4P7VA

Structural insights into higher-order assembly and function of the bacterial microcompartment protein pdua
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
86
structure length
86
Chain Sequence
EALGMVETKGLTAAIEAADAMVDSANVMLVGYEKIGSGLVTVIVRGDVGAVKAATDAGAAAARNVGEVKAVHVIPRPHTDVEKILP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polyhedral bodies
publication title Structural Insights into Higher Order Assembly and Function of the Bacterial Microcompartment Protein PduA.
pubmed doi rcsb
source organism Citrobacter freundii
molecule tags Structural protein, electron transport
total genus 20
structure length 86
sequence length 86
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2014-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00936 BMC BMC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1710 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4p7vA00
3DNCA 3NWGA 3MPWA 2A10A 4LIWA 4DDFA 3NGKA 4QIVA 4OX7A 4OLOA 5DJBA 4QIEA 4RBUA 4OLPA 3N79A 3DN9A 4P7TA 4PPDA 3PACA 3SSRA 3VCDA 3I96A 3IA0A 3MPYA 4P2SA 4AXIA 4RBVA 3SSSA 3CIMA 2A1BA 4OX6A 2G13A 4QIFA 3SSQA 2EWHA 4AXJA 4QIGA 3CGIA 4P7VA 3BN4A 2A18A 4OX8A 5L38A 3H8YA 4RBTA 3I6PA
chains in the Genus database with same CATH superfamily
4EBEA 4DLGA 3KUEA 4QR0A 2QGFB 1UWAA 2O3DA 3M30B 1Y9OA 3GMGA 3IG1A 4I7FA 2KDOA 4DFJA 2RF2A 3M8YA 3FNNA 3T9NA 3NCRA 1K9MT 1VRTB 1RP5A 4L76A 5AE3A 2YWHA 1PCAA 1RBLA 3HFKA 3IBCB 1S12A 2VIHA 4DQPA 2RE1A 3WC2A 4URQU 3Q89A 4L3NA 2XCPA 1T9XA 2DHHA 2J5AA 5D0HA 1X0PA 2FJWA 1R0BG 1UTAA 3FEYB 3FFIA 4RPFA 2VZ9A 2MHNA 4K8RA 2UVWA 2B7BB 3KLHA 1QAYA 5GMKa 2MXYA 4OX6A 4NMXA 4JI0J 3LP1A 5L38A 1YJTA 2COLA 2QV6A 4ZMMA 1BXNA 2F8EX 1TL1A 2HLTA 3GIRA 4ECXA 5ETVA 5DZ6A 4ALZA 3RBDA 1GT8A 3RU0A 3DM2A 4Q5VA 3QGGA 3AJDA 1QM9A 4ED1A 1TUVA 1Q0NA 1HBNA 3W9HA 2IHR1 2BDPA 3CCUS 3PO4A 3BGUA 3V5RA 3EVMA 3D2WA 4F2RA 2A2DA 1UVKA 1UVIA 2DGXA 2HBQB 4R8UB 1YG0A 1JNRB 1JLBA 2XC9A 2XGPA 3P49B 3UD5A 4HI2A 5B0CA 1I6JA 1LK7A 2Z2ZA 1VCTA 3M6WA 1DQ8A 2J8AA 5MLCV 4JI5J 3GR1A 1N36J 1FJGJ 2RSQA 1H6KX 4JYAJ 2G2YA 3OLBA 1IR0A 5ETSA 3IAS9 2XHWA 1C0UA 1K47A 5CZVA 2HRYA 4KGXB 1D8ZA 1VMBA 1HBUA 2R7VA 5IWAJ 4AQYF 2YNHB 2JC1A 5H1SV 3GYGA 5I3UB 1TTHB 2MTLA 3EX7B 3UN3A 4RU2A 3C16A 3GU0A 1HNWF 1TKZB 4EFAC 3OTOJ 3I9V9 3PW0A 2ALZA 4IOBA 1T95A 3U02A 1FEHA 4C98A 4KO0A 1Y5IB 2CIMA 2YKOA 4UOCA 4MYUA 2KG0A 1YITS 2KRRA 4LF8F 4O23A 3VAFA 2L9WA 1WDTA 3MCNA 1T9TA 3HSZA 1JJ2R 3QFHA 2A6OA 2CPYA 3K5LA 3FBCA 1BLUA 3A13A 4WFXA 4LF9F 2HWHA 2J9CA 3H2VE 2ABYA 3PRDA 4P52A 4JB8B 3H4DA 1RAAB 1HI1A 5KG2A 1SH3A 3OL7A 1UWBB 5DM6Q 2WOMB 3SSSA 2FHJA 3AJ1A 1JLAB 1YRXA 2LECA 2HGMA 3PEHA 2DR7A 4L75A 4ELUA 5E7OB 3R5CA 4KHMA 1HHSA 1F60B 1HL6A 2HVZA 1R89A 2UXBJ 2NS1B 4DEZA 2KO1A 5K8PA 1X4HA 5E3RA 3E01A 1FHTA 1VRUA 3UCZP 4IH6A 4C3KA 1TK0A 2YX1A 2IYGA 1H2VZ 4FNHA 4YQWA 2QIFA 3L7PA 2FJEB 3MMBA 3CCMS 2CJBA 3UE2A 4ZJQA 2MSTA 2NSCA 1RWPB 1F1BB 3GIKA 2NLWA 2J9DA 2M3DA 4ITSA 2FZGB 3GPAA 3C6UB 2AJ4A 3E2EA 4LFAJ 4Q8EA 4LIWA 3MECA 2GO8A 4J91A 4XPCA 1IN0A 3A4TA 2GX8A 4C0BA 2MJNA 3OSNA 2E9RX 4QZVB 2QA4S 3AODA 1S48A 3KOAA 1RT2B 2JJ4D 4NA3A 2UU9J 2B8QA 2CQ0A 2NXCA 3LA0A 3PYGA 2DGUA 2DRBA 5KG5A 2KL8A 2PN6A 2R8JA 3T1YF 4I2PB 2XMTA 3K5MA 4LF4F 2QZ8A 1MWYA 4NA1A 3LANA 4UY8T 2X51A 3CCRS 2AEFA 3P5TL 2QJ3A 1PJ6A 3R1HA 4CI0B 1S9GA 3ZO7A 3W5XA 1FVQA 1JXVA 4B3MJ 4DLEA 4LQ9A 4NLPA 3M32B 1HNIB 2AGQA 2DGOA 5KTQA 4V19J 5A8WB 1UCNA 3OUYB 5L46A 3TUZC 5DDQC 3CJ0A 2E5GA 2W2PP 2VV5A 2J0QD 3RBEA 3K57A 1TV6B 5IXUA 2AGPA 4DL7A 3NS6A 4WJBA 2ILZA 2PMHA 5H9FJ 3BO3A 1M5KC 2BKOA 3V81B 2BEFA 4XAKA 4F4XA 2HSEB 3G8SA 2MZSA 2GJFA 5F3ZA 4MFBB 3DLKA 4DMZA 4OI1A 1RT1B 1IQTA 2KFNA 3DLJA 4KH0B 1RHKB 2HHTA 1U48A 1RT5A 2DNNA 3HP6A 2UXCJ 4JV0A 1TK5A 2F3JA 3NY0A 2HKEA 2XQCA 2JL9A 2HG4A 1U6FA 3HHLB 3WX4A 1RU2A 3CJQA 2QLBB 2CQCA 4A8KA 3NNHA 2MZJA 4ANEA 3PR5B 5C7PA 1PC5A 2YNHA 3WQPA 3WC0A 1S1TB 3SQGA 4HACB 1VR6A 2IJNA 3V6JA 5JVHQ 4AXIA 2E7VA 1TKZA 3DU5A 2NCKL 2I2YA 1N5YB 2CQ1A 4CT8A 5B0DA 4QYZK 1O6XA 4ID5A 2ZM6F 1ZYQA 2RQMA 3OL9A 4LMZA 3VGTA 1F3VA 3KLIB 3GFYA 1KQFB 3EPGA 1RHUB 3M9NB 4FBTA 3OJSA 2XS5A 1PAEX 4LRFA 3GLJA 1G7CB 3IFEA 1CSJA 2G0IA 4M5NA 2QA1A 4ICLB 2F4VF 4ZP9A 2MJUA 5JUMA 1SIWB 4NX9A 4CLZA 2ZFHA 3W3SA 4J9UE 2ZE2B 1WTFA 4MIBA 5KFPA 4OYPA 4CYUB 4NLYA 4FS1A 5K9FA 3IBFB 2LXIA 1UWBA 1HQEA 1TKXA 2HK2A 2AJFE 3TUPA 4W92B 3H20A 2AKWB 3W9IA 4EBCA 5KFAA 2M8HA 4WP3A 1FRKA 4CCHA 5K5MA 2CADA 3D68A 2U2FA 2FGOA 3HVRA 1SKSA 1FE0A 2WRMA 1K0TA 2HNDB 3I96A 1YKWA 3TUIC 1U2CA 1VQPS 3R8YA 3R2DJ 1UVMA 4I64A 2OPPA 1QJHA 3DMJB 2EFOA 2MKHA 2IVFB 3LW5C 1ZPVA 3D6MB 1EETA 4ED4A 1IBKJ 5ETOA 4LSNB 5ETLA 1IQZA 4NASA 4ZPDA 4ZOSA 4CM2A 3W7BA 1FJEB 1NJIT 2ZOFA 2G9OA 4J37A 4UF4A 4CNZA 2JVOA 4R5PB 1IBMF 2M52A 2DGTA 1L3KA 2J8SA 1RT2A 3N01A 5L9NA 1PJ5A 1WUUA 1WKLA 5DGBA 4I2PA 3K17A 2JX2A 4DV3J 1C4CA 1T94A 3R5DA 4XDCA 4KFBB 2E5IA 4K4VA 2H1YA 2FC9A 4CLYA 4RUAA 3BPSP 3SEOA 2WCXA 3MM5B 4OJHA 3VQTA 1HNIA 2CDQA 3AOAA 3MCMA 4QIEA 2QL5B 2MZ1A 1HWJA 2DK2A 2BJ3A 5A8WA 2R7SA 1RACB 2UV8G 3J81j 4DU7A 4UOFA 4IRCA 4FPIA 1S9FA 2YKMB 2EEYA 1FWPA 4Y28C 3RTVA 2N4CA 3BQ2A 3HO1A 3OTDA 3MM7A 2OTJS 2O5DA 1S7IA 1H7XA 5E5NA 4QYZJ 2QFJA 8AT1B 5L1LA 1DTTA 1FXRA 4FF2A 1VK3A 3HCXA 1X4DA 5HN0A 2DPIA 1NDLA 1AT1B 2V68A 2E7XA 4N77A 2PSZA 2V67A 4WE1A 1EB0A 3D1QA 4R0JA 2NZ4A 3LOUA 4RW8A 4M5LA 4YHHF 4CRJA 2H54B 1Y5LB 2A18A 4ZJLA 1I94J 3I5BA 1MG7A 4PYAA 3J7Z5 4UT4A 3W1YC 2VASA 4O44A 3MZIA 1NK6A 3CPWR 2MQLA 4B3RF 2WVCA 1JLQB 4FXWA 4AXJA 4C8NA 1X9SA 1FO1A 4GKJF 2BUNA 2HMIB 4PEOA 5KFNA 3UCGA 3MPYA 4X64F 1S5ZA 4AT1B 3TP2A 1LW2A 4RZRA 2W9CB 3KHRA 1X0FA 2IJFA 2ZH6A 1CULB 3LWMA 1W2BR 1PBAA 1SQFA 5CQGA 4OX7A 1N5YA 2E1AA 2L41A 1CQMA 2YNGB 3TO8A 5IC6B 3M8WA 1REVB 2D1CA 4DX5A 4BBYA 4K5SA 2DJWA 2RS8A 4X4NA 3DRPA 1LXNA 3HFZB 4K50A 3N6NA 4ZPWR 2ATLA 2B5JB 1L3TA 4PZVA 3KK1B 2DB1A 4RW7B 2GQQA 1S1WB 2KYZA 1NB7A 5HROA 2F5GA 4ICLA 4Q44A 3NBPB 3F41A 2VG5A 5GAHU 5F8HA 3SBMA 2V8DA 4OZLA 6FD1A 2MLYA 4RU9A 2FVPA 4DFPA 2ASLA 2VG6A 1URNA 1YJVA 5ETKA 4PWDB 2CNLB 3PKYA 2AQ4A 4WFBQ 3H5YA 4HH0A 1CG2A 3I9ZA 4A8YA 1HNXF 2RT3A 4QWAA 3DLGA 3BBCA 3PXGa 1HD0A 4NLOA 3DN9A 3FUYA 4DX8H 3CE8A 4KPCA 1RJJA 2MYFA 2MY7A 1YTYA 2DNLA 4J9SA 1VFJA 5HBMB 4NA2A 2HHPA 4EBDA 2HNDA 1NDPA 4NLVA 4FF3A 1RT7B 3THVA 3AD7C 3QRPA 1T9VA 4HEA9 3PM9A 2ZZNA 2QYCA 3DMJA 3T5LA 1NMEB 3LH2S 1XNRF 3DOMB 1FRJA 4Q2MA 4DPYA 1SJFA 4ZIVA 3HHLD 4OYIA 3EE3A 5GAHI 3R5JB 3X1LB 3UN5A 1JLEB 8RUCA 3IRXA 4OX8A 2VOOA 4OHVA 1K0VA 1HD1A 3HI9A 2KVQE 5A2QY 2DR9A 2RHSB 2LYVA 2OGUA 4A47A 4UY85 3C46A 2OJ3A 2ZD1A 3QGPA 1U0HB 1TAUA 3NXZA 4R5PA 1F9EB 2R7XA 4H4KC 4J9KA 1LW0B 3I0SB 2DHAA 3HT3A 1ZH5A 4HR2A 4XPEA 4ECYA 1EJ7L 2VC1A 4WF9Q 3CJ4A 1BC6A 3SDEA 1EHWA 3MPUB 4F7VA 3KMSA 3CIZA 5ETQA 2BRLA 1U1MA 4K7QA 3LAKA 4QIVA 4F8RA 3DRSB 1JLGA 3PJWA 5K20B 3TWZA 2ASDA 4NI2A 2H4YB 2LA4A 4JI4J 2FJBB 3H5SA 3EXYA 2FD2A 4P72A 4G1IA 3MM5A 2DRDA 3MEGB 1D8YA 4KRWA 4NEYA 4DPTA 1Q81T 1RYRA 2MKCA 4WFNQ 3AA8A 1GXTA 4A48A 1VQKS 3MEDB 4F3QA 1VBZA 4NLWA 1NJZA 2VFUA 1TL5A 3M2UB 2P5VA 1W26A 2LLZA 4I4BA 1N48A 2B4OA 2B51A 3KDOA 5GAEU 1H38A 3CJKB 3GILA 3MM8B 3V6KA 3HVAA 3NAIA 4K5RA 2RQ4A 2NXEA 1KNZA 3EICA 5KFFA 2GMLA 2RILA 3HFVA 4CT9A 4NWBA 2YQ0A 3Q8RB 3GB0A 4X4TA 2R9LA 3QWPA 5F9NA 1WTBA 2JC0A 1WWHA 1GQEA 1WG1A 1GMWD 2IM2A 2DIUA 3K8WA 1WC0A 3D5MA 1Q5VA 4C6AA 1VC5A 1NEEA 4OI6A 4OX9F 2JVRA 4USJC 3TZWA 4F0MA 3GFXA 4WIQA 1JLQA 5HJXA 1WI8A 4XDDA 1B7YB 2E1RA 2IM0A 4MJKA 4TU7A 4KC5A 1VGYA 2ZBRA 4V19X 2RIJA 2Y1JA 4IR1A 3RB6A 2C3OA 2ZH3A 4M8LA 4MYTA 4CLPA 5A2QU 4YMEA 2W9CA 1LWEB 3VQSA 2PE8A 1D9AA 4N56A 2LFVA 4CLUA 1IR2A 2XEXA 2YNGA 4JV5F 5GAEI 2WVFA 3G96A 3BN4A 2W25A 1PO6A 1A9NB 4FN5A 5LT5A 4PG6A 1QD1A 1L3VA 5GADU 4MIAA 2K3KA 1MROB 1S79A 1Q8LA 3LF0A 4RWXA 2X7IA 1H0HB 5M2RA 2OEJA 3N6MA 2G1DA 1U1OA 1D9DA 4BWMA 4DG1A 4PKDB 3AOCA 4A8OA 2BZ2A 5HMWA 4PG8A 2B4UA 1U1QA 1SH2A 3IWLA 2ZOGA 4PWDA 4UW2A 4DN9A 2K1RA 1SQGA 1FXLA 3LGMA 4C8KA 3PCOB 2X1BA 4LFBJ 3QLHB 2VDHA 3KNGA 1ITPA 2RDDA 3PYDA 1CJKB 4JI0F 4DQQA 4IYQA 2JRSA 3H90A 1UAWA 3EUNA 5HBMA 1FDNA 4WP9A 4F4YA 2V4JB 4DV0F 1RA6A 3PVXA 4B3TF 4DX7A 3H98A 4Y0FA 1A7GE 3C15B 2Z0GA 3F56A 3FSXA 1KSPA 5GADI 1VQNS 3UFCX 2IMOA 3HVTB 2NZCA 1AZSA 4LUBA 4AYBD 2KZZA 5EHHA 2GMJA 3D28A 4KGMA 2X1AA 4F2SA 4I68A 5FJ4A 3H5UA 4GKKJ 3DOMA 1FFSB 4F4AA 2ZH1A 3SQOP 2ZWOA 5LMUF 3J7YU 3PDNA 2DH8A 5D15A 4BDPA 2KRBA 1PILA 4OJGA 1AB8A 1BY9A 4JI5F 4OYWA 1N36F 1FJGF 2KT5A 2IA6A 1SI9A 4C97A 4LBHA 2XO7A 2K7KA 1M1GA 3W2WB 4W90B 1NPKA 1LW0A 5CA5A 2D9PA 3HF5A 4FZVA 4QBUA 5ADZA 3HJVA 3W61A 1RGVA 1NJWA 4P9SA 3DHXA 5LXRA 3HK2A 1EKSA 3ULHA 1RCXB 2C2KB 1N5QA 1NK8A 3LO3A 1HR0F 3K2YA 3PW7A 3NGTA 4DR7F 4OL8A 4FYDA 2CQDA 1GX6A 3OTOF 1OY9A 2J6SA 2QEXS 4U6PA 4EU0A 3CJ2A 4PPDA 1GAOA 4IDKB 3PIPQ 5ITHA 1Q78A 4U8YA 3DOLA 3LGHA 2XMKA 4L72B 4MK8A 2QSWA 3ISNC 3M4XA 5ETMA 1RHJB 1NB2A 3ZTOA 1F9HA 1KQKA 4EO8A 4DV2J 5L9XA 2V5HG 2IBKA 3NMAA 2FPHX 4JI8J 2EFGA 2OIHA 2K2PA 2W24A 4H4MA 3J7YI 4LVNP 3ZZZA 3UWTA 4ECQA 5SUHA 4Z37A 2UVUA 3ZZPA 4UZCA 3M2UA 5LJ5Y 4J9LA 4M5DA 2WSEC 3H7HB 3MM8A 3J7AN 3FMBA 1IM6A 1H72C 4FXDA 3RR7A 2CVIA 3OFHA 2WAQD 3VWSA 3NGRA 3DNCA 1Y0HA 3GYXB 4OYZA 3TQEA 3M9MB 3VAGA 5KT5A 2PIIA 3MTJA 4TLRA 3MUMP 1QY7A 4OHYA 2UXBF 4KV8B 1P1LA 2Q79A 2R2SA 4O3PA 4MAKA 4HT5A 2MQMA 3B4DA 3RAQA 3HPOA 2XNQA 2GQ2A 2OMLA 4HH1A 2BV3A 1S6OA 1RISA 1OO0B 2D69A 1X5SA 4Y2CA 1IVZA 2IC3B 1FCAA 1QE1B 1NSAA 2J7WA 1V6HA 1NH8A 1WF0A 2YXLA 3MAHA 1KOHA 2PO4A 4URSA 1Z1ZA 2RNEA 2EW9A 4UQGA 1BHNA 2E5JA 4NLUA 4LFAF 1MN7A 4U96A 2ZC3A 4CO5A 3D66A 4NYPA 1NDCA 1NH7A 2Z8QA 1RK8A 4AL7A 1FX2A 1RTIB 2NQPA 4L6V3 4PWWA 3N5FA 5L1IA 4DDFA 3DOKB 2DO4A 3NOCA 5B0GA 4XO0A 1MROA 3HD1A 2OPSA 4RW6B 3AXKA 2P9GA 2UU9F 4WYLA 2V0NA 1TU0B 6AT1B 1WG4A 2JLGA 2PGCA 3C19A 1D09B 3MR7A 5CXTA 2KG1A 5AXKA 4F50A 5F41A 3FDSA 4CLLA 3WDOA 1WF2A 4DR5J 1UVLA 3D7SB 5HK4A 1KHWA 3BBBA 1TKTB 2VKRA 2F8MA 4FVMA 2W7PA 2I0XA 4NEZA 4B3MF 3IWXA 2BACA 4GVLA 4DR6F 4OQJA 4NLTA 4DQSA 4NL5A 2XLJA 1SC3B 3D67A 5AXMA 4ILLA 4Q8FA 1G2EA 1FFGB 4DJBA 2DNGA 5G0RB 4N5SA 3KHHA 3MMAB 4EYIB 2OPRB 3A8JA 3NP5A 4OYBA 3E3XA 2K3IA 1K8AT 1QUVA 5KFIA 3NNAA 1R8AA 2ZWPA 3OFGA 2ZHAA 2XYHB 3FVYA 4OLOA 3GWCA 4A8XA 4K0KF 3UNGC 3HVTA 1APSA 1AW0A 5T14A 4GO5X 2LXFA 1VC0A 3ENQA 1YBAA 2F65A 1TFYA 1VDHA 1DQ9A 2DRAA 2J6TA 1VQ4S 4UZBA 2UXDJ 3H4BA 4F25A 5DG7A 2HHQA 1FK9B 3OSPA 2C2RA 3DHWC 4ZJOA 1N33J 3SCLE 3D1HA 1NM2A 4O4GB 1UJ5A 3THPA 3OT9A 3QRQA 4Y00A 1NAQA 3AJ2A 3C8YA 3CJ3A 1MMLA 1ZETA 1S49A 1RWVB 3DRYA 2ROPA 1UW4A 1RAIB 1FDDA 3X3UA 1LFWA 2IBOA 5IZHA 2C3MA 3O6QA 2MGZB 2W7OA 1J5EJ 3EGZA 2OFHX 3NEKA 1TUGB 2OLWA 3JQKA 1XNQJ 1N6QB 2VJVA 1YJNS 2M70A 2QA2A 4DV1F 4ZPVR 1FFWB 2CPEA 4FYVB 3L95X 2R2TA 2LVWA 4NZ0A 3TAMB 1RHMB 1VQMS 3IMQJ 1I3OB 2ZH4A 2HFZA 2R7RA 2JNJA 4EO6A 4PR6A 5DG8A 4BWJA 4DR1J 2WVDA 2DGWA 5G4DA 1RWNB 3K58A 1HPZB 4X4PA 2VOPA 1Z4UA 2V9WA 3TQ1A 1KOOA 3GSDA 2A10A 5HLFB 1VIXA 5KT4A 4USKA 3LWLA 4D3HA 2DNOA 3IR7B 4DOZA 3EZ5A 2B9XA 2M2BA 5LM7E 3G8TA 2LDYA 4WZMA 3EZUA 5T7LB 1ELOA 3TNVA 4X65F 4J9OA 1FRHA 1Y11A 2JZ5A 5A8KB 4ECZA 5HQLA 4LR9A 4DSEA 3RAXA 2OFGX 3KJQB 3LAMA 4LRBA 4I0WA 1SKRA 3GIIA 5AXLA 2F8HA 2EK1A 2XY5A 3N9UC 3U1LA 2WW8A 1SCJB 3RB0A 1FF2A 3D54A 4KHPJ 2EFVA 1SL1A 2I8EA 2XZWA 2KFYA 5E0OA 3C14B 4K4TA 2H48B 2P6SA 3BSOA 5IT4A 1M1KT 2F7VA 5KG3A 4X84A 1HYSB 3T6JA 4OYOA 2HS0A 4PABA 1N0UA 2GIFA 3TAQA 1R6YA 2IC3A 4DR3F 2H5EA 2IYIA 2JEJA 2D3OR 1U49A 3H2UB 1BD6A 3N5BA 2VBXA 4MTPA 4B9VA 1IBKF 2ZDOA 4J9NA 1R6VA 4PQAA 4OV6A 2JFKA 4NMLA 1IBCB 4Q45A 3Q24A 2Q6BA 2ZDPA 2I5JB 1RYSA 4Z7CA 4ZPAA 2W2QP 1H2UX 4RW6A 1X4BA 3V6HA 2VFVA 4O3RA 1REGX 2OO4A 1SUQB 3EWGA 1SJRA 3CD7A 1RTHB 1SH0A 5K8MA 4LREA 1V3ZA 4DV3F 1RTJA 2IRXA 2HQCA 1NHKL 4D3GA 2RAQA 1N32J 1NSQA 1E6VA 4FF4A 1OY6A 3KLEB 4RWWA 2IJRA 4NLGA 3TW0A 1F9FA 2HFVA 2C42A 2KI2A 1KLNA 1C1CA 3BPDA 1H2TZ 3QO9B 1IBLF 1VHFA 2UV8A 3O1LA 4LF6J 1RABB 2P9EA 5E33A 4TYBA 3DDKA 5C25B 3B6BA 3CTRA 5G0RA 1FRMA 2CJAA 4ZLJA 1WACA 1O8BA 4NPOA 4IFVB 1TZ0A 1B64A 1NJYA 3KG4A 2YNIA 1U6BA 4QR2A 4U8VA 1FE4A 3M8RA 3UDEA 2CNKB 4CLKA 2IA0A 3UO0A 3D1OA 1BWEA 3HHNB 4G65A 3I31A 4F02A 3CDAA 5J2PB 3C6TB 2XS2A 2VC0A 3VAKA 1GMVA 5KFXA 5HO4A 2FQQB 2D3UA 4DZ6A 1I94F 2ZC4A 2FB0A 1FNOA 4B02A 4E98A 1BWVA 1LNQA 1HNVA 1WJ9A 7AT1B 4PXCA 2ZZTA 3I87A 3W63A 3W62A 4ID8A 1VLYA 4I56A 1DTQA 2AHOB 1A6LA 4O4GA 2KJWA 4S0MA 3G6XA 1WSVA 2DNMA 5LJ3Y 1KQGB 2J7UA 4P7TA 1PSDA 3SCJE 1KVKA 2GJ2A 2BKNA 2A1BA 4Y3CA 3L7OA 4KSEB 1QLNA 4QCLA 3D6HB 3MD1A 3LGNA 7FD1A 3KLGA 2MGZA 1JWWA 1WOSA 2Q6CA 5GMEA 4DR4J 3BSCA 2CZVC 1WNEA 1NO8A 2XM3A 4WXOA 1X60A 2OI2A 5CYQB 3NMRA 1OWXA 1HBOA 2E1CA 4LIRA 1EQ0A 4ZDNA 4LFCJ 4B9NA 3OBIA 5IV4A 4DCPB 2V2QA 4F3MA 2RJZA 2PA3A 4ZHRB 3SMZA 1NJXA 4FYXB 3M8PB 3GFHA 4DFMA 4CO1A 2HHUA 2DY1A 3CCZA 3ETMA 4NOHA 3JXOA 2RF2B 2MKJA 2NXUA 3DGPB 4RLEA 2Y8WA 4WTYA 3BQ0A 3RB3A 2XB2D 3GFZA 1IKYB 3TOQA 1ZBTA 3JTOA 4YDDB 2KZMA 5KFSA 1SL2A 1S6PB 3RZAA 2G2ZA 3FKBA 2CPXA 5BYRA 4ED0A 2ZJRQ 1XN9A 3S7RA 1YI2S 3CD0A 2AJ2A 3NOGA 1F0XA 3ILOA 1Q8IA 2ZBPA 1TMMA 1N5VA 3AB4B 2OD4A 3GJTB 1ZS6A 3BF4A 5J1PA 1U1LA 1EKRA 3LP1B 3W9JA 1OJ4A 3MR2A 2VHGA 4E2FB 3C14A 4YB5A 1TL1B 1IWGA 5DETA 5C5JA 1HYSA 4HI1A 1JNZB 3QAUA 4ER8A 3GJSB 4RBTA 3MPWA 1UETA 3FEZA 4LT6A 1HBNB 3PW4A 2C2OB 3OXGA 1ZAWA 2OEMA 2W01A 1GXUA 1IKWA 2Y0SD 2FC8A 4I6AA 4O0NA 3OR2A 2GVDA 3MCOA 3NGKA 1MN9A 1JLBB 2HHHF 3K5OA 2AIRB 2DIVA 4Y2AA 1T11A 4LVOP 4AUKA 2I5JA 1UFKA 2EBEA 1KTQA 3PJXA 4DPUA 2DNKA 4TU9A 3MDFA 3CNQP 1SUQA 3OTBA 3PRBA 3JSRA 1SV5A 1IUJA 3RRHA 1CJTB 5L8RC 4M1KA 4USVA 4FXVA 1HBUB 1RTDA 3ZZRA 1YJ9S 3I55S 4ZS6A 4USUA 5K8NA 1WHVA 2GJIA 5D0GA 3T3FA 3C16B 1S1VA 1AXQA 3RW7A 4JI4F 3MURP 2XSJB 5LXYA 2CZ4A 3G4SS 1JKHA 5J1EA 2CJXB 4FDFA 4GC7A 1YBUA 3QO9A 2F9DA 1NNDA 4QWCA 3O44A 2RS2A 2GHVC 1H98A 4BS2A 3MTKA 3K7RA 4ZVEA 1VISA 2BQUA 3WX8A 4CP5A 1YVFA 1H73A 3BKFA 5BR8J 2AJ1A 2EWHA 3W60A 1VHIA 2YKAA 5KFRA 1VS3A 1VQ5S 3R7NB 1RWXB 2HAFA 4F26A 5T41A 4LQ3A 1T9UA 2EC2A 3BV8A 3L09A 2WB4A 1S6QA 3UD4P 4NLDA 2M0GB 4C4WA 3GJRB 3ZZUA 2V8GA 2GHWA 4Q0BA 3CDBA 4PRFA 2D9OA 3EDQB 4Z2XA 3U7JA 1DZ5A 2C3YA 3QT8A 5KFVA 3DI6B 1WKJA 4USIA 4JI7F 1WC4A 1HNWJ 4ZVFA 1NSPA 1KLMA 4I67A 2PA8D 4B9SA 3HMJG 1DHMA 2N4DA 1VQ8S 4DWIA 2HWTA 1WC3A 1N88A 1UW9A 5F8GA 4MT1A 3I56S 4KKOB 4PWUA 3SCIE 2Y3YA 1RT3A 4LF8J 1SQEA 5LSOA 3SV4A 3FGVA 1U02A 1KWMA 4J9MA 4J9VA 3M2VB 1SXLA 1Q5YA 5HSPA 2MKIA 2QX0A 5F8MA 3J80Y 2AMCB 5THWA 3MMBB 5J2QB 3PR4A 4Y6IA 2YWGA 5KFQA 2K7JA 3QFWA 4TVAB 4ECSA 1PIEA 1F3FA 1LXJA 3P3DA 5CYQA 2HRUA 4DV4F 2HQDA 2VODA 1VJQA 3MECB 1TL3B 4ZHRA 5DDRC 3M8PA 2B6AA 2MQPA 5CABA 3MR5A 3CJRA 4H54A 3IGNA 4DR2J 3BZQA 5E3PA 3OW2R 3PX0A 1ZAVA 3V2UC 2KKHA 3DGPA 2YX7A 1Q8BA 1OSCA 1KBRA 1R3NA 2GA7A 3GV5B 4ILRA 4OHWA 1IKYA 1U8WA 2EFQA 1VC6A 2VB6A 5KFZA 4DU8A 3HVWA 3VGSA 1UP1A 1S6PA 3PACA 2B4PA 3NCPA 2Q1LA 1HI8A 5KFYA 4PG4A 2VBZA 3GG1A 4DL5A 4IRKA 5B0AA 2VA3A 1S9GB 2ZITA 3HSGA 2DXFA 1NDKA 4QJVA 5CYMA 3QZ7A 3EVWA 1UA0A 1CC8A 5B0BA 2VKZG 4QWDA 2KTQA 3CSKA 3R3TA 2ERRA 3NGSA 5F0UA 2BJ9A 5JMNA 4RUBA 3F0NA 1Q79A 3RRGA 1HBMB 1SBRA 3QJJA 2AX1A 5HI7A 5KAKA 1T7PA 2MPUA 3CVKA 2APOA 2BE9B 2FHKA 5C2GA 2EFNA 4P2FA 1QTMA 1VI7A 2W2OP 4GKKF 3T1YJ 1S97A 1N5SA 3DLKB 3MEKA 1N0VC 2NUHA 4TKTA 2IRYA 1FTCA 3T1AA 2BVZA 4K4WA 2QT7A 5AE1A 4CH7A 1G4CA 2DR6A 2RMLA 1RT5B 3HHEA 4OI0A 1DARA 1GTHA 1YJUA 4OZ1A 3H25A 1JB0C 2Y0BB 3TUJC 3CCES 2XY7A 3M2RA 2DVIA 1ZOTA 2HHWA 1R8HA 3W5YA 3BGLA 1RU1A 3GIJA 1AFIA 2C28A 3HT0A 1CJTA 4J5OA 2ZUGA 4LF1A 3W2VA 3EZOA 3NLCA 2UVRA 2QSFA 3SQGB 2G0JA 2BBEA 3SI8A 1X4EA 5HP1A 5IT9Y 2XSJA 1QAXA 2X3GA 4ID5B 1B3TA 3CJTA 4A8SA 1RT6A 3PJ9A 1VIOA 1LOUA 1T03B 4JI8F 5EX0A 4HHHA 3OTCA 2PEBA 1XERA 1VRQC 5KG1A 3TZYA 5F8LA 1WF1A 1X9MA 1D9FA 2KT3A 4DS4A 5MAOA 5CAAA 4TY9A 2PD1A 1U4BA 2DNYA 3TJ8A 3M6UA 5KFKA 3F44A 3ZNJ1 4TQRA 4AD6A 1ZTWA 1KS2A 4ECRA 1R0AB 2DR5A 2HURA 3VTIA 5I42B 3ISND 1HQEB 1TKXB 1TFWA 2LMIA 4M5MA 2FVCA 3DI6A 2V94A 5K14A 2XMVA 2BJ8A 3V6DB 3P96A 4NLXA 5AJ3J 1JLFA 3MHYA 2YPZA 4HHUA 4KKOA 1KHVA 2DISA 3E51A 2C2MB 3M2VA 4LRDA 2OHDA 3CF5Q 2CXEA 1VBKA 2OPPB 4MIWA 5FD1A 2Y1IA 1FESA 1S10A 5J2QA 4CZCA 4KE5A 1X9WA 4JV1A 4WPAA 3QNWB 3NKYA 1K1QA 4JOUA 5KFOA 4DV5F 4ZVQB 1YBTA 5F8JA 1EETB 4IG3A 5KFGA 2D3O1 4QPXA 2DHXA 3OFEA 4MMOA 3EJMA 3AFGA 1M5PC 1TL3A 2WONA 1HQ2A 2Z2LA 4JI3J 2KHDA 1JMTA 1R0CB 3R2CJ 1FJ7A 3QMQA 2FY1A 1YQHA 3KG0A 3MD3A 3POTA 2KB2A 5D6GA 1VQSA 2HYIB 3U27A 3TYTA 1M5HA 2MZTA 4DS5A 2MQQA 4H4OB 3ZNUA 4HVZA 2H4WB 3RGIA 3Q8UA 4QQBA 4RNNA 1ZM3A 4LF2A 2SXLA 2DITA 2JSXA 3CDWA 1FI4A 4RW9A 1HI0P 1XMOJ 5DS7A 1EIYB 2MZRA 1NUEA 1DURA 1UKUA 1B7FA 3DRRA 2AYGA 2UVVA 3M6VA 5L39A 3T5KA 4C8ZA 3PW5A 3IR6B 3CULA 4KT0C 4IUFA 2BW2A 3UW1A 3ZTRA 2C2EA 2BW7A 1BQMA 1EP4A 4QPTA 4B17A 5B0FA 3O5TB 4UTGA 2WSFC 2V6AA 3VF0B 1LFPA 1HBMA 3ETOA 4DL6A 3W65A 2FHJD 2EPIA 2XLIA 3MM7B 4G1QA 1JK9B 1S9EB 5F8NA 2Z56B 5A8RB 2CG8A 3CJSA 3NRBA 1DTTB 3KLFA 3JSYA 3RRKA 2VL1A 1F6TA 1U6ZA 3FQKA 3M8QB 3SSRA 4WE1B 3IM9A 4ZCLA 4RW8B 4XIUA 2FUG9 3QBCA 3NNCA 2JLEA 3UDVA 3K5PA 1YRUA 3CC7S 3OXFA 3BKTA 3JSMB 4O44B 1B0TA 2HFNA 1WORA 1WELA 1RCOB 2WVEA 3J81Y 1KKHA 2ZEJA 5D78A 2EVZA 3ITHB 3UN2A 2DGVA 5E3AA 2RRNA 2M9KA 2AYBA 1NHUA 3NS5A 2K06A 1XQIA 1WHXA 1TELA 1NK7A 1YHQS 1LW2B 3T19A 3KDNA 2W8LA 2EG1A 1V5IB 1C4AA 1UJ6A 3N4WA 2D41A 2DHGA 2G2OA 3TVZA 4TNOA 2BANA 4Y2MA 1F2HA 4UUXA 5C42A 5KG7A 4OFZA 3JYTB 1NPPA 3ZZTA 3HXMA 1AYEA 3TX0A 4FVCA 9RUBA 3C66A 3MCSA 3CT9A 4V1Ak 4YHHJ 2A6MA 3DRPB 2YWKA 4OZJA 1T03A 4HHJA 2XO6A 4YUDA 4DR1F 4HT7A 4TYAA 2VONA 3BQ1A 2D7SA 3TARA 5HROB 2LU1A 2MQOA 2VG5B 2K8GA 3HHKA 3TJAA 4RJVA 3AA9A 1R0AA 2C3PA 4NCGA 3RYLA 5HQ8A 2VG6B 5I42A 4NCAA 1WC1A 5GVQA 3M05A 4CM0A 2ZH8A 4F67A 4ZVPB 4QW9A 1CC7A 2B3TB 2WHOA 3PHTA 5AT1B 3AQOA 2M7SA 3NL0A 2ZNZA 4KJIA 3DLGB 3IM8A 3V6DA 4RNHA 5D0RA 4OI2A 5B08A 1NKBA 3VALA 5I3QA 2DKOB 3RW6A 4M5GA 1ZZFA 2OEKA 1VK8A 2KFZA 3VAHA 3HZEA 5IM0B 5D3GA 2J0XA 2FJAB 4U7CA 3UNYA 4PAAA 2PC6A 1W7WA 2O66A 3J81U 1WEYA 4LF5F 3OR1A 1IM4A 1VQLS 1QVFR 2AJQA 1YGYA 3IS9B 3PYEA 3KJVA 5AXNA 3GYNA 2BYCA 2FJVA 5EUHA 2VQEJ 3IRXB 5DO2A 1V3SA 4OZ0A 2BABA 3CO9A 2V34A 5J1NA 1I1GA 4LF7J 4QU6A 1Z2LA 1RT4B 4WXWA 4QR1A 2VU5A 2ZD1B 3L9ZA 1PJ7A 4HKQA 1RQ0A 4Y65A 2R8IA 2IIHA 4DV7J 4QWEA 3PRVA 3CMQA 2LA6A 1S4FA 4ZVSB 1NK0A 2OP5A 5FDLB 3EMTA 5EN1A 1ACMB 3SDEB 4H4OA 4CO4A 3CCSS 4LBIA 1K44A 4EI2A 2R8HA 4TQSA 2DNRA 1MWZA 2GNKA 1HNZF 1JLGB 4PPZA 4ZLNA 2L9NA 2O67A 2W1BA 4NI2B 5E2QA 2A2CA 2ZH7A 1XNRJ 4DL2A 1KFDA 4LF6F 3WIUA 1RHQB 4ED5A 4N47A 3TRGA 1ZM9A 2JOQA 4P2SA 2KVIA 2BR0A 1FA0A 3DXSX 1EQMA 2LEAA 3JTPA 2VBYA 2AGOA 1OQ3A 3L7UA 3MM6A 1S9EA 2CNNB 1CS4A 5A8RA 3FBBA 3S1TA 2ALYB 1XC9A 1TKDA 3D9BA 2FZCB 2XWXA 4ZP6A 4URGA 1LWXA 3A3OB 3BO2A 3UR3C 2BM1A 1FRXA 1YZ6A 3M8QA 1SB6A 1X31C 2LCWA 3VZIA 3O2IA 1FD2A 1P27B 1JJHA 2YPYA 1YLXA 3Q86A 4GVBA 4P6QA 5F0WA 1RWKB 1XR6A 2WW4A 1NSKL 3KK3B 3K0JA 2ZHBA 1S7HA 3JSMA 2VPXB 3OLAA 3G9CA 2KXFA 3I4HX 3AAWB 3Q8SB 3ITHA 3A8EA 1G3OA 3U1MA 2PI5A 4DL0C 1AUDA 2DPJA 1PC4A 2BJ7A 2QO3A 3FCHA 1U2FA 2HQIA 1S4EA 4YR3A 2GGPA 2HW3A 4WP8A 4B08A 4C8LA 3M6XA 2XBPA 3FJ2A 1TR0A 1L3UA 4DR4F 4WTOB 3I0RA 1X4CA 4JI6J 1JXLA 2CJKA 4NE9C 1RXOB 2XTJP 3H40A 2CWKA 4XK8C 3DDIA 2G1HA 3JYTA 1SPBP 4LFCF 2GQCA 3BYRA 2PFDA 2VH7A 4DZDA 2ZVSA 4TY8B 1YK9A 2HLUA 3GZ7A 1D1UA 1XIQA 2BM0A 2IFXA 3G6VA 2X1GA 1QAJA 4CLSA 2FHOB 4B9TA 3TJ9A 4OX9J 1LEOA 1NHVA 2DBBA 2HNYB 4LRAA 5CD4H 2QMXA 3CD6S 4ILMA 4PYDA 4WK3A 2AYMA 4DG1B 1S0OA 2QFIA 3KNAA 2CUYA 1NU4A 3IAM9 2IPOB 2XMAA 3ZZ0A 5EWEA 1FD8A 4JV2A 5B09A 4CH1A 2DEJA 5I3PA 5HMYA 3R6GB 1WC5A 3EYZA 2K1RB 1WKKA 1VBXA 3T5JA 4LSLA 3GTYX 3VV2B 2RHQB 3SCKE 1T8EA 2DT9A 3C3LA 4JV5J 3I32A 4A8WA 1RB0A 3BSNA 1HA1A 1VQ6S 4CTAA 3QPIA 3PYFA 3N0VA 5IM0A 2G4BA 2IAJB 3ZTPA 3A3PB 1GXLA 1VQ9S 2WTFA 3PY8A 2CJQA 4DX6A 3PV8A 3BM7A 1HLWA 1AZSB 2N3OA 1OYDA 1F5BA 4O4RA 3IS9A 2DXDA 2LQJA 4YY3J 2DO0A 3A12A 2V4QA 3T1HF 1HQUB 7FDRA 4KBIA 1T3OA 3BYPA 3ZXWA 1KC8T 1URRA 4CLWA 2MKKA 4U67Q 3BN7A 3SFGA 1KDNA 1TUWA 2M8DB 2RKIA 2B0GA 1H3DA 5K8OA 2AEMA 3TR5A 1RT4A 2Z4PA 3AHPA 1ZZNA 2QN6B 1IKXA 1VOMA 3TVKA 3GR0A 2ZOMA 2VF3A 3H2LA 3P5BP 4WK1A 1WG5A 2HVEA 4CQ1A 3DDNA 1CQNA 1U47A 4CO0A 1NCLA 3P45B 4X66F 3CWJA 3VVTA 2UUCF 2YX4A 3H0PA 3ENWA 5FDLA 1NRKA 4QIWD 3ILIA 3TA1A 1JLCA 2Y1LB 4X4OA 5M2UA 1Y10A 1Y3KA 2LKZA 3CCWA 2DGSA 3CCTA 4DV0J 3MF5A 4B3TJ 1DLOB 4QYRA 5EWFA 2QMWA 2YWEA 2YKPA 1K73T 4NCBA 3DOLB 4DXLA 3LP0B 1PG5B 2E5LJ 1OMSA 2NXJA 2OPQA 5D4OA 3CMES 1RSCA 4IR9A 1RE1B 3R5GA 3NWRA 4P73A 5LMUJ 4RKUC 4E8UA 2R3VA 2XGQA 4BC9A 4FPRA 4I6WA 5KFBA 4H4MB 1ICEB 1XK8A 5BR8F 4W4MA 3VZHA 1J5OA 3DYAB 4M5DB 1GK8A 2QLJB 2MQNA 3J7ZT 3MAAB 3FCWA 2HVIA 4TU8A 1UA1A 4G3IA 5KFMA 2M88A 3LP2B 3GIMA 2LQ9A 3KK2B 2NYIA 2W2NP 3BDPA 4DV6J 2UUBJ 1HR0J 1ZA2B 4DR7J 4CLFA 2RB7A 4B3SJ 3J7A1 4TXSA 2EXUA 3S6EA 3KK3A 1RWUA 2E1PA 1U25A 3SFUA 1PYOB 3KKFA 3BEGB 3MFHA 4A8MP 3W8PA 3R5AA 4EGLA 4J9QA 3V4IA 2R2RA 5H9FK 4M5JA 2V8HA 4C11A 4ZP7A 1G1XA 1LWFB 4MK9A 2XLKA 4OJ1A 3ZTQA 2FGCA 2XYPB 3M7VA 4C8OA 2BMBA 2Q66A 3I5AA 4JI2J 2KXHA 4IRDA 1I5OB 4ETXA 3OHBA 1P1TA 4OZ2A 1Q1KA 3KYLA 2CAJA 3EGWB 2Q43A 4J9RA 5B7WA 5D4NA 2F1FA 1FKPB 2B56A 2VUGA 4P7VA 4TY8A 4DR2F 4A8FA 3ZZYA 3KMQA 3DLEA 3EGNA 3HKWA 5KG4A 4EK2A 4RBVA 4IQXA 5DDPC 2OPSB 2FJDB 4MKBA 3VAJA 2ZHOA 1VYAA 5J2MA 3JB9k 3VR1A 1HWIA 2HNYA 2CQ3A 4L3KA 2WBMA 4M5KA 4EWTA 2DEIA 3P4UB 1K1SA 4GMKA 1S72S 2KXNB 3OVBA 2HFUA 3B8HA 4GC6A 2B7CB 4KH1B 3BDEA 3A1YG 1DBDA 4NXMJ 1CBKA 5HJYA 2DXEA 2GC8A 4C0OC 1HWKA 1XMQJ 2CZ9A 2HVHA 1RAHB 2V2ZA 2HZAA 1SC4B 3LTOA 3WZ0A 2QL7B 4DN0A 3M30A 1L5UA 4WYWA 1Q82T 3FCVA 4ED2A 4LBPA 2NUUG 4C3LA 2IDLA 3PEJA 1R43A 2ADBA 1SJ4P 4DQRA 2IAJA 4C48A 1VRTA 4QU7A 2I1RA 4OMFG 5RUBA 3CXCR 2BQRA 2KT2A 2CJ9A 2V50A 1LQ9A 1NZ8A 4JP8A 3M9OB 3ZTSA 1HQUA 5JXSA 4JUZA 4MH8A 3MOZA 1C0TB 4WKRA 1T05B 2R7WA 2E1MC 2AX0A 2ACMA 3SZ2A 2VPYB 2PEHA 1TQLA 1FRLA 2VFSA 1MMDA 3UPFA 4DUZJ 3VAIA 2DNZA 4RX6A 1YX2A 2WZ1A 4DR6J 4KGVB 1HMVB 1M5VC 4JYAF 4RUCA 4IKAA 4HLBA 4DI6A 3CIMA 2HEKA 4KQZA 1MMNA 2UUWA 1IKVB 1Q53A 1NKEA 2ADCA 4DUYJ 5E3QA 3Q22A 2HQFA 2RQCA 5IWAF 4DF8A 3D0HE 1R31A 1KEKA 4ES1A 2CDRB 2DNQA 3CEDA 2FTRA 4NLSA 2DTJA 1S1UB 1X7VA 1DLOA 3VAMA 1JIHA 4OYAA 4K0KJ 4ZVRB 1OY8A 2GW8A 1MW7A 5CD4A 4NYOA 4ZA1A 3LP0A 3W64A 4ATNA 4IOCQ 4ZVGA 4MKVA 4R8UA 3T6BA 5DDOC 4M5IA 4KR0B 1QSLA 4YOEA 1HWLA 4DSKA 3QZ8A 2KJVA 2W4DA 4ZITA 2FVQA 1QDUB 1WHWA 2LQBA 3OHAA 2GHPA 2A0FB 2CRLA 1KR4A 3DYAA 2J7KA 5DG9A 1KVJA 2MY8A 4OI3A 3AY0A 3MAAA 2AEJA 2BX6A 3LP2A 1W2IA 4PXDA 2EG2A 4YEAA 1SC1B 1KVIA 3KK2A 2HBZB 3GP9A 3CD5A 5I3UA 2YQ3A 3PZPA 5HATA 3DRXA 2RDIA 1VQ7S 2OELA 3OXLA 4DV1J 3R9LA 2JEGA 1SJ1A 4DPXA 4YB1P 1QTNB 3MMJA 5AJ3F 3CC2S 3K89A 2LXUA 3MM9B 1EX8A 3M1VB 3VCDA 3RR8A 3GCWP 4ES3A 2NXNA 5AE2A 1LWFA 3FMWA 1DAXA 4PG5A 2NPFA 4IOAQ 1S6UA 2POKA 3JSBA 1FX4A 1S0NA 1ROFA 4ETZA 3FBFA 2BRKA 1S77D 4ZIWA 2R7TA 1OPZA 2WOMA 1FKPA 2U1AA 3I5CA 2UZAA 2ACYA 3H59A 4X65J 1JLAA 3R7SB 5KFCA 4U9RA 4PUOB 1UVJA 3IGVA 4JI3F 2B43A 1S1XB 2AV5A 2LQ5A 4WFYA 4DSJA 2KU7A 4LRCA 1J27A 3PX4A 5CZXA 3QIPB 1S57A 2RRBA 2XG8A 2RQKA 3TVYA 5JJBA 4U7UK 1RTJB 4K2XA 4AL5A 4F4WA 4FS2A 1IR1A 1DQAA 1N52B 1SC6A 3SXLA 2GCFA 5KFHA 2XYGB 5JVGQ 4PCQA 5DQIA 2NR0A 1U8SA 2HHXA 2H5JB 1E6VB 4DR3J 3IBWA 2YH1A 1XMOF 2V8VA 2MEWA 5LMNJ 4IQMA 2HK3A 3KXDA 1PGZA 4X4UA 1X5PA 3QSIA 2FJXA 3G6YA 4L73A 2OMOA 2V2KA 1C1CB 3KUGA 5L1KA 2AWZA 4OYMA 2L48A 3C6UA 2CKWA 2GIQA 4DBQA 4M5HA 5HL7Q 3VHQA 4K4UA 2MQ8A 4KB7A 1RLCL 4R0EA 2FLOA 3HSJA 2YNIB 3JQMA 4QW8A 5BXIA 4PXEA 5KFLA 3R97A 4X4RA 1P9QC 5EDWA 3BH7B 2RU3A 1GX5A 3UI3A 3RBXA 3SIPB 2OUGA 3FSIA 3WBZA 1RAJA 2H5IB 3RUBL 2XY6A 2YVSA 2R2UA 4MKAA 2LEBA 3QSYB 2VA2A 3QATA 2R42A 4WU3A 5KOXA 3GJQB 1YJWS 4OZ5A 4X62J 1C0TA 1JJCB 1JXEA 2BE2B 1T05A 2MKYA 1MU2B 1HNVB 3M8ZA 3LQVA 1RBOB 2UXCF 1U0SA 3PTWA 4WCEQ 1DTQB 3L3CA 4IH5A 3JTNA 3M32A 5B0EA 3DLHA 1HMVA 2IMWP 2Y8YA 1IBLJ 2M4MA 4RUHA 1PBUA 5KG6A 1IKVA 3MMCB 1P9YA 3I4PA 4XTTA 4NXNJ 3OUYA 2AD9A 2RUSA 4DSFA 5J2NB 3KLGB 1U1NA 3K8VA 1TV6A 1R27B 1S1UA 1FNXH 1MLAA 1DY3A 1FERA 3IR5B 4M94A 3V81A 1HBOB 1S59A 3IRWP 1X4GA 4RBUA 4O3SA 4FBUA 4ED6A 2QE5A 4MFBA 1T3NA 1RT1A 1SJ3P 2JEFA 1S0VA 4J7CA 2NPIA 2DYAA 2BXJA 4KPYA 1FDAA 4HDHA 3HHLA 1DFDA 3LPEA 1RLDA 4EUVA 3UR0A 1W25A 4RNOA 1UL3A 2LDIA 2MZQA 5ETNA 4CO2A 4BC7A 1B0PA 2HBRB 1VLOA 3JAMY 3NS7B 4DPOA 2HQGA 4EYHB 2JWNA 3OTEA 2W4PA 2CPDA 3BGOP 3DFEA 1D0EA 4ZLPA 1WHYA 2ZH5A 4N8OA 1S1TA 2BJEA 4HACA 1RBAA 5DLGA 2CPFA 3OJUA 4HL9A 1FJCA 3TANA 2QG9B 1I51B 2ZJPQ 1N34J 1TL7B 2RH3A 2EK6A 2QLXA 2XZTB 3MM9A 2B9EA 2VFTA 3G86A 3M1VA 1B4SA 4BLGA 2IM1A 1OSDA 3KLIA 2I38A 4EEYA 4JI1J 3G71S 2HZCA 4F04B 3JQJA 1FDBA 4CLTA 3W5ZA 5HANA 4DF4A 1RTZA 3PFEA 4ZVHA 1MNEA 4CWBA 3NGUA 3AXMA 1LWCB 3Q8YA 2E7WA 2ZE2A 1YSJA 3Q0AA 4CYUA 5LSLA 1IKWB 2VQEF 3OR2B 2XMJA 4C7QA 4ECUA 2GVDB 5A76A 5A0YB 4PUOA 4UUWA 3CJ8A 5KG0A 4LF7F 5KT3A 1S1XA 2VQFJ 4I1TA 3IWNC 2IRUA 4I69A 5GAGU 4DV7F 4L74A 3B4MA 2UUAJ 4ZLLA 3ZFVA 1V5VA 3KG1A 3QIPA 1Q7YT 1SV5B 2P2CB 4RNMA 1XJWB 1UZDA 1GMWA 3HKZD 1RTDB 3CCJS 2VPZB 1XWLA 4ELTA 2CWXA 2YBVA 1HFEL 4YFUA 5KFJA 2ZKUA 1UZHA 1FVSA 3AQPA 2N7CA 3BREA 1S1VB 2BOAA 2V63A 2CA9A 1SJQA 3QGHA 4YR0A 1UEUA 4GO7X 3D6FB 1JKHB 5J1EB 3JAMU 3D3CJ 4IO9Q 2VDIA 3SSQA 1FTRA 4LSNA 5A6WA 2ZVIA 2HHVA 2UUTA 2GFFA 2C3UA 2O01C 2HHHJ 3GSIA 1QSSA 4NZ7A 4N76A 1HIYA 5IQ6A 1M1HA 2RUGA 3QT5A 1O0PA 3H42A 1FKAF 1X5TA 2GZOA 3DGVA 5GMDA 1RWMB 1X8DA 2L08A 3T5HA 4ZVUB 1Q7LB 2B9WA 3D4JA 5GAGI 1S6QB 3ONQA 2W2MP 1XTZA 1SKUB 3HHDA 2EC0A 3ET6B 1QVGR 1B0VA 2N3LA 4Q0BB 1KONA 3CCLS 1PYSB 4KFBA 3AD9C 2BE2A 1Q86T 1MU2A 2CPIA 4A46A 1KLMB 5E41A 1SKWA 1OYEA 2XULA 3CCVS 3OL8A 3NG8A 2OTLS 2AP6A 2ILYA 4K4XA 3MMCA 2VBWA 1RT3B 5LOQA 5CYJA 4B3OB 2XMUA 3ICLA 2RVJA 4C9DA 2DCLA 2FVRA 2XZDB 4B9MA 5J2NA 2YKMA 3MFIA 1AFJA 4ZK7M 4BCAA 2BA9A 5CCMA 4ES2A 3VVUA 1Q16B 1QUPA 4FKXA 4JI6F 2FDNA 3G82B 2BJ1A 2JH3A 3HZGA 3KLVA 3U1NA 4YS2A 5ETTA 3E8OA 2FIUA 2B8PA 4U7UD 3T41A 2E5HA 1BQNB 1FXDA 5IV3A 1BE4A 3PHEA 3AB2B 1U1RA 1U45A 2IY5B 2CQBA 1AA1B 2DHSA 2DGQA 2Z30B 2B6AB 2KH9A 1ZM2A 1LK5A 4ZVTB 4JI7J 3CJ5A 1U09A 2Y9HA 4F36A 5DQHA 1R8BA 3B82A 2ZH2A 2FLPA 3IXQA 2PT0A 3VGVA 3V4MA 2H3EB 3ADAC 3MUTP 2HMIA 3EM1A 1NZAA 3SYZA 4P2XA 2AYEA 2C2DA 4JBCA 4RR5A 2KM8C 1TAQA 3QJPA 4WIIA 3Q2TC 1NBEB 4O3OA 1CULA 3RJMB 4Y2IA 1P8GA 5CYMB 3TX8A 1UPMB 5HMZA 3DU6A 1R8PA 1TL7A 2D3ZA 4DV4J 1REVA 3BSAA 1TK8A 1WSRA 1TVRB 3R7BB 1BQXA 4Q7AA 1TL4A 3GQCA 1OS5A 2B5JA 3KK1A 4RW7A 2JEIA 3FK4A 1S1WA 3MUVP 1XMBA 2E44A 4OV1A 4ECVA 2BKPA 5KFTA 2R4FA 1T9YA 3NBPA 2QMUB 1IJFB 4WU2A 1RAGB 1LWCA 1H74A 4YY3F 3FC9A 4RL1A 4NRUA 1KRPA 4NRTA 3W8GA 3MPVA 2UP1A 5DQGA 1FKOB 1N5TA 2VPWB 2B4VA 3QRRA 5A0YA 3HSDA 3P8BB 4DSIA 3GG0A 4U95A 1OIAA 1U24A 4IG0B 3OQ2A 4P75A 2OD6A 3G8QA 2FY8A 4KGKA 4YB7A 3M2RB 1S0MA 4ENOA 4P71A 2X3DA 1FWLA 2HPUA 2G13A 3MI7X 3DKDA 2YWFA 4ZCIA 2HS3A 2W9AA 2CQIA 4Z7YA 1NXIA 3CDEA 3W2VB 4ZN3A 5IT0A 1RT7A 2RRAA 1T0TV 1HWUA 2J0SD 5HP1B 4KAIA 4YN3B 2Q3PA 2XI2A 2BQ3A 2L3MA 1U7LA 2GS8A 1RHRB 3THTA 2E5LF 1E6YB 2CG4A 1RT6B 2MLZA 1JLEA 2KHCA 4QIFA 3Q83A 2C22A 3PNIA 3UVJB 2R8GA 3R27A 1EARA 2NYHA 2ZBCA 1U0HA 4GRSA 4DUTA 3KUHA 5IS2A 4PQUB 4K4SA 2FLLA 3HX9A 4F3OA 2EI5A 3I0SA 3OPKA 2DR8A 4YP3A 2ZZMA 5KFEA 2I9SA 1A0OB 2QL9B 1Z2ZA 1Y3JA 2ROGA 3PW2A 3ET6A 3R6LB 3WHIA 2HVDA 2HIQA 4KYZA 4DV6F 2UUBF 1YDLA 4OZ3A 2BOPA 4AQYJ 4PG7A 1U2RA 2WBRA 3ISZA 1UVNA 4B3SF 3O3LA 5K14B 4A8QA 3DRSA 5DJBA 1U1KA 3RB4A 3PO5A 1QAIA 1WDDA 2XHCA 3N28A 1C1BB 2QYGA 2VFRA 1RWOB 1YJRA 1BUXA 3MEGA 1JLFB 2N82B 3Q8QB 3CDUA 4R25A 1Q95G 1FT8A 1ZTTA 3RAMA 1N8RT 4B9UA 2HHSA 1YJ7A 5L1JA 4CNYA 5U47A 2HBYB 4B3OA 3MEDA 2CJYB 1VQYA 3MOJB 4LSZB 3D3BJ 2HAIA 4JI2F 2HRTA 1G6BA 3BB5A 4LF9J 1GNKA 2PMZD 3G82A 5HVFA 3CJKA 2IM3A 4WFZA 1HHQA 2ZNYA 4HDGA 4IG3B 5D0EA 3MR3A 1NPRA 1BQNA 2QA4G 1ZAXA 1IWAA 3K5NA 3CMAS 2WONB 1O51A 1RUSA 2XNRA 3O8WA 2F4FA 1MWQA 1T02A 3CCQS 4NLRA 5IOLA 2J76E 3IP0A 4EMDA 1Y4ZB 3POTB 4UOGA 4ZN1A 3DC2A 1CJUB 4CIOA 4IO1A 4DCOB 1VQOS 2QC3A 2HNZB 3Q8VA 2ZUAA 4K4YA 1V3RA 2KYXA 8ATCB 2Z2YB 3ENVA 3FRYA 4NXMF 5DGAA 3KTQA 3HULA 1RZMA 3KHLA 1LWEA 2B9YA 4RW9B 3DLBA 4LFBF 2CPJA 4F0KA 2EKNA 2H65B 2ZBQA 3DRRB 1XMQF 3MR6A 4I6YA 4DV5J 3UCUP 2AZ1A 4WWSA 4X4QA 4LJMA 1IJEB 4C3MA 1BQMB 1EP4B 3OVSA 4N7TA 5DM7Q 1TVRA 2BE7D 4ZPTR 2CQPA 1MSWD 3MWBA 3HM9A 4W98A 3KHGA 2W9BB 2ASYA 4G1QB 3HD2A 3BH6B 4DFKA 4HTIA 2Y1RI 4HYKA 1GH8A 5I4MA 3KLFB 4K2JA 1WD6A 3CW2C 3AOBA 1RAEB 3LPYA 2Z58B 4LF4J 1YWXA 1IXKA 3OVAA 3GV8B 4KTQA 1S76D 1FKOA 2F9JA 2RDJA 3NWGA 4N8NA 4ELVA 4HTJA 5KT6A 3J80U 2XWYA 2C2ZB 2AZ3A 3FRZA 4DUZF 4IG0A 3QLHA 3JS9A 1P6TA 1SL0A 3UQSA 1R8CA 2WB1D 3H8YA 1CJKA 3FQLA 3FSYA 2F63A 1LKZA 4P74A 1ZPWX 2H9ZA 4DUYF 2E66A 2KN4A 1PYTA 3AT1B 3IC1A 2HQ3A 1R7IA 5CHCB 2V4JA 1AUSL 4ED8A 3C15A 2BANB 2HS4A 4NZ6A 3K59A 2OAUA 5C24B 5C42B 1NK5A 3OL6A 4BHQA 1UMJA 2F40A 2YTCA 2XI3A 1E6YA 4NYZA 4DV2F 1SVDA 4IFYB 3I82A 1GTEA 2AJ0A 2MSSA 3MXHP 2P8IA 3UVJA 2VICA 3KJNB 1KTVA 4TLQA 4OI4A 3W2WA 4PQUA 4KGZB 2DH7A 4WFAQ 2RU9A 2Z57B 2PI4A 2R7UA 4P10A 5D77A 4NCGB 2HFOA 2LU2A 3OV7A 1PKUA 3Q8PB 1CLFA 2OKQA 5HMXA 1H7WA 5D4PA 1N4LA 4ZVOB 1UFLA 2CVEA 3RBZA 4IDKA 1WC6A 3QYYA 4DL4A 1C1BA 4WZQA 3R5BA 4N41A 1HW9A 2ZM6J 2OSQA 4X2BA 5FIIA 2YKQA 5LL6d 5BYQA 1VBYA 2H51B 4WKYA 3AD8C 2GAGC 2JFDA 2RD5C 4RW4B 5D3GB 5IQQA 1RWWB 3LUYA 1RAOA 2YY3A 2CQHA 3PG9A 2P9CA 3KWMA 1Y7PA 2XS7A 4ZPCA 1NK4A 2F4VJ 3KJFB 4RO0A 3OR1B 1B99A 2MMYA 1FWKA 2A3JA 3BS9A 1QSYA 3WIVA 3D0IE 4ANCA 3KJVB 1XBWA 1GFWB 3IA0A 2V4RA 2DCUB 3S8SA 2R7OA 3N6LA 4Y2KA 2MB0B 5KFDA 4DL3A 1F2GA 4O0IA 3GV7B 1Q4RA 2N7YA 1NK9A 1WEXA 4FYYB 3Q2SC 3HLUA 2W7AA 1O5JA 2MLXA 4I2QB 3US5A 2YNFB 4KV8A 3ILLA 5IT9U 4C8MA 1RKIA 3CC4S 2JHEA 1KP6A 1HHTP 3BGFA 2YKNB 1FRIA 1CJUA 1CVJA 2CYYA 1KFSA 2HNZA 1M5OC 2DY9A 2GIRA 1UJ4A 5CH7B 1JJ4A 1S99A 1XR7A 1JX4A 1NKCA 4ZCMA 1QE1A 4DR5F 5LMNF 3MEEB 4FF1A 3BGRB 4QIGA 4LF5J 1M0SA 5FLXY 1UEKA 2MKSA 4OZNA 3NAHA 2XCAA 2V8PA 1RAFB 2ZKTA 2V2VA 3C2PA 2C1EB 2HGLA 4RNFA 1RA7A 3A8IA 2VD3A 2FLNA 2ZBIA 1AROP 4ECWA 4X4SA 1RTIA 3HJFA 4ERDA 4DQIA 2QLWA 1C2PA 3DOKA 1L3SA 3MM6B 2W9BA 4M63A 1DRZA 1UFWA 1WEZA 1CS4B 1RKJA 5KOWA 1IBMJ 5E3CA 4WBFA 3NCQA 3TZXA 5EX3A 2X1FA 1X5OA 4FP9A 2KM8B 1BGXT 1SIZA 4X62F 3G2XA 4CH0S 2GVZB 3PFOA 4Y34A 3CGIA 2C2NA 4GVBB 2UXDF 3OD2A 4O3NA 4CO3A 2J9EA 1HNZJ 2CQ4A 2GMHA 1N33F 3Q23A 2XMWA 5C2CA 1TKTA 1RI7A 2FVSA 1BMQB 3EVOA 3TEGA 2J6UA 2VJUA 1YIJS 5H9EK 4B9LA 3BO4A 1Q8KA 5HVHA 2L9DA 5DLFA 4F4ZA 3ENAA 2IVMA 4AE5A 4NXNF 3MMAA 4OJ3A 2OPRA 2DNPA 2EFPA 4C0HA 2GGPB 1CJVB 2R7QA 1J5EF 1UPPA 3SV3A 5F8IA 1XNQF 2HFSA 3IN5A 3I0RB 5EWGA 2VG7B 2YH0A 1TP7A 5HAOA 1Y00A 5C24A 1LV5A 4KY3A 2YQ1A 2CPHA 2V69A 2CQ2A 3W66A 9ATCB 3QGIA 5D8HB 2W4CA 2LQ8A 4IFYA 4K4ZA 2LP4A 1FK9A 2XMMA 4FKYA 2CFXA 1WOOA 3ILJA 3TZZA 5FLXU 5DRKA 4B3RJ 3DCAA 3UDLA 2GAHC 4AFFA 2MDAA 4ZKAA 1VJWA 4AL6A 4K59A 3B78A 4UOHA 4GKJJ 1B70B 2MHEA 2CQGA 3L4BC 4ZP8A 3PIOQ 4X64J 4OIXA 1OQ6A 4UQTA 4QWBA 2ASJA 5BJRA 1N6QA 3DLLQ 3BR9A 3RG6A 3BKUA 2HGNA 4LSLB 1GMUA 1N34F 2ATCB 4KHPF 3TAMA 3F73A 2LEPA 3KFWX 5BYSA 2E9TA 4JI1F 3FEXB 3IG1B 2ROEA 4CTAB 4USTA 4I7FB 4CDIA 3P6YC 3N79A 3TAPA 4RW4A 1DJ0A 5HVGA 4IH7A 1GEHA 1HPZA 4H4KA 1NLKL 1M90T 4G6VB 4P2MA 2J0WA 5HLFA 3QQCD 5DZ7A 4ED7A 1KQSR 1N54B 1V9OA 4YDXA 2WVBA 5T7LA 4YB6A 2GV1A 2WK4A 3IO1A 1U1PA 2E29A 4DCJB 5A8KA 2AU0A 1X4AA 2QTWA 3GCXP 4O3QA 1FEEA 2RKIB 4C2MA 1N56A 3FFIB 3EPIA 5HQMA 3AH6A 2VQFF 4EZ6A 2Z2MA 1HNXJ 3KLHB 4I2QA 1IKXB 2YNFA 4LR8A 2UUAF 1CPZA 4FYWB 3HHLC 3VGUA 3A3NB 2PFFB 1XR5A 5F9LA 3I6PA 3EXCX 2AW0A 2YKNA 3GONA 4QOTA 2NREA 3MPDA 4TN2A 2BJDA 1HKAA 4G1PA 1JLCB 1YRTA 4ZCKA 3HDSA 2I6WA 1N32F 4OYXA 3ELHA 2G0CA 2HIYA 3EGVA 3DM2B 4ANDA 2E9ZA 5H9EJ 3A8KA 3EDRB 3MEEA 4KIAA 3BGRA 3QT6A 6FDRA 4USMA 1TMJA 5KFWA 5F3TA 5SZTA 5LSRA 3H5XA 2FYXA 4F4KA 5IC4B 2OPQB 3T1HJ 2FZKB 3PX6A 1F5AA 3QWUA 4PXBA 4ED3A 1U26A 5KT2A 3TA0A 3BR8A 3G6ES 1J2VA 4A4JA 2D74B 4J9PA 1ZA1B 2EBGA 2WSCC 2PDAA 3M8SA 2JLFA 3D6TB 4YR2A 4M95A 1KD1T 1J5OB 3TA2A 3BBFA 1RADB 1RTHA 4NLQA 2HZVA 3MGJA 4X66J 2PMWA 1C0UB 5D4LA 2UUCJ 4LR7A 4USWA 2M5YA 1M5SA 3UD3P 2ZJQQ 4MKYA 3NGDA 1Y5NB 5CCLA 2GVZA 3R1LA 1PAUB 4Q2LA 2XSFA 1F5CA 2IDEA 2W8KA 2P6TA 4Q43A 3KLEA 4EZ9A 2J9DE 4X4VA 3GE9A 2EKYA 3FZ2A 2QLFB 3G87A 1YZ7A 1FNMA 1CEZA 4KO0B 1HARA 3QAEA 4C8YA 3B54A 3V4IB 1T9WA 1WOPA 2AT1B 2DNHA 3TI0A 4C11B 5C25A 4ECTA 4DPWA 4IFVA 3UDCA 2O1PA 1CJVA 2YWWA 3CUNA 5IFMA 2CNOB 1JQGA 3LALA 3QT7A 2GO9A 2VG7A 3QJLA 4KHRA 3QIDA 3CO0P 4ZPBA 4E0DA 5J2PA 1KN6A 3C6TA 4DHVA 3PKMA 5KFUA 5M2PA 1X4FA 1UEVA 2QRRA 3TEHB 1ZM4A 3BJYA 3DLEB 4OHZA 2IVYA 3S01A 2JDJA 1HW8A 2AF6A 2HWIA 2ZH9A 5J2MB 2DD8S 3ZC4A 1RDRA 1EAYC 1D3WA 4F0HA 3E01B 3DXBA 3ZZOA 1VRUB 2DH9A 2OH2A 4DSLA 1EZZB 5KT7A 4FNIA 1ULRA 2R8KA 2FHMA 5EGYA 2OSRA 4USHA 2V9KA 4MK7A 3OFFA 3CB4A 5ETPA 4OLPA 3MAQA 1XEZA 4J90A 5A6PA 5ETRA 3FZBA 3D0GE 3T9ZA 2NSBA 4OHXA 2CPZA 1WI6A 1OPIA 3FBEA
chains in the Genus database with same CATH topology
3M2UA 3K5PA 5LJ5Y 4EBEA 4DLGA 3HKZD 1YRUA 4J9LA 1RTDB 4QR0A 3CCJS 3CC7S 3OXFA 4M5DA 2VPZB 2WSEC 1XWLA 2O3DA 3JSMB 4ELTA 4O44B 1B0TA 3MM8A 1HFEL 2HFNA 1WELA 4YFUA 3FMBA 3M30B 5KFJA 1Y9OA 2ZKUA 3J81Y 1FVSA 4FXDA 3GMGA 3RR7A 3IG1A 4I7FA 3AQPA 2N7CA 2CVIA 5D78A 3BREA 3OFHA 2WAQD 3VWSA 2EVZA 3ITHB 2KDOA 1S1VB 3DNCA 2DGVA 1Y0HA 4DFJA 1SJQA 2RF2A 3QGHA 3GYXB 5E3AA 3FNNA 1UEUA 4YR0A 3T9NA 4GO7X 2RRNA 3M9MB 3NCRA 1JKHB 2M9KA 5J1EB 3VAGA 2AYBA 1NHUA 3NS5A 1K9MT 1VRTB 1RP5A 5AE3A 5KT5A 1WHXA 2PIIA 3MTJA 4IO9Q 4TLRA 3SSQA 3MUMP 1YHQS 1QY7A 2YWHA 1FTRA 4LSNA 1LW2B 3T19A 1NK7A 4OHYA 2W8LA 5A6WA 2EG1A 2HHVA 3HFKA 2UUTA 2UXBF 4KV8B 4DQPA 1P1LA 1C4AA 2GFFA 2C3UA 2RE1A 2Q79A 3WC2A 2R2SA 4URQU 4MAKA 4O3PA 2O01C 4HT5A 1UJ6A 3N4WA 2D41A 2DHGA 3TVZA 2MQMA 1QSSA 3B4DA 4NZ7A 4N76A 4TNOA 3RAQA 2BANA 5IQ6A 3HPOA 4L3NA 2XCPA 2XNQA 4Y2MA 2GQ2A 2RUGA 1O0PA 2OMLA 4UUXA 4HH1A 1FKAF 1X5TA 5C42A 5KG7A 2BV3A 4OFZA 1S6OA 3JYTB 2J5AA 1RISA 1X0PA 2FJWA 3ZZTA 3HXMA 1OO0B 1X8DA 1X5SA 3FEYB 4FVCA 3FFIA 3C66A 2L08A 4Y2CA 2VZ9A 3MCSA 3T5HA 3CT9A 2MHNA 3DRPB 1Q7LB 2B9WA 2IC3B 2UVWA 1FCAA 5GAGI 2B7BB 1S6QB 2YWKA 3ONQA 4OZJA 3KLHA 1T03A 1QE1B 1QAYA 5GMKa 2MXYA 4HHJA 1XTZA 3HHDA 2EC0A 4YUDA 1QVGR 1B0VA 2N3LA 4OX6A 4Q0BB 4DR1F 1KONA 2J7WA 1V6HA 4HT7A 1NH8A 1WF0A 4TYAA 3CCLS 3BQ1A 2VONA 3MAHA 3LP1A 2D7SA 1YJTA 5L38A 2COLA 3TARA 1KOHA 2QV6A 5HROB 2PO4A 4URSA 1Z1ZA 2RNEA 4ZMMA 2EW9A 4KFBA 2F8EX 1TL1A 4UQGA 2BE2A 2HLTA 1Q86T 1MU2A 4ECXA 2E5JA 2LU1A 4NLUA 4LFAF 2MQOA 2VG5B 2CPIA 2K8GA 3HHKA 2ZC3A 4CO5A 4NYPA 4A46A 1NH7A 1KLMB 4ALZA 3RBDA 5E41A 1GT8A 2Z8QA 1SKWA 3RU0A 3DM2A 4Q5VA 3QGGA 1RK8A 4AL7A 1QM9A 3AA9A 1RTIB 4ED1A 1TUVA 2NQPA 2XULA 2C3PA 1R0AA 3CCVS 4L6V3 4NCGA 3RYLA 5HQ8A 3OL8A 3NG8A 3N5FA 2VG6B 5L1IA 4DDFA 2OTLS 5I42A 1HBNA 3DOKB 2DO4A 4NCAA 2AP6A 5B0GA 2ILYA 4K4XA 2IHR1 5GVQA 3M05A 2BDPA 3MMCA 2ZH8A 4XO0A 2VBWA 1RT3B 1MROA 4RW6B 2OPSA 3CCUS 4F67A 3PO4A 4QW9A 1CC7A 2B3TB 2P9GA 2WHOA 3BGUA 2UU9F 5CYJA 4B3OB 4WYLA 3V5RA 2XMUA 3ICLA 2RVJA 2V0NA 3AQOA 4C9DA 2DCLA 3D2WA 2M7SA 2FVRA 4F2RA 2A2DA 4B9MA 3NL0A 2ZNZA 1WG4A 5J2NA 1UVKA 2YKMA 2JLGA 3DLGB 3MFIA 4KJIA 4ZK7M 1AFJA 2PGCA 3V6DA 2DGXA 1UVIA 4BCAA 2BA9A 1YG0A 4R8UB 5CCMA 1JNRB 4ES2A 4RNHA 1Q16B 4OI2A 1JLBA 1QUPA 4JI6F 2FDNA 2XC9A 2XGPA 5B08A 3P49B 5CXTA 4HI2A 5B0CA 1I6JA 2JH3A 2KG1A 3HZGA 5AXKA 1LK7A 3KLVA 1NKBA 3U1NA 3M6WA 4F50A 3VALA 1DQ8A 5I3QA 5F41A 3RW6A 3FDSA 3E8OA 2FIUA 2J8AA 2HHWA 5MLCV 1ZZFA 3GR1A 1VK8A 2E5HA 1BQNB 1FXDA 3WDOA 1WF2A 2KFZA 1UVLA 2RSQA 1H6KX 1KHWA 3PHEA 3AB2B 3VAHA 1U1RA 3HZEA 1U45A 5IM0B 1TKTB 2VKRA 2CQBA 5D3GA 2F8MA 2J0XA 4FVMA 2W7PA 2I0XA 4B3MF 3OLBA 3IWXA 2BACA 4DR6F 2FJAB 4OQJA 2DHSA 1IR0A 2DGQA 4NLTA 4DQSA 2B6AB 3IAS9 4NL5A 4U7CA 2XHWA 2XLJA 1C0UA 5CZVA 5AXMA 2KH9A 2HRYA 2PC6A 2O66A 1D8ZA 1VMBA 4ILLA 1WEYA 1HBUA 4Q8FA 1ZM2A 1LK5A 1G2EA 2R7VA 4DJBA 4LF5F 3OR1A 1IM4A 1VQLS 3CJ5A 4AQYF 2YNHB 1QVFR 2JC1A 1U09A 2AJQA 1YGYA 3IS9B 2DNGA 5G0RB 5H1SV 4N5SA 3KJVA 5DQHA 3KHHA 3MMAB 1R8BA 5AXNA 5I3UB 4EYIB 2OPRB 3GYNA 3B82A 2ZH2A 2FLPA 3EX7B 4RU2A 3IXQA 2PT0A 3NP5A 2BYCA 2FJVA 1HNWF 3V4MA 1TKZB 4EFAC 3E3XA 5EUHA 2K3IA 3I9V9 3PW0A 2ALZA 1K8AT 3IRXB 4IOBA 1QUVA 1T95A 5KFIA 3U02A 3NNAA 1FEHA 1R8AA 5DO2A 3OFGA 1V3SA 4OZ0A 2ZHAA 2BABA 3CO9A 3MUTP 2HMIA 1NZAA 3FVYA 4C98A 3SYZA 4OLOA 4KO0A 1Y5IB 5J1NA 2CIMA 3GWCA 1I1GA 2AYEA 4A8XA 2YKOA 2C2DA 4JBCA 4UOCA 1Z2LA 2KM8C 4QU6A 1RT4B 4MYUA 4K0KF 3UNGC 3HVTA 1TAQA 4WXWA 2KG0A 1YITS 4QR1A 2ZD1B 1APSA 1AW0A 3QJPA 5T14A 4HKQA 2KRRA 4WIIA 4LF8F 1RQ0A 3Q2TC 4GO5X 2LXFA 4Y65A 4O23A 4O3OA 2R8IA 3VAFA 2L9WA 1VC0A 3ENQA 4QWEA 4Y2IA 1JJ2R 1P8GA 1YBAA 2CPYA 3K5LA 5CYMB 3TX8A 2LA6A 1TFYA 1S4FA 1BLUA 1DQ9A 1NK0A 4WFXA 2OP5A 5HMZA 2DRAA 2J6TA 5FDLB 4LF9F 3DU6A 1R8PA 2HWHA 1VQ4S 3H4BA 4F25A 2D3ZA 5DG7A 2HHQA 1FK9B 5EN1A 2J9CA 1REVA 2ABYA 3H2VE 3SDEB 3OSPA 3PRDA 2C2RA 3DHWC 4H4OA 4CO4A 3CCSS 3BSAA 1TK8A 3SCLE 3H4DA 3D1HA 4O4GB 1TVRB 1HI1A 1UJ5A 2R8HA 1BQXA 4Q7AA 4TQSA 3THPA 1TL4A 2DNRA 5KG2A 1MWZA 2GNKA 3GQCA 1SH3A 4Y00A 1HNZF 1OS5A 2B5JA 3KK1A 3OL7A 4RW7A 1NAQA 1JLGB 1UWBB 3AJ2A 3C8YA 4PPZA 2WOMB 5DM6Q 3SSSA 2JEIA 1S1WA 2FHJA 2L9NA 2O67A 3MUVP 1XMBA 3AJ1A 1MMLA 1JLAB 2A2CA 3CJ3A 5E2QA 1ZETA 2ZH7A 1S49A 2E44A 4OV1A 4ECVA 5KFTA 2R4FA 3DRYA 2ROPA 4DL2A 1KFDA 1UW4A 1YRXA 3NBPA 1FDDA 2LECA 4LF6F 2HGMA 3PEHA 1IJFB 1LFWA 2IBOA 3X3UA 2DR7A 4WU2A 4ELUA 4ED5A 5IZHA 4N47A 5E7OB 3R5CA 3TRGA 1LWCA 1ZM9A 2C3MA 4KHMA 3O6QA 2MGZB 1HHSA 2JOQA 4P2SA 2W7OA 4YY3F 1F60B 2KVIA 2OFHX 1FA0A 1HL6A 2BR0A 3DXSX 3EGZA 2HVZA 1R89A 2OLWA 4NRUA 1KRPA 2NS1B 4NRTA 4DEZA 3MPVA 1N6QB 2KO1A 2UP1A 2LEAA 5K8PA 1YJNS 5DQGA 2M70A 1X4HA 1FKOB 1N5TA 2QA2A 2VPWB 5E3RA 3E01A 4DV1F 3JTPA 2B4VA 4ZPVR 1FHTA 2VBYA 2AGOA 1OQ3A 1VRUA 5A0YA 2CPEA 3MM6A 4IH6A 4C3KA 3UCZP 1TK0A 2YX1A 4DSIA 1S9EA 5A8RA 3GG0A 2IYGA 3L95X 3S1TA 2R2TA 1XC9A 1H2VZ 2LVWA 4FNHA 1TKDA 4YQWA 1OIAA 2QIFA 1U24A 4IG0B 4NZ0A 3TAMB 3OQ2A 1VQMS 2XWXA 2OD6A 2ZH4A 2HFZA 4ZP6A 4URGA 3L7PA 3BO2A 2FJEB 2R7RA 3MMBA 3G8QA 3UR3C 3CCMS 2CJBA 4KGKA 4YB7A 4EO6A 4PR6A 2BM1A 5DG8A 3UE2A 1FRXA 3M2RB 4BWJA 3M8QA 1S0MA 1SB6A 2MSTA 2NSCA 2LCWA 3VZIA 3GIKA 2NLWA 3O2IA 1FD2A 1P27B 1JJHA 2HPUA 2DGWA 5G4DA 2G13A 3K58A 1HPZB 2J9DA 2M3DA 3MI7X 2YWFA 4ZCIA 4X4PA 2HS3A 4P6QA 4ITSA 2VOPA 2W9AA 2CQIA 5F0WA 1Z4UA 3C6UB 2AJ4A 1XR6A 2V9WA 3CDEA 3W2VB 3E2EA 4Q8EA 3TQ1A 1KOOA 3GSDA 5IT0A 3KK3B 3K0JA 2A10A 4LIWA 2ZHBA 1S7HA 3JSMA 5HLFB 2VPXB 3OLAA 1VIXA 3MECA 2GO8A 4XPCA 3G9CA 5KT4A 1IN0A 3LWLA 2KXFA 2DNOA 4D3HA 3IR7B 4DOZA 3I4HX 3EZ5A 2B9XA 3AAWB 2GX8A 1RT7A 2M2BA 2RRAA 3G8TA 1HWUA 2J0SD 5HP1B 2LDYA 4KAIA 4C0BA 4WZMA 3EZUA 5T7LB 2MJNA 1ELOA 3Q8SB 2Q3PA 3ITHA 3TNVA 4X65F 3A8EA 1G3OA 3OSNA 4J9OA 3U1MA 2E9RX 1FRHA 2PI5A 4QZVB 2XI2A 2BQ3A 2L3MA 2JZ5A 4DL0C 5A8KB 2QA4S 4ECZA 1AUDA 1U7LA 2DPJA 1S48A 1PC4A 4DSEA 3THTA 3KOAA 1RT2B 2JJ4D 2E5LF 2QO3A 3FCHA 1U2FA 1E6YB 4NA3A 3RAXA 2HQIA 2OFGX 4YR3A 2CG4A 2CQ0A 3LAMA 1RT6B 2GGPA 1JLEA 2DGUA 4I0WA 1SKRA 2HW3A 2DRBA 2KHCA 5KG5A 4B08A 4C8LA 3M6XA 4QIFA 2PN6A 2R8JA 3GIIA 3T1YF 4I2PB 2XBPA 2XMTA 3FJ2A 5AXLA 3K5MA 4LF4F 1TR0A 2QZ8A 2F8HA 2EK1A 2XY5A 2C22A 1L3UA 4DR4F 3N9UC 3U1LA 3I0RA 3PNIA 1X4CA 1JXLA 2WW8A 3RB0A 1FF2A 3D54A 1MWYA 4NA1A 2CJKA 3LANA 2EFVA 1SL1A 2I8EA 2R8GA 4UY8T 2XZWA 2KFYA 2X51A 3R27A 3CCRS 5E0OA 3P5TL 2ZBCA 4K4TA 3H40A 3R1HA 4XK8C 4CI0B 4LFCF 3JYTA 2P6SA 3BSOA 2GQCA 1S9GA 5IT4A 5IS2A 4PQUB 1M1KT 2F7VA 5KG3A 4X84A 4K4SA 2FLLA 1HYSB 3HX9A 2VH7A 3T6JA 4F3OA 1FVQA 2EI5A 3I0SA 2HS0A 2ZVSA 4TY8B 3OPKA 1N0UA 3TAQA 1R6YA 2DR8A 2HLUA 2IC3A 4DR3F 4YP3A 4DLEA 2H5EA 2ZZMA 4LQ9A 4NLPA 3GZ7A 5KFEA 1D1UA 2I9SA 3M32B 1HNIB 1Z2ZA 1Y3JA 2ROGA 3PW2A 2IYIA 2JEJA 2D3OR 1U49A 2BM0A 2IFXA 2AGQA 2DGOA 3G6VA 5KTQA 3H2UB 2HIQA 2X1GA 1BD6A 1QAJA 4DV6F 2UUBF 2BOPA 4V19J 2FHOB 5A8WB 4B9TA 3N5BA 2VBXA 4MTPA 4PG7A 4B9VA 1NHVA 1U2RA 3OUYB 2WBRA 3ISZA 1IBKF 1UVNA 2ZDOA 3TUZC 4B3SF 2DBBA 3O3LA 5K14B 4J9NA 5DDQC 3CJ0A 4A8QA 2HNYB 2E5GA 4PQAA 5CD4H 2QMXA 3DRSA 5DJBA 2JFKA 2VV5A 1U1KA 2J0QD 3CD6S 3RB4A 4ILMA 4NMLA 3RBEA 4WK3A 3PO5A 2AYMA 3K57A 4DG1B 1S0OA 1TV6B 1QAIA 3N28A 1C1BB 3KNAA 4Q45A 1NU4A 3IAM9 5IXUA 2AGPA 2VFRA 4DL7A 3NS6A 1YJRA 4WJBA 3Q24A 2ILZA 3ZZ0A 5EWEA 2Q6BA 2ZDPA 3MEGA 1FD8A 1JLFB 4JV2A 2N82B 2I5JB 3Q8QB 2PMHA 3CDUA 4R25A 5H9FJ 3BO3A 5B09A 4CH1A 1FT8A 1ZTTA 1M5KC 3RAMA 3V81B 1N8RT 4XAKA 4B9UA 5I3PA 5HMYA 4F4XA 2HHSA 5L1JA 1RYSA 4ZPAA 1H2UX 4RW6A 1X4BA 5U47A 4CNYA 2VFVA 3V6HA 3EYZA 3G8SA 2K1RB 4O3RA 2OO4A 2MZSA 5F3ZA 4B3OA 3MEDA 4MFBB 3DLKA 1SUQB 4DMZA 4OI1A 1VQYA 1SJRA 1RT1B 1IQTA 2KFNA 3DLJA 3MOJB 1VBXA 3CD7A 1RTHB 3T5JA 1SH0A 4LSLA 5K8MA 2HHTA 2HAIA 1U48A 1V3ZA 3SCKE 4JI2F 2DT9A 4DV3F 1G6BA 3BB5A 1RTJA 1T8EA 3C3LA 2IRXA 1RT5A 1GNKA 3I32A 2PMZD 2DNNA 3HP6A 4D3GA 4JV0A 3CJKA 1TK5A 4A8WA 2F3JA 2IM3A 4WFZA 3BSNA 1HA1A 2JL9A 2ZNYA 2HG4A 4HDGA 1U6FA 4IG3B 1E6VA 3HHLB 3WX4A 3MR3A 1VQ6S 4CTAA 4FF4A 1BQNA 3KLEB 3QPIA 4RWWA 2CQCA 4A8KA 2QA4G 3NNHA 4NLGA 3N0VA 3TW0A 1F9FA 1ZAXA 5IM0A 2G4BA 2C42A 2MZJA 2IAJB 2KI2A 3K5NA 1KLNA 1C1CA 3CMAS 2WONB 1H2TZ 3QO9B 1GXLA 1O51A 1VQ9S 2WTFA 1IBLF 1VHFA 3PY8A 2CJQA 2XNRA 3PR5B 3PV8A 2UV8A 3BM7A 3O1LA 3O8WA 2N3OA 1PC5A 1T02A 2P9EA 1F5BA 2YNHA 5E33A 4O4RA 3IS9A 4TYBA 3DDKA 3CCQS 5C25B 4NLRA 3CTRA 5G0RA 1S1TB 2LQJA 3WC0A 1FRMA 2CJAA 2J76E 2DO0A 3SQGA 1WACA 1O8BA 1Y4ZB 4IFVB 4NPOA 2IJNA 2V4QA 1TZ0A 3V6JA 3T1HF 1HQUB 7FDRA 4KBIA