4OV1A

The crystal structure of a novel electron transfer ferredoxin from r. palustris haa2
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
66
structure length
66
Chain Sequence
MLTIHVDQDKCQGHARCKALAPELFDLDDYGNAHEKGDGVVPADLIDKAWLAKSNCPENAIDITED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of a novel electron-transfer ferredoxin from Rhodopseudomonas palustris HaA2 which contains a histidine residue in its iron–sulfur cluster-binding motif
doi rcsb
source organism Rhodopseudomonas palustris
molecule tags Electron transport
molecule keywords Putative ferredoxin
total genus 12
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2014-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13459 Fer4_15 4Fe-4S single cluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4ov1A00
1FRJA 1GTHA 2FJAB 2VKRA 1PC4A 4OV1A 1FDDA 3MM7A 4RKUC 4AYBD 1HFEL 1FERA 3IR5B 1FRIA 1FDNA 6FD1A 2GMHA 1XERA 1H98A 2V2KA 1FEHA 3OR1A 3OR2B 1VJWA 2C3UA 3MM5A 6FDRA 1BWEA 5E7OB 1FRLA 1PC5A 1H0HB 2C3YA 5BYQA 1F5CA 1H7XA 2WSEC 3MM9B 1SJ1A 3MM7B 2GMJA 2FJBB 2UZAA 3EGWB 1FXRA 2O01C 4OMFG 1BQXA 1GTEA 1IR0A 4L6V3 2PMZD 1IQZA 1C4CA 2C3PA 1GAOA 1C4AA 1Q16B 2WAQD 3EXYA 1GT8A 3MMCA 3IR7B 1G3OA 2PA8D 1A6LA 2FGOA 3MM5B 2C42A 1KQFB 2FJEB 1FCAA 4Y28C 1Y5IB 1F5BA 1B0TA 1F2GA 1KEKA 1Y4ZB 3MM8A 3EUNA 2XSJB 4KT0C 4XDDA 1FRMA 3MM9A 5FD1A 1R27B 2V4JB 3GYXB 1WTFA 1FRXA 7FD1A 2VPWB 1JB0C 1H7WA 3HKZD 3MMAB 1ROFA 1FRHA 3MMBA 2C3MA 2WSFC 2WB1D 3OR1B 3MM6B 1FF2A 1K0TA 1FDAA 1FTCA 2VPYB 7FDRA 3IR6B 2WSCC 2Y0SD 2V4JA 3OR2A 2VPZB 3MMAA 1FD2A 3MMBB 4XDCA 2XSJA 3PNIA 2Z8QA 1Y5NB 4DHVA 1BC6A 2FDNA 3MMCB 1SIZA 1JNZB 1FXDA 1KQGB 3MM6A 1SIWB 1DFDA 1AXQA 3LW5C 4ID8A 1B0VA 2IVFB 5L8RC 1G6BA 1Y5LB 2FD2A 5BYRA 4XK8C 5CHCB 4YDDB 1BLUA 3MM8B 1BD6A 1FRKA 3C8YA 2C3OA 5CH7B 1D3WA 2FJDB 1DAXA 5BYSA 1FDBA 1CLFA 1JNRB 1DURA 1RGVA 4CI0B 2VPXB 2ZVSA 2PDAA 1B0PA
chains in the Genus database with same CATH superfamily
3AD9C 3GE9A 4ZK7M 2YBVA 1XBWA 3U27A 2PD1A 1FDDA 1G4CA 2OTJS 3TVZA 1QTMA 2UVWA 3H2UB 3MUVP 1SXLA 3RU0A 4YR0A 4GKJF 3BM7A 4NXMJ 1Y10A 2W4CA 2A0FB 2CAJA 2KRBA 1X9WA 3M2VA 4FXVA 3BDPA 2YNIA 4O3RA 1XEZA 4N76A 2DXEA 5DLGA 2A3JA 1TV6A 1NLKL 1R7IA 4RW7B 1FX2A 2ERRA 5L9XA 1NB7A 1WI8A 4XAKA 1HBUA 3K2YA 3M2UB 4NOHA 4PPZA 3RBDA 3QPIA 4B3SJ 3Q8VA 3ENVA 4NYOA 4EWTA 4Q5VA 2YNFA 4ZJLA 2OKQA 2GGPA 2BJDA 1QLNA 2DNNA 4KRWA 2MMYA 5KOWA 3MPUB 3ADAC 2V0NA 2XWXA 4ITSA 4U95A 1GMWA 4ZMMA 2XCPA 2PEBA 3PEHA 2XSFA 4Q43A 3IBWA 1RTJA 4I0WA 3I4PA 4YUDA 2LKZA 2J5AA 1SPBP 2RDDA 2LVWA 1FKPB 2J9DE 3MZIA 1PILA 3SIPB 4C3KA 1V5IB 1RTHA 4LRCA 5C25B 1RT7B 1QVFR 4X65J 1RTZA 1M5OC 2XMJA 3HT3A 3PFOA 1PJ7A 3Q89A 2MGZB 1A6LA 1URNA 3FGVA 4FF2A 5GMKa 2UXCF 2XTJP 3W5YA 3DLKB 4X4QA 1I5OB 2YPZA 3LP2A 1IKXB 1RAAB 4LF5F 3LTOA 1F2GA 5THWA 1YJNS 1R43A 3MM8A 1AROP 1HQUA 4JUZA 2GVZB 1KRPA 3H5SA 2R2UA 2G1HA 1Q7LB 2Q66A 2IM0A 2NLWA 2VB6A 3ZZ0A 5HO4A 1NJXA 1UW4A 3SCKE 1VGYA 4DV7J 3R3TA 3AY0A 4C8LA 2NXCA 2YNHA 2XMMA 2LU1A 4LF4F 3E8OA 4DJBA 5ETNA 3KK3B 3GFYA 4DL0C 5J2MA 1ZZNA 3R7SB 3V81A 2JL9A 1YITS 1VBYA 2JEIA 1RADB 1BXNA 1T7PA 3T1AA 5ETMA 1IWAA 4NI2A 4R5PA 1Q1KA 4PWDB 2J7UA 3I0SA 3Q83A 5IV3A 2WZ1A 4RNMA 1L3SA 4Q2LA 3EXCX 2KB2A 3L4BC 3MMBB 4USMA 5KT3A 1YJTA 3H40A 1JJHA 4ER8A 1KS2A 1N36F 2NXNA 1MMDA 1C1BB 1UVKA 2X51A 2XZTB 3DDIA 1TTHB 3PYGA 4M5JA 3W2VB 3KK3A 1L3TA 1IM4A 1OQ3A 4I68A 8AT1B 1S6PB 3KHLA 4QR1A 4YB5A 2ZJRQ 5L1IA 2KT5A 3KLGA 4DR4J 3MPYA 2M7SA 4G1PA 1UEKA 3IA0A 1RWNB 1HNWJ 3LPYA 3G82A 2I0XA 4ID8A 1IKVA 4BLGA 4ZP9A 2M5YA 3CJKB 3GIMA 2W8LA 3T3FA 4YHHF 2B5JB 3DOLB 1UVIA 1S76D 2JEGA 1U09A 1XIQA 1XQIA 2GVZA 4Y2KA 4EGLA 3OW2R 3PRDA 2O1PA 2C3OA 2PA3A 4ZCKA 2AEMA 3UI3A 1KLMA 1QD1A 3GV8B 3KJQB 1S48A 4KQZA 2DO0A 3T6BA 2NSCA 4B3TJ 2HVIA 4DV0F 1S10A 1RCOB 3GPAA 1NK7A 2Q43A 3SFGA 4CNZA 2HFNA 4ANDA 3IN5A 4GKJJ 4RWWA 4UQGA 2AQ4A 1S6PA 2XNQA 4WWSA 5JVGQ 2B8QA 3FSXA 2U2FA 2DHAA 4B9UA 2AJQA 3HVRA 4AYBD 2QV6A 1KKHA 3RBEA 4A46A 4G1QA 1EARA 2DY9A 3C66A 2GMHA 1XJWB 2HHHF 2ROPA 4B3SF 1DTQA 1H98A 1YDLA 2CDQA 4PYAA 2LXIA 1U2RA 1F2HA 3PW7A 3LGHA 4DCPB 1D8ZA 1JKHA 5KAKA 4MK8A 1X9SA 3Q2SC 1X5SA 2LXUA 3BSAA 4R25A 2OFGX 2HFVA 3QIPB 1N5QA 5HVHA 2OUGA 1J5EJ 2YKQA 3K7RA 1AB8A 2ZH6A 2YNHB 1LW0B 1YIJS 2EXUA 2I8EA 1T05B 1UZHA 1V5VA 3I6PA 2KYXA 2HLTA 3M9OB 1H7XA 4FPRA 3H4BA 1WC3A 2MJUA 4MTPA 5LMNF 2H54B 4WBFA 1CJKA 2B7CB 4FPIA 3FCHA 2UZAA 3EGWB 3DLGA 5CYQA 2V9KA 2YTCA 2V6AA 1U8WA 4OMFG 2QT7A 4EBCA 4DMZA 1EB0A 3NAHA 3A3OB 3GJRB 3EXYA 1B99A 1C4AA 1DTQB 2VUGA 3G96A 2B9WA 3HJFA 2EK6A 3V5RA 4DQIA 4PYDA 4DWIA 1RT4B 3N0VA 1WOPA 5IM0A 5CXTA 1NZ8A 4WZMA 5AE2A 1AW0A 1TL5A 5M2UA 3THTA 4OZLA 1MU2B 3CIZA 5CZXA 1OO0B 3G2XA 3MM5B 1M5HA 3RBZA 5AJ3F 2FJEB 4F3QA 3BQ2A 4J9KA 2C2RA 4UOGA 1BUXA 1B0TA 3NGRA 4PPDA 4TU9A 4DR2F 1OMSA 5J1EA 3Q8QB 4U9RA 2HRYA 1M5VC 3G6XA 4DR6J 1FRMA 1XMOF 2Z2YB 1RP5A 2BBEA 1TL7B 2IYIA 2P2CB 3CJTA 3CCRS 4EBDA 1Q8LA 1RTIA 1JXVA 3CD5A 3FK4A 3GJSB 5I3UB 1WEZA 1T9UA 2RKIA 2HGLA 4OYIA 2OPPB 3MR6A 3GMGA 3UVJA 1S97A 2ROEA 3D6FB 4OLPA 5A0YA 1YVFA 2KH9A 4F8RA 4Z37A 3DOMB 5D4PA 3TZWA 1WF0A 2MQ8A 1HR0F 2DNMA 2YNFB 4I69A 2LU2A 1X31C 2AJ1A 3SDEA 1HBUB 3M2UA 1OS5A 2WSCC 3PACA 4F4AA 4ZHRA 4U6PA 3N79A 1QM9A 3POTA 1B64A 1GK8A 4FKXA 2AWZA 3BKTA 4I2QB 1F60B 1IBMJ 3MMAA 1N4LA 4DCOB 4NCBA 3MWBA 1JLGA 2P9EA 4FYWB 4DR4F 3R7NB 2HNDB 2XYPB 4ZPTR 1P9YA 3FNNA 3KXDA 1UWBB 2DGSA 3BN7A 2XMUA 3LW5C 3O3LA 3GU0A 4CP5A 2YKAA 4XPEA 4NI2B 4YHHJ 4LF6J 4K2JA 3CCTA 1CJTB 4B9TA 3D6HB 3NMRA 2FLNA 3POTB 2Z0GA 3PYEA 4PEOA 2K2PA 1G2EA 1YJVA 8RUCA 4YQWA 3CCUS 2G0JA 1SVDA 1R8AA 1SB6A 2EC2A 2QTWA 5HBMA 4DFMA 1K44A 2OAUA 1XMBA 4U7UK 3H8YA 1S59A 2HSEB 3NCQA 1Z2ZA 1CLFA 2IFXA 1Q8BA 2GQQA 1M5KC 1V3RA 2M9KA 1AZSA 4NYZA 4OHXA 4QIWD 4RW9A 5F8HA 2C2DA 2VA3A 2XC9A 2UVUA 3I9V9 3QRPA 4QWAA 2ZUAA 3PIOQ 2J0WA 2BANA 3FDSA 5EX3A 1RYRA 2DB1A 1EIYB 2B5JA 2HHUA 1QTNB 1IKYB 1U47A 2VG7A 4ZVSB 4M5LA 2VL1A 1MLAA 1ZS6A 3RYLA 4M94A 3D1QA 1X5TA 2DY1A 4Q7AA 4ZVUB 3OSNA 1R0AA 4KH0B 4WFAQ 3AH6A 2V2VA 4DSKA 1S0VA 2B7BB 2OD4A 1IJEB 5F9LA 1HL6A 3OFGA 4NMXA 2NYIA 1S6OA 1JMTA 1VJQA 3DU6A 4LSNB 2Y1RI 1GNKA 2MXYA 4LF9F 4NCGA 2J8AA 2CWKA 4USUA 2MQQA 2FHJA 4F67A 1J5EF 3D0HE 1U45A 1UPPA 1VJWA 3OXFA 4C3MA 2QA4G 1GQEA 3J7YU 3I96A 1SKWA 1SJRA 4R5PB 2RJZA 1FE0A 2C3YA 5LMNJ 5RUBA 3FVYA 1WUUA 1TKTA 2CIMA 3KLFB 3N28A 2K1RA 1SJFA 2RUGA 4F4KA 2E7XA 4Y2AA 3BDEA 3NWRA 2YQ1A 5HATA 4CO3A 3GFZA 3OQ2A 1NSAA 3KDNA 5LXRA 3HVTB 4G65A 2E66A 1RA6A 4UUWA 3QZ8A 1RAJA 2F8EX 4TY8A 3CJ0A 2IJNA 2VQEF 4NZ6A 4DUZF 1SJ3P 1IUJA 1HNZF 2KT2A 4RJVA 1ZOTA 4WCEQ 1TV6B 4OX9F 4JI5F 4IH5A 3I31A 4OYWA 1Y9OA 2CKWA 5AJ3J 1A7GE 1PAEX 3D1HA 4F4XA 4AQYF 3IR7B 2CQCA 1S1UB 3PZPA 3LP0A 3RRHA 1SUQA 4ZPCA 2R8HA 4PUOB 2ZC4A 1SV5B 2OPRA 1MWZA 1N5SA 5ITHA 4N8OA 1Y5IB 4G1QB 4ZN1A 2QN6B 1RXOB 2HWHA 1P1LA 3HDSA 1RAIB 5IT9U 3FBEA 1HNVA 3ZZYA 4I64A 5MAOA 1DTTA 1D8YA 1U0HA 2AU0A 4V19X 4F3MA 2Z4PA 4LSZB 3I5AA 2EW9A 2KG1A 2BEFA 1H7WA 2HQCA 2A1BA 4NX9A 5C42B 1FRHA 4LIRA 3CCMS 3HM9A 1HR0J 2FQQB 2CWXA 1CC8A 1ZAWA 2PGCA 5KFPA 4MAKA 1SC6A 3ISNC 2BE9B 2BW7A 3AOCA 3LPEA 5A6WA 2QA1A 5HL7Q 1D9DA 2C2EA 2QEXS 1HD0A 2BVZA 2OP5A 1ZPWX 3D0IE 1XR5A 3W66A 2B6AA 1IBMF 5D77A 2GNKA 3N4WA 1NKEA 2WBMA 1IKVB 2I2YA 1WHVA 3OD2A 2UU9F 4FXWA 5ETLA 4ILMA 4QCLA 4WE1B 2OO4A 4HH1A 3DDNA 1KNZA 1TL1A 2QLJB 4E0DA 2R7TA 1WF2A 2Z8QA 1RAEB 3THVA 2YXLA 4KGMA 1U1KA 3M1VB 5AXLA 3RB0A 4DG1B 2BJ8A 4GRSA 5CAAA 3CJ8A 1LW2A 2R7VA 4ZCLA 3KDOA 3IMQJ 1KFSA 3IGVA 4LSLA 3SSQA 4C7QA 1NK9A 4GO5X 2FD2A 2KJWA 2DNRA 2XMKA 3LH2S 3OTOJ 4K4SA 2FHOB 1HWUA 5C2GA 4Q45A 4L75A 4ALZA 5DQHA 4DI6A 2VU5A 3OJUA 4DR6F 2HAFA 2DH7A 1O0PA 3OJSA 2VD3A 1KONA 2J0XA 1RBAA 3KLHB 4HT5A 4IG3B 2GJFA 2VFVA 3S7RA 3PO4A 1JLQB 2Z2ZA 1VRUB 5E33A 3C6TA 3O6QA 3JTOA 3TEHB 1VQOS 3VALA 2EWHA 2BRKA 3KLEA 3QT6A 4OHYA 1VIXA 3IRWP 5KFJA 4JI7J 2AF6A 3SQGA 4PCQA 1D9AA 3I9ZA 3P5TL 4FVCA 4OYXA 3PIPQ 4CLUA 2XLIA 1BQNB 4ZPVR 4DFKA 1JLCB 2CQ1A 2IRUA 2LA4A 2YNGA 3QGHA 3R5GA 2FHMA 4HACA 3H7HB 4OV6A 4K5RA 2EKYA 4FBUA 2ILYA 1J5OB 4OYAA 5CYMA 3DOLA 4DSEA 2FHJD 2BABA 3E51A 2MHNA 3IWLA 4NZ0A 1ITPA 2V8VA 3LANA 4Y2CA 2IBOA 2RU9A 3DKDA 3WX8A 2M8HA 5F3TA 3W63A 1U2FA 4J9VA 1QUVA 2DCUB 4JI6F 2VF3A 2V5HG 4DL6A 2MKJA 2IPOB 1F5AA 2QLXA 2RF2A 4GVBA 4OI1A 2Y1IA 2VQEJ 4DCJB 2XM3A 4DUZJ 1HNZJ 4USKA 3MDFA 5HP1A 3RW6A 5DG9A 5L1KA 1NK6A 2B56A 3TQ1A 5D4NA 2W7OA 2MZTA 1YLXA 3JSMB 4OX9J 1GTEA 1EP4A 1WI6A 2CXEA 1CJUB 2YWKA 3OFEA 4I2QA 3TI0A 3GIKA 3CGIA 5KG5A 1IQZA 5ETVA 3F73A 2BX6A 2OFHX 1Q16B 3M30A 3V6DB 1S0OA 1S7HA 1OQ6A 5IWAF 4IO9Q 2QRRA 3C15A 3C16B 5C24B 5DM7Q 3AQOA 5C42A 1FFGB 1U48A 1JQGA 2E9RX 1Y11A 3HHDA 3JAMU 1TK5A 3HX9A 3KK1B 3M4XA 2QGFB 3NNAA 1D0EA 3LO3A 1HBNA 3SSRA 3J81j 2W2OP 2GJ2A 1QAIA 4NLDA 1KHVA 1HBMA 4ZOSA 1X4HA 2CJAA 2FC8A 3DLEA 4ID5A 4EYHB 2HAIA 3OL8A 4PQUB 2HBYB 1WTFA 4LVNP 3F0NA 5D15A 3UDCA 1U4BA 5L39A 1XK8A 3LP0B 3UCGA 3OVAA 3FCWA 1YBUA 1L3UA 5A2QY 3FFIB 2DISA 1SC4B 3QMQA 4ZVGA 4ILRA 1IR2A 3BPSP 3MEKA 2HHTA 1U6FA 1BE4A 2VJVA 2DNPA 5IM0B 1LWFB 4DV1J 1AFJA 2QLFB 2MPUA 2C2OB 4I7FB 5HLFA 3UWTA 3IR6B 2MZ1A 4F4YA 3MEEA 4FF1A 3KLHA 2QL9B 1WG5A 1S6QB 3GG0A 1K0VA 1TKXB 3CCZA 3QWUA 2AIRB 2X1GA 1NH7A 1OY6A 1U2CA 2H65B 2JRSA 3DLJA 1WC1A 3T9NA 4ZJQA 1N52B 1Y5NB 2MSSA 3P8BB 4BDPA 1HHQA 4IH6A 2NREA 2HHSA 1IJFB 3NS7B 1RSCA 4NLSA 2W8KA 4KPYA 3HO1A 1UETA 2ZKTA 2RH3A 3TJ8A 2NSBA 3DLLQ 1IVZA 3WX4A 1U7LA 1YHQS 3SMZA 4USIA 2HYIB 2AZ3A 3CIMA 3ITHA 1LFWA 2FLOA 2CPEA 1V3SA 1TKXA 2WCXA 4JI8F 3UO0A 2OI2A 2CYYA 5J2QB 4J37A 4YR2A 1LEOA 1BD6A 3WHIA 3C14B 3TAMB 5A8WB 1DLOB 4HHUA 3C46A 2GAGC 3R9LA 2XS2A 2HGNA 3HZEA 2WONB 4OQJA 1WC5A 3CJQA 1FDBA 2N4CA 3U7JA 3GIJA 4DUYF 4DV6F 4W90B 1ICEB 4I6WA 1JNRB 5B0DA 3VCDA 5JVHQ 4JI7F 3T5KA 3ILJA 1HBMB 1HKAA 2XY6A 2GQ2A 3G8SA 1N56A 1HMVB 1GTHA 5KG6A 2FVSA 3MOZA 3BS9A 1SC1B 3MM7A 3HJVA 4D3GA 4KGVB 4NL5A 3AFGA 3OL6A 1N6QB 3CJ5A 3IR5B 3GSIA 3FFIA 1TR0A 4HL9A 4PABA 4B3MJ 3NLCA 4I1TA 3BGUA 4C3LA 2PIIA 3IM9A 2HURA 3JSRA 4IDKA 3HULA 3IWNC 4KPCA 1RB0A 3HSZA 4C8KA 2PC6A 4QIFA 1NDLA 4MK9A 1VQ4S 1P9QC 3NEKA 3EYZA 4K8RA 4AUKA 4L3KA 2OEKA 3C16A 3AB2B 5GADI 5LMUF 5EX0A 2G2OA 1I3OB 2B9EA 5IOLA 2PEHA 1YBAA 5BXIA 4JI6J 4KFBA 4WIIA 4F25A 3SXLA 5E7OB 3K5NA 4J9LA 2JVRA 3AA9A 3HT0A 4PQAA 3QJLA 2UV8G 2AZ1A 3DHXA 5AXMA 1ULRA 3K59A 2CJYB 1G7CB 5KFCA 3D54A 4NEYA 3SFUA 4P2FA 1C1BA 4HI2A 5DDRC 2GMJA 3O1LA 4C48A 5C5JA 2CQ4A 2JSXA 2O01C 3TP2A 3TQEA 5HJXA 4X65F 1Z1ZA 5B0EA 5ETQA 3QT8A 3KG1A 3TR5A 5F3ZA 1QAJA 3FMBA 5HQLA 2KVQE 4IYQA 2R8GA 2KFZA 1T8EA 1BGXT 1QJHA 2GMLA 4RUCA 3DOMA 1UVLA 2XB2D 3TZZA 2GX8A 5KFDA 3TUIC 1F3FA 4AFFA 4KR0B 5B08A 4DV4F 5J2PA 2V9WA 2HHWA 3CJRA 4I2PB 3PY8A 4NLUA 1FFSB 4P6QA 1UJ4A 2L48A 4LF5J 2BKOA 4LFCF 5CD4H 3BYPA 3Q86A 4U67Q 4RW4B 1XC9A 2F1FA 2HS4A 3BBBA 3CWJA 5FJ4A 4ZP8A 1ZBTA 1Q0NA 4UT4A 1Y4ZB 4XDDA 2X1FA 2XSJB 2DVIA 1HYSA 2NPIA 1BQNA 1H3DA 2P9CA 3QIDA 2ZOGA 3R5CA 2DPIA 1LKZA 1RT3B 2DHGA 3ZFVA 3TEGA 3CDWA 1N34J 3DXSX 4IG3A 5F8GA 3P49B 3MEGA 3R27A 3LAKA 3JTNA 3IS9A 2IDEA 2MKHA 4DV1F 2IMOA 1NNDA 1JLEB 2Q6CA 2JFDA 2BOAA 1T9YA 3FBCA 3R1HA 5E41A 4UOHA 1IWGA 1HA1A 2VG5A 3LGNA 2V67A 2EFOA 3Q8UA 5D4LA 2Y8YA 1RTJB 2VPYB 2HZAA 4I2PA 1KN6A 2VBZA 1LW2B 3OHBA 1RISA 1PIEA 2XQCA 1VYAA 4ZN3A 1N36J 3OR2A 2AYGA 1HW8A 1TP7A 2XO7A 1HIYA 3C6TB 1KDNA 1NPKA 3WIUA 1FK9B 1MROB 5K8OA 2WK4A 1HWLA 3IRXA 3M2RB 2GFFA 2W9BB 1XNRJ 2BJ3A 1HNIB 2FDNA 3OLBA 3HLUA 4RWXA 5DM6Q 2GO9A 1X5OA 2CPIA 2J0QD 3PYDA 2FJVA 1RLDA 3RB3A 1UEVA 2B6AB 1RA7A 1LWCA 2XMWA 4F0HA 4YDXA 3NNCA 3M2VB 4L73A 4KV8B 3W64A 3KTQA 2QE5A 2F8MA 2XHWA 4N7TA 1TUWA 4LF8J 2EKNA 2YX1A 1BLUA 5DQIA 4M5MA 4RUBA 4JV0A 5EGYA 2R9LA 2P6SA 1RAFB 3HD1A 3MPVA 4FN5A 5LOQA 1IBKF 4B3TF 5CH7B 3DMJB 4BBYA 2MKIA 2ZVIA 1S9EB 3ZZUA 4K4XA 4DV0J 1RTDB 4A4JA 4ZHRB 2GGPB 5KFFA 4DFPA 3J7A1 1TU0B 3TZYA 1WSRA 4ZS6A 2JHEA 1JJCB 1DURA 2F40A 3B8HA 4B9NA 2BE7D 1P6TA 1RK8A 4LRFA 1KP6A 2ZVSA 2PDAA 3T5JA 2PI4A 2HS0A 2VBXA 2UXBF 3R97A 3BSNA 2M88A 2HK2A 2FJWA 4QWDA 1RWVB 3C6UA 4ZJOA 3B54A 1PKUA 3FEXB 2LYVA 4IH7A 4WIQA 4HKQA 3KNAA 2G13A 1FERA 3PJ9A 4I4BA 1TL7A 4P10A 4NA1A 1S5ZA 2L41A 4JV2A 1S9FA 4ZIVA 4CLPA 1B7FA 2Y0BB 2O67A 3OTDA 3CT9A 1QY7A 2CADA 5D8HB 2WVDA 4CWBA 3KWMA 2J6UA 3DFEA 5EDWA 4JP8A 1U6BA 3M6XA 4P71A 2YWHA 4WPAA 1BWEA 2MLYA 2XYGB 4LRAA 3UDLA 2X1AA 1Q81T 2ALYB 2CQBA 4FP9A 2VA2A 2KT3A 3W2VA 3OFHA 2FGCA 4IFVA 2J9DA 5DO2A 2AGQA 1U1RA 1ZAVA 1IQTA 3S01A 1VCTA 2RRAA 1NK4A 4J9MA 1DLOA 1WDDA 2E5IA 4F2SA 4DS4A 4DQQA 4OYOA 3FUYA 2FJBB 3GONA 3H90A 4Y00A 1LWCB 2I5JB 4OJGA 2BJ1A 3VHQA 2RVJA 1BQXA 1Q86T 4RR5A 2IA6A 2CDRB 3HSDA 1QE1B 3A1YG 4RW8B 2VV5A 4CH7A 4DV4J 4K5SA 1X5PA 3MOJB 2K7JA 2Q1LA 2DHSA 1HQEA 1OSCA 3M2RA 4JBCA 4KO0A 4M5DA 3MCSA 2LDIA 4ICLA 5L1LA 3MMCA 4EYIB 5B0BA 3EPGA 1LK7A 3NWGA 3DRYA 4MYUA 5IQQA 1YJ9S 4B9SA 4O44A 4NA2A 4CLTA 1RAGB 5K8PA 3MI7X 5DJBA 3EX7B 1VQYA 5LL6d 2HZVA 4O3OA 3QQCD 4DR1F 1XMOJ 1ZYQA 1L3VA 2DH8A 1R8CA 3AXMA 2MYFA 2RDIA 3T41A 1KQKA 1N34F 3OPKA 4A8XA 4EZ6A 3I0RA 2LLZA 2H51B 5HMYA 4HEA9 4QBUA 5F8MA 2OHDA 2KZZA 4HLBA 1RAHB 3RAXA 1ZM2A 1T3OA 1SL1A 1XR6A 1AUSL 3N5BA 5D6GA 2BOPA 1NZAA 1LWEA 2MZSA 3NG8A 3THPA 2N7YA 3M8RA 2D3UA 2RS8A 1YKWA 3K8VA 4K59A 5E3CA 4PKDB 3WC2A 1R8PA 2HBQB 2VFTA 5ADZA 1HPZB 1X4CA 3MGJA 2CPFA 2CJQA 4FZVA 3MM6B 4Y6IA 2MQPA 2B3TB 2VG7B 4DBQA 4W98A 1UTAA 4PZVA 5C24A 3AQPA 3DNCA 3M7VA 3A3PB 3HMJG 2VODA 4USVA 4X64J 3CEDA 1Y0HA 1RT2B 1TL4A 5GMDA 2DNKA 2MKKA 2J0SD 4RW9B 4OL8A 3RRKA 3NGKA 4NLXA 2U1AA 2OELA 4ECQA 4FS2A 2YWWA 3DGPB 2PN6A 3IAM9 2QL7B 2F9DA 3DRXA 4F50A 2Y1JA 4LF6F 2QYGA 1FD8A 4DQPA 4FDFA 4LF8F 4IO1A 3SDEB 2VZ9A 2AKWB 3SSSA 1WKLA 2DNGA 4O0IA 2FYXA 2IVFB 4OLOA 3EDRB 4ETZA 3M6VA 1T11A 3GCWP 2DNLA 4K7QA 8ATCB 4WTOB 3RUBL 4ECVA 2M8DB 3MR7A 2DGOA 2Z2LA 3QJJA 2R7WA 4JI4J 3D2WA 3U02A 3CO9A 3PKYA 2I5JA 3H25A 5ETKA 3HCXA 2ADBA 5KG2A 5I3UA 3VGUA 4M63A 1HBOB 1HQ2A 1IXKA 2DR8A 1F9FA 4B9MA 5EN1A 3CJ4A 1JXLA 1NCLA 4DU8A 5ETRA 2QSWA 3UVJB 4EO6A 5GADU 4DN0A 2GW8A 3OHAA 2VPXB 1B0PA 3I5BA 2RRNA 1HPZA 2WVEA 4HT7A 1H74A 2VKRA 2EFVA 5CD4A 2A2CA 4UF4A 3GQCA 4EEYA 2ZEJA 2QFJA 3UN5A 1NHKL 2PI5A 2DK2A 1IKWA 4USHA 5E2QA 4DSJA 2DXFA 1HQUB 2FC9A 3BH7B 2W9CA 1PJ6A 4CYUA 3B78A 2AGOA 4DV2F 4QQBA 4LR7A 1M1GA 4P2XA 2ZC3A 2F63A 5LT5A 1XN9A 1HI1A 3DOKB 1VI7A 4A8KA 2MKYA 3H4DA 3UN2A 1H2UX 2ZWPA 1UPMB 3MHYA 3RW7A 1H0HB 2K8GA 4NRUA 1Q95G 2MTLA 2NUHA 4ICLB 3GILA 1T02A 4RLEA 3DXBA 5KFKA 3NRBA 3MM9B 2MQLA 2XCAA 4JI3F 1WD6A 2KU7A 2RILA 3VZHA 1YQHA 2CFXA 2JC1A 1RTDA 3KHRA 2M3DA 1FESA 2LEAA 4JI5J 3AD8C 3TJ9A 4UZBA 2CQPA 3TAPA 4DEZA 2VC0A 2WB4A 2VKZG 3VAKA 1RT5A 1T3NA 3R2DJ 3LOUA 3E01A 4Q44A 1E6VB 1GMUA 5KG7A 4FS1A 4MT1A 2CG4A 2H4YB 2VC1A 3PHEA 1JKHB 3DN9A 1BWVA 2HQ3A 4RW6A 2DO4A 2PE8A 2PA8D 1Q5YA 2GZOA 2Q6BA 4KC5A 5K14A 3G86A 4DR1J 3J7AN 2V34A 4LJMA 1UFWA 5T7LA 2A6MA 2HZCA 2QLBB 5DQGA 5DRKA 3M32A 4YP3A 1UKUA 3R2CJ 5K20B 4HHJA 1MROA 4Q8EA 1S57A 3RAMA 2KO1A 4FF3A 2DGUA 3BZQA 2IM3A 4G6VB 3D9BA 4CIOA 1NJIT 4NLGA 5AE3A 2E9TA 3IO1A 2IA0A 4WFXA 3LA0A 2RUSA 3P4UB 1NSQA 3JQJA 2G2ZA 1YG0A 1NEEA 4X4OA 1VBZA 4WYLA 3Q8SB 3GR1A 3K0JA 1WKJA 2ZH2A 4DF4A 3VAMA 2CQGA 5HMXA 3OV7A 1N5YB 1J5OA 2HWTA 4M5IA 3KK2B 4X64F 2LFVA 3GJQB 1S1VB 4MFBA 1S1UA 1Y3KA 1HNVB 3I0RB 3NS6A 2UU9J 2HLUA 1JLCA 5IXUA 4PG6A 3CCWA 1YRTA 4USWA 5MLCV 1VISA 1EETB 4PXBA 4FF4A 2HQIA 4ZCMA 3EICA 4O4GB 3DYAA 2ZJPQ 2E1RA 2WBRA 4CTAB 1BHNA 4N41A 3UR0A 5KFHA 1AFIA 3M8QA 1LXNA 2CZVC 3MMCB 1U1QA 4HH0A 3HSJA 1KQGB 2VBWA 2EPIA 2C2ZB 1YX2A 3QT7A 4WFBQ 2RHSB 2HQDA 1I51B 1S1XA 3PDNA 1TL3B 1UL3A 2CNNB 3FBBA 5AT1B 5T41A 4CO0A 5GAGI 5DG7A 1VLYA 2QA4S 3KLFA 3KLVA 3H59A 1Y5LB 4TY8B 5BYRA 4L76A 4XK8C 3CUNA 2CUYA 2RS2A 1ZH5A 4OI2A 3M8YA 2EFNA 4AL6A 5D0RA 3CMQA 2LECA 4DL5A 1AT1B 3OT9A 2XS7A 1MMNA 2AMCB 5BYSA 1WORA 3DI6A 1YI2S 2VICA 3EWGA 5B0FA 4O4GA 1ACMB 1O8BA 1N5YA 4OYPA 3M9NB 1RGVA 2HVDA 1NSPA 4N56A 2QIFA 5CZVA 1RZMA 3TA2A 3D66A 3HHLB 3RZAA 4N5SA 3TAQA 1FWPA 3PM9A 3N6NA 2ZH5A 4X4NA 4IOCQ 3EZOA 2B43A 2HRTA 1LXJA 1L5UA 2GHPA 3SCIE 5KFRA 4ZVTB 3M8PA 3V4IA 3I5CA 4DV2J 4WF9Q 2GVDA 4BC7A 3UNYA 4CLZA 1ELOA 5KT4A 4EBEA 3AJDA 4DV5F 1K1SA 4DSLA 3GJTB 3CCES 3O2IA 4OI3A 4I6AA 1FEEA 3K57A 5L1JA 2DEIA 1GXLA 2FVQA 3HI9A 2HNYA 2LP4A 1RT7A 1AZSB 4CQ1A 3HHLD 4QOTA 1E6YB 4ELVA 4JI3J 2B9YA 2O66A 1NSKL 3EGVA 3W2WB 5KFQA 2CPDA 1RHKB 4KE5A 2KRRA 4DL3A 1SJ1A 5IS2A 1RQ0A 2UXDF 2OPRB 2QMWA 4MH8A 2JLFA 3BGRB 5IV4A 1QVGR 1JJ4A 2ZITA 3RGIA 3M32B 3AHPA 4F2RA 3ZNJ1 3H2LA 3BV8A 2DKOB 4I6YA 5H9EJ 2CNKB 5IWAJ 1DZ5A 3KUHA 5IZHA 3DLHA 2LDYA 1C4CA 1ZTWA 2YX4A 2AT1B 3MR3A 1K9MT 4F02A 1WF1A 3BGOP 3DRRB 3DMJA 2UVVA 3SV3A 1LK5A 1WHYA 2JOQA 4Y65A 3ZZTA 1HNIA 2HFZA 2RB7A 3OTCA 3QBCA 4M8LA 1M1HA 1N33F 3OVSA 4FYDA 1ZM4A 1KBRA 2R7UA 4U7UD 4URQU 3HVWA 2WTFA 1FCAA 3DM2B 4Y28C 5HN0A 5H1SV 2EFGA 3G8TA 2HG4A 1F5BA 3TARA 4C8OA 2YNIB 2R7XA 2ZH9A 2AYMA 1KEKA 2OEMA 2R8KA 3M05A 1H2VZ 3MM9A 4UOCA 3UQSA 1GXUA 2W9BA 1GMVA 4KGZB 3TX0A 3IM8A 3JXOA 3H5XA 3MD1A 2L9NA 2OPQA 2N3LA 4B3OB 1U0SA 1GH8A 3M6UA 4KBIA 1U02A 2BYCA 4AL7A 1YJUA 3CSKA 1VBKA 3H42A 1U6ZA 4LSNA 4Z2XA 1CQMA 2F4FA 4IQMA 1NB2A 3I56S 1WC0A 1R31A 2CNOB 1PYTA 2GVDB 2Z57B 4B02A 2N4DA 4QW9A 2VJUA 4NLQA 3OVBA 4C4WA 5ETOA 3PX0A 2XEXA 3GB0A 4CYUB 1PO6A 3H5YA 3U1NA 4PQUA 3WBZA 2IM2A 2NPFA 4C11B 1JXEA 4HR2A 2L9WA 5HANA 1AYEA 4CO1A 3MEGB 4NXNF 4RZRA 2HNYB 2R4FA 3TX8A 5A8WA 3KFWX 4PG5A 4ES2A 1FHTA 2KKHA 3MEDB 4RU2A 2K7KA 3IWXA 4A8FA 2KI2A 1S72S 1WC6A 3DLGB 5CYQB 5J2PB 1VK8A 3FC9A 3TVYA 1FXDA 4AXIA 1RWOB 4K4VA 2JFKA 3GSDA 3OL7A 4MIAA 2DGVA 4K4TA 5I42A 4JI8J 1EQ0A 9RUBA 3N6MA 4RW4A 2Z2MA 4FVMA 2OPSB 3W8PA 4OZ1A 2JEFA 1F0XA 3CDUA 2HS3A 2E5JA 1SKUB 4MK7A 3VVUA 1RBOB 4OHVA 1ZETA 5KFZA 3JTPA 4ES3A 3IG1A 4DV6J 3NS5A 1C0UB 4NEZA 4WJBA 2KFNA 1KVIA 1RT6A 1VQSA 2CPYA 2ZD1B 1D3WA 5F9NA 1NHVA 1GFWB 1TMMA 3BBCA 3KLIA 3GIRA 4NYPA 3BJYA 3BF4A 1PYSB 3J81U 4GKKF 2D3O1 3L9ZA 3EM1A 4TYBA 2VHGA 3K5OA 4G3IA 4ZIWA 3LQVA 2MHEA 1PJ5A 2FJAB 2J9CA 3HF5A 4LF1A 3TWZA 3A13A 3KHGA 2MKSA 3LGMA 4B3MF 4RKUC 2BMBA 1Q53A 4RNHA 2DRAA 3TUZC 1HFEL 3CD7A 4B17A 4Z7YA 2UV8A 1NRKA 3KNGA 3VTIA 4NLWA 4ED5A 3MCNA 4KAIA 5LXYA 1B70B 6FD1A 2ZZMA 1MMLA 4PG7A 1LFPA 4IRDA 3KK2A 4KGXB 4FKYA 2KZMA 2EG1A 4P7TA 1T03B 4DR7F 2LEPA 5LMUJ 4QPXA 3FBFA 2JC0A 4NZ7A 1A9NB 1VQ7S 4LR9A 2F7VA 3B6BA 3M8QB 2ZBIA 5HQMA 2YWFA 4B9VA 2KJVA 2PMWA 2DNZA 4YB7A 4CT9A 3QZ7A 2MQNA 3A8JA 1B7YB 3W1YC 3DYAB 6AT1B 1P27B 1HD1A 1RHUB 1PC5A 2A2DA 4ZPAA 3PV8A 2R7QA 4J90A 1NK5A 1VQKS 2E1AA 1KVJA 1SL2A 1YRUA 4EMDA 3CJSA 2OTLS 1FJ7A 1WHWA 4C8MA 1S1VA 2DNOA 3H5UA 4MFBB 3BQ1A 2XNRA 2CNLB 3AAWB 2E5GA 3ZTPA 1N48A 1UVJA 2D69A 2RQ4A 2ZKUA 1YSJA 2YH0A 3NAIA 2KYZA 1NM2A 2WAQD 3O44A 2R7OA 4ZVEA 2KDOA 4UOFA 4LFCJ 2A6OA 5FLXY 1NK8A 4NLVA 3UCUP 3SCLE 4ZKAA 3P5BP 4H4MA 3B4MA 4BWJA 4ZLPA 1C0UA 2JVOA 4DG1A 4KGKA 2CZ9A 4GMKA 3MECA 1VQLS 2GCFA 2HHVA 4BS2A 1EQMA 4EI2A 2ZHOA 3N5FA 2XYHB 5A2QU 4QPTA 2CA9A 1RYSA 4LUBA 4L74A 2CJKA 5DZ7A 3NBPA 5HLFB 4ZVRB 4CLLA 3H20A 4QIEA 2D41A 2M70A 4H4OB 4LREA 4ANEA 2XBPA 1I94J 4LFBF 3D6MB 1RBLA 2HPUA 1N32J 3CW2C 4LFAJ 3BH6B 4MIBA 2B4OA 4F0KA 1RWPB 2C3MA 2HVZA 2VFSA 3F41A 3HHLC 3G8QA 2R3VA 5DGBA 1U1MA 3OL9A 5J2NB 4AXJA 2G2YA 3HHKA 1TVRB 1IKWB 3CCSS 5J1EB 2EEYA 4DPWA 2MQMA 2BA9A 3D6TB 4N47A 5D0HA 4NXNJ 3M8SA 4RO0A 4DUTA 1D9FA 4H4KA 4U8YA 5A8KA 1U0HB 1U1OA 3TYTA 5KFAA 2AJ4A 2OPQB 1EHWA 2RE1A 2ZBRA 5HJYA 2COLA 2YKMB 5HROB 2XG8A 3R5JB 1NDPA 4DPXA 4Y0FA 4DR5F 3SZ2A 5IC4B 1XNRF 4YOEA 4JI2F 4LRDA 4DSFA 1U8SA 1LOUA 2FVRA 1S9EA 3DLEB 1HWKA 3NNHA 4MJKA 4IR1A 5CA5A 4RNFA 1Y00A 2PSZA 1FXLA 3G87A 2AJ2A 1RTHB 3V6DA 3PVXA 1VQPS 3Q24A 1S0MA 4OIXA 2G9OA 5KT2A 1IBKJ 1EP4B 1RACB 3LALA 4YY3F 1MSWD 3A8IA 3A3NB 3D5MA 4OZNA 1I1GA 3AT1B 3HKWA 1TL1B 2L08A 3SQOP 4ENOA 2P5VA 1QDUB 3DHWC 5E3RA 4A8YA 4GKKJ 4QYZK 3IBCB 3ISND 2QSFA 2ASDA 2QYCA 5K8NA 1NJWA 2KHDA 1SKSA 2UXBJ 4NLOA 3ULHA 2GO8A 2DGTA 2XI2A 1SH0A 2F9JA 1TKDA 3RR8A 1RWMB 1TKZA 3UD4P 1BMQB 4ZA1A 3CMES 4DFJA 2IY5B 3W2WA 4NRTA 1MNEA 3UE2A 3W7BA 5EWGA 1PC4A 3J7ZT 2ZHBA 3T1HJ 1VDHA 4TU8A 1FWKA 1T9TA 4ATNA 3KG4A 3MURP 5JXSA 3G6YA 4ED7A 2ATLA 4P75A 2YQ3A 5IT4A 4CM2A 1FRIA 1VHIA 2LQ8A 2I1RA 1JLEA 4DR7J 1NKCA 2BM0A 2IJRA 2KHCA 2EK1A 4OFZA 3IS9B 3N9UC 3UDVA 3CC2S 2XLJA 2RRBA 2HIYA 4C98A 4S0MA 1VOMA 3QLHB 3NXZA 2HFUA 3RR7A 3SQGB 3OR2B 4C8NA 2W2PP 2D9OA 2C3UA 1KTVA 1SV5A 2CJBA 2DYAA 2ZBQA 4YN3B 3PW0A 5L38A 1S79A 3PX6A 2HIQA 4EO8A 1FTRA 3CTRA 4WZQA 2YKNA 3M8PB 1FFWB 2RQKA 2BQRA 5LSOA 1T0TV 2N82B 2ZFHA 4PWUA 2Q3PA 9ATCB 7AT1B 5BR8F 2GHVC 2I9SA 4CLFA 3JAMY 3J80Y 2AD9A 2MEWA 1T9VA 1LQ9A 3UCZP 2P8IA 2B4UA 2BACA 4RPFA 3P45B 5J1PA 3NGDA 3KLGB 1CPZA 3V6HA 4J9RA 3V4IB 1YTYA 2XLKA 4L3NA 1WACA 2LA6A 3TUJC 3BR9A 5K5MA 5DG8A 3KJFB 2HEKA 2YWGA 1KWMA 3CVKA 2V68A 3TVKA 4ZVHA 1G3OA 1ZA2B 3O8WA 2XMAA 2IDLA 1HBOA 4HVZA 2E7WA 2HGMA 2JNJA 3EVOA 1NJYA 1S1XB 1KLNA 2BRLA 3NCRA 4W92B 3TNVA 4LT6A 5JJBA 4K4UA 2DR6A 1SH3A 4F3OA 4CM0A 4IFVB 3EUNA 5KFXA 2HFOA 4Q2MA 3VAGA 4ED6A 1I94F 3RBXA 1NPPA 1N32F 1O6XA 2VDHA 1R27B 4DPYA 4LFAF 4KO0B 4M5DB 2ZH8A 1HI0P 5DGAA 1S12A 3IC1A 4TY9A 4YMEA 5I42B 4MKBA 4WE1A 2C22A 1H72C 1S7IA 2JDJA 2X3GA 3GG1A 4RW8A 2KG0A 4RW7A 4CLKA 3KHHA 4IOBA 3NY0A 4M1KA 2BANB 2NXUA 2CRLA 2P9GA 2WVCA 2V4QA 2CQ3A 2QO3A 3FJ2A 3HHNB 1W25A 4F36A 1X0PA 4KFBB 4RUHA 2UUCJ 1UJ6A 2YPYA 3DLKA 2WW8A 3H2VE 3PYFA 4LIWA 3UD5A 2NXJA 3W65A 3MAQA 1I6JA 2DHXA 3JQMA 4UUXA 3DRSB 4DXLA 1Z4UA 1OJ4A 4XDCA 4O3QA 4TQSA 2O3DA 3CC7S 3W62A 1U25A 2BUNA 4QWBA 2R2RA 1GX6A 3HZGA 4BC9A 3BB5A 4XPCA 4DSIA 1JLAA 2W24A 4BCAA 5M2PA 1MU2A 1N6QA 4YY3J 2LQ9A 4TN2A 4Z7CA 2RT3A 4J9PA 1U1PA 4DN9A 2N7CA 3L7OA 5AXNA 1FI4A 2VG6B 3E01B 3HK2A 4DF8A 4JI4F 4WP8A 3T9ZA 3EJMA 1JLGB 4UY8T 1VMBA 1WDTA 3VGVA 3GFHA 4OI6A 2ASLA 2FJDB 3DM2A 2CZ4A 1NAQA 3DGVA 3KJVA 2VBYA 3UNGC 4MKVA 4ZDNA 4IG0B 3ZZZA 4A8QA 2ZH4A 1YRXA 3ONQA 1UFLA 4WP3A 4U7CA 2AYBA 5CABA 3DRRA 4DX8H 2L9DA 1J27A 1C0TB 4AD6A 2DRDA 3D7SB 4RW6B 3ZTSA 4CRJA 2PO4A 2AHOB 1RCXB 5HI7A 1MN7A 3R5BA 3PRVA 5LJ3Y 4F4ZA 3FSIA 3F56A 2FVCA 4HTJA 2Y9HA 1RWWB 3HFZB 4DOZA 2VIHA 1WOSA 3HVAA 2IRXA 5F8NA 2IC3B 2HMIA 4M5KA 3J81Y 5LSRA 1XMQF 4TYAA 2BV3A 4X66F 4NLYA 1YK9A 3Q8PB 2RDJA 2F65A 4FNIA 3Q23A 2J9EA 4PAAA 4A8MP 3FSYA 3MM5A 6FDRA 3D3CJ 2EI5A 3LP1A 3N6LA 4EFAC 3RTVA 2WOMB 4OZ3A 2OSQA 5KT6A 5BR8J 5C2CA 1SI9A 1R6VA 2Z56B 2ZH7A 5IT9Y 2RMLA 1Q79A 1RT4A 2G0IA 1F5CA 2IM1A 4J91A 1NKBA 1JJ2R 3DRSA 3PFEA 1IKYA 2ACYA 2ZOFA 3DC2A 3MD3A 4IFYA 4BHQA 4D3HA 4OJHA 3TANA 3MFHA 2NR0A 1EAYC 4ZLLA 2NXEA 3A4TA 5B09A 1JLFA 1YZ7A 2M2BA 3MF5A 4OYBA 1FO1A 4NLRA 1VBXA 3NMAA 2C3PA 5LM7E 3G71S 3QGGA 3ENWA 2MKCA 1DBDA 1QUPA 5GAHI 3CJKA 2DRBA 4Y2IA 1GT8A 2XI3A 4WU3A 2GC8A 1A0OB 4UTGA 4BWMA 3PW4A 2J7WA 1VFJA 4CCHA 2FGOA 4IR9A 2C2KB 3QIPA 3ET6A 2VQFJ 2V2QA 1D09B 4K4WA 2JEJA 2H3EB 4LQ9A 2AJ0A 2BJ9A 1S4FA 4P73A 3BYRA 2YWEA 4FBTA 3ZZPA 2J6SA 4WFZA 3FZ2A 3W5XA 4QZVB 2RF2B 1VQMS 1YBTA 2HNDA 1RT2A 4L72B 5HVFA 1JLBB 1UP1A 2E1MC 4PXEA 3W60A 4X2BA 1T95A 1T9WA 1MN9A 1CULB 3MMAB 4M5NA 4WXOA 5CYMB 3FRYA 2BM1A 3CDEA 3A8EA 3GTYX 3TRGA 4UQTA 3CD0A 2ZM6F 1S1TA 3X3UA 1X60A 2EG2A 2M52A 2QMUB 2HWIA 2OMLA 1BQMB 2V50A 2WB1D 5HAOA 4M5GA 2UUCF 5H9FJ 4O3NA 4NWBA 1M1KT 2CQ0A 3W9HA 1WNEA 4CO4A 2F4VF 1FWLA 1VRTB 4LRBA 4F26A 4OJ1A 2Y0SD 2VONA 1VC5A 4O3SA 3EE3A 3CJ3A 1JLFB 1SC3B 2DTJA 2HKEA 2IAJA 3LP1B 3RG6A 2PT0A 1O5JA 5FIIA 2ABYA 2I6WA 5DETA 3HP6A 2YKOA 3PX4A 3SI8A 3R5DA 1N8RT 2H5IB 5IT0A 4KSEB 2V8PA 1P8GA 1R6YA 3G6ES 3CC4S 4JYAJ 4WXWA 3ZTRA 1JNZB 3FMWA 3MM6A 4A8WA 4DQSA 1DFDA 1AXQA 2ZNZA 1REVB 2DT9A 2YNGB 3AOAA 5SUHA 1HWJA 3EZ5A 3CF5Q 1UWAA 4NE9C 3QSYB 2DH9A 3I32A 2DGQA 5CHCB 1WEYA 3ETMA 3Q22A 1QSSA 3RJMB 1SBRA 1UW9A 4UZCA 2GV1A 2ZH1A 4R0EA 1XR7A 3A8KA 4URGA 2XZWA 4B3OA 5T14A 4O23A 3I0SB 1QAYA 4E8UA 4ILLA 2WVBA 2MY7A 5KFUA 2BW2A 2MJNA 4ETXA 3SV4A 1M5SA 1VLOA 3AXKA 2AX1A 2C2NA 2J7KA 3SEOA 4OX7A 5F0UA 5KFTA 2MZJA 2HQFA 4H4OA 4NMLA 2CQ2A 4ANCA 3W3SA 2AP6A 2HVHA 1CJVB 3JS9A 1JK9B 2AJFE 4OYZA 1KSPA 4YR3A 2A18A 2VDIA 2DJWA 4Q0BA 3D0GE 5I4MA 1LW0A 1RE1B 3CO0P 3ENQA 5DDQC 1URRA 1QE1A 4DV5J 1XMQJ 4IG0A 4X66J 1TQLA 2XGQA 2W7AA 2DPJA 2V2KA 3OTEA 4K2XA 5FLXU 3PO5A 2E9ZA 3NP5A 4OI4A 1KC8T 2ROGA 2R8JA 1RDRA 2V8GA 2ZNYA 2AGPA 3K5LA 4LF7J 1N5VA 3TO8A 1REVA 2EFPA 2VFUA 1IBLF 4QWEA 2HNZB 2MLXA 1C1CA 3ZTQA 3K8WA 3CPWR 3V6JA 2Z58B 1CS4B 4CLYA 3QAUA 2UXDJ 2AV5A 2EVZA 3FEZA 4Y34A 5KTQA 1V6HA 2H4WB 2YX7A 1N54B 4OJ3A 4X4RA 4ELUA 1FE4A 4WU2A 1EKSA 1V3ZA 2BKPA 1F6TA 2ZDOA 2DXDA 4KKOA 5E0OA 2UUBF 3G9CA 4TU7A 4LBPA 1M5PC 1LWXA 2JJ4D 3A12A 3FEYB 1HNXF 3OUYB 2VASA 2HQGA 4PXDA 1N33J 3R7BB 3KYLA 1FJCA 1CS4A 2OEJA 1UFKA 1W2BR 3R6LB 2RU3A 3PJXA 1CJVA 1VC0A 2NUUG 5D78A 1CULA 3HHEA 3T5LA 4RBVA 2AEJA 2XY7A 5F8LA 1M0SA 3DRPB 3MUTP 5G0RB 1HARA 3TA0A 1RI7A 2CJ9A 3J7YI 4N77A 3E3XA 1Q5VA 3C3LA 3JSYA 2APOA 4HI1A 4AT1B 5GAEI 2BZ2A 1JIHA 2HHQA 2FZGB 2XWYA 3TOQA 2MLZA 2ZM6J 1ZA1B 3VAIA 2C2MB 1EX8A 4ZITA 3MXHP 2ZWOA 2HW3A 3HKZD 4H4MB 4U96A 2HBZB 1JX4A 5HVGA 4GO7X 3Q0AA 1XNQF 1FK9A 2FZKB 1NUEA 1U24A 2HFSA 1VQ8S 1VS3A 2BXJA 1K8AT 2F4VJ 4AE5A 2K1RB 4J9QA 1L3KA 1OIAA 4M5HA 5GAGU 3ZTOA 1H6KX 1S1WB 2J76E 1OY8A 1WELA 1DQ8A 2CQHA 1FTCA 2M0GB 2POKA 3CDBA 4GVBB 4WTYA 3P96A 5E5NA 4F0MA 5L9NA 5GAEU 1RT3A 4UW2A 3VWSA 1IKXA 2W2QP 2JH3A 3MR2A 1FD2A 3LWLA 3T1YF 2XS5A 4JYAF 2V8HA 2XSJA 3VAJA 4C2MA 3R8YA 2OH2A 1EJ7L 3BGLA 1M90T 3V6KA 5F41A 4WKYA 1P1TA 3RB6A 3VQTA 1DQAA 1RABB 4V1Ak 3NL0A 4HDGA 3WIVA 3EVWA 1YJ7A 3BREA 2H9ZA 4PR6A 5C25A 4JV5J 4DPOA 5E3AA 1KFDA 5L8RC 2W7PA 3WC0A 3P3DA 4F4WA 3HHLA 3OFFA 1S49A 2C1EB 1HBNB 3W9IA 4DU7A 5C7PA 1BY9A 2W2MP 4PXCA 1J2VA 4IRKA 3EPIA 4RX6A 2W25A 2VOPA 1DAXA 1SCJB 2OGUA 5KFVA 1SJ4P 3VF0B 1PYOB 2E5LJ 3KG0A 3ZNUA 2HK3A 2D7SA 2KVIA 4HTIA 2QMXA 1HW9A 3PR5B 4ED1A 1YJWS 3HD2A 1RAOA 3CB4A 3ILOA 1YGYA 1HQEB 4ZVOB 3CCLS 1H73A 2XULA 4DLEA 2NS1B 1MWQA 5G4DA 5D3GB 3KUGA 4DS5A 5K14B 4B3RF 1TL3A 2A10A 2QX0A 4LSLB 5HQ8A 3CMAS 5KFWA 2P6TA 2RKIB 3CCJS 4NXMF 5A8RB 1VQNS 1JWWA 2BKNA 2DR7A 5DDPC 1F9EB 5KFMA 2G4BA 2BJEA 1S9GB 2F8HA 1PAUB 5IQ6A 4A8SA 3D28A 4OHZA 1NO8A 2IIHA 4CLSA 4DPUA 3QRQA 3HPOA 5G0RA 2YY3A 2BDPA 5HROA 3UFCX 3Q8RB 1NDCA 3PHTA 4CLWA 3CNQP 3G4SS 2LCWA 5KFYA 2ADCA 3ZO7A 2UUBJ 5KFOA 2V4RA 1HHTP 3KJNB 2FTRA 2K06A 3MM7B 3BKUA 2GIRA 4CNYA 3I55S 3LAMA 3WQPA 2D74B 4DV3F 4LR8A 3LWMA 1HNXJ 1RTIB 1CSJA 3DOKA 3ZZRA 2EC0A 2UUTA 1IR0A 2YKMA 1KOHA 5D4OA 1UEUA 1HI8A 1XTZA 3FKBA 1CG2A 4WFYA 2CQIA 5LSLA 1YJRA 1WOOA 1TUVA 2HNZA 3QNWB 2W9CB 3AJ2A 2ZOMA 2ALZA 2D3ZA 2B4VA 3B82A 5J2QA 3MTKA 3OXLA 3IFEA 3M8ZA 1JLQA 3V4MA 3TAMA 1S0NA 2XMVA 2DR9A 3DU5A 4ZVQB 1R0CB 1C1CB 1SKRA 1UCNA 3ITHB 1X4BA 2AW0A 1F9HA 1TVRA 2IVMA 4KIAA 3VZIA 4QWCA 2UXCJ 2DGXA 2IC3A 4KT0C 2KTQA 5KOXA 4LFBJ 4OI0A 5FD1A 4Q0BB 3UN3A 1XNQJ 2V4JB 1S6QA 3I82A 1RWXB 2GAHC 3KKFA 4MMOA 2E7VA 2VPWB 1DJ0A 4QU6A 1ROFA 1X8DA 1RWUA 4JOUA 3S1TA 3MTJA 3AA8A 3VQSA 4RU9A 5EWEA 4UY85 3PW2A 3AB4B 3UR3C 2CPXA 4EK2A 1JLAB 1FF2A 5LJ5Y 1K0TA 1REGX 3QATA 2OSRA 3BGFA 1TELA 4EU0A 4DR5J 2ZZTA 4K4YA 3MECB 1X4AA 3KJVB 4JI2J 3DCAA 4ECRA 1QSLA 1TKTB 4DR3F 2B51A 1RUSA 1WC4A 3KMQA 2ILZA 4A8OA 1UMJA 2E1CA 3VAHA 1E6YA 3K17A 4DQRA 2YKNB 4C8YA 1KLMB 4Q8FA 4IOAQ 4E2FB 2HVEA 1WSVA 1B3TA 1AUDA 4JV5F 1G1XA 5CYJA 2ZBPA 3OSPA 5SZTA 1H38A 1VRTA 3MAAB 4OX8A 5DDOC 1KVKA 2ASYA 5BJRA 3PJWA 3VGSA 2CPHA 4CDIA 1VR6A 3FCVA 4H54A 4KHRA 5AXKA 4DX6A 1HNWF 3M30B 3L7UA 1Q82T 1HYSB 2OMOA 3M8WA 2E5LF 2EBGA 4ID5B 5IFMA 4P7VA 1KHWA 1R89A 1S9GA 4KH1B 4EZ9A 3C15B 4KHMA 2ATCB 5KG4A 4P9SA 1ZM9A 3BO2A 4W4MA 1UWBA 3KK1A 4CO2A 4XTTA 2AYEA 3QO9A 5A8RA 3NGUA 3WDOA 3VR1A 3T1HF 1VQ5S 4FYVB 1SH2A 2JLEA 3U1LA 4B3RJ 3HSGA 2XZDB 3F44A 5AE1A 4WP9A 4OV1A 5KFGA 1O51A 2WW4A 2WRMA 3IG1B 4ZPBA 3ZXWA 5U47A 3PW5A 2IBKA 4DX7A 4WKRA 3PTWA 1S1TB 1FDNA 5JUMA 1R8BA 2OPSA 3J7Z5 2ZJQQ 1EZZB 1S99A 3FRZA 3EZUA 5DZ6A 4C6AA 3BSOA 4ECYA 3BBFA 3EGNA 5A0YB 2B4PA 4TLQA 5HP1B 1FEHA 3CXCR 1APSA 2HHHJ 1UA0A 3V81B 2CJXB 2E44A 4OZ2A 4C9DA 3DDKA 1MG7A 2YVSA 2BJ7A 3GLJA 4WK1A 4ZVFA 3TW0A 4DL4A 3X1LB 2GQCA 1RHMB 5CCLA 1S4EA 3LP2B 3AD7C 4ES1A 1X0FA 4IUFA 4C11A 2OLWA 4JB8B 3RAQA 4MKYA 3ILIA 5J2MB 3ENAA 4DV3J 5HK4A 2FB0A 2WSEC 3JSBA 1NJZA 1NHUA 2MGZA 3N01A 1K73T 1FJEB 1W2IA 4TQRA 5K8MA 3KOAA 3MEDA 5KG0A 2R2TA 1PG5B 3NOCA 2I38A 4TVAB 3TA1A 1N5TA 4JI1F 4Y2MA 4U8VA 3MCOA 1Q78A 3OTBA 3IBFB 2GA7A 4GC6A 3Q2TC 2OPPA 4ECUA 1X9MA 2QG9B 2CPZA 4R8UA 1Q4RA 4X4SA 5DS7A 1NDKA 2ZHAA 1MWYA 2AX0A 2HMIB 1TAUA 4CT8A 2FHKA 3L09A 4DDFA 1TZ0A 4LF2A 2N3OA 2FLPA 1UVMA 5EWFA 2K3KA 1Q8IA 3PRBA 3R1LA 5H9FK 1YZ6A 3KLEB 4ECZA 2WONA 3OBIA 1SL0A 3M6WA 1FKOB 4NPOA 1U1LA 4JV1A 4QIGA 3PXGa 3QJPA 2AEFA 1PBUA 1DARA 4DL2A 5EHHA 3FZBA 3KMSA 2MB0B 3CD6S 4QYRA 4DR2J 2W1BA 1UA1A 3GYXB 3GR0A 1FRXA 2R42A 2DITA 3CCVS 4LQ3A 2KN4A 5FDLB 4CZCA 1OPIA 4J9SA 2DBBA 5KFNA 1Q8KA 5F8JA 4ERDA 1N0UA 1WEXA 2GS8A 4KTQA 4WK3A 3DRPA 1ZAXA 2V63A 3GZ7A 4C0OC 2UP1A 2WSFC 2R8IA 2J8SA 2XMTA 2NYHA 3M1VA 1Y7PA 2X7IA 3QSIA 4HHHA 4OZJA 4OZ0A 1Y3JA 1CJKB 2HHPA 4RL1A 2DNYA 4ED4A 4DR3J 1FKAF 2KM8C 3E2EA 1OYEA 4FNHA 4A47A 1T05A 4JI0J 2QA2A 3AJ1A 3MMJA 1RT1B 4ELTA 1NXIA 2SXLA 4F04B 4P52A 2FY8A 4DPTA 4YFUA 2DD8S 4LBIA 3ELHA 1DQ9A 3ZC4A 4J9NA 3LUYA 4TKTA 2Y3YA 3BO3A 1EKRA 1UAWA 3MAHA 2YH1A 1AA1B 4PUOA 3V2UC 4ZPWR 3BGRA 3QWPA 2ZZNA 2M4MA 3CDAA 3TJAA 2NZCA 1G6BA 2B9XA 4KHPF 2RQMA 4HDHA 4J7CA 3AODA 1TAQA 3EGZA 3QFHA 4B9LA 1FRKA 4MKAA 3U1MA 2E5HA 3BKFA 4KJIA 1VK3A 1F3VA 4XIUA 5A8KB 3HVTA 1UZDA 4X4PA 3SBMA 3M9MB 1HLWA 1WJ9A 1LWEB 4X84A 4G1IA 1K1QA 2DNHA 3RB4A 4KYZA 4OHWA 4OX6A 5J2NA 3IGNA 1TK0A 1CBKA 5E3QA 2QL5B 2MDAA 2KM8B 2BR0A 2ZE2A 2EBEA 2LXFA 1KTQA 2FIUA 5F0WA 1QSYA 1H2TZ 1LNQA 1OWXA 1RJJA 2RSQA 4PWDA 4C0HA 2R2SA 3G82B 2VFRA 4AL5A 1U26A 3DI6B 3BQ0A 3JQKA 3WZ0A 2UVRA 2LQBA 4P72A 2H5EA 2GIQA 2HRUA 2XO6A 4HYKA 1FNXH 3IRXB 2PFDA 4WYWA 3BPDA 2RHQB 5B7WA 2JWNA 2BE2B 4YS2A 1NMEB 1LWFA 2DEJA 2V8DA 2J6TA 1TFYA 2QZ8A 3H98A 4LF9J 3RRGA 2UUWA 2QC3A 5KFBA 1N0VC 4OYMA 1KOOA 3QT5A 1EETA 2UUAF 1FA0A 2DGWA 3W8GA 2FPHX 3GCXP 4DZDA 4ED3A 2VG5B 3SYZA 2Y8WA 2LQ5A 4C97A 3T19A 4JI1J 1IR1A 1VIOA 1RHQB 3B4DA 5K9FA 3TUPA 2ZH3A 2XHCA 1HWIA 3K5MA 2D3OR 3MFIA 4QIVA 2ZBCA 3BN4A 4P74A 1UJ5A 3PG9A 4HACB 3D67A 1D1UA 1RWKB 4H4KC 5M2RA 2ZUGA 1Q7YT 3ISZA 2IAJB 3TZXA 2KXHA 1N88A 1GAOA 1FNOA 1WG4A 4PG8A 2WVFA 1PSDA 1LV5A 3QFWA 4USJC 3D68A 3UD3P 1SJQA 5B0CA 2R7RA 4ED8A 2VQFF 2LMIA 3K58A 4FYYB 2RAQA 1OPZA 3UPFA 3EVMA 4LBHA 3JB9k 5HBMB 4URSA 1DY3A 1VRUA 2WHOA 2Y1LB 2FJXA 1DHMA 3H0PA 1KQFB 4AQYJ 1CVJA 5E3PA 3NKYA 4ZP6A 1X7VA 2JX2A 4X62F 4RNNA 1CJUA 1S1WA 5I3PA 1T03A 2H1YA 4RNOA 3C6UB 2W2NP 4O4RA 2RQCA 3VAFA 2Q79A 1VQ9S 2VOOA 1RT6B 3QLHA 4N8NA 4TNOA 5ETTA 1ZTTA 1E6VA 2EFQA 1IN0A 5KFEA 3R6GB 2W4PA 3K89A 2ACMA 3JYTB 5D0EA 3BR8A 1PGZA 1KD1T 4B08A 2V69A 1TKZB 2QFIA 3PR4A 1FVQA 4GVLA 3MR5A 4QR0A 3GYNA 1WTBA 3HXMA 2FVPA 2FY1A 3OR1B 2IMWP 2KL8A 3ILLA 3PKMA 2BQ3A 3VVTA 1W7WA 4JI0F 1TFWA 4J9OA 1VC6A 2R7SA 4ZLJA 2MY8A 3NGSA 2V4JA 4KV8A 4YB6A 1HHSA 4F7VA 2G0CA 1FKOA 2VPZB 4RBUA 2IJFA 1RHRB 1X4GA 5FDLA 4DZ6A 2FLLA 4QYZJ 1FJGF 3D3BJ 3D4JA 2C28A 4PRFA 5H9EK 2GJIA 4RUAA 1Z2LA 1R8HA 2JZ5A 3QYYA 4DHVA 4QW8A 2XY5A 1BC6A 1SIZA 2YKPA 3HFKA 2YQ0A 3HFVA 1RHJB 1XWLA 2B0GA 4IFYB 4USTA 4ZPDA 4J9UE 2RNEA 1NH8A 2BQUA 4KB7A 4I7FA 4PG4A 1ZPVA 4KHPJ 2NQPA 3BO4A 4R8UB 2MZQA 4IKAA 3AOBA 1GMWD 4KKOB 3MUMP 1B0VA 2DIVA 3CCQS 3ETOA 5F8IA 4LVOP 5KFLA 4YDDB 3MM8B 2K3IA 1SQFA 2DIUA 4FXDA 1TMJA 1UVNA 4P2MA 4K0KF 5CCMA 3GWCA 4X4VA 1ZZFA 2CPJA 4K4ZA 5GVQA 3OTOF 5KFIA 2DCLA 2V94A 1NU4A 3LF0A 1W26A 2Z30B 1U49A 3BEGB 3GV7B 4QR2A 1PBAA 3QGPA 1SUQB 5ETSA 5GMEA 3OLAA 1RLCL 1FNMA 2WOMA 3BSCA 4E98A 2D1CA 3D1OA 3PEJA 3NBPB 1X4FA 3W9JA 1QAXA 4GC7A 3O5TB 1FRJA 5HMWA 1VHFA 3QGIA 2KFYA 4ZVPB 1KR4A 5KFSA 2ASJA 4ZLNA 1VQ6S 2CG8A 3GP9A 5B0AA 2LEBA 4O0NA 2GIFA 3MCMA 4I56A 4NA3A 1BQMA 1GEHA 3VV2B 4C0BA 5HSPA 3JYTA 1XERA 1NPRA 4YEAA 4ECTA 4LF7F 3Q8YA 1ZM3A 4QU7A 2VH7A 4CH1A 1KQSR 5DLFA 2OJ3A 1X4DA 1IBLJ 3OR1A 1FX4A 3I4HX 1C0TA 2CVIA 4Y3CA 4M95A 1JLBA 3MPWA 4PWWA 5A76A 3EMTA 3T5HA 4O3PA 4CTAA 2QLWA 2UUAJ 5D3GA 2CVEA 3MEEB 1FRLA 4FYXB 3S8SA 1GXTA 3QAEA 3T6JA 4DL7A 1NK0A 5BYQA 3MPDA 4YB1P 2HHXA 2NZ4A 2HBRB 1RU2A 2F5GA 4IRCA 1OYDA 1IBCB 1B4SA 3DGPA 1DTTB 3FQLA 5IC6B 2O5DA 3UW1A 2DNQA 1FVSA 5GAHU 1FXRA 1R0AB 4NLPA 5CQGA 2VG6A 4L6V3 4ECXA 3QO9B 1YWXA 2PMZD 2JLGA 3GIIA 3I87A 2H5JB 3OXGA 2L3MA 3MAAA 2V2ZA 3NOGA 4ED2A 4EUVA 1TUGB 3J80U 1S77D 5JMNA 2W9AA 4C8ZA 3GYGA 3ICLA 1T9XA 4X62J 1DRZA 4TXSA 3NGTA 5B0GA 2KXNB 3GFXA 2C42A 2FUG9 3IXQA 3S6EA 1X4EA 3VGTA 5I3QA 2MQOA 4ZCIA 4RBTA 2KXFA 3C19A 5ETPA 3PCOB 1SQEA 1CC7A 4DX5A 4TLRA 3QRRA 1HMVA 2IHR1 4R0JA 3L95X 7FD1A 2RD5C 3KLIB 3JSMA 1JB0C 1WG1A 2LQJA 3IAS9 3L7PA 4A48A 1R0BG 3MMBA 1IM6A 1R3NA 2QJ3A 2OIHA 4K50A 4ZP7A 4CH0S 4XO0A 1FT8A 1RT5B 4J5OA 4CO5A 5A6PA 4DV7F 3W61A 2FZCB 2BE2A 2GHWA 2E29A 2IRYA 1K47A 2XGPA 3C14A 1FDAA 2ZE2B 7FDRA 4LF4J 4X4UA 2OD6A 3CULA 4NCGB 4O44B 4QJVA 1FJGJ 3T1YJ 1S6UA 3ET6B 5KG1A 2NCKL 1MW7A 4OZ5A 3GV5B 3G6VA 2F3JA 3W5ZA 4NLTA 3K5PA 2X3DA 4X4TA 1WKKA 2PMHA 4KY3A 5D0GA 3UDEA 1TK8A 4LMZA 1VRQC 2H48B 4I67A 3EDQB 3PNIA 4NCAA 1NBEB 1OY9A 2D9PA 2ZD1A 5KT7A 1WHXA 1RKJA 1RU1A 4NASA 5EUHA 3CE8A 4ECWA 4MYTA 5L46A 1CEZA 1SIWB 1RKIA 1OSDA 3P6YC 4P2SA 5KT5A 4IQXA 1U1NA 4ECSA 2B8PA 2W01A 2X1BA 5J1NA 1V9OA 2W4DA 3FQKA 3ZZOA 4K0KJ 2PFFB 4WFNQ 4V19J 4IDKB 2IVYA 1SQGA 2CQDA 2E1PA 3IP0A 3OUYA 3R5AA 3C8YA 2MZRA 3NCPA 2RIJA 2MSTA 4DLGA 2G1DA 4ED0A 3US5A 2IYGA 3C2PA 1CQNA 1F1BB 1FKPA 2ZDPA 4MIWA 1T94A 3L3CA 3SCJE 3CJ2A 1RT1A 5KG3A 3KUEA 1WWHA 2DHHA 4DUYJ 2DR5A 5T7LB 3DLBA 1PCAA 1CJTA 4CI0B 5HMZA 1GX5A 1C2PA
chains in the Genus database with same CATH topology
3GE9A 4ZK7M 1XBWA 3U27A 2PD1A 1FDDA 2OTJS 3TVZA 1QTMA 2UVWA 3H2UB 3MUVP 1SXLA 3RU0A 4YR0A 4GKJF 3BM7A 2W4CA 2KRBA 1X9WA 3M2VA 4FXVA 3BDPA 2YNIA 4O3RA 1XEZA 4N76A 5DLGA 2A3JA 1TV6A 1R7IA 4RW7B 1NB7A 2ERRA 5L9XA 1WI8A 4XAKA 1HBUA 3K2YA 3M2UB 4NOHA 4PPZA 3RBDA 3QPIA 1QLNA 3ENVA 4NYOA 4EWTA 4Q5VA 2YNFA 2OKQA 2GGPA 2BJDA 2DNNA 4KRWA 2MMYA 5KOWA 2V0NA 2XWXA 4ITSA 4ZMMA 3PEHA 2XSFA 4Q43A 3IBWA 1RTJA 4I0WA 3I4PA 4YUDA 2LKZA 2J5AA 2LVWA 1FKPB 2J9DE 3MZIA 1PILA 4C3KA 1RTHA 5C25B 1RT7B 1QVFR 1M5OC 2XMJA 3HT3A 3PFOA 2MGZB 1A6LA 1URNA 3FGVA 4FF2A 5GMKa 2UXCF 3DLKB 4X4QA 3LP2A 1IKXB 4LF5F 1F2GA 5THWA 1YJNS 1R43A 3MM8A 1AROP 1HQUA 4JUZA 1KRPA 3H5SA 2R2UA 1Q7LB 2Q66A 2IM0A 2NLWA 2VB6A 3ZZ0A 5HO4A 1NJXA 1UW4A 3SCKE 1VGYA 3R3TA 3AY0A 4C8LA 2YNHA 2XMMA 2LU1A 4LF4F 3E8OA 4DJBA 3KK3B 3GFYA 4DL0C 5J2MA 1ZZNA 2JEIA 3V81A 2JL9A 1YITS 1VBYA 1T7PA 3T1AA 4R5PA 1Q1KA 4PWDB 2J7UA 3I0SA 4RNMA 1L3SA 4Q2LA 3EXCX 2KB2A 3MMBB 5KT3A 1N36F 1YJTA 3H40A 1JJHA 1KS2A 3BQ1A 1MMDA 1C1BB 1UVKA 2X51A 3W2VB 2XY5A 3KK3A 1L3TA 3NMAA 1IM4A 1OQ3A 4I68A 1S6PB 3KHLA 4QR1A 4YB5A 2ZJRQ 5L1IA 2KT5A 3KLGA 3MPYA 2M7SA 4G1PA 3IA0A 3LPYA 4ID8A 2I0XA 3GIMA 1IKVA 2W8LA 4ZP9A 2M5YA 3CJKB 3T3FA 4YHHF 2B5JB 3DOLB 1UVIA 1S76D 2JEGA 1U09A 4Y2KA 3OW2R 3PRDA 2O1PA 2C3OA 2PA3A 4ZCKA 3UI3A 1KLMA 3GV8B 1S48A 4KQZA 2DO0A 3T6BA 2NSCA 2HVIA 4DV0F 1S10A 1NK7A 2Q43A 3SFGA 4CNZA 2HFNA 3IN5A 4RWWA 4UQGA 2AQ4A 1S6PA 2XNQA 5JVGQ 3FSXA 2U2FA 2DHAA 4B9UA 2AJQA 3HVRA 4AYBD 2QV6A 3RBEA 4A46A 4G1QA 3C66A 2GMHA 2HHHF 2ROPA 4B3SF 1DTQA 1H98A 2CDQA 2LXIA 1U2RA 3PW7A 1D8ZA 1JKHA 5KAKA 4MK8A 1X9SA 3Q2SC 1X5SA 2LXUA 3BSAA 4R25A 2OFGX 3QIPB 1N5QA 2YKQA 3K7RA 2ZH6A 1YIJS 2YNHB 1LW0B 2I8EA 1T05B 3I6PA 2KYXA 2HLTA 3M9OB 1H7XA 4FPRA 3H4BA 4MTPA 2MJUA 5LMNF 2B7CB 3FCHA 2UZAA 3EGWB 3DLGA 5CYQA 2V9KA 2YTCA 4EBCA 4OMFG 2QT7A 4DMZA 3NAHA 3EXYA 1C4AA 1DTQB 2VUGA 3G96A 2B9WA 3HJFA 2EK6A 3V5RA 4DQIA 4DWIA 1RT4B 3N0VA 5IM0A 5CXTA 4WZMA 5AE2A 1AW0A 1TL5A 5M2UA 3THTA 4OZLA 1MU2B 3CIZA 5CZXA 1OO0B 3MM5B 5AJ3F 1M5HA 3BQ2A 4J9KA 2FJEB 4F3QA 2C2RA 1B0TA 4PPDA 4TU9A 4DR2F 5J1EA 3Q8QB 4U9RA 2HRYA 1M5VC 3G6XA 1FRMA 1XMOF 1RP5A 2BBEA 2IYIA 3CCRS 4EBDA 1U1KA 1Q8LA 1RTIA 3CD5A 5I3UB 1WEZA 2RKIA 2HGLA 3MR6A 2OPPB 3GMGA 1S97A 2ROEA 4OLPA 5A0YA 1YVFA 2KH9A 4F8RA 4Z37A 5D4PA 1WF0A 1HR0F 2DNMA 2YNFB 4I69A 2LU2A 2AJ1A 3SDEA 1HBUB 3M2UA 1OS5A 2WSCC 3PACA 4U6PA 4ZHRA 3N79A 1QM9A 3POTA 2AWZA 4I2QB 1F60B 3MMAA 1N4LA 4NCBA 3MWBA 1JLGA 2P9EA 4DR4F 2HNDB 4ZPTR 3FNNA 1UWBB 2DGSA 3BN7A 2XMUA 3LW5C 3O3LA 4XPEA 2YKAA 3CCTA 4B9TA 3NMRA 2FLNA 3POTB 2Z0GA 1G2EA 2K2PA 1YJVA 4YQWA 3CCUS 1R8AA 1SB6A 5HBMA 4DFMA 2OAUA 1XMBA 4U7UK 3H8YA 3NCQA 1Z2ZA 1CLFA 2IFXA 1Q8BA 2GQQA 1M5KC 1V3RA 2M9KA 4NYZA 4OHXA 4RW9A 4QIWD 5F8HA 2C2DA 2VA3A 2UVUA 2XC9A 3I9V9 4QWAA 3PIOQ 2J0WA 2BANA 3FDSA 5EX3A 1RYRA 2DB1A 2HHUA 2B5JA 1IKYB 1U47A 2VG7A 2VL1A 3RYLA 4M94A 3D1QA 1X5TA 4Q7AA 3OSNA 1R0AA 4WFAQ 3AH6A 4DSKA 1S0VA 2B7BB 2OD4A 1IJEB 5F9LA 1HL6A 3OFGA 2NYIA 1S6OA 1JMTA 3DU6A 4LSNB 2Y1RI 1GNKA 2MXYA 4LF9F 4NCGA 2J8AA 1J5EF 2MQQA 2FHJA 4F67A 3D0HE 1U45A 1VJWA 3OXFA 4C3MA 2QA4G 1GQEA 3J7YU 3I96A 1SKWA 1SJRA 4R5PB 2RJZA 1FE0A 2C3YA 3FVYA 3KLFB 1TKTA 2CIMA 3N28A 2K1RA 1SJFA 2RUGA 4F4KA 2E7XA 4Y2AA 3BDEA 4CO3A 3GFZA 3OQ2A 5LXRA 3HVTB 2E66A 1RA6A 4UUWA 3QZ8A 1RAJA 2F8EX 4TY8A 3CJ0A 2IJNA 2VQEF 4NZ6A 4DUZF 1SJ3P 1IUJA 1HNZF 2KT2A 1ZOTA 4WCEQ 1TV6B 4OX9F 4JI5F 4IH5A 3I31A 1L3VA 1Y9OA 2CKWA 4F4XA 1A7GE 3D1HA 4AQYF 3IR7B 2CQCA 1S1UB 3PZPA 3LP0A 3RRHA 1SUQA 4ZPCA 2R8HA 4PUOB 2ZC4A 1SV5B 2OPRA 1MWZA 1N5SA 5ITHA 4N8OA 1Y5IB 4G1QB 2HWHA 1P1LA 3HDSA 1HNVA 3ZZYA 4I64A 5MAOA 1DTTA 1D8YA 2AU0A 4V19X 4F3MA 2Z4PA 2KG1A 3I5AA 2EW9A 1H7WA 2A1BA 4NX9A 5C42B 1FRHA 4LIRA 3CCMS 3HM9A 2PGCA 1CC8A 1ZAWA 5KFPA 4MAKA 1SC6A 3ISNC 5A6WA 5HL7Q 2QA1A 1D9DA 2C2EA 2QEXS 1HD0A 2OP5A 2BVZA 1ZPWX 3D0IE 1XR5A 1IBMF 2B6AA 5D77A 2GNKA 3N4WA 1NKEA 2WBMA 1IKVB 2I2YA 1WHVA 2UU9F 4FXWA 4ILMA 4QCLA 4WE1B 2OO4A 4HH1A 3DDNA 1KNZA 1TL1A 4E0DA 1WF2A 2Z8QA 3THVA 4KGMA 3M1VB 5AXLA 3RB0A 4DG1B 1LW2A 2R7VA 4ZCLA 1KFSA 3IGVA 4LSLA 3SSQA 4C7QA 1NK9A 4GO5X 2FD2A 2KJWA 2DNRA 2XMKA 3LH2S 4K4SA 2FHOB 1HWUA 4Q45A 5DQHA 3OJUA 4DR6F 2DH7A 1O0PA 2VD3A 1KONA 2J0XA 3KLHB 4HT5A 4IG3B 3S7RA 2VFVA 3PO4A 1JLQB 1VRUB 5E33A 3C6TA 3O6QA 3JTOA 1VQOS 3VALA 2BRKA 2EWHA 3KLEA 4OHYA 1VIXA 3IRWP 5KFJA 2AF6A 3SQGA 4PCQA 1D9AA 3I9ZA 3P5TL 4FVCA 3PIPQ 2XLIA 1BQNB 4ZPVR 4DFKA 1JLCB 2CQ1A 2IRUA 2LA4A 2YNGA 3QGHA 5K5MA 2FHMA 4K5RA 2EKYA 4FBUA 2ILYA 1J5OB 5CYMA 3DOLA 4DSEA 2FHJD 2BABA 3E51A 2MHNA 3IWLA 4NZ0A 2V8VA 3LANA 4Y2CA 2IBOA 2RU9A 2M8HA 5F3TA 1U2FA 1QUVA 2DCUB 4JI6F 2V5HG 4DL6A 2MKJA 1F5AA 2QLXA 2Y1IA 2RF2A 4OI1A 3PY8A 4B9MA 3RW6A 5HP1A 3MDFA 5DG9A 5L1KA 1NK6A 2B56A 3TQ1A 5D4NA 2W7OA 2MZTA 3JSMB 1GTEA 1EP4A 1WI6A 2YWKA 3OFEA 4I2QA 3TI0A 3GIKA 3CGIA 5KG5A 1IQZA 3F73A 3V6DB 3M30A 2OFHX 1Q16B 1S0OA 1S7HA 1OQ6A 5IWAF 4IO9Q 2QRRA 5C24B 5DM7Q 3AQOA 5C42A 1U48A 2E9RX 3HHDA 1TK5A 3HX9A 3KK1B 3M4XA 3NNAA 1D0EA 3LO3A 1HBNA 3SSRA 1QAIA 2GJ2A 4NLDA 1KHVA 1HBMA 4ZOSA 1X4HA 2CJAA 2FC8A 3DLEA 4ID5A 4EYHB 2HAIA 3OL8A 4PQUB 1WTFA 4LVNP 3UDCA 1U4BA 5L39A 1XK8A 3LP0B 3UCGA 3OVAA 1L3UA 5A2QY 3FFIB 2DISA 3QMQA 4ZVGA 4ILRA 3MEKA 2HHTA 1U6FA 2DNPA 5IM0B 1LWFB 1AFJA 2MPUA 4I7FB 5HLFA 3UWTA 3IR6B 2MZ1A 4F4YA 3MEEA 4FF1A 3KLHA 1WG5A 1S6QB 3GG0A 1K0VA 1TKXB 3CCZA 3QWUA 2X1GA 1NH7A 2JRSA 3DLJA 3T9NA 1N52B 1Y5NB 2MSSA 4BDPA 4IH6A 2NREA 2HHSA 1IJFB 2W8KA 4NLSA 4KPYA 3HO1A 1UETA 2ZKTA 2RH3A 3DLLQ 2NSBA 3WX4A 1U7LA 1YHQS 3SMZA 4USIA 2HYIB 3CIMA 3ITHA 1LFWA 2FLOA 2WCXA 1V3SA 1TKXA 2CPEA 4JI8F 5J2QB 2CYYA 4J37A 4YR2A 1BD6A 5A8WB 3TAMB 3C46A 1DLOB 2XS2A 2HGNA 3HZEA 2WONB 4OQJA 4DUYF 3U7JA 1FDBA 2N4CA 4DV6F 3GIJA 4W90B 4I6WA 1JNRB 5B0DA 3VCDA 5JVHQ 4JI7F 3T5KA 1HBMB 2XY6A 2GQ2A 3G8SA 1N56A 1HMVB 1GTHA 5KG6A 2FVSA 3MOZA 3BS9A 3MM7A 4D3GA 4NL5A 1N6QB 3OL6A 3CJ5A 3IR5B 3FFIA 1TR0A 4HL9A 3NLCA 4I1TA 3BGUA 4C3LA 2PIIA 3IWNC 3JSRA 4IDKA 4C8KA 2PC6A 4QIFA 4MK9A 1VQ4S 1P9QC 3EYZA 4AUKA 3AB2B 5GADI 5LMUF 5EX0A 2PEHA 1YBAA 4KFBA 4WIIA 4F25A 3SXLA 5E7OB 3K5NA 4J9LA 2JVRA 3AA9A 4PQAA 3QJLA 2UV8G 3DHXA 5AXMA 1ULRA 3K59A 1G7CB 5KFCA 3D54A 3SFUA 1C1BA 4HI2A 5DDRC 2GMJA 3O1LA 5C5JA 2CQ4A 2JSXA 2O01C 3TP2A 4X65F 1Z1ZA 5B0EA 3TR5A 3KG1A 5F3ZA 1QAJA 3FMBA 2R8GA 4IYQA 2KFZA 1T8EA 1BGXT 1QJHA 2GMLA 4RUCA 3DOMA 1UVLA 2XB2D 2GX8A 5KFDA 3TUIC 4AFFA 4KR0B 5B08A 4DV4F 5J2PA 2V9WA 2HHWA 4I2PB 4NLUA 4P6QA 1UJ4A 2L48A 4LFCF 5CD4H 4U67Q 1XC9A 4RW4B 5FJ4A 2F1FA 2HS4A 3CWJA 4ZP8A 1ZBTA 1Y4ZB 4XDDA 2X1FA 2XSJB 2DVIA 1HYSA 2NPIA 1BQNA 1H3DA 2P9CA 3QIDA 2ZOGA 3R5CA 2DPIA 1LKZA 1RT3B 2DHGA 3ZFVA 3P49B 3CDWA 3DXSX 4IG3A 5F8GA 3MEGA 3R27A 3LAKA 3JTNA 3IS9A 2MKHA 4DV1F 2IMOA 1NNDA 1JLEB 2Q6CA 2JFDA 3R1HA 5E41A 2VG5A 1HA1A 3LGNA 2EFOA 5D4LA 1RTJB 2VPYB 4I2PA 1KN6A 2VBZA 1LW2B 3OHBA 1RISA 2AYGA 3OR2A 1HW8A 1TP7A 2XO7A 3C6TB 1FK9B 1MROB 5K8OA 2WK4A 1HWLA 3IRXA 3M2RB 2GFFA 2W9BB 1HNIB 2FDNA 3OLBA 3HLUA 4RWXA 5DM6Q 2GO9A 1X5OA 2CPIA 2J0QD 2FJVA 3RB3A 1UEVA 2B6AB 1RA7A 1LWCA 2XMWA 3NNCA 4YDXA 3M2VB 4KV8B 3KTQA 2QE5A 2F8MA 2XHWA 2YX1A 1BLUA 5DQIA 4JV0A 2R9LA 5EGYA 2P6SA 3MPVA 4FN5A 1IBKF 4B3TF 5CH7B 3DMJB 4BBYA 2MKIA 3ZZUA 1S9EB 4K4XA 1RTDB 4A4JA 4ZHRB 2GGPB 5KFFA 4DFPA 3J7A1 4ZS6A 2JHEA 2F40A 1DURA 3B8HA 4B9NA 1P6TA 1RK8A 2ZVSA 3T5JA 2PDAA 2PI4A 2UXBF 2HS0A 2VBXA 3BSNA 2M88A 2FJWA 4QWDA 3C6UA 3FEXB 2LYVA 4IH7A 4HKQA 3KNAA 2G13A 1FERA 4I4BA 2L41A 4NA1A 4JV2A 1B7FA 2O67A 3OTDA 3CT9A 1QY7A 5D8HB 3KWMA 2J6UA 3DFEA 5EDWA 3M6XA 2YWHA 1BWEA 3UDLA 2X1AA 1Q81T 2CQBA 4FP9A 2VA2A 2KT3A 3W2VA 3OFHA 2FGCA 4IFVA 2J9DA 5DO2A 2AGQA 1U1RA<