4RX6A

Structure of b. subtilis glnk-atp complex to 2.6 angstrom
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
117
structure length
109
Chain Sequence
b'AMSGQMFKVEIVTRPANFEKLKQELGKIGVTSLTFSNVHGCGLQKAKIESNVYERLKIEIVVSKVPVDQVTETAKRVLKTGSPGDGKIFVYEISNTINIRTGEEGPEAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrogen regulatory PII-like protein
publication title Structures of regulatory machinery reveal novel molecular mechanisms controlling B. subtilis nitrogen homeostasis.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Transcription
total genus 19
structure length 109
sequence length 117
chains with identical sequence B, D
ec nomenclature
pdb deposition date 2014-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4rx6A00
2Z0GA 1NH8A 4AFFA 1UFLA 3O5TB 2PIIA 3NCPA 4R25A 3TA0A 1UKUA 1O51A 2EG2A 4RWXA 4RX6A 5D4LA 3GSDA 2J9CA 3TA2A 2DCLA 4NYPA 1XK8A 1Q1KA 2J9EA 2NUUG 3AA8A 2O67A 3X3UA 1VFJA 2NUHA 4YB7A 4C3MA 4D3GA 4Y6IA 3L7PA 4C3LA 3LF0A 3DFEA 2GX8A 1OSCA 4C3KA 2J9DA 2J9DE 3O8WA 3MHYA 3T9ZA 1NZAA 2NS1B 2VD3A 2XZWA 3AH6A 1O5JA 4YB5A 2XULA 4CO0A 5L9NA 1V9OA 2JJ4D 4WK1A 2XBPA 3M05A 1P1LA 3TA1A 2GNKA 1H3DA 1NH7A 3OPKA 2GW8A 5D4OA 2RD5C 4OZLA 4YB6A 4USJC 2CZ4A 2ZOMA 4CO1A 4CO4A 1V3SA 5DS7A 4WK3A 2E66A 3BZQA 4IYQA 5D4NA 1HWUA 3CE8A 4RWWA 4D3HA 4CO2A 2O66A 5DRKA 4CNYA 4OZJA 1V6HA 1J2VA 3NCQA 3NCRA 4ZK7M 5D4PA 3AHPA 1UL3A 2XG8A 4OZNA 2V5HG 4CNZA 1V3RA 1GNKA 4CO3A 4USIA 1PILA 3HLUA 2EG1A 1QY7A 1NAQA 1UMJA 4CO5A 4RLEA 1KR4A 1VHFA 4USHA 2ZFHA 4NYOA 3AA9A 4Y65A 4E98A 3N5BA
chains in the Genus database with same CATH superfamily
5ETOA 2QX0A 2WVDA 3NRBA 5D78A 3NG8A 3ZZZA 2R8HA 1S1XB 3KNAA 1N5QA 4WZQA 1NSQA 1NHKL 4OI4A 4EI2A 5BR8J 4GVLA 3VGVA 2J0QD 3VWSA 5LSOA 1KD1T 4W92B 3I9ZA 4TU7A 4HHJA 4E8UA 2OO4A 2V4RA 3HM9A 4I2PB 4ZVPB 1H2UX 2Z56B 3G71S 2IVYA 3K57A 2H9ZA 2LXFA 3FSIA 3JSMB 1ZZNA 4DQIA 2B3TB 2CPXA 4DX7A 1YJ9S 3W9JA 4M5NA 5C2GA 1UW4A 2K7KA 1HKAA 3O44A 3GIJA 4K4ZA 1F9HA 3G9CA 3H4DA 2MQMA 2KZMA 3SIPB 1CQMA 1CC7A 3QGHA 3HFZB 3CDWA 4TLQA 2VQFJ 4NOHA 1RBOB 1JKHA 1IUJA 2HZVA 1HPZB 2XWYA 3NL0A 2C2MB 2FGCA 4X4TA 3CUNA 3GFZA 4PPZA 5CCLA 2CFXA 2J9CA 1U0SA 3MR2A 3J7YU 1JK9B 2C2OB 4U7UK 2EW9A 3MCNA 1WKKA 4C0OC 1U6FA 5JVHQ 4DSJA 3D68A 4NRUA 2OTJS 1F60B 1T95A 4A8KA 2D3O1 3SZ2A 1S4FA 1CJKB 5E3CA 3DLGA 3I0SA 4QWAA 1DTQB 4DZDA 3GE9A 2QO3A 5I3PA 4YOEA 4N76A 4M94A 3M8ZA 4OHZA 1HLWA 3ILIA 4ZKAA 2DGUA 1CBKA 2GQ2A 1BQNB 2MSTA 4IG0B 4IYQA 3QZ8A 2LU1A 4IRDA 1YHQS 3L4BC 3KK3A 1YRTA 4L76A 1XJWB 4MKBA 4CNYA 2RILA 4J9KA 4ED6A 2JFKA 3EGNA 3QGGA 1YRXA 3A3NB 3AOCA 3CC2S 5J2NA 1N5TA 2PA3A 2CQPA 5KT6A 3HK2A 4CO5A 4CLSA 5IZHA 2DT9A 2QYCA 3QIPB 5DG9A 3F0NA 4OX9J 1R3NA 5KFWA 5CH7B 5T41A 1XTZA 1C4AA 1E6VB 3IWNC 2XMTA 2KM8C 1NU4A 4ZITA 2YKNB 3IP0A 1CJUB 2AD9A 3AJDA 4I67A 1XMQF 4USUA 1ZTWA 1S48A 3FMWA 4FYDA 4ZVRB 4RO0A 3K5NA 3TWZA 1DAXA 3TEGA 2R8JA 4NLQA 3K5MA 5KFIA 3Q89A 1F9FA 2GGPA 1RTHA 1WORA 4W4MA 3EZUA 2UUAF 4RUBA 2DY1A 3PYEA 2VPXB 2B8PA 1RACB 2JLFA 1RYRA 2FY1A 2CZ4A 1XC9A 4IO1A 2G2OA 2DNGA 1M90T 1IKWB 3MPDA 5JVGQ 1ZETA 2ZWPA 1NHVA 5KT3A 5H9EJ 3M8QB 2FVCA 5CQGA 1OMSA 3I56S 2MXYA 4DV7F 1QTMA 4NI2B 4OI1A 4USIA 1N5YB 4JYAF 3OBIA 1HYSB 4QYRA 4AL7A 4AFFA 2I0XA 1EX8A 2NSCA 5FJ4A 1WF1A 4DR5F 2R3VA 4F4ZA 2VOOA 5LMUF 5HAOA 4KY3A 1SH3A 3M6VA 5E0OA 2NCKL 1RAOA 1EP4A 4ES2A 3MFIA 5HMXA 3J80U 5KOWA 1M5SA 5EHHA 2HHPA 4FZVA 4DLGA 2E29A 2RF2A 3R97A 3DMJB 5A2QY 4A8OA 5DM6Q 4DPXA 4DR2F 3PHEA 4L72B 1TL3A 5DO2A 1E6YA 5H9EK 1RADB 1YLXA 3THVA 2ZVSA 4ZLPA 2K1RB 1FA0A 2VFTA 2YBVA 2X1FA 2V9KA 3J81j 3AB4B 3SMZA 1IXKA 1XMQJ 2NXNA 5M2UA 2F5GA 5FDLB 2CJQA 4S0MA 2W01A 1C4CA 1YBAA 2HNDB 3IBWA 3UW1A 3SDEA 4Q2LA 1Q78A 3B54A 1TMJA 2FC9A 2GFFA 3TYTA 4PAAA 1ROFA 1PJ7A 4I1TA 4ED1A 1HQEA 4QPXA 4WE1A 4QIVA 3HHLA 4KGZB 3W8GA 4JP8A 2EBEA 4UQGA 5F8LA 1X9MA 3POTB 2DNHA 1S6QA 2HPUA 2BKPA 5EX0A 3DYAB 4NLTA 1KQFB 4C3MA 4DV7J 1VISA 1UJ6A 4JI2F 2ZITA 3FK4A 3WDOA 1Q53A 3OL6A 1UFWA 3KKFA 4JYAJ 2W9BA 1SKSA 3Q83A 2CPIA 2VIHA 4ZJOA 1VI7A 4B3OB 1YI2S 1GMWA 4PG5A 5F41A 5GAGU 2YX7A 4DR5J 1S9FA 2ZKTA 2GQCA 1X60A 3CCQS 5A8KB 4X84A 5LMUJ 1R27B 5GMKa 3IGNA 3PV8A 3SI8A 1KVKA 2W9AA 2OTLS 4DV6F 3I0RB 4WFYA 1Q0NA 1M5OC 2VDIA 1S1TA 2VG5A 2FLOA 4I0WA 3GG1A 2M3DA 4XPCA 5KG4A 1OPZA 3NGTA 1TFWA 4DR2J 3DOLA 1TKTB 1D9FA 5FIIA 3JYTA 2HVHA 1QDUB 2HURA 3Q2SC 1S6UA 5CYQB 1BLUA 2CPHA 3A12A 2HMIB 5ETQA 4N7TA 2X1BA 1KSPA 2O1PA 2PO4A 4X4SA 4LVOP 1FD8A 1CG2A 4GKKF 3QFWA 2MQOA 4B3MF 5BYSA 2HRYA 2YPYA 1YKWA 2PDAA 2HGLA 3T1HF 4LFBF 5JJBA 1CVJA 2P6SA 4IFYA 5D0RA 1KWMA 1VIOA 2C2RA 1Q8KA 2GC8A 1S7HA 3OHBA 2GNKA 1UP1A 3VALA 4MFBA 5EWFA 3V81A 3DRXA 3LGHA 4EFAC 2WONB 2AJ2A 4HI2A 1NPKA 2W2OP 4NLPA 3UD3P 4FNIA 1JLBB 4RL1A 2N4DA 2XYPB 1RT6A 1HNWJ 2E5LF 1PBAA 2V5HG 4C9DA 1OY8A 1ZA2B 2UXDF 4QR2A 2XZDB 2CQIA 2BR0A 4AT1B 4DV6J 3HHDA 2P5VA 3BH6B 2DR5A 3KHGA 3MEEA 1L5UA 3CC4S 2HWHA 4U6PA 2HNYB 1FRXA 1HI1A 1NK0A 5HATA 3A8JA 1QAXA 4KV8B 4PQUA 3R9LA 2CQ0A 1GH8A 4NZ6A 4P6QA 2BE9B 3TZYA 4NPOA 4CI0B 1D09B 1RKJA 4KE5A 1RUSA 1KTVA 4OLOA 5C2CA 4NL5A 1Y3KA 4GKKJ 4Q8FA 4M5KA 3CCZA 3M8PA 4ELUA 1Q82T 4B3MJ 3HJVA 1KFSA 1WC0A 2KTQA 3T1HJ 3FC9A 5GAEI 5KFCA 4LFBJ 1KQGB 3BPDA 2MKHA 4WTYA 1H38A 1CQNA 3HJFA 2LVWA 4ZLJA 3NMAA 3AOAA 1KR4A 4CM2A 1VJWA 2U1AA 3ISZA 1PO6A 3N5BA 1JLQB 6AT1B 1PJ5A 4OYMA 2JC1A 1WJ9A 2CA9A 3GSDA 3FQKA 3OSNA 2CZ9A 2WW4A 2QEXS 5HLFA 1NNDA 1TTHB 4HEA9 3AXMA 1TP7A 2E5LJ 2FJEB 2V0NA 1X8DA 1VQYA 5KFNA 2C3YA 3J81Y 1Y5NB 2X51A 3D0HE 3KUHA 2CG8A 4USJC 5KT7A 4ZP8A 2XWXA 2FD2A 3IXQA 2AU0A 3GIRA 2OMOA 3IWLA 2G13A 1EARA 4F4WA 2J8AA 2MGZB 1BUXA 1WACA 2CPJA 2NXUA 2HQCA 3ILLA 1FJGF 5D0GA 3R3TA 3MEDA 2DNNA 1T9VA 4USTA 3TA0A 4DN9A 1XMOF 2H65B 4ZLLA 1TUVA 1T9UA 2LQ8A 2HLUA 3OFGA 1NK7A 4NZ7A 5KT2A 3I82A 2W4DA 3BQ1A 4UOHA 2ZE2B 1RI7A 2PT0A 4OJGA 2VKZG 4UTGA 3I31A 1UWBA 2HQGA 2HHHJ 4X4PA 3S6EA 3W9HA 3HXMA 4NLYA 4DCOB 3G96A 1ZPWX 3OTCA 3SBMA 1AFJA 2R9LA 4J9PA 2RD5C 3JS9A 1ZOTA 1RA7A 4WK3A 3VGTA 3CF5Q 4JV1A 1HD1A 4P75A 3NGRA 5L1IA 3D66A 2C3UA 3JSYA 3ZFVA 2JEGA 4ID8A 3MD3A 1AZSB 2QSWA 4ZP9A 3ZO7A 3TW0A 2VA3A 5CCMA 2XO6A 2Q66A 1X5PA 3S8SA 5D3GA 3NS7B 2DNRA 2GHWA 1T05B 4NEYA 1RTIB 4BWMA 5IOLA 1RHMB 2MLZA 4ALZA 4RWXA 4WF9Q 5CA5A 2LQ5A 1MW7A 1RWPB 1JLAB 4QWDA 1CSJA 4K50A 4KGKA 2BJ1A 1HNIA 4Y6IA 3C66A 2M8HA 2ZBIA 3LF0A 5CD4A 4FF3A 1OSCA 1IWGA 1GEHA 3D6FB 5HANA 3HKWA 2GJ2A 1TV6B 3FQLA 4NCGA 2VU5A 4ED3A 2ERRA 5HP1A 1YBTA 4OI2A 4WTOB 1XMOJ 2V8VA 1BQMB 2V34A 3F56A 5HVFA 4DV4F 2AEMA 3V6DB 1H74A 3OT9A 4FF4A 4QWCA 3HO1A 2Y1IA 2G0IA 4QZVB 1VS3A 4RWWA 1X4EA 2N3OA 1H6KX 4DL7A 2DR9A 2W1BA 3PTWA 3PIOQ 3Q86A 3AQPA 1PKUA 3TQEA 1F1BB 1WI6A 1YJNS 1M5HA 3EICA 4FXWA 2QZ8A 1G4CA 4A8QA 2C3PA 1K0TA 3LAMA 4FKXA 2FVRA 3MURP 4I2PA 1U1PA 1BHNA 4ZCKA 4OYIA 4LUBA 4WBFA 2HYIB 3G87A 3N79A 1FESA 4AYBD 2A1BA 3OUYB 4MK7A 3MCMA 1D3WA 2DXFA 4AL5A 1URNA 4PWDB 1N34J 1HPZA 2E44A 4ZLNA 1WHWA 2EFVA 2FGOA 4TLRA 2XCAA 3U27A 4OZ0A 2Z58B 2FJXA 1Z1ZA 3HMJG 3ICLA 2XMVA 3I5BA 4LRCA 1UL3A 1VQ5S 2PFFB 2XG8A 4N47A 3OVBA 4LF7F 4G6VB 3ZZTA 2H5IB 4DV4J 3ZNJ1 1CJKA 3E01B 4HACB 4ED7A 4IRCA 1DTQA 5DQIA 3WBZA 1NHUA 4RNOA 2DH9A 1O8BA 2AMCB 3G6VA 1JLEB 2L41A 2J9EA 4RW7B 2LXUA 3L7UA 1KDNA 3SEOA 1PSDA 3BBBA 2QYGA 4KHMA 1Q8LA 2IC3B 4DV0F 1EHWA 3JQKA 2QMWA 1FCAA 1OYEA 1FERA 2CNNB 3P5BP 3CJKA 3QT6A 2CJBA 2I1RA 2KRBA 3UR0A 3E3XA 2C42A 2YNFB 3QIPA 3IFEA 5GMEA 1UCNA 5HJYA 2V2VA 1ULRA 3WHIA 1IBLF 4IRKA 2XMAA 5HK4A 1S6OA 1E6VA 3IWXA 3JQJA 1A9NB 1JJHA 2QE5A 2OELA 3IR6B 2W8LA 1P1TA 2A18A 2BJ9A 5HJXA 2YKNA 1CJUA 3I6PA 1KVJA 3BSAA 2MSSA 3CCJS 3CD7A 1QY7A 4Y2AA 2DY9A 3RZAA 2XY7A 5CD4H 4RU2A 2XS5A 4KSEB 3NLCA 3ZZYA 2KT5A 3AFGA 4W98A 2XGPA 4MIWA 3S7RA 3TUJC 4RPFA 3LP0B 4K2XA 2CJXB 1HI8A 3HPOA 1B99A 3BGUA 1IBMF 3PX6A 1IKWA 1N6QB 2M0GB 2RRBA 1VRTA 2NS1B 1W2BR 3M8QA 2Y8YA 4YB5A 3FCHA 5H1SV 1NPRA 2E7XA 4NI2A 4OX6A 1XNRF 2FLPA 2UVRA 4C8OA 1N5YA 2VG7B 1HYSA 4ELTA 2EBGA 4YB6A 2RSQA 4ZPBA 2W2MP 5E2QA 3KXDA 4ZPAA 3BZQA 3DN9A 3UWTA 5DG7A 1CULB 2UUBF 1SBRA 2FYXA 4DV0J 4DFPA 1U1NA 3CDUA 5M2PA 1T7PA 5T14A 4WKYA 2LA4A 3EX7B 1NXIA 2DHXA 5L1JA 1B7YB 4FPRA 3AJ2A 4DSIA 3H98A 2MHEA 4PYDA 2ZUGA 3DMJA 2SXLA 1IBLJ 1SQEA 2VDHA 2WW8A 1N4LA 3JXOA 4RKUC 1TL1B 4RNNA 3ZNUA 2K1RA 1ZM3A 2YWKA 3GMGA 3SSSA 2OEKA 3GYNA 1S59A 3Q8VA 3PFOA 3G2XA 2J7KA 3NAIA 5FDLA 1VQ7S 2C2DA 4M5HA 2HNDA 3NXZA 1P1LA 4RU9A 1KP6A 1X4BA 4ES1A 4URQU 4PUOB 3BKFA 1VQ6S 2IHR1 2DNZA 3Q8UA 3P5TL 4DR4F 1IBMJ 4KGVB 2HWTA 3QFHA 2RS2A 4PR6A 3POTA 3R7NB 4H4KA 3WC0A 1LWFB 3DYAA 4TVAB 3MOJB 1LW0B 9RUBA 1U1RA 4OZNA 2DR8A 1AXQA 1XNRJ 1KOHA 1PYOB 4FDFA 4V19J 4DSLA 1NB2A 2HHXA 1Z2LA 1LWXA 5KG1A 1RAIB 5G4DA 2R7WA 4B3OA 2ZEJA 4K4WA 3OR1B 1X0FA 4Y34A 4NLXA 2UUBJ 4AXJA 3MEKA 1S1WB 2OPQB 1VC5A 3JTOA 4N41A 2VFUA 5KFDA 3PW7A 5RUBA 3I0RA 3G6ES 5D77A 4Z7YA 2JC0A 4Z37A 3CCES 4KTQA 2XHCA 1GMUA 1VBZA 5L46A 1FKPB 2AV5A 4TN2A 2MQNA 2ZH1A 1TKTA 2MZSA 3O6QA 2HFVA 1MN9A 1NH7A 1WC5A 1NPPA 1ZAVA 1MLAA 3K89A 2R7XA 2WAQD 5J2MB 5CYQA 1XERA 1BD6A 2HMIA 1C0TB 4DSEA 2D1CA 2QLXA 2PEBA 3BYRA 2BMBA 4DUYF 4X4UA 1HHSA 3F44A 1QSSA 3QBCA 1NK8A 1JMTA 4OHXA 3CCMS 5I3UB 1S77D 4GKJF 3J7YI 4YMEA 3VVUA 4Y2KA 3UDEA 4XPEA 1UVJA 2P9CA 4DR4J 3R5AA 2YKMB 1X0PA 4EZ9A 4AL6A 3BBCA 4XDDA 3MR6A 4DL2A 3UN2A 4U67Q 4D3GA 2O3DA 3FEXB 2QLJB 4RBTA 1SIWB 4ICLB 4C6AA 2QLWA 4L74A 1OS5A 2D9OA 1PC4A 3DM2B 4X66F 2RHSB 3RTVA 2EK6A 3NGUA 1FJ7A 3D54A 3LO3A 3AJ1A 5ETMA 2RDJA 3PYGA 4ZS6A 3B6BA 2E1CA 3VCDA 4Y28C 1QSLA 2COLA 4N56A 3FCWA 3DC2A 3V4MA 3OXLA 4YUDA 4C8MA 4W90B 1LK7A 5LT5A 2I8EA 3GR0A 4OZJA 2F9JA 2NZCA 1VQLS 3CIZA 4J9RA 4X4RA 1V3RA 4AXIA 3C2PA 4I56A 4R5PB 4JI7F 2HNYA 2CPEA 1SV5B 5C25B 3KJNB 1SXLA 2R2RA 5HQMA 4JI1F 2GV1A 1LWEB 4F0KA 4OLPA 1TELA 1TU0B 1WEYA 1V5VA 1RHRB 2YQ3A 2R8KA 3QSYB 5BXIA 1Q8IA 4FF2A 4RW8B 1X31C 4C2MA 2KFYA 4DUYJ 1IVZA 4M5LA 3TX8A 1LWCB 3TRGA 5ETVA 2E5GA 2DPIA 1M1KT 2WVEA 4O3RA 3H5XA 1QAIA 2HFSA 3CJ5A 4Q7AA 4H4MB 5L9NA 1ZH5A 1X4FA 3QLHB 1T3OA 1DHMA 3DRYA 2PFDA 4DHVA 1AA1B 4H4OB 1KTQA 4M8LA 1T9TA 1RCXB 3N0VA 3H25A 1NJYA 2FLNA 2MHNA 3R7BB 2Z30B 2B7BB 4X66J 3V6KA 2AYMA 2B9XA 2GA7A 4FS1A 5ETNA 3R7SB 3U1MA 8ATCB 3LA0A 2LP4A 5KFOA 4CCHA 1HNVB 1BXNA 1G7CB 1A6LA 1FRMA 4G1QB 4YB1P 1Q86T 2EC2A 2VONA 4IOCQ 1N54B 2IM3A 3KOAA 1SH2A 3H42A 4O3OA 2IAJB 2RVJA 2V8DA 3R5JB 3K5LA 2LU2A 2MGZA 3A1YG 2DEIA 1F9EB 1RKIA 4JI1J 2RB7A 3FRZA 4UT4A 4DLEA 2WVFA 2XLJA 4RNMA 2BJ7A 4CLUA 4RNFA 3D6HB 4A47A 1HBNA 3VQSA 3J7AN 5F8JA 3HZEA 2OEMA 3BQ0A 4J9UE 1B4SA 1MNEA 4C97A 2IBOA 1R0AA 3ZZPA 1VCTA 3BGRB 2ZH3A 3OFEA 3BEGB 2LMIA 2IRYA 1MSWD 3SXLA 2LDYA 3PRVA 2DIUA 2AJQA 3NP5A 2C2KB 2K3KA 2CQCA 3H0PA 2ZE2A 5F8NA 2MKYA 4USHA 2IMOA 3DGVA 3PW2A 1RSCA 5L38A 3HDSA 2QIFA 2Z2YB 3ETMA 1U0HB 1VBKA 2FHJD 3MAHA 1Y10A 3BN7A 2QLFB 2HS3A 4B3TF 2YNHB 2B56A 3JTPA 2FZKB 4WP8A 2QG9B 3DU5A 4I68A 1DQAA 1VYAA 2V68A 2J76E 1MWYA 2P6TA 1RWWB 2FPHX 1M5KC 1B70B 1AZSA 3Q22A 2UVUA 2DYAA 2MQLA 2VZ9A 1T05A 1RTIA 4F4XA 2CDQA 2XCPA 1MN7A 2UZAA 5LMNF 1OWXA 2XGQA 1FFGB 5KFYA 1RWMB 1XIQA 3GV7B 2BE2B 2I5JB 3OTOJ 4CO2A 3ZXWA 3KLHA 1JLAA 3GZ7A 1UWAA 1RAJA 5H9FJ 2EK1A 2M5YA 3OHAA 1K47A 3SCLE 1TV6A 3MCSA 2KHDA 4F2RA 1SJ1A 3QAEA 2ZDPA 4CM0A 4G1IA 4U7CA 3V6DA 2G4BA 2J6SA 4UUWA 4M63A 2W8KA 5IT9Y 2HLTA 3WX8A 2IJNA 3ADAC 1SKWA 2VKRA 3PYFA 1PCAA 3GPAA 1B3TA 5E33A 3LTOA 3G82B 1HWKA 1S6PB 1SC1B 4NLVA 2DHSA 3MMBB 4WFNQ 2WTFA 2XSJB 1OY6A 2X7IA 3LPEA 2E66A 3CWJA 5KFFA 2CQHA 1IBKF 2D3OR 4EBDA 2AX0A 2XO7A 1HMVB 2H48B 3HF5A 3OLBA 4CLWA 3RBEA 2OSQA 2HIQA 1KLNA 4K4VA 3CCTA 2F1FA 2Z4PA 3N6NA 1WKLA 3AQOA 2FHOB 2PE8A 4GC6A 3OUYA 5LMNJ 1XR5A 4X4VA 4ZVSB 4EWTA 4QWBA 1FK9B 2HFOA 4EEYA 3UVJA 1REVA 2HS0A 4F0HA 4PWDA 3D6MB 2C2ZB 2DR6A 1VC6A 4HKQA 2RAQA 1MMDA 4HDGA 4DL0C 3NOGA 3R2DJ 4MT1A 1URRA 1U02A 3NGSA 2RU3A 4A8XA 4QR0A 1Q79A 1S9EB 1EQMA 4MKYA 4Q8EA 9ATCB 1G6BA 2V6AA 4ECQA 4A46A 3E01A 3FBCA 3MM7B 1BMQB 3QPIA 2QA4G 4OZ1A 1WG5A 5DZ6A 2VH7A 3HP6A 1NDLA 4YP3A 1N52B 4LFCF 3JAMY 1W2IA 4RW7A 4NA3A 1SL1A 1NRKA 1PYTA 4U8YA 2IYIA 5ITHA 1S4EA 3N6MA 3CD0A 2GAHC 1FRLA 1F3VA 1UFLA 2E1AA 2KG1A 2BEFA 4J7CA 1CS4B 3GONA 4OHVA 3SQGB 3C15B 2AIRB 4DV2F 2IA6A 2VC0A 2YNFA 3UD5A 3KLEB 1IBKJ 4MMOA 4DQSA 2MYFA 3AT1B 4Z2XA 1Q5VA 2CKWA 1FWPA 2GZOA 3WIVA 2E5IA 2VFSA 4KQZA 5KFTA 5GADI 2VD3A 5L1KA 5D8HB 2CJ9A 4Z7CA 1JLCA 5LXRA 1IN0A 1PG5B 2V63A 3M05A 4IO9Q 4ZCMA 3RR8A 2GW8A 2ZNZA 4C98A 1UEKA 3ZTRA 2CWXA 4M5MA 2DXDA 3MAQA 4KJIA 3R5BA 4I7FB 3QJJA 3DLHA 4IH7A 2EFNA 1KQSR 2HHVA 2F8MA 5A2QU 3PX0A 3NGDA 1H2VZ 3LP0A 3KMSA 2GS8A 2VICA 4QIFA 5IXUA 3P4UB 1GTEA 1NBEB 4YHHJ 1YG0A 1PILA 3T5KA 2ZH4A 1YJVA 4KRWA 3PEJA 3P3DA 3GYXB 5J1EB 4DPTA 3SSQA 3CJ4A 3QGIA 4QJVA 4HR2A 5KT4A 4WYLA 4LFCJ 3CXCR 3T1AA 2YNGB 3THTA 2VG7A 1MMLA 3C6TB 3HVTB 5A0YB 5F3TA 1RABB 4C7QA 5KG3A 3PRBA 1IKYB 1VQMS 2FHMA 1GXUA 2RKIB 1CULA 2KXHA 4M5GA 3QATA 4KPYA 3R1LA 2CAJA 3M4XA 1WDDA 4Q0BB 2YKQA 3ITHB 3OVSA 3RBXA 1GQEA 1NMEB 5E3RA 3DDIA 1VQKS 3PX4A 2ZWOA 4HLBA 4QW9A 4PXDA 5KFZA 1VLYA 5HQLA 3RJMB 2DGXA 4O3QA 1I6JA 4DSKA 1N32J 2ASJA 1WUUA 3EVWA 3QO9A 1X7VA 2E1RA 3G86A 2HHTA 4F3MA 4IDKB 3OR2B 4BLGA 3M2RA 3GLJA 4FKYA 3N28A 3V4IB 3DLLQ 4USWA 4HT7A 5IFMA 2BM0A 4P52A 1CJTB 3FNNA 4N8NA 3K8WA 2LQ9A 1TVRB 2IPOB 5HMZA 2FIUA 3C16B 3MM8B 1I5OB 4M1KA 2FZGB 1LFPA 2G2YA 5A8RA 1Q8BA 4PUOA 5B0BA 2NR0A 2J8SA 3L7OA 3DOMB 4IH6A 1R6VA 1HW8A 1LWFA 2XULA 1FXLA 3RW7A 1LW0A 4ZA1A 1U1MA 3VZHA 1AYEA 4AE5A 2XBPA 3F41A 2OSRA 2AJFE 4ANDA 1SVDA 2MQQA 3VVTA 3N5FA 1KFDA 1RHKB 3DGPB 3OR1A 3G4SS 2KI2A 2HS4A 1HL6A 2G1DA 5CYMA 4LBPA 4WCEQ 1RT5B 1VQOS 4CYUB 2ALZA 1S1WA 2ZH7A 3NCRA 3R5DA 4B3RF 1YZ6A 3KLFA 3EUNA 3GV8B 3DLJA 1YVFA 4K4XA 1OJ4A 2F3JA 3E51A 3I9V9 1HHQA 2HHUA 2R7QA 1FKPA 2L9DA 1HR0J 2IM1A 1WNEA 4ZVEA 4DR7F 4X64F 2OUGA 2MLXA 3P49B 3TANA 5I42B 5K20B 1L3SA 2IFXA 4USMA 2ADCA 5DGBA 2DRAA 2CJYB 1IKXB 5AE3A 5J2MA 1C0TA 2E9TA 2KVIA 4ED2A 2YH0A 5B0EA 1I94F 4G3IA 4LR7A 1T3NA 3LQVA 1WELA 2GIFA 1KHWA 4ILRA 2A2CA 1F0XA 3D1OA 2VHGA 2K7JA 4DU7A 2JDJA 3C14B 5I3UA 1XNQJ 2F4VJ 3G6YA 4ETXA 1DTTB 3ENVA 4EBCA 1R0CB 1RT3B 7AT1B 1O6XA 3H20A 3D6TB 4WFZA 2CIMA 3G6XA 3Q8RB 2YKMA 4LVNP 4DL5A 2Y8WA 5K8MA 3BKUA 4XTTA 1C1CB 3DLBA 4ICLA 3H2LA 2JH3A 4BWJA 4DPYA 1WOPA 4CTAB 3DM2A 1WG1A 3KK2A 4I2QB 5B09A 1D9DA 2JSXA 1EQ0A 4IH5A 1M1HA 1KKHA 3V6JA 4K5RA 1HNZF 3SCJE 4KH0B 3CJTA 4IQXA 4ITSA 2B5JA 4B3RJ 2XSFA 3T9NA 4YN3B 1K9MT 1ZPVA 1AW0A 2OPRB 4ZHRA 5HSPA 3THPA 2YTCA 3LAKA 4KHRA 4DR7J 4X64J 4M5IA 2LEAA 2HZCA 3Q8YA 4KIAA 4R5PA 4ILMA 3O1LA 4IUFA 4OI0A 5KFEA 4ATNA 2DVIA 4ZVHA 4CO1A 5BR8F 2UUTA 1FRJA 1LWEA 4KO0B 1N5SA 3MECB 4M5JA 4ECRA 1TUWA 4K4UA 2EFOA 3J81U 1I94J 1N0VC 3MMAB 4C0HA 2KYXA 4ZK7M 3HHLC 4RW8A 1LWCA 4FP9A 2OAUA 4NWBA 2XYGB 3UE2A 5LOQA 4U7UD 2OGUA 3AXKA 4JI5F 2NPIA 4ZPCA 1XQIA 1UPMB 1K1SA 3MR3A 3BS9A 2U2FA 1VQNS 4H4MA 2XTJP 4K0KJ 3QLHA 2NUUG 4P10A 4WU3A 3GCXP 4H4OA 1S72S 3L7PA 2QA1A 3F73A 3PJWA 1RHUB 2E7VA 2VQFF 2OH2A 2WVCA 2ZJQQ 2AF6A 1F6TA 5T7LA 2WBMA 3KFWX 3B4MA 5LJ3Y 4OHYA 2W7AA 2JVOA 4DUZF 5HMYA 5BYRA 1HNZJ 2KXFA 1HNVA 3D1HA 4I69A 5DJBA 3LGMA 4G1QA 1BQXA 1RT4B 4J37A 4KGMA 2ATCB 2EPIA 5L39A 4HL9A 4OYAA 4DL6A 3TUZC 5DLFA 4OX7A 1S1UA 2L3MA 1SQGA 1CJVB 3HT3A 2FJWA 4WZMA 1JXVA 4M95A 1RU2A 4LF6F 3OXFA 4NXMF 2DCLA 2Q6BA 2G0CA 4QU6A 3UCGA 3ULHA 4QQBA 2XMKA 4HTJA 1ZTTA 1RT2A 1RGVA 1FT8A 3O8WA 4OX9F 1RJJA 3DLKB 1WTFA 4ZVGA 4JI5J 3BGRA 5BYQA 1UVNA 5MAOA 3FJ2A 2RQCA 1TKZB 4WK1A 3UNYA 3R1HA 1SJ4P 4IFVB 2QJ3A 3MZIA 3GJSB 4DJBA 5ETKA 3TEHB 3HX9A 1R89A 1TK5A 4DCPB 3OFHA 1NEEA 1U0HA 2WVBA 2AT1B 3TP2A 3TUPA 3T41A 4DR1J 5AJ3F 2CQBA 1WC6A 4DUZJ 2EG1A 3L09A 3A8EA 3R2CJ 3JQMA 4DX8H 3RB6A 2I2YA 3PXGa 2RRNA 2ZH8A 2DIVA 3FMBA 5THWA 3BBFA 1WEZA 3TNVA 4LT6A 2OJ3A 3NNCA 2JEIA 4KR0B 4DPOA 1NZ8A 1RLDA 2YWWA 2BE2A 1SC6A 2I5JA 2WSEC 3P8BB 2RMLA 3GU0A 1NLKL 3GJQB 3TARA 1VC0A 3MMCB 3AH6A 4BDPA 5F0WA 3PO5A 5HBMB 5KFHA 4LF6J 4LJMA 4CLFA 4G1PA 3IRXB 4DCJB 4NXMJ 1FJCA 3FUYA 3QAUA 4OYZA 3M8SA 2UP1A 3PM9A 2UUCF 5HN0A 1EKSA 5E41A 4PPDA 3RU0A 1F3FA 3SCIE 1F2GA 1S12A 2P2CB 3Q0AA 3W5ZA 4Q43A 2YWHA 4Y00A 5HL7Q 1NDCA 4ENOA 2GMJA 2OFHX 2DGQA 5I4MA 1VQPS 1YTYA 4CRJA 2MKIA 1VHIA 4F3QA 5KG0A 2EG2A 4YR3A 3DLGB 3G82A 3DCAA 1S6PA 2BW7A 4YY3F 4AQYF 1CPZA 3MMBA 5AXLA 3EMTA 2BW2A 1NJWA 4F0MA 2XSJA 5AJ3J 4BHQA 4DSFA 2GJIA 2VPYB 1ZAXA 1X5SA 3RYLA 2A6OA 2LQJA 3K8VA 3WIUA 3KK3B 2QMXA 1HMVA 2GQQA 5EUHA 4CT8A 3ZC4A 3MR7A 3S1TA 1IBCB 1R6YA 4ZPTR 1ZS6A 1CC8A 3RRKA 3I5AA 2XI2A 2OKQA 2JL9A 2ZM6F 2D74B 1LKZA 4QPTA 1IR1A 8RUCA 3H40A 1FK9A 3HSJA 3CNQP 3LWMA 3VAKA 2G1HA 3B78A 3IR5B 4KB7A 2X1AA 4RUCA 4EZ6A 2BKNA 3W65A 1FX2A 3BSOA 2HBYB 2G9OA 1S97A 1DQ9A 4NLDA 2PI4A 2UUCJ 2ZFHA 4EU0A 1OQ6A 3M9NB 1UKUA 1WF2A 3TOQA 1VJQA 1S9EA 1C0UB 3TAQA 2GGPB 2A10A 3WZ0A 3FZ2A 2GO9A 4TQSA 4ILLA 2VOPA 1KQKA 4NLRA 4CZCA 3MM7A 2KFZA 2PEHA 3BV8A 4PYAA 4ZDNA 5GAEU 1FTRA 5AXNA 4XK8C 3VTIA 3WX4A 1NK6A 2RT3A 4OQJA 2DNYA 1RWUA 2LQBA 2NYIA 2Q43A 1NCLA 1VR6A 4TNOA 2RDDA 2F63A 3JSRA 2HFNA 4YY3J 3QWUA 4CDIA 3FGVA 4KYZA 4AQYJ 1WC3A 4ANCA 2J6UA 4FF1A 3MGJA 4O23A 3EDQB 4NCBA 3SQGA 3C6UA 4PCQA 1FWKA 3KLEA 3C3LA 1S5ZA 3LUYA 4DI6A 2HVDA 1BY9A 4DX5A 1EJ7L 4QOTA 2RQMA 4MTPA 1KOOA 3A8IA 3HKZD 1Q16B 5KFPA 2HK2A 2Y0BB 4OYBA 2DISA 4TY8B 3SFUA 4U9RA 2KJVA 2ZM6J 4R25A 1SL0A 2JRSA 1SB6A 1I51B 2C2NA 1VLOA 3OVAA 2XM3A 3UN5A 1HNWF 4ED0A 3ZZOA 3CMQA 1KNZA 2MDAA 4I7FA 1Y4ZB 3CCSS 4M5DB 2JEJA 3VAHA 3AAWB 2AEFA 2R7SA 1QE1A 4C0BA 1W26A 5C24B 1YJ7A 4YR2A 1LOUA 1NSAA 4LBIA 4DS5A 2IIHA 3UI3A 4UOCA 4X4OA 5C42B 1N0UA 2PMZD 3NNAA 3E8OA 4QBUA 2GIQA 5D4NA 4O0IA 2YNGA 4B9VA 3C6TA 2E1MC 3HVTA 5A0YA 4QYZJ 3Q8PB 2NLWA 2WSFC 1FVQA 1IKYA 2N7CA 4K5SA 2RKIA 3TJ9A 2XS7A 4UW2A 4PRFA 1S1VA 1HD0A 1AFIA 2LDIA 4Q0BA 3TA2A 1S7IA 5GMDA 2DXEA 4O3SA 4ZPDA 1U09A 2DNOA 2VG6B 4RNHA 5D15A 3OV7A 2JHEA 2Z8QA 3D3CJ 3ZTOA 2EFQA 2DCUB 3K2YA 1NKCA 1SPBP 1S76D 1RAEB 2V2QA 3KJVA 1VRQC 3U1NA 3A13A 3BPSP 4F67A 4K59A 1HARA 4IDKA 3OR2A 1H2TZ 3MDFA 2HW3A 1PAEX 2B0GA 4CLLA 3QRRA 2BJ8A 1VOMA 4KFBB 2BBEA 4ECTA 4EO8A 2PGCA 2DR7A 3KJQB 1BWVA 2AX1A 6FD1A 1TVRA 3W64A 3C16A 2B9EA 2VF3A 4C8YA 4MYTA 4O4GB 4LF8F 2HHWA 2RUGA 1YK9A 3DOMA 3M6WA 5I3QA 3CO9A 3W61A 2JEFA 3MTKA 2AWZA 1UVMA 2CJKA 1UZDA 4I4BA 2DGWA 4PXBA 3BO4A 2ZBPA 4YDDB 2Y1LB 3IAM9 2XYHB 4ZPWR 2VUGA 3AD7C 4IFYB 4MKAA 4LRAA 1N5VA 2YH1A 1YX2A 1N48A 2JVRA 1WD6A 3QT5A 1KONA 3DGPA 4MFBB 1N56A 1TL5A 1FKOB 1RT5A 3LGNA 2FHJA 3OJUA 3K58A 1YJRA 4ECSA 2ZDOA 2AZ1A 5KFGA 2FVQA 2ASYA 2V67A 4B9TA 3U7JA 2D7SA 2RQKA 3NNHA 4KH1B 4TU9A 3KHHA 3LALA 4OZ5A 2R42A 1TAQA 1V5IB 2O66A 2HHHF 2BQRA 5C7PA 3GSIA 1IKXA 2WRMA 3MFHA 2QL9B 3TO8A 2HRUA 4Y2MA 4DF4A 3MEEB 2W2PP 2DEJA 4LR8A 1U1OA 1QJHA 2OI2A 2JNJA 1WTBA 1M5VC 4DFMA 5HI7A 3C14A 4LF8J 4KT0C 4LSNB 5DDPC 3HVRA 2WHOA 3VF0B 1DTTA 2YXLA 4PKDB 2BVZA 3PKMA 1RT3A 3MF5A 1VQ4S 2MB0B 5KFLA 1TUGB 3KTQA 2VJVA 2YKPA 2V4JB 1YQHA 1C1CA 1QAYA 2H5EA 2YWGA 3IA0A 3UDCA 4A48A 1XWLA 4JV5F 3CULA 2LXIA 1UEUA 4CTAA 4USVA 3IS9B 4RBUA 2H4WB 4DEZA 2DGVA 2H4YB 4D3HA 2KJWA 1YSJA 1TFYA 4DQRA 2B43A 2CYYA 2ZD1A 5F8IA 2KM8B 3DOKB 3DI6B 2WOMB 2UXBF 5AXMA 2X1GA 3B8HA 4NLWA 5HLFB 1X5OA 2OPRA 4NRTA 2BRKA 2VQEF 1U4BA 2N82B 1JX4A 1FF2A 2HBZB 4P7TA 1QVFR 3KLGB 2R2SA 3MM9B 3KK1A 4GMKA 3QRPA 4ZVFA 5JUMA 3CEDA 3OL8A 2ZHAA 3CJQA 4KO0A 3MECA 1F2HA 2VFRA 3PRDA 2LA6A 1D1UA 3MMAA 2QV6A 1KC8T 1UFKA 4DS4A 2RDIA 1GT8A 1V3ZA 2BZ2A 2B4UA 1N33F 4Q5VA 3CPWR 3EDRB 4H4KC 1FRHA 4NXNF 2ZOMA 3DXSX 1TK8A 2EFGA 4PQAA 2FVSA 3NOCA 5J2PB 1ACMB 4Y0FA 3IRWP 2EXUA 1WG4A 4P2SA 4LFAF 4MJKA 1OPIA 2AYBA 1N34F 1K8AT 1VDHA 2W24A 1B7FA 1SKRA 4JV5J 2W2QP 1WHVA 4FYVB 4F02A 1JNRB 2D69A 2GO8A 1LXJA 4C8LA 1VK8A 4A8MP 1XN9A 3CDBA 3RAMA 2UXBJ 4A8YA 4C3LA 1Y9OA 4B9MA 1REGX 2FB0A 5A6PA 2VQEJ 1RT4A 4UOFA 5AE2A 2LEPA 5CYJA 3MPVA 4C11B 3MPUB 3O2IA 2GVDB 1CJVA 1ZAWA 1ZA1B 1S1XA 5KFUA 4NEZA 4TKTA 3OLAA 5DQHA 5SUHA 2ZZMA 3MEGB 3H59A 1X5TA 3D0GE 2BKOA 4QR1A 2CQ1A 2OHDA 2BQUA 3TQ1A 1Q95G 3W2WB 2VASA 3W3SA 2A2DA 4LRDA 3RB4A 2AHOB 1HNIB 5LJ5Y 4X4NA 4F4AA 3D2WA 1N33J 3DLKA 4JI4F 5IV4A 3EE3A 3J7Z5 3JSMA 2MKCA 2R8GA 2DHAA 4TY9A 2IM0A 4NXNJ 4NCGB 3ENWA 1TKZA 2R7TA 3TZZA 1TZ0A 5HP1B 5IC4B 3QSIA 3T1YF 1HW9A 1VGYA 4OI6A 4E0DA 4F3OA 4LFAJ 4BCAA 1M0SA 1UTAA 5DGAA 2N7YA 4C3KA 2J9DA 4DXLA 2AKWB 3PG9A 1APSA 4IR9A 4P73A 1D8ZA 5CXTA 2QLBB 4ZMMA 3QYYA 2UVWA 1SJFA 4QU7A 3HSDA 2RQ4A 2VA2A 3GILA 3CJRA 4FN5A 3TVKA 2F4FA 1RWKB 4CLYA 1QVGR 2QFIA 4ERDA 1U1KA 5IT9U 4IR1A 1U2CA 3D9BA 2DH7A 3DLEB 2VBXA 4PWWA 1R7IA 3NWGA 3AOBA 2BV3A 3MUVP 3AHPA 2QGFB 2MPUA 5FLXY 4EO6A 1RA6A 1UVLA 4CNZA 2ZH9A 4GVBB 2P8IA 2CNOB 5LSLA 3MMCA 2NSBA 1GXLA 1BQNA 1FJEB 3KG1A 4IG0A 1W7WA 1DRZA 4LF4F 5HBMA 1N88A 4U8VA 3IRXA 5J1PA 1TKXB 4OMFG 4DV5F 4ECUA 2V2KA 1RTJB 3PJXA 5KFRA 2HNZB 2DNMA 2K8GA 4JI0J 3PYDA 5EWGA 5KG7A 2H1YA 1DLOB 2BQ3A 2YKOA 3P6YC 4USKA 4B3SF 3CCVS 2HGNA 4JI4J 3KHRA 2DRDA 1O5JA 4ZP6A 4QIEA 1NDKA 4RUHA 3VR1A 1J5EF 7FD1A 1U26A 1V9OA 4MKVA 4F50A 2H54B 4UUXA 3T1YJ 4OYWA 1V3SA 1H73A 1Q81T 4TXSA 4AUKA 3Q2TC 3RGIA 2UV8G 3OTDA 1RZMA 2BE7D 4PXEA 5DQGA 1NUEA 2BOPA 2VL1A 1RT1B 3BGFA 5D4PA 3BR8A 2XY6A 1WOSA 3VGSA 2XZTB 2KZZA 5MLCV 2ZHBA 3RB0A 2PA8D 3PCOB 3CMES 1H72C 1RB0A 3JAMU 3MPWA 1Q7YT 3H7HB 2V69A 2CADA 4K2JA 1YJUA 3CJKB 2Z2ZA 3OFFA 4UZBA 2VODA 2ZC3A 2QA2A 5GAHU 3VV2B 2ROEA 3EM1A 4EK2A 4WJBA 2ALYB 2VJUA 4LF4J 1SUQB 1YIJS 1K44A 3AD8C 1YGYA 2E5JA 4DV5J 1MG7A 3OPKA 3QJLA 5C5JA 2M8DB 5G0RB 1KS2A 1Q4RA 4BC7A 1FNMA 3JB9k 2O01C 2ZOGA 4Q44A 2D41A 1C0UA 4U95A 4B3SJ 2XLIA 1U24A 1L3KA 4CH7A 5K9FA 4RJVA 3U1LA 3DNCA 4P7VA 1ICEB 4WFBQ 3EGVA 3KG0A 2DB1A 2GMHA 1J5EJ 4CO3A 4L3KA 2FHKA 1UMJA 1HIYA 4XDCA 1TKDA 2CNLB 2HZAA 3GYGA 1VRTB 1K1QA 1JB0C 2WBRA 2JWNA 1UVKA 2AYGA 1P27B 2RNEA 1HBUB 1IR2A 2H5JB 2P9EA 3MM5B 2MZRA 3AA8A 3GFYA 4L73A 1Y0HA 3UCUP 4LQ9A 3FVYA 4FXVA 4RW4B 3BSCA 5D0EA 1S0MA 4LIRA 1Z4UA 5IQ6A 3A3PB 2AP6A 2H3EB 4DMZA 4DQPA 2VBYA 1DJ0A 1N36F 5F8GA 4TY8A 2NXCA 2IRXA 3DHXA 3FBFA 3MUTP 4N77A 3UR3C 1JWWA 2DGOA 1UPPA 2D9PA 5DDRC 4PXCA 5CHCB 4A8FA 3SYZA 3SV4A 2AGQA 4ECZA 5HMWA 1FX4A 2XHWA 2NXEA 2UV8A 4M5DA 3GIMA 2ZBRA 5A8KA 4HTIA 3W2VB 1PIEA 1U2FA 3PJ9A 1RBLA 2QN6B 4E98A 3T19A 3O5TB 2A6MA 3BR9A 3UNGC 3QJPA 5C24A 5ETTA 2BANB 3I4PA 2NYHA 1HHTP 3OXGA 4PABA 4LREA 1KLMB 5K5MA 2UUAJ 4I6AA 3VZIA 5C42A 1RU1A 1WOOA 2WB1D 1EAYC 2RJZA 3HSZA 2J7UA 1JNZB 3LP1B 2C3OA 2PMWA 1HQUB 2YX1A 3LW5C 1AUDA 4NZ0A 1Y5IB 2LKZA 1A7GE 2YWFA 3HHNB 3MOZA 3CJ8A 4I6YA 1X4AA 3BGOP 4FXDA 3PVXA 1HI0P 4NLGA 2RHQB 3M32B 3BDPA 3U02A 1LW2B 2OPPB 3KYLA 2VG6A 2WB4A 3M8WA 1FFSB 3S01A 3ENQA 3D0IE 1TK0A 3K5OA 1N36J 1X4GA 3EZ5A 3ISND 4WIIA 2ZKUA 2DHGA 4P9SA 2WONA 1OO0B 4DUTA 2RU9A 4BS2A 1HWJA 1GX6A 4URSA 1RWXB 4KFBA 1JLBA 4BBYA 2V4QA 5BJRA 1QUVA 3TVYA 4GRSA 1XR6A 2ZNYA 3KNGA 3DFEA 1L3VA 4O4GA 2CQ4A 3GP9A 4NLOA 2IBKA 1FDAA 2DNLA 4UY85 4F4KA 1RAFB 1NKEA 1GAOA 1VQSA 4CO4A 1NJIT 2YNIB 4PG7A 1HNXF 4DR3F 1SC4B 3CC7S 4KV8A 2YQ1A 5L8RC 4ZVQB 3CDAA 1RAHB 2RUSA 3MAAB 3ILOA 3CJ2A 4B9LA 1ITPA 1T02A 5F8HA 1MWQA 4JI2J 1FKOA 1YJTA 3I32A 1KHVA 2MTLA 3J7A1 2E1PA 5HVHA 1U8WA 2UU9F 3OD2A 4RX6A 3CVKA 5EDWA 2Y0SD 3P45B 3HD2A 4EGLA 3DRRB 3DU6A 3UDLA 5AXKA 4OV1A 5EWEA 5KFXA 1RCOB 1JLQA 1KVIA 4CWBA 2BOAA 1JLFB 2FJDB 3PW4A 2KB2A 4JOUA 2MKSA 2OD6A 5KG5A 4FYYB 2V50A 3ILJA 4C48A 4L75A 3RAXA 3EPIA 4L6V3 1U7LA 4OI3A 4LIWA 4LF9F 2BXJA 1TQLA 3RRGA 1MU2B 2XMJA 4LSNA 4P2MA 4OJHA 2ILZA 2IJRA 2D3ZA 3EGZA 3LPYA 2PC6A 2QA4S 2DK2A 2V4JA 3CD5A 2CZVC 3B4DA 4O44B 3OTOF 1O51A 1T9XA 2CRLA 4KKOB 3FBEA 3DRSB 1HNXJ 1RT7B 3TJAA 4DR3J 4LQ3A 4WFXA 4XAKA 2GVZB 1D8YA 3IS9A 3SCKE 4F04B 4B9UA 2YQ0A 4ELVA 3FFIB 3R5CA 5KFAA 3VAJA 4NLUA 3GB0A 3GFXA 4DOZA 1EETB 2ZC4A 5KFKA 2EKYA 2Q79A 3DOKA 5IWAF 3DI6A 2WOMA 2UU9J 8AT1B 1T0TV 1QLNA 2B7CB 3FEZA 1QUPA 4F4YA 3KUGA 1IJFB 3EVOA 3VGUA 1B0PA 5KFQA 3FSYA 2AEJA 1X4CA 4EBEA 1WWHA 2UXDJ 2CJAA 1U49A 3KLGA 3FKBA 3MM9A 3GIKA 1OY9A 4OYXA 2KU7A 2E9RX 5GADU 4DDFA 5KFMA 1RAAB 3KDNA 4Q2MA 2DO0A 2QFJA 4CH0S 3CCLS 3O3LA 1YWXA 4P71A 4GC7A 2F9DA 3NCPA 5GAGI 4LF9J 2NQPA 1KBRA 3V2UC 4K7QA 3IG1B 3D67A 4NA1A 1GK8A 3X3UA 5DZ7A 3BO3A 1JJ4A 5L1LA 2MLYA 5ETLA 1WSRA 5SZTA 4DV3F 4J9VA 1HBNB 5J2PA 1D0EA 2OIHA 4JI8F 4HH1A 2DKOB 2K06A 1R0AB 2J0XA 4X65F 3CJ0A 2PSZA 2Z2LA 4O3NA 3TA1A 4ZJLA 2EFPA 1FXDA 1OQ3A 3BJYA 1NDPA 4DQQA 3R5GA 2J5AA 2XMUA 4J90A 1NM2A 2OD4A 2CVIA 4ZVUB 4CH1A 1DZ5A 1FDBA 3SV3A 5IWAJ 4JI6F 3W1YC 3ET6B 3A4TA 4I6WA 2ROPA 1BQMA 1X9WA 2E5HA 1NAQA 1Z2ZA 4EYIB 1S0NA 1Y3JA 1KRPA 4QCLA 1NH8A 4P2FA 1YITS 3GQCA 4OV6A 2M4MA 4JV2A 1FI4A 4C11A 2AJ1A 4UQTA 4LMZA 2GVDA 3CIMA 1C1BB 4FYXB 1RTDB 1P9QC 3PIPQ 1X4DA 2OEJA 3MEGA 1S49A 2XS2A 1PJ6A 5H9FK 1WC4A 1RAGB 2QL5B 4OFZA 3T9ZA 1JLGB 3IBCB 5CABA 4J91A 3KLHB 1HBMB 3W2WA 2GJFA 4MYUA 2JJ4D 1LNQA 2M7SA 5IQQA 1RXOB 1U1LA 3PR4A 1FJGJ 4PZVA 2R2UA 6FDRA 3PACA 2ZJRQ 3QWPA 4WWSA 5A76A 4DV3J 1SJ3P 2MJNA 2KT3A 3H5UA 4JI8J 3MMJA 2C3MA 3MR5A 1Q7LB 2KYZA 1WF0A 1BWEA 2HAFA 2UVVA 2FJAB 2HFZA 2X3DA 4X65J 4CLPA 2LECA 3JSBA 1UVIA 3UD4P 3NY0A 4OZ2A 4ZVOB 1RHJB 2GIRA 2CPZA 2FZCB 2AZ3A 3T3FA 1RWNB 5J2QB 2NXJA 2XNQA 1KN6A 2J6TA 4QWEA 4O0NA 1ELOA 5E5NA 2ZH2A 3D7SB 2A3JA 5J1NA 5K14B 2M2BA 1GMVA 1R8CA 4JI6J 5B08A 4YHHF 4IQMA 4Y2CA 3KMQA 4LR9A 1HFEL 1QM9A 2XLKA 3DLEA 4ER8A 3EXCX 3US5A 4HACA 4QW8A 2B4VA 1SL2A 3JTNA 2AJ4A 3RG6A 1NJZA 1JLEA 4RZRA 1HWIA 3T6JA 1LEOA 4GVBA 3QIDA 2ZUAA 1MWZA 2L08A 2L9NA 3C19A 2HIYA 4DL4A 2F7VA 4JB8B 2B9YA 2FLLA 2IC3A 4N5SA 4DPUA 3PZPA 1TKXA 4FBTA 2Q1LA 3BSNA 5DDQC 3UVJB 1REVB 1RTJA 2MMYA 3CT9A 2HNZA 4F36A 4P74A 1DBDA 4R8UB 4CIOA 3H8YA 3N6LA 1S9GB 1DLOA 3G8QA 5LL6d 1UETA 4GO5X 1X4HA 5CZVA 3I5CA 4YDXA 1VMBA 3H5SA 2R4FA 1N32F 3RAQA 4DFKA 4LF2A 2BJEA 2JZ5A 1PGZA 1P6TA 3I55S 3IMQJ 2W9CB 3CTRA 2CPDA 5IM0B 3KHLA 2MKKA 2HHSA 1BC6A 3ETOA 3PEHA 3T5JA 5CAAA 2GMLA 1RT1A 2DNQA 3MTJA 3M8YA 2BM1A 1JXLA 1T11A 4CP5A 3FZBA 4B08A 4E2FB 2WZ1A 2PD1A 2IM2A 2CVEA 4K8RA 7FDRA 2GAGC 1U6ZA 2IYGA 2UXCF 1N6QA 1BGXT 3AB2B 2ZZNA 2GHPA 4EUVA 2KL8A 2NZ4A 4ECXA 4HT5A 1N8RT 3HSGA 3HFKA 1GNKA 3VAFA 1NJXA 4RW9B 2DGTA 3IN5A 4JI3F 3D3BJ 3GFHA 2RIJA 3D1QA 1GFWB 2PN6A 4OX8A 3J80Y 2EEYA 1MROB 1SUQA 1RISA 1HBOB 5A8WB 1JLCB 4ZN1A 3DXBA 2FY8A 3EVMA 4X4QA 1MMNA 3TAMB 1JIHA 3M1VB 5G0RA 2EI5A 3FDSA 4YB7A 4HDHA 1S79A 3W8PA 3TI0A 2CQDA 5D6GA 1TL7B 3L95X 3HT0A 3CO0P 3OJSA 3FBBA 1R8PA 1LK5A 3HCXA 1HR0F 1TL1A 3QT8A 1YBUA 2EVZA 2MY8A 1R0BG 4F2SA 2M9KA 4BC9A 3I87A 3G8SA 4LF7J 4DPWA 2J0WA 3CCWA 3K17A 3DRPB 2W4CA 2DO4A 2F8HA 1HBUA 1QD1A 4CLKA 3MM5A 4NMXA 4ZP7A 3BH7B 4F25A 4Q45A 3Q8QB 2XI3A 3K5PA 4RW6B 1F5BA 2XMMA 1XNQF 4R0JA 2F4VF 2MZ1A 1U2RA 4RW4A 4YQWA 4RUAA 3W7BA 2DRBA 1I3OB 2UXCJ 4OJ1A 3EJMA 2C22A 2HEKA 1HQ2A 4UOGA 1XK8A 3GV5B 2GCFA 3CMAS 2NUHA 4JBCA 2RE1A 3W9IA 4JI3J 2YPZA 1U45A 3M7VA 5E3QA 4MK8A 3QO9B 5U47A 1UAWA 2CQ3A 3M8RA 2DH8A 3M2RB 2OPQA 3W2VA 3M9MB 4NLSA 3AY0A 4OZLA 2ZH6A 2OMLA 2WCXA 2V8HA 1H0HB 2ILYA 2BANA 1Y7PA 5ETRA 1CEZA 1PYSB 4DL3A 4WXWA 3HFVA 1G3OA 1LXNA 1KLMA 3W60A 3PR5B 3QGPA 5A8RB 3M30B 2FQQB 2QT7A 3LP1A 3KJFB 2HSEB 2BJ3A 4KAIA 2DTJA 1HQUA 2OPSB 1S0VA 1S10A 3LH2S 2KFNA 4HHHA 3UDVA 3GWCA 3M2VB 2M88A 5HROB 5HO4A 2DITA 1U1QA 1Q1KA 4LBHA 3ZTQA 3M2UB 4NE9C 1PC5A 4IG3B 3LP2B 2KHCA 4B9NA 4J9MA 1NK5A 3MD1A 3M32A 4OYOA 5GVQA 1LW2A 4K0KF 5CYMB 2YY3A 4WIQA 2OPPA 4OHWA 3KLFB 1JQGA 1J5OB 3BF4A 4K4TA 2FUG9 4I64A 5F3ZA 5IT0A 3W62A 4JUZA 4HHUA 2FDNA 2MJUA 2G0JA 3CB4A 1RYSA 2DNKA 1NSPA 1R8BA 5JXSA 2IMWP 5IS2A 3AD9C 3T5LA 3RW6A 1KEKA 1FNOA 2FJBB 2QRRA 1VQ9S 1P9YA 5K8PA 2ACMA 4J5OA 2KXNB 2KKHA 3BO2A 2R2TA 5E7OB 4RR5A 3I4HX 1RK8A 3BDEA 3NKYA 1J27A 1ZYQA 3L9ZA 2PI5A 1SV5A 3ISNC 1WC1A 1GTHA 2YNIA 2YVSA 4NMLA 5KTQA 5C25A 2J9DE 2Q6CA 1VRUB 3K7RA 3MAAA 1SIZA 3NBPB 1XEZA 3R27A 2LCWA 1FVSA 3E2EA 4F7VA 5K8OA 1PBUA 1FD2A 1ZM9A 2B4PA 4QIWD 2HWIA 1SQFA 2CQGA 3KK2B 2VB6A 5IT4A 4YR0A 3C8YA 3IR7B 2BDPA 5DM7Q 1AROP 5DRKA 2NREA 3NAHA 3OQ2A 1AB8A 3HHLD 1IR0A 3NS6A 4GO7X 3L3CA 3FSXA 1FDNA 3VHQA 2IRUA 1Q5YA 3DRRA 2B5JB 5F9LA 3WC2A 2HAIA 4LSLB 1IKVB 1T03B 4ZHRB 3IGVA 1IQZA 2KVQE 5B0FA 2LEBA 3OL9A 1JLFA 5GAHI 1SKUB 4DR1F 3HULA 3DKDA 4DV1F 2F65A 4DR6F 3MWBA 3H2UB 2IVFB 2W7PA 3RR7A 1GMWD 5IC6B 1U6BA 1B0TA 2Z57B 3RUBL 3C46A 4V1Ak 1MU2A 3PW0A 1DFDA 4KGXB 2JFDA 3T6BA 3H5YA 1JJCB 4ID5B 2BJDA 4OJ3A 5E3PA 4WYWA 2MQ8A 4ECYA 3IC1A 2KG0A 2B6AB 2Y1JA 4GKJJ 4P72A 5EX3A 3N01A 4O44A 4WU2A 3KLIB 2IAJA 1XR7A 3GJTB 4KKOA 3MPYA 2N4CA 3DRSA 1RT7A 1V6HA 3KUEA 2NPFA 1SC3B 2EC0A 2GVZA 1R31A 1NK9A 3Q24A 4ETZA 1TAUA 5L9XA 3FFIA 4RLEA 1EETA 2HGMA 4DG1B 1TL4A 4JV0A 5K8NA 3A3OB 4YEAA 1HA1A 5T7LB 2B51A 2WK4A 2BA9A 2OFGX 1NB7A 2W25A 2HQ3A 1QAJA 3MUMP 3PY8A 2AGPA 3MM6B 4WFAQ 5FD1A 2AQ4A 3IO1A 1RDRA 3NS5A 3SFGA 3QRQA 1WSVA 1T8EA 2YWEA 2V94A 1S1UB 4DV1J 2YNHA 4DR6J 1H7XA 5KOXA 4JI7J 3VAGA 1IQTA 3UFCX 4U96A 1JXEA 2QC3A 4MAKA 5AT1B 4DBQA 1B0VA 3QMQA 3IG1A 1PAUB 4RBVA 1VIXA 2CNKB 3QNWB 2JX2A 1RBAA 2FC8A 4ZCIA 3LWLA 3HZGA 3MXHP 4PG6A 1VHFA 4NYOA 1RT2B 1O0PA 2CG4A 2ZOFA 3TX0A 4MIBA 3NMRA 4TYBA 2F8EX 1ZM4A 1ZM2A 3D4JA 2BUNA 2V8GA 4NYPA 3W5YA 3GG0A 1RE1B 2WSCC 4MK9A 5B0GA 2VBWA 3GTYX 5B0CA 2GX8A 3CD6S 4R0EA 4J9SA 4PWUA 5KAKA 3ZZ0A 1JKHB 1F5AA 2XMWA 3ET6A 2IJFA 3IAS9 3DDNA 5KFJA 2R7RA 3MI7X 1WI8A 1H3DA 2BABA 5KG6A 2Y3YA 2VFVA 3EXYA 2ASLA 2LFVA 4EMDA 5ETPA 3NEKA 5DS7A 2DBBA 3V6HA 1HWUA 2ADBA 3CE8A 4K4SA 1C1BA 2YKAA 2O5DA 5EN1A 3I0SB 1RTDA 1FXRA 3OW2R 4EYHB 1EIYB 2DPJA 1NSKL 4NCAA 5AE1A 3PNIA 2VBZA 1JLGA 3LOUA 1A0OB 4IKAA 1HBMA 2HQIA 5D4LA 2HVZA 1T9YA 1DURA 2I6WA 5FLXU 2O67A 1RLCL 1FRKA 1R8HA 1UA1A 1FDDA 5J2NB 1FKAF 1RTZA 3FRYA 4ZOSA 4HYKA 2KDOA 4H54A 3Q23A 1QSYA 4ZVTB 4L3NA 3BREA 4OZ3A 4QIGA 2X3GA 2HVEA 2DJWA 4YS2A 1T94A 1VQ8S 3W66A 5J2QA 1U47A 3ZTSA 2KN4A 4C4WA 2CPFA 2QMUB 1FTCA 5K14A 1L3UA 2MZTA 4F26A 1RTHB 4B3TJ 1RHQB 4V19X 4DF8A 1YDLA 2IDLA 2OLWA 2KT2A 3BM7A 5M2RA 5B0DA 1R8AA 2CQ2A 3PW5A 4J9NA 4NASA 2ATLA 5KFBA 3Q8SB 1T9WA 1SH0A 4C8KA 1X9SA 3UO0A 3VAMA 3KDOA 2N3LA 2R8IA 1WHYA 2AW0A 3SQOP 2C28A 2XZWA 1UW9A 5F9NA 1DARA 1CS4A 2KH9A 4TU8A 4FS2A 2ZVIA 3C15A 3PO4A 2D3UA 4LRFA 2XQCA 4R8UA 1K73T 1U25A 1S9GA 3FCVA 3H4BA 4LF5F 3M6XA 5D4OA 4B02A 1FE0A 1YJWS 2CUYA 1IJEB 4WPAA 5KFVA 1WEXA 2DGSA 3UQSA 1FE4A 5F8MA 4CQ1A 5JMNA 1EP4B 5HVGA 3BB5A 4WXOA 5DETA 4DU8A 5DG8A 2RF2B 4P2XA 3X1LB 2W9CA 1TL3B 5IM0A 1E6YB 1OSDA 1UJ4A 3CDEA 3J7ZT 2PMHA 2B8QA 3P96A 4ED8A 4OL8A 1JJ2R 4YFUA 3OL7A 1F5CA 2ZZTA 3QQCD 3DDKA 1H98A 3A8KA 3V5RA 4J9LA 3PKYA 3HHKA 4ZJQA 3UCZP 5LSRA 1VFJA 3H90A 3SDEB 2MY7A 2KRRA 1BE4A 5EGYA 4ED5A 3BQ2A 3MHYA 5J1EA 1RP5A 4UZCA 5F0UA 3VQTA 3C6UB 1NKBA 1HQEB 4WE1B 4DZ6A 2E9ZA 1VK3A 3HHLB 2BYCA 1XBWA 3HI9A 4F8RA 1U48A 3WQPA 4RW9A 3TZWA 4A8WA 3ONQA 2FJVA 1S6QB 1EKRA 1FFWB 1SJQA 4Y2IA 2MEWA 5B7WA 4KPCA 3M9OB 1MROA 1HBOA 1H7WA 4ANEA 5A8WA 1AUSL 4J9OA 2W9BB 3DHWC 3H2VE 3TAMA 2HG4A 4K4YA 2F40A 2ZBQA 3M1VA 2POKA 4KBIA 3ITHA 3MCOA 2IA0A 1TL7A 4A4JA 4LF5J 4LSZB 3ZZUA 2KO1A 3AA9A 2HK3A 2BACA 3EPGA 1WKJA 2PIIA 2QTWA 2L48A 3TUIC 1NK4A 2W7OA 1QE1B 2V8PA 2JLEA 3N9UC 4OYPA 3HVAA 1S1TB 2VG5B 4ECWA 3DRPA 4NA2A 2HQDA 2M70A 2MKJA 2HVIA 1I1GA 4B9SA 3V4IA 3DOLB 4O3PA 2CXEA 4CLTA 4QYZK 3JYTB 1TR0A 1VBYA 1CJTA 3PHTA 3CCRS 1NZAA 2HKEA 4DX6A 1K0VA 2HRTA 4RW6A 1L3TA 3MM8A 2CWKA 2M52A 1M5PC 3RBDA 3OTBA 3RRHA 3SSRA 1ZZFA 2DNPA 3K0JA 2APOA 1R43A 3UPFA 1S1VB 2IY5B 2IVMA 3EWGA 2V9WA 2JLGA 2R7OA 4DV2J 4FPIA 1EB0A 3NGKA 4G65A 1YRUA 4KHPF 3T5HA 2FVPA 2ZHOA 1UJ5A 4FYWB 2Z0GA 2R7VA 1WHXA 3KJVB 3V81B 1RWVB 3HD1A 4CYUA 1U8SA 4NYZA 1Y00A 1FWLA 4CLZA 4FVMA 3I96A 1RT6B 1IM4A 5ADZA 1NO8A 2XEXA 5ETSA 5E3AA 4N8OA 2EWHA 4MH8A 2JOQA 2XB2D 2HFUA 3BGLA 3R6GB 2GHVC 3AODA 1CLFA 3M30A 5I42A 4X2BA 3ZZRA 2Z2MA 1P8GA 5KFSA 1XMBA 2UUWA 3LANA 2ACYA 3TVZA 4ES3A 2OPSA 1G1XA 1YZ7A 2YX4A 4DFJA 3EZOA 3GCWP 1C2PA 3M2VA 5HROA 1OIAA 4ZN3A 1QTNB 1LQ9A 5HQ8A 2FTRA 2XC9A 3RB3A 3R8YA 4MIAA 5CZXA 3M2UA 4IG3A 4PQUB 4CT9A 1GXTA 2MZQA 2ABYA 2I9SA 3IM8A 3LP2A 2J0SD 3BYPA 1FNXH 3ELHA 2G2ZA 1UEVA 1Y5LB 5KT5A 4OIXA 4URGA 5LXYA 2RRAA 4O4RA 3CJSA 2QSFA 3M8PB 3W63A 1J5OA 4PEOA 4HVZA 5B0AA 2C1EB 3TAPA 3IBFB 3TZXA 3N4WA 1G2EA 4FBUA 4ED4A 4PG8A 4KHPJ 2EKNA 4I2QA 4HH0A 2CPYA 1OYDA 2CDRB 2AYEA 4CO0A 4ECVA 2A0FB 2DHHA 3UN3A 2VPZB 5IV3A 2P9GA 5DLGA 1SI9A 2HBQB 4AD6A 3KWMA 4C8NA 1S57A 4TYAA 4X62F 3OTEA 1RQ0A 2C2EA 3GIIA 3GJRB 4IOAQ 3GR1A 2E7WA 3PDNA 4B17A 4DWIA 2Q3PA 1AT1B 2MZJA 2VC1A 2K3IA 1FRIA 2HHQA 3HLUA 4LRBA 2ASDA 3TJ8A 4ZIWA 3TR5A 2Y1RI 1S0OA 4Y65A 4KC5A 3BN4A 1VRUA 1IWAA 5DDOC 1D9AA 4ZCLA 3NBPA 2I38A 3OSPA 4FNHA 1DY3A 3KG4A 1TMMA 3PFEA 5D0HA 4UF4A 5A6WA 3MEDB 1SCJB 3CGIA 3IM9A 2ZH5A 2W2NP 3QZ7A 3ENAA 1SJRA 2ZD1B 4WKRA 2AGOA 4LSLA 1IKVA 3CCUS 2RS8A 3CW2C 4XO0A 1T03A 2RH3A 1LV5A 1FHTA 1S99A 1WDTA 3EYZA 3CJ3A 1IM6A 2LLZA 1FO1A 3KLVA 4A8SA 4DN0A 3BKTA 1UA0A 2ZJPQ 2Y9HA 3VAIA 3KK1B 4IOBA 1UWBB 4C8ZA 3NCQA 2XNRA 3B82A 4XIUA 2VPWB 3EGWB 1EZZB 2XY5A 3D5MA 1HWLA 4J9QA 4ZPVR 2QL7B 2IDEA 3FEYB 4Y3CA 2AJ0A 2BX6A 4ID5A 4PG4A 1DQ8A 4X62J 1GX5A 4WP9A 3ZTPA 1FEHA 3RBZA 1B64A 2B6AA 3G8TA 4NX9A 3KLIA 5D3GB 2MQPA 2VV5A 2K2PA 4ZIVA 3K59A 2DD8S 4HI1A 3QT7A 2V2ZA 4WP3A 2W4PA 4UY8T 1UZHA 4LF1A 2HQFA 2L9WA 4DG1A 4JI0F 2OP5A 3NWRA 3HVWA 1VBXA 2HBRB 3W5XA 1M1GA 2ROGA 3R6LB 2R7UA 4FVCA 1ZBTA 2J7WA 3M6UA 1RWOB 4TQRA 5KG2A 2B9WA 5LM7E 1FEEA 1J2VA 3HHEA 3D28A 2BRLA 3MM6A 2ZBCA 2B4OA 1Y11A 2LYVA 2H51B 4IFVA 1LFWA 1W25A 3CSKA
chains in the Genus database with same CATH topology
1HD0A 1VMBA 1SXLA 2R2RA 3H5SA 2GV1A 2R4FA 4JI1F 1AFIA 1LWEB 2LDIA 4Q0BA 1N32F 3RAQA 4OLPA 4DFKA 3NRBA 5D78A 2BJEA 3TA2A 1WEYA 3NG8A 2JZ5A 4O3SA 2YQ3A 2R8KA 3ZZZA 1PGZA 2R8HA 4ZPDA 1P6TA 3I55S 1U09A 1Q8IA 4FF2A 1S1XB 3CTRA 2CPDA 4RW8B 2W9CB 3KNAA 1N5QA 4WZQA 4C2MA 2KFYA 2DNOA 2VG6B 5IM0B 4OI4A 3TX8A 3KHLA 4RNHA 2MKKA 2HHSA 1LWCB 3TRGA 3OV7A 1BC6A 3ETOA 2JHEA 2Z8QA 3PEHA 2EFQA 3T5JA 2DCUB 3K2YA 1NKCA 2E5GA 2J0QD 1S76D 2DPIA 3VWSA 1M1KT 2GMLA 4O3RA 3KJVA 3H5XA 5LSOA 1QAIA 1RT1A 2DNQA 3U1NA 3MTJA 1KD1T 4W92B 3CJ5A 3I9ZA 4Q7AA 4F67A 4K59A 1HARA 4H4MB 5L9NA 4TU7A 4HHJA 4E8UA 4IDKA 3OR2A 1H2TZ 2BM1A 1X4FA 1JXLA 1ZH5A 3MDFA 3QLHB 2OO4A 2HW3A 2B0GA 3FZBA 2V4RA 3HM9A 1T3OA 1DHMA 4B08A 3DRYA 1VOMA 4KFBB 2BBEA 4I2PB 2PD1A 1H2UX 4ECTA 3G71S 2IM2A 2CVEA 4EO8A 7FDRA 2IVYA 2PGCA 4DHVA 3K57A 2H9ZA 2LXFA 2DR7A 4H4OB 1U6ZA 2IYGA 3FSIA 2UXCF 3JSMB 2AX1A 1KTQA 1ZZNA 1N6QA 1BGXT 3AB2B 6FD1A 4DQIA 1TVRA 2B3TB 4M8LA 3N0VA 2CPXA 3H25A 1NJYA 2FLNA 4C8YA 2ZZNA 2GHPA 2MHNA 1YJ9S 4MYTA 1UW4A 4O4GB 4LF8F 4EUVA 2K7KA 3O44A 3GIJA 4K4ZA 3G9CA 2NZ4A 2B7BB 4ECXA 4HT5A 1N8RT 2HHWA 3H4DA 2MQMA 3V6KA 2RUGA 2AYMA 2KZMA 3M6WA 3DOMA 5I3QA 2B9XA 1CQMA 1CC7A 3HFKA 1GNKA 2GA7A 3QGHA 4FS1A 3VAFA 1NJXA 4RW9B 2DGTA 3IN5A 3CO9A 2JEFA 3CDWA 3MTKA 4JI3F 2AWZA 4TLQA 1UVMA 4NOHA 3GFHA 2CJKA 1JKHA 1IUJA 2RIJA 4I4BA 1HPZB 3D1QA 3U1MA 2XWYA 3NL0A 2PN6A 4OX8A 3J80Y 2DGWA 2FGCA 5KFOA 4X4TA 3CUNA 4PXBA 3BO4A 4CCHA 4YDDB 3GFZA 1HNVB 1MROB 1SUQA 3IAM9 4PPZA 2CFXA 5CCLA 1RISA 1HBOB 4ZPWR 2VUGA 4IFYB 2J9CA 4MKAA 1G7CB 5A8WB 1JLCB 1N5VA 3DXBA 3MR2A 1A6LA 1FRMA 4G1QB 4YB1P 4X4QA 1MMNA 3TAMB 2YH1A 1Q86T 1N48A 3J7YU 1JK9B 2JVRA 1WD6A 1JIHA 2VONA 3M1VB 5G0RA 4U7UK 4IOCQ 2EW9A 2EI5A 3FDSA 1N54B 4YB7A 1KONA 4HDHA 4C0OC 2IM3A 1S79A 1U6FA 3DGPA 4MFBB 3TI0A 5JVHQ 3KOAA 2CQDA 1N56A 4DSJA 5D6GA 4NRUA 1TL5A 1SH2A 2OTJS 3L95X 1F60B 1FKOB 1T95A 4O3OA 3OJSA 4A8KA 2IAJB 2RVJA 3SZ2A 1R8PA 1LK5A 1S4FA 2V8DA 1HR0F 5E3CA 1RT5A 3K5LA 3DLGA 3LGNA 2LU2A 3I0SA 2MGZA 2FHJA 1DTQB 3A1YG 4QWAA 3OJUA 1TL1A 3K58A 1RKIA 1YJRA 2RB7A 4ECSA 2ZDOA 2EVZA 3GE9A 2QO3A 3FRZA 4DLEA 5I3PA 5KFGA 4YOEA 2MY8A 4F2SA 4N76A 2FVQA 2M9KA 2ASYA 4M94A 4B9TA 4BC9A 4OHZA 2XLJA 3I87A 3U7JA 4RNMA 3G8SA 2D7SA 2J0WA 4ZKAA 2RQKA 3CCWA 2DGUA 3NNHA 3DRPB 2GQ2A 4RNFA 2W4CA 1BQNB 2DO4A 2MSTA 2F8HA 4A47A 1HBNA 3VQSA 5F8JA 3HZEA 4IG0B 4TU9A 1HBUA 4IYQA 3QZ8A 2LU1A 3KHHA 3LALA 3BQ0A 1YHQS 1MNEA 4IRDA 4OZ5A 3KK3A 3MM5A 4C97A 1YRTA 4ZP7A 2IBOA 4F25A 1TAQA 2O66A 4MKBA 4CNYA 4Q45A 2RILA 3Q8QB 1R0AA 4J9KA 3ZZPA 2HHHF 2XI3A 3BGRB 2BQRA 4ED6A 1IKXA 2ZH3A 2JFKA 2WRMA 3BEGB 3EGNA 2LMIA 3K5PA 3OFEA 2IRYA 3QGGA 4RW6B 1F5BA 3MFHA 1MSWD 3TO8A 1YRXA 2LDYA 3SXLA 3CC2S 2DIUA 2HRUA 4Y2MA 2XMMA 5J2NA 3NP5A 2AJQA 1XNQF 4R0JA 4DF4A 2F4VF 2PA3A 1N5TA 2K3KA 2CQCA 2MZ1A 1U2RA 2CQPA 3MEEB 5KT6A 3HK2A 2ZE2A 5F8NA 4CO5A 4RW4A 5IZHA 2DT9A 4YQWA 4USHA 2QYCA 3QIPB 5DG9A 4RUAA 2IMOA 3W7BA 2DRBA 1U1OA 1R3NA 3PW2A 5KFWA 4OJ1A 2C22A 5CH7B 5L38A 3HDSA 5T41A 2QIFA 1QJHA 1XTZA 3CULA 1C4AA 1E6VB 3IWNC 2XMTA 4C8KA 1WTBA 1M5VC 4DFMA 5HI7A 2FHJD 3MAHA 2KM8C 4KT0C 1XK8A 1NU4A 4LSNB 5DDPC 2WHOA 3HVRA 3VF0B 3BN7A 2HS3A 4B3TF 3GV5B 2GCFA 3CMAS 1DTTA 2YNHB 2B56A 4PKDB 2BVZA 2NUHA 3JTPA 2YKNB 2AD9A 4JBCA 3PKMA 1RT3A 3MF5A 1VQ4S 4I67A 1XMQF 2MB0B 3DU5A 5KFLA 4I68A 1DQAA 2RE1A 1ZTWA 1S48A 3FMWA 4FYDA 3K5NA 3KTQA 1DAXA 2YKPA 2J76E 1MWYA 2V4JB 2P6TA 2R8JA 4NLQA 1U45A 3K5MA 2FPHX 1M5KC 5KFIA 1F9FA 5E3QA 4MK8A 3QO9B 5U47A 1UAWA 2GGPA 1RTHA 3Q22A 2UVUA 1YQHA 2CQ3A 3EZUA 1C1CA 2MQLA 2UUAF 2VZ9A 3M8RA 1T05A 1QAYA 2DH8A 2H5EA 2YWGA 3M2RB 2OPQA 2VPXB 3W2VA 3M9MB 3IA0A 3UDCA 1RTIA 4F4XA 2CDQA 4A48A 1XWLA 2XCPA 4JV5F 4NLSA 3AY0A 4OZLA 2ZH6A 2LXIA 2JLFA 1UEUA 2UZAA 1OWXA 2OMLA 2WCXA 3IS9B 4RBUA 4CTAA 5LMNF 2CZ4A 2XGQA 1XC9A 5KFYA 1RYRA 2FY1A 2V8HA 4IO1A 1H0HB 2DNGA 2ILYA 2BANA 4DEZA 1M90T 1IKWB 3GV7B 5JVGQ 1Y7PA 2BE2B 2DGVA 1ZETA 2I5JB 1CEZA 4D3HA 4DL3A 2KJWA 1YSJA 1NHVA 4WXWA 1TFYA 5KT3A 4CO2A 1G3OA 1LXNA 4DQRA 5H9EJ 3M8QB 2B43A 2CYYA 2ZD1A 2FVCA 1KLMA 5F8IA 3KLHA 1JLAA 2KM8B 3DOKB 3PR5B 5CQGA 3DI6B 2WOMB 2UXBF 5AXMA 2X1GA 3B8HA 3QGPA 3GZ7A 5A8RB 3M30B 3I56S 2MXYA 4DV7F 1RAJA 1QTMA 4NLWA 2QT7A 5H9FJ 4OI1A 2EK1A 5HLFB 1X5OA 2M5YA 2OPRA 3LP1A 4USIA 3OHAA 4KAIA 1N5YB 4NRTA 4JYAF 2DTJA 2BRKA 1HQUA 3OBIA 2OPSB 1S0VA 1HYSB 3SCLE 1TV6A 2VQEF 1S10A 3LH2S 4QYRA 3MCSA 4AL7A 2KFNA 1U4BA 4AFFA 2KHDA 2N82B 4F2RA 2I0XA 1SJ1A 1JX4A 1FF2A 2NSCA 3QAEA 4P7TA 1QVFR 5FJ4A 1WF1A 3KLGB 3GWCA 3M2VB 2M88A 5HROB 2R2SA 2ZDPA 3MM9B 3KK1A 4DR5F 4F4ZA 4GMKA 5HO4A 2DITA 4ZVFA 1U1QA 1Q1KA 4G1IA 2VOOA 4U7CA 3V6DA 2G4BA 3M2UB 5LMUF 5JUMA 1SH3A 3CEDA 2J6SA 1PC5A 3M6VA 4IG3B 4UUWA 4M63A 3LP2B 2KHCA 3OL8A 2ZHAA 4B9NA 2W8KA 4J9MA 4KO0A 5E0OA 3MD1A 1NK5A 5IT9Y 3M32A 2HLTA 4ES2A 1EP4A 3MFIA 3MECA 5HMXA 2IJNA 5GVQA 2VFRA 1SKWA 3PRDA 5KOWA 1M5SA 2VKRA 2LA6A 1D1UA 3MMAA 5EHHA 1LW2A 2HHPA 4FZVA 4DLGA 4K0KF 2QV6A 2E29A 2RF2A 3DMJB 2YY3A 5CYMB 5E33A 5A2QY 1KC8T 4A8OA 2OPPA 5DM6Q 4DR2F 1HWKA 3PHEA 1S6PB 4L72B 1TL3A 4DS4A 2RDIA 5DO2A 1E6YA 1GT8A 1V3ZA 3THVA 4OHWA 2BZ2A 4NLVA 3KLFB 2B4UA 2DHSA 2ZVSA 1J5OB 4ZLPA 1N33F 4Q5VA 2K1RB 3BF4A 4K4TA 1FA0A 2FUG9 3CPWR 4H4KC 3MMBB 2VFTA 2X1FA 4I64A 5F3ZA 4WFNQ 2WTFA 5IT0A 2V9KA 2XSJB 1FRHA 3AB4B 4JUZA 4NXNF 2ZOMA 3DXSX 3SMZA 1IXKA 1TK8A 2FDNA 2E66A 2EFGA 2MJUA 4PQAA 2FVSA 5J2PB 3CB4A 3CWJA 5M2UA 1RYSA 4Y0FA 2DNKA 5KFFA 5FDLB 2CJQA 2CQHA 1IBKF 2D3OR 3IRWP 4EBDA 1R8BA 2AX0A 2XO7A 1HMVB 1WG4A 4P2SA 3HF5A 1C4CA 3OLBA 3KMQA 1YBAA 5JXSA 2IMWP 4LFAF 5IS2A 3RBEA 4MJKA 2OSQA 2HIQA 1OPIA 1KLNA 2HNDB 3IBWA 3T5LA 3UW1A 3SDEA 2AYBA 3CCTA 4K4VA 2F1FA 1Q78A 4Q2LA 1N34F 1K8AT 3RW6A 1KEKA 1FNOA 2Z4PA 2FC9A 2GFFA 2W24A 3N6NA 3TYTA 2FJBB 1B7FA 3AQOA 2QRRA 2FHOB 1SKRA 2PE8A 1VQ9S 1ROFA 4GC6A 3OUYA 4I1TA 5K8PA 4ED1A 1HQEA 4QPXA 1WHVA 4F02A 4WE1A 1XR5A 4QIVA 1JNRB 4X4VA 4J5OA 3HHLA 2GO8A 4QWBA 4EWTA 2KXNB 1FK9B 1LXJA 4C8LA 1VK8A 2HFOA 4EEYA 2EBEA 4A8MP 4UQGA 1REVA 2KKHA 2HS0A 1XN9A 3BO2A 2R2TA 5F8LA 4PWDA 3CDBA 1X9MA 3POTB 3RAMA 2DNHA 1S6QA 2HPUA 5E7OB 1VC6A 5EX0A 3DYAB 4NLTA 3I4HX 1RK8A 1KQFB 3BDEA 3NKYA 4C3MA 4HKQA 4A8YA 1MMDA 1UJ6A 1ZYQA 4JI2F 2ZITA 4C3LA 4HDGA 4DL0C 1Y9OA 3WDOA 4B9MA 2PI5A 1SV5A 3ISNC 1GTHA 2YNIA 1Q53A 2YVSA 4NMLA 3OL6A 1UFWA 3KKFA 5C25A 2J9DE 5KTQA 1URRA 2W9BA 2Q6CA 1SKSA 2FB0A 2RU3A 5A6PA 1RT4A 4A8XA 2CPIA 1VRUB 3K7RA 4QR0A 1VI7A 4B3OB 1Q79A 5AE2A 2LEPA 5CYJA 1S9EB 3MPVA 1YI2S 1SIZA 4C11B 4PG5A 5F41A 3NBPB 5GAGU 4MKYA 2YX7A 1XEZA 3R27A 4Q8EA 1G6BA 3O2IA 1S9FA 4ECQA 1ZAWA 4A46A 2ZKTA 2GQCA 2LCWA 3CCQS 1FVSA 1S1XA 3E01A 5KFUA 5A8KB 3E2EA 4X84A 4TKTA 3MM7B 3OLAA 3QPIA 5DQHA 2QA4G 5K8OA 5SUHA 4OZ1A 1R27B 1WG5A 1FD2A 5GMKa 1ZM9A 2B4PA 3IGNA 2ZZMA 4QIWD 2HWIA 3PV8A 3SI8A 2W9AA 2CQGA 3MEGB 3KK2B 2VH7A 3HP6A 2VB6A 5IT4A 2OTLS 4YR0A 3C8YA 3H59A 3IR7B 4YP3A 4DV6F 2BDPA 3I0RB 4WFYA 1N52B 4LFCF 1X5TA 3D0GE 5DM7Q 1M5OC 3JAMY 1AROP 1S1TA 4QR1A 2VG5A 5DRKA 1W2IA 2CQ1A 2FLOA 2NREA 3NAHA 3OQ2A 3HHLD 4GO7X 1IR0A 3NS6A 4I0WA 4NA3A 4RW7A 3GG1A 3L3CA 3FSXA 1SL1A 1FDNA 1NRKA 3TQ1A 3W2WB 2IRUA 2M3DA 4XPCA 5KG4A 1OPZA 2VASA 1TFWA 3DRRA 3W3SA 2A2DA 3RB4A 2IYIA 2B5JB 3DOLA 1TKTB 1D9FA 5F9LA 3WC2A 1HNIB 5LJ5Y 4X4NA 5FIIA 2HAIA 4LSLB 1IKVB 3JYTA 5ITHA 3D2WA 2HVHA 3N6MA 1T03B 4ZHRB 3CD0A 3DLKA 3Q2SC 3IGVA 3JSMA 4JI4F 3J7Z5 1FRLA 2MKCA 1IQZA 2R8GA 2DHAA 1S6UA 4TY9A 5CYQB 1UFLA 1BLUA 2E1AA 2IM0A 5B0FA 2KG1A 2CPHA 2LEBA 3OL9A 2HMIB 4NCGB 1JLFA 3ENWA 1TKZA 5GAHI 2R7TA 4OHVA 3SQGB 1TZ0A 2X1BA 5HP1B 1KSPA 4DV2F 4DR1F 2IA6A 2VC0A 2O1PA 2PO4A 4DV1F 4X4SA 4DR6F 2YNFA 3MWBA 3H2UB 3KLEB 2IVFB 1HW9A 3T1YF 4MMOA 1VGYA 4LVOP 2W7PA 4DQSA 3RR7A 4OI6A 1FD8A 4E0DA 2MYFA 1U6BA 4F3OA 1CG2A 4Z2XA 4GKKF 4BCAA 1B0TA 2CKWA 1M0SA 5DGAA 2E5IA 2VFSA 2MQOA 2N7YA 4KQZA 2J9DA 4C3KA 5KFTA 5BYSA 4B3MF 5GADI 3C46A 2HRYA 1MU2A 2VD3A 1APSA 2PDAA 2HGLA 4IR9A 3T1HF 5L1KA 1D8ZA 3PW0A 5CXTA 4LFBF 1DFDA