4P7VA

Structural insights into higher-order assembly and function of the bacterial microcompartment protein pdua
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
86
structure length
86
Chain Sequence
EALGMVETKGLTAAIEAADAMVDSANVMLVGYEKIGSGLVTVIVRGDVGAVKAATDAGAAAARNVGEVKAVHVIPRPHTDVEKILP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein, electron transport
molecule keywords Polyhedral bodies
publication title Structural Insights into Higher Order Assembly and Function of the Bacterial Microcompartment Protein PduA.
pubmed doi rcsb
source organism Citrobacter freundii
total genus 20
structure length 86
sequence length 86
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2014-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00936 BMC BMC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1710 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4p7vA00
4OLOA 3PACA 4QIEA 4QIVA 4P2SA 4OX8A 3CGIA 3I6PA 3I96A 4LIWA 4OX7A 4QIGA 4QIFA 4RBUA 4DDFA 2A18A 4OX6A 4OLPA 3NGKA 3SSQA 3SSRA 3VCDA 2G13A 2A10A 3BN4A 3MPWA 5DJBA 4PPDA 3SSSA 3DN9A 5L38A 4P7TA 3IA0A 4P7VA 3H8YA 4RBVA 3DNCA 3NWGA 2EWHA 3MPYA 4RBTA 3CIMA 4AXJA 4AXIA 3N79A 2A1BA
chains in the Genus database with same CATH superfamily
4N76A 1S6UA 1HLWA 1RAGB 4Z7YA 4DQPA 3F44A 2AYGA 2M2BA 1KQGB 1AW0A 4X4RA 3VWSA 3I0SA 3MM7B 3KJNB 2BW2A 3GB0A 4F25A 4ZLNA 5HROA 1XMOF 1L3UA 2FQQB 3C3LA 2W2PP 3VCDA 3CJKB 3O1LA 3CD6S 3IMQJ 2Q43A 2JC1A 1AZSB 2EW9A 1NXIA 4PR6A 3KYLA 2HFNA 2W01A 1V5IB 1UA0A 5J2QA 2DHXA 4DR4J 2MTLA 3H2LA 1LWCA 4ZCKA 2OPRA 4USUA 4NWBA 2DEJA 5EX3A 4Q8FA 1N0VC 1WC6A 1HWJA 3BGRA 2IM2A 2HHPA 4JI3J 2W7PA 2QA2A 4DPWA 3MFIA 4U95A 1JLCB 4BC9A 3R5GA 2VJVA 4NZ6A 3EJMA 4QZVB 3BJYA 5CZVA 4RKUC 2LQ8A 1UFWA 3G71S 1D0EA 3OUYB 1IKYA 2HWTA 3A12A 2JEIA 3CXCR 1IR1A 1RU2A 2A18A 3SEOA 1R6YA 1SL2A 2C42A 3UR3C 1SV5B 4IH6A 3QYYA 3OR1B 2D3OR 2OFHX 4MK8A 3V6HA 4KE5A 4LFCJ 4B3SF 3LWMA 2XTJP 3JSMB 3K5PA 4YR2A 5LM7E 1XERA 4HVZA 1VS3A 4F7VA 2FHJA 2ZBQA 1KDNA 3MD3A 2A10A 4WZMA 3OTDA 3DRXA 2B43A 1NH7A 4R5PA 3MCOA 2HZVA 4B9NA 4C3LA 3RBEA 2M70A 4EYHB 2D1CA 4N8OA 4PWDB 5IC4B 4F50A 4U6PA 4P7TA 2ZM6J 2G9OA 5A0YA 2YTCA 3IGNA 3KK2A 4H4MA 3MAQA 1N8RT 4IRDA 1XQIA 3JYTA 4NLYA 4PXBA 2XYHB 5B0AA 2HS3A 3GFXA 4FPIA 1R8AA 4TU9A 1ZPWX 4DN0A 5HQ8A 1X0PA 1VIXA 1N6QA 3WBZA 4Y28C 2WTFA 2V63A 4M5KA 3R5CA 4ZS6A 4YY3F 2YKPA 2IRYA 5KFGA 4KGKA 3BGLA 1YWXA 4XDCA 2RUSA 3WIUA 5BYRA 5H9FJ 3DLEB 1SPBP 4O44B 1X4HA 3A8KA 1WDDA 3J7A1 1B64A 3B4MA 3DI6B 2E5LF 2KJWA 1NB2A 3KMQA 3KLFB 2Z4PA 1D9AA 3FEZA 4URSA 3CC7S 2J0QD 4JI1J 1FWLA 3DLKB 2V4QA 2AF6A 3H40A 4FBTA 3K2YA 1TUWA 2EFGA 3ZTSA 3AD8C 3HVTB 3MZIA 4ID8A 4UY8T 3BPSP 4LBHA 2FDNA 4M95A 2HHSA 1DTQB 3EE3A 5F8IA 4YR0A 2GA7A 4UOGA 1NJZA 2C2OB 1KEKA 3CCUS 5BJRA 1UJ5A 1J5EF 2VONA 4M1KA 4KTQA 4ILLA 5GMDA 2OMOA 2KH9A 2MY8A 2JC0A 3FSIA 3CDAA 2UVWA 3W65A 2LMIA 2PSZA 2RVJA 3SSQA 1T94A 3D1OA 2R8IA 5K20B 3QT8A 1N4LA 1CG2A 3NNHA 4AD6A 2R2TA 1JLCA 1GQEA 1RAEB 4DR7J 3LW5C 1U24A 4OYPA 5DO2A 3OUYA 2AX0A 1ZZFA 1Y5NB 4PYAA 4UTGA 4OYMA 5D4NA 2CJXB 1U6ZA 4HH0A 2XCAA 3OR1A 2F3JA 3AOAA 1ZAXA 1IUJA 4Z2XA 3PW5A 1VQNS 3PYEA 4OYXA 3TAPA 4NCGB 1DAXA 3CIMA 2EC2A 3H5YA 1KWMA 2HBYB 1SH0A 1O0PA 2IBOA 2QO3A 3M7VA 1EQMA 4ZHRA 3GR0A 3CCQS 4F3QA 4KGMA 2KYZA 4X4PA 2UUAF 2YWKA 4LFAF 2KXFA 4PWDA 4JI5J 4MAKA 4ZVRB 3THVA 2WBMA 3K5NA 1V3SA 3GSIA 5D3GB 4BLGA 1IBMJ 2EKYA 3K8VA 5LT5A 1UETA 2B0GA 4ZJOA 5IQQA 3BSCA 2XI3A 1UVJA 1RT2B 2BRKA 4TNOA 4WE1B 4W4MA 4RUBA 3G86A 4F2RA 2XB2D 2CQBA 2DK2A 1WD6A 2VOPA 4OZLA 1Q0NA 4X2BA 5DJBA 3ISNC 5DGAA 1L3VA 5B0EA 3BQ2A 3TAMB 3ENQA 1TELA 3DLEA 3L7PA 4O44A 3VGUA 5KFJA 1Q4RA 4NLTA 2F4VF 3R7SB 4KGVB 1IKVB 4RNFA 3KLFA 1HARA 2M52A 2RU3A 1UJ4A 3DLKA 4EEYA 2VZ9A 1RHQB 4TKTA 3CB4A 1TFYA 3DLJA 3BGUA 2ZH8A 4DF8A 1OMSA 3HVTA 4X4SA 3VHQA 2OPSA 3ILOA 4X64F 1I94J 2H5EA 5C2GA 1J5OA 3FSYA 3W9IA 3L7OA 4EFAC 4B3MJ 4U7UD 3H2VE 2DY1A 1YGYA 5HQMA 4OZ0A 4CWBA 1C4CA 4LF5J 4A8WA 3WC0A 2WCXA 2GO9A 2JH3A 1PYSB 1X4AA 5L8RC 4AE5A 2ZBIA 2WVCA 2FHOB 4GKKF 3RR8A 2M3DA 1RAAB 2GCFA 4EYIB 1Q8KA 5DZ6A 5E3RA 3ZNUA 2HIYA 3HKWA 2VH7A 3BO2A 3NGTA 1XC9A 3QO9B 4AYBD 4X84A 4J37A 1GNKA 3MMBB 4RW7B 5HP1B 2HMIB 3UDEA 4WKRA 2VG7B 1VBKA 1M5HA 3MCNA 3IR7B 1UCNA 1QJHA 5HN0A 1U1LA 1Q7LB 3HHNB 1OPZA 2JL9A 5IZHA 4FF4A 4USKA 3VQSA 2E7VA 1F2HA 1UVLA 1N48A 4ZITA 1QAYA 1U8SA 3M8RA 4Y2AA 4UZBA 2GV1A 5EGYA 1XN9A 3QGHA 2NXUA 4TLRA 4ZN1A 2NS1B 3OD2A 3VVUA 2W4PA 3CJ8A 3E3XA 2DR6A 1Q53A 4OHZA 3W9JA 1WEYA 2NSCA 3MMCB 1K8AT 2CQDA 4A8FA 2RILA 5EUHA 2W4CA 4CYUB 1QD1A 2ZHBA 2BEFA 1FJCA 2IJRA 4NCGA 1UPMB 2XMAA 3TUIC 3RB3A 2LKZA 1KKHA 2BE7D 1WF1A 2GJFA 5EX0A 4WXOA 1TP7A 1T3NA 2VU5A 2Q1LA 3FUYA 3GU0A 3RB4A 3SIPB 2ZFHA 3WDOA 2Z56B 2IAJB 2K06A 4JI2F 1Z2LA 4UUWA 2WOMB 3I9V9 2E1AA 2J9DE 1FE0A 3QJJA 3MTKA 2KM8C 4OZ3A 1G3OA 1HIYA 3LOUA 2FGOA 2AJFE 3GONA 1M5SA 2D3ZA 2UXDJ 1RT2A 1Q5YA 3IAS9 4CO5A 3OSPA 4W90B 4IG0A 1GEHA 1TKZA 4HLBA 2ZBCA 3PJXA 4WFXA 2OFGX 3MAHA 6AT1B 2HQDA 4E98A 4CO4A 4H4OB 3AA8A 1RHUB 2CZ4A 4ZPWR 2UU9J 2PD1A 4PG5A 2DNZA 2Q79A 2YNFB 3CGIA 2B4VA 3VALA 4YEAA 4NXMF 1IKVA 3CC2S 2W9CB 1EARA 2DIUA 3PFOA 4B3TF 3W62A 1S9GA 4DV2J 3CE8A 4DSIA 1CSJA 1X4CA 2AGQA 2KZZA 2B9XA 1HBMB 1SH2A 5HAOA 3A8JA 3L9ZA 3Q8PB 1YQHA 2HLTA 3K89A 1NMEB 2XSFA 2E9RX 3MEGA 1S76D 2FJEB 2BMBA 3D5MA 3HJFA 4DR5J 3BSNA 2IJFA 1S1VA 3ZTQA 1VRTB 3P8BB 1JLQA 3VAFA 4HKQA 3MM8B 3MMBA 1TK5A 3DRRB 1WC0A 1RBLA 4DV1J 4AUKA 3PYDA 5KG5A 2RD5C 4MFBB 3PY8A 1N0UA 1U25A 3IGVA 2CJQA 1ELOA 4HACB 4EUVA 5F8LA 1R8BA 1T3OA 1WG4A 3GCWP 4FNIA 1DLOA 1Q82T 1DHMA 1XK8A 4O3SA 1HNWJ 2DKOB 3QT6A 3FZ2A 4UY85 4R25A 3DRSB 4J9NA 5H9EK 2J0WA 4ZKAA 4DEZA 2BE2B 2V9KA 4YQWA 3VV2B 1SXLA 4DPTA 1WC5A 3D1QA 3FQLA 1IWAA 4WBFA 4DL7A 5GADU 4CYUA 2AEFA 3VAMA 2CJ9A 1I1GA 4AXIA 3MF5A 3N28A 2OO4A 2HNZB 5DG8A 1U1NA 2B5JB 1KN6A 1TUGB 4KYZA 3D2WA 4USIA 1LK7A 4TU7A 4M5MA 3AQPA 1URNA 3NGSA 5M2PA 3CCWA 4I6YA 2IAJA 4DL2A 5AXLA 3OTCA 4NLRA 4KSEB 2F8HA 3RRGA 2WOMA 2AZ1A 1VR6A 3TA2A 2R7TA 2ROEA 4E0DA 3PO4A 1VRQC 3QJPA 4DPOA 5IT4A 4Q0BA 3N79A 4C98A 2VQFJ 3T6BA 2FJVA 1KHWA 3GWCA 5IOLA 3VZHA 2PT0A 3P45B 1HW8A 4OX7A 4K7QA 1VBZA 2G4BA 2DPIA 1I51B 2V8PA 1Y3KA 3TUZC 1WWHA 4DR1F 4OL8A 1RTIB 4C11A 1GXTA 4L73A 4NRUA 3NL0A 4QIGA 3PXGa 1K0VA 3HSDA 5C25B 3G6ES 4P52A 2YNFA 1W2IA 4B3SJ 2OP5A 3MECB 2FHKA 4B9VA 3FBFA 1AUDA 2H65B 3PM9A 5ADZA 1PJ7A 1C0TB 3BYRA 2W9CA 5KFNA 2YH1A 1HI0P 3GIJA 2EFNA 4EU0A 2IBKA 1S0OA 4G1IA 5KFXA 1JLEB 1LK5A 2IHR1 1HBMA 5F0WA 1P9YA 2ZNZA 3MPWA 1OQ3A 2YNGB 3HULA 3GMGA 2X7IA 2RS8A 2GO8A 3KLIB 4L6V3 4DSKA 1ZM3A 2JVRA 5HMWA 2AMCB 3D9BA 4NE9C 2HVZA 2IM3A 3M8QB 1TL5A 1CS4B 1RKIA 1HD0A 4WU2A 1JLFA 2MHEA 3IWLA 4K2XA 2VA2A 5M2RA 4KKOB 1B70B 1VRTA 4B08A 1ICEB 4YY3J 4ZVPB 4RNNA 4DV6J 2OMLA 3M2UB 3DRRA 3KG0A 3DFEA 2HAFA 3TP2A 2ZH1A 2ACMA 2MKSA 4DFMA 3RBDA 3CCLS 3H8YA 1S77D 3LF0A 3QBCA 1OWXA 2YX4A 4FVCA 3UR0A 1PO6A 3HVRA 4N47A 1RCXB 2IYIA 2E5LJ 2XMTA 4CTAB 3EXYA 1ZM9A 4WIIA 4HACA 4WZQA 3ZNJ1 4IRKA 1NHVA 4L3KA 2XLIA 4I4BA 2EC0A 2V4RA 1AFJA 4OI6A 4N56A 2MY7A 5BR8F 2L9DA 5B0FA 4DUYF 2C28A 2Y0BB 2B8PA 5J1NA 1RUSA 3ZZTA 4K4ZA 3ENAA 5U47A 2DEIA 2MXYA 3B78A 3A3PB 2V8DA 2HNZA 2B5JA 4RPFA 3DDKA 3TJAA 5GVQA 4OIXA 4LRDA 1MW7A 3UQSA 3LH2S 2KT3A 1U49A 1CQNA 3QT5A 2PMZD 3PJWA 4HTIA 4DR3F 1AA1B 2JEFA 3BSOA 1S7HA 2X1AA 2DGOA 1NCLA 4ECZA 1FK9A 1VQPS 2YBVA 4F4XA 4ITSA 1WHXA 2HHXA 3K8WA 5KFHA 1Q16B 3V4IA 1UVNA 4B9MA 4NXNF 3QRPA 4A47A 3T3FA 1RZMA 3GG0A 2AW0A 3OFEA 1V3RA 1RTIA 5SZTA 1U2RA 2W24A 3DOKB 1UFLA 4PG4A 2KHDA 2QA4G 3RB0A 1YHQS 2DNPA 4MT1A 1VHIA 1WJ9A 5C25A 4Q43A 3PVXA 4FYVB 3UWTA 3MECA 3S1TA 2VFVA 1BC6A 2CDQA 5JVGQ 1E6YA 2MKYA 2X3GA 4HYKA 4DFPA 3V6KA 1FDDA 2YX7A 3D1HA 2FZKB 4B3RF 2LP4A 5D0EA 3RBZA 1QSLA 2F65A 2BANB 2LA4A 2HURA 2UUAJ 1UEKA 2CPXA 2HK3A 3NBPB 3UD3P 3SCKE 2YNGA 1VMBA 3CO9A 2HGNA 3PEJA 3EPGA 1B7FA 3WC2A 4C3MA 4DBQA 2MZRA 1R8HA 2JSXA 2MZJA 3NWGA 3HHDA 3M8QA 2A6MA 1CS4A 5CQGA 3JTNA 3KOAA 4ICLB 3VF0B 1VGYA 2CRLA 1EQ0A 2OELA 5KOWA 4W98A 1T11A 4DN9A 3ITHB 4ENOA 1R3NA 4RJVA 2FJXA 1U0HB 4HL9A 1WORA 3CDWA 2KB2A 4J91A 4IR9A 3HSZA 4ES3A 1RYRA 3GIIA 3M2RB 3M1VB 3HP6A 4FF3A 1OY6A 4CTAA 2A6OA 2DVIA 3W5XA 1VQ5S 3SFUA 3CCRS 3CVKA 1VFJA 5KFRA 3QIDA 2JFDA 5CABA 2OUGA 5K8PA 2ZH6A 3Q8SB 1N54B 5IT0A 4X64J 1X4GA 4CIOA 2FC8A 2FVSA 2MSSA 4ZLPA 3DC2A 3MEEA 3FMWA 2O01C 4FNHA 1RLCL 2DCLA 1NHKL 5I42B 2EFPA 4GKKJ 1N36J 2KI2A 3HFVA 3Q24A 3ZO7A 2GMHA 5F9LA 3EDRB 2VPXB 1RAHB 3RZAA 4ZLLA 3AJDA 2G2OA 2XMKA 3EVMA 2ZJPQ 1XNQF 1RK8A 2N3OA 2HBZB 4ZVQB 1NSQA 3U02A 4Y0FA 5KG4A 3WQPA 3HSJA 1KTQA 3SCJE 3MEDA 2PI5A 5CCMA 4KO0B 2QMXA 1X9MA 3IR6B 2N7CA 1NKBA 1SJ1A 1U47A 1VYAA 3FFIB 4CQ1A 3CTRA 3ZZRA 3VAJA 1JLGB 5E7OB 4ED7A 3Q23A 1EAYC 2QA4S 2UUWA 4K59A 5KG6A 5FD1A 3I6PA 4JB8B 1TKDA 1FNXH 4X65F 4NPOA 4BC7A 2OTLS 1BQNB 2EFQA 3PDNA 3G8SA 1S1WB 4K50A 3MWBA 4IYQA 2HHQA 2UXCJ 4R8UB 3QT7A 4E2FB 5GAEI 3T1HJ 1UPPA 1RQ0A 2HHWA 4CNYA 4RW6A 2W2QP 3JB9k 2ATCB 4ED1A 2MB0B 4WCEQ 2RE1A 1R8PA 1TL3B 2EG1A 4O3NA 5CCLA 1DFDA 3OL6A 5AE1A 3HO1A 2HVEA 3HFKA 4C8NA 3I32A 2VUGA 3PRBA 3ET6A 3NBPA 3T5JA 1WC4A 4AL5A 4A8QA 3HHLB 3AOCA 2RRAA 1VBYA 4CLUA 4OJHA 4F36A 1UW4A 1MMLA 4JV1A 2W8KA 5HI7A 3RUBL 3Q8RB 4P2FA 1KNZA 1T8EA 2HHHJ 2HW3A 4DF4A 1M1KT 3JQJA 4ZK7M 2DH8A 4ICLA 2LXFA 3VTIA 1RTDB 1XIQA 1R89A 3MFHA 2BM1A 2L9WA 3W7BA 3ITHA 4ER8A 1IBLF 2XHWA 2QLXA 2WSFC 5EN1A 2G0IA 3QMQA 1U0HA 3HVAA 1YJRA 1X4FA 2A2DA 3RU0A 2FVCA 5F8HA 3W3SA 3MPVA 2CNKB 1WF0A 4ERDA 5IWAF 4F26A 1UP1A 5G4DA 2RUGA 5E3QA 3MDFA 4NXMJ 4DS4A 2KG1A 3HD2A 4YB5A 1TMMA 3QATA 2BABA 5IXUA 1VQKS 1O5JA 3LWLA 5EWEA 5F8MA 4B3TJ 2CNLB 1HPZB 2K1RA 1F3FA 3IM8A 5ETRA 3J81U 4B9SA 4FBUA 2J7KA 4OYBA 4UT4A 4ED2A 2QA1A 4OYZA 4ECUA 2F63A 5LMNF 3RJMB 1MG7A 3QLHB 2M88A 4OZ5A 1NRKA 4F02A 1HMVB 1N5VA 3X1LB 1DARA 2VJUA 5I42A 5D4PA 1XWLA 2JLEA 1QTNB 3ISND 3CO0P 2QMUB 2DD8S 3FMBA 1TQLA 1RT5B 2GNKA 4UZCA 4JBCA 4N7TA 1RWOB 3GFYA 1Y10A 1XMBA 1FF2A 4WFZA 4K4WA 4B9LA 3MPUB 5E41A 2CIMA 2B6AB 2CQ2A 4KO0A 3M8ZA 3VZIA 3OQ2A 3D3BJ 2DHAA 3FFIA 1RWPB 1N5QA 4WP9A 5A8KB 5H9EJ 2DB1A 1N5SA 1RWMB 1H7XA 2NYIA 2P6TA 2ZZNA 5F3TA 4ZLJA 5JMNA 4ZVUB 1J2VA 4JI8J 5D4LA 1S0VA 2ZH7A 1BQNA 5CYMB 2R8GA 1YI2S 4FVMA 1S1WA 4ZP8A 4J9LA 2MPUA 1NDKA 1FWKA 1VQOS 3UO0A 4PEOA 1CBKA 1H0HB 2KFNA 4KRWA 1U1OA 2QFJA 3PJ9A 3EZOA 5IC6B 4U7CA 1I6JA 2PI4A 4X62F 2UV8G 1KBRA 3Q8QB 1S9EB 3H42A 2ADBA 5ETSA 3ZZZA 3D7SB 2F40A 3PKMA 1C2PA 3SI8A 2DRAA 3ENVA 5GAGI 3HHLA 4RBUA 4TY8B 2BJ8A 4OX6A 3TX0A 4RUHA 1FJGF 3CJ4A 4CH1A 3NS7B 1G2EA 4I7FB 5E5NA 3V81B 5L1LA 2HG4A 1G4CA 3CCTA 4ZJQA 2V67A 2WSEC 2UUTA 5DRKA 2NZ4A 4CLTA 3NXZA 1PAEX 3KHRA 1SC3B 4K2JA 4DX8H 4XDDA 3AB4B 3N5FA 3KHLA 2ZHAA 3ZC4A 2DHGA 3MMAB 4LREA 2ABYA 3SV3A 1YBAA 1KLMB 1YLXA 1CULA 5B0BA 2JEJA 1QVGR 2ZC4A 3UD5A 1RTJA 4GKJJ 2RRNA 1FX2A 2CPIA 2QYCA 3R1HA 1S9FA 3PX0A 3FBBA 2HFSA 3D6MB 4IH5A 2LDYA 1HNZF 2AYMA 1SQFA 3DYAB 2X51A 2ZOFA 2FLLA 1LXJA 4P6QA 5D6GA 2M5YA 4QPTA 1TFWA 4KGZB 5FDLA 1HMVA 2W1BA 5DZ7A 2H5IB 4ECQA 4CO3A 4NX9A 4WP8A 1UL3A 4XPCA 1WC3A 1HHQA 2HRYA 1ZTWA 4B9UA 2BKNA 1CEZA 5BYQA 4YB7A 2J8SA 3Q22A 1X0FA 3JQKA 2IJNA 3TI0A 3VAGA 3AJ2A 1S0NA 1HHSA 4KAIA 4ZVTB 3JAMU 2IMWP 4YB1P 2V0NA 3HHLC 2HQ3A 4DPXA 4TQSA 4TVAB 4EI2A 1M0SA 2GQQA 2FUG9 4RNHA 1F5BA 1C1BB 5A8KA 3FNNA 2W9AA 2YPYA 1S6PA 5BR8J 2RJZA 2KFYA 5L46A 2RU9A 5E2QA 1VLYA 1LW0A 2R3VA 5FJ4A 4ZVSB 3HHKA 4OI2A 3RAMA 1LFWA 2WAQD 3I5AA 5CYMA 2DGXA 3G8TA 4RL1A 3RAXA 5LXRA 3MGJA 2KXHA 2GMLA 1VRUA 3LP2B 3CSKA 3OHBA 1C1CB 4C8ZA 3FQKA 1LWFB 4LSZB 1P1LA 4DR3J 2P9GA 2AU0A 2B4UA 2AJ0A 4YB6A 1HL6A 3I5CA 2P6SA 1JJ2R 4TY8A 2ALYB 4X4OA 4ATNA 4P2XA 1S59A 3OR2B 3DRPA 3G4SS 2DR7A 4USMA 1U1PA 4I7FA 4H54A 3M6VA 4CLSA 3V81A 3GIMA 2VFRA 4HHHA 3PHEA 4NRTA 4K4VA 5HLFB 3HT0A 1H73A 4C8LA 1NJIT 4CLWA 5F8NA 2BR0A 2RSQA 4ANDA 3ZXWA 4I67A 3IAM9 3CUNA 2VKZG 2RKIA 1YITS 3R5BA 3QSIA 1VHFA 3BGFA 1F2GA 3ISZA 1KLMA 1IR0A 3R1LA 2DJWA 1NNDA 3GLJA 1HQUA 3C16A 2IC3B 5K8MA 2UVUA 1CJKB 1KFSA 1GFWB 2MLXA 5T41A 3S01A 1JKHB 5I3UB 4GC7A 4NLDA 1V5VA 2VQEF 1ZA2B 3TYTA 2WB4A 2Y1LB 2LECA 4DLEA 2B9YA 4B3RJ 3DYAA 3KK3B 2LLZA 3GJRB 4C8MA 2KL8A 2QTWA 1H74A 1BUXA 2V2ZA 4KV8B 3BO3A 1NAQA 2OI2A 3VR1A 3N4WA 1OJ4A 3J81Y 3M30B 3BDPA 1H6KX 2Q66A 3QWUA 3PEHA 3Q2SC 4OQJA 4F4ZA 4RBTA 1BQXA 5GAGU 2UUBF 3CJ0A 2R7SA 3JSBA 1DJ0A 3LAMA 2UUCF 3THTA 4DL0C 4EZ9A 2BM0A 3U1LA 2RHSB 2E29A 5IM0B 2GAHC 1U2FA 2DCUB 2IVYA 3I4HX 1UFKA 1ZAWA 5LJ3Y 2P9EA 1ZPVA 2OAUA 2FC9A 2WBRA 3E01B 1M90T 2PMHA 5FLXU 1D3WA 1RWXB 2H3EB 5E0OA 4OZJA 1SL1A 1RWKB 3M8YA 1MU2B 1NPPA 4NLPA 1C1BA 3N0VA 1SI9A 1FESA 2YKAA 4C2MA 4DV0F 1HBOB 1IVZA 1UWBB 1WTBA 1A7GE 3OHAA 1PJ6A 4RU9A 3IS9B 3MM6A 3BEGB 4KY3A 1KQFB 2W7OA 1SC6A 3PZPA 2PEHA 1T03B 3SYZA 4ES2A 2VA3A 4FF1A 1GK8A 3I0RB 1C1CA 4LF2A 4OX9F 3WX8A 2AYEA 2AEMA 3QFHA 4AXJA 2W7AA 4NL5A 3R5JB 2V4JA 5ETMA 2OD6A 1XNQJ 3DOLB 3UVJB 3EMTA 5HMXA 2MZSA 2YWWA 1KD1T 3CCJS 2E66A 4JI7F 4YUDA 2NPFA 5HLFA 2OKQA 2LCWA 5EWFA 5B7WA 2APOA 3ICLA 5GAHI 1OS5A 2VG5A 1SIWB 3H4BA 4LF6F 1PG5B 1QM9A 4QYRA 4I64A 2EXUA 8ATCB 3Q2TC 2ZDPA 5E33A 1DURA 4A46A 1RAIB 2Z2MA 4IDKB 4NLOA 1RBOB 2Z30B 3NGDA 4Q45A 3G87A 2VBXA 5KAKA 2DO0A 1MN7A 1ROFA 2R8JA 4RX6A 1TKTA 1JKHA 5I3UA 3KG1A 1GH8A 2DNHA 4C0HA 2QLJB 3P6YC 4CNZA 4K8RA 3KK3A 2R7RA 3GJSB 2F1FA 2B7BB 2LA6A 3QWPA 1RT3B 3KJVB 3BN4A 2J9EA 1FD2A 3GJTB 5AE2A 5F8GA 2HZCA 2XULA 4FYXB 4DI6A 1PAUB 3VQTA 4CM0A 5CHCB 3BPDA 2OSQA 4YHHJ 1KQSR 1NJXA 3TEGA 4F3MA 4MKYA 3KG4A 2R9LA 1SQEA 4OI0A 3GSDA 4NASA 4PUOA 2N4CA 1IBLJ 5C42B 1MSWD 1EKRA 3M2VB 5IM0A 5KFEA 4PWWA 2DGUA 1NDLA 4A8OA 1O51A 2JNJA 3Q86A 5IWAJ 2IM1A 2DHHA 5DM6Q 3SSRA 1RE1B 1W7WA 3MR5A 5KFCA 4XAKA 1MU2A 4DCOB 2JFKA 3MR3A 1FRIA 2AV5A 2B4OA 3HXMA 1NJWA 3JAMY 2NXJA 2HQIA 3OVBA 3T9NA 5KT4A 1TVRB 1UWBA 1XR7A 2QEXS 3QFWA 2HBQB 1HBNB 1D09B 3D4JA 5LMNJ 4YS2A 4P74A 2VFSA 4KBIA 3GYNA 3GIRA 4C9DA 3IS9A 5DDPC 2QLBB 1KTVA 4K5SA 1BE4A 1G7CB 2UZAA 3NCRA 2J7UA 3D0IE 1AFIA 4X4UA 3KWMA 1RHKB 3PRDA 3W5YA 3I0RA 1ACMB 1NUEA 2J5AA 5MLCV 3BYPA 4G1QB 3QIPA 4LF4J 3C14B 5IV4A 3PHTA 1UMJA 2RQ4A 4LBPA 3AJ1A 3DOLA 1AXQA 3UVJA 2HHUA 4CLLA 3MR2A 3H25A 3N9UC 4MJKA 3A13A 2ZUAA 1NPKA 1H2TZ 2HHVA 2EFVA 3M9OB 2NXEA 4ZN3A 4QIEA 3VVTA 4OLPA 3JTOA 1VJWA 3HK2A 4V19X 4A8YA 4DV3F 5ETVA 3DCAA 1S6QB 1X8DA 2E1RA 3E51A 4OHVA 4I6WA 2MKKA 5RUBA 2C2EA 4PQUB 2XM3A 5LMUJ 4Y2CA 4ECSA 2YWHA 2DNMA 1E6VB 2ZZMA 4RW8A 5CYQB 3D54A 2O3DA 3BH6B 2VPYB 1KQKA 3OTOJ 3O44A 1P27B 1Y4ZB 4ES1A 5KG1A 3CJSA 5IT9Y 1JJHA 4PKDB 1F5CA 1JNRB 1IBCB 4X62J 1VQ7S 4LQ9A 3IBFB 3CCSS 1LXNA 4RW9A 1FJEB 1JLBB 1DQAA 1WACA 3KJVA 1Y11A 1S1XA 3W1YC 3SQOP 2FY1A 3EVOA 4KJIA 4ED4A 4IOAQ 3OFGA 2Z57B 8RUCA 1IJFB 1S1UB 2CDRB 4L3NA 4GMKA 1LWEB 1R27B 3G82B 2MZ1A 2E44A 4LRCA 4TYAA 3N6LA 1SC1B 3O3LA 3LGHA 1RTHA 3SCIE 3HKZD 1ZA1B 2J6TA 1NB7A 5C42A 4ZPBA 2HNYA 4I0WA 2Y1IA 1BHNA 3M2VA 3DLBA 3MM9A 4IFVA 4DV7F 3P5BP 1L5UA 1NZ8A 5D0HA 4NMXA 4A8MP 1GXUA 2JEGA 2MGZA 1FRMA 4N77A 2AP6A 3MOJB 1YVFA 2WK4A 2OHDA 2VODA 4U67Q 2AD9A 4CO1A 2ALZA 1M1GA 2KRBA 3TZWA 5FLXY 5K8NA 3HZEA 1CPZA 5J2PB 1TVRA 1IJEB 3T6JA 3AODA 2DGSA 2DNGA 3Q0AA 4IQMA 2BACA 2ZNYA 5DDOC 5F0UA 2HFZA 1CJTB 2XS7A 1SKSA 5C7PA 2RF2A 2VG6B 1RKJA 2E7XA 1OO0B 1HNIA 3M9NB 4DR4F 3RTVA 1UWAA 4Y3CA 1NKCA 1SVDA 2JJ4D 1FKOA 3KDOA 3MPYA 3WHIA 2SXLA 3EICA 3FVYA 5CAAA 1Q95G 1FEHA 3HT3A 3C14A 2NR0A 3ZTPA 2XBPA 2R7UA 3LP1B 5IV3A 2OSRA 1VK8A 1X4BA 4DU7A 4MYTA 2BKPA 5IFMA 3AD7C 1WG5A 1FD8A 1K47A 2B56A 5KFKA 4PRFA 1T05A 2Y8YA 2HNDA 2CQGA 1RISA 1CC7A 1WKKA 1NK0A 4ETZA 3OJSA 2IYGA 3KUGA 1K1QA 4OYOA 2YWFA 1JXEA 4Y6IA 3QSYB 4LFCF 1WC1A 3RYLA 3M6WA 2QSFA 4O4RA 2GGPB 1H2VZ 1QLNA 4HHJA 3K17A 1S6QA 3BN7A 1QUPA 3MM7A 4K4UA 4DS5A 3BDEA 4JP8A 2FPHX 4NCAA 4PQUA 5B0CA 8AT1B 5CXTA 2QYGA 3DGVA 3MAAB 3CJKA 1E6VA 2XMUA 3LPYA 1VCTA 1AZSA 3MD1A 4KFBB 4LUBA 2PFDA 5K8OA 2FLPA 2ZM6F 1IKXB 2AZ3A 2VB6A 4JI6F 2DH7A 4ZVEA 1NO8A 4V1Ak 2U2FA 3LA0A 2MLZA 4EBCA 2XY7A 1JLBA 2E1CA 3M8SA 4WFYA 1U6BA 2RAQA 2XYPB 3KXDA 2CQ0A 2H4WB 3CCVS 4K0KF 4PZVA 2N7YA 1RU1A 2D41A 1S1UA 3TOQA 3NY0A 2CZVC 3G82A 4M5JA 2RS2A 1RABB 1HW9A 1U1KA 4LSLB 4Y65A 1SV5A 1ULRA 1N5TA 1HI1A 3AH6A 6FD1A 4ED3A 3UE2A 4USTA 1H72C 3JSMA 2GQCA 2KYXA 1RT6B 2WVDA 3GE9A 4MK9A 2HIQA 3W8GA 1JXVA 1HD1A 2Q6BA 4JI1F 3O8WA 4OYIA 3UCUP 2LQ5A 2BOAA 3KUHA 3DU5A 2FTRA 1B0TA 1WEXA 7FDRA 1X5PA 2W9BB 4NMLA 3J7YI 1GXLA 3SBMA 2VQEJ 3PTWA 2WB1D 4KR0B 3VGVA 3KJFB 1KP6A 4CLYA 2AGPA 1A6LA 4UOCA 3JXOA 1VJQA 1EHWA 5CD4H 4NOHA 5EHHA 7AT1B 2DBBA 3OFHA 2I2YA 2A2CA 2IA6A 1CJTA 2BJ3A 2AIRB 1QAIA 4ELTA 2DNQA 4NI2B 2W2NP 2VL1A 1YRXA 4IO1A 4KH1B 4YOEA 4BBYA 2HZAA 4CLPA 2VBYA 1CVJA 5GMEA 3MCSA 4OMFG 2UUCJ 4FF2A 2BRLA 2FZCB 2XY6A 2XNRA 1FVSA 4DR2F 3DI6A 4DR6F 2VBZA 3FCHA 3IRWP 1FCAA 3KKFA 3BBCA 2C2KB 3PO5A 3M4XA 3IFEA 1NHUA 2C3UA 3B54A 3HMJG 3G2XA 3SSSA 4MTPA 4WK3A 5HJXA 1FDBA 1NU4A 2UVVA 3QAEA 4NLVA 2GAGC 4DV5J 1P9QC 1YJTA 2LQJA 1DTQA 2GGPA 2R2SA 4KHPJ 2WONB 4AFFA 1EB0A 2BJ1A 1V9OA 3GCXP 3A8EA 3MCMA 1TKXB 3BREA 3TO8A 3RGIA 5KFUA 2BDPA 4ZIVA 2CPDA 2CQHA 4ZPTR 3MAAA 1RP5A 1S49A 3THPA 2ILYA 4KFBA 2AX1A 3GFZA 1P8GA 3MOZA 1C0UB 2RDIA 2GIQA 3N6NA 4JI5F 2MQNA 5AJ3F 3EGVA 2HLUA 5DG7A 1XR6A 3UDVA 2BX6A 4ILMA 2ERRA 3F56A 4ZP7A 2R7VA 3DKDA 3HHLD 1YG0A 3RW6A 1Q78A 1XNRJ 3CIZA 3POTB 1EX8A 3LGMA 4PPDA 4RUCA 2DHSA 5KFDA 3SMZA 1BXNA 4L72B 2ZZTA 4ZPAA 5BXIA 3DDNA 2ILZA 4JI7J 3L4BC 2MEWA 1S99A 1GTEA 3UCZP 3BB5A 1WOOA 2FD2A 1IR2A 2YNHB 3C6TB 2HVHA 3OVSA 5AE3A 4LF6J 2WW4A 1KONA 3I96A 2PA8D 1UAWA 2ZE2B 1GX6A 1VQ8S 1IKWB 4XPEA 3T5KA 4M5NA 2XS2A 2C2ZB 4ZIWA 4ECVA 2Z0GA 4QBUA 4IQXA 1LFPA 3KJQB 2W9BA 1OY8A 2R2RA 1JNZB 4LR9A 1S79A 2HFOA 4B3MF 1U26A 3MHYA 4DSJA 4DJBA 4X4VA 1PGZA 3KLEB 5D3GA 4RW4B 1SUQB 2KTQA 1HWIA 1QY7A 4JI0F 3MR6A 1U02A 3R3TA 2K7JA 1PKUA 1NM2A 1RT1B 2J9DA 4WKYA 1LOUA 2YKQA 4O23A 2E1PA 1FRJA 5KT5A 2JX2A 1HNVB 4WE1A 1FWPA 4NZ0A 2PE8A 3D3CJ 2MZTA 2ZH4A 4IR1A 2QE5A 4FDFA 1GMVA 2BXJA 3TVKA 2ZJQQ 4EO6A 5L39A 2R7WA 1ZM4A 1CLFA 5A2QU 4ZP9A 4C48A 1WDTA 2CPZA 1JK9B 3TAMA 2HVDA 1M1HA 3V6DB 3QQCD 3BSAA 2FZGB 1SJQA 4G1PA 4NLSA 1OY9A 1QSYA 3PX6A 2G2ZA 4EWTA 5HVGA 4M8LA 5L9NA 3W2WB 2XHCA 5H1SV 5ETPA 2V8VA 4TYBA 1IQZA 1FT8A 2YNIB 3I31A 1S5ZA 4J9MA 3CPWR 4OI4A 5K14B 2DNLA 5HVHA 2VICA 2QMWA 4IG3B 2UXBF 3H59A 1T9UA 3DGPB 1NBEB 4ECYA 1VC6A 2VD3A 4ECRA 3G6XA 1D9DA 4IKAA 5ETKA 3BM7A 2R7XA 2HYIB 1HBUB 2GVDB 4OI1A 1KLNA 2ASJA 4CP5A 3I0SB 2WONA 1X9WA 2ATLA 2Z2YB 3OPKA 4QWAA 2GFFA 3L09A 5HROB 2GZOA 3X3UA 1TKXA 4OV1A 3UPFA 1ZETA 3OLAA 2UP1A 4JYAF 5IS2A 2LQ9A 2H54B 1Q81T 3K58A 1RHMB 1K1SA 4QR2A 3EYZA 4MIBA 4A8XA 3FCWA 3QO9A 1C0UA 3D67A 4RW7A 5HP1A 1LWCB 4MYUA 2HMIA 3IP0A 2HSEB 2VG7A 3T19A 3TX8A 3CT9A 1FA0A 2V34A 3BGRB 5DS7A 1VLOA 4KHRA 2DXFA 2HFUA 2N82B 2VDIA 1AT1B 3BO4A 4OJ3A 4FXWA 5MAOA 5KFSA 2ROGA 2WRMA 3G6YA 1YZ7A 1R0CB 4USJC 1HR0F 3QGGA 4HR2A 3T5LA 4FN5A 2PA3A 2IY5B 1D8ZA 3TZYA 1T9VA 4J9VA 1VC0A 2YNHA 2FVPA 2E5HA 3D66A 2BW7A 3MMCA 4DV3J 3QZ7A 2IVFB 2K3IA 2AEJA 2ASDA 3CW2C 2OTJS 1XMOJ 2ZE2A 1S1TB 2EK1A 1IKWA 2X1BA 1OSDA 3FK4A 2ZHOA 4QWDA 4DV2F 4ZVOB 1HNXF 1RA7A 1FDNA 3N6MA 1U8WA 3TA0A 2ZH5A 4CRJA 2FJAB 2BQUA 2W4DA 3C6UB 1FXRA 4R0EA 2AJ2A 3FCVA 2JDJA 3LTOA 5A0YB 2XY5A 1MROB 1XEZA 4ZPDA 3KK2B 1WKJA 4H4MB 1SUQA 3JYTB 1RT1A 2DRBA 2QZ8A 1RWVB 2D74B 2OH2A 2CVEA 1HWUA 4DR5F 4U7UK 2OD4A 3B6BA 2IMOA 2BJ7A 3IO1A 2C2NA 2J0SD 3PR4A 2F9JA 3OTEA 3H5UA 5AXKA 3I56S 2YX1A 5K5MA 3GV7B 4FKYA 1QUVA 3R97A 2AQ4A 4H4OA 1BWEA 3V5RA 1AYEA 4QU6A 3CCZA 4DQSA 3ELHA 4M5LA 1YJVA 2HK2A 2C2MB 3JQMA 2XO7A 3C46A 1EJ7L 4Y2IA 3W2WA 4L74A 1F9FA 3NS5A 3FJ2A 5ETTA 1HWKA 2VPWB 1KVIA 2M8HA 5K14A 2ZOMA 1NZAA 4JV5F 5D8HB 4IG3A 4ED6A 3DHXA 4P73A 1K73T 2KO1A 3CJQA 4C97A 2AJQA 4Z7CA 4DZ6A 5KTQA 3PFEA 3FKBA 2PN6A 5B0DA 2RRBA 4DPYA 1TL4A 2DNYA 1HBUA 4QYZK 4RBVA 2GVDA 1NK8A 1WSRA 5KFQA 4Q2MA 4J7CA 1RAJA 2FHMA 2EVZA 1FI4A 1YK9A 4RU2A 2IDEA 1JMTA 2M4MA 2JVOA 3EM1A 2JRSA 2J7WA 4XK8C 4FYDA 4DV4F 3BZQA 5J1EB 4CO0A 4ILRA 2XMVA 2XQCA 2VC0A 1TZ0A 3MM8A 3LALA 5FIIA 2V94A 3R6LB 4O3QA 5ETOA 1KS2A 4CDIA 2LU1A 5L1JA 3AY0A 3ONQA 3MUTP 1U6FA 2G1HA 4MFBA 2VQFF 1NSPA 1WNEA 1WELA 1SCJB 5KFFA 3OBIA 3MUVP 2E5GA 3FBCA 4DX5A 3H5SA 1WHYA 3TA1A 4DX6A 1SKWA 3IRXB 1WHVA 1SJRA 2OEJA 3DRSA 4OJ1A 1VQ6S 3EGNA 2BE2A 3HJVA 2DNOA 4KH0B 3LQVA 1TUVA 2W2OP 1AROP 2A1BA 3LO3A 3NS6A 1FEEA 2XI2A 3AA9A 3EVWA 4PWUA 1S4FA 2X3DA 1JJ4A 5ETQA 2J0XA 1WG1A 1KR4A 2G2YA 1S1TA 2BQ3A 1J5EJ 1RWUA 3JSYA 4N5SA 2ZH9A 4QCLA 4ZHRB 2H9ZA 4PG8A 2CZ9A 4KQZA 4DL3A 3C6UA 2QRRA 4LQ3A 1N5YB 4CI0B 1MROA 1GX5A 1SH3A 1S97A 4O0NA 4JI6J 3IM9A 4FP9A 5JJBA 2NSBA 5F41A 1U48A 3WZ0A 2QIFA 1F3VA 2CAJA 3OTBA 2F8MA 2NZCA 3LGNA 2V8HA 1RTZA 4X4QA 4GO5X 3PW4A 4ED0A 4K0KJ 2ZKUA 1K44A 2Y8WA 2NXNA 3EZ5A 2CG4A 5KT6A 4DV6F 1EETB 1YBUA 1NSKL 1HA1A 1Y5IB 4B02A 3GTYX 3JSRA 1X9SA 5EWGA 1SL0A 5LL6d 2R8KA 3P4UB 1NK6A 5HBMB 3E2EA 2H51B 5DLFA 5A2QY 4GO7X 1C0TA 4F3OA 3M6XA 4USWA 4Z37A 3FSXA 1BGXT 5HQLA 3J81j 3K57A 1QTMA 1JLEA 2ZWOA 3CNQP 1Y0HA 2OPSB 2AYBA 1NK9A 1FO1A 2KM8B 1CJUB 3BKFA 1J5OB 4I68A 5L9XA 4QQBA 4LFAJ 1S10A 1A9NB 2KG0A 4A8SA 1L3SA 3KLIA 2CPEA 1NLKL 1FFWB 2C2DA 5HL7Q 2N4DA 2R42A 1JB0C 2NPIA 4QWCA 1N88A 4M94A 2CPJA 2C22A 4DDFA 4KKOA 3ZZPA 2NYHA 5J1EA 3I55S 3KHHA 5L1IA 1WI8A 3M2UA 3H0PA 3RB6A 2PEBA 3IBCB 3R6GB 4O3PA 2CXEA 3O6QA 4Y34A 5DLGA 3CJ2A 2WSCC 4DR2J 4ZCMA 2F4VJ 1F60B 2K3KA 1F1BB 1KRPA 4DR6J 2LU2A 2QFIA 1KHVA 4YN3B 4KGXB 3GIKA 4LF8F 3AQOA 1ZAVA 4QW8A 5C5JA 4IOBA 1W26A 3IRXA 4E8UA 2I1RA 3B4DA 5HMYA 2KFZA 1SJ3P 2VIHA 1N32F 4NLUA 2F7VA 2QL7B 1XR5A 2KJVA 1H2UX 2JLFA 3I9ZA 3R5AA 3AD9C 1BQMB 2IVMA 3EX7B 1RDRA 1RT4B 3IXQA 4H4KA 2DXDA 2ZKTA 3U27A 2EFOA 2F5GA 5J2NB 3U1NA 3O5TB 2Y0SD 5KT3A 1X31C 3R2CJ 5KFTA 2DGWA 3K5OA 4F4YA 5E3PA 3NCPA 5I4MA 4QPXA 3HCXA 4CH0S 2XC9A 5AJ3J 1N5YA 2AKWB 1P6TA 3RRKA 2OGUA 1ZBTA 3HZGA 5DQIA 4OZ2A 3KHGA 4DUTA 4U9RA 1QDUB 4NEYA 2QV6A 1MWQA 3HD1A 4HI2A 1HYSB 1WOPA 4QIWD 3A4TA 1IBKF 2GHPA 4G3IA 4IG0B 1U0SA 4C3KA 2MDAA 1TKZB 2DR9A 4J9QA 1TAQA 3OV7A 4UUXA 3DDIA 3CMES 1EETA 4BCAA 3DOKA 4J5OA 4PABA 3HPOA 2Z2ZA 4MK7A 2YQ0A 1UTAA 2MJUA 3RAQA 2KXNB 4LRFA 4XIUA 2Z8QA 4UQTA 5C24B 5HBMA 3SV4A 3NP5A 4J90A 2HHTA 2CPYA 4LR7A 2L08A 5DGBA 2V2QA 1L3KA 1YJWS 4DSEA 1S9GB 1YDLA 2XZWA 5D0GA 3P3DA 2N3LA 2B3TB 3U7JA 1JX4A 1S12A 5GADI 2YKOA 2F9DA 1IM6A 1SQGA 1CJUA 4DPUA 2BANA 2HRUA 4JI2J 4WP3A 4F4AA 2XWYA 2O67A 4MIAA 2MQLA 4ANCA 1WUUA 4WIQA 2GW8A 4JI0J 1FRHA 3W9HA 3HVWA 5I3PA 3MEGB 5KFOA 2XS5A 1WI6A 2EPIA 1N36F 4P71A 4H4KC 1S1VB 4LBIA 3TJ8A 1YJNS 5SUHA 3BQ1A 4P2SA 1JLQB 4U8YA 4LRBA 1ZS6A 1K0TA 2R7QA 1U7LA 4DL5A 3D0GE 4DQRA 3UN3A 2MQ8A 1DBDA 3TW0A 3UCGA 4OHXA 2CADA 5KFVA 3R7NB 2DITA 3CDBA 3M2RA 2V2VA 4DL6A 3M1VA 3CC4S 2K2PA 3BV8A 1U1QA 2HFVA 3VGTA 1MMDA 4ZA1A 3BKTA 1DLOB 5F8JA 4KT0C 4RR5A 2LXIA 3W66A 2MHNA 1ZOTA 3V6JA 2UXBJ 4L75A 1N34F 3CCES 1ITPA 4G6VB 3W8PA 3H7HB 5HMZA 1IM4A 3NGUA 1BQMA 2V5HG 2UXCF 1RT4A 1WF2A 1F6TA 1H38A 4F4WA 2DNRA 4ED5A 4YDDB 3T1HF 1YTYA 3LAKA 4C6AA 3T1YF 5J2NA 4O4GB 4JYAJ 2M7SA 1FXDA 2NLWA 5BYSA 2V68A 4LF9F 2VDHA 4PPZA 2GS8A 3J80U 2B9WA 2D7SA 4KHMA 3PW2A 4C0OC 2FY8A 1VBXA 1KOOA 3IR5B 3ETMA 3H5XA 4PG6A 2BBEA 4Q0BB 1L3TA 1U45A 2B51A 1HYSA 5DQGA 3TNVA 4PQAA 3TUPA 2HHHF 2EKNA 2KVIA 1JLGA 1XBWA 1X5TA 1VQ9S 4ANEA 4NLXA 1YSJA 1FKAF 5HJYA 4C11B 3KK1B 1V6HA 5G0RB 1HR0J 1WOSA 3TWZA 2QC3A 2V2KA 2EK6A 4HT5A 4I2QB 4AL6A 4QIVA 5KFZA 4OX8A 4C8OA 3HHEA 2I0XA 5IQ6A 2ZVSA 4QOTA 5C24A 3PYFA 4R8UA 1YJ7A 2Y9HA 3HI9A 2YKNB 4RUAA 2E1MC 1U09A 2YPZA 2JWNA 1HNXJ 1B0VA 5HATA 1UA1A 1TL3A 1R43A 1UW9A 4K4XA 3T1AA 3WIVA 3TQ1A 1X4DA 1KVJA 2LEBA 1Y9OA 3W5ZA 2BJDA 3KLVA 1NJYA 1FJ7A 2J9CA 4Y2KA 4AL7A 3C15B 1JLFB 3NNCA 2AGOA 3I82A 1S6OA 4NZ7A 2D9PA 3GJQB 3AOBA 3I4PA 1RTDA 4LIRA 2NUHA 4DR1J 2R7OA 3RRHA 3UFCX 2OJ3A 2MKJA 2MQPA 5HVFA 3LUYA 2RQKA 1DQ8A 5A8WB 3TAQA 2ZUGA 4NCBA 4K4TA 3EDQB 1M5PC 2J6UA 1R0BG 4PXEA 3W63A 2QT7A 1RAFB 3D68A 3GFHA 5B0GA 4F8RA 1Q79A 1GMWA 1PYTA 3O2IA 4UOHA 1JJCB 1HPZA 2ZBPA 4JV5J 2HS4A 1RADB 2BA9A 4A8KA 2BJEA 2FJBB 3FDSA 4M5HA 4WJBA 5GAEU 3PW7A 1S4EA 1SJ4P 4OLOA 4CT9A 3A8IA 4QYZJ 3UDLA 3I5BA 4JI8F 4BDPA 3KMSA 3AXKA 2BKOA 2PO4A 2O1PA 2ZJRQ 3QLHA 2I9SA 4HDGA 2YWGA 1X5SA 1CJVB 4JV0A 4BWMA 4O4GA 2H48B 2CG8A 1RBAA 1EKSA 4P7VA 4Q5VA 3ULHA 4F0MA 1RT5A 4WTOB 4DV4J 3KNGA 2R2UA 3GP9A 4P2MA 4DSFA 4QJVA 4Y00A 1U1RA 2J8AA 2DR5A 1Q8BA 3EPIA 2MSTA 3DRYA 3IA0A 1FK9B 2B6AA 4DOZA 1FHTA 2ROPA 2GIFA 2ZEJA 1IN0A 2I8EA 3UNYA 2CWXA 1Z4UA 4X4NA 5KFLA 3V4IB 3KTQA 2B8QA 2CFXA 3M32B 1TR0A 4WWSA 4I56A 3KK1A 5G0RA 1U4BA 3HFZB 5AXNA 3ETOA 4DUYJ 2D9OA 2YWEA 1RJJA 3B82A 2L48A 4I2QA 4LF1A 4C4WA 4QR0A 4F0HA 1ZYQA 2V6AA 1DTTB 1F9EB 1PILA 4GKJF 2EG2A 4M5IA 1E6YB 2K8GA 2W2MP 2YKNA 2R4FA 4WYLA 2ZC3A 2CKWA 3DLLQ 4O3RA 1O6XA 3SQGB 3OLBA 2RIJA 3TARA 3KNAA 1HI8A 4M63A 1N33F 1H7WA 1GMUA 1S9EA 3TZXA 4JOUA 4ELUA 1QSSA 2P2CB 3MMJA 4F2SA 2BV3A 2GMJA 2DGTA 1FFSB 4USHA 2YH0A 1JWWA 2CQ3A 4HEA9 5DDRC 3C15A 3E8OA 3GZ7A 3UI3A 1RYSA 3MTJA 4NXNJ 2D69A 1P1TA 2KT5A 1RT7B 2R8HA 2E7WA 1GT8A 3IWNC 1VISA 2DYAA 2XMMA 3MMAA 5T7LB 4QU7A 4NYZA 2F4FA 1G1XA 3CWJA 1Z2ZA 3NOGA 3NRBA 5A8WA 2DPJA 5IT9U 3G6VA 1LKZA 3P5TL 4YR3A 2XLKA 1WTFA 5A8RB 1N52B 2FLOA 4MKAA 3BBFA 2MQOA 2C2RA 2YXLA 1QAXA 3H2UB 3BR8A 2KKHA 2DO4A 1PBAA 2G1DA 2OEMA 1VQ4S 4PYDA 4B17A 2ZD1B 4M5GA 2IDLA 2RT3A 1SBRA 4DG1B 2VC1A 4Y2MA 4QWEA 2PGCA 1JIHA 2ASLA 2XSJB 2FGCA 2V9WA 3MEEB 3QRRA 1PBUA 2LVWA 1EIYB 3HLUA 4LVNP 4HHUA 2DNNA 1YRTA 1UKUA 4ZMMA 4DL4A 2Q6CA 3L3CA 5K9FA 1B3TA 4Q7AA 2WVBA 1CJVA 5F3ZA 3K59A 5DDQC 4DMZA 3K5LA 3BQ0A 5KFMA 4QR1A 4NLGA 4ZP6A 4J9SA 1PSDA 4LVOP 4AQYF 1DRZA 3NMAA 1F5AA 4LT6A 4LF7F 1N56A 4DCJB 4FS1A 2DIVA 1I3OB 1MNEA 4IUFA 3MEDB 3DM2B 2GVZB 2CVIA 3S7RA 2LDIA 3CDEA 3J80Y 2CQ1A 3UW1A 3PR5B 3H4DA 4P72A 1XTZA 1LW2B 2CPFA 3M32A 2QL9B 4LF8J 1YZ6A 4CLKA 5B09A 3RBXA 3PG9A 2CJKA 4CLFA 1RI7A 3ZZ0A 4OI3A 4DSLA 1GTHA 1N32J 4D3HA 4QIFA 1SIZA 3GILA 2NUUG 4GC6A 3SCLE 2ZWPA 5DETA 1DTTA 2ZVIA 2C3PA 4RW6B 2HEKA 4OYAA 1Q7YT 2CA9A 2Z2LA 3CD5A 3PCOB 3LP2A 3K7RA 4X4TA 5KT7A 1JLAB 2ASYA 3SQGA 4MKBA 1LWFA 1U1MA 1SJFA 3GR1A 1UVKA 2DY9A 3I87A 1YBTA 2NQPA 4FZVA 3ET6B 1S48A 2KVQE 2PDAA 3PYGA 5THWA 2HKEA 2YKMB 3R7BB 2B7CB 1UZHA 7FD1A 3D28A 3OR2A 2XGPA 1OIAA 3J7ZT 3M6UA 1T9YA 5KFYA 3ZTOA 4BS2A 3Q8UA 4KC5A 4ZVFA 5KT2A 1IBKJ 2BE9B 1S57A 2WZ1A 4JUZA 2MQMA 4ZOSA 1Q8LA 1HQEB 3GYGA 3S6EA 2VV5A 3A1YG 2CJBA 4UOFA 1RT7A 3NWRA 2VKRA 2DISA 4NA1A 3GQCA 1RHRB 1T0TV 1T9WA 4CO2A 2M9KA 2KT2A 4X65J 1Y5LB 1H98A 4TLQA 5T7LA 1Y00A 5KOXA 2MKIA 3Q83A 4ECTA 4RWXA 3QJLA 1D1UA 1EP4B 2OIHA 5A8RA 2JOQA 4ZPVR 4C0BA 2E5IA 3CULA 3BH7B 3AB2B 4ETXA 2IC3A 2JZ5A 1NDPA 1CJKA 2I38A 4JI4F 1FE4A 2MKHA 2K1RB 4EBEA 4YMEA 4O0IA 2GQ2A 1RXOB 2ZD1A 5A76A 3NG8A 3ZZYA 4DG1A 1TL7B 2XSJA 4WFAQ 4C7QA 4KV8A 4K4SA 3FEXB 2KN4A 1YX2A 4R0JA 2CNOB 4EZ6A 3M30A 1PC5A 1R31A 3PW0A 1IXKA 2HPUA 1KOHA 2C3OA 2HQCA 2H4YB 1RHJB 2VOOA 3CEDA 4UF4A 3SZ2A 5HO4A 1LWXA 1BWVA 4BHQA 2CJAA 4GVBB 3CF5Q 4LSNB 2NCKL 2POKA 4HH1A 2J76E 3VAKA 1S72S 2HGLA 1NK4A 2XZDB 4U8VA 2QL5B 2YQ3A 4DU8A 1B99A 3SXLA 3DM2A 2GVZA 1Q86T 2DT9A 4FKXA 1YJUA 4YDXA 1AUSL 1VOMA 4PCQA 3E01A 5ETLA 2ZOGA 2WW8A 5D4OA 2G13A 3PKYA 2QJ3A 1LEOA 2DGVA 2MMYA 1LW2A 4ZVHA 1U2CA 4X66F 5J1PA 3QAUA 2A0FB 2MZQA 4DUZF 3D6TB 4IFYB 2GC8A 3IWXA 1HBOA 1XMQF 1N34J 2EBGA 1VC5A 3CJ5A 3UNGC 3UN5A 1HWLA 4W92B 4LFBF 5LSRA 3SFGA 1X4EA 4WFNQ 3IC1A 2QLWA 4Q8EA 4LIWA 3OSNA 1B0PA 2FHJD 2DR8A 5C2CA 3QGIA 4NLWA 2IRXA 2CWKA 2HAIA 3T1YJ 3EGWB 3P49B 4RNOA 1T03A 2H1YA 3CD0A 1HQ2A 1TAUA 1PJ5A 2HQFA 4LF9J 1JLAA 4HT7A 2V8GA 4S0MA 1JQGA 1KSPA 5DQHA 3JS9A 3TZZA 3BS9A 5LSOA 4FPRA 3C19A 1H3DA 2GJ2A 4HDHA 1M5OC 2YKMA 3TEHB 4YHHF 4B3OB 2B9EA 3KUEA 3ZZUA 4EBDA 3OXLA 1R7IA 4C8YA 2FVRA 1TTHB 2X1GA 2HQGA 1MLAA 3HF5A 1MN9A 3NCQA 5CD4A 5KFBA 4CH7A 1HQEA 3MI7X 3R9LA 2EBEA 1SC4B 2ADCA 3W2VB 1FRXA 2HWHA 2LEPA 1RWWB 3HDSA 1CULB 3R2DJ 1TMJA 5EDWA 2O5DA 5JXSA 3NOCA 3Q8VA 1FTRA 1YRUA 2XEXA 1RTJB 1HHTP 2XG8A 1EP4A 4IDKA 1WKLA 3DOMB 4DCPB 3OXGA 3W60A 3T9ZA 4Q2LA 1NPRA 5D15A 1FXLA 1R6VA 4J9UE 2HWIA 1FDAA 3G96A 5GMKa 1PCAA 2A3JA 2CQPA 3FC9A 3NEKA 3Q89A 2LFVA 3FEYB 1RT3A 1TL7A 2CUYA 2XCPA 3DLHA 5J2MB 1OPIA 1T95A 9RUBA 2FLNA 5FDLB 1REGX 1FJGJ 1FVQA 4WXWA 2VHGA 1NKEA 5KG7A 3RW7A 1VDHA 4WF9Q 1W2BR 4I2PB 2FIUA 2IPOB 2QSWA 3N01A 3TANA 3ZZOA 5A6PA 1K9MT 1FNOA 4GVBA 1VQLS 4LSNA 3ILIA 3NLCA 1B4SA 4LF4F 3DLGB 5D0RA 2CQCA 3HX9A 1UZDA 3D6HB 4P75A 2CNNB 3GYXB 5GAHU 4IOCQ 4XTTA 2OPQB 4ED8A 1QE1B 2C1EB 5KG3A 4QWBA 1WSVA 1T9TA 4GVLA 1NEEA 2PC6A 4NYPA 5AXMA 3U1MA 2E9TA 3MXHP 4UW2A 2BYCA 1UVIA 1S6PB 3KLGB 1HNZJ 3VAIA 2DTJA 2DH9A 3PIPQ 4KIAA 4IFYA 1D8YA 1LW0B 1HBNA 2GX8A 3R8YA 3BBBA 3NGKA 1T9XA 1G6BA 3T5HA 5LMUF 1TK8A 4TU8A 2IRUA 2OLWA 3WX4A 3OXFA 1X7VA 2LYVA 5KFPA 1RA6A 1SKUB 4DLGA 3OTOF 2IA0A 1VRUB 3ENWA 4WPAA 4FYWB 2J6SA 3AFGA 2Z58B 2W8LA 4G1QA 4MMOA 4JI3F 3MUMP 1B7YB 2CQIA 2VF3A 2V50A 4OHWA 4ECWA 1CC8A 4V19J 3DRPB 5L38A 3OVAA 4OJGA 4K4YA 2IFXA 3L95X 4TXSA 2IIHA 4B3OA 1ZM2A 2DRDA 4DQQA 3FBEA 4C8KA 3MPDA 2VFTA 2HBRB 2WVEA 2ZH3A 1PIEA 2GIRA 4ZJLA 1REVB 2RKIB 1KFDA 3QNWB 3PACA 4DWIA 1M5VC 3W2VA 4PAAA 3D6FB 2BUNA 1T7PA 2D3UA 2KHCA 3G9CA 1HQUB 3C16B 3FZBA 2FJWA 1BMQB 1BLUA 3OT9A 5CYQA 3QZ8A 1LNQA 3LP0B 3DOMA 4OZNA 1FRLA 2E5JA 2CYYA 4ALZA 2KU7A 2U1AA 3TRGA 2OEKA 4URGA 1TU0B 3T41A 4I1TA 1N33J 2GHVC 1A0OB 4HTJA 1APSA 2RQCA 1TV6B 5J2MA 4USVA 1F9HA 3IN5A 3J7Z5 3DNCA 1FERA 5AT1B 4PXDA 2MKCA 4YP3A 2FB0A 3IBWA 4WU3A 4OZ1A 4I2PA 4MIWA 3FRYA 3NMRA 3HSGA 3SDEB 1LWEA 4FXVA 2Q3PA 1ZH5A 3CJ3A 4URQU 2AWZA 3OW2R 1J27A 1FTCA 4ID5B 3M8WA 3DLGA 2CQ4A 2COLA 5H9FK 2NXCA 3LPEA 2EEYA 1Q5VA 2G0JA 1WEZA 3RG6A 3R5DA 4OV6A 1LQ9A 2B4PA 4ECXA 4U96A 1BY9A 2OPQA 2YVSA 1FKPB 1QE1A 1NDCA 3CCMS 1RSCA 1IQTA 2QX0A 3NNAA 3H20A 1JXLA 1HKAA 1UEVA 2RNEA 1RLDA 3BGOP 1D9FA 2ZH2A 1RB0A 2QGFB 2MLYA 3B8HA 3KLGA 2F8EX 3N5BA 3CJTA 2VFUA 1Q1KA 5J2PA 3DN9A 3CMAS 1OQ6A 2PMWA 4RZRA 3MM6B 5DM7Q 2BJ9A 4YFUA 4EK2A 4O3OA 1TL1B 4RLEA 4M5DB 4DX7A 2L41A 3OL9A 2VG6A 4DHVA 4RWWA 2UUBJ 2QG9B 3EGZA 4A4JA 5B08A 3RR7A 4AQYJ 5HANA 2OPPB 4NA2A 2ACYA 2V4JB 1TK0A 3LP1A 4LF7J 4CZCA 1CQMA 2ZITA 4D3GA 2AJ1A 4CLZA 4DR7F 2YY3A 3TUJC 5D78A 5KG0A 3CD7A 3OJUA 3C2PA 4DZDA 2RHQB 5JUMA 1RAOA 3TQEA 4UQGA 2ZBRA 2L3MA 1YJ9S 2KZMA 2VG5B 3TVZA 1REVA 3GV8B 4DV0J 2RH3A 3M8PB 1FRKA 2D3O1 4KPYA 4JV2A 3GPAA 1VIOA 2LQBA 3MURP 3K5MA 2I6WA 3OL8A 2RDDA 4Q44A 4LR8A 3AAWB 4RNMA 2ZDOA 4J9PA 1V3ZA 2CJYB 1T02A 3LP0A 5CZXA 4KB7A 5T14A 4N41A 1TKTB 2UVRA 4DFJA 4I6AA 5CA5A 4LRAA 2W25A 3C66A 1IKXA 4I69A 3DXSX 3ZTRA 3BKUA 1VQSA 1IBMF 5CH7B 4OX9J 1KVKA 1S0MA 2V69A 3MEKA 1LV5A 5I3QA 4TQRA 3S8SA 2XLJA 1TV6A 4LMZA 4AT1B 3J7AN 2UV8A 5M2UA 2H5JB 2HVIA 1VI7A 2YQ1A 2GJIA 3KDNA 2NREA 3QPIA 1Q8IA 3SDEA 3QRQA 1AB8A 4RO0A 1WHWA 2PIIA 2XMWA 4LSLA 1I5OB 3TR5A 2HS0A 4PUOB 4TY9A 1XJWB 4NLQA 4F0KA 4ID5A 1YIJS 4G65A 1F0XA 1RT6A 3DMJB 1DY3A 4DXLA 1Y7PA 4ZCIA 2VPZB 3MM5B 1KC8T 4PG7A 2QN6B 3AXMA 3G8QA 3K0JA 1UVMA 3PV8A 2VASA 1NK7A 4P9SA 1FKPA 1PC4A 2AT1B 3FGVA 1ZZNA 3V2UC 5A6WA 3BR9A 1GMWD 2JHEA 4DV5F 1I94F 4JI4J 5LOQA 2Y3YA 1FX4A 1MWZA 1FFGB 3H98A 1Y3JA 3H90A 1S7IA 3PX4A 2PFFB 2I5JB 4KHPF 2XZTB 4LF5F 2WVFA 3OL7A 2G0CA 4A48A 5LSLA 1QAJA 3C8YA 1PYOB 4OFZA 2P8IA 4PXCA 5D77A 3KLHB 2M0GB 1TL1A 4M5DA 2EI5A 3FRZA 2AHOB 2IM0A 4NI2A 3GG1A 2Y1JA 4WTYA 4WYWA 4F04B 4DQIA 4XO0A 3GV5B 3QIPB 3UD4P 3VGSA 2XGQA 5KG2A 3NGRA 2LEAA 2OPPA 1RGVA 2WHOA 2CPHA 1XNRF 4J9RA 4HI1A 2AJ4A 3ZFVA 2VBWA 1R0AB 4TN2A 5E3CA 3EXCX 4OHYA 1GAOA 4NYOA 2RMLA 5ITHA 1X5OA 1ZTTA 3IG1B 4F4KA 2K7KA 2XYGB 2XWXA 4J9KA 4J9OA 3P96A 4LJMA 1VQYA 3HM9A 3QGPA 4EO8A 4X66J 4QW9A 2HRTA 2O66A 5ETNA 4IO9Q 3W64A 1C4AA 4DUZJ 3V4MA 1W25A 3J7YU 2FJDB 1NH8A 3UDCA 1XMQJ 3M8PA 3CJRA 4MKVA 4ZVGA 1OYEA 1DZ5A 1OSCA 1RCOB 5LJ5Y 5L1KA 4K5RA 4RW8B 4LFBJ 4ZCLA 2P5VA 3EZUA 2Y1RI 1RACB 2MYFA 2C3MA 4CCHA 1RWNB 5J2QB 3EUNA 3AHPA 1O8BA 2OPRB 2GHWA 3KFWX 4MH8A 2BQRA 2FYXA 4RW9B 1DQ9A 1EZZB 1S1XB 4GRSA 4KPCA 4P10A 5HSPA 3OFFA 2UXDF 4OYWA 1VQMS 3F0NA 3POTA 5E3AA 3TJ9A 3PRVA 3L7UA 1SKRA 3UN2A 5CYJA 3NAHA 2HGMA 2MQQA 2XMJA 1IKYB 4ZPCA 3MR7A 3W61A 1UEUA 2KRRA 4ELVA 2UU9F 2BZ2A 4ZDNA 1RTHB 2DXEA 3ADAC 4CM2A 3AT1B 1FNMA 3C6TA 3JTPA 3ILLA 5DG9A 1BD6A 6FDRA 2HNYB 3DHWC 4FS2A 3VAHA 5KFWA 5KFAA 3DMJA 4NA3A 3MM5A 1X60A 2EWHA 4FYYB 3PIOQ 2RDJA 1R8CA 1HFEL 3MM9B 4IFVB 4WK1A 4BWJA 2DGQA 1OYDA 4CT8A 4R5PB 2RB7A 4DFKA 1MMNA 3CDUA 2MGZB 5F9NA 1SB6A 4L76A 2DNKA 3F73A 1VK3A 1UJ6A 3NAIA 2M8DB 3M05A 4F67A 1URRA 3NKYA 2I5JA 3KLEA 4EMDA 1M5KC 4RW4A 4IH7A 3A3NB 4NEZA 3R27A 4B9TA 3CMQA 3LANA 3BF4A 4FXDA 2FVQA 1NSAA 2MJNA 4EGLA 2KDOA 1Z1ZA 2BVZA 1HNVA 3KLHA 9ATCB 1N6QB 2C3YA 3A3OB 2RF2B 2XNQA 2JLGA 1YKWA 3DXBA 1HNIB 3US5A 5JVHQ 3Q8YA 3DU6A 1NK5A 2L9NA 3EWGA 4N8NA 1FKOB 4DV1F 2X1FA 3V6DA 2QLFB 4WFBQ 3PNIA 2RQMA 1MWYA 1QVFR 5HK4A 3ILJA 5LXYA 2YNIA 1IWGA 1R0AA 4DV7J 1HNWF 2BOPA 2P9CA 3D0HE 1T05B 2E9ZA 3TVYA 2HNDB 4IRCA 5KFIA 2XO6A 2LXUA 3IG1A 3F41A 3DGPA 3M9MB
chains in the Genus database with same CATH topology
2GMJA 4N76A 1S6UA 1P9QC 1UW4A 2DGTA 1MMLA 4JV1A 4DQPA 2W8KA 1YJTA 2LQJA 3F44A 5HI7A 1DTQA 4USHA 2AYGA 2YH0A 3Q8RB 1JWWA 1KNZA 2M2BA 2GGPA 2CQ3A 1KQGB 4HEA9 2R2SA 1AW0A 5DDRC 4X4RA 1T8EA 2WONB 4AFFA 2HW3A 3E8OA 3VWSA 3GZ7A 4DF4A 1M1KT 4ZK7M 2DH8A 3I0SA 4ICLA 2LXFA 3UI3A 1RYSA 3MM7B 2BW2A 3MTJA 3VTIA 1RTDB 1V9OA 3GB0A 1R89A 4F25A 1P1TA 3A8EA 1TKXB 2KT5A 3MFHA 5HROA 1XMOF 2BM1A 3BREA 2L9WA 3TO8A 1L3UA 1RT7B 2R8HA 3W7BA 3ITHA 1IBLF 3C3LA 2XHWA 2E7WA 2QLXA 5KFUA 3VCDA 2BDPA 1GT8A 3IWNC 3CJKB 3O1LA 2CPDA 2CQHA 4ZPTR 2WSFC 3CD6S 2Q43A 5EN1A 2XMMA 2JC1A 1RP5A 3MMAA 3QMQA 3HVAA 1YJRA 1S49A 1X4FA 2A2DA 2EW9A 3THPA 2ILYA 5T7LB 3RU0A 4QU7A 4KFBA 4NYZA 2AX1A 1G1XA 3GFZA 4PR6A 3CWJA 1Z2ZA 2FVCA 1P8GA 3NRBA 5F8HA 5A8WA 2DPJA 3KYLA 3MOZA 1C0UB 2RDIA 3G6VA 1LKZA 2HFNA 3W3SA 3P5TL 3MPVA 4YR3A 2GIQA 1WF0A 3N6NA 2XLKA 4ERDA 4JI5F 1UA0A 5J2QA 2DHXA 1WTFA 2MQNA 5A8RB 1N52B 4F26A 2FLOA 5IWAF 4MKAA 5AJ3F 2MQOA 3H2LA 1UP1A 1LWCA 5G4DA 2C2RA 2RUGA 5E3QA 4ZCKA 2OPRA 3MDFA 1QAXA 2HLUA 5DG7A 4DS4A 4NWBA 2KG1A 3H2UB 4YB5A 3BR8A 1XR6A 5EX3A 2BABA 5IXUA 4Q8FA 1N0VC 1VQKS 4ILMA 1O5JA 2KKHA 3LWLA 2ERRA 1HWJA 2DO4A 3BGRA 3F56A 5EWEA 2IM2A 2HHPA 5F8MA 4ZP7A 2G1DA 2W7PA 1HPZB 2K1RA 2R7VA 3HHLD 1VQ4S 1YG0A 2QA2A 3RW6A 3MFIA 4B9SA 4B17A 2ZD1B 1Q78A 4FBUA 1JLCB 2J7KA 4BC9A 3CIZA 3POTB 4NZ6A 4QZVB 3LGMA 4PPDA 4RUCA 2DHSA 2RT3A 5KFDA 1SBRA 3SMZA 2QA1A 4DG1B 2VC1A 4ED2A 4L72B 4Y2MA 4QWEA 3BJYA 4ZPAA 5CZVA 2PGCA 4ECUA 5LMNF 1JIHA 3DDNA 2ASLA 2XSJB 4RKUC 2ILZA 2FGCA 2V9WA 1UFWA 3MEEB 3G71S 3QLHB 1D0EA 2M88A 2LVWA 4OZ5A 3OUYB 1IKYA 1NRKA 2HWTA 2JEIA 3CXCR 1S99A 4F02A 1GTEA 2A18A 3UCZP 1HMVB 1N5VA 3SEOA 1R6YA 3HLUA 1SL2A 2C42A 4LVNP 3X1LB 2DNNA 3BB5A 1DARA 3UR3C 1YRTA 1SV5B 1UKUA 4ZMMA 4DL4A 4IH6A 3QYYA 3OR1B 2Q6CA 2D3OR 2FD2A 2OFHX 3L3CA 2YNHB 5K9FA 5I42A 4MK8A 3V6HA 4Q7AA 5D4PA 1XWLA 4KE5A 3C6TB 2HVHA 3OVSA 4B3SF 2JLEA 5AE3A 3LWMA 3ISND 5F3ZA 3JSMB 3K5PA 4YR2A 3K59A 5DDQC 4DMZA 2DD8S 3K5LA 1XERA 4HVZA 1KONA 1VS3A 3FMBA 3I96A 2PA8D 5KFMA 3BQ0A 4QR1A 4NLGA 1TQLA 2FHJA 4ZP6A 3MD3A 1RT5B 4J9SA 2A10A 4WZMA 1PSDA 1UAWA 2ZE2B 4LVOP 1GX6A 2GNKA 1VQ8S 3OTDA 4AQYF 1DRZA 1IKWB 3NMAA 1F5AA 3DRXA 4JBCA 4XPEA 3T5KA 2B43A 2XS2A 1NH7A 3GFYA 1XMBA 4R5PA 1FF2A 4LT6A 4B9NA 4WFZA 4K4WA 4B9LA 4LF7F 4C3LA 2Z0GA 4ECVA 1N56A 4QBUA 4IQXA 1LFPA 5E41A 3RBEA 4FS1A 2W9BA 2DIVA 2R2RA 2CIMA 1MNEA 2B6AB 1JNZB 2M70A 4EYHB 2D1CA 4IUFA 4N8OA 3MEDB 3DM2B 4PWDB 4F50A 4U6PA 1S79A 2CQ2A 2HFOA 4KO0A 4B3MF 1U26A 2CVIA 3S7RA 2LDIA 3MHYA 3CDEA 2G9OA 4P7TA 3J80Y 5A0YA 4DJBA 2CQ1A 3UW1A 4DSJA 2YTCA 3PR5B 3H4DA 3VZIA 3IGNA 3OQ2A 2DHAA 4X4VA 3FFIA 1PGZA 3KLEB 3KK2A 5D3GA 4RW4B 4H4MA 1XTZA 3MAQA 1N8RT 1SUQB 2KTQA 1HWIA 1QY7A 4JI0F 3MR6A 1LW2B 4IRDA 1N5QA 3JYTA 2CPFA 3M32A 4NLYA 4PXBA 3R3TA 2K7JA 5A8KB 5H9EJ 1RT1B 2DB1A 1N5SA 5B0AA 2NYIA 1H7XA 2HS3A 2J9DA 2P6TA 4WKYA 1LOUA 2YKQA 4O23A 3GFXA 5B09A 2ZZNA 5F3TA 1FRJA 5KT5A 2JX2A 2CJKA 1HNVB 4WE1A 1RI7A 1R8AA 4TU9A 1ZPWX 2PE8A 4NZ0A 4DN0A 5HQ8A 1J2VA 1X0PA 3ZZ0A 4OI3A 4DSLA 1VIXA 1N6QA 3WBZA 1GTHA 2MZTA 2ZH4A 4D3HA 4Y28C 2QE5A 4IR1A 2BXJA 5D4LA 3TVKA 2WTFA 1S0VA 2ZJQQ 4QIFA 1SIZA 3GILA 2NUUG 4ZS6A 3R5CA 2ZH7A 4YY3F 4EO6A 5L39A 1BQNA 1ZM4A 2YKPA 5CYMB 2R7WA 1CLFA 2IRYA 4GC6A 5KFGA 3SCLE 2R8GA 1YI2S 4ZP9A 4FVMA 4KGKA 1S1WA 3BGLA 1YWXA 4ZP8A 4XDCA 4J9LA 2MPUA 5BYRA 2CPZA 5DETA 5H9FJ 1VQOS 1DTTA 1JK9B 2C3PA 3DLEB 3TAMA 4O44B 4RW6B 3V6DB 1H0HB 3BSAA 2KFNA 1Q7YT 4KRWA 1U1OA 2Z2LA 1SJQA 3CD5A 1X4HA 4G1PA 4NLSA 1QSYA 3J7A1 3PX6A 2QFJA 1B64A 3B4MA 4EWTA 4M8LA 5L9NA 3DI6B 3W2WB 5H1SV 3LP2A 2E5LF 1I6JA 4U7CA 2PI4A 2KJWA 3KMQA 2V8VA 3KLFB 4TYBA 1IQZA 4X62F 3K7RA 1FT8A 4X4TA 2Z4PA 1JLAB 2ASYA 1D9AA 2YNIB 2UV8G 5KT7A 3SQGA 3FEZA 4MKBA 3I31A 1S9EB 4URSA 3Q8QB 1LWFA 4J9MA 1U1MA 4OJHA 3CC7S 1SJFA 2J0QD 3GR1A 3CPWR 4OI4A 1UVKA 3DLKB 5K14B 2V4QA 2AF6A 3H40A 4FBTA 2ADBA 3I87A 2NQPA 3K2YA 2DNLA 4FZVA 3ZZZA 1S48A 2QMWA 2F40A 3PKMA 4IG3B 1C2PA 3SI8A 2UXBF 2PDAA 2DRAA 3ENVA 2EFGA 3HHLA 4RBUA 5THWA 5GAGI 3H59A 4TY8B 4OX6A 4RUHA 1FJGF 3CJ4A 3HVTB 4CH1A 3MZIA 2YKMB 2B7CB 4ID8A 7FD1A 4ECYA 3D28A 1VC6A 1G2EA 2VD3A 3OR2A 4UY8T 2FDNA 4I7FB 4ECRA 2XGPA 1OIAA 3G6XA 4M95A 3J7ZT 3M6UA 5E5NA 1D9DA 4IKAA 5KFYA 3V81B 2HHSA 3BM7A 1DTQB 5L1LA 2HG4A 4BS2A 5F8IA 4YR0A 2R7XA 2GA7A 2HYIB 3CCTA 2WSEC 4KC5A 4ZVFA 1HBUB 2UUTA 5DRKA 2NZ4A 4OI1A 5KT2A 1NJZA 1KLNA 2ASJA 3I0SB 1KEKA 4JUZA 2MQMA 2WONA 4ZOSA 1X9WA 3KHRA 2ATLA 1Q8LA 1HQEB 3OPKA 4QWAA 2GFFA 3CCUS 4DX8H 3L09A 1UJ5A 5BJRA 5HROB 3S6EA 3X3UA 1TKXA 4OV1A 2VV5A 3A1YG 4XDDA 3UPFA 3AB4B 1ZETA 2CJBA 3N5FA 3KHLA 1RT7A 1J5EF 3OLAA 2UP1A 4JYAF 2ZHAA 2VKRA 3ZC4A 2DISA 4NA1A 3GQCA 2DHGA 3MMAB 2VONA 5IS2A 2ABYA 4CO2A 3SV3A 2M9KA 4M1KA 2KT2A 1YBAA 1KLMB 2LQ9A 1Y5LB 1Q81T 3K58A 4KTQA 1H98A 4TLQA 5T7LA 4QR2A 1K1SA 1Y00A 5B0BA 5KOXA 3EYZA 4ILLA 4MIBA 4A8XA 3QO9A 1C0UA 2MKIA 4ECTA 4RWXA 2OMOA 2KH9A 2MY8A 2JEJA 3QJLA 2JC0A 1QVGR 1D1UA 1EP4B 2ZC4A 4RW7A 3FSIA 1RTJA 5HP1A 1LWCB 4MYUA 2JOQA 5A8RA 2OIHA 4ZPVR 4C0BA 2HMIA 2E5IA 3CDAA 2UVWA 2VG7A 3CULA 3AB2B 4ETXA 2RRNA 2IC3A 2JZ5A 2LMIA 3T19A 3TX8A 3CT9A 2CPIA 2QYCA 3R1HA 2I38A 2PSZA 1FA0A 2RVJA 1FE4A 3BGRB 3SSQA 1S9FA 2MKHA 5DS7A 4JI4F 1T94A 3PX0A 4KHRA 2K1RB 3D1OA 4EBEA 2R8IA 4YMEA 2N82B 4IH5A 4O0IA 1N4LA 2LDYA 2GQ2A 1CG2A 1HNZF 3BO4A 2AYMA 3NNHA 4OJ3A 2ZD1A 4FXWA 3DYAB 2X51A 2ZOFA 1JLCA 3NG8A 2R2TA 1GQEA 1LXJA 4P6QA 5MAOA 5D6GA 2FLLA 5KFSA 4J9PA 2ROGA 3ZZYA 2M5YA 3LW5C 4DG1A 1U24A 2WRMA 4QPTA 3G6YA 2XSJA 4WFAQ 4C7QA 4KV8A 1TFWA 4USJC 3FEXB 4K4SA 2KN4A 5FDLA 1HR0F 5DO2A 3OUYA 2AX0A 3QGGA 1ZZFA 1Y5NB 4R0JA 3T5LA 4FN5A 2PA3A 1HMVA 4EZ6A 1D8ZA 3M30A 1PC5A 5D4NA 4ECQA 1R31A 4CO3A 3PW0A 1IXKA 1U6ZA 2HPUA 4HH0A 1KOHA 2C3OA 4NX9A 2XCAA 3OR1A 1VC0A 2VOOA 2F3JA 2YNHA 3CEDA 1UL3A 1ZAXA 2FVPA 4XPCA 2E5HA 3MMCA 2HRYA 3QZ7A 1ZTWA 2IVFB 5HO4A 2K3IA 3SZ2A 1IUJA 4Z2XA 3PW5A 4B9UA 1VQNS 1CEZA 2ASDA 4BHQA 2CJAA 3CF5Q 4LSNB 3TAPA 4NCGB 1DAXA 3CIMA 2OTJS 3H5YA 5BYQA 2POKA 4HH1A 2J76E 3VAKA 1SH0A 1S1TB 2ZE2A 2EK1A 4YB7A 1S72S 1IKWA 2X1BA 1OSDA 1O0PA 2IBOA 2ZHOA 4QWDA 3Q22A 1X0FA 2QO3A 2IJNA 4DV2F 1HNXF 2HGLA 1RA7A 1FDNA 1NK4A 3TI0A 3VAGA 3N6MA 3TA0A 4ZHRA 3AJ2A 3GR0A 1S0NA 2ZH5A 1HHSA 2FJAB 3CCQS 4F3QA 4KGMA 2BQUA 2W4DA 2YQ3A 2KYZA 3C6UB 4X4PA 3SXLA 1FXRA 4KAIA 2UUAF 2YWKA 3DM2A 4R0EA 4LFAF 2KXFA 2DT9A 1Q86T 2IMWP 1YJUA 4PWDA 2JDJA 4YDXA 1VOMA 4YB1P 4MAKA 4PCQA 5A0YB 3E01A 2XY5A 2V0NA 1MROB 2WBMA 3HHLC 2HQ3A 4TQSA 3THVA 2ZOGA 1XEZA 3K5NA 2WW8A 1V3SA 5D4OA 4ZPDA 3KK2B 5D3GB 2G13A 4H4MB 3PKYA 2EKYA 3K8VA 5LT5A 1UETA 1M0SA 2GQQA 1SUQA 3JYTB 2FUG9 4RNHA 2DGVA 1F5BA 2B0GA 2MMYA 1LW2A 4ZVHA 1C1BB 5IQQA 4X66F 3BSCA 5A8KA 2XI3A 1RT1A 3FNNA 5J1PA 2W9AA 2DRBA 3QAUA 1UVJA 2QZ8A 1RT2B 2MZQA 1S6PA 2BRKA 2RJZA 4DUZF 4TNOA 2KFYA 2D74B 2OH2A 4IFYB 2RU9A 4WE1B 2GC8A 3IWXA 5E2QA 2CVEA 1HWUA 4DR5F 1VLYA 4U7UK 1HBOA 2OD4A 1LW0A 2IMOA 3G86A 1XMQF 3IO1A 2EBGA 5FJ4A 4F2RA 1VC5A 3HHKA 2J0SD 3PR4A 3CJ5A 2F9JA 4OI2A 2XB2D 3RAMA 3OTEA 3UNGC 1LFWA 3H5UA 2WAQD 2CQBA 2DK2A 1WD6A 5AXKA 3I56S 2YX1A 5K5MA 2VOPA 3GV7B 4OZLA 1HWLA 3I5AA 5CYMA 1QUVA 4X2BA 5DJBA 3ISNC 4W92B 5DGAA 2AQ4A 5B0EA 4H4OA 1L3VA 4LFBF 1BWEA 5LSRA 3V5RA 3SFGA 1X4EA 2DGXA 4WFNQ 3IC1A 2QLWA 4QU6A 4Q8EA 4LIWA 3OSNA 1B0PA 3G8TA 2FHJD 3CCZA 3BQ2A 3TAMB 4DQSA 2DR8A 3QGIA 3ENQA 3DLEA 2IRXA 4NLWA 3L7PA 4O44A 3RAXA 1YJVA 2HAIA 3P49B 3EGWB 5LXRA 3MGJA 4RNOA 2XO7A 5KFJA 1Q4RA 2KXHA 1T03A 4NLTA 3C46A 2GMLA 1VRUA 3LP2B 3CSKA 3CD0A 3OHBA 4Y2IA 2F4VF 3W2WA 1TAUA 1C1CB 1IKVB 4RNFA 3KLFA 4C8ZA 1F9FA 3FQKA 1HARA 1LWFB 1JLAA 2M52A 3NS5A 4HT7A 3FJ2A 2RU3A 1UJ4A 1P1LA 1HWKA 2VPWB 1KVIA 2V8GA 2P9GA 2AU0A 2M8HA 3DLKA 5K14A 4EEYA 2VZ9A 2B4UA 2AJ0A 2ZOMA 4YB6A 1KSPA 4TKTA 5DQHA 1NZAA 1HL6A 3I5CA 4JV5F 2P6SA 3BS9A 3CB4A 1TFYA 4IG3A 5D8HB 4ED6A 3DHXA 5LSOA 1JJ2R 3DLJA 3BGUA 2ZH8A 4DF8A 4TY8A 4FPRA 4X4OA 3HVTA 1H3DA 4X4SA 2GJ2A 4HDHA 2OPSA 4ATNA 1K73T 1M5OC 3OR2B 2KO1A 4C97A 2YKMA 3DRPA 4X64F 3G4SS 2DR7A 2AJQA 2H5EA 5KTQA 1U1PA 1J5OA 3FSYA 4I7FA 4YHHF 4H54A 3PFEA 4B3OB 3M6VA 3L7OA 3V81A 3GIMA 2VFRA 3ZZUA 4EFAC 2PN6A 4EBDA 3OXLA 3PHEA 4NRTA 2RRBA 3H2VE 5B0DA 4K4VA 1R7IA 1TL4A 5HLFB 1YGYA 4C8YA 2DNYA 4OZ0A 1HBUA 2FVRA 4C8LA 2X1GA 4RBVA 1NJIT 1C4CA 3HF5A 1NK8A 4A8WA 3WC0A 3NCQA 2WCXA 5F8NA 5KFBA 2GO9A 4CH7A 5KFQA 2BR0A 2RSQA 2JH3A 1X4AA 1HQEA 3MI7X 4Q2MA 5L8RC 1RAJA 4I67A 2EBEA 4AE5A 2FHMA 2ZBIA 3IAM9 3CUNA 2FHOB 4GKKF 2VKZG 2ADCA