4OV1A

The crystal structure of a novel electron transfer ferredoxin from r. palustris haa2
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
66
structure length
66
Chain Sequence
MLTIHVDQDKCQGHARCKALAPELFDLDDYGNAHEKGDGVVPADLIDKAWLAKSNCPENAIDITED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Putative ferredoxin
publication title The structure of a novel electron-transfer ferredoxin from Rhodopseudomonas palustris HaA2 which contains a histidine residue in its iron–sulfur cluster-binding motif
doi rcsb
source organism Rhodopseudomonas palustris
total genus 12
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2014-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13459 Fer4_15 4Fe-4S single cluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ov1A00
4OMFG 2FJDB 1PC4A 2O01C 1GTHA 1ROFA 1RGVA 2FGOA 1SJ1A 1AXQA 2PA8D 2FJEB 3MM7A 4KT0C 4ID8A 2GMHA 3MMCB 1DAXA 3MM8A 1F5CA 1DURA 1B0PA 1GTEA 1IR0A 2C3MA 1Y4ZB 2Z8QA 2VKRA 3IR7B 3MM5B 2PMZD 1FRLA 1SIZA 1GAOA 1JNZB 2UZAA 4OV1A 1D3WA 3MMBB 1FRXA 2WSEC 1KQGB 3MMAA 3OR1A 1WTFA 2VPYB 5BYQA 7FD1A 3MMAB 1G3OA 2FJAB 2ZVSA 4XDCA 1BWEA 1B0VA 1BC6A 5CH7B 1SIWB 5BYRA 4DHVA 1FRMA 2V4JA 5CHCB 1C4AA 3MM7B 3IR5B 3IR6B 1B0TA 1FRKA 3MM8B 4XDDA 2V4JB 4CI0B 1JNRB 1GT8A 2WSFC 1Y5NB 1FF2A 1VJWA 1FRJA 3GYXB 5BYSA 5E7OB 2C3PA 2IVFB 7FDRA 1XERA 1R27B 3OR1B 3EGWB 1BQXA 6FD1A 1K0TA 3PNIA 1F2GA 2C42A 2WSCC 3OR2A 1A6LA 1BD6A 2FJBB 5L8RC 1H7XA 4YDDB 1JB0C 1PC5A 1H0HB 2FDNA 4XK8C 1FCAA 2VPXB 4Y28C 2XSJA 1F5BA 1FD2A 1KQFB 3HKZD 3MM6A 6FDRA 1FDDA 4AYBD 2C3OA 4L6V3 1FDBA 1FERA 3LW5C 1G6BA 2PDAA 2FD2A 2GMJA 2VPWB 3EXYA 2VPZB 1FTCA 2Y0SD 3MMCA 1BLUA 3EUNA 5FD1A 1C4CA 2C3YA 1CLFA 3MM5A 1Y5LB 1HFEL 1FRIA 1H7WA 2WAQD 2WB1D 2V2KA 1H98A 1IQZA 1FEHA 4RKUC 1DFDA 3OR2B 3MM9A 3MMBA 1Q16B 1KEKA 2C3UA 1FXRA 1FDAA 3MM9B 3C8YA 1FXDA 2XSJB 1Y5IB 3MM6B 1FRHA 1FDNA
chains in the Genus database with same CATH superfamily
1FJGJ 3PHTA 1UVLA 4MIBA 1S1VA 2HRTA 2M88A 3IR7B 3KK2A 2ASJA 4ZS6A 2K1RA 2VBXA 1IKWB 3M8ZA 2JLGA 4ZPCA 1HHQA 1HI8A 4GVLA 7FD1A 2MQOA 3RW6A 2XHWA 4NYZA 4DMZA 2DNPA 3H20A 3O8WA 1T0TV 2ZJQQ 1UPMB 3LAMA 2BEFA 1VYAA 4LRAA 3F0NA 3VVTA 2V34A 4AQYF 4RW4A 1VC5A 4LQ3A 2ZFHA 3GONA 4ZPVR 2CVIA 1S9EA 1EQ0A 2UXCF 3LPEA 1B70B 2CJ9A 1Q0NA 3OL6A 3EX7B 2NUHA 1S9FA 4OYMA 3B4DA 3IS9B 5DDQC 3RUBL 3TA0A 3OVBA 4URQU 2OPPB 2CUYA 3JYTA 3PEJA 1U6FA 2XBPA 1G4CA 5KFXA 4B3TJ 4B3OA 2MDAA 4NLPA 1OYEA 2BRLA 1IBMJ 2D3UA 1X5TA 2YPZA 3I87A 1U26A 2BX6A 2FJEB 3DGVA 1D0EA 4ZIWA 3OQ2A 1V3SA 1P8GA 4FXWA 4KGMA 3FQLA 5IOLA 3FC9A 2E5LJ 3SV3A 2C2OB 2KRRA 2QGFB 3KFWX 2D41A 1WHYA 1NDLA 5KFFA 4AXIA 1B0VA 2XB2D 4K0KF 3PRDA 5IV3A 2GO8A 3NOCA 4F67A 3QWPA 2KG0A 1Q81T 3OTEA 4FBUA 4QU6A 4M5LA 4YS2A 2IDEA 3ZZOA 4BS2A 3VAJA 3C2PA 3KK1A 3OW2R 3E01A 2BE2A 3W9JA 4DPTA 3M9MB 1L3UA 1RAIB 2DD8S 3R5GA 2KT3A 3C6TA 2FQQB 4P9SA 2MLXA 5LMUJ 3CEDA 3WZ0A 2ACMA 3D5MA 2R8KA 2L48A 3MFHA 4C11B 5MLCV 2R7OA 2W2NP 2JDJA 1ZM3A 4KT0C 3PW7A 2R7WA 1IBCB 1A0OB 2PMZD 1TELA 1RABB 1SV5A 3QRQA 4NZ0A 2A1BA 2RNEA 5T7LA 1TKTB 3DXSX 3K58A 3PX4A 3KMSA 3MECA 2RRNA 1IR1A 1FRKA 5DM6Q 4WTYA 2XMWA 3S1TA 3TOQA 2IVFB 2OMLA 2JHEA 3BYPA 1BWVA 2B4OA 4RW9A 3CJ8A 1KVIA 5D4LA 4EBDA 5D4NA 1T3OA 3EPGA 1SC6A 4AL6A 1G7CB 1LW2B 3BN7A 4X4VA 3HVTA 4PRFA 1HBNB 2FD2A 4GVBA 5GADI 2L9DA 5C42A 2MQNA 4X4NA 3NCRA 1Q1KA 4Y0FA 3BPSP 2UP1A 1RZMA 4RNNA 3IN5A 4FYWB 1J5EF 5ETSA 3TJ8A 1UMJA 2OJ3A 3CDAA 1PJ6A 4M5DA 5ETNA 2ADCA 4HDGA 2Y0BB 1HBOA 2C2NA 3GU0A 3FSXA 3ZTPA 1R0AA 4PABA 3A8KA 4LR8A 1V3ZA 1YJRA 4NLGA 4DV3J 1JLQB 1R43A 2IRXA 4ZVRB 3VAHA 4B3RJ 1CQMA 1RBLA 3VQTA 1XC9A 1ZPVA 4ZCKA 4O3NA 1YKWA 1YGYA 1TL3B 4U96A 2V68A 4LF4J 4K59A 3G6YA 4C2MA 1AZSB 4F3QA 1M5KC 2MJUA 3TZXA 3LP1B 5F0UA 4O4GB 5EWGA 3GSDA 4PG7A 4AXJA 2MQ8A 2VICA 2Y0SD 1VBKA 4FNIA 2RKIA 4ICLA 3HFZB 5G4DA 4NXNF 3PYEA 1H98A 2KG1A 2CQ1A 3GLJA 5B0EA 4YP3A 1ZTWA 3SIPB 1F9HA 5ETPA 3PJXA 5E33A 3GWCA 3U1MA 3VTIA 3LWLA 3EGZA 1S79A 1UVJA 1RACB 2V94A 2E5IA 4UUXA 1KLMB 2F8MA 1QJHA 5GAEI 3M6VA 3L09A 2BJDA 5DDRC 1D9DA 1S7HA 3VWSA 4Z7CA 2FJAB 1MSWD 3NKYA 3DI6B 3VVUA 1RT2B 2X1GA 3HD1A 2G0JA 3LGHA 1F2HA 3V5RA 2MKSA 4C0OC 3QMQA 4YFUA 2IM1A 3PM9A 1Q86T 4J9QA 3DNCA 2ROGA 1SL2A 4CM2A 1H2UX 4JI6F 4OZ2A 2B7CB 2QN6B 4QR0A 1SB6A 4IOBA 4P7VA 3J7A1 3HD2A 1S72S 2NPFA 1UL3A 3GCWP 3ENQA 2Y9HA 3R2DJ 2KXFA 4DLGA 2CPIA 4YB7A 2PO4A 1S99A 4Y2KA 1XNRF 2Z30B 2CNNB 5T41A 4CLWA 3H5YA 1TKZA 3MMCB 3OLAA 4KRWA 2FVPA 1CJTA 3G86A 4USIA 4XIUA 5A2QU 1LWEA 3QIPA 3MPUB 1F9FA 3A1YG 1U47A 1VQYA 4DR6F 2HS4A 1DZ5A 4QBUA 3IFEA 4HI1A 2WOMA 2CPZA 4XDDA 4ID5B 1YBTA 3H5UA 2WVBA 2H4WB 2OLWA 3I5AA 5SUHA 4FYXB 3Q22A 4ITSA 2C1EB 4NA1A 1RHMB 4OX8A 5DS7A 3ZZTA 4ZPTR 1X4EA 3PIOQ 2YQ3A 1SJQA 3JSMA 2HMIB 4BWMA 3MUMP 2LQ8A 3H7HB 2Y3YA 4FKXA 2MGZB 2ASDA 2V4QA 4CT9A 4IH7A 3IBWA 1I94F 4FVMA 1K73T 4BC7A 1S0NA 2CPJA 1PC4A 1ZH5A 4DL6A 5J1EB 1NUEA 2W25A 5LOQA 3V6KA 2VKRA 1T9XA 2V50A 5IZHA 1NZAA 3CXCR 3DFEA 2R7UA 4UY8T 3UI3A 4U8YA 3MMBB 3WHIA 1D8ZA 2RRAA 5BYQA 1NZ8A 2CQ4A 4DPXA 4QCLA 2VG7B 4XDCA 1T05A 1BC6A 1N33J 2HK2A 4IG0A 2Q6BA 2U1AA 3FSYA 3CJQA 3UN3A 5EX0A 1NJZA 2M7SA 2KVIA 5LXRA 3N9UC 1LKZA 1UA0A 1JJHA 3CCQS 1XMQF 3HVAA 1WG4A 2YNGB 4E2FB 3GIKA 2CWKA 4PUOB 4IR9A 1X4BA 3RGIA 1RI7A 4ECXA 2ROEA 3HDSA 1M5OC 3HHLB 5DGBA 4DL5A 1IM4A 3NCPA 3U1LA 5K14B 1SQGA 4DV1F 3O1LA 3I82A 3PTWA 4YR2A 3LOUA 4MKVA 2VA2A 1OMSA 5J2NB 1RTJB 4DCOB 4KHPF 1HMVB 4Y3CA 5L38A 1HBUA 2RSQA 4PR6A 1RU1A 4F26A 3J80Y 3G4SS 1YRUA 1WF1A 3CD0A 4ZPWR 3RR7A 1VQOS 3NBPB 1SI9A 3G8TA 2B9YA 1R8BA 2BACA 1FFSB 2HFOA 4LFCF 3L7UA 3KLEA 2VOPA 1PBUA 5LSOA 2RHQB 3FCHA 3TJ9A 2BR0A 2C2KB 5L1IA 1VQ9S 5EHHA 1OY6A 3HPOA 2UUBJ 1VRTB 1R0BG 3Q8UA 2YNFA 4DF8A 3CCLS 4KO0A 1IXKA 4IFYB 1NSQA 5M2RA 2LQJA 1RISA 1TAUA 1F5BA 4N5SA 4X4RA 2Y1JA 1DARA 1TK5A 4A47A 3CO0P 2KFNA 2V63A 2CG8A 2VFTA 2QMXA 2M4MA 4F36A 3HHEA 2CJQA 1N32J 3MTJA 2YWGA 1VRUB 1UKUA 2M9KA 1XJWB 1IVZA 4OI2A 4WFYA 2OPSA 3W5YA 4C3LA 1RT6B 2IAJA 3MEGB 3A8IA 2G2OA 3CCUS 2Z8QA 3MCSA 4EO6A 5CAAA 1V5IB 1XNQF 4CT8A 1SIZA 3RB3A 4ZVGA 1ZOTA 1KVKA 2J8AA 3M1VB 2IM0A 1S5ZA 1ZBTA 1RT4A 3Q2SC 3PX6A 3TP2A 4DQPA 3A8EA 1QSLA 1FRMA 1ZS6A 3DGPB 2FHMA 3PFEA 4WU3A 3PRBA 2UUAJ 4WE1A 2HLUA 1U09A 1H2TZ 3MPYA 3QAUA 3I0RB 3I9V9 4ED1A 4W4MA 2P9EA 1F60B 2YKAA 3GYGA 2BQUA 5B09A 2F3JA 2X7IA 2KI2A 2BM1A 2QFJA 1T02A 4ZCIA 3VGVA 1I1GA 3V6JA 3PV8A 2ZEJA 3VGTA 3SSSA 1S9GA 2AKWB 4IRKA 2W4DA 1SL0A 3IXQA 1NH7A 3TR5A 1FDAA 4QW8A 3H90A 4DLEA 1FE0A 4DU7A 4U67Q 5F8JA 1K1QA 2FGOA 1AXQA 3T6BA 3PKMA 2E5GA 2IJNA 1U6ZA 4GKJJ 1FXLA 3TUJC 3C3LA 3UD4P 5F8HA 1LWFA 1RQ0A 2RAQA 2OSQA 2G0CA 4F0MA 5HL7Q 4Y65A 4ECRA 3PO5A 1S1XA 1VMBA 2OTJS 3W2WB 2DHGA 4PG4A 4QW9A 2QIFA 4WXWA 2HVEA 5B0BA 2YNIA 3CMES 1HQUB 2CA9A 2CFXA 1BY9A 1TR0A 2LU2A 1Q8LA 1S49A 3S01A 3DOLA 2RS2A 2B4PA 3WC0A 2CNOB 3GJSB 3ILLA 4R0EA 2XNQA 1NJIT 4K5SA 1O6XA 3CB4A 4RLEA 4K4ZA 1NEEA 1TKXB 4RW6A 2ZH4A 2UVUA 3ZZRA 4QWEA 2JOQA 1KOHA 3MR2A 1PKUA 4ECVA 2UVRA 4RU2A 4YEAA 2VF3A 2BKOA 4LSLB 3H59A 4LFAF 3QLHA 1WHVA 2JLEA 2XZWA 1WG5A 2DVIA 1FJ7A 3TA1A 1FO1A 5HP1B 1FT8A 3K89A 3W5XA 5BXIA 1YZ7A 4F0KA 2ZZMA 4HL9A 2VC0A 5HLFB 1LFPA 4H4MB 4ATNA 4FS1A 1C0TB 5HMXA 4UY85 2W2MP 3QATA 5F9NA 3O3LA 1RT5B 3SDEB 1CJKB 2ZWOA 4OZNA 4IRDA 2XNRA 1N34F 1DHMA 1MN9A 4ZVEA 4NEYA 1UZDA 3DLKA 2J6TA 5CQGA 3PZPA 3BH7B 1E6VA 3CCMS 4QPTA 5C24A 4YY3J 4USKA 3T6JA 4PG6A 1BXNA 1IJEB 3CCVS 1E6YA 3QQCD 4DX8H 1AW0A 3HKZD 6FDRA 1UZHA 1KQSR 1FJCA 4KAIA 2FHOB 5C25B 5GVQA 2BKPA 4BLGA 2OO4A 1X31C 4NRTA 3DM2A 5KFJA 4OLPA 1R3NA 2XLJA 2V2KA 2DB1A 2AW0A 2B8PA 5FDLA 2C22A 5B0GA 1DRZA 3DDNA 4TY8B 3D6MB 2W9BB 4JI4F 3DRYA 2OEMA 1RB0A 3SCLE 4N76A 3PCOB 1LK7A 2IHR1 3BS9A 1X4CA 3QJJA 1QDUB 2ZBRA 2PFDA 5KFTA 2ALZA 2W7AA 3DRRA 2JLFA 4UQGA 3KTQA 4I6AA 4J9NA 1HKAA 1GMWA 3R5CA 4G1QA 1X9MA 4PYAA 1JLBA 3A8JA 2I5JA 4CP5A 4P74A 2HZAA 3HHDA 4KKOA 1U0HB 2GV1A 5K8OA 3BGUA 1QSYA 4RJVA 3PRVA 2BMBA 1TUWA 3OJSA 3BR9A 3DDIA 3L95X 3K5LA 4XPCA 2AJFE 1ZAVA 2NR0A 3J80U 3BGOP 4OI0A 4MH8A 4UQTA 3HI9A 1V6HA 4HTIA 3N6MA 4ERDA 4Y6IA 1JK9B 1J27A 1QVFR 1RK8A 5HROB 1TQLA 1ITPA 2FPHX 2OPQA 4F4ZA 1DTQB 3FBFA 3OPKA 1FWLA 2HWHA 3AQOA 1NSKL 1NBEB 3M6XA 2DGWA 3OTDA 4IYQA 3KUHA 3FEZA 2PIIA 3LALA 1QUPA 4FYVB 3LH2S 4KSEB 8ATCB 4LSNA 4RPFA 4DG1A 5KT5A 4HH0A 4ZP9A 3GILA 2GZOA 2RILA 3OXGA 2E29A 3V4IB 1XR6A 2MXYA 1I3OB 3ET6B 3NS6A 2HNZA 5GAHI 1Y11A 8AT1B 1BQMB 4YQWA 3EUNA 1NMEB 1LQ9A 4FN5A 3NNHA 4U7CA 2CXEA 4DDFA 3BO3A 3OR2B 2FHJA 5F8GA 1O5JA 4RL1A 2V2VA 3M2UB 4EUVA 3RW7A 1W25A 2KJWA 3BSOA 4TVAB 3TZZA 3AODA 3A4TA 3DCAA 4ZPAA 4ZP7A 1VQSA 3DLEB 2R7VA 1VK3A 3OR1A 3C14B 3R6GB 1NH8A 4MJKA 2R8HA 3VALA 1WC6A 2HNDA 1RSCA 2PEHA 2DRBA 3UVJA 3MTKA 4GO7X 1QAYA 2QL5B 3US5A 2ZH8A 3OTOJ 4CCHA 1FKPA 1X5OA 5HATA 4CLTA 2ZE2A 1S6PA 5D0EA 3DHWC 2XYPB 1XEZA 4ZLLA 2UXCJ 2M2BA 3SI8A 2K3KA 4V19X 2XZDB 4K4TA 1CJVB 4FNHA 5BR8F 3SEOA 1KN6A 2WW8A 4KE5A 5DETA 1WI6A 1UVKA 2L41A 1NM2A 1YJ9S 2AYMA 4ER8A 3VHQA 1W26A 3OL7A 4DQQA 1QY7A 4RW7A 2VG5B 1CS4B 2K8GA 2Z2ZA 5A8RA 2KKHA 3R5DA 4PCQA 4FKYA 5KFBA 4L74A 4GO5X 1WEZA 1GXLA 3ZFVA 1JNZB 4DL2A 3S6EA 3IWXA 3T1YF 3T5LA 3D3CJ 4ELUA 4HACA 4J9VA 1D9AA 4A48A 5I3UA 4Z7YA 1FE4A 1SKWA 3IBFB 1NK5A 3BDEA 4K0KJ 4QIEA 4KPCA 2E7WA 3D28A 3G8QA 2K2PA 2QA4S 4CNZA 3M05A 1MWQA 2DGQA 3EJMA 2HFVA 1C1CA 3R5AA 1UEVA 3JSBA 1H6KX 4TLQA 2B9XA 3L9ZA 1IKVA 1JMTA 3EXYA 1R8AA 1GMUA 4ELVA 2HHQA 5KFRA 3PJWA 1RTDB 3FRZA 5D3GB 3OXLA 4I7FA 5A8WA 1QM9A 2IM3A 4NCGA 4MT1A 5JVHQ 2IPOB 4RNHA 1RXOB 2QG9B 4Q2MA 4RO0A 2QA2A 5ETTA 2CNKB 1N56A 1BQNA 1YJ7A 3D7SB 2CJKA 3I9ZA 3HZEA 1KR4A 5I3QA 4L3NA 5GAGI 2VU5A 4OI6A 1HBMB 3TARA 4USTA 4IG3B 3O5TB 3AXKA 1T3NA 2Y8WA 2VFUA 2HZVA 3Q86A 2VJVA 2HBRB 5EX3A 1QE1A 5CYQA 2HS3A 4QYRA 3SMZA 2AZ3A 4EMDA 4YHHF 3C19A 1HIYA 3O44A 4OL8A 3LO3A 3H2LA 1PIEA 2IBOA 3MHYA 3MEDB 3ZZZA 5HMWA 4H4OA 2PDAA 2MKHA 2UU9F 3KLGB 4K2XA 3UE2A 2QYCA 4V19J 2WB1D 2Y1RI 2RH3A 3W5ZA 3GFHA 3D1QA 3M7VA 2VIHA 1B3TA 1VHFA 3T1HF 1OSDA 2FY1A 1J5EJ 2W8KA 4DPYA 5CYJA 2XI2A 1V3RA 4RUAA 3M2RB 1JLCB 5AXKA 3GB0A 1VJQA 3DYAB 2Q1LA 1FRXA 2BVZA 1X5PA 5B0FA 3EZUA 1VRQC 3MEEB 4JYAJ 5F8LA 1FKOB 4Z2XA 2AGQA 3C15A 3IBCB 1FJEB 3R6LB 2E9RX 3LP0A 2AMCB 1HW9A 3HVWA 4PEOA 1UFKA 3AOBA 4DF4A 1P9QC 3VAMA 4EEYA 4HLBA 2XO6A 1N54B 4ZPDA 3EDQB 3R7SB 2EFNA 2NLWA 4H4KC 3MDFA 2XTJP 2QTWA 5K9FA 2UXDF 2MTLA 4CYUB 2CVEA 1TVRB 5DG8A 2DXFA 2DPJA 4NXNJ 3TWZA 3D6FB 4TQRA 3OXFA 4RKUC 3B54A 2DGUA 5KOXA 5HQMA 2L9NA 3JB9k 3CMQA 4C97A 2O3DA 2QLFB 1NSPA 2HGNA 4USVA 1DLOA 1NKBA 5D6GA 1RTHA 5ETVA 1G2EA 4K5RA 3C66A 4DSFA 5CH7B 2HLTA 2OPRB 5CHCB 5H9FK 1XBWA 1U4BA 2RF2B 1FK9B 4OYPA 3CD5A 1HNZF 2RUSA 4J90A 2JC0A 6FD1A 4ANDA 3VR1A 4ZHRA 4LQ9A 1T8EA 3GV8B 3V2UC 4PXEA 5DRKA 1Y0HA 2CAJA 1C1BA 1SJFA 1JIHA 1RT1B 4DPOA 2W2OP 3MM5A 2ZC3A 1VQMS 5IC4B 2COLA 1PO6A 1JLAB 4ECTA 1XNRJ 2V9KA 4OZJA 2VC1A 2BZ2A 3QBCA 1HW8A 3M8WA 2PA8D 4X84A 4FDFA 4CIOA 2EKNA 2OD4A 1XQIA 4P10A 2D74B 2IA0A 3KHHA 1LWCB 2VQFF 3FBCA 1ZZFA 1RKIA 2VQEF 1PSDA 3BBBA 4DR6J 3BBCA 4RX6A 1TK0A 3CJKA 2IC3A 4P52A 4NLYA 2HURA 2QMWA 2IRYA 1YJNS 2V9WA 2DT9A 4A4JA 3JAMY 1S97A 2XM3A 3H4BA 5DGAA 2DR5A 2K06A 1S0VA 3WX4A 5J1PA 2PFFB 2RQCA 4DWIA 3IS9A 2ADBA 1ELOA 1TL7B 2V8GA 5DLGA 3THVA 3TAMA 2HFSA 3B82A 2DRAA 1VHIA 4C8OA 1DFDA 3W2VB 2H65B 1I94J 2ZUAA 3TQ1A 2E1PA 1JJ2R 1LK5A 4UOFA 2EPIA 1GX6A 4Y00A 2N4DA 5LL6d 2DNQA 1IN0A 4LRCA 3DOMB 2N82B 3FBBA 2P9GA 2W2QP 3PYFA 4O4RA 3NGSA 5KFDA 1WTFA 1XMOJ 2X3DA 1NJXA 3BF4A 1UFLA 5LSRA 1TV6A 4OHVA 1FA0A 1MROB 4ZITA 1RU2A 2FIUA 1MWZA 1JLEB 1S1VB 1O8BA 1GMVA 3KK2B 1H2VZ 4Y2MA 5IT0A 1HD1A 4BDPA 6AT1B 2LYVA 2RQKA 2RRBA 2ASLA 1XMQJ 4OX9F 4NCAA 1FX4A 4DFJA 1Y9OA 3FEXB 4M94A 1DQ8A 2AIRB 1FEEA 3HT0A 3ICLA 2D1CA 3DN9A 2YX1A 2HQIA 1VQ8S 2ZOGA 2J5AA 5ETOA 2HKEA 2XYHB 4K50A 4DV1J 2MLZA 5DQIA 3SQGA 1S9EB 4C11A 1QAXA 5F3ZA 2JEIA 2AV5A 4KHPJ 2LDYA 2JX2A 4MYUA 1IKXA 2H3EB 2GJIA 3AA9A 3RZAA 2L3MA 1WD6A 2V8PA 3JYTB 2W4CA 1TKTA 2Q6CA 4G1PA 4IUFA 2IBKA 1U2FA 3KUEA 1RT3A 4OZ5A 2QRRA 5E3PA 5KFMA 2DEJA 1S59A 4N8NA 3K17A 1SIWB 4LFCJ 2QV6A 2RMLA 4CLUA 4PWDA 4ZJLA 1X4HA 3MCMA 1VJWA 2HW3A 1OPIA 5D78A 1UWAA 3FZ2A 3VGUA 1RLCL 3PR5B 1WSRA 2WZ1A 4PQAA 3EVOA 4DL4A 3HX9A 3QT6A 3KJVA 4Q44A 1B99A 3MXHP 4DR3F 3WIUA 4ZN3A 5C7PA 2DNHA 4JI2J 3N4WA 3BSCA 4X65J 1B7YB 3W9IA 1FDNA 3KK1B 3E01B 2BE2B 2AQ4A 1GTEA 3MOZA 5HSPA 3CDUA 1XNQJ 3C6TB 4R8UA 3DLHA 3J81Y 2J0WA 5H9EJ 1REVA 4DR7F 2PSZA 4F4YA 4OYIA 4Q2LA 4WCEQ 2HVZA 4KR0B 2IA6A 2MY7A 4B17A 5I4MA 1X7VA 1N5YA 4ECZA 1AT1B 2O5DA 3UDVA 5LMNJ 4TQSA 5FLXY 2JJ4D 2QE5A 1U8WA 3UPFA 3BGFA 2W9CA 3V6HA 5T7LB 5HMZA 2MPUA 1VIXA 4YDDB 3K8VA 1I5OB 1N36F 4NXMF 4OFZA 2YPYA 2B3TB 1TAQA 3D3BJ 5ETKA 1SJ4P 4TNOA 2E66A 3GFXA 3ZZ0A 2J7KA 3ADAC 4ILLA 4RW9B 1CC7A 1SBRA 2N3LA 3T9ZA 3E8OA 2KTQA 1KOOA 4U95A 1NDCA 3NAHA 4OI4A 2DCLA 1NDPA 5AXNA 2A10A 4GVBB 4A8OA 4FXVA 1HNWJ 1AFJA 4A8MP 2Y1LB 2JEJA 1HNVA 4MK7A 3OUYA 1FNXH 4L75A 1U1NA 3K5OA 2MKJA 1RT2A 5KFZA 4WYLA 1WC5A 3FMBA 3HT3A 1RWVB 4M5DB 4LF6F 2O66A 1HBOB 1Y5NB 1R0AB 3TX0A 1ZM9A 2MQLA 1SXLA 1GH8A 4IQMA 3KLFA 2HFZA 2MSSA 4QYZJ 2B0GA 2EW9A 2O67A 4WIQA 4M8LA 1EX8A 4QZVB 3IP0A 5HMYA 2GFFA 5HK4A 2OGUA 1KP6A 1FD2A 4EO8A 3MAQA 4A8SA 3QFHA 1KS2A 1CG2A 4HR2A 1NJYA 4C98A 2AT1B 3NS5A 4LFAJ 2Z0GA 1IJFB 1SVDA 4CO1A 4C8LA 3TEHB 3BQ0A 2NZCA 3QSIA 3NOGA 1SQEA 4FXDA 3JAMU 1N8RT 2BQ3A 3KMQA 3GIIA 1RE1B 4OZ1A 1HA1A 1W2BR 3A3NB 3BV8A 2DNRA 2RKIB 4ICLB 2N4CA 3NNAA 2UUCF 2WSEC 4WP9A 4OYOA 1YIJS 4M5HA 2H5IB 4DV6J 4LREA 5J2PB 3P49B 3EPIA 2R8GA 4J9PA 5KFLA 2ZJPQ 4OLOA 3PIPQ 3H5XA 3OV7A 3HFKA 3DOKA 4UZBA 5KOWA 4QIWD 4B3SF 3U02A 2RHSB 4R25A 3ZTOA 2Z57B 1Q95G 2YKPA 2VZ9A 4B08A 3OD2A 1DTTA 3AOCA 2P2CB 3RB0A 2DGVA 1V5VA 1FVQA 1Y3KA 2CZVC 1LW0A 1FVSA 1S6QA 3RTVA 2DR8A 4WTOB 1NHVA 1SJRA 4CQ1A 2H51B 5G0RA 4JOUA 1BUXA 2C2MB 4ZOSA 2IJRA 2KZZA 3KK3A 3T3FA 3UD3P 3RBDA 4J9SA 1U24A 1YITS 4TYAA 4LMZA 2OEJA 3G2XA 1CQNA 4P73A 5KFQA 3TRGA 4F25A 1RCXB 3CC7S 4AFFA 1Y7PA 3RB4A 2F8HA 1IKYB 3G82A 3CWJA 3OVSA 2OD6A 1TKZB 5IT4A 1RYSA 1CJTB 3SBMA 4JI1J 3THPA 4KH0B 2XS2A 4WP8A 4KY3A 5BYSA 2UUTA 1LWEB 3TUIC 2DH8A 5IXUA 3T5HA 1RWKB 4DX5A 3RB6A 4CM0A 4USUA 2WOMB 2ZKUA 5IFMA 3DRSA 3HHLA 3Q2TC 4Q5VA 2H48B 4G65A 5H1SV 2XGPA 3RRKA 4PZVA 2WAQD 1A9NB 2D3O1 3ZNJ1 1EKSA 4F4AA 4F2SA 1F3FA 2DIVA 3D1HA 4K8RA 2HNYA 2HHPA 2A2DA 3K8WA 4HH1A 3JSMB 2RQ4A 1IR0A 1M1GA 3R5BA 5KAKA 4NEZA 4HTJA 2DGSA 3NBPA 2DY9A 2ZHBA 3IRXB 2B56A 4NLXA 4U7UK 4OHWA 3BKTA 2R7RA 4LF5F 1TK8A 1SH3A 3AHPA 4JV1A 2BJ9A 2RJZA 3D6TB 4C7QA 5A6PA 4NA2A 4M5KA 5KFEA 1U7LA 3MPWA 1NLKL 2HBZB 3QO9A 1MLAA 1N0VC 1RLDA 4IFYA 2NQPA 3I0SA 3RRHA 4DUYF 1U1LA 1CC8A 4M5IA 3TVZA 2OIHA 2GX8A 3ISZA 3MM6A 2QLJB 2HHHF 4IG0B 1QD1A 3FMWA 4GC7A 3L7PA 2HIYA 3J81U 4LF9F 3I6PA 3NAIA 4AUKA 3HVRA 5K8MA 1F3VA 2KT2A 1ZM2A 2BOPA 1OY9A 1RWWB 3SSQA 2AYGA 4JUZA 1WKLA 3W66A 4QJVA 5KFUA 2DGOA 3GJTB 5LJ3Y 3MEGA 2G13A 2VD3A 1YVFA 2FHKA 5E2QA 1VC0A 3UD5A 3OFEA 1WOSA 5KG6A 2KFYA 5E3AA 3N79A 3CUNA 3M1VA 3CJ0A 3OTBA 2RDJA 4OZLA 5KFKA 1VBYA 2VOOA 3U27A 4K4VA 3CCZA 5HVGA 2XLIA 2WB4A 3W9HA 2DNMA 1R7IA 4L76A 2GIQA 2XSJA 2QJ3A 2NREA 5K8PA 5BR8J 4TU9A 3I31A 3UFCX 5GMEA 3V81A 3ISNC 5AXMA 5FD1A 4KGXB 3M8PA 3DMJA 2NPIA 1Y5LB 1H7WA 2YNFB 4KO0B 3EWGA 3BGLA 5AE1A 5KFAA 1WEYA 3FCVA 2XWYA 2HQDA 2MSTA 3MWBA 2MZRA 3V6DB 4EBEA 1RCOB 1NPKA 2AZ1A 4O0IA 3TEGA 2CPYA 3T1YJ 4IFVA 2F5GA 2AX1A 5L9XA 4NZ6A 1RJJA 1X4FA 4K4XA 2GAGC 3D66A 4HEA9 4USWA 5A2QY 4NYOA 2FJWA 2B6AA 2IAJB 1GQEA 1HPZA 1FRJA 2WHOA 4JI0F 4OYBA 2JNJA 3OFGA 4DV3F 2VONA 3LA0A 5M2UA 4WF9Q 4NL5A 2JFKA 1RT4B 5J1NA 3I4PA 3BSNA 3GMGA 2GMLA 4A8YA 3KLHB 2J8SA 2YKMB 5HBMA 2CPEA 4LF4F 4JV5F 3IG1B 4WE1B 4B9VA 4IQXA 1L3KA 2POKA 5HP1A 3MUVP 3KHRA 1ZA2B 3UN2A 1RAAB 3Q8SB 2LQ9A 1TL5A 2WBMA 3OL8A 2NXNA 1CJUB 2GHWA 5JVGQ 4F04B 2E5JA 1U1KA 3H98A 5KFGA 4ZK7M 1UW9A 4C48A 3AD9C 1LOUA 5KFSA 1RT5A 2EEYA 1S9GB 2XI3A 3RBZA 1TL1A 2KH9A 4FPRA 3ETMA 4C6AA 4RNOA 1N88A 2YNHA 5IM0A 1YI2S 1UPPA 2ROPA 1UW4A 2HIQA 1LWFB 1YTYA 4NCBA 2MMYA 5D4PA 3HK2A 4F3OA 3HHLC 5EGYA 2MQQA 1M5PC 4YUDA 3BN4A 2CPFA 1NHKL 2YNIB 4RUHA 3OVAA 1PAEX 2HQFA 3R8YA 3PFOA 3BJYA 1NHUA 1UJ4A 5KG7A 3P45B 3LWMA 2OKQA 2UU9J 4CLLA 2V2QA 2GMJA 3DOLB 3CJ3A 2M0GB 3IWLA 1N5QA 4ALZA 2WVDA 3KDNA 2ZNZA 1FRIA 4DI6A 4WFZA 5GADU 3N5BA 3ENAA 1MNEA 2XC9A 1WOOA 1S0MA 2LQ5A 3T1HJ 2KU7A 2J9DA 4GMKA 1P9YA 3KHGA 5CYMA 5DG7A 1KBRA 2F4VF 3NMAA 3QLHB 2YWKA 3KNAA 3Q8YA 1ZPWX 1EJ7L 3R7NB 4C3KA 1PYOB 3HLUA 5FJ4A 1M5HA 4DZDA 2CQ2A 5DZ6A 2MZSA 3MAAA 3ZZUA 3GFZA 5KTQA 3NGUA 4W98A 1CULA 2XMAA 3J7YI 1TP7A 3MD1A 3ONQA 4BCAA 2PI4A 2XGQA 3DXBA 2VG6A 1XR5A 2MKCA 4KGZB 1FHTA 4FPIA 1EIYB 5KFWA 4ZP6A 1F2GA 3EVMA 2AHOB 1QVGR 1PC5A 3NMRA 2HGLA 4MFBA 3DLKB 1H72C 1CEZA 4ZCLA 1E6VB 5C24B 2ZZNA 2VPZB 1QAJA 5ETRA 2UXDJ 4LR9A 4KJIA 1FTRA 3EVWA 1BMQB 1K9MT 1WEXA 3TNVA 3POTA 2YKNA 1E6YB 2VB6A 2B5JA 1F5AA 2WRMA 4X4OA 3PACA 1ZM4A 4RBUA 1B64A 2ZH2A 3DM2B 4CTAA 3EM1A 5D0GA 1XTZA 3BR8A 1IBLJ 4K2JA 1UTAA 5CXTA 2OFHX 4DSEA 5L1JA 2DYAA 3UCGA 1JLGA 2HRUA 2J9CA 4KV8A 1HL6A 5HAOA 5FDLB 3MR5A 4NLDA 3VZHA 2ZDPA 4ED6A 1KFSA 1YBAA 4JI3J 4KPYA 5GAEU 2BJ7A 1SCJB 4P2FA 4CH7A 4DPWA 4N56A 3CDBA 1RHJB 3BKUA 1VS3A 3HSDA 4C4WA 1AROP 2ZNYA 2PN6A 4MTPA 1HHTP 1HNZJ 1Q5YA 3TANA 1OS5A 2V2ZA 4N77A 2J9DE 2NYHA 3WIVA 3DRRB 4M1KA 2KVQE 2AWZA 2HVDA 2VFRA 4LFBF 3H5SA 1MU2A 3J7AN 3KYLA 5EWEA 4G1QB 3KDOA 2C3OA 3EMTA 4A8FA 4C0BA 1JLBB 1SC1B 2I5JB 1VLOA 5B08A 2ZH9A 1FESA 4U6PA 2H54B 1OYDA 3CCSS 4KKOB 2DISA 3CT9A 4KGVB 3GG0A 2DHXA 1F1BB 4N7TA 4JBCA 2LP4A 3M2UA 4C8YA 2BYCA 4P6QA 1RYRA 1FX2A 1U02A 1FFWB 2WTFA 3NL0A 3MM8A 1R31A 1WORA 1EARA 3BYRA 2VQFJ 2VQEJ 2BOAA 4HI2A 3LGMA 1RBOB 2JEGA 3TZYA 2H5EA 4X64F 4F8RA 4CZCA 1YJTA 3IR5B 4PXBA 2OPQB 3FZBA 4ECWA 3W7BA 1T11A 3MCOA 4FZVA 5LM7E 2HHUA 3AD7C 3SQOP 1UFWA 3SCKE 3EGWB 5D0RA 1X8DA 1YSJA 2PGCA 1RT7A 4LT6A 3M8RA 4CO3A 1WG1A 2R3VA 1Q78A 1Y3JA 4LSNB 5LSLA 4C3MA 1KDNA 7AT1B 2XMUA 3IGVA 2C3YA 4ETZA 4DG1B 4WWSA 5CZVA 3K2YA 1SKSA 2CQIA 3AJ1A 5CZXA 4H54A 2MQPA 3MUTP 3BO2A 3UO0A 3MM9B 1HWUA 2HNZB 2XMVA 1WELA 1DBDA 2ACYA 2AJ1A 4FF2A 1MW7A 4QWAA 4KC5A 2HQCA 3MURP 1LNQA 2SXLA 2DITA 2Q3PA 3D0HE 4U9RA 1NNDA 4ZJOA 1ACMB 4DQRA 1UVMA 2L9WA 1W7WA 3D4JA 4ZVUB 2BANB 4E0DA 1X0FA 4ZIVA 4EI2A 2LLZA 5AT1B 1SH0A 4DV0F 4TYBA 2HWTA 2QYGA 3ZZYA 2A0FB 1XERA 3OR1B 3FFIA 5IV4A 4OHYA 2FLOA 2BW7A 1VQ4S 3R5JB 1Z1ZA 5F8NA 4DV2F 1OPZA 3RJMB 2PMHA 2HNDB 4F4WA 1V9OA 3C46A 5L1KA 3UVJB 4RWWA 3LW5C 2JEFA 2X1BA 3EE3A 2MLYA 4ZPBA 1N6QB 3NG8A 1FKPB 3BH6B 1NPRA 2ZE2B 2XS5A 5LJ5Y 3NCQA 3IO1A 1S6PB 1U1MA 3IM8A 5M2PA 5D3GA 4YB1P 2DGTA 4A8WA 1QLNA 3I5CA 2D9PA 4DSKA 1NB2A 3MM7A 4OX7A 4EZ6A 4AD6A 2GMHA 4MKYA 3EICA 1ZETA 2XO7A 4KIAA 1FRLA 1FNMA 2Z56B 5KFYA 1JLFA 2WCXA 1M1KT 4AT1B 4MKAA 4RW7B 2DRDA 4J37A 5A8RB 5JUMA 2YKOA 3R9LA 4GKJF 2K7KA 3M30A 1FWKA 2XMMA 4F4XA 1S57A 5F3TA 4IRCA 3UN5A 2R2UA 3ILOA 4HACB 5I3UB 4RR5A 1UA1A 3ISND 2YWHA 1PYSB 3AA8A 3KJQB 3KLGA 3PX0A 1SKUB 2HYIB 4WFNQ 1CLFA 4DR3J 4I69A 5E0OA 5F8MA 1B4SA 1RWUA 4ILMA 1C1CB 1WKJA 1F6TA 2XHCA 4PPDA 3G96A 1SUQB 4ZVFA 3QYYA 5AXLA 1IKVB 1EZZB 4ANCA 2H9ZA 2MYFA 4KH1B 4Q7AA 3WBZA 1VR6A 2CIMA 2OFGX 2CQ0A 3W8GA 3RYLA 4I7FB 3MEEA 3HJFA 3I32A 4NCGB 2OTLS 3Q23A 1WC1A 1RAEB 3O6QA 2Q66A 4DHVA 3PKYA 1Z2ZA 1BQNB 4DCJB 2B51A 4DV4F 4J9UE 2LQBA 3G87A 4MIAA 4Y2IA 1Q5VA 4S0MA 4DUZJ 3CC2S 3P6YC 5CD4H 1Q7YT 4LRBA 2APOA 3VF0B 2MKIA 1N36J 4NXMJ 3M6WA 1D9FA 4K4YA 1QE1B 5CYQB 3FEYB 4CYUA 4OHXA 5C5JA 3NWGA 1BLUA 4D3GA 3M32A 5F8IA 2DH9A 3GG1A 2XMTA 3OBIA 2D7SA 1PG5B 4ECUA 3HJVA 5IQ6A 2OH2A 4H4OB 3GIJA 1SJ1A 2RS8A 2DK2A 1M0SA 4UZCA 4DS5A 4DR4F 4QPXA 3QAEA 2H5JB 3MOJB 2ZBCA 4TN2A 2GVZA 2LCWA 3PDNA 4NYPA 1XIQA 3JSYA 1PJ5A 1T9TA 2W1BA 2FLNA 3KLIB 5MAOA 4KYZA 3HHLD 2VV5A 3KG4A 5I42A 1RWMB 3NXZA 4LUBA 4P2XA 4RNMA 3CCJS 1WHWA 2BXJA 2AYBA 3RAQA 2OHDA 3W3SA 4MKBA 2JFDA 3C15B 4I2PA 4NLOA 3NLCA 3LP0B 1FDBA 2B4VA 1G6BA 1HQEB 4I56A 3GTYX 4A8XA 3AFGA 3QFWA 3I55S 2YX4A 1RTIA 3MEKA 2GGPA 2HHWA 1OQ3A 4XPEA 1R8PA 4P2MA 4OMFG 1WDTA 1X4GA 1J5OA 3Q24A 2W4PA 4RUCA 4KHMA 2R7SA 2LEBA 1VBXA 3M9NB 1S4FA 3G8SA 2E44A 4NRUA 1N52B 4OYWA 2CDRB 2UXBF 2GAHC 2V8VA 2OI2A 3HHNB 4Q8EA 1D09B 2LXIA 3D0IE 1WF2A 4G1IA 1DQ9A 3D0GE 1DY3A 4DV5F 1DLOB 4UOHA 3ZNUA 3A3OB 3LTOA 4RW8A 4B3SJ 4IOAQ 4EGLA 1WC4A 1S1WA 5L1LA 3X1LB 2QMUB 2MZTA 4A8QA 1KTQA 3T19A 1RTHB 3QNWB 4USHA 1KVJA 4F50A 3EXCX 2IIHA 2VBZA 2FJBB 1JX4A 1S1TB 1WUUA 3KXDA 1VOMA 4R5PA 2B9WA 5B7WA 4XO0A 2MEWA 3OT9A 4ECSA 4NI2A 5HI7A 2HQGA 3QZ8A 2VA3A 4UF4A 3MI7X 2W7PA 2GIRA 5D77A 3FQKA 3HF5A 1LV5A 3G71S 4IKAA 1NKCA 3BB5A 4P71A 4PXCA 5J2QA 1C1BB 1N5SA 4YR3A 3HCXA 1R89A 3ZTSA 2V67A 3MM5B 2ZM6F 3IAS9 5E3QA 1C2PA 2JVOA 2G2YA 2E5HA 1RHUB 1RADB 2QSWA 1MROA 1JLEA 3HULA 1C4AA 1NPPA 2JSXA 4ED5A 1VQLS 1KTVA 3CE8A 1JNRB 3OL9A 4DV7F 3NWRA 4DFMA 2YY3A 3AB4B 5HVFA 4GKKJ 2R8JA 3GV7B 4DR1J 3CJSA 1RWXB 2ZD1A 5A0YB 3BM7A 3DRPB 3CJKB 2IC3B 4B9NA 1IBKF 2R2SA 4B3MF 3M2VA 1FD8A 2U2FA 4J9MA 1K8AT 3UWTA 2EFOA 3TAQA 3OTOF 1N48A 1RA6A 2BQRA 5ETLA 2QLBB 3BKFA 2VODA 4DR2F 4DU8A 3LGNA 1PYTA 1U6BA 1YJUA 3Q0AA 4P2SA 3CDWA 1GTHA 1ULRA 3AT1B 4ZKAA 1C0UB 3PXGa 3TAMB 2P9CA 2AEMA 2F8EX 3M8QA 3VGSA 2J0QD 2J6UA 3KHLA 3DKDA 1JKHA 2HRYA 2I8EA 4FF4A 4ED0A 2MB0B 4LF5J 5IWAF 2R2RA 5HQ8A 5IS2A 1HNIB 2GJ2A 3IR6B 5IC6B 4HYKA 3P4UB 4KBIA 4ZCMA 9RUBA 1K0TA 4N41A 4E8UA 3AB2B 2I9SA 5AJ3J 2OAUA 3BDPA 4IDKA 1RBAA 4TU8A 4DUYJ 2KYXA 2LA6A 2W24A 1TV6B 3UCUP 4RNFA 4TXSA 2HHHJ 2AGPA 2G9OA 5IT9U 2IJFA 4LF9J 4QOTA 4DQIA 2ALYB 5GAHU 4X4QA 3Q8RB 2EXUA 2GVDA 2XCAA 3PYDA 2FZCB 2EFVA 1CPZA 1VBZA 4FF1A 3TAPA 5JMNA 4FF3A 2W7OA 5KG3A 2DO4A 2FZGB 4C0HA 3PEHA 4Q8FA 4DX7A 4AL5A 2J0XA 3FBEA 1T94A 5ITHA 3AXMA 4DFPA 2F40A 4EWTA 2N3OA 3SQGB 3QT5A 1KFDA 2Y8YA 4I6YA 4CRJA 1VK8A 1T95A 4M5JA 1IKXB 5BYRA 1QSSA 4IOCQ 4B9LA 2I1RA 2QO3A 2XYGB 3R1LA 2AGOA 3C16B 4DOZA 2HBQB 1NCLA 1VQPS 4ED3A 3HSJA 1VQ6S 4C8NA 1RT3B 1BD6A 5KG1A 4CLFA 4CH1A 4H4KA 3TYTA 1RAOA 1HWIA 3NS7B 2RVJA 1REGX 3D68A 2GW8A 1X9WA 1HYSA 4PWDB 4F4KA 3QJPA 1FTCA 4TY9A 1AUDA 4ES2A 5DDPC 3F41A 1KLNA 2RD5C 4DX6A 2DKOB 1Y5IB 3HHKA 2IMWP 1EP4A 1PJ7A 3Q83A 3KJVB 3GYNA 4O44A 2B9EA 3TX8A 3KG1A 5CCLA 3IGNA 2ILYA 4WFBQ 3K57A 2BJ1A 2PEBA 2FTRA 4AQYJ 2D69A 4NE9C 3JQMA 2AJ4A 4USMA 2G2ZA 2IYGA 4EBCA 2E1RA 2VDIA 2VUGA 3DHXA 2P5VA 4ZJQA 1HWKA 1MMLA 2DY1A 4R8UB 4JI0J 1WF0A 2Z2YB 3F73A 3CTRA 4O3PA 2NUUG 4CNYA 1P1LA 1REVB 3TJAA 2I0XA 4OYZA 2HHXA 2CKWA 2DNOA 4JYAF 3SV4A 1VCTA 1N5YB 2O1PA 1UEKA 4K4WA 2W01A 4MAKA 3OSPA 3N6LA 2EK1A 4JV5J 3E2EA 1U25A 4HHJA 2W9CB 2BJ8A 3KWMA 2CQ3A 2MJNA 2QT7A 5JJBA 2MKKA 1IQZA 3C6UA 4L3KA 2ZVIA 1KEKA 4WFXA 2BV3A 2ZITA 4J5OA 1I6JA 1HARA 4OJ3A 2QA4G 5L9NA 1KWMA 1EHWA 1DAXA 1NK6A 2M3DA 2EFPA 4I4BA 3GQCA 4I1TA 3G6ES 2HEKA 2AP6A 5J2PA 2E7XA 5KT3A 5GAGU 3PW2A 4HT7A 4KGKA 2MZQA 1B0TA 1S77D 2OELA 2V4JB 1JWWA 2OP5A 2RQMA 4LF7F 2EWHA 5E7OB 4O3OA 4M5NA 3GR1A 5D4OA 1HNVB 1S48A 3OUYB 4Q0BA 1NB7A 1TKDA 5J2MB 4XK8C 5AE2A 4Q43A 1U1PA 5HN0A 2RU9A 2LA4A 4LRDA 5HVHA 3KLFB 4I0WA 4DFKA 1BE4A 3BSAA 1MN7A 4ZVHA 2KM8B 4ZVTB 3LP2A 5DO2A 1HD0A 3CNQP 3H25A 3LAKA 3TQEA 2HK3A 3A13A 2F4VJ 3IRWP 1IR2A 4TKTA 4ZDNA 2I6WA 2N7CA 1VDHA 3CCES 1GAOA 4O3RA 2PD1A 4QWCA 2BDPA 2AJ2A 4WK1A 3SZ2A 1TFWA 1SQFA 2VPYB 2GQ2A 2HAFA 5L46A 3MMAB 1IKYA 5D15A 2XSFA 5A8KB 5E3RA 4LF1A 3DLGA 2IFXA 3GCXP 4F7VA 3Q8QB 3IWNC 2LVWA 2QLXA 3HP6A 3S7RA 2PI5A 1JXVA 2B8QA 3T5KA 3R3TA 1ZAXA 4ECYA 1U2CA 3ITHA 1KRPA 3EYZA 2I38A 2KO1A 2XY7A 1T9YA 2VPXB 4Y28C 3OJUA 3DOKB 5LXYA 4X66F 4KHRA 4EFAC 3P8BB 5KT7A 5B0AA 1PBAA 1DTTB 2CJBA 1R6YA 2V5HG 1X4AA 2ASYA 2K3IA 2HG4A 4LF8F 2WK4A 2FJDB 1GFWB 1EAYC 1RHQB 2V0NA 5KG2A 2F7VA 1B0PA 2D3OR 4U7UD 1RHKB 1UP1A 3JTPA 1LW0B 1S6QB 4UUWA 4GC6A 3IRXA 2C2EA 5GMKa 2VASA 4WKRA 2M5YA 4C8MA 5A76A 3TW0A 1NJWA 2QFIA 5G0RB 5DM7Q 1MWYA 4DXLA 4F2RA 3W60A 2DTJA 3KK3B 3OFHA 1UVNA 2DXEA 2BE9B 1GXUA 1S76D 4O23A 1HNXF 4I2QA 2Z2MA 1NK9A 2R7TA 4Z37A 1XMOF 1BQXA 4IH6A 1RHRB 3MD3A 2WONA 2X1FA 3J7ZT 4LFBJ 5E5NA 3SXLA 2DCUB 3G82B 4AE5A 1UJ5A 3RRGA 3UDLA 3N01A 3W62A 5D8HB 4AYBD 1XN9A 3MAHA 1X4DA 3THTA 3MPDA 3D54A 2HSEB 4ED7A 1EETA 3VAFA 4KFBA 4NLUA 1WC3A 5DG9A 2E7VA 4EZ9A 1IM6A 4CO4A 4PQUA 1EB0A 1SKRA 3DRSB 5HJYA 2IY5B 4LBHA 4JI8F 4C9DA 2EC0A 2NXEA 3TI0A 1OJ4A 3KUGA 3MR3A 2IRUA 3BZQA 3QJLA 1WJ9A 2YWFA 4X64J 2XEXA 2WBRA 2HNYB 2B43A 2RDIA 4PG5A 3TA2A 2EFGA 3JS9A 2LECA 4JI6J 2MZJA 5ETMA 1K44A 2R7XA 1WDDA 1NO8A 2HVIA 1M90T 2XQCA 2DJWA 3HZGA 3BGRA 1KONA 2Z2LA 4UOCA 1S1UA 1UCNA 3H2UB 4I64A 1J2VA 3BQ1A 4ZMMA 3K59A 1YDLA 2V8DA 3GE9A 1BHNA 1FWPA 3QO9B 4W92B 2X1AA 1DQAA 2BRKA 1HR0F 3DU6A 1YG0A 3N6NA 4F0HA 3I0SB 2OEKA 1IKWA 3MGJA 1VQ5S 1FEHA 2CG4A 1RAGB 3MM6B 3K7RA 3SFGA 2J0SD 3V6DA 2YH0A 3I56S 4K4UA 2JC1A 3RU0A 3AD8C 4QIVA 3E3XA 5IQQA 4WZMA 1PILA 1T03B 2EVZA 3FJ2A 3MFIA 4JI2F 2CQBA 4CWBA 4X65F 2QC3A 1RAFB 5I3PA 3U7JA 4BHQA 3NGTA 2JVRA 4DV0J 1G1XA 4ED4A 3GYXB 1R0CB 1YWXA 2OPPA 1VLYA 2HWIA 1JJ4A 4QR1A 2QZ8A 3KLHA 2NYIA 2YKMA 3ZTQA 4DV2J 1URNA 2V6AA 4O0NA 4UW2A 1U48A 5LMNF 3IG1A 3QT8A 2CQHA 2JZ5A 3TUPA 3D1OA 4DS4A 1UWBB 4I68A 2UVWA 4C8KA 2F65A 2XSJB 1CJUA 2MZ1A 2D3ZA 2IVYA 1RWOB 3DU5A 1OY8A 1RGVA 3V81B 2HVHA 1FNOA 2M8DB 2C3MA 3M8PB 2RE1A 3DMJB 3MR6A 1TUGB 3RAMA 4LF2A 3H0PA 3IC1A 1I51B 2EBEA 2K1RB 4ZLNA 4ENOA 3E51A 2YTCA 2DBBA 3P5BP 5EUHA 1T7PA 4DUTA 3NRBA 3HSGA 2HHVA 4RWXA 4HDHA 1HNWF 3QGIA 2WSFC 4XAKA 3UQSA 3MCNA 2KN4A 3GV5B 3RAXA 2CNLB 4IFVB 4RW4B 3CF5Q 3K5NA 2A2CA 3UCZP 1HWLA 4ZVSB 1RTZA 2B6AB 1FDDA 1HPZB 2EFQA 2CJYB 5ADZA 1IQTA 3CDEA 4ETXA 1HLWA 4V1Ak 4JV2A 3M4XA 3M8SA 1Q8KA 1VGYA 2GHPA 5HBMB 4B3OB 1MMNA 3ELHA 3ENWA 2V69A 4ID8A 4D3HA 9ATCB 2DHHA 4CLYA 2N7YA 2DR6A 1N5TA 5F41A 4RBTA 1AUSL 3SCJE 4X4PA 3CJ5A 2GS8A 5K8NA 2KFZA 3KG0A 4DEZA 2CQDA 1DJ0A 1LW2A 4TLRA 1GK8A 1M5VC 4J91A 1HBNA 4DV4J 1FF2A 1YJWS 2PE8A 4HKQA 2RIJA 2E1MC 4OJ1A 4RU9A 1HQ2A 1TL1B 2QEXS 4DV6F 3J7Z5 4MK9A 5DQGA 3Q8VA 2YNHB 2CWXA 5IM0B 4X4SA 2FDNA 1Z4UA 3CJ4A 2EC2A 2PA3A 2CDQA 4J7CA 5HANA 1SL1A 1NK4A 1JLQA 2XWXA 4WZQA 3N28A 1JXLA 1YK9A 2ILZA 1F0XA 2GC8A 3EGNA 2FZKB 3QWUA 2NZ4A 4NX9A 1TU0B 3ZC4A 1TL3A 4DR4J 1WACA 3RBEA 1L3VA 2WVFA 3QRRA 4NLVA 1F9EB 1O0PA 1U45A 1SV5B 1AZSA 2Y1IA 3LP1A 4O4GA 4JI5F 3R97A 3MECB 5CYMB 1UAWA 1S7IA 4QWDA 2FC8A 1TL4A 1WNEA 5KFPA 4YN3B 2HQ3A 4JI7F 3WDOA 4OI3A 1HHSA 5L8RC 1H0HB 3DC2A 3MAAB 2VBWA 2EKYA 5DDOC 4X4UA 1CULB 4QR2A 4JI1F 4EU0A 3ZO7A 3BREA 3NNCA 3HVTB 1U8SA 2VG6B 2BABA 3L4BC 2FB0A 4IO1A 1U0SA 1KLMA 5C42B 1LXNA 1FXRA 3C8YA 2EG2A 4MFBB 1S4EA 2XULA 3DI6A 2DEIA 5KT2A 2VL1A 2JRSA 1XK8A 2GQCA 1X0PA 3CGIA 2UZAA 3POTB 2YKNB 2UXBJ 2KXNB 4NOHA 4LIWA 2B5JB 3H8YA 2DGXA 3KJNB 1KHWA 1Y10A 5KG5A 2QX0A 3S8SA 3CD6S 4CTAB 4DV5J 2YXLA 1K1SA 4OYAA 2YWEA 1GT8A 4OJGA 5H9FJ 3VQSA 3JTOA 4URSA 2G0IA 4YB6A 1EKRA 1U1RA 1JLGB 2MY8A 4KV8B 4ED2A 2J6SA 4BWJA 4X4TA 2EG1A 3O2IA 3KOAA 3ZZPA 2MHNA 2XLKA 2I2YA 3H4DA 4DR5F 1TTHB 2HFNA 2FLLA 3WX8A 3MMCA 3PW4A 4WFAQ 1GNKA 2QA1A 3AAWB 2LDIA 2MQMA 3P5TL 1UJ6A 3W8PA 1NSAA 3MM9A 4P75A 2EK6A 4DL3A 1P27B 3DLBA 1MU2B 3CPWR 2FGCA 4IH5A 2O01C 3T41A 1N34J 1BGXT 4WP3A 1KSPA 4WK3A 2PMWA 2LEPA 4ID5A 5HO4A 2GNKA 2ZM6J 1P6TA 4X62F 4HHUA 3B6BA 1SC4B 1OIAA 3V4MA 4O3QA 3BPDA 2BANA 4G3IA 3UNGC 3MM8B 4DV7J 2DR9A 2HMIA 5F9LA 2FY8A 1AYEA 3VAKA 3VV2B 2JL9A 2CPHA 4Q45A 2UVVA 2MGZA 2F1FA 2KYZA 3JQKA 1IBKJ 4B3MJ 5HQLA 1NAQA 4NLWA 5J1EA 1N6QA 4JI4J 2CQGA 2ZWPA 2LEAA 3GJRB 4ELTA 4PYDA 2QLWA 2ZOFA 4DR2J 1ZZNA 3MMBA 5DQHA 3G6VA 1RT7B 2P6TA 2FVRA 4PPZA 1FRHA 1RA7A 2VG7A 2UV8A 1T9WA 2CYYA 2KZMA 1FJGF 3Q89A 2RUGA 3X3UA 2KRBA 3D67A 1TZ0A 1Y4ZB 3AJ2A 3UW1A 2ZH1A 2G1HA 3QIPB 5IWAJ 1S10A 2DNZA 3W65A 1Z2LA 2YNGA 4IO9Q 4PUOA 2LU1A 3TO8A 2FJXA 3AY0A 3H2VE 4LVNP 4EYHB 2J9EA 1NDKA 2YKQA 2CQCA 3HKWA 1FFGB 5K14A 4U8VA 3UDCA 3B8HA 2DPIA 1Q79A 2MHEA 5J2NA 3G6XA 4IR1A 1RTJA 1AB8A 4OIXA 3SCIE 1GX5A 1VQ7S 1L5UA 3QGGA 2M70A 3JTNA 1HMVA 3F44A 1FI4A 3FFIB 4B3TF 2AJQA 1SUQA 5EDWA 3LQVA 4ILRA 3RBXA 4W90B 1IBMF 4CLPA 2XG8A 1QTNB 3WC2A 3NP5A 3EZOA 2YWWA 3F56A 2E5LF 3J81j 2XZTB 5C2GA 5E3CA 1X9SA 1VRTA 1Q82T 3TUZC 2FVSA 1T05B 2BBEA 3MM7B 4J9RA 1NU4A 3P3DA 5F0WA 3M9OB 2IM2A 3PO4A 4DSIA 3A12A 2NSCA 1JLFB 4OJHA 3PNIA 3VCDA 2IYIA 2BE7D 5FIIA 1VRUA 2KHCA 5KFNA 1UVIA 2E9TA 2NSBA 4WIIA 1S6UA 3M30B 5DLFA 1RT6A 1SJ3P 3VZIA 4XTTA 5LMUF 5EN1A 3T9NA 2GO9A 4CLSA 2KT5A 2C3UA 4FYDA 3D9BA 4PG8A 1RAJA 1Q8IA 2HHSA 1MMDA 1IWGA 4QU7A 3DGPA 1VFJA 1F5CA 3T1AA 4QIFA 2ZHOA 5H9EK 3HO1A 3QT7A 1HBUB 2FLPA 1D3WA 1XR7A 3T5JA 3FVYA 1VC6A 4NMXA 3I0RA 1BWEA 3IMQJ 3KLIA 8RUCA 3GZ7A 3MF5A 2NXCA 1VISA 4MYTA 3BEGB 1NK7A 1CVJA 2YQ1A 4A46A 3KLEB 1NXIA 5A6WA 4FBTA 2RDDA 4NASA 4BBYA 2DH7A 4OX6A 1KC8T 1UETA 2M52A 4NMLA 1A6LA 4OZ0A 1JB0C 1FCAA 2YH1A 3VAIA 2HAIA 1HQEA 5B0DA 1FERA 5D0HA 4WKYA 4CLKA 4ZVQB 4YOEA 2W2PP 4B9MA 1OWXA 2CQPA 1S12A 1WTBA 3PG9A 4L72B 3W2WA 5KFVA 3Q8PB 2BA9A 3HFVA 1S6OA 2CJAA 1HQUA 4CO2A 2B4UA 3LUYA 2OPSB 2XMJA 3KLVA 2K7JA 2LKZA 2AX0A 4F3MA 2KJVA 4GRSA 3M32B 4PWWA 3W61A 3PHEA 4OHZA 4OV1A 3L7OA 4LVOP 1K0VA 2DR7A 2IVMA 1TKXA 4B3RF 1Q7LB 4P72A 1UEUA 1IBLF 3W1YC 5CABA 2CZ4A 4QYZK 4ECQA 4LSLA 4LF7J 1R8CA 5KT6A 2C3PA 1IUJA 3CJTA 2R42A 2GVZB 3SYZA 2ZZTA 5T14A 4WU2A 2WSCC 2VKZG 1S1TA 4JI3F 3K5PA 2F9JA 4J9LA 2PC6A 2XMKA 1PCAA 2BKNA 4TU7A 5HLFA 4H4MA 2DIUA 5KFOA 1WSVA 2YQ0A 1C0TA 2CPXA 5I42B 4WJBA 4DPUA 3VAGA 1LFWA 3SDEA 5JXSA 1HWJA 3DDKA 1CJKA 1FXDA 4UT4A 3IAM9 2PT0A 2RT3A 4L73A 4I2PB 3JXOA 5AE3A 2JH3A 2P6SA 3CIMA 3ZXWA 3QRPA 1DURA 3UR0A 2Z4PA 2ABYA 1RTIB 3NGDA 1NK0A 2GGPB 1L3SA 3H40A 1OSCA 2QL9B 1H3DA 4YHHJ 4NLTA 1WKKA 1KHVA 1S1XB 2BW2A 1J5OB 3MMJA 4FS2A 1XMBA 1MG7A 1NK8A 4QWBA 4DN0A 4LR7A 5C25A 4FVCA 3MZIA 3B78A 2BM0A 1PAUB 2ZKTA 2V4RA 3J7YU 5A0YA 1R27B 2HBYB 3DRPA 1OO0B 3ILIA 1CBKA 3EZ5A 4OZ3A 3CCTA 3TVKA 5K20B 4RW6B 2R7QA 3CC4S 4TY8A 2ZH7A 2DHSA 3FCWA 2W9BA 4X66J 4RW8B 3TZWA 1URRA 2C2DA 2VPWB 1X5SA 4JP8A 1LXJA 1S1WB 3W63A 1KKHA 3L3CA 4DJBA 4DCPB 3ZTRA 3TVYA 3JQJA 2ZUGA 4LF8J 2CADA 4L6V3 4R5PB 5KFHA 1C0UA 3OHBA 2J76E 1YBUA 1U49A 4NI2B 3NEKA 1Y00A 3HMJG 4RUBA 2ZH6A 5GMDA 3QSYB 1YHQS 1T9VA 2L08A 1U0HA 3CIZA 2VFVA 2R2TA 1JJCB 1YJVA 1HNIA 5J2QB 2FC9A 1H38A 3GJQB 3K5MA 2ZHAA 4CLZA 4ZVOB 1HNXJ 4OQJA 4WBFA 3CO9A 1EQMA 2HFUA 1GXTA 2BJEA 3M6UA 1HI0P 3DRXA 2J7WA 4M95A 2G1DA 4LSZB 2XCPA 1QTMA 1RWPB 5HROA 2XY5A 2FUG9 5KFCA 2WVEA 3D6HB 2DNLA 2AYEA 1D8YA 1DTQA 2D9OA 2NCKL 5K5MA 2FVCA 4CO5A 2ZD1B 2A6MA 2ATLA 4WYWA 2VFSA 3M2VB 2LMIA 4NA3A 3EDRB 4UOGA 4JI8J 3FGVA 2E1CA 1RDRA 3KJFB 1YQHA 2ERRA 4B9UA 2F63A 2RU3A 2IMOA 4DN9A 2A3JA 1RP5A 4ES1A 3V4IA 3ET6A 3AQPA 1N33F 4DSLA 2P8IA 4Y2CA 1BQMA 2VJUA 3C16A 3M8QB 2YVSA 5DZ7A 1M1HA 3CCWA 4N47A 1JKHB 4ZLPA 4WXOA 4UTGA 3DLJA 3BO4A 3PY8A 3R27A 2R8IA 3A3PB 3OR2A 4M63A 2WW4A 2VBYA 4C8ZA 3R2CJ 3GPAA 3R1HA 1CSJA 1HR0J 3OFFA 3ETOA 2V8HA 5KG4A 1HFEL 4DL7A 1HI1A 3DLEA 1VQKS 4IDKB 3CMAS 3C14A 1JXEA 2ZBIA 3AH6A 3PYGA 3OHAA 2UV8G 4CH0S 1H73A 4P7TA 2VHGA 4NPOA 3GIRA 1KQKA 2Z58B 3ILJA 2H4YB 2GVDB 1NRKA 3I5BA 4CDIA 4N8OA 4USJC 4KQZA 4YR0A 2QSFA 3GP9A 3QGHA 4ZN1A 2OUGA 1A7GE 5KFIA 3ENVA 3HXMA 3QZ7A 1WOPA 1YRXA 5ETQA 2H1YA 1CJVA 4YB5A 3H42A 1ZAWA 5KG0A 2FJVA 4AL7A 4X2BA 2ZDOA 2UUBF 2GCFA 2C42A 2DNYA 1Q4RA 1O51A 1N5VA 3PW0A 2VG5A 3R7BB 4K4SA 1CS4A 4WPAA 4ANEA 4EYIB 3NY0A 1VI7A 1YRTA 2FVQA 3CULA 2UUWA 5E41A 1QUVA 4MMOA 4DUZF 3NGRA 4J9KA 2E9ZA 1TMMA 2CPDA 1N0UA 1N32F 2XY6A 5C2CA 2B7BB 2LXFA 1HYSB 2R4FA 2HGMA 2BUNA 4FP9A 2ATCB 2F4FA 1FKAF 4OV6A 1N4LA 4G6VB 1KQGB 1YX2A 4LBIA 1L3TA 4M5MA 2ZBPA 1G3OA 1RUSA 2A6OA 3M8YA 4OX9J 1EP4B 3KKFA 2OMOA 4ES3A 1S0OA 3UDEA 1GMWD 4O44B 2V4JA 2ZBQA 4JB8B 5KT4A 2UUAF 3KNGA 3BBFA 1U1QA 4MK8A 5J2MA 1RTDA 2WVCA 3NGKA 2HHTA 3GIMA 4HHHA 3PJ9A 3IA0A 4RBVA 1D1UA 2GIFA 3GSIA 2C28A 2NXUA 2ZC4A 5SZTA 4R0JA 5CCMA 5CD4A 1YZ6A 4JV0A 4K7QA 5DJBA 3GFYA 4I6WA 1T9UA 1HBMA 3CSKA 1LWXA 2DXDA 4IG3A 3HSZA 4CO0A 2C2ZB 4BC9A 4F02A 2GQQA 2KL8A 4I67A 3C6UB 1U1OA 3MMAA 5A8KA 2AEFA 2DO0A 1TMJA 1LEOA 2EI5A 2BJ3A 5L39A 1SH2A 2LXUA 3MEDA 2AD9A 3P96A 1X60A 4PWUA 2G4BA 2GJFA 2KB2A 3PW5A 7FDRA 3B4MA 4DQSA 4FYYB 3QGPA 3U1NA 1H7XA 4NLSA 2J7UA 2VDHA 1APSA 1U2RA 1TFYA 3M2RA 3CW2C 2EBGA 1JLCA 1ZTTA 5U47A 2VH7A 3QPIA 3DYAA 5THWA 3ULHA 4Q0BB 4OI1A 5IT9Y 2FHJD 2GA7A 4QQBA 3SFUA 4RZRA 3FDSA 5HJXA 4DR7J 3HM9A 4DSJA 5A8WB 1FKOA 1WHXA 2AJ0A 4DL0C 4DBQA 1RWNB 2ZOMA 3PR4A 3PVXA 1P1TA 4LBPA 1NKEA 1OQ6A 1WC0A 1Q53A 4ZLJA 3LP2B 2F9DA 2ZH5A 1ZYQA 2Q43A 5EWFA 3I4HX 4NLRA 4JI5J 3CJ2A 4O3SA 4HT5A 2IDLA 3LF0A 1H74A 3FUYA 4OYXA 3UNYA 4M5GA 4JI7J 1R6VA 4YY3F 1TVRA 3DLGB 2XS7A 4KB7A 1KQFB 2DNGA 1SC3B 4ZVPB 4LJMA 2DHAA 1TUVA 4GKKF 3QIDA 4PKDB 4DR1F 3FNNA 4LRFA 4Y2AA 3ITHB 4ZA1A 2KHDA 2RB7A 2LFVA 2AU0A 1M5SA 2R9LA 2GHVC 2E1AA 2HZCA 5BJRA 3RG6A 3AOAA 4QIGA 3IM9A 2OPRA 1AFIA 1GEHA 2RF2A 1VIOA 1FK9A 4LF6J 1AA1B 2MKYA 4J9OA 2YX7A 1PGZA 1B7FA 2ZVSA 3I96A 2HPUA 4NWBA 4URGA 4B9TA 4CI0B 1K47A 1RT1A 3SSRA 4NZ7A 3CJRA 1ZA1B 3LANA 2HS0A 2M8HA 1JLAA 4HVZA 2W8LA 5CA5A 2FYXA 4DR5J 1YLXA 4I2QB 3W64A 3D2WA 1KNZA 1RAHB 2NS1B 1C4CA 4MIWA 4YMEA 4B02A 2DNNA 5AJ3F 1LWCA 1QAIA 3G9CA 2WONB 3CVKA 2UUCJ 1Q16B 1W2IA 1Q8BA 3N5FA 3RR8A 2X3GA 3MR7A 2X51A 3BQ2A 1JQGA 4ED8A 4B9SA 4Y34A 1ROFA 1VQNS 2ZH3A 4ZP8A 3FKBA 3FSIA 2OSRA 4KTQA 4NLQA 1R8HA 1KD1T 1T03A 5LT5A 4X62J 3DLLQ 2CRLA 3CD7A 1EETB 3OSNA 2A18A 3N0VA 4YDXA 2Q79A 2CZ9A 4KFBB 2W9AA 5FLXU 4E98A 5RUBA 4PQUB 3EGVA 3OLBA 2AF6A 4PAAA 2CJXB 1TL7A 2AEJA 2ZJRQ 1RKJA 2KDOA 2YBVA 3JSRA 1XWLA 3FRYA 3WQPA 3CCRS 4A8KA 3K0JA 2JWNA 5B0CA 3GR0A 1WI8A 3AJDA 3W2VA 4DZ6A 3FK4A 4ZHRB 3UR3C 2KM8C 2C2RA 3LPYA 3OTCA 3MPVA 2DNKA 2QL7B 2NXJA 3DOMA 1IWAA 1UWBA 1SPBP 1ICEB 4PXDA 3BGRB 2KXHA 1S1UB 1WWHA 4LIRA 4EK2A
chains in the Genus database with same CATH topology
1F0XA 1WELA 2W8KA 5CYJA 1DBDA 2XI2A 2ACYA 2GC8A 3EGNA 2AJ1A 1UVLA 1V3RA 3QWUA 4RUAA 4FF2A 1MW7A 4QWAA 2NZ4A 3M2RB 4KC5A 4MIBA 1JLCB 1S1VA 4NX9A 3MURP 3ZC4A 1TL3A 1WACA 3RBEA 3KK2A 2M88A 3IR7B 2ASJA 1L3VA 2SXLA 5AXKA 3GB0A 2DITA 2Q3PA 2K1RA 3DYAB 4ZS6A 2VBXA 1IKWB 4NLVA 3D0HE 2JLGA 4ZPCA 4U9RA 2Q1LA 1HI8A 1NNDA 1FRXA 1O0PA 1U45A 1SV5B 2BVZA 7FD1A 2Y1IA 4DQRA 1UVMA 3LP1A 1X5PA 5B0FA 4O4GA 3EZUA 4JI5F 3MEEB 2L9WA 2MQOA 3RW6A 5F8LA 1FKOB 2BANB 2XHWA 4NYZA 4DMZA 3MECB 5CYMB 4Z2XA 2AGQA 1X0FA 2DNPA 1UAWA 3H20A 3O8WA 4QWDA 2FC8A 2ZJQQ 1TL4A 2LLZA 1FJEB 3LAMA 1WNEA 2E9RX 3LP0A 5KFPA 1HW9A 1SH0A 4DV0F 4TYBA 2HWTA 3HVWA 3ZZYA 4DF4A 1P9QC 2HQ3A 4AQYF 4RW4A 4JI7F 3VAMA 4EEYA 1VC5A 4HLBA 4LQ3A 1XERA 2ZFHA 3OR1B 3WDOA 4ZPVR 3FFIA 2CVIA 4OI3A 4OHYA 1HHSA 1N54B 5L8RC 1S9EA 2FLOA 1H0HB 1VQ4S 1Z1ZA 3DC2A 5F8NA 4ZPDA 4DV2F 2VBWA 1OPZA 2UXCF 2EKYA 2PMHA 2HNDB 5DDOC 2CJ9A 1V9OA 4F4WA 3C46A 4X4UA 3OL6A 3EX7B 2EFNA 5L1KA 4QR2A 2NLWA 4H4KC 4JI1F 2NUHA 1S9FA 4RWWA 4EU0A 3LW5C 2JEFA 3MDFA 2X1BA 3B4DA 3IS9B 3BREA 5DDQC 3NNCA 3HVTB 4ZPBA 3TA0A 1U8SA 2VG6B 5K9FA 2BABA 1N6QB 2UXDF 3NG8A 2CVEA 1TVRB 5DG8A 3OVBA 2DPJA 4URQU 1FKPB 2FB0A 4IO1A 2OPPB 2ZE2B 2XS5A 5LJ5Y 1KLMA 3NCQA 5C42B 3OXFA 3IO1A 4TQRA 1LXNA 3JYTA 1S6PB 3PEJA 1U1MA 5M2PA 5D3GA 4RKUC 1U6FA 2DGUA 5KOXA 2XBPA 4YB1P 2DGTA 5KFXA 2L9NA 4A8WA 1QLNA 1FXRA 3C8YA 2EG2A 4B3OA 2MDAA 4NLPA 4MFBB 2BRLA 3JB9k 3I5CA 2D3UA 2D9PA 1X5TA 4C97A 2XULA 3DI6A 3I87A 1U26A 4DSKA 2O3DA 2FJEB 1D0EA 3MM7A 4OX7A 4EZ6A 2GMHA 5KT2A 4MKYA 3OQ2A 2HGNA 1V3SA 1P8GA 1DLOA 4FXWA 4KGMA 3FQLA 2VL1A 1ZETA 2JRSA 2XO7A 4KIAA 1FRLA 1FNMA 1XK8A 2GQCA 1X0PA 3CGIA 3SV3A 5KFYA 2UZAA 3POTB 1NKBA 1JLFA 2KRRA 2YKNB 2KXNB 2WCXA 1M1KT 4NOHA 3KFWX 4LIWA 2B5JB 2D41A 1WHYA 4MKAA 3H8YA 5D6GA 4RW7B 1RTHA 1G2EA 5KFFA 4J37A 5A8RB 4K5RA 2DGXA 4AXIA 5JUMA 1KHWA 3C66A 1B0VA 2YKOA 4DSFA 2XB2D 5KG5A 5CH7B 2HLTA 2OPRB 3S8SA 5CHCB 3CD6S 4CTAB 4GKJF 4K0KF 1K1SA 3PRDA 1XBWA 2K7KA 1U4BA 2RF2B 2YWEA 1GT8A 4OJGA 1FK9B 3M30A 5H9FJ 3VQSA 3JTOA 2XMMA 3CD5A 4F4XA 4URSA 1HNZF 4YB6A 1U1RA 4IRCA 5F3TA 1JLGB 2JC0A 2MY8A 4KV8B 2GO8A 6FD1A 4ED2A 2R2UA 4F67A 2J6SA 3QWPA 3VR1A 2KG0A 4BWJA 5I3UB 4X4TA 1Q81T 2EG1A 4ZHRA 3O2IA 4LQ9A 1T8EA 3KOAA 3OTEA 4FBUA 3GV8B 3V2UC 1UA1A 4QU6A 3ISND 3ZZPA 4PXEA 2MHNA 5DRKA 2XLKA 3ZZOA 2YWHA 2I2YA 4BS2A 1Y0HA 3AA8A 3H4DA 3VAJA 4DR5F 3KK1A 1C1BA 3OW2R 3KLGA 1SJFA 3E01A 3C2PA 2HFNA 3PX0A 2BE2A 2FLLA 1JIHA 3MMCA 3M9MB 3PW4A 4WFAQ 1GNKA 1L3UA 1RT1B 2QA1A 3AAWB 2DD8S 2KT3A 2HYIB 4WFNQ 1CLFA 2LDIA 2MQMA 4DPOA 3MM5A 4I69A 5E0OA 5F8MA 3C6TA 2ZC3A 1VQMS 3P5TL 1RWUA 1UJ6A 2COLA 1PO6A 3CEDA 1JLAB 3MM9A 3WZ0A 4ILMA 1C1CB 3D5MA 2EK6A 4DL3A 1P27B 3DLBA 2R8KA 4ECTA 1MU2B 3CPWR 2FGCA 2L48A 4IH5A 2V9KA 4PPDA 4OZJA 3G96A 3MFHA 4C11B 1SUQB 2VC1A 2BZ2A 4ZVFA 2O01C 1HW8A 3QYYA 1BGXT 2R7OA 5AXLA 1IKVB 2PA8D 5MLCV 4X84A 2H9ZA 2JDJA 1KSPA 1ZM3A 2MYFA 4KT0C 3PW7A 4WK3A 4CIOA 2LEPA 4Q7AA 3WBZA 4ID5A 2R7WA 5HO4A 2OD4A 2CIMA 2GNKA 2D74B 2IA0A 2OFGX 2PMZD 1P6TA 2CQ0A 3KHHA 4X62F 1LWCB 2VQFF 1SV5A 1ZZFA 1RKIA 4NZ0A 2VQEF 2A1BA 1PSDA 2RNEA 1OIAA 3RYLA 3V4MA 5T7LA 1TKTB 3DXSX 4I7FB 4RX6A 3MEEA 4O3QA 3K58A 1TK0A 3PX4A 3HJFA 3KMSA 3I32A 3CJKA 2BANA 4NCGB 4G3IA 2IC3A 3MECA 2OTLS 3Q23A 4NLYA 2QMWA 2IRYA 2RRNA 1YJNS 2V9WA 3O6QA 2DT9A 4A4JA 4DHVA 3JAMY 3PKYA 2Q66A 3UNGC 1FRKA 1S97A 3MM8B 5DM6Q 4WTYA 1Z2ZA 2DR9A 1BQNB 2HMIA 5F9LA 2B51A 2XMWA 4DV4F 3H4BA 3VAKA 2JL9A 3S1TA 2LQBA 2IVFB 3TOQA 5DGAA 2OMLA 2CPHA 4MIAA 4Y2IA 4Q45A 2DR5A 2JHEA 2UVVA 2B4OA 2MGZA 4RW9A 3CC2S 1KVIA 5D4LA 3P6YC 2F1FA 1S0VA 2KYZA 5CD4H 4EBDA 5D4NA 1Q7YT 1T3OA 3EPGA 2APOA 1SC6A 3VF0B 4AL6A 3WX4A 5J1PA 2MKIA 1G7CB 1LW2B 3BN7A 2PFFB 3M6WA 1D9FA 4K4YA 2RQCA 1NAQA 4DWIA 3IS9A 2ADBA 1ELOA 1QE1B 2V8GA 5CYQB 4X4VA 3HVTA 3FEYB 4NLWA 4PRFA 5DLGA 3THVA 3TAMA 5J1EA 1HBNB 2FD2A 5GADI 1N6QA 4OHXA 3B82A 5C5JA 3NWGA 1BLUA 4D3GA 2L9DA 2DRAA 2CQGA 2LEAA 5C42A 2MQNA 4ELTA 4X4NA 3NCRA 1Q1KA 2QLWA 4C8OA 4Y0FA 3M32A 5F8IA 2DH9A 2ZOFA 3GG1A 2XMTA 2UP1A 3OBIA 1DFDA 2D7SA 1ZZNA 3MMBA 5DQHA 3W2VB 4RNNA 3G6VA 1RT7B 3IN5A 4ECUA 2P6TA 3TQ1A 2FVRA 4PPZA 1JJ2R 1LK5A 2EPIA 1FRHA 1RA7A 2VG7A 2UV8A 5IQ6A 1J5EF 1GX6A 2CYYA 2KZMA 1FJGF 4Y00A 2OH2A 2RUGA 2N4DA 4H4OB 3GIJA 1SJ1A 3X3UA 5LL6d 2KRBA 2RS8A 2DNQA 1IN0A 1UMJA 2DK2A 1M0SA 2OJ3A 3CDAA 4M5DA 1TZ0A 4DS5A 2N82B 2ADCA 1Y4ZB 3AJ2A 4HDGA 1HBOA 4DR4F 4QPXA 3FSXA 1R0AA 2P9GA 3UW1A 3QAEA 4O4RA 2ZH1A 3MOJB 1V3ZA 2ZBCA 1YJRA 4TN2A 4NLGA 5KFDA 2LCWA 1WTFA 3PDNA 3QIPB 1JLQB 4NYPA 1R43A 3JSYA 2IRXA 1NJXA 3BF4A 1UFLA 1S10A 2DNZA 5LSRA 1TV6A 4OHVA 3VAHA 1Z2LA 2YNGA 1CQMA 1FA0A 3VQTA 2FLNA 1MROB 4IO9Q 4PUOA 1XC9A 1ZPVA 2FIUA 4ZCKA 1MWZA 3KLIB 2LU1A 3TO8A 5MAOA 2FJXA 1JLEB 3AY0A 4O3NA 1S1VB 1YGYA 1O8BA 1TL3B 3HHLD 3KK2B 3H2VE 4LVNP 2VV5A 4K59A 3KG4A 1H2VZ 2J9EA 4Y2MA 4EYHB 3G6YA 5IT0A 5I42A 4C2MA 1HD1A 2YKQA 2CQCA 4BDPA 3HKWA 2LYVA 2RQKA 4LUBA 2RRBA 5K14A 2ASLA 4F3QA 4RNMA 1M5KC 2MJUA 4OX9F 3CCJS 4NCAA 3LP1B 1WHWA 4DFJA 5F0UA 4O4GB 3UDCA 2BXJA 3B8HA 2AYBA 3RAQA 1Y9OA 3FEXB 4M94A 3W3SA 2DPIA 1Q79A 2MHEA 4MKBA 2JFDA 3G6XA 5J2NA 4IR1A 1DQ8A 1RTJA 5EWGA 4OIXA 3SCIE 3GSDA 4I2PA 4NLOA 3NLCA 1FEEA 4PG7A 4AXJA 3LP0B 1FDBA 1GX5A 1VQ7S 2B4VA 1L5UA 1G6BA 3ICLA 1HQEB 2D1CA 4I56A 3DN9A 3QGGA 2M70A 2Y0SD 2YX1A 4A8XA 2HQIA 3JTNA 1VQ8S 2ZOGA 2J5AA 4FNIA 1HMVA 2RKIA 3F44A 4ICLA 5G4DA 3I55S 4K50A 2YX4A 4NXNF 1RTIA 3FFIB 3MEKA 1H98A 2KG1A 5DQIA 2GGPA 2CQ1A 3SQGA 2HHWA 5B0EA 1S9EB 4YP3A 1ZTWA 1OQ3A 4XPEA 4B3TF 3PJXA 4C11A 1R8PA 1SUQA 1QAXA 2AJQA 5F3ZA 5E33A 3GWCA 2JEIA 5EDWA 3U1MA 3LQVA 2AV5A 4ILRA 4OMFG 2LDYA 1X4GA 3VTIA 3LWLA 1J5OA 3Q24A 2W4PA 2JX2A 1IBMF 4RUCA 4KHMA 1IKXA 4MYUA 2XG8A 2R7SA 2LEBA 3EGZA 1S79A 1VBXA 2GJIA 3M9NB 3WC2A 1S4FA 1UVJA 3AA9A 3G8SA 3RZAA 2E44A 3NP5A 3F56A 2V94A 2E5IA 4NRUA 2E5LF 2L3MA 4UUXA 1KLMB 1WD6A 2F8MA 3JYTB 1N52B 5E3CA 2W4CA 1TKTA 2Q6CA 1QJHA 2UXBF 2V8VA 1X9SA 5GAEI 1VRTA 3M6VA 3L09A 2BJDA 4G1PA 5DDRC 1Q82T 3TUZC 1D9DA 4IUFA 3HHNB 2IBKA 1S7HA 1U2FA 3VWSA 1RT3A 4OZ5A 2QRRA 5E3PA 5KFMA 4Q8EA 2FJAB 1MSWD 2LXIA 4N8NA 3NKYA 3D0IE 3DI6B 1WF2A 2FVSA 1T05B 1SIWB 1RT2B 4G1IA 1DQ9A 3D0GE 2BBEA 3MM7B 2QV6A 2X1GA 4DV5F 4J9RA 1NU4A 2RMLA 3P3DA 5F0WA 1DLOB 3M9OB 4PWDA 4RW8A 4IOAQ 3V5RA 1X4HA 2IM2A 4EGLA 3PO4A 1VJWA 2HW3A 4DSIA 2MKSA 1S1WA 2NSCA 4C0OC 5L1LA 1JLFB 1OPIA 5D78A 3X1LB 2MZTA 3QMQA 4YFUA 4OJHA 4A8QA 2IM1A 3PM9A 1KTQA 3T19A 1Q86T 3PNIA 1RTHB 3VCDA 4USHA 2IYIA 4F50A 1KVJA 4J9QA 3FZ2A 3EXCX 2VBZA 2FJBB 5FIIA 1JX4A 3DNCA 1VRUA 2KHCA 1S1TB 5KFNA 3PR5B 1UVIA 4PQAA 2ROGA 2E9TA 1SL2A 2NSBA 1VOMA 1H2UX 4WIIA 1S6UA 4R5PA 2B9WA 5B7WA 4XO0A 4JI6F 2B7CB 4DL4A 3HX9A 3KJVA 4QR0A 1SB6A 4Q44A 4IOBA 4ECSA 3M30B 4P7VA 3J7A1 5DLFA 1RT6A 1SJ3P 5HI7A 3QZ8A 2VA3A 3VZIA 3MXHP 1S72S 4DR3F 3MI7X 2NPFA 1UL3A 2GIRA 2W7PA 5LMUF 5EN1A 5D77A 3T9NA 2GO9A 2DNHA 3FQKA 3ENQA 2KT5A 2C3UA 3HF5A 4FYDA 2KXFA 3N4WA 1LV5A 3BSCA 4PG8A 1RAJA 4DLGA 2CPIA 1Q8IA 2HHSA 4YB7A 3G71S 4IKAA 2PO4A 1S99A 1NKCA 4Y2KA 1MMDA 3BB5A 1FDNA 1XNRF 4PXCA 5J2QA 3KK1B 1C1BB 5T41A 4QU7A 3E01B 1N5SA 2BE2B 3DGPA 1VFJA 4YR3A 3H5YA 1TKZA 3MMCB 3OLAA 1R89A 4KRWA 1F5CA 2AQ4A 1GTEA 2FVPA 3MOZA 3G86A 4USIA 3CDUA 3MM5B 3T1AA 4QIFA 2ZHOA 2ZM6F 3C6TB 3HO1A 4R8UA 3IAS9 5E3QA 4XIUA 3DLHA 1C2PA 2JVOA 3J81Y 1HBUB 2E5HA 1LWEA 3QIPA 2FLPA 1D3WA 2J0WA 1XR7A 5H9EJ 3T5JA 1F9FA 3FVYA 3A1YG 1REVA 1VC6A 4DR7F 1U47A 1VQYA 2PSZA 4DR6F 2HS4A 4F4YA 3I0RA 4Q2LA 2QSWA 1DZ5A 1MROA 4WCEQ 1BWEA 2HVZA 4KR0B 3KLIA 2IA6A 2MY7A 1JLEA 4B17A 3IFEA 4HI1A 4QBUA 2WOMA 3GZ7A 1C4AA 5I4MA 3MF5A 2CPZA 1X7VA 1N5YA 2JSXA 4ECZA 4ED5A 1VQLS 1KTVA 4MYTA 4XDDA 2O5DA 4ID5B 3BEGB 3CE8A