4OV1A

The crystal structure of a novel electron transfer ferredoxin from r. palustris haa2
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
66
structure length
66
Chain Sequence
b'MLTIHVDQDKCQGHARCKALAPELFDLDDYGNAHEKGDGVVPADLIDKAWLAKSNCPENAIDITED'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative ferredoxin
publication title The structure of a novel electron-transfer ferredoxin from Rhodopseudomonas palustris HaA2 which contains a histidine residue in its iron–sulfur cluster-binding motif
doi rcsb
source organism Rhodopseudomonas palustris
molecule tags Electron transport
total genus 12
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2014-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13459 Fer4_15 4Fe-4S single cluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ov1A00
2C3UA 2WSEC 3C8YA 2PDAA 4YDDB 3IR5B 1JB0C 2PMZD 4AYBD 4XDCA 2V2KA 5FD1A 1BWEA 3MM8B 5BYQA 1FDAA 1FRMA 3MMCB 1RGVA 4OMFG 1H0HB 1G3OA 5CHCB 1DURA 3IR7B 6FDRA 4L6V3 2C3PA 1FRJA 3MM5B 1ROFA 1JNZB 3MM6A 3EGWB 1H7XA 1R27B 2XSJB 1F5CA 1B0VA 1BQXA 4XK8C 1F5BA 5E7OB 2FJEB 3OR2B 1SJ1A 2IVFB 3MMAB 1CLFA 2GMHA 1IQZA 1FRXA 1Y5LB 1FRHA 2FGOA 1PC4A 1G6BA 1FDBA 4RKUC 1FDDA 1Y5IB 2ZVSA 1FERA 3OR1A 1HFEL 2VKRA 4XDDA 1F2GA 3MMBA 1C4AA 1FTCA 1KQGB 2V4JA 3GYXB 4KT0C 2C3MA 2FJAB 1B0TA 1VJWA 1WTFA 1FEHA 1GTHA 3MM6B 2FJDB 1JNRB 1A6LA 2FD2A 1AXQA 7FD1A 1DAXA 2FDNA 2O01C 3PNIA 1GTEA 4DHVA 1KQFB 1DFDA 1FRLA 1IR0A 1Y5NB 1FF2A 1FCAA 1FRIA 1GAOA 3MM8A 5BYSA 1FD2A 1FRKA 3HKZD 7FDRA 2VPXB 2C3OA 2PA8D 1GT8A 1BC6A 1SIZA 1BLUA 3OR1B 3MM5A 1Q16B 1Y4ZB 1D3WA 2WSCC 1K0TA 2Z8QA 1FXRA 6FD1A 1BD6A 1H7WA 2C42A 3EXYA 2GMJA 2XSJA 1H98A 2V4JB 3MMBB 3MM7A 4Y28C 2WB1D 1XERA 2VPWB 5CH7B 1FDNA 1PC5A 3IR6B 3LW5C 3OR2A 3MM9A 1B0PA 2VPYB 3MMAA 5L8RC 4CI0B 2C3YA 2WSFC 2FJBB 4ID8A 1C4CA 2VPZB 2WAQD 1SIWB 3EUNA 3MM7B 2UZAA 1KEKA 4OV1A 2Y0SD 3MMCA 1FXDA 3MM9B 5BYRA
chains in the Genus database with same CATH superfamily
2HS0A 4IG0B 3IA0A 4I2PB 4HI2A 5HROB 3QWUA 1VQPS 2FJVA 1U1QA 3W2VB 3PKYA 1AB8A 1H38A 1JWWA 4OYWA 2R2SA 3DN9A 4RL1A 1YJ9S 3TJAA 4PUOA 3NCQA 1JLFA 2K06A 1RKJA 2MKIA 4P2FA 2LECA 2C3MA 4F4AA 4NMLA 2G0JA 1UWAA 1KQSR 2FDNA 2EI5A 1HQUB 4IOAQ 2FQQB 3NWGA 4ELUA 2HZVA 5KFFA 2DCLA 4B08A 1CS4B 2ZUGA 3VGTA 1SJQA 4OL8A 2RRAA 5HL7Q 3CMAS 1U45A 2Y3YA 3M8SA 3FRZA 2DGTA 2XMJA 4MH8A 2EC0A 1N5QA 1SC6A 3TJ8A 3BBFA 2XLIA 1G3OA 4M5DA 4DU7A 1UW4A 2J9DA 3MR6A 1BQXA 2FVSA 1FE4A 1TAQA 5J1PA 1H6KX 3MAAB 2CVIA 3RB3A 1NBEB 2W01A 4WYWA 1T03B 4YMEA 1DTTB 1SV5B 4LR7A 3GG1A 3LP2B 4I69A 1IJEB 2VFUA 2HVDA 4OZ2A 4MK9A 1IR2A 2FC8A 2DGSA 3B8HA 4QWEA 2J6TA 4DX7A 4IG0A 1HW9A 4I2PA 4DPYA 2C3OA 4LMZA 5HROA 5KFWA 3W2VA 1EQMA 2Z8QA 5LMNF 5I3UB 3FDSA 1SQGA 4TVAB 4A8FA 2M88A 1CQNA 1O51A 2ZZNA 1UZHA 2R8HA 2V2VA 3C8YA 2CQCA 3D9BA 4DDFA 4QR2A 1N4LA 4ZVEA 2W2QP 3DC2A 4EBDA 1REVB 2CJKA 2L9DA 2EKYA 3ISND 2KO1A 1HBNB 3UCUP 2DR9A 1TUGB 4OZNA 2OLWA 4FKXA 2C2RA 1RT2B 5JVGQ 2VB6A 1CS4A 2FHJA 4CLPA 3AQPA 3M4XA 5D78A 1U1KA 1QTNB 3JYTB 2W9CB 4F2SA 5D0EA 2QLFB 3W5ZA 3ELHA 2YBVA 1JX4A 1TAUA 4Y6IA 3ZZPA 2W4CA 1RKIA 5E2QA 3GWCA 2E9ZA 1K9MT 3HKWA 4B9NA 3SFUA 2JFDA 1WHWA 4PYAA 3MURP 4IOBA 1FNXH 5K5MA 4MJKA 1D09B 2QFIA 1LWXA 1V5IB 4BCAA 4ALZA 1B4SA 3BJYA 3T1HF 1HWKA 3MAAA 1VC0A 4ED5A 1WSVA 1HARA 2EFGA 4HKQA 5A0YB 3BEGB 3G6XA 5DG9A 1T03A 2OELA 1DTTA 1SV5A 2CG4A 1RTDB 3AJDA 1HYSB 5LXRA 4JI8J 3PX4A 4M5KA 3R5CA 3GIIA 4K5RA 1YIJS 1UFKA 2KM8C 1GXLA 3ENQA 3OT9A 2HYIB 3ZZYA 2R2TA 5ETOA 1JLEB 4OZ1A 4OYAA 1NHUA 1KLNA 1GXTA 3UPFA 2RQCA 1W26A 1KQGB 3CWJA 2E1MC 4QR0A 1XMOJ 2FJDB 5I3UA 2ASYA 2ADCA 5KG3A 2V9KA 3H40A 4TKTA 1HHQA 4USVA 3KUHA 3R3TA 1RAGB 2NPIA 2UXDF 4PG8A 3FNNA 1REVA 4P75A 1XR7A 1X5TA 2HZAA 1KVJA 2MKSA 2ZOFA 1E6YB 3RTVA 3ZNUA 3UCZP 2VPYB 4DMZA 4ED1A 4A4JA 1YRUA 1CPZA 1RT2A 5I4MA 2C3UA 1JB0C 2LLZA 4Q0BB 1PILA 2BACA 1SH3A 3JYTA 4F4YA 1T05B 2IDLA 2HQIA 2W9CA 1UVNA 3AOAA 1JNZB 2LXIA 3VAFA 3NGRA 2LQJA 2JFKA 2KJVA 4ECSA 1FTRA 1N52B 2UXCF 4OV6A 2B4OA 1B7FA 4DR1J 3MPUB 1YJNS 4YY3J 3PYDA 1CBKA 3DLKB 3DOLA 2QJ3A 2ZJQQ 1BWVA 5A0YA 2YWEA 2QA1A 4A8YA 3ETMA 1RTDA 3EVMA 1BC6A 2UUBF 1I6JA 1IM4A 1HYSA 2UUWA 2MQPA 1G2EA 4Z7YA 4U7CA 2XMUA 1FDNA 1SC4B 2DH9A 3M1VB 1JLEA 2WAQD 1NSPA 3Q8RB 3FEXB 3BKUA 1U1NA 3LF0A 1HNWF 4KFBB 2CXEA 1HI1A 1S7IA 2BANB 4RW4B 4K2JA 2KXHA 3D2WA 4OHYA 4Y2MA 2XSFA 1L5UA 3RW7A 3MD3A 1RYRA 4ZVGA 5F8GA 5BXIA 4MKAA 4JUZA 3QGHA 3RZAA 4PG4A 4DF8A 3NGTA 4TN2A 3AJ1A 4TQRA 3C46A 2V50A 4PQAA 3IO1A 4ANCA 4KTQA 4WXOA 1NSQA 2M9KA 1FTCA 1E6YA 3GYXB 4JI8F 4JI3J 4P73A 3H20A 2BVZA 2W9BB 4WU3A 3TOQA 5HQ8A 3PNIA 4ZCMA 2ZH1A 1U8WA 1S0OA 3IMQJ 1VK8A 4Q0BA 4DL0C 2R9LA 3WC2A 1XNQJ 3JSRA 2CUYA 2CNOB 3TA2A 1FD8A 3M8YA 4LFCJ 3LGHA 4WPAA 3BR8A 2WK4A 1KFSA 1H98A 4K8RA 1XMOF 3MR2A 3OHBA 2G2ZA 2ZJRQ 2MKCA 2Q6BA 1NJIT 1VBXA 1DARA 3OPKA 2YXLA 4LF6F 2UVUA 1S77D 3QLHB 3S7RA 5E0OA 1RT7A 4ZPCA 1RLCL 3JAMY 4PWUA 3FBFA 3ILJA 1N32F 2QL7B 2O5DA 2YKOA 4NA1A 4YOEA 1TL7B 3HT0A 1KN6A 3I87A 3DLKA 2QYCA 3GPAA 5IOLA 1U1PA 3JXOA 2WTFA 1V9OA 2MQLA 2FHJD 5C25B 1DJ0A 1UFLA 3UDEA 4FVCA 4RW8B 3KDOA 2V2ZA 2J8SA 5HJXA 2ATLA 1HQEB 2AZ3A 3CW2C 4P7VA 2ILZA 3AXMA 1X4EA 4KFBA 1TR0A 2MY8A 4RW4A 2Z0GA 2B9XA 2ZKTA 4M5HA 4L3KA 1NH7A 2A10A 4C0HA 5E3AA 3M2UB 2XMMA 4YY3F 1TFYA 4KR0B 4JI4F 4USKA 1C0UB 5KFBA 1SJ3P 3MWBA 1S7HA 1S1UB 3L95X 2R7SA 1S79A 1B99A 4B9TA 1SQFA 1QY7A 3KLFB 3C2PA 4NLGA 2XMTA 5FIIA 5KFHA 3KJVB 2YVSA 3VAGA 5A8WB 4MYUA 1UEUA 3D67A 4HL9A 2CQ2A 3EX7B 2CPZA 2OPSB 2W9BA 2RQMA 5KT6A 2BRKA 2EFQA 4DPOA 4OI2A 4NCGB 9RUBA 3V81B 1LNQA 1XR6A 1Y10A 4Y2AA 4ED0A 1RWKB 4KSEB 2B9YA 3CCLS 2F63A 2CQGA 2ZE2B 2DHXA 1WEXA 1MMLA 1VRUA 2QA4G 5J2NB 5CZXA 3HVAA 3GR1A 4I7FB 2W7AA 1TL7A 1BD6A 4I56A 3GV5B 4FBUA 1HWLA 3KK1B 2C2KB 4A8WA 3DHWC 5C25A 4AXIA 2DK2A 3D6FB 2J9EA 4ZIVA 4IH7A 1FI4A 1FRMA 2E44A 2MJUA 3U1LA 1Q7LB 3HHEA 3M8ZA 2OGUA 3DGVA 1TKZB 1HQEA 3UFCX 1CJVB 4X65F 3BPSP 2KXFA 3OHAA 4PYDA 1FJ7A 1VQKS 3KWMA 5F9NA 5F8LA 2HW3A 2QSFA 2GGPB 1IVZA 5IV4A 2RKIB 4KHMA 3M2UA 3I5BA 1RADB 4ETXA 3FBEA 4DR3J 1S1UA 2UV8A 4TLQA 2ZOMA 1KRPA 3RB4A 4B3RF 2MYFA 2PE8A 5ETRA 2M0GB 2GX8A 2L9NA 2CZVC 2H4YB 4F7VA 4RR5A 1UVIA 4U6PA 4F04B 5A8WA 4KHPF 2HBQB 3UR3C 3CIZA 4HYKA 2UVRA 2OPSA 3OTOF 4ELTA 2BRLA 4IRKA 4F4ZA 4TY8B 4DV2J 2JEGA 4NCGA 2V9WA 4IG3B 2IC3B 5ETNA 3V81A 5KT5A 3SSRA 2W8KA 4DUZJ 5KT7A 2FC9A 4ZVUB 5KFMA 2M3DA 4OJGA 4QW8A 1WELA 3F44A 3SMZA 5LM7E 4B9VA 1YHQS 4F2RA 4QIFA 4JB8B 2ROPA 3UNGC 3R6GB 1R43A 3R7NB 2ZE2A 3UD3P 3THVA 4MFBB 4ZDNA 2YTCA 1IM6A 3TJ9A 1JJ2R 3TRGA 1AUDA 5EWFA 1VBKA 1NK6A 3KHLA 3J81U 4I7FA 1F3FA 3CJ5A 3PRVA 4NLVA 3KK1A 2ZDOA 1U0HB 4IYQA 1JQGA 5CCMA 1ZPVA 4W4MA 2A1BA 4MK7A 2V68A 1KTQA 1V3ZA 1FD2A 1LV5A 8RUCA 2NXCA 1UZDA 4UZCA 1HWIA 4USUA 3T6BA 1HLWA 3R97A 4EO8A 1TKZA 2GMJA 4X4UA 1CJVA 1JK9B 3IR6B 2UU9J 2LFVA 2AJ1A 2NYHA 2DR6A 3BGRB 4ZPDA 1N8RT 2QG9B 4Y0FA 2Y0SD 2AGQA 2AEFA 1WI8A 3Q89A 2RKIA 1CJTB 1S0MA 4WFBQ 1IN0A 5A6WA 1WDDA 3OSNA 5CYMB 4HH1A 2DNRA 4USWA 4U67Q 4ERDA 4KRWA 3LA0A 1M0SA 3G87A 3GYGA 1S1VB 4ED2A 2C2ZB 4ZLJA 3NS5A 4JP8A 5E3PA 3T3FA 2VFVA 4FYWB 2QLXA 1NPRA 4D3HA 3JSYA 1U2FA 2YH1A 1LKZA 3CSKA 2MB0B 1K1SA 3T1YJ 1A6LA 3AB2B 4X62F 4NE9C 3NS7B 4H4MB 1TQLA 2ZBCA 1OS5A 2BYCA 2IC3A 3VWSA 3TVYA 1F3VA 4QW9A 2OSRA 3W61A 2LA4A 5GAHU 4WBFA 4P10A 2CPIA 1NB2A 2JSXA 1WG4A 1X8DA 3CJSA 4JI1J 4DX6A 1FA0A 2B0GA 1HD0A 5D8HB 4C3KA 1Q5VA 3DNCA 3V6KA 5IQQA 1YLXA 2RQ4A 2QV6A 3Q86A 1S9FA 1PGZA 2XYGB 3FEZA 4G65A 1WORA 1VK3A 1X4DA 1RWXB 1U0HA 3K5LA 1MLAA 1IBLJ 2H65B 2QA4S 5E7OB 4DV2F 3SCKE 1KBRA 3FCWA 3KDNA 1HBUB 1UVLA 3G2XA 1RWMB 1DLOB 2HZCA 3T19A 4DR4J 5HP1B 2R4FA 2BJ7A 1EARA 3IFEA 2LDYA 2FD2A 3NL0A 5KFPA 1WD6A 1CJTA 4MMOA 2BZ2A 5CYMA 2O66A 6FD1A 4U96A 1EB0A 2K1RB 1NJZA 3E8OA 4PQUB 3DXBA 2E7WA 2ZUAA 4QU7A 3KOAA 2R7OA 4OIXA 2MQNA 2B4VA 4CT8A 4C98A 4J9QA 2VJUA 2CQBA 1RCOB 2ZBRA 2HHXA 1WEYA 5K8NA 2SXLA 2WOMB 2QN6B 5AE3A 2UU9F 4H4MA 3CO0P 2VBYA 1APSA 2LVWA 3DGPB 4K50A 5J1EB 3C66A 3NBPB 4ZOSA 1TU0B 2EFPA 4WFAQ 4FYYB 3T41A 1UEKA 4K0KF 2L3MA 2KVIA 3WQPA 4QR1A 1JLCB 2E9RX 2B7CB 4XPCA 3K8VA 4UZBA 2MZQA 2HPUA 1U26A 5I42B 2HHSA 1W2BR 5M2UA 3R1HA 2BM1A 2MLYA 2YPYA 4UUXA 2DRDA 1EETB 1XMQF 2N7CA 4ZJOA 2AX1A 1FESA 2VQFJ 2IJRA 1HBUA 2C1EB 1FJCA 2X1BA 2MXYA 2CAJA 1PG5B 1HNZF 2J6SA 3ZC4A 1Y3JA 3K57A 1I94J 4ZP9A 3K59A 1QAIA 4Q44A 3W1YC 2NUUG 4NZ0A 4YHHF 3CULA 2BKOA 1BMQB 2LP4A 1VI7A 2CJXB 4CH7A 1UW9A 4MIBA 4IR1A 4DV3F 2D74B 1YTYA 1N36J 3IC1A 1L3TA 1F9EB 2NZ4A 4JI7J 4LF5F 2Z30B 4RKUC 5DZ6A 4UF4A 5LXYA 3JQJA 1SJFA 4OQJA 4DL4A 4XDDA 4QYZJ 2MSSA 1E6VA 1N5TA 2VG5B 4HHJA 1DFDA 4MK8A 4K2XA 3UI3A 1NDCA 1WTBA 4NI2B 4ID5A 1XR5A 4X4VA 4DR7J 4O3OA 2F8EX 3LH2S 4RU2A 2OKQA 4RW6A 2WOMA 1RP5A 3PFEA 1HBMA 3DLHA 3CMQA 1DQAA 3M05A 2BE9B 1C4CA 3DGPA 5J1EA 3NBPA 3PYGA 1XBWA 2R7TA 1PIEA 1AUSL 3U27A 5JJBA 1FEEA 1JLCA 2UVVA 3MGJA 4DZ6A 2GQQA 4QWCA 1S6UA 1IWAA 1RAIB 5M2PA 2N7YA 1QDUB 3MUMP 3ZFVA 3W8PA 5I3PA 3TARA 2YKAA 2CNKB 4O3RA 2IVMA 5L1IA 3EDQB 5I42A 1FVSA 5KOXA 1WF2A 4ZPVR 3CPWR 1SKUB 2M8HA 2WBRA 1EETA 4NLWA 3AODA 3TP2A 3QWPA 1S59A 3SQOP 5G0RB 3D68A 5E3QA 5DG7A 1JMTA 1KOOA 2KFZA 1XWLA 2HHUA 3UDLA 4X4NA 1R3NA 2QRRA 1WOSA 2FZKB 4LSZB 2W8LA 1UTAA 3UN2A 1JKHA 4KQZA 1N56A 4LSLB 2ZH9A 2BJ9A 3HPOA 1KKHA 2FJXA 1SC3B 1BUXA 2B4PA 5BR8J 1RDRA 3I82A 1GMVA 5HN0A 3MM7B 2W2NP 2VF3A 3H5UA 4HTIA 1D9AA 4NRUA 1VHIA 3LWLA 1LW0B 3SXLA 1NDPA 3JSBA 3MM8B 1RJJA 4OMFG 4X4OA 1IBCB 1Z2LA 3OQ2A 1RHRB 3D0IE 4J9KA 3JTPA 3QT6A 2D1CA 3TZXA 2VQFF 3M6UA 2VG5A 2DHSA 3CC2S 4R5PB 2A6MA 4K4YA 3OVBA 4ED3A 4KPCA 1N33J 2OP5A 1RWPB 4O23A 1MNEA 4ANEA 3N6MA 4J9UE 3EVOA 1TL1B 5KFAA 2XMKA 5HATA 4TXSA 4X4TA 5AT1B 2GW8A 3HVTB 3PO5A 2FJWA 7FD1A 1S0VA 4U8YA 1ZA1B 3R5BA 3D5MA 1GMWA 5GVQA 3TAQA 4DL2A 3SCIE 3AD9C 3ISZA 4DJBA 1N5YB 2KJWA 4GKJJ 5GADU 1RAAB 3K5MA 3QIPB 3KUEA 3MM9A 2RH3A 3Q2SC 2XCPA 3MUTP 1Q8LA 2YX4A 3MMCA 5CYJA 3CMES 2OPPB 4GO5X 4YR3A 4UOHA 2PMZD 4B3SF 3FQLA 3Q8PB 3TANA 3OL9A 2LXFA 5CHCB 5ADZA 2C3PA 2VQEJ 1NAQA 5G0RA 4J9MA 2U2FA 3Q24A 3LGMA 1K8AT 2GO8A 1Q86T 3CD6S 3QJPA 4PRFA 3OJUA 2DHHA 2YKPA 3QRPA 1X9SA 2I9SA 4LSLA 2GV1A 1RTIB 3HHNB 3D1OA 1UVJA 1V3RA 4C3LA 3HT3A 1VQMS 2IM2A 4CCHA 1F1BB 2BQRA 1Y5NB 4DS4A 1Y0HA 1SL1A 1LW0A 2YNGB 4J37A 4L76A 3MM8A 3CCJS 3QRQA 2XS7A 3AOBA 3KG0A 1MU2B 1BLUA 4CLFA 3NNAA 4NLDA 3A8JA 1Q0NA 5DDPC 3JS9A 5T41A 2AYEA 2UV8G 1BQNA 4DSFA 3PW2A 4R5PA 1SCJB 2E1CA 4WP8A 2QZ8A 4ENOA 3C16A 2WSEC 3HD2A 2IRYA 3HXMA 4PCQA 1TL1A 3AHPA 4WP3A 4C0BA 4NLTA 2G1DA 5BR8F 2IJNA 4K5SA 2R2UA 2KRBA 3CCES 4YB1P 1NK0A 4I6AA 1XJWB 1N5YA 3DMJB 4JI6F 1HFEL 2IBOA 4ZN3A 3LO3A 5J2QB 2ASLA 1N34F 1RBAA 3UE2A 4KT0C 3QIPA 3NOGA 4I67A 1HA1A 1FWLA 3MCNA 2LYVA 2V63A 2V2QA 3CCQS 3SFGA 2OPPA 2BKPA 4ZMMA 2XMAA 4KC5A 4KO0B 2WHOA 2DXDA 5ETVA 3HKZD 1VR6A 1U1RA 4GO7X 3TUJC 4KGMA 3OXGA 2H1YA 4WTYA 3PYFA 3CDUA 5DM7Q 4DR2F 4AT1B 4ED6A 2IA6A 1S49A 2FHKA 1S9GB 4OV1A 2RHSB 3IRXB 1NKCA 2R3VA 3A3NB 4WF9Q 4AQYF 4OX8A 5HVFA 4C6AA 3IR7B 3BGOP 1RTIA 2XCAA 1WC3A 2IY5B 3H8YA 4XK8C 1MG7A 5C2CA 2FLNA 3C6TB 4GC7A 2YNGA 2VC0A 2V8DA 3GMGA 2AU0A 1MU2A 2GHVC 4DUYF 1L3KA 5D77A 5KOWA 2GHPA 1RT1B 3GZ7A 3UDCA 4PR6A 1FEHA 2HBRB 2OD4A 2OEKA 1VQ7S 1T94A 4TU9A 2E5LF 3M2RB 2MGZB 4CRJA 4B3OA 4PG5A 5IWAF 3QAEA 2YH0A 2PN6A 3J80U 3OW2R 4F3QA 3R7BB 4P9SA 2C2MB 4NXMF 3R7SB 4PPZA 5L1LA 5GMEA 1R0AA 2HFOA 3W64A 1KVIA 2B5JB 2RSQA 2YKQA 2K3IA 1U6FA 3J7A1 3DMJA 1BWEA 2HRUA 3RRGA 5J2QA 2L41A 1SQEA 4QWAA 1YBAA 3MEGB 2KU7A 1FRJA 4DF4A 4DOZA 1HIYA 2G2OA 3PY8A 1Y9OA 4Y00A 2RUGA 3HSZA 2VONA 3A12A 5LMUF 4G1IA 5E3CA 2XZWA 4KO0A 1D1UA 3D7SB 3BSCA 1URNA 4NYOA 3BBCA 2DR8A 2QLWA 3N5BA 2ZZTA 4M5IA 1TKTA 1F2GA 2PFDA 4K4UA 3ZTOA 2AV5A 1GMWD 3EMTA 1S9GA 2DBBA 4F36A 4NA2A 2ZWOA 3IRXA 2DJWA 5K20B 4WZQA 4F3MA 3UWTA 3VR1A 2MZRA 1G7CB 5HQLA 2HLUA 1Q81T 4DPWA 3WX8A 1MWQA 1NPPA 3F0NA 4UT4A 2GVDB 2AKWB 4C0OC 3HFKA 3ULHA 3C6TA 2XC9A 4LF9J 3QZ8A 5D6GA 2UUCJ 1KLMB 3WIUA 2BOPA 1WUUA 3NAHA 2Z4PA 1HBOB 4X2BA 4RWWA 2HFVA 3H59A 4WU2A 5F8MA 1RT1A 2IBKA 1DURA 2W7PA 2M52A 4FKYA 3CCSS 3CNQP 1NZ8A 4EBEA 1S5ZA 3RBZA 1X4AA 3MMAB 4Y65A 5CQGA 3M2RA 1B3TA 2MGZA 2Y1IA 3T9ZA 5LJ5Y 1EIYB 3EVWA 4LBIA 3A13A 4EO6A 2MKYA 3GSIA 2VUGA 1WOOA 1D8YA 3Q23A 5HBMA 1FNOA 3DRXA 1AXQA 1UFWA 4FBTA 1LEOA 2AHOB 2EFVA 4X4SA 3KYLA 3OLBA 3VGUA 1NPKA 2IYIA 5DO2A 1RT5B 4Q2MA 4O3SA 2DIVA 3MEGA 2B3TB 2VIHA 2WSCC 4F8RA 3FSXA 3GV7B 1GX5A 4RLEA 4P2XA 5D3GB 5CD4H 1MN9A 4QZVB 2EBGA 3HD1A 2YWHA 1UJ6A 3UQSA 1R0BG 2COLA 4WKYA 5L9NA 5ETKA 4LFAF 1NK8A 5SUHA 5J2MB 2QEXS 4RBTA 1VGYA 2Q6CA 3Q8SB 1TUWA 1D9FA 2CQ3A 1LXJA 3VAKA 3NEKA 4LR9A 2BOAA 3PDNA 1GEHA 2FZCB 4ECTA 3G8QA 1N0VC 3KK3B 1TKXB 3BPDA 4J9VA 1U6BA 2JNJA 4OFZA 2CPHA 1PYOB 4DQRA 2XMVA 4WJBA 4NASA 4C8MA 5EX3A 3KKFA 2F7VA 2LQ5A 3H5YA 1HI8A 3BQ0A 1JJ4A 2ZITA 2OFGX 2LQ8A 3MI7X 3RG6A 4BBYA 2E5IA 4DHVA 1KLMA 4J9NA 1HBOA 2UXBF 4QBUA 2QX0A 4C48A 2ZHAA 4QQBA 2X1AA 2UUTA 4MKYA 5K14B 1UCNA 2VOOA 1P6TA 3TNVA 2PFFB 3MMAA 4IR9A 4M8LA 3G82A 3M8WA 5IS2A 4ILRA 4H4KC 4DCOB 1SXLA 3VTIA 2R8JA 3UNYA 1Q82T 1XNRJ 4PKDB 4RNHA 1L3UA 4DLEA 3AOCA 1UWBB 1W25A 1NNDA 3GJSB 4C4WA 5H9FK 1VBYA 3D4JA 2ZC3A 1RA7A 2UUCF 1JLGB 1O0PA 3G86A 4N8OA 1RT5A 1EQ0A 3J7YI 4ZP6A 2E1AA 2OJ3A 4GC6A 2CQPA 1RACB 2EW9A 2VBWA 1Z1ZA 1LWFB 4BLGA 4PXEA 2RU3A 5K8OA 2LXUA 4B3MJ 4L3NA 2D41A 4I64A 4GVLA 1IKWB 1MROB 5J2MA 1VBZA 4N7TA 1YGYA 4RNFA 4ZVHA 5L39A 3KMQA 3CUNA 2IMOA 2J76E 4J9RA 2WW4A 1TZ0A 2AYMA 3CJKB 3KK3A 5KTQA 3AY0A 1TKXA 2L48A 2AGPA 4K4SA 2DNLA 1WACA 2H51B 5DETA 4DR6J 3HHLB 2BDPA 7AT1B 2LU1A 5A8RA 4KV8B 4CNYA 1DQ8A 3I6PA 3OL6A 5D0HA 5MLCV 2V8GA 4RW7A 4M94A 1BQMA 1TK0A 3GIKA 4DQIA 4TU7A 2ROEA 1U47A 2AJ4A 5M2RA 1S6OA 3ADAC 3NOCA 4M95A 1OSCA 3UN5A 1VQLS 2I5JB 1NSKL 3V4MA 3DOKB 5K14A 1Q1KA 1FJGJ 5DM6Q 1W2IA 4AXJA 2HQFA 2R7VA 3DRSB 2HHPA 4CLSA 1HWJA 4TU8A 2FLLA 4CO0A 1KQFB 3H2LA 4OYXA 5E5NA 4NZ7A 2FZGB 2VASA 4K7QA 1EP4B 4UY85 3HJFA 3MFIA 2GJIA 1R0CB 1UWBA 5F8NA 1KD1T 3CCVS 1UL3A 4URGA 2O1PA 2FJBB 1OO0B 3LWMA 3GFXA 1FK9B 5GAGI 3C3LA 4LBHA 4LRAA 2V2KA 1FKOB 1HNXF 3ILLA 3P3DA 3QGPA 1ZYQA 1VQ6S 1YQHA 4I0WA 5HJYA 2V0NA 3G9CA 3TZWA 3VQSA 3DLJA 1MROA 3B4MA 2AZ1A 5HLFB 3LPYA 2J7WA 2QIFA 3M8RA 3CJKA 2IM3A 1H2VZ 4RNNA 2MPUA 3KUGA 5AJ3F 3QIDA 2C2NA 2HFSA 4CO2A 2XI3A 3HHLA 4CLZA 3EPGA 4JI5J 2DPIA 3PRBA 3MAHA 4KV8A 4O3QA 1F5AA 4IQMA 3I9ZA 1QLNA 2DEIA 2NREA 2E7VA 1B70B 1AYEA 4DEZA 4OHVA 4UUWA 4DR5J 3L7UA 4ECWA 4LT6A 4ZLPA 5EX0A 3FK4A 2I5JA 3T9NA 3WC0A 5I3QA 4Q5VA 1RTJB 3DOKA 4JV2A 1OIAA 1XMBA 2O67A 1NLKL 1YVFA 3BH6B 1FFSB 2MTLA 4P2SA 4B17A 4OZJA 5DG8A 2AGOA 2E5GA 1EP4A 4PUOB 1MW7A 1JLFB 3PW5A 2HURA 3RBDA 1LK5A 2YNIB 1FK9A 1Q8BA 1WKKA 1NHVA 3TUIC 3WX4A 3SSSA 2XMWA 5C7PA 1FKOA 3E51A 2A0FB 1NSAA 2NPFA 3KK2B 2N4DA 3VGSA 2CQHA 1S12A 3MZIA 2NSBA 4UY8T 1VMBA 2RAQA 4RNMA 3D3CJ 1V3SA 1I1GA 4C9DA 4QPTA 2VPZB 4LFBJ 3O1LA 2HGNA 4NLRA 3N6NA 4EBCA 3LGNA 3HZGA 3CCZA 5IC4B 4JI2J 3W62A 1YRTA 2BJ3A 3PV8A 2YPZA 2A6OA 3CB4A 2BKNA 5HLFA 3Q83A 1RT4A 3CCWA 1H2UX 3IM8A 3HO1A 1QTMA 3N6LA 5DQGA 5LMNJ 3OR2B 3PX0A 2GMHA 2WVDA 2CIMA 3EYZA 2E29A 3I56S 1GMUA 2NR0A 3WBZA 3NGKA 1SVDA 3I96A 3EWGA 3AXKA 2CRLA 3I0RA 2RILA 1YZ7A 1FKPB 2NCKL 1GFWB 1PBAA 1P1TA 1JLAB 2HNYB 4URSA 2J7UA 3LUYA 1RTJA 2EBEA 2MQ8A 4QOTA 4JYAF 4V1Ak 3MMBB 3FEYB 5KFJA 4N76A 2CWKA 4OYMA 4DV5F 3KNAA 2OTJS 2DY9A 1X4GA 3ICLA 2RMLA 5BYRA 5JUMA 4JI5F 1R8PA 3PZPA 2KYZA 2Q66A 4ZPTR 1EAYC 4CO1A 3DYAB 4DSEA 3ZTPA 2QFJA 4LJMA 2FJEB 2YNIA 4DR5F 2KHDA 1WKLA 4EEYA 3T1HJ 1URRA 2RD5C 1B64A 4O4RA 2CDRB 1M5HA 4CLKA 3KK2A 3OUYB 3NAIA 2MZ1A 4A8SA 4WKRA 1X31C 3DDKA 4EUVA 4CDIA 2ROGA 3AD7C 3GIMA 1XN9A 4DWIA 5F8HA 1TV6B 2DYAA 4CH0S 4NRTA 2XS5A 1FRLA 1HQ2A 3D54A 2Y0BB 4B3TJ 4LSNA 4ZLLA 2DNZA 4YEAA 4IFVB 1UJ4A 3GJQB 2WB1D 4QIVA 4WIQA 4RUBA 3OR2A 3GIJA 2XYPB 3P49B 3DCAA 1OJ4A 3IBFB 4ED4A 4NLUA 5AXMA 1IKVB 1JXEA 1MMNA 5KG2A 1RLDA 1HR0F 3IN5A 3LAKA 1NKEA 3ONQA 5JMNA 3B82A 2W9AA 1FKPA 2UXDJ 2B51A 1GQEA 3UDVA 4R25A 1LXNA 3DFEA 2FVPA 4M1KA 3SEOA 2NXUA 2CQDA 3EXCX 4LFBF 1JLAA 1FRXA 2HNYA 1Q79A 2ZBIA 1VISA 3QATA 4JI2F 3WHIA 3AT1B 1I3OB 1ITPA 3H90A 4TQSA 2AJ0A 3CD7A 3IWXA 2DO0A 3MMBA 3KJNB 4IUFA 1RWUA 1N48A 2JVRA 4CTAB 3HHLD 3KG1A 5B0DA 2ZM6J 3ISNC 2ZH2A 3FGVA 3PIOQ 5IC6B 1FNMA 4ZITA 5LSRA 3LANA 3FBBA 3ZZ0A 2E1RA 2HAIA 3DYAA 5ETSA 2UXCJ 3N5FA 4DI6A 2ABYA 3PTWA 3W3SA 2VA3A 1S0NA 5SZTA 5D4PA 3BN4A 1QVFR 2KXNB 4O3PA 4ECUA 1DQ9A 4BHQA 4J91A 4X64F 1V6HA 5DZ7A 3ILIA 4PXDA 4XDCA 3OUYA 3OV7A 2EVZA 2HFZA 4E8UA 3FVYA 1Q78A 2JHEA 4N8NA 1QUPA 4NEYA 1NK7A 2MQMA 3SCLE 2P6SA 2OSQA 3DU5A 2UUBJ 2CZ4A 1TV6A 2JZ5A 3PJ9A 4F0HA 4MTPA 3N0VA 1CULB 1KHWA 3CJRA 3JQKA 3FMBA 1FFWB 2IAJB 2BW2A 2HIQA 4NCAA 1HNWJ 2R7RA 1ZBTA 2XY7A 5GAHI 4IFVA 3CDBA 4GRSA 3CVKA 4MAKA 3OTDA 1F9FA 2ZWPA 3SZ2A 2GNKA 1X5SA 3GE9A 1IKVA 3W9HA 4QIWD 3DOLB 3P4UB 1S72S 3TVZA 2HSEB 4RUAA 1PYTA 1FRKA 4DFJA 3M32B 2P9EA 2PA8D 1S57A 3ZXWA 4EWTA 5KAKA 3GYNA 4HDGA 4OYZA 3THTA 3SV4A 4MKBA 2K7JA 4YB6A 4DSLA 3NMRA 2B6AB 1KHVA 4LQ3A 4BC7A 4ZJQA 2CJQA 3M9OB 4B3TF 3G96A 2F3JA 3PG9A 2HQGA 1HMVA 2RS2A 4LRDA 1FJEB 4J9OA 4PAAA 3C19A 4CTAA 1WNEA 3S6EA 1Q8KA 4JV1A 3K5OA 1LWCB 2NXEA 3FFIB 2HQDA 2VBXA 2YNFB 3K5PA 3Q2TC 3HZEA 1RA6A 4LF6J 4KH1B 2Z58B 5KFQA 4ICLB 4KGVB 1JXLA 2EFNA 1N32J 2BJ1A 5HMXA 2AWZA 3PHEA 3PX6A 4KY3A 3U02A 5IXUA 4ECQA 4NLQA 2MSTA 2ACMA 3W2WB 2AYBA 4F67A 2HS4A 2J6UA 3CDEA 2XY5A 1KC8T 4NLSA 4E98A 1F60B 1CULA 2PMWA 3QT8A 4KAIA 3RR7A 2ZM6F 2QYGA 1JLQB 4OI4A 2IAJA 2LEPA 3N01A 3KHGA 1FKAF 1YZ6A 3DM2B 2HVZA 1HHSA 3EDRB 3PACA 2F4VJ 2HLTA 2WCXA 3I0SB 4KE5A 1KR4A 1RT7B 3TW0A 1BGXT 2N82B 4JI4J 3BQ2A 2U1AA 3DDIA 2Y1LB 2D3ZA 2I2YA 3ZZOA 2J9CA 3M32A 5T14A 5H9EK 1WHYA 1FERA 5B0BA 2KH9A 4YUDA 2XY6A 3V6DB 4OI0A 4ZVQB 3POTB 2XEXA 4OJ3A 3M30B 2XZTB 1CJUB 1X9WA 3S8SA 2BV3A 4MIWA 2F1FA 1ZOTA 1NK4A 2B6AA 1OQ6A 3OFGA 5HSPA 3PYEA 3PR4A 2JC1A 3CDAA 2QSWA 2AT1B 4GKKF 3BZQA 3EM1A 1CC8A 2XNRA 3I5CA 3C14A 3VAIA 1LWCA 3MTJA 4BWJA 4ZPAA 3FFIA 2YNFA 3OXFA 3J81Y 3PFOA 4YDDB 3IR5B 4MKVA 2BABA 4ICLA 5CYQB 1YJTA 2FY1A 4QWBA 4R0EA 2DGQA 2ZJPQ 5KFEA 4NZ6A 4CM2A 5K9FA 3CCUS 3DLBA 3RRHA 1K73T 3W2WA 1OSDA 3M2VB 3P5BP 2HHQA 2ZBPA 4OZ0A 1SKWA 2OHDA 1PBUA 2YQ3A 1QSYA 3KFWX 4LF8F 5IT0A 1JLQA 3C6UB 4X65J 3MOJB 4Q45A 4CWBA 3DM2A 2A3JA 2DR5A 4A48A 3S1TA 3KLIB 5ITHA 3HJVA 3I0SA 1GT8A 1VRUB 4ECZA 3MF5A 1IWGA 1VRQC 2YWKA 2ERRA 3PRDA 2QMXA 4ZVFA 2BEFA 2C3YA 2W2OP 4QCLA 2F5GA 3PJXA 3V4IA 3GCWP 2MHEA 4B3RJ 4LF2A 1N0UA 2JX2A 1RWWB 2E9TA 1RGVA 3UVJB 4A46A 3V6DA 4U9RA 3POTA 2IRUA 2PO4A 3M30A 1P27B 1YX2A 3IM9A 4I2QB 3IWLA 3LTOA 4KHPJ 3RB0A 1CJUA 2P9CA 1ULRA 3VGVA 2CJAA 3OTOJ 1FVQA 1FRHA 2HFNA 3BS9A 5F0UA 1VQ8S 2J0XA 2DPJA 4USIA 2F4VF 3AA8A 3X3UA 4E0DA 4J9SA 2JEFA 2DO4A 1U25A 1YKWA 4HHHA 2IM1A 1VDHA 3M7VA 4DQSA 3TVKA 4IQXA 2VFSA 4YFUA 1TVRB 3P5TL 2GMLA 4I6WA 2KG0A 3T1AA 3AJ2A 3EZUA 5CYQA 2ZHOA 5B08A 2NLWA 4Z2XA 1AZSB 3NRBA 3BGLA 3HI9A 3KXDA 2ZH3A 3T5KA 2N3OA 5IT9U 3FKBA 4N77A 2MLXA 2MMYA 2JL9A 4GMKA 3QSYB 1X0PA 1IBMF 1U4BA 3M2VA 4P71A 4NCBA 4DV0J 2DNNA 3CCRS 4USTA 5DQIA 2HHHF 4X84A 6FDRA 4L6V3 5DQHA 3GV8B 1K1QA 2WVFA 1T9WA 1TL3B 2Q79A 2VICA 2HNZB 3TWZA 3C6UA 4OHXA 1OYEA 2UVWA 2KL8A 3RAQA 3KLIA 4CLWA 1RHJB 3BKTA 2VKRA 3NMAA 3H2UB 3ET6B 3OXLA 1JIHA 2PGCA 3VVTA 5FDLB 1M5PC 4MT1A 1YJWS 5GADI 3RGIA 3ZZRA 3UD5A 1LOUA 4NLPA 1FRIA 2FGCA 3A8EA 3WDOA 3UVJA 4OYIA 4EYIB 5C24B 3MPWA 1RAOA 3HCXA 1LFWA 1SI9A 4I2QA 4IO9Q 3BM7A 5HAOA 3FC9A 4NL5A 2Z2LA 1KONA 4AD6A 3F41A 3BYRA 4X62J 5J1NA 2CQ0A 4JI0J 3K17A 3I4PA 3ZNJ1 5C42B 4WFZA 2HEKA 2R8IA 3L3CA 3F56A 1AFJA 1NRKA 4IKAA 2DHGA 4OJHA 1DHMA 1ICEB 1N54B 5EDWA 5AE1A 1TVRA 2DY1A 3HHDA 2MHNA 2KM8B 3N79A 2XQCA 3QGGA 3NXZA 3J7AN 2B7BB 2WBMA 4LF7F 3KTQA 1PJ6A 1AZSA 1C4AA 3IP0A 1SC1B 3W5XA 5CZVA 4MIAA 2R8KA 4LR8A 4DPTA 5KFSA 3TUZC 1RK8A 4R0JA 3VZHA 1D8ZA 3H0PA 3EJMA 1YBTA 2GQCA 2B8PA 1YDLA 1YWXA 3P8BB 2QT7A 1X0FA 1IBKF 1TL3A 5K8PA 2HBZB 4JOUA 2LKZA 4HDHA 2MDAA 2HNZA 3G6VA 3VALA 2A2DA 2GCFA 3ZTRA 1QAXA 2EK1A 4A47A 2QMWA 1Q7YT 2OMOA 3ET6A 2ZD1B 1QVGR 1J27A 5FDLA 3WZ0A 3A1YG 2H54B 3OTEA 4ECRA 3SYZA 3PEHA 2X3GA 1DZ5A 2WONB 4JV0A 4DV0F 1WF0A 1R89A 3TZYA 1Y5IB 5C24A 3OFHA 4L73A 2I8EA 1U02A 4RUCA 1QD1A 5J2PB 1Z4UA 1JJCB 4WFYA 1WC5A 3OD2A 4I1TA 3QSIA 2XZDB 5A2QU 3K58A 2H9ZA 4NWBA 4ZN1A 2VL1A 3TUPA 3GU0A 5C42A 5LOQA 4DSJA 3MUVP 3GIRA 3K7RA 3V2UC 4K0KJ 2KYXA 4F25A 2DRBA 4QJVA 3W5YA 1IQTA 3FCHA 2NXJA 2DNHA 4FXVA 2DNPA 4IO1A 1NDKA 3KHRA 4FYVB 3NWRA 4CLLA 1YG0A 1AFIA 4NA3A 5DLFA 4URQU 2Y9HA 1ZAVA 5ETTA 1NJWA 1ZA2B 3BYPA 3TEHB 3K0JA 3IXQA 1XMQJ 2QTWA 5L9XA 3VAJA 4JI0F 4DPUA 1C1BB 5AXLA 3FCVA 1HNZJ 3R2CJ 4NXNF 3H4DA 2B4UA 2D3OR 1SJRA 1RI7A 2IM0A 4YHHJ 4I6YA 4CLTA 2FB0A 4I4BA 4DV3J 3IWNC 2B8QA 3CD0A 1T3NA 4FF3A 4WWSA 4ZPWR 4OX9F 3D0HE 2IHR1 1R8AA 4Y3CA 2CPJA 3IAS9 4C11A 4LF5J 2ZD1A 3HLUA 1NXIA 4KB7A 4ZP7A 3DRRB 2V4JB 2E5HA 1R8HA 2F9JA 1VC6A 4CI0B 3CF5Q 2WONA 1AROP 1YITS 5B0CA 3QFHA 1HNVB 3E3XA 1H2TZ 3MEDB 5L1KA 3RB6A 4Y2IA 5J2PA 1P9QC 1XQIA 3L7PA 2W24A 3SCJE 9ATCB 2DGOA 2DHAA 3CO9A 2DR7A 2HG4A 2XNQA 4FPIA 2DGXA 2JDJA 4RX6A 3BQ1A 1FT8A 3M8PB 1FFGB 1UPPA 3D6HB 4Q7AA 3CCTA 4ZK7M 2M70A 3OL8A 1UAWA 4AL5A 1RU2A 1Y11A 3U1NA 1Q95G 2HIYA 2V4RA 4CYUB 2OTLS 3G4SS 2R2RA 1E6VB 3P6YC 4CH1A 1RHUB 3HX9A 1ZM9A 3J7Z5 7FDRA 2DKOB 2P6TA 1R7IA 3EZ5A 2W4DA 2CPYA 4M5NA 1Y4ZB 4ID5B 4P74A 1MSWD 4Y28C 1N5VA 4RW6B 1GXUA 1HBMB 5LT5A 2C2EA 1C1BA 2CA9A 1WKJA 1YI2S 1ZH5A 4J5OA 2HHTA 5A6PA 4CLUA 4FDFA 3UD4P 1RZMA 4CP5A 4EYHB 3NCPA 1T9TA 1CLFA 3GFYA 2P2CB 1HHTP 3MR3A 4ZPBA 2KB2A 2V4QA 4DPXA 2AW0A 4KKOB 1YK9A 5KFDA 1L3SA 3DRRA 2V4JA 2Y8WA 2WZ1A 3QQCD 4DLGA 1HQUA 1ZM4A 2VG6B 3CJ8A 2I1RA 3B6BA 4ZVPB 1WG1A 4NLYA 1IR0A 1HNVA 3KHHA 3D6MB 4F26A 3MEDA 2FPHX 4YP3A 2F65A 4WCEQ 1JKHB 5GAEI 1U48A 2FTRA 2HMIB 4ES1A 2MZSA 4DXLA 5KFTA 5H9FJ 3DOMB 2I6WA 3M8PA 2GJ2A 1U09A 3MPVA 3ZZTA 1RAHB 1M1KT 2LEAA 3PW0A 3MCOA 4CYUA 4W90B 3GLJA 3M9MB 2Z2YB 4N5SA 3GJRB 4MYTA 3HK2A 3SDEB 5MAOA 4CNZA 4UQGA 4C7QA 2D9OA 3LALA 3LP2A 4LVNP 5FLXU 2IIHA 2R7QA 4B3SJ 3QT7A 2C28A 2ZEJA 3CJ3A 3HSDA 1LW2B 2ADBA 2LMIA 4ZVTB 3QMQA 2ZC4A 1FCAA 3M9NB 2W2PP 1PKUA 2E66A 3MFHA 2VPXB 1OY9A 3J7ZT 1FWKA 2JRSA 2J0QD 2R7WA 2V8VA 2VDHA 2ATCB 2JEJA 1PYSB 4DX8H 1S48A 1WEZA 2GS8A 3W60A 1WOPA 3J7YU 3Q8VA 1N6QB 4HR2A 2OEJA 3MM9B 2AMCB 3PJWA 1RWNB 4KKOA 2PMHA 2EEYA 4HHUA 1OPZA 3H7HB 4ECVA 3RR8A 4PWWA 3MMCB 3TX0A 1X5PA 1HBNA 2JVOA 3HHKA 1HPZB 1EHWA 1T3OA 2RNEA 2VG6A 2YQ1A 1M1GA 3RUBL 4TYAA 5BJRA 3VAHA 2R8GA 2HKEA 3PR5B 2ZNYA 4K59A 2QLJB 3J80Y 1NKBA 2IFXA 2GA7A 4ZIWA 1IKXB 2KRRA 2BUNA 1T95A 3T5JA 2NSCA 4YR0A 2AJFE 4EGLA 2ALYB 2FJAB 4Q8FA 3ZO7A 4F0KA 2HMIA 2PEHA 4L75A 1RAJA 3TI0A 4IH5A 1FF2A 3DOMA 2HWHA 5JXSA 2HNDB 3I9V9 2V94A 1RT3B 3KLHB 3DI6B 4G6VB 3TR5A 1X9MA 4NYPA 3OR1B 1K0TA 4JI6J 3UN3A 1RHQB 1NH8A 3LPEA 2RE1A 3O8WA 4K4WA 1N34J 1MWZA 3SDEA 1BQNB 3CIMA 4PXCA 2PT0A 4OI1A 3GQCA 4ELVA 2VG7B 3GTYX 3C16B 4CIOA 1A9NB 1LW2A 2KKHA 3BBBA 3NY0A 4YB5A 5KG7A 4WK3A 4ED7A 4N41A 2GO9A 5B7WA 3FQKA 4DR2J 2BXJA 1AW0A 2YY3A 4C8KA 4AQYJ 1B0TA 1X4CA 5GAGU 2AYGA 1OPIA 1N6QA 5DDQC 2DB1A 3E01B 2AQ4A 1VJQA 4OI3A 4ZCLA 5F9LA 4Y2CA 2HAFA 4PG6A 1HPZA 1FE0A 3RJMB 5F8JA 3UO0A 4DUYJ 5KFKA 3T6JA 1FWPA 2NYIA 2M2BA 4HACB 2KG1A 4BC9A 2VU5A 3W65A 2DTJA 1IKXA 1U0SA 3T5LA 1T05A 4RO0A 5B0FA 2WB4A 4P7TA 2E5LJ 5IWAJ 3MTKA 4KYZA 2D3UA 1B0VA 3I32A 2HFUA 3MCSA 1S1XB 3TAMB 4NXMJ 2HNDA 3N28A 5KFYA 1RT3A 3KLHA 3DI6A 2X1FA 3IGNA 4WE1B 4OI6A 3RBEA 3OR1A 2ZH7A 5E41A 2ACYA 2HHVA 3SQGB 2F4FA 3L7OA 4R8UB 2VZ9A 3NGSA 2J0SD 1PAEX 3HSGA 5U47A 3QJJA 1UP1A 2L08A 2VG7A 3R1LA 3OTCA 5GMKa 5LMUJ 3W66A 5E33A 2B9WA 4YDXA 1NJXA 3I55S 1WWHA 4Y34A 3H25A 4B3OB 3M1VA 2FY8A 3G6ES 3X1LB 2F8MA 1U1OA 1PC5A 4F0MA 3Q8UA 3ZTSA 1VLYA 2BANA 4B02A 2QA2A 1FXLA 2GJFA 1R0AB 5DS7A 4DR1F 4HVZA 4JBCA 4NEZA 2RU9A 1VFJA 1R6VA 1TK8A 1IUJA 2LCWA 3BB5A 2G4BA 3E01A 4ZJLA 4NLXA 1G6BA 1FDBA 4XPEA 3KMSA 4K4ZA 3NG8A 2H5IB 4K4TA 1TTHB 3QYYA 2L9WA 2I0XA 5HMWA 3BKFA 1WTFA 1RAFB 2WVEA 1TKTB 2CNLB 4HACA 4LREA 1VQ4S 3H98A 2RDDA 2DT9A 2BQUA 2RF2B 1UA1A 2H5JB 1CVJA 3A4TA 2HVHA 4OZ5A 1RSCA 4OJ1A 2F8HA 2E5JA 3EXYA 3NP5A 3FMWA 4FYXB 1VQ9S 2RIJA 4PG7A 1S1XA 3TAMA 2APOA 3QLHA 2ZHBA 3V6JA 2DGUA 4YS2A 4HI1A 4LVOP 1O5JA 4H4OB 4WE1A 1H3DA 3KNGA 4YR2A 4OZLA 3R6LB 3SQGA 4C2MA 4PPDA 4JI3F 1FX2A 4R8UA 2LA6A 2CKWA 4TLRA 4EMDA 1VOMA 3GCXP 2GIFA 1XNQF 2FGOA 1KP6A 3K89A 4CQ1A 3H42A 2KT2A 3BR9A 1TKDA 4AL6A 4LFCF 4RW8A 1NEEA 2VBZA 3EPIA 4Z37A 2UUAJ 4KPYA 2CG8A 4LFAJ 3TO8A 4ILMA 1UJ5A 4ZVOB 1GTEA 5KFUA 3K2YA 2PIIA 3VCDA 2V69A 5HBMB 2FLPA 4RW9B 1TFWA 5DDRC 3MEKA 3O6QA 3VQTA 1C0UA 3KJFB 3RBXA 3W8GA 3AQOA 5GMDA 1R31A 5CH7B 4LF1A 2JLFA 5F0WA 3KLFA 4ID8A 1T9UA 3BSOA 4OYOA 2YKMB 3KJVA 1ZZFA 4A8KA 1M5KC 2XS2A 3FUYA 3JSMB 3QJLA 2UXBJ 3NS6A 2D3O1 2OEMA 2CADA 4M5LA 3BO2A 1WHXA 3NGDA 5CA5A 1FX4A 2DGVA 2CJYB 5EWEA 3FRYA 1FHTA 4RBUA 4WIIA 2OMLA 2V5HG 4X4RA 2CQ1A 2RF2A 3B54A 4ZCKA 2E7XA 4B9LA 2OUGA 1KDNA 2DCUB 3IBWA 4C97A 2VH7A 5KG0A 1M5OC 2G2YA 8ATCB 4DG1B 4WFXA 2XWXA 1TL5A 5J2NA 3TA1A 1QUVA 4H4OA 3CDWA 2VJVA 2Q1LA 1W7WA 4FS2A 1KQKA 2QL9B 1SIZA 1WI6A 5EGYA 1FXRA 4O0NA 1QM9A 1AT1B 3QFWA 2GZOA 2WSFC 2AP6A 4HTJA 3RW6A 1T9XA 2FIUA 5DRKA 4HH0A 2JJ4D 4KGKA 2KN4A 2V34A 2RS8A 5JVHQ 3G82B 3I5AA 1FDAA 3THPA 1N88A 2VFTA 4FPRA 1KS2A 5LL6d 4M5JA 3VF0B 2HK3A 3KLEB 2GGPA 2EFOA 1IQZA 1SL0A 4RW9A 3OVSA 1PC4A 3QPIA 1RWOB 2VV5A 3AFGA 4WTOB 3LOUA 2J8AA 2R42A 4BWMA 4RNOA 3TQ1A 3PW4A 3JAMU 3D0GE 1BHNA 4EZ6A 4J7CA 1NK9A 2BBEA 2YKMA 3CCMS 3HVRA 2HVIA 2Y1JA 4ER8A 2CYYA 3CJQA 3JSMA 4ES2A 2UUAF 1BXNA 2MY7A 4TY8A 4LF4J 1SL2A 2XO7A 4LIWA 2A18A 2VPWB 4IG3A 2J5AA 4BDPA 2D7SA 4ECYA 1OQ3A 1SIWB 1NK5A 2UZAA 5B0AA 2GC8A 3PKMA 4ED8A 3EZOA 2H5EA 5F41A 2LEBA 1YJUA 1WHVA 2DNKA 4DR3F 4ETZA 4PZVA 5EHHA 4DG1A 5D15A 4DL6A 3PHTA 4MFBA 4DL5A 5L46A 5KFNA 5A8RB 4DUTA 2IVFB 1VS3A 2AX0A 4EI2A 4O4GB 4RW7B 5CD4A 3KG4A 1BQMB 1FDDA 2JLEA 2M4MA 2POKA 2NQPA 1VLOA 5KFXA 3DKDA 4F4KA 1KSPA 4FF2A 1CG2A 2KDOA 3DXSX 1HNXJ 2CWXA 4DU8A 1U8SA 4RBVA 1NUEA 4QIGA 3AA9A 1XTZA 3OVAA 1DRZA 4DUZF 2XI2A 1CJKB 2DNGA 1YSJA 2MKJA 3IGVA 2ZNZA 4P52A 1EX8A 1NU4A 2B9EA 1CQMA 3BGRA 3HDSA 3DHXA 4LRFA 2RB7A 2XO6A 3LW5C 5CABA 3ENAA 3CTRA 5IFMA 3KLEA 4DQQA 3VZIA 2KTQA 3QO9B 1J5OB 1XC9A 1WJ9A 3S01A 5THWA 4DSKA 2QC3A 1M5SA 2DVIA 5IQ6A 5AJ3J 1JLBB 2V8HA 2QO3A 5HK4A 1S1VA 1SBRA 5H9EJ 1VQNS 3K8WA 2WW8A 4FXDA 1ZTTA 1RT6B 2LQBA 1ACMB 3GB0A 1X5OA 2IRXA 1NCLA 1PJ7A 2Q43A 4CLYA 4DFKA 3E2EA 2KFNA 2MKHA 3KLGB 4NLOA 1L3VA 3EICA 2PD1A 2NUHA 1HNIB 2V8PA 1S1TB 4KJIA 1DAXA 3D3BJ 3D66A 1VQ5S 5B0EA 3V5RA 3O3LA 2ZVIA 2BMBA 2MLZA 1RBLA 1UETA 3P45B 2CPDA 4ANDA 3GP9A 2R7XA 3LP0B 1ZAXA 5L38A 1D3WA 1F6TA 2H48B 4BS2A 1UVKA 2GHWA 4USJC 5A8KB 1J2VA 2VODA 4WK1A 1K47A 4O4GA 1TP7A 5IV3A 3UW1A 4Z7CA 5EWGA 4QWDA 1R8CA 4PEOA 2IYGA 2M8DB 4KGZB 2KT5A 1C0TB 2FYXA 2X1GA 3T1YF 4LF4F 3TZZA 2BJEA 2XYHB 3DRYA 4ZVSB 1TK5A 1R27B 2ZZMA 3PCOB 4HEA9 1DLOA 2DISA 2I38A 1N5SA 1RQ0A 1SPBP 2X51A 2XBPA 3R2DJ 1I5OB 1CJKA 4JI1F 5KT3A 2C2DA 3CC7S 5HP1A 3A8IA 4CO4A 4QIEA 3QZ7A 1IJFB 3ZZUA 4KH0B 4YQWA 2BW7A 1Z2ZA 1GH8A 3QO9A 3NGUA 4OYBA 5KFVA 1U24A 4DCPB 3QRRA 1J5OA 4QYRA 2OI2A 3IS9B 1G1XA 1KWMA 3P96A 1NB7A 2K1RA 3HF5A 2P8IA 4ATNA 1JLBA 4PQUA 1IBLF 2Q3PA 3JQMA 1O6XA 1RT6A 2K8GA 5L8RC 1U49A 1EKRA 4KGXB 3RRKA 2UP1A 1NDLA 3R5GA 4NOHA 2BQ3A 2F9DA 4ECXA 1WG5A 4DR4F 3LP1B 2PI5A 3OTBA 4FXWA 3KLGA 2ZKUA 1RWVB 5AXKA 5ETMA 2W25A 4L72B 1HNIA 1M1HA 4UQTA 1HD1A 5HI7A 2PSZA 1S1TA 4LQ9A 3BDEA 4IDKB 1H7XA 3FZ2A 1NJYA 2CQIA 4RZRA 1MN7A 4JYAJ 4I68A 2FVQA 4H54A 1RT4B 4DSIA 4V19X 1ELOA 5C5JA 4DV5J 2R7UA 1D0EA 1EJ7L 2BJ8A 2DGWA 3LP0A 2QE5A 3MPYA 3B4DA 1VQSA 5A8KA 4WP9A 3I0RB 1PCAA 4FP9A 1U1LA 1WF1A 4AUKA 3W9IA 1VIXA 1C0TA 4CT9A 1RAEB 5KFCA 5D0GA 3QT5A 4PABA 2ZH8A 2CPEA 3HMJG 5D4LA 4DQPA 3I31A 4C8LA 1QSSA 4EZ9A 1KTVA 1S76D 4N56A 4AYBD 3BO4A 4A8XA 3QBCA 4FF1A 1SH0A 3MCMA 4RWXA 3TX8A 3BSAA 3HFZB 2AD9A 1F5CA 2BX6A 2G9OA 3IS9A 4ZHRB 3BGFA 1H74A 1Q5YA 2IMWP 1S9EB 5FJ4A 3Q8YA 4YN3B 2CQ4A 3PXGa 2LDIA 1NMEB 1HR0J 5KG1A 3ETOA 1TELA 3MHYA 4OX7A 4NI2A 3R9LA 3ENWA 1QSLA 1S10A 5D4NA 3C15B 1I94F 3PO4A 3H5XA 4X4PA 2JH3A 3LP1A 5IZHA 5AXNA 3NLCA 3OL7A 3AAWB 2VDIA 2FHMA 2W1BA 1OMSA 1P9YA 2CPFA 3DLLQ 1GNKA 1REGX 4IDKA 4LSNB 1N36F 2AJ2A 4ZP8A 1T8EA 4LBPA 2OH2A 3AD8C 4YB7A 2RUSA 4JI7F 1NZAA 2ZH5A 2E1PA 4HT7A 2N3LA 2ZDPA 1C2PA 2DXFA 4M63A 5DGBA 4L74A 2LQ9A 5G4DA 3JB9k 2GIRA 4QU6A 4DCJB 2J0WA 4XO0A 1SUQB 4WYLA 4OHZA 4M5GA 4OHWA 2YQ0A 3ZZZA 4DR7F 2MJNA 1BY9A 2RRNA 4X64J 1HWUA 5ETPA 3OSPA 2CPXA 2KHCA 3PVXA 1RHKB 1ZM3A 2D69A 3SV3A 4GVBB 1RHMB 1UMJA 1U2RA 3TEGA 2DITA 1S6QB 1KNZA 2ZBQA 3IBCB 2AEJA 1FO1A 5KFLA 2RRBA 2VA2A 4PXBA 5F3TA 3OLAA 3LAMA 2YKNB 1G4CA 5ETLA 3MXHP 2DD8S 2Z56B 3MM7A 1UVMA 4DX5A 3CT9A 1U1MA 2MZJA 2ILYA 4ZHRA 1ZAWA 1S9EA 2ALZA 1RXOB 2G13A 3NNHA 4J9PA 3BN7A 4J9LA 2X7IA 3WIVA 2C22A 2VFRA 2DH7A 4UOCA 1T9YA 2XSJB 1YBUA 1F5BA 3M8QB 3C15A 1T9VA 4A8OA 2DRAA 2ASDA 5IM0B 5KFOA 1IXKA 1QAYA 2RQKA 2GVZB 1K44A 2H3EB 3HVTA 3BF4A 4IH6A 1T7PA 1MWYA 3HULA 2RVJA 3M6VA 1F0XA 3SIPB 2O01C 5DLGA 3UCGA 6AT1B 2Z57B 3MMJA 1GAOA 1S4FA 4HLBA 4LUBA 8AT1B 3PW7A 2EWHA 1YRXA 4IRDA 2AIRB 2D9PA 1N33F 5EUHA 1SUQA 4USMA 1S4EA 3GFZA 1ZS6A 2Z2ZA 2DIUA 3HHLC 1K0VA 3HVWA 1YJ7A 4WXWA 2CJBA 3FZBA 1RABB 3D6TB 2RJZA 5CCLA 3MM5B 2O3DA 4IOCQ 1U2CA 1IR1A 4GVBA 1CC7A 3SBMA 1HMVB 2W7OA 2KFYA 2AEMA 2XWYA 1S6QA 1T0TV 2CNNB 2HS3A 3MECB 4C8NA 4DBQA 2AJQA 3NKYA 2VHGA 1D9DA 4GKJF 1JJHA 2IVYA 2YKNA 2CDQA 4FVMA 5B0GA 1VJWA 5KT2A 4DL7A 2VD3A 4IFYB 3BSNA 1T02A 5B09A 4LIRA 2EPIA 3DRPB 3RAXA 3R27A 1UKUA 4C8YA 2OIHA 1WC1A 3W7BA 4OZ3A 1RTZA 4H4KA 5HANA 2VQEF 1VYAA 2KI2A 3BDPA 1DBDA 4EU0A 4OLPA 3KLVA 4AL7A 3CEDA 2NS1B 2VKZG 2XSJA 1RU1A 1XERA 3M8QA 5IM0A 1Y00A 3OJSA 3PIPQ 3L9ZA 2GVZA 5HVHA 1O8BA 2KVQE 4X66J 5FD1A 3RYLA 3OFEA 1R6YA 1SKRA 1PSDA 3I4HX 1OY6A 4P6QA 1ROFA 1F9HA 2DNYA 4NX9A 4GKKJ 4Q2LA 2DNQA 3K5NA 1VC5A 3EE3A 5KG6A 1RYSA 2XHCA 1Q53A 3QGIA 3VHQA 4CM0A 1A7GE 3V6HA 5IT9Y 2CFXA 2XG8A 1ZM2A 2HK2A 4KBIA 2BE7D 2A2CA 4O3NA 4ILLA 2BM0A 3RAMA 3R8YA 2MZTA 2H4WB 2B56A 5A76A 2QGFB 4PWDB 2KZMA 4Q43A 3R5DA 1TL4A 5HO4A 1VCTA 5F3ZA 4AE5A 3ILOA 4DV4J 3ZTQA 4UW2A 4ZVRB 3DLEB 2JOQA 3MM5A 1NM2A 2C42A 1HKAA 1V5VA 1UA0A 4O44B 3CC4S 4FZVA 1RE1B 3U1MA 4OLOA 4OX6A 1QJHA 3EUNA 3MECA 4LF8J 3C14B 1I51B 2XTJP 2VOPA 2PDAA 2DXEA 2HRYA 4E2FB 2M5YA 4WFNQ 2NXNA 4M5MA 4FF4A 3O5TB 2OD6A 4FNHA 4IFYA 1M5VC 4F02A 2VC1A 2CZ9A 2YWFA 3DRPA 1SJ1A 5IT4A 1VQOS 3SSQA 4DS5A 1A0OB 1Y5LB 1CSJA 3OBIA 4UOFA 4G1PA 2BE2B 3MEEB 1TUVA 5C2GA 1ZETA 1SKSA 2QLBB 4DV7J 4B9MA 3JTOA 4UOGA 4FS1A 3AB4B 2FHOB 2K7KA 3MR7A 4F50A 3R5JB 1PJ5A 3DU6A 1X4FA 1PO6A 2JWNA 3BH7B 3D28A 5T7LB 2YNHB 1QAJA 2GQ2A 2CJ9A 3US5A 2PA3A 2K3KA 1VHFA 4RU9A 2JLGA 2B5JA 3GR0A 1XIQA 4DN9A 4NYZA 3FBCA 5KG4A 1GX6A 3G8TA 1S1WB 1VIOA 2F40A 1FXDA 3CGIA 3GJTB 4V19J 3HFVA 1SH2A 5KFIA 2DEJA 3V4IB 2AF6A 4USHA 4B9SA 1DTQB 1H72C 2HQ3A 2MKKA 2RDJA 4PWDA 2OPQB 3HM9A 3IRWP 4X66F 1S6PB 5GAEU 1GK8A 3M6WA 1T11A 1BE4A 2W4PA 4C8OA 1XK8A 3DLEA 4DV6J 1IBMJ 2OPRB 3OFFA 1ZZNA 3AH6A 4O44A 3N4WA 4TYBA 2HHHJ 4FNIA 1TMJA 1GTHA 3CJ0A 3MDFA 3GONA 1ZTWA 2YWWA 3RU0A 2PEBA 5DGAA 3BV8A 4ZS6A 2V67A 2EK6A 2GVDA 2HQCA 1KOHA 1NHKL 5KFZA 3TQEA 4P72A 1DY3A 4NPOA 4U7UD 2RDIA 4LRBA 2IJFA 2FVCA 4F4XA 1H73A 4RUHA 2IA0A 2ASJA 1RBOB 1KEKA 1RCXB 2BE2A 3MEEA 2BJDA 3PEJA 5HMYA 4C8ZA 4DV4F 3IG1B 2Y1RI 5CAAA 2ZFHA 2JEIA 5A2QY 3H2VE 4NMXA 2XGQA 3ITHB 4FYDA 3G8SA 1MMDA 5T7LA 1Q8IA 2YNHA 3JTNA 4IRCA 5ETQA 5DDOC 2IDEA 3O44A 4RJVA 4WZMA 4LF9F 4ZA1A 3MM6B 1S1WA 1JNRB 2C2OB 1RTHB 2HWTA 4S0MA 4ZCIA 2WRMA 3MPDA 2LU2A 4QYZK 2EXUA 3F73A 3B78A 4AFFA 4ZLNA 3O2IA 5D3GA 4DV7F 1S97A 4LF7J 1SJ4P 3H5SA 1DTQA 2P5VA 1IKYB 1AA1B 3TYTA 2XB2D 2OPQA 2V6AA 4XTTA 1EZZB 2YX1A 2XLJA 4B9UA 1S6PA 4ITSA 5BYQA 3CD5A 1PAUB 4G1QB 1H0HB 2BA9A 2OPRA 4KHRA 1WC4A 2OO4A 2HHWA 4DL3A 2P9GA 1IBKJ 1LQ9A 4DFMA 3GSDA 3W63A 3J81j 4LRCA 2HVEA 2GAGC 5HVGA 4DV1J 4CO5A 1B7YB 1Y3KA 3Q8QB 1KFDA 3H4BA 1WC0A 1VRTB 2N4CA 1J5EJ 2GAHC 3TAPA 1C1CB 5E3RA 3Q0AA 1SB6A 3CJ4A 1LK7A 2G1HA 3L09A 5K8MA 2ZOGA 4A8MP 3CXCR 4K4VA 3IG1A 2EKNA 2Z2MA 4DV6F 1EKSA 5CXTA 3DLGB 2WVCA 2DNOA 2BR0A 2MQOA 4ZKAA 3HP6A 3D1HA 1CEZA 1B0PA 3ITHA 1WC6A 4JV5J 1LWEB 5H1SV 2G0CA 2FUG9 4X4QA 1X4HA 3W9JA 3BO3A 1X60A 2GFFA 3PM9A 3CE8A 1LFPA 2Y8YA 2EG2A 3LQVA 3MM6A 3N9UC 1JLGA 1TMMA 3TA0A 1RTHA 5D4OA 1VQYA 5KFRA 5RUBA 2PI4A 4TNOA 3EGVA 4K4XA 2PC6A 4D3GA 2ZVSA 4CO3A 3MAQA 1LWFA 2HBYB 3A8KA 4KIAA 3IAM9 3GFHA 1U6ZA 3BREA 3G71S 1IKYA 3SI8A 4C3MA 2ZH4A 2X3DA 1P1LA 2J7KA 4DN0A 3A3OB 1IKWA 1XNRF 3VV2B 2XGPA 3EGNA 4G1QA 3EGZA 1F2HA 3VVUA 2HGLA 4HT5A 4P2MA 1YJRA 4NXNJ 4XAKA 1QE1B 3NNCA 3U7JA 5KFGA 1RISA 3MD1A 1OY8A 4XIUA 3A3PB 1WDTA 3QNWB 3GILA 2XULA 2FLOA 4OX9J 2EG1A 1VRTA 1C1CA 4FN5A 4RPFA 4TY9A 5LSLA 3EGWB 5LJ3Y 3UR0A 4A8QA 1UPMB 4B3MF 2XHWA 3CJ2A 2CVEA 1U7LA 4UTGA 3FSIA 5D0RA 2HWIA 3CJTA 2XM3A 3D1QA 4U95A 2B43A 3DLGA 4F4WA 4G3IA 3MR5A 2QMUB 2NZCA 4ES3A 4U7UK 1NO8A 3DRSA 1RB0A 5L1JA 3QAUA 4CZCA 3DDNA 2MEWA 1LWEA 1X4BA 3HSJA 3G6YA 1M90T 4J90A 1HW8A 3R5AA 1Q4RA 4DR6F 2YWGA 1S99A 3M6XA 2RHQB 5HQMA 5HMZA 4O0IA 5KT4A 5BYSA 3MOZA 1P8GA 4DV1F 3ENVA 4W98A 2OAUA 2YX7A 1J5EF 1Y7PA 2K2PA 4Y2KA 4C11B 2WVBA 2DH8A 1XEZA 1JXVA 2HGMA 5KG5A 1YJVA 4EFAC 4Q8EA 4N47A 5F8IA 5FLXY 2G0IA 2QL5B 1X7VA 4DFPA 3FSYA 3BGUA 4W92B 1UEVA 2RT3A 1HI0P 1FJGF 2OFHX 1HL6A 3L4BC 3NCRA 5AE2A 1OYDA 2IPOB 1WSRA 4OYPA 3Q22A 4JV5F 3GG0A 2DNMA 1OWXA 3VAMA 5EN1A 1KVKA 3KJQB 2HRTA 3FJ2A 4M5DB 2KT3A 2EC2A 1QE1A 4EK2A 4F3OA 1R8BA 2M7SA 2W2MP 5DJBA 4DZDA 2FVRA 2J9DE 2JC0A 4U8VA 1Q16B 1H7WA 3T5HA 2XLKA 2KZZA 2MQQA 2ZH6A 4QPXA 1ZPWX 2GIQA 1RUSA 5LSOA
chains in the Genus database with same CATH topology
2H5EA 5F41A 2LEBA 3PFOA 4GO5X 4YDDB 2HS0A 3IR5B 4YR3A 2PMZD 4IG0B 1YJUA 4B3SF 1WHVA 3IA0A 3FQLA 3Q8PB 3TANA 2BABA 3OL9A 2LXFA 4I2PB 5CHCB 4ICLA 2DNKA 5CYQB 1YJTA 5ADZA 4DR3F 2C3PA 4HI2A 3QWUA 4ETZA 5HROB 1VQPS 1U1QA 1NAQA 5G0RA 2FJVA 3W2VB 5EHHA 4DG1A 4J9MA 3PKYA 2U2FA 2FY1A 4DL6A 4MFBA 4QWBA 4DL5A 3Q24A 1H38A 4R0EA 5KFNA 3LGMA 5A8RB 2DGQA 2IVFB 1K8AT 1JWWA 2ZJPQ 1VS3A 2GO8A 2R2SA 1Q86T 3CD6S 3DN9A 4NZ6A 5KFEA 2AX0A 5K9FA 4O4GB 4RW7B 3QJPA 1YJ9S 4PRFA 3KG4A 3OJUA 3CCUS 3DLBA 1BQMB 1FDDA 2JLEA 2M4MA 2YKPA 3W2WA 3RRHA 3NCQA 1K73T 1OSDA 3M2VB 4PUOA 1JLFA 1RKJA 2POKA 1X9SA 2NQPA 2I9SA 5KFXA 2MKIA 4F4KA 4LSLA 1KSPA 4FF2A 2HHQA 4OZ0A 1CG2A 2GV1A 2KDOA 3DXSX 1SKWA 2LECA 2C3MA 1RTIB 3HHNB 3D1OA 2YQ3A 4NMLA 1UVJA 1V3RA 1QSYA 4C3LA 1U8SA 3KFWX 3HT3A 4RBVA 4LF8F 1KQSR 5IT0A 4QIGA 3AA9A 2FDNA 1VQMS 1XTZA 1JLQA 2IM2A 4CCHA 2EI5A 3OVAA 1HQUB 1DRZA 3C6UB 4DUZF 2BQRA 1Y5NB 3MOJB 4Q45A 3DM2A 2A3JA 2XI2A 1Y0HA 4DS4A 1SL1A 4IOAQ 1LW0A 2YNGB 4J37A 3NWGA 4ELUA 3MM8A 3CCJS 2DR5A 2DNGA 4A48A 1YSJA 3S1TA 3KLIB 2MKJA 5KFFA 3IGVA 2XS7A 2DCLA 5ITHA 3I0SA 1GT8A 4B08A 3KG0A 2ZNZA 2ZUGA 1MU2B 1SJQA 1BLUA 4OL8A 2RRAA 3NNAA 1VRUB 4NLDA 3MF5A 4ECZA 5DDPC 5T41A 1NU4A 2AYEA 2UV8G 5HL7Q 1CQMA 3BGRA 3HDSA 3DHXA 2YWKA 3CMAS 1BQNA 2ERRA 2RB7A 1U45A 4DSFA 3PW2A 3PRDA 3LW5C 3M8SA 4R5PA 2QMXA 3CTRA 5IFMA 3KLEA 4DQQA 4ZVFA 2C3YA 3FRZA 3VZIA 2KTQA 2E1CA 2DGTA 2QZ8A 3QO9B 4QCLA 2XMJA 3PJXA 3V4IA 1J5OB 1XC9A 2MHEA 2WSEC 1N5QA 1SC6A 4MH8A 3S01A 5THWA 2EC0A 2IRYA 3HXMA 4DSKA 1N0UA 2JX2A 4PCQA 1M5SA 1TL1A 3AHPA 2DVIA 2E9TA 1RGVA 4A46A 5IQ6A 2XLIA 1G3OA 3V6DA 4U9RA 3POTA 4M5DA 2IRUA 2PO4A 1JLBB 1P27B 2QO3A 2V8HA 3M30A 4C0BA 1S1VA 1UW4A 4I2QB 1SBRA 4NLTA 5H9EJ 3IWLA 1VQNS 3RB0A 2J9DA 3K8WA 2WW8A 4FXDA 2G1DA 3MR6A 5BR8F 2P9CA 1ZTTA 1ULRA 1BQXA 1RT6B 2LQBA 2FVSA 2CJAA 1FE4A 2IJNA 1TAQA 5J1PA 1FVQA 4K5SA 1FRHA 2HFNA 1H6KX 3BS9A 5F0UA 2KRBA 2R2UA 1VQ8S 2CVIA 1X5OA 3GB0A 3CCES 4YB1P 2IRXA 2J0XA 3RB3A 2DPJA 2Q43A 1NK0A 4I6AA 4USIA 4DFKA 2F4VF 4WYWA 1T03B 3AA8A 3DMJB 4YMEA 1N5YA 4JI6F 1DTTB 3X3UA 3E2EA 4E0DA 2KFNA 1HFEL 4J9SA 1SV5B 2IBOA 2MKHA 3KLGB 3GG1A 3LO3A 2JEFA 5J2QB 4NLOA 2ASLA 2DO4A 1L3VA 1N34F 3UE2A 2PD1A 1U25A 2NUHA 3LP2B 4KT0C 1HNIB 3QIPA 4I69A 1IJEB 2IM1A 2VFUA 1S1TB 4I67A 1HA1A 4DQSA 4KJIA 3TVKA 4IQXA 1DAXA 2VFSA 4MK9A 2FC8A 2LYVA 1VQ5S 5B0EA 3CCQS 2DGSA 3B8HA 3V5RA 3SFGA 3O3LA 2OPPA 4YFUA 4ZMMA 4KC5A 4KO0B 1TVRB 4QWEA 3P5TL 2J6TA 4IG0A 1UETA 2GMLA 2WHOA 4I6WA 2CPDA 1HW9A 2KG0A 3T1AA 3AJ2A 3HKZD 3EZUA 4I2PA 2R7XA 5CYQA 2C3OA 2ZHOA 5B08A 4LMZA 5HROA 2NLWA 5KFWA 4Z2XA 3LP0B 3W2VA 1ZAXA 5L38A 1D3WA 2Z8QA 1U1RA 3NRBA 5LMNF 4GO7X 3TUJC 4KGMA 3BGLA 3HI9A 3OXGA 2ZH3A 4WTYA 4BS2A 1UVKA 2GHWA 4USJC 5A8KB 3CDUA 1J2VA 3T5KA 2N3OA 5DM7Q 2VODA 4WK1A 5I3UB 4N77A 4DR2F 3FDSA 4ED6A 4A8FA 2IA6A 2M88A 1CQNA 1S49A 2FHKA 1O51A 4O4GA 1S9GB 2JL9A 2MMYA 4OV1A 1TP7A 2ZZNA 4GMKA 3IRXB 3UW1A 2R8HA 1X0PA 3C8YA 1IBMF 2CQCA 1NKCA 5EWGA 4DDFA 1U4BA 3M2VA 4QWDA 4NCBA 4QR2A 4WF9Q 4AQYF 1R8CA 1N4LA 2DNNA 3CCRS 2IYGA 4OX8A 2M8DB 4ZVEA 5DQIA 2HHHF 2KT5A 4X84A 3DC2A 4EBDA 1C0TB 3IR7B 6FDRA 4L6V3 1RTIA 2X1GA 1REVB 3T1YF 4LF4F 5DQHA 2BJEA 3GV8B 1K1QA 2CJKA 2XCAA 3DRYA 2L9DA 1TK5A 1R27B 1TL3B 2EKYA 2ZZMA 3ISND 2KO1A 1HBNB 2Q79A 3H8YA 4HEA9 4XK8C 1DLOA 3UCUP 2FLNA 2DR9A 2DISA 2HNZB 2I38A 3C6UA 1N5SA 1RQ0A 3C6TB 2X51A 4OHXA 2XBPA 4OZNA 2UVWA 2OLWA 4GC7A 2YNGA 2VC0A 2V8DA 4JI1F 2C2RA 1RT2B 3RAQA 3KLIA 5JVGQ 3GMGA 5KT3A 2VB6A 2AU0A 2C2DA 3CC7S 5HP1A 1MU2A 2GHVC 4DUYF 1L3KA 2FHJA 2VKRA 5D77A 3NMAA 5KOWA 2GHPA 3H2UB 4CO4A 3AQPA 1RT1B 3M4XA 3GZ7A 4QIEA 3OXLA 5D78A 3UDCA 1U1KA 3JYTB 3QZ7A 1JIHA 2PGCA 2W9CB 1IJFB 5FDLB 1M5PC 4F2SA 3ZZUA 4PR6A 1FEHA 4YQWA 1YJWS 1Z2ZA 1JX4A 1GH8A 5GADI 2OD4A 1TAUA 4Y6IA 3ZZPA 1VQ7S 3QO9A 5KFVA 1U24A 3ZZRA 2W4CA 1J5OA 1RKIA 5E2QA 1LOUA 4NLPA 4QYRA 3IS9B 1T94A 4TU9A 3GWCA 1G1XA 2E5LF 3M2RB 2E9ZA 1K9MT 1FRIA 2MGZB 2FGCA 3A8EA 3HKWA 4B9NA 4B3OA 3P96A 4PG5A 3SFUA 3WDOA 1NB7A 2JFDA 5IWAF 1WHWA 3MURP 2K1RA 3HF5A 3QAEA 4EYIB 4ATNA 5C24B 2YH0A 1JLBA 3MPWA 2PN6A 4IOBA 1LFWA 1SI9A 4I2QA 4IO9Q 3OW2R 4PQUA 4F3QA 1IBLF 3BM7A 2Q3PA 1FNXH 4NL5A 5K5MA 2Z2LA 4MJKA 1RT6A 4NXMF 5L1LA 4PPZA 1KONA 2K8GA 4BCAA 4ALZA 5L8RC 1U49A 3BJYA 3T1HF 1R0AA 2HFOA 3F41A 3RRKA 1HWKA 2UP1A 1VC0A 4ED5A 1KVIA 1HARA 4NOHA 2B5JB 2RSQA 2BQ3A 2EFGA 5J1NA 2F9DA 2YKQA 4ECXA 1WG5A 4DR4F 2CQ0A 5A0YB 4HKQA 2K3IA 3BEGB 3LP1B 3G6XA 1U6FA 2PI5A 5DG9A 3J7A1 1T03A 3DMJA 1DTTA 3I4PA 3OTBA 1BWEA 2HRUA 1SV5A 2CG4A 4FXWA 3KLGA 3RRGA 2ZKUA 5C42B 4WFZA 5J2QA 2L41A 1SQEA 1RTDB 5AXKA 4QWAA 1YBAA 2R8IA 2W25A 3MEGB 2KU7A 3L3CA 3F56A 4L72B 1HNIA 1FRJA 4UQTA 5LXRA 4DF4A 1HYSB 1AFJA 1HD1A 5HI7A 2PSZA 1S1TA 4LQ9A 4DOZA 3BDEA 4IDKB 3PX4A 1NRKA 1H7XA 3R5CA 3FZ2A 4IKAA 2DHGA 2CQIA 3GIIA 4OJHA 1NJYA 1Y9OA 4K5RA 4RZRA 1YIJS 2KM8C 4Y00A 1GXLA 1DHMA 2RUGA 3ENQA 4I68A 2HYIB 3ZZYA 2VONA 2FVQA 4H54A 2R2TA 5LMUF 1RT4B 4DSIA 4V19X 1N54B 1JLEB 4G1IA 1ELOA 5E3CA 5AE1A 5C5JA 2XZWA 1TVRA 4KO0A 5EDWA 1D1UA 3HHDA 3BSCA 4OZ1A 2MHNA 2KM8B 2R7UA 1URNA 3N79A 4NYOA 1D0EA 3QGGA 2DR8A 2QLWA 1NHUA 3N5BA 1KLNA 2B7BB 2WBMA 1GXTA 4LF7F 3KTQA 2DGWA 3LP0A 1TKTA 3UPFA 2RQCA 2QE5A 1F2GA 1C4AA 1KQGB 4K4UA 3CWJA 2E1MC 3MPYA 2AV5A 4QR0A 3B4DA 1VQSA 5A8KA 5CZVA 2FJDB 5I3UA 2ASYA 3I0RB 4MIAA 2ADCA 2R8KA 5KG3A 2V9KA 3H40A 1S9GA 2DBBA 4TKTA 4NA2A 3IRXA 2DJWA 4WZQA 4FP9A 4F3MA 3UWTA 5KFSA 3TUZC 3R3TA 1U1LA 3VR1A 2MZRA 1G7CB 2NPIA 1RK8A 4R0JA 1WF1A 4AUKA 3VZHA 1D8ZA 2UXDF 1VIXA 4PG8A 1C0TA 4CT9A 2GQCA 3FNNA 2HLUA 1REVA 1Q81T 1YWXA 2QT7A 1XR7A 1X0FA 1X5TA 1KVJA 2MKSA 1IBKF 2ZOFA 5KFCA 1E6YB 1TL3A 3RTVA 5K8PA 2ZH8A 4JOUA 2LKZA 4HDHA 3UCZP 2MDAA 4C0OC 2HNZA 2CPEA 2VPYB 3HMJG 3G6VA 3VALA 3HFKA 2A2DA 2GCFA 3ULHA 3C6TA 2XC9A 4DMZA 3QZ8A 4ED1A 5D6GA 5D4LA 1QAXA 2EK1A 4DQPA 3I31A 4A4JA 1YRUA 1CPZA 1RT2A 1KLMB 5I4MA 1QSSA 4C8LA 4EZ9A 2C3UA 1KTVA 2BOPA 1S76D 4A47A 1JB0C 2Z4PA 2LLZA 3NAHA 4AYBD 4N56A 1HBOB 3BO4A 4RWWA 4Q0BB 4X2BA 2QMWA 1Q7YT 1PILA 2BACA 3H59A 2OMOA 4WU2A 5F8MA 1RT1A 4A8XA 2ZD1B 1QVGR 1DURA 1SH3A 2IBKA 3JYTA 2W7PA 4F4YA 2M52A 1T05B 4FF1A 2HQIA 2W9CA 5FDLA 1UVNA 1SH0A 3WZ0A 3CCSS 3A1YG 1JNZB 2LXIA 4RWXA 3TX8A 3VAFA 3BSAA 2AD9A 1F5CA 4EBEA 3OTEA 1X4AA 2LQJA 4ECRA 2JFKA 3MMAB 3SYZA 2KJVA 3PEHA 2G9OA 4Y65A 4ECSA 2X3GA 3IS9A 4ZHRB 3BGFA 2IMWP 1S9EB 5FJ4A 1FTRA 5CQGA 1DZ5A 3M2RA 2WONB 2MGZA 1N52B 4JV0A 2Y1IA 2CQ4A 3T9ZA 4DV0F 1WF0A 5LJ5Y 1R89A 3PXGa 2UXCF 1Y5IB 5C24A 3OFHA 2LDIA 2B4OA 2I8EA 1B7FA 4RUCA 4EO6A 2VUGA 5J2PB 1Z4UA 1YJNS 5KG1A 4WFYA 1D8YA 3ETOA 3Q23A 5HBMA 1FNOA 3DRXA 3MHYA 1AXQA 1UFWA 3DLKB 4OX7A 3ENWA 1QSLA 3DOLA 5D4NA 1S10A 4I1TA 4FBTA 2EFVA 3K58A 2ZJQQ 1I94F 3PO4A 4X4SA 3KYLA 2H9ZA 4NWBA 3H5XA 4X4PA 2JH3A 5A0YA 3OLBA 3LP1A 5IZHA 5AXNA 2IYIA 2VL1A 2YWEA 3NLCA 2QA1A 3PY8A 4A8YA 5DO2A 3OL7A 1RT5B 3AAWB 5C42A 4Q2MA 4O3SA 1RTDA 2FHMA 4DSJA 2DIVA 3MEGA 1BC6A 2UUBF 3MUVP 2CPFA 1IM4A 2B3TB 3K7RA 3V2UC 1I6JA 3DLLQ 1HYSA 1GNKA 2WSCC 2UUWA 2MQPA 1G2EA 4IDKA 4LSNB 1N36F 4ZP8A 2KYXA 1T8EA 4F8RA 3FSXA 4U7CA 3GV7B 1GX5A 2XMUA 4RLEA 4F25A 2OH2A 1FDNA 4QJVA 2DRBA 4YB7A 5D3GB 1IQTA 5CD4H 4JI7F 4QZVB 2DH9A 3M1VB 3FCHA 1JLEA 1NZAA 2WAQD 2ZH5A 2DNHA 3Q8RB 2EBGA 3FEXB 4HT7A 2YWHA 4FXVA 2N3LA 1U1NA 2DNPA 3LF0A 2ZDPA 4IO1A 1UJ6A 1C2PA 3UQSA 2COLA 1HNWF 4WKYA 4KFBB 5L9NA 1HI1A 2BANB 4M63A 5DGBA 4RW4B 3KHRA 4LFAF 2KXHA 1YG0A 2LQ9A 1NK8A 5SUHA 1AFIA 4NA3A 5DLFA 5J2MB 4URQU 5G4DA 2QEXS 4RBTA 1VGYA 2Q6CA 3D2WA 4OHYA 3JB9k 2GIRA 4Y2MA 2XSFA 4QU6A 1ZAVA 3Q8SB 1NJWA 1L5UA 1D9FA 2CQ3A 1LXJA 3VAKA 3RW7A 3MD3A 2J0WA 1RYRA 4XO0A 4ZVGA 5F8GA 3K0JA 1SUQB 3IXQA 4WYLA 4OHZA 4MKAA 5L9XA 3PDNA