4P7VA

Structural insights into higher-order assembly and function of the bacterial microcompartment protein pdua
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
86
structure length
86
Chain Sequence
EALGMVETKGLTAAIEAADAMVDSANVMLVGYEKIGSGLVTVIVRGDVGAVKAATDAGAAAARNVGEVKAVHVIPRPHTDVEKILP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into Higher Order Assembly and Function of the Bacterial Microcompartment Protein PduA.
pubmed doi rcsb
source organism Citrobacter freundii
molecule tags Structural protein, electron transport
molecule keywords Polyhedral bodies
total genus 20
structure length 86
sequence length 86
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2014-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00936 BMC BMC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1710 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4p7vA00
4RBUA 2A18A 4OLOA 4QIVA 3SSRA 3DN9A 3DNCA 3CIMA 3I96A 4RBVA 3NGKA 4DDFA 3CGIA 3VCDA 3SSSA 2A10A 4OX6A 4QIGA 5L38A 2G13A 3I6PA 4AXIA 4P7VA 3NWGA 4AXJA 4OX8A 4OX7A 3SSQA 4QIFA 4QIEA 4PPDA 3MPYA 4P7TA 3MPWA 4OLPA 4P2SA 2A1BA 3BN4A 4LIWA 5DJBA 3IA0A 3N79A 3PACA 2EWHA 3H8YA 4RBTA
chains in the Genus database with same CATH superfamily
4AUKA 3VAGA 3BDEA 3AOCA 4LSNA 3KMSA 2ZHAA 2F8EX 2HFVA 4FF4A 2R7SA 1X4CA 2OGUA 3M2UA 3SDEB 1PJ6A 4ECRA 4MAKA 2DGVA 3SSSA 4LF6F 1Q95G 3V6KA 3R97A 4WP8A 1T9YA 5IXUA 1NDPA 3DRRA 2QL9B 2DY1A 3M05A 4TNOA 5IM0B 4QWCA 5JJBA 1M0SA 2FJDB 3CTRA 1JMTA 4RW9B 3K5LA 2ZEJA 2BR0A 1TL4A 1WDDA 2VG7A 2MQPA 4BDPA 1FDNA 1F5AA 1LXJA 1OYEA 1SXLA 3CMQA 3M32B 3POTA 3LGHA 5F8MA 2FJXA 4QYRA 3GMGA 2PDAA 2K2PA 2FVSA 3TVZA 2HIQA 4D3GA 3TZWA 2MQQA 2UVWA 3UDLA 4TXSA 1RJJA 4FF3A 1VISA 2QC3A 3OR1B 4FN5A 2V2QA 4OJHA 2NXJA 5GAEU 4IKAA 3OR1A 3U1NA 2NREA 1J5OA 2MY7A 8RUCA 2OTLS 1U8WA 3D5MA 3F0NA 2BBEA 1PYOB 3FCWA 1P1TA 4LF1A 2JEIA 4FPIA 4FBUA 1Q8BA 1IN0A 2WHOA 4AXIA 2ASYA 1OPZA 4CRJA 1NK6A 1DRZA 4QIFA 2V8PA 5J1PA 3D6TB 2R8HA 1RHMB 1XNQJ 2GIRA 5FIIA 3DM2A 1J5EJ 1NMEB 2HAIA 1LWXA 2VFUA 3ENQA 3T6BA 3OL7A 3PW7A 5ETMA 8AT1B 5FD1A 3E51A 2ASJA 1KFSA 2POKA 5HO4A 2KFZA 2LQBA 4RW4B 3SFUA 1J5EF 2BDPA 2KYXA 2PO4A 1QVGR 2WCXA 3MCOA 1KFDA 2PMWA 5IQ6A 3AAWB 3QWPA 1FRXA 2PT0A 2HEKA 3PX0A 3UN2A 2BM1A 2HQGA 3DMJB 3KJQB 4ECTA 5D3GA 3GFYA 2J7UA 2JSXA 3RBDA 3AXKA 1G1XA 1HMVB 1N0UA 4ECYA 2XBPA 4KB7A 2V69A 5CYMA 4YR0A 1FX4A 1VRTB 4DBQA 4K2XA 3BBBA 1B7FA 1ELOA 1TL1B 3T5KA 4ES3A 1V3RA 4ZKAA 1FKAF 2ZBQA 1G3OA 2RRNA 1EQ0A 3C16A 4JBCA 2AX0A 5D4PA 5GAHU 1N32F 1RWVB 2UUWA 3KOAA 4OYMA 2VPWB 4LUBA 3AQPA 4TU7A 2HHHJ 5CYJA 4A8MP 2OUGA 4RNFA 2YX4A 3J7ZT 3Q2SC 4FP9A 1TZ0A 3OFGA 2B8QA 4CO4A 3T5HA 4ES2A 4LRDA 1RQ0A 4OJGA 2DNPA 2E1PA 2FLOA 2G0IA 3MM6B 3OD2A 4FF1A 3KTQA 3QRRA 3GJRB 4K4YA 2XY7A 3DOKB 2C2RA 2PI5A 4C8NA 1F3VA 1GX6A 4MYTA 3N5FA 4ZPCA 2R7XA 4G1QB 5F0UA 2XC9A 2H5IB 5IT4A 4E8UA 3R2CJ 1C1BA 4DL2A 3M8WA 4JB8B 4PUOB 3TZYA 2LQ8A 1DARA 3VAHA 1IBLF 2BQRA 3JQMA 2UU9F 1TL7A 3LUYA 2EFQA 2IC3B 1SI9A 2Q6CA 1LWEA 5M2UA 2R2RA 2RSQA 4LFCF 4OZ5A 1VBKA 2B43A 1JLQA 2ZOMA 2Q43A 1EETA 3IS9B 2EVZA 3QO9B 4MYUA 4RW4A 4QWEA 4F36A 1EB0A 1TV6A 6FD1A 4J9OA 1U09A 2VL1A 3G6XA 2G1DA 1PIEA 2MZTA 3BYPA 2X1AA 1NK5A 1GX5A 1RTDA 3DFEA 2C2MB 1YQHA 2P6TA 5DZ7A 4ZVEA 2MSSA 3PW4A 3CDBA 4URQU 4K4ZA 1T7PA 5IZHA 3CCVS 2VOOA 2OO4A 3PZPA 1MROB 1S5ZA 3G9CA 2CNNB 4CO0A 3MMCB 2HFOA 1KQKA 3N6LA 3FZBA 1AB8A 3N28A 4KFBA 4M1KA 2JWNA 2RIJA 1CJVA 1RAGB 1S1UA 2BXJA 3GG1A 2MEWA 5H9EK 2MYFA 5IV3A 2XCPA 3GPAA 3CCES 4P2XA 1TKDA 2HVIA 4CQ1A 2W7PA 2YKOA 3CF5Q 5IC4B 1FTCA 2EBGA 3UI3A 3UFCX 3A3NB 5E41A 4EBCA 5HL7Q 4NRUA 4YY3J 4K59A 3TEGA 4CLPA 4ALZA 2HHQA 2JVRA 4FYWB 1UFWA 3NG8A 1CC8A 4X4NA 2CIMA 1Q4RA 2BJ8A 4QW9A 3IBWA 3NGUA 2AYBA 2MY8A 4OV6A 1G7CB 4QIGA 5EN1A 4ZA1A 3GB0A 2E5LJ 1VJQA 4P7VA 1TKXA 2VDIA 2M88A 2N3LA 1X5PA 2OPSB 2J6UA 2M2BA 1S1WB 4WP3A 3BQ1A 2UV8G 1TV6B 4O0NA 3NS7B 4PG4A 1CQNA 1VLOA 2NS1B 2QLWA 3C66A 4RPFA 3PFEA 3KG1A 4FYYB 4TYAA 4Y34A 2CG8A 1N34F 3KXDA 2FJAB 4N47A 2EFPA 3WX4A 5A8KA 1E6VB 1SIZA 3I55S 1UVIA 7FD1A 2XTJP 1KBRA 4F0HA 3MM8B 5KG5A 3K2YA 1RWWB 3ZZPA 3J7YU 3CB4A 3JTPA 4LJMA 3RTVA 1XWLA 2L9NA 3OJUA 1S0NA 5L1IA 1CJUA 4K2JA 3PO4A 2CVIA 4JUZA 1DY3A 3GJQB 1T03A 3HHEA 3N6NA 4WE1B 3NGDA 4FKYA 2QTWA 4DFKA 1DJ0A 2U1AA 1MNEA 3PXGa 2Y1JA 4DCJB 4ZLPA 3DOKA 1LFPA 5DZ6A 3G6ES 3W8PA 3QIPA 3J81U 2IIHA 2W9CA 4HDGA 4DL3A 3MMAB 2BJ7A 3NCRA 1RP5A 2DNZA 3DU6A 2AZ1A 2ATLA 5A8RA 3LP2B 3GILA 2CJKA 4LVOP 2A6OA 1NDCA 2FQQB 2UUAJ 1AT1B 3JQKA 4ELTA 3MD1A 2WB1D 2KM8C 2EXUA 3ENVA 3MPWA 1Q8IA 4M5DB 4KAIA 2W7AA 4IG0B 4M5JA 1SC4B 1D1UA 3D4JA 1RWOB 2QV6A 4AYBD 4G1IA 4XPCA 3I87A 5HVFA 2M8HA 3C16B 3WQPA 2MGZB 4M5NA 3C46A 4WXOA 1S1VA 3JTNA 2DH8A 2YKAA 4RKUC 5EX3A 2J0QD 2HNDA 2C2OB 1TU0B 2EC2A 4EI2A 2RS2A 2J9EA 1WKLA 2IAJA 1HI1A 4E98A 2GJ2A 3W63A 3W9HA 4Q44A 4E0DA 1YDLA 5JVHQ 3DRSA 2M9KA 2JC1A 2XCAA 2HFSA 3TVKA 2OD6A 5HQLA 1V6HA 4I7FA 1MROA 1X4HA 3GIJA 4WKYA 2QEXS 2DGQA 1G4CA 4QIEA 4LFCJ 3OV7A 3RR8A 1NUEA 1TL3B 2H65B 3DLJA 5KT4A 2YWWA 3KLHA 1FDDA 2HFUA 2QLJB 3AT1B 4J9QA 4AQYJ 1LV5A 1JJ2R 1N5QA 1S10A 3W2WA 3QFWA 2RKIB 4HR2A 4JI3F 1RAAB 1S1XA 1X4FA 1KQGB 2C3OA 4NZ0A 4KR0B 1FFWB 4AL5A 1P6TA 3CVKA 1FJCA 2COLA 2OMLA 3BR9A 1Y4ZB 3MOZA 3QSYB 1S7IA 3R5AA 4CNYA 2BZ2A 1QDUB 3C2PA 1GH8A 4JI4J 2UXDJ 2ZUGA 3MMBB 3EGZA 3DRSB 3MPDA 9RUBA 4ECQA 4OZ3A 3KDNA 1IBMJ 2IAJB 3BGLA 1HBNB 1N36J 1NJXA 1C1BB 2BJDA 5C24B 1FRLA 4ANEA 3DDKA 4ED4A 2VBWA 3CJ8A 2XO6A 2FVRA 1RTHB 2B4PA 3RAQA 1UWAA 2CZ4A 1MWYA 2RE1A 5CD4A 2HRTA 2VF3A 3W65A 2ASDA 1QJHA 3SYZA 2WVCA 1YZ6A 1YHQS 4JI8J 4OLPA 4DUYF 3IAS9 1H2VZ 4R0JA 4WKRA 2B4OA 2F65A 2LLZA 3PCOB 3CCSS 1VQ9S 3AJDA 3ENAA 3N79A 2W25A 3CULA 3BM7A 3PACA 2G2OA 2YBVA 4PG7A 3Q24A 4YFUA 3CCLS 2AJ1A 1HQEB 1RAOA 2XEXA 2GC8A 1JNZB 1Z1ZA 2BRLA 2DO0A 2UZAA 3ADAC 3EXYA 3GG0A 4I2QB 2W9CB 3UD4P 2C42A 5BR8F 4HEA9 1X9MA 4DPUA 3FZ2A 2IRYA 1ZM9A 1U1RA 5B0DA 1PBAA 4UOGA 1RI7A 2KM8B 4DR7J 3I4HX 4U7CA 1CEZA 5DLFA 3CPWR 3V4IB 3M1VA 1U49A 3DLHA 4MJKA 2C2NA 4OZ2A 1DQ8A 1R89A 2CQHA 4PPDA 1KRPA 3Q8YA 1RA6A 5LM7E 2V68A 2XB2D 1UJ4A 1RACB 2MMYA 3IA0A 3K57A 1HFEL 2OELA 3V81B 1ACMB 1NKEA 1S1WA 1S6PA 3PO5A 2Y9HA 1Q86T 1NJZA 3MUMP 2HURA 2DHSA 4EZ9A 1HD0A 3KJNB 1QD1A 2EW9A 4DSJA 2HQIA 4I2PA 4YMEA 1U2FA 1LW0A 2VB6A 3R7SB 1KTVA 3D1OA 5F3TA 3CMAS 2UVRA 4GO5X 4ES1A 3OL9A 3BZQA 3CJKA 3BSNA 3JSMA 2HBZB 1SQFA 4O44A 5J1EA 1CJKB 1Q8KA 2EG2A 3NS6A 4YB5A 4DHVA 2CQIA 3KLEB 2V9KA 2DNQA 3I56S 4DR3F 2O67A 2P8IA 3QRQA 4PYAA 2YNHB 1KKHA 1TAQA 3ULHA 1IQTA 3F41A 1S1UB 4DV1F 4UOFA 3HFZB 1ZAXA 2FZGB 1HBNA 2A3JA 2P2CB 5KFAA 4WTOB 1AZSB 1KLNA 1HI8A 4ZJQA 2RILA 1GXTA 1LW2A 1JQGA 5C42A 3H5XA 5B0BA 4DDFA 2HVDA 8ATCB 5AE2A 3WC0A 1MG7A 3SCIE 5HBMB 3MOJB 1FXRA 1U6FA 1ZBTA 3OW2R 1REVA 5LSOA 2C2EA 1PAEX 2VV5A 3AOAA 5ETQA 4C0OC 4K0KF 3WIVA 1KP6A 2MKCA 2IMOA 1UFLA 2YWHA 1RBAA 2CNLB 3PIPQ 4UT4A 4XDCA 2RHSB 1GFWB 5I42A 3TA1A 3CJ0A 2ZE2A 2GX8A 2XMTA 3JYTA 2QA4G 3FKBA 5H1SV 5L1JA 2C2DA 1T9UA 1YJ7A 1N8RT 2CQBA 4MIWA 3UNGC 2B9XA 5HMXA 3MURP 1XIQA 3MAHA 4KE5A 2W4DA 1O8BA 1KOHA 4LREA 1IBKF 2DH9A 4YB6A 3CCUS 4W98A 2DR5A 3OR2B 5E2QA 2MHNA 5HJYA 2HZAA 1SPBP 4C7QA 1FXDA 5DO2A 2HKEA 2V34A 1WC4A 1I1GA 4DN0A 2MKKA 2V4QA 4F7VA 2NXUA 4ICLA 3BBFA 1TK5A 3H25A 3KK3B 1FFGB 2AX1A 4L75A 2CJYB 4ZDNA 1X4DA 1D8YA 2A0FB 4KO0A 3KK1B 4I56A 2LU1A 2HPUA 4CT8A 2A2CA 4NI2A 1ZH5A 4KO0B 3KK1A 2GIFA 4ECWA 3N9UC 5IT9Y 2HWHA 4MKAA 5F8GA 4WTYA 1IBCB 3J81j 4ED3A 1YBUA 1HNVA 1FDBA 1TMMA 4LR7A 4DV6J 5IC6B 2FGOA 4J9NA 4ZVQB 1KONA 3FVYA 3NOGA 3LQVA 3IMQJ 4K7QA 2DR9A 4KGMA 3T41A 4F8RA 4DN9A 4J9VA 3PYDA 3Q23A 1UEVA 4NA2A 1W26A 4NRTA 4DPYA 1ZAVA 5KFEA 3CJSA 1S4EA 2Q66A 3VV2B 1FD8A 1LWFB 4ZP8A 4USMA 3N5BA 4ZS6A 1JJHA 4AQYF 1G2EA 2WW8A 4LF7J 2QLBB 2VKRA 1W25A 2F4FA 3R5GA 4B17A 3V2UC 1M1GA 1VDHA 3IWLA 3HVTB 2ZC4A 1FI4A 2DKOB 3EGNA 2QLFB 2BKPA 5A6PA 4N76A 1H7XA 3H5YA 1GEHA 1NK7A 2HVEA 1VJWA 3L9ZA 4MK9A 1REVB 2LFVA 4DS4A 3TZXA 1HNIB 1S6QA 2RNEA 1FKPA 1T8EA 1RWKB 3GCWP 4PWUA 1N33J 4C6AA 4X4VA 2I5JB 4X4TA 3ZZRA 5EX0A 1VR6A 2HRUA 4NMLA 2BMBA 5CYQB 2XO7A 3PV8A 4KHPJ 3E01B 1N33F 2RD5C 4XK8C 4DR6F 4RNMA 1OY9A 3IGVA 2DNRA 2UUAF 3FRYA 2VOPA 4LF9J 2AGOA 3N0VA 2FHOB 3DGVA 2RRBA 4ZVPB 2RRAA 3W61A 1KQFB 4NLGA 3TUPA 2D41A 5DM7Q 4IR1A 2GNKA 1U25A 3TW0A 3LA0A 5BXIA 4F02A 1WD6A 1HKAA 2WB4A 3CO0P 4P2SA 2KO1A 3DRPA 1CJKA 4IQMA 3G4SS 4CZCA 4NCGB 4NLUA 4PXDA 5CCMA 2B6AA 2OI2A 3DKDA 2BV3A 3NAIA 3PYEA 3GIMA 4DQIA 2K3IA 4CYUB 2D1CA 4CCHA 5L46A 2RU3A 4GVBA 1CS4A 2W01A 5AXMA 1RGVA 2ACMA 2AZ3A 4IOAQ 2XS5A 1U26A 4I2PB 4DU8A 3QQCD 1IKXA 1HNZF 4IG3A 3OFHA 1HW8A 3KMQA 3QT8A 4PWDA 3C19A 3D1QA 1N5VA 3GSDA 3M2UB 3PFOA 4DXLA 4I6AA 3TWZA 3UD3P 2NZCA 5CH7B 2RB7A 3RB4A 2AYGA 4LBPA 1G6BA 4NLXA 1RHQB 1YLXA 4PRFA 3P4UB 4Q0BB 4KPCA 1WC1A 1MLAA 4LT6A 3THPA 3VGVA 1LWEB 1LEOA 3HSZA 3EWGA 1RYRA 4JI5F 3SI8A 2IC3A 3M8RA 4IFYB 3OR2A 3HT0A 3E3XA 1NK4A 1ZOTA 1K9MT 1FK9A 5ETVA 3LOUA 1UAWA 1BQNA 3NXZA 5C25A 5KFOA 4IDKA 1R8CA 1CSJA 2D3OR 2KRBA 3T9NA 2Z2MA 4NZ7A 4B3OB 2I1RA 1V5IB 1SV5A 3JB9k 2B4VA 4YY3F 2KXNB 2HNYB 1BQXA 1QE1B 1L3KA 5A2QU 3H2UB 3L7UA 3BJYA 3OTEA 3FUYA 1RHRB 3HKZD 3OXLA 4EUVA 2M3DA 4X66J 3MDFA 3GIKA 4K4TA 1OYDA 2F9JA 2FPHX 3IC1A 3PNIA 4XAKA 4QQBA 1R8BA 5K9FA 4DR7F 4IOCQ 4ED0A 2FC8A 2H3EB 4NYOA 4LBIA 1RT4B 2VFVA 1GTHA 2BW2A 3A13A 1R3NA 3DLKB 3HFVA 3DLGA 5B0AA 1SBRA 2MZ1A 3W8GA 1VYAA 3QNWB 4B9VA 2QT7A 1FXLA 4NEZA 2CADA 1UTAA 2PEHA 2C3PA 4Q2MA 4WU3A 5C42B 3V6JA 1ZM2A 3M7VA 4Y3CA 1NBEB 3TYTA 4IQXA 1FJGF 2WTFA 2DVIA 3HJFA 1JLGA 3OFEA 1NB2A 1H2TZ 4UF4A 3KUEA 3LP1B 2J76E 4K4XA 2GCFA 1RISA 3KHRA 1RT7B 1CQMA 1VRQC 1WSRA 2YNIB 3N01A 4JP8A 2WVEA 4C8MA 1TK8A 2UXBF 1FE4A 1IM4A 1YKWA 2XGPA 2R2UA 1R6YA 2ZWPA 4NOHA 5J2QA 1ZTTA 1KSPA 1PYSB 2F3JA 4F4XA 3DRXA 5EWEA 1B70B 4DV7F 2HHUA 2DPJA 1TUVA 1T94A 2RQ4A 2ZH5A 4ZLLA 2PA8D 4IO1A 4B08A 4WFXA 3VWSA 4DL4A 2MLXA 1X4AA 1PKUA 3TR5A 3VF0B 4CNZA 1SV5B 2DY9A 4FKXA 2PEBA 4DCOB 1Q81T 2KTQA 3FQKA 2MPUA 1UVMA 3ITHB 3TA2A 1YITS 5F9NA 1V9OA 5IFMA 4MIBA 2RDDA 4DLEA 4X4QA 1SIWB 2QMWA 1K0TA 2B4UA 2H54B 4ZK7M 4HT7A 4OV1A 2IBKA 4OX9F 4X66F 1MW7A 2F9DA 2R7TA 4F3MA 1JLCB 3CWJA 4FYVB 5JXSA 4Q5VA 3I5CA 1QSLA 1LOUA 1XK8A 3CJ3A 2BE2B 4ID5A 4DSLA 2QG9B 1H73A 4ZPWR 2YQ3A 5HLFA 4WIQA 4NL5A 3MAQA 2E1RA 4IYQA 3LPYA 4ZJLA 1H38A 2O3DA 2ATCB 3CJ2A 3NWRA 4NX9A 5KFZA 1RCXB 2BYCA 4IG3B 1QUPA 2G2ZA 2JL9A 1FFSB 3SCKE 3KK2B 1GMUA 5F41A 2VHGA 2P9CA 4NYZA 4X65J 2M0GB 4OYOA 1FX2A 4RW8A 3K5PA 4JOUA 3P5TL 1CBKA 5KG0A 2CZVC 1TL5A 4OZ1A 4CLKA 5LXRA 3TUZC 1T05B 2EFOA 1UPMB 2CQ4A 1XMQJ 2KVIA 2JEJA 2B6AB 4B3MF 4RBVA 2VBXA 3QAUA 1BUXA 4A8FA 2ZOFA 4JV1A 3R2DJ 3F44A 1PAUB 1JLFB 1RLCL 3PYFA 2BE2A 3MUTP 1RT1B 2OKQA 2Y1LB 1NK8A 1DBDA 1H2UX 2HIYA 2MQLA 3PX4A 3CC4S 2BOAA 4R8UB 4ANCA 5IT9U 1S9GA 4LBHA 3PW5A 2DGUA 3EM1A 2HLUA 3VVTA 1IXKA 2KYZA 4FVCA 4RW7B 2HHSA 3B78A 4OYBA 1JJCB 2FJEB 3OL8A 3KHLA 2DCLA 1VQLS 1UP1A 2FLPA 4TU9A 2FHJA 5D4LA 2CKWA 3VTIA 4U6PA 4ZMMA 3K59A 1APSA 1Y5LB 2B3TB 3HZGA 4FPRA 5LXYA 1U7LA 5L1LA 1FKPB 1NCLA 2FVCA 4YDDB 3JQJA 1Q82T 5H9EJ 5KOXA 3T3FA 4M5GA 2E44A 4NLDA 2KH9A 1SKRA 1BC6A 4JV5F 1HPZB 5DG7A 1IUJA 1U0HA 1XMQF 5J1NA 3D67A 2ADBA 2ASLA 4Q45A 5KFKA 2J0WA 1IM6A 4LF8F 4P2FA 4N7TA 3A1YG 4NASA 1HHSA 4HHHA 1NDKA 4QYZJ 3QT7A 5HVHA 3OTOF 2YKNB 3D3BJ 4A8SA 3M9NB 3G82B 1A0OB 2RMLA 3BR8A 2J0SD 2BQ3A 2AEJA 4LMZA 1CJVB 2GIQA 3Q8UA 3MECA 5ITHA 1KLMB 2E66A 3KLFB 2DBBA 2IJNA 2VUGA 4KHMA 5D0EA 2IBOA 3GV8B 1S0MA 2ILYA 2L9WA 3PKMA 1I94J 2DR8A 3J80Y 1P1LA 4DCPB 4CLUA 2VD3A 2VONA 1S1TB 1C1CB 4OLOA 5AJ3F 5MLCV 4F4ZA 4PQUB 1RDRA 3O5TB 4PXBA 3U7JA 3I96A 4U8YA 1N5YB 4B9UA 2R42A 2ZD1B 4MKVA 1EHWA 2ZDPA 3B4DA 3D6HB 1U8SA 3MR7A 1RLDA 4MTPA 3LAMA 2YKPA 3RBEA 3O1LA 4ED8A 2OIHA 4HKQA 2H4YB 3W9IA 1BQMA 4DR3J 1T9XA 1NPRA 1PJ7A 3I0RB 1HBMA 1QE1A 1JLQB 3IS9A 4I6WA 3TANA 2JH3A 2XQCA 2F4VJ 2LYVA 1UW4A 3JXOA 1CLFA 4GRSA 2W4CA 5IWAF 1OJ4A 4DR4J 1X0FA 3V5RA 1BWEA 1C4CA 2LEPA 2IFXA 1ZA2B 3BN4A 4A8OA 2E7XA 4IDKB 4CLLA 1UWBB 3LWMA 1TMJA 1ZS6A 5FDLA 2IRUA 4L3KA 3UDCA 1FNXH 1QAYA 1KD1T 1FWPA 1KN6A 4G1QA 4CM0A 3N6MA 2CPXA 4DQRA 2ZJQQ 3M2RA 4NWBA 3OHAA 1VQNS 1ZETA 2MJUA 4WU2A 4DU7A 4RJVA 1OSCA 2JEFA 5D0GA 4ZIWA 4Q0BA 3Q0AA 3I0RA 3GYGA 1QSYA 1HARA 5HROB 1FRHA 5B0GA 2F8HA 1BQMB 3X3UA 4QWDA 3PIOQ 2K8GA 5KAKA 2OHDA 2ZBPA 4DV0J 4ER8A 3UO0A 2OPSA 3MEDA 4KC5A 3TJAA 3KLGA 2MKHA 3G2XA 4DV3F 1VQ6S 4UW2A 1Y0HA 2HWIA 1H72C 5CQGA 2YNGA 5CD4H 4ETZA 1FA0A 3DCAA 3G71S 2MJNA 4J7CA 1Q5YA 2CWXA 2IJFA 2AJ2A 1DQAA 2DO4A 4GVBB 4USHA 4XIUA 5FLXU 1VQPS 3FBFA 1FRJA 1RA7A 2G0CA 1GMVA 2MQMA 4IRDA 2LXFA 2YWKA 3IXQA 3R3TA 3AH6A 4Y28C 3G86A 1HBOA 5BYRA 4ID5B 3TRGA 3T1HJ 2XS2A 3BKUA 4LFBJ 1JLAA 4LVNP 5H9FK 5K14A 2FB0A 5JUMA 4FYDA 5ETTA 1IJFB 1T02A 4ZPDA 3RB3A 4ZIVA 3R1LA 1B64A 4RNNA 4KPYA 4A46A 2GMLA 3DYAB 2D3O1 3P8BB 2R7QA 3L95X 3MTKA 3Q89A 4TQRA 1M1KT 4OYAA 3MM5B 4ECXA 2UP1A 1MMDA 3Q2TC 2YWGA 3ETOA 4R0EA 2MKIA 2ZH4A 1H0HB 3EGVA 1Y10A 4LF4J 1AXQA 1IWGA 1UZHA 2E7VA 3MZIA 5KFCA 5ETRA 3CCTA 5GAHI 1HNZJ 4ED6A 3PJ9A 4PEOA 3U1MA 2V9WA 2YTCA 3DOMA 3S01A 3JSBA 3MXHP 2B5JA 3D6MB 2IY5B 2V8DA 2E9TA 3US5A 1R8PA 3HFKA 3TP2A 4L73A 3IRWP 5KT5A 3HXMA 2DIVA 1S99A 2CFXA 2ZC3A 4JI4F 2V67A 2QIFA 4ZVUB 2JX2A 1J27A 4YN3B 5AXNA 3UR3C 4K4WA 1ZA1B 3QO9A 5J2QB 1J5OB 4OL8A 4H4OB 4EU0A 3MM9A 4F4WA 1FEHA 1LWFA 1EIYB 1SC6A 3T6JA 3VQTA 1JLGB 4CM2A 1VS3A 2M5YA 3CJ4A 3EUNA 2UV8A 3M8PB 3SFGA 2W8KA 1HWLA 1T3OA 3KLIB 5KG6A 4K0KJ 3O3LA 4B9LA 1M5KC 1HWJA 1WHVA 2KU7A 3M32A 5DDQC 4DMZA 2HQFA 4DPTA 1T05A 3ZTQA 3IGNA 4CI0B 3OTBA 4MMOA 4FF2A 2XZWA 1MN7A 2GQQA 2QMUB 1R7IA 3LTOA 3M6WA 4OHYA 3IFEA 1VLYA 3MEDB 3KLGB 2PFFB 2KJVA 2DTJA 3OL6A 4ERDA 3DLBA 2DPIA 4KHPF 4Q43A 2ABYA 3VALA 4ZITA 1BY9A 5RUBA 2WSFC 5A0YB 1HL6A 2PI4A 3HULA 2ADCA 1U2RA 1PC5A 1FTRA 1RAIB 4IOBA 3KK3A 3CT9A 1NKCA 1JLCA 3I5AA 4X4PA 1XJWB 1RTHA 4F50A 1YJTA 2DGWA 4OZJA 5DETA 4NXMF 2R2SA 1VIOA 1X31C 2CPIA 3IP0A 2E5HA 2AV5A 5GADI 2LEAA 3UW1A 1VQSA 1U1LA 1MU2B 2K7JA 2YQ1A 5DJBA 1P9YA 1RT3A 4DQPA 1FDAA 2HHTA 2H1YA 1R0CB 2FC9A 3WIUA 5A8WB 3CC2S 4DUYJ 3GWCA 4L3NA 2ZH8A 1L3SA 3X1LB 3EJMA 3K8WA 3R9LA 3BPSP 3UPFA 1RCOB 3M2VB 3OQ2A 4O0IA 4DS5A 1FKOA 4P9SA 1B3TA 2UUTA 1PJ5A 2ERRA 3KFWX 4NPOA 2IYIA 4ZVHA 3ZZ0A 2DK2A 4W92B 4HHJA 1YTYA 1TVRA 3SQGA 2DJWA 1S49A 5EGYA 5HBMA 3KUHA 3GP9A 4O3NA 4ZPBA 4EWTA 1U6BA 4PPZA 4EK2A 1R0AB 2N4DA 2VPZB 3BSCA 2RDJA 4HDHA 3KLFA 1VBYA 1QTMA 3DRPB 2KHCA 2JFKA 3W66A 4B9TA 3GTYX 4HL9A 1ZAWA 3UVJA 4EBEA 1MWQA 2LMIA 3G82A 3K7RA 5JVGQ 5BR8J 1UPPA 2M4MA 5CHCB 3T1AA 4RU2A 3MM9B 4C3KA 1FRMA 2YNHA 2EK6A 1EP4A 4LRAA 4BWJA 4J9KA 3AODA 3TQ1A 2HW3A 3BGUA 5HJXA 3KLEA 2NYIA 4M5DA 1U45A 1KVKA 2LP4A 3PRDA 4N8OA 2HQDA 5D0HA 2XMKA 1WI6A 4ZVOB 1KHVA 3Q8SB 3GQCA 2X3GA 1QTNB 3KHHA 3CCJS 2WVBA 5T14A 2VA3A 4FBTA 3HSDA 3AA8A 4Y2IA 1WTBA 1S48A 1VGYA 1Y3KA 2QZ8A 2CG4A 1YJRA 2OJ3A 4EEYA 3PHTA 1LW0B 1LXNA 3AFGA 1M5SA 4RW9A 2R7RA 3HHLB 1ZYQA 4DR6J 2Q1LA 2AD9A 1IR0A 2XWYA 2QFJA 2DEIA 1Q53A 2H9ZA 3UD5A 5C7PA 2ZH7A 1WF1A 2C1EB 3C14B 1T03B 2R7VA 3FEYB 1IQZA 2JVOA 5T7LB 4WFYA 3IN5A 1ZTWA 1S6PB 5KFMA 2AGPA 1RWMB 2GO9A 3FCVA 3R5CA 2WVFA 4LSNB 3UCUP 3NKYA 1FERA 4HACA 1RAJA 2QLXA 5J2MB 4MK8A 2R4FA 3KG0A 2IVFB 3CJQA 3DLLQ 3M8SA 2CDRB 3CD6S 4DV5F 1Q5VA 4DR5J 1K0VA 1S6UA 1RU1A 4UQTA 3R7NB 1JX4A 3V4IA 2VQEJ 2RAQA 3ZC4A 5HQ8A 4JI7J 3OFFA 4TY9A 3UCZP 1EZZB 2C3UA 4M8LA 2HBRB 5THWA 4N5SA 1RE1B 3HD1A 4B3RF 1A6LA 4XO0A 3ZNUA 5K8OA 4B9SA 2HFZA 2HGLA 2OLWA 4FVMA 4LQ3A 1BGXT 4ECUA 1WG4A 4O3OA 2VASA 5D15A 3IG1A 2MDAA 1CS4B 2ZHOA 5HVGA 2BE7D 2AYEA 3NCQA 2QSWA 2J9CA 4IFVA 3W5ZA 4USWA 3D3CJ 1UA1A 3S7RA 2AIRB 1R8HA 1T0TV 3AXMA 4I0WA 1S9EA 1FO1A 2QX0A 4OZ0A 4GMKA 5I3UB 1NEEA 3SCJE 4DUTA 3I4PA 5KG7A 3OSNA 4NXNJ 3RRGA 2QL7B 3ZTRA 3RG6A 3KUGA 4JI0F 4ITSA 4OX6A 4GKKF 2B8PA 1SQEA 3CDWA 3LP0A 3U02A 1S76D 1WC3A 2C22A 4M94A 1RT2A 3VGTA 1AUDA 1FJEB 1ULRA 4YHHJ 1S0VA 2MZJA 3PEJA 5CYQA 5KFNA 4DLGA 2FY1A 2CA9A 1WJ9A 4UTGA 4ZN3A 2XI2A 2OFGX 1U0SA 4NLOA 1P9QC 3EMTA 4O3PA 2ZDOA 1SJ4P 1C2PA 3VGUA 2DGXA 1Y5IB 4B9NA 3PTWA 5LJ5Y 4N56A 2A2DA 3LANA 1EJ7L 3O2IA 4KGZB 3W62A 2KG1A 3D0HE 5HAOA 2RKIA 4U9RA 3W7BA 3HX9A 2Z2ZA 3I32A 4X4UA 3TX8A 2R8IA 5DGAA 4U96A 1DTTA 5KT3A 4GC6A 4CLSA 4J9MA 2HBYB 4Y2AA 2WOMB 5K8NA 1DLOB 3T1HF 2HHXA 4HI2A 2CZ9A 2J5AA 3THVA 4QWBA 5D4NA 3T5JA 3FBEA 1K44A 4IR9A 1UVJA 3FC9A 3HHNB 3AJ1A 3QAEA 4LFAF 1EKSA 2YY3A 1YK9A 3CEDA 3NGRA 1SH2A 7AT1B 1JJ4A 4JI6J 4ZVSB 3H2LA 4ZVTB 2PMHA 3TNVA 1URRA 1N5TA 1IR2A 4Z7YA 1QAXA 1WG5A 1U48A 4LSLA 2HNZA 2MGZA 5DGBA 2OTJS 3QLHB 2V50A 4FYXB 5D8HB 3GV7B 2XLKA 5BYSA 2ZKUA 4O44B 5J1EB 1T9TA 4DV1J 3SSRA 2WAQD 1GXLA 4KT0C 2RH3A 3C15A 4JI0J 4GKKJ 1OQ3A 3LP2A 4DUZF 3R5BA 3IG1B 3Q8VA 5J2NA 3W1YC 5CZXA 3M9OB 4DSIA 4DL5A 3AY0A 3J7A1 3IRXB 2XMUA 3HHKA 1NSQA 1KWMA 3MM7A 1BWVA 3MWBA 1TL1A 1WOPA 1GK8A 3DOLB 4RW6A 4C3LA 2HG4A 4L6V3 4RR5A 3CSKA 1VRTA 4C11A 4QIWD 5IWAJ 2XY5A 2ZWOA 4IUFA 3P3DA 2RJZA 1SUQB 2CQ1A 5HSPA 1WF0A 5KFFA 1AYEA 2XG8A 2D3UA 1ZPVA 5KFGA 3MM8A 3CCRS 2CUYA 4ZP9A 2FYXA 2AYMA 2HZCA 2NXEA 3M8QB 4DX8H 1N6QB 1S97A 3BO4A 5LT5A 1U47A 4I69A 3EX7B 1URNA 1JK9B 2HS4A 5F8HA 2KI2A 1H3DA 5I42B 1NHKL 2LDYA 2V8HA 2XMVA 3DNCA 3UCGA 2BJEA 3NGKA 1VBXA 4RNHA 4H54A 5T7LA 1KS2A 1TKTB 3BS9A 4U8VA 4YDXA 3BO3A 3FSXA 3HZEA 2QYCA 1WC0A 3QPIA 3AA9A 5CCLA 1H98A 3OSPA 1XN9A 2MB0B 2GFFA 4NLTA 4M63A 4IH7A 4W90B 1Q1KA 4P52A 2PIIA 3N4WA 3D1HA 4K5SA 4YUDA 4X84A 4Y6IA 3MCNA 4BC7A 1YJ9S 5L9XA 2HS0A 3AB2B 4ID8A 4J90A 4MH8A 3CIZA 4PCQA 4R5PA 2GJFA 1VMBA 4Y2CA 1QY7A 2VA2A 1WOOA 1EQMA 4OI6A 2IVYA 3KJFB 5LJ3Y 4Z7CA 2M8DB 2YH0A 1N88A 2YX1A 1EP4B 4OJ1A 2HHHF 4OHVA 1YWXA 1HNWF 1VQ5S 3NMAA 2DIUA 5E7OB 3OXGA 1S72S 2DNLA 5GMKa 1ZZFA 2LDIA 3I0SB 4RUAA 1OY6A 3CD0A 1MWZA 3J7YI 3VCDA 1NU4A 1VC0A 1N48A 3IR5B 2BEFA 2CPDA 1S59A 2GQCA 3H98A 3ITHA 3M30A 3MMCA 3ZZTA 4OQJA 3ZZYA 1F60B 4KH1B 4CLFA 3MCMA 4JI5J 3M9MB 2E1AA 3EPIA 1RBLA 2GGPA 2LXIA 1FVSA 2BA9A 2OFHX 4ED2A 1N36F 2YXLA 3DRRB 1FJGJ 3QBCA 4LRBA 4JI2J 4X4OA 1N0VC 5CAAA 1D09B 2CQCA 3Q22A 3VVUA 1XC9A 2BUNA 4JYAF 2CDQA 3SV3A 5GMDA 3V81A 1Y5NB 4MKYA 2VBZA 2PGCA 5D4OA 2N82B 2OPQA 4C8ZA 2HWTA 4ELUA 4G6VB 4I7FB 2KVQE 3CO9A 4PG5A 2RU9A 2XY6A 1MU2A 1OS5A 2QA1A 4B3SJ 3CJ5A 3LP1A 3K5MA 3Q8PB 2UXCF 1SUQA 2ZJRQ 1ZZNA 3QATA 3HK2A 3ZTOA 4ZP6A 3PEHA 2ZM6F 4YB1P 1JLEB 1JXLA 2Z30B 1XNQF 1S1VB 4ILLA 1PBUA 3DI6A 4KKOA 1F9EB 2KKHA 4DFMA 1X0PA 1S12A 1NRKA 4LF9F 4IG0A 4YHHF 4G3IA 3H59A 5J2NB 3W9JA 3M8ZA 5A0YA 4BC9A 3EDQB 3EICA 2I0XA 4DZDA 2NR0A 3MEEB 2ZH3A 1YJNS 1WG1A 2W2OP 2NCKL 3Q83A 4JI1J 1OPIA 1ROFA 4OI3A 3JS9A 3PG9A 3J7Z5 2AEMA 2ZVSA 3HF5A 4DX5A 1RT6A 1NJYA 3QLHA 2VBYA 3A8EA 1HNWJ 2BKOA 2D69A 2JLEA 4B3TJ 4LSLB 1XEZA 4UY8T 5BJRA 4CIOA 4KJIA 1LKZA 1S7HA 3DI6B 3OTCA 4KKOB 1JB0C 4AE5A 1RAEB 2XLJA 4DR2J 2GAGC 3BB5A 1TELA 3CDEA 1S57A 3E8OA 5D77A 5DDOC 1JKHB 1K47A 2ZBIA 5I3QA 2Y1RI 1CG2A 1U6ZA 2E29A 2WSEC 4IFYA 4BHQA 1T11A 3DMJA 2VQFF 4IO9Q 3V4MA 2LEBA 3QJPA 1U4BA 1CJTB 3ZTPA 3FBBA 2APOA 3FK4A 5A8KB 3MCSA 3LALA 1HHQA 3JYTB 1K73T 1K8AT 3HI9A 3QGHA 2VQFJ 2CJXB 2B7CB 1YBTA 1A9NB 4A47A 3G96A 4CLWA 3D28A 4P71A 4EO8A 3IM8A 4F25A 3BEGB 1TKXB 4P72A 1NDLA 2P9EA 3AOBA 2JFDA 1SL1A 3ZFVA 1K1QA 1NZ8A 2AT1B 2DNKA 2VPYB 2X1BA 4M5HA 2J8AA 2H4WB 1FD2A 3MMJA 4LFAJ 4C0BA 5JMNA 5KFDA 4DL7A 3W5XA 2H5JB 5U47A 2R9LA 4J9SA 2OEMA 2DH7A 2DNNA 4X62F 1C0UB 5A76A 2WK4A 4QBUA 4EYHB 4WZMA 3QWUA 4NLRA 2RUSA 3MI7X 5E3RA 4CTAA 5AE3A 1DHMA 1HYSA 1F5CA 1WHYA 2IM1A 2HFNA 2E5LF 3UQSA 2AF6A 1R6VA 2X7IA 4I64A 5KFUA 2IMWP 1WNEA 3E2EA 3GJSB 3CCQS 4F4YA 2DGOA 2F1FA 4J91A 3HO1A 2LVWA 2CPFA 2X3DA 4QU6A 1B4SA 2KL8A 2H51B 1SH3A 4B02A 1RBOB 2IPOB 4C9DA 1ICEB 1R43A 1HWKA 1UEUA 2H5EA 4H4MA 5G4DA 3RZAA 2I2YA 3GIRA 3OT9A 4R5PB 4C2MA 2P6SA 3POTB 1SC3B 2DGTA 1S79A 5A8RB 2A10A 2IM0A 4OYZA 1R31A 4HVZA 3OVSA 4WPAA 2FTRA 3T5LA 2G4BA 2OPRB 3PRBA 1IR1A 1FT8A 3IWNC 2J6SA 4UZCA 2MKSA 5F8LA 4OX8A 3VGSA 4OI1A 1RTDB 2XS7A 1HW9A 1FF2A 6AT1B 1TAUA 2MSTA 4I6YA 3R8YA 3UE2A 3RB0A 1FWLA 1WACA 4QWAA 4RNOA 3AB4B 2XSJA 2SXLA 5M2PA 2YPZA 4I67A 4KH0B 1HNXJ 3EGWB 4PXCA 1AA1B 3T1YF 4QZVB 1S9GB 2K1RA 3HHLC 3QIDA 3G8SA 2D3ZA 3NY0A 2CPEA 4KSEB 4WWSA 4JI3J 2IJRA 5KFPA 3L7OA 1RB0A 1VQ7S 3HM9A 3CJTA 2B9WA 1FEEA 2DR6A 3PR5B 2VH7A 3TUJC 3KHGA 2ALZA 5J2PA 4FS2A 2GQ2A 2FHKA 3C6TA 2GMHA 4A8WA 2ZKTA 5HMZA 1LNQA 2KHDA 3K89A 3IRXA 1HNVB 2GW8A 2K7KA 3MD3A 4RLEA 3MR6A 5E3AA 4DF8A 5M2RA 3SEOA 1GXUA 1GTEA 5IV4A 1TTHB 4ECSA 2BABA 2E5GA 4A8YA 4HI1A 3NP5A 1F0XA 2HSEB 3AJ2A 1VQYA 4NLQA 3HVRA 2DHAA 2VFRA 4H4MB 5KOWA 5HLFB 1Z2LA 4V19X 2BVZA 2FZKB 2KB2A 5HI7A 4TU8A 4J9PA 1N5YA 4P10A 3WC2A 5HP1B 1PG5B 2V0NA 4ED5A 1C1CA 4PQUA 4OJ3A 4GO7X 3D0GE 1M5OC 1WC5A 2OAUA 1KHWA 2B56A 4GC7A 4DSFA 5C24A 5KG3A 1PC4A 5CYMB 1HI0P 3PX6A 3AD7C 1GT8A 1TR0A 3OUYB 2X1FA 2ZNYA 5HANA 1YRUA 2ROGA 3GSIA 4DR1J 1W7WA 4P2MA 4KIAA 4RUBA 4DR5F 3MR3A 3G6YA 1NZAA 2DXEA 4NE9C 5KFWA 5LL6d 2OH2A 2BKNA 2VODA 2ZM6J 3TAQA 4MKBA 5HN0A 3NAHA 3BO2A 4WP9A 2NSBA 3FSYA 2V6AA 3TX0A 2J0XA 3TJ9A 2D74B 5C2CA 1SKSA 4LIWA 2G1HA 2J7KA 3DM2B 3UDEA 4QCLA 3HHDA 3VAJA 1HWUA 1TL3A 2JZ5A 2MTLA 3DLEA 1NPPA 3A12A 1PYTA 1EETB 2LQJA 4DQQA 2RUGA 4QU7A 2ILZA 3BGFA 4DSKA 4CH7A 1VIXA 1RTIB 3MAAA 1H74A 2FGCA 3Q8RB 3M30B 4DPWA 4DV2J 3H5SA 5HQMA 2LCWA 3JSRA 4NXMJ 1U02A 4UY85 3TO8A 2FY8A 1AZSA 2J9DA 5ETOA 1AFIA 2ROEA 4YOEA 1JKHA 2HNDB 3B6BA 2GHWA 3PDNA 5DDRC 1FWKA 2CJAA 3OXFA 3W3SA 4C8LA 5DQIA 4PKDB 2V2ZA 3CCWA 2KFNA 3QT6A 5EWGA 1XR6A 4CT9A 4ILRA 5I4MA 2KRRA 4ZLJA 3RR7A 1CC7A 1NO8A 5G0RA 1IJEB 4DSEA 1RYSA 4F26A 1LQ9A 5KFBA 3M6XA 1XR7A 5L9NA 3ILLA 5K8PA 1HQUB 2FDNA 4RBTA 3UWTA 4RU9A 3VZIA 3RW6A 2QA4S 5IS2A 4C4WA 2AJFE 2VDHA 2V8GA 4AL7A 4KRWA 2Y0SD 3W60A 4NCAA 4OYWA 5F8NA 2WBMA 5D78A 3ZZUA 3H5UA 4DG1B 3OLAA 1NH7A 4QOTA 2YPYA 3FEXB 2G13A 1XR5A 3GYXB 1XBWA 2XYHB 1HMVA 1S6OA 4F0KA 4X64J 2DRBA 2P5VA 2VU5A 1K1SA 2Z2LA 2ZZTA 3F73A 1NH8A 2K1RB 2KN4A 2W24A 1YJWS 2FHJD 5DDPC 4AT1B 2CPHA 1OSDA 4ETXA 3K5NA 2QSFA 1R0BG 4Z2XA 4DV0F 3HLUA 3HVWA 2OPQB 4USUA 4DL6A 1RAHB 2NXNA 1Y9OA 3GONA 2BQUA 4JI8F 4URGA 3D2WA 3M6VA 3P45B 4QPTA 4K4UA 4FDFA 4DF4A 3ENWA 2IM2A 3KYLA 2HHVA 2IRXA 4WF9Q 1FCAA 2IA6A 1SJQA 2VFTA 4OHXA 1WOSA 2Q79A 4PXEA 4DG1A 1VHFA 3D7SB 1T3NA 1NK9A 3K0JA 4GKJF 1RSCA 3HHLA 5D0RA 4DR1F 4F2RA 4ZPTR 1NHUA 4WBFA 1JIHA 1YIJS 1HQEA 3PY8A 2UUBJ 4DV2F 2D7SA 2UXCJ 2RT3A 1IKYA 1KDNA 2QO3A 1YBAA 2RQKA 5CXTA 1CULA 2JLFA 2O66A 2RF2B 3W2VA 1DAXA 4PG8A 4QPXA 5A2QY 2NSCA 1NM2A 3TAMB 3SMZA 4RZRA 5AT1B 3OHBA 2W2QP 3DHXA 3A8IA 3OVAA 3DYAA 1M90T 1H6KX 4USTA 4F4KA 2LQ9A 2W4PA 2LA4A 3PM9A 4R25A 2V5HG 4USIA 1Q7YT 1GMWD 2NXCA 3WBZA 1HBUA 2VG5A 1C0TB 3MFIA 1X5SA 2UUCJ 2E7WA 3IR7B 1XQIA 4JI1F 3GV5B 1O5JA 4WYWA 2YKMB 1RHUB 1B7YB 4PABA 2W1BA 2PN6A 3IAM9 3AQOA 3F56A 3DLGB 4F0MA 3H4DA 2R8JA 2J8SA 3NNCA 2HK3A 4HHUA 4ZVRB 4Z37A 3DXBA 1BXNA 3MPUB 2DNGA 2NUUG 1NJIT 1QLNA 1XERA 1UCNA 1S1XB 4J9UE 1Q8LA 2DITA 1Y11A 3BYRA 1F9FA 2ZBRA 2CQ2A 4PR6A 2OSRA 2OEKA 1D3WA 5HROA 3H40A 2RQCA 2UVUA 3RBXA 2CQDA 4I1TA 1NJWA 4N41A 5F8JA 1F1BB 3L7PA 4IRCA 1EKRA 5A8WA 1XNRF 2ZZMA 1N6QA 2HGMA 2NYHA 3S1TA 3SIPB 2B7BB 2KG0A 1TL7B 3A4TA 3PR4A 1RWNB 1Y7PA 4Q8FA 1BQNB 3DHWC 1UA0A 2DNMA 1FK9B 4H4KC 1UWBA 1YGYA 2OPPB 2F63A 2JRSA 5L1KA 2HK2A 2IDLA 3QJJA 2X1GA 2GHPA 2Y1IA 3L09A 3RJMB 4RW6B 4C11B 3OLBA 4OZLA 4M5KA 4HYKA 2ZUAA 3MM7B 4LF7F 2KT5A 1GNKA 1RT6B 1OMSA 1RT5B 1S9EB 3KNGA 4ZVGA 3UN3A 2J6TA 2HMIB 2XLIA 3HSJA 1RTJA 5EDWA 2CAJA 1YJUA 3K8VA 4IFVB 2W2NP 1UL3A 1AFJA 1NB7A 4OX9J 2D9PA 2CYYA 2UVVA 1VI7A 3H4BA 2JOQA 1R8AA 2ZD1A 2RVJA 1F6TA 1WEXA 1OWXA 2FLLA 3QIPB 2GJIA 2ZHBA 1VBZA 2UXDF 1D9DA 4TY8B 2A6MA 3C6TB 1KOOA 3CIMA 2OD4A 4EO6A 4YS2A 1RABB 2DB1A 4M5LA 3FNNA 3TA0A 2QMXA 4BLGA 5ETLA 4O3SA 5DQGA 3BF4A 3BH7B 5CA5A 4BWMA 3G8TA 1KEKA 4O23A 4DOZA 5K8MA 1NSKL 2AU0A 4M95A 2C3MA 4ATNA 5KFRA 1U1KA 3NWGA 4LRFA 4HTIA 3NNAA 2CQ0A 3VHQA 4YR2A 4WYLA 1DLOA 1PO6A 4D3HA 2FJVA 2D9OA 1HPZA 4YB7A 2IVMA 1PSDA 4ZHRA 2J7WA 2K3KA 2HLTA 2CVEA 1LK7A 2QGFB 1SJFA 3SCLE 2HHWA 4NLYA 4QR2A 1Y3JA 4CO3A 4DQSA 1X5TA 3KKFA 3LAKA 2JJ4D 3EZUA 3WHIA 4Q2LA 2V8VA 2YKMA 4X62J 4K8RA 1EAYC 2VJUA 3BSOA 4ZPAA 5KT6A 1RT2B 3EDRB 3QJLA 2CJQA 2CQGA 3FCHA 3LP0B 1BHNA 4NEYA 9ATCB 2OP5A 2WW4A 3HT3A 2CJ9A 4R8UA 4C97A 1KVJA 3DXSX 2RHQB 1RT1A 3LGNA 5K14B 3C8YA 2NPFA 2BRKA 1REGX 3JTOA 5DG8A 1CULB 1JLBB 2RF2A 2WONA 2W7OA 2YH1A 2XM3A 2FUG9 3A3PB 5CZVA 2UUCF 1YX2A 1R0AA 4F3OA 1OO0B 4TY8A 5CABA 3NOCA 1SQGA 1YRTA 4CLTA 1MN9A 5AE1A 5KG2A 3OTDA 3PHEA 1DZ5A 1P8GA 5IT0A 2V94A 4LF5J 1N54B 3J80U 1IKWB 2YNFA 5LMNF 1QM9A 3CJRA 2E9RX 2EC0A 1HD1A 4CO5A 1LWCA 3ELHA 4DPXA 4ZCMA 1IBKJ 1RK8A 1DQ9A 1FKOB 2VKZG 1JXVA 2DNHA 3DU5A 4KY3A 5KFLA 5KFVA 3BREA 4AXJA 1FNMA 3ZZZA 2HQCA 4LR9A 3W64A 4WFAQ 1CJTA 2HAFA 5J2MA 4OHWA 1RXOB 5L39A 3O8WA 3KJVA 1SH0A 4N8NA 4F04B 3DDIA 1W2IA 5FDLB 1L3UA 3HJVA 3FDSA 4PUOA 4AL6A 3IBCB 1VC5A 1SKUB 4RWXA 1VFJA 3VZHA 2LECA 3NBPB 1NKBA 4K4SA 1MMLA 2FVQA 1OQ6A 2XSFA 1HR0F 3A8JA 4Y00A 4YP3A 1WELA 4UOCA 1KVIA 4J9LA 3D68A 3H0PA 5GAGU 2EEYA 3P49B 2DCUB 1WF2A 1RU2A 2YX7A 3A3OB 2CWKA 2OSQA 1HQUA 1FE0A 3C15B 4LSZB 2GVZB 4TKTA 4X2BA 2YQ0A 2GS8A 5G0RB 1HA1A 1T9VA 3IO1A 1WORA 2HS3A 1VK3A 1X5OA 2PC6A 4HT5A 3MPYA 4A4JA 3QZ8A 1L5UA 2HNZB 4A8QA 2W2MP 4DV4J 3VR1A 1S77D 1RT7A 2YNIA 4F2SA 1UVNA 3NRBA 1CVJA 3EYZA 3HSGA 2DNYA 1JLEA 5KFXA 3TVYA 3U1LA 1RWXB 3MECB 3D9BA 4E2FB 5LMUJ 5FLXY 2V4RA 3NGSA 3MMBA 4QR1A 4C98A 4PZVA 1NHVA 5LSLA 2FZCB 3MR5A 1GAOA 4FXVA 2B51A 1FRIA 3SQGB 2FLNA 3HHLD 3TAMA 1VQKS 4B3RJ 4LF6J 2NLWA 2DD8S 3Q86A 1IKYB 5DS7A 1LK5A 2KXFA 3SQOP 2WSCC 3CJKB 2Z57B 3UNYA 3Q8QB 4JI7F 1J2VA 1JWWA 3ZTSA 3LF0A 3HKWA 1VHIA 2QE5A 3FFIA 2QL5B 2B5JB 3DGPA 3M2VA 4UUXA 3RRHA 2HNYA 1TK0A 2E1MC 2KT3A 2GGPB 3CE8A 4LQ9A 4Y65A 4ED7A 1FHTA 5T41A 2KZMA 4DX6A 4U95A 2WBRA 3CCZA 3CGIA 2KDOA 2ZITA 4PAAA 5HK4A 3VAIA 4DV4F 3P5BP 3R1HA 2VG6B 3CD7A 3ICLA 4HH1A 3UN5A 5C25B 1FVQA 5E5NA 2AMCB 2EKYA 5SZTA 4NZ6A 3OUYA 1TFYA 1LFWA 4WJBA 1L3TA 4UUWA 2PE8A 1E6YA 2Z2YB 4ED1A 2LQ5A 1TKZA 2VICA 5GVQA 3VAMA 2HYIB 4GKJJ 3SZ2A 2BM0A 2EKNA 3DC2A 4NLWA 4O4GA 1N4LA 7FDRA 4ECVA 3FJ2A 5I3UA 4WZQA 1JLAB 2NPIA 4J5OA 2CNKB 3M1VB 2DEJA 4RWWA 2U2FA 4AFFA 1RTZA 3SSQA 4DX7A 2GZOA 2XMWA 2V63A 5HATA 2VZ9A 5SUHA 3TOQA 4CO2A 4A8XA 3TARA 1KQSR 2BX6A 2PD1A 4TLRA 2ZJPQ 3GR1A 2VG7B 3BH6B 3MMAA 2DRAA 4U7UK 1F2GA 4L74A 2HVHA 3THTA 4B3SF 3IR6B 5IM0A 1FJ7A 3T1YJ 3WDOA 1V3SA 4PQAA 1HNXF 1WSVA 2GHVC 1TKTA 4CLZA 3KLIA 4XPEA 1IBMF 1JLBA 2WONB 2Y0BB 3M8PA 2XMAA 3JSYA 1YJVA 5E0OA 1TUGB 1RHKB 5DQHA 3VQSA 2W8LA 3EPGA 3M2RB 1TQLA 1T95A 3M6UA 3V6HA 1UJ5A 2AKWB 4O4GB 2QYGA 4JI2F 3PJXA 4ZLNA 4H4OA 1X60A 4O3QA 4WCEQ 2MZRA 2PMZD 3TAPA 3MEGB 2Q6BA 1SB6A 2BANB 2EI5A 2EFVA 4X4SA 5ADZA 2VG6A 4PG6A 2DHHA 4WFZA 4BBYA 5DM6Q 4RX6A 3NS5A 3DOLA 1WI8A 2XHCA 4L72B 6FDRA 4YQWA 1JXEA 4KV8A 2OPRA 1HR0J 4Y2MA 3S8SA 5KT2A 2G2YA 1HBMB 3DOMB 2GO8A 5E3QA 3DLEB 2KZZA 3CUNA 2VJVA 2ZBCA 2FJBB 4I4BA 3W2WB 1UKUA 3EZOA 5H9FJ 4NA3A 2R7UA 4MFBB 2DR7A 2I38A 1VCTA 3HVTA 4LFBF 3OBIA 5KFSA 5KFHA 3FGVA 3MM5A 5F3ZA 1KR4A 2F4VF 4EYIB 3CC7S 1S4FA 2XNRA 3D66A 5AXKA 2AJ4A 1EARA 5F0WA 2Z8QA 3J7AN 2DRDA 2B0GA 4IH6A 4KYZA 1V3ZA 2DXFA 3MFHA 1ZPWX 3D6FB 3QT5A 4TYBA 4UOHA 4F4AA 1O0PA 3NL0A 1UEKA 3ETMA 4F67A 2CPJA 2EWHA 1C0UA 3BKFA 2YKNA 2PFDA 3T9ZA 4LF5F 3I31A 2E9ZA 1NSAA 2C3YA 4M5IA 2E1CA 1GMWA 3IM9A 3QZ7A 1TVRB 3BPDA 2VPXB 2KJWA 3DRYA 2MKYA 3GYNA 1SL0A 4QJVA 3GZ7A 2ACYA 2LA6A 4V1Ak 3G6VA 3QRPA 1P27B 3B4MA 3ISNC 4LIRA 1DURA 2OMOA 1I5OB 2B9EA 2J9DE 4QW8A 3OTOJ 1N56A 3G87A 4DV5J 3U27A 3K17A 2AQ4A 1RKIA 1C4AA 4BCAA 3K58A 5KG1A 3RRKA 4O3RA 1XMBA 2KT2A 3FMBA 3ZXWA 2N7YA 2QN6B 2DYAA 1X4BA 2VC1A 4KGKA 4KV8B 3V6DA 2ZH9A 2QA2A 5K20B 3H2VE 1MMNA 5D6GA 1SCJB 2JLGA 3RBZA 3NBPA 3MEKA 3KLVA 1D8ZA 1NLKL 4CH1A 2ZH2A 4ENOA 2XNQA 4NCBA 3LW5C 3CDUA 1SVDA 1CJUB 3ET6B 2R8GA 5B7WA 3P6YC 3A8KA 3OJSA 4CH0S 4XDDA 3VAKA 4DUZJ 4WK3A 2AGQA 1XMOF 2L9DA 3HCXA 4IH5A 3CNQP 3CXCR 1VQMS 3DN9A 5E3CA 2UXBJ 4HTJA 1FRKA 2XSJB 4OIXA 5EUHA 1KTQA 1Z4UA 4F3QA 1JLFA 2VC0A 3MM6A 3TQEA 2Y8YA 2UU9J 5LMUF 4DI6A 4I68A 1IBLJ 4H4KA 3NEKA 1WUUA 5KTQA 1B0VA 1VK8A 1WEYA 4G1PA 2NQPA 2PA3A 3EVWA 4OX7A 4DR2F 4RW8B 1YVFA 1IKXB 4WK1A 1RHJB 4UZBA 1N34J 2Y3YA 3FQLA 2FJWA 4USJC 3SV4A 3OPKA 2GA7A 5B08A 4CYUA 2L08A 1PILA 1YZ7A 4XTTA 1LW2B 2GAHC 3HP6A 1SC1B 1VRUA 2AJQA 4DFJA 4ANDA 1U1OA 4RBUA 1IVZA 4FXWA 2RQMA 4QIVA 1X4EA 4M5MA 4RO0A 1VOMA 2HRYA 2XZDB 5A6WA 2K06A 4DZ6A 4DV6F 5F9LA 4DL0C 2FVPA 3BKTA 3I9V9 3TI0A 3PRVA 2Z58B 2FD2A 4AD6A 2XWXA 1M1HA 1I3OB 2YVSA 3JAMU 3RB6A 4DV3J 2F8MA 3R5DA 3ILIA 3ILJA 1AROP 1UJ6A 2C2KB 2CQ3A 2W9BA 1FESA 2ZH6A 1WWHA 1IWAA 1VQ8S 1AW0A 3E01A 2L3MA 3KG4A 4CTAB 4USVA 1VQOS 1D0EA 1IKVA 1M5HA 3GCXP 2HZVA 4IRKA 3C14A 5KT7A 1WKKA 2DXDA 4RUCA 1OY8A 5KFQA 2QRRA 2Z0GA 1N52B 3HVAA 2AP6A 4J9RA 1PCAA 1UVLA 2ALYB 4KTQA 4TLQA 2W9AA 2Z4PA 4CO1A 1I51B 4PYDA 3PJWA 2BE9B 1D9FA 4NXNF 3EVMA 3SXLA 3IBFB 1DTQA 3I5BA 1L3VA 2W2PP 3RGIA 5LMNJ 3QGGA 2BANA 2M52A 4NLSA 1WHXA 2AW0A 3I0SA 5HMYA 1A7GE 3MGJA 4B3MJ 3CW2C 3QYYA 3ILOA 1SL2A 1I6JA 4B3TF 1U2CA 4RL1A 3NNHA 3BBCA 3HMJG 3FRZA 1SJ1A 2HQ3A 2C28A 2LU2A 4OI4A 5E3PA 1HBOB 4MT1A 4CLYA 3GJTB 1F2HA 2DGSA 3BQ2A 2IM3A 1VRUB 2O1PA 4A48A 4DPOA 1T9WA 2IDEA 4EMDA 3LH2S 2MHEA 4U67Q 3EE3A 3KWMA 3FBCA 3LGMA 2FIUA 3RUBL 2YKQA 4CDIA 2NZ4A 4NLVA 1Y00A 2PSZA 5C2GA 4I2QA 1VC6A 1QVFR 2CRLA 2YNGB 3AHPA 3R27A 5ETSA 4DFPA 4NLPA 3PVXA 3ISZA 4Q7AA 5LSRA 2Y8WA 3KNAA 2MKJA 4KQZA 2XYGB 5KFYA 4NI2B 2V4JB 3LPEA 1ZM3A 1SJ3P 1UZDA 3QFHA 4OYPA 4EBDA 4BS2A 2CXEA 3B54A 3FMWA 4ZVFA 4X64F 2UUBF 4C8YA 2HMIA 2DHGA 5L8RC 2ZH1A 1YI2S 1TFWA 1RT5A 4FNIA 4ICLB 3T19A 3WX8A 5C5JA 3M8QA 1RZMA 2IYGA 3MF5A 1W2BR 1RT3B 5DRKA 2EK1A 1S9FA 1F5BA 1WC6A 2GVDA 2XMJA 2XYPB 3RW7A 5F8IA 5FJ4A 2JHEA 3ZO7A 2XZTB 1X8DA 1B99A 3M8YA 5I3PA 3TJ8A 2MQNA 4OHZA 2MXYA 1U1MA 2A1BA 3H90A 1X4GA 1RADB 3B8HA 2AHOB 3EXCX 3I9ZA 4LRCA 3V6DB 5KFJA 1SJRA 4QR0A 1SKWA 4WIIA 3CDAA 2ZE2B 4OFZA 5GAEI 3ISND 2RDIA 3DGPB 1NNDA 4X4RA 3FSIA 2DT9A 3QGIA 3G8QA 1U1QA 3GR0A 2MZQA 1LWCB 4P74A 4ECZA 4C8KA 1Z2ZA 2BJ3A 1GQEA 2V4JA 1UVKA 1IKWA 2YNFB 2Z56B 3O6QA 2FHMA 2I6WA 3WZ0A 3MR2A 3MTJA 2P9GA 2JC0A 3S6EA 5B09A 4K5RA 2JEGA 3O44A 4U7UD 4URSA 2X51A 2G9OA 3AD8C 3QMQA 5GADU 3VAFA 4LR8A 4OYXA 1HLWA 1PGZA 4JYAJ 3J81Y 2QJ3A 4K4VA 3RAMA 4CWBA 2N7CA 3UR0A 2CNOB 2JDJA 2AEFA 3BDPA 2ZZNA 2L41A 3H7HB 3CMES 4DEZA 2F7VA 2KFYA 3I82A 3TUIC 2VIHA 1HIYA 2F40A 1M5VC 2I8EA 4FZVA 1F9HA 2GV1A 1QSSA 1RKJA 3HPOA 1X7VA 2ZNZA 3B82A 3R7BB 1DTTB 1TUWA 4MFBA 1KC8T 1DTQB 4JI6F 1HQ2A 2N4CA 1RWPB 3BGRA 3R5JB 4O4RA 4OMFG 4OYIA 2I5JA 3TEHB 1AUSL 4EZ6A 5IOLA 2DISA 1VQ4S 3LWLA 1XTZA 1HNIA 4KGXB 3MUVP 4JV2A 2R2TA 1Q79A 4V19J 1HWIA 1O51A 4DR4F 1WEZA 3D54A 2BACA 2H48B 1HHTP 2N3OA 4B3OA 3HDSA 1B0TA 1BMQB 2ZFHA 1IKVB 4DJBA 2EBEA 3NLCA 3SDEA 1JNRB 2HVZA 2XI3A 1Q16B 3OVBA 2MQ8A 2W9BB 1NXIA 4RW7A 3K5OA 4ZPVR 2WRMA 4JV0A 5HMWA 1F3FA 5MAOA 4YR3A 2XGQA 3CCMS 4C8OA 1KNZA 2R7OA 1Q7LB 2WZ1A 4ZCKA 3ZNJ1 4FNHA 1YRXA 2XMMA 3C6UA 2F5GA 1D9AA 5K5MA 5AJ3J 4MK7A 3PW0A 4OI0A 1WKJA 4ILMA 2VFSA 3P96A 1UFKA 3GE9A 4P6QA 1N5SA 3H42A 5L38A 3W5YA 3GIIA 2BJ9A 3PYGA 3BSAA 2KXHA 2BOPA 3MHYA 2BJ1A 2XHWA 2R7WA 5ETNA 4J37A 4PWDB 3EZ5A 4WFNQ 4K50A 5B0CA 4C0HA 3PW2A 5DLGA 4Y0FA 5B0EA 4QYZK 2YWEA 4YEAA 4C3MA 3KK2A 2JNJA 2B9YA 2HGNA 2CPZA 3EVOA 2MQOA 4KGVB 1TP7A 3R6GB 3DDNA 3UDVA 2CQPA 3H8YA 4RUHA 3MPVA 4NCGA 1RTJB 1NSPA 4ZCIA 4JV5J 2M7SA 5AXLA 1BE4A 1U24A 3IWXA 3HD2A 3QGPA 3BV8A 1QUVA 1X9SA 4CP5A 2CPYA 2EPIA 1WDTA 2XULA 2O01C 4ZJOA 4LF8J 4L76A 1TKZB 4NMXA 3RYLA 1E6YB 2E5IA 4HACB 4N77A 1BLUA 4B9MA 2G0JA 1V5VA 1HYSB 4NA1A 1CPZA 2ZVIA 3ET6A 4KFBB 4LF2A 1ITPA 2HHPA 3L4BC 3PKYA 1S0OA 2MLZA 1Q78A 4OI2A 3ZZOA 2ROPA 1YG0A 3GU0A 1RTIA 3MAAB 1U1NA 4LF4F 1I94F 2EFGA 2E5JA 2WVDA 1S6QB 1Q0NA 2EFNA 2WOMA 5B0FA 2BW7A 4PWWA 3FFIB 4OZNA 4EGLA 5EWFA 1X9WA 1O6XA 4DWIA 1NAQA 1B0PA 3L3CA 4G65A 5KFIA 3NMRA 3BGRB 5IQQA 3BN7A 4ZHRB 3SBMA 2A18A 2IA0A 1UETA 1XNRJ 4FS1A 1RAFB 2ZOGA 3KLHB 2OEJA 2R8KA 4ZP7A 4Y2KA 1EX8A 1M5PC 1OIAA 1DFDA 3D0IE 3BGOP 4C48A 1S1TA 1QAIA 1UMJA 2MLYA 2GMJA 1BD6A 3I6PA 1R27B 1QAJA 2C2ZB 2NUHA 3GLJA 3UVJB 4A8KA 3GFHA 1KLMA 5EHHA 4TN2A 4WXWA 1C0TA 2Q3PA 1HBUB 2VG5B 5E33A 4ELVA 1MSWD 2LKZA 2LXUA 4MIAA 3NGTA 2IHR1 3GFXA 3H20A 4USKA 5ETKA 1FNOA 2I9SA 2V2VA 2EG1A 4TQSA 2AJ0A 3RU0A 3DLKA 1NPKA 5BYQA 4FXDA 2AWZA 2QFIA 4TVAB 1RT4A 5HP1A 4Q8EA 3W2VB 3FEZA 4WFBQ 3QSIA 3AD9C 1N32J 3C3LA 2RS8A 1U0HB 3M4XA 2DNOA 3KDOA 1UW9A 3JSMB 2GVZA 3BQ0A 1RUSA 3MEEA 3LO3A 4HLBA 3JAMY 4ZN1A 4P75A 4ZOSA 2VQEF 2R3VA 2O5DA 1XMOJ 1WTFA 4W4MA 3R6LB 5GMEA 3GFZA 4S0MA 4KBIA 1WHWA 2CJBA 4P73A 1RWUA 2MZSA 4GVLA 3ONQA 2YWFA 3CD5A 4KHRA 4WE1A 5LOQA 5GAGI 4EFAC 5J2PB 1U1PA 2OPPA 2L48A 4X65F 2V2KA 4UQGA 1YSJA 4P7TA 4DV7J 1ZM4A 2DHXA 3MEGA 5ETPA 4ZCLA 3KJVB 3RAXA 5D3GB 2GVDB 3C6UB 2M70A 5KG4A 2HBQB 4HH0A 3TZZA 3NCPA 1H7WA 5KFTA 4NYPA 1E6VA 1NK0A 5DG9A
chains in the Genus database with same CATH topology
4AUKA 3VAGA 3BDEA 4LSNA 3KMSA 2ZHAA 2F8EX 4FF4A 2R7SA 1X4CA 3M2UA 3SDEB 4MAKA 2DGVA 3SSSA 4LF6F 3V6KA 5IXUA 3DRRA 3M05A 4TNOA 5IM0B 4QWCA 5JJBA 1M0SA 2FJDB 3CTRA 1JMTA 4RW9B 3K5LA 2BR0A 1TL4A 2VG7A 2MQPA 4BDPA 1FDNA 1F5AA 1LXJA 1SXLA 3M32B 3POTA 5F8MA 2FJXA 4QYRA 3GMGA 2PDAA 2K2PA 2FVSA 3TVZA 2HIQA 4D3GA 2MQQA 2UVWA 3UDLA 4TXSA 1RJJA 4FF3A 3OR1B 4FN5A 4OJHA 5GAEU 4IKAA 3OR1A 3U1NA 2NREA 1J5OA 2MY7A 2OTLS 3D5MA 2BBEA 1P1TA 4FBUA 1Q8BA 1IN0A 2WHOA 4AXIA 2ASYA 1OPZA 1NK6A 1DRZA 4QIFA 5J1PA 2R8HA 2GIRA 5FIIA 3DM2A 2HAIA 2VFUA 3ENQA 3T6BA 3OL7A 3PW7A 2ASJA 5FD1A 3E51A 1KFSA 2POKA 5HO4A 2KFZA 2LQBA 4RW4B 3SFUA 1J5EF 2BDPA 2KYXA 2PO4A 1QVGR 2WCXA 1KFDA 5IQ6A 3AAWB 3QWPA 1FRXA 2PT0A 3PX0A 2BM1A 3DMJB 4ECTA 5D3GA 3GFYA 2J7UA 2JSXA 3RBDA 1G1XA 1HMVB 1N0UA 4ECYA 2XBPA 4KB7A 5CYMA 4YR0A 1VRTB 4DBQA 1B7FA 4K2XA 1ELOA 1TL1B 3T5KA 1FKAF 1V3RA 4ZKAA 1G3OA 2RRNA 4JBCA 2AX0A 5D4PA 5GAHU 2UUWA 3KOAA 2VPWB 4LUBA 3AQPA 4TU7A 5CYJA 4A8MP 4RNFA 2YX4A 3J7ZT 3Q2SC 4FP9A 1TZ0A 3OFGA 4CO4A 3T5HA 4ES2A 4OJGA 1RQ0A 2DNPA 2FLOA 4FF1A 3MM6B 3KTQA 4K4YA 2XY7A 3DOKB 2C2RA 2PI5A 4C8NA 1GX6A 4MYTA 3N5FA 4ZPCA 2R7XA 4G1QB 5F0UA 2XC9A 5IT4A 4E8UA 1C1BA 4DL2A 4PUOB 1IBLF 1DARA 3VAHA 2BQRA 2UU9F 3LUYA 2EFQA 2IC3B 1SI9A 2Q6CA 1LWEA 5M2UA 2R2RA 2RSQA 4LFCF 4OZ5A 2B43A 2ZOMA 1JLQA 3IS9B 2Q43A 1EETA 3QO9B 2EVZA 4MYUA 4RW4A 1HNZF 4QWEA 1TV6A 6FD1A 4J9OA 1U09A 2VL1A 3G6XA 2G1DA 2MZTA 2X1AA 1NK5A 1RTDA 1GX5A 3DFEA 1YQHA 2P6TA 4ZVEA 2MSSA 3PW4A 3CDBA 4URQU 4K4ZA 1T7PA 5IZHA 3CCVS 3G9CA 2OO4A 3PZPA 1MROB 4CO0A 3MMCB 2HFOA 1KQKA 3N6LA 3FZBA 3N28A 4KFBA 4M1KA 2JWNA 2RIJA 1S1UA 2BXJA 3GG1A 2MYFA 2XCPA 3CCES 1TKDA 4CQ1A 2W7PA 2YKOA 3CF5Q 1FTCA 2EBGA 3UI3A 3UFCX 5E41A 4EBCA 5HL7Q 4NRUA 4K59A 4ALZA 2HHQA 2JVRA 1UFWA 3NG8A 1CC8A 4X4NA 2CIMA 1Q4RA 4QW9A 2AYBA 3IBWA 2MY8A 1G7CB 4QIGA 5EN1A 4ZA1A 3GB0A 4P7VA 1TKXA 2M88A 2N3LA 1X5PA 2OPSB 2J6UA 2M2BA 1S1WB 3BQ1A 2UV8G 1TV6B 4TKTA 4PG4A 5KAKA 1CQNA 2NS1B 2QLWA 3C66A 4ED0A 3PFEA 3KG1A 4TYAA 4Y34A 1N34F 3WX4A 2FJAB 4N47A 2EFPA 5A8KA 1UVIA 1E6VB 1SIZA 3I55S 7FD1A 3VAIA 3MM8B 5KG5A 3K2YA 3J7YU 3ZZPA 3RTVA 3CB4A 3JTPA 4LJMA 1S0NA 1XWLA 2L9NA 3OJUA 5L1IA 3PO4A 2CVIA 4JUZA 1T03A 3HHEA 3N6NA 4WE1B 3NGDA 4DFKA 2Y1JA 1DJ0A 2U1AA 1MNEA 3PXGa 4ZLPA 3DOKA 1LFPA 3G6ES 3QIPA 2W9CA 4HDGA 4DL3A 3MMAB 3NCRA 1RP5A 2DNZA 3DU6A 2ATLA 5A8RA 3LP2B 3GILA 2CJKA 4LVOP 4ELTA 3MD1A 2WB1D 2KM8C 3ENVA 3MPWA 1Q8IA 4M5DB 4KAIA 2W7AA 4IG0B 1D1UA 2QV6A 4AYBD 4XPCA 4G1IA 3I87A 2M8HA 2MGZB 3C46A 4WXOA 1S1VA 3JTNA 2DH8A 2YKAA 4RKUC 5EX3A 2J0QD 2HNDA 2RS2A 2J9EA 2IAJA 1HI1A 4E98A 2GJ2A 4E0DA 4Q44A 5JVHQ 3DRSA 2M9KA 2JC1A 2XCAA 3TVKA 2OD6A 1V6HA 4I7FA 1MROA 1X4HA 3GIJA 4WKYA 2QEXS 2DGQA 4QIEA 3OV7A 3RR8A 3DLJA 1TL3B 5KT4A 3KLHA 1FDDA 4J9QA 1LV5A 1N5QA 1S10A 3W2WA 2RKIB 4JI3F 1S1XA 1X4FA 4NZ0A 1KQGB 2C3OA 4KR0B 3CVKA 1P6TA 1FJCA 2COLA 2OMLA 3BR9A 1Y4ZB 3MOZA 3R5AA 4CNYA 2BZ2A 3C2PA 1GH8A 2ZUGA 3MMBB 3EGZA 3DRSB 4ECQA 2IAJB 3BGLA 1HBNB 1NJXA 1C1BB 2BJDA 5C24B 1FRLA 1QSYA 3DDKA 2FVRA 2VBWA 1RTHB 2B4PA 3RAQA 2CZ4A 1MWYA 2RE1A 2ASDA 1QJHA 3SYZA 1YHQS 4OLPA 4DUYF 3IAS9 1H2VZ 4R0JA 4WKRA 2B4OA 2LLZA 1VQ9S 3CCSS 3CULA 3N79A 2W25A 3BM7A 3PACA 4PG7A 3Q24A 3CCLS 4YFUA 2AJ1A 1HQEB 2XEXA 2GC8A 1JNZB 1Z1ZA 2BRLA 2DO0A 2UZAA 3EXYA 3GG0A 2W9CB 4I2QB 3UD4P 2C42A 5BR8F 4HEA9 1X9MA 3FZ2A 2IRYA 1ZM9A 5B0DA 1CEZA 1RI7A 2KM8B 3I4HX 5DLFA 3CPWR 3V4IB 3M1VA 1U49A 3DLHA 4MJKA 1DQ8A 1R89A 2CQHA 4PPDA 1KRPA 1RA6A 2XB2D 1UJ4A 2MMYA 3IA0A 3K57A 1HFEL 3V81B 1NKEA 1S1WA 1S6PA 3PO5A 1Q86T 1NJZA 3MUMP 2DHSA 4EZ9A 1HD0A 2EW9A 4DSJA 2HQIA 4I2PA 4YMEA 1U2FA 1LW0A 2VB6A 1KTVA 3D1OA 5F3TA 3CMAS 2UVRA 4GO5X 4ES1A 3OL9A 3BZQA 3CJKA 3BSNA 3JSMA 4O44A 5J1EA 2EG2A 4YB5A 3NS6A 4DHVA 2CQIA 3KLEB 2V9KA 2DNQA 3I56S 4DR3F 2O67A 2YNHB 1TAQA 3ULHA 1IQTA 3F41A 1S1UB 4DV1F 1KLNA 1ZAXA 1HBNA 2A3JA 5KFAA 1HI8A 2RILA 1GXTA 1LW2A 5C42A 5B0BA 4DDFA 5AE2A 3WC0A 3SCIE 5HBMB 3MOJB 1FXRA 1U6FA 1ZBTA 3OW2R 1REVA 5LSOA 2C2EA 4K0KF 2VV5A 4C0OC 2MKCA 2IMOA 1UFLA 2YWHA 3PIPQ 4XDCA 5I42A 3TA1A 3CJ0A 2ZE2A 2GX8A 2XMTA 3JYTA 2QA4G 5H1SV 5L1JA 1U1RA 2C2DA 1N8RT 2JEIA 2CQBA 4MIWA 3UNGC 2B9XA 5HMXA 3MURP 3MAHA 4KE5A 2W4DA 1O8BA 1KOHA 1IBKF 2DH9A 4YB6A 3CCUS 2DR5A 3OR2B 5E2QA 2MHNA 4C7QA 1FXDA 5DO2A 4DN0A 1I1GA 2MKKA 2V4QA 2NXUA 4ICLA 1TK5A 3H25A 3KK3B 2AX1A 4ZDNA 1X4DA 1D8YA 4KO0A 3KK1B 4I56A 2LU1A 2HPUA 4CT8A 2A2CA 1ZH5A 4KO0B 3KK1A 5IT9Y 4ECWA 3N9UC 2HWHA 4MKAA 5F8GA 4WTYA 4ED3A 1HNVA 1FDBA 2FGOA 4J9NA 1KONA 3FVYA 3LQVA 2DR9A 4KGMA 4F8RA 4DN9A 3Q23A 1UEVA 4NA2A 4NRTA 1ZAVA 5KFEA 2Q66A 1FD8A 1LWFB 4ZP8A 3N5BA 4ZS6A 1JJHA 4AQYF 1G2EA 2WW8A 2VKRA 1W25A 4B17A 3V2UC 3IWLA 3HVTB 2ZC4A 3EGNA 5A6PA 4N76A 1H7XA 3H5YA 1NK7A 1VJWA 4DS4A 4MK9A 1REVB 1HNIB 1S6QA 2RNEA 1FKPA 1T8EA 4PWUA 4X4VA 2I5JB 4X4TA 3ZZRA 5EX0A 2HRUA 4NMLA 5CYQB 2XO7A 3PV8A 3E01B 1N33F 2RD5C 4XK8C 4DR6F 4RNMA 3IGVA 2DNRA 2UUAF 3FRYA 2AGOA 3N0VA 2FHOB 2RRAA 2RRBA 1KQFB 4NLGA 2D41A 5DM7Q 4IR1A 2GNKA 1U25A 3TW0A 4F02A 1WD6A 2WB4A 3G4SS 4P2SA 2KO1A 3DRPA 4IQMA 4CZCA 4NCGB 4NLUA 4PXDA 5CCMA 2B6AA 3GIMA 4DQIA 2BV3A 3NAIA 2K3IA 2D1CA 4CCHA 2RU3A 5AXMA 1RGVA 4IOAQ 2XS5A 1U26A 4I2PB 1IKXA 4IG3A 3OFHA 1HW8A 3KMQA 4PWDA 3GSDA 3D1QA 1N5VA 3M2UB 3PFOA 3UD3P 4I6AA 2AYGA 5CH7B 2RB7A 3RB4A 1G6BA 4NLXA 4Q0BB 4PRFA 4LT6A 3THPA 1LWEB 1RYRA 4JI5F 3SI8A 2IC3A 3M8RA 4IFYB 3OR2A 3E3XA 1NK4A 1ZOTA 1K9MT 1FK9A 3LOUA 1UAWA 1BQNA 5KFOA 5C25A 2D3OR 4IDKA 1R8CA 1CSJA 2KRBA 3T9NA 2Z2MA 4NZ7A 4B3OB 2I1RA 1SV5A 3JB9k 2B4VA 4YY3F 2KXNB 2HNYB 1BQXA 1QE1B 1L3KA 3H2UB 3BJYA 3OTEA 3HKZD 3OXLA 3GIKA 4EUVA 4K4TA 2M3DA 1N32F 3MDFA 2F9JA 3IC1A 2FPHX 3PNIA 4XAKA 4QQBA 1R8BA 5K9FA 4DR7F 4IOCQ 2FC8A 4NYOA 1RT4B 2VFVA 1GTHA 2BW2A 3DLKB 1R3NA 5B0AA 3DLGA 2MZ1A 1SBRA 4B9VA 2QT7A 1FXLA 4V19X 3V6JA 2PEHA 2C3PA 4Q2MA 4WU3A 5C42B 4IQXA 1ZM2A 3TYTA 4Y3CA 1FJGF 2WTFA 2DVIA 3HJFA 1JLGA 3OFEA 1H2TZ 3LP1B 2J76E 4K4XA 2GCFA 1RISA 3KHRA 1RT7B 1CQMA 2YNIB 3N01A 4C8MA 1TK8A 2UXBF 1FE4A 1IM4A 2XGPA 2R2UA 1ZTTA 1R6YA 4NOHA 5J2QA 1KSPA 2F3JA 4F4XA 3DRXA 5EWEA 4DV7F 2HHUA 2DPJA 1TUVA 1T94A 2RQ4A 2ZH5A 2PA8D 4IO1A 4B08A 4WFXA 3VWSA 4DL4A 1X4AA 3TR5A 3VF0B 4CNZA 1SV5B 1Q81T 2KTQA 3FQKA 2MPUA 1UVMA 3ITHB 3TA2A 1YITS 5F9NA 1V9OA 5IFMA 4MIBA 4DLEA 4X4QA 1SIWB 2QMWA 1K0TA 2B4UA 4ZK7M 4HT7A 4OV1A 2IBKA 4OX9F 4X66F 1MW7A 2F9DA 2R7TA 4F3MA 1JLCB 3CWJA 5JXSA 4Q5VA 3I5CA 1QSLA 1LOUA 1XK8A 3CJ3A 2BE2B 4ID5A 4DSLA 5HLFA 4ZPWR 2YQ3A 1H38A 4NL5A 3MAQA 2E1RA 4IYQA 3LPYA 2O3DA 3CJ2A 4NX9A 5KFZA 2BYCA 4IG3B 1QUPA 2JL9A 3SCKE 3KK2B 5F41A 2P9CA 4NYZA 2M0GB 4U7CA 4RW8A 3K5PA 4JOUA 3P5TL 5KG0A 5LXRA 2CZVC 1TL5A 4OZ1A 1T05B 1JJ2R 3TUZC 2JEJA 2EFOA 2CQ4A 2KVIA 4A8FA 2B6AB 4B3MF 4RBVA 2VBXA 3QAUA 2ZOFA 4JV1A 3F44A 1JLFB 3MUTP 2I2YA 2BE2A 1RT1B 2OKQA 1NK8A 1DBDA 1H2UX 3PX4A 2MQLA 3CC4S 4R8UB 1S9GA 3PW5A 2DGUA 2HLUA 2HHSA 1IXKA 2KYZA 4FVCA 4RW7B 3B78A 3KHLA 2FJEB 3OL8A 2DCLA 1VQLS 1UP1A 2FLPA 4TU9A 2FHJA 5D4LA 2CKWA 3VTIA 4U6PA 4ZMMA 3K59A 1APSA 1Y5LB 2B3TB 3HZGA 4FPRA 5LXYA 1U7LA 5L1LA 1FKPB 2FVCA 4YDDB 1Q82T 5H9EJ 5KOXA 3T3FA 2E44A 4NLDA 2KH9A 1SKRA 1BC6A 4JV5F 1HPZB 5DG7A 1IUJA 1XMQF 5J1NA 2ADBA 2ASLA 4Q45A 5KFKA 2J0WA 4LF8F 3A1YG 1HHSA 4QYZJ 3OTOF 2YKNB 4A8SA 3M9NB 2RMLA 3BR8A 2J0SD 2BQ3A 4LMZA 2GIQA 5ITHA 3MECA 1KLMB 2E66A 3KLFB 2DBBA 2IJNA 2VUGA 4KHMA 3GV8B 2IBOA 1S0MA 3PKMA 2ILYA 2L9WA 2DR8A 3J80Y 1P1LA 2VD3A 2VONA 1S1TB 1C1CB 4OLOA 5AJ3F 5MLCV 4F4ZA 4PQUB 1RDRA 3O5TB 4PXBA 3U7JA 3I96A 1N5YB 4B9UA 2ZD1B 2ZDPA 3B4DA 1U8SA 4MTPA 3LAMA 2YKPA 3RBEA 3O1LA 4ED8A 2OIHA 4HKQA 1BQMA 3I0RB 1HBMA 1QE1A 1JLQB 3IS9A 4I6WA 3TANA 2JH3A 2VOOA 1CLFA 2LYVA 1UW4A 2W4CA 5IWAF 1X0FA 3V5RA 1BWEA 1C4CA 3BN4A 2LEPA 2IFXA 3LWMA 4A8OA 2E7XA 4IDKB 1UWBB 5FDLA 2IRUA 3UDCA 1KD1T 1FNXH 1QAYA 1KN6A 4G1QA 3N6MA 2CPXA 4DQRA 2ZJQQ 3M2RA 4NWBA 3OHAA 1VQNS 1ZETA 2MJUA 4WU2A 1OSCA 2JEFA 4Q0BA 3Q0AA 3I0RA 1HARA 5HROB 1FRHA 5B0GA 2F8HA 1BQMB 3X3UA 4QWDA 3PIOQ 2K8GA 2OPSA 3MEDA 4KC5A 3KLGA 2MKHA 4DV3F 1VQ6S 4UW2A 1Y0HA 2HWIA 5CQGA 5CD4H 2YNGA 4ETZA 1FA0A 3DCAA 3G71S 2MJNA 2IJFA 4USHA 4XIUA 1VQPS 1DQAA 2DO4A 1FRJA 1RA7A 2G0CA 2MQMA 4IRDA 2LXFA 2YWKA 3IXQA 3R3TA 3AH6A 4Y28C 3G86A 1HBOA 5BYRA 4ID5B 3TRGA 2XS2A 1JLAA 4LVNP 5K14A 2FB0A 5JUMA 4FYDA 1IJFB 1T02A 4ZPDA 3RB3A 3R1LA 1B64A 4RNNA 4KPYA 4A46A 2GMLA 3DYAB 2R7QA 3L95X 3MTKA 4TQRA 1M1KT 3MM5B 4ECXA 2UP1A 1MMDA 3Q2TC 2YWGA 3ETOA 4R0EA 2MKIA 2ZH4