4OV1A

The crystal structure of a novel electron transfer ferredoxin from r. palustris haa2
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
66
structure length
66
Chain Sequence
MLTIHVDQDKCQGHARCKALAPELFDLDDYGNAHEKGDGVVPADLIDKAWLAKSNCPENAIDITED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of a novel electron-transfer ferredoxin from Rhodopseudomonas palustris HaA2 which contains a histidine residue in its iron–sulfur cluster-binding motif
doi rcsb
source organism Rhodopseudomonas palustris
molecule tags Electron transport
molecule keywords Putative ferredoxin
total genus 12
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2014-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13459 Fer4_15 4Fe-4S single cluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ov1A00
3IR5B 1FRLA 5BYRA 2XSJB 3EUNA 2FJBB 2C3MA 1IQZA 2FD2A 3GYXB 2FDNA 4ID8A 1G3OA 1H98A 3LW5C 3MM9A 5CH7B 1WTFA 1FRJA 1FRHA 1GTEA 1KQGB 1FCAA 3MM8A 2UZAA 7FD1A 2V4JA 3MMBA 3PNIA 2PA8D 4Y28C 1FTCA 1FXRA 3MMCB 5CHCB 1SJ1A 1DFDA 1C4AA 1K0TA 4CI0B 2Y0SD 1PC5A 1GT8A 1FXDA 4AYBD 2VPXB 4DHVA 4XDCA 2XSJA 6FD1A 1BWEA 1H0HB 4RKUC 1Y5LB 1KQFB 1BLUA 2C3OA 2V2KA 1XERA 1C4CA 3EGWB 3IR7B 3OR1A 7FDRA 1FD2A 1PC4A 3HKZD 1KEKA 1RGVA 3C8YA 4YDDB 1FRMA 3MMBB 2PDAA 3MM5A 3MM7B 1Y5IB 1DURA 6FDRA 3IR6B 1Q16B 1FDBA 1CLFA 1FF2A 2WAQD 1HFEL 1ROFA 1BQXA 1JNZB 1SIZA 2IVFB 1JNRB 3MMAA 1FDNA 2FJDB 3MM6A 1B0TA 1JB0C 1VJWA 3OR1B 5FD1A 1GAOA 1F5BA 1FDDA 4L6V3 2VPZB 1FRIA 2WSCC 1BD6A 2FJAB 3EXYA 3MM5B 3MM7A 4XK8C 2FJEB 1FRXA 2WSEC 5BYQA 1FRKA 2VKRA 2FGOA 4OV1A 2WB1D 3OR2B 2VPWB 5BYSA 1H7WA 2GMJA 2ZVSA 1Y4ZB 2WSFC 4XDDA 1R27B 3MMAB 1GTHA 2C3UA 5L8RC 3MM9B 2Z8QA 1IR0A 3MM6B 1FEHA 1D3WA 1G6BA 1B0VA 1SIWB 2GMHA 4KT0C 2VPYB 3MM8B 2C3YA 1A6LA 1BC6A 2C42A 2V4JB 1AXQA 2O01C 1H7XA 1B0PA 1FDAA 1FERA 1Y5NB 1F2GA 3MMCA 2PMZD 1F5CA 1DAXA 2C3PA 5E7OB 3OR2A 4OMFG
chains in the Genus database with same CATH superfamily
4NEYA 2F8MA 1NMEB 5BYRA 5DETA 4MMOA 2GFFA 4JI0J 2I38A 2HHVA 1PG5B 4TY9A 4ED7A 1R3NA 3LA0A 1J5OA 4BWJA 3CSKA 2CPYA 4ZOSA 1R8AA 4ZVEA 1H98A 4RNOA 2W2MP 5ITHA 5C7PA 2JLFA 4WP8A 3SV3A 5DM7Q 1S97A 1N5SA 3M30B 2HHWA 4M5NA 3VQTA 4NRTA 1JX4A 1FCAA 4FP9A 1R0BG 3QFWA 2DGUA 4FYWB 1MLAA 5KG0A 2QYGA 2UZAA 2DHXA 2ZE2B 4CYUA 2FVRA 1RT2B 3MUTP 5K8NA 4GO5X 4TY8B 4JP8A 1FXRA 3LAKA 3MR5A 2D3O1 1T9UA 2QA1A 1M5VC 1Y0HA 4ECTA 1HBOA 3OTBA 3MR6A 4IFYA 4YHHF 4CLWA 1RT4A 3GV5B 1NHUA 5ETTA 5J1EB 2VL1A 3CMAS 2QZ8A 3P5TL 2V94A 4KO0A 4ZMMA 5KG4A 4EUVA 3NGKA 2POKA 3UVJA 2C28A 2Q6BA 1FK9B 2XCPA 3AQOA 5KTQA 1Q81T 1Q4RA 3KJQB 2UUAJ 1HYSB 4NX9A 3ZZYA 1S59A 1U26A 2UUBJ 2BX6A 3V6DA 4TYBA 2IDLA 7FDRA 2GQCA 2CQBA 1UW9A 3QT5A 3PX0A 2IA6A 4GKKF 1RZMA 1RGVA 2IRUA 4E98A 5I42A 2ZM6F 3W64A 3TJAA 3VGVA 2KG0A 2CDQA 2P9EA 4LBIA 4BHQA 3PYFA 2W8LA 4OHVA 1B7YB 1X8DA 2WVFA 1ZPWX 2L9WA 4P6QA 4NYOA 4MKVA 4M5IA 4DCPB 1S9FA 5G4DA 2I5JB 2AYGA 3NOGA 1WD6A 2FHMA 4BLGA 4ELVA 3QJLA 4D3GA 2PFFB 2BOAA 4LF6J 1Q78A 2RU9A 2RE1A 1P1LA 4CO2A 5A0YB 5LMUF 5D8HB 1C0UB 1DTQA 2N7YA 3TUIC 1MW7A 4H4KC 2VA2A 3D3BJ 3CDUA 5LJ3Y 2GC8A 3BR8A 2ROEA 5FJ4A 4U9RA 1YG0A 1X5PA 5L1IA 4RW8B 4WFXA 2HHHJ 4DFJA 1FDDA 2HWHA 3GJTB 4PXBA 1KFSA 2YQ1A 1FRIA 3EVOA 3MECA 3J7Z5 3MM7A 3RB4A 5ETNA 4IOBA 4KRWA 3QGPA 2LP4A 5H9EJ 3CCVS 1TV6B 3PX6A 4ZS6A 4K8RA 3DLEA 3I9V9 5BYQA 1FRKA 3BR9A 2DD8S 4OV1A 4ZVGA 1HWUA 3CDAA 4J9MA 1RT7B 3T1AA 1YRXA 4PUOA 4ZK7M 1Y4ZB 2MJNA 3E8OA 3EZOA 3FMBA 1T11A 4IH7A 4XDDA 5EWGA 2H5IB 3G6XA 1UTAA 1JJHA 2XTJP 1XMQF 5L8RC 3R5DA 1U7LA 2L08A 3BO3A 1HBNA 3H59A 3L7OA 4YY3F 5JUMA 3GB0A 1NJWA 2B8QA 2GMHA 1U1PA 1KTVA 3TRGA 3QAUA 4HKQA 4QR2A 2DKOB 1EKRA 2O1PA 2J0XA 3CJ3A 2DO4A 2IM3A 1B0PA 1N54B 1Y5NB 2VBXA 3AH6A 5F0WA 5J2NB 3UN3A 3N01A 2GNKA 1S1VB 3K89A 2VQFF 3HVTB 2XI3A 2KFZA 5CXTA 3H0PA 1RWUA 3WC2A 2R2UA 2YWFA 1QAYA 3PM9A 1H2TZ 1I3OB 2HFZA 1ZAXA 2CPZA 2XHCA 3GR1A 3DMJB 4DXLA 2L41A 1G3OA 4NZ6A 2PO4A 2YH0A 4I2PA 4O3PA 1V3ZA 4X84A 5CH7B 1CG2A 3DOKB 3E3XA 3LWLA 1X9WA 3HD2A 4DL2A 3MUMP 2HRYA 1OQ3A 2KT3A 2LMIA 1CJUB 1DQAA 2ZOGA 3SSSA 2RQCA 3IGNA 1Q79A 1WKKA 3DOMB 5D4LA 3G8TA 3TJ8A 2VFUA 4OI1A 2W7PA 1NAQA 4LRDA 1XTZA 1K0VA 2DGVA 3GCWP 1C4AA 1S4EA 5ETPA 2YWEA 3KG1A 4ZVTB 5HO4A 2J6UA 3K0JA 1K0TA 2KHCA 4LIWA 3KLHB 2G0IA 3IGVA 2A2DA 4KYZA 3ETOA 4FYDA 4JI6F 4X66J 3LH2S 4EBDA 2YWWA 2FJWA 1JK9B 4DV1J 3POTB 1QSLA 2HFUA 1I5OB 3DCAA 1ZPVA 2E1MC 4HR2A 2FJVA 4M5GA 4X4QA 1IBCB 4PXDA 1WHXA 3US5A 2MQMA 2E1CA 2BDPA 4H4OB 2YKOA 1U6BA 4Z7YA 3IP0A 3ISNC 1BGXT 1JXVA 3SFUA 2K7JA 3WBZA 2RDDA 2ZNYA 5A8KB 2MHEA 5DM6Q 1S6PA 1FA0A 3C8YA 3D7SB 4HLBA 3VGTA 3CCJS 2QL7B 3G2XA 4QIWD 3CCUS 1MU2B 4FXWA 3MM5A 2MYFA 2QJ3A 3IBCB 3TP2A 4HT7A 4YMEA 3GV7B 3OL9A 3ONQA 2PE8A 4DPUA 1NJIT 2DPJA 2DH9A 3KHLA 2YXLA 5K14B 3PTWA 3MTJA 2ZC4A 1RT5A 4DS4A 2PC6A 4EO8A 1EAYC 4F50A 1U45A 3G87A 2G2OA 1FDBA 4CM2A 5GAEU 2CQ0A 4ED1A 1FE4A 2KYZA 3LP0A 4QWDA 4UY85 2Y8YA 4A8WA 3CPWR 1XMOF 2GIQA 1NK8A 4K4SA 4MIAA 3F56A 2OO4A 1UW4A 1HNIA 3Q8VA 4PG4A 1U1MA 4RUHA 5F41A 5DDQC 4PXCA 2DR8A 3CDWA 5ETMA 1JB0C 4UW2A 4DJBA 2KVQE 4J9LA 2XEXA 1UVKA 2AJ1A 4BS2A 2W9BB 4DUZJ 3IAM9 2QO3A 3J81Y 1ZTWA 2RNEA 5CYQA 3AJ1A 1VQSA 1C2PA 4LF1A 4HDHA 1AUSL 3ZZPA 2BW7A 5KG3A 1J2VA 2M7SA 1U1LA 3QGGA 3W9JA 2UVUA 4YR0A 3GIKA 4NZ7A 4U7UK 3CMQA 4DOZA 2J76E 3L9ZA 2WW4A 3QZ7A 5IT9U 2DK2A 1TELA 2JFDA 4MIBA 3CJTA 2OELA 3PYEA 3TNVA 3GG1A 4ZVOB 5BYSA 4WCEQ 5JVGQ 4F4ZA 5KFFA 1SUQA 2AGQA 3WIUA 4ZCKA 4ETXA 2GZOA 1VIOA 2LA4A 3CJSA 3HFVA 5JMNA 5AJ3F 2W2OP 2WTFA 4GC6A 4ZLJA 2QE5A 4P73A 3ISND 2MKSA 3SDEB 2JEJA 1IM6A 4F02A 1R8PA 2DH7A 1SIWB 3W60A 1ZZNA 5AXKA 4Y0FA 2IJRA 1FJ7A 2YPYA 2WVBA 3M8QB 2DGSA 3HZEA 1B64A 2V2QA 2ZBPA 4YR3A 3JAMY 1ZBTA 4GO7X 2XSFA 5KFHA 4UT4A 2PMZD 1F5CA 3HULA 1Z2LA 3AOBA 3TR5A 5D4OA 2E9ZA 2DR9A 4WKRA 3BN4A 4CLZA 3AD7C 2BZ2A 2LEAA 4ZA1A 2LYVA 3V2UC 4ZJQA 4L75A 4PEOA 3IR5B 5IWAF 5C24A 4LR7A 2NREA 3VGUA 1KBRA 1BQMA 1Z4UA 3I9ZA 4ED5A 1IQZA 1QY7A 2FD2A 2XYHB 3RU0A 3FRZA 3C46A 4USMA 3DM2A 2HAIA 2W01A 4JI8F 2VG5A 2QC3A 2V67A 1EJ7L 1N33J 2NCKL 4P2MA 4AD6A 5IT4A 1VC0A 4JI7F 4J9VA 3NNHA 2VBZA 3H20A 4ED6A 1KS2A 2G1DA 2NXNA 3HVWA 3VZHA 2CPDA 4EFAC 4LF8J 2KRBA 4IOAQ 2VF3A 4ED3A 4TLRA 4DV6F 2V4JA 4DPXA 1J5EJ 4DPWA 2PA8D 4M5HA 4YQWA 2KG1A 2UV8A 5K20B 4CIOA 2CJKA 4QU7A 2CWXA 5LXYA 5CHCB 1F6TA 4OJGA 1RTIA 1TU0B 4ER8A 2J6SA 3UN5A 5DG8A 4OX7A 5IZHA 2Z57B 3QGIA 3OT9A 2VPXB 4CLSA 2VFSA 3D4JA 3NRBA 3OFEA 3CJ0A 2IBOA 4J9OA 2XQCA 1MROB 4URQU 5HAOA 3T5KA 1HI0P 4RUAA 2QEXS 3LP2B 4DV5J 4RX6A 3CT9A 2Q1LA 3Q8PB 2AEFA 4IFVB 3WQPA 3A8IA 3BGUA 1BLUA 3JTPA 2KHDA 2VJVA 4EZ6A 4NOHA 4LRAA 1GX5A 1WF1A 2EW9A 2IC3B 1R0CB 1EP4A 2JVOA 3HKZD 3GFHA 5I3UA 2XCAA 3DLKA 3Q22A 2WONA 1KHWA 4RW6B 4NLQA 3MCSA 3VAFA 4NYPA 2MEWA 4RR5A 5J2MA 5MAOA 2HKEA 3I0SA 3NL0A 1CULA 2QMXA 4WPAA 3SIPB 5KFGA 2QG9B 4ILRA 3ET6A 1YIJS 1FJGJ 3BN7A 3HSZA 1CLFA 4IO1A 3RG6A 1VQMS 1NPPA 4HI1A 3D5MA 4QQBA 3LALA 2EK1A 5KT2A 2B6AA 3TAMB 4F67A 4YP3A 3KK3A 3T3FA 2HK2A 1KHVA 1HI8A 3PJ9A 2BUNA 1EQ0A 3MMAA 1VRUB 1UWBA 3MEGA 4YOEA 2OTJS 1HD0A 2FLNA 1LWCB 5GVQA 1RCXB 2GQ2A 3NKYA 4Y00A 1N5VA 2KDOA 1SV5B 1SJQA 2QRRA 2MPUA 2ZWOA 1VJWA 3LP1A 3PCOB 2GJ2A 3TVZA 2LKZA 4F04B 3T1HF 2ZITA 4WE1A 3VCDA 4C0OC 4CRJA 2NUUG 3BGFA 1YRUA 1CJTB 3W66A 2DGWA 3KOAA 4G1QA 1SL0A 4TNOA 3SYZA 1S9GB 3Q24A 5J2QB 3ZTQA 1QAXA 3FBEA 2GX8A 2VHGA 2COLA 3CCTA 1FKAF 4OL8A 3GTYX 3M7VA 2ZHOA 1MMDA 4G1IA 3TAQA 4JI3J 5KT4A 3LANA 2QA4G 2GHPA 3BEGB 1TL1B 1FESA 2CQIA 4LFAF 1SKSA 3W2WA 4OX9J 5CAAA 4U6PA 3O6QA 5KFZA 2DPIA 2RKIA 2CG4A 1Q95G 1U1QA 1RSCA 2D3OR 2Z56B 4DSLA 3D1HA 4RLEA 3N79A 1B0VA 5M2PA 5L1KA 1XNRF 3BSAA 2ATCB 4WIQA 2R8IA 1DQ9A 1DTTA 2X1BA 1QLNA 4Q8EA 2Y1IA 4ZVFA 1R8HA 1FNMA 3B8HA 1U2CA 1RBAA 1JLBB 2KJWA 4DN9A 3MMCA 4WK1A 3T1YJ 2F63A 3FRYA 3D28A 2UU9F 3LGNA 3F41A 4I67A 4YB1P 2C3PA 3QJPA 2NXCA 1N36J 2IBKA 1SL1A 3QWPA 3FQLA 2B5JA 1Z1ZA 5B0DA 1XK8A 4M5JA 3MOJB 3G86A 4B17A 5CQGA 2CJ9A 1HMVA 2Q6CA 4ZKAA 1WC3A 4NLGA 4OZNA 4DR3J 5F8JA 1RT1A 1WG4A 1HQEA 3GP9A 5FDLB 1FRHA 2F4VJ 2EI5A 3C15B 4JUZA 3P5BP 1NH8A 4USTA 3RGIA 3A3PB 1LV5A 1YZ7A 1E6VB 4K4UA 4ZVRB 2DHHA 2R8JA 4NI2B 3UR3C 3EGNA 2NQPA 1R8BA 2B43A 2VH7A 3FCWA 3H98A 3T41A 1S1WA 3QSIA 5T14A 1JLQB 2ZWPA 2YNFB 4CTAA 1U6ZA 3E01A 3QZ8A 4PUOB 4ZPTR 4KB7A 1SVDA 4YN3B 5HLFB 1QM9A 1S9EB 4OJ1A 3SI8A 5C25B 1TK0A 2RQ4A 3WX8A 1KTQA 5D0HA 1BWEA 5A0YA 1H0HB 5U47A 4A4JA 2OPQA 2Q79A 4X65J 3HVRA 2E1AA 1EARA 2KT5A 1U02A 1TL3B 1UCNA 2YNIB 3LGHA 3ZZZA 1HBMA 4LF5J 4BDPA 3KLEA 4KFBB 3D3CJ 3CJRA 2HHUA 2K06A 2IVMA 3HHDA 5LMNJ 1VQNS 2H4YB 1HD1A 3AXMA 3MXHP 5KFXA 2ZOFA 5D3GA 3H7HB 1DRZA 4TLQA 5RUBA 3IN5A 3MM7B 1HNVB 3W5YA 2ZOMA 1T7PA 3IM8A 3CIMA 3HLUA 3LOUA 4Y6IA 1PYTA 3FMWA 1RTJA 3P8BB 4M94A 3ILIA 2ABYA 4CLLA 3ZTOA 1SC4B 1X0PA 3KFWX 1FF2A 3UDLA 3VTIA 4LF9J 1A7GE 2I6WA 3P4UB 4ED4A 3M6UA 1N0VC 2RSQA 4LSNA 3MAAB 4PZVA 1S5ZA 2HZAA 3PIPQ 5E3QA 1D9DA 3AFGA 3G6VA 2FJDB 2GGPA 3A3OB 1B7FA 2BVZA 1GEHA 2IVYA 4UOFA 4WFZA 5BJRA 4DSKA 3AQPA 5H1SV 1Q1KA 2CQHA 3BH7B 4HACA 2N7CA 3I96A 4DR6F 1FE0A 3CB4A 2QFJA 3MD1A 4B3SJ 4DFKA 3DI6A 1IKYB 2PMHA 3C16A 4IG0A 4DUTA 3CO0P 3FEZA 4C3KA 2W8KA 5FLXY 3PRDA 4XK8C 4FNHA 1WELA 2DT9A 1KFDA 1YQHA 4ZDNA 2J8SA 2AZ1A 3Q8SB 2G13A 1O51A 5KFNA 2FTRA 1VQKS 3R6LB 4CO0A 2KN4A 2KXHA 1S1TA 2F9DA 3BZQA 1HPZA 3OR2B 4X66F 1NK7A 4JI6J 1RWVB 3SEOA 3UW1A 2V9WA 2KVIA 3OFFA 3EWGA 4S0MA 1IBLF 1KWMA 1UL3A 2RQMA 1JLEB 3QIPB 1DZ5A 5D15A 1NLKL 2H9ZA 4EBCA 3QT8A 3MCMA 4PPDA 2UUCF 2YNGA 3Q2TC 3DNCA 3L7PA 5DLGA 5H9FJ 5KFCA 2MXYA 4QWEA 3DOKA 3OL6A 2XMUA 1CQNA 2HHXA 2BQUA 3CJQA 4A8SA 2E5LJ 2MZ1A 2V69A 1UAWA 3M6XA 3V4MA 5F9LA 3RR8A 5DG7A 1F2HA 4LF2A 4FXVA 1KQSR 1REVB 3A12A 3V4IB 1AXQA 2JRSA 1S10A 4OI0A 4P9SA 2XZWA 3MPVA 5K8OA 1YVFA 1GMVA 2B9WA 4U95A 3TUZC 2HVIA 1T03A 3QYYA 2CJYB 4K7QA 2KZZA 1U1KA 5KFQA 2MB0B 3B6BA 1VFJA 3CEDA 2B9XA 5HMYA 3JYTA 4P2SA 1TKXA 5KFSA 3CCES 3D6TB 4L76A 5LXRA 3LPEA 5KFTA 3TEHB 3DGPB 4DPOA 1RTZA 2V68A 4ID5B 2D1CA 2K3IA 2GVDB 3Q0AA 2A6MA 3DXBA 4FXDA 2AGPA 4JI1F 2F8HA 4NPOA 4CLPA 1O0PA 2VDIA 2AJQA 3MM8A 1UFLA 2B9YA 3O3LA 3PJWA 4HHUA 1XR7A 2R8HA 4Y28C 3M6VA 4ZLNA 2QL9B 1JQGA 1HW9A 2KT2A 3O2IA 2ZH1A 1CSJA 2KU7A 2XYGB 2WVDA 1RP5A 4HHJA 3Q8RB 2R9LA 3T5JA 2XO7A 1SKWA 1M90T 1RYSA 4O3RA 3T5LA 3I4PA 4QW9A 3BSNA 1XNQF 1NDKA 2GVZB 1VBKA 2E5JA 3GQCA 5B0CA 2CWKA 2LEBA 2OGUA 2HBRB 3RBDA 1ZETA 2R3VA 1NK5A 1RACB 5AXLA 2KFNA 2DGOA 4DL3A 2NPFA 1UP1A 3IBWA 2QA4S 5IT9Y 1WC1A 1PAEX 2WVCA 1B4SA 1HKAA 1X9SA 4FBTA 2CKWA 2CNKB 3DU5A 4M1KA 3MFHA 1TMMA 4O3QA 4NYZA 3H2VE 4A8YA 4JI2F 2GCFA 2NZ4A 5LT5A 1S4FA 2R7OA 2ZJQQ 4NLYA 5CYQB 2ZE2A 4CYUB 5C2GA 2P6SA 5AE3A 5KG2A 2Y1LB 4N8OA 3ITHB 1S0OA 2FVSA 2XWXA 4HEA9 4MK8A 4AQYJ 3TI0A 3CDBA 1DQ8A 2OD6A 1S57A 1OSDA 3DRSB 3HJVA 1RXOB 2V0NA 4YB6A 2M52A 2QLWA 2VUGA 1KR4A 3R5JB 2WAQD 2HS0A 1SUQB 2JL9A 1JNZB 3BGRB 3C14A 4WFNQ 4DCOB 4F0MA 3R5AA 2VC0A 3G82B 1RTHA 4RW7A 5L1JA 4C97A 2FVQA 4B3TF 1REGX 4P74A 4PAAA 3NBPB 2X7IA 4WJBA 3M2RB 1LEOA 1GAOA 3I56S 2AF6A 3VWSA 1QD1A 1BQNA 2EBEA 3DLGA 3MEDA 3TEGA 3TVYA 3HSGA 2E7VA 3ZZRA 3K7RA 2LVWA 2GIFA 4KGKA 5LSLA 3E51A 1T95A 1SC1B 4ZPWR 2OMLA 3R6GB 3FVYA 3CD5A 5HVHA 3C3LA 5KG7A 5CZXA 2BE2B 2CFXA 2W2QP 2BACA 1TUWA 3H4DA 2CJAA 5CYMB 4Q2LA 4RNFA 4JI4J 4IQMA 1YBUA 1FWKA 2RHSB 3MPYA 4OYWA 5KT5A 1RAJA 1UA1A 4KPYA 3U7JA 2W2PP 3PW2A 2R2RA 1DTQB 1XMQJ 3I0RB 1SBRA 2PEHA 2VG5B 2VFVA 3B54A 4LSLB 1PJ6A 2CJQA 2EVZA 3BM7A 3MMJA 4IKAA 5IQQA 1TZ0A 1L3KA 5C42B 3EPIA 2DHSA 2DISA 1RAFB 1N0UA 1GXUA 4KGXB 1SH3A 4J9RA 3RAMA 2MZQA 1N5YB 1S6QA 4JV1A 3W5XA 1JWWA 3NP5A 4WIIA 1ZA2B 4OZ5A 2V4JB 5KFUA 3W1YC 3CCRS 1FJCA 1XN9A 1BMQB 4CLKA 2XY5A 4IDKB 2K1RB 5A6WA 5GAHI 3AA9A 5HI7A 1MNEA 3GFXA 1U49A 1SL2A 3HVAA 4RNNA 4PWWA 3QJJA 2FLLA 4FYVB 3AJ2A 1JLCB 2ZUAA 1E6YB 3I5CA 4OMFG 1M5KC 2JDJA 4N47A 2V4RA 1RAAB 3HJFA 3HHNB 3OFHA 3TW0A 4TN2A 3W63A 3HHLA 2UXCF 3JQKA 2UVWA 1W7WA 1RT6A 4FYXB 4N56A 3MM9A 4EYIB 3CF5Q 3KHHA 1KD1T 1BXNA 3G96A 1TVRA 1JJCB 1HBNB 3GE9A 3JQMA 3QLHB 4OZ1A 4CQ1A 4OX8A 4B3MF 5HQ8A 2IDEA 5I3UB 3EZUA 2MGZB 3HX9A 4J7CA 1U1NA 4IRKA 2IJNA 3G8QA 1VRTA 2CQDA 2OUGA 4M5MA 2G0CA 3TA2A 3H25A 3H40A 1T3OA 1XC9A 4HL9A 1Y7PA 2E1RA 2XS5A 1LFPA 2IM1A 3M32A 3TWZA 2ERRA 3GILA 1D8YA 3QIDA 2XGPA 1VBZA 4OHYA 4NLUA 2NYHA 1JXEA 3JSMB 2X1AA 2J7KA 5IXUA 1LOUA 3T19A 3HXMA 3JB9k 1Q7YT 4ENOA 1KOHA 4UF4A 4NMXA 4CWBA 4DG1B 3DMJA 3J7A1 1JKHA 1VRUA 2YKMA 4RL1A 2FZCB 2W24A 1YJUA 4F26A 1LWCA 1S0VA 3X3UA 2B0GA 3DDKA 2ZBIA 2PIIA 2XYPB 3BREA 2OI2A 3BSOA 1L3TA 1T0TV 1XERA 2HHTA 1RA6A 4H4MB 1SPBP 3TA0A 4D3HA 4RZRA 1L3VA 2K7KA 4ZPBA 1MWYA 3KDNA 2PDAA 2MY7A 1MN7A 3EXCX 1S76D 4F3QA 3CCWA 2DEJA 5E5NA 3TOQA 2RS2A 2LECA 1DJ0A 2OD4A 4C98A 4DV7F 1X60A 1UFWA 2YWGA 1Q53A 2VODA 2HRTA 3RJMB 2OP5A 4ILMA 2N4DA 4HVZA 2WZ1A 3MD3A 1N6QA 2ZDPA 3GMGA 3ZNUA 3N0VA 4U7CA 3D6MB 4LBHA 1RK8A 4RW9B 1IKVA 5AE1A 1TMJA 3B4MA 1JLFA 3MOZA 4O4RA 4ECXA 4NCAA 1HQ2A 3PG9A 1B0TA 2RS8A 1NO8A 4OYMA 4ZCLA 1ZA1B 2DBBA 2U1AA 5HROA 4R25A 3IRXB 2MQ8A 5HMZA 2GAGC 2UXBJ 1S7HA 3OR1B 5FD1A 1YKWA 4WZQA 1RT3B 4JOUA 3S8SA 2AP6A 3M2VA 2OAUA 2O66A 2EKNA 1S1UA 4KE5A 4OI3A 1R8CA 2CQPA 2VPZB 3ISZA 3D67A 1RWXB 1WDTA 1F3VA 1SCJB 2FJAB 2LDIA 1TKDA 2J6TA 3BO2A 5EHHA 2EFOA 2YQ0A 3H5XA 2RAQA 4FVCA 1MWZA 2XMKA 2EG2A 1RHRB 2B4UA 4WU3A 1VC5A 3PO5A 1XMBA 4Z37A 4Q43A 1IBLJ 2RH3A 3AODA 3FCHA 5SZTA 1DARA 5F3TA 3M9NB 2ZH6A 3MCNA 2FUG9 2QV6A 4HYKA 3FZ2A 2C2OB 2X1GA 2M70A 3TO8A 4NA3A 1RA7A 1HNIB 1TKZA 2E5HA 1YITS 1WOPA 1DBDA 2DXEA 4Y2AA 2Y9HA 3UQSA 4I4BA 3GWCA 1K47A 1FEHA 4DQPA 2VQEF 2EFNA 5I3QA 3D0GE 2E5IA 2V6AA 4WF9Q 1AZSB 3GIJA 1RI7A 4RBVA 2XLJA 2DVIA 2V63A 4FKYA 5CYJA 2RMLA 5F8LA 3QGHA 1TL4A 2HAFA 1RYRA 3I5BA 5DZ7A 4N7TA 1S1WB 2AEMA 4YR2A 1KSPA 3OTDA 1FERA 1FVQA 1X4GA 2HFVA 2R4FA 4EK2A 3NS5A 1S77D 3HK2A 3BS9A 3MUVP 4PYDA 2A10A 5HSPA 4B3RF 2HWIA 2J9DE 5IV4A 2CPEA 4P7VA 4URGA 3OW2R 1N34F 4RUBA 5CZVA 2Y1JA 2FJBB 2QFIA 2BV3A 1D1UA 2LXFA 1OQ6A 2BRLA 3DDIA 4QR1A 4DR1F 1N8RT 4JI8J 2FHJD 3TQEA 3LW5C 3OSNA 3CCZA 2PSZA 4AL7A 3SDEA 3IMQJ 1LK5A 1IXKA 2BJDA 2EG1A 4RW4A 3KLEB 2UXDF 3CD7A 1V5VA 2MLYA 4BBYA 4ECSA 1KQGB 1ZM2A 1Q82T 3IC1A 3GJRB 1AUDA 4DR6J 2IYIA 3UNGC 1I94J 4U7UD 4WBFA 3QATA 1HWKA 1IKXA 1T9TA 1U0HA 1PSDA 4E8UA 1NXIA 1X5OA 4FKXA 2ZJPQ 2R7UA 4LQ9A 3CW2C 3OVBA 1RCOB 2A1BA 2P9CA 3IG1B 2ZH5A 2CVEA 2RT3A 3DYAB 1N32F 1Z2ZA 4DL4A 4RNMA 2JWNA 3R1LA 1S1XA 2MZJA 5KT3A 4F4YA 5F8GA 2VDHA 5KFBA 3AOAA 3QBCA 3W2VA 1OYEA 3F73A 1R89A 2ASLA 1X4FA 1XBWA 2DR7A 4LR8A 2DNPA 2PEBA 4H4KA 4P75A 4AL6A 3IS9B 4EWTA 2OIHA 1X5TA 3TUPA 2B7BB 2QLBB 2QSWA 3NLCA 1S12A 3HHKA 3DRRB 4HACB 5EDWA 2CYYA 2E5LF 3N5FA 2E1PA 4NLWA 4W4MA 3W8GA 3MEEA 5D6GA 1SJ3P 1NEEA 1NZAA 1JJ2R 3NNAA 2HHQA 2P8IA 2HWTA 4QYZK 1IKWB 3SSRA 2HMIB 4LSZB 2EK6A 1OSCA 1U6FA 2LFVA 3EDQB 4DX8H 2FY1A 2KXNB 2LQJA 3GIMA 2ASJA 1L3UA 2YX1A 2RD5C 2ZZTA 2QMUB 3C6TB 3ELHA 3N4WA 4LJMA 1Q16B 5BXIA 3QSYB 2CAJA 2HQDA 2W25A 4E2FB 2AEJA 3CULA 3FC9A 2V8HA 4F7VA 2YTCA 4OIXA 4JB8B 1YJNS 1CJVB 1JLEA 2VBYA 3I5AA 3LP2A 2AHOB 5M2RA 2IVFB 1APSA 2O5DA 3EE3A 4EGLA 2XMJA 1WSRA 1WTBA 4HH1A 3VR1A 3KLFB 3DFEA 3M8ZA 2HVEA 1TFWA 1NDCA 4K4TA 3W3SA 1X5SA 2WVEA 1F5BA 1EP4B 3RB3A 3HO1A 4ZHRB 4JV2A 2YWHA 1RTDB 4PQUA 3D6FB 3UD5A 1REVA 5HL7Q 4M95A 1T9VA 2HK3A 3NAHA 2GJIA 2UUWA 4B02A 2FJEB 3MAHA 2G4BA 3BBBA 2PN6A 3Q8UA 4OYZA 1ZAVA 4K4ZA 3I82A 3ZC4A 1RE1B 1K1QA 1VCTA 3R7NB 4PCQA 2B7CB 3LTOA 4DQSA 4K2JA 2CQ4A 2G2ZA 4OX9F 1KNZA 2BE7D 2RVJA 4OZJA 3BPDA 3G8SA 4HI2A 3H42A 5GMEA 3PXGa 2NR0A 5K5MA 4AXJA 4A46A 2KH9A 2YKNB 2A0FB 1IR0A 2Z8QA 3GU0A 4FVMA 2W9CA 3J7AN 2DIVA 4F36A 5DQHA 2RF2B 3GIRA 4KY3A 4FNIA 4MKBA 5KFVA 4PPZA 4C4WA 4K50A 5ETKA 1OIAA 3M1VB 1IBMF 2HFOA 1CJTA 4FPRA 4FPIA 2C42A 1OY6A 3SCKE 4LVOP 4TXSA 1U09A 1H7XA 3KK1A 1NB7A 4NXNF 3ZXWA 1AROP 3K5OA 3H4BA 3V5RA 3T1YF 1RU2A 4J9KA 2KM8C 1DHMA 4NLOA 3P3DA 4GC7A 1Q86T 2UU9J 3N5BA 4DR4F 2JLGA 1V3SA 1F9FA 4PXEA 2LDYA 5C2CA 3CWJA 1QSYA 2GVZA 1VOMA 1WF2A 3TAPA 3A4TA 3DU6A 3LUYA 1T05B 2NXJA 4B9SA 1F9EB 5SUHA 2ZHAA 3MTKA 4IG3A 2HQGA 2AX0A 3MGJA 4OI4A 2YNHA 3UPFA 3QT6A 2DEIA 4WTOB 5T7LA 3W61A 3JSBA 1Q8LA 3OXFA 5D78A 2MKHA 2EFGA 1VISA 2VOOA 1XR6A 3BYPA 3EGVA 4RWXA 3NXZA 5EWFA 1OJ4A 1MU2A 1OMSA 2DRAA 1NHKL 4R5PA 1SJ1A 4GKJJ 1HNWJ 2GQQA 1HQUB 2IA0A 2H51B 2Y0SD 3DRSA 3A8KA 3O44A 5LM7E 2M4MA 1BE4A 2IAJB 4LUBA 2ZKUA 4XPCA 4L74A 1YHQS 5CD4H 2J8AA 3GG0A 3UCZP 2L3MA 4ES3A 5IV3A 4DSIA 1AFIA 1C0TA 2C22A 4CO1A 4I64A 3V6HA 4WXOA 5CD4A 4LF5F 3CD0A 2JHEA 5C5JA 3B82A 1N52B 3U27A 4LF4F 2RILA 2P6TA 1SH2A 3MFIA 1Y3KA 5M2UA 1VQLS 4WZMA 2BKNA 4E0DA 1BQNB 1GK8A 3C6UA 1U8SA 1T9YA 1LWFA 4AUKA 5DGAA 2V5HG 1Q8KA 3MZIA 2DH8A 2ZD1B 2IYGA 3MMBB 3KK2B 4MIWA 4DLEA 3RTVA 2M8DB 1TTHB 4ZP9A 4EMDA 1VI7A 4B9MA 4PG5A 4EBEA 2EC2A 2JOQA 1FX4A 5A8WA 4JV5F 7AT1B 2BE2A 4PKDB 1WC0A 1DY3A 2PFDA 5AT1B 3D0HE 4KO0B 3KYLA 3G9CA 4DMZA 3VGSA 2MTLA 2VFRA 3CJ5A 3UVJB 1FD8A 2V2ZA 3I87A 3FEYB 1B99A 3QMQA 3D2WA 1HYSA 4J9SA 1QAIA 4KFBA 4TYAA 1SXLA 1RB0A 4DLGA 1U0SA 3NWGA 2ATLA 1HR0F 4P52A 4LF6F 4KH1B 4DSJA 2RRNA 1G4CA 3CCLS 2BE9B 5D3GB 2CG8A 1U2RA 1ZM9A 3H90A 3N6NA 1WHVA 1LXJA 4EO6A 2XNQA 5KOWA 1M1GA 2JLEA 2APOA 3SV4A 1H72C 3HHLD 3TYTA 5HMWA 2BR0A 1NK4A 1B3TA 4QPXA 3SMZA 2ZJRQ 3ZO7A 2UUBF 2ZBRA 4F3OA 1H3DA 4K0KJ 2I5JA 1E6YA 1X7VA 1LW0A 3Q89A 4X2BA 4ECRA 1BQMB 2QSFA 1SJFA 2ZVSA 3RYLA 1HLWA 3BV8A 3DM2B 3R7SB 5AE2A 3RRGA 4IOCQ 2HIQA 1RT6B 4WYWA 3RW6A 5GAGI 1D3WA 2CPFA 2FY8A 2JFKA 5DG9A 2C2ZB 3FFIA 5EGYA 3OUYA 3BQ0A 3A8JA 3P6YC 1C1CB 5DLFA 2MKCA 1K8AT 3N6LA 2NUHA 2OPRB 2C3YA 3BB5A 3DI6B 4ECQA 4K4VA 4I2QB 3K59A 3MECB 4U8YA 5JVHQ 1WOOA 4DV2F 1D09B 3VAKA 1RWKB 4ED2A 3GR0A 3AB2B 1CC7A 2PD1A 5A8KA 1JLAA 1FWLA 4OYPA 5E7OB 1S1TB 3OR2A 2R7VA 4KKOB 5T41A 5KFYA 2CNNB 1CJKB 4OI6A 3JSMA 4DF8A 1M5OC 2D69A 1T3NA 5E3PA 4MAKA 1MROA 2FDNA 3KLIA 1P6TA 5HBMA 3KJNB 1S72S 4PWDB 2H4WB 2H5EA 3IO1A 4Q8FA 2YNGB 3J80Y 2DNLA 1T03B 3CJ2A 2UXBF 1WTFA 3I55S 2PGCA 5DQGA 1FRJA 1NH7A 3IRWP 1HW8A 2QTWA 5KFKA 4LMZA 2EKYA 2XGQA 2DNOA 3HDSA 4DR5J 1NPKA 1TK8A 1ZH5A 2ASYA 2BMBA 2I1RA 5EX0A 9ATCB 2Q3PA 2CVIA 1QTMA 1FFWB 4LFBJ 5D0GA 2D7SA 1VQ6S 3K8WA 5J2MB 3HHLC 4TVAB 2BJ9A 3I0SB 2WCXA 1DFDA 2MQNA 4OYXA 1QE1B 1S1VA 4CNZA 3ENAA 2J7UA 2GV1A 4L72B 4ETZA 2DY9A 3K8VA 4KSEB 4YY3J 4KIAA 3PKMA 4USKA 1FTRA 2FB0A 2XSJA 2W4DA 4XDCA 3RRKA 3J7ZT 3AB4B 2B6AB 2HQCA 3TAMA 3ENVA 3HP6A 1HNZJ 2BJ3A 4RW9A 4EI2A 4ID5A 3GJSB 2FC9A 1QUPA 4A48A 3IBFB 4ZPCA 2CZ9A 1P27B 2IMOA 4ICLA 4CO3A 1VS3A 1SV5A 1FKPB 4X62F 3IRXA 2HRUA 3KKFA 2FJXA 3EGWB 2CJBA 2R42A 2V8VA 4ZPDA 1SI9A 3AHPA 3M2VB 1D9FA 2M9KA 2AGOA 1MG7A 4YDDB 1FRMA 3O1LA 4IUFA 2DJWA 1IN0A 4C0HA 3AD8C 4QWBA 1M5HA 3SQGA 3KNAA 4O4GB 3CJKA 1C1BA 4B3RJ 3SFGA 3IR6B 4DL0C 3KLHA 2OPPB 1WHWA 2B56A 3D1OA 1P1TA 1V9OA 1VQ8S 1NHVA 2UVVA 1QJHA 3GZ7A 3PW4A 2H3EB 4XAKA 2W4CA 4HT5A 4O0NA 3VHQA 3GV8B 2FLOA 3RAXA 3CD6S 4X4NA 3AJDA 3KJFB 2JJ4D 5GMKa 3FNNA 4YB7A 3PV8A 4O44B 2FPHX 1H2VZ 1S0NA 2UXDJ 1I51B 2AYMA 2KKHA 2DR5A 1O8BA 2GAHC 2ADBA 1R0AB 4OYAA 4NRUA 3TANA 4QOTA 1SQGA 4WU2A 4L6V3 2WOMA 3THVA 2ILZA 3WX4A 4BC9A 4O3OA 2P5VA 3L95X 5L1LA 4ECYA 1K73T 1RAEB 3ITHA 3JS9A 3R8YA 3THPA 1HWLA 2E9TA 1KVJA 3VZIA 4V1Ak 2AKWB 4NE9C 3MR7A 4ZIWA 5K14A 5HMXA 3M4XA 1YI2S 4WP9A 2NZCA 2FGOA 1U8WA 2GMLA 2LQ8A 4CP5A 4JI4F 5F0UA 2XULA 4J90A 1CBKA 2B5JB 3ZZTA 1EETA 2NPIA 1VDHA 4DR7J 2QGFB 1OO0B 3G82A 4NLTA 1YSJA 3NGRA 4Q5VA 3QPIA 1YDLA 3BKTA 3CVKA 4YHHJ 1GXTA 4UOCA 2HZVA 1QAJA 4NLSA 4R8UA 5AXNA 4NXMF 4A8KA 3BBCA 5E3CA 3R5CA 4ANDA 4DCJB 4C8MA 4JI0F 2DO0A 2XMVA 2CPHA 3EVWA 4XPEA 2SXLA 1S79A 3KUHA 1HWIA 4UY8T 1XMOJ 4KH0B 3E01B 2BJ8A 1T02A 1NSAA 2BM0A 2E7XA 1WACA 1HBOB 2P2CB 1ULRA 3AA8A 3QO9A 3G71S 3IG1A 4PYAA 1HARA 2HEKA 2LCWA 3DYAA 4IH5A 4ES2A 5A6PA 5C25A 4GKKJ 2HHSA 1V3RA 5J1EA 5CYMA 3PHTA 1NKCA 3KLGB 2CUYA 1YZ6A 1IBKF 4ZCMA 2D9OA 1TAQA 3JQJA 3OTEA 5IC6B 3BKUA 3TJ9A 4P71A 2QIFA 4LSLA 3SCLE 3V6JA 4NA1A 4QWAA 4JYAF 2HURA 1CQMA 1VK8A 2DR6A 1GFWB 4UQGA 2W9AA 2R7SA 1WG5A 5ADZA 5A8RA 2DXFA 4B9VA 1SJRA 5IWAJ 4U8VA 3W9IA 3R7BB 2OPSA 4KHRA 5GAHU 1N5YA 1S6QB 2HNYB 1JJ4A 3SXLA 2UV8G 2DNKA 5LMUJ 4ILLA 4CH0S 4W92B 3U1LA 2EC0A 2HVZA 3HI9A 1J27A 1Q8IA 3V6KA 1R6YA 1RU1A 5LSOA 3RB6A 3FDSA 4KGZB 4LF8F 1H74A 2UUAF 2HHHF 1A9NB 1Y9OA 4W98A 1YJVA 6FD1A 2MY8A 1YJTA 3DLJA 3NG8A 3NGTA 2K3KA 3HHLB 3MAAA 4WKYA 3PRBA 2HGNA 3QT7A 1CC8A 3MF5A 1KVIA 2GIRA 5LSRA 2KRRA 1L3SA 3VAJA 1LK7A 1TFYA 2V2KA 5DS7A 2AQ4A 1IBMJ 1XIQA 2EFQA 4I6YA 4ELTA 3M2UA 1F9HA 1RWWB 2A6OA 1T8EA 1F0XA 2EBGA 2NLWA 2VG7B 3GYNA 2DYAA 5EX3A 1VRTB 1ZZFA 4QZVB 4DU8A 2V2VA 4EU0A 2BW2A 4HTJA 2I2YA 4NCBA 1RAOA 4NEZA 2ZHBA 1UETA 2ACMA 3OQ2A 3PFEA 3U1MA 3DLBA 4NWBA 1RT7A 4URSA 2PT0A 1SIZA 4N77A 4BWMA 2ILYA 2DNZA 2MZRA 2AJFE 4DBQA 1WF0A 1GX6A 1VLYA 2CQCA 4FS1A 2XM3A 2FZGB 5IOLA 2MQPA 9RUBA 4IFVA 5EN1A 2XO6A 1TL5A 2BQRA 2MLZA 2IIHA 5KFAA 4ECZA 2ALYB 2R8KA 2LA6A 1JLGA 4DU7A 1HNXF 2P9GA 3M1VA 4YUDA 3UFCX 4PR6A 2AMCB 4DX7A 3O8WA 4RU9A 2E7WA 4DV4F 4B9LA 3KMQA 4LF7J 1K9MT 4CO5A 2HG4A 1X4EA 4ZVSB 1FEEA 2D9PA 1OYDA 3SZ2A 1XWLA 2PI5A 1N5QA 2M0GB 2BANB 2ZDOA 2WSEC 5IT0A 1X9MA 1W2IA 1TP7A 4G1PA 3EMTA 3UR0A 4C11A 3ET6B 2WB4A 5I4MA 2RRBA 3HHEA 2ACYA 2MJUA 2VPWB 4LREA 2F4FA 4UUWA 5KFLA 3OL7A 3JYTB 4DL6A 3D1QA 4IG3B 3PFOA 5KG1A 5ETQA 3SCJE 4J9NA 1ZTTA 2WSFC 3DGPA 1OS5A 2CPJA 3GYGA 5B7WA 2GVDA 2C3UA 3MM6B 4CH1A 5T7LB 4M5DB 4LRCA 1N56A 4RBUA 1UEKA 3NMAA 1RKIA 2DGQA 3PR5B 2X1FA 4X4SA 4CLFA 1IWGA 3KWMA 1FO1A 1YWXA 4WE1B 3MM8B 3HT0A 1A6LA 3QAEA 4USHA 3ZTRA 3Q86A 4I56A 5HJYA 3K5NA 1VQOS 4PRFA 1X4HA 1SC6A 2PA3A 2HS3A 2VV5A 4X4PA 4LQ3A 1CEZA 2IRYA 3MEKA 4MK7A 5J2PA 4FF3A 3J81j 4FS2A 1HQUA 1RHQB 1FKOA 5F8IA 2ZVIA 4YS2A 4B9UA 1F1BB 2IAJA 1FVSA 5CA5A 3NCRA 1RWPB 3X1LB 1TL1A 3CO9A 3UCGA 3EVMA 4LIRA 4DR1J 3GFZA 4I7FA 1X4BA 2XNRA 2XMTA 2FC8A 2RKIB 3OSPA 4OLPA 1UJ4A 3ICLA 1NSPA 4YEAA 2O67A 1DLOA 4NLVA 2JSXA 2N82B 4U96A 2HW3A 4DFMA 4ZJLA 5DZ6A 4B9NA 2L9NA 4P7TA 1PILA 2MMYA 3CTRA 4FDFA 3RZAA 2E29A 2D3UA 1S6PB 3RBXA 4CT8A 4DN0A 2QN6B 4ZP8A 4QPTA 3PR4A 2B3TB 3MMBA 4DV1F 4KPCA 1P9YA 3NS7B 2B9EA 4C9DA 2HNZB 1JLBA 2CDRB 1VLOA 3OXLA 4K4WA 4DR3F 1H38A 1UEUA 2FGCA 1VJQA 1NUEA 4K5SA 2J7WA 4LRBA 4M5LA 2OFHX 1RT5B 2FHKA 2HVDA 2W4PA 5F8MA 3I32A 2BBEA 3GSIA 2R2SA 4DUZF 1EKSA 4AYBD 1XNRJ 2BABA 2MKJA 3HKWA 3LP0B 1UVIA 2OSQA 2OTLS 3C14B 1NPRA 3KUEA 1HHQA 1RHMB 2W7OA 1HMVB 2MDAA 2XG8A 3GIIA 3MCOA 3OLBA 1WWHA 3NWRA 1WJ9A 2MKKA 3NBPA 1UJ5A 1HQEB 1L5UA 2C2KB 2N4CA 4KHPF 3IR7B 4TU7A 4G3IA 3AOCA 3W62A 2KZMA 4OFZA 4WYLA 5E33A 3BPSP 3MEDB 3R97A 4ITSA 2XHWA 5J1NA 1EB0A 4RPFA 3EPGA 5B0EA 2N3LA 2W1BA 3JXOA 1UPPA 1U0HB 2MQLA 4TU9A 1NK9A 1FNXH 1KDNA 4OQJA 4TY8A 4CTAB 4MFBA 5DDRC 2F65A 2BXJA 1CPZA 3T6BA 4X4RA 1QTNB 4M5KA 2XS7A 4HHHA 3PW0A 3CC4S 5HLFA 1RT4B 1T9XA 2QT7A 4C2MA 4ZITA 1LW0B 4J5OA 3TUJC 2OMOA 2R7WA 1N48A 2DTJA 2OLWA 1Y00A 4M8LA 4ZPAA 3KJVB 1CS4A 2AYBA 3H2LA 3NGUA 1X4DA 3TARA 2DHGA 3N28A 2ZC3A 3EYZA 3IS9A 3D6HB 3DOLA 3MWBA 4OHZA 3FFIB 4F25A 5E3AA 1UFKA 2LQ9A 3FCVA 1C1CA 1U1OA 2BOPA 3QRRA 2K2PA 4LFCJ 1M1HA 3HPOA 3M8QA 2J0QD 1UWAA 4DL5A 1IKWA 5I42B 1HNVA 4ZP7A 4NLXA 2K1RA 5AJ3J 2ZBCA 1MMNA 4Q0BB 2VU5A 3OVSA 2JNJA 2F40A 3ZZOA 3OLAA 1WKJA 3MI7X 4DV0F 4DF4A 2YVSA 1WC5A 1JLCA 3EICA 1UJ6A 2AIRB 1LQ9A 2NXEA 4DV6J 1S6UA 3BSCA 3ENWA 3CC2S 5LMNF 2DRBA 5DJBA 2LQ5A 2JC0A 4K5RA 4OJHA 1NDLA 2XZDB 1GTHA 2CRLA 1Q8BA 1O6XA 2GGPB 3FSXA 1WEZA 3LF0A 1VRQC 3MM9B 2YKQA 4GVLA 4USUA 3DN9A 5FIIA 4PG8A 3QLHA 3RR7A 2WW8A 5DGBA 4KT0C 4ZHRA 1PJ5A 4UTGA 5E3RA 1MMLA 2GHWA 3RB0A 4IG0B 2BEFA 1IM4A 3T9NA 2R8GA 3PEHA 4F2RA 4NXNJ 4KV8B 3DLHA 4KHMA 3R2CJ 3QRPA 4DR4J 3EJMA 3H5SA 3MR3A 1QVGR 1TV6A 3J80U 4EZ9A 1QE1A 2XLIA 1N33F 5IC4B 2RB7A 3R2DJ 2CQ2A 3DLEB 3OJSA 3BO4A 1VBYA 3NNCA 2B4OA 3QWUA 1VHIA 1HPZB 4DS5A 1TKTA 1BUXA 2HNDA 2IM2A 2XSJB 4OHXA 2H1YA 3PVXA 4RJVA 2VB6A 3LWMA 1P9QC 1RQ0A 1RABB 3DXSX 2XZTB 1KONA 2LQBA 3OD2A 1J5EF 3FBBA 4MK9A 4ZPVR 2KFYA 1SKRA 5KFEA 4TKTA 5ETRA 4OV6A 2CNLB 1RDRA 1LNQA 3FZBA 2MZTA 4LR9A 1EX8A 4YB5A 3FGVA 4A8MP 3EX7B 3BQ1A 2FLPA 3CDEA 2OEJA 1CVJA 3NS6A 4WTYA 1JXLA 3U1NA 4X4OA 4ZVQB 3V4IA 4F4XA 1HL6A 1PYOB 3Q23A 1G2EA 5J2NA 2IPOB 2DB1A 4K59A 3J81U 3NGSA 3ZZUA 3PKYA 1CULB 3IM9A 3T1HJ 5AXMA 4QJVA 2UUCJ 3HVTA 4DQRA 1NCLA 1PKUA 2OPPA 1N4LA 1UZHA 3MHYA 3RBEA 3PDNA 5K9FA 1FFGB 2UUTA 3D68A 1TKXB 5D4NA 4ZIVA 3S01A 2M5YA 3HSDA 4DR7F 2J9CA 1WI6A 3C19A 3K17A 3LO3A 1UWBB 3MEGB 4C8LA 1UPMB 5G0RB 2UP1A 2MHNA 1KC8T 2AU0A 3N6MA 3MURP 3LP1B 4ED0A 4IRDA 3OR1A 2L9DA 3I31A 4NXMJ 2A3JA 1RWNB 3DC2A 1R0AA 1CJUA 4NLDA 4DX6A 1KEKA 2YKAA 1HWJA 3KDOA 1UKUA 4RWWA 4Q45A 3IWNC 1ELOA 2J9EA 4QIGA 3A3NB 3ILJA 2DNQA 1PBAA 1ZAWA 2CPIA 2WBRA 5L39A 3HMJG 4KGVB 1NDPA 1I6JA 2WRMA 2E9RX 4R5PB 3LAMA 5KT6A 3KNGA 4RUCA 1Y5IB 3EDRB 4DUYF 3U02A 1SC3B 2ZH7A 2OFGX 3CE8A 3CCSS 2IJFA 1NSKL 2MKIA 4JI2J 1H6KX 3N9UC 5L9XA 5KFWA 4R0EA 8ATCB 1O5JA 1MSWD 4QCLA 2C1EB 1HI1A 2YPZA 5BR8J 3W2WB 1U47A 3UO0A 3FEXB 4TQRA 1TKZB 4JYAJ 5J1PA 1WEXA 3Q2SC 3G6ES 1NJYA 4O0IA 2HGMA 4DR2F 1IUJA 4V19X 8RUCA 1HR0J 2E44A 4N8NA 2M2BA 3M8PA 1AZSA 5KFOA 4MKYA 4JI3F 3C6UB 3DRPA 2GS8A 2AYEA 4ZP6A 2F7VA 2LXUA 2HBZB 4MKAA 2A2CA 1UZDA 3BDEA 3EXYA 4LFAJ 4KJIA 2DITA 3S6EA 1YJWS 1D8ZA 2RUGA 4PQAA 1OWXA 3J7YI 2V50A 3V81A 2F9JA 4KTQA 1M1KT 2C2DA 4ES1A 1N5TA 1VMBA 4FYYB 3VF0B 5IM0B 4K0KF 2YX7A 5E2QA 3DLLQ 2ZZNA 4J91A 3KLGA 3BGRA 3TZWA 2XY7A 2KTQA 2GMJA 2VZ9A 3R1HA 2Y8WA 4J37A 1R27B 4KQZA 4AXIA 5B0BA 3ADAC 4Y34A 5KOXA 5A2QY 5D77A 4B3TJ 1SQEA 2IRXA 4EEYA 1M5SA 3HCXA 2W7AA 1AW0A 3FUYA 4QYZJ 5FDLA 2BKOA 2ZH3A 5L9NA 2WHOA 3UDEA 3DLGB 1E6VA 2RQKA 2VPYB 1T94A 2RRAA 3PHEA 2JEGA 4NI2A 4DPTA 4ZLLA 2B8PA 3RW7A 1RJJA 2VC1A 3M05A 1NU4A 2XC9A 1FDAA 4DV3F 4OX6A 3LPYA 4OZLA 3W7BA 1RBOB 1H73A 3BGLA 4C0BA 1KRPA 4A47A 5CCMA 2BM1A 4AFFA 1YGYA 4F8RA 2EWHA 2J9DA 3KG0A 4GVBB 3W5ZA 2Q43A 4OHWA 5KFRA 4F3MA 3EUNA 3WZ0A 4MYTA 3T6JA 3GYXB 3VAMA 1RHJB 2O3DA 1BY9A 2I8EA 2OPQB 1FK9A 4WXWA 3W2VB 1TL3A 1VYAA 2YNIA 1KLMB 5C42A 1HBMB 2FIUA 1LFWA 4IH6A 4ZJOA 2MSTA 1LXNA 3W65A 3OUYB 1I1GA 2HBYB 2HGLA 1WUUA 4F4WA 3V6DB 2Z2MA 3DRRA 1HNXJ 4B3OB 4C8ZA 5HANA 4OI2A 1U4BA 2OHDA 2ZFHA 3PIOQ 4LF7F 1OY9A 4ALZA 1ACMB 1SJ4P 2HLUA 3R5GA 3THTA 2HMIA 4IDKA 2D74B 4X65F 1XR5A 5B0GA 2YQ3A 3UN2A 4X64F 3C6TA 1PC5A 1GT8A 1AT1B 2GHVC 2DCLA 2QMWA 4HDGA 4R0JA 4UUXA 4C7QA 2D41A 4A8QA 5C24B 1CJKA 3MPUB 2CNOB 5HATA 3HM9A 2BQ3A 3CCQS 1SQFA 5JXSA 3C66A 4RKUC 3WDOA 1Y5LB 4TQSA 4LSNB 2ZH2A 1C0UA 3BQ2A 1FJEB 5GMDA 1YTYA 4QR0A 1S7IA 3AAWB 4P2XA 3OBIA 1TVRB 2DCUB 2CXEA 4ELUA 3ZFVA 2MQOA 1HBUB 2RU3A 4FF4A 1WI8A 3GPAA 4CLUA 2MGZA 3SQOP 3FK4A 4DEZA 4F0KA 1HHTP 5HQMA 3JAMU 4LF9F 4WFAQ 1Q5YA 3OTOJ 3CIZA 3IFEA 2RJZA 1EQMA 5K8MA 5DQIA 3VVTA 2XB2D 2WBMA 2GO8A 2F5GA 1LWEB 1LW2B 2BANA 1NBEB 2W2NP 1RLDA 2EPIA 4I6WA 2A18A 5GADI 2U2FA 4PG7A 3M32B 4AE5A 5KFDA 2XS2A 3HT3A 4EYHB 1EIYB 1HIYA 2XMAA 2VOPA 1QVFR 2QA2A 3W9HA 1TQLA 3R3TA 3NCQA 3UDVA 2V4QA 3TX0A 3UE2A 3QIPA 1ZYQA 5HP1A 1FDNA 2YKMB 5DDPC 1YLXA 4DV7J 3PX4A 4I6AA 2V8DA 3MM6A 2AWZA 1R31A 2G9OA 2HHPA 3GONA 4ICLB 4KR0B 1FKPA 3CUNA 4OJ3A 2VIHA 4ZVHA 2QYCA 4O3NA 1RHUB 1XJWB 4K4YA 2WONB 1OPZA 3C2PA 2H5JB 1YBAA 2V8GA 2WSCC 4CZCA 1WEYA 4C8NA 3JTNA 1W2BR 2LXIA 2DXDA 3SQGB 1PO6A 3SCIE 2ALZA 1IR1A 1RWMB 2F1FA 4Y65A 3K5LA 2OH2A 4ANCA 3SSQA 4NCGA 4OZ0A 2G0JA 4USWA 2Z4PA 3TX8A 3ZTSA 1D0EA 3CJ4A 1TAUA 4NMLA 3OXGA 3H5YA 3MPWA 1N6QB 2Q66A 1VC6A 2NSBA 3H5UA 2XMMA 3UDCA 2VONA 1IKVB 1TL7B 3MMAB 4LBPA 3L3CA 1JLFB 2AX1A 4C3MA 2IMWP 1RKJA 3OTCA 1XNQJ 3GLJA 1IR2A 2IFXA 4IR9A 1RAHB 4DI6A 1RT3A 4I68A 4RU2A 4MT1A 4USIA 1NRKA 4DZ6A 4J9QA 1Q0NA 2MKYA 3MR2A 4G6VB 5IS2A 1S49A 2LU2A 3DOMA 3HF5A 4USJC 4G1QB 5CCLA 1BHNA 1NNDA 2KM8B 1F2GA 4IR1A 4JI5J 3CNQP 3D54A 5MLCV 5HQLA 2ZH4A 3BF4A 1WC4A 2VQEJ 4DDFA 4RO0A 3RBZA 4F0HA 1NK6A 3A8EA 5LOQA 1M0SA 1YX2A 4JI1J 3M6WA 3M9OB 2BRKA 5EUHA 5D4PA 4O3SA 1IBKJ 2FQQB 3AD9C 4B3OA 2ROGA 3POTA 5B09A 1RUSA 1C0TB 4OYIA 2RUSA 4OZ3A 2BKPA 2BJ1A 3PACA 4QW8A 4H4OA 4LT6A 2VG6B 1KLNA 2OSRA 1NKEA 2VA3A 2AT1B 1AFJA 2R7XA 4A8XA 4FBUA 2ZBQA 4DQQA 4DWIA 1LWFB 5F3ZA 1TUVA 3QNWB 1RHKB 2HSEB 1PCAA 5D0EA 2HFNA 3Q8QB 1UA0A 1OY8A 4MFBB 3MMCB 1YK9A 4L3KA 4ZN3A 1K44A 3TZZA 2YWKA 2Z2YB 4BCAA 3D66A 2Y1RI 2Z58B 1MWQA 2MSSA 3NAIA 2DNGA 1NSQA 1MN9A 2ASDA 3TZYA 2VBWA 2BYCA 3TZXA 4X4TA 4DHVA 2CPXA 1NJXA 1KOOA 2DGXA 1GH8A 3ETMA 4IYQA 1X4AA 2F8EX 3PRVA 2FHOB 1OPIA 1AA1B 4ZVPB 2J5AA 4Z7CA 2XI2A 2AJ0A 1RT1B 2QLXA 2D3ZA 3M30A 2C2EA 1QDUB 4AQYF 1YJRA 3M2RA 3C15A 2OPSB 4GMKA 1PC4A 4YDXA 3M8RA 5H9EK 2W9BA 1VQ7S 4XIUA 3QQCD 3FBCA 1RT2A 3J7YU 2VD3A 3DRXA 4DPYA 1JIHA 3ILLA 2YNFA 2FVPA 2ZKTA 1VQPS 1SH0A 2VKZG 5KT7A 4L73A 6FDRA 1WC6A 3MAQA 3BYRA 4Q0BA 4IFYB 1AYEA 1IWAA 1KP6A 1S9EA 1W26A 1Y11A 5DO2A 3SBMA 4ZN1A 3RRHA 5ETLA 2V8PA 4ANEA 3OFGA 1ROFA 1BQXA 3F0NA 1QUVA 4QIEA 1S1XB 3KTQA 5KFJA 1JNRB 1Q7LB 1VR6A 4CNYA 4KC5A 3HD1A 5HVFA 5ETVA 4ECWA 1TR0A 4G65A 5IQ6A 1UMJA 3H8YA 4DV4J 1UVJA 1A0OB 3UNYA 1N32J 2ZH9A 5DRKA 4P72A 3FSIA 4PG6A 1YBTA 2HQ3A 3OPKA 3VAHA 3IWXA 1BD6A 4IO9Q 2GW8A 1H2UX 1URRA 3CCMS 4DL7A 1FT8A 4U67Q 2NS1B 3TQ1A 1EZZB 3ENQA 4Y2IA 1RTJB 3Q83A 2BJEA 1NKBA 2HS4A 1JLAB 3L4BC 2EXUA 1P8GA 2OKQA 4YFUA 2WB1D 2AJ2A 3UD4P 1UEVA 2IY5B 1PAUB 3JSRA 4CLYA 1RAIB 2CQ1A 2E66A 4LVNP 2ZZMA 3FKBA 3HFZB 4WFYA 4ZLPA 3M9MB 2Z2ZA 1PJ7A 2NYIA 4C48A 1WKLA 5A76A 4XO0A 3KHGA 3D9BA 3GFYA 4MJKA 1VHFA 3R27A 2XBPA 3DHXA 4K4XA 4UOHA 4HTIA 3M8WA 5FLXU 1TK5A 3T5HA 3B4DA 2G1HA 1JLGB 2M88A 3GJQB 2PMWA 4KBIA 4RW8A 2I9SA 1FXLA 3RUBL 1RTDA 1IKYA 1ICEB 3C16B 2ZH8A 4BC7A 1NB2A 2BA9A 1AB8A 3PZPA 2C2RA 4C8KA 4N5SA 1VBXA 3P49B 2ZM6J 1LKZA 4UQTA 2UXCJ 2JX2A 2HIYA 2ROPA 2PI4A 4NZ0A 3KG4A 3Q8YA 3EZ5A 4M63A 4ATNA 4C11B 1FWPA 1S6OA 3DDNA 1GNKA 3CGIA 1FRLA 2KJVA 4B3MJ 5BR8F 3M8YA 2Z0GA 2R7TA 4DG1A 2LEPA 4ID8A 4QIFA 4DQIA 3KUGA 2YKNA 1HHSA 3MPDA 2YX4A 5HJXA 5G0RA 2W9CB 3I4HX 4DR2J 2R7RA 1X0FA 2RF2A 1URNA 3AXKA 3B78A 5HVGA 1HA1A 4FF1A 2HVHA 1Y10A 2E5GA 4H4MA 2OJ3A 2YBVA 1VQYA 4OYOA 2RDJA 4LRFA 2HQIA 3DLKB 5KAKA 4ECVA 4P2FA 1G7CB 7FD1A 2H65B 3NOCA 3KK1B 1FTCA 3K58A 2GJFA 3PEJA 2JEIA 5J2PB 3R5BA 1C1BB 4GRSA 3I6PA 1B70B 1FKOB 4CI0B 2OEMA 5A2QU 3DHWC 1YJ7A 1RLCL 1UVLA 3A1YG 3PJXA 2ZEJA 4QIVA 2EFVA 4ECUA 5D0RA 1T05A 4QBUA 4QU6A 3PW7A 1BWVA 5GAEI 1EHWA 2HBQB 1V6HA 4UZCA 2VASA 2HFSA 4C8OA 2YNHB 2AJ4A 1WHYA 3BKFA 4Y2KA 3DKDA 5I3PA 4DV5F 4I2PB 3EGZA 2FYXA 4O44A 5HROB 4KHPJ 2X51A 2B4PA 2OEKA 2R2TA 2C3OA 1NZ8A 1C4CA 1FFSB 3NGDA 3K2YA 2XY6A 4F4KA 2GO9A 1S1UB 2F3JA 3DRPB 4P10A 3TVKA 4UZBA 1KN6A 3JTOA 3CXCR 1F5AA 4MYUA 1Q5VA 3A13A 1KVKA 1S9GA 5J2QA 3E2EA 2HNZA 5F9NA 3K5PA 4CT9A 2R7QA 4NASA 2MQQA 3S7RA 2DGTA 3KLVA 4Q7AA 2RIJA 2VQFJ 3UD3P 2YKPA 2B51A 1VK3A 2FHJA 3T9ZA 1LWXA 4NL5A 1U48A 1HFEL 2DNHA 1EETB 1RBLA 3DGVA 3VAGA 2C2NA 2HZCA 5B0AA 2JC1A 2DNNA 1S99A 4J9UE 2JVRA 1FNOA 1RISA 1GMWD 2LLZA 4FN5A 1PYSB 2J0SD 3HSJA 2QLJB 2BJ7A 1S0MA 2K8GA 4JV5J 3D0IE 1HNWF 1YRTA 2GA7A 4F4AA 4R8UB 4A8FA 4WP3A 4LFCF 2DNYA 3QFHA 3FJ2A 1DTTB 1RAGB 1Y3JA 2CADA 2RHQB 3BH6B 3DRYA 4Q44A 4A8OA 4DSEA 3VAIA 2ZD1A 3KK2A 1IJFB 3WHIA 1M5PC 4RBTA 3MM5B 1WORA 4DSFA 5IFMA 2AD9A 1WG1A 1FRXA 2EEYA 4OZ2A 1JMTA 2JEFA 4I69A 1FI4A 4J9PA 4DV0J 4X64J 3QO9B 5A8WB 2M3DA 4V19J 4IRCA 2YY3A 2QX0A 1SB6A 2CQ3A 4WK3A 4CDIA 4GVBA 1ZS6A 1I94F 1RADB 5DDOC 2KO1A 5K8PA 1H7WA 3VQSA 3HZGA 2V34A 2FVCA 3KJVA 3G6YA 2NXUA 1CS4B 1RTHB 3NY0A 4RW7B 2KL8A 1W25A 1KLMA 3BGOP 3R9LA 1VGYA 5L38A 1J5OB 4I1TA 1G6BA 4RW4B 3DOLB 1ZM3A 5THWA 5A8RB 5F8HA 1FX2A 2H54B 2HNYA 1U2FA 3K5MA 1ZM4A 1N34J 3GCXP 1WDDA 4KGMA 3OTOF 1BC6A 5KG5A 1IKXB 1N88A 1JLQA 2G2YA 2MLXA 3MDFA 2EFPA 1QSSA 4CM0A 3HFKA 3ILOA 2UVRA 3O5TB 5B08A 2VICA 3LGMA 3RAQA 1N36F 1XQIA 5E0OA 3W8PA 3OJUA 4ERDA 2C3MA 1IJEB 2KI2A 2AW0A 5HK4A 2IHR1 4RNHA 5KG6A 1FHTA 2KXFA 3H2UB 3I0RA 4FF2A 6AT1B 2JH3A 4UOGA 1TUGB 2RDIA 3EM1A 1GTEA 3PO4A 2F4VF 1HBUA 3M2UB 1UVNA 3PW5A 3IXQA 3MEEB 2OPRA 4B9TA 4I2QA 4MH8A 3PNIA 3VVUA 1RWOB 2VG7A 2YH1A 2HYIB 1GQEA 4KV8A 1NK0A 3TA1A 4Y2CA 4Y2MA 1LWEA 1LW2A 4WFBQ 4WWSA 4HH0A 4PABA 4ED8A 2AZ3A 2FZKB 2KB2A 4DR5F 3L09A 2KYXA 4PWUA 4DZDA 4F2SA 3ZZ0A 1WSVA 1S48A 1FXDA 1TKTB 2HNDB 2CIMA 2NSCA 4KKOA 4Y3CA 1ITPA 2JZ5A 3P96A 1D9AA 3KLIB 1CJVA 1KQFB 3KHRA 5E41A 5HBMB 5HP1B 4PWDA 4JBCA 3CMES 4DV2J 2V9KA 4K2XA 1GXLA 2Y3YA 1KQKA 1U25A 4CLTA 4QYRA 4ZCIA 5KFMA 4B08A 2ZUGA 4C8YA 2Z30B 1FD2A 4AT1B 3NCPA 1YJ9S 4PQUB 2M8HA 2WK4A 3JSYA 3LQVA 4OLOA 3WC0A 4DX5A 1HNZF 4TU8A 3F44A 4W90B 5ETSA 3OVAA 1IQTA 1PGZA 3KXDA 4FZVA 4OYBA 4JI5F 2DY1A 2CQGA 2CJXB 1RTIB 3UI3A 4DUYJ 3NMRA 2ADCA 1DURA 2C2MB 1R6VA 2Z2LA 3FSYA 4NA2A 4XTTA 3ULHA 3M8SA 1F60B 2VJUA 3G4SS 2AV5A 4NCGB 4JV0A 4O23A 3NEKA 1F3FA 4CO4A 3P45B 3GSDA 4Q2MA 2X3DA 5JJBA 4QWCA 1X31C 2L48A 3UWTA 1GMWA 3ZNJ1 3K57A 4CCHA 1TL7A 1JKHB 3L7UA 3BDPA 2Y0BB 4LFBF 5F8NA 1R7IA 4I0WA 2DNMA 4KAIA 2XMWA 4M5DA 4JI7J 1ZOTA 3VALA 2DRDA 4C3LA 3WIVA 1PBUA 3OL8A 2IC3A 4Z2XA 5L46A 2HPUA 4B3SF 4X4UA 4NLPA 4RW6A 1XEZA 2CA9A 3VV2B 5ETOA 1KKHA 5GAGU 3OHAA 3BJYA 4L3NA 1VIXA 2CZ4A 4N41A 5GADU 2HLTA 2B4VA 5LJ5Y 1IVZA 3IAS9 3S1TA 4O4GA 3CJKB 3IA0A 3OHBA 3AT1B 2X3GA 2XWYA 3PY8A 3UCUP 2VKRA 4X62J 4H54A 3ZTPA 4C6AA 4DFPA 1G1XA 4ZVUB 1WNEA 2DNRA 1VQ9S 3KK3B 4USVA 4N76A 3IWLA 8AT1B 4I7FB 5KFPA 4GKJF 2VFTA 5HN0A 3BBFA 1GMUA 3PYDA 2HQFA 1U24A 2DHAA 2MZSA 2VG6A 1DLOB 3PYGA 2DIUA 5KFIA 5B0FA 1WOSA 3OV7A 1X4CA 3M8PB 1VQ4S 3CC7S 1SKUB 1NM2A 1NJZA 2XLKA 1T9WA 3CJ8A 1VQ5S 1UVMA 4AL5A 2ZNZA 2I0XA 5H9FK 2WOMB 3FBFA 2QL5B 2CZVC 4DV3J 2O01C 1U1RA 4IQXA 3KMSA 2N3OA 2QLFB 4MTPA 5EWEA 1K1SA 2IM0A 1V5IB 4NLRA 4CH7A 1R43A 5CABA 3V81B 4LF4J 2J0WA 3QRQA 1DAXA 3FQKA 1PIEA 3AY0A 5IM0A 5LL6d 3KLFA 4X4VA 2H48B 2LU1A 1FJGF
chains in the Genus database with same CATH topology
2F8MA 5BYRA 5DETA 4MMOA 2GFFA 2I38A 2HHVA 4TY9A 4ED7A 1R3NA 1J5OA 4BWJA 3CSKA 2CPYA 4ZOSA 1R8AA 4ZVEA 1H98A 4RNOA 5ITHA 2JLFA 5DM7Q 3SV3A 1S97A 1N5SA 3M30B 2HHWA 3VQTA 4NRTA 1JX4A 1FCAA 4FP9A 2DGUA 5KG0A 2UZAA 2DHXA 2ZE2B 2FVRA 1RT2B 3MUTP 5K8NA 4GO5X 4TY8B 1FXRA 3LAKA 3MR5A 1M5VC 2QA1A 1Y0HA 4ECTA 1HBOA 3OTBA 3MR6A 4IFYA 4YHHF 1RT4A 3GV5B 1NHUA 5J1EB 2VL1A 3CMAS 2QZ8A 3P5TL 2V94A 4KO0A 4ZMMA 5KG4A 4EUVA 3NGKA 2POKA 2C28A 2Q6BA 1FK9B 2XCPA 3AQOA 5KTQA 1Q81T 1Q4RA 1HYSB 4NX9A 3ZZYA 1U26A 3V6DA 4TYBA 3PX0A 7FDRA 2GQCA 2CQBA 2IA6A 4GKKF 1RGVA 2IRUA 4E98A 5I42A 2ZM6F 2KG0A 2CDQA 2P9EA 4BHQA 4PUOA 2W8LA 4OHVA 1X8DA 4P6QA 1ZPWX 2L9WA 1S9FA 4NYOA 5G4DA 2I5JB 2AYGA 4ELVA 1WD6A 2FHMA 2PFFB 3QJLA 4D3GA 1Q78A 2RU9A 2RE1A 1P1LA 4CO2A 5A0YB 5LMUF 5D8HB 1C0UB 1DTQA 2N7YA 3TUIC 1MW7A 4H4KC 2VA2A 3CDUA 5LJ3Y 2GC8A 3BR8A 2ROEA 5FJ4A 4U9RA 1YG0A 1X5PA 5L1IA 4RW8B 4WFXA 4DFJA 1FDDA 2HWHA 4PXBA 1KFSA 1FRIA 3MECA 3J7Z5 3MM7A 3RB4A 4IOBA 4KRWA 3QGPA 5H9EJ 3CCVS 1TV6B 3PX6A 4ZS6A 3DLEA 3I9V9 5BYQA 1FRKA 3BR9A 2DD8S 4OV1A 4ZVGA 1HWUA 3CDAA 4J9MA 1RT7B 3T1AA 1YRXA 4ZK7M 1Y4ZB 2MJNA 3E8OA 3FMBA 4XDDA 4IH7A 5EWGA 3G6XA 1JJHA 1XMQF 5L8RC 3R5DA 1U7LA 2L08A 3BO3A 1HBNA 3H59A 3L7OA 4YY3F 5JUMA 3GB0A 1NJWA 2GMHA 1U1PA 1KTVA 3TRGA 3QAUA 4HKQA 4QR2A 2O1PA 2J0XA 3CJ3A 2DO4A 2IM3A 1B0PA 1N54B 1Y5NB 2VBXA 3AH6A 5F0WA 5J2NB 3N01A 2GNKA 1S1VB 2VQFF 2KFZA 3HVTB 2XI3A 5CXTA 1RWUA 3WC2A 2R2UA 2YWFA 1QAYA 3PM9A 1H2TZ 2HFZA 1ZAXA 2CPZA 3GR1A 3DMJB 2L41A 1G3OA 4NZ6A 2PO4A 2YH0A 4I2PA 4O3PA 1V3ZA 4X84A 5CH7B 1CG2A 3DOKB 3E3XA 3LWLA 1X9WA 4DL2A 3MUMP 2HRYA 1OQ3A 2KT3A 2LMIA 1DQAA 2ZOGA 2RQCA 3SSSA 3IGNA 1Q79A 5D4LA 3G8TA 2VFUA 4OI1A 2W7PA 1NAQA 1XTZA 1K0VA 2DGVA 5HO4A 1C4AA 1K0TA 3K0JA 2YWEA 3KG1A 2J6UA 2KHCA 4LIWA 3KLHB 3IGVA 2A2DA 4FYDA 3ETOA 4JI6F 3LH2S 4EBDA 2FJWA 1JK9B 3POTB 1QSLA 3DCAA 1ZPVA 2E1MC 2FJVA 4X4QA 4PXDA 1WHXA 3US5A 2MQMA 2E1CA 2BDPA 4H4OB 2YKOA 1U6BA 3ISNC 1BGXT 3SFUA 2K7JA 3WBZA 2ZNYA 5A8KB 2MHEA 5DM6Q 1S6PA 1FA0A 3C8YA 4HLBA 3CCJS 3CCUS 4QIWD 1MU2B 4FXWA 3MM5A 2MYFA 3TP2A 4YMEA 4HT7A 3GV7B 3ONQA 2PE8A 1NJIT 2DPJA 2DH9A 3KHLA 5K14B 4DS4A 1U45A 3MTJA 2ZC4A 1RT5A 2PC6A 4EO8A 4F50A 5GAEU 1FDBA 4ED1A 2CQ0A 1FE4A 2KYZA 3LP0A 4QWDA 4UY85 4A8WA 3CPWR 1XMOF 2GIQA 1NK8A 4MIAA 3F56A 2OO4A 1UW4A 1HNIA 4PG4A 1U1MA 4RUHA 5F41A 5DDQC 4PXCA 2DR8A 3CDWA 1JB0C 4UW2A 4DJBA 4J9LA 2XEXA 1UVKA 2AJ1A 4BS2A 2W9BB 3IAM9 2QO3A 3J81Y 1ZTWA 2RNEA 5CYQA 3AJ1A 1VQSA 1C2PA 4HDHA 3ZZPA 5KG3A 1J2VA 2M7SA 1U1LA 3QGGA 2UVUA 4YR0A 3GIKA 4NZ7A 4U7UK 4DOZA 3QZ7A 2J76E 2DK2A 2JFDA 4MIBA 1IBLF 3TNVA 4WCEQ 3GG1A 5BYSA 5JVGQ 4F4ZA 5KFFA 1SUQA 2AGQA 4ZCKA 4ETXA 2LA4A 1VIOA 5AJ3F 4GC6A 2WTFA 2QE5A 3ISND 2MKSA 3SDEB 2JEJA 4F02A 1R8PA 2DH7A 1SIWB 1ZZNA 1FJ7A 5AXKA 4Y0FA 3M8QB 2DGSA 3HZEA 1B64A 4YR3A 3JAMY 1ZBTA 4GO7X 2XSFA 5KFHA 2PMZD 1F5CA 1Z2LA 3TR5A 5D4OA 2E9ZA 2DR9A 4WKRA 3BN4A 2BZ2A 2LEAA 4ZA1A 2LYVA 3V2UC 3IR5B 5IWAF 5C24A 2NREA 1Z4UA 1BQMA 3I9ZA 4ED5A 1IQZA 1QY7A 2FD2A 3RU0A 3C46A 3FRZA 3DM2A 2HAIA 4JI8F 2VG5A 5IT4A 3NNHA 4JI7F 1VC0A 2VBZA 3H20A 4ED6A 1KS2A 2G1DA 3HVWA 3VZHA 4EFAC 2CPDA 2KRBA 4IOAQ 4ED3A 4TLRA 4DV6F 2V4JA 4QU7A 2PA8D 1KN6A 4YQWA 2KG1A 2UV8A 4CIOA 2CJKA 5LXYA 5CHCB 4OJGA 1RTIA 2J6SA 5DG8A 4OX7A 5IZHA 3QGIA 2VPXB 2VFSA 3NRBA 3OFEA 3CJ0A 2IBOA 4J9OA 3T5KA 1MROB 4URQU 1HI0P 4RUAA 2QEXS 3LP2B 4RX6A 3CT9A 2Q1LA 3Q8PB 4IFVB 3BGUA 1BLUA 3JTPA 2KHDA 4EZ6A 4NOHA 1GX5A 1WF1A 2EW9A 2IC3B 2JVOA 1EP4A 3HKZD 5I3UA 3GFHA 2XCAA 3DLKA 3Q22A 2WONA 1KHWA 4RW6B 4NLQA 3MCSA 3VAFA 4NYPA 5J2MA 5MAOA 3I0SA 3NL0A 2QMXA 5KFGA 4ILRA 1YIJS 3BN7A 1CLFA 4IO1A 1VQMS 4HI1A 4QQBA 3D5MA 3LALA 2EK1A 5KT2A 2B6AA 3TAMB 4F67A 4YP3A 3KK3A 3T3FA 1KHVA 1HI8A 2BUNA 3MMAA 1VRUB 1UWBA 3MEGA 4YOEA 2OTJS 1HD0A 2FLNA 1LWCB 5GVQA 2GQ2A 3NKYA 4Y00A 1N5VA 2KDOA 1SV5B 1SJQA 2QRRA 2MPUA 3LP1A 1VJWA 3T1HF 3TVZA 2GJ2A 2LKZA 2ZITA 4WE1A 3VCDA 4C0OC 2NUUG 3BGFA 1YRUA 2DGWA 3KOAA 4G1QA 1SL0A 4TNOA 3SYZA 1S9GB 3Q24A 5J2QB 1QAXA 2GX8A 2COLA 3CCTA 1FKAF 4OL8A 2ZHOA 1MMDA 4G1IA 3TAQA 5KT4A 3LANA 2QA4G 2GHPA 3BEGB 1TL1B 1FESA 2CQIA 4LFAF 1SKSA 3W2WA 4U6PA 3O6QA 5KFZA 2DPIA 2RKIA 2CG4A 1U1QA 4DSLA 2D3OR 3D1HA 4RLEA 3N79A 1B0VA 5M2PA 5L1KA 1XNRF 3BSAA 2R8IA 1DQ9A 1DTTA 2X1BA 1QLNA 4Q8EA 2Y1IA 4ZVFA 1R8HA 1FNMA 3B8HA 4DN9A 2KJWA 1JLBB 3MMCA 4WK1A 3FRYA 3D28A 2UU9F 3LGNA 3F41A 4I67A 4YB1P 2C3PA 3QJPA 2IBKA 1SL1A 3QWPA 3FQLA 2B5JA 1Z1ZA 5B0DA 1XK8A 3MOJB 3G86A 4B17A 5CQGA 2CJ9A 1HMVA 2Q6CA 4ZKAA 4NLGA 4OZNA 5F8JA 1RT1A 1WG4A 1HQEA 5FDLB 1FRHA 2EI5A 4JUZA 1NH8A 1LV5A 1E6VB 4K4UA 2R8JA 3UR3C 3EGNA 2NQPA 1R8BA 2B43A 2VH7A 3H98A 1S1WA 5T14A 1JLQB 2YNFB 4CTAA 1U6ZA 3E01A 3QZ8A 4PUOB 4ZPTR 4KB7A 5HLFB 1QM9A 1S9EB 4OJ1A 3SI8A 5C25B 1TK0A 2RQ4A 1KTQA 1BWEA 5A0YA 1H0HB 5U47A 4A4JA 2OPQA 2Q79A 3HVRA 2E1AA 2KT5A 1TL3B 2YNIB 3ZZZA 1HBMA 4BDPA 3KLEA 4KFBB 2HHUA 2IVMA 3HHDA 1VQNS 1HD1A 3MXHP 5KFXA 2ZOFA 5D3GA 1DRZA 4TLQA 3IN5A 3MM7B 1HNVB 2ZOMA 1T7PA 3CIMA 3HLUA 3LOUA 4Y6IA 3FMWA 1RTJA 2ABYA 1X0PA 3KFWX 1FF2A 3UDLA 3VTIA 1A7GE 3M6UA 1N0VC 2RSQA 4LSNA 3PIPQ 5E3QA 1D9DA 3G6VA 2FJDB 2GGPA 1B7FA 2BVZA 2IVYA 5BJRA 4WFZA 4DSKA 3AQPA 5H1SV 1Q1KA 2CQHA 2N7CA 3I96A 4DR6F 1FE0A 3CB4A 2QFJA 3MD1A 4DFKA 3DI6A 1IKYB 2PMHA 4IG0A 4C3KA 3FEZA 2W8KA 5FLXY 3PRDA 4XK8C 4FNHA 1WELA 2DT9A 1KFDA 1YQHA 4ZDNA 3Q8SB 2G13A 1O51A 5KFNA 2FTRA 1VQKS 4CO0A 2KN4A 2KXHA 1S1TA 2F9DA 3BZQA 1HPZA 3OR2B 4X66F 1NK7A 3SEOA 3UW1A 2V9WA 2KVIA 3OFFA 1UL3A 2RQMA 1JLEB 3QIPB 1DZ5A 2H9ZA 4EBCA 4PPDA 2UUCF 2YNGA 3Q2TC 3DNCA 3L7PA 5DLGA 5H9FJ 5KFCA 2MXYA 4QWEA 3DOKA 3OL6A 2XMUA 1CQNA 2HHXA 2BQUA 4A8SA 2MZ1A 1UAWA 3M6XA 3V4MA 5F9LA 3RR8A 5DG7A 4FXVA 1KQSR 1REVB 3V4IB 1AXQA 2JRSA 1S10A 4OI0A 2XZWA 3MPVA 5K8OA 1YVFA 2B9WA 3TUZC 2HVIA 3QYYA 2KZZA 1U1KA 5KFQA 2MB0B 3CEDA 1VFJA 5HMYA 2B9XA 3JYTA 4P2SA 1TKXA 5KFSA 3CCES 5LXRA 4DPOA 5KFTA 4ID5B 3Q0AA 2D1CA 2K3IA 3DXBA 4FXDA 2AGPA 4JI1F 2F8HA 4NPOA 1O0PA 2AJQA 3MM8A 1UFLA 2B9YA 3O3LA 3PJWA 2R8HA 1XR7A 4Y28C 3M6VA 2ZH1A 2KT2A 1HW9A 3O2IA 1CSJA 2KU7A 4HHJA 3Q8RB 1RP5A 2R9LA 1SKWA 3T5JA 2XO7A 1M90T 1RYSA 4O3RA 3T5LA 3I4PA 4QW9A 3BSNA 1XNQF 2E5JA 3GQCA 5B0CA 2LEBA 3RBDA 1ZETA 1NK5A 5AXLA 2KFNA 2DGOA 4DL3A 2NPFA 1UP1A 3IBWA 2QA4S 5IT9Y 1X9SA 4FBTA 2CKWA 3DU5A 4M1KA 3MFHA 4O3QA 4NYZA 3H2VE 4A8YA 4JI2F 2GCFA 2NZ4A 5LT5A 1S4FA 2R7OA 2ZJQQ 4NLYA 5CYQB 2ZE2A 2P6SA 5AE3A 5KG2A 4N8OA 3ITHB 1S0OA 2FVSA 2XWXA 4HEA9 4MK8A 3TI0A 3CDBA 1DQ8A 2OD6A 4YB6A 1OSDA 3DRSB 3HT3A 1U47A 2V0NA 2M52A 2QLWA 2VUGA 1KR4A 2WAQD 2HS0A 1SUQB 2JL9A 1JNZB 3BGRB 4WFNQ 3R5AA 2VC0A 2FVQA 1RTHA 4RW7A 5L1JA 4C97A 4B3TF 3NBPB 4WJBA 3M2RB 3I56S 1GAOA 2AF6A 3VWSA 1BQNA 2EBEA 3DLGA 3MEDA 3TVYA 3ZZRA 3K7RA 2LVWA 4KGKA 5LSLA 3E51A 1T95A 4ZPWR 2OMLA 3FVYA 3CD5A 3C3LA 5KG7A 5CZXA 2BE2B 2CFXA 2BACA 3H4DA 2CJAA 5CYMB 4Q2LA 4RNFA 4IQMA 3MPYA 1UA1A 5KT5A 1RAJA 4KPYA 3U7JA 3PW2A 2R2RA 1DTQB 3I0RB 1SBRA 2PEHA 2VG5B 2VFVA 4LSLB 4NLXA 2CJQA 2EVZA 4IKAA 3BM7A 3MMJA 5IQQA 5C42B 1TZ0A 1L3KA 3EPIA 2DHSA 2DISA 1N0UA 1GXUA 4J9RA 1SH3A 1N5YB 3RAMA 2MZQA 4JV1A 1S6QA 1JWWA 3NP5A 4WIIA 4OZ5A 2V4JB 5KFUA 3CCRS 1FJCA 1XN9A 2XY5A 4IDKB 2K1RB 5A6WA 5GAHI 3AA9A 5HI7A 1MNEA 3GFXA 1U49A 1SL2A 3HVAA 4RNNA 3QJJA 2FLLA 3AJ2A 1JLCB 3I5CA 1E6YB 4OMFG 1M5KC 3HJFA 2JDJA 4N47A 2V4RA 3HHNB 3OFHA 3TW0A 4TN2A 3HHLA 2UXCF 2UVWA 4EYIB 1RT6A 4N56A 3MM9A 3CF5Q 3KHHA 1KD1T 3G96A 1TVRA 1HBNB 3GE9A 3QLHB 4OZ1A 4CQ1A 4OX8A 4B3MF 5HQ8A 5I3UB 3EZUA 2MGZB 3HX9A 1U1NA 4IRKA 2IJNA 3G8QA 1VRTA 2CQDA 3H25A 3TA2A 2G0CA 1XC9A 3H40A 1T3OA 4HL9A 1Y7PA 2E1RA 2XS5A 1LFPA 2IM1A 3M32A 2ERRA 1D8YA 3GILA 3QIDA 2XGPA 1VBZA 4OHYA 4NLUA 3JSMB 1JXEA<