4FNIA

Crystal structure of isdi-w66y in complex with heme and cyanide
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
110
structure length
110
Chain Sequence
AHMFMAENRLQLQKGSAEETIERFYNRQGIETIEGFQQMFVTKTLNTEDTDEVKILTIWESEDSFNNYLNSDVFKEAHKNVRLKSDDDGQQSPILSNKVFKYDIGYHYQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Heme-degrading monooxygenase isdI
publication title Inactivation of the heme degrading enzyme IsdI by an active site substitution that diminishes heme ruffling.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
total genus 30
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature ec 1.14.99.48: Heme oxygenase (staphylobilin-producing).
pdb deposition date 2012-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03992 ABM Antibiotic biosynthesis monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4fniA00
2K1RB 1YRXA 2GV1A 4EFAC 3QGPA 4U9RA 4A47A 4DN9A 1Q4RA 3IWLA 3BGUA 1Y0HA 1X7VA 2FTRA 1K0VA 1YJUA 3BDEA 2ROPA 1N5VA 2W4PA 2LXFA 1FVSA 2CRLA 1Y3KA 2KT2A 3HFKA 1IUJA 1FE0A 5B0EA 3CJKB 4DL0C 2ZDPA 1ULRA 3WDOA 3HHLC 1VQYA 1YJRA 1MWZA 2BYCA 2OFGX 2XMJA 3KNGA 3HDSA 1Y9OA 2AW0A 4YEAA 2GO8A 4HL9A 4DPOA 1TR0A 3MZIA 4NL5A 4OJ1A 1SI9A 3BM7A 2VH7A 1V3ZA 3FMBA 2OMOA 3FGVA 3T9NA 1YJVA 2AJ1A 1S6OA 1FVQA 2RILA 3QMQA 2HFOA 4OJ3A 1SB6A 2HFNA 3KKFA 2XMVA 2GFFA 1YG0A 1WD6A 2RMLA 1VQSA 3I9ZA 3E8OA 5B0CA 2LQ9A 3HHLA 2K1RA 2XMTA 3IWXA 4YDXA 4OJHA 1SQEA 2ACYA 2QLWA 3KG1A 1MWYA 4Y2MA 5B0DA 2BJDA 1KVJA 4HI1A 2OAUA 3TRGA 2GGPB 2IYGA 4QOTA 5B09A 2ROEA 2ROGA 1TZ0A 1XBWA 3KG0A 2XMUA 2GGPA 2AP6A 2W4DA 4OJGA 5A6WA 1KQKA 4A46A 5F0WA 3BR8A 1OQ3A 3CJKA 3VTIA 3LO3A 5A6PA 2QIFA 2G9OA 3HX9A 2HIQA 1QUPA 3BN7A 3GZ7A 4Y2IA 1R6YA 4Q2MA 1X0PA 1URRA 4Q2LA 4Y2KA 4HH0A 1FEEA 3TOQA 5B08A 3F44A 2ASYA 1N5SA 1Q8BA 2K2PA 2N7YA 1AFJA 5B0BA 5IXUA 2IFXA 1TL5A 4ZA1A 3DXSX 2BBEA 2FB0A 3HF5A 2Q3PA 3MCSA 2W4CA 1Y3JA 2N4DA 1N5TA 5B0AA 1KVIA 4F67A 2BJEA 2RSQA 1P8GA 1S6UA 2VV5A 3HHLD 1AFIA 2XMWA 2FHMA 1FE4A 2LDIA 2L3MA 1JK9B 2XMKA 2JDJA 1Q53A 2AJ0A 2HQIA 5B0GA 1X8DA 2BUNA 3LGMA 2XMMA 1U7LA 1AW0A 4A48A 2KT3A 2EW9A 2K7KA 3UDCA 1CC7A 4NPOA 2OD6A 4FNHA 2OD4A 4HI2A 4HH1A 2K7JA 1GXUA 2HLTA 2OP5A 1CC8A 1APSA 1CPZA 1RJJA 1GXTA 2ZDOA 2IYIA 3BF4A 2RU9A 5KAKA 1JWWA 4FNIA 2KYZA 1FESA 1N5QA 2PD1A 3K7RA 2OKQA 1YJTA 2OFHX 5K9FA 1P6TA 1TL4A 1TUVA 4A4JA 2N4CA 2FIUA 2QLXA 2GA7A 5B0FA 4OIXA 5F0UA 1OPZA 3BB5A 4ZOSA 2PGCA 3TNVA 1W2IA 1OSDA 1OQ6A 2QYCA 3LGNA 5T7LB 2KKHA 1LQ9A 1Q8LA 2GCFA 2HLUA 2LQBA 3DCAA 5T7LA 1FD8A 3FRYA 3HHLB
chains in the Genus database with same CATH superfamily
3MMCB 2RS2A 3M8WA 2V94A 1Q5YA 3T6BA 2GMHA 4D3GA 3MM7B 4FXWA 4OQJA 5D6GA 4K0KF 3HCXA 3QO9B 5KFAA 1NCLA 2QLWA 2ZH1A 2GGPA 4I68A 1ZTWA 2R8IA 1FNMA 3K8VA 3TUJC 1FEEA 4CT8A 4JI8F 1IKWB 2EFQA 4X64J 3S1TA 1VDHA 3OSNA 2L3MA 5HMWA 2YWKA 2NREA 1R89A 2VKZG 5LOQA 3BN4A 4UW2A 3OFHA 3UQSA 3DLJA 1K44A 3NOCA 1BWVA 2BOAA 2R8GA 4TU7A 1D8YA 2DRDA 4WE1A 3K7RA 1RWVB 1R31A 4G1QA 1Q7LB 1B3TA 1FKAF 1R0CB 1TMJA 4AT1B 2RB7A 1WTBA 4FKYA 1U2FA 1W26A 2MKSA 4M1KA 2FUG9 2KFYA 5KFIA 1L3UA 1O8BA 3MURP 4KJIA 5DG8A 5IWAF 3H4BA 4Z7CA 1KLMB 2OGUA 1SQEA 1C4CA 1H73A 2BJDA 3MDFA 5KFCA 2HHVA 1ZAXA 3L7PA 3KUGA 3IM8A 4RNFA 2OPSA 1NJXA 2GVZB 2WONB 2VQFJ 3DLKA 2XMKA 3AY0A 4WF9Q 4WIQA 4RJVA 4PCQA 4W98A 4E8UA 4NXMF 4Q0BB 3M6UA 3V81A 2FHJA 2Z56B 1VQ5S 5D4NA 2KJVA 4I6YA 3ZZOA 5C5JA 3I9V9 5A8WA 1H2UX 1PIEA 2PT0A 5IS2A 4IRCA 2R7SA 1LW2B 2WSEC 1KOOA 1GQEA 3PHEA 3W9IA 3OW2R 1RWXB 1LWEA 2KVQE 3PJXA 4L3KA 4DUTA 3ZXWA 4KH0B 5HROB 2E5LJ 3ISNC 2J8SA 2HFVA 3J81Y 2R8HA 1NDCA 2ERRA 4DPWA 1X4HA 2E1AA 3IBWA 5K14B 5BR8J 1T7PA 3TJAA 4J9QA 2GMJA 4J9UE 3CVKA 4DR1J 4DL4A 2ZBCA 4RWWA 2GJFA 4PPZA 1UMJA 3O2IA 3KJVA 3LA0A 3SQGA 3Q8UA 3MEGA 2C2DA 3J80Y 2XB2D 2C3PA 1YITS 2EFGA 3TX8A 3QRPA 2YKOA 1QY7A 3RBDA 4KKOB 2E7WA 3OVAA 4CYUB 4UF4A 2CNNB 3DRYA 5LM7E 2MHNA 1N5QA 2RDJA 1KN6A 2VG6A 1RT2A 3D2WA 1FX4A 1U1OA 2CPEA 2CZ9A 3T6JA 1T9UA 2HVZA 1NBEB 4MYUA 2HQGA 2BEFA 1NK8A 1JQGA 3MD1A 3M2VA 3GWCA 2QA4G 4LIWA 2R8JA 3QJPA 1BWEA 1NDLA 1JJ4A 2RILA 1RHUB 2H5JB 1YG0A 3MR3A 1VQSA 5EX3A 1S1TB 3D6TB 1QDUB 4RW7B 4QWCA 1HBNA 3H42A 2NS1B 2LEBA 1TKDA 1U25A 4RNMA 2QIFA 5DZ7A 2Z0GA 1S12A 4OX8A 3F44A 5C25B 1OYDA 4WJBA 1UFWA 5JUMA 4P2XA 4F4AA 2VA2A 1LWCA 2P6SA 1T94A 2CNOB 4NLSA 4PZVA 3KLVA 2B3TB 3JYTB 4BLGA 4F04B 3Q0AA 3D1OA 5AJ3J 3LP2A 1HYSA 4C98A 3I56S 1M1GA 2D3O1 2AZ3A 1VBYA 2ZH9A 3CEDA 3SV4A 4DR2J 1S1XB 4ZLLA 2XNQA 2I1RA 3UR0A 4ERDA 3DU6A 1KTQA 3NWRA 3TZYA 3AJ2A 1HBOB 4G65A 5A8KB 4K8RA 2FLNA 5HMYA 2BOPA 3FEXB 4HTJA 3T9ZA 3BGFA 2KM8B 1WNEA 4GO5X 1V5IB 4L6V3 2AJFE 3EXCX 4RNNA 4PQUA 4QOTA 4XIUA 1S77D 5D4LA 1QUPA 1TKTB 4ID5B 1SC4B 3IAM9 4LUBA 3OUYA 2KYXA 3PRDA 2N4DA 2W24A 1NSQA 4WYLA 2Y3YA 1KVKA 1G7CB 3RR8A 3HO1A 4NRUA 4MJKA 2BJ3A 1Z2ZA 2CJBA 1VLYA 2VPZB 5AE3A 2JWNA 5KG0A 2G2OA 1OYEA 2OTLS 1N48A 4G1IA 1KOHA 3BREA 4EWTA 3QRQA 3SFGA 1NJWA 2GCFA 2PC6A 3TJ9A 1HMVB 1HD1A 3IR5B 3MPUB 4RUBA 2AEFA 4NLQA 4DV0F 2IAJB 2YWGA 1U6BA 2X51A 2EC2A 4AD6A 1HKAA 1BHNA 1URNA 1GTEA 2JFDA 3MM7A 5IV4A 2FDNA 1JXVA 5T14A 4USVA 3QO9A 5DM7Q 4JI6J 2ZH7A 2PFDA 4DQPA 2XWYA 1SJ3P 5I3UB 3VZIA 3IA0A 3FSIA 1NEEA 3C15A 4TLRA 3A12A 2RQMA 2YBVA 4OL8A 4KPCA 1CLFA 4K4UA 4B9SA 4LRAA 4GKKF 2ZWPA 4LREA 2DH8A 2G1DA 4K4YA 2HNZB 2WTFA 3K57A 4ZS6A 4FXDA 4WXOA 3PZPA 5A2QY 5F9NA 1SL0A 2IA0A 1BQNB 4ER8A 2HVDA 4USHA 5HLFA 2RQCA 1RQ0A 4ED6A 2DRAA 1RT6A 2E29A 2K1RB 3GYGA 4HHJA 2OH2A 1SJRA 1E6VA 1MSWD 3EGVA 3I55S 6FD1A 1HNWJ 3KUEA 3VCDA 4H54A 1RA7A 2W9BB 3JAMY 1WC4A 2AEJA 4HT5A 5KT5A 2QC3A 3RB4A 5AXKA 4JI4J 5G0RB 4WFNQ 2IM3A 3K17A 4LT6A 2CQIA 4I1TA 5KT7A 2NCKL 4HH0A 1HNXF 3ZNJ1 1Y7PA 5IXUA 1XR5A 3W66A 5DO2A 4EMDA 1R3NA 4DV3J 3GJTB 3LF0A 5KFFA 1BE4A 3LH2S 1GMUA 4O3QA 4XK8C 2J9EA 4OHXA 4DFJA 3MMBB 3NG8A 2WSFC 2ZHBA 1JJCB 2B9YA 1WORA 1WELA 1HNIB 4FNIA 1NH8A 1ZH5A 5K5MA 1X4DA 2GS8A 3CCUS 4BBYA 1R6VA 5JXSA 2X3GA 2KG1A 2F8HA 2XCPA 1N34J 1PILA 3P5TL 4ECYA 2CKWA 5L39A 3PO5A 2DCUB 4QYRA 1SQGA 5DQGA 2CQCA 4Q8FA 2CZ4A 1SPBP 3SFUA 2VZ9A 3GG1A 1ZS6A 4NLVA 5KG6A 3RRGA 3B4DA 3RBZA 5KG2A 1KD1T 4B9LA 3CC4S 3OJSA 3SV3A 4JI3F 3N6LA 2AKWB 4TQSA 2FPHX 5D0RA 4DX7A 2NQPA 5D8HB 1HQUB 5HANA 3D9BA 1YJ7A 3OFFA 4RW8B 2WOMB 3TR5A 3MOZA 4QIVA 1SKSA 2W4CA 3CF5Q 2M4MA 4LR7A 2K3IA 2XGPA 5KT4A 2KB2A 4I64A 4AL6A 3BPSP 3C19A 1IBMF 3BZQA 2V0NA 3W7BA 4ECVA 4CYUA 2MZQA 4RU2A 4JI2F 2MY7A 3FKBA 1GXLA 2AV5A 1KFDA 4OHWA 5B0FA 3OV7A 1M1KT 1RT5B 2Y8YA 1IJEB 5F8JA 3UE2A 5CAAA 3N4WA 2VODA 5J2MA 1FTCA 1X7VA 5D0EA 2VF3A 3T5HA 3T5JA 1AROP 1TELA 4GKJJ 3HFKA 3BGRB 4ZPDA 4XO0A 2OPQA 2VOPA 3OTOF 1SKUB 3CT9A 2F4VF 2VPYB 2HW3A 2HWHA 2HGNA 2L9WA 2V9KA 3RU0A 4RW7A 1HI8A 1OQ3A 5GAHU 1NSAA 5D0HA 1ZYQA 2AJ4A 4ZJOA 4OYPA 1NK4A 4ANEA 3CDAA 5B0BA 4KHRA 3TA0A 1LW0B 4ES3A 1S72S 4BDPA 1S10A 5C25A 3RB6A 4ALZA 2M8DB 4F67A 3WQPA 3T1HJ 4ETXA 3LPEA 9RUBA 3DDIA 2OI2A 1DRZA 4B9TA 3QT7A 3B54A 3UDVA 2ZITA 3BV8A 1YRTA 2B7CB 3J81j 2CNKB 4PUOA 3PACA 1YRUA 2H51B 4JV5J 2CQDA 3C6UA 2VH7A 3DDNA 1D09B 1MN7A 1GFWB 2GJIA 5J2QB 1ZZFA 3RTVA 3TO8A 4GVLA 4L76A 2XLKA 2AQ4A 2RHQB 2BZ2A 3CSKA 3QJLA 1XMOF 5KFEA 2HFOA 4DMZA 1S57A 2DGWA 3IXQA 4IH6A 3SCJE 1H0HB 1TKXB 1UVKA 3MCNA 3CJKA 3SSSA 3RB3A 1Y5IB 4MKVA 3TVYA 1LWXA 2IM0A 4BS2A 2RUSA 2C2MB 4ID5A 4TXSA 2NUHA 1CSJA 3FEYB 4M95A 3CGIA 4B9UA 1V3SA 2ZE2B 3PYEA 1ELOA 3K58A 5CD4A 2HQIA 1S6PB 2ZHOA 3CJSA 4KHPJ 1ICEB 3QT8A 1REGX 2PMHA 1XR6A 1K1QA 1JLEA 2HFZA 3D0GE 3O8WA 4ECRA 4IDKB 2GC8A 1T9YA 3NGSA 4X66F 3H5UA 2Z30B 1HQ2A 1JLAA 2CPDA 3QGIA 4CNYA 4X4NA 1HWKA 2MKYA 2LXIA 3GMGA 3NMRA 3HVRA 1HMVA 2K06A 2IA6A 2JFKA 2H5EA 3AH6A 2YH1A 3X3UA 3NP5A 1Y3KA 2NPIA 4K5SA 2V8GA 3HKZD 3VAMA 1NLKL 2A18A 3C16B 2XI3A 2IAJA 3HT0A 2B7BB 3SSQA 2IRYA 2AYMA 4ECWA 1MMDA 1IQTA 3GU0A 1YQHA 1NJIT 5BJRA 2ZH2A 4O4GB 2LKZA 5M2RA 4A8YA 1LXJA 4DCPB 2ZWOA 1TAUA 5E3PA 4Y34A 2DY1A 3CCES 3B8HA 1WG4A 3QIPB 4LFCF 2DKOB 2UUCJ 2B6AB 1PYTA 1IKYB 2JHEA 1X60A 4K5RA 2VICA 4QR1A 4JB8B 2HVEA 1FI4A 1DHMA 5KFQA 4R0EA 4N47A 2PGCA 5SZTA 1LQ9A 2VASA 3U1LA 2GV1A 2AZ1A 2ZZTA 1RTDA 3W9JA 1H7WA 1U8SA 2QL5B 1UWBB 2HMIB 4UTGA 5C42A 3A3NB 3Q89A 1YIJS 1JLCA 1VK3A 3E2EA 3P3DA 2FGOA 1FDNA 4PEOA 3LGHA 1H72C 2W9BA 4YN3B 1NJYA 2EXUA 2ACYA 3EDRB 2V69A 1OS5A 3M8SA 3I5BA 3EYZA 2UUWA 2VHGA 4OV6A 2W7PA 5H9EK 4JI0J 3L95X 4O23A 2ASYA 4QZVB 1IXKA 3G6XA 2UUBJ 2CIMA 3P4UB 1BC6A 4DR7F 4NMLA 1ZTTA 1WOOA 1R8CA 3IM9A 4HACA 4KH1B 2HSEB 5J1PA 4DL7A 1MNEA 3BYPA 2XEXA 5KG7A 1WI8A 2FHKA 2L9NA 1UA0A 1HNIA 2P9EA 2Z2YB 2EG2A 1OY6A 4NA2A 4WKRA 3C14B 1N54B 1LK5A 4J5OA 3R5AA 2XS7A 1IWGA 1WI6A 2XZTB 1N5VA 3KFWX 1U6ZA 3JSYA 3MEEA 2R2UA 5KFWA 4V19X 3W5ZA 1L3TA 1Q7YT 5KFGA 3HK2A 1S1UA 1PSDA 4FDFA 1T9TA 4R0JA 1YK9A 5B09A 2R7TA 2AP6A 5KFZA 2L48A 2CPHA 4CO0A 1DQ9A 1M5VC 3MF5A 3ILOA 1R27B 1FDAA 4IR1A 1DLOB 1FNXH 4ZCKA 1QD1A 3BSNA 2WOMA 4ZVFA 4C8YA 1Y3JA 2QA4S 4MKAA 2WAQD 1FKOB 3AHPA 5D3GB 5CABA 2HS4A 3JQMA 2V8DA 3LWMA 4OX9F 2MLYA 4ED0A 2Q6BA 2KI2A 4LF8J 2DNKA 3L4BC 4N8NA 4X2BA 1G2EA 3HHNB 4I2QA 5FDLA 4GC6A 5JVHQ 3D6FB 2ZKUA 2BE2B 1FX2A 2NXUA 2JVRA 1HFEL 1VQMS 1NK7A 5GVQA 2ZKTA 1N4LA 3NCRA 3O3LA 5HP1B 2ATLA 3HT3A 2ZDPA 2IHR1 2VJVA 3AOAA 3FMBA 1UFKA 3QQCD 4DV1J 3MM6B 1MMNA 1TL3A 2A0FB 1PYSB 2Q79A 4OJGA 2F4FA 1Q82T 1U45A 2HQDA 4EBDA 4HT7A 2BQ3A 1RHRB 2LVWA 2XY6A 3O6QA 1AFJA 3AB2B 2Q3PA 2KXNB 2AYGA 1BMQB 3BBCA 3UDLA 2W9CB 3K89A 2J9CA 1U7LA 1F2HA 2DITA 4PXDA 3GILA 2Y0SD 5ETLA 1MLAA 4DU8A 5K9FA 4HTIA 2O5DA 3UDEA 2AGOA 4H4KA 3TAPA 4DBQA 2MQOA 5KFKA 2ADBA 3SXLA 5J2QA 4JBCA 4DV6F 4G3IA 2XSFA 3UN5A 5ETQA 4LF4J 3WHIA 2V8PA 4FF2A 1EKSA 3ZZTA 1MROB 2OMOA 4HKQA 2OSRA 1L5UA 2XSJB 2CQ4A 4J9SA 1ZBTA 3UD4P 1TKXA 4MK9A 3LANA 3EGZA 3KLGB 5LSOA 4X62F 3VF0B 3KJNB 2IFXA 1EAYC 1SC6A 2FB0A 5LMUF 3MM5A 2VKRA 3CCQS 3B78A 1SV5B 1T11A 1N33J 2ZE2A 1A0OB 4HHUA 5ETVA 3JTOA 2DRBA 4DR4F 4DL6A 4DV7J 1H74A 1T03B 3NOGA 3R97A 4ES2A 2HWTA 4AL5A 4ZVQB 4IDKA 4J37A 2HHXA 3RUBL 1OSDA 1ACMB 4IO1A 1NB2A 3W61A 3IWLA 4C2MA 3ZZUA 1EP4B 4NYPA 1FVSA 2LQJA 5J2NA 2ZOGA 1A9NB 2Z8QA 2DH7A 2DNZA 1OMSA 2HAFA 3ZC4A 3VAGA 2RD5C 1KHVA 3I32A 4UZBA 1NNDA 4X4UA 2E9ZA 1FDBA 5IM0A 2ZBPA 3DOMB 2BE7D 3QJJA 1SL2A 5A6PA 1RWWB 2AGQA 1RT3B 1TK8A 2WZ1A 3H59A 1WEYA 3K5NA 3H5XA 5E33A 1LXNA 1NXIA 3CJ3A 1HWIA 3TAMA 2OHDA 4CH0S 4DI6A 5ETNA 4DL5A 3KLEB 1HL6A 2DEJA 3JQJA 1XMQF 3BDPA 3TZXA 4LFAF 1IKYA 3DM2B 3G71S 5FJ4A 2ZEJA 2ILZA 4Y2CA 3IAS9 3Q8VA 2OKQA 2VQEF 2KRRA 2W2QP 5GADI 5EWFA 1EQ0A 4YOEA 3KLIB 1T05A 1T9WA 1T02A 2IC3B 2QYCA 2MJUA 2R8KA 5IT9U 4KE5A 2F3JA 4U7CA 3C3LA 1UA1A 4FF1A 1NPPA 2B4VA 3CCTA 1Z2LA 1UWBA 4O3RA 4PRFA 3MMAB 2BJ8A 4HHHA 4FYXB 3K59A 1YJVA 3SCKE 1WJ9A 2XLJA 1HIYA 1KVJA 2ROEA 2EFOA 2YPZA 1GMVA 1IBLF 4UOHA 4ED1A 4Y2KA 2WW4A 3QZ7A 2YX4A 1HWLA 2N7YA 4X64F 1HLWA 4AXIA 5GMKa 1RISA 2O3DA 4NLOA 5GAGI 5H9EJ 1LWFB 3ZFVA 3RGIA 1HR0J 4ZMMA 3BO3A 3GJSB 4B08A 3DYAA 2OTJS 2UP1A 2ALYB 4P73A 3LP0B 4ZN1A 3CMES 3MPWA 4ZP8A 2HKEA 3HJFA 3UO0A 1S0OA 2MHEA 1O6XA 2AJQA 1NSKL 1VQLS 1U49A 1HBMB 4DN9A 1H3DA 1D3WA 3V4MA 5CZXA 2PMWA 1WEXA 2DR5A 2G0CA 1FRMA 4C4WA 3KK1B 2G2YA 2F8EX 3M2RA 2PA8D 2VFUA 4YEAA 2HRTA 4JI5F 2V8HA 4OZ1A 1U2RA 2Z58B 4OI2A 4M5LA 4IQXA 3M30B 3G96A 2KN4A 1O5JA 4RUCA 1WG1A 1KSPA 3J7AN 2MQNA 4BHQA 5LXYA 4X65J 3BR9A 4QYZK 1X5OA 1NHKL 4WFZA 3C2PA 2V63A 1FE4A 5HL7Q 5I3PA 4LSLB 1X5PA 4JI1J 1FJGJ 2UXDF 1XQIA 4BWJA 4P74A 5IT9Y 2QL7B 1CC8A 1R43A 2KXFA 1WF1A 4WFAQ 2HBRB 3EGNA 2IIHA 2BW7A 2N3OA 1QVGR 1IKVB 1RU1A 4KC5A 4P10A 1S0MA 2BE2A 4MKYA 4K50A 5KFRA 3HHLB 2C28A 5J1NA 4YB6A 2KTQA 1WC3A 2ZH6A 2C2NA 1RWPB 4B3RJ 1U48A 3WX8A 3D0HE 3I5CA 2XHCA 3I0RB 1HPZB 1Q79A 1S99A 3MM6A 4PXBA 1LFPA 4LF1A 2OAUA 3ZO7A 5F3TA 1RK8A 4EUVA 4J91A 2LMIA 1VOMA 3LOUA 3MGJA 5AE1A 4E98A 4DZ6A 5IOLA 3K5MA 3RZAA 4KR0B 2OELA 4NASA 1M5SA 3PO4A 1RTIA 2RRNA 2DR9A 1UPPA 4ZITA 2NLWA 1I3OB 1CEZA 8RUCA 4LSNA 2R3VA 2PN6A 4XPEA 2E7XA 1FFWB 2VC0A 4CO5A 1Q81T 3U02A 1VQ7S 2DNHA 3W65A 1WTFA 2L08A 4WBFA 4L74A 3HHDA 4ZCMA 3AT1B 4LRBA 2J0WA 3PIPQ 2ZJRQ 1VRQC 3G82B 2FVRA 3H2VE 1LOUA 1DURA 4IFVA 3D5MA 4Y3CA 3D68A 2XSJA 2PDAA 4OJHA 4C0HA 4CO2A 3TRGA 3PYFA 3PW7A 1NPRA 3BR8A 4CWBA 1PBUA 3AQPA 2E5IA 1FRLA 4ES1A 4MAKA 3KLGA 4S0MA 2CYYA 4C7QA 5DDOC 1B64A 4V19J 4F50A 1N6QB 1W7WA 4JOUA 2DHGA 2HVHA 4OZLA 1SV5A 5HQMA 1JLBB 2W25A 1JLQB 3QYYA 4DUZF 3RBEA 2QZ8A 3J7Z5 5AJ3F 1WHVA 4A4JA 2ZH8A 2XO6A 4ECTA 4FPRA 2YNGB 3MCOA 4WP3A 2AU0A 4H4MA 1WHWA 3M32B 4ED7A 2CA9A 3HVTA 4OYAA 2EPIA 1ULRA 2UZAA 4OYXA 2YKPA 1VJWA 3SCLE 2CJXB 4KGVB 1XR7A 3VGSA 2EKYA 3FQLA 1RT3A 2X3DA 2XYPB 5L1IA 3K0JA 3VR1A 1FRXA 4ELVA 3RRKA 2GO9A 4NYZA 2FVSA 4B3MJ 3SMZA 1VQ8S 2XLIA 3T5LA 3HSDA 1TL1A 2GHWA 1C1BA 1RZMA 3QAUA 3IN5A 4PXCA 3DM2A 1FWLA 1Q16B 1I5OB 3RR7A 1KONA 3HMJG 1I94J 4F0KA 4TNOA 2FJEB 4QR2A 1XNRJ 3NGDA 3AD8C 2DEIA 2GNKA 4KV8B 2WVFA 4LF7J 1QE1A 2FD2A 5KT3A 5FD1A 4KO0A 1V9OA 4DSJA 2YNHB 3KLIA 4C3MA 5KFBA 2IC3A 2EK1A 2MY8A 2YKNA 1RHKB 1RTJB 3ZZRA 5IC6B 3GIJA 4RW9A 1MWZA 2BYCA 3MMAA 4IG3B 3W8PA 3FGVA 1NKCA 4ZLNA 2RMLA 1B0VA 1GMWD 3MWBA 4YMEA 2W9AA 3IO1A 1SC1B 4B3SF 3A8KA 4ETZA 1RYSA 4Y2IA 1Y00A 3HSJA 3MPVA 4NE9C 5L9NA 1X5SA 5B08A 2AD9A 2RUGA 2XC9A 4K0KJ 3AJDA 4DR6J 4ZHRB 3PX0A 4F0HA 1PJ7A 3TZWA 1YVFA 2XWXA 1LWFA 2CUYA 3GR1A 5KFVA 4AXJA 2MZ1A 1NAQA 3D1HA 2RIJA 4JI8J 1PJ5A 1U1QA 3NNAA 2R4FA 3IP0A 2MZRA 1GXTA 4NLPA 4ZP6A 1NU4A 1P9YA 5KFPA 3ZTPA 4P2SA 4DS4A 2HZAA 4CTAB 3OR2B 3HFVA 4URSA 2LA4A 3CD0A 4QR0A 5DLFA 1XEZA 4A47A 3OXGA 1HBMA 1RHQB 2I5JA 3FBBA 1NZ8A 3SCIE 5CCLA 4O4RA 2HQCA 2CJYB 3KK1A 3HP6A 2E1PA 4M5MA 2PI4A 2E44A 4YUDA 1U1LA 4USTA 5H1SV 4WFXA 4ZVHA 3MM9A 4C8KA 2YQ1A 2ZUAA 3KWMA 2ZM6F 1WDTA 1TMMA 3KG0A 4QQBA 3JSMA 5KG1A 2A1BA 4DSFA 1I6JA 4B17A 3VVUA 3ZZZA 5IWAJ 4OZ2A 3DXSX 4ZVRB 4WE1B 2ZNYA 4G1QB 4N7TA 3EPIA 3QT6A 3M1VA 2P6TA 1EX8A 4DV2J 4QYZJ 4EZ6A 3DGPA 4PWUA 3UNGC 4LSLA 5A8RB 3PDNA 1EARA 3BH6B 2OD6A 1FRIA 1R8AA 5CHCB 5E7OB 4YP3A 1D9FA 1P1TA 5KAKA 5HJXA 1FRJA 1VGYA 1CG2A 3H98A 4UOGA 1JLGB 1IKVA 3DOKA 2DGUA 3OLAA 1W2IA 4NXMJ 2RAQA 3MPDA 1AB8A 1KKHA 2ALZA 3QWUA 1Y9OA 4ED8A 1XNQF 4TQRA 1VK8A 4KY3A 3I31A 2B0GA 3CCLS 1WHYA 2G13A 3RAQA 3BO4A 1HPZA 3N6NA 2MDAA 2WB4A 3UN3A 4QIEA 5HSPA 3DLKB 8ATCB 3RB0A 3LO3A 4Z7YA 2CQHA 5U47A 3G9CA 3CDEA 2R2TA 1CVJA 4AE5A 1EZZB 4FP9A 2XNRA 3QGHA 5C24B 4UQTA 1T3OA 1S6UA 1CS4A 3HPOA 3DRRB 1YHQS 2B4OA 1BY9A 2BRKA 3MCMA 4IFYA 1Y11A 3OBIA 2ZDOA 3UWTA 2B43A 2MZSA 4ZIWA 1RB0A 3FDSA 3MR7A 3UCGA 1HWUA 2JH3A 7FD1A 4ZVTB 4OHVA 2YTCA 3DRSB 4B9NA 3GSDA 3H7HB 4NLGA 1JNZB 4P7VA 4RNHA 2C3MA 2IM1A 4DDFA 4QPXA 3CD7A 3NNCA 1VQYA 2PMZD 3G82A 2E5HA 1UTAA 4ZIVA 4K4VA 1YI2S 1YWXA 3KJVB 3SQGB 2XMVA 3VAIA 5JVGQ 2DNOA 3MEGB 1JNRB 3KG1A 1V3RA 2BJ7A 2XHWA 4RKUC 1R0AA 2CPJA 1AUSL 2XYHB 3Q2TC 1ZM3A 3TVZA 3THPA 2DR7A 3HHKA 2XYGB 4DQIA 4OYZA 1VR6A 4X4OA 2DR8A 4ATNA 2DNNA 2R7RA 2VG6B 3T1HF 1RT2B 2O67A 4CH7A 3R6LB 2JDJA 1B7YB 3NS6A 1JLBA 3UDCA 4X4RA 3I0SA 1WC1A 1N36F 2K7JA 4IG0A 4J9KA 2CPYA 3M2VB 1YJTA 4KT0C 2LQ8A 2VFTA 3BQ1A 5DZ6A 2YNGA 3N0VA 3G6VA 1Q8LA 3DOLA 1S7HA 2VBZA 3FRYA 2W7OA 1T0TV 3GB0A 3M32A 4L3NA 2ZC3A 1RU2A 2CRLA 4QU7A 2VOOA 4KQZA 5LT5A 4C8ZA 2YKMB 1M5PC 2DYAA 1OJ4A 2QLBB 2HEKA 1ZPVA 4P71A 4RX6A 2RVJA 5B0CA 3HVAA 1CJTB 2G2ZA 2FLOA 2DBBA 1IM6A 1Q86T 3VGVA 5L38A 3PJWA 4DWIA 4Q2LA 2FJXA 3LTOA 2V9WA 2DGQA 1EHWA 3AD9C 3M6VA 5IFMA 4OYIA 3IRWP 4W90B 3LP2B 3CUNA 3D66A 3IFEA 1T9XA 5AXLA 4DFKA 1JK9B 1S7IA 3KHLA 2ABYA 4LF2A 4PG7A 2UUAF 2M2BA 3DMJB 4KHPF 1SC3B 2SXLA 2C42A 3AFGA 3TI0A 2Z4PA 4URGA 5KFJA 2Y8WA 5DQIA 1P6TA 1FJ7A 4KV8A 2YPYA 1SQFA 2B8QA 4DLGA 3DLGB 5IT0A 4QW9A 2DGXA 4TY8B 4NPOA 2WVCA 2OP5A 4U9RA 3ET6A 1FTRA 3KJFB 3DC2A 1ZETA 1T3NA 1RTHB 4YHHJ 2UV8G 1U4BA 3TAQA 4DL2A 1U26A 2JZ5A 4EZ9A 5GADU 3OUYB 2WRMA 2HNYA 3IR6B 2DIVA 1E6YB 4DV0J 2XZWA 2FJWA 2FZCB 2DK2A 2MKCA 1RWMB 3F0NA 1WKJA 4J9VA 2M52A 1C2PA 3E3XA 3NBPB 4FVCA 3FJ2A 4OZ0A 5KFTA 3I4HX 3ZTOA 3VAFA 5K20B 3R7BB 3LGMA 1U0HA 3NCPA 3PVXA 1DBDA 4DV4J 5MLCV 2P2CB 2JRSA 2BDPA 1UP1A 4A8WA 4GKKJ 3WC0A 1RACB 5ETKA 4CTAA 4L73A 3OR2A 5GAGU 4KPYA 2KZZA 5K8PA 1GTHA 4X4SA 1Q4RA 3OR1B 3M05A 1CJUB 5BYQA 1FE0A 2H48B 7FDRA 3ELHA 4I6WA 2IVYA 2DHSA 1G6BA 1RTZA 3BO2A 3C15B 3ILJA 4WTOB 1S6OA 3HXMA 2ZOMA 4F4XA 4EO8A 2MEWA 1DY3A 2VBWA 4J9LA 4HI1A 3HKWA 2BKPA 1TZ0A 3ILIA 3VWSA 1UCNA 4DSEA 3GP9A 1QAXA 2V50A 3Q8PB 1IJFB 4NXNJ 4O3PA 2V5HG 4JI0F 4OYBA 4JV2A 3VZHA 2RE1A 5DG9A 4FF4A 1WC5A 1QAYA 2AHOB 3D0IE 5HLFB 2DR6A 1GNKA 3ETMA 1B0TA 3R7NB 3QATA 5F3ZA 1QAIA 4ZJLA 1RT6B 2X1FA 1HNXJ 3T19A 5A8RA 1E6VB 1D9DA 1YBUA 2CQ2A 2D9PA 4DJBA 2YX7A 1C0TB 1HW8A 3BBFA 1JLGA 1Q95G 4DSKA 4P75A 5KOXA 4NLUA 4OMFG 1AZSB 1EJ7L 3M8YA 2FTRA 1N8RT 2EFPA 4A8MP 3QRRA 4LF9J 2XS5A 1IBCB 3ENWA 4Y28C 1P9QC 4NL5A 2J0XA 2ZZMA 2DNGA 4DPYA 2HHHF 3CCJS 3RRHA 2QFIA 2W8KA 4ZPCA 3KOAA 1FEHA 2V68A 5RUBA 4CQ1A 2W2NP 1U1RA 1R6YA 1EKRA 5B7WA 4Y0FA 3UFCX 1I1GA 1B0PA 1R8HA 2IVMA 1FWKA 4LF5F 4JI3J 1FHTA 1P8GA 5C24A 2A6OA 1ZA2B 3I6PA 3AJ1A 3QNWB 4RBTA 3DRRA 3QT5A 2LA6A 3PYGA 4K4ZA 3IMQJ 2FVQA 1U1KA 2JEJA 3W63A 4DR5J 4ITSA 4RUHA 4C0BA 1RKJA 1FESA 3LW5C 1NDPA 3EJMA 3VQSA 1N5YA 1U8WA 2KZMA 4M5HA 2R42A 3OJUA 1TU0B 1S9GB 2HLUA 4NEZA 1IBMJ 2VFSA 2DNPA 5HMXA 4NRTA 3DRSA 4AFFA 4U8YA 2IBOA 1JXEA 4JI2J 3MM8B 3N9UC 3MR5A 5L1LA 4TKTA 5C2CA 1R8PA 1IVZA 2A2CA 4DX8H 2F9DA 4QW8A 5D4PA 5KFDA 2J5AA 5HI7A 2LCWA 3QZ8A 3JTNA 5L8RC 3FRZA 1DAXA 1B4SA 2CAJA 2HFSA 3OTOJ 3KMQA 3ADAC 4Q2MA 3NL0A 4FS1A 1RABB 2WW8A 1S4EA 1A7GE 1Z4UA 2HRUA 4GVBB 4PPDA 4YS2A 3KLFB 3GYXB 3T41A 3CTRA 1YJNS 4B02A 5BYSA 4PAAA 2BUNA 3W60A 4CRJA 2CJ9A 4HI2A 5J2MB 1HNVA 1JJHA 1VQ4S 1F2GA 4CCHA 1JWWA 2P8IA 2OPQB 5CXTA 4P2FA 3RBXA 5E3AA 1YBTA 4I56A 1GMWA 2HYIB 1O0PA 4CIOA 5HN0A 4LF4F 4PG6A 1CBKA 4B9VA 4HL9A 2YKMA 3IS9A 2H4YB 4OI0A 4JUZA 3CD5A 2KVIA 3N79A 3VGUA 1CJTA 1FXRA 3EICA 4JI7J 1C1CA 4GRSA 1XMOJ 4NLRA 4Q5VA 1X0PA 1URRA 9ATCB 4HR2A 3GG0A 3SBMA 2QRRA 2GZOA 1IR2A 2D3OR 2LLZA 3ENAA 3CDBA 2R9LA 2ADCA 4PUOB 2NZCA 2V2KA 3C6UB 3SZ2A 2DNMA 2EW9A 2F40A 1CC7A 3DMJA 2VBYA 2VG7B 3M6WA 3V6DA 1RJJA 3FSXA 2OPRB 3PW2A 3NEKA 3M8PA 3DLGA 3QPIA 4TY8A 2LECA 2QJ3A 2XTJP 2GIFA 4A8XA 4ZCIA 1TK0A 3CJKB 1HI0P 2EKNA 2Y1IA 4WK1A 3D67A 1RTHA 4OHYA 4M5GA 4R5PB 3GIIA 1UJ5A 2PA3A 3NMAA 4X66J 3GLJA 3DGVA 1T9VA 5HBMB 3A3OB 2QA2A 3G8SA 4ECQA 4F4YA 1F5BA 3IWNC 2LQ5A 2NUUG 1EQMA 4ED4A 2YVSA 4M5NA 1E6YA 2I6WA 2FVCA 2YQ0A 4C48A 2MXYA 2OEJA 1HHQA 5L1KA 2CQ3A 3CE8A 2CVIA 5DRKA 1JLEB 2CQGA 3MTKA 3NBPA 1ZM2A 2M7SA 2FHMA 5F8IA 1JLAB 3G4SS 1ROFA 3SDEA 4DV5F 2KFNA 4A8OA 4LSZB 1W25A 4LFCJ 4LRCA 1WG5A 1VFJA 2V4RA 1SH3A 2N4CA 3EDQB 2I8EA 1OQ6A 2DPIA 4H4OA 2QTWA 1K47A 3TVKA 4EFAC 1RWOB 4B3OB 3OR1A 3R27A 1CJUA 4CM2A 2XGQA 2AGPA 2V2QA 4X4VA 2VONA 1H98A 2EVZA 2E5JA 1F6TA 5E3QA 1M5HA 3DLEA 4ELTA 4YR3A 3G86A 4DX5A 1VRUA 3HSZA 1UW4A 2BACA 1NZAA 1RAJA 1K73T 1NMEB 5I42B 2AIRB 1JB0C 2WVBA 1RWUA 3NS7B 2RF2A 2BJ9A 2E1CA 3WX4A 4RZRA 3RW6A 2XM3A 2YKAA 1RTDB 1JLFB 2MQLA 5KFUA 5C42B 4RR5A 3CO9A 1G1XA 1JLCB 2OFHX 4U95A 2EBGA 1C0TA 1S49A 3DFEA 3DHXA 4F3MA 1UEKA 3ISZA 3E01B 3TNVA 1XTZA 2ZBIA 4CLTA 1FD8A 3QSYB 3QGPA 1AZSA 4U6PA 1K0VA 5B0EA 5F8GA 4NX9A 4RW6A 3OL7A 2OFGX 3HDSA 3TW0A 2IJFA 6AT1B 3V6JA 1PAUB 5C2GA 4CP5A 1VLOA 3QMQA 2ZBQA 3Q8QB 3D3CJ 2CQBA 4HLBA 2V67A 2VD3A 1HHSA 3PX4A 3U7JA 4HACB 4NLWA 1SH0A 2Y1JA 3PFEA 2V34A 2BKOA 1X4FA 3UCZP 1S9EB 4CO4A 3KYLA 3V4IB 3BKUA 2A2DA 2H54B 4IRDA 4C8NA 1CJKB 1BGXT 3OT9A 4BC7A 3F41A 2O1PA 4RBUA 4U96A 3US5A 3MEEB 1BLUA 1DTTA 1V6HA 2HGMA 5EGYA 1UJ6A 3R1LA 5DS7A 1M5OC 4MIWA 1S1UB 3G6YA 3AXKA 1VBKA 1S9GA 2R7VA 4OX9J 3PRBA 4LF6F 2H4WB 3L9ZA 4YY3J 4DL0C 3MM8A 1F3VA 4B9MA 2BQRA 3PR5B 5H9FK 4CO1A 4CI0B 3GE9A 1U1NA 1AUDA 2OLWA 1KFSA 3CJQA 1K8AT 3VHQA 3GZ7A 3WC2A 3BGOP 3UCUP 2UXBF 2GW8A 2HG4A 3IG1B 4CLFA 2CFXA 1QAJA 2BANA 1KP6A 4GVBA 2I9SA 4CLZA 3KLFA 4USIA 4I2QB 5FDLB 1NKEA 3TANA 1D9AA 3UI3A 1PKUA 1LFWA 4IH7A 4BC9A 5GAEU 3NGTA 5LXRA 4EI2A 3K5OA 1CQMA 5D4OA 3BS9A 3CWJA 2BM0A 3EE3A 1DTQA 3EZUA 4A8QA 1BUXA 1TUVA 4P9SA 3H8YA 3PY8A 1LK7A 1LEOA 3QBCA 2CQ0A 1RI7A 1TL3B 1NRKA 5HK4A 5D77A 3H25A 1VS3A 4CLUA 3FBCA 1CQNA 4A8FA 2NSCA 4F0MA 3ONQA 1V3ZA 1F9EB 4I67A 5L9XA 2C2EA 5GAHI 1UEVA 2IYGA 3V6KA 3S6EA 1KS2A 2AF6A 3DN9A 1ZAVA 3OFGA 1DQAA 1FO1A 3BKTA 2GHPA 3CMQA 4ZPVR 3ZZ0A 2V8VA 1CULB 4X62J 1MMLA 3NGUA 4ECZA 1ZM4A 2VG7A 5LMUJ 4QWEA 1QLNA 3ZTSA 3I96A 2OPRA 4XDCA 1AT1B 1T95A 2DHXA 3A1YG 3DI6B 3MTJA 4PG4A 4DR4J 4IQMA 2W8LA 5J2PB 2DIUA 2F5GA 1VBZA 4LIRA 5F8MA 4LQ3A 3IRXB 3H2LA 3WDOA 3Q24A 4R5PA 2N82B 2VB6A 2UU9F 2QV6A 4TYAA 5M2UA 3CCZA 3MM5B 5HBMA 4M5DB 1S6QA 4CDIA 2JNJA 2GHVC 2G9OA 1F5AA 2FGCA 1SUQA 1TV6B 2U1AA 3SEOA 1PO6A 5DGAA 1LKZA 3MOJB 1X4EA 1QM9A 2IJNA 1U1PA 1GEHA 1J5EJ 1NKBA 2DXEA 2RRAA 1X4GA 4OLPA 3FK4A 4O0IA 2MSTA 1YZ6A 4NI2B 4P6QA 3D1QA 3CC2S 4LJMA 2OEMA 3HHEA 5J2NB 1U02A 4N77A 3T1YF 1MW7A 1VC6A 1YSJA 3T1AA 1XNRF 1Q5VA 1XMQJ 2PEBA 2QLXA 1NPKA 3W1YC 3N28A 2CG8A 2JX2A 4J9MA 5IM0B 2QMXA 3TZZA 4B3OA 4OHZA 2H1YA 2VQEJ 2XY5A 5DETA 2X1GA 5HVGA 3S01A 2WSCC 1SJ4P 1J2VA 1IQZA 3TAMB 2Y0BB 3E8OA 2HS3A 3C46A 1WC0A 4Y2MA 4RW4A 5IQ6A 3HULA 4LQ9A 3KLHB 3K5LA 2K3KA 4IH5A 2CZVC 4ILMA 4DLEA 2FQQB 2AMCB 5I42A 1VC0A 4OZJA 1RE1B 4ZVOB 3PXGa 4DR6F 4C6AA 1S0NA 2ZUGA 4PYDA 3S7RA 1IBLJ 3PX6A 4USMA 3V5RA 1T05B 3S8SA 3F56A 4C0OC 3OTCA 1WF0A 3J81U 2ACMA 4DCOB 5KFLA 4TYBA 2DNRA 3G8QA 3J7ZT 4F25A 1NH7A 1RWNB 4NZ7A 3IC1A 1JLFA 2QLJB 2RKIB 2RQKA 5DJBA 3D6MB 4LMZA 3M2UB 3BSAA 2XBPA 4Q43A 4MYTA 3QFHA 1GH8A 1JJ2R 4R8UB 2KL8A 1RAFB 3E01A 5KFYA 3GV5B 4DR3F 1TQLA 1RAOA 3NCQA 3H5YA 3BQ2A 3J80U 3CO0P 1KHWA 2EC0A 2VBXA 2DD8S 2VC1A 2BVZA 4C3KA 3PNIA 3HD1A 1BQMB 1RSCA 5DGBA 2YNFA 1KR4A 4U67Q 5K8OA 3P49B 1R0BG 3P6YC 3IGNA 2HHQA 4JI5J 3DYAB 3C8YA 4F4WA 4W92B 1N5TA 1S9EA 2NXEA 2QG9B 2YWWA 3V4IA 3FZBA 1VRTA 4DV2F 1VIOA 1AW0A 3CJTA 2ILYA 1CJKA 1KBRA 4DL3A 5A76A 2KYZA 2PD1A 3M2RB 5HQ8A 4WP8A 2QE5A 1L3VA 2UXDJ 3DCAA 1T8EA 3GR0A 4KSEB 4PQAA 2DVIA 2AW0A 4WYWA 3KKFA 1ZZNA 5AE2A 2MLXA 4WKYA 4M5KA 4E0DA 3MAQA 2DT9A 3LAKA 1RT4B 4NLYA 2QL9B 3GIRA 2F9JA 1MG7A 2PIIA 3OVSA 2J0QD 5H9FJ 1RT7B 4NA1A 1S59A 5KFHA 3IG1A 3M7VA 1SIWB 3FCVA 3TUPA 4KGMA 3NRBA 4N5SA 5F8HA 2E9TA 3I87A 1RYRA 2E5GA 4DSIA 3NAIA 1FK9A 4C8LA 5G4DA 1N56A 4F36A 3M9MB 2WBRA 1SXLA 3GFYA 4AUKA 5LMNF 2IMWP 3J7A1 3AODA 3MUVP 1WDDA 4OLOA 1YJUA 1U6FA 1YLXA 3MAAB 3FUYA 3H0PA 2CWKA 4YB5A 5KG5A 3R1HA 2RS8A 2JC1A 4ICLA 1SB6A 2OJ3A 2FZKB 3EMTA 1WACA 5F41A 4DFPA 3CCMS 1RTIB 2IPOB 2Z57B 4UQGA 3CC7S 4MFBA 1S48A 1QTNB 2P5VA 4N76A 3BKFA 4LSNB 1K1SA 4DUYJ 4C9DA 3A8JA 3LP1B 5HMZA 4WXWA 1SJFA 4CLPA 1WUUA 5EN1A 2B8PA 4ZVSB 1S0VA 1DQ8A 1C0UB 4Y2AA 3BSCA 3TARA 1HQEB 3QWPA 4NZ6A 4ZPAA 5IZHA 3G2XA 1CULA 4I2PB 4FYDA 3BF4A 2RU9A 1GK8A 1RGVA 4OYMA 1PG5B 1QJHA 1TL4A 4IFVB 4KFBB 3DI6A 2KDOA 3KK3A 1HI1A 2PSZA 4DUZJ 2M3DA 4QU6A 4PABA 3MHYA 5J2PA 4K59A 1S97A 1LV5A 2ZBRA 3ZTQA 5ETSA 1YJRA 3IRXA 1SKRA 2EBEA 1TR0A 4WU2A 2FJAB 1RBAA 1IWAA 2G0IA 2ZD1A 4TVAB 4QIFA 5A2QU 4M5DA 4ED5A 5DM6Q 1X9SA 2UXCJ 2XMUA 3F73A 2I2YA 2OUGA 1PC5A 4DQRA 4ZK7M 4BWMA 3EXYA 1VISA 4DF8A 2KFZA 1TV6A 3DLBA 2QO3A 3P45B 4DN0A 2WCXA 4RBVA 2C2OB 1Z1ZA 2FJBB 2J76E 4C3LA 2DGVA 1EETA 1Q53A 2YXLA 4YDDB 3O1LA 4H4MB 2XQCA 3R3TA 2VA3A 3DLHA 4DXLA 3LPYA 3JAMU 4NI2A 3ICLA 3HVTB 4Z2XA 5CCMA 1UVIA 5L46A 2IDLA 2GA7A 3CMAS 4NMXA 5SUHA 3ULHA 4I7FB 2NXNA 2YWHA 1BXNA 2FJDB 3OTDA 1DFDA 1L3SA 2HHSA 2XO7A 1S1WB 3W62A 3PHTA 3G8TA 4X4QA 2F65A 3C6TA 4ZLPA 4YHHF 2KRBA 4X84A 1U2CA 3MZIA 2E66A 1WD6A 1QVFR 3PW5A 4R25A 3MMCA 4O44B 2AWZA 3O5TB 4YQWA 1TL1B 2HWIA 1C1BB 1QSLA 3KLHA 2CPZA 2MSSA 4AQYF 4LFBF 4K4WA 2MPUA 4FKXA 1N32F 4USUA 4ZA1A 3NGKA 3MECB 1MWQA 2M5YA 2C2KB 3BBBA 1M90T 2NXCA 1QE1B 4B3SJ 2CVEA 4KO0B 4DS5A 4F8RA 2LDYA 2ZH4A 3MFHA 3M4XA 1X9MA 2YKNB 3L7OA 2RJZA 3PM9A 1IKWA 1RAEB 3PIOQ 4DV4F 1UVMA 4RW9B 2LU2A 2RKIA 3M2UA 2HGLA 3M8ZA 2ASLA 3EPGA 2DXDA 4R8UA 2B4UA 3FC9A 2DGOA 3AD7C 5KTQA 4UOCA 1Q78A 3NXZA 3HHLC 3PCOB 5C7PA 1GT8A 1UZHA 4Y00A 3MPYA 2J7UA 4MT1A 1QSYA 4FPIA 3GCXP 1FWPA 2CJKA 1F0XA 3OTBA 3FSYA 1BQMA 3V6HA 2HK2A 4TLQA 1OY9A 1F9FA 2F1FA 1FF2A 2KHCA 1B7FA 4NXNF 3FBFA 2WB1D 1FRHA 2V4JB 4MTPA 2KG0A 2HBQB 1RA6A 1JXLA 4IUFA 3CDWA 1KLMA 2ZM6J 1PJ6A 2C22A 2XS2A 3CCWA 4L75A 1KWMA 1S79A 3FNNA 4FZVA 3EWGA 1IR0A 3K5PA 2OD4A 2I5JB 4NLTA 2Z2ZA 5F8LA 2JLFA 1N0UA 2GVZA 3G6ES 2WONA 2QMUB 3HJVA 3TX0A 5ITHA 4DPUA 3MM9B 3W5YA 1ZOTA 4KGKA 3GIMA 2KU7A 3H40A 4JP8A 4Q0BA 3R5BA 3AXMA 5KFNA 2IDEA 2ROPA 1VHIA 3JSMB 4LF9F 3DXBA 4KHMA 5J1EB 2C1EB 3N5FA 3GFXA 3MI7X 2IMOA 5E5NA 5L1JA 4NCGB 3TWZA 3DKDA 4A8KA 4F3OA 1LW2A 5AT1B 2DHHA 3PJ9A 4N8OA 1RCOB 3W3SA 1BQXA 4P52A 1P1LA 3M1VB 3GFHA 1FCAA 2VQFF 4CLWA 1RT4A 3DGPB 2HQ3A 1XNQJ 3GCWP 4QIWD 3PW4A 5HROA 2QLFB 4DQQA 1RT7A 3PV8A 4IOCQ 3U27A 1KQFB 1O51A 3O44A 1ZM9A 1S76D 4C11B 2BE9B 3DOKB 1NHUA 3VAHA 5K14A 2LU1A 3OQ2A 2FJVA 4DR5F 1VQPS 3L09A 4RLEA 1WEZA 1UW9A 3EUNA 2AX1A 3U1NA 1BD6A 3NAHA 4ZP9A 2G4BA 1OPZA 2O66A 2E5LF 4OZ3A 2B9XA 2MKKA 5E0OA 5F0WA 3CJ8A 4KKOA 4FYYB 8AT1B 4EYHB 3MR2A 4NZ0A 2HAIA 4PXEA 3MAAA 4AL7A 3HZGA 5BR8F 1RP5A 2UVWA 4JYAJ 4LR9A 2C3OA 4DR1F 2ATCB 2ASJA 2K8GA 2AEMA 2G0JA 3VALA 1ZA1B 3IWXA 4YDXA 1CS4B 2DNLA 3M8RA 1X0FA 2M88A 4ZCLA 1NK6A 2J7KA 5LJ3Y 3THTA 2HBZB 2M9KA 1IBKJ 4KGXB 3LP1A 4IFYB 3TP2A 2NSBA 4TY9A 2BXJA 1S1TA 1H2VZ 4ZN3A 3R5CA 1C0UA 1PCAA 1AFIA 4FVMA 4C97A 4P2MA 3RAXA 1HQEA 1Q1KA 1YZ7A 4HH1A 4I2PA 4RPFA 5D0GA 1VHFA 2BMBA 4K2JA 4QJVA 4WP9A 3MFIA 2IRXA 4QWBA 3JSBA 2VDHA 3GJQB 4KFBA 1JIHA 1HNZJ 3GTYX 2WVDA 2GIQA 3UN2A 4F4ZA 1N36J 1HARA 3JYTA 1R0AB 3DU5A 1RBOB 4ILRA 1Q8KA 1B70B 3U1MA 1QSSA 1KLNA 1RKIA 3CIMA 2RRBA 4OJ3A 2NR0A 3ENVA 1UZDA 3MUMP 2A3JA 5ETMA 1S1XA 1XBWA 1KQKA 2B9EA 2JEGA 3DHWC 3Q8SB 4LVNP 4FYWB 4JI7F 3NNHA 3AOCA 1HBOA 3I0SB 3N6MA 5A8KA 4IG0B 1N52B 2BBEA 4ZJQA 4F2SA 1VI7A 2BM1A 4KBIA 3M6XA 1F1BB 2BJ1A 3DOLB 1MN9A 2V2VA 1TKTA 1TL7B 1KNZA 2HLTA 5KFMA 4DR2F 1YJWS 1SIZA 3WBZA 2CDRB 3ITHB 4IOBA 1M1HA 1Y10A 2DTJA 4BCAA 2DNYA 2BA9A 4ZOSA 3VVTA 2DCLA 4DOZA 2UUAJ 4I7FA 3OPKA 1R8BA 2B56A 1S1WA 4IO9Q 2JC0A 2WBMA 2HZCA 1FXLA 3HI9A 3HVWA 2GAHC 4OJ1A 3SSRA 4QBUA 3UD5A 3LAMA 2X7IA 3W8GA 3WZ0A 4F3QA 1NK5A 2GFFA 1S1VB 5EHHA 4J7CA 4O44A 3RG6A 1RADB 4ECXA 5ETRA 5A6WA 4FS2A 4MH8A 5EUHA 3MUTP 5E3CA 2HHWA 4B3TJ 5E3RA 1IR1A 2BW2A 4PYAA 1GX5A 3TOQA 3BPDA 1UFLA 2R7WA 1NB7A 3DLLQ 2VFRA 4V1Ak 5CZVA 5CH7B 2MQPA 3Q22A 3IGVA 3MECA 4UUXA 1K0TA 4G6VB 1R7IA 2AJ0A 5I3UA 2UVRA 1VC5A 2HBYB 4DPTA 3EZ5A 2ZZNA 3ET6B 2PFFB 4FN5A 2HFUA 2DJWA 2YKQA 5I4MA 2ZJQQ 2VIHA 1UPMB 2KHDA 5CA5A 1KEKA 4ILLA 2C2ZB 3ISND 2V4QA 2HNZA 2LQBA 2R7OA 4YFUA 2HNYB 4CH1A 4ED3A 4LVOP 2LXFA 4DZDA 4JI6F 2L41A 4WU3A 2ZH3A 1BQNA 2HQFA 4EK2A 4OZNA 2YWFA 4Y65A 2OSQA 5HVHA 2K1RA 2BKNA 4A46A 2ZFHA 4CM0A 2R7QA 1V5VA 3GONA 1U0HB 1U09A 4JV0A 2IY5B 4ENOA 4J9NA 2V4JA 3ILLA 3DDKA 4NEYA 2OEKA 5ETPA 3MCSA 1GAOA 3P96A 2A6MA 5G0RA 2VPWB 3PEJA 2FLLA 4JV1A 2MGZB 1YGYA 2HHPA 4DU7A 3M9OB 3WIVA 4OI6A 4FF3A 1ITPA 2MB0B 4AYBD 2P9GA 5EX0A 1HNWF 1ZPWX 4PG8A 3TQEA 1WKKA 3MMBA 2IVFB 2Q1LA 3GV7B 4JI4F 3PW0A 1FA0A 3RYLA 2H3EB 2Z2LA 4OI3A 5J1EA 1RAIB 1KDNA 4XAKA 3Q2SC 4NCGA 3JSRA 2H65B 4FYVB 4DV3F 3EVMA 1AA1B 2W4DA 3OTEA 3OL6A 1D1UA 2YWEA 2HHHJ 5HQLA 2ZC4A 5AXNA 3EGWB 1WOPA 2W2OP 2BJEA 2LDIA 3H4DA 2MZJA 2C2RA 2LFVA 4C11A 2DGSA 3Q83A 1N34F 3BSOA 1HQUA 4FXVA 2VU5A 2EFNA 4MK8A 4RW8A 3R5DA 2FC8A 2GAGC 1REVB 4LF5J 3W64A 2DO0A 4ZVUB 5EDWA 1WWHA 3D28A 1NM2A 3SI8A 5K8NA 2P9CA 3RJMB 2X1AA 3CIZA 2DO4A 5IC4B 1NSPA 2AX0A 3BDEA 1X31C 2QSWA 4YY3F 1MU2B 2B5JB 5LL6d 2AYBA 2QGFB 3KG4A 1Y5NB 1OO0B 4QWDA 3QSIA 2KXHA 3EM1A 1RT5A 3OL9A 3PKYA 2A10A 3FEZA 1YBAA 2DXFA 3B4MA 4L72B 3BGRA 2CPFA 2HNDB 2OO4A 2MQQA 4ZVEA 2YQ3A 3FCHA 1WC6A 1DARA 5DQHA 1N5YB 5HO4A 4Q8EA 4MMOA 1UKUA 5T41A 4QPTA 2RT3A 3KDOA 4UUWA 2VL1A 1QUVA 4RL1A 1LW0A 3D3BJ 4C8MA 1S9FA 1RBLA 4GKJF 3W5XA 1RT1B 2B4PA 2HURA 5KOWA 1VJQA 2JL9A 1XERA 3KHGA 2D1CA 2E1MC 4KAIA 3W2VB 4FBUA 5GMDA 4ZLJA 2W4PA 3Q86A 3B82A 3PKMA 3K8WA 3UVJB 2GO8A 3POTB 2VG5B 1PYOB 5D78A 2YH0A 4LBPA 2HFNA 3AQOA 2D69A 1H6KX 2IM2A 2W2MP 1RAHB 2D3UA 1VQ9S 4O3SA 1WKLA 4KIAA 3OSPA 4IR9A 2QX0A 2WK4A 3KTQA 3IBFB 5MAOA 1HNVB 2OMLA 2VDIA 4FBTA 1SCJB 4IKAA 4HEA9 3HZEA 5B0AA 4KYZA 2VV5A 3HHLD 2QFJA 1JX4A 3H90A 2JEFA 2M8HA 4HDGA 3MEKA 5B0GA 5DDQC 2NYIA 4JV5F 2AT1B 1RDRA 1TL7A 2FY8A 2PEHA 3ITHA 3KJQB 3RW7A 2GJ2A 3IS9B 3QFWA 4ZPBA 2RNEA 1S6PA 1FDDA 3GJRB 3LQVA 1RHMB 1OIAA 3CDUA 4WZMA 2KT2A 1C1CB 1RCXB 3A8EA 1WF2A 2EFVA 2FVPA 1VYAA 4USWA 3I9ZA 2LQ9A 1S1VA 1KC8T 3R6GB 1K9MT 3TA2A 4MK7A 1Y5LB 2BV3A 3C16A 2CDQA 1A6LA 3V6DB 3EX7B 5JMNA 4K7QA 4LBHA 1TL5A 2W7AA 1WHXA 1G4CA 2YNIB 4CO3A 2RQ4A 3NY0A 4P7TA 4O4GA 1SJ1A 3M8PB 4G1PA 3M8QB 2JOQA 1J5EF 3HSGA 1VBXA 1X8DA 2XMMA 2QEXS 2G1HA 3TJ8A 4DG1B 2Y9HA 2DPJA 3E51A 3QIPA 3J7YI 4ED2A 3D54A 3BYRA 2B6AA 5D15A 2IJRA 6FDRA 3Q8RB 1WSRA 3MMJA 2FYXA 4KTQA 2HIYA 2KKHA 4DX6A 4DV5J 2J0SD 3V2UC 4O0NA 5HATA 1YJ9S 4PWWA 3JTPA 2RDIA 1NDKA 1LNQA 4EU0A 2H9ZA 2XMJA 4OFZA 2ZVSA 4PWDB 2XULA 4K4TA 1U47A 5CQGA 1RWKB 5EWEA 2KJWA 1MWYA 2UUCF 4F7VA 4C8OA 2HMIA 3QGGA 2UUTA 3TUZC 3CJ4A 3SDEB 4XDDA 1JMTA 3T3FA 3UR3C 2BABA 2MMYA 2PO4A 5HVFA 2MQ8A 1KVIA 4MKBA 2RSQA 1FT8A 3AOBA 4F02A 1F3FA 1YKWA 4I69A 4H4OB 2F8MA 4M63A 2MGZA 4OV1A 3CCVS 1H38A 2ASDA 1RAAB 2D41A 2BRLA 4OIXA 3JQKA 4Q7AA 3DLEB 1RUSA 5T7LB 4XTTA 1VCTA 5LJ5Y 1VRUB 2D9OA 4CZCA 2CPXA 4RNOA 5EWGA 1TVRB 4EYIB 3MXHP 5BXIA 1SJQA 3C14A 2UUBF 4X4TA 2RF2B 5B0DA 1FD2A 2POKA 2Y1RI 2HHTA 4LRFA 2J8AA 2CJQA 4ZPWR 4OX6A 4K4SA 3KK2B 2XZDB 1CJVB 1NO8A 4Y6IA 1TKZB 2MKIA 3NLCA 2J6SA 4DF4A 1FNOA 1H7XA 4UZCA 2FC9A 4A48A 2J7WA 3KDNA 2BX6A 2RH3A 1DLOA 3FMWA 5KFSA 1X4BA 2FHOB 4RW6B 2YX1A 1REVA 4O3NA 2F63A 1FKOA 2IBKA 5D3GA 3I4PA 3C66A 5FIIA 1YTYA 2J9DA 2NXJA 3OD2A 4ECUA 4ANCA 4UY8T 2MZTA 2HK3A 3JXOA 1MU2A 2B5JA 2APOA 3HFZB 1SI9A 4OX7A 2B51A 2NZ4A 5IV3A 2GQ2A 4GMKA 3H20A 4WK3A 2UV8A 4LF6J 1XJWB 5K8MA 2R2SA 3KMSA 1KRPA 5HP1A 2BR0A 3VV2B 3UPFA 4HYKA 5A0YB 2HNDA 2GX8A 3A13A 2FY1A 1N5SA 4KRWA 1U0SA 3PYDA 3VGTA 3PFOA 1B99A 4LF8F 2ZHAA 1RAGB 3A3PB 1DTTB 1JKHB 3NKYA 3CJRA 2NYHA 2U2FA 3I82A 4QWAA 1VMBA 3KNAA 3BJYA 4LR8A 4WPAA 5ETOA 2C3UA 1VQKS 4HDHA 2K7KA 2UXBJ 2OPPB 4FNHA 3A4TA 1H2TZ 2ZOFA 3GQCA 4I0WA 3MEDB 5E41A 3VAJA 5CYJA 4Q45A 1IKXB 4DCJB 2UVUA 1S5ZA 1RT1A 2W9CA 4CLKA 2CNLB 3CXCR 5FLXU 2GVDB 4DV1F 4WWSA 4USKA 2XCAA 1IN0A 1KQGB 3W2VA 5CYMB 5CYQB 2EG1A 2ZVIA 4LBIA 5ETTA 2KM8C 3UVJA 4GC7A 3POTA 2CPIA 4J90A 2D7SA 2XY7A 2VG5A 1KQSR 3SQOP 2F4VJ 1M5KC 3I5AA 2BANB 3TEGA 5THWA 4OYWA 2QYGA 3UNYA 5ADZA 3MR6A 2J6UA 4DUYF 1VQ6S 4E2FB 2MKJA 3JS9A 1D8ZA 2AJ2A 2QSFA 1MROA 1FERA 1TFWA 4J9OA 3DRPB 1DTQB 4HVZA 4ZPTR 2H5IB 4XPCA 4U7UD 5CD4H 3NS5A 1YX2A 3D4JA 1EB0A 4MIBA 3ZZYA 2IRUA 2DHAA 3PEHA 4ZDNA 2W2PP 2JLEA 4M8LA 2XG8A 1TUWA 4IYQA 4N41A 5DLGA 1AYEA 4K4XA 2E7VA 2BQUA 3OHAA 4QCLA 4YB1P 1SKWA 3BGUA 3UD3P 1T03A 2FHJD 2LEPA 3KXDA 1RLDA 4I4BA 3BM7A 2RU3A 3SYZA 1VQNS 3AA8A 2MJNA 2XMTA 4MIAA 3BQ0A 3CW2C 1FKPB 1EP4A 2V2ZA 2UXCF 1N33F 3PTWA 1VQOS 4GO7X 3FBEA 2UU9J 1HA1A 4LRDA 2W01A 4DV7F 2EWHA 1DJ0A 4Z37A 1GX6A 1I51B 5LSLA 3CCSS 2YNIA 4NCBA 4NWBA 4EEYA 4U8VA 1OWXA 3ETOA 2QT7A 3DOMA 3IR7B 4Q44A 3M8QA 2KT3A 3NWGA 4RUAA 5FLXY 4DG1A 3GV8B 1Q8IA 2HPUA 2HZVA 2FLPA 3FFIB 2COLA 3Q8YA 3CJ0A 4ZVPB 3KLEA 5KT2A 1WOSA 4NYOA 3R5GA 3QAEA 4CLSA 1M0SA 3VAKA 4D3HA 1J5OB 3LGNA 4ZP7A 3EZOA 3QLHB 1Y0HA 1S6QB 3BEGB 3TYTA 3T1YJ 4TU9A 1UJ4A 1UVJA 2DH9A 2CQPA 2QA1A 3K2YA 2VJUA 2VFVA 4PWDA 1SUQB 4OYOA 3AAWB 2JSXA 3R2CJ 2M70A 3W2WB 4DFMA 3VQTA 3OXFA 4ZKAA 5KT6A 3BGLA 3OLBA 2MTLA 1C4AA 1UEUA 3KUHA 1XIQA 3R8YA 2E1RA 1Q0NA 2JEIA 2K2PA 1L3KA 2W1BA 3HF5A 2KH9A 2CQ1A 1HBUB 1TAQA 2QN6B 2I38A 3TEHB 1XWLA 2I0XA 3N01A 5KFXA 3MD3A 2GQQA 4F4KA 4F2RA 2E9RX 3CULA 2CG4A 7AT1B 4J9RA 4TU8A 4TN2A 5T7LA 3N5BA 1N88A 2VPXB 4RW4B 4RU9A 5IQQA 4IRKA 3LP0A 1IUJA 1TVRA 2AYEA 1X9WA 4P72A 2D3ZA 2LYVA 3FVYA 3R2DJ 1UWAA 2EEYA 3AA9A 3D7SB 4CLLA 2RHSB 4DR3J 2EK6A 3KHRA 3H2UB 2DNQA 2GGPB 1OSCA 1WSVA 2ZH5A 3T5KA 3WIUA 5F8NA 1HR0F 1ZAWA 3MAHA 3TUIC 1P27B 3UW1A 4F26A 4I6AA 2R7UA 1TTHB 2CWXA 3KK2A 3OXLA 1FJEB 1CJVA 2VUGA 4EO6A 3M30A 4DR7J 1TKZA 3OVBA 3CJ5A 1G3OA 5DDRC 3PG9A 2V6AA 5LSRA 2MQMA 1N0VC 4ZVGA 4PG5A 4ECSA 1APSA 4RWXA 1NHVA 3W9HA 4WTYA 3CJ2A 5DDPC 1PBAA 2FZGB 3OFEA 2Z2MA 4O3OA 4M5JA 1YRXA 3LUYA 2YNFB 2Y1LB 1FXDA 2B9WA 4ANDA 3P8BB 4DPOA 2HS0A 3ZZPA 3D6HB 4X65F 3GFZA 4UT4A 3HHLA 4DEZA 4WIIA 4NOHA 1U24A 5E2QA 1DZ5A 1VRTB 5M2PA 5HJYA 5A0YA 2MYFA 4JI1F 5KG4A 1FJGF 2OPSB 1Q8BA 2WHOA 4ID8A 4NLXA 3JB9k 3I0RA 3R7SB 3OHBA 4U7UK 1EIYB 2O01C 1PC4A 2MKHA 1SVDA 2PI5A 3QIDA 3X1LB 1JKHA 3CCRS 4YR2A 1KTVA 2DISA 4PKDB 3V81B 1HD0A 2HHUA 2OPPA 2HVIA 2PE8A 2J9DE 3TQ1A 1NJZA 3MEDA 3AB4B 4H4KC 1U1MA 4KB7A 5I3QA 5A8WB 1IKXA 4B3RF 4W4MA 2JLGA 5KG3A 4YB7A 2R7XA 2DGTA 1LWEB 2GVDA 1UETA 4N56A 3HM9A 4EGLA 5CYMA 5CYQA 2F7VA 2UVVA 2KO1A 5LMNJ 1SH2A 1YDLA 4NCAA 3OL8A 1HHTP 4JYAF 1F9HA 2XMAA 3GYNA 3NGRA 1NUEA 3H5SA 4CT9A 1UVNA 4A8SA 4QIGA 3HX9A 4M5IA 3GPAA 3EVOA 3DRXA 2HRYA 1FK9B 1IBKF 3LALA 2LP4A 2Q43A 3L7UA 1TFYA 3DRPA 2EI5A 5GAEI 1J27A 4WCEQ 3G87A 3HLUA 2JVOA 4WFBQ 1RHJB 2KT5A 4DQSA 3P5BP 1GXUA 1F5CA 1CPZA 3FZ2A 3HD2A 2N3LA 4OZ5A 2OIHA 5AXMA 2X1BA 4UOFA 3RAMA 3ENQA 1PAEX 1N6QA 1FRKA 3A8IA 3THVA 4M94A 4YR0A 1HWJA 5HAOA 5F0UA 4ICLB 2JJ4D 1HNZF 1Y4ZB 2LXUA 1JLQA 1TP7A 4MFBB 5DG7A 4DV6J 1OY8A 3LWLA 3PR4A 1NK0A 3L3CA 4DSLA 3T9NA 2CJAA 1VIXA 2Q6CA 3EVWA 2D74B 2GQCA 1F60B 3DNCA 3GIKA 4PR6A 1HBNB 4OI4A 2CADA 1UVLA 4URQU 1FKPA 1UAWA 2ROGA 2GMLA 4CNZA 4RO0A 2HIQA 1SL1A 2DY9A 5IT4A 2R2RA 1NK9A 2QMWA 4X4PA 2YY3A 1LWCB 1XN9A 1OPIA 3R9LA 1X4AA 3KK3B 4IOAQ 1FFGB 3Q23A 3SIPB 5KFOA 1W2BR 3CPWR 2IYIA 1XMBA 4EBCA 3FFIA 1HYSB 1D0EA 1QTMA 1S4FA 3BH7B 1X4CA 2FIUA 2GIRA 2ZD1B 3GSIA 2LEAA 3M9NB 1J5OA 1FJCA 3ZNUA 3FCWA 5F9LA 5GMEA 3QLHA 2WVEA 4NA3A 4J9PA 3KNGA 4USJC 1SBRA 3J7YU 4DHVA 2J6TA 2L9DA 2AJ1A 5BYRA 1FVQA 2YNHA 4WFYA 3PRVA 3CB4A 1HW9A 2C3YA 3W2WA 4B3MF 4PQUB 1PGZA 1EETB 1RTJA 3KHHA 3TA1A 3VTIA 2ZNZA 4CLYA 3BN7A 4IG3A 4B3TF 2RDDA 1TK5A 2XI2A 5JJBA 1I94F 4WZQA 3FQKA 3R5JB 4ELUA 2NPFA 2XMWA 2DB1A 3IBCB 2M0GB 1HBUA 4LF7F 2CXEA 4LFAJ 1FFSB 4AQYJ 4LFBJ 2MLZA 1RXOB 1XC9A 1TUGB 1RLCL 1N32J 4K2XA 3C6TB 1AXQA 4DPXA 4OI1A 4NLDA 4ZHRA 4UY85 4KGZB 1IM4A 3ZTRA 3CNQP 2N7CA 3BB5A 3CD6S 3B6BA 1XK8A 1X5TA 2Q66A 2ZJPQ 4EBEA 1UL3A
chains in the Genus database with same CATH topology
3TVKA 3MMCB 4EFAC 4YFUA 4KE5A 2HNYB 4CH1A 2F3JA 2RS2A 4ED3A 2V94A 4U7CA 4B3OB 3T6BA 3C3LA 4LVOP 3OR1A 1UA1A 2LXFA 3R27A 4FF1A 2B4VA 3CCTA 4JI6F 1Z2LA 2XGQA 2AGPA 2GMHA 1UWBA 4O3RA 4PRFA 3MMAB 2L41A 4WU3A 2ZH3A 1BQNA 2VONA 4X4VA 1H98A 2EVZA 4D3GA 2E5JA 3MM7B 5E3QA 4FXWA 4OQJA 3K59A 1M5HA 1YJVA 3SCKE 4OZNA 3DLEA 2YWFA 4ELTA 4YR3A 5D6GA 3G86A 4K0KF 4Y65A 2OSQA 2K1RA 2XLJA 1VRUA 3QO9B 5KFAA 2QLWA 1KVJA 2ROEA 2ZH1A 2EFOA 1UW4A 2BACA 4A46A 2GGPA 1IBLF 2ZFHA 4I68A 1NZAA 1RAJA 2R8IA 1ZTWA 1K73T 1FNMA 2R7QA 3K8VA 4ED1A 5I42B 1U09A 3TUJC 4Y2KA 1JB0C 4JV0A 3QZ7A 1FEEA 2YX4A 4CT8A 4JI8F 1IKWB 1HWLA 2EFQA 2N7YA 3S1TA 4J9NA 4X64F 2V4JA 3DDKA 4AXIA 5GMKa 1RWUA 3MCSA 1GAOA 1RISA 3OSNA 2RF2A 2O3DA 3P96A 4NLOA 5GAGI 5H9EJ 2E1CA 3WX4A 1LWFB 5G0RA 4RZRA 3ZFVA 2VPWB 2L3MA 3RW6A 5HMWA 4ZMMA 2YWKA 2NREA 3PEJA 1R89A 3BO3A 2FLLA 4JV1A 2VKZG 2MGZB 3BN4A 4UW2A 1YGYA 4B08A 2HHPA 3OFHA 3UQSA 3DLJA 2YKAA 3DYAA 2OTJS 1RTDB 2UP1A 2R8GA 3LP0B 1JLFB 2MQLA 5KFUA 4TU7A 3CMES 5C42B 1D8YA 3M9OB 3MPWA 4ZP8A 4OI6A 4WE1A 3K7RA 4FF3A 3CO9A 3HJFA 1R31A 4G1QA 1G1XA 1JLCB 2OFHX 1S0OA 2MB0B 4AYBD 2P9GA 2EBGA 2MHEA 1C0TA 1Q7LB 5EX0A 1S49A 1HNWF 3DFEA 3DHXA 1ZPWX 4PG8A 1FKAF 2AJQA 4F3MA 3ISZA 3E01B 1WTBA 2RB7A 3TNVA 1XTZA 2ZBIA 1VQLS 1FD8A 1U49A 1HBMB 3QGPA 3MMBA 4DN9A 1H3DA 4U6PA 2IVFB 1D3WA 2Q1LA 3V4MA 3GV7B 1K0VA 5CZXA 4JI4F 3PW0A 1U2FA 1WEXA 5B0EA 1FA0A 5F8GA 3RYLA 2DR5A 2G0CA 1FRMA 2MKSA 2Z2LA 4M1KA 2FUG9 2F8EX 4NX9A 4RW6A 3OL7A 3M2RA 3KK1B 2PA8D 2OFGX 3HDSA 3TW0A 2IJFA 2KFYA 2VFUA 4OI3A 4YEAA 5KFIA 1L3UA 3V6JA 1O8BA 3MURP 5J1EA 4JI5F 2V8HA 4KJIA 4XAKA 3Q2SC 3QMQA 4OZ1A 1U2RA 4NCGA 3JSRA 5DG8A 5IWAF 3Q8QB 2CQBA 3H4BA 4OI2A 4HLBA 4IQXA 1KLMB 3M30B 4DV3F 3G96A 1SQEA 1C4CA 2VD3A 1HHSA 2BJDA 2KN4A 3MDFA 1O5JA 4RUCA 1WG1A 5KFCA 1KSPA 2W4DA 3PX4A 3U7JA 2MQNA 3OTEA 3OL6A 2HHVA 1D1UA 4BHQA 1ZAXA 4NLWA 3L7PA 2YWEA 1SH0A 4RNFA 5LXYA 2Y1JA 2OPSA 3PFEA 3BR9A 1NJXA 1X4FA 2ZC4A 5AXNA 3UCZP 1X5OA 1S9EB 2WONB 4CO4A 3EGWB 4WFZA 3KYLA 2BJEA 3C2PA 3V4IB 1FE4A 2LDIA 2MZJA 3H4DA 2C2RA 3DLKA 5HL7Q 2XMKA 2A2DA 4C11A 3AY0A 4WF9Q 5I3PA 2DGSA 4IRDA 4LSLB 4C8NA 1X5PA 4PCQA 1BGXT 4E8UA 4NXMF 1N34F 4Q0BB 2UXDF 3BSOA 3M6UA 4BC7A 3V81A 1HQUA 4FXVA 2FHJA 3F41A 4BWJA 2EFNA 5IT9Y 1CC8A 1R43A 2O1PA 4MK8A 1VQ5S 4RBUA 5D4NA 4RW8A 3US5A 3R5DA 2FC8A 2KXFA 1BLUA 2KJVA 1REVB 3MEEB 4I6YA 1WF1A 3ZZOA 4WFAQ 5C5JA 3EGNA 1DTTA 1V6HA 2DO0A 2HGMA 3I9V9 5EGYA 2N3OA 1QVGR 1IKVB 1UJ6A 5A8WA 4KC5A 1H2UX 5EDWA 1S0MA 2BE2A 2PT0A 5DS7A 3R1LA 1M5OC 4MIWA 1S1UB 1WWHA 5IS2A 3G6YA 4MKYA 4IRCA 3D28A 2R7SA 1S9GA 3SI8A 4K50A 2R7VA 1LW2B 2WSEC 1KOOA 5KFRA 5K8NA 2P9CA 3PHEA 3HHLB 3OW2R 2C28A 5J1NA 3CIZA 3PRBA 2X1AA 4YB6A 1LWEA 2DO4A 4LF6F 2KTQA 3PJXA 2AX0A 3BDEA 2QSWA 4YY3F 1MU2B 4DL0C 3MM8A 2B5JB 2ZH6A 5LL6d 2AYBA 3KG4A 1Y5NB 5HROB 1OO0B 1U48A 4QWDA 3D0HE 4B9MA 2BQRA 3I5CA 3ISNC 3J81Y 2KXHA 2R8HA 3I0RB 1RT5A 3OL9A 1HPZB 3PKYA 3PR5B 2ERRA 2A10A 3FEZA 1Q79A 1S99A 3MM6A 1YBAA 3B4MA 1X4HA 4L72B 4CI0B 4CO1A 4PXBA 1LFPA 3GE9A 1U1NA 2OAUA 1AUDA 2OLWA 5F3TA 1KFSA 1RK8A 2E1AA 3IBWA 4EUVA 3BGRA 5K14B 2CPFA 1K8AT 2HNDB 2LMIA 1VOMA 1T7PA 3LOUA 3MGJA 5AE1A 3GZ7A 4J9QA 2GMJA 3WC2A 2OO4A 3CVKA 2MQQA 4ZVEA 3UCUP 2UXBF 4E98A 4DL4A 2ZBCA 2YQ3A 4RWWA 2GW8A 2HG4A 3K5MA 4PPZA 3IG1B 4KR0B 3RZAA 1UMJA 3O2IA 3KJVA 3SQGA 2CFXA 3FCHA 1QAJA 2BANA 1DARA 5DQHA 2I9SA 1N5YB 1M5SA 5HO4A 3MEGA 3KLFA 4USIA 2C2DA 3PO4A 1RTIA 2RRNA 4I2QB 5FDLB 1NKEA 3J80Y 3TANA 2DR9A 4Q8EA 2XB2D 4MMOA 2NLWA 1D9AA 1UKUA 5T41A 2C3PA 1YITS 3UI3A 1CEZA 1LFWA 4QPTA 2EFGA 2RT3A 4IH7A 4LSNA 4BC9A 3TX8A 5GAEU 4UUWA 2VL1A 2PN6A 2YKOA 2E7XA 4XPEA 1QY7A 5LXRA 3RBDA 4KKOB 1QUVA 2E7WA 2VC0A 3K5OA 4CO5A 3OVAA 1Q81T 1CQMA 5D4OA 3U02A 3BS9A 3CWJA 1LW0A 2BM0A 3DRYA 1VQ7S 4C8MA 1S9FA 2MHNA 1DTQA 3EZUA 4GKJF 1N5QA 2DNHA 4A8QA 1RT1B 1WTFA 2RDJA 2B4PA 2L08A 1KN6A 1TUVA 2VG6A 1RT2A 3D2WA 3HHDA 3H8YA 5KOWA 3PY8A 1LK7A 4ZCMA 1U1OA 2JL9A 2CPEA 3T6JA 1XERA 2HVZA 2CQ0A 1RI7A 3KHGA 1TL3B 2D1CA 2E1MC 4KAIA 1NRKA 4MYUA 3W2VB 4FBUA 2W4PA 2J0WA 3PIPQ 1NK8A 2ZJRQ 3B82A 5D77A 3PKMA 3K8WA 3H25A 1VS3A 3H2VE 3MD1A 2FVRA 3M2VA 3GWCA 1LOUA 2GO8A 4LIWA 3POTB 2QA4G 1CQNA 1DURA 2R8JA 4IFVA 4A8FA 3QJPA 2NSCA 1BWEA 2VG5B 3D5MA 3ONQA 1V3ZA 4Y3CA 5D78A 2RILA 1JJ4A 2YH0A 2HFNA 3AQOA 4I67A 1YG0A 2XSJA 3MR3A 1VQSA 5EX3A 5L9XA 1S1TB 2C2EA 2PDAA 1H6KX 2IM2A 5GAHI 2D3UA 4OJHA 4RW7B 4C0HA 1VQ9S 4O3SA 4CO2A 4QWCA 1HBNA 3TRGA 1UEVA 2IYGA 3PW7A 4KIAA 3V6KA 3S6EA 2NS1B 2LEBA 3OSPA 1KS2A 2AF6A 4IR9A 3BR8A 1TKDA 1U25A 3AQPA 4RNMA 2QIFA 2E5IA 1FRLA 2WK4A 3DN9A 1ZAVA 3OFGA 4ES1A 2Z0GA 3KTQA 4MAKA 3KLGA 5MAOA 4OX8A 1HNVB 1DQAA 2CYYA 2OMLA 3F44A 4C7QA 1FO1A 4FBTA 5C25B 2GHPA 4IKAA 5DDOC 1B64A 4V19J 4F50A 4HEA9 1N6QB 4WJBA 3HZEA 5B0AA 1UFWA 5JUMA 2VV5A 3HHLD 4ZPVR 3ZZ0A 4JOUA 2QFJA 2VA2A 1JX4A 2DHGA 2HVHA 4OZLA 2JEFA 1LWCA 2M8HA 2V8VA 4HDGA 1SV5A 3MEKA 5B0GA 2P6SA 1JLBB 1T94A 5DDQC 2NYIA 2W25A 4JV5F 1JLQB 3QYYA 4NLSA 1MMLA 3KLVA 1RDRA 2B3TB 4DUZF 3JYTB 3RBEA 4ECZA 1ZM4A 2QZ8A 2VG7A 3J7Z5 3Q0AA 3D1OA 2PEHA 4QWEA 5AJ3F 3ITHA 1QLNA 3I96A 3LP2A 3RW7A 1HYSA 2GJ2A 2OPRA 3IS9B 4XDCA 4C98A 1T95A 4ZPBA 1WHVA 4A4JA 2ZH8A 2DHXA 3A1YG 4ECTA 4FPRA 3DI6B 2YNGB 3MTJA 3I56S 4PG4A 2RNEA 1S6PA 2AU0A 1VBYA 2ZH9A 4H4MA 3CEDA 1FDDA 3LQVA 4IQMA 3SV4A 1WHWA 3M32B 1OIAA 4ED7A 3CDUA 2W8LA 5J2PB 2DIUA 1S1XB 4WZMA 2XNQA 2I1RA 3UR0A 3HVTA 3DU6A 2KT2A 1VBZA 4ERDA 4LIRA 5F8MA 4LQ3A 3IRXB 2EPIA 1C1CB 1KTQA 1ULRA 3H2LA 3WDOA 3AJ2A 3A8EA 2UZAA 3Q24A 1HBOB 2YKPA 4R5PA 1VJWA 1WF2A 2N82B 2VB6A 3SCLE 5A8KB 2UU9F 2EFVA 2QV6A 2FVPA 4TYAA 5HMYA 2BOPA 2FLNA 3FEXB 5M2UA 4HTJA 3I9ZA 3T9ZA 3CCZA 3MM5B 3BGFA 2KM8B 2LQ9A 5HBMA 4M5DB 1WNEA 1S1VA 1XR7A 4GO5X 4L6V3 2AJFE 1KC8T 3EXCX 1S6QA 4RNNA 4PQUA 4QOTA 4XIUA 1S77D 1K9MT 3TA2A 4MK7A 2EKYA 5D4LA 2GHVC 1Y5LB 3FQLA 2G9OA 1QUPA 2BV3A 1RT3A 1TKTB 5L1IA 3K0JA 1F5AA 2CDQA 2FGCA 4ID5B 1A6LA 3VR1A 1FRXA 1SUQA 3V6DB 3EX7B 1TV6B 2U1AA 4ELVA 3RRKA 2GO9A 3IAM9 4NYZA 2FVSA 4LUBA 1TL5A 2W7AA 1WHXA 3OUYA 2YNIB 4CO3A 2KYXA 3SMZA 3PRDA 3SEOA 1VQ8S 1PO6A 2N4DA 5DGAA 2W24A 1LKZA 2XLIA 2RQ4A 3MOJB 4WYLA 1X4EA 4P7TA 3T5LA 1QM9A 2IJNA 1U1PA 1G7CB 1TL1A 4O4GA 1SJ1A 2GHWA 3M8PB 4G1PA 3RR8A 1C1BA 2JOQA 3M8QB 1J5EF 1VBXA 1NKBA 1X8DA 3IN5A 3QAUA 2RRAA 3HO1A 2XMMA 1X4GA 4NRUA 4OLPA 2QEXS 4PXCA 4MJKA 3DM2A 4O0IA 1Q16B 2MSTA 4DG1B 3RR7A 1Z2ZA 1KONA 3HMJG 4P6QA 3D1QA 2DPJA 3CC2S 4LJMA 4TNOA 3HHEA 5J2NB 2CJBA 3E51A 3QIPA 3J7YI 4N77A 1VLYA 3T1YF 2FJEB 3D54A 4ED2A 1MW7A 1VC6A 4QR2A 3NGDA 1YSJA 3T1AA 1XNRF 2VPZB 2B6AA 5AE3A 2GNKA 2JWNA 4KV8B 2QLXA 5KG0A 1QE1A 2FD2A 6FDRA 5FD1A 4KO0A 5KT3A 1V9OA 3Q8RB 1N48A 2OTLS 2YNHB 3KLIA 1KOHA 3MMJA 4G1IA 4DSJA 3BREA 4KTQA 4EWTA 4C3MA 2KKHA 5KFBA 3SFGA 1NJWA 2GCFA 2IC3A 2PC6A 3N28A 2J0SD 3V2UC 2EK1A 1HMVB 2JX2A 2MY8A 2YKNA 5IM0B 4J9MA 1HD1A 1YJ9S 3IR5B 2QMXA 2RDIA 3JTPA 1RTJB 4NLQA 4B3OA 4OHZA 3ZZRA 4EU0A 2H9ZA 3GIJA 4DV0F 2IAJB 4RW9A 1MWZA 2BYCA 2XMJA 2YWGA 1U6BA 2X51A 4OFZA 2ZVSA 2XY5A 3MMAA 4IG3B 5DETA 4PWDB 2X1GA 1URNA 1GTEA 3S01A 2JFDA