4NXNJ

Crystal structure of the 30s ribosomal subunit from a gidb (rsmg) mutant of thermus thermophilus (hb8), bound with streptomycin
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 10
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4nxnJ00
4KY3A 1HNWJ 4X66J 4DUZJ 4NXMJ 2F4VJ 3IMQJ 1J5EJ 5A2QU 4YY3J 4LF8J 4B3SJ 4HHUA 1FJGJ 3D3CJ 1N32J 4PWWA 4LF5J 4DR1J 4DV4J 4JI2J 2VQFJ 4K0KJ 4JI8J 5LM7E 4JI0J 1XMQJ 1HR0J 5LMUJ 4DV0J 4DR2J 4KYZA 4X62J 5AJ3J 4LFCJ 4LF7J 2E5LJ 2UUBJ 4AQYJ 4JV5J 4B3MJ 4KHPJ 4B3TJ 2HHHJ 2MEWA 4DUYJ 4RJVA 4LF6J 4LFAJ 4LF4J 4OX9J 4JI1J 4JI7J 3J7AN 1IBLJ 4X65J 4JI3J 1N34J 3OTOJ 3R2CJ 2UUAJ 1HNXJ 4JYAJ 4DV5J 4DV1J 3R2DJ 1N33J 2VQEJ 3T1HJ 4X64J 4NXNJ 4DR7J 5IWAJ 1N36J 4DR6J 4LFBJ 2UUCJ 4B3RJ 4GKJJ 1XNQJ 4DR3J 2KVQE 2UXDJ 2MTLA 4JI5J 4DV2J 1IBMJ 5FLXU 4LF9J 2UXBJ 3T1YJ 3JAMU 4DV6J 3D3BJ 4YHHJ 4DV3J 4NEYA 2UU9J 2ZM6J 2KL8A 4DR5J 4JI6J 4V1Ak 1XMOJ 1I94J 2UXCJ 3J81U 3W1YC 2MQ8A 1IBKJ 4NEZA 5BR8J 4DR4J 4GKKJ 5IT9U 5LMNJ 1XNRJ 1HNZJ 4JI4J 3J80U 4DV7J
chains in the Genus database with same CATH superfamily
3DRPA 1TELA 3JSBA 1B7YB 4C97A 3E8OA 4QWDA 3LWMA 2HBRB 3MPUB 2C2DA 2YQ1A 2LU1A 4NCAA 1Y4ZB 3OVBA 4DX8H 2B5JA 3ET6B 4C8YA 4H4OA 3BO4A 2UVRA 2VFSA 4K4XA 4K4SA 3OR2B 4YB5A 2YNFA 4F02A 4P2MA 4PG6A 4RL1A 1TK5A 3BDEA 1NCLA 2HMIA 3FZBA 2Q43A 1E6VB 3R97A 1HBNA 2FJEB 2LEAA 2H3EB 2KU7A 4LF5F 1D1UA 4GMKA 3PW5A 1ZH5A 5L1JA 3NLCA 4WZQA 5GVQA 2POKA 3MURP 3DRPB 1DARA 1M5PC 4O4RA 2UXBF 3HJVA 3MI7X 2KZMA 3WIUA 2PE8A 2YPZA 3CWJA 3D9BA 1V6HA 2R7XA 2DGQA 4Q2LA 2QG9B 2RU3A 2C2EA 4OLOA 1VBZA 4LF4F 2FHKA 3NGDA 1SBRA 2D69A 2Q6BA 2RF2B 4O3RA 4AQYJ 2IHR1 3CIZA 1JLQB 1KBRA 4A8OA 3E3XA 5KFYA 4C2MA 1RT4B 2IAJA 1NJYA 4AT1B 4RJVA 2IJFA 1RT7B 3SSQA 1FCAA 1IKVB 2HEKA 2QT7A 3FBBA 2CDQA 1WG5A 3HHLC 5DJBA 4UOHA 1RQ0A 2H48B 5DDQC 4Y0FA 4RZRA 2XC9A 3B4MA 2V69A 1U2FA 2R42A 3T19A 1SQGA 1N56A 2DGUA 4FXDA 1PAUB 2GO8A 2NS1B 3N5BA 1VHFA 1GH8A 5LT5A 2DITA 2LMIA 3Q0AA 1IR0A 3DKDA 2W9BB 2BE2B 1XNQF 4ECRA 4DHVA 4OHVA 4DUYF 4BWJA 2ZH6A 1GTEA 1F0XA 1WC5A 1FX2A 4ZK7M 5IFMA 2DGVA 3WQPA 4DR1F 3UD3P 2HAIA 4TXSA 1UVNA 4F67A 1T03A 5LSLA 5EUHA 3HHDA 2AYGA 2HFNA 1X31C 1HQEB 2PEHA 4ZPCA 3CCTA 1IKWB 2BACA 4ED2A 3DMJB 3PW7A 4OYOA 4USHA 2CQGA 4IKAA 1VBKA 1RT6A 4IH5A 2UXBJ 3SV4A 5DGAA 2CZ9A 1WC3A 3NOCA 1U7LA 4HVZA 4ZPAA 2HVHA 2C3OA 3EDRB 2HIYA 2KRRA 3NKYA 1WACA 2KT3A 1F9EB 5IZHA 4QCLA 1UVLA 3NCRA 4W4MA 3R5GA 4M5JA 1FD2A 2G1HA 5IQ6A 3D4JA 2M8DB 1CJUB 2WOMB 3W63A 1S10A 2VL1A 1H0HB 3BYRA 2P6SA 5M2PA 1CULB 1HWKA 2H5IB 4TYAA 2FHOB 4UUWA 4DR6F 3W8PA 4R8UB 4MFBB 2CQCA 3EVWA 3KUEA 2MQ8A 1GNKA 3MM7B 4RO0A 4DJBA 3UN5A 2ZM6F 2XS2A 2CQBA 1UVJA 4F50A 3SCLE 3QLHA 3TQEA 2L9NA 4B9SA 1HWIA 2FJDB 3PV8A 1FKAF 1TL5A 2VFUA 1HR0F 3D0IE 4DLEA 2MSSA 3VAMA 1Z2ZA 2CZVC 4RNMA 3UVJB 1KHVA 1VQMS 3ENVA 2QRRA 3PJXA 2AU0A 4P52A 1FFWB 2BJ8A 1XC9A 3A13A 1URNA 4DPOA 1HL6A 4WP8A 1U1LA 3GJQB 4F0HA 1RBAA 2IJNA 3LP2A 3S7RA 1RT3A 5HATA 3U27A 4NLDA 3V6DA 4DL2A 3OXFA 2J0QD 4C9DA 6AT1B 3IXQA 1HNVB 1TUVA 2MJUA 3N01A 4F4KA 3KK1A 3VAFA 4DSLA 2E1RA 3KTQA 2Z58B 5BYQA 4FKYA 5KFOA 1J5EJ 4Q0BA 3D68A 2ZITA 1QE1A 3DYAB 3GWCA 3IAS9 4ZCKA 5KFVA 4PPZA 1UZHA 3WBZA 1NPKA 3QT7A 4F3OA 2W4PA 4DX7A 2Y8YA 5L38A 2EFGA 5H9EJ 4WP3A 5HJXA 1N0UA 4NX9A 1DTTA 3KLIA 4FN5A 5D4PA 4NWBA 5DS7A 3W64A 4CO1A 2E1AA 2HPUA 3X1LB 3AXMA 4OYMA 4J9MA 5JUMA 2RU9A 2PA3A 3FEXB 2GVDB 4ID5B 1F60B 3GPAA 1HA1A 1UFLA 2C1EB 1HQ2A 2IDEA 1KKHA 3C16A 3D7SB 3NS5A 4MFBA 4RW7B 4IRKA 2XCAA 1JKHA 2K2PA 2AZ3A 5ETKA 2MZRA 4M94A 2L08A 2OGUA 4OJGA 4PWUA 2KHCA 2V2KA 3K0JA 3TUZC 1LWXA 5HROB 3BH6B 5E2QA 1ZM3A 1TFWA 1SVDA 4KRWA 2HHTA 2FIUA 1K44A 1WF1A 1R6VA 2DHSA 2C3YA 4IYQA 4WPAA 4Q43A 4B9LA 1FXRA 1N88A 5C24B 2L9WA 3CCQS 1IVZA 3MPDA 4ED0A 3OFHA 3QSYB 3R1HA 4DBQA 1YIJS 2GAGC 3JB9k 4CLYA 3DDNA 2HG4A 2G2YA 4ID5A 4ID8A 5KG7A 2KJVA 4DV0F 4N77A 2LQBA 3THPA 4NYOA 3KLFB 4JI7J 3C66A 4QU6A 2GGPB 3M8YA 3DLLQ 1H7XA 3CJ4A 3TX0A 4NLGA 3MOJB 3OL7A 2A18A 2CJXB 5BJRA 4IO1A 1SL1A 5KOWA 2RHQB 3LUYA 4NLOA 2W01A 2I9SA 4P74A 4C8MA 1HYSA 5KFDA 5ETQA 2ASDA 3DYAA 2APOA 3MM9B 1VQ6S 3BGLA 4KE5A 1FXLA 5T7LA 3PIOQ 3IS9B 5F9LA 4R5PB 3WC2A 1BWVA 4ICLA 3HSZA 2MTLA 4C11B 5GADU 4KPCA 4KGXB 5FLXU 4JI2F 1D3WA 3FJ2A 5HN0A 3MFIA 3O2IA 1ACMB 3DLEA 3KLHB 5D4NA 3GFHA 2I6WA 2MZJA 2F1FA 4ED4A 4YMEA 2W9AA 3D3BJ 2F3JA 2E9TA 3HJFA 3FBEA 1PCAA 2UVUA 4EU0A 3NGRA 2KL8A 1ZYQA 1NXIA 4X65F 4P2FA 1VIXA 1FE0A 3AQOA 1RU2A 5L9NA 2FTRA 1H3DA 3PX0A 1U49A 2W2OP 2WVEA 3C6UA 4IRDA 2BV3A 2Z2LA 3TUJC 3QAEA 3J81U 4DL4A 1NJWA 4OL8A 2P9GA 1RXOB 2KVIA 2V2ZA 2K7JA 3NBPA 1SH0A 3QGPA 2W24A 2L3MA 1RU1A 2CJQA 1EETB 4Y28C 3OLBA 1DTQB 3PRVA 1KTQA 1WF2A 1Y5NB 2JOQA 4PPDA 5SUHA 3PG9A 2YWWA 2VJVA 2NXCA 1FNXH 4HHHA 2A2DA 1SKWA 2R2UA 1SI9A 2WVCA 4NZ6A 3K59A 5F9NA 3O8WA 2DHGA 4G1QB 2RRBA 3O6QA 4CLSA 4MK9A 5A0YB 2AJ1A 2VF3A 1XR7A 3OR2A 2CNOB 5KG4A 3JSMA 1FDNA 4J9NA 1S1UA 4USIA 7FDRA 3MCNA 4HACB 8AT1B 2P8IA 2BUNA 2Z2MA 2GZOA 3GU0A 3KJFB 2MKSA 3DOLA 4USMA 4KY3A 2HRTA 2J5AA 4ZP6A 4TU7A 1K73T 1LWCB 1FVSA 3UCUP 4ZHRA 3MF5A 1FKOB 3TAMB 5C5JA 2GAHC 3C6TB 4KQZA 2BANA 4QIVA 2HS3A 3VHQA 3TO8A 5T14A 5A2QU 1L3VA 3HX9A 2WVBA 3OTCA 3V6JA 3HT0A 2M3DA 3DRRB 1R27B 5ITHA 2OSRA 1NPRA 3KG4A 2PMZD 2MGZA 3C14A 1SC6A 2X7IA 2G2OA 4P7VA 1X4FA 3CPWR 2MKIA 2DH7A 1YRXA 3ILJA 4QYRA 2ZH5A 2FY1A 2G0IA 1HWUA 5M2UA 4TY8B 1S7HA 1WEZA 2QLFB 3AB2B 3MDFA 4LIWA 4UF4A 4F25A 2C2NA 3VALA 4NYPA 1RYRA 2HNDB 2XMUA 4B02A 5A8WB 1S1TA 1HMVB 2BKOA 4Y2KA 5DQHA 4J91A 1JXLA 1MW7A 2J6UA 1VRTA 3GIIA 1VRTB 1R43A 2DYAA 4XDDA 3W60A 3I87A 3NAHA 1RBOB 5HLFB 3W2VA 3R5JB 2WVDA 1B99A 4EBDA 1QVGR 4RW4A 1U1RA 1VQ5S 2J0WA 4USVA 3C46A 1HBMA 1JLQA 5AE3A 2OPRA 3MUTP 5H9FK 3IG1A 4RPFA 4XTTA 4LQ3A 3G6XA 2ZZNA 1OMSA 1V5IB 4C0OC 2XWYA 2ZNYA 4WP9A 1YBUA 2N4DA 4X4PA 2KN4A 2QZ8A 5J2MB 4DUYJ 2RHSB 1N8RT 3L3CA 2CQ4A 3IBCB 3R7SB 3R7BB 2ZE2B 3H59A 2ZZTA 3MEDA 3DRYA 1B7FA 1WHYA 3HLUA 3UDLA 4PXDA 3NMAA 1Q5VA 2CJYB 2DNMA 2VU5A 4LBHA 1IBMF 1HHSA 2CNNB 1UA0A 1W7WA 1U24A 3CD5A 5GMDA 5HI7A 2ROGA 4LVNP 1T9WA 3H4DA 1WI6A 3DFEA 1N54B 1AYEA 3Q24A 4FF1A 1HNIA 1G1XA 2QLBB 2NQPA 3MEEB 1FKPA 3T1YF 3G6YA 1K9MT 3DNCA 5L1LA 4EI2A 3BH7B 4K50A 3D54A 3J7Z5 1FHTA 5CYMB 1OPZA 3H7HB 2V8GA 2MPUA 3DOKB 3I0RB 4FPIA 3P5BP 4H4OB 1NM2A 4OX7A 4CO0A 3FRYA 2AIRB 4DDFA 4DR3J 5A8WA 3FDSA 1RISA 5T7LB 2V9WA 3CJQA 3PO4A 2ATCB 3IP0A 4DV4F 2UP1A 1U0SA 3Q8PB 4KT0C 2BRKA 3DLHA 1FEHA 3OL6A 4J9QA 4LIRA 4H4KA 4LR9A 4CLFA 1KRPA 2OELA 3KK2A 4BDPA 1NO8A 3CEDA 4FS1A 2H65B 1DQAA 2HKEA 2P5VA 1BC6A 1Y9OA 3L4BC 3QRRA 3I5CA 4DV2F 1C0UA 1IR1A 1QJHA 5HBMB 2XY5A 1REVA 4ZCMA 3D6TB 1KFSA 3OVAA 2W9CA 1TQLA 1SB6A 1YQHA 1G4CA 1RTJB 4KKOA 2DRAA 5KFXA 1PJ7A 5H9FJ 1SC1B 1TL3B 2R7WA 1SCJB 1CC8A 4WFZA 3N5FA 3DXBA 4B3OA 2Z0GA 2M4MA 3CD0A 3HSGA 4ICLB 5C24A 3H2VE 3ZZUA 3DU5A 2HGNA 4MIBA 4QIWD 4IFVA 4KFBA 4OI1A 3N6NA 4EWTA 1JLGB 4C6AA 3DLJA 3MPYA 1DURA 4G1IA 1RAJA 1WC0A 1RAAB 1X4CA 3FSIA 3NNAA 4N7TA 4MKYA 1KOOA 2GW8A 3TZYA 2QGFB 3NCPA 5ETLA 9RUBA 4PWDB 8RUCA 3TARA 2QTWA 5K5MA 3NXZA 3UN2A 2LCWA 1U1MA 3LOUA 1TL1B 4DUZJ 2CPEA 4LF9F 3MEGA 3EDQB 1FWKA 1QY7A 2CXEA 1GQEA 1NSQA 3J7ZT 2VOOA 4YR3A 4PRFA 4LJMA 2D3UA 1Y5IB 2GS8A 3D3CJ 4M63A 4U9RA 4QWBA 4U95A 2VC1A 3KKFA 3M6WA 3SSSA 3OV7A 3BKFA 2JC0A 3KHGA 3HHLD 4YR2A 1X4HA 1NAQA 4HH0A 4J9KA 2RRAA 4F36A 2YKQA 1XR5A 2QMWA 4HTIA 4YFUA 1HBUA 1Y3KA 2YWEA 4K0KJ 1DLOA 1RABB 3QYYA 6FDRA 4CH1A 1M5HA 1SUQA 3GFZA 3BEGB 3MECA 1OO0B 1RWKB 2WCXA 2HFUA 3CJ3A 3MMBB 4KKOB 2B4OA 2WHOA 4ZP8A 3HD1A 4ECVA 5BR8F 2BJ1A 3NWGA 3CMQA 1TAQA 4CYUA 3T41A 1IBLF 3H5UA 4KYZA 3IRWP 2W9CB 3DC2A 3R1LA 1X0PA 2E5GA 2IVMA 4F26A 4NCGB 2XEXA 4OI4A 5AXKA 4E98A 1JJCB 3A3PB 2Y3YA 3W61A 4ZLNA 2ROPA 2LA6A 1J5OB 2JEJA 3KK2B 1LWEA 1BQMA 5FLXY 3CC7S 2W7AA 2BJDA 1XMBA 3RBXA 1RWPB 4B3MJ 4JV5F 4C8LA 3OR1A 2LXFA 2VKRA 3GJSB 1BY9A 3U1LA 3JAMY 1VS3A 4YHHF 3D1QA 2GC8A 2CPXA 2CWXA 2AHOB 1FRHA 1NK5A 4A8YA 2ZD1A 4DL6A 1D9AA 2O5DA 5J1NA 2FHJA 4TLRA 1HI0P 3LP1A 4X4UA 2V4JB 3BBFA 3OL9A 4OX9J 1RHKB 4JI1J 3CMES 3BSAA 1M5KC 3MMAB 1X4GA 4HR2A 4P73A 5KG6A 4OMFG 5DRKA 1BGXT 5DZ7A 3CJKB 3WHIA 3ZZTA 3OXLA 4OX6A 1SQFA 3LP2B 4C7QA 2ZHAA 1U2RA 1PYOB 1S6QA 3ZXWA 1Q79A 1HNXJ 3MTJA 1HARA 4CIOA 2ZWOA 1TP7A 4J90A 1M1HA 1PAEX 2UUBF 2E29A 2DNQA 2J0XA 3KXDA 2KM8B 3M8QA 4L6V3 1JKHB 4EFAC 5KT6A 1K0TA 4NLRA 4RW7A 3G9CA 4A48A 3LW5C 3I4PA 1UCNA 1ZAXA 2COLA 4B9VA 2W25A 3NCQA 2WSEC 4MKVA 2N7CA 1S77D 1RLDA 1RWVB 1N5YB 1P9QC 4ZJOA 1NK9A 4ECWA 4PG8A 2R7QA 2EK1A 3M32B 4IDKA 2YH0A 2AW0A 4ZJQA 2K1RB 4C48A 2RQ4A 2VPXB 1RTHA 2ZVIA 2W7PA 3TQ1A 2MKKA 1YVFA 1S0OA 2H5EA 1L3UA 2RS2A 3LAMA 4DR7F 1JLBB 1MWZA 2CJ9A 2HVIA 3CO0P 1CJUA 2WOMA 2HZVA 3MAQA 1CEZA 3EZ5A 4LR8A 1O5JA 2PEBA 3FBCA 3IR5B 3ZNJ1 2D3ZA 1CJKB 1SH2A 3KUHA 2W2QP 5HQMA 3SI8A 3KNAA 2QMXA 4ECTA 1SJRA 3KWMA 3PRBA 3VWSA 3RBDA 2I2YA 4FF3A 1WG4A 1YZ6A 1RTJA 2EWHA 2RSQA 2V6AA 3LP1B 2B4UA 2HS4A 2MKCA 4FYXB 2LXUA 1R89A 3UO0A 2VH7A 4CTAA 2NXEA 3MTKA 1M1GA 3UI3A 1FTCA 1RYSA 4KHRA 5AXNA 3ISZA 4ZIWA 1WC4A 3RR8A 1S4FA 3TAPA 4W90B 4HYKA 4L3NA 2P6TA 4DV7F 5GAGI 1BQMB 1ZPVA 3IC1A 4OYZA 4JBCA 3HSDA 3HCXA 4PQUA 1HPZB 5AE1A 3DCAA 2ZH3A 2KJWA 2RJZA 2MYFA 1ZM4A 2XYHB 2HYIB 1F9HA 5H9EK 1CSJA 2JNJA 4YEAA 4R8UA 1T05A 1K47A 4F4YA 1WHWA 1YTYA 2NUUG 2UUTA 4CT8A 2EEYA 1MMNA 5JJBA 1IUJA 2XG8A 4DLGA 2AWZA 3F0NA 3DGPA 4O3SA 2NR0A 2ZHOA 5KFTA 5CYMA 5I4MA 1VQSA 2ZJRQ 1S48A 2Z8QA 3W5XA 3FZ2A 4OI2A 5I3QA 5I3UA 2CQHA 2DHHA 2ZC4A 3H2LA 1MMDA 4DR1J 2FLPA 4LF7F 3ZFVA 2MXYA 4N76A 1ZA1B 1Y5LB 2W4DA 5LM7E 3TA0A 2NSCA 5HJYA 4A8QA 2HW3A 1AZSA 4BWMA 3Q23A 4QU7A 4XO0A 4L76A 3IWXA 1HWJA 3MXHP 4X64F 3QLHB 3MR5A 4U8YA 1OY9A 5LMUJ 4LBIA 4RBTA 4L3KA 1SJQA 4LR7A 2QA1A 5JXSA 3W65A 1X0FA 1TUWA 4IR1A 3Q8VA 1RZMA 4KH0B 3CB4A 4FZVA 4JV0A 3EZOA 4WZMA 2EC0A 3M6XA 4CNZA 5F8GA 4TU9A 3POTA 4Q8EA 4I6YA 5I3PA 1N5SA 1YLXA 1SH3A 4X4TA 2FLLA 2BM0A 3A8EA 3CMAS 4A8WA 2FLOA 3UCGA 4DR2F 3P49B 3R9LA 1VQLS 1WKLA 2PC6A 1U1QA 1Y7PA 3TA1A 2BX6A 2XHWA 2EI5A 2H51B 1Q81T 4WFYA 4RWXA 4UY85 2RD5C 1Q8BA 4FXWA 3W7BA 2XI2A 2VPYB 2VG5B 3DHWC 1FRXA 1ZZNA 4WTOB 2CJBA 4KGMA 2IAJB 4V19J 4FYDA 1CJTA 3DMJA 1TR0A 1XR6A 5A6WA 3UN3A 4B9TA 2PO4A 1IKYB 1QUPA 4X65J 1IBLJ 1PC5A 1F9FA 2BABA 5F0UA 2CQ3A 2ZBIA 3M05A 2AEJA 1NRKA 4NOHA 4Y2AA 5I42B 1X4DA 2VQEJ 1TK0A 4NXNJ 2CVIA 4P2SA 3EX7B 1VDHA 1G2EA 2W9BA 3EGNA 3P4UB 3FVYA 3M9OB 4ZHRB 1R6YA 5A6PA 2OMOA 1X9MA 3C6TA 1KQSR 2BMBA 2DNOA 3ITHA 5LSOA 2KTQA 2BJ7A 2J9DA 3VVTA 1KTVA 1JLFA 2DT9A 3M8RA 1WC6A 1VQ4S 3JAMU 1REGX 2I8EA 3D66A 3I0SA 2IYIA 4HH1A 4NA3A 4Y2MA 3RB0A 4LFBF 1S1UB 4WIIA 5DZ6A 4OFZA 4DWIA 4CLPA 4N5SA 3FFIA 1HNXF 3ET6A 3ISNC 3VV2B 5B0EA 1QUVA 1VLOA 5D78A 4I68A 3BKTA 2MLYA 2ZDPA 4MKAA 5D4LA 5CYQA 1ZM9A 1N33F 3HULA 4OI6A 4J5OA 4KGVB 4NPOA 3VR1A 2XGQA 1U02A 3CJ8A 4LQ9A 2G2ZA 4ZN3A 2WZ1A 2HQ3A 2N3OA 1BD6A 2IDLA 1QAIA 2BXJA 4TQRA 1ELOA 1NNDA 4A8KA 4NXMF 3CDEA 4F4XA 3DLKA 4GKKJ 5CABA 1XTZA 4NA1A 2BM1A 3K89A 4YS2A 2KH9A 2LEBA 1U0HB 1VBXA 1I5OB 3LAKA 1TL4A 1RAIB 1FWLA 3OD2A 1U47A 1PO6A 3DI6B 1FA0A 2YKNA 1Q0NA 4ES2A 2K3IA 2MQMA 2JDJA 2J7KA 4YDDB 4WKRA 5IWAF 3J7YU 1TU0B 3GE9A 4OYIA 2K8GA 4C11A 4B3RF 3V2UC 2E5JA 2NUHA 2AYMA 1WG1A 5FDLB 1YSJA 5AXMA 3W9HA 2HQDA 5DDPC 3IMQJ 1S6PB 1HBUB 1SJ1A 3CDBA 5K14A 2QA2A 3NWRA 2CPJA 4YN3B 2X1FA 1YWXA 3FEZA 2W7OA 3WC0A 2NYIA 3CCSS 1LNQA 2YH1A 5KT3A 1A9NB 1QAYA 4O44A 1CJVB 3QT6A 4FNHA 3BJYA 1NBEB 1Y3JA 2D74B 5U47A 3QATA 3BR9A 2RUSA 3DXSX 4IG0B 2H4WB 2B9XA 3IM8A 4QBUA 1NEEA 2I1RA 2ZUGA 4ZLJA 4MMOA 2MB0B 2OJ3A 1OSDA 2QLXA 5EN1A 2FJAB 2C2OB 2DNGA 1V3SA 1VCTA 2HBYB 4LRCA 5IT9Y 4FF4A 2JFKA 3GQCA 5J2NA 2QFJA 3H5YA 1F5CA 4NLWA 4ZP9A 5HVFA 4FBTA 1V3ZA 3PDNA 1XERA 2XMJA 4F8RA 4X4RA 2E5LJ 2KI2A 1P9YA 5GAHU 4DL0C 2SXLA 2EW9A 1FERA 2QX0A 2UUBJ 3N6LA 1UVMA 2R7UA 3T5LA 2NCKL 4ZCIA 3G82B 3CJ2A 4QR1A 1UPMB 4U7CA 2KXHA 1RAGB 1RKIA 2Q6CA 2MQQA 1DRZA 2HLUA 5IQQA 3H5XA 1AUDA 1IJEB 3Q8YA 2HHPA 2JRSA 3CJ5A 4FP9A 2GA7A 3ENAA 4DPXA 1FESA 1S72S 1MG7A 2I0XA 2KYXA 3PHEA 5K9FA 5A8RA 3PVXA 2CPYA 4LF1A 3CULA 2C2KB 1MNEA 2CPIA 3ZTRA 1Y11A 4ZPWR 1RCOB 1SIWB 2GJIA 3RBEA 3G2XA 4CNYA 4FYWB 1X8DA 3EJMA 2RAQA 2VOPA 4WYWA 2WTFA 1O6XA 2CJAA 3GFXA 2EPIA 2GMLA 2E1PA 1K8AT 3CW2C 4WXOA 4ZA1A 5ETSA 2ASLA 3R2DJ 3QQCD 2HRUA 7AT1B 3GG0A 1VQ9S 2KXNB 4OV6A 1KVKA 1O0PA 3H42A 2LQ5A 2JSXA 2CIMA 4B3RJ 4OYXA 1FRMA 2KT2A 3OTOF 2R8HA 4DFKA 5ETOA 4USTA 2I38A 2VDIA 2RILA 4UZBA 3K5OA 1SKSA 1DBDA 5FDLA 3V6DB 3UCZP 3T5KA 1QSLA 3HMJG 3JSRA 2QFIA 5LXYA 3DDKA 5J1PA 5IC6B 1PJ6A 2R3VA 4CLUA 2YWHA 1S6OA 2MY8A 5D77A 3Q22A 1QVFR 1GXLA 3SFUA 3V6KA 5LL6d 3PACA 4K2XA 1YK9A 4DFMA 1KN6A 3OR1B 1S0VA 4EZ9A 3HDSA 1IJFB 4RNNA 3PIPQ 3Q2TC 3CTRA 4NRTA 4K2JA 3AA8A 2ZE2A 3MPVA 2ZJPQ 4M5IA 1NDCA 1OYDA 1WKJA 1G3OA 5A8RB 2PI4A 3H8YA 3JTOA 4I56A 1IWGA 2MKYA 2YNGB 2Y1RI 4ECQA 2HFSA 3N6MA 3IRXA 2XO7A 4PQAA 1HBNB 2A10A 5I3UB 4NZ7A 2OIHA 3N9UC 2A6OA 2YNIB 1CQNA 4RW4B 1OY8A 2OPQB 3HD2A 3RAXA 2HSEB 3IR6B 5K8PA 3GTYX 2VA3A 4OV1A 1K0VA 3N79A 4J9VA 3MZIA 4X4OA 1KVJA 2CPFA 2ZOGA 1KD1T 3QGIA 2FYXA 4PAAA 1RT6B 3KHHA 3Q83A 1FFGB 1FRLA 3C19A 1VBYA 2JEIA 1TFYA 2QIFA 2AQ4A 2ZEJA 4GRSA 1B0VA 1LOUA 3K5PA 2W4CA 3B4DA 4PXBA 3H5SA 4GVBA 1T3OA 1RT5A 3G4SS 4JV2A 2GVDA 3R5CA 2E1CA 1TZ0A 2MDAA 2MZTA 2UV8A 3QMQA 2QSWA 4OYPA 4OZ1A 4HHUA 1EB0A 4M5DA 3C2PA 1R0CB 3LP0A 3RB6A 4NLPA 3PKYA 2KFYA 3BSNA 4DFPA 1F1BB 3WZ0A 1IKXB 3HHEA 2V8PA 3SQGA 2BE9B 2EBGA 4QIFA 3HFKA 3QJJA 5LXRA 3T1HF 2B4PA 2ADBA 1MROB 3CDAA 2HBQB 4MKBA 2GVZA 4RR5A 2XSFA 4O23A 1UFKA 3RB4A 1PYTA 3O3LA 5KT2A 4RU9A 3I56S 1LV5A 1FDBA 2NXUA 2QE5A 3IAM9 2KM8C 1EKSA 4ATNA 5KFFA 1N34F 3G6ES 2BJ3A 5D3GA 3C15A 2OD4A 2Y0SD 5AJ3J 4DR3F 3ULHA 1ZAVA 3AJ2A 1NDLA 1R0BG 4URQU 4DQIA 4MJKA 3D6MB 5C2CA 2FJWA 1HNZJ 1F6TA 1ZZFA 3CT9A 3KG0A 1VK3A 4DU8A 1YJUA 2GJFA 4ZPTR 3H4BA 4CM2A 1T3NA 5THWA 3EUNA 2CADA 3TA2A 2W8LA 4WF9Q 1FF2A 2CQIA 2DK2A 4YB6A 1T8EA 2HHHJ 1F2GA 2MEWA 2VICA 4RLEA 3OPKA 3GR1A 4AD6A 3U1NA 3VQTA 5KFJA 3GCWP 2DJWA 2CDRB 2HNYB 4CDIA 2Q3PA 4TYBA 5F8MA 4PYAA 3SDEA 5E3RA 2CKWA 3OJSA 4NXNF 5CZXA 3M2VB 2YKMB 3KHLA 1FK9B 1YZ7A 2UV8G 4OJHA 4OHXA 4KB7A 2W1BA 4ZN1A 1HQUA 1ZS6A 2OPPB 4CI0B 1UPPA 3QIPB 1E6VA 1CULA 2QMUB 4UW2A 3CXCR 5HSPA 2UUAJ 1C4CA 1TL7B 3LPEA 3P8BB 1VRQC 2VASA 2RKIB 4JYAJ 3ZZ0A 3CD7A 4NLSA 2OPQA 4JP8A 2GIFA 1EIYB 4D3HA 1ZBTA 3TRGA 4DF8A 1C0TB 3I9ZA 5DG7A 4DR7J 1N36J 3D6FB 4DSFA 2O66A 3M4XA 4CH0S 1HD0A 1RHRB 5KG3A 4AXJA 4DL3A 2FD2A 3R5AA 1KC8T 1RAHB 2BW7A 1S79A 4JI5J 1IBMJ 3BBBA 1RAEB 2GVZB 3SDEB 1RT1A 2CQ0A 3PEJA 1GMVA 3WDOA 1M5VC 3BGFA 4DPWA 4RNHA 2KFNA 1UFWA 3OFEA 4HT7A 1VC6A 2RE1A 3VAIA 1H2VZ 1LWEB 1OWXA 1U6ZA 2EG1A 3FCVA 1HBOB 3H90A 2GO9A 3PJ9A 4JOUA 3V81A 1LEOA 1T03B 4IOAQ 3BQ2A 1V3RA 1V9OA 2ZM6J 2WW8A 3GILA 4JI4F 1SL2A 3CCVS 2BQRA 3LWLA 2WBRA 3E01A 3MPWA 2VDHA 4LRAA 3M1VB 2AKWB 3PX6A 1I94J 2UXCJ 3BN7A 2B7BB 4NLTA 2IA6A 4CCHA 4NLYA 2BOAA 3GV8B 1S0NA 2HIQA 4ELUA 4DUTA 1QTMA 3AA9A 2NPIA 1YX2A 3B82A 3DLBA 4NEZA 3TJAA 1F3VA 1H6KX 5KFLA 3UFCX 3ZTQA 5EGYA 5F8HA 3N28A 3HVWA 3QFWA 4L72B 5ETTA 2E66A 5BR8J 4DCPB 3K58A 3Q8UA 1NZAA 2FDNA 3AH6A 3EWGA 3SIPB 5L39A 2K7KA 2VBXA 2UZAA 5KTQA 2HFVA 2DBBA 3D0HE 2R7TA 4DPTA 4MTPA 4P9SA 2HNZA 3M8ZA 4IG3B 2YPYA 5G0RA 3R5DA 3ZO7A 3TWZA 2DNNA 2PMWA 1L3KA 1LW2B 1Z1ZA 3LP0B 3DRRA 1WSRA 3G86A 5AXLA 2YX7A 2EFVA 3TOQA 1VC5A 1HNWJ 3SMZA 2LQJA 4WIQA 1XMQF 1U4BA 1NUEA 4ZVHA 3LGHA 1H98A 1WI8A 2LECA 3TANA 2OP5A 5JVHQ 2IRUA 4IG0A 3PR5B 1L3TA 1XEZA 2OAUA 1TKXB 4WXWA 3GJRB 5T41A 1RP5A 3AXKA 2O3DA 3DU6A 4C0BA 1N32J 3GJTB 4OHYA 1EQ0A 5DLGA 1QDUB 1YJWS 2JH3A 2VFTA 1IR2A 1FO1A 4LREA 3SXLA 5B09A 1S6QB 4C0HA 3T9ZA 1CC7A 1WKKA 4OQJA 4UUXA 1GMWD 3GYNA 3ETMA 3BGRA 4C4WA 3SCIE 5D0GA 3AOCA 3IBFB 1F3FA 3TJ8A 2MZQA 4CWBA 3MR7A 2XM3A 2C2MB 1U8WA 3Q8QB 2ZBPA 1OYEA 2ZH8A 2YQ0A 1H38A 2UU9F 1BLUA 5L9XA 4RBUA 1EKRA 3GZ7A 4F04B 4DR4F 3NMRA 1BE4A 1NU4A 3CDWA 2ZD1B 2VUGA 4F3QA 5HMXA 1REVB 1UVIA 2CQ2A 2RRNA 5DM6Q 2BR0A 1RWNB 3RAMA 1U0HA 1TUGB 1X5OA 1RWXB 5KG2A 2XS7A 5KFUA 2XSJA 2MZSA 3C6UB 3D0GE 2HVZA 2YWFA 3SV3A 2M70A 3M2UB 4LSZB 3M2UA 4IFYA 3KJVA 2DGWA 2VPWB 3I5BA 3PW4A 2ACMA 1JJ4A 4B3TJ 2BJEA 2LA4A 4KGKA 5F8IA 2FJVA 2K06A 2QLJB 1DHMA 3FKBA 3DLGB 3WX8A 4ANCA 4DFJA 2I5JA 1Q95G 3V4IB 4B9UA 4K4VA 4A8SA 4RNFA 3KLHA 1B0TA 4FF2A 3T6JA 4URSA 4YB1P 2E9ZA 3LPYA 1TKTA 2E7XA 1C0TA 3MUMP 2UVWA 5KT5A 3W62A 3S6EA 1YJNS 3FRZA 3J7AN 3N0VA 1N34J 4FVCA 2G13A 5IOLA 3DHXA 3NNCA 1IN0A 5CQGA 4ZVUB 2DXDA 4IUFA 1WJ9A 1X60A 2BKNA 1QLNA 3QZ7A 1VQPS 3CJ0A 2XZDB 4KO0B 4ZVTB 1IXKA 5L8RC 1D8YA 1RT2A 4EGLA 1VRUA 4LSLB 1SQEA 5CCLA 1X5PA 4WKYA 2QJ3A 2OTLS 4B9NA 4GKJJ 3FUYA 4J9LA 4DOZA 4LF2A 4K5SA 1P8GA 3KLFA 3C3LA 2UXDJ 3MAAB 1WHVA 2MQPA 4KSEB 1ZAWA 3ENQA 2BRLA 3L09A 3R27A 2B9WA 3RZAA 4OYBA 5DG9A 2LDYA 3QZ8A 3IR7B 3IM9A 2JEFA 5IM0A 3LGMA 2OPRB 3B8HA 5D15A 4DL7A 4WWSA 1T9YA 2B43A 1APSA 2WBMA 3M6VA 1ZM2A 3LO3A 4JV1A 1HI8A 4QR0A 1RHUB 2HVEA 3R8YA 2R8IA 3OHAA 3GIJA 1S6PA 3GYXB 4D3GA 3MEKA 2LVWA 1DY3A 1ZA2B 3TR5A 1HNVA 4LVOP 1S1TB 2PSZA 3NEKA 2F5GA 2XZTB 4ZS6A 3CIMA 3ETOA 5L1IA 1NHVA 2OPSA 3GLJA 4EYHB 3FEYB 5CHCB 2G4BA 2WSCC 1VOMA 1RWUA 1RSCA 1IKWA 2DIVA 2QLWA 3E01B 3MM6A 3TW0A 1BWEA 2RB7A 3ICLA 3EPIA 1TMJA 3GSIA 4CO4A 2IYGA 4Q2MA 4DQSA 3UVJA 3CGIA 2EFQA 1TV6A 2KG1A 5C25A 3ONQA 2C3PA 2FC8A 2GX8A 2O01C 3NGKA 2DY1A 4PR6A 3A4TA 1HKAA 5KFNA 2F40A 3V81B 1NK6A 2AEFA 2CZ4A 2V0NA 1WF0A 3ADAC 4NCGA 4PZVA 3VGUA 2AF6A 2DTJA 1AW0A 3PYDA 4ZJLA 3A1YG 2KT5A 2ROEA 2ZBQA 3MM8A 1TK8A 1MWQA 4I1TA 1P6TA 3I0RA 2DCUB 3JSMB 1FJGJ 1R8PA 1SXLA 3CVKA 1T0TV 3SYZA 2PFDA 3MM5B 3SZ2A 1T9TA 2AV5A 1NPPA 2DKOB 2DXEA 3BREA 4OLPA 1IQZA 3OT9A 3JXOA 4ED8A 1RCXB 2A1BA 2B5JB 5H1SV 3AJ1A 1T94A 2IA0A 5KT4A 4QYZK 4PG4A 1YG0A 4WK1A 4JI0J 2PGCA 3UD5A 3UR0A 5KG0A 1HPZA 3OUYA 4CH7A 3T9NA 1W2IA 1KOHA 3OQ2A 1AT1B 4ZVFA 2PA8D 3GONA 3QO9B 2VG7B 4Y34A 2XY7A 1M0SA 4Q7AA 4KV8A 3BQ0A 1HBMB 5BYSA 2JVOA 3IG1B 4M5GA 2YXLA 2ZJQQ 1W2BR 1XMOF 4O0NA 5LOQA 4BCAA 2JC1A 3NGSA 4EYIB 1URRA 4O4GA 4C8NA 3FMBA 3QWUA 3UDCA 2C28A 3JQJA 4ZMMA 3EGWB 3KLEA 2EXUA 1EZZB 1Q4RA 5HLFA 3RGIA 1WUUA 2K3KA 1B3TA 4W92B 3F56A 2XCPA 2B3TB 3M30A 4CLTA 2RDIA 5KFBA 1FI4A 3HK2A 4OZLA 1JLEB 4DN9A 3OBIA 4Z37A 4K4WA 4AE5A 4U67Q 3QFHA 1JNZB 4USJC 3M1VA 4W98A 2CWKA 3R2CJ 4FNIA 3K7RA 3VGTA 5CAAA 2H1YA 3V4MA 2VIHA 1FXDA 4NMLA 2GQ2A 4U8VA 2MKJA 2RIJA 4AQYF 5C25B 1RA7A 2WONB 2X1BA 2DNHA 1UEKA 3PCOB 4I64A 4LRBA 4I7FA 4DV1J 2UUAF 1JJHA 1MU2A 5IWAJ 4ED7A 1NB7A 4Q5VA 4DR6J 1MN9A 1RT5B 1PIEA 1QAXA 2VG6B 3RYLA 1D09B 2WK4A 2VBWA 1KLMA 2ZH7A 3DN9A 3P5TL 3UNGC 9ATCB 3T1YJ 3M30B 2BZ2A 3FBFA 1S97A 2BDPA 4YOEA 4L73A 1UKUA 2OMLA 4A4JA 2M88A 3G96A 2DR9A 4G1QA 2D41A 3A3OB 3U1MA 4QWAA 5HP1B 2N82B 4KR0B 1TMMA 3R6GB 1WWHA 2DR8A 4DPYA 1S99A 1LKZA 1NK4A 1VISA 1NH8A 1RTDA 2BOPA 4M8LA 4EZ6A 1NDKA 5F41A 1J2VA 3RW7A 5B08A 2AP6A 2FGOA 4MYUA 3FK4A 2L41A 3HPOA 4ZLLA 3BBCA 4J9PA 5KFSA 1OY6A 3LQVA 1TTHB 3CCES 2IMWP 2H5JB 3ZZZA 2F9JA 1NHKL 2A6MA 3HVRA 3QT8A 3OUYB 2KXFA 3EZUA 2ZH4A 4DSEA 1Y00A 3PX4A 1PGZA 1JJ2R 1N5TA 1DFDA 4UTGA 5LJ3Y 4DUZF 1JNRB 4O3NA 5L1KA 1NKCA 1TKZA 2DGOA 2R7SA 5HVGA 2FJBB 4E2FB 1S49A 1WEYA 4DU7A 4JUZA 4MH8A 3R7NB 5KFRA 4QW9A 2AJ2A 4HEA9 2YKOA 3EVOA 2MQNA 2PI5A 3BM7A 3MMAA 3SQOP 4G1PA 2RQKA 3TYTA 2BQUA 3G87A 4ECUA 4G65A 3CUNA 3GSDA 1VQ8S 3KYLA 3PFEA 4BC9A 1UVKA 2F9DA 4BBYA 1JLAA 1KLNA 3KK3A 1UJ4A 4GC7A 1HMVA 3CC2S 3OFFA 4DN0A 3VQSA 1S57A 2AJ4A 2HQGA 2ALYB 5A8KB 5KAKA 1OPIA 5L46A 4B3SJ 1XWLA 1Z2LA 2EC2A 3PEHA 1NKEA 3T1AA 4PWWA 4RU2A 4M95A 1N48A 4R0EA 2NYHA 4M5HA 5KG5A 4L74A 1EJ7L 1UWAA 4ITSA 3TVKA 3MR2A 2VC0A 4FDFA 3Q86A 4EK2A 2JEGA 3C14B 3HI9A 1TV6B 1YDLA 3KG1A 2XSJB 4JI0F 3E2EA 2BYCA 5J1EB 4ZOSA 3GG1A 3W9JA 4A46A 1Q8IA 2LKZA 4ZVEA 1U1KA 4GVBB 2HLTA 3QWPA 3VAJA 1HR0J 5K8NA 2LQ8A 3K8WA 1NDPA 4DV0J 3NGTA 3FFIB 1U1NA 1BMQB 4Q8FA 2HNZB 2R9LA 2AEMA 5B7WA 3G8TA 1CJKA 2DNLA 3M7VA 3NS7B 1T95A 3EXYA 4M5NA 5BXIA 1Q7YT 3I0SB 2EK6A 2AYBA 3FQKA 1K1QA 4FVMA 4P71A 2U2FA 2MY7A 3TZWA 2KZZA 1OQ6A 3PRDA 4IQMA 3TZXA 2Q1LA 4OZ3A 2CJKA 3AFGA 1NB2A 2AGPA 2B8PA 2C42A 2ZOFA 4O3QA 2DR5A 4LFCF 3MEGB 1AXQA 2D3OR 5J1EA 2B4VA 2DD8S 3SCKE 2RQCA 2NLWA 4GKJF 4MT1A 3W2WA 2Z56B 5KFQA 5D8HB 2AYEA 2XMMA 3BB5A 2IVFB 2X1AA 1CG2A 2RQMA 2G9OA 4KO0A 4NLQA 4OIXA 3S01A 4B17A 1S59A 3A8JA 4H4MA 5A8KA 4Q0BB 5CYJA 3T1HJ 1QE1B 5F3ZA 4MIAA 3GIRA 1XNQJ 4WU2A 2FJXA 1PJ5A 5JVGQ 3CCUS 2RH3A 3H98A 2J76E 5GAEU 2F63A 1H73A 4Z7YA 2DNPA 3MGJA 1IBCB 1TKDA 2AJFE 2XULA 2YKNB 2P2CB 3BSCA 4DV5F 4PXCA 3GIMA 2HS0A 3PZPA 3DM2B 3KJQB 2LDIA 2AGQA 1S76D 1CQMA 2ZBRA 1LXJA 4YY3F 3HXMA 3AY0A 2IJRA 1KWMA 1VQOS 1PBUA 4DR5J 4JI3F 3HKZD 2H4YB 1Q5YA 1G7CB 5CD4H 2V63A 1X5SA 3CNQP 4J9SA 3HZEA 2XMAA 2GCFA 5B0FA 4I69A 1BQNA 4K0KF 3T5HA 2ZUAA 2QL5B 4MK8A 3G8SA 3AJDA 1XNRF 4OYAA 4Y3CA 4PXEA 4DPUA 2J9DE 5ETRA 3JSYA 3MWBA 6FD1A 3BO2A 4ECXA 4PEOA 4ED1A 2J6SA 4DSJA 2IMOA 3BGRB 5F0WA 2ERRA 2RKIA 4N8OA 1X4EA 2XYPB 5K20B 2B7CB 2OHDA 1WDTA 4K5RA 1N32F 3QT5A 4DV7J 1S9EA 1GT8A 3ITHB 5LMUF 2IY5B 3MR6A 4C8ZA 1YJ9S 2HHSA 4GO7X 4U7UD 2G1DA 3J7YI 1I3OB 2C22A 1NSKL 1RK8A 2F4VJ 2DVIA 4DV1F 3MCMA 1JX4A 1H72C 1FVQA 2B51A 2EFOA 5FIIA 1MU2B 2HGLA 5HK4A 5KFEA 3EPGA 4WFXA 5J2MA 5B0GA 3PO5A 5KFKA 4OX9F 5D0EA 4LF5J 5A76A 2M7SA 1SC4B 1P1LA 3EMTA 1VR6A 3M9MB 2F4FA 1JLGA 1WD6A 2FZKB 3AAWB 4XPCA 4JI8J 2HHXA 2OPSB 3O1LA 2FB0A 2MSTA 3FGVA 3KDOA 5ETNA 4LMZA 4G3IA 2DGTA 4K4UA 3M2RB 1UWBA 3DOKA 1UWBB 1KNZA 4HACA 5E33A 1WNEA 3VAHA 4NZ0A 1RHMB 4RUCA 2FZCB 1ULRA 4O4GB 5IV4A 3KLEB 1X9SA 2IM2A 4I6WA 2JZ5A 4RNOA 2VBZA 5EDWA 2D3O1 3BR8A 4P72A 1GK8A 1P1TA 2RF2A 3POTB 4F7VA 2XO6A 4OZNA 2UVVA 2IC3B 2R7VA 5DG8A 1DJ0A 1LWFB 1RUSA 4KIAA 1EETA 4MIWA 4RUHA 1M90T 3EM1A 3PY8A 4HT5A 1BUXA 2V5HG 3PM9A 3QO9A 1VQKS 4LF6J 1S9GA 5D6GA 4FXVA 4I2QB 4I2QA 4ILLA 3I96A 3DRSB 4AXIA 3J81j 1M5OC 4H54A 3KLGB 1VJWA 2ADCA 3MCSA 1D9FA 3K5LA 1IWAA 1TAUA 3CSKA 2ZKTA 3UW1A 2DGXA 2HQFA 3IFEA 2IM3A 3SSRA 2UXDF 3KMQA 1YJ7A 1U26A 2MQLA 3MM5A 2EVZA 4BC7A 4F3MA 3K57A 2OTJS 1Q53A 1RKJA 4X4QA 4FBUA 3W2VB 4M5KA 2B0GA 3TEGA 2AX1A 4K59A 3QGGA 4G6VB 1RDRA 3ZTSA 2ZH2A 1FE4A 2VHGA 2YNFB 3AD8C 3UD4P 1JK9B 1FRIA 1T02A 3QIPA 2DHXA 3IRXB 1KP6A 4A8XA 1FD8A 2XS5A 1GMWA 4NMXA 4R25A 2VFVA 4LRFA 2HFZA 4OI3A 4ZVOB 3K17A 3OLAA 1LK7A 3RRKA 4H4MB 3KLGA 4GKKF 3B54A 2LXIA 2NXJA 2V34A 5LJ5Y 3Q89A 1T9VA 2HFOA 4DQRA 1LW0A 1OSCA 2VPZB 5GAEI 2L9DA 2KB2A 2YWKA 3M8PA 2QA4S 5CD4A 4WTYA 1U2CA 3W2WB 1UMJA 4ED3A 4M5DB 1LWFA 4ELVA 5I42A 4ZVSB 3WX4A 1KFDA 4CO3A 4CLZA 3UDEA 4XDCA 3OFGA 1RHJB 2R4FA 4CRJA 2ZKUA 1S6UA 2IRXA 2V8DA 3BZQA 3FC9A 1HNZF 3VF0B 4N41A 4I4BA 4O0IA 1JXVA 1S9FA 1HW9A 8ATCB 3CD6S 1EHWA 5HL7Q 2OI2A 3M2RA 2R7RA 3G82A 2AGOA 2AMCB 5KFWA 1V5VA 1XK8A 4DR4J 3VAKA 2YWGA 3ZNUA 1NMEB 3LA0A 4CLKA 5GAGU 4LFAF 4DQQA 2FVSA 4UY8T 4DI6A 1H74A 5RUBA 4QR2A 4K7QA 1MSWD 4B3TF 4DR5F 5KT7A 2W2PP 1RWWB 1DTQA 1S1WB 3SBMA 2MQOA 2B9YA 3CCMS 2DRBA 2HQCA 1ZETA 3X3UA 4I0WA 3HO1A 2CPDA 1VMBA 2QSFA 3Q8RB 4OHWA 4CO5A 1GFWB 3GFYA 3MAAA 1VYAA 2EFNA 5D4OA 5GADI 2KRBA 3M8QB 1X7VA 2VJUA 3OW2R 3PYFA 4ILRA 2IIHA 3QPIA 1FDAA 2NREA 4J37A 2V94A 3QRQA 1UW9A 5KFHA 1M1KT 3DOLB 4O44B 1X4BA 2CA9A 2RMLA 3AODA 2IM0A 3MMCA 5E3QA 5KG1A 1UW4A 4L75A 4B3SF 4HI2A 2RS8A 3BGUA 5DO2A 5J2QB 2Q66A 1HFEL 1J5EF 1RTIA 3ENWA 2VB6A 1HW8A 4C3LA 3P6YC 1R7IA 3T6BA 1RACB 2GIRA 4WJBA 1C4AA 2XMWA 1WC1A 1VQYA 3TP2A 4XAKA 5E3AA 1FFSB 2HK3A 3AOAA 2GQCA 3AT1B 3VCDA 4KGZB 2I5JB 2E44A 1C0UB 2YY3A 4NL5A 1GAOA 5HBMA 4RWWA 2HZAA 2IPOB 4USUA 4ENOA 4Z7CA 4ED6A 2ASJA 2DCLA 1PSDA 4N47A 2HZCA 1NJXA 2DEJA 3RG6A 2BA9A 3IGNA 3NGUA 1N0VC 4BS2A 2ZH9A 4DCJB 2HK2A 1GX5A 1FT8A 2DISA 3HHKA 3H0PA 3D28A 1GMUA 4KPYA 2YNHA 5FD1A 5B0CA 4RW9A 2OFHX 4URGA 4J7CA 3TJ9A 4ZVQB 1JLAB 4N56A 5KFZA 5KFAA 5HANA 4BHQA 3QJLA 1LQ9A 3CCJS 1DLOB 4YDXA 2DNYA 5AT1B 1SUQB 3MECB 1MLAA 3QNWB 2AT1B 3BS9A 4EBEA 2C2ZB 3ZZRA 4FYYB 3SCJE 2KKHA 3ELHA 2Z2YB 4QIEA 3KDNA 2BJ9A 2M5YA 4C98A 2CQ1A 3FSXA 4LF6F 2F4VF 2VZ9A 2MKHA 1U6BA 4DXLA 1JLFB 1H7WA 2Y0BB 3I82A 2CVEA 4UQTA 1JIHA 4NYZA 3CC4S 1BHNA 1P27B 1HHTP 3V5RA 2A3JA 1HWLA 3M2VA 4BLGA 3QBCA 5ETMA 3TVZA 4LFBJ 4DS4A 1DQ9A 5IT9U 4RW8A 2UUCJ 4ECZA 3H25A 4DSIA 2B6AA 3KOAA 1XJWB 1T11A 2XI3A 4DF4A 4IRCA 1BXNA 2LLZA 2XYGB 2ILYA 3HF5A 1UJ5A 5CYQB 1DTTB 2OEJA 3AD7C 3KLIB 3NRBA 2OKQA 2NSBA 5HMYA 3J80Y 3GMGA 1UTAA 4DMZA 3IN5A 5D0HA 3F73A 2QO3A 3TI0A 1FDDA 1Y0HA 3TUPA 2PFFB 4YHHJ 3TEHB 4MAKA 2P9CA 5DGBA 4IR9A 3V6HA 4HHJA 2W2MP 2YVSA 2QL9B 2ZDOA 4TN2A 2DNRA 4ES3A 1XMOJ 4ZKAA 4QW8A 1PC4A 2F7VA 4B08A 5E7OB 4CP5A 3EXCX 2FVQA 2IBKA 3J7A1 4XPEA 5KFCA 2LYVA 3N4WA 5HO4A 4IO9Q 3DRXA 4B3OB 2HQIA 2A0FB 3BN4A 3QRPA 2ZC3A 2E7WA 1KLMB 2V2VA 3G6VA 3EYZA 2C2RA 2YNHB 1JB0C 4LBPA 3SQGB 1PKUA 5E3CA 3PYEA 4M1KA 5E3PA 3GR0A 3CJTA 2WONA 4ZLPA 4HKQA 2ZFHA 1AROP 2CRLA 3RTVA 1LW0B 1SV5B 2B56A 4JI4J 2X3DA 5B0BA 4FS2A 2E9RX 3EICA 3MMJA 1NLKL 2WB1D 2V67A 4RW6B 4PUOB 1RT1B 4C8OA 3DOMB 1U1OA 2OD6A 3EE3A 3H2UB 3UR3C 3HHLB 3LANA 4X66J 2ZH1A 4J9OA 5K14B 4ECSA 4ED5A 3MUVP 1YBTA 4QWEA 4TKTA 2VODA 4LF8J 3UQSA 5HP1A 1JMTA 1NH7A 2V9KA 5J2PB 1SKUB 5CH7B 2V4QA 1RT4A 4EUVA 1UZDA 1I94F 2UXCF 2GNKA 2ZOMA 1B0PA 4QWCA 1KR4A 3MD3A 2IRYA 4P7TA 2DO4A 4P10A 1CLFA 4OX8A 1KSPA 2QV6A 4KV8B 1KDNA 1NJIT 4K8RA 4FPRA 4XK8C 4DV6F 1G6BA 1FK9A 2FY8A 5AE2A 3PW2A 3I6PA 2VG6A 2VQEF 1YJRA 4AL6A 1WDDA 4XIUA 2FUG9 4WFBQ 4A8FA 3MEDB 2DO0A 3OSNA 4JI7F 2IFXA 5J2QA 2MZ1A 1I1GA 3OXGA 3Q8SB 3H20A 2RDDA 2VA2A 2AD9A 2XNQA 2ZBCA 1YI2S 1UEVA 2IC3A 2Z30B 5EWEA 3HP6A 5HVHA 4PUOA 2Z57B 2KYZA 2P9EA 3MD1A 4IG3A 1RGVA 5G0RB 1S12A 4CT9A 4JV5J 3THTA 4KHPJ 5GMEA 4IOCQ 3OTEA 1QTNB 4ZPVR 4CTAB 4WCEQ 2DPJA 3M6UA 4ZVRB 3JQMA 4JB8B 1JQGA 5GMKa 5D3GB 1VLYA 4QZVB 1HD1A 2GJ2A 3C15B 3DGPB 1AFJA 1HIYA 2XNRA 2R8JA 1RJJA 4X2BA 2FVPA 4V19X 4K4YA 2N4CA 2HNDA 1H2TZ 1OJ4A 4RW6A 3BV8A 4QJVA 4ZCLA 1JLBA 1OQ3A 3LF0A 3P45B 4YR0A 4TQSA 4JI3J 3OTOJ 2MHEA 2VD3A 4EO8A 4PQUB 5KFGA 4M5MA 3W9IA 4I67A 2YKAA 1Q86T 2NZ4A 4JI6F 4DV5J 1XNRJ 3KJNB 1SPBP 2XMKA 1CVJA 4X64J 1Z4UA 2DY9A 2F8HA 3AQPA 1L5UA 2X3GA 3F44A 3EGZA 3BPDA 4UT4A 1S7IA 3RJMB 1F5BA 5CXTA 4DV2J 1N5QA 4DL5A 2J8SA 1UAWA 2J8AA 3TAMA 1VK8A 1LWCA 2XQCA 1WOOA 4AL7A 1SJ3P 4UQGA 2J0SD 2GQQA 1GXTA 1FRKA 1Q7LB 2CNLB 2FVCA 2DGSA 4NRUA 4DX6A 3BO3A 3OL8A 4OYWA 2HMIB 3FNNA 4DV6J 3W8GA 3IWNC 2QYCA 3RUBL 5J2PA 1CPZA 1VI7A 1XN9A 1NJZA 1TL7A 2CYYA 5A2QY 3AD9C 2V68A 2WVFA 1NKBA 3HVAA 3PNIA 4LSNA 5C7PA 3MM8B 1SJFA 1AFIA 4TVAB 3THVA 3BPSP 4WE1A 5KOXA 1QM9A 4PKDB 1YBAA 1M5SA 2DR7A 1BQNB 1S0MA 4Y2CA 4F4ZA 3QGHA 2FHJD 2DIUA 4UZCA 4UOCA 2M52A 2OEKA 4RW8B 5IT4A 1VQ7S 2Y1LB 2ZWPA 5B0DA 2FPHX 4H4KC 3RRHA 5K8MA 2D9PA 1WORA 2OUGA 1YRTA 5AJ3F 3MR3A 2W8KA 1W25A 2E7VA 1S4EA 5DLFA 4N8NA 4QYZJ 1FJ7A 1HI1A 2CG8A 2LFVA 4CO2A 3ISND 4YP3A 2BQ3A 3RRGA 3J80U 5ETPA 4NE9C 1ZTWA 2MLXA 4C3KA 2PDAA 4AYBD 3GV7B 1VIOA 3K2YA 3HKWA 1TKTB 2L48A 3BSOA 1L3SA 3VZHA 1DAXA 4MYTA 2FZGB 3ZZOA 1XIQA 4WBFA 5DDRC 3ILOA 1R3NA 3HT3A 2HRYA 3KFWX 3A8IA 4Y00A 4CLWA 4X84A 1QSSA 3KHRA 3JTPA 3MMCB 4ZDNA 3BDPA 2KFZA 1RA6A 2ACYA 3K8VA 1HNWF 1Q16B 2XLIA 3MHYA 2HHWA 2XHCA 2IM1A 1E6YA 2XMVA 1IKXA 4JI2J 2R8KA 2R2TA 1J5OA 4X66F 4DG1A 4O3OA 5E5NA 4RUAA 4ES1A 1C2PA 2XBPA 4KBIA 1GTHA 3MM6B 3PXGa 2E1MC 1FEEA 4PWDA 3NP5A 4FKXA 3TNVA 3IGVA 1Q8KA 4NI2A 4P2XA 4TU8A 3S8SA 3I55S 4ANEA 3FQLA 2F8MA 4TY9A 3OVSA 4OI0A 1JWWA 3R5BA 4K4TA 4DQPA 4JI5F 3CCWA 1RTIB 5IV3A 4Q44A 4IFVB 2YKPA 4HI1A 1GX6A 3KNGA 4YQWA 3L7OA 3CJKA 1IM4A 1N6QA 5IT0A 3K5MA 2CPZA 1ZTTA 1Y10A 3NG8A 3QSIA 1X9WA 1R8HA 1WTBA 1A0OB 2J6TA 2CPHA 2ABYA 4ZPDA 2RT3A 3FSYA 1S5ZA 4AUKA 2RVJA 4USWA 4EEYA 4JI1F 4LF4J 2EBEA 2PMHA 1N5YA 3BF4A 5DQGA 1A7GE 2OFGX 2X51A 5IC4B 5DETA 2DHAA 3C8YA 4ZPBA 3LH2S 2U1AA 2YX4A 3PTWA 2IVYA 3HFZB 4IFYB 4Y6IA 1WELA 1WOPA 4X4SA 1S1WA 4R0JA 3KJVB 4F2RA 1I6JA 2JL9A 3L95X 4UOGA 4ELTA 2WAQD 2J9EA 3CO9A 1T7PA 3NL0A 1NSPA 3FMWA 1S1VA 1EP4A 2ILZA 4J9UE 4P75A 1B70B 3W5ZA 2NZCA 3DM2A 5EX3A 2CNKB 2VG5A 2HVDA 3PKMA 3VGSA 1RI7A 1LFWA 2KHDA 3AOBA 3MMBA 4ZP7A 2V50A 3OTDA 3VVUA 4AFFA 2A2CA 1ROFA 2EG2A 2XZWA 3L7UA 1IKVA 3DDIA 3TX8A 4F2SA 3IWLA 4IQXA 1FKPB 4CZCA 4WK3A 2GIQA 2H9ZA 1RTZA 2HHQA 5M2RA 5CCMA 1KHWA 2PN6A 3ZC4A 5EX0A 3MM9A 3R3TA 1HLWA 2O1PA 1HQUB 2OPPA 3HFVA 5DQIA 4O3PA 1U45A 2FLNA 2XB2D 2GHWA 2V2QA 1UL3A 4V1Ak 2VQFF 4JI6J 1RTDB 4IH6A 4NLUA 5HQLA 5LMNF 3VTIA 5HMWA 2JLGA 3CCRS 4WFAQ 2DNZA 2WRMA 2E5IA 3B6BA 3HVTB 5HAOA 4EBCA 1R0AA 1S9GB 3CE8A 1IQTA 3GP9A 3LTOA 2Y1IA 1LXNA 2CQDA 3RBZA 4DSKA 1LW2A 2BBEA 3K5NA 4B3MF 3HZGA 2XTJP 3L9ZA 2PIIA 4A8MP 4DCOB 4X4VA 3KLVA 4LSNB 3QJPA 1KVIA 2JLEA 3P96A 1NK7A 4B9MA 1NSAA 3AB4B 3ZTPA 1N52B 3D1OA 4CM0A 5SZTA 3JQKA 2HHUA 1FNOA 2HURA 1DZ5A 2OLWA 4F0KA 2OEMA 3KMSA 4KH1B 3MAHA 2JJ4D 3QAUA 3ZTOA 3M9NB 3BYPA 1NK8A 2V8VA 5D0RA 5ADZA 1W26A 2FC9A 3JYTB 2CAJA 5F8NA 2ZZMA 2D9OA 1C1BA 4EMDA 2F8EX 2VFRA 4I6AA 3GV5B 4E8UA 1FX4A 2DR6A 3O5TB 3U7JA 3NS6A 4F4AA 1UETA 2HNYA 3C16B 1HQEA 4YUDA 1MN7A 2Y9HA 2QEXS 1IBKF 2MGZB 4I7FB 5ETVA 1RAFB 3O44A 1K1SA 3M8PB 4ECYA 1T9XA 2J9CA 2R2RA 4HLBA 1FJGF 2LEPA 4OJ1A 2GHVC 5C42B 4DV4J 1X4AA 1XQIA 4ER8A 3ZZYA 4CLLA 2VQFJ 3T5JA 2HHHF 4X4NA 4QIGA 4KFBB 2R8GA 1YKWA 1GEHA 1R8CA 2W2NP 1UA1A 4DV3F 3CJRA 4TLQA 1RAOA 2CFXA 3GYGA 2HAFA 2IBOA 3I32A 2F65A 4CQ1A 2JHEA 2J7WA 4DR2J 3OTBA 2ATLA 1RT7A 4HDHA 2XMTA 3E51A 2FHMA 2J7UA 4PG5A 4QQBA 3RAQA 4LF7J 3GIKA 5EWFA 3MEEA 5F8LA 4ALZA 1Q8LA 4TY8A 1EAYC 1UP1A 1WEXA 2ZNZA 4QPTA 1R8BA 1EQMA 4K4ZA 5F3TA 1RTHB 3DI6A 4S0MA 2NPFA 3U02A 5B0AA 4RUBA 4USKA 5GAHI 3Q2SC 1CS4A 1TVRB 2PT0A 3ILIA 2XGPA 3T3FA 1D9DA 1ZOTA 4ERDA 1KQGB 1FNMA 2DH9A 2ALZA 4ZVPB 1WOSA 3CCLS 2BANB 1N4LA 1AB8A 4KHMA 3RR7A 1KQFB 3MM7A 4J9RA 1PG5B 3TUIC 1IM6A 2PD1A 4U6PA 4KTQA 2VKZG 3M8SA 1S9EB 3VAGA 3HHNB 1C1CB 2JVRA 1N5VA 2DRDA 1YRUA 1MWYA 2DXFA 5A0YA 5DDOC 1H2UX 2G0CA 4DX5A 4ZITA 3OHBA 2ASYA 3D5MA 4OZ0A 2M2BA 4NA2A 4NCBA 4NASA 4R5PA 1OS5A 2MMYA 1Q78A 2YNGA 3DOMA 3JS9A 2MLZA 3HHLA 3FCHA 3DLGA 3GB0A 1T05B 3CDUA 4NLVA 1S1VB 5MLCV 3OSPA 3NBPB 4X62F 3DRSA 1QSYA 2JLFA 5JMNA 2XY6A 4OHZA 2RNEA 4Z2XA 1SV5A 2HWIA 1X5TA 4TNOA 4HL9A 2CUYA 1BQXA 2UU9J 4F0MA 1D0EA 2VONA 2GGPA 4PYDA 4OZ5A 3TZZA 3RW6A 1CS4B 1R31A 1TVRA 2OSQA 3L7PA 3S1TA 5KFIA 3JTNA 2V4RA 4KJIA 1KONA 4IOBA 1RLCL 4I2PB 2BE2A 2JX2A 1NK0A 2GMHA 3W3SA 5CA5A 4OJ3A 5MAOA 4ILMA 1FKOA 1MMLA 2BKPA 2FGCA 4PABA 2M8HA 2DEIA 1JLEA 2DNKA 2AJ0A 2KDOA 1NHUA 1Q1KA 2B8QA 2H54B 3MOZA 1YITS 5EHHA 2G0JA 4LRDA 3A12A 1YJTA 1T9UA 3VGVA 2EKYA 3H40A 1VC0A 2XLKA 4OZ2A 2FVRA 2YNIA 5LMNJ 1SJ4P 1SL0A 1MROA 4RX6A 3I4HX 1SIZA 2E5HA 5IM0B 3D67A 1I51B 1UEUA 1J27A 3M32A 4IDKB 3NY0A 4NI2B 3UDVA 2K1RA 2YBVA 3ZZPA 1EX8A 4AL5A 4LT6A 1FRJA 1TL1A 1VGYA 2XWXA 1JLCA 1RBLA 2UUCF 3QIDA 1PILA 2Y1JA 2B6AB 1UJ6A 3CF5Q 3M8WA 3ILLA 1A6LA 3HVTA 4OZJA 3MCOA 4MK7A 3W5YA 1KEKA 4NXMJ 2N7YA 5HMZA 1SC3B 4LSLA 3RU0A 1C1BB 3G71S 3SFGA 4DZ6A 4YY3J 2M9KA 1AZSB 1QAJA 3GCXP 1B64A 1O51A 2HWTA 1VRUB 1U6FA 1YJVA 2AZ1A 2Q79A 2D7SA 2R7OA 2Z2ZA 4GVLA 4WFNQ 2DH8A 5E41A 3JYTA 1YHQS 3UPFA 4LF8F 1FWPA 5C2GA 4DS5A 4C3MA 1ITPA 2QYGA 4ETZA 2UUWA 3DLEB 2KO1A 2QN6B 4Y2IA 1ICEB 3F41A 3UE2A 1KQKA 3KK1B 1VJQA 1O8BA 5HROA 1OIAA 3PFOA 2WSFC 4JYAF 1F5AA 2JFDA 1TL3A 1YGYA 4HTJA 3CCZA 3TVYA 2DPIA 2HWHA 4A47A 5CZVA 1XMQJ 4U96A 3IS9A 5F8JA 3BGOP 5J2NB 4I2PA 3MFHA 4KC5A 1U1PA 4RW9B 4X62J 1FTRA 2QC3A 3EVMA 1DQ8A 2NXNA 1VHIA 5E0OA 1U48A 4LFCJ 2MJNA 3A8KA 4DG1B 3I9V9 1R0AB 3DLKB 1LFPA 5DM7Q 5EWGA 4HDGA 3DGVA 1S1XB 1PBAA 1S1XA 2C3UA 3LALA 4RKUC 4ANDA 1RB0A 3BQ1A 1CJVA 2AX0A 2CQPA 5FJ4A 3HM9A 5HQ8A 4P6QA 4CYUB 1JXEA 4LFAJ 4E0DA 2E5LF 4WE1B 4F4WA 3I5AA 2BE7D 3TAQA 2AJQA 3KK3B 4Q45A 3NNHA 1QD1A 1U09A 1R8AA 3A3NB 2BEFA 2X1GA 1D8ZA 4ZVGA 4EO6A 3OJUA 1N6QB 1RT3B 1WTFA 1ZPWX 2C3MA 3J81Y 2D1CA 2GV1A 3BKUA 1VFJA 3HSJA 4NLXA 1HNIB 1CBKA 4M5LA 4YB7A 3PYGA 2Y8WA 1C1CA 2HGMA 2O67A 1EP4B 1GXUA 1NZ8A 2GFFA 2OO4A 2V8HA 3B78A 4KAIA 5BYRA 1U8SA 2M0GB 3US5A 3UNYA 5KFMA 1HHQA 3PJWA 1HYSB 1FJCA 1AUSL 2LU2A 3SEOA 2YKMA 2EKNA 3D6HB 1TKXA 2XLJA 4FYVB 1RWMB 4LUBA 4IH7A 2KVQE 4RBVA 1Q82T 1JLCB 1U25A 2YTCA 2HBZB 3IBWA 5K8OA 4C8KA 4LF9J 3LGNA 2EFPA 2BVZA 2FQQB 1E6YB 2RUGA 2RDJA 2GMJA 4ETXA 1RT2B 1FJEB 4DV3J 4NEYA 1N33J 3UWTA 2VBYA 2QL7B 7FD1A 2WW4A 4U7UK 2BW2A 2MHNA 2N3LA 2KG0A 1WSVA 1CJTB 5IXUA 3D2WA 1PYSB 4KHPF 4DEZA 2OH2A 4PG7A 3I31A 3IO1A 4QPXA 5IS2A 4UOFA 3PW0A 4Y65A 4GO5X 1F2HA 1KS2A 2CG4A 1RADB 3KUGA 3R6LB 2JWNA 1AA1B 4QOTA 2HHVA 3W1YC 2VV5A 3PR4A 3FCWA 2YX1A 2WB4A 3D1HA 2V4JA 2R2SA 1RWOB 5KFPA 1IBKJ 1VQNS 2LQ9A 2B9EA 1WHXA 2LP4A 3P3DA 2GHPA 3G8QA 5C42A 3V4IA 1EARA 3AHPA 3PHTA 1RHQB 4WYLA 1TKZB 3NOGA 3EGVA 4WU3A 1B4SA 2Z4PA 3VZIA 4ZIVA 2DB1A 1N36F 1HBOA 2VG7A 3IA0A 5G4DA 2ZVSA 3CJSA 4PCQA 1LK5A 4JI8F 3W66A 4DZDA 2QA4G 1RE1B 2YQ3A 3NAIA 4GC6A 1SKRA 2ZHBA 5LSRA 3WIVA 3RB3A 1XBWA 1IKYA
chains in the Genus database with same CATH topology
4KY3A 1HNWJ 4X66J 4DUZJ 4NXMJ 2F4VJ 3IMQJ 1J5EJ 5A2QU 4YY3J 4LF8J 4B3SJ 4HHUA 1FJGJ 3D3CJ 1N32J 4PWWA 4LF5J 4DR1J 4DV4J 4JI2J 2VQFJ 4K0KJ 4JI8J 5LM7E 4JI0J 1XMQJ 1HR0J 5LMUJ 4DV0J 4DR2J 4KYZA 4X62J 5AJ3J 4LFCJ 4LF7J 2E5LJ 2UUBJ 4AQYJ 4JV5J 4B3MJ 4KHPJ 4B3TJ 2HHHJ 2MEWA 4DUYJ 4RJVA 4LF6J 4LFAJ 4LF4J 4OX9J 4JI1J 4JI7J 3J7AN 1IBLJ 4X65J 4JI3J 1N34J 3OTOJ 3R2CJ 2UUAJ 1HNXJ 4JYAJ 4DV5J 4DV1J 3R2DJ 1N33J 2VQEJ 3T1HJ 4X64J 4NXNJ 4DR7J 5IWAJ 1N36J 4DR6J 4LFBJ 2UUCJ 4B3RJ 4GKJJ 1XNQJ 4DR3J 2KVQE 2UXDJ 2MTLA 4JI5J 4DV2J 1IBMJ 5FLXU 4LF9J 2UXBJ 3T1YJ 3JAMU 4DV6J 3D3BJ 4YHHJ 4DV3J 4NEYA 2UU9J 2ZM6J 2KL8A 4DR5J 4JI6J 4V1Ak 1XMOJ 1I94J 2UXCJ 3J81U 3W1YC 2MQ8A 1IBKJ 4NEZA 5BR8J 4DR4J 4GKKJ 5IT9U 5LMNJ 1XNRJ 1HNZJ 4JI4J 3J80U 4DV7J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KY3 A;  1HNW J;  4X66 J;  4DUZ J;  4NXM J;  2F4V J;  3IMQ J;  1J5E J;  5A2Q U;  4YY3 J;  4LF8 J;  4B3S J;  4HHU A;  1FJG J;  3D3C J;  1N32 J;  4PWW A;  4LF5 J;  4DR1 J;  4DV4 J;  4JI2 J;  2VQF J;  4K0K J;  4JI8 J;  5LM7 E;  4JI0 J;  1XMQ J;  1HR0 J;  5LMU J;  4DV0 J;  4DR2 J;  4KYZ A;  4X62 J;  5AJ3 J;  4LFC J;  4LF7 J;  2E5L J;  2UUB J;  4AQY J;  4JV5 J;  4B3M J;  4KHP J;  4B3T J;  2HHH J;  2MEW A;  4DUY J;  4RJV A;  4LF6 J;  4LFA J;  4LF4 J;  4OX9 J;  4JI1 J;  4JI7 J;  3J7A N;  1IBL J;  4X65 J;  4JI3 J;  1N34 J;  3OTO J;  3R2C J;  2UUA J;  1HNX J;  4JYA J;  4DV5 J;  4DV1 J;  3R2D J;  1N33 J;  2VQE J;  3T1H J;  4X64 J;  4NXN J;  4DR7 J;  5IWA J;  1N36 J;  4DR6 J;  4LFB J;  2UUC J;  4B3R J;  4GKJ J;  1XNQ J;  4DR3 J;  2KVQ E;  2UXD J;  2MTL A;  4JI5 J;  4DV2 J;  1IBM J;  5FLX U;  4LF9 J;  2UXB J;  3T1Y J;  3JAM U;  4DV6 J;  3D3B J;  4YHH J;  4DV3 J;  4NEY A;  2UU9 J;  2ZM6 J;  2KL8 A;  4DR5 J;  4JI6 J;  4V1A k;  1XMO J;  1I94 J;  2UXC J;  3J81 U;  3W1Y C;  2MQ8 A;  1IBK J;  4NEZ A;  5BR8 J;  4DR4 J;  4GKK J;  5IT9 U;  5LMN J;  1XNR J;  1HNZ J;  4JI4 J;  3J80 U;  4DV7 J; 
#chains in the Genus database with same CATH topology
 3DRP A;  1TEL A;  3JSB A;  1B7Y B;  4C97 A;  3E8O A;  4QWD A;  3LWM A;  2HBR B;  3MPU B;  2C2D A;  2YQ1 A;  2LU1 A;  4NCA A;  1Y4Z B;  3OVB A;  4DX8 H;  2B5J A;  3ET6 B;  4C8Y A;  4H4O A;  3BO4 A;  2UVR A;  2VFS A;  4K4X A;  4K4S A;  3OR2 B;  4YB5 A;  2YNF A;  4F02 A;  4P2M A;  4PG6 A;  4RL1 A;  1TK5 A;  3BDE A;  1NCL A;  2HMI A;  3FZB A;  2Q43 A;  1E6V B;  3R97 A;  1HBN A;  2FJE B;  2LEA A;  2H3E B;  2KU7 A;  4LF5 F;  1D1U A;  4GMK A;  3PW5 A;  1ZH5 A;  5L1J A;  3NLC A;  4WZQ A;  5GVQ A;  2POK A;  3MUR P;  3DRP B;  1DAR A;  1M5P C;  4O4R A;  2UXB F;  3HJV A;  3MI7 X;  2KZM A;  3WIU A;  2PE8 A;  2YPZ A;  3CWJ A;  3D9B A;  1V6H A;  2R7X A;  2DGQ A;  4Q2L A;  2QG9 B;  2RU3 A;  2C2E A;  4OLO A;  1VBZ A;  4LF4 F;  2FHK A;  3NGD A;  1SBR A;  2D69 A;  2Q6B A;  2RF2 B;  4O3R A;  4AQY J;  2IHR 1;  3CIZ A;  1JLQ B;  1KBR A;  4A8O A;  3E3X A;  5KFY A;  4C2M A;  1RT4 B;  2IAJ A;  1NJY A;  4AT1 B;  4RJV A;  2IJF A;  1RT7 B;  3SSQ A;  1FCA A;  1IKV B;  2HEK A;  2QT7 A;  3FBB A;  2CDQ A;  1WG5 A;  3HHL C;  5DJB A;  4UOH A;  1RQ0 A;  2H48 B;  5DDQ C;  4Y0F A;  4RZR A;  2XC9 A;  3B4M A;  2V69 A;  1U2F A;  2R42 A;  3T19 A;  1SQG A;  1N56 A;  2DGU A;  4FXD A;  1PAU B;  2GO8 A;  2NS1 B;  3N5B A;  1VHF A;  1GH8 A;  5LT5 A;  2DIT A;  2LMI A;  3Q0A A;  1IR0 A;  3DKD A;  2W9B B;  2BE2 B;  1XNQ F;  4ECR A;  4DHV A;  4OHV A;  4DUY F;  4BWJ A;  2ZH6 A;  1GTE A;  1F0X A;  1WC5 A;  1FX2 A;  4ZK7 M;  5IFM A;  2DGV A;  3WQP A;  4DR1 F;  3UD3 P;  2HAI A;  4TXS A;  1UVN A;  4F67 A;  1T03 A;  5LSL A;  5EUH A;  3HHD A;  2AYG A;  2HFN A;  1X31 C;  1HQE B;  2PEH A;  4ZPC A;  3CCT A;  1IKW B;  2BAC A;  4ED2 A;  3DMJ B;  3PW7 A;  4OYO A;  4USH A;  2CQG A;  4IKA A;  1VBK A;  1RT6 A;  4IH5 A;  2UXB J;  3SV4 A;  5DGA A;  2CZ9 A;  1WC3 A;  3NOC A;  1U7L A;  4HVZ A;  4ZPA A;  2HVH A;  2C3O A;  3EDR B;  2HIY A;  2KRR A;  3NKY A;  1WAC A;  2KT3 A;  1F9E B;  5IZH A;  4QCL A;  1UVL A;  3NCR A;  4W4M A;  3R5G A;  4M5J A;  1FD2 A;  2G1H A;  5IQ6 A;  3D4J A;  2M8D B;  1CJU B;  2WOM B;  3W63 A;  1S10 A;  2VL1 A;  1H0H B;  3BYR A;  2P6S A;  5M2P A;  1CUL B;  1HWK A;  2H5I B;  4TYA A;  2FHO B;  4UUW A;  4DR6 F;  3W8P A;  4R8U B;  4MFB B;  2CQC A;  3EVW A;  3KUE A;  2MQ8 A;  1GNK A;  3MM7 B;  4RO0 A;  4DJB A;  3UN5 A;  2ZM6 F;  2XS2 A;  2CQB A;  1UVJ A;  4F50 A;  3SCL E;  3QLH A;  3TQE A;  2L9N A;  4B9S A;  1HWI A;  2FJD B;  3PV8 A;  1FKA F;  1TL5 A;  2VFU A;  1HR0 F;  3D0I E;  4DLE A;  2MSS A;  3VAM A;  1Z2Z A;  2CZV C;  4RNM A;  3UVJ B;  1KHV A;  1VQM S;  3ENV A;  2QRR A;  3PJX A;  2AU0 A;  4P52 A;  1FFW B;  2BJ8 A;  1XC9 A;  3A13 A;  1URN A;  4DPO A;  1HL6 A;  4WP8 A;  1U1L A;  3GJQ B;  4F0H A;  1RBA A;  2IJN A;  3LP2 A;  3S7R A;  1RT3 A;  5HAT A;  3U27 A;  4NLD A;  3V6D A;  4DL2 A;  3OXF A;  2J0Q D;  4C9D A;  6AT1 B;  3IXQ A;  1HNV B;  1TUV A;  2MJU A;  3N01 A;  4F4K A;  3KK1 A;  3VAF A;  4DSL A;  2E1R A;  3KTQ A;  2Z58 B;  5BYQ A;  4FKY A;  5KFO A;  1J5E J;  4Q0B A;  3D68 A;  2ZIT A;  1QE1 A;  3DYA B;  3GWC A;  3IAS 9;  4ZCK A;  5KFV A;  4PPZ A;  1UZH A;  3WBZ A;  1NPK A;  3QT7 A;  4F3O A;  2W4P A;  4DX7 A;  2Y8Y A;  5L38 A;  2EFG A;  5H9E J;  4WP3 A;  5HJX A;  1N0U A;  4NX9 A;  1DTT A;  3KLI A;  4FN5 A;  5D4P A;  4NWB A;  5DS7 A;  3W64 A;  4CO1 A;  2E1A A;  2HPU A;  3X1L B;  3AXM A;  4OYM A;  4J9M A;  5JUM A;  2RU9 A;  2PA3 A;  3FEX B;  2GVD B;  4ID5 B;  1F60 B;  3GPA A;  1HA1 A;  1UFL A;  2C1E B;  1HQ2 A;  2IDE A;  1KKH A;  3C16 A;  3D7S B;  3NS5 A;  4MFB A;  4RW7 B;  4IRK A;  2XCA A;  1JKH A;  2K2P A;  2AZ3 A;  5ETK A;  2MZR A;  4M94 A;  2L08 A;  2OGU A;  4OJG A;  4PWU A;  2KHC A;  2V2K A;  3K0J A;  3TUZ C;  1LWX A;  5HRO B;  3BH6 B;  5E2Q A;  1ZM3 A;  1TFW A;  1SVD A;  4KRW A;  2HHT A;  2FIU A;  1K44 A;  1WF1 A;  1R6V A;  2DHS A;  2C3Y A;  4IYQ A;  4WPA A;  4Q43 A;  4B9L A;  1FXR A;  1N88 A;  5C24 B;  2L9W A;  3CCQ S;  1IVZ A;  3MPD A;  4ED0 A;  3OFH A;  3QSY B;  3R1H A;  4DBQ A;  1YIJ S;  2GAG C;  3JB9 k;  4CLY A;  3DDN A;  2HG4 A;  2G2Y A;  4ID5 A;  4ID8 A;  5KG7 A;  2KJV A;  4DV0 F;  4N77 A;  2LQB A;  3THP A;  4NYO A;  3KLF B;  4JI7 J;  3C66 A;  4QU6 A;  2GGP B;  3M8Y A;  3DLL Q;  1H7X A;  3CJ4 A;  3TX0 A;  4NLG A;  3MOJ B;  3OL7 A;  2A18 A;  2CJX B;  5BJR A;  4IO1 A;  1SL1 A;  5KOW A;  2RHQ B;  3LUY A;  4NLO A;  2W01 A;  2I9S A;  4P74 A;  4C8M A;  1HYS A;  5KFD A;  5ETQ A;  2ASD A;  3DYA A;  2APO A;  3MM9 B;  1VQ6 S;  3BGL A;  4KE5 A;  1FXL A;  5T7L A;  3PIO Q;  3IS9 B;  5F9L A;  4R5P B;  3WC2 A;  1BWV A;  4ICL A;  3HSZ A;  2MTL A;  4C11 B;  5GAD U;  4KPC A;  4KGX B;  5FLX U;  4JI2 F;  1D3W A;  3FJ2 A;  5HN0 A;  3MFI A;  3O2I A;  1ACM B;  3DLE A;  3KLH B;  5D4N A;  3GFH A;  2I6W A;  2MZJ A;  2F1F A;  4ED4 A;  4YME A;  2W9A A;  3D3B J;  2F3J A;  2E9T A;  3HJF A;  3FBE A;  1PCA A;  2UVU A;  4EU0 A;  3NGR A;  2KL8 A;  1ZYQ A;  1NXI A;  4X65 F;  4P2F A;  1VIX A;  1FE0 A;  3AQO A;  1RU2 A;  5L9N A;  2FTR A;  1H3D A;  3PX0 A;  1U49 A;  2W2O P;  2WVE A;  3C6U A;  4IRD A;  2BV3 A;  2Z2L A;  3TUJ C;  3QAE A;  3J81 U;  4DL4 A;  1NJW A;  4OL8 A;  2P9G A;  1RXO B;  2KVI A;  2V2Z A;  2K7J A;  3NBP A;  1SH0 A;  3QGP A;  2W24 A;  2L3M A;  1RU1 A;  2CJQ A;  1EET B;  4Y28 C;  3OLB A;  1DTQ B;  3PRV A;  1KTQ A;  1WF2 A;  1Y5N B;  2JOQ A;  4PPD A;  5SUH A;  3PG9 A;  2YWW A;  2VJV A;  2NXC A;  1FNX H;  4HHH A;  2A2D A;  1SKW A;  2R2U A;  1SI9 A;  2WVC A;  4NZ6 A;  3K59 A;  5F9N A;  3O8W A;  2DHG A;  4G1Q B;  2RRB A;  3O6Q A;  4CLS A;  4MK9 A;  5A0Y B;  2AJ1 A;  2VF3 A;  1XR7 A;  3OR2 A;  2CNO B;  5KG4 A;  3JSM A;  1FDN A;  4J9N A;  1S1U A;  4USI A;  7FDR A;  3MCN A;  4HAC B;  8AT1 B;  2P8I A;  2BUN A;  2Z2M A;  2GZO A;  3GU0 A;  3KJF B;  2MKS A;  3DOL A;  4USM A;  4KY3 A;  2HRT A;  2J5A A;  4ZP6 A;  4TU7 A;  1K73 T;  1LWC B;  1FVS A;  3UCU P;  4ZHR A;  3MF5 A;  1FKO B;  3TAM B;  5C5J A;  2GAH C;  3C6T B;  4KQZ A;  2BAN A;  4QIV A;  2HS3 A;  3VHQ A;  3TO8 A;  5T14 A;  5A2Q U;  1L3V A;  3HX9 A;  2WVB A;  3OTC A;  3V6J A;  3HT0 A;  2M3D A;  3DRR B;  1R27 B;  5ITH A;  2OSR A;  1NPR A;  3KG4 A;  2PMZ D;  2MGZ A;  3C14 A;  1SC6 A;  2X7I A;  2G2O A;  4P7V A;  1X4F A;  3CPW R;  2MKI A;  2DH7 A;  1YRX A;  3ILJ A;  4QYR A;  2ZH5 A;  2FY1 A;  2G0I A;  1HWU A;  5M2U A;  4TY8 B;  1S7H A;  1WEZ A;  2QLF B;  3AB2 B;  3MDF A;  4LIW A;  4UF4 A;  4F25 A;  2C2N A;  3VAL A;  4NYP A;  1RYR A;  2HND B;  2XMU A;  4B02 A;  5A8W B;  1S1T A;  1HMV B;  2BKO A;  4Y2K A;  5DQH A;  4J91 A;  1JXL A;  1MW7 A;  2J6U A;  1VRT A;  3GII A;  1VRT B;  1R43 A;  2DYA A;  4XDD A;  3W60 A;  3I87 A;  3NAH A;  1RBO B;  5HLF B;  3W2V A;  3R5J B;  2WVD A;  1B99 A;  4EBD A;  1QVG R;  4RW4 A;  1U1R A;  1VQ5 S;  2J0W A;  4USV A;  3C46 A;  1HBM A;  1JLQ A;  5AE3 A;  2OPR A;  3MUT P;  5H9F K;  3IG1 A;  4RPF A;  4XTT A;  4LQ3 A;  3G6X A;  2ZZN A;  1OMS A;  1V5I B;  4C0O C;  2XWY A;  2ZNY A;  4WP9 A;  1YBU A;  2N4D A;  4X4P A;  2KN4 A;  2QZ8 A;  5J2M B;  4DUY J;  2RHS B;  1N8R T;  3L3C A;  2CQ4 A;  3IBC B;  3R7S B;  3R7B B;  2ZE2 B;  3H59 A;  2ZZT A;  3MED A;  3DRY A;  1B7F A;  1WHY A;  3HLU A;  3UDL A;  4PXD A;  3NMA A;  1Q5V A;  2CJY B;  2DNM A;  2VU5 A;  4LBH A;  1IBM F;  1HHS A;  2CNN B;  1UA0 A;  1W7W A;  1U24 A;  3CD5 A;  5GMD A;  5HI7 A;  2ROG A;  4LVN P;  1T9W A;  3H4D A;  1WI6 A;  3DFE A;  1N54 B;  1AYE A;  3Q24 A;  4FF1 A;  1HNI A;  1G1X A;  2QLB B;  2NQP A;  3MEE B;  1FKP A;  3T1Y F;  3G6Y A;  1K9M T;  3DNC A;  5L1L A;  4EI2 A;  3BH7 B;  4K50 A;  3D54 A;  3J7Z 5;  1FHT A;  5CYM B;  1OPZ A;  3H7H B;  2V8G A;  2MPU A;  3DOK B;  3I0R B;  4FPI A;  3P5B P;  4H4O B;  1NM2 A;  4OX7 A;  4CO0 A;  3FRY A;  2AIR B;  4DDF A;  4DR3 J;  5A8W A;  3FDS A;  1RIS A;  5T7L B;  2V9W A;  3CJQ A;  3PO4 A;  2ATC B;  3IP0 A;  4DV4 F;  2UP1 A;  1U0S A;  3Q8P B;  4KT0 C;  2BRK A;  3DLH A;  1FEH A;  3OL6 A;  4J9Q A;  4LIR A;  4H4K A;  4LR9 A;  4CLF A;  1KRP A;  2OEL A;  3KK2 A;  4BDP A;  1NO8 A;  3CED A;  4FS1 A;  2H65 B;  1DQA A;  2HKE A;  2P5V A;  1BC6 A;  1Y9O A;  3L4B C;  3QRR A;  3I5C A;  4DV2 F;  1C0U A;  1IR1 A;  1QJH A;  5HBM B;  2XY5 A;  1REV A;  4ZCM A;  3D6T B;  1KFS A;  3OVA A;  2W9C A;  1TQL A;  1SB6 A;  1YQH A;  1G4C A;  1RTJ B;  4KKO A;  2DRA A;  5KFX A;  1PJ7 A;  5H9F J;  1SC1 B;  1TL3 B;  2R7W A;  1SCJ B;  1CC8 A;  4WFZ A;  3N5F A;  3DXB A;  4B3O A;  2Z0G A;  2M4M A;  3CD0 A;  3HSG A;  4ICL B;  5C24 A;  3H2V E;  3ZZU A;  3DU5 A;  2HGN A;  4MIB A;  4QIW D;  4IFV A;  4KFB A;  4OI1 A;  3N6N A;  4EWT A;  1JLG B;  4C6A A;  3DLJ A;  3MPY A;  1DUR A;  4G1I A;  1RAJ A;  1WC0 A;  1RAA B;  1X4C A;  3FSI A;  3NNA A;  4N7T A;  4MKY A;  1KOO A;  2GW8 A;  3TZY A;  2QGF B;  3NCP A;  5ETL A;  9RUB A;  4PWD B;  8RUC A;  3TAR A;  2QTW A;  5K5M A;  3NXZ A;  3UN2 A;  2LCW A;  1U1M A;  3LOU A;  1TL1 B;  4DUZ J;  2CPE A;  4LF9 F;  3MEG A;  3EDQ B;  1FWK A;  1QY7 A;  2CXE A;  1GQE A;  1NSQ A;  3J7Z T;  2VOO A;  4YR3 A;  4PRF A;  4LJM A;  2D3U A;  1Y5I B;  2GS8 A;  3D3C J;  4M63 A;  4U9R A;  4QWB A;  4U95 A;  2VC1 A;  3KKF A;  3M6W A;  3SSS A;  3OV7 A;  3BKF A;  2JC0 A;  3KHG A;  3HHL D;  4YR2 A;  1X4H A;  1NAQ A;  4HH0 A;  4J9K A;  2RRA A;  4F36 A;  2YKQ A;  1XR5 A;  2QMW A;  4HTI A;  4YFU A;  1HBU A;  1Y3K A;  2YWE A;  4K0K J;  1DLO A;  1RAB B;  3QYY A;  6FDR A;  4CH1 A;  1M5H A;  1SUQ A;  3GFZ A;  3BEG B;  3MEC A;  1OO0 B;  1RWK B;  2WCX A;  2HFU A;  3CJ3 A;  3MMB B;  4KKO B;  2B4O A;  2WHO A;  4ZP8 A;  3HD1 A;  4ECV A;  5BR8 F;  2BJ1 A;  3NWG A;  3CMQ A;  1TAQ A;  4CYU A;  3T41 A;  1IBL F;  3H5U A;  4KYZ A;  3IRW P;  2W9C B;  3DC2 A;  3R1L A;  1X0P A;  2E5G A;  2IVM A;  4F26 A;  4NCG B;  2XEX A;  4OI4 A;  5AXK A;  4E98 A;  1JJC B;  3A3P B;  2Y3Y A;  3W61 A;  4ZLN A;  2ROP A;  2LA6 A;  1J5O B;  2JEJ A;  3KK2 B;  1LWE A;  1BQM A;  5FLX Y;  3CC7 S;  2W7A A;  2BJD A;  1XMB A;  3RBX A;  1RWP B;  4B3M J;  4JV5 F;  4C8L A;  3OR1 A;  2LXF A;  2VKR A;  3GJS B;  1BY9 A;  3U1L A;  3JAM Y;  1VS3 A;  4YHH F;  3D1Q A;  2GC8 A;  2CPX A;  2CWX A;  2AHO B;  1FRH A;  1NK5 A;  4A8Y A;  2ZD1 A;  4DL6 A;  1D9A A;  2O5D A;  5J1N A;  2FHJ A;  4TLR A;  1HI0 P;  3LP1 A;  4X4U A;  2V4J B;  3BBF A;  3OL9 A;  4OX9 J;  1RHK B;  4JI1 J;  3CME S;  3BSA A;  1M5K C;  3MMA B;  1X4G A;  4HR2 A;  4P73 A;  5KG6 A;  4OMF G;  5DRK A;  1BGX T;  5DZ7 A;  3CJK B;  3WHI A;  3ZZT A;  3OXL A;  4OX6 A;  1SQF A;  3LP2 B;  4C7Q A;  2ZHA A;  1U2R A;  1PYO B;  1S6Q A;  3ZXW A;  1Q79 A;  1HNX J;  3MTJ A;  1HAR A;  4CIO A;  2ZWO A;  1TP7 A;  4J90 A;  1M1H A;  1PAE X;  2UUB F;  2E29 A;  2DNQ A;  2J0X A;  3KXD A;  2KM8 B;  3M8Q A;  4L6V 3;  1JKH B;  4EFA C;  5KT6 A;  1K0T A;  4NLR A;  4RW7 A;  3G9C A;  4A48 A;  3LW5 C;  3I4P A;  1UCN A;  1ZAX A;  2COL A;  4B9V A;  2W25 A;  3NCQ A;  2WSE C;  4MKV A;  2N7C A;  1S77 D;  1RLD A;  1RWV B;  1N5Y B;  1P9Q C;  4ZJO A;  1NK9 A;  4ECW A;  4PG8 A;  2R7Q A;  2EK1 A;  3M32 B;  4IDK A;  2YH0 A;  2AW0 A;  4ZJQ A;  2K1R B;  4C48 A;  2RQ4 A;  2VPX B;  1RTH A;  2ZVI A;  2W7P A;  3TQ1 A;  2MKK A;  1YVF A;  1S0O A;  2H5E A;  1L3U A;  2RS2 A;  3LAM A;  4DR7 F;  1JLB B;  1MWZ A;  2CJ9 A;  2HVI A;  3CO0 P;  1CJU A;  2WOM A;  2HZV A;  3MAQ A;  1CEZ A;  3EZ5 A;  4LR8 A;  1O5J A;  2PEB A;  3FBC A;  3IR5 B;  3ZNJ 1;  2D3Z A;  1CJK B;  1SH2 A;  3KUH A;  2W2Q P;  5HQM A;  3SI8 A;  3KNA A;  2QMX A;  4ECT A;  1SJR A;  3KWM A;  3PRB A;  3VWS A;  3RBD A;  2I2Y A;  4FF3 A;  1WG4 A;  1YZ6 A;  1RTJ A;  2EWH A;  2RSQ A;  2V6A A;  3LP1 B;  2B4U A;  2HS4 A;  2MKC A;  4FYX B;  2LXU A;  1R89 A;  3UO0 A;  2VH7 A;  4CTA A;  2NXE A;  3MTK A;  1M1G A;  3UI3 A;  1FTC A;  1RYS A;  4KHR A;  5AXN A;  3ISZ A;  4ZIW A;  1WC4 A;  3RR8 A;  1S4F A;  3TAP A;  4W90 B;  4HYK A;  4L3N A;  2P6T A;  4DV7 F;  5GAG I;  1BQM B;  1ZPV A;  3IC1 A;  4OYZ A;  4JBC A;  3HSD A;  3HCX A;  4PQU A;  1HPZ B;  5AE1 A;  3DCA A;  2ZH3 A;  2KJW A;  2RJZ A;  2MYF A;  1ZM4 A;  2XYH B;  2HYI B;  1F9H A;  5H9E K;  1CSJ A;  2JNJ A;  4YEA A;  4R8U A;  1T05 A;  1K47 A;  4F4Y A;  1WHW A;  1YTY A;  2NUU G;  2UUT A;  4CT8 A;  2EEY A;  1MMN A;  5JJB A;  1IUJ A;  2XG8 A;  4DLG A;  2AWZ A;  3F0N A;  3DGP A;  4O3S A;  2NR0 A;  2ZHO A;  5KFT A;  5CYM A;  5I4M A;  1VQS A;  2ZJR Q;  1S48 A;  2Z8Q A;  3W5X A;  3FZ2 A;  4OI2 A;  5I3Q A;  5I3U A;  2CQH A;  2DHH A;  2ZC4 A;  3H2L A;  1MMD A;  4DR1 J;  2FLP A;  4LF7 F;  3ZFV A;  2MXY A;  4N76 A;  1ZA1 B;  1Y5L B;  2W4D A;  5LM7 E;  3TA0 A;  2NSC A;  5HJY A;  4A8Q A;  2HW3 A;  1AZS A;  4BWM A;  3Q23 A;  4QU7 A;  4XO0 A;  4L76 A;  3IWX A;  1HWJ A;  3MXH P;  4X64 F;  3QLH B;  3MR5 A;  4U8Y A;  1OY9 A;  5LMU J;  4LBI A;  4RBT A;  4L3K A;  1SJQ A;  4LR7 A;  2QA1 A;  5JXS A;  3W65 A;  1X0F A;  1TUW A;  4IR1 A;  3Q8V A;  1RZM A;  4KH0 B;  3CB4 A;  4FZV A;  4JV0 A;  3EZO A;  4WZM A;  2EC0 A;  3M6X A;  4CNZ A;  5F8G A;  4TU9 A;  3POT A;  4Q8E A;  4I6Y A;  5I3P A;  1N5S A;  1YLX A;  1SH3 A;  4X4T A;  2FLL A;  2BM0 A;  3A8E A;  3CMA S;  4A8W A;  2FLO A;  3UCG A;  4DR2 F;  3P49 B;  3R9L A;  1VQL S;  1WKL A;  2PC6 A;  1U1Q A;  1Y7P A;  3TA1 A;  2BX6 A;  2XHW A;  2EI5 A;  2H51 B;  1Q81 T;  4WFY A;  4RWX A;  4UY8 5;  2RD5 C;  1Q8B A;  4FXW A;  3W7B A;  2XI2 A;  2VPY B;  2VG5 B;  3DHW C;  1FRX A;  1ZZN A;  4WTO B;  2CJB A;  4KGM A;  2IAJ B;  4V19 J;  4FYD A;  1CJT A;  3DMJ A;  1TR0 A;  1XR6 A;  5A6W A;  3UN3 A;  4B9T A;  2PO4 A;  1IKY B;  1QUP A;  4X65 J;  1IBL J;  1PC5 A;  1F9F A;  2BAB A;  5F0U A;  2CQ3 A;  2ZBI A;  3M05 A;  2AEJ A;  1NRK A;  4NOH A;  4Y2A A;  5I42 B;  1X4D A;  2VQE J;  1TK0 A;  4NXN J;  2CVI A;  4P2S A;  3EX7 B;  1VDH A;  1G2E A;  2W9B A;  3EGN A;  3P4U B;  3FVY A;  3M9O B;  4ZHR B;  1R6Y A;  5A6P A;  2OMO A;  1X9M A;  3C6T A;  1KQS R;  2BMB A;  2DNO A;  3ITH A;  5LSO A;  2KTQ A;  2BJ7 A;  2J9D A;  3VVT A;  1KTV A;  1JLF A;  2DT9 A;  3M8R A;  1WC6 A;  1VQ4 S;  3JAM U;  1REG X;  2I8E A;  3D66 A;  3I0S A;  2IYI A;  4HH1 A;  4NA3 A;  4Y2M A;  3RB0 A;  4LFB F;  1S1U B;  4WII A;  5DZ6 A;  4OFZ A;  4DWI A;  4CLP A;  4N5S A;  3FFI A;  1HNX F;  3ET6 A;  3ISN C;  3VV2 B;  5B0E A;  1QUV A;  1VLO A;  5D78 A;  4I68 A;  3BKT A;  2MLY A;  2ZDP A;  4MKA A;  5D4L A;  5CYQ A;  1ZM9 A;  1N33 F;  3HUL A;  4OI6 A;  4J5O A;  4KGV B;  4NPO A;  3VR1 A;  2XGQ A;  1U02 A;  3CJ8 A;  4LQ9 A;  2G2Z A;  4ZN3 A;  2WZ1 A;  2HQ3 A;  2N3O A;  1BD6 A;  2IDL A;  1QAI A;  2BXJ A;  4TQR A;  1ELO A;  1NND A;  4A8K A;  4NXM F;  3CDE A;  4F4X A;  3DLK A;  4GKK J;  5CAB A;  1XTZ A;  4NA1 A;  2BM1 A;  3K89 A;  4YS2 A;  2KH9 A;  2LEB A;  1U0H B;  1VBX A;  1I5O B;  3LAK A;  1TL4 A;  1RAI B;  1FWL A;  3OD2 A;  1U47 A;  1PO6 A;  3DI6 B;  1FA0 A;  2YKN A;  1Q0N A;  4ES2 A;  2K3I A;  2MQM A;  2JDJ A;  2J7K A;  4YDD B;  4WKR A;  5IWA F;  3J7Y U;  1TU0 B;  3GE9 A;  4OYI A;  2K8G A;  4C11 A;  4B3R F;  3V2U C;  2E5J A;  2NUH A;  2AYM A;  1WG1 A;  5FDL B;  1YSJ A;  5AXM A;  3W9H A;  2HQD A;  5DDP C;  3IMQ J;  1S6P B;  1HBU B;  1SJ1 A;  3CDB A;  5K14 A;  2QA2 A;  3NWR A;  2CPJ A;  4YN3 B;  2X1F A;  1YWX A;  3FEZ A;  2W7O A;  3WC0 A;  2NYI A;  3CCS S;  1LNQ A;  2YH1 A;  5KT3 A;  1A9N B;  1QAY A;  4O44 A;  1CJV B;  3QT6 A;  4FNH A;  3BJY A;  1NBE B;  1Y3J A;  2D74 B;  5U47 A;  3QAT A;  3BR9 A;  2RUS A;  3DXS X;  4IG0 B;  2H4W B;  2B9X A;  3IM8 A;  4QBU A;  1NEE A;  2I1R A;  2ZUG A;  4ZLJ A;  4MMO A;  2MB0 B;  2OJ3 A;  1OSD A;  2QLX A;  5EN1 A;  2FJA B;  2C2O B;  2DNG A;  1V3S A;  1VCT A;  2HBY B;  4LRC A;  5IT9 Y;  4FF4 A;  2JFK A;  3GQC A;  5J2N A;  2QFJ A;  3H5Y A;  1F5C A;  4NLW A;  4ZP9 A;  5HVF A;  4FBT A;  1V3Z A;  3PDN A;  1XER A;  2XMJ A;  4F8R A;  4X4R A;  2E5L J;  2KI2 A;  1P9Y A;  5GAH U;  4DL0 C;  2SXL A;  2EW9 A;  1FER A;  2QX0 A;  2UUB J;  3N6L A;  1UVM A;  2R7U A;  3T5L A;  2NCK L;  4ZCI A;  3G82 B;  3CJ2 A;  4QR1 A;  1UPM B;  4U7C A;  2KXH A;  1RAG B;  1RKI A;  2Q6C A;  2MQQ A;  1DRZ A;  2HLU A;  5IQQ A;  3H5X A;  1AUD A;  1IJE B;  3Q8Y A;  2HHP A;  2JRS A;  3CJ5 A;  4FP9 A;  2GA7 A;  3ENA A;  4DPX A;  1FES A;  1S72 S;  1MG7 A;  2I0X A;  2KYX A;  3PHE A;  5K9F A;  5A8R A;  3PVX A;  2CPY A;  4LF1 A;  3CUL A;  2C2K B;  1MNE A;  2CPI A;  3ZTR A;  1Y11 A;  4ZPW R;  1RCO B;  1SIW B;  2GJI A;  3RBE A;  3G2X A;  4CNY A;  4FYW B;  1X8D A;  3EJM A;  2RAQ A;  2VOP A;  4WYW A;  2WTF A;  1O6X A;  2CJA A;  3GFX A;  2EPI A;  2GML A;  2E1P A;  1K8A T;  3CW2 C;  4WXO A;  4ZA1 A;  5ETS A;  2ASL A;  3R2D J;  3QQC D;  2HRU A;  7AT1 B;  3GG0 A;  1VQ9 S;  2KXN B;  4OV6 A;  1KVK A;  1O0P A;  3H42 A;  2LQ5 A;  2JSX A;  2CIM A;  4B3R J;  4OYX A;  1FRM A;  2KT2 A;  3OTO F;  2R8H A;  4DFK A;  5ETO A;  4UST A;  2I38 A;  2VDI A;  2RIL A;  4UZB A;  3K5O A;  1SKS A;  1DBD A;  5FDL A;  3V6D B;  3UCZ P;  3T5K A;  1QSL A;  3HMJ G;  3JSR A;  2QFI A;  5LXY A;  3DDK A;  5J1P A;  5IC6 B;  1PJ6 A;  2R3V A;  4CLU A;  2YWH A;  1S6O A;  2MY8 A;  5D77 A;  3Q22 A;  1QVF R;  1GXL A;  3SFU A;  3V6K A;  5LL6 d;  3PAC A;  4K2X A;  1YK9 A;  4DFM A;  1KN6 A;  3OR1 B;  1S0V A;  4EZ9 A;  3HDS A;  1IJF B;  4RNN A;  3PIP Q;  3Q2T C;  3CTR A;  4NRT A;  4K2J A;  3AA8 A;  2ZE2 A;  3MPV A;  2ZJP Q;  4M5I A;  1NDC A;  1OYD A;  1WKJ A;  1G3O A;  5A8R B;  2PI4 A;  3H8Y A;  3JTO A;  4I56 A;  1IWG A;  2MKY A;  2YNG B;  2Y1R I;  4ECQ A;  2HFS A;  3N6M A;  3IRX A;  2XO7 A;  4PQA A;  1HBN B;  2A10 A;  5I3U B;  4NZ7 A;  2OIH A;  3N9U C;  2A6O A;  2YNI B;  1CQN A;  4RW4 B;  1OY8 A;  2OPQ B;  3HD2 A;  3RAX A;  2HSE B;  3IR6 B;  5K8P A;  3GTY X;  2VA3 A;  4OV1 A;  1K0V A;  3N79 A;  4J9V A;  3MZI A;  4X4O A;  1KVJ A;  2CPF A;  2ZOG A;  1KD1 T;  3QGI A;  2FYX A;  4PAA A;  1RT6 B;  3KHH A;  3Q83 A;  1FFG B;  1FRL A;  3C19 A;  1VBY A;  2JEI A;  1TFY A;  2QIF A;  2AQ4 A;  2ZEJ A;  4GRS A;  1B0V A;  1LOU A;  3K5P A;  2W4C A;  3B4D A;  4PXB A;  3H5S A;  4GVB A;  1T3O A;  1RT5 A;  3G4S S;  4JV2 A;  2GVD A;  3R5C A;  2E1C A;  1TZ0 A;  2MDA A;  2MZT A;  2UV8 A;  3QMQ A;  2QSW A;  4OYP A;  4OZ1 A;  4HHU A;  1EB0 A;  4M5D A;  3C2P A;  1R0C B;  3LP0 A;  3RB6 A;  4NLP A;  3PKY A;  2KFY A;  3BSN A;  4DFP A;  1F1B B;  3WZ0 A;  1IKX B;  3HHE A;  2V8P A;  3SQG A;  2BE9 B;  2EBG A;  4QIF A;  3HFK A;  3QJJ A;  5LXR A;  3T1H F;  2B4P A;  2ADB A;  1MRO B;  3CDA A;  2HBQ B;  4MKB A;  2GVZ A;  4RR5 A;  2XSF A;  4O23 A;  1UFK A;  3RB4 A;  1PYT A;  3O3L A;  5KT2 A;  4RU9 A;  3I56 S;  1LV5 A;  1FDB A;  2NXU A;  2QE5 A;  3IAM 9;  2KM8 C;  1EKS A;  4ATN A;  5KFF A;  1N34 F;  3G6E S;  2BJ3 A;  5D3G A;  3C15 A;  2OD4 A;  2Y0S D;  5AJ3 J;  4DR3 F;  3ULH A;  1ZAV A;  3AJ2 A;  1NDL A;  1R0B G;  4URQ U;  4DQI A;  4MJK A;  3D6M B;  5C2C A;  2FJW A;  1HNZ J;  1F6T A;  1ZZF A;  3CT9 A;  3KG0 A;  1VK3 A;  4DU8 A;  1YJU A;  2GJF A;  4ZPT R;  3H4B A;  4CM2 A;  1T3N A;  5THW A;  3EUN A;  2CAD A;  3TA2 A;  2W8L A;  4WF9 Q;  1FF2 A;  2CQI A;  2DK2 A;  4YB6 A;  1T8E A;  2HHH J;  1F2G A;  2MEW A;  2VIC A;  4RLE A;  3OPK A;  3GR1 A;  4AD6 A;  3U1N A;  3VQT A;  5KFJ A;  3GCW P;  2DJW A;  2CDR B;  2HNY B;  4CDI A;  2Q3P A;  4TYB A;  5F8M A;  4PYA A;  3SDE A;  5E3R A;  2CKW A;  3OJS A;  4NXN F;  5CZX A;  3M2V B;  2YKM B;  3KHL A;  1FK9 B;  1YZ7 A;  2UV8 G;  4OJH A;  4OHX A;  4KB7 A;  2W1B A;  4ZN1 A;  1HQU A;  1ZS6 A;  2OPP B;  4CI0 B;  1UPP A;  3QIP B;  1E6V A;  1CUL A;  2QMU B;  4UW2 A;  3CXC R;  5HSP A;  2UUA J;  1C4C A;  1TL7 B;  3LPE A;  3P8B B;  1VRQ C;  2VAS A;  2RKI B;  4JYA J;  3ZZ0 A;  3CD7 A;  4NLS A;  2OPQ A;  4JP8 A;  2GIF A;  1EIY B;  4D3H A;  1ZBT A;  3TRG A;  4DF8 A;  1C0T B;  3I9Z A;  5DG7 A;  4DR7 J;  1N36 J;  3D6F B;  4DSF A;  2O66 A;  3M4X A;  4CH0 S;  1HD0 A;  1RHR B;  5KG3 A;  4AXJ A;  4DL3 A;  2FD2 A;  3R5A A;  1KC8 T;  1RAH B;  2BW7 A;  1S79 A;  4JI5 J;  1IBM J;  3BBB A;  1RAE B;  2GVZ B;  3SDE B;  1RT1 A;  2CQ0 A;  3PEJ A;  1GMV A;  3WDO A;  1M5V C;  3BGF A;  4DPW A;  4RNH A;  2KFN A;  1UFW A;  3OFE A;  4HT7 A;  1VC6 A;  2RE1 A;  3VAI A;  1H2V Z;  1LWE B;  1OWX A;  1U6Z A;  2EG1 A;  3FCV A;  1HBO B;  3H90 A;  2GO9 A;  3PJ9 A;  4JOU A;  3V81 A;  1LEO A;  1T03 B;  4IOA Q;  3BQ2 A;  1V3R A;  1V9O A;  2ZM6 J;  2WW8 A;  3GIL A;  4JI4 F;  1SL2 A;  3CCV S;  2BQR A;  3LWL A;  2WBR A;  3E01 A;  3MPW A;  2VDH A;  4LRA A;  3M1V B;  2AKW B;  3PX6 A;  1I94 J;  2UXC J;  3BN7 A;  2B7B B;  4NLT A;  2IA6 A;  4CCH A;  4NLY A;  2BOA A;  3GV8 B;  1S0N A;  2HIQ A;  4ELU A;  4DUT A;  1QTM A;  3AA9 A;  2NPI A;  1YX2 A;  3B82 A;  3DLB A;  4NEZ A;  3TJA A;  1F3V A;  1H6K X;  5KFL A;  3UFC X;  3ZTQ A;  5EGY A;  5F8H A;  3N28 A;  3HVW A;  3QFW A;  4L72 B;  5ETT A;  2E66 A;  5BR8 J;  4DCP B;  3K58 A;  3Q8U A;  1NZA A;  2FDN A;  3AH6 A;  3EWG A;  3SIP B;  5L39 A;  2K7K A;  2VBX A;  2UZA A;  5KTQ A;  2HFV A;  2DBB A;  3D0H E;  2R7T A;  4DPT A;  4MTP A;  4P9S A;  2HNZ A;  3M8Z A;  4IG3 B;  2YPY A;  5G0R A;  3R5D A;  3ZO7 A;  3TWZ A;  2DNN A;  2PMW A;  1L3K A;  1LW2 B;  1Z1Z A;  3LP0 B;  3DRR A;  1WSR A;  3G86 A;  5AXL A;  2YX7 A;  2EFV A;  3TOQ A;  1VC5 A;  1HNW J;  3SMZ A;  2LQJ A;  4WIQ A;  1XMQ F;  1U4B A;  1NUE A;  4ZVH A;  3LGH A;  1H98 A;  1WI8 A;  2LEC A;  3TAN A;  2OP5 A;  5JVH Q;  2IRU A;  4IG0 A;  3PR5 B;  1L3T A;  1XEZ A;  2OAU A;  1TKX B;  4WXW A;  3GJR B;  5T41 A;  1RP5 A;  3AXK A;  2O3D A;  3DU6 A;  4C0B A;  1N32 J;  3GJT B;  4OHY A;  1EQ0 A;  5DLG A;  1QDU B;  1YJW S;  2JH3 A;  2VFT A;  1IR2 A;  1FO1 A;  4LRE A;  3SXL A;  5B09 A;  1S6Q B;  4C0H A;  3T9Z A;  1CC7 A;  1WKK A;  4OQJ A;  4UUX A;  1GMW D;  3GYN A;  3ETM A;  3BGR A;  4C4W A;  3SCI E;  5D0G A;  3AOC A;  3IBF B;  1F3F A;  3TJ8 A;  2MZQ A;  4CWB A;  3MR7 A;  2XM3 A;  2C2M B;  1U8W A;  3Q8Q B;  2ZBP A;  1OYE A;  2ZH8 A;  2YQ0 A;  1H38 A;  2UU9 F;  1BLU A;  5L9X A;  4RBU A;  1EKR A;  3GZ7 A;  4F04 B;  4DR4 F;  3NMR A;  1BE4 A;  1NU4 A;  3CDW A;  2ZD1 B;  2VUG A;  4F3Q A;  5HMX A;  1REV B;  1UVI A;  2CQ2 A;  2RRN A;  5DM6 Q;  2BR0 A;  1RWN B;  3RAM A;  1U0H A;  1TUG B;  1X5O A;  1RWX B;  5KG2 A;  2XS7 A;  5KFU A;  2XSJ A;  2MZS A;  3C6U B;  3D0G E;  2HVZ A;  2YWF A;  3SV3 A;  2M70 A;  3M2U B;  4LSZ B;  3M2U A;  4IFY A;  3KJV A;  2DGW A;  2VPW B;  3I5B A;  3PW4 A;  2ACM A;  1JJ4 A;  4B3T J;  2BJE A;  2LA4 A;  4KGK A;  5F8I A;  2FJV A;  2K06 A;  2QLJ B;  1DHM A;  3FKB A;  3DLG B;  3WX8 A;  4ANC A;  4DFJ A;  2I5J A;  1Q95 G;  3V4I B;  4B9U A;  4K4V A;  4A8S A;  4RNF A;  3KLH A;  1B0T A;  4FF2 A;  3T6J A;  4URS A;  4YB1 P;  2E9Z A;  3LPY A;  1TKT A;  2E7X A;  1C0T A;  3MUM P;  2UVW A;  5KT5 A;  3W62 A;  3S6E A;  1YJN S;  3FRZ A;  3J7A N;  3N0V A;  1N34 J;  4FVC A;  2G13 A;  5IOL A;  3DHX A;  3NNC A;  1IN0 A;  5CQG A;  4ZVU B;  2DXD A;  4IUF A;  1WJ9 A;  1X60 A;  2BKN A;  1QLN A;  3QZ7 A;  1VQP S;  3CJ0 A;  2XZD B;  4KO0 B;  4ZVT B;  1IXK A;  5L8R C;  1D8Y A;  1RT2 A;  4EGL A;  1VRU A;  4LSL B;  1SQE A;  5CCL A;  1X5P A;  4WKY A;  2QJ3 A;  2OTL S;  4B9N A;  4GKJ J;  3FUY A;  4J9L A;  4DOZ A;  4LF2 A;  4K5S A;  1P8G A;  3KLF A;  3C3L A;  2UXD J;  3MAA B;  1WHV A;  2MQP A;  4KSE B;  1ZAW A;  3ENQ A;  2BRL A;  3L09 A;  3R27 A;  2B9W A;  3RZA A;  4OYB A;  5DG9 A;  2LDY A;  3QZ8 A;  3IR7 B;  3IM9 A;  2JEF A;  5IM0 A;  3LGM A;  2OPR B;  3B8H A;  5D15 A;  4DL7 A;  4WWS A;  1T9Y A;  2B43 A;  1APS A;  2WBM A;  3M6V A;  1ZM2 A;  3LO3 A;  4JV1 A;  1HI8 A;  4QR0 A;  1RHU B;  2HVE A;  3R8Y A;  2R8I A;  3OHA A;  3GIJ A;  1S6P A;  3GYX B;  4D3G A;  3MEK A;  2LVW A;  1DY3 A;  1ZA2 B;  3TR5 A;  1HNV A;  4LVO P;  1S1T B;  2PSZ A;  3NEK A;  2F5G A;  2XZT B;  4ZS6 A;  3CIM A;  3ETO A;  5L1I A;  1NHV A;  2OPS A;  3GLJ A;  4EYH B;  3FEY B;  5CHC B;  2G4B A;  2WSC C;  1VOM A;  1RWU A;  1RSC A;  1IKW A;  2DIV A;  2QLW A;  3E01 B;  3MM6 A;  3TW0 A;  1BWE A;  2RB7 A;  3ICL A;  3EPI A;  1TMJ A;  3GSI A;  4CO4 A;  2IYG A;  4Q2M A;  4DQS A;  3UVJ A;  3CGI A;  2EFQ A;  1TV6 A;  2KG1 A;  5C25 A;  3ONQ A;  2C3P A;  2FC8 A;  2GX8 A;  2O01 C;  3NGK A;  2DY1 A;  4PR6 A;  3A4T A;  1HKA A;  5KFN A;  2F40 A;  3V81 B;  1NK6 A;  2AEF A;  2CZ4 A;  2V0N A;  1WF0 A;  3ADA C;  4NCG A;  4PZV A;  3VGU A;  2AF6 A;  2DTJ A;  1AW0 A;  3PYD A;  4ZJL A;  3A1Y G;  2KT5 A;  2ROE A;  2ZBQ A;  3MM8 A;  1TK8 A;  1MWQ A;  4I1T A;  1P6T A;  3I0R A;  2DCU B;  3JSM B;  1FJG J;  1R8P A;  1SXL A;  3CVK A;  1T0T V;  3SYZ A;  2PFD A;  3MM5 B;  3SZ2 A;  1T9T A;  2AV5 A;  1NPP A;  2DKO B;  2DXE A;  3BRE A;  4OLP A;  1IQZ A;  3OT9 A;  3JXO A;  4ED8 A;  1RCX B;  2A1B A;  2B5J B;  5H1S V;  3AJ1 A;  1T94 A;  2IA0 A;  5KT4 A;  4QYZ K;  4PG4 A;  1YG0 A;  4WK1 A;  4JI0 J;  2PGC A;  3UD5 A;  3UR0 A;  5KG0 A;  1HPZ A;  3OUY A;  4CH7 A;  3T9N A;  1W2I A;  1KOH A;  3OQ2 A;  1AT1 B;  4ZVF A;  2PA8 D;  3GON A;  3QO9 B;  2VG7 B;  4Y34 A;  2XY7 A;  1M0S A;  4Q7A A;  4KV8 A;  3BQ0 A;  1HBM B;  5BYS A;  2JVO A;  3IG1 B;  4M5G A;  2YXL A;  2ZJQ Q;  1W2B R;  1XMO F;  4O0N A;  5LOQ A;  4BCA A;  2JC1 A;  3NGS A;  4EYI B;  1URR A;  4O4G A;  4C8N A;  3FMB A;  3QWU A;  3UDC A;  2C28 A;  3JQJ A;  4ZMM A;  3EGW B;  3KLE A;  2EXU A;  1EZZ B;  1Q4R A;  5HLF A;  3RGI A;  1WUU A;  2K3K A;  1B3T A;  4W92 B;  3F56 A;  2XCP A;  2B3T B;  3M30 A;  4CLT A;  2RDI A;  5KFB A;  1FI4 A;  3HK2 A;  4OZL A;  1JLE B;  4DN9 A;  3OBI A;  4Z37 A;  4K4W A;  4AE5 A;  4U67 Q;  3QFH A;  1JNZ B;  4USJ C;  3M1V A;  4W98 A;  2CWK A;  3R2C J;  4FNI A;  3K7R A;  3VGT A;  5CAA A;  2H1Y A;  3V4M A;  2VIH A;  1FXD A;  4NML A;  2GQ2 A;  4U8V A;  2MKJ A;  2RIJ A;  4AQY F;  5C25 B;  1RA7 A;  2WON B;  2X1B A;  2DNH A;  1UEK A;  3PCO B;  4I64 A;  4LRB A;  4I7F A;  4DV1 J;  2UUA F;  1JJH A;  1MU2 A;  5IWA J;  4ED7 A;  1NB7 A;  4Q5V A;  4DR6 J;  1MN9 A;  1RT5 B;  1PIE A;  1QAX A;  2VG6 B;  3RYL A;  1D09 B;  2WK4 A;  2VBW A;  1KLM A;  2ZH7 A;  3DN9 A;  3P5T L;  3UNG C;  9ATC B;  3T1Y J;  3M30 B;  2BZ2 A;  3FBF A;  1S97 A;  2BDP A;  4YOE A;  4L73 A;  1UKU A;  2OML A;  4A4J A;  2M88 A;  3G96 A;  2DR9 A;  4G1Q A;  2D41 A;  3A3O B;  3U1M A;  4QWA A;  5HP1 B;  2N82 B;  4KR0 B;  1TMM A;  3R6G B;  1WWH A;  2DR8 A;  4DPY A;  1S99 A;  1LKZ A;  1NK4 A;  1VIS A;  1NH8 A;  1RTD A;  2BOP A;  4M8L A;  4EZ6 A;  1NDK A;  5F41 A;  1J2V A;  3RW7 A;  5B08 A;  2AP6 A;  2FGO A;  4MYU A;  3FK4 A;  2L41 A;  3HPO A;  4ZLL A;  3BBC A;  4J9P A;  5KFS A;  1OY6 A;  3LQV A;  1TTH B;  3CCE S;  2IMW P;  2H5J B;  3ZZZ A;  2F9J A;  1NHK L;  2A6M A;  3HVR A;  3QT8 A;  3OUY B;  2KXF A;  3EZU A;  2ZH4 A;  4DSE A;  1Y00 A;  3PX4 A;  1PGZ A;  1JJ2 R;  1N5T A;  1DFD A;  4UTG A;  5LJ3 Y;  4DUZ F;  1JNR B;  4O3N A;  5L1K A;  1NKC A;  1TKZ A;  2DGO A;  2R7S A;  5HVG A;  2FJB B;  4E2F B;  1S49 A;  1WEY A;  4DU7 A;  4JUZ A;  4MH8 A;  3R7N B;  5KFR A;  4QW9 A;  2AJ2 A;  4HEA 9;  2YKO A;  3EVO A;  2MQN A;  2PI5 A;  3BM7 A;  3MMA A;  3SQO P;  4G1P A;  2RQK A;  3TYT A;  2BQU A;  3G87 A;  4ECU A;  4G65 A;  3CUN A;  3GSD A;  1VQ8 S;  3KYL A;  3PFE A;  4BC9 A;  1UVK A;  2F9D A;  4BBY A;  1JLA A;  1KLN A;  3KK3 A;  1UJ4 A;  4GC7 A;  1HMV A;  3CC2 S;  3OFF A;  4DN0 A;  3VQS A;  1S57 A;  2AJ4 A;  2HQG A;  2ALY B;  5A8K B;  5KAK A;  1OPI A;  5L46 A;  4B3S J;  1XWL A;  1Z2L A;  2EC2 A;  3PEH A;  1NKE A;  3T1A A;  4PWW A;  4RU2 A;  4M95 A;  1N48 A;  4R0E A;  2NYH A;  4M5H A;  5KG5 A;  4L74 A;  1EJ7 L;  1UWA A;  4ITS A;  3TVK A;  3MR2 A;  2VC0 A;  4FDF A;  3Q86 A;  4EK2 A;  2JEG A;  3C14 B;  3HI9 A;  1TV6 B;  1YDL A;  3KG1 A;  2XSJ B;  4JI0 F;  3E2E A;  2BYC A;  5J1E B;  4ZOS A;  3GG1 A;  3W9J A;  4A46 A;  1Q8I A;  2LKZ A;  4ZVE A;  1U1K A;  4GVB B;  2HLT A;  3QWP A;  3VAJ A;  1HR0 J;  5K8N A;  2LQ8 A;  3K8W A;  1NDP A;  4DV0 J;  3NGT A;  3FFI B;  1U1N A;  1BMQ B;  4Q8F A;  2HNZ B;  2R9L A;  2AEM A;  5B7W A;  3G8T A;  1CJK A;  2DNL A;  3M7V A;  3NS7 B;  1T95 A;  3EXY A;  4M5N A;  5BXI A;  1Q7Y T;  3I0S B;  2EK6 A;  2AYB A;  3FQK A;  1K1Q A;  4FVM A;  4P71 A;  2U2F A;  2MY7 A;  3TZW A;  2KZZ A;  1OQ6 A;  3PRD A;  4IQM A;  3TZX A;  2Q1L A;  4OZ3 A;  2CJK A;  3AFG A;  1NB2 A;  2AGP A;  2B8P A;  2C42 A;  2ZOF A;  4O3Q A;  2DR5 A;  4LFC F;  3MEG B;  1AXQ A;  2D3O R;  5J1E A;  2B4V A;  2DD8 S;  3SCK E;  2RQC A;  2NLW A;  4GKJ F;  4MT1 A;  3W2W A;  2Z56 B;  5KFQ A;  5D8H B;  2AYE A;  2XMM A;  3BB5 A;  2IVF B;  2X1A A;  1CG2 A;  2RQM A;  2G9O A;  4KO0 A;  4NLQ A;  4OIX A;  3S01 A;  4B17 A;  1S59 A;  3A8J A;  4H4M A;  5A8K A;  4Q0B B;  5CYJ A;  3T1H J;  1QE1 B;  5F3Z A;  4MIA A;  3GIR A;  1XNQ J;  4WU2 A;  2FJX A;  1PJ5 A;  5JVG Q;  3CCU S;  2RH3 A;  3H98 A;  2J76 E;  5GAE U;  2F63 A;  1H73 A;  4Z7Y A;  2DNP A;  3MGJ A;  1IBC B;  1TKD A;  2AJF E;  2XUL A;  2YKN B;  2P2C B;  3BSC A;  4DV5 F;  4PXC A;  3GIM A;  2HS0 A;  3PZP A;  3DM2 B;  3KJQ B;  2LDI A;  2AGQ A;  1S76 D;  1CQM A;  2ZBR A;  1LXJ A;  4YY3 F;  3HXM A;  3AY0 A;  2IJR A;  1KWM A;  1VQO S;  1PBU A;  4DR5 J;  4JI3 F;  3HKZ D;  2H4Y B;  1Q5Y A;  1G7C B;  5CD4 H;  2V63 A;  1X5S A;  3CNQ P;  4J9S A;  3HZE A;  2XMA A;  2GCF A;  5B0F A;  4I69 A;  1BQN A;  4K0K F;  3T5H A;  2ZUA A;  2QL5 B;  4MK8 A;  3G8S A;  3AJD A;  1XNR F;  4OYA A;  4Y3C A;  4PXE A;  4DPU A;  2J9D E;  5ETR A;  3JSY A;  3MWB A;  6FD1 A;  3BO2 A;  4ECX A;  4PEO A;  4ED1 A;  2J6S A;  4DSJ A;  2IMO A;  3BGR B;  5F0W A;  2ERR A;  2RKI A;  4N8O A;  1X4E A;  2XYP B;  5K20 B;  2B7C B;  2OHD A;  1WDT A;  4K5R A;  1N32 F;  3QT5 A;  4DV7 J;  1S9E A;  1GT8 A;  3ITH B;  5LMU F;  2IY5 B;  3MR6 A;  4C8Z A;  1YJ9 S;  2HHS A;  4GO7 X;  4U7U D;  2G1D A;  3J7Y I;  1I3O B;  2C22 A;  1NSK L;  1RK8 A;  2F4V J;  2DVI A;  4DV1 F;  3MCM A;  1JX4 A;  1H72 C;  1FVQ A;  2B51 A;  2EFO A;  5FII A;  1MU2 B;  2HGL A;  5HK4 A;  5KFE A;  3EPG A;  4WFX A;  5J2M A;  5B0G A;  3PO5 A;  5KFK A;  4OX9 F;  5D0E A;  4LF5 J;  5A76 A;  2M7S A;  1SC4 B;  1P1L A;  3EMT A;  1VR6 A;  3M9M B;  2F4F A;  1JLG A;  1WD6 A;  2FZK B;  3AAW B;  4XPC A;  4JI8 J;  2HHX A;  2OPS B;  3O1L A;  2FB0 A;  2MST A;  3FGV A;  3KDO A;  5ETN A;  4LMZ A;  4G3I A;  2DGT A;  4K4U A;  3M2R B;  1UWB A;  3DOK A;  1UWB B;  1KNZ A;  4HAC A;  5E33 A;  1WNE A;  3VAH A;  4NZ0 A;  1RHM B;  4RUC A;  2FZC B;  1ULR A;  4O4G B;  5IV4 A;  3KLE B;  1X9S A;  2IM2 A;  4I6W A;  2JZ5 A;  4RNO A;  2VBZ A;  5EDW A;  2D3O 1;  3BR8 A;  4P72 A;  1GK8 A;  1P1T A;  2RF2 A;  3POT B;  4F7V A;  2XO6 A;  4OZN A;  2UVV A;  2IC3 B;  2R7V A;  5DG8 A;  1DJ0 A;  1LWF B;  1RUS A;  4KIA A;  1EET A;  4MIW A;  4RUH A;  1M90 T;  3EM1 A;  3PY8 A;  4HT5 A;  1BUX A;  2V5H G;  3PM9 A;  3QO9 A;  1VQK S;  4LF6 J;  1S9G A;  5D6G A;  4FXV A;  4I2Q B;  4I2Q A;  4ILL A;  3I96 A;  3DRS B;  4AXI A;  3J81 j;  1M5O C;  4H54 A;  3KLG B;  1VJW A;  2ADC A;  3MCS A;  1D9F A;  3K5L A;  1IWA A;  1TAU A;  3CSK A;  2ZKT A;  3UW1 A;  2DGX A;  2HQF A;  3IFE A;  2IM3 A;  3SSR A;  2UXD F;  3KMQ A;  1YJ7 A;  1U26 A;  2MQL A;  3MM5 A;  2EVZ A;  4BC7 A;  4F3M A;  3K57 A;  2OTJ S;  1Q53 A;  1RKJ A;  4X4Q A;  4FBU A;  3W2V B;  4M5K A;  2B0G A;  3TEG A;  2AX1 A;  4K59 A;  3QGG A;  4G6V B;  1RDR A;  3ZTS A;  2ZH2 A;  1FE4 A;  2VHG A;  2YNF B;  3AD8 C;  3UD4 P;  1JK9 B;  1FRI A;  1T02 A;  3QIP A;  2DHX A;  3IRX B;  1KP6 A;  4A8X A;  1FD8 A;  2XS5 A;  1GMW A;  4NMX A;  4R25 A;  2VFV A;  4LRF A;  2HFZ A;  4OI3 A;  4ZVO B;  3K17 A;  3OLA A;  1LK7 A;  3RRK A;  4H4M B;  3KLG A;  4GKK F;  3B54 A;  2LXI A;  2NXJ A;  2V34 A;  5LJ5 Y;  3Q89 A;  1T9V A;  2HFO A;  4DQR A;  1LW0 A;  1OSC A;  2VPZ B;  5GAE I;  2L9D A;  2KB2 A;  2YWK A;  3M8P A;  2QA4 S;  5CD4 A;  4WTY A;  1U2C A;  3W2W B;  1UMJ A;  4ED3 A;  4M5D B;  1LWF A;  4ELV A;  5I42 A;  4ZVS B;  3WX4 A;  1KFD A;  4CO3 A;  4CLZ A;  3UDE A;  4XDC A;  3OFG A;  1RHJ B;  2R4F A;  4CRJ A;  2ZKU A;  1S6U A;  2IRX A;  2V8D A;  3BZQ A;  3FC9 A;  1HNZ F;  3VF0 B;  4N41 A;  4I4B A;  4O0I A;  1JXV A;  1S9F A;  1HW9 A;  8ATC B;  3CD6 S;  1EHW A;  5HL7 Q;  2OI2 A;  3M2R A;  2R7R A;  3G82 A;  2AGO A;  2AMC B;  5KFW A;  1V5V A;  1XK8 A;  4DR4 J;  3VAK A;  2YWG A;  3ZNU A;  1NME B;  3LA0 A;  4CLK A;  5GAG U;  4LFA F;  4DQQ A;  2FVS A;  4UY8 T;  4DI6 A;  1H74 A;  5RUB A;  4QR2 A;  4K7Q A;  1MSW D;  4B3T F;  4DR5 F;  5KT7 A;  2W2P P;  1RWW B;  1DTQ A;  1S1W B;  3SBM A;  2MQO A;  2B9Y A;  3CCM S;  2DRB A;  2HQC A;  1ZET A;  3X3U A;  4I0W A;  3HO1 A;  2CPD A;  1VMB A;  2QSF A;  3Q8R B;  4OHW A;  4CO5 A;  1GFW B;  3GFY A;  3MAA A;  1VYA A;  2EFN A;  5D4O A;  5GAD I;  2KRB A;  3M8Q B;  1X7V A;  2VJU A;  3OW2 R;  3PYF A;  4ILR A;  2IIH A;  3QPI A;  1FDA A;  2NRE A;  4J37 A;  2V94 A;  3QRQ A;  1UW9 A;  5KFH A;  1M1K T;  3DOL B;  4O44 B;  1X4B A;  2CA9 A;  2RML A;  3AOD A;  2IM0 A;  3MMC A;  5E3Q A;  5KG1 A;  1UW4 A;  4L75 A;  4B3S F;  4HI2 A;  2RS8 A;  3BGU A;  5DO2 A;  5J2Q B;  2Q66 A;  1HFE L;  1J5E F;  1RTI A;  3ENW A;  2VB6 A;  1HW8 A;  4C3L A;  3P6Y C;  1R7I A;  3T6B A;  1RAC B;  2GIR A;  4WJB A;  1C4A A;  2XMW A;  1WC1 A;  1VQY A;  3TP2 A;  4XAK A;  5E3A A;  1FFS B;  2HK3 A;  3AOA A;  2GQC A;  3AT1 B;  3VCD A;  4KGZ B;  2I5J B;  2E44 A;  1C0U B;  2YY3 A;  4NL5 A;  1GAO A;  5HBM A;  4RWW A;  2HZA A;  2IPO B;  4USU A;  4ENO A;  4Z7C A;  4ED6 A;  2ASJ A;  2DCL A;  1PSD A;  4N47 A;  2HZC A;  1NJX A;  2DEJ A;  3RG6 A;  2BA9 A;  3IGN A;  3NGU A;  1N0V C;  4BS2 A;  2ZH9 A;  4DCJ B;  2HK2 A;  1GX5 A;  1FT8 A;  2DIS A;  3HHK A;  3H0P A;  3D28 A;  1GMU A;  4KPY A;  2YNH A;  5FD1 A;  5B0C A;  4RW9 A;  2OFH X;  4URG A;  4J7C A;  3TJ9 A;  4ZVQ B;  1JLA B;  4N56 A;  5KFZ A;  5KFA A;  5HAN A;  4BHQ A;  3QJL A;  1LQ9 A;  3CCJ S;  1DLO B;  4YDX A;  2DNY A;  5AT1 B;  1SUQ B;  3MEC B;  1MLA A;  3QNW B;  2AT1 B;  3BS9 A;  4EBE A;  2C2Z B;  3ZZR A;  4FYY B;  3SCJ E;  2KKH A;  3ELH A;  2Z2Y B;  4QIE A;  3KDN A;  2BJ9 A;  2M5Y A;  4C98 A;  2CQ1 A;  3FSX A;  4LF6 F;  2F4V F;  2VZ9 A;  2MKH A;  1U6B A;  4DXL A;  1JLF B;  1H7W A;  2Y0B B;  3I82 A;  2CVE A;  4UQT A;  1JIH A;  4NYZ A;  3CC4 S;  1BHN A;  1P27 B;  1HHT P;  3V5R A;  2A3J A;  1HWL A;  3M2V A;  4BLG A;  3QBC A;  5ETM A;  3TVZ A;  4LFB J;  4DS4 A;  1DQ9 A;  5IT9 U;  4RW8 A;  2UUC J;  4ECZ A;  3H25 A;  4DSI A;  2B6A A;  3KOA A;  1XJW B;  1T11 A;  2XI3 A;  4DF4 A;  4IRC A;  1BXN A;  2LLZ A;  2XYG B;  2ILY A;  3HF5 A;  1UJ5 A;  5CYQ B;  1DTT B;  2OEJ A;  3AD7 C;  3KLI B;  3NRB A;  2OKQ A;  2NSB A;  5HMY A;  3J80 Y;  3GMG A;  1UTA A;  4DMZ A;  3IN5 A;  5D0H A;  3F73 A;  2QO3 A;  3TI0 A;  1FDD A;  1Y0H A;  3TUP A;  2PFF B;  4YHH J;  3TEH B;  4MAK A;  2P9C A;  5DGB A;  4IR9 A;  3V6H A;  4HHJ A;  2W2M P;  2YVS A;  2QL9 B;  2ZDO A;  4TN2 A;  2DNR A;  4ES3 A;  1XMO J;  4ZKA A;  4QW8 A;  1PC4 A;  2F7V A;  4B08 A;  5E7O B;  4CP5 A;  3EXC X;  2FVQ A;  2IBK A;  3J7A 1;  4XPE A;  5KFC A;  2LYV A;  3N4W A;  5HO4 A;  4IO9 Q;  3DRX A;  4B3O B;  2HQI A;  2A0F B;  3BN4 A;  3QRP A;  2ZC3 A;  2E7W A;  1KLM B;  2V2V A;  3G6V A;  3EYZ A;  2C2R A;  2YNH B;  1JB0 C;  4LBP A;  3SQG B;  1PKU A;  5E3C A;  3PYE A;  4M1K A;  5E3P A;  3GR0 A;  3CJT A;  2WON A;  4ZLP A;  4HKQ A;  2ZFH A;  1ARO P;  2CRL A;  3RTV A;  1LW0 B;  1SV5 B;  2B56 A;  4JI4 J;  2X3D A;  5B0B A;  4FS2 A;  2E9R X;  3EIC A;  3MMJ A;  1NLK L;  2WB1 D;  2V67 A;  4RW6 B;  4PUO B;  1RT1 B;  4C8O A;  3DOM B;  1U1O A;  2OD6 A;  3EE3 A;  3H2U B;  3UR3 C;  3HHL B;  3LAN A;  4X66 J;  2ZH1 A;  4J9O A;  5K14 B;  4ECS A;  4ED5 A;  3MUV P;  1YBT A;  4QWE A;  4TKT A;  2VOD A;  4LF8 J;  3UQS A;  5HP1 A;  1JMT A;  1NH7 A;  2V9K A;  5J2P B;  1SKU B;  5CH7 B;  2V4Q A;  1RT4 A;  4EUV A;  1UZD A;  1I94 F;  2UXC F;  2GNK A;  2ZOM A;  1B0P A;  4QWC A;  1KR4 A;  3MD3 A;  2IRY A;  4P7T A;  2DO4 A;  4P10 A;  1CLF A;  4OX8 A;  1KSP A;  2QV6 A;  4KV8 B;  1KDN A;  1NJI T;  4K8R A;  4FPR A;  4XK8 C;  4DV6 F;  1G6B A;  1FK9 A;  2FY8 A;  5AE2 A;  3PW2 A;  3I6P A;  2VG6 A;  2VQE F;  1YJR A;  4AL6 A;  1WDD A;  4XIU A;  2FUG 9;  4WFB Q;  4A8F A;  3MED B;  2DO0 A;  3OSN A;  4JI7 F;  2IFX A;  5J2Q A;  2MZ1 A;  1I1G A;  3OXG A;  3Q8S B;  3H20 A;  2RDD A;  2VA2 A;  2AD9 A;  2XNQ A;  2ZBC A;  1YI2 S;  1UEV A;  2IC3 A;  2Z30 B;  5EWE A;  3HP6 A;  5HVH A;  4PUO A;  2Z57 B;  2KYZ A;  2P9E A;  3MD1 A;  4IG3 A;  1RGV A;  5G0R B;  1S12 A;  4CT9 A;  4JV5 J;  3THT A;  4KHP J;  5GME A;  4IOC Q;  3OTE A;  1QTN B;  4ZPV R;  4CTA B;  4WCE Q;  2DPJ A;  3M6U A;  4ZVR B;  3JQM A;  4JB8 B;  1JQG A;  5GMK a;  5D3G B;  1VLY A;  4QZV B;  1HD1 A;  2GJ2 A;  3C15 B;  3DGP B;  1AFJ A;  1HIY A;  2XNR A;  2R8J A;  1RJJ A;  4X2B A;  2FVP A;  4V19 X;  4K4Y A;  2N4C A;  2HND A;  1H2T Z;  1OJ4 A;  4RW6 A;  3BV8 A;  4QJV A;  4ZCL A;  1JLB A;  1OQ3 A;  3LF0 A;  3P45 B;  4YR0 A;  4TQS A;  4JI3 J;  3OTO J;  2MHE A;  2VD3 A;  4EO8 A;  4PQU B;  5KFG A;  4M5M A;  3W9I A;  4I67 A;  2YKA A;  1Q86 T;  2NZ4 A;  4JI6 F;  4DV5 J;  1XNR J;  3KJN B;  1SPB P;  2XMK A;  1CVJ A;  4X64 J;  1Z4U A;  2DY9 A;  2F8H A;  3AQP A;  1L5U A;  2X3G A;  3F44 A;  3EGZ A;  3BPD A;  4UT4 A;  1S7I A;  3RJM B;  1F5B A;  5CXT A;  4DV2 J;  1N5Q A;  4DL5 A;  2J8S A;  1UAW A;  2J8A A;  3TAM A;  1VK8 A;  1LWC A;  2XQC A;  1WOO A;  4AL7 A;  1SJ3 P;  4UQG A;  2J0S D;  2GQQ A;  1GXT A;  1FRK A;  1Q7L B;  2CNL B;  2FVC A;  2DGS A;  4NRU A;  4DX6 A;  3BO3 A;  3OL8 A;  4OYW A;  2HMI B;  3FNN A;  4DV6 J;  3W8G A;  3IWN C;  2QYC A;  3RUB L;  5J2P A;  1CPZ A;  1VI7 A;  1XN9 A;  1NJZ A;  1TL7 A;  2CYY A;  5A2Q Y;  3AD9 C;  2V68 A;  2WVF A;  1NKB A;  3HVA A;  3PNI A;  4LSN A;  5C7P A;  3MM8 B;  1SJF A;  1AFI A;  4TVA B;  3THV A;  3BPS P;  4WE1 A;  5KOX A;  1QM9 A;  4PKD B;  1YBA A;  1M5S A;  2DR7 A;  1BQN B;  1S0M A;  4Y2C A;  4F4Z A;  3QGH A;  2FHJ D;  2DIU A;  4UZC A;  4UOC A;  2M52 A;  2OEK A;  4RW8 B;  5IT4 A;  1VQ7 S;  2Y1L B;  2ZWP A;  5B0D A;  2FPH X;  4H4K C;  3RRH A;  5K8M A;  2D9P A;  1WOR A;  2OUG A;  1YRT A;  5AJ3 F;  3MR3 A;  2W8K A;  1W25 A;  2E7V A;  1S4E A;  5DLF A;  4N8N A;  4QYZ J;  1FJ7 A;  1HI1 A;  2CG8 A;  2LFV A;  4CO2 A;  3ISN D;  4YP3 A;  2BQ3 A;  3RRG A;  3J80 U;  5ETP A;  4NE9 C;  1ZTW A;  2MLX A;  4C3K A;  2PDA A;  4AYB D;  3GV7 B;  1VIO A;  3K2Y A;  3HKW A;  1TKT B;  2L48 A;  3BSO A;  1L3S A;  3VZH A;  1DAX A;  4MYT A;  2FZG B;  3ZZO A;  1XIQ A;  4WBF A;  5DDR C;  3ILO A;  1R3N A;  3HT3 A;  2HRY A;  3KFW X;  3A8I A;  4Y00 A;  4CLW A;  4X84 A;  1QSS A;  3KHR A;  3JTP A;  3MMC B;  4ZDN A;  3BDP A;  2KFZ A;  1RA6 A;  2ACY A;  3K8V A;  1HNW F;  1Q16 B;  2XLI A;  3MHY A;  2HHW A;  2XHC A;  2IM1 A;  1E6Y A;  2XMV A;  1IKX A;  4JI2 J;  2R8K A;  2R2T A;  1J5O A;  4X66 F;  4DG1 A;  4O3O A;  5E5N A;  4RUA A;  4ES1 A;  1C2P A;  2XBP A;  4KBI A;  1GTH A;  3MM6 B;  3PXG a;  2E1M C;  1FEE A;  4PWD A;  3NP5 A;  4FKX A;  3TNV A;  3IGV A;  1Q8K A;  4NI2 A;  4P2X A;  4TU8 A;  3S8S A;  3I55 S;  4ANE A;  3FQL A;  2F8M A;  4TY9 A;  3OVS A;  4OI0 A;  1JWW A;  3R5B A;  4K4T A;  4DQP A;  4JI5 F;  3CCW A;  1RTI B;  5IV3 A;  4Q44 A;  4IFV B;  2YKP A;  4HI1 A;  1GX6 A;  3KNG A;  4YQW A;  3L7O A;  3CJK A;  1IM4 A;  1N6Q A;  5IT0 A;  3K5M A;  2CPZ A;  1ZTT A;  1Y10 A;  3NG8 A;  3QSI A;  1X9W A;  1R8H A;  1WTB A;  1A0O B;  2J6T A;  2CPH A;  2ABY A;  4ZPD A;  2RT3 A;  3FSY A;  1S5Z A;  4AUK A;  2RVJ A;  4USW A;  4EEY A;  4JI1 F;  4LF4 J;  2EBE A;  2PMH A;  1N5Y A;  3BF4 A;  5DQG A;  1A7G E;  2OFG X;  2X51 A;  5IC4 B;  5DET A;  2DHA A;  3C8Y A;  4ZPB A;  3LH2 S;  2U1A A;  2YX4 A;  3PTW A;  2IVY A;  3HFZ B;  4IFY B;  4Y6I A;  1WEL A;  1WOP A;  4X4S A;  1S1W A;  4R0J A;  3KJV B;  4F2R A;  1I6J A;  2JL9 A;  3L95 X;  4UOG A;  4ELT A;  2WAQ D;  2J9E A;  3CO9 A;  1T7P A;  3NL0 A;  1NSP A;  3FMW A;  1S1V A;  1EP4 A;  2ILZ A;  4J9U E;  4P75 A;  1B70 B;  3W5Z A;  2NZC A;  3DM2 A;  5EX3 A;  2CNK B;  2VG5 A;  2HVD A;  3PKM A;  3VGS A;  1RI7 A;  1LFW A;  2KHD A;  3AOB A;  3MMB A;  4ZP7 A;  2V50 A;  3OTD A;  3VVU A;  4AFF A;  2A2C A;  1ROF A;  2EG2 A;  2XZW A;  3L7U A;  1IKV A;  3DDI A;  3TX8 A;  4F2S A;  3IWL A;  4IQX A;  1FKP B;  4CZC A;  4WK3 A;  2GIQ A;  2H9Z A;  1RTZ A;  2HHQ A;  5M2R A;  5CCM A;  1KHW A;  2PN6 A;  3ZC4 A;  5EX0 A;  3MM9 A;  3R3T A;  1HLW A;  2O1P A;  1HQU B;  2OPP A;  3HFV A;  5DQI A;  4O3P A;  1U45 A;  2FLN A;  2XB2 D;  2GHW A;  2V2Q A;  1UL3 A;  4V1A k;  2VQF F;  4JI6 J;  1RTD B;  4IH6 A;  4NLU A;  5HQL A;  5LMN F;  3VTI A;  5HMW A;  2JLG A;  3CCR S;  4WFA Q;  2DNZ A;  2WRM A;  2E5I A;  3B6B A;  3HVT B;  5HAO A;  4EBC A;  1R0A A;  1S9G B;  3CE8 A;  1IQT A;  3GP9 A;  3LTO A;  2Y1I A;  1LXN A;  2CQD A;  3RBZ A;  4DSK A;  1LW2 A;  2BBE A;  3K5N A;  4B3M F;  3HZG A;  2XTJ P;  3L9Z A;  2PII A;  4A8M P;  4DCO B;  4X4V A;  3KLV A;  4LSN B;  3QJP A;  1KVI A;  2JLE A;  3P96 A;  1NK7 A;  4B9M A;  1NSA A;  3AB4 B;  3ZTP A;  1N52 B;  3D1O A;  4CM0 A;  5SZT A;  3JQK A;  2HHU A;  1FNO A;  2HUR A;  1DZ5 A;  2OLW A;  4F0K A;  2OEM A;  3KMS A;  4KH1 B;  3MAH A;  2JJ4 D;  3QAU A;  3ZTO A;  3M9N B;  3BYP A;  1NK8 A;  2V8V A;  5D0R A;  5ADZ A;  1W26 A;  2FC9 A;  3JYT B;  2CAJ A;  5F8N A;  2ZZM A;  2D9O A;  1C1B A;  4EMD A;  2F8E X;  2VFR A;  4I6A A;  3GV5 B;  4E8U A;  1FX4 A;  2DR6 A;  3O5T B;  3U7J A;  3NS6 A;  4F4A A;  1UET A;  2HNY A;  3C16 B;  1HQE A;  4YUD A;  1MN7 A;  2Y9H A;  2QEX S;  1IBK F;  2MGZ B;  4I7F B;  5ETV A;  1RAF B;  3O44 A;  1K1S A;  3M8P B;  4ECY A;  1T9X A;  2J9C A;  2R2R A;  4HLB A;  1FJG F;  2LEP A;  4OJ1 A;  2GHV C;  5C42 B;  4DV4 J;  1X4A A;  1XQI A;  4ER8 A;  3ZZY A;  4CLL A;  2VQF J;  3T5J A;  2HHH F;  4X4N A;  4QIG A;  4KFB B;  2R8G A;  1YKW A;  1GEH A;  1R8C A;  2W2N P;  1UA1 A;  4DV3 F;  3CJR A;  4TLQ A;  1RAO A;  2CFX A;  3GYG A;  2HAF A;  2IBO A;  3I32 A;  2F65 A;  4CQ1 A;  2JHE A;  2J7W A;  4DR2 J;  3OTB A;  2ATL A;  1RT7 A;  4HDH A;  2XMT A;  3E51 A;  2FHM A;  2J7U A;  4PG5 A;  4QQB A;  3RAQ A;  4LF7 J;  3GIK A;  5EWF A;  3MEE A;  5F8L A;  4ALZ A;  1Q8L A;  4TY8 A;  1EAY C;  1UP1 A;  1WEX A;  2ZNZ A;  4QPT A;  1R8B A;  1EQM A;  4K4Z A;  5F3T A;  1RTH B;  3DI6 A;  4S0M A;  2NPF A;  3U02 A;  5B0A A;  4RUB A;  4USK A;  5GAH I;  3Q2S C;  1CS4 A;  1TVR B;  2PT0 A;  3ILI A;  2XGP A;  3T3F A;  1D9D A;  1ZOT A;  4ERD A;  1KQG B;  1FNM A;  2DH9 A;  2ALZ A;  4ZVP B;  1WOS A;  3CCL S;  2BAN B;  1N4L A;  1AB8 A;  4KHM A;  3RR7 A;  1KQF B;  3MM7 A;  4J9R A;  1PG5 B;  3TUI C;  1IM6 A;  2PD1 A;  4U6P A;  4KTQ A;  2VKZ G;  3M8S A;  1S9E B;  3VAG A;  3HHN B;  1C1C B;  2JVR A;  1N5V A;  2DRD A;  1YRU A;  1MWY A;  2DXF A;  5A0Y A;  5DDO C;  1H2U X;  2G0C A;  4DX5 A;  4ZIT A;  3OHB A;  2ASY A;  3D5M A;  4OZ0 A;  2M2B A;  4NA2 A;  4NCB A;  4NAS A;  4R5P A;  1OS5 A;  2MMY A;  1Q78 A;  2YNG A;  3DOM A;  3JS9 A;  2MLZ A;  3HHL A;  3FCH A;  3DLG A;  3GB0 A;  1T05 B;  3CDU A;  4NLV A;  1S1V B;  5MLC V;  3OSP A;  3NBP B;  4X62 F;  3DRS A;  1QSY A;  2JLF A;  5JMN A;  2XY6 A;  4OHZ A;  2RNE A;  4Z2X A;  1SV5 A;  2HWI A;  1X5T A;  4TNO A;  4HL9 A;  2CUY A;  1BQX A;  2UU9 J;  4F0M A;  1D0E A;  2VON A;  2GGP A;  4PYD A;  4OZ5 A;  3TZZ A;  3RW6 A;  1CS4 B;  1R31 A;  1TVR A;  2OSQ A;  3L7P A;  3S1T A;  5KFI A;  3JTN A;  2V4R A;  4KJI A;  1KON A;  4IOB A;  1RLC L;  4I2P B;  2BE2 A;  2JX2 A;  1NK0 A;  2GMH A;  3W3S A;  5CA5 A;  4OJ3 A;  5MAO A;  4ILM A;  1FKO A;  1MML A;  2BKP A;  2FGC A;  4PAB A;  2M8H A;  2DEI A;  1JLE A;  2DNK A;  2AJ0 A;  2KDO A;  1NHU A;  1Q1K A;  2B8Q A;  2H54 B;  3MOZ A;  1YIT S;  5EHH A;  2G0J A;  4LRD A;  3A12 A;  1YJT A;  1T9U A;  3VGV A;  2EKY A;  3H40 A;  1VC0 A;  2XLK A;  4OZ2 A;  2FVR A;  2YNI A;  5LMN J;  1SJ4 P;  1SL0 A;  1MRO A;  4RX6 A;  3I4H X;  1SIZ A;  2E5H A;  5IM0 B;  3D67 A;  1I51 B;  1UEU A;  1J27 A;  3M32 A;  4IDK B;  3NY0 A;  4NI2 B;  3UDV A;  2K1R A;  2YBV A;  3ZZP A;  1EX8 A;  4AL5 A;  4LT6 A;  1FRJ A;  1TL1 A;  1VGY A;  2XWX A;  1JLC A;  1RBL A;  2UUC F;  3QID A;  1PIL A;  2Y1J A;  2B6A B;  1UJ6 A;  3CF5 Q;  3M8W A;  3ILL A;  1A6L A;  3HVT A;  4OZJ A;  3MCO A;  4MK7 A;  3W5Y A;  1KEK A;  4NXM J;  2N7Y A;  5HMZ A;  1SC3 B;  4LSL A;  3RU0 A;  1C1B B;  3G71 S;  3SFG A;  4DZ6 A;  4YY3 J;  2M9K A;  1AZS B;  1QAJ A;  3GCX P;  1B64 A;  1O51 A;  2HWT A;  1VRU B;  1U6F A;  1YJV A;  2AZ1 A;  2Q79 A;  2D7S A;  2R7O A;  2Z2Z A;  4GVL A;  4WFN Q;  2DH8 A;  5E41 A;  3JYT A;  1YHQ S;  3UPF A;  4LF8 F;  1FWP A;  5C2G A;  4DS5 A;  4C3M A;  1ITP A;  2QYG A;  4ETZ A;  2UUW A;  3DLE B;  2KO1 A;  2QN6 B;  4Y2I A;  1ICE B;  3F41 A;  3UE2 A;  1KQK A;  3KK1 B;  1VJQ A;  1O8B A;  5HRO A;  1OIA A;  3PFO A;  2WSF C;  4JYA F;  1F5A A;  2JFD A;  1TL3 A;  1YGY A;  4HTJ A;  3CCZ A;  3TVY A;  2DPI A;  2HWH A;  4A47 A;  5CZV A;  1XMQ J;  4U96 A;  3IS9 A;  5F8J A;  3BGO P;  5J2N B;  4I2P A;  3MFH A;  4KC5 A;  1U1P A;  4RW9 B;  4X62 J;  1FTR A;  2QC3 A;  3EVM A;  1DQ8 A;  2NXN A;  1VHI A;  5E0O A;  1U48 A;  4LFC J;  2MJN A;  3A8K A;  4DG1 B;  3I9V 9;  1R0A B;  3DLK B;  1LFP A;  5DM7 Q;  5EWG A;  4HDG A;  3DGV A;  1S1X B;  1PBA A;  1S1X A;  2C3U A;  3LAL A;  4RKU C;  4AND A;  1RB0 A;  3BQ1 A;  1CJV A;  2AX0 A;  2CQP A;  5FJ4 A;  3HM9 A;  5HQ8 A;  4P6Q A;  4CYU B;  1JXE A;  4LFA J;  4E0D A;  2E5L F;  4WE1 B;  4F4W A;  3I5A A;  2BE7 D;  3TAQ A;  2AJQ A;  3KK3 B;  4Q45 A;  3NNH A;  1QD1 A;  1U09 A;  1R8A A;  3A3N B;  2BEF A;  2X1G A;  1D8Z A;  4ZVG A;  4EO6 A;  3OJU A;  1N6Q B;  1RT3 B;  1WTF A;  1ZPW X;  2C3M A;  3J81 Y;  2D1C A;  2GV1 A;  3BKU A;  1VFJ A;  3HSJ A;  4NLX A;  1HNI B;  1CBK A;  4M5L A;  4YB7 A;  3PYG A;  2Y8W A;  1C1C A;  2HGM A;  2O67 A;  1EP4 B;  1GXU A;  1NZ8 A;  2GFF A;  2OO4 A;  2V8H A;  3B78 A;  4KAI A;  5BYR A;  1U8S A;  2M0G B;  3US5 A;  3UNY A;  5KFM A;  1HHQ A;  3PJW A;  1HYS B;  1FJC A;  1AUS L;  2LU2 A;  3SEO A;  2YKM A;  2EKN A;  3D6H B;  1TKX A;  2XLJ A;  4FYV B;  1RWM B;  4LUB A;  4IH7 A;  2KVQ E;  4RBV A;  1Q82 T;  1JLC B;  1U25 A;  2YTC A;  2HBZ B;  3IBW A;  5K8O A;  4C8K A;  4LF9 J;  3LGN A;  2EFP A;  2BVZ A;  2FQQ B;  1E6Y B;  2RUG A;  2RDJ A;  2GMJ A;  4ETX A;  1RT2 B;  1FJE B;  4DV3 J;  4NEY A;  1N33 J;  3UWT A;  2VBY A;  2QL7 B;  7FD1 A;  2WW4 A;  4U7U K;  2BW2 A;  2MHN A;  2N3L A;  2KG0 A;  1WSV A;  1CJT B;  5IXU A;  3D2W A;  1PYS B;  4KHP F;  4DEZ A;  2OH2 A;  4PG7 A;  3I31 A;  3IO1 A;  4QPX A;  5IS2 A;  4UOF A;  3PW0 A;  4Y65 A;  4GO5 X;  1F2H A;  1KS2 A;  2CG4 A;  1RAD B;  3KUG A;  3R6L B;  2JWN A;  1AA1 B;  4QOT A;  2HHV A;  3W1Y C;  2VV5 A;  3PR4 A;  3FCW A;  2YX1 A;  2WB4 A;  3D1H A;  2V4J A;  2R2S A;  1RWO B;  5KFP A;  1IBK J;  1VQN S;  2LQ9 A;  2B9E A;  1WHX A;  2LP4 A;  3P3D A;  2GHP A;  3G8Q A;  5C42 A;  3V4I A;  1EAR A;  3AHP A;  3PHT A;  1RHQ B;  4WYL A;  1TKZ B;  3NOG A;  3EGV A;  4WU3 A;  1B4S A;  2Z4P A;  3VZI A;  4ZIV A;  2DB1 A;  1N36 F;  1HBO A;  2VG7 A;  3IA0 A;  5G4D A;  2ZVS A;  3CJS A;  4PCQ A;  1LK5 A;  4JI8 F;  3W66 A;  4DZD A;  2QA4 G;  1RE1 B;  2YQ3 A;  3NAI A;  4GC6 A;  1SKR A;  2ZHB A;  5LSR A;  3WIV A;  3RB3 A;  1XBW A;  1IKY A; 
#chains in the Genus database with same CATH homology
 4KY3 A;  1HNW J;  4X66 J;  4DUZ J;  4NXM J;  2F4V J;  3IMQ J;  1J5E J;  5A2Q U;  4YY3 J;  4LF8 J;  4B3S J;  4HHU A;  1FJG J;  3D3C J;  1N32 J;  4PWW A;  4LF5 J;  4DR1 J;  4DV4 J;  4JI2 J;  2VQF J;  4K0K J;  4JI8 J;  5LM7 E;  4JI0 J;  1XMQ J;  1HR0 J;  5LMU J;  4DV0 J;  4DR2 J;  4KYZ A;  4X62 J;  5AJ3 J;  4LFC J;  4LF7 J;  2E5L J;  2UUB J;  4AQY J;  4JV5 J;  4B3M J;  4KHP J;  4B3T J;  2HHH J;  2MEW A;  4DUY J;  4RJV A;  4LF6 J;  4LFA J;  4LF4 J;  4OX9 J;  4JI1 J;  4JI7 J;  3J7A N;  1IBL J;  4X65 J;  4JI3 J;  1N34 J;  3OTO J;  3R2C J;  2UUA J;  1HNX J;  4JYA J;  4DV5 J;  4DV1 J;  3R2D J;  1N33 J;  2VQE J;  3T1H J;  4X64 J;  4NXN J;  4DR7 J;  5IWA J;  1N36 J;  4DR6 J;  4LFB J;  2UUC J;  4B3R J;  4GKJ J;  1XNQ J;  4DR3 J;  2KVQ E;  2UXD J;  2MTL A;  4JI5 J;  4DV2 J;  1IBM J;  5FLX U;  4LF9 J;  2UXB J;  3T1Y J;  3JAM U;  4DV6 J;  3D3B J;  4YHH J;  4DV3 J;  4NEY A;  2UU9 J;  2ZM6 J;  2KL8 A;  4DR5 J;  4JI6 J;  4V1A k;  1XMO J;  1I94 J;  2UXC J;  3J81 U;  3W1Y C;  2MQ8 A;  1IBK J;  4NEZ A;  5BR8 J;  4DR4 J;  4GKK J;  5IT9 U;  5LMN J;  1XNR J;  1HNZ J;  4JI4 J;  3J80 U;  4DV7 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...