUA 1C1BA 1S49A 5LMNJ 2R7QA 1Q78A 4PAAA 1URNA 2EBEA 3KK3A 5KT5A 4DN0A 5J1NA 2L48A 3MCMA 4BCAA 3ZZTA 2UVVA 1RHJB 3TZWA 2ZM6J 4BLGA 1CS4B 1KWMA 4DV6F 3S7RA 1JNRB 1QJHA 3VCDA 2XMWA 1S10A 4IKAA 4F02A 1S7IA 3CVKA 1P6TA 4EO8A 4LFCJ 1T3OA 3GPAA 4M5DB 1NK8A 1V3SA 3PW7A 3VALA 1F3FA 4C6AA 4PUOB 2E9RX 3NMRA 4AL7A 3CMAS 3QNWB 1IJFB 2C3MA 3MMCB 2DHHA 3WZ0A 2ZH8A 4OYIA 3BV8A 4QPXA 3J7YU 5GMDA 4O4GB 3NY0A 3GYNA 2Y8YA 4U6PA 3TUJC 5T7LA 1YBTA 2IJFA 2CNOB 3MMAA 3PRDA 4DPOA 2U1AA 4KJIA 2C2KB 2JDJA 1FF2A 5DQGA 5ETTA 3LOUA 1D3WA 4EBCA 5ETRA 4KHPJ 3KLFA 1B7YB 2QO3A 3MCSA 3NGKA 4PWWA 3TQ1A 5CHCB 1UEVA 3VAMA 3HSJA 2R2RA 2CZVC 2DEJA 2VFUA 3ETOA 2I0XA 3D66A 3ITHB 3HK2A 2DGXA 5IZHA 2A18A 4TN2A 4BC7A 2IM0A 1NJYA 3DMJA 4Y6IA 4B9NA 3G9CA 2E5IA 2W9CB 1TL3B 4LRBA 3IRXA 3MM8B 3JSMA 1LK5A 3TANA 1AROP 2AX0A 3KLGA 2UUAJ 1ICEB 5C24B 4DSKA 2ZWPA 1V3ZA 3NGUA 1UJ5A 1ZAWA 2OFHX 4ZPBA 3GCWP 2IMOA 4HTIA 3G82A 4ECUA 1DZ5A 2P5VA 3V6JA 3ADAC 2RKIB 1SJFA 2LFVA 1SV5A 4B9UA 1G1XA 2C2MB 2MQPA 1C4CA 2ZOMA 3DOMB 5ETKA 3EM1A 3KHRA 1VRQC 3KJNB 2XM3A 1RT7B 5C7PA 1JXEA 4IRKA 1U1KA 3NWRA 2J6TA 3WDOA 1TFYA 5KG6A 4ID5B 1U0HA 2XB2D 4A48A 1Z2ZA 1JLQA 2D7SA 2E1PA 1RHUB 4KY3A 4FNIA 5HATA 1T3NA 4DSEA 2XBPA 3NL0A 3M8SA 5LSLA 3H40A 3EGVA 1WJ9A 1GK8A 4GVBB 4CYUB 4P2SA 3UN5A 3IWXA 4M5MA 3UN2A 2DXDA 4IO1A 1S1VB 5CD4H 3J7A1 1Q4RA 1RWXB 3CJKA 1T05A 1BQMB 3NXZA 3A1YG 9RUBA 1SUQA 4PQUB 2VDIA 3JQJA 1FD8A 2KJVA 3QLHB 3C14B 4GKJF 4J9LA 3QJJA 4OHVA 3IMQJ 1FJCA 3J81j 2X1BA 2HMIA 1XEZA 4NRTA 3HFZB 5D0RA 1VOMA 1WKJA 2ALYB 3CCQS 2DO0A 5F8JA 4R25A 1PIEA 1ZOTA 1KTQA 3D68A 1VQNS 3J7ZT 3I31A 3QBCA 3TP2A 1S4FA 2RHSB 1YJWS 2IRXA 3FSYA 3NBPB 2P9CA 4A4JA 4OYPA 2DH7A 2RE1A 1Y3JA 3IAS9 2V68A 5HQLA 1YRTA 3A4TA 2ZWOA 1Y00A 4DQPA 2XZDB 4JI0J 1N6QA 2LECA 1TUGB 1HNZF 1W26A 4I6WA 1FFGB 2P9EA 1DURA 1HHTP 1SJ4P 4KQZA 4ZVQB 1B70B 1CSJA 2PSZA 4F26A 5K20B 4A8YA 1IKVA 2UUTA 3CJ5A 1RK8A 2AJ1A 3CTRA 4KFBB 3H5XA 5G0RA 3M8QB 2KJWA 1WC5A 4FYXB 3U1MA 1SC4B 3BPDA 3GLJA 3PY8A 1FRKA 3IR7B 4USIA 1A6LA 3B82A 2PIIA 2EW9A 3ZZZA 1HWKA 4U7CA 3KDOA 4RU2A 1VQOS 2FJXA 2DR9A 3HHLD 5IWAF 2W9BB 3IBFB 1QTNB 3KJQB 5L39A 2K7JA 1X0FA 1F5AA 4M5JA 1RLCL 1SL1A 4F0HA 4L73A 1LWFB 4FZVA 3FCHA 2IIHA 2H48B 4CLTA 1U25A 3G6ES 3BJYA 2AHOB 1HNWJ 3ILLA 1YZ6A 4DR2J 3LP1B 4HHUA 1LXJA 1KONA 3W8GA 1UZDA 2GJIA 5CYQB 1RA7A 3GJSB 5F8GA 3PFEA 3RBZA 2A10A 2BM1A 4RW6B 1U09A 5CYMA 1FDAA 2JEFA 1SH3A 3HFVA 5ITHA 3T19A 5HO4A 1UVMA 4IG3B 3MAAA 3WC2A 2XHCA 2WTFA 5E0OA 1FX4A 5KG3A 1JKHA 1TU0B 1NSPA 3FEXB 3F73A 1RHMB 2YX4A 1REVB 2OD4A 3HKZD 4IO9Q 4NLQA 2PMHA 1RT5A 3R8YA 4EK2A 1TKTA 2N7YA 2IRUA 4A8OA 2ZHBA 2XWYA 1G3OA 1NZAA 2AEFA 3KK1B 9ATCB 3TUZC 3AXMA 1LFPA 3R3TA 1U6FA 4B3OB 3HVRA 1YJUA 3QZ8A 2HHTA 3MM9B 1S76D 1JLBB 1KHVA 4BC9A 4OYMA 3NG8A 4C8NA 5GAEI 2FY8A 3SSSA 4UUXA 2OTLS 1C0UA 4F0KA 5F9NA 4NLDA 4N8OA 3PFOA 4J91A 2P8IA 3BB5A 2H5IB 3RJMB 4LF9J 2EFVA 4EI2A 3MOZA 4TKTA 2RB7A 2LQ5A 1K0TA 1RE1B 4ED1A 1FWLA 3F44A 5BYQA 3BH7B 2HFOA 2XGPA 3Q0AA 4ED6A 1S99A 4LF6F 4ILMA 1S7HA 4OI3A 1X4BA 4FDFA 4RLEA 1GMUA 2BX6A 4DU8A 1E6VA 5DM6Q 1VLYA 2FDNA 2GHWA 5HLFB 2OMOA 3B4DA 2ZH3A 1N5VA 1S79A 3L7UA 1SKRA 5FD1A 2UUCF 5D0EA 4DL7A 3BZQA 3MEEA 3KLHA 2BJ1A 4LIRA 1LKZA 4WFNQ 3M2RA 3C6UA 4U8VA 3CF5Q 4DV5F 3SCLE 2OSQA 2M0GB 4EGLA 4ECYA 2ROPA 2OEJA 2Y1JA 5E3QA 1U1PA 5GAGI 1RTHB 3T6BA 2HHXA 1TV6A 1JLEA 2DKOB 2FJWA 4DR5J 5JVGQ 3BEGB 4RPFA 4EBDA 3GILA 1NKCA 4DCJB 5HANA 3D6HB 1NM2A 4EU0A 5HQMA 3HHNB 1ZM4A 1Y11A 1Q8LA 5ETSA 2UV8A 4WU3A 3AJ2A 4USVA 1N4LA 5LSOA 2ZFHA 2G2OA 4DV0J 2HVZA 1MNEA 3QJPA 4OJ1A 3D5MA 2DHXA 1HWIA 4CTAB 1XK8A 3F56A 3IWLA 4IOCQ 4JI2F 3MEGA 1JB0C 5AE2A 5KG7A 2NXCA 2BJEA 2GNKA 3R97A 3ENQA 3SV4A 3LP0A 1FKAF 1VQ9S 2HQCA 2YNIA 4K4SA 4ZPCA 1PC5A 2HYIB 4CLKA 2VBYA 4I67A 2ZE2A 1LV5A 4WIIA 2ACMA 5IC4B 2KRBA 2IRYA 1NLKL 3V81A 1RAEB 4KTQA 1VR6A 1S9GA 4UOHA 4MAKA 5AXNA 1LOUA 1QLNA 2QMXA 1APSA 1KQGB 3RB0A 2RDDA 4IFVA 4NRUA 2RHQB 1REGX 3EXYA 2V2QA 4KRWA 4Y2MA 5DLFA 1NEEA 3MECB 2VC1A 1HBUA 2OD6A 1WG1A 1F1BB 2FLPA 4NCAA 3TA1A 2WBRA 2EKNA 2OPSA 1Q5YA 5THWA 3SCJE 1J5EJ 4WZMA 3MUTP 3M8WA 3H2LA 5MAOA 4AL6A 2IM2A 3K8WA 1IJEB 3UR0A 4A8QA 1HLWA 4YR0A 3GV8B 2BDPA 1F6TA 3HVTA 3PJ9A 4QIGA 1QAXA 3NS6A 3LH2S 4LF1A 5ETNA 3HHDA 2CNKB 3EDRB 1U49A 1RAAB 1KHWA 2YKPA 5GAHI 4RNFA 4XPEA 4JI6F 3Q22A 1D9FA 3A3PB 3MURP 2HIQA 4I2QB 1RWNB 2FLNA 2X1AA 1NDPA 1N32F 1YDLA 4ZP6A 5FLXY 1VJWA 3I0RA 3BSAA 3CCJS 2W4CA 4U8YA 2AU0A 4PZVA 2DEIA 1P1TA 1RWWB 3HHLA 4DSLA 4QR1A 5IV3A 4DR3J 3PV8A 3THVA 2VB6A 3T9ZA 2XQCA 3JTOA 2JVOA 4DSIA 1KTVA 1HKAA 5D4PA 4OI0A 4ZJOA 3LGHA 2QIFA 3AOCA 2MQMA 5CCLA 1TVRA 2NXUA 3SFGA 4DX5A 1Q8IA 1RT6B 4X65F 2MEWA 1HBMA 2HQIA 1YJNS 1WDDA 4IG0B 2UU9F 4RJVA 3RRGA 3P6YC 2KFYA 1WC0A 4FS1A 4KPYA 4QPTA 2ZJRQ 3AHPA 4AUKA 5D4OA 2R7SA 4ZIWA 1Q1KA 3M32B 1RT2B 5KFZA 4LSLB 2IM3A 4ENOA 2BOPA 5HBMB 4RKUC 3U1NA 1Y5NB 2ZHAA 3WC0A 4DL4A 3D2WA 3V6HA 4OHXA 1FT8A 2W1BA 2GX8A 2CQPA 5KFEA 2POKA 1RCXB 4OYAA 2DK2A 3FCWA 1NCLA 2AW0A 4DL0C 2YNGB 1UAWA 2Z8QA 5A8WA 2Y0SD 1IVZA 1R0AB 5L9XA 2U2FA 2Y0BB 2ZD1B 2HURA 2XMKA 4RW4A 4OZJA 1HFEL 4F4WA 1AFJA 4P10A 1S1UB 1EETB 2LEPA 4WP3A 3RB3A 4B3SF 2YKNB 2ZH2A 1VIXA 4FVMA 4YQWA 1FWPA 4AXIA 4RR5A 1HQEB 1HR0F 3GFXA 4JI5J 4IDKB 4TQRA 4PWUA 1ZZNA 2KHCA 4KGKA 3NCRA 4P74A 3P4UB 1WKKA 2EC0A 2Z2LA 2QC3A 5D78A 5AJ3F 3KNGA 3LWLA 2ILZA 3KLIB 4QU7A 3LO3A 5BYSA 2FPHX 4GKKF 4Y65A 1X4HA 1GEHA 1DAXA 2UXBF 2MB0B 2M8HA 1R3NA 4LVOP 4WJBA 1PGZA 1VHIA 3KG0A 4OYBA 3L4BC 3HF5A 1KVIA 2PMWA 3DM2A 3CIZA 3SIPB 1XQIA 3GJQB 4HI1A 2WVDA 5HROA 5FLXU 2B9EA 3BH6B 3HSGA 4DV4F 4Q0BB 3BO3A 1A7GE 1JIHA 1P27B 4LFAF 3Q24A 3SDEA 3BKUA 3M6VA 1C1CB 1OPIA 2J9EA 4EYHB 5HQ8A 2RQ4A 3E01A 2F40A 4WKRA 1F0XA 1YJVA 1IBMJ 5A0YA 1GH8A 2YPZA 3T1YJ 1F9FA 1FK9A 1MMLA 2OJ3A 1S6UA 4LMZA 3OUYA 2GIRA 3EPIA 5KFVA 5LOQA 1T9VA 1TAUA 1S57A 4OX9J 2AZ1A 4DL6A 3I4HX 1MROB 2F9JA 2VG5B 2E9TA 3GIIA 2VFSA 3D1OA 5C25A 1TKXB 4N8NA 4ILRA 4ZIVA 4OLPA 5LMNF 3DLGA 1IKXA 2D41A 5IQQA 2DY1A 3CDUA 3FBBA 5DJBA 3OD2A 6AT1B 1H2VZ 1MW7A 3IR5B 2BKPA 3M8ZA 4FYYB 3MM6A 2CJQA 2OGUA 3H8YA 2XYGB 5DDQC 1WF2A 2PDAA 2VQEF 1PC4A 1HNVA 5K14B 1IBLF 3NAIA 3BDPA 2P9GA 2VG6B 2E1MC 2J6SA 4LF5J 3MD3A 3L95X 1SJ3P 4G1QB 2C3PA 4AQYJ 4L74A 3D1QA 4FNHA 7AT1B 2IBOA 4X4NA 1FWKA 3OV7A 2ZITA 3M2UA 4DR1F 4NLGA 4O3NA 3GSIA 1YQHA 5T41A 1I1GA 4JV5J 1NKEA 2DD8S 4TYAA 4WFZA 4ZVEA 2VFRA 2Z57B 3GG0A 2A1BA 3T1HJ 3KFWX 1UPPA 2M88A 1R8HA 3RW7A 4KHPF 1O6XA 1PJ5A 1VQYA 4UY85 4P72A 1CS4A 3THPA 2ZBRA 4KC5A 1NJIT 4LIWA 2EI5A 4K2JA 4DR7J 2JX2A 4WFBQ 4ZCMA 1C1BB 3KK3B 4DL2A 2AYGA 1YTYA 4PYDA 2CA9A 2AYEA 3CWJA 1Y0HA 4KIAA 1HHSA 3M8YA 3PW2A 4ES1A 4Q8FA 4TY8B 4ED7A 2AGOA 3JSYA 3LANA 4CQ1A 1KEKA 1RU2A 1TELA 1OYEA 2F4VJ 3FEYB 2R7WA 3UD4P 3N6LA 3OLAA 4RZRA 3HZEA 4U7UK 2HHPA 2DH8A 4DOZA 1FVSA 1JX4A 2W4PA 3W1YC 4ELVA 2DR5A 4CO1A 1RWOB 2WCXA 1O0PA 3NKYA 2WSEC 5KOWA 1ZETA 1F5BA 2VBXA 1NU4A 5AT1B 2DYAA 1P9QC 2OHDA 2OPQA 5T7LB 4HH0A 4OZLA 4CM0A 4ZPDA 3MMAB 3ITHA 3FRZA 1ZAXA 2YNFA 3OTCA 4P6QA 3PTWA 2K1RA 4C8ZA 5B08A 2EPIA 3R5GA 4BWMA 3T1AA 3N5BA 4DF8A 4MFBA 3D1HA 2AGQA 5ETQA 2W9CA 3J7YI 3VZIA 5J2NA 4DV6J 3RU0A 4CLLA 4DF4A 3P96A 1C4AA 4OI6A 4OI1A 4NZ6A 3KJVB 3M05A 4AFFA 2DITA 1WF1A 4RWXA 5J2MB 1WUUA 1XJWB 5BXIA 5I3UB 2GQ2A 4RBVA 5CCMA 3DMJB 8AT1B 3TVYA 3DOMA 3R9LA 3RR8A 3VVUA 3I9V9 3JSMB 2HNZA 1H7XA 2WB4A 4NWBA 1NDKA 4PKDB 3KLGB 1QM9A 4XK8C 1JLAA 2HZAA 4C48A 3BS9A 3ZTQA 1EQ0A 3W66A 3G82B 2IDEA 1FRJA 3ICLA 3PZPA 3PYEA 1YWXA 1SV5B 2J7KA 2ZC4A 4GO5X 3C19A 1IWGA 3T5JA 1GAOA 2L3MA 1I51B 2AKWB 2JEJA 5KAKA 2C1EB 1T9WA 4JI0F 4LF4J 5D6GA 4CYUA 1NJZA 2E5JA 3HLUA 4Z7YA 1PYSB 3KUHA 2BJDA 2YPYA 1M0SA 2H54B 4ECVA 2DJWA 5AE1A 3GFZA 2VJUA 2LQ8A 4USWA 1U0HB 5F0WA 2OSRA 2RUGA 5IM0A 1BQXA 4J37A 2XY5A 1JNZB 2CQ2A 1DTQA 1RTJA 2RU9A 1BQMA 1SC1B 1EJ7L 1RTIA 2B7CB 4IQMA 2N3OA 2H51B 2BVZA 1MMDA 1WELA 3QLHA 3SMZA 2VBWA 4CWBA 3DRYA 2K06A 3UN3A 1RKJA 2ERRA 4ZA1A 5K8OA 3AD8C 2HFZA 2HFUA 3CJKB 2DNOA 4QOTA 1AUDA 1T05B 1RBAA 2RNEA 1Z1ZA 3GONA 1YX2A 3NBPA 3C8YA 5KFGA 1ZS6A 4USJC 2VPWB 3A3OB 3A8IA 2IA6A 1AXQA 1HNWF 5KFHA 3RGIA 1R8CA 4DR2F 4ZP9A 3VAIA 2HMIB 2EK6A 3NOCA 4ANEA 2M7SA 5B0EA 2HNYA 4OIXA 2AT1B 4AE5A 3NNHA 3OSPA 2I6WA 2BQRA 2EFOA 4RNHA 2XWXA 4L3KA 1YJTA 1WC4A 2B4UA 3Q8SB 4PABA 4X4UA 2ABYA 3BO4A 3M8QA 3DFEA 2XO7A 3I4PA 4A46A 1N6QB 2QLXA 4N7TA 1NXIA 5LSRA 3LA0A 4NLTA 1N36J 4RNOA 3SCIE 1Q16B 3D3BJ 1B4SA 1W2IA 3FGVA 1FRHA 5G0RB 5AXKA 2Y1LB 2XMUA 3CDBA 2DHGA 3CDAA 4KHRA 1ZPVA 5ETOA 5HMWA 1N52B 1LWFA 2DCLA 2HEKA 4GKJJ 3CW2C 4ZVUB 5BJRA 2PFDA 3PO4A 2JJ4D 3AODA 4PG7A 5EX0A 2MKHA 3KMQA 3IS9A 2UVRA 5CYQA 4JI8J 2W2NP 2MLYA 1KSPA 2HWHA 3V2UC 2NSBA 3I55S 2L08A 2WOMB 5KFSA 2XO6A 1PSDA 1U45A 4ZVGA 1XN9A 2O5DA 4X4RA 4LF9F 1CJUB 1SCJB 4RW6A 2AGPA 2EK1A 4NI2B 4ZVSB 1D8ZA 4WYLA 3EYZA 1RISA 5DDOC 2MMYA 2FIUA 2HBQB 1GX5A 4H4OB 1FRLA 2E7XA 4IG3A 1VQ5S 2DPIA 1OJ4A 4QIFA 4E0DA 1ZTWA 3DXSX 3C15B 2RF2A 3L7OA 2BR0A 2LEBA 3GIRA 1M5KC 4EFAC 2O01C 2J7UA 1REVA 3DN9A 2J76E 2X1FA
chains in the Genus database with same CATH topology
4ID5B 1N88A 1NO8A 2MKJA 2XB2D 2WSCC 4A48A 1S1TA 3CCWA 1Z2ZA 1JLQA 3I5BA 3TAQA 2KU7A 5CYMB 2D7SA 3EXCX 1N34F 3OFEA 4NCGA 4ZCIA 4OMFG 1U1OA 4A47A 4WFYA 4GC7A 1IKWA 4FNIA 2DH9A 2NQPA 1T3NA 4NLUA 2O1PA 4DSEA 3N0VA 3DOKB 3VAJA 1U8SA 1S0OA 2J0QD 1XTZA 1WHXA 3LAMA 2XBPA 1J2VA 2YNHA 4YB1P 3NL0A 2JVRA 3M8SA 1MSWD 4CH0S 2GMLA 5LSLA 4PG4A 3H40A 4I7FA 3GFYA 4JV2A 1U1RA 1WHYA 5F8IA 3BR9A 2ADBA 4P2SA 4X84A 3IWXA 1CQNA 2M9KA 4WE1B 3V4IB 2HHUA 2HWIA 1JKHB 4IO1A 1S1VB 5CD4H 1GTEA 3J7A1 4P7VA 4OHYA 5CZXA 4UQGA 2HHQA 3AH6A 3KTQA 1YGYA 2AYMA 3OW2R 1S1WB 1QSYA 4PXEA 1QY7A 1Q4RA 1RT1B 4QWDA 4KT0C 4B02A 1QUVA 4NOHA 1FXRA 1QE1A 3C2PA 1KOHA 4YMEA 3T5HA 2IVFB 3H2UB 1RT5B 3MM9A 3CJKA 1F5CA 1JLBA 4DR5F 3TARA 1FJ7A 2BRLA 1T05A 1BQMB 1TKTB 2NPIA 5B7WA 2EFNA 3A1YG 4DLEA 1SUQA 4PQUB 4HT5A 3IBWA 2BA9A 3M2VB 4M5DA 3OHAA 1VI7A 4CO2A 1K0VA 1U24A 3CCVS 4K4TA 1VQSA 1RT3B 1FD8A 2G0CA 2COLA 2LCWA 3LALA 3OTDA 5E3PA 2QV6A 1BWEA 2KJVA 3QLHB 4R8UB 4PUOA 4GKJF 1Z4UA 4NLYA 4J9LA 2MZ1A 3SYZA 2NS1B 2XGQA 3QJJA 4OHVA 2FHJD 3MMCA 2JLEA 4C3KA 5I42B 2K8GA 4RW8B 1S9FA 2CJKA 1FJCA 2AWZA 5AE3A 3GB0A 1FJGF 3MFHA 5A6WA 1N5QA 2X1BA 1TR0A 2DNQA 2UUAF 5T14A 2KH9A 2KYXA 1TL5A 2HMIA 1XEZA 4NRTA 4O4GA 4NLXA 4Y28C 5D4NA 2KXFA 2RDJA 1VOMA 3CCQS 4F4XA 2DO0A 1C0TB 4NMLA 4DV0F 2DTJA 5F8JA 4R25A 3UDCA 3UCZP 1ZOTA 3N01A 1KTQA 3O2IA 2DNGA 3HHLC 3GSDA 3H98A 3J7ZT 3FDSA 1VQNS 3I31A 3TP2A 4TXSA 3VAHA 1S4FA 3K7RA 4XAKA 4I64A 1D0EA 1YJWS 2VKZG 3L7PA 3HVAA 3UR3C 1S1XA 2IRXA 2IBKA 3FSYA 2BE2A 2PT0A 3NBPB 3OTBA 2C2RA 1FXLA 4O3QA 2P9CA 4JOUA 5M2RA 2D3ZA 2J0XA 4A4JA 2V8HA 1IUJA 1BQNA 4H54A 5A6PA 2MJNA 2DH7A 3SZ2A 2RE1A 3K5MA 1Y3JA 2I1RA 3IAS9 5JJBA 3MR5A 5U47A 1YRTA 2YKAA 2YWFA 4DUYF 3TAMB 4ZP7A 3RAMA 2YTCA 2FJEB 1VQPS 2ZOGA 4JI1F 2IVMA 2BV3A 4ES2A 3HPOA 1XMQF 1X0PA 1Y00A 2ASJA 4DQPA 4YHHF 1N6QA 4DQIA 2LECA 2VOPA 1HNZF 4I6WA 2DHSA 2V4JA 1RQ0A 2P9EA 1DURA 1G7CB 3QGIA 1HHTP 4QJVA 1E6VB 1Q82T 1SJ4P 5K8MA 4KQZA 3OR1A 5F9LA 4G3IA 3M30B 4O23A 4J9NA 4FF3A 3O1LA 5K8PA 1AFIA 1CSJA 2EG2A 4FN5A 2A2CA 3UWTA 1U2RA 2PSZA 4F26A 4C0OC 1RDRA 2LQJA 3V4MA 4ALZA 4K4WA 1U1NA 3U27A 4RWWA 4A8YA 1IKVA 2UUTA 2VOOA 3CJ5A 2ZZMA 1RK8A 3JTNA 3MEEB 4ELUA 2AJ1A 4WXOA 5DG9A 1U47A 3CTRA 5EN1A 4KFBB 4YOEA 3H5XA 3GMGA 5G0RA 3M8QB 2KJWA 4HLBA 4KV8A 3BGLA 3M2RB 3BO2A 1BGXT 4RNMA 1M5PC 1N8RT 2CPJA 3U1MA 2HGMA 3HHKA 3PM9A 4AXJA 5JVHQ 3FSXA 3SQGA 5LXRA 3PY8A 2JFDA 1FRKA 3KLFB 3UI3A 3IR7B 2WBMA 4USIA 3LAKA 1FKPB 2FJBB 5KT2A 2KFNA 4A8SA 1A6LA 2MSSA 4ITSA 1Q79A 3B82A 2PIIA 2EW9A 1ELOA 1HWKA 1TL3A 2BANA 3U1LA 3ZZZA 4U7CA 4RU2A 1FO1A 3MM8A 5KOXA 5MLCV 1VQOS 2GA7A 1S0MA 3I0SA 2FJXA 4ZMMA 4C9DA 2DR9A 4LFBF 2J6UA 1WI6A 2XSJA 4RW7B 4I56A 2J5AA 3GQCA 1FEEA 1WF0A 4DUZF 3BREA 4BHQA 3KMSA 2E7WA 1KLNA 2RRNA 3CB4A 2B6AB 3HHLD 1JLEB 2PE8A 2XSFA 3ONQA 3GFHA 3OR2B 5C24A 4Z2XA 1J5EF 2RU3A 3BQ0A 4AL5A 4OL8A 1SKSA 4J9QA 5IWAF 1W2BR 1HW8A 5B0FA 2W9BB 1IXKA 1ROFA 3DOLA 3RYLA 3KK2A 1HD0A 5L39A 5KFTA 3JAMY 2K7JA 3MM5A 5DGAA 1X0FA 3S6EA 1F5AA 2VZ9A 3H4BA 2IJNA 2ZNZA 3UE2A 1SL1A 3KHHA 3HX9A 4WU2A 1ZTTA 2RKIA 1FRMA 2CQGA 3ENVA 5EX3A 1LWFB 4FZVA 2PO4A 3FCHA 2CQ4A 4RW9B 3HVWA 4JUZA 1URRA 1X5TA 5H1SV 2DO4A 2LXFA 1U25A 2GO8A 1T94A 3IRXB 1D8YA 3G6ES 1GTHA 2GJ2A 4K4YA 4URQU 3BJYA 3CCSS 1UVLA 2YKQA 3BGRB 4M8LA 3T9NA 3CCMS 1KS2A 4HTJA 1B7FA 2HHWA 3NNAA 1VIOA 1RT7A 3LP1B 2DR7A 3I5CA 3V6DA 1LXJA 2KXHA 1KONA 2C28A 4GC6A 1AW0A 2ZOFA 2AQ4A 3FZBA 3OTEA 3R1HA 2GJIA 2BBEA 1P1LA 2WONB 5CYQB 5GMKa 2MKKA 1RA7A 1MMNA 1FDDA 1QAJA 5DDPC 2AP6A 4LQ3A 2OTJS 3W2VB 5F8GA 2DNZA 2XI3A 3PFEA 2W25A 2QEXS 2VA2A 2JZ5A 2JL9A 3UQSA 3LF0A 2A10A 1XMBA 2BM1A 4ID5A 4W92B 5HP1A 1S9EB 4RW6B 1WG5A 3SCKE 1U09A 2LQ9A 2OPPB 1YRXA 3PIPQ 3PR4A 3PX0A 5CYMA 3FFIB 2KG1A 1FDAA 2NYIA 2OO4A 4CO4A 3CEDA 5HL7Q 2JEFA 1XERA 3NWGA 1SH3A 4Y0FA 3IGNA 2B43A 5KFJA 3C6TB 3MEGB 3E8OA 3MWBA 5ITHA 3DOKA 3HI9A 1FKOB 2DB1A 3DDNA 4ZPVR 4DEZA 3T19A 5HO4A 1UVMA 4IG3B 4JI7F 4QWEA 4HYKA 3WC2A 1UVKA 4NA3A 2F3JA 3NMAA 4FYDA 3PW4A 2WTFA 5E0OA 4DR3F 3N6MA 4EBEA 3LP0B 3MECA 1V3RA 4NYPA 2AF6A 2V0NA 2YNIB 2E9ZA 5KG3A 1D9AA 1JKHA 1S1VA 3QWPA 4NA2A 3FEXB 1XWLA 3F73A 4NLRA 2MGZA 2HGLA 2YX4A 2ZE2B 1NK7A 1REVB 2K3KA 2GQCA 2GMHA 3IAM9 4DN9A 1RT1A 4ECRA 1KFDA 2OD4A 3HKZD 4IO9Q 1QTMA 4NLQA 2PMHA 3RR7A 1UEUA 1RT5A 1JLQB 3PX4A 3HJFA 4K0KF 2L9DA 4OX8A 4NCGB 1TKTA 4OV1A 3OJSA 2N7YA 1Y7PA 2IRUA 1WTBA 1ZAVA 3E2EA 2IVYA 3CD7A 4PQUA 3NNCA 4A8OA 1K1QA 3M2VA 3AAWB 4L6V3 2ZHBA 3OVBA 2XWYA 1G3OA 4ZHRB 2YNHB 1RT3A 3M9MB 1NZAA 5LJ3Y 3CGIA 4I7FB 4R8UA 1XR7A 3KK1B 4A8KA 2WSFC 3LUYA 2APOA 1SIWB 3HT3A 3TUZC 2J7WA 2KT3A 4F67A 2KXNB 1HBUB 4WCEQ 1LFPA 3Q8PB 5DG7A 1VHFA 4B9LA 1CPZA 2PI5A 2CVIA 4RW8A 2I8EA 1QAIA 1NH7A 2NUUG 3R3TA 2WAQD 1U6FA 1N0VC 4B3OB 2QLWA 4DFPA 3HVRA 4MMOA 1HQUB 2NSCA 4Y2IA 3S1TA 1M90T 1NHUA 3MFIA 2AJFE 2B4OA 2EVZA 2OPSB 4YP3A 2DGVA 2PA8D 1YJUA 2M8DB 3QZ8A 1TUVA 2KFZA 2HHTA 3MM9B 2YWGA 1S76D 1JLBB 2MZTA 2RIJA 2KM8B 4EYIB 1KHVA 1JJHA 4I2QA 1C0TA 2LA4A 2YWKA 3NG8A 4YB5A 5AXLA 4C8NA 4BC9A 5GAEI 1I6JA 3SSSA 4UUXA 4J9PA 1SUQB 3AB2B 1Q8BA 2RVJA 3IA0A 1C0UA 4MYTA 1VBYA 1L3TA 2OTLS 1C2PA 5F9NA 2B9WA 4NLDA 1VQ6S 4N8OA 4Q7AA 3DLLQ 3PFOA 3Q2TC 5IT0A 5F41A 3ZC4A 2J9CA 4ED8A 1X8DA 2VUGA 3BB5A 2ZC3A 5KG4A 3M1VA 3ZZRA 4N41A 1RWUA 3CDEA 1VQMS 2EFVA 1GXTA 4EEYA 3DGPA 3MOZA 3SV3A 5KFKA 4TKTA 4QWAA 3TNVA 2RB7A 2LQ5A 2ASLA 1K0TA 4NZ7A 3BSNA 1SQEA 4ED1A 1DHMA 4F8RA 4BWJA 3F44A 5BYQA 3HM9A 3DI6B 3IO1A 3QZ7A 4KGMA 2HFOA 2M5YA 2NPFA 4X66F 2XGPA 3Q0AA 4ED6A 2E5LF 1S99A 3TAMA 2LEAA 1N48A 2BABA 4LF6F 4ILMA 1FERA 3D28A 1S7HA 2BZ2A 2HNDA 4OI3A 1X4BA 1FE0A 4RLEA 3B8HA 2R8JA 3BGFA 4FS2A 1E6VA 4NX9A 2W8LA 3M6XA 5DM6Q 2V8VA 1KLMB 3PVXA 1VLYA 2AJ0A 2FDNA 2GHWA 1RI7A 2V9WA 2E1CA 5HLFB 2B0GA 2BACA 2OMOA 3B4DA 3ULHA 2AV5A 4QWCA 2ZH3A 1TKDA 2VONA 1N5VA 1S79A 2QA1A 4ECTA 1SKRA 2R8IA 2EKYA 5FD1A 2UUCF 4J9KA 2C3UA 4DS5A 3IRWP 4DL7A 1GXUA 2R8KA 5KG5A 1L3UA 3BZQA 2E66A 4TNOA 4C7QA 2GGPB 4F4ZA 3I0RB 3MEEA 3KLHA 3O44A 2JEIA 2G13A 4KFBA 2H9ZA 4URGA 4LIRA 1LKZA 2ILYA 2CVEA 4WFNQ 3QGPA 4Y34A 2R7OA 4C3LA 2DGOA 2FD2A 3M2RA 1S0VA 3C6UA 1GQEA 2QRRA 2OLWA 4IOBA 4ECWA 1H6KX 1FRIA 3MTJA 4ERDA 3CF5Q 4F2RA 2LVWA 5DG8A 2DGSA 3VQTA 1JLGA 3OXLA 2MZQA 2V4JB 4DV5F 3SCLE 4PXDA 2OSQA 2M0GB 4EGLA 2QA4S 2VFTA 3R5BA 4YDXA 2XLIA 1VK8A 4ECYA 2OMLA 4RBTA 2ROPA 3I5AA 3DXBA 3ENWA 4I4BA 4IG0A 4X2BA 1NRKA 2V2KA 2CPIA 3PEJA 1DTTB 5E3QA 2Y1JA 1RYSA 1U1PA 5GAGI 1TFWA 3Q2SC 3V5RA 3MI7X 4EWTA 1ZM2A 1RTHB 3T6BA 2HHXA 1FNMA 2XG8A 1WG4A 1SJRA 1TV6A 2DGQA 1IKVB 2B6AA 3BSCA 1JLEA 3OR2A 2JH3A 2I9SA 2FJWA 2CZ4A 3QGHA 4JI5F 5E3CA 4O4RA 1UMJA 2RS2A 5JVGQ 3H25A 4RUHA 2IA0A 2W9BA 3BEGB 3MPVA 4PWDB 4EBDA 3LW5C 3POTA 4KV8B 2E5GA 3MZIA 3OL8A 3GILA 1UA0A 2ROGA 1NKCA 1RT2A 3H5SA 5F8NA 5FJ4A 3DRRA 2D3UA 2NLWA 5CYJA 1H3DA 3QPIA 3SQGB 3K5PA 1W25A 4I6AA 1K73T 1M5VC 4Q44A 4F3OA 4K5RA 2HS0A 4EU0A 3HHNB 3WX4A 3MMBB 3K8VA 1X5OA 3HKWA 1M1KT 2FVSA 1ZM4A 2UP1A 3IC1A 4DMZA 1Q8LA 2NZ4A 3BGRA 2UV8A 4Q5VA 4OI2A 1X4DA 5L1IA 3GE9A 2UVUA 3R5DA 4DX8H 4WU3A 3HMJG 1KFSA 3AJ2A 4X4PA 3LP1A 1U1QA 1N4LA 4LT6A 4NLPA 3FRYA 5LSOA 2XS2A 2LU2A 1JLCB 2ZFHA 4L3NA 4JYAF 5BR8F 3THTA 3PW0A 1FE4A 3UCGA 3OL6A 2WONA 2HVZA 3DOLB 5KG1A 4ETZA 1MNEA 3QJPA 4ECZA 5D77A 3SI8A 4NCBA 4OJ1A 3D5MA 4X64F 4B3MF 2DHXA 3CD6S 1HWIA 4BDPA 4CTAB 3F41A 3BDEA 4PXBA 5IQ6A 2UVWA 1XK8A 3F56A 3IWLA 2CKWA 4IOCQ 4GMKA 3UFCX 1NHVA 4A8MP 2CQ3A 4IH6A 4M63A 1IM4A 2DPJA 4DV3F 1B0TA 1HI1A 2X1GA 5CA5A 2XZWA 2AD9A 5J1PA 2P6TA 4JI2F 2ZUGA 1ZZFA 5KFNA 2ZD1A 2HWTA 1GX6A 2MYFA 3PDNA 1X4GA 4JBCA 4C98A 2RS8A 3MEGA 2X51A 1JB0C 5AE2A 2E29A 2CPXA 5KG7A 4DS4A 1SJ1A 4J9SA 2KZMA 5GVQA 2BJEA 5E2QA 5EGYA 3Q8RB 3P3DA 2HS3A 3NGDA 2GNKA 3JB9k 3OXGA 1NB7A 3ENQA 2LA6A 3GIKA 3LP0A 3SV4A 1EETA 1FKAF 2LDYA 1VQ9S 2YNIA 4K4SA 4ZPCA 1PC5A 2UXDF 2HYIB 1DFDA 2F1FA 1WHWA 1UFLA 1GXLA 4HL9A 3I96A 3IFEA 2IYIA 2FVRA 5F0UA 3NCPA 1OPZA 5B0AA 2VBYA 5EUHA 4J5OA 1S72S 4I67A 1HI0P