4NXNJ

Crystal structure of the 30s ribosomal subunit from a gidb (rsmg) mutant of thermus thermophilus (hb8), bound with streptomycin
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 10
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4nxnJ00
1N32J 4DR5J 1IBLJ 4B3SJ 4LFAJ 4JI5J 1FJGJ 4X64J 4LF9J 3D3CJ 5AJ3J 4KY3A 3JAMU 2UUBJ 5A2QU 4NEZA 2MQ8A 4DR1J 4KHPJ 1N34J 4RJVA 4GKJJ 4GKKJ 4DR3J 2KL8A 2MTLA 3IMQJ 1I94J 3D3BJ 1J5EJ 2HHHJ 4LF6J 1IBMJ 4DV4J 5LM7E 4LFCJ 3OTOJ 4JI8J 1HNWJ 5FLXU 4JI1J 4DR4J 4DV0J 4LF7J 4DV2J 5LMUJ 4DUYJ 4JI7J 4JV5J 3T1YJ 1XMOJ 5IWAJ 2VQFJ 4DV5J 4B3MJ 4KYZA 4HHUA 4LF5J 4DR6J 3T1HJ 3J81U 4PWWA 4DUZJ 4DV6J 4JI4J 2UXDJ 4DV7J 4DV3J 2ZM6J 2E5LJ 4K0KJ 2VQEJ 2UUAJ 3R2CJ 3W1YC 1HNXJ 4JI2J 1IBKJ 4OX9J 1HR0J 4JI6J 4V1Ak 1N33J 4JI0J 4DR7J 4JYAJ 1XNRJ 1XNQJ 4YY3J 2MEWA 1HNZJ 1XMQJ 4NXNJ 4LF8J 4NEYA 4JI3J 2UUCJ 2UU9J 5IT9U 5BR8J 2KVQE 4YHHJ 3J80U 5LMNJ 1N36J 4AQYJ 4X65J 4NXMJ 4LFBJ 2UXCJ 4B3TJ 4DV1J 3J7AN 4X66J 4DR2J 4LF4J 2UXBJ 4X62J 4B3RJ 2F4VJ 3R2DJ
chains in the Genus database with same CATH superfamily
3PW7A 1TUVA 2I9SA 4F2SA 2XGQA 3BGRA 5IWAF 4P75A 5D4LA 1VGYA 2HFUA 3KLEB 1WC3A 5KFSA 3E3XA 7FD1A 1XWLA 3UNYA 2OJ3A 5DDOC 2B4UA 3OD2A 1XMBA 2FJBB 2ZH5A 1QJHA 3MCNA 5CXTA 1QSSA 3BPSP 5EGYA 1FJGF 4OYMA 2N7CA 4NLUA 2HNYA 4A8FA 1NU4A 1N5YA 4A8WA 5IQ6A 4OX9J 3SSRA 2L9DA 2L48A 4LSZB 1UEUA 3JAMY 3B4DA 4TY8A 3PO4A 2UUCJ 1LQ9A 2VC0A 5HLFB 2FVSA 2DY9A 3HMJG 3SYZA 3OBIA 2MSSA 4P7TA 2IYGA 1NJYA 2LXFA 2MZSA 2EKYA 3MR3A 5AXLA 3SZ2A 1CJUB 4QYZK 2GVZA 3AD9C 1ZM2A 2IVYA 3JYTA 4N76A 1IQTA 4RUAA 3UFCX 1RUSA 3Q83A 3V6HA 1CEZA 1MROA 2POKA 1RWPB 4LF1A 3LALA 2FIUA 2ZH4A 2HBQB 3HHLB 1S1UB 1R0BG 3UNGC 3QIPB 4U7UD 1ZZFA 4K4ZA 1VQKS 4ILLA 3ZFVA 4MFBB 3Q0AA 2VQEJ 3SI8A 1T03B 1VOMA 3HHLD 1HIYA 1IKYA 1CS4A 4FZVA 1CQNA 1QD1A 3GQCA 3H25A 2HIYA 2HFZA 4JYAJ 1XNQJ 3W7BA 1BHNA 1MWZA 1U6ZA 5GAEU 4NMXA 5CD4H 5CYJA 3OR1A 1FRKA 3FRYA 3BH7B 3UQSA 2HHHF 4CO0A 4Y0FA 2QT7A 1VCTA 1P8GA 4HH0A 4IH6A 4TLQA 2HPUA 3HHKA 3I56S 2FJVA 3E8OA 4WP3A 5HJYA 2P9CA 1H3DA 2C2MB 1HI1A 1RYRA 2W9BB 4GKJJ 3MOZA 3K5PA 2ZM6F 2BRLA 1FA0A 4HDGA 2C2DA 1U0SA 5HVFA 3NMRA 2W1BA 4N56A 3NAHA 3CDUA 3FFIB 4RNHA 4PWDA 2K06A 4C11A 1YSJA 4L3NA 1PJ7A 5IT0A 1NCLA 4QWCA 3M30B 2DXFA 5BYQA 4DV3J 3DLKB 3BDPA 1XJWB 1X9MA 1S6PB 3CCMS 4DCPB 3C6UB 3OQ2A 4DZ6A 2J6UA 1YZ7A 1PG5B 3HZGA 1FXLA 2W2OP 1REGX 2ZBPA 4J9KA 2J8AA 4RW7A 4RNMA 3RB0A 1XTZA 1AUDA 3H5SA 2KU7A 1N0VC 3FDSA 1S76D 1LXJA 2ZEJA 3RR7A 1LWEA 4DV4F 2XLJA 1XBWA 3DOLA 3AB4B 4NX9A 3AY0A 1TKTA 1FKAF 2NREA 1YRUA 1SH0A 2HVEA 1WKKA 1NO8A 3CJKA 4EBDA 2DPJA 2WZ1A 5E5NA 2F63A 4WJBA 1KC8T 4WFAQ 3D4JA 5HJXA 1S9EB 1TKDA 2KJWA 3I4HX 4MIAA 5K14A 3RTVA 4DL3A 3QT8A 1E6VB 2EG2A 3KG4A 1UFWA 4B9SA 2PC6A 5K8MA 2UUWA 4IFYB 2MXYA 5J2NB 1BQMB 4ITSA 2BBEA 2LQ9A 3FBCA 4CDIA 3FRZA 2R7RA 3MM7A 2ATLA 4ES1A 2DNKA 2BOPA 4OHZA 2DNPA 2AJ0A 3QIDA 4KH0B 4QWEA 4EBCA 4C2MA 3W5ZA 4ZDNA 2KHCA 2ZBQA 1NK8A 3HVRA 4JI4F 3KG0A 1VRTA 5LT5A 3Q8QB 3HVAA 1HWUA 9ATCB 1WOPA 4WCEQ 3MPWA 3BN4A 4DV0J 1RISA 4MMOA 2F3JA 2DR5A 4IOAQ 4ZP6A 1WHVA 1RHQB 3G8SA 1R8AA 4NXNF 3V5RA 4DV5J 3THPA 4ECQA 2GIRA 3ITHB 1FFSB 1IKWA 5C7PA 2CG4A 1WJ9A 2BE9B 3NCPA 2IMOA 2JFKA 4B3TF 4YR0A 1RT5B 2LA6A 1B64A 1KEKA 2KZZA 1NBEB 2GIFA 2IA6A 2BVZA 5F8JA 3N6NA 3CC2S 1YQHA 4TYAA 3VGTA 4KR0B 5KFQA 1U02A 3SFUA 4I0WA 2V50A 1TK5A 1KHVA 2EK1A 2H5JB 5GMKa 2WVBA 3E51A 4JI1F 2BQ3A 1WF2A 4AT1B 3DGPB 4DL6A 2LKZA 2MQLA 5F8NA 3TA0A 2MZ1A 3R9LA 2LECA 2AQ4A 3I0SA 2NXJA 4KKOA 4ZVEA 3HHLC 3MR7A 2LCWA 3MEGA 1NJZA 2AJ2A 3PO5A 2AD9A 2YQ0A 1RP5A 4A8KA 4HVZA 4QJVA 4DZDA 4DX7A 3R1LA 1EAYC 1G4CA 2V5HG 1FFGB 4WYLA 5KFBA 2FVCA 2J7KA 3UI3A 3ZTPA 3MM6A 4B3RF 1S1WA 2V4QA 2GX8A 4UQGA 2MKYA 3AXMA 2RB7A 4OZJA 1TV6B 1S1XA 1QLNA 1VIOA 2HGMA 1RA6A 3MMCA 3FQLA 2GJ2A 1W2BR 2YH1A 2ZC3A 3TW0A 4H4MB 4I6AA 4TU7A 2JL9A 2JZ5A 1NDPA 4MIBA 4DQQA 4OI3A 2FZCB 4K4TA 4NA2A 2DR6A 4F0HA 3D0GE 5D4OA 1D8ZA 4EYHB 2A6MA 4PKDB 4ZHRB 2RKIA 4Z7CA 1R0AB 1LWCB 4OYWA 4CLLA 3BM7A 4Y00A 1XEZA 2C2NA 2OIHA 5KFTA 3KLEA 3O5TB 2BJDA 1HNXJ 4OZLA 4QIFA 2M5YA 1UVLA 3M8WA 1LK5A 1RT1B 4OI4A 1NDKA 1SKWA 4EEYA 2Z2MA 1N5TA 1SH2A 3O3LA 3QQCD 3ILIA 2CNOB 4RBTA 1GQEA 1H2UX 4AD6A 2EPIA 3P6YC 2AW0A 1WWHA 1Y4ZB 2HNDB 1FVSA 4ENOA 3JS9A 2DYAA 1SL0A 4YFUA 4R8UA 2XULA 2HNZB 3SCIE 3MMBB 4F8RA 4KHPJ 5HI7A 2XSJB 4W98A 6FD1A 3IMQJ 3M9MB 1XR6A 2L41A 3I5CA 5HLFA 2XWYA 2HGLA 1U24A 5D4PA 1GH8A 2GHPA 1Y3KA 1C4CA 4C0BA 1DTTB 2E44A 4FYVB 3C46A 3C19A 4B9NA 3M8SA 1B99A 1CJUA 4L76A 2E66A 1M1KT 3W1YC 3GIRA 2AEMA 2WONB 1TZ0A 2PI5A 5J2PB 3QMQA 4PEOA 4X64F 3WX4A 4M5DA 1BE4A 4C0OC 4RU9A 3HHLA 1S1UA 3KK2B 2QSWA 1C2PA 1SPBP 2BJ7A 5K5MA 4WP8A 1REVB 1QE1B 1CLFA 2W25A 4MFBA 3BYPA 3D9BA 2ZJPQ 3KNAA 2LDYA 2DPIA 3CVKA 2O01C 2ASLA 3CB4A 4C0HA 3RR8A 2DKOB 4CLSA 3FQKA 2L9NA 2XY6A 2QL9B 5IFMA 3DLEA 1RCXB 1KTQA 2ZFHA 2J9EA 1H74A 2HHPA 4EFAC 3V6KA 1SUQB 3WZ0A 2OMOA 2RRNA 2E1CA 1DURA 4ZCLA 1YTYA 1N36F 1X4FA 4X4QA 4MKVA 5D0HA 1BLUA 5JJBA 2DNZA 1XQIA 2V68A 3GTYX 1R7IA 1ZTWA 5A2QY 4OI6A 3GIIA 4DF8A 3HP6A 1A6LA 3GYNA 2I8EA 4X4OA 3LOUA 3SMZA 1O51A 4NLGA 3M30A 3PW5A 2ZBCA 3Q2SC 1IKVA 2IC3B 3AD7C 3TOQA 3D5MA 2VOPA 5JVHQ 1EX8A 2RILA 1FVQA 4L75A 3RW7A 3FC9A 4LF5F 4DF4A 1DQAA 2H54B 2D3UA 1QAJA 4P2MA 1FKOA 4D3HA 4MKBA 1VDHA 2AX0A 2YNGB 1G7CB 2FZGB 2LEAA 2DIUA 3G4SS 1O5JA 4BLGA 1DHMA 2Y1LB 5LMUJ 3R7SB 4C8MA 4KB7A 1L5UA 2PN6A 1FWPA 2CA9A 3RB3A 2RDDA 2GVDB 4IKAA 4V19J 2R8KA 4P72A 3VGSA 1FEHA 1BQNB 5BJRA 3N5BA 2MY8A 5KG3A 4ZVQB 3HHNB 4WFZA 2KFYA 2VB6A 1RAAB 1DAXA 4C3KA 2V8HA 4OLPA 4QWDA 3DGVA 1DQ9A 4ZK7M 2HHUA 1ZPVA 2FY1A 3VQSA 4HTJA 5H1SV 4NLOA 5KFGA 2WTFA 4PYAA 1KSPA 5CYQB 4P71A 4IFYA 1ZM9A 2JOQA 2OPRB 4IR9A 4PUOB 5J2NA 2G1DA 3AJDA 4USHA 3ZZPA 2VJVA 2QFIA 3CD6S 1MU2B 4USVA 1NPKA 4K4SA 5E3CA 4X2BA 1TMJA 3OR2B 2HVHA 3N5FA 1B0TA 4USMA 5F3ZA 2XQCA 4OYOA 3UCZP 3Q8YA 1HW9A 4FVCA 5B09A 3DLLQ 1YBUA 4DSIA 1VYAA 3EWGA 4EK2A 1Q81T 2BM1A 4LFAF 2PIIA 4G3IA 4DUYF 3IWXA 4K2JA 3GR0A 3HFKA 2ADBA 1JK9B 5EDWA 4WZQA 3U1NA 3ITHA 1WEYA 5C25B 1SI9A 3THTA 1N5QA 2BM0A 2X1AA 4DV1J 4F50A 3I0RA 2DNHA 2OAUA 2H9ZA 4DV2F 1HBOA 3NEKA 4EMDA 2COLA 4RNNA 1A9NB 1U6FA 2L08A 1Q16B 3TX0A 5HN0A 2RQ4A 1X8DA 1X4DA 2J0WA 5HROB 2XO7A 4WIQA 2MTLA 3MWBA 2GIQA 1RAFB 2RUGA 3VGUA 2YWWA 1Y5NB 1Y0HA 2OMLA 2KM8B 1SC6A 2ILYA 3O1LA 4CP5A 3HJVA 3QWPA 2ZUAA 3NNHA 5F9LA 1XNRF 2KT2A 2B5JA 5IWAJ 4U7CA 2EKNA 2PSZA 2OI2A 3AAWB 1Q82T 1YJRA 3QRPA 2ATCB 1YJWS 4Q0BB 2B56A 2M3DA 5KFYA 5E3QA 1RWWB 3RBEA 1IWGA 4KJIA 2CJXB 3LP2B 2ZH9A 1C1BA 3OHAA 2IYIA 2RS8A 1IBLF 2WAQD 3TAPA 2V2KA 1C0TA 3DNCA 3PJXA 3IR6B 1T3NA 1WELA 3TI0A 1YRXA 5M2RA 2ZH7A 1KVIA 2W2NP 4FF1A 1DTQB 1VC5A 3BGFA 1UA1A 1T7PA 2CPXA 2LU1A 2VHGA 4R25A 3KLGB 3EGNA 2GJFA 2DGXA 2QL5B 4QPTA 4HACA 3U02A 3TUPA 2V8DA 3DHXA 4PPDA 1TV6A 2UXDF 3D1HA 5HMYA 4K0KF 1FERA 1Y7PA 1JLQB 3U1MA 3QAEA 2WOMA 3MMJA 4RX6A 4NLQA 2JEGA 4WKRA 2FGCA 1UFLA 2XGPA 1R43A 3VGVA 2HEKA 3RUBL 3E01B 5EN1A 2C2OB 4PWWA 4TQRA 4H4MA 4F3OA 4AQYF 3CMQA 1KR4A 3VHQA 1LOUA 4JV2A 5THWA 4BS2A 2ZDOA 1G6BA 1B0PA 2GJIA 2JHEA 2UUTA 1JJ2R 4ZHRA 2NPIA 3RRGA 2Y0SD 2KN4A 1X4GA 2I6WA 4O3OA 2FYXA 4K8RA 3C14B 1IM6A 1YX2A 4N7TA 1HW8A 1ZYQA 2ZNYA 3WC0A 4IFVB 4LFCF 3KK1A 5H9FK 1KN6A 1JJCB 4ZN1A 3DXBA 1RU1A 1K73T 3UW1A 2UVVA 2RHQB 3N6LA 3MTJA 3W3SA 1Q1KA 2D7SA 3EVMA 2HHHJ 3TQ1A 2C22A 2Q3PA 1RT6B 5KFZA 1S57A 1L3UA 3HK2A 5F8LA 4DQIA 4FN5A 2HNDA 3PRDA 5K8PA 2VPZB 3QPIA 2BACA 1XMQF 2PA8D 4ZITA 5E7OB 4OX7A 4MKAA 1HBMB 3M8RA 2MKCA 4ZPTR 2XTJP 2UVWA 3AOBA 2ZM6J 3MMBA 2XSJA 3BKFA 5DGAA 2ASDA 1U1NA 4N41A 2IJRA 2K3IA 4ZA1A 4LSLB 5JUMA 2RDJA 5I42A 1RAOA 3CCSS 3R5BA 4NLVA 2A1BA 4IH7A 4YS2A 5C42A 1JX4A 4O3SA 4ED2A 1BMQB 3AT1B 5L8RC 2ZC4A 3IBWA 5DG9A 1EETB 4DR1J 3J7Z5 4UOHA 1JLAB 1IXKA 3M7VA 1SL2A 3PYGA 2V0NA 2C28A 4DQRA 3EICA 2Y3YA 4B9LA 2BXJA 4DV4J 5U47A 2LQ5A 2RAQA 1REVA 1KS2A 1QE1A 1R3NA 1Q79A 1YLXA 5JVGQ 5ETQA 1VLOA 3DCAA 2Z2LA 4Y28C 2W7OA 4ECZA 1NHVA 5LSOA 3HSZA 4H54A 2IRXA 1WC0A 1NH7A 1IQZA 4DS5A 3RJMB 4NYOA 3CJ4A 3L7PA 5A8WA 1FF2A 4K59A 4H4KC 3UDLA 3DRPA 2FQQB 1R6YA 1DZ5A 4DL4A 1F2HA 3AFGA 2W8LA 4A8SA 3QRQA 2AJQA 4YOEA 1MSWD 2HWIA 1FX4A 5EWFA 3CULA 1K0TA 4OX6A 2MJNA 2V67A 3U7JA 1E6YB 2UVUA 2I1RA 3L09A 2I5JB 1UW4A 1SJRA 4DSJA 4ZVHA 3TZWA 2Y8YA 3QO9B 2MZQA 2ALYB 2BQRA 2UUAF 2PFDA 2J0XA 5KFMA 4RUHA 5KFVA 3PZPA 2ZOFA 2MGZB 3CCTA 3PFOA 3S01A 2EK6A 2IJNA 4P10A 4FKYA 1TKZB 4KAIA 3M2RB 3C16A 4ELUA 3NBPB 1NK6A 4JI4J 1F9FA 3V2UC 4CLFA 5HP1A 3B8HA 2J8SA 1NB2A 3MXHP 3G6VA 1YJ9S 2P5VA 1SB6A 3CT9A 1AROP 1RKJA 2JRSA 3K5LA 2YNGA 3HKWA 2YKMA 3BQ0A 4NXNJ 1PC4A 1ZTTA 2IRYA 4U6PA 2DO4A 4C4WA 4RLEA 3VAIA 4R0EA 5CYMA 5L39A 1U0HA 2QJ3A 3QYYA 2IM0A 1Q78A 2GVDA 1DBDA 4DPWA 4LF6F 3G96A 2B8PA 3OFEA 4B3TJ 4NLRA 4L3KA 2B9EA 5ADZA 1BQNA 2V4JB 3UE2A 2C3PA 1VBYA 2F8MA 3D3CJ 1NK5A 2XLIA 1QDUB 1D9AA 1X5OA 4BCAA 2XG8A 4OYAA 3VTIA 5DM6Q 1IUJA 3KLHB 2M8HA 2VG7B 1CJVB 2W4DA 1JKHA 4F67A 4JI1J 5D0RA 2V4RA 1R8HA 1OWXA 3ENQA 3SSQA 3ILOA 3OT9A 5F8HA 5H9FJ 4UT4A 1PKUA 5IV4A 5J2MA 1C1CA 4RW8B 5CAAA 1QUPA 1U2CA 1RHUB 2UXCF 1KLNA 2AKWB 1TQLA 2UXBF 2ZWOA 1H0HB 2GGPB 3UN3A 2NYIA 2XLKA 2HHSA 3CCWA 4ZIVA 1KNZA 3MECA 1Q8BA 4QWBA 2EVZA 4WIIA 1SIWB 3MEDA 1HWLA 1FRJA 2BJ9A 2JDJA 4IRDA 4NLTA 1W26A 3J80U 3OR2A 5IT4A 3NOGA 4JP8A 4B3RJ 4ZJLA 1SQGA 1MMNA 2BDPA 2W4PA 2B9XA 1FXRA 4U8YA 2RMLA 3A1YG 1RWXB 3IN5A 1YI2S 3K58A 1YIJS 2MSTA 4DX6A 3RZAA 3J7ZT 4H4KA 2M4MA 4JB8B 5HMWA 4FPIA 2DJWA 4KT0C 2EG1A 2DNRA 3TJAA 2LP4A 5HROA 3VAHA 4B9TA 1T05B 3K5OA 3Q23A 1FESA 1V3ZA 3NGSA 2KTQA 4DR5F 4YQWA 2MEWA 5L9NA 2NCKL 5G4DA 4RUCA 4WZMA 2KXFA 3PJWA 4IDKB 3KHLA 2P6TA 2IVFB 3TR5A 3LP0B 3ZC4A 3CCQS 1AW0A 2BE2B 1FDAA 1B7FA 2HZAA 2HS4A 2HQIA 5LXRA 3ZTRA 3GB0A 2HRTA 3B54A 1HA1A 3RAMA 1CSJA 1RT2B 3V4MA 4UOFA 4ANCA 4BBYA 2XS5A 4LQ3A 2CJYB 2RF2B 1DY3A 3K2YA 5IM0A 2YKQA 2MY7A 3SCJE 4N8OA 3OFHA 5E0OA 2F40A 2KRRA 1ICEB 2QMWA 3KLGA 2UU9F 1SH3A 4KE5A 2CDQA 4IG3B 4LIWA 2AJ1A 5H9EJ 3ISZA 3EDRB 1RBOB 2I2YA 1ITPA 4LMZA 1X7VA 1H38A 1HFEL 3LW5C 4K4XA 2E9ZA 5L1KA 4KO0B 3OXFA 1AUSL 1R8CA 2WVFA 2QFJA 3BO2A 3A3PB 1K8AT 2Y0BB 3VALA 1G1XA 1X4AA 2OPQA 2A2CA 1Y5IB 1Z2ZA 1HMVB 3ZTQA 1FT8A 4DOZA 3MUVP 4X64J 4Z7YA 2J9DA 1URRA 4XDDA 1X60A 2E1RA 4ECTA 5AE3A 2FJXA 1T3OA 3CD0A 1EP4A 3AHPA 3S8SA 4USUA 4PCQA 2CQDA 2DTJA 4IFVA 1RTJA 1DQ8A 3ELHA 1M1GA 4L6V3 1NHKL 1Q4RA 2YXLA 3IGVA 4LRFA 3ZO7A 1Y9OA 2FHJD 3QATA 1GMWA 5KFWA 3K5MA 3JTPA 1T9UA 2EBEA 3LO3A 2CZ9A 1I3OB 4GVLA 4QQBA 4U9RA 2O66A 1GX6A 1RT6A 3RBXA 3R5AA 2ZVIA 2PMZD 5ETVA 3KHHA 1JQGA 3CDAA 1EKSA 3P49B 3NCRA 4F3QA 2Z8QA 4C9DA 1N36J 4CM0A 3UCUP 4TKTA 2NPFA 4Z2XA 1SBRA 3NGRA 3MPUB 3PKYA 1RT4B 2HS0A 3J7AN 4R5PB 1BXNA 1NMEB 1S5ZA 3DXSX 3CF5Q 1P9QC 5D77A 3QJPA 4IG0B 1DLOB 3ETOA 2FC9A 2MQ8A 1HPZA 5F0WA 3L95X 3TUJC 1PIEA 1Z4UA 1S4FA 4Q5VA 3MMAA 4JI6F 4EWTA 3D0IE 1NKEA 5IZHA 3V6JA 2YQ3A 3CCUS 3MAHA 1Z1ZA 4A48A 4LF5J 1RT7B 2RNEA 2AHOB 3KYLA 3A4TA 5KG2A 1F3VA 3M8YA 2KRBA 3EGWB 4XDCA 1JLAA 2JEIA 3KFWX 3IBFB 1S97A 3FBBA 2ZNZA 2PMWA 4I7FA 4JI5F 1FJ7A 3O2IA 1VQSA 2MQQA 4ZLNA 2Z57B 3S7RA 2W4CA 4DX8H 5HSPA 4S0MA 1Y5LB 2Z58B 1R8BA 4PRFA 3CDWA 4LREA 4ZLPA 2XMWA 3FSXA 4Y65A 3QNWB 1LNQA 4J9MA 4CO2A 2DNNA 2O5DA 4DR6F 2DH7A 4ZCIA 3MGJA 3BGLA 3BBCA 3T9ZA 3JB9k 1RHMB 1WI6A 5FD1A 1VJQA 1FTCA 3QGPA 3T5JA 2Y1RI 2XZDB 3TUIC 1K1SA 4M5NA 2OTJS 1SQFA 2IM3A 1CJKB 2X1GA 6FDRA 4NA3A 5AXNA 2HZVA 2DNQA 3ET6A 1E6YA 2ZH6A 3PVXA 5GADI 4EO8A 1JXLA 3ZZUA 1VQMS 2DHGA 4AUKA 1QTNB 5C24A 4CYUB 3QLHB 4O3QA 1TR0A 4M94A 1P27B 7AT1B 3ZTSA 1MNEA 1UJ4A 2X1BA 2P9EA 1TKZA 2CFXA 1KOOA 2IFXA 4NYZA 5B0AA 4X4UA 3NBPA 1R27B 1FXDA 1WSRA 4EZ9A 2XSFA 3KHRA 1UJ5A 1HQEB 1TAQA 5I3UA 4LFAJ 1RTDB 4WU2A 1HD1A 2OFGX 4OHWA 3TEGA 1U48A 4ZVRB 1R31A 2GV1A 2WVCA 1IJFB 3FCWA 3HVWA 3DOKB 5JXSA 2AGOA 2RD5C 4DV2J 2BABA 1LXNA 2W7AA 3CO9A 3TZYA 4HHUA 2W7PA 4KFBA 2JEJA 2ZKTA 2VICA 4J9VA 4N8NA 1VR6A 2QSFA 4ILRA 4LFBF 2HHWA 4OI0A 2D9OA 4X62F 4DFMA 2LXUA 3G2XA 4WTYA 1XNRJ 2VG7A 1CJVA 1N6QB 4RWXA 4QU7A 3QRRA 4URQU 1S7HA 2DNMA 4DBQA 1QVGR 1HYSA 1TL1A 4XO0A 2IHR1 3OTOF 2VONA 2W2PP 1S9GB 1SVDA 1ZM3A 1FWKA 1IBLJ 1SJ4P 1VBXA 1MMLA 2Y9HA 5AXMA 4YDDB 1FE4A 5J1EA 2MYFA 1D09B 4ATNA 2KH9A 1JJ4A 5SZTA 4I64A 4ECYA 1MG7A 2JFDA 1SCJB 1WF1A 3TAMA 2AIRB 1FNMA 1PYOB 1TK0A 1U1KA 1QUVA 3PX0A 2UXDJ 1AFIA 1NH8A 3BGUA 4K0KJ 2PD1A 4RKUC 1HI0P 2RQCA 5L38A 1VHFA 3QGHA 1KOHA 2OFHX 4WP9A 4YEAA 5HMXA 3W61A 3QBCA 4HL9A 4FXVA 4AQYJ 1BY9A 3A3OB 3TA1A 4TLRA 2LDIA 4ZVTB 2JWNA 1T05A 3PTWA 3JQMA 3T1YF 4KGXB 2ZVSA 5FDLA 3M8PB 1J5OB 2Z4PA 5F8GA 4QR0A 1EQMA 1U8SA 3W9IA 3DI6B 1S1TB 2KYXA 3T6BA 1K1QA 3LP0A 3P45B 2ROPA 3IM8A 2BE2A 4CLUA 3GLJA 4LFCJ 2QN6B 3EZOA 3HJFA 3UD3P 1TUWA 3FBFA 3EUNA 5KFOA 1EHWA 3DRSB 4QU6A 3CO0P 3CCZA 3I5BA 5DETA 3GWCA 3TQEA 3V4IB 3G82B 1RT2A 4G6VB 1VQLS 2XMUA 3PFEA 1R0CB 4CCHA 3FK4A 3BQ2A 3GJTB 2QA1A 2DGSA 2RF2A 5B0BA 2ZKUA 3NS6A 1FRIA 1HWKA 2YX7A 1XMQJ 3MEKA 3GFHA 4QW9A 4NLDA 4XIUA 3IS9B 3CIMA 2C1EB 1LWFB 4X4VA 1Y10A 2F8HA 2R7TA 4IG3A 1SL1A 3GV5B 1HBNA 1F5CA 4HHJA 1X4HA 4I6YA 2K3KA 1F2GA 2AP6A 1ZAVA 1LWXA 3DRRB 2ADCA 4DXLA 1MLAA 2B6AA 4RUBA 3CDBA 3M2UA 4JI8J 1RBAA 1VQ4S 1UEKA 4B3OB 2BR0A 3H98A 4KYZA 4JI3F 3MTKA 1BC6A 4KPYA 1VFJA 2AJFE 3CD7A 3ZZOA 3WIVA 2R8IA 3D7SB 5KFCA 2ZH8A 3AODA 3IR5B 4KGVB 1MWQA 3M6XA 5LSLA 1JLFA 2FHJA 1BGXT 4NL5A 3ZZTA 2EC0A 4LF9F 4PG6A 4Y3CA 2YY3A 3S6EA 1AXQA 3WBZA 3CJTA 3T19A 1LW0B 4HH1A 1UPMB 4HT5A 4PWUA 5E2QA 2R4FA 4LF2A 3TARA 2VOOA 5KOXA 4GMKA 3MURP 4RNFA 4JV5F 3SV3A 4F2RA 3W63A 1D3WA 2F4FA 3TA2A 3K7RA 5J2QA 1VBKA 2YKPA 5DJBA 1UZDA 2DEJA 4IYQA 3HD1A 2OP5A 2Z0GA 1F0XA 1OSCA 1YVFA 3H5UA 4ED8A 5GAHI 2HFOA 3DM2B 3GSDA 2NSCA 4OHYA 4ED0A 2YNIB 4IG0A 2BW7A 1DLOA 5ETNA 3G86A 2UUAJ 2YPZA 2PGCA 2Q43A 4ZLJA 1DARA 4URGA 2ZZNA 1CJTB 4K7QA 5KG4A 3KUGA 3QJLA 2OSRA 4EYIB 2LA4A 5HQ8A 2HQFA 4ZVPB 2NUHA 3PIOQ 1C0UB 1RT7A 1CC8A 1J5EF 2GNKA 3C6TB 1RWKB 3ILLA 4HYKA 1P1TA 2DNOA 1Q8LA 2F1FA 2E5GA 3O8WA 1L3VA 1S49A 4K4VA 1JLGB 3JTOA 2HSEB 2RU9A 2YKAA 5MAOA 3FMBA 2B7BB 1FNOA 4KQZA 1A7GE 4DUZF 4WFXA 1WNEA 3FEXB 2E5LF 5KFLA 4LF6J 2OHDA 2QLBB 3R5DA 4ZLLA 2NSBA 4A8MP 3HKZD 3D6FB 3EZ5A 4PR6A 4ERDA 5BYSA 3VQTA 1PAUB 2GMLA 1GAOA 2BRKA 3J80Y 2RS2A 3PRVA 2RT3A 4QYRA 2CJAA 3IGNA 3MZIA 3KKFA 1IVZA 2C2ZB 4X4TA 4RNOA 3B82A 2O67A 3GFZA 2IDEA 3OL7A 4X4SA 1RE1B 2Q1LA 4X66F 5K8NA 4FXDA 3IAM9 2R7SA 1H98A 4CO5A 5KG6A 4DFPA 5AE1A 1CC7A 1ELOA 2I0XA 5HMZA 2DD8S 3T41A 5A8KB 3KMSA 5DDPC 3D68A 2QLXA 3HHEA 2RUSA 2UXCJ 2YNFA 2MKHA 2UXBJ 3P96A 5IV3A 2K1RA 3VV2B 2R2TA 3M32A 4YB7A 4JI7F 2YX1A 1XMOF 1Z2LA 1RTHA 2D74B 4QIEA 3EGVA 2ZJRQ 2XMTA 2VG5B 4KH1B 1S12A 1VMBA 2QX0A 5KFKA 5MLCV 1W25A 2CPHA 3UD4P 2N4DA 1HQEA 1PAEX 3FKBA 1ROFA 5AXKA 2WBMA 2R7UA 1TL3B 2NXUA 3A3NB 3MUTP 2R2UA 4I69A 4CO1A 4OYPA 4BHQA 1QSYA 1SKSA 5E3PA 1S72S 4A8XA 4JBCA 1HNZJ 3MCSA 4OZNA 1U1LA 3N28A 3DU6A 3HFZB 3MAAB 4P2SA 2HBYB 3AJ2A 3OL6A 4PG4A 4URSA 1KD1T 1H73A 3L4BC 4LQ9A 4DLEA 4CI0B 5HK4A 1NSPA 3X3UA 2L3MA 4MH8A 3OLAA 2EEYA 1NSAA 4DR5J 2XO6A 4ECSA 5GADU 1VQPS 1FKPA 1N6QA 3V6DA 2HAFA 4CH7A 3G87A 4XPEA 3GIJA 3BKUA 3LP1B 4WE1A 4OZ5A 2XWXA 2G0JA 4FNIA 1PILA 1ZA1B 2C2KB 1VQYA 5B0DA 3RAQA 2CXEA 3PX6A 2DEIA 2JSXA 1S9GA 2VPXB 2MPUA 1HNVB 1FCAA 3Q8SB 2XBPA 3QT5A 5K20B 4DR1F 4X65F 2HFNA 4JUZA 3MM8B 1KQGB 1NJXA 1GTEA 4Q2LA 1SKUB 4ICLB 4CQ1A 2J7UA 5DG8A 4MTPA 3GYXB 2ZE2B 5AJ3F 2RJZA 3DLGA 2VF3A 3EX7B 2UU9J 1J2VA 1RZMA 3NXZA 1XK8A 3BKTA 2QLFB 4ZVUB 3OJSA 2LEBA 1IBCB 2V63A 5KFXA 1FNXH 2F7VA 3IO1A 4G1QB 3JSRA 1FI4A 2YVSA 3GV8B 3B4MA 2XZWA 2RDIA 4ZMMA 2FC8A 3KG1A 3HHDA 5DO2A 2MDAA 4RW4B 3CUNA 4I4BA 3NP5A 1PCAA 4OYBA 2X7IA 3QSYB 3IA0A 1V5VA 1OPIA 1SJFA 5HATA 2JC1A 1SXLA 2U2FA 4C8LA 4USWA 1KFDA 3M8PA 2IAJA 1L3SA 1J5OA 2NR0A 9RUBA 1S1TA 1AZSB 5C5JA 1S6QB 4KGZB 2KDOA 2WBRA 1TKXB 3PM9A 4AXIA 2DR7A 5KFAA 1WSVA 3JSBA 3MOJB 1H2VZ 2VG6B 2N4CA 3RRKA 1JLEB 2FDNA 4PZVA 1SV5B 3DRSA 3DLJA 2MLZA 2V2QA 3V4IA 3TANA 3G82A 4IQMA 2K8GA 2ZBRA 3GSIA 4TU9A 2VDIA 4LVNP 1VRUA 2PEHA 4YDXA 4MJKA 2W2QP 4KTQA 2DCLA 3VR1A 4FYWB 4LT6A 2A3JA 1KLMA 1LWFA 4DL5A 3R5CA 3KLIA 5HVHA 4W92B 3IRXA 3DOMA 1FD2A 4CT8A 2FHMA 3AD8C 1VQOS 2XZTB 2ZH2A 1SQEA 3NG8A 1I6JA 4LBIA 1EIYB 1IKXB 3DRRA 3UDEA 1U09A 1UAWA 4FBUA 1KTVA 4F4AA 1RHKB 2GZOA 3VVUA 4JI6J 1N32F 3H2VE 4W90B 3TEHB 1MN7A 2HQDA 3ULHA 4WFBQ 2ALZA 2DGTA 3VZHA 4B3OA 1S48A 3IP0A 3GMGA 1Y11A 5F3TA 4C8NA 1TL7B 4DPTA 3J7A1 1KKHA 3O44A 4ECUA 1NXIA 3GE9A 3HM9A 3JYTB 3LPYA 4JI5J 3FNNA 4ES2A 5IT9Y 1QTMA 1FDDA 1F6TA 1MROB 3GV7B 4NWBA 3ZNUA 4LSNB 3AOCA 1FWLA 2AV5A 4M1KA 5KFPA 5LM7E 5DDQC 4ALZA 3BR9A 4LF7J 1S0MA 2CUYA 5DLGA 4FP9A 2AF6A 5KFDA 2HG4A 3TP2A 2ZUGA 1SKRA 4DR6J 1IM4A 2HIQA 3L7OA 4K4UA 3ADAC 2DK2A 1X4EA 4MIWA 1CULA 3MM5A 3MM9B 5HVGA 4HEA9 3M8QB 5KFFA 3UO0A 3OR1B 4ED7A 5L46A 3KXDA 4OFZA 1OPZA 1R8PA 4YB6A 2CAJA 4ED4A 3KJFB 2CG8A 3DRYA 2ZOMA 1VC0A 1U8WA 1YJNS 4WKYA 1X9WA 4O23A 3H42A 1RWVB 4MT1A 4AXJA 4I67A 2GHVC 4UUXA 2ZWPA 5LJ3Y 5HQLA 8AT1B 1CJTA 3CD5A 3BR8A 5A6PA 1T9VA 1GTHA 4RZRA 4CT9A 2P6SA 2P9GA 1RB0A 2HW3A 1RAHB 2R8GA 4YB1P 4PWDB 1TL5A 1Q53A 4C11B 3WX8A 4QZVB 1HR0F 5KFEA 1C0UA 1M5VC 2OD4A 3C6TA 5EWGA 2VPWB 4PQUB 4PAAA 1JLGA 1WDTA 3T3FA 1VK8A 2V9KA 2B8QA 4RW7B 4CLTA 4R0JA 1OJ4A 2QA4S 2CPZA 3GG0A 4NI2B 1GEHA 3CW2C 1CVJA 2B43A 4EU0A 1KBRA 4YP3A 1LWEB 3I82A 4B9MA 2CQBA 2NXCA 1RA7A 1ACMB 2C42A 3EYZA 3W9JA 3VF0B 4LFBJ 3AH6A 3R6GB 1TKTB 2EW9A 3TRGA 5GAHU 4X62J 2CQ1A 3RBDA 2E5HA 1H6KX 3W2VB 1RDRA 1RCOB 2HK2A 3VAJA 4WK3A 4ZP8A 3RGIA 3R7BB 4JI2F 2OPSB 5HAOA 1U6BA 2ASJA 4QIVA 2OGUA 3PV8A 5FJ4A 3OTOJ 5FLXU 5K14B 8RUCA 2V8GA 2CDRB 2MKJA 2MQMA 1IR2A 2VFVA 2CADA 2PO4A 3AA8A 5HBMB 1O0PA 2VG5A 4DDFA 3NKYA 3K5NA 2FHOB 3QIPA 2DGVA 2LQJA 2Z2YB 2LU2A 2B51A 1T03A 5ETOA 3MM7B 2L9WA 3OLBA 3H40A 1R6VA 2KB2A 5CCMA 2IIHA 2XYPB 1U49A 4F3MA 1MWYA 1SC1B 2HZCA 1U2FA 3BDEA 2EFVA 3M9OB 4DPUA 3D1QA 3PW2A 4ID8A 3TJ9A 1IWAA 2MLXA 4OI2A 2DB1A 2KYZA 1T11A 4PPZA 2ZH1A 1VK3A 4ZPCA 4CLYA 1JLCB 2LVWA 5DQIA 2R8HA 3HF5A 2W9BA 5F0UA 4JV0A 3D66A 2FJAB 4PG5A 3NGUA 5KG1A 3T1YJ 1RSCA 3EGZA 2OEKA 1TUGB 4HR2A 4J9OA 1EQ0A 2XNQA 5KAKA 1WG4A 3PX4A 2LEPA 3FFIA 2DNLA 3SQGB 3HZEA 4BWMA 2N82B 4CH1A 1NDLA 2DRAA 3OTDA 4BC9A 3K8WA 4C8ZA 1N5VA 1T9XA 3GILA 1WC5A 4ID5B 3DLKA 3KMQA 3W2WB 4B3SF 1S6PA 3SCKE 4DUTA 3H0PA 2DISA 4FYDA 3C6UA 4ETZA 2K7JA 3EPIA 4FF2A 1M5PC 3P4UB 2MQOA 4TY9A 1UVIA 4AL6A 1TP7A 3TYTA 3MM8A 2BZ2A 4DN0A 4ICLA 2MZRA 4E98A 1VQ6S 2MLYA 4GO5X 6AT1B 1RGVA 3BSCA 1FTRA 5IC4B 1UA0A 1PJ5A 2R7WA 2QC3A 3PR5B 2D9PA 3NWRA 1U1OA 1QSLA 1X5TA 3CCLS 2WRMA 4IRKA 3CIZA 2XNRA 1SIZA 2GQCA 2KT3A 3J81j 3BSNA 2CPEA 4YMEA 3CC7S 4PQAA 3TVKA 3LA0A 2C2EA 4WU3A 2AZ3A 2DH9A 2BKPA 3MM6B 1KVKA 3F56A 3I9V9 3HD2A 2XS7A 5LMNF 4NCAA 2EFQA 2WSFC 2FUG9 4F26A 3CMAS 1S9EA 2EFNA 3DFEA 2X1FA 2BX6A 4RW6B 3SQOP 1E6VA 2E1PA 1LV5A 4JI3J 2HLTA 2Q6CA 3D0HE 1WI8A 4HI1A 1YJTA 2CIMA 4LR7A 2M2BA 5CA5A 2VBYA 1FJCA 4C48A 1BQMA 4QBUA 2CQIA 3I32A 1UZHA 2QLJB 2FVQA 1QAYA 4A8OA 4J9LA 1F3FA 5KG5A 3A8KA 1AZSA 1S6QA 4CNYA 4LF9J 3I9ZA 1TKXA 1T94A 3OVAA 3QT6A 1M5HA 2JX2A 4RJVA 1NK9A 2OUGA 3GIMA 1YBAA 2VG6A 2NUUG 1JLEA 2GO9A 3R5GA 2UV8G 2DRDA 3AJ1A 1B4SA 4RW9B 1NZAA 2V34A 4JV5J 2KFNA 2HMIB 4ES3A 4CH0S 3M6UA 1K47A 1NKBA 3MDFA 1HL6A 4DL2A 4O3PA 1URNA 2H1YA 1JXVA 3SDEB 3AB2B 2MHNA 2V2ZA 2NXEA 1X5PA 3CJQA 5CD4A 1RT5A 4GKKF 5GVQA 3M8ZA 2YKNB 2A18A 4R8UB 2E7VA 5D0GA 4X4NA 3PNIA 2XYHB 1KRPA 1IBMF 1AA1B 1IKXA 2QTWA 2WSEC 4DJBA 2OEMA 2HBRB 1NSKL 2DXDA 3G6YA 3LF0A 4G1IA 3LAKA 3DGPA 4LJMA 4CO4A 3P8BB 2OD6A 4Z37A 1I5OB 1J5EJ 2VDHA 3D6MB 2X3DA 1UFKA 2XHCA 5B0FA 1TL7A 1HNWJ 3PYFA 3CCES 5IOLA 5CZVA 3BYRA 3Q2TC 4LVOP 3IM9A 4F0KA 2DH8A 1RI7A 1TAUA 2NS1B 2R3VA 1K0VA 3DLHA 4DUZJ 1GXLA 1OSDA 2DXEA 2ILZA 3MUMP 4XPCA 4OX8A 2E5LJ 2CVEA 2RE1A 4LSNA 4M5DB 2BANB 4OJ1A 2IPOB 1HD0A 4CNZA 4NOHA 2D3OR 4GC7A 5GMDA 1UW9A 4RBUA 2IMWP 5B08A 4NCBA 2H3EB 4E8UA 3D6TB 3CXCR 3MHYA 4U7UK 1LKZA 2D41A 2YBVA 1NLKL 4USIA 4DPYA 3PKMA 4X66J 3GPAA 3MM9A 3M8QA 1MW7A 1FO1A 1QAIA 3CWJA 2JVOA 2QA2A 3TJ8A 4DV6F 4M63A 2AU0A 3DLEB 3G8QA 3UDCA 4X84A 1MN9A 1FRMA 3R97A 4LUBA 2ZBIA 1D1UA 2I38A 2BJ1A 4JI7J 4CIOA 2HWTA 3FGVA 4DSKA 3LGNA 1XMOJ 4LF8F 3F41A 1R0AA 1LWCA 2BA9A 4UW2A 1T9TA 1XC9A 1HHSA 3FCVA 3IG1B 1V3SA 1RHJB 4FKXA 3BJYA 3LH2S 4TN2A 4ECVA 4G65A 2IBOA 3MEEB 1EKRA 1LFPA 1IKVB 4RPFA 4OQJA 4PQUA 3GZ7A 1U25A 1HARA 1RT1A 3WHIA 1RQ0A 2EFPA 4WXWA 4C3MA 4J37A 1TELA 1VQ5S 3BQ1A 2F9DA 2ZZTA 5KG7A 2XCPA 1FKOB 3N6MA 2XY5A 4USJC 4O3RA 1JMTA 4NI2A 1AB8A 5ETSA 3W66A 4DV7F 3DHWC 5B0CA 1NK0A 2HNZA 3QFHA 3BPDA 1VQ8S 4JV1A 2F65A 2HBZB 4JI0F 4OYXA 2W9CB 2FJDB 4B9UA 3T1AA 4FS2A 3W2VA 5DGBA 2CQGA 2J0SD 5G0RB 4TU8A 4NLPA 3VAKA 3VAGA 1DTTA 1OY8A 1HHTP 3GR1A 2LMIA 1NB7A 2F4VF 2QV6A 1RYSA 2R8JA 2OPSA 4OMFG 2NLWA 4JI8F 3PCOB 3OHBA 2WONA 2U1AA 5M2UA 5J2PA 4WBFA 3SV4A 5LOQA 2YWGA 4CLWA 2PI4A 2RQMA 3I96A 4WF9Q 2HFSA 4X65J 4IOBA 4DCJB 2XMAA 3CJ5A 4NLSA 1U7LA 3FEYB 3IFEA 1UJ6A 5HBMA 3KK2A 3G8TA 2VU5A 1WEZA 1FK9B 5AJ3J 3I31A 4F4WA 1RTZA 4F25A 4ZPAA 4NEZA 3HXMA 1TU0B 2HQCA 5IC6B 2QLWA 2KO1A 3M1VB 2C3YA 1YDLA 2UZAA 1KHWA 1NPRA 2W9AA 4LRCA 2J6TA 3HVTB 3EVOA 4FNHA 1T0TV 1S99A 3GFYA 3BBBA 3PIPQ 4YHHF 4IUFA 1RWMB 3U27A 4P9SA 3A8IA 5M2PA 1N8RT 1RAJA 1SUQA 1HQUB 3ONQA 1FRLA 1TFYA 1VS3A 3IR7B 3V81B 2D69A 1L3KA 3D1OA 3QFWA 3JSMB 1JLCA 4K2XA 2X51A 3R6LB 1NSQA 5H9EK 2H51B 2EBGA 1YBTA 2UUBF 2WB4A 1FD8A 3I0RB 4NMLA 4DFJA 1N34F 4DR3F 1UVNA 1HBOB 4QYZJ 4OL8A 2KM8C 2FLNA 2DHXA 1LK7A 3GG1A 4OZ3A 5E3AA 3SQGA 1B3TA 1N52B 3EJMA 2W01A 4O44B 4KIAA 2VQFF 2IC3A 4ID5A 5CH7B 3W2WA 1JXEA 2DVIA 4ELVA 3OSNA 4DEZA 3DRXA 2VBXA 2B5JB 3L9ZA 4X4RA 2MMYA 3C2PA 1IBKF 4Y2AA 3KOAA 1N33F 2CRLA 4DR7F 1FHTA 3MPDA 4ER8A 3S1TA 3CE8A 1C1BB 2V2VA 3N79A 3HDSA 4HDHA 3PHEA 2E7XA 1C0TB 4ETXA 3FBEA 4NZ6A 1BWVA 2GW8A 2E7WA 5L1IA 5T41A 3UVJB 4IOCQ 1Q86T 2YNHB 3PW0A 5D78A 1YHQS 1U47A 5I4MA 4M5LA 4HACB 5DDRC 2DNYA 3MPYA 4YR2A 2QGFB 2IM2A 5C2GA 1DRZA 1YKWA 4OJ3A 3CJ2A 1N32J 1N0UA 2G2OA 3KNGA 4UOGA 4DG1B 4A8QA 2WOMB 4RW6A 4AFFA 2N7YA 2GCFA 3J7YI 3P5BP 3D2WA 2CQCA 3Q89A 3C8YA 3EPGA 5CYQA 4I1TA 5KG0A 3OXLA 2PT0A 4DFKA 2OPRA 2ZD1B 4PUOA 5J1NA 2P8IA 2QYCA 3H5YA 2HVDA 4U95A 4QWAA 4I6WA 2CVIA 1MU2A 5CZXA 2NXNA 3UN5A 2CPFA 4A46A 3NMAA 3BBFA 1OYEA 4OHXA 4DR2F 4KC5A 2VFUA 1P9YA 1RBLA 2J9CA 1CQMA 2VC1A 4ZPVR 3EM1A 1WF0A 2VFTA 4RW9A 5BXIA 1YK9A 2HMIA 3KK1B 1VJWA 1SC4B 3HSDA 1Q5VA 5ETLA 4WTOB 3W5XA 4ZP9A 3KDNA 3AXKA 2AYMA 5KFUA 3C15B 1H72C 3PEJA 1LFWA 2EI5A 5C25A 2GMJA 4NRTA 4B3MF 4KY3A 3SDEA 1U4BA 1X0FA 1RADB 1HNZF 1OMSA 1UWBB 1BWEA 4M5IA 2E1MC 2G2YA 2VUGA 4FBTA 2KG0A 2CQ2A 1XR7A 3D3BJ 4RO0A 2YKNA 5EUHA 3IAS9 2V94A 4XTTA 4EGLA 4IQXA 3O6QA 5DG7A 3CC4S 4I2QB 4P2FA 4DQSA 1U1MA 4HTIA 3HT3A 2F8EX 2BYCA 2N3LA 4DSFA 3NOCA 2MQPA 1N5SA 2FHKA 4Q43A 3TWZA 4ZPBA 1VQ7S 4LBPA 2DR8A 2Z2ZA 3ENAA 1HR0J 5E41A 3PRBA 5I42B 4Q0BA 2CJQA 4J9QA 1NKCA 2Q66A 3LP2A 4BWJA 4Q8EA 1GXUA 5C42B 2E1AA 1JIHA 4CM2A 3HULA 2K7KA 4ZOSA 4YUDA 3EZUA 4ZIWA 3SSSA 5ETMA 5FLXY 1M5SA 5DQGA 3KUEA 1N48A 4OI1A 4DPOA 1DTQA 1OQ6A 2BANA 2DNGA 2VD3A 1BQXA 4CZCA 1UVJA 4PXDA 3ILJA 2A0FB 1ZZNA 1M0SA 2XCAA 1EJ7L 2J6SA 3D28A 4M5JA 3Q8PB 4ZPDA 3GJQB 4F4KA 4I2PB 2HYIB 1LW2B 2CNNB 1JLQA 2V8PA 4DQPA 3MCMA 2DBBA 1RKIA 3J81U 2FVPA 4GC6A 3I5AA 3MD1A 3E01A 3IWLA 5A8WB 4K4YA 4JI2J 5A76A 2M88A 1U1PA 3DRPB 3POTB 1RU2A 2FGOA 4KSEB 2AMCB 2BJ8A 2XI3A 4IO9Q 5AT1B 4JOUA 4FVMA 2IDLA 4EBEA 4ILMA 2VBZA 2BE7D 3FZBA 3EXYA 3LGHA 1Q7YT 4Y2CA 2HURA 1I94F 1H2TZ 4FYYB 3W8GA 5ETRA 4TVAB 3C14A 3IG1A 5CABA 2LQ8A 4K5RA 3SFGA 3K89A 5B7WA 2M9KA 3T1HF 3MEEA 3C3LA 2EFGA 3BEGB 3CJRA 4OHVA 3RYLA 4J90A 5K8OA 1WACA 2MKKA 1QM9A 3UN2A 3OUYB 5CQGA 5LL6d 5HO4A 1GT8A 3C16B 4M5HA 3BO3A 4GVBB 5CHCB 4DPXA 1IR1A 2G4BA 5HP1B 2DGWA 3JSYA 5RUBA 3D6HB 2YKMB 3BSAA 2LXIA 3I87A 4A47A 1HBMA 1RT3B 1WKJA 5CYMB 1U0HB 3JQJA 4ZVSB 2FLOA 3Q8VA 1ZPWX 4Q8FA 2W9CA 4OZ0A 4UY85 4HI2A 2KVQE 1O8BA 2GMHA 1U1RA 4NLYA 3MAQA 2M70A 1S6UA 2J0QD 3KJNB 4LSLA 5G0RA 4ZPWR 2BJ3A 1HKAA 4NLWA 3IC1A 3X1LB 2X3GA 4B3SJ 1YWXA 4YR3A 2VZ9A 1UVMA 2B3TB 7FDRA 1JKHB 2G9OA 3R8YA 1NZ8A 2DHSA 2CNKB 3GYGA 1KVJA 2VL1A 1YRTA 1EETA 2R7XA 3EDQB 2G0IA 4ZVGA 2M8DB 3ZTOA 3CCRS 5J2MB 1C1CB 2QL7B 3TZZA 2E29A 2E9TA 1FK9A 3MD3A 1YG0A 1WHWA 3I6PA 1RK8A 3MECB 5T7LB 4DCOB 2WVDA 2XMVA 3MEDB 4E2FB 3CCJS 3M1VA 1NJIT 5T14A 3PYEA 5KT3A 4B02A 2YWKA 5D3GB 4LF7F 1WEXA 1DFDA 3HVTA 1IJEB 2FJEB 3PXGa 1RAEB 4FS1A 5LMNJ 4RWWA 2OTLS 2ROGA 2XB2D 1RABB 3UD5A 4DR4F 4KGMA 4ED1A 3Q22A 1HQUA 3NRBA 2B4VA 2MHEA 4N77A 2ACMA 4P73A 3V81A 3JSMA 2H65B 1XN9A 3M9NB 2JVRA 1K9MT 2C2RA 2D3O1 3MCOA 2I5JA 2WB1D 4OJHA 3BZQA 4NRUA 1PBAA 3FJ2A 3KLFB 3QO9A 2QMUB 2DITA 1M90T 2HHQA 1UP1A 2LLZA 3DYAB 1WUUA 2PMHA 4O44A 3CMES 3P3DA 2MGZA 5KT4A 4YB5A 2DRBA 3KLVA 2B9YA 3R7NB 4PXCA 3JQKA 3BF4A 3M2RA 4QW8A 4LRBA 1F1BB 3L3CA 3HPOA 3PR4A 1S79A 2FD2A 3TUZC 3BSOA 1S7IA 2HQGA 4NEYA 5ETTA 1GFWB 2R9LA 4PG8A 3RB6A 1M5KC 1VHIA 1ZS6A 2B9WA 3HCXA 2CKWA 1JNRB 2KVIA 1OQ3A 3NL0A 2VPYB 1S9FA 3PACA 1KP6A 5I3PA 2HRYA 4QPXA 2XC9A 1F60B 4CLKA 1FJGJ 2E9RX 3CJ3A 1PSDA 5IM0B 2AZ1A 3QSIA 3A12A 5JMNA 4GKKJ 3UVJA 4DI6A 2V4JA 2YNHA 2D3ZA 3KDOA 5EHHA 2APOA 2QG9B 1IBMJ 2ZH3A 2MQNA 1RJJA 1T95A 1NUEA 1YZ6A 2CNLB 4C8KA 3KLHA 4C7QA 1APSA 1WTFA 4DG1A 3R1HA 2IY5B 2B0GA 1OY6A 4NXMF 3NLCA 3H8YA 1W7WA 4DU8A 5EX3A 2GA7A 3GCXP 4RW8A 2G0CA 2ZD1A 2RQKA 1WOSA 2OPQB 2DO0A 2GGPA 2BV3A 2E5IA 3RW6A 4DHVA 3ZZ0A 2R2SA 2CPJA 4RBVA 4B9VA 1UVKA 4UY8T 5DS7A 5A8RB 5IS2A 2LFVA 2BEFA 5E3RA 2HHTA 2VIHA 3IWNC 1EP4B 4CTAB 3NS7B 1GMVA 5D0EA 4DMZA 4MK8A 4NLXA 3ZZZA 1S4EA 3U1LA 2KJVA 1RTJB 2GQQA 1TK8A 1UWAA 1ZAWA 4TNOA 2WSCC 2C3MA 2ASYA 3UPFA 4DL0C 4J91A 4YY3F 3T5KA 4F36A 2Y8WA 2KXNB 2IM1A 3C15A 4ED6A 4DV6J 4KPCA 1JNZB 1FX2A 1GMWD 1UL3A 1TFWA 1UWBA 4ELTA 4ANDA 5B0GA 1SJQA 2JC0A 2O3DA 4UQTA 4A8YA 2W24A 3M2VB 1F5AA 2XY7A 4WXOA 3F0NA 3J7YU 2B4OA 2R2RA 4LF8J 4AE5A 1EB0A 2KKHA 4I2QA 2GS8A 2VKRA 4ECRA 4EZ6A 3FEZA 4IDKA 1NK7A 5KFNA 1HPZB 1QVFR 1X0PA 3H59A 3TAQA 1S1VB 1RLDA 2R7OA 4EO6A 4UTGA 2XEXA 3MMAB 2JLFA 4HHHA 2CPYA 4F0MA 2UV8A 1VISA 4WK1A 2VBWA 2AT1B 4P52A 3H7HB 2CPIA 1HI8A 3OSPA 3DMJB 3GU0A 3WC2A 4UUWA 2WCXA 3RRHA 5C2CA 2F5GA 3WQPA 3TZXA 2H48B 3AA9A 1UMJA 1TL4A 1RWOB 1BUXA 4K5SA 2FZKB 4OIXA 2YPYA 1FRHA 4V19X 4P6QA 2LQBA 4DV7J 4I7FB 1ZBTA 1HQ2A 4ZJOA 3B6BA 1GNKA 3PW4A 1RWNB 4LF4F 3M6VA 4G1PA 2O1PA 4JI0J 4ZS6A 3BB5A 3IBCB 3BO4A 2BW2A 3Q86A 2KFZA 4I2PA 5KFJA 4USKA 2RU3A 1LW2A 2CJ9A 2C3UA 1WC1A 2BMBA 1K44A 2HAIA 3OTBA 1Q8KA 2IA0A 3FSYA 1VIXA 3QWUA 4L74A 1HWIA 4DU7A 1RTIB 4DWIA 1VQNS 2DHAA 3LANA 4DX5A 1P6TA 4KO0A 2BJEA 2SXLA 2H5EA 2F4VJ 1VBZA 3POTA 2ZHBA 3E2EA 2V9WA 4TYBA 1RAIB 3RU0A 3F44A 1HMVA 4NCGB 5LJ5Y 1SJ3P 1HBUB 4HKQA 4B17A 3MFHA 1PBUA 4YN3B 1OS5A 3ET6B 1NJWA 4FYXB 4F4XA 4ECWA 3QZ7A 3QZ8A 1L3TA 3PG9A 2XHWA 4ECXA 4J9PA 4NE9C 1JB0C 4PYDA 4F7VA 3ENWA 5BR8F 2FTRA 4A4JA 2MZTA 4H4OB 4FPRA 5C24B 1FE0A 3HSGA 4MYTA 2AJ4A 3LGMA 5ITHA 1WD6A 2MB0B 2V6AA 2FJWA 2BOAA 2BKOA 5L1LA 2WW8A 3OUYA 4OLOA 4GVBA 4Y2MA 1OIAA 4NYPA 3WIUA 1DJ0A 3FUYA 2HQ3A 3LWMA 3H2LA 2CQ0A 2Z56B 1KDNA 3KJQB 4YHHJ 3KK3B 1YITS 2W2MP 3NY0A 1KQSR 5I3UB 2H5IB 1ZOTA 1IN0A 2M7SA 4MK7A 3T6JA 1B0VA 2OEJA 4ED3A 4CLZA 2GQ2A 3W60A 4RU2A 1PYSB 1RACB 4KHRA 1RT3A 2ROEA 4W4MA 1RT4A 2UUBJ 4R5PA 3K57A 1NK4A 1N34J 3KHGA 4DR3J 1BD6A 4KHMA 4C8OA 4OX9F 1J27A 4KRWA 3EMTA 4KFBB 3L7UA 1F5BA 3A8JA 4HT7A 5GMEA 2UP1A 1V3RA 2XI2A 1U2RA 2RRBA 3G6ES 1XIQA 2VQFJ 2GHWA 1UCNA 2CWXA 2UUCF 1WTBA 4DSEA 4LBHA 1CBKA 5KFIA 2EXUA 4HLBA 1NPPA 1IBKJ 1GX5A 1T9WA 1N33J 5KT2A 4DR7J 4MAKA 1FRXA 4FF3A 1HNWF 3I55S 2IRUA 1HYSB 2R7QA 1TL1B 4O4RA 3GJRB 3SCLE 1FJEB 2HVIA 3R27A 2YKOA 5LXYA 3PHTA 3DLBA 5ETPA 1KONA 5T7LA 5F8MA 2F9JA 4WPAA 2AYEA 2FVRA 2RIJA 1NM2A 1RAGB 2YQ1A 1F9HA 5J1EB 3JAMU 4J9NA 5D3GA 1H7XA 3PY8A 1NEEA 4BDPA 5D6GA 5SUHA 2VQEF 3QT7A 3TAMB 3EE3A 4ZJQA 2QA4G 2VA2A 2HWHA 3KTQA 3BREA 5ETKA 4C97A 3UDVA 5I3QA 3RB4A 4JYAF 1XNQF 1D9FA 1X31C 3T9NA 3TO8A 4MK9A 2IVMA 3IXQA 1ZETA 4PG7A 4KV8B 3UCGA 1XERA 2OLWA 1T02A 4F4YA 3ETMA 1CJKA 1T9YA 1VLYA 4CLPA 2DHHA 3CSKA 1M1HA 4UOCA 4KGKA 2BUNA 4U96A 3DU5A 4QIGA 2M0GB 4I56A 3PJ9A 1YJUA 2HS3A 3CJ8A 3KLFA 1X4CA 3SIPB 4GKJF 3NS5A 4CYUA 4DLGA 2A6OA 3H5XA 2WK4A 5KFRA 2DIVA 2M52A 2YX4A 3DYAA 3H20A 2EC2A 3QLHA 5KT6A 5FDLB 4CWBA 4DR2J 1U1QA 4J9UE 5DQHA 1HNIB 3PDNA 1T8EA 4RR5A 2RH3A 3R3TA 4ZCMA 3B78A 3BN7A 2QYGA 5D8HB 2H4WB 1B70B 2WVEA 2ZZMA 2PDAA 2HKEA 4DV3F 4OJGA 1RTDA 4F02A 2R42A 4XK8C 4N5SA 4AL7A 1S6OA 2CJBA 3K17A 3UR0A 4O3NA 3CCVS 5L9XA 1SJ1A 4GRSA 3DOKA 3ZZRA 3TNVA 3Q8RB 4B3MJ 5KOWA 1UETA 1Q0NA 2G1HA 2J5AA 2NQPA 4I68A 1WG1A 3LAMA 1JLBB 1FDNA 2HVZA 1ZAXA 4ZN3A 3RG6A 2VV5A 4Q2MA 4EUVA 3ZXWA 4J9SA 1LEOA 5GAGI 1O6XA 2MKIA 3IRWP 1S0VA 1UTAA 2AEFA 2GFFA 3Q24A 5L1JA 4OYIA 2V69A 5IXUA 1XR5A 1ZH5A 2PEBA 3CDEA 1HBNB 5EX0A 4C6AA 1P1LA 1UEVA 2VFSA 4DS4A 1D9DA 4Q45A 3LUYA 3J81Y 4Y2KA 2B6AB 2QEXS 3OV7A 1U45A 2GAGC 2CWKA 4BC7A 3M2UB 3LQVA 1CPZA 3FCHA 1W2IA 2OELA 3CTRA 3JTNA 1KQFB 2B7CB 2E5JA 5IQQA 2G2ZA 2PFFB 4USTA 5J1PA 4OV6A 3A13A 5A8RA 2FY8A 1YJ7A 2Q6BA 1M5OC 2CQ4A 4TQSA 3KJVB 1ZA2B 1MMDA 1JLFB 4M5GA 4CTAA 3G9CA 3AQOA 4RL1A 1V6HA 1G2EA 1U26A 3FSIA 3VCDA 3N0VA 3R5JB 4M95A 4F04B 4O0NA 3TVZA 3ENVA 8ATCB 1Q5YA 2HHXA 5D15A 1KFSA 1OO0B 3QAUA 1WOOA 4O4GB 5DZ7A 3CJSA 3ISND 4DV0F 3R2DJ 3AOAA 5J2QB 1QAXA 1H7WA 3W9HA 4DV5F 3T5LA 2VJUA 2OPPB 3M2VA 1X5SA 4PABA 4AYBD 2CPDA 4ZCKA 2EFOA 2ABYA 1I94J 5A0YB 4Y2IA 2CYYA 3N01A 1PC5A 1TVRB 3DI6A 4LR8A 3VWSA 1X9SA 4FF4A 3H4BA 4UZCA 3T1HJ 1S1VA 2WW4A 3NAIA 3ZZYA 3LTOA 1S0OA 4OYZA 3LPEA 2CZ4A 4PXBA 2GC8A 4O0IA 3CGIA 1GK8A 3BGRB 1RWUA 3NNAA 4N47A 3DMJA 1ULRA 4U8VA 2FLPA 2KHDA 3JXOA 4WFNQ 2NZ4A 2PA3A 1S0NA 4GO7X 3SBMA 1KQKA 3NGTA 2D1CA 2ZOGA 3IS9A 3D67A 1ZM4A 2KZMA 2KXHA 5DRKA 3HSJA 3MI7X 2HNYB 4Q7AA 2G13A 1N5YB 4NZ7A 5GAEI 2DY1A 3MF5A 4IO1A 2IBKA 2HFVA 2BQUA 4M5MA 2NZCA 5K9FA 2VH7A 1RTIA 3QGIA 3OFGA 3W62A 2JNJA 4WYWA 2XMKA 3OPKA 4TY8B 1X4BA 2JH3A 3OVBA 3P5TL 1G3OA 2V8VA 1WG5A 3HO1A 3KUHA 3OTEA 1PGZA 2ZHAA 2BKNA 2FLLA 2VKZG 2NYHA 4NCGA 2DCUB 2KI2A 3T5HA 4M5KA 5AE2A 3R2CJ 1HBUA 2AX1A 2JEFA 1B7YB 2GVZB 2B4PA 2IJFA 3US5A 4IRCA 5IT9U 2YNFB 2CZVC 2HHVA 2YWHA 2K1RB 4OV1A 5A6WA 3M32B 3VAFA 3GCWP 1RTHB 4H4OA 5KFHA 1WKLA 1LW0A 2YWFA 5HANA 1WHXA 2HK3A 2HRUA 1R89A 3MR5A 3FMWA 3DDIA 1N56A 2XS2A 3HI9A 2DGQA 1IKYB 1CS4B 3DDKA 3OW2R 2QMXA 1HNXF 1RHRB 4F4ZA 4QR1A 3KK3A 2CJKA 4IH5A 4DR4J 1VI7A 4QR2A 4DUYJ 3LWLA 3H2UB 3MPVA 3ZNJ1 2YTCA 3G71S 3HFVA 5HL7Q 1AYEA 3Q8UA 4Y6IA 2J7WA 3DM2A 4TXSA 4Q44A 3OJUA 2YNIA 2YWEA 1VC6A 3NCQA 4CO3A 1NAQA 1Q7LB 3SEOA 2ACYA 4KHPF 1EZZB 1AFJA 3I4PA 1VRQC 4OZ2A 2GAHC 2OSQA 4DN9A 1FDBA 1N4LA 1FKPB 1EARA 3TVYA 3V6DB 5KTQA 1IR0A 2LYVA 1V5IB 3TX8A 3OXGA 3BH6B 4WE1B 4IR1A 1NRKA 3NWGA 2KL8A 1UPPA 3MFIA 5DZ6A 1NDCA 4E0DA 2DR9A 1FEEA 4XAKA 3CNQP 1N88A 2EWHA 3NNCA 3PYDA 4Y34A 4PXEA 3M4XA 2WHOA 4ZP7A 3SXLA 5KT7A 4NPOA 4L72B 1OY9A 4X4PA 4DSLA 1YGYA 2AWZA 3GJSB 3AQPA 5E33A 4NZ0A 2R7VA 1PJ6A 3DOLB 3D54A 1D0EA 3DLGB 1WC4A 2QIFA 3DKDA 3ISNC 2FB0A 4V1Ak 2ZHOA 3UWTA 2AEJA 3H90A 1Y00A 4U67Q 5HQMA 1N54B 2QZ8A 2Q79A 1PO6A 3VVTA 1HLWA 3OL8A 3CJKB 1QY7A 4LR9A 3VAMA 3W8PA 4NXMJ 3WDOA 4J9RA 5A8KA 4KV8A 1S59A 4D3GA 2XMJA 1RXOB 1V9OA 5F41A 3DC2A 4J7CA 2OH2A 2C3OA 4WWSA 4MKYA 1I51B 2JJ4D 2RSQA 3RBZA 2CQ3A 2Y1IA 3OL9A 4M8LA 1SC3B 2VODA 2IAJB 3M05A 4QIWD 1HNIA 3HX9A 5B0EA 4KBIA 2OO4A 4ZKAA 3G6XA 3N4WA 2CQPA 4P7VA 3K0JA 3FVYA 1I1GA 5DLFA 1C4AA 2AGQA 1OYDA 1TL3A 4B08A 3CEDA 4YY3J 4NA1A 5D4NA 4K50A 3KWMA 2JLGA 1VRTB 4P2XA 1NHUA 3FZ2A 1Q8IA 3CPWR 4QOTA 1VRUB 2RHSB 2XYGB 3VZIA 3MAAA 2GO8A 3M6WA 2A2DA 4C98A 2RVJA 2Z30B 1JLBA 1TTHB 5LMUF 1HHQA 3H4DA 4EI2A 2MKSA 1IKWB 2J9DE 3EXCX 1KLMB 1Y3JA 5A2QU 1FFWB 1JJHA 3EVWA 3KLIB 5CCLA 2AGPA 4DL7A 3DN9A 2ZITA 3IRXB 3PEHA 3GP9A 3DOMB 4FDFA 4P74A 4NASA 2QRRA 2DGOA 1WHYA 2AYGA 2P2CB 1UKUA 4C8YA 3LP1A 1PYTA 2CQHA 3HT0A 1S10A 2MJUA 1NNDA 1GMUA 1WC6A 2DT9A 5DM7Q 2FPHX 1D8YA 3K8VA 4C3LA 2XMMA 1HNVA 3UR3C 4UZBA 2W8KA 2OKQA 1A0OB 3A8EA 3QJJA 3QGGA 3GONA 3I0SB 4KKOB 2HLUA 3CJ0A 4FXWA 2KT5A 3ICLA 1S77D 4L73A 2ZE2A 2ZJQQ 4OZ1A 3KJVA 3MR2A 1KWMA 3MEGB 4K4WA 3BS9A 1JWWA 3K59A 1GXTA 4MYUA 4LF4J 3W65A 4CRJA 3RAXA 1Q95G 2ZDPA 2VFRA 3C66A 3W5YA 4G1QA 5F8IA 2A10A 2VA3A 4ZVOB 1YJVA 2N3OA 3MR6A 2UVRA 3BGOP 3F73A 2HGNA 2K2PA 1S1WB 5GAGU 2JLEA 2RRAA 4LRDA 4QCLA 5KT5A 2DGUA 4O4GA 1WDDA 1S1XB 1VQ9S 2H4YB 4UF4A 4RW4A 1WORA 3OTCA 1CULB 2MZJA 4J5OA 4LIRA 3MM5B 3NGDA 3DDNA 5BYRA 2PE8A 5EWEA 2OPPA 3THVA 2QE5A 3OFFA 3MMCB 1TMMA 2QO3A 3W64A 4ED5A 5F9NA 4DV1F 2XM3A 1F9EB 5A0YA 4LRAA 1CG2A 4ZVFA 2YH0A 3HLUA 5LSRA 1RLCL 1TVRA 4WFYA 3BV8A 3NGKA 3OVSA 5BR8J 5FIIA 2VASA 3GIKA 2Y1JA 2RKIB 2J76E 2ERRA 4AL5A 1AT1B 3N9UC 2AYBA 3GFXA 2KG1A 1HWJA 1SV5A 4ANEA
chains in the Genus database with same CATH topology
1N32J 4DR5J 1IBLJ 4B3SJ 4LFAJ 4JI5J 1FJGJ 4X64J 4LF9J 3D3CJ 5AJ3J 4KY3A 3JAMU 2UUBJ 5A2QU 4NEZA 2MQ8A 4DR1J 4KHPJ 1N34J 4RJVA 4GKJJ 4GKKJ 4DR3J 2KL8A 2MTLA 3IMQJ 1I94J 3D3BJ 1J5EJ 2HHHJ 4LF6J 1IBMJ 4DV4J 5LM7E 4LFCJ 3OTOJ 4JI8J 1HNWJ 5FLXU 4JI1J 4DR4J 4DV0J 4LF7J 4DV2J 5LMUJ 4DUYJ 4JI7J 4JV5J 3T1YJ 1XMOJ 5IWAJ 2VQFJ 4DV5J 4B3MJ 4KYZA 4HHUA 4LF5J 4DR6J 3T1HJ 3J81U 4PWWA 4DUZJ 4DV6J 4JI4J 2UXDJ 4DV7J 4DV3J 2ZM6J 2E5LJ 4K0KJ 2VQEJ 2UUAJ 3R2CJ 3W1YC 1HNXJ 4JI2J 1IBKJ 4OX9J 1HR0J 4JI6J 4V1Ak 1N33J 4JI0J 4DR7J 4JYAJ 1XNRJ 1XNQJ 4YY3J 2MEWA 1HNZJ 1XMQJ 4NXNJ 4LF8J 4NEYA 4JI3J 2UUCJ 2UU9J 5IT9U 5BR8J 2KVQE 4YHHJ 3J80U 5LMNJ 1N36J 4AQYJ 4X65J 4NXMJ 4LFBJ 2UXCJ 4B3TJ 4DV1J 3J7AN 4X66J 4DR2J 4LF4J 2UXBJ 4X62J 4B3RJ 2F4VJ 3R2DJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N32 J;  4DR5 J;  1IBL J;  4B3S J;  4LFA J;  4JI5 J;  1FJG J;  4X64 J;  4LF9 J;  3D3C J;  5AJ3 J;  4KY3 A;  3JAM U;  2UUB J;  5A2Q U;  4NEZ A;  2MQ8 A;  4DR1 J;  4KHP J;  1N34 J;  4RJV A;  4GKJ J;  4GKK J;  4DR3 J;  2KL8 A;  2MTL A;  3IMQ J;  1I94 J;  3D3B J;  1J5E J;  2HHH J;  4LF6 J;  1IBM J;  4DV4 J;  5LM7 E;  4LFC J;  3OTO J;  4JI8 J;  1HNW J;  5FLX U;  4JI1 J;  4DR4 J;  4DV0 J;  4LF7 J;  4DV2 J;  5LMU J;  4DUY J;  4JI7 J;  4JV5 J;  3T1Y J;  1XMO J;  5IWA J;  2VQF J;  4DV5 J;  4B3M J;  4KYZ A;  4HHU A;  4LF5 J;  4DR6 J;  3T1H J;  3J81 U;  4PWW A;  4DUZ J;  4DV6 J;  4JI4 J;  2UXD J;  4DV7 J;  4DV3 J;  2ZM6 J;  2E5L J;  4K0K J;  2VQE J;  2UUA J;  3R2C J;  3W1Y C;  1HNX J;  4JI2 J;  1IBK J;  4OX9 J;  1HR0 J;  4JI6 J;  4V1A k;  1N33 J;  4JI0 J;  4DR7 J;  4JYA J;  1XNR J;  1XNQ J;  4YY3 J;  2MEW A;  1HNZ J;  1XMQ J;  4NXN J;  4LF8 J;  4NEY A;  4JI3 J;  2UUC J;  2UU9 J;  5IT9 U;  5BR8 J;  2KVQ E;  4YHH J;  3J80 U;  5LMN J;  1N36 J;  4AQY J;  4X65 J;  4NXM J;  4LFB J;  2UXC J;  4B3T J;  4DV1 J;  3J7A N;  4X66 J;  4DR2 J;  4LF4 J;  2UXB J;  4X62 J;  4B3R J;  2F4V J;  3R2D J; 
#chains in the Genus database with same CATH topology
 3PW7 A;  1TUV A;  2I9S A;  4F2S A;  2XGQ A;  3BGR A;  5IWA F;  4P75 A;  5D4L A;  1VGY A;  2HFU A;  3KLE B;  1WC3 A;  5KFS A;  3E3X A;  7FD1 A;  1XWL A;  3UNY A;  2OJ3 A;  5DDO C;  2B4U A;  3OD2 A;  1XMB A;  2FJB B;  2ZH5 A;  1QJH A;  3MCN A;  5CXT A;  1QSS A;  3BPS P;  5EGY A;  1FJG F;  4OYM A;  2N7C A;  4NLU A;  2HNY A;  4A8F A;  1NU4 A;  1N5Y A;  4A8W A;  5IQ6 A;  4OX9 J;  3SSR A;  2L9D A;  2L48 A;  4LSZ B;  1UEU A;  3JAM Y;  3B4D A;  4TY8 A;  3PO4 A;  2UUC J;  1LQ9 A;  2VC0 A;  5HLF B;  2FVS A;  2DY9 A;  3HMJ G;  3SYZ A;  3OBI A;  2MSS A;  4P7T A;  2IYG A;  1NJY A;  2LXF A;  2MZS A;  2EKY A;  3MR3 A;  5AXL A;  3SZ2 A;  1CJU B;  4QYZ K;  2GVZ A;  3AD9 C;  1ZM2 A;  2IVY A;  3JYT A;  4N76 A;  1IQT A;  4RUA A;  3UFC X;  1RUS A;  3Q83 A;  3V6H A;  1CEZ A;  1MRO A;  2POK A;  1RWP B;  4LF1 A;  3LAL A;  2FIU A;  2ZH4 A;  2HBQ B;  3HHL B;  1S1U B;  1R0B G;  3UNG C;  3QIP B;  4U7U D;  1ZZF A;  4K4Z A;  1VQK S;  4ILL A;  3ZFV A;  4MFB B;  3Q0A A;  2VQE J;  3SI8 A;  1T03 B;  1VOM A;  3HHL D;  1HIY A;  1IKY A;  1CS4 A;  4FZV A;  1CQN A;  1QD1 A;  3GQC A;  3H25 A;  2HIY A;  2HFZ A;  4JYA J;  1XNQ J;  3W7B A;  1BHN A;  1MWZ A;  1U6Z A;  5GAE U;  4NMX A;  5CD4 H;  5CYJ A;  3OR1 A;  1FRK A;  3FRY A;  3BH7 B;  3UQS A;  2HHH F;  4CO0 A;  4Y0F A;  2QT7 A;  1VCT A;  1P8G A;  4HH0 A;  4IH6 A;  4TLQ A;  2HPU A;  3HHK A;  3I56 S;  2FJV A;  3E8O A;  4WP3 A;  5HJY A;  2P9C A;  1H3D A;  2C2M B;  1HI1 A;  1RYR A;  2W9B B;  4GKJ J;  3MOZ A;  3K5P A;  2ZM6 F;  2BRL A;  1FA0 A;  4HDG A;  2C2D A;  1U0S A;  5HVF A;  3NMR A;  2W1B A;  4N56 A;  3NAH A;  3CDU A;  3FFI B;  4RNH A;  4PWD A;  2K06 A;  4C11 A;  1YSJ A;  4L3N A;  1PJ7 A;  5IT0 A;  1NCL A;  4QWC A;  3M30 B;  2DXF A;  5BYQ A;  4DV3 J;  3DLK B;  3BDP A;  1XJW B;  1X9M A;  1S6P B;  3CCM S;  4DCP B;  3C6U B;  3OQ2 A;  4DZ6 A;  2J6U A;  1YZ7 A;  1PG5 B;  3HZG A;  1FXL A;  2W2O P;  1REG X;  2ZBP A;  4J9K A;  2J8A A;  4RW7 A;  4RNM A;  3RB0 A;  1XTZ A;  1AUD A;  3H5S A;  2KU7 A;  1N0V C;  3FDS A;  1S76 D;  1LXJ A;  2ZEJ A;  3RR7 A;  1LWE A;  4DV4 F;  2XLJ A;  1XBW A;  3DOL A;  3AB4 B;  4NX9 A;  3AY0 A;  1TKT A;  1FKA F;  2NRE A;  1YRU A;  1SH0 A;  2HVE A;  1WKK A;  1NO8 A;  3CJK A;  4EBD A;  2DPJ A;  2WZ1 A;  5E5N A;  2F63 A;  4WJB A;  1KC8 T;  4WFA Q;  3D4J A;  5HJX A;  1S9E B;  1TKD A;  2KJW A;  3I4H X;  4MIA A;  5K14 A;  3RTV A;  4DL3 A;  3QT8 A;  1E6V B;  2EG2 A;  3KG4 A;  1UFW A;  4B9S A;  2PC6 A;  5K8M A;  2UUW A;  4IFY B;  2MXY A;  5J2N B;  1BQM B;  4ITS A;  2BBE A;  2LQ9 A;  3FBC A;  4CDI A;  3FRZ A;  2R7R A;  3MM7 A;  2ATL A;  4ES1 A;  2DNK A;  2BOP A;  4OHZ A;  2DNP A;  2AJ0 A;  3QID A;  4KH0 B;  4QWE A;  4EBC A;  4C2M A;  3W5Z A;  4ZDN A;  2KHC A;  2ZBQ A;  1NK8 A;  3HVR A;  4JI4 F;  3KG0 A;  1VRT A;  5LT5 A;  3Q8Q B;  3HVA A;  1HWU A;  9ATC B;  1WOP A;  4WCE Q;  3MPW A;  3BN4 A;  4DV0 J;  1RIS A;  4MMO A;  2F3J A;  2DR5 A;  4IOA Q;  4ZP6 A;  1WHV A;  1RHQ B;  3G8S A;  1R8A A;  4NXN F;  3V5R A;  4DV5 J;  3THP A;  4ECQ A;  2GIR A;  3ITH B;  1FFS B;  1IKW A;  5C7P A;  2CG4 A;  1WJ9 A;  2BE9 B;  3NCP A;  2IMO A;  2JFK A;  4B3T F;  4YR0 A;  1RT5 B;  2LA6 A;  1B64 A;  1KEK A;  2KZZ A;  1NBE B;  2GIF A;  2IA6 A;  2BVZ A;  5F8J A;  3N6N A;  3CC2 S;  1YQH A;  4TYA A;  3VGT A;  4KR0 B;  5KFQ A;  1U02 A;  3SFU A;  4I0W A;  2V50 A;  1TK5 A;  1KHV A;  2EK1 A;  2H5J B;  5GMK a;  2WVB A;  3E51 A;  4JI1 F;  2BQ3 A;  1WF2 A;  4AT1 B;  3DGP B;  4DL6 A;  2LKZ A;  2MQL A;  5F8N A;  3TA0 A;  2MZ1 A;  3R9L A;  2LEC A;  2AQ4 A;  3I0S A;  2NXJ A;  4KKO A;  4ZVE A;  3HHL C;  3MR7 A;  2LCW A;  3MEG A;  1NJZ A;  2AJ2 A;  3PO5 A;  2AD9 A;  2YQ0 A;  1RP5 A;  4A8K A;  4HVZ A;  4QJV A;  4DZD A;  4DX7 A;  3R1L A;  1EAY C;  1G4C A;  2V5H G;  1FFG B;  4WYL A;  5KFB A;  2FVC A;  2J7K A;  3UI3 A;  3ZTP A;  3MM6 A;  4B3R F;  1S1W A;  2V4Q A;  2GX8 A;  4UQG A;  2MKY A;  3AXM A;  2RB7 A;  4OZJ A;  1TV6 B;  1S1X A;  1QLN A;  1VIO A;  2HGM A;  1RA6 A;  3MMC A;  3FQL A;  2GJ2 A;  1W2B R;  2YH1 A;  2ZC3 A;  3TW0 A;  4H4M B;  4I6A A;  4TU7 A;  2JL9 A;  2JZ5 A;  1NDP A;  4MIB A;  4DQQ A;  4OI3 A;  2FZC B;  4K4T A;  4NA2 A;  2DR6 A;  4F0H A;  3D0G E;  5D4O A;  1D8Z A;  4EYH B;  2A6M A;  4PKD B;  4ZHR B;  2RKI A;  4Z7C A;  1R0A B;  1LWC B;  4OYW A;  4CLL A;  3BM7 A;  4Y00 A;  1XEZ A;  2C2N A;  2OIH A;  5KFT A;  3KLE A;  3O5T B;  2BJD A;  1HNX J;  4OZL A;  4QIF A;  2M5Y A;  1UVL A;  3M8W A;  1LK5 A;  1RT1 B;  4OI4 A;  1NDK A;  1SKW A;  4EEY A;  2Z2M A;  1N5T A;  1SH2 A;  3O3L A;  3QQC D;  3ILI A;  2CNO B;  4RBT A;  1GQE A;  1H2U X;  4AD6 A;  2EPI A;  3P6Y C;  2AW0 A;  1WWH A;  1Y4Z B;  2HND B;  1FVS A;  4ENO A;  3JS9 A;  2DYA A;  1SL0 A;  4YFU A;  4R8U A;  2XUL A;  2HNZ B;  3SCI E;  3MMB B;  4F8R A;  4KHP J;  5HI7 A;  2XSJ B;  4W98 A;  6FD1 A;  3IMQ J;  3M9M B;  1XR6 A;  2L41 A;  3I5C A;  5HLF A;  2XWY A;  2HGL A;  1U24 A;  5D4P A;  1GH8 A;  2GHP A;  1Y3K A;  1C4C A;  4C0B A;  1DTT B;  2E44 A;  4FYV B;  3C46 A;  3C19 A;  4B9N A;  3M8S A;  1B99 A;  1CJU A;  4L76 A;  2E66 A;  1M1K T;  3W1Y C;  3GIR A;  2AEM A;  2WON B;  1TZ0 A;  2PI5 A;  5J2P B;  3QMQ A;  4PEO A;  4X64 F;  3WX4 A;  4M5D A;  1BE4 A;  4C0O C;  4RU9 A;  3HHL A;  1S1U A;  3KK2 B;  2QSW A;  1C2P A;  1SPB P;  2BJ7 A;  5K5M A;  4WP8 A;  1REV B;  1QE1 B;  1CLF A;  2W25 A;  4MFB A;  3BYP A;  3D9B A;  2ZJP Q;  3KNA A;  2LDY A;  2DPI A;  3CVK A;  2O01 C;  2ASL A;  3CB4 A;  4C0H A;  3RR8 A;  2DKO B;  4CLS A;  3FQK A;  2L9N A;  2XY6 A;  2QL9 B;  5IFM A;  3DLE A;  1RCX B;  1KTQ A;  2ZFH A;  2J9E A;  1H74 A;  2HHP A;  4EFA C;  3V6K A;  1SUQ B;  3WZ0 A;  2OMO A;  2RRN A;  2E1C A;  1DUR A;  4ZCL A;  1YTY A;  1N36 F;  1X4F A;  4X4Q A;  4MKV A;  5D0H A;  1BLU A;  5JJB A;  2DNZ A;  1XQI A;  2V68 A;  3GTY X;  1R7I A;  1ZTW A;  5A2Q Y;  4OI6 A;  3GII A;  4DF8 A;  3HP6 A;  1A6L A;  3GYN A;  2I8E A;  4X4O A;  3LOU A;  3SMZ A;  1O51 A;  4NLG A;  3M30 A;  3PW5 A;  2ZBC A;  3Q2S C;  1IKV A;  2IC3 B;  3AD7 C;  3TOQ A;  3D5M A;  2VOP A;  5JVH Q;  1EX8 A;  2RIL A;  1FVQ A;  4L75 A;  3RW7 A;  3FC9 A;  4LF5 F;  4DF4 A;  1DQA A;  2H54 B;  2D3U A;  1QAJ A;  4P2M A;  1FKO A;  4D3H A;  4MKB A;  1VDH A;  2AX0 A;  2YNG B;  1G7C B;  2FZG B;  2LEA A;  2DIU A;  3G4S S;  1O5J A;  4BLG A;  1DHM A;  2Y1L B;  5LMU J;  3R7S B;  4C8M A;  4KB7 A;  1L5U A;  2PN6 A;  1FWP A;  2CA9 A;  3RB3 A;  2RDD A;  2GVD B;  4IKA A;  4V19 J;  2R8K A;  4P72 A;  3VGS A;  1FEH A;  1BQN B;  5BJR A;  3N5B A;  2MY8 A;  5KG3 A;  4ZVQ B;  3HHN B;  4WFZ A;  2KFY A;  2VB6 A;  1RAA B;  1DAX A;  4C3K A;  2V8H A;  4OLP A;  4QWD A;  3DGV A;  1DQ9 A;  4ZK7 M;  2HHU A;  1ZPV A;  2FY1 A;  3VQS A;  4HTJ A;  5H1S V;  4NLO A;  5KFG A;  2WTF A;  4PYA A;  1KSP A;  5CYQ B;  4P71 A;  4IFY A;  1ZM9 A;  2JOQ A;  2OPR B;  4IR9 A;  4PUO B;  5J2N A;  2G1D A;  3AJD A;  4USH A;  3ZZP A;  2VJV A;  2QFI A;  3CD6 S;  1MU2 B;  4USV A;  1NPK A;  4K4S A;  5E3C A;  4X2B A;  1TMJ A;  3OR2 B;  2HVH A;  3N5F A;  1B0T A;  4USM A;  5F3Z A;  2XQC A;  4OYO A;  3UCZ P;  3Q8Y A;  1HW9 A;  4FVC A;  5B09 A;  3DLL Q;  1YBU A;  4DSI A;  1VYA A;  3EWG A;  4EK2 A;  1Q81 T;  2BM1 A;  4LFA F;  2PII A;  4G3I A;  4DUY F;  3IWX A;  4K2J A;  3GR0 A;  3HFK A;  2ADB A;  1JK9 B;  5EDW A;  4WZQ A;  3U1N A;  3ITH A;  1WEY A;  5C25 B;  1SI9 A;  3THT A;  1N5Q A;  2BM0 A;  2X1A A;  4DV1 J;  4F50 A;  3I0R A;  2DNH A;  2OAU A;  2H9Z A;  4DV2 F;  1HBO A;  3NEK A;  4EMD A;  2COL A;  4RNN A;  1A9N B;  1U6F A;  2L08 A;  1Q16 B;  3TX0 A;  5HN0 A;  2RQ4 A;  1X8D A;  1X4D A;  2J0W A;  5HRO B;  2XO7 A;  4WIQ A;  2MTL A;  3MWB A;  2GIQ A;  1RAF B;  2RUG A;  3VGU A;  2YWW A;  1Y5N B;  1Y0H A;  2OML A;  2KM8 B;  1SC6 A;  2ILY A;  3O1L A;  4CP5 A;  3HJV A;  3QWP A;  2ZUA A;  3NNH A;  5F9L A;  1XNR F;  2KT2 A;  2B5J A;  5IWA J;  4U7C A;  2EKN A;  2PSZ A;  2OI2 A;  3AAW B;  1Q82 T;  1YJR A;  3QRP A;  2ATC B;  1YJW S;  4Q0B B;  2B56 A;  2M3D A;  5KFY A;  5E3Q A;  1RWW B;  3RBE A;  1IWG A;  4KJI A;  2CJX B;  3LP2 B;  2ZH9 A;  1C1B A;  3OHA A;  2IYI A;  2RS8 A;  1IBL F;  2WAQ D;  3TAP A;  2V2K A;  1C0T A;  3DNC A;  3PJX A;  3IR6 B;  1T3N A;  1WEL A;  3TI0 A;  1YRX A;  5M2R A;  2ZH7 A;  1KVI A;  2W2N P;  4FF1 A;  1DTQ B;  1VC5 A;  3BGF A;  1UA1 A;  1T7P A;  2CPX A;  2LU1 A;  2VHG A;  4R25 A;  3KLG B;  3EGN A;  2GJF A;  2DGX A;  2QL5 B;  4QPT A;  4HAC A;  3U02 A;  3TUP A;  2V8D A;  3DHX A;  4PPD A;  1TV6 A;  2UXD F;  3D1H A;  5HMY A;  4K0K F;  1FER A;  1Y7P A;  1JLQ B;  3U1M A;  3QAE A;  2WOM A;  3MMJ A;  4RX6 A;  4NLQ A;  2JEG A;  4WKR A;  2FGC A;  1UFL A;  2XGP A;  1R43 A;  3VGV A;  2HEK A;  3RUB L;  3E01 B;  5EN1 A;  2C2O B;  4PWW A;  4TQR A;  4H4M A;  4F3O A;  4AQY F;  3CMQ A;  1KR4 A;  3VHQ A;  1LOU A;  4JV2 A;  5THW A;  4BS2 A;  2ZDO A;  1G6B A;  1B0P A;  2GJI A;  2JHE A;  2UUT A;  1JJ2 R;  4ZHR A;  2NPI A;  3RRG A;  2Y0S D;  2KN4 A;  1X4G A;  2I6W A;  4O3O A;  2FYX A;  4K8R A;  3C14 B;  1IM6 A;  1YX2 A;  4N7T A;  1HW8 A;  1ZYQ A;  2ZNY A;  3WC0 A;  4IFV B;  4LFC F;  3KK1 A;  5H9F K;  1KN6 A;  1JJC B;  4ZN1 A;  3DXB A;  1RU1 A;  1K73 T;  3UW1 A;  2UVV A;  2RHQ B;  3N6L A;  3MTJ A;  3W3S A;  1Q1K A;  2D7S A;  3EVM A;  2HHH J;  3TQ1 A;  2C22 A;  2Q3P A;  1RT6 B;  5KFZ A;  1S57 A;  1L3U A;  3HK2 A;  5F8L A;  4DQI A;  4FN5 A;  2HND A;  3PRD A;  5K8P A;  2VPZ B;  3QPI A;  2BAC A;  1XMQ F;  2PA8 D;  4ZIT A;  5E7O B;  4OX7 A;  4MKA A;  1HBM B;  3M8R A;  2MKC A;  4ZPT R;  2XTJ P;  2UVW A;  3AOB A;  2ZM6 J;  3MMB A;  2XSJ A;  3BKF A;  5DGA A;  2ASD A;  1U1N A;  4N41 A;  2IJR A;  2K3I A;  4ZA1 A;  4LSL B;  5JUM A;  2RDJ A;  5I42 A;  1RAO A;  3CCS S;  3R5B A;  4NLV A;  2A1B A;  4IH7 A;  4YS2 A;  5C42 A;  1JX4 A;  4O3S A;  4ED2 A;  1BMQ B;  3AT1 B;  5L8R C;  2ZC4 A;  3IBW A;  5DG9 A;  1EET B;  4DR1 J;  3J7Z 5;  4UOH A;  1JLA B;  1IXK A;  3M7V A;  1SL2 A;  3PYG A;  2V0N A;  2C28 A;  4DQR A;  3EIC A;  2Y3Y A;  4B9L A;  2BXJ A;  4DV4 J;  5U47 A;  2LQ5 A;  2RAQ A;  1REV A;  1KS2 A;  1QE1 A;  1R3N A;  1Q79 A;  1YLX A;  5JVG Q;  5ETQ A;  1VLO A;  3DCA A;  2Z2L A;  4Y28 C;  2W7O A;  4ECZ A;  1NHV A;  5LSO A;  3HSZ A;  4H54 A;  2IRX A;  1WC0 A;  1NH7 A;  1IQZ A;  4DS5 A;  3RJM B;  4NYO A;  3CJ4 A;  3L7P A;  5A8W A;  1FF2 A;  4K59 A;  4H4K C;  3UDL A;  3DRP A;  2FQQ B;  1R6Y A;  1DZ5 A;  4DL4 A;  1F2H A;  3AFG A;  2W8L A;  4A8S A;  3QRQ A;  2AJQ A;  4YOE A;  1MSW D;  2HWI A;  1FX4 A;  5EWF A;  3CUL A;  1K0T A;  4OX6 A;  2MJN A;  2V67 A;  3U7J A;  1E6Y B;  2UVU A;  2I1R A;  3L09 A;  2I5J B;  1UW4 A;  1SJR A;  4DSJ A;  4ZVH A;  3TZW A;  2Y8Y A;  3QO9 B;  2MZQ A;  2ALY B;  2BQR A;  2UUA F;  2PFD A;  2J0X A;  5KFM A;  4RUH A;  5KFV A;  3PZP A;  2ZOF A;  2MGZ B;  3CCT A;  3PFO A;  3S01 A;  2EK6 A;  2IJN A;  4P10 A;  4FKY A;  1TKZ B;  4KAI A;  3M2R B;  3C16 A;  4ELU A;  3NBP B;  1NK6 A;  4JI4 J;  1F9F A;  3V2U C;  4CLF A;  5HP1 A;  3B8H A;  2J8S A;  1NB2 A;  3MXH P;  3G6V A;  1YJ9 S;  2P5V A;  1SB6 A;  3CT9 A;  1ARO P;  1RKJ A;  2JRS A;  3K5L A;  2YNG A;  3HKW A;  2YKM A;  3BQ0 A;  4NXN J;  1PC4 A;  1ZTT A;  2IRY A;  4U6P A;  2DO4 A;  4C4W A;  4RLE A;  3VAI A;  4R0E A;  5CYM A;  5L39 A;  1U0H A;  2QJ3 A;  3QYY A;  2IM0 A;  1Q78 A;  2GVD A;  1DBD A;  4DPW A;  4LF6 F;  3G96 A;  2B8P A;  3OFE A;  4B3T J;  4NLR A;  4L3K A;  2B9E A;  5ADZ A;  1BQN A;  2V4J B;  3UE2 A;  2C3P A;  1VBY A;  2F8M A;  3D3C J;  1NK5 A;  2XLI A;  1QDU B;  1D9A A;  1X5O A;  4BCA A;  2XG8 A;  4OYA A;  3VTI A;  5DM6 Q;  1IUJ A;  3KLH B;  2M8H A;  2VG7 B;  1CJV B;  2W4D A;  1JKH A;  4F67 A;  4JI1 J;  5D0R A;  2V4R A;  1R8H A;  1OWX A;  3ENQ A;  3SSQ A;  3ILO A;  3OT9 A;  5F8H A;  5H9F J;  4UT4 A;  1PKU A;  5IV4 A;  5J2M A;  1C1C A;  4RW8 B;  5CAA A;  1QUP A;  1U2C A;  1RHU B;  2UXC F;  1KLN A;  2AKW B;  1TQL A;  2UXB F;  2ZWO A;  1H0H B;  2GGP B;  3UN3 A;  2NYI A;  2XLK A;  2HHS A;  3CCW A;  4ZIV A;  1KNZ A;  3MEC A;  1Q8B A;  4QWB A;  2EVZ A;  4WII A;  1SIW B;  3MED A;  1HWL A;  1FRJ A;  2BJ9 A;  2JDJ A;  4IRD A;  4NLT A;  1W26 A;  3J80 U;  3OR2 A;  5IT4 A;  3NOG A;  4JP8 A;  4B3R J;  4ZJL A;  1SQG A;  1MMN A;  2BDP A;  2W4P A;  2B9X A;  1FXR A;  4U8Y A;  2RML A;  3A1Y G;  1RWX B;  3IN5 A;  1YI2 S;  3K58 A;  1YIJ S;  2MST A;  4DX6 A;  3RZA A;  3J7Z T;  4H4K A;  2M4M A;  4JB8 B;  5HMW A;  4FPI A;  2DJW A;  4KT0 C;  2EG1 A;  2DNR A;  3TJA A;  2LP4 A;  5HRO A;  3VAH A;  4B9T A;  1T05 B;  3K5O A;  3Q23 A;  1FES A;  1V3Z A;  3NGS A;  2KTQ A;  4DR5 F;  4YQW A;  2MEW A;  5L9N A;  2NCK L;  5G4D A;  4RUC A;  4WZM A;  2KXF A;  3PJW A;  4IDK B;  3KHL A;  2P6T A;  2IVF B;  3TR5 A;  3LP0 B;  3ZC4 A;  3CCQ S;  1AW0 A;  2BE2 B;  1FDA A;  1B7F A;  2HZA A;  2HS4 A;  2HQI A;  5LXR A;  3ZTR A;  3GB0 A;  2HRT A;  3B54 A;  1HA1 A;  3RAM A;  1CSJ A;  1RT2 B;  3V4M A;  4UOF A;  4ANC A;  4BBY A;  2XS5 A;  4LQ3 A;  2CJY B;  2RF2 B;  1DY3 A;  3K2Y A;  5IM0 A;  2YKQ A;  2MY7 A;  3SCJ E;  4N8O A;  3OFH A;  5E0O A;  2F40 A;  2KRR A;  1ICE B;  2QMW A;  3KLG A;  2UU9 F;  1SH3 A;  4KE5 A;  2CDQ A;  4IG3 B;  4LIW A;  2AJ1 A;  5H9E J;  3ISZ A;  3EDR B;  1RBO B;  2I2Y A;  1ITP A;  4LMZ A;  1X7V A;  1H38 A;  1HFE L;  3LW5 C;  4K4X A;  2E9Z A;  5L1K A;  4KO0 B;  3OXF A;  1AUS L;  1R8C A;  2WVF A;  2QFJ A;  3BO2 A;  3A3P B;  1K8A T;  2Y0B B;  3VAL A;  1G1X A;  1X4A A;  2OPQ A;  2A2C A;  1Y5I B;  1Z2Z A;  1HMV B;  3ZTQ A;  1FT8 A;  4DOZ A;  3MUV P;  4X64 J;  4Z7Y A;  2J9D A;  1URR A;  4XDD A;  1X60 A;  2E1R A;  4ECT A;  5AE3 A;  2FJX A;  1T3O A;  3CD0 A;  1EP4 A;  3AHP A;  3S8S A;  4USU A;  4PCQ A;  2CQD A;  2DTJ A;  4IFV A;  1RTJ A;  1DQ8 A;  3ELH A;  1M1G A;  4L6V 3;  1NHK L;  1Q4R A;  2YXL A;  3IGV A;  4LRF A;  3ZO7 A;  1Y9O A;  2FHJ D;  3QAT A;  1GMW A;  5KFW A;  3K5M A;  3JTP A;  1T9U A;  2EBE A;  3LO3 A;  2CZ9 A;  1I3O B;  4GVL A;  4QQB A;  4U9R A;  2O66 A;  1GX6 A;  1RT6 A;  3RBX A;  3R5A A;  2ZVI A;  2PMZ D;  5ETV A;  3KHH A;  1JQG A;  3CDA A;  1EKS A;  3P49 B;  3NCR A;  4F3Q A;  2Z8Q A;  4C9D A;  1N36 J;  4CM0 A;  3UCU P;  4TKT A;  2NPF A;  4Z2X A;  1SBR A;  3NGR A;  3MPU B;  3PKY A;  1RT4 B;  2HS0 A;  3J7A N;  4R5P B;  1BXN A;  1NME B;  1S5Z A;  3DXS X;  3CF5 Q;  1P9Q C;  5D77 A;  3QJP A;  4IG0 B;  1DLO B;  3ETO A;  2FC9 A;  2MQ8 A;  1HPZ A;  5F0W A;  3L95 X;  3TUJ C;  1PIE A;  1Z4U A;  1S4F A;  4Q5V A;  3MMA A;  4JI6 F;  4EWT A;  3D0I E;  1NKE A;  5IZH A;  3V6J A;  2YQ3 A;  3CCU S;  3MAH A;  1Z1Z A;  4A48 A;  4LF5 J;  1RT7 B;  2RNE A;  2AHO B;  3KYL A;  3A4T A;  5KG2 A;  1F3V A;  3M8Y A;  2KRB A;  3EGW B;  4XDC A;  1JLA A;  2JEI A;  3KFW X;  3IBF B;  1S97 A;  3FBB A;  2ZNZ A;  2PMW A;  4I7F A;  4JI5 F;  1FJ7 A;  3O2I A;  1VQS A;  2MQQ A;  4ZLN A;  2Z57 B;  3S7R A;  2W4C A;  4DX8 H;  5HSP A;  4S0M A;  1Y5L B;  2Z58 B;  1R8B A;  4PRF A;  3CDW A;  4LRE A;  4ZLP A;  2XMW A;  3FSX A;  4Y65 A;  3QNW B;  1LNQ A;  4J9M A;  4CO2 A;  2DNN A;  2O5D A;  4DR6 F;  2DH7 A;  4ZCI A;  3MGJ A;  3BGL A;  3BBC A;  3T9Z A;  3JB9 k;  1RHM B;  1WI6 A;  5FD1 A;  1VJQ A;  1FTC A;  3QGP A;  3T5J A;  2Y1R I;  2XZD B;  3TUI C;  1K1S A;  4M5N A;  2OTJ S;  1SQF A;  2IM3 A;  1CJK B;  2X1G A;  6FDR A;  4NA3 A;  5AXN A;  2HZV A;  2DNQ A;  3ET6 A;  1E6Y A;  2ZH6 A;  3PVX A;  5GAD I;  4EO8 A;  1JXL A;  3ZZU A;  1VQM S;  2DHG A;  4AUK A;  1QTN B;  5C24 A;  4CYU B;  3QLH B;  4O3Q A;  1TR0 A;  4M94 A;  1P27 B;  7AT1 B;  3ZTS A;  1MNE A;  1UJ4 A;  2X1B A;  2P9E A;  1TKZ A;  2CFX A;  1KOO A;  2IFX A;  4NYZ A;  5B0A A;  4X4U A;  3NBP A;  1R27 B;  1FXD A;  1WSR A;  4EZ9 A;  2XSF A;  3KHR A;  1UJ5 A;  1HQE B;  1TAQ A;  5I3U A;  4LFA J;  1RTD B;  4WU2 A;  1HD1 A;  2OFG X;  4OHW A;  3TEG A;  1U48 A;  4ZVR B;  1R31 A;  2GV1 A;  2WVC A;  1IJF B;  3FCW A;  3HVW A;  3DOK B;  5JXS A;  2AGO A;  2RD5 C;  4DV2 J;  2BAB A;  1LXN A;  2W7A A;  3CO9 A;  3TZY A;  4HHU A;  2W7P A;  4KFB A;  2JEJ A;  2ZKT A;  2VIC A;  4J9V A;  4N8N A;  1VR6 A;  2QSF A;  4ILR A;  4LFB F;  2HHW A;  4OI0 A;  2D9O A;  4X62 F;  4DFM A;  2LXU A;  3G2X A;  4WTY A;  1XNR J;  2VG7 A;  1CJV A;  1N6Q B;  4RWX A;  4QU7 A;  3QRR A;  4URQ U;  1S7H A;  2DNM A;  4DBQ A;  1QVG R;  1HYS A;  1TL1 A;  4XO0 A;  2IHR 1;  3OTO F;  2VON A;  2W2P P;  1S9G B;  1SVD A;  1ZM3 A;  1FWK A;  1IBL J;  1SJ4 P;  1VBX A;  1MML A;  2Y9H A;  5AXM A;  4YDD B;  1FE4 A;  5J1E A;  2MYF A;  1D09 B;  4ATN A;  2KH9 A;  1JJ4 A;  5SZT A;  4I64 A;  4ECY A;  1MG7 A;  2JFD A;  1SCJ B;  1WF1 A;  3TAM A;  2AIR B;  1FNM A;  1PYO B;  1TK0 A;  1U1K A;  1QUV A;  3PX0 A;  2UXD J;  1AFI A;  1NH8 A;  3BGU A;  4K0K J;  2PD1 A;  4RKU C;  1HI0 P;  2RQC A;  5L38 A;  1VHF A;  3QGH A;  1KOH A;  2OFH X;  4WP9 A;  4YEA A;  5HMX A;  3W61 A;  3QBC A;  4HL9 A;  4FXV A;  4AQY J;  1BY9 A;  3A3O B;  3TA1 A;  4TLR A;  2LDI A;  4ZVT B;  2JWN A;  1T05 A;  3PTW A;  3JQM A;  3T1Y F;  4KGX B;  2ZVS A;  5FDL A;  3M8P B;  1J5O B;  2Z4P A;  5F8G A;  4QR0 A;  1EQM A;  1U8S A;  3W9I A;  3DI6 B;  1S1T B;  2KYX A;  3T6B A;  1K1Q A;  3LP0 A;  3P45 B;  2ROP A;  3IM8 A;  2BE2 A;  4CLU A;  3GLJ A;  4LFC J;  2QN6 B;  3EZO A;  3HJF A;  3UD3 P;  1TUW A;  3FBF A;  3EUN A;  5KFO A;  1EHW A;  3DRS B;  4QU6 A;  3CO0 P;  3CCZ A;  3I5B A;  5DET A;  3GWC A;  3TQE A;  3V4I B;  3G82 B;  1RT2 A;  4G6V B;  1VQL S;  2XMU A;  3PFE A;  1R0C B;  4CCH A;  3FK4 A;  3BQ2 A;  3GJT B;  2QA1 A;  2DGS A;  2RF2 A;  5B0B A;  2ZKU A;  3NS6 A;  1FRI A;  1HWK A;  2YX7 A;  1XMQ J;  3MEK A;  3GFH A;  4QW9 A;  4NLD A;  4XIU A;  3IS9 B;  3CIM A;  2C1E B;  1LWF B;  4X4V A;  1Y10 A;  2F8H A;  2R7T A;  4IG3 A;  1SL1 A;  3GV5 B;  1HBN A;  1F5C A;  4HHJ A;  1X4H A;  4I6Y A;  2K3K A;  1F2G A;  2AP6 A;  1ZAV A;  1LWX A;  3DRR B;  2ADC A;  4DXL A;  1MLA A;  2B6A A;  4RUB A;  3CDB A;  3M2U A;  4JI8 J;  1RBA A;  1VQ4 S;  1UEK A;  4B3O B;  2BR0 A;  3H98 A;  4KYZ A;  4JI3 F;  3MTK A;  1BC6 A;  4KPY A;  1VFJ A;  2AJF E;  3CD7 A;  3ZZO A;  3WIV A;  2R8I A;  3D7S B;  5KFC A;  2ZH8 A;  3AOD A;  3IR5 B;  4KGV B;  1MWQ A;  3M6X A;  5LSL A;  1JLF A;  2FHJ A;  1BGX T;  4NL5 A;  3ZZT A;  2EC0 A;  4LF9 F;  4PG6 A;  4Y3C A;  2YY3 A;  3S6E A;  1AXQ A;  3WBZ A;  3CJT A;  3T19 A;  1LW0 B;  4HH1 A;  1UPM B;  4HT5 A;  4PWU A;  5E2Q A;  2R4F A;  4LF2 A;  3TAR A;  2VOO A;  5KOX A;  4GMK A;  3MUR P;  4RNF A;  4JV5 F;  3SV3 A;  4F2R A;  3W63 A;  1D3W A;  2F4F A;  3TA2 A;  3K7R A;  5J2Q A;  1VBK A;  2YKP A;  5DJB A;  1UZD A;  2DEJ A;  4IYQ A;  3HD1 A;  2OP5 A;  2Z0G A;  1F0X A;  1OSC A;  1YVF A;  3H5U A;  4ED8 A;  5GAH I;  2HFO A;  3DM2 B;  3GSD A;  2NSC A;  4OHY A;  4ED0 A;  2YNI B;  4IG0 A;  2BW7 A;  1DLO A;  5ETN A;  3G86 A;  2UUA J;  2YPZ A;  2PGC A;  2Q43 A;  4ZLJ A;  1DAR A;  4URG A;  2ZZN A;  1CJT B;  4K7Q A;  5KG4 A;  3KUG A;  3QJL A;  2OSR A;  4EYI B;  2LA4 A;  5HQ8 A;  2HQF A;  4ZVP B;  2NUH A;  3PIO Q;  1C0U B;  1RT7 A;  1CC8 A;  1J5E F;  2GNK A;  3C6T B;  1RWK B;  3ILL A;  4HYK A;  1P1T A;  2DNO A;  1Q8L A;  2F1F A;  2E5G A;  3O8W A;  1L3V A;  1S49 A;  4K4V A;  1JLG B;  3JTO A;  2HSE B;  2RU9 A;  2YKA A;  5MAO A;  3FMB A;  2B7B B;  1FNO A;  4KQZ A;  1A7G E;  4DUZ F;  4WFX A;  1WNE A;  3FEX B;  2E5L F;  5KFL A;  4LF6 J;  2OHD A;  2QLB B;  3R5D A;  4ZLL A;  2NSB A;  4A8M P;  3HKZ D;  3D6F B;  3EZ5 A;  4PR6 A;  4ERD A;  5BYS A;  3VQT A;  1PAU B;  2GML A;  1GAO A;  2BRK A;  3J80 Y;  2RS2 A;  3PRV A;  2RT3 A;  4QYR A;  2CJA A;  3IGN A;  3MZI A;  3KKF A;  1IVZ A;  2C2Z B;  4X4T A;  4RNO A;  3B82 A;  2O67 A;  3GFZ A;  2IDE A;  3OL7 A;  4X4S A;  1RE1 B;  2Q1L A;  4X66 F;  5K8N A;  4FXD A;  3IAM 9;  2R7S A;  1H98 A;  4CO5 A;  5KG6 A;  4DFP A;  5AE1 A;  1CC7 A;  1ELO A;  2I0X A;  5HMZ A;  2DD8 S;  3T41 A;  5A8K B;  3KMS A;  5DDP C;  3D68 A;  2QLX A;  3HHE A;  2RUS A;  2UXC J;  2YNF A;  2MKH A;  2UXB J;  3P96 A;  5IV3 A;  2K1R A;  3VV2 B;  2R2T A;  3M32 A;  4YB7 A;  4JI7 F;  2YX1 A;  1XMO F;  1Z2L A;  1RTH A;  2D74 B;  4QIE A;  3EGV A;  2ZJR Q;  2XMT A;  2VG5 B;  4KH1 B;  1S12 A;  1VMB A;  2QX0 A;  5KFK A;  5MLC V;  1W25 A;  2CPH A;  3UD4 P;  2N4D A;  1HQE A;  1PAE X;  3FKB A;  1ROF A;  5AXK A;  2WBM A;  2R7U A;  1TL3 B;  2NXU A;  3A3N B;  3MUT P;  2R2U A;  4I69 A;  4CO1 A;  4OYP A;  4BHQ A;  1QSY A;  1SKS A;  5E3P A;  1S72 S;  4A8X A;  4JBC A;  1HNZ J;  3MCS A;  4OZN A;  1U1L A;  3N28 A;  3DU6 A;  3HFZ B;  3MAA B;  4P2S A;  2HBY B;  3AJ2 A;  3OL6 A;  4PG4 A;  4URS A;  1KD1 T;  1H73 A;  3L4B C;  4LQ9 A;  4DLE A;  4CI0 B;  5HK4 A;  1NSP A;  3X3U A;  2L3M A;  4MH8 A;  3OLA A;  2EEY A;  1NSA A;  4DR5 J;  2XO6 A;  4ECS A;  5GAD U;  1VQP S;  1FKP A;  1N6Q A;  3V6D A;  2HAF A;  4CH7 A;  3G87 A;  4XPE A;  3GIJ A;  3BKU A;  3LP1 B;  4WE1 A;  4OZ5 A;  2XWX A;  2G0J A;  4FNI A;  1PIL A;  1ZA1 B;  2C2K B;  1VQY A;  5B0D A;  3RAQ A;  2CXE A;  3PX6 A;  2DEI A;  2JSX A;  1S9G A;  2VPX B;  2MPU A;  1HNV B;  1FCA A;  3Q8S B;  2XBP A;  3QT5 A;  5K20 B;  4DR1 F;  4X65 F;  2HFN A;  4JUZ A;  3MM8 B;  1KQG B;  1NJX A;  1GTE A;  4Q2L A;  1SKU B;  4ICL B;  4CQ1 A;  2J7U A;  5DG8 A;  4MTP A;  3GYX B;  2ZE2 B;  5AJ3 F;  2RJZ A;  3DLG A;  2VF3 A;  3EX7 B;  2UU9 J;  1J2V A;  1RZM A;  3NXZ A;  1XK8 A;  3BKT A;  2QLF B;  4ZVU B;  3OJS A;  2LEB A;  1IBC B;  2V63 A;  5KFX A;  1FNX H;  2F7V A;  3IO1 A;  4G1Q B;  3JSR A;  1FI4 A;  2YVS A;  3GV8 B;  3B4M A;  2XZW A;  2RDI A;  4ZMM A;  2FC8 A;  3KG1 A;  3HHD A;  5DO2 A;  2MDA A;  4RW4 B;  3CUN A;  4I4B A;  3NP5 A;  1PCA A;  4OYB A;  2X7I A;  3QSY B;  3IA0 A;  1V5V A;  1OPI A;  1SJF A;  5HAT A;  2JC1 A;  1SXL A;  2U2F A;  4C8L A;  4USW A;  1KFD A;  3M8P A;  2IAJ A;  1L3S A;  1J5O A;  2NR0 A;  9RUB A;  1S1T A;  1AZS B;  5C5J A;  1S6Q B;  4KGZ B;  2KDO A;  2WBR A;  1TKX B;  3PM9 A;  4AXI A;  2DR7 A;  5KFA A;  1WSV A;  3JSB A;  3MOJ B;  1H2V Z;  2VG6 B;  2N4C A;  3RRK A;  1JLE B;  2FDN A;  4PZV A;  1SV5 B;  3DRS A;  3DLJ A;  2MLZ A;  2V2Q A;  3V4I A;  3TAN A;  3G82 A;  4IQM A;  2K8G A;  2ZBR A;  3GSI A;  4TU9 A;  2VDI A;  4LVN P;  1VRU A;  2PEH A;  4YDX A;  4MJK A;  2W2Q P;  4KTQ A;  2DCL A;  3VR1 A;  4FYW B;  4LT6 A;  2A3J A;  1KLM A;  1LWF A;  4DL5 A;  3R5C A;  3KLI A;  5HVH A;  4W92 B;  3IRX A;  3DOM A;  1FD2 A;  4CT8 A;  2FHM A;  3AD8 C;  1VQO S;  2XZT B;  2ZH2 A;  1SQE A;  3NG8 A;  1I6J A;  4LBI A;  1EIY B;  1IKX B;  3DRR A;  3UDE A;  1U09 A;  1UAW A;  4FBU A;  1KTV A;  4F4A A;  1RHK B;  2GZO A;  3VVU A;  4JI6 J;  1N32 F;  3H2V E;  4W90 B;  3TEH B;  1MN7 A;  2HQD A;  3ULH A;  4WFB Q;  2ALZ A;  2DGT A;  3VZH A;  4B3O A;  1S48 A;  3IP0 A;  3GMG A;  1Y11 A;  5F3T A;  4C8N A;  1TL7 B;  4DPT A;  3J7A 1;  1KKH A;  3O44 A;  4ECU A;  1NXI A;  3GE9 A;  3HM9 A;  3JYT B;  3LPY A;  4JI5 J;  3FNN A;  4ES2 A;  5IT9 Y;  1QTM A;  1FDD A;  1F6T A;  1MRO B;  3GV7 B;  4NWB A;  3ZNU A;  4LSN B;  3AOC A;  1FWL A;  2AV5 A;  4M1K A;  5KFP A;  5LM7 E;  5DDQ C;  4ALZ A;  3BR9 A;  4LF7 J;  1S0M A;  2CUY A;  5DLG A;  4FP9 A;  2AF6 A;  5KFD A;  2HG4 A;  3TP2 A;  2ZUG A;  1SKR A;  4DR6 J;  1IM4 A;  2HIQ A;  3L7O A;  4K4U A;  3ADA C;  2DK2 A;  1X4E A;  4MIW A;  1CUL A;  3MM5 A;  3MM9 B;  5HVG A;  4HEA 9;  3M8Q B;  5KFF A;  3UO0 A;  3OR1 B;  4ED7 A;  5L46 A;  3KXD A;  4OFZ A;  1OPZ A;  1R8P A;  4YB6 A;  2CAJ A;  4ED4 A;  3KJF B;  2CG8 A;  3DRY A;  2ZOM A;  1VC0 A;  1U8W A;  1YJN S;  4WKY A;  1X9W A;  4O23 A;  3H42 A;  1RWV B;  4MT1 A;  4AXJ A;  4I67 A;  2GHV C;  4UUX A;  2ZWP A;  5LJ3 Y;  5HQL A;  8AT1 B;  1CJT A;  3CD5 A;  3BR8 A;  5A6P A;  1T9V A;  1GTH A;  4RZR A;  4CT9 A;  2P6S A;  2P9G A;  1RB0 A;  2HW3 A;  1RAH B;  2R8G A;  4YB1 P;  4PWD B;  1TL5 A;  1Q53 A;  4C11 B;  3WX8 A;  4QZV B;  1HR0 F;  5KFE A;  1C0U A;  1M5V C;  2OD4 A;  3C6T A;  5EWG A;  2VPW B;  4PQU B;  4PAA A;  1JLG A;  1WDT A;  3T3F A;  1VK8 A;  2V9K A;  2B8Q A;  4RW7 B;  4CLT A;  4R0J A;  1OJ4 A;  2QA4 S;  2CPZ A;  3GG0 A;  4NI2 B;  1GEH A;  3CW2 C;  1CVJ A;  2B43 A;  4EU0 A;  1KBR A;  4YP3 A;  1LWE B;  3I82 A;  4B9M A;  2CQB A;  2NXC A;  1RA7 A;  1ACM B;  2C42 A;  3EYZ A;  3W9J A;  3VF0 B;  4LFB J;  3AH6 A;  3R6G B;  1TKT B;  2EW9 A;  3TRG A;  5GAH U;  4X62 J;  2CQ1 A;  3RBD A;  2E5H A;  1H6K X;  3W2V B;  1RDR A;  1RCO B;  2HK2 A;  3VAJ A;  4WK3 A;  4ZP8 A;  3RGI A;  3R7B B;  4JI2 F;  2OPS B;  5HAO A;  1U6B A;  2ASJ A;  4QIV A;  2OGU A;  3PV8 A;  5FJ4 A;  3OTO J;  5FLX U;  5K14 B;  8RUC A;  2V8G A;  2CDR B;  2MKJ A;  2MQM A;  1IR2 A;  2VFV A;  2CAD A;  2PO4 A;  3AA8 A;  5HBM B;  1O0P A;  2VG5 A;  4DDF A;  3NKY A;  3K5N A;  2FHO B;  3QIP A;  2DGV A;  2LQJ A;  2Z2Y B;  2LU2 A;  2B51 A;  1T03 A;  5ETO A;  3MM7 B;  2L9W A;  3OLB A;  3H40 A;  1R6V A;  2KB2 A;  5CCM A;  2IIH A;  2XYP B;  1U49 A;  4F3M A;  1MWY A;  1SC1 B;  2HZC A;  1U2F A;  3BDE A;  2EFV A;  3M9O B;  4DPU A;  3D1Q A;  3PW2 A;  4ID8 A;  3TJ9 A;  1IWA A;  2MLX A;  4OI2 A;  2DB1 A;  2KYZ A;  1T11 A;  4PPZ A;  2ZH1 A;  1VK3 A;  4ZPC A;  4CLY A;  1JLC B;  2LVW A;  5DQI A;  2R8H A;  3HF5 A;  2W9B A;  5F0U A;  4JV0 A;  3D66 A;  2FJA B;  4PG5 A;  3NGU A;  5KG1 A;  3T1Y J;  1RSC A;  3EGZ A;  2OEK A;  1TUG B;  4HR2 A;  4J9O A;  1EQ0 A;  2XNQ A;  5KAK A;  1WG4 A;  3PX4 A;  2LEP A;  3FFI A;  2DNL A;  3SQG B;  3HZE A;  4BWM A;  2N82 B;  4CH1 A;  1NDL A;  2DRA A;  3OTD A;  4BC9 A;  3K8W A;  4C8Z A;  1N5V A;  1T9X A;  3GIL A;  1WC5 A;  4ID5 B;  3DLK A;  3KMQ A;  3W2W B;  4B3S F;  1S6P A;  3SCK E;  4DUT A;  3H0P A;  2DIS A;  4FYD A;  3C6U A;  4ETZ A;  2K7J A;  3EPI A;  4FF2 A;  1M5P C;  3P4U B;  2MQO A;  4TY9 A;  1UVI A;  4AL6 A;  1TP7 A;  3TYT A;  3MM8 A;  2BZ2 A;  4DN0 A;  4ICL A;  2MZR A;  4E98 A;  1VQ6 S;  2MLY A;  4GO5 X;  6AT1 B;  1RGV A;  3BSC A;  1FTR A;  5IC4 B;  1UA0 A;  1PJ5 A;  2R7W A;  2QC3 A;  3PR5 B;  2D9P A;  3NWR A;  1U1O A;  1QSL A;  1X5T A;  3CCL S;  2WRM A;  4IRK A;  3CIZ A;  2XNR A;  1SIZ A;  2GQC A;  2KT3 A;  3J81 j;  3BSN A;  2CPE A;  4YME A;  3CC7 S;  4PQA A;  3TVK A;  3LA0 A;  2C2E A;  4WU3 A;  2AZ3 A;  2DH9 A;  2BKP A;  3MM6 B;  1KVK A;  3F56 A;  3I9V 9;  3HD2 A;  2XS7 A;  5LMN F;  4NCA A;  2EFQ A;  2WSF C;  2FUG 9;  4F26 A;  3CMA S;  1S9E A;  2EFN A;  3DFE A;  2X1F A;  2BX6 A;  4RW6 B;  3SQO P;  1E6V A;  2E1P A;  1LV5 A;  4JI3 J;  2HLT A;  2Q6C A;  3D0H E;  1WI8 A;  4HI1 A;  1YJT A;  2CIM A;  4LR7 A;  2M2B A;  5CA5 A;  2VBY A;  1FJC A;  4C48 A;  1BQM A;  4QBU A;  2CQI A;  3I32 A;  1UZH A;  2QLJ B;  2FVQ A;  1QAY A;  4A8O A;  4J9L A;  1F3F A;  5KG5 A;  3A8K A;  1AZS A;  1S6Q A;  4CNY A;  4LF9 J;  3I9Z A;  1TKX A;  1T94 A;  3OVA A;  3QT6 A;  1M5H A;  2JX2 A;  4RJV A;  1NK9 A;  2OUG A;  3GIM A;  1YBA A;  2VG6 A;  2NUU G;  1JLE A;  2GO9 A;  3R5G A;  2UV8 G;  2DRD A;  3AJ1 A;  1B4S A;  4RW9 B;  1NZA A;  2V34 A;  4JV5 J;  2KFN A;  2HMI B;  4ES3 A;  4CH0 S;  3M6U A;  1K47 A;  1NKB A;  3MDF A;  1HL6 A;  4DL2 A;  4O3P A;  1URN A;  2H1Y A;  1JXV A;  3SDE B;  3AB2 B;  2MHN A;  2V2Z A;  2NXE A;  1X5P A;  3CJQ A;  5CD4 A;  1RT5 A;  4GKK F;  5GVQ A;  3M8Z A;  2YKN B;  2A18 A;  4R8U B;  2E7V A;  5D0G A;  4X4N A;  3PNI A;  2XYH B;  1KRP A;  1IBM F;  1AA1 B;  1IKX A;  2QTW A;  2WSE C;  4DJB A;  2OEM A;  2HBR B;  1NSK L;  2DXD A;  3G6Y A;  3LF0 A;  4G1I A;  3LAK A;  3DGP A;  4LJM A;  4CO4 A;  3P8B B;  2OD6 A;  4Z37 A;  1I5O B;  1J5E J;  2VDH A;  3D6M B;  2X3D A;  1UFK A;  2XHC A;  5B0F A;  1TL7 A;  1HNW J;  3PYF A;  3CCE S;  5IOL A;  5CZV A;  3BYR A;  3Q2T C;  4LVO P;  3IM9 A;  4F0K A;  2DH8 A;  1RI7 A;  1TAU A;  2NS1 B;  2R3V A;  1K0V A;  3DLH A;  4DUZ J;  1GXL A;  1OSD A;  2DXE A;  2ILZ A;  3MUM P;  4XPC A;  4OX8 A;  2E5L J;  2CVE A;  2RE1 A;  4LSN A;  4M5D B;  2BAN B;  4OJ1 A;  2IPO B;  1HD0 A;  4CNZ A;  4NOH A;  2D3O R;  4GC7 A;  5GMD A;  1UW9 A;  4RBU A;  2IMW P;  5B08 A;  4NCB A;  2H3E B;  4E8U A;  3D6T B;  3CXC R;  3MHY A;  4U7U K;  1LKZ A;  2D41 A;  2YBV A;  1NLK L;  4USI A;  4DPY A;  3PKM A;  4X66 J;  3GPA A;  3MM9 A;  3M8Q A;  1MW7 A;  1FO1 A;  1QAI A;  3CWJ A;  2JVO A;  2QA2 A;  3TJ8 A;  4DV6 F;  4M63 A;  2AU0 A;  3DLE B;  3G8Q A;  3UDC A;  4X84 A;  1MN9 A;  1FRM A;  3R97 A;  4LUB A;  2ZBI A;  1D1U A;  2I38 A;  2BJ1 A;  4JI7 J;  4CIO A;  2HWT A;  3FGV A;  4DSK A;  3LGN A;  1XMO J;  4LF8 F;  3F41 A;  1R0A A;  1LWC A;  2BA9 A;  4UW2 A;  1T9T A;  1XC9 A;  1HHS A;  3FCV A;  3IG1 B;  1V3S A;  1RHJ B;  4FKX A;  3BJY A;  3LH2 S;  4TN2 A;  4ECV A;  4G65 A;  2IBO A;  3MEE B;  1EKR A;  1LFP A;  1IKV B;  4RPF A;  4OQJ A;  4PQU A;  3GZ7 A;  1U25 A;  1HAR A;  1RT1 A;  3WHI A;  1RQ0 A;  2EFP A;  4WXW A;  4C3M A;  4J37 A;  1TEL A;  1VQ5 S;  3BQ1 A;  2F9D A;  2ZZT A;  5KG7 A;  2XCP A;  1FKO B;  3N6M A;  2XY5 A;  4USJ C;  4O3R A;  1JMT A;  4NI2 A;  1AB8 A;  5ETS A;  3W66 A;  4DV7 F;  3DHW C;  5B0C A;  1NK0 A;  2HNZ A;  3QFH A;  3BPD A;  1VQ8 S;  4JV1 A;  2F65 A;  2HBZ B;  4JI0 F;  4OYX A;  2W9C B;  2FJD B;  4B9U A;  3T1A A;  4FS2 A;  3W2V A;  5DGB A;  2CQG A;  2J0S D;  5G0R B;  4TU8 A;  4NLP A;  3VAK A;  3VAG A;  1DTT A;  1OY8 A;  1HHT P;  3GR1 A;  2LMI A;  1NB7 A;  2F4V F;  2QV6 A;  1RYS A;  2R8J A;  2OPS A;  4OMF G;  2NLW A;  4JI8 F;  3PCO B;  3OHB A;  2WON A;  2U1A A;  5M2U A;  5J2P A;  4WBF A;  3SV4 A;  5LOQ A;  2YWG A;  4CLW A;  2PI4 A;  2RQM A;  3I96 A;  4WF9 Q;  2HFS A;  4X65 J;  4IOB A;  4DCJ B;  2XMA A;  3CJ5 A;  4NLS A;  1U7L A;  3FEY B;  3IFE A;  1UJ6 A;  5HBM A;  3KK2 A;  3G8T A;  2VU5 A;  1WEZ A;  1FK9 B;  5AJ3 J;  3I31 A;  4F4W A;  1RTZ A;  4F25 A;  4ZPA A;  4NEZ A;  3HXM A;  1TU0 B;  2HQC A;  5IC6 B;  2QLW A;  2KO1 A;  3M1V B;  2C3Y A;  1YDL A;  2UZA A;  1KHW A;  1NPR A;  2W9A A;  4LRC A;  2J6T A;  3HVT B;  3EVO A;  4FNH A;  1T0T V;  1S99 A;  3GFY A;  3BBB A;  3PIP Q;  4YHH F;  4IUF A;  1RWM B;  3U27 A;  4P9S A;  3A8I A;  5M2P A;  1N8R T;  1RAJ A;  1SUQ A;  1HQU B;  3ONQ A;  1FRL A;  1TFY A;  1VS3 A;  3IR7 B;  3V81 B;  2D69 A;  1L3K A;  3D1O A;  3QFW A;  3JSM B;  1JLC A;  4K2X A;  2X51 A;  3R6L B;  1NSQ A;  5H9E K;  2H51 B;  2EBG A;  1YBT A;  2UUB F;  2WB4 A;  1FD8 A;  3I0R B;  4NML A;  4DFJ A;  1N34 F;  4DR3 F;  1UVN A;  1HBO B;  4QYZ J;  4OL8 A;  2KM8 C;  2FLN A;  2DHX A;  1LK7 A;  3GG1 A;  4OZ3 A;  5E3A A;  3SQG A;  1B3T A;  1N52 B;  3EJM A;  2W01 A;  4O44 B;  4KIA A;  2VQF F;  2IC3 A;  4ID5 A;  5CH7 B;  3W2W A;  1JXE A;  2DVI A;  4ELV A;  3OSN A;  4DEZ A;  3DRX A;  2VBX A;  2B5J B;  3L9Z A;  4X4R A;  2MMY A;  3C2P A;  1IBK F;  4Y2A A;  3KOA A;  1N33 F;  2CRL A;  4DR7 F;  1FHT A;  3MPD A;  4ER8 A;  3S1T A;  3CE8 A;  1C1B B;  2V2V A;  3N79 A;  3HDS A;  4HDH A;  3PHE A;  2E7X A;  1C0T B;  4ETX A;  3FBE A;  4NZ6 A;  1BWV A;  2GW8 A;  2E7W A;  5L1I A;  5T41 A;  3UVJ B;  4IOC Q;  1Q86 T;  2YNH B;  3PW0 A;  5D78 A;  1YHQ S;  1U47 A;  5I4M A;  4M5L A;  4HAC B;  5DDR C;  2DNY A;  3MPY A;  4YR2 A;  2QGF B;  2IM2 A;  5C2G A;  1DRZ A;  1YKW A;  4OJ3 A;  3CJ2 A;  1N32 J;  1N0U A;  2G2O A;  3KNG A;  4UOG A;  4DG1 B;  4A8Q A;  2WOM B;  4RW6 A;  4AFF A;  2N7Y A;  2GCF A;  3J7Y I;  3P5B P;  3D2W A;  2CQC A;  3Q89 A;  3C8Y A;  3EPG A;  5CYQ A;  4I1T A;  5KG0 A;  3OXL A;  2PT0 A;  4DFK A;  2OPR A;  2ZD1 B;  4PUO A;  5J1N A;  2P8I A;  2QYC A;  3H5Y A;  2HVD A;  4U95 A;  4QWA A;  4I6W A;  2CVI A;  1MU2 A;  5CZX A;  2NXN A;  3UN5 A;  2CPF A;  4A46 A;  3NMA A;  3BBF A;  1OYE A;  4OHX A;  4DR2 F;  4KC5 A;  2VFU A;  1P9Y A;  1RBL A;  2J9C A;  1CQM A;  2VC1 A;  4ZPV R;  3EM1 A;  1WF0 A;  2VFT A;  4RW9 A;  5BXI A;  1YK9 A;  2HMI A;  3KK1 B;  1VJW A;  1SC4 B;  3HSD A;  1Q5V A;  5ETL A;  4WTO B;  3W5X A;  4ZP9 A;  3KDN A;  3AXK A;  2AYM A;  5KFU A;  3C15 B;  1H72 C;  3PEJ A;  1LFW A;  2EI5 A;  5C25 A;  2GMJ A;  4NRT A;  4B3M F;  4KY3 A;  3SDE A;  1U4B A;  1X0F A;  1RAD B;  1HNZ F;  1OMS A;  1UWB B;  1BWE A;  4M5I A;  2E1M C;  2G2Y A;  2VUG A;  4FBT A;  2KG0 A;  2CQ2 A;  1XR7 A;  3D3B J;  4RO0 A;  2YKN A;  5EUH A;  3IAS 9;  2V94 A;  4XTT A;  4EGL A;  4IQX A;  3O6Q A;  5DG7 A;  3CC4 S;  4I2Q B;  4P2F A;  4DQS A;  1U1M A;  4HTI A;  3HT3 A;  2F8E X;  2BYC A;  2N3L A;  4DSF A;  3NOC A;  2MQP A;  1N5S A;  2FHK A;  4Q43 A;  3TWZ A;  4ZPB A;  1VQ7 S;  4LBP A;  2DR8 A;  2Z2Z A;  3ENA A;  1HR0 J;  5E41 A;  3PRB A;  5I42 B;  4Q0B A;  2CJQ A;  4J9Q A;  1NKC A;  2Q66 A;  3LP2 A;  4BWJ A;  4Q8E A;  1GXU A;  5C42 B;  2E1A A;  1JIH A;  4CM2 A;  3HUL A;  2K7K A;  4ZOS A;  4YUD A;  3EZU A;  4ZIW A;  3SSS A;  5ETM A;  5FLX Y;  1M5S A;  5DQG A;  3KUE A;  1N48 A;  4OI1 A;  4DPO A;  1DTQ A;  1OQ6 A;  2BAN A;  2DNG A;  2VD3 A;  1BQX A;  4CZC A;  1UVJ A;  4PXD A;  3ILJ A;  2A0F B;  1ZZN A;  1M0S A;  2XCA A;  1EJ7 L;  2J6S A;  3D28 A;  4M5J A;  3Q8P B;  4ZPD A;  3GJQ B;  4F4K A;  4I2P B;  2HYI B;  1LW2 B;  2CNN B;  1JLQ A;  2V8P A;  4DQP A;  3MCM A;  2DBB A;  1RKI A;  3J81 U;  2FVP A;  4GC6 A;  3I5A A;  3MD1 A;  3E01 A;  3IWL A;  5A8W B;  4K4Y A;  4JI2 J;  5A76 A;  2M88 A;  1U1P A;  3DRP B;  3POT B;  1RU2 A;  2FGO A;  4KSE B;  2AMC B;  2BJ8 A;  2XI3 A;  4IO9 Q;  5AT1 B;  4JOU A;  4FVM A;  2IDL A;  4EBE A;  4ILM A;  2VBZ A;  2BE7 D;  3FZB A;  3EXY A;  3LGH A;  1Q7Y T;  4Y2C A;  2HUR A;  1I94 F;  1H2T Z;  4FYY B;  3W8G A;  5ETR A;  4TVA B;  3C14 A;  3IG1 A;  5CAB A;  2LQ8 A;  4K5R A;  3SFG A;  3K89 A;  5B7W A;  2M9K A;  3T1H F;  3MEE A;  3C3L A;  2EFG A;  3BEG B;  3CJR A;  4OHV A;  3RYL A;  4J90 A;  5K8O A;  1WAC A;  2MKK A;  1QM9 A;  3UN2 A;  3OUY B;  5CQG A;  5LL6 d;  5HO4 A;  1GT8 A;  3C16 B;  4M5H A;  3BO3 A;  4GVB B;  5CHC B;  4DPX A;  1IR1 A;  2G4B A;  5HP1 B;  2DGW A;  3JSY A;  5RUB A;  3D6H B;  2YKM B;  3BSA A;  2LXI A;  3I87 A;  4A47 A;  1HBM A;  1RT3 B;  1WKJ A;  5CYM B;  1U0H B;  3JQJ A;  4ZVS B;  2FLO A;  3Q8V A;  1ZPW X;  4Q8F A;  2W9C A;  4OZ0 A;  4UY8 5;  4HI2 A;  2KVQ E;  1O8B A;  2GMH A;  1U1R A;  4NLY A;  3MAQ A;  2M70 A;  1S6U A;  2J0Q D;  3KJN B;  4LSL A;  5G0R A;  4ZPW R;  2BJ3 A;  1HKA A;  4NLW A;  3IC1 A;  3X1L B;  2X3G A;  4B3S J;  1YWX A;  4YR3 A;  2VZ9 A;  1UVM A;  2B3T B;  7FDR A;  1JKH B;  2G9O A;  3R8Y A;  1NZ8 A;  2DHS A;  2CNK B;  3GYG A;  1KVJ A;  2VL1 A;  1YRT A;  1EET A;  2R7X A;  3EDQ B;  2G0I A;  4ZVG A;  2M8D B;  3ZTO A;  3CCR S;  5J2M B;  1C1C B;  2QL7 B;  3TZZ A;  2E29 A;  2E9T A;  1FK9 A;  3MD3 A;  1YG0 A;  1WHW A;  3I6P A;  1RK8 A;  3MEC B;  5T7L B;  4DCO B;  2WVD A;  2XMV A;  3MED B;  4E2F B;  3CCJ S;  3M1V A;  1NJI T;  5T14 A;  3PYE A;  5KT3 A;  4B02 A;  2YWK A;  5D3G B;  4LF7 F;  1WEX A;  1DFD A;  3HVT A;  1IJE B;  2FJE B;  3PXG a;  1RAE B;  4FS1 A;  5LMN J;  4RWW A;  2OTL S;  2ROG A;  2XB2 D;  1RAB B;  3UD5 A;  4DR4 F;  4KGM A;  4ED1 A;  3Q22 A;  1HQU A;  3NRB A;  2B4V A;  2MHE A;  4N77 A;  2ACM A;  4P73 A;  3V81 A;  3JSM A;  2H65 B;  1XN9 A;  3M9N B;  2JVR A;  1K9M T;  2C2R A;  2D3O 1;  3MCO A;  2I5J A;  2WB1 D;  4OJH A;  3BZQ A;  4NRU A;  1PBA A;  3FJ2 A;  3KLF B;  3QO9 A;  2QMU B;  2DIT A;  1M90 T;  2HHQ A;  1UP1 A;  2LLZ A;  3DYA B;  1WUU A;  2PMH A;  4O44 A;  3CME S;  3P3D A;  2MGZ A;  5KT4 A;  4YB5 A;  2DRB A;  3KLV A;  2B9Y A;  3R7N B;  4PXC A;  3JQK A;  3BF4 A;  3M2R A;  4QW8 A;  4LRB A;  1F1B B;  3L3C A;  3HPO A;  3PR4 A;  1S79 A;  2FD2 A;  3TUZ C;  3BSO A;  1S7I A;  2HQG A;  4NEY A;  5ETT A;  1GFW B;  2R9L A;  4PG8 A;  3RB6 A;  1M5K C;  1VHI A;  1ZS6 A;  2B9W A;  3HCX A;  2CKW A;  1JNR B;  2KVI A;  1OQ3 A;  3NL0 A;  2VPY B;  1S9F A;  3PAC A;  1KP6 A;  5I3P A;  2HRY A;  4QPX A;  2XC9 A;  1F60 B;  4CLK A;  1FJG J;  2E9R X;  3CJ3 A;  1PSD A;  5IM0 B;  2AZ1 A;  3QSI A;  3A12 A;  5JMN A;  4GKK J;  3UVJ A;  4DI6 A;  2V4J A;  2YNH A;  2D3Z A;  3KDO A;  5EHH A;  2APO A;  2QG9 B;  1IBM J;  2ZH3 A;  2MQN A;  1RJJ A;  1T95 A;  1NUE A;  1YZ6 A;  2CNL B;  4C8K A;  3KLH A;  4C7Q A;  1APS A;  1WTF A;  4DG1 A;  3R1H A;  2IY5 B;  2B0G A;  1OY6 A;  4NXM F;  3NLC A;  3H8Y A;  1W7W A;  4DU8 A;  5EX3 A;  2GA7 A;  3GCX P;  4RW8 A;  2G0C A;  2ZD1 A;  2RQK A;  1WOS A;  2OPQ B;  2DO0 A;  2GGP A;  2BV3 A;  2E5I A;  3RW6 A;  4DHV A;  3ZZ0 A;  2R2S A;  2CPJ A;  4RBV A;  4B9V A;  1UVK A;  4UY8 T;  5DS7 A;  5A8R B;  5IS2 A;  2LFV A;  2BEF A;  5E3R A;  2HHT A;  2VIH A;  3IWN C;  1EP4 B;  4CTA B;  3NS7 B;  1GMV A;  5D0E A;  4DMZ A;  4MK8 A;  4NLX A;  3ZZZ A;  1S4E A;  3U1L A;  2KJV A;  1RTJ B;  2GQQ A;  1TK8 A;  1UWA A;  1ZAW A;  4TNO A;  2WSC C;  2C3M A;  2ASY A;  3UPF A;  4DL0 C;  4J91 A;  4YY3 F;  3T5K A;  4F36 A;  2Y8W A;  2KXN B;  2IM1 A;  3C15 A;  4ED6 A;  4DV6 J;  4KPC A;  1JNZ B;  1FX2 A;  1GMW D;  1UL3 A;  1TFW A;  1UWB A;  4ELT A;  4AND A;  5B0G A;  1SJQ A;  2JC0 A;  2O3D A;  4UQT A;  4A8Y A;  2W24 A;  3M2V B;  1F5A A;  2XY7 A;  4WXO A;  3F0N A;  3J7Y U;  2B4O A;  2R2R A;  4LF8 J;  4AE5 A;  1EB0 A;  2KKH A;  4I2Q A;  2GS8 A;  2VKR A;  4ECR A;  4EZ6 A;  3FEZ A;  4IDK A;  1NK7 A;  5KFN A;  1HPZ B;  1QVF R;  1X0P A;  3H59 A;  3TAQ A;  1S1V B;  1RLD A;  2R7O A;  4EO6 A;  4UTG A;  2XEX A;  3MMA B;  2JLF A;  4HHH A;  2CPY A;  4F0M A;  2UV8 A;  1VIS A;  4WK1 A;  2VBW A;  2AT1 B;  4P52 A;  3H7H B;  2CPI A;  1HI8 A;  3OSP A;  3DMJ B;  3GU0 A;  3WC2 A;  4UUW A;  2WCX A;  3RRH A;  5C2C A;  2F5G A;  3WQP A;  3TZX A;  2H48 B;  3AA9 A;  1UMJ A;  1TL4 A;  1RWO B;  1BUX A;  4K5S A;  2FZK B;  4OIX A;  2YPY A;  1FRH A;  4V19 X;  4P6Q A;  2LQB A;  4DV7 J;  4I7F B;  1ZBT A;  1HQ2 A;  4ZJO A;  3B6B A;  1GNK A;  3PW4 A;  1RWN B;  4LF4 F;  3M6V A;  4G1P A;  2O1P A;  4JI0 J;  4ZS6 A;  3BB5 A;  3IBC B;  3BO4 A;  2BW2 A;  3Q86 A;  2KFZ A;  4I2P A;  5KFJ A;  4USK A;  2RU3 A;  1LW2 A;  2CJ9 A;  2C3U A;  1WC1 A;  2BMB A;  1K44 A;  2HAI A;  3OTB A;  1Q8K A;  2IA0 A;  3FSY A;  1VIX A;  3QWU A;  4L74 A;  1HWI A;  4DU7 A;  1RTI B;  4DWI A;  1VQN S;  2DHA A;  3LAN A;  4DX5 A;  1P6T A;  4KO0 A;  2BJE A;  2SXL A;  2H5E A;  2F4V J;  1VBZ A;  3POT A;  2ZHB A;  3E2E A;  2V9W A;  4TYB A;  1RAI B;  3RU0 A;  3F44 A;  1HMV A;  4NCG B;  5LJ5 Y;  1SJ3 P;  1HBU B;  4HKQ A;  4B17 A;  3MFH A;  1PBU A;  4YN3 B;  1OS5 A;  3ET6 B;  1NJW A;  4FYX B;  4F4X A;  4ECW A;  3QZ7 A;  3QZ8 A;  1L3T A;  3PG9 A;  2XHW A;  4ECX A;  4J9P A;  4NE9 C;  1JB0 C;  4PYD A;  4F7V A;  3ENW A;  5BR8 F;  2FTR A;  4A4J A;  2MZT A;  4H4O B;  4FPR A;  5C24 B;  1FE0 A;  3HSG A;  4MYT A;  2AJ4 A;  3LGM A;  5ITH A;  1WD6 A;  2MB0 B;  2V6A A;  2FJW A;  2BOA A;  2BKO A;  5L1L A;  2WW8 A;  3OUY A;  4OLO A;  4GVB A;  4Y2M A;  1OIA A;  4NYP A;  3WIU A;  1DJ0 A;  3FUY A;  2HQ3 A;  3LWM A;  3H2L A;  2CQ0 A;  2Z56 B;  1KDN A;  3KJQ B;  4YHH J;  3KK3 B;  1YIT S;  2W2M P;  3NY0 A;  1KQS R;  5I3U B;  2H5I B;  1ZOT A;  1IN0 A;  2M7S A;  4MK7 A;  3T6J A;  1B0V A;  2OEJ A;  4ED3 A;  4CLZ A;  2GQ2 A;  3W60 A;  4RU2 A;  1PYS B;  1RAC B;  4KHR A;  1RT3 A;  2ROE A;  4W4M A;  1RT4 A;  2UUB J;  4R5P A;  3K57 A;  1NK4 A;  1N34 J;  3KHG A;  4DR3 J;  1BD6 A;  4KHM A;  4C8O A;  4OX9 F;  1J27 A;  4KRW A;  3EMT A;  4KFB B;  3L7U A;  1F5B A;  3A8J A;  4HT7 A;  5GME A;  2UP1 A;  1V3R A;  2XI2 A;  1U2R A;  2RRB A;  3G6E S;  1XIQ A;  2VQF J;  2GHW A;  1UCN A;  2CWX A;  2UUC F;  1WTB A;  4DSE A;  4LBH A;  1CBK A;  5KFI A;  2EXU A;  4HLB A;  1NPP A;  1IBK J;  1GX5 A;  1T9W A;  1N33 J;  5KT2 A;  4DR7 J;  4MAK A;  1FRX A;  4FF3 A;  1HNW F;  3I55 S;  2IRU A;  1HYS B;  2R7Q A;  1TL1 B;  4O4R A;  3GJR B;  3SCL E;  1FJE B;  2HVI A;  3R27 A;  2YKO A;  5LXY A;  3PHT A;  3DLB A;  5ETP A;  1KON A;  5T7L A;  5F8M A;  2F9J A;  4WPA A;  2AYE A;  2FVR A;  2RIJ A;  1NM2 A;  1RAG B;  2YQ1 A;  1F9H A;  5J1E B;  3JAM U;  4J9N A;  5D3G A;  1H7X A;  3PY8 A;  1NEE A;  4BDP A;  5D6G A;  5SUH A;  2VQE F;  3QT7 A;  3TAM B;  3EE3 A;  4ZJQ A;  2QA4 G;  2VA2 A;  2HWH A;  3KTQ A;  3BRE A;  5ETK A;  4C97 A;  3UDV A;  5I3Q A;  3RB4 A;  4JYA F;  1XNQ F;  1D9F A;  1X31 C;  3T9N A;  3TO8 A;  4MK9 A;  2IVM A;  3IXQ A;  1ZET A;  4PG7 A;  4KV8 B;  3UCG A;  1XER A;  2OLW A;  1T02 A;  4F4Y A;  3ETM A;  1CJK A;  1T9Y A;  1VLY A;  4CLP A;  2DHH A;  3CSK A;  1M1H A;  4UOC A;  4KGK A;  2BUN A;  4U96 A;  3DU5 A;  4QIG A;  2M0G B;  4I56 A;  3PJ9 A;  1YJU A;  2HS3 A;  3CJ8 A;  3KLF A;  1X4C A;  3SIP B;  4GKJ F;  3NS5 A;  4CYU A;  4DLG A;  2A6O A;  3H5X A;  2WK4 A;  5KFR A;  2DIV A;  2M52 A;  2YX4 A;  3DYA A;  3H20 A;  2EC2 A;  3QLH A;  5KT6 A;  5FDL B;  4CWB A;  4DR2 J;  1U1Q A;  4J9U E;  5DQH A;  1HNI B;  3PDN A;  1T8E A;  4RR5 A;  2RH3 A;  3R3T A;  4ZCM A;  3B78 A;  3BN7 A;  2QYG A;  5D8H B;  2H4W B;  1B70 B;  2WVE A;  2ZZM A;  2PDA A;  2HKE A;  4DV3 F;  4OJG A;  1RTD A;  4F02 A;  2R42 A;  4XK8 C;  4N5S A;  4AL7 A;  1S6O A;  2CJB A;  3K17 A;  3UR0 A;  4O3N A;  3CCV S;  5L9X A;  1SJ1 A;  4GRS A;  3DOK A;  3ZZR A;  3TNV A;  3Q8R B;  4B3M J;  5KOW A;  1UET A;  1Q0N A;  2G1H A;  2J5A A;  2NQP A;  4I68 A;  1WG1 A;  3LAM A;  1JLB B;  1FDN A;  2HVZ A;  1ZAX A;  4ZN3 A;  3RG6 A;  2VV5 A;  4Q2M A;  4EUV A;  3ZXW A;  4J9S A;  1LEO A;  5GAG I;  1O6X A;  2MKI A;  3IRW P;  1S0V A;  1UTA A;  2AEF A;  2GFF A;  3Q24 A;  5L1J A;  4OYI A;  2V69 A;  5IXU A;  1XR5 A;  1ZH5 A;  2PEB A;  3CDE A;  1HBN B;  5EX0 A;  4C6A A;  1P1L A;  1UEV A;  2VFS A;  4DS4 A;  1D9D A;  4Q45 A;  3LUY A;  3J81 Y;  4Y2K A;  2B6A B;  2QEX S;  3OV7 A;  1U45 A;  2GAG C;  2CWK A;  4BC7 A;  3M2U B;  3LQV A;  1CPZ A;  3FCH A;  1W2I A;  2OEL A;  3CTR A;  3JTN A;  1KQF B;  2B7C B;  2E5J A;  5IQQ A;  2G2Z A;  2PFF B;  4UST A;  5J1P A;  4OV6 A;  3A13 A;  5A8R A;  2FY8 A;  1YJ7 A;  2Q6B A;  1M5O C;  2CQ4 A;  4TQS A;  3KJV B;  1ZA2 B;  1MMD A;  1JLF B;  4M5G A;  4CTA A;  3G9C A;  3AQO A;  4RL1 A;  1V6H A;  1G2E A;  1U26 A;  3FSI A;  3VCD A;  3N0V A;  3R5J B;  4M95 A;  4F04 B;  4O0N A;  3TVZ A;  3ENV A;  8ATC B;  1Q5Y A;  2HHX A;  5D15 A;  1KFS A;  1OO0 B;  3QAU A;  1WOO A;  4O4G B;  5DZ7 A;  3CJS A;  3ISN D;  4DV0 F;  3R2D J;  3AOA A;  5J2Q B;  1QAX A;  1H7W A;  3W9H A;  4DV5 F;  3T5L A;  2VJU A;  2OPP B;  3M2V A;  1X5S A;  4PAB A;  4AYB D;  2CPD A;  4ZCK A;  2EFO A;  2ABY A;  1I94 J;  5A0Y B;  4Y2I A;  2CYY A;  3N01 A;  1PC5 A;  1TVR B;  3DI6 A;  4LR8 A;  3VWS A;  1X9S A;  4FF4 A;  3H4B A;  4UZC A;  3T1H J;  1S1V A;  2WW4 A;  3NAI A;  3ZZY A;  3LTO A;  1S0O A;  4OYZ A;  3LPE A;  2CZ4 A;  4PXB A;  2GC8 A;  4O0I A;  3CGI A;  1GK8 A;  3BGR B;  1RWU A;  3NNA A;  4N47 A;  3DMJ A;  1ULR A;  4U8V A;  2FLP A;  2KHD A;  3JXO A;  4WFN Q;  2NZ4 A;  2PA3 A;  1S0N A;  4GO7 X;  3SBM A;  1KQK A;  3NGT A;  2D1C A;  2ZOG A;  3IS9 A;  3D67 A;  1ZM4 A;  2KZM A;  2KXH A;  5DRK A;  3HSJ A;  3MI7 X;  2HNY B;  4Q7A A;  2G13 A;  1N5Y B;  4NZ7 A;  5GAE I;  2DY1 A;  3MF5 A;  4IO1 A;  2IBK A;  2HFV A;  2BQU A;  4M5M A;  2NZC A;  5K9F A;  2VH7 A;  1RTI A;  3QGI A;  3OFG A;  3W62 A;  2JNJ A;  4WYW A;  2XMK A;  3OPK A;  4TY8 B;  1X4B A;  2JH3 A;  3OVB A;  3P5T L;  1G3O A;  2V8V A;  1WG5 A;  3HO1 A;  3KUH A;  3OTE A;  1PGZ A;  2ZHA A;  2BKN A;  2FLL A;  2VKZ G;  2NYH A;  4NCG A;  2DCU B;  2KI2 A;  3T5H A;  4M5K A;  5AE2 A;  3R2C J;  1HBU A;  2AX1 A;  2JEF A;  1B7Y B;  2GVZ B;  2B4P A;  2IJF A;  3US5 A;  4IRC A;  5IT9 U;  2YNF B;  2CZV C;  2HHV A;  2YWH A;  2K1R B;  4OV1 A;  5A6W A;  3M32 B;  3VAF A;  3GCW P;  1RTH B;  4H4O A;  5KFH A;  1WKL A;  1LW0 A;  2YWF A;  5HAN A;  1WHX A;  2HK3 A;  2HRU A;  1R89 A;  3MR5 A;  3FMW A;  3DDI A;  1N56 A;  2XS2 A;  3HI9 A;  2DGQ A;  1IKY B;  1CS4 B;  3DDK A;  3OW2 R;  2QMX A;  1HNX F;  1RHR B;  4F4Z A;  4QR1 A;  3KK3 A;  2CJK A;  4IH5 A;  4DR4 J;  1VI7 A;  4QR2 A;  4DUY J;  3LWL A;  3H2U B;  3MPV A;  3ZNJ 1;  2YTC A;  3G71 S;  3HFV A;  5HL7 Q;  1AYE A;  3Q8U A;  4Y6I A;  2J7W A;  3DM2 A;  4TXS A;  4Q44 A;  3OJU A;  2YNI A;  2YWE A;  1VC6 A;  3NCQ A;  4CO3 A;  1NAQ A;  1Q7L B;  3SEO A;  2ACY A;  4KHP F;  1EZZ B;  1AFJ A;  3I4P A;  1VRQ C;  4OZ2 A;  2GAH C;  2OSQ A;  4DN9 A;  1FDB A;  1N4L A;  1FKP B;  1EAR A;  3TVY A;  3V6D B;  5KTQ A;  1IR0 A;  2LYV A;  1V5I B;  3TX8 A;  3OXG A;  3BH6 B;  4WE1 B;  4IR1 A;  1NRK A;  3NWG A;  2KL8 A;  1UPP A;  3MFI A;  5DZ6 A;  1NDC A;  4E0D A;  2DR9 A;  1FEE A;  4XAK A;  3CNQ P;  1N88 A;  2EWH A;  3NNC A;  3PYD A;  4Y34 A;  4PXE A;  3M4X A;  2WHO A;  4ZP7 A;  3SXL A;  5KT7 A;  4NPO A;  4L72 B;  1OY9 A;  4X4P A;  4DSL A;  1YGY A;  2AWZ A;  3GJS B;  3AQP A;  5E33 A;  4NZ0 A;  2R7V A;  1PJ6 A;  3DOL B;  3D54 A;  1D0E A;  3DLG B;  1WC4 A;  2QIF A;  3DKD A;  3ISN C;  2FB0 A;  4V1A k;  2ZHO A;  3UWT A;  2AEJ A;  3H90 A;  1Y00 A;  4U67 Q;  5HQM A;  1N54 B;  2QZ8 A;  2Q79 A;  1PO6 A;  3VVT A;  1HLW A;  3OL8 A;  3CJK B;  1QY7 A;  4LR9 A;  3VAM A;  3W8P A;  4NXM J;  3WDO A;  4J9R A;  5A8K A;  4KV8 A;  1S59 A;  4D3G A;  2XMJ A;  1RXO B;  1V9O A;  5F41 A;  3DC2 A;  4J7C A;  2OH2 A;  2C3O A;  4WWS A;  4MKY A;  1I51 B;  2JJ4 D;  2RSQ A;  3RBZ A;  2CQ3 A;  2Y1I A;  3OL9 A;  4M8L A;  1SC3 B;  2VOD A;  2IAJ B;  3M05 A;  4QIW D;  1HNI A;  3HX9 A;  5B0E A;  4KBI A;  2OO4 A;  4ZKA A;  3G6X A;  3N4W A;  2CQP A;  4P7V A;  3K0J A;  3FVY A;  1I1G A;  5DLF A;  1C4A A;  2AGQ A;  1OYD A;  1TL3 A;  4B08 A;  3CED A;  4YY3 J;  4NA1 A;  5D4N A;  4K50 A;  3KWM A;  2JLG A;  1VRT B;  4P2X A;  1NHU A;  3FZ2 A;  1Q8I A;  3CPW R;  4QOT A;  1VRU B;  2RHS B;  2XYG B;  3VZI A;  3MAA A;  2GO8 A;  3M6W A;  2A2D A;  4C98 A;  2RVJ A;  2Z30 B;  1JLB A;  1TTH B;  5LMU F;  1HHQ A;  3H4D A;  4EI2 A;  2MKS A;  1IKW B;  2J9D E;  3EXC X;  1KLM B;  1Y3J A;  5A2Q U;  1FFW B;  1JJH A;  3EVW A;  3KLI B;  5CCL A;  2AGP A;  4DL7 A;  3DN9 A;  2ZIT A;  3IRX B;  3PEH A;  3GP9 A;  3DOM B;  4FDF A;  4P74 A;  4NAS A;  2QRR A;  2DGO A;  1WHY A;  2AYG A;  2P2C B;  1UKU A;  4C8Y A;  3LP1 A;  1PYT A;  2CQH A;  3HT0 A;  1S10 A;  2MJU A;  1NND A;  1GMU A;  1WC6 A;  2DT9 A;  5DM7 Q;  2FPH X;  1D8Y A;  3K8V A;  4C3L A;  2XMM A;  1HNV A;  3UR3 C;  4UZB A;  2W8K A;  2OKQ A;  1A0O B;  3A8E A;  3QJJ A;  3QGG A;  3GON A;  3I0S B;  4KKO B;  2HLU A;  3CJ0 A;  4FXW A;  2KT5 A;  3ICL A;  1S77 D;  4L73 A;  2ZE2 A;  2ZJQ Q;  4OZ1 A;  3KJV A;  3MR2 A;  1KWM A;  3MEG B;  4K4W A;  3BS9 A;  1JWW A;  3K59 A;  1GXT A;  4MYU A;  4LF4 J;  3W65 A;  4CRJ A;  3RAX A;  1Q95 G;  2ZDP A;  2VFR A;  3C66 A;  3W5Y A;  4G1Q A;  5F8I A;  2A10 A;  2VA3 A;  4ZVO B;  1YJV A;  2N3O A;  3MR6 A;  2UVR A;  3BGO P;  3F73 A;  2HGN A;  2K2P A;  1S1W B;  5GAG U;  2JLE A;  2RRA A;  4LRD A;  4QCL A;  5KT5 A;  2DGU A;  4O4G A;  1WDD A;  1S1X B;  1VQ9 S;  2H4Y B;  4UF4 A;  4RW4 A;  1WOR A;  3OTC A;  1CUL B;  2MZJ A;  4J5O A;  4LIR A;  3MM5 B;  3NGD A;  3DDN A;  5BYR A;  2PE8 A;  5EWE A;  2OPP A;  3THV A;  2QE5 A;  3OFF A;  3MMC B;  1TMM A;  2QO3 A;  3W64 A;  4ED5 A;  5F9N A;  4DV1 F;  2XM3 A;  1F9E B;  5A0Y A;  4LRA A;  1CG2 A;  4ZVF A;  2YH0 A;  3HLU A;  5LSR A;  1RLC L;  1TVR A;  4WFY A;  3BV8 A;  3NGK A;  3OVS A;  5BR8 J;  5FII A;  2VAS A;  3GIK A;  2Y1J A;  2RKI B;  2J76 E;  2ERR A;  4AL5 A;  1AT1 B;  3N9U C;  2AYB A;  3GFX A;  2KG1 A;  1HWJ A;  1SV5 A;  4ANE A; 
#chains in the Genus database with same CATH homology
 1N32 J;  4DR5 J;  1IBL J;  4B3S J;  4LFA J;  4JI5 J;  1FJG J;  4X64 J;  4LF9 J;  3D3C J;  5AJ3 J;  4KY3 A;  3JAM U;  2UUB J;  5A2Q U;  4NEZ A;  2MQ8 A;  4DR1 J;  4KHP J;  1N34 J;  4RJV A;  4GKJ J;  4GKK J;  4DR3 J;  2KL8 A;  2MTL A;  3IMQ J;  1I94 J;  3D3B J;  1J5E J;  2HHH J;  4LF6 J;  1IBM J;  4DV4 J;  5LM7 E;  4LFC J;  3OTO J;  4JI8 J;  1HNW J;  5FLX U;  4JI1 J;  4DR4 J;  4DV0 J;  4LF7 J;  4DV2 J;  5LMU J;  4DUY J;  4JI7 J;  4JV5 J;  3T1Y J;  1XMO J;  5IWA J;  2VQF J;  4DV5 J;  4B3M J;  4KYZ A;  4HHU A;  4LF5 J;  4DR6 J;  3T1H J;  3J81 U;  4PWW A;  4DUZ J;  4DV6 J;  4JI4 J;  2UXD J;  4DV7 J;  4DV3 J;  2ZM6 J;  2E5L J;  4K0K J;  2VQE J;  2UUA J;  3R2C J;  3W1Y C;  1HNX J;  4JI2 J;  1IBK J;  4OX9 J;  1HR0 J;  4JI6 J;  4V1A k;  1N33 J;  4JI0 J;  4DR7 J;  4JYA J;  1XNR J;  1XNQ J;  4YY3 J;  2MEW A;  1HNZ J;  1XMQ J;  4NXN J;  4LF8 J;  4NEY A;  4JI3 J;  2UUC J;  2UU9 J;  5IT9 U;  5BR8 J;  2KVQ E;  4YHH J;  3J80 U;  5LMN J;  1N36 J;  4AQY J;  4X65 J;  4NXM J;  4LFB J;  2UXC J;  4B3T J;  4DV1 J;  3J7A N;  4X66 J;  4DR2 J;  4LF4 J;  2UXB J;  4X62 J;  4B3R J;  2F4V J;  3R2D J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...