1IBKF

Structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotic paromomycin
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 24
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ibkF00
4DV4F 1HNZF 1QJHA 2B7CB 1G7CB 1FKAF 4DV3F 1IJFB 5LMUF 4LF5F 4DR2F 1GH8A 4B3SF 4NXMF 4YY3F 4LFBF 4DV5F 2BVZA 4DR4F 4X65F 4JV5F 4DR6F 5AJ3F 1LOUA 1I94F 4DR5F 4JI2F 2UUBF 4KHPF 4JI8F 1XNQF 4DR7F 1CQNA 3T1YF 4LFAF 4AQYF 1N34F 4NXNF 4LF4F 1G1XA 4JI1F 4DUYF 4JI5F 1FJGF 1F60B 4OX9F 4DR3F 5IWAF 1N33F 1XMOF 1RISA 2E5LF 4JYAF 2B7BB 3ZZPA 2UUCF 4DUZF 4DV1F 2UU9F 2J5AA 1HNXF 4LF8F 4GKKF 1J5EF 2KJVA 4JI4F 4JI0F 1N36F 4LF7F 1HNWF 4JI3F 2VQEF 2HHHF 4B3TF 2RJZA 5BR8F 1IJEB 4B3RF 1B64A 1XMQF 2F4VF 3T1HF 2YY3A 2VQFF 4DV2F 2ZM6F 4JI7F 4GKJF 4DV7F 5LMNF 4DV6F 4B3MF 1IBLF 2UXBF 4X64F 4X62F 1N32F 4K0KF 3OTOF 2UXCF 1XNRF 2UXDF 4LF9F 4LF6F 1HR0F 2UUAF 2BXJA 4DV0F 3R3TA 1CQMA 4DR1F 4LFCF 1IBMF 1IBKF 1VMBA 2KJWA 4YHHF 4X66F 4JI6F
chains in the Genus database with same CATH superfamily
4DV4F 3OT9A 2EC2A 2Z8QA 3ELHA 3HJVA 4KGVB 1SQFA 1UL3A 2DY9A 2PMHA 4WIIA 1RBOB 3AB4B 2MLXA 2B3TB 2VG6A 2WZ1A 3D68A 4K2XA 4MIAA 2F4FA 4OI4A 1UFWA 4P75A 5KT2A 3Q22A 2FHOB 3UCZP 2XO7A 5A6WA 4N8OA 2MPUA 3CO0P 3KG1A 5A8KA 5KFSA 1B0PA 2N7YA 1U1LA 1FJ7A 2BVZA 4ELVA 1XEZA 4ZPDA 4WYWA 3HSJA 3JSYA 5K14A 3RGIA 1KQFB 3GQCA 1HQ2A 2WTFA 1UWAA 2V94A 5KFCA 1RAAB 3CC7S 2C3MA 1HNIA 2RNEA 1HNXJ 3JTPA 4R0EA 3UWTA 4PQUB 2P5VA 1X5OA 8RUCA 5B0EA 5KFXA 1P1LA 5KG0A 3AQOA 3GYGA 3TRGA 3WQPA 2MMYA 4URQU 3POTA 2WVFA 4GC6A 1VQ9S 3TEGA 1V3ZA 2M0GB 3W66A 1VJQA 4F4WA 1YJRA 2IHR1 4DPYA 4EZ9A 2OHDA 2O3DA 1IXKA 2AX0A 4F26A 2C2KB 2W2QP 5LSRA 2MGZA 2JLGA 3A8JA 2ZC3A 4MJKA 3UW1A 5J2NB 1IQTA 3K57A 1S4FA 4DR3J 4OQJA 3W5YA 1LV5A 3C16A 3KUEA 1UW4A 4USWA 1L3SA 3BN7A 1WG5A 4KHPJ 1S57A 2GIFA 2JX2A 4PXEA 5DDOC 2D74B 1GXUA 4OI3A 1FE0A 2UVUA 4LF9J 2B51A 1KOHA 4YB1P 4I2PB 1WC6A 5D77A 5KG3A 4DV1F 4QWCA 2GV1A 2MZJA 1S9EB 3H5SA 4LF2A 3BJYA 4HVZA 3VF0B 2XGPA 4IRDA 1VIOA 2R7RA 1U2RA 5LMNJ 1TL7B 1U0HB 5ETNA 2XI2A 2CJAA 5C7PA 4IQXA 3KK2A 4N77A 3VZIA 1UA1A 2DBBA 1FRJA 2XZWA 1GAOA 2G0CA 4O3OA 5HSPA 2LA4A 2XEXA 3DXBA 1Z2ZA 3KG4A 1EB0A 2R8KA 4R5PA 1NK4A 2XZDB 1H3DA 4CLTA 1FCAA 4Q8EA 4H4KC 2K7KA 1UZHA 1EKRA 3D54A 2B43A 4KH1B 5EX0A 4ECSA 1OIAA 4KO0A 2K1RB 5KFAA 2ADCA 2HGLA 5E3CA 2O1PA 5D3GB 2NSBA 2K1RA 2QA4G 2R7VA 4ZP8A 3ETOA 5JXSA 3NS6A 2YBVA 3BPDA 2JFKA 1IKXA 2BOAA 3KUHA 2MB0B 2IDLA 1TL1A 2CWKA 1S12A 2V8DA 2J6UA 2ZFHA 3TQEA 1HR0J 2V5HG 2VBZA 3M8RA 4C9DA 3QLHA 5CABA 4LFCJ 4Z2XA 1HBUB 3QLHB 5D4NA 2F8EX 2OI2A 4IG0A 3B8HA 1D09B 1YBAA 1HL6A 2HAFA 4I56A 4DWIA 2XNRA 2RAQA 3M6VA 1JLBA 3QO9B 5DJBA 3BQ1A 4RW6B 2G2OA 5E41A 3I0RB 1L3VA 4ERDA 3S7RA 1WTFA 2VA3A 2PC6A 2X1GA 5HN0A 1CJVA 2AZ3A 2MKCA 3IFEA 1IBLJ 1N88A 1MMLA 3H2VE 2YXLA 4NL5A 1Q7LB 4TVAB 4ZK7M 4ECVA 2R7WA 3NCQA 3VAFA 3W8GA 5GAEU 1RKJA 2BJ9A 2WSEC 3FSIA 4JI6F 3WC2A 4K59A 5KFGA 4C8MA 2W1BA 1OMSA 2RT3A 4QQBA 3MEGB 3MEKA 5GAHI 4MKBA 1MN7A 3JB9k 2B56A 1WOSA 1U1RA 1RADB 3UN2A 4M95A 4NZ0A 3HK2A 4TKTA 2XY7A 3P49B 2FHMA 2V2QA 4EWTA 2X3GA 1YRUA 1BD6A 1JLCB 1RJJA 3EM1A 1UJ6A 2ZH7A 3N6NA 2AYBA 1IKYA 1RE1B 3LALA 1NKBA 1JLCA 1FXRA 1Y5LB 1IKYB 1IR0A 1CBKA 4P6QA 4QWAA 4IUFA 4K0KF 2YH1A 1S9GA 1J5EJ 5EN1A 2P2CB 3OR2B 4I68A 1Q82T 2HHSA 4M5NA 1JJ2R 3D0IE 4F8RA 3GG1A 4F02A 2NXCA 4EGLA 4PPDA 4DQRA 1AW0A 5KFBA 1U25A 2B9WA 3Q86A 5A76A 3OQ2A 2CQDA 1F0XA 3FFIA 3R9LA 3T1YF 4NA2A 1VQPS 2O01C 4BC9A 1YQHA 4CH7A 2B9EA 3M4XA 3HZEA 1C1BA 2HNYB 1OO0B 3MR2A 2WW8A 1RZMA 3R8YA 3EGWB 1OY6A 2BOPA 2E1PA 2XCAA 3PKYA 4NZ7A 1HQUA 3KHLA 4OZ2A 5A8WB 1FNXH 2VBWA 3TJAA 2R8JA 2XS2A 1W25A 1T9WA 1XMOF 3IP0A 3HP6A 4JI1J 4OHWA 2Z0GA 4ZOSA 3CF5Q 4ECRA 1WC1A 2R4FA 2MEWA 2E5LF 3ZTOA 2YWHA 5GADI 4IR1A 4OZ0A 2OEJA 4KGKA 2LQBA 3CDWA 1UVMA 3FC9A 2HLUA 2DRBA 3MUMP 1S1XB 3QT6A 4AYBD 2JOQA 1EP4A 1V5IB 1YRTA 3DDKA 3MCNA 2H4WB 4ZDNA 4YFUA 3T3FA 1ZAXA 3MM9B 4Y00A 3WZ0A 5T14A 3K5MA 2R2SA 4RU2A 4JI4J 5GAGU 3DOKB 3E01A 3RAMA 4JBCA 3BF4A 4GO7X 1CPZA 4PXDA 2RQMA 2VFUA 3DLEA 3GE9A 2EW9A 1KHWA 4L6V3 5E5NA 4Q5VA 2V9KA 2HS3A 4M1KA 4B9TA 2OSQA 2RRAA 2I6WA 3TO8A 4ECTA 1TU0B 4M8LA 2IBKA 2RB7A 2X1AA 1NSKL 2ERRA 4P52A 1S5ZA 2YY3A 1FERA 1T9YA 4OV1A 5J2PB 3IM8A 4PUOB 4ICLA 4MFBA 1JNZB 1S1UB 3CTRA 4YDDB 1YJWS 3THTA 3M2RA 3W2VA 3OUYB 2ZHBA 3OFFA 1U2FA 3AA8A 3MCOA 5KFZA 2CQ2A 4B3MF 2BW2A 2KFZA 5HMYA 2EK1A 1EETA 2L9WA 2UXBF 2Y0BB 5DG8A 1BUXA 5K9FA 1FJGJ 2HYIB 2XMTA 1N32F 2UXCF 1DLOB 3HFZB 1JMTA 5ETMA 2RKIA 1RU1A 4LF4J 1FE4A 3MR7A 2DITA 3EE3A 3FBEA 1OJ4A 2AJ2A 3J7A1 3O44A 2IVYA 4DLEA 3MM8B 2VA2A 1WACA 2EG1A 4LMZA 5GVQA 1DURA 3P96A 1ZM9A 2Z30B 2XHWA 2O5DA 2HHTA 1MNEA 5CCLA 2GVZA 3HT3A 3JSMB 2PIIA 1U1MA 4BWJA 1WJ9A 5CYJA 3UVJA 2XWXA 3CCWA 2KTQA 1I1GA 4J9NA 2BANA 1YJVA 2VG7B 2D1CA 2AF6A 2KJWA 4ED0A 3RB4A 4AQYJ 4WK3A 2HLTA 2HK2A 4I0WA 2KT5A 2RRBA 3RAXA 1P8GA 4NLDA 3UD4P 1H2VZ 2GHVC 3BKFA 1WTBA 1EHWA 1Z2LA 1VC0A 4DSKA 3G82A 5LMUF 2HAIA 4IG3A 2W2MP 1B0TA 3KNGA 3P5BP 4RW7B 1PJ5A 3BV8A 5DGBA 2DPIA 4Y65A 4B9LA 4C8YA 2WHOA 3NOCA 4X4RA 4NXMF 2X1BA 4P7TA 1XR6A 3THVA 3C8YA 1QLNA 3MM7A 3T19A 2OIHA 3I96A 3M1VB 3CJKB 1U2CA 2CQGA 4HHJA 3H2LA 4X65F 1S99A 1Y7PA 2LCWA 3QFWA 2GQQA 4LRAA 2LXFA 3UI3A 4DG1B 1SL1A 2VFSA 4K4ZA 4J9LA 1C4CA 1S48A 2DHHA 4KGMA 4WU3A 1HQEB 3DHWC 3QSIA 1VK8A 2JEFA 2M8HA 5CQGA 1S6OA 1N34F 1VRTB 2J8SA 2HWHA 3AD7C 3I0SA 2V8GA 1NB2A 1Q0NA 1IBKJ 4LF4F 1A9NB 2CZ4A 4C98A 4YR2A 3DLKB 4LRCA 1FWKA 4DUYJ 2HZAA 1NXIA 2AKWB 4XPCA 1T9UA 3NOGA 1X5SA 4A8WA 1SJQA 1NJYA 3HMJG 3TA0A 4ES2A 1RDRA 1H6KX 5DDPC 2HBRB 4XDCA 2CRLA 3C15B 2RILA 4CH1A 1K1QA 2BBEA 2ZITA 4B02A 2Q6CA 4A4JA 2N4DA 3LTOA 1UVKA 5K8OA 3S8SA 2XNQA 3ZZPA 4EFAC 4DF8A 2HMIB 3T5KA 1Q7YT 5CYMB 2KG1A 1U8SA 1H74A 3W2WB 3PX0A 3DFEA 3FEZA 2LYVA 3HSGA 3E51A 3OFGA 3HHLC 4OYBA 2OO4A 3MECB 1BQNB 1RCXB 1WNEA 4HL9A 3SCKE 2FJWA 1J5EF 3M8QA 4LQ3A 2CPEA 3SBMA 1PJ7A 5ETKA 1UP1A 1CJUA 4D3GA 1U6BA 2MLZA 2PN6A 3DLGB 4CDIA 3K58A 3MOJB 4B3RF 2JDJA 4CLZA 3ZTPA 5KT4A 1T9TA 3KK3A 3CDEA 2R8GA 1UVNA 1HI0P 4MH8A 2J76E 1YBTA 3C6UB 5K8NA 2R2UA 1S1XA 2VQEJ 4DV2F 1DFDA 3NG8A 2E29A 4FPRA 3MR3A 2YNIA 3FCWA 4AXIA 4ZCKA 3R5JB 2GMJA 4FS1A 1DRZA 3CW2C 4LRDA 3QRPA 4UOFA 4NA1A 4OX9J 1FESA 1RU2A 3R5BA 4PXCA 2NCKL 3QAUA 3LP2A 5F8GA 3RRHA 1RTDB 4L75A 2H5IB 4QBUA 1FTRA 3N6MA 5B7WA 3R6LB 5KFKA 4LR8A 3KYLA 3AXMA 2QC3A 4LF6F 3WIVA 4NE9C 4CLWA 3ZZUA 3N6LA 1S1WA 5D0HA 3W9JA 4ES1A 1PYOB 3RBZA 2CQ1A 5JVGQ 4L3KA 4EO8A 5L1IA 4F0HA 3BPSP 4V19J 1FRHA 3TP2A 2BE9B 2W7PA 1FD8A 3NWGA 5SZTA 3T9ZA 1S4EA 1TMJA 3M2RB 3DLJA 3B54A 1N5YB 1KSPA 2FVPA 5DO2A 1U48A 4TY9A 3L3CA 1TL7A 2XWYA 3NGDA 2PO4A 3HM9A 4DSEA 4M5LA 1TK5A 3KTQA 3BSCA 3I87A 1VQ5S 1P1TA 5ETQA 2DHGA 4NRTA 4IOBA 4R5PB 3VALA 2MZRA 3M2VB 1XTZA 4RKUC 5LOQA 3MAAB 4MT1A 1MU2A 4DEZA 1RWNB 3PW0A 3DKDA 3EDQB 3MM8A 2ZUGA 3L09A 4M5HA 2JSXA 4H4MA 2Y0SD 3PXGa 5K8MA 5J1PA 3KLHA 5KAKA 1YSJA 3MTJA 5ITHA 2DNOA 4X4QA 3KDNA 4H4MB 4U96A 1FFSB 1UZDA 3QWUA 5BJRA 5C24B 3JSMA 2DR8A 3BDPA 2WCXA 2OD4A 2HGMA 3BKUA 3GIKA 3PW7A 2YPZA 5C24A 3GR1A 1CJTB 1D8YA 5HVHA 2XYHB 2CPIA 3W62A 4CM0A 4J7CA 2CA9A 1W2IA 2BKOA 3RB0A 2PI4A 1X4EA 4ECWA 4N47A 3OV7A 1TL1B 2AYEA 1HHTP 1YK9A 2OUGA 4F0KA 1MROB 2UV8G 2B6AB 3CT9A 4LRFA 5C25B 4X4SA 3CD7A 4GMKA 1H73A 2B6AA 2XMJA 3F0NA 2FLOA 5C25A 4W4MA 5H1SV 4OJHA 2C2RA 2IVMA 1J5OB 5HROB 1Y5NB 1LW0A 1F5CA 3DRPA 4OL8A 4PG6A 1HI1A 2NYIA 2F9JA 2FHJA 3BBBA 3OTOJ 4DS4A 3HLUA 2DRDA 1R3NA 3CXCR 1KEKA 1S9FA 4DDFA 1Q5VA 5A0YB 2DIUA 2K8GA 4CRJA 2FVCA 3PRBA 5DQGA 2BE7D 3K8VA 3LWLA 2KFNA 1IN0A 2KVQE 1VIXA 1FRLA 1HBNA 4M63A 3ZO7A 7AT1B 1ZAVA 3CCLS 4K4VA 5KOXA 4C7QA 4B3OA 4FKXA 4NMLA 2UUCF 1TP7A 3DGPA 4J37A 4NEZA 5F3TA 4W98A 4DUZF 3CCUS 1G2EA 5EWFA 2ALYB 1SUQA 2JC1A 2WB4A 4ECYA 2OLWA 5DZ7A 1OWXA 1S7HA 4UZBA 1HNXF 4JI3J 1T05B 1X31C 2HWTA 1LWFA 3HULA 3KLFB 2VONA 2VD3A 2JEIA 3DI6B 4X4PA 1JXVA 2KJVA 4HT5A 2C3YA 4RPFA 2YKOA 3FRZA 3QT5A 4C8NA 3TNVA 4F4KA 2VQFJ 2MQLA 4AD6A 4F3QA 1RT5B 2GC8A 2OPQA 2RJZA 3KHGA 2C3UA 1X9SA 2HSEB 2EBGA 3IG1B 2LU1A 4U7UK 2RH3A 5BYSA 4CP5A 3KWMA 2J0QD 3HVTA 5I3UA 4JI6J 4FPIA 4B3TJ 2HHHJ 1TKXA 3HVTB 3QBCA 1FFWB 3SDEA 1QSYA 3QIDA 1AFJA 2RQ4A 4Z7YA 1IBMJ 2HWIA 3LANA 1FJEB 5CD4H 2M88A 4ZVEA 5B08A 2GIQA 3M9NB 3H4BA 4Y2AA 2KH9A 2HVDA 2CKWA 1F1BB 2KKHA 2J0WA 3KKFA 4WTYA 5KFUA 1X9WA 3TUPA 5F3ZA 2QG9B 4ZP6A 5DZ6A 5A8RA 2HIQA 2E9TA 1YZ7A 3VAIA 1XJWB 2QLFB 4K4TA 1U02A 3PYDA 1ROFA 2NSCA 5KTQA 3DC2A 3SV3A 1R27B 2BUNA 1X9MA 4K4XA 4A8QA 3MWBA 1NK7A 1RT1A 3FSYA 4UF4A 4DZ6A 2CYYA 3O1LA 1QUPA 2A6OA 2KRRA 2X3DA 1X4BA 5A2QU 4QW9A 4A8OA 2ADBA 4CTAB 4LSLB 3C6UA 3ISZA 4O4GA 4RLEA 2RUGA 1RAFB 4DS5A 4DFKA 3IWNC 4N7TA 1CQMA 1X4CA 2R7OA 2YNIB 2YWFA 1JLQB 3POTB 4WU2A 2IY5B 1EP4B 3EZOA 4JV1A 2IIHA 4DPTA 1OY8A 2HVHA 3MCSA 2D3ZA 1S0OA 1ZM4A 1REVA 1WEZA 2YKMA 3DRSA 2FLNA 4ID5B 2VF3A 4PWUA 1YBUA 2XY6A 2QGFB 2IM0A 3DRSB 1RLDA 3EJMA 5E3QA 2YH0A 3JSBA 3T5LA 4QYZK 4F4AA 4RW8A 1CC8A 5B0CA 1KDNA 4HR2A 5AXLA 1IJFB 3BR9A 4J90A 3TARA 1MSWD 2CQIA 3QGIA 4I67A 1T3NA 4MIWA 4ZIVA 3FCHA 1HNWJ 4UT4A 1NH8A 2OPRB 1UTAA 4ELTA 5CD4A 4DV4J 5DQHA 3HHNB 1SJRA 2HRYA 3W8PA 4WYLA 1B4SA 3HSZA 4NYPA 4I7FA 4NYOA 2HVIA 3R6GB 4LRBA 2DEJA 4P73A 2QLJB 2RUSA 3QIPB 4ANEA 2FZKB 3UCGA 4JV0A 2CUYA 2V34A 3OFEA 1EETB 1S79A 3FGVA 3PACA 4DBQA 2JL9A 2GZOA 3MMCB 1FD2A 2CPDA 2RQKA 4CO1A 3T41A 4WZMA 3I6PA 3VQSA 3KLHB 2ZH4A 1TV6B 1U1NA 4RUAA 3DLBA 3T6JA 1DQAA 4CIOA 1WEYA 3DOLA 4X66J 2Z2LA 1WKLA 4NZ6A 3I5CA 2H4YB 4IO1A 3EMTA 1TELA 4DQQA 2P6TA 2JVOA 4WFXA 2BJ1A 3NWRA 2WVCA 3BS9A 2CVIA 3OPKA 4OX9F 2MQPA 2B8PA 2HNDB 3W63A 4CLPA 1K47A 2K7JA 4DOZA 2BACA 4IRKA 4C0BA 2HEKA 1ZS6A 2HVZA 4ZPWR 1L3UA 2FJEB 2AYGA 1S77D 1K0VA 2PEBA 3MD1A 4CZCA 2B7BB 1L5UA 1QSLA 1U26A 1P6TA 3G82B 3OFHA 3TVZA 5K14B 4CO2A 2VICA 4FVCA 2J5AA 5H9EK 3IGVA 3PYEA 4FF2A 2DXEA 3DM2A 4AUKA 2CADA 2Y1LB 3ZC4A 1CLFA 4CNYA 5G0RA 2J9CA 3ILIA 4WP3A 2CG4A 1HNIB 4QIFA 3B6BA 1RACB 1Y0HA 3PR4A 3JYTA 1FX4A 4GKKF 2W9AA 3SMZA 1RT3A 1FVSA 4U8YA 1WG1A 1GMUA 2NYHA 2IRXA 3PJXA 1A6LA 4ZPCA 1ZTWA 3K17A 5CHCB 5HQ8A 2R3VA 1IUJA 2IC3A 5I3QA 1S7IA 1JLEA 1VRUB 5BYRA 1JJCB 2Z57B 3HHLB 1OY9A 3P45B 2YPYA 2B4VA 1KOOA 4KR0B 1T03B 3BB5A 2F3JA 2RD5C 3T1HF 1HQEA 1OYDA 4BCAA 2CPXA 4DPOA 2BR0A 2Y3YA 2C3PA 3MD3A 2OJ3A 1RTZA 2LEPA 3HHKA 1NO8A 2RVJA 5L38A 3RR7A 3ZZZA 1Q8LA 1UWBA 1P27B 4KE5A 4OHXA 5LSLA 4DR1J 2HHXA 3DCAA 1BQMB 1HI8A 2XBPA 3IWLA 1FK9A 1UWBB 3K8WA 4HI2A 4YB5A 3TYTA 4ATNA 4ECQA 2VASA 1N6QB 1CULA 3N5BA 3QRQA 2KHCA 2DGQA 4LT6A 2VDIA 2EFOA 1ZZFA 2LQ8A 3D1OA 5LM7E 1LWEA 2HURA 3NCPA 3EUNA 3MR5A 2V63A 3OR2A 3F41A 2DISA 3J7Z5 2RMLA 3CDUA 4M5DA 5EWGA 2P9EA 1SVDA 3O5TB 1HWIA 3OVAA 1FVQA 1MWQA 1VRQC 3H20A 3HT0A 3NGKA 4DLGA 3SDEB 3JTNA 2YTCA 4DQPA 4DX6A 4BHQA 4WFNQ 4V19X 3FVYA 5J1NA 1B0VA 5EWEA 3FZBA 3IM9A 4OZ3A 4NI2B 3J81Y 3V81B 1T94A 3I31A 2FC8A 4D3HA 1P9QC 3ZNUA 1RT2A 1UPPA 1R8PA 2ZD1B 2R42A 2KXFA 3T1YJ 1RT2B 1QE1B 3GLJA 3Q8VA 1WKJA 2VG5A 3L7UA 1WF2A 4RX6A 2D41A 5ETPA 4CO5A 5M2UA 3OHAA 4A8YA 1URNA 3SCLE 3QMQA 4QR2A 3G8SA 1VISA 1RAGB 3GPAA 1KD1T 1WI6A 4BS2A 2VPWB 4LVNP 5FJ4A 1KVJA 2DEIA 2K3IA 2KB2A 3PHTA 1Q5YA 1T11A 3BR8A 2AZ1A 1S6UA 3GILA 2LA6A 5T7LB 1WC4A 3D6MB 3EPGA 3CCMS 2BRLA 3EXYA 5BR8J 3K5LA 1F2GA 3KLIB 2F63A 3SV4A 2GO9A 1Q78A 4IOAQ 1NK9A 2F5GA 1QAXA 4OV6A 2YKMB 2YQ3A 4CO3A 3VAGA 4RW9A 2KT2A 3BH6B 2RHSB 5F0WA 1T3OA 3W65A 4ENOA 3HFVA 3OL7A 3AOAA 2L08A 1QAIA 3GONA 3DNCA 4B9SA 6FDRA 4LBHA 2B5JA 4GVBB 4KY3A 4DCPB 4RL1A 1BE4A 1OPZA 2CIMA 2IDEA 4UZCA 2B5JB 4GVBA 2HKEA 4LFAF 4NXNF 2AGOA 3HSDA 2ZH6A 2W2OP 2WOMB 2ZBPA 3CULA 3VHQA 1F60B 2UXBJ 2M4MA 2YWGA 1I3OB 1CS4B 2D9OA 4F50A 4J9PA 1FKOB 3D5MA 3MEGA 2OTJS 2EKNA 4AXJA 3TR5A 3IS9B 1RBAA 1FKOA 1Q8BA 2KVIA 3HX9A 1R6VA 2DNPA 2N82B 5GAHU 3NGTA 2I5JA 4TNOA 2A1BA 4L72B 3ZNJ1 5EGYA 4MK7A 4RNOA 4EYIB 4ETXA 2I5JB 3VVTA 2W2PP 5F8NA 2W4DA 3H2UB 1DTTA 4K2JA 1R43A 3JS9A 5BYQA 3WIUA 2BJ3A 3KLVA 4HTIA 4OYWA 2GJIA 4ZVSB 2IMWP 2ZDPA 1S9GB 3M6WA 4TXSA 4ZVHA 3KUGA 3PR5B 4ILRA 3AOBA 3EWGA 4B9VA 2OPPB 3PNIA 4NPOA 4ZJOA 5DDRC 4A8MP 1HWKA 1S1TA 4KQZA 1K1SA 2FIUA 2VBYA 2JRSA 2MTLA 2J0XA 3TX0A 4Y6IA 4LF8J 2YNHA 3FQKA 1YI2S 2C2EA 4WP9A 4QU6A 1RWXB 2VG7A 5D0GA 1SQEA 4CLYA 3AXKA 3CMES 1HWUA 3UNGC 5DS7A 1T95A 1HNZJ 1SIZA 1B64A 3D3BJ 4N8NA 3CE8A 3QSYB 4QZVB 1UJ5A 2EK6A 4ETZA 1NJZA 3CB4A 4C97A 3AHPA 4UY85 2WRMA 3TANA 3RBXA 2EPIA 1JJHA 1XMOJ 1RTJA 5KFYA 3VAHA 4QWBA 1ZETA 4FKYA 4ZPTR 4J9VA 3PX6A 2DY1A 3CIZA 5LJ5Y 4ED2A 4O4RA 3RYLA 5HJXA 3C6TA 4ZCMA 3NBPB 5L9NA 5ETRA 3CJ8A 3GR0A 3KLGA 2DH9A 1S59A 1ZA1B 2LQJA 5KFQA 2ATLA 5D8HB 3G6XA 1U24A 3FDSA 1XWLA 4AFFA 4LF9F 1KTVA 3RR8A 2NZ4A 1JJ4A 1AA1B 4IFVA 2UUAJ 3PV8A 3OL9A 3ZFVA 1OSCA 4HYKA 2HW3A 1C1CA 1SXLA 3IR6B 3KJQB 4P2FA 4U8VA 7FD1A 1NPPA 5MLCV 2MGZB 4F2RA 3QNWB 2GVDA 4ILMA 5J2NA 4DV7J 4LIWA 3F73A 2MQNA 1IWAA 1TK8A 3DGVA 3G86A 4MYTA 2HBZB 4DSLA 2J9DA 4ANDA 3DMJB 2DXFA 2YX4A 1IBMF 2CJKA 3DI6A 4EBCA 1S97A 5FDLB 4F4ZA 3OJSA 2R7QA 1FRKA 3WC0A 3OXGA 3ISNC 1VCTA 2AJ0A 2AIRB 3GIRA 4KBIA 5F8MA 1RT7A 2F8MA 1HW9A 4TY8B 4DR2J 3IAM9 2HQ3A 2GGPB 2XSFA 1S1UA 1G3OA 4OZ1A 3LOUA 1O8BA 2OD6A 2WONA 2KM8B 2XCPA 3W2VB 5I3UB 2PMZD 3OUYA 3L4BC 3M8YA 4FXWA 4DSJA 2CQPA 3BQ0A 1Y5IB 3C2PA 3DYAB 3QGGA 4YB7A 4ZVOB 4X4VA 1S6PA 1DBDA 1V5VA 3BGRA 1RAEB 3CJRA 4DPUA 1XBWA 6FD1A 1JLFB 1Q95G 1LKZA 1TMMA 3A12A 2UVVA 1BQNA 2R2RA 4JV5F 2DNGA 4J9KA 1HA1A 1N8RT 5HO4A 2VG5B 3HHLD 4ZLLA 4F67A 1RKIA 1VR6A 4DR5F 1RTIB 4Q0BB 2QJ3A 1RT1B 4JI8F 4A8FA 2L9NA 3J7AN 4Q0BA 4YMEA 3WDOA 1NSAA 5B0DA 3OHBA 1VBYA 3BDEA 2E5IA 1S10A 2AHOB 2MZSA 3J7YU 3OTBA 2N4CA 4MKYA 2V6AA 4JP8A 1LXNA 4O3QA 1ZTTA 4ZN1A 2RIJA 2DT9A 2QE5A 4CT9A 2FVQA 1N33F 3L7PA 2G1DA 4U95A 2ZKTA 2MHEA 2GQCA 2MQOA 1L3TA 1ZYQA 4JI5J 4IG3B 3LAKA 3AH6A 1ZM3A 1PSDA 2H65B 2RE1A 3V5RA 4WFBQ 1MMDA 1VQMS 4MAKA 1I6JA 3C3LA 2KXHA 5M2PA 3MPUB 4DL0C 4QYZJ 3C66A 3TVYA 1XNRJ 4BLGA 2VFVA 3D2WA 2CQ4A 1RK8A 5KT7A 1WG4A 1R0BG 4NWBA 2V8HA 4V1Ak 5GMEA 3ZZ0A 4OI0A 3UDEA 2NR0A 3F44A 3QRRA 1SJ1A 1HPZB 2CQ0A 1CJVB 3IR5B 3GV7B 3A3NB 3K5PA 4IYQA 5LSOA 2ALZA 4CCHA 4LF8F 4LFBJ 1FNOA 3OTEA 3SCJE 3S1TA 1FXLA 1U6FA 5HQMA 1HBMB 4JI0F 3K59A 3O6QA 1N5YA 2DGOA 4MK9A 2XZTB 3MM6A 1IJEB 1F5AA 3CCSS 3V6DA 2IRYA 1NHKL 3PW5A 3CJ0A 3MMCA 1YIJS 2FJBB 1F2HA 2ZBQA 5DGAA 2HFSA 1H0HB 4E0DA 1SC6A 2DB1A 5LMUJ 2CFXA 5IZHA 2CPFA 4DU7A 4DHVA 1Y9OA 1DTQB 4ZJLA 2MZ1A 1HYSB 4YOEA 1PC5A 2DGSA 2ZWPA 3M8ZA 4CM2A 4QWDA 3A4TA 4GKJF 5RUBA 4LR9A 4DV7F 1KNZA 2HNZA 1MN9A 4WTOB 4DFMA 3BBCA 2HNZB 1B99A 4X64F 5D4PA 2V2VA 4TU8A 3QWPA 4TU9A 4FYDA 2UZAA 3TI0A 3VGVA 2FJXA 2JH3A 4NXNJ 2OEKA 2ZWOA 2DGVA 3W2WA 3T5HA 4L3NA 2XHCA 2BRKA 2V4JB 4QWEA 2AJ1A 2KN4A 2L3MA 1FDDA 2MSSA 3FJ2A 4C0HA 4RU9A 3B82A 1B3TA 1GTEA 4E8UA 1F5BA 3GWCA 3SQGA 5IQ6A 2FY1A 3GJRB 3ENWA 2XQCA 1JX4A 4C11B 5MAOA 2E1AA 2Y8YA 2MJNA 3R5DA 2F7VA 3M8QB 5AJ3J 2Q6BA 1NU4A 5H9EJ 1H98A 4X62J 3KMSA 4B9NA 2QX0A 1NRKA 2J6SA 3WHIA 3U02A 1LFWA 3N0VA 3OR1B 4KH0B 2ASLA 2MLYA 2WBMA 1AT1B 1HNZF 1R0CB 4G6VB 2D3O1 4Y34A 1VYAA 1Y00A 4UUXA 4A47A 1HD1A 1RT4B 3HD2A 4RBVA 2VPYB 4RBTA 5L8RC 4IFVB 5L1KA 1YHQS 4LF5F 2P9CA 2ZH3A 1S0NA 3IBFB 1VFJA 2CZ9A 1WHWA 2Y1RI 1S49A 2QFJA 3LPYA 3CMQA 4A46A 5JJBA 2VOOA 5LT5A 2LQ5A 4WBFA 4Y3CA 4DN0A 2KG0A 3H4DA 3MMJA 5HMWA 4PEOA 2ZZMA 3I5BA 1X5TA 3RW7A 4E2FB 4QPXA 5F8LA 4ZVTB 2IM3A 3N79A 4K5SA 3ILLA 5FDLA 1KP6A 3TWZA 3W5XA 2ZJQQ 3RBDA 2A2DA 2EBEA 4IDKA 5IT9Y 3AFGA 2CQCA 1RQ0A 1PILA 3NRBA 1JKHA 1I94F 4P2SA 4DJBA 2ZHAA 5J2QB 3IR7B 4ES3A 2UUBF 1M0SA 2LLZA 4DR7F 3FUYA 4ICLB 1NK0A 1RBLA 1NK6A 3EGNA 3D28A 2XMWA 1HNVB 3KNAA 3QT8A 4Y2KA 3TOQA 2R7SA 2BA9A 4PG5A 3CDBA 3MM5A 2JWNA 4BBYA 1FA0A 4K0KJ 5IXUA 3GZ7A 4R25A 2H48B 5HATA 2BQ3A 3QAEA 4DPXA 2FJVA 1R89A 1VQ8S 1DHMA 1NBEB 1UFLA 4KTQA 2AJ4A 3UPFA 1E6YA 3D0HE 4XDDA 2FB0A 2QL7B 4LFAJ 1SKRA 1HKAA 3A8IA 1M90T 1FRIA 2IVFB 3RG6A 4NLYA 4DUTA 5B0BA 4XAKA 4DFPA 4ZITA 2C2NA 5B09A 5AE2A 1O51A 1H7XA 3HZGA 3PW4A 4QCLA 1YLXA 1XNQJ 2GVZB 3RJMB 3T9NA 4ZN3A 4KO0B 4JOUA 3AJ2A 5HMXA 2SXLA 1IKWA 1JLGB 2HQFA 4HACA 1RHMB 4HT7A 2EKYA 1PAUB 2F40A 5EUHA 4DV6J 3RB3A 2QTWA 3V4IB 2JJ4D 2ACYA 4P72A 4RR5A 1JIHA 3KLIA 4I6WA 4TLRA 2JZ5A 1URRA 4FP9A 4A8SA 5HVFA 4IQMA 2BKNA 2CQBA 4HHHA 4ZMMA 5KG1A 2QO3A 5E3RA 3B78A 5GADU 3UCUP 5HAOA 4YUDA 1ZPWX 2XI3A 3FK4A 4WE1B 3EXCX 2R8HA 4K5RA 4I2QB 3SFGA 1TL3A 3PCOB 4OX8A 1JLBB 3PDNA 5EHHA 1IKVA 5A0YA 2I0XA 2IJRA 1A0OB 5E7OB 3A3PB 2UUTA 5IM0B 2DR7A 4C8KA 2IAJA 3EVOA 3U7JA 4RZRA 2KYZA 2GW8A 2KRBA 2A10A 2WOMA 4USTA 3J81U 2BDPA 4IKAA 3JXOA 4LJMA 3U1LA 1NKEA 4G1QB 4I7FB 3GTYX 1NHVA 1GNKA 2WK4A 4WP8A 1CJKA 2BM0A 5D4OA 2G2ZA 1FX2A 5KG4A 4ZHRB 3MM6B 3L95X 2ZEJA 2AW0A 1RSCA 3SSRA 2ATCB 2WAQD 3PFEA 4PWWA 4DR7J 1JB0C 1SC1B 2UXCJ 3P3DA 3ZZYA 2M52A 3ENQA 1DTTB 4LVOP 1SH3A 2NQPA 2EWHA 1WEXA 4QR0A 1TKTA 1Q81T 5CZXA 3SIPB 2BV3A 2GHPA 2Z2YB 4FYWB 1KRPA 3DXSX 4NEYA 3AB2B 4DQSA 3UD5A 3HHDA 1FHTA 1VMBA 2V0NA 4F3MA 1LFPA 1I51B 2RDDA 3T1HJ 4OLOA 2E7WA 3SXLA 3Q8PB 5E3PA 2HNDA 3EDRB 1QJHA 3VAKA 1AUDA 1DZ5A 3PJWA 9RUBA 2CQ3A 5CYMA 4HH0A 1HR0F 4ED1A 2EEYA 1NPRA 1S6QA 1U09A 1AZSB 1GH8A 1PIEA 2EVZA 4DI6A 4FS2A 4X4UA 1UAWA 1EJ7L 1NJXA 1EIYB 1TTHB 2BJ8A 2BJDA 1G4CA 4K8RA 3WBZA 4DSFA 3IGNA 3ZZTA 1U49A 4DR4F 2L9DA 3LUYA 3J80U 1KFSA 1JWWA 2RDJA 2KU7A 1OYEA 3IAS9 4WKRA 2VB6A 3PM9A 4F0MA 3NBPA 1NDPA 3BKTA 1NZAA 4OYIA 3O8WA 4YDXA 5I3PA 2Y1JA 2E5LJ 4DL5A 1LOUA 2X51A 3J7YI 5KT3A 4X2BA 2PA8D 1FRXA 3NGRA 1RAHB 1LEOA 1CQNA 1M5HA 2HBQB 4J9UE 4DUZJ 2NREA 2XS7A 2PEHA 4X4NA 4DL3A 3BGUA 1VQYA 3OW2R 1XERA 1Q8IA 2V2ZA 1T03A 1G1XA 2IRUA 4IFYA 2DGXA 1R31A 1NK5A 3PY8A 3BGLA 4LREA 1T7PA 2W9BA 3SZ2A 4IFYB 3FBFA 4QOTA 3SQOP 2QA2A 3UDCA 1U8WA 2QSFA 4M5MA 5GMDA 2XYPB 4URGA 4FBUA 1U7LA 2WSCC 3OXLA 3THPA 1PG5B 3CSKA 2V8PA 1YX2A 1M5PC 3NNHA 3EPIA 1ITPA 5HMZA 1TQLA 5H9FK 1YTYA 2QFIA 2W7AA 1JKHB 1RISA 2HK3A 1JK9B 2GMLA 3SCIE 5KG2A 2MZTA 5KFEA 1IVZA 3FBCA 4WK1A 4LF1A 5J2PA 4NLRA 4ZLPA 2JVRA 2C22A 2UU9F 3Q2TC 4MKVA 5KFLA 4P9SA 4B9MA 4DMZA 4XIUA 1FDBA 1R7IA 3AJDA 3KK2B 2KFYA 1E6VB 4DR6J 3MMAB 3LGNA 3BBFA 3RZAA 4I6AA 1K8AT 3PRVA 4R0JA 5DM6Q 2NXEA 3QZ8A 3N28A 3MEEA 4CO4A 1UMJA 3V81A 1JLFA 4DR4J 1NZ8A 2KXNB 2BMBA 1TVRA 3MAAA 1BY9A 4G65A 3HO1A 1NPKA 2ZD1A 2AYMA 3DOLB 4ILLA 1SH2A 1LK7A 2GO8A 2B4OA 2AMCB 2VL1A 3TA1A 1WF0A 2APOA 2MQQA 4Q8FA 2CJQA 2CNNB 2VZ9A 3NL0A 4KV8B 1Y11A 4KPCA 5F0UA 3GFXA 3MCMA 3HCXA 2JEGA 2AV5A 3MZIA 4Y2CA 4JI7F 1Q16B 3L9ZA 3V4IA 3CDAA 5LMNF 3M9OB 3GYNA 4JUZA 5IOLA 1TL4A 1VQKS 3Q2SC 1SIWB 2HQGA 4OI1A 1LNQA 1R8AA 3KLEA 2MY8A 2UVRA 2AT1B 5C42A 3PX4A 1MROA 1QDUB 1RI7A 3H5UA 4N76A 1SV5B 2HZCA 5KFWA 4L74A 4QJVA 1LWCB 3MHYA 2LXIA 3M8PB 3UDVA 3DDIA 5DM7Q 4AL5A 2YNGA 2MJUA 3ZZOA 1J5OA 1KQGB 5SUHA 1NH7A 3BH7B 3T1AA 5M2RA 2YNGB 4EBEA 5G0RB 1KLMA 1WSVA 1Q86T 3PRDA 2E1CA 4DL4A 3G8QA 3SYZA 3NAHA 1FTCA 5IM0A 2AU0A 3R5AA 2FLPA 2JEJA 2AEJA 1NMEB 2ACMA 2B9YA 2FUG9 3D67A 4TN2A 5KG7A 3J7ZT 2A6MA 4PPZA 3UFCX 3VCDA 2OTLS 3H98A 5AE3A 2ILZA 1VDHA 1RAJA 5LXRA 1JLEB 1VRUA 1WWHA 5GMKa 2V4QA 3V6JA 4DSIA 1P9YA 4B3OB 2UVWA 3NNAA 2LU2A 5KFTA 3TJ9A 1M1KT 1RWWB 4UUWA 4B3SJ 1RTHB 2NPIA 4PG7A 3U1MA 3AOCA 2DR5A 4EEYA 5L9XA 3DRXA 5EDWA 2OMOA 4UW2A 1YVFA 4OZJA 2RF2A 4PR6A 1KBRA 3ENVA 1BQMA 1FDAA 2VC0A 3D66A 4RW4B 4U6PA 2BQUA 2ASDA 4M5JA 1WI8A 1WC3A 7FDRA 4EUVA 2AD9A 2LXUA 1C2PA 2PFDA 5L1LA 4EI2A 1LWEB 4Y0FA 2QN6B 3HJFA 1C0UA 2OPPA 3FQLA 4NLPA 2O67A 3D7SB 4OYMA 4OZ5A 1YITS 1GK8A 1JXLA 1WD6A 1ZBTA 4RUBA 5F8JA 2DD8S 2MQMA 4ITSA 3KDOA 3VR1A 2DRAA 3OTDA 1SL0A 1BGXT 1K44A 1TKXB 4KHPF 3E8OA 3TUJC 1SBRA 3MURP 4LF6J 4HI1A 1X4AA 3ULHA 1CVJA 3BZQA 2E1MC 4WFZA 1XN9A 1C1BB 1R8BA 3G6YA 3G6VA 5L46A 2EXUA 2PSZA 1FNMA 3OVSA 3Q8QB 1NB7A 1YWXA 2XMVA 1RWPB 2EFGA 3NKYA 4K7QA 4H54A 1RTJB 5IWAF 3MGJA 3JQJA 3TAMA 5LL6d 4DV0J 5F8HA 1HQUB 3LO3A 2ZVIA 1CJUB 1OPIA 3Q8YA 3W60A 4WWSA 4XK8C 4FN5A 3W7BA 3M2UB 2KYXA 4ZLNA 5HLFA 1U47A 4X4OA 3KK3B 4KGXB 4LSLA 4O4GB 3MR6A 4I6YA 1X60A 3ZXWA 2CJBA 3MPVA 2YVSA 4RWXA 3MUVP 5HP1B 2QA1A 4B3RJ 2XMKA 3FZ2A 3NMRA 4PQUA 4ZCIA 4U7CA 1N5QA 2A2CA 4RW9B 3FNNA 4NLTA 3D6TB 4LBPA 1RP5A 2P8IA 3AT1B 3HD1A 4ZPVR 3ZTRA 3I55S 1B7FA 4PWDA 2GVDB 3HKZD 1SJFA 2ABYA 2ZZNA 3FSXA 2MZQA 2YNFB 3LAMA 4UTGA 5KFNA 2LEAA 2DGTA 3PFOA 3Q8RB 3GU0A 1M1HA 2W25A 3VV2B 3Q83A 2U1AA 2M7SA 2HFNA 2JLEA 5IS2A 3M32A 2FZCB 2C2OB 1S1WB 4GO5X 2DK2A 1RWOB 2PT0A 5J2QA 3RRGA 3K0JA 2Y9HA 2VJVA 4UQTA 2EFVA 3CCZA 1N5VA 4IH6A 1N4LA 2DNKA 3FRYA 4GRSA 4NYZA 1Q79A 5C5JA 2ZNYA 4DV6F 2HHVA 5CH7B 1DQ8A 2GCFA 2R9LA 2CNKB 2MSTA 1EQMA 1GXLA 1RXOB 4O0NA 4QIVA 5D4LA 4X62F 3DYAA 1GEHA 4O44B 1QTNB 3A8EA 2FDNA 4OZLA 2V4RA 1TVRB 1D9DA 1PO6A 1IBCB 1VBKA 2RKIB 1JLAB 2V68A 3CCES 1VLYA 1MMNA 1GMVA 2B4UA 2Q3PA 2PA3A 3DU6A 3IMQJ 5B0AA 1S0VA 3KMQA 1IR1A 1X4HA 3US5A 2AWZA 4JV2A 1GMWD 1J27A 2DHAA 5AT1B 3OSNA 2VPXB 2CWXA 2W01A 3W5ZA 3JAMY 3QJPA 5B0FA 2KZZA 1QTMA 5AXNA 1CJTA 1SCJB 4O3SA 2I1RA 2GMHA 1NDCA 2DHSA 5J1EB 5KFPA 4TQRA 4B3MJ 4AE5A 2WVBA 4X66F 3AODA 1RAIB 4OYAA 3HVWA 4N41A 4HLBA 2UP1A 3K2YA 1WOOA 2MKHA 3PJ9A 5HL7Q 3GCWP 4F7VA 3X1LB 4DCJB 2FVSA 1RYSA 2WVEA 3Q0AA 2DO0A 4YP3A 3UQSA 3K5OA 3RB6A 3T6BA 2GHWA 1JNRB 1LW0B 3DRPB 3QO9A 3LPEA 1TL3B 1WC0A 4F3OA 3S01A 4DL6A 4YY3F 1TFWA 3NLCA 1IKVB 2KL8A 2G13A 3TZZA 2MKIA 2NUUG 2VOPA 1RWMB 2DNLA 3CEDA 3M30A 3QPIA 5KG6A 2DNRA 3W61A 3MOZA 3CCVS 2E7XA 1EAYC 3F56A 1D0EA 2IC3B 3CJSA 4LF5J 3MFIA 2I8EA 2Z56B 4JI2F 2R7UA 3I32A 3OVBA 1H2UX 3GFZA 1CG2A 1D9FA 2QL9B 1NAQA 3FMBA 2RF2B 3BEGB 3V6DB 1NUEA 2A0FB 2B9XA 2Q43A 4CH0S 3QATA 5I42A 1IM6A 2ZH8A 4A8KA 4JI5F 2HZVA 3MAQA 1TKTB 2ZDOA 3M6UA 1DTQA 4I69A 1DQ9A 1HYSA 1CULB 3LP0A 4YR0A 3KJVB 4NCBA 2ROEA 1C0UB 4UQGA 2V67A 4A8XA 3KJVA 3PZPA 3OL8A 2UUBJ 2HHUA 2WONB 1ZPVA 4M5DB 3ET6B 3H7HB 4CQ1A 4OJGA 4RBUA 2DYAA 3ET6A 1NSPA 1YJ9S 2YKNA 2BEFA 9ATCB 2VUGA 1U45A 4MYUA 3TVKA 2HMIA 3I5AA 3OL6A 4HHUA 1NLKL 4X64J 1NK8A 5HK4A 4WKYA 1FKPA 2HIYA 1F3FA 2FTRA 2QLXA 1X4DA 3SQGB 5A8KB 4LF7J 3NGSA 3P4UB 3MECA 4G1IA 4A48A 8AT1B 2ZJRQ 1M5KC 4LSNA 3SFUA 3TJ8A 4JI4F 1N36F 4CLFA 2HBYB 2I2YA 3PO4A 1FO1A 3BSAA 3DLGA 1UETA 4B3TF 3FEYB 5IT0A 3OR1A 2GFFA 4USIA 2VBXA 4W90B 4CT8A 2D3UA 1ACMB 2CPJA 3KJFB 3BN4A 1YZ6A 1X5PA 2W8LA 3P6YC 2Q79A 2VU5A 1KTQA 1TKZA 2QT7A 4QR1A 4TLQA 1RWKB 3MM9A 1TKZB 1HHQA 1RHKB 3C19A 3GIJA 2GAGC 4XO0A 3X3UA 1JQGA 3DRRB 5IWAJ 4ZS6A 1UVLA 1QM9A 2BQRA 4OHYA 4PWDB 3MF5A 2DH8A 1T8EA 1X8DA 3K89A 1DARA 2YWEA 3C16B 1G6BA 3LP2B 3RRKA 4KYZA 2K3KA 3A3OB 1SKUB 1BQXA 1X7VA 3GMGA 5FD1A 5H9FJ 1QAJA 2J9DE 1PBUA 2LFVA 2Y1IA 3IBWA 2XLJA 1S0MA 1NJIT 2UUAF 4KJIA 4WZQA 1FEEA 4O3PA 2BXJA 5DETA 1OSDA 2J7KA 3R3TA 2OPRA 2WB1D 5FLXY 2WBRA 2G0JA 1TAUA 4LFCF 5KT6A 3ADAC 4PZVA 1ZM2A 1LXJA 4R8UA 2FHJD 4GC7A 2AEFA 2GNKA 4P10A 3QIPA 2C2DA 4C8OA 4KHRA 5DLGA 4C0OC 3VGTA 4USHA 4OYOA 4YEAA 5F9NA 2XO6A 2E5JA 4XPEA 1DLOA 1IWGA 3EZ5A 3DOMA 1MU2B 1GMWA 4KC5A 1PGZA 2C3OA 4LSZB 4F4YA 4DR5J 2F1FA 5A2QY 1R0AB 1NSQA 2XLIA 1FKAF 2LDYA 2HQCA 2IM1A 3BYRA 3CVKA 1R0AA 1NNDA 1FEHA 4UOHA 4WCEQ 1YJUA 3PO5A 1QVFR 2FD2A 1BLUA 3Q24A 2R2TA 4B3SF 4Q43A 3PKMA 2LQ9A 3MEDB 3KG0A 3Q23A 1SJ3P 2OAUA 3R5CA 2NXUA 4B08A 4KRWA 2ZZTA 4MIBA 4ZLJA 1WF1A 4ZVPB 4YQWA 2BKPA 3G4SS 3QGHA 1PAEX 3FBBA 3R7BB 4OYPA 3E3XA 4WXOA 4DR6F 4KKOA 5ADZA 2KM8C 3KLEB 3TA2A 3TAPA 4MTPA 3G9CA 1XR7A 4DX8H 2OSRA 1RCOB 5HI7A 1A7GE 4F2SA 3DLLQ 1Y10A 1HBUA 4DV1J 4F4XA 2BZ2A 4RW7A 2BE2B 2DCLA 2LECA 4F25A 3LP1A 5C2CA 2XM3A 4DL2A 1VQNS 3N5FA 3DM2B 3UR0A 2VDHA 1WUUA 3LP1B 5IC6B 4RW6A 1QD1A 4K4UA 2D9PA 5LJ3Y 4K50A 2ZBRA 3C14A 1T02A 4DR3F 1QSSA 5AXKA 1C4AA 4M5IA 3KLGB 4G1PA 1FDNA 2RRNA 2IJFA 2IAJB 4FF4A 1U1OA 4JI7J 5HQLA 3NEKA 3D0GE 2KDOA 1WHXA 2FLLA 3L7OA 2Y8WA 2F8HA 3DGPB 2BM1A 4NMXA 4E98A 3CUNA 4NLXA 2QA4S 2GJ2A 4YN3B 3BO2A 4EBDA 1N48A 2W24A 2W4PA 5HVGA 2R8IA 2D3OR 3P5TL 4ZHRA 4C8ZA 1V3SA 4RNHA 1S1VA 1UCNA 4NX9A 1RLCL 1S72S 4OX7A 1S1VB 1R8HA 2OFHX 3SSSA 4PCQA 3PYGA 3I56S 3OXFA 3PEHA 2YX1A 3Q8SB 1HMVA 2WSFC 3TZYA 2IA0A 3ISND 2QMXA 1AB8A 1KWMA 2PMWA 1Q53A 4S0MA 1FRMA 1ZH5A 3KOAA 4NLSA 1YDLA 4USMA 3I4PA 3CC2S 4DCOB 4JI3F 3TZWA 5KOWA 3MPWA 4TY8A 2R7XA 2UU9J 3QGPA 1F9FA 1RT5A 4KSEB 2NS1B 2VKZG 2RS8A 1NDLA 2AEMA 3IG1A 4KFBB 4TQSA 4EO6A 4KIAA 2W8KA 2YX7A 1CSJA 2UUCJ 3MPDA 1SQGA 4UOGA 4AL7A 3BGFA 1LW2A 5I42B 2ZKUA 4DXLA 3AAWB 1FT8A 1E6YB 1RAOA 4ZVUB 2ZM6F 4Q44A 1S6QB 3D6FB 2ZH1A 1FFGB 2C28A 3W1YC 3IRWP 2HNYA 1IM4A 3JQKA 4K4WA 4RUCA 1UW9A 4LSNB 1AFIA 2G4BA 2CDQA 4U67Q 3IBCB 4IH7A 3M9MB 2ZOFA 1RUSA 2DJWA 2I9SA 2LP4A 3TAMB 5A8RB 3OTOF 1QE1A 3H5YA 2DPJA 1VQLS 1KS2A 3CD0A 3BYPA 1W26A 3GFHA 2HHQA 1AUSL 3R27A 4DL7A 1GXTA 5L39A 1MWZA 2HFZA 2VC1A 2QMWA 3G87A 4ZP9A 5ETSA 4DX5A 2C2MB 1U1PA 1KC8T 4U9RA 5U47A 2LKZA 3R97A 3QYYA 3H59A 5HBMA 2DGWA 4B9UA 1RB0A 4P2XA 2D69A 1HLWA 4NLOA 1N34J 1VQ4S 1RTDA 2G9OA 5FLXU 1REVB 2DH7A 4PG4A 1IR2A 2NXNA 1XMQJ 1PBAA 1M5VC 1WC5A 2DNYA 4FYVB 3EICA 2FJDB 2LDIA 1BWVA 1PYTA 3KJNB 1U1QA 1BHNA 4WF9Q 3CGIA 4IH5A 3UDLA 4DZDA 2MXYA 4ZVFA 2F4VJ 2JLFA 1VHIA 2LVWA 3M32B 1CEZA 4EZ6A 1AYEA 3E2EA 1H7WA 3H0PA 4PUOA 1VBZA 3R1LA 4DV5F 2ZHOA 2W4CA 3OTCA 2GA7A 4USUA 1I94J 4YY3J 3R2CJ 4DPWA 5KFJA 2MYFA 1U0HA 2CPHA 3G8TA 1KQSR 1J2VA 3MMAA 1GT8A 2F65A 2H3EB 1VBXA 1SKWA 2HHWA 1K9MT 3GSDA 3ILJA 2OGUA 3NGUA 4DV3J 4CNZA 3SSQA 3P8BB 3W64A 3JTOA 4O0IA 2N3OA 3BSOA 1XNQF 3ETMA 1X0PA 2VIHA 2XYGB 4ZVQB 4ZA1A 1GX6A 1YKWA 5KFIA 4AQYF 3GSIA 1YJNS 4IOCQ 3MEDA 5ETOA 1VC5A 4PRFA 4M5GA 4PXBA 1MG7A 2J7UA 4ECUA 2FGCA 1KONA 4DFJA 2ZBCA 1NHUA 1VQ6S 3IN5A 4FXDA 1NCLA 1WDDA 2GX8A 2FHKA 3NAIA 4LIRA 1TUVA 5DG9A 2EFPA 2OP5A 2P9GA 4KPYA 1MWYA 2XMUA 4EU0A 3QZ7A 4CO0A 4IR9A 2AGPA 1HBOB 2M3DA 5C42B 5DQIA 3UE2A 5KFOA 4Q2LA 4PABA 1SV5A 1HFEL 2B0GA 4RWWA 2OKQA 2H54B 4C11A 2YKAA 4ED3A 1LWCA 3U27A 5CAAA 1F6TA 1XK8A 1U1KA 1N56A 4O3RA 2ASYA 3CJ5A 3CJ4A 3M8WA 4JB8B 4OIXA 3QQCD 3CPWR 3H25A 3TUZC 4OZNA 1ELOA 3H40A 1S76D 1N36J 2VV5A 3U1NA 1R6YA 3C14B 1DAXA 1VK3A 2CJXB 2NXJA 3GYXB 3NS5A 4CYUA 3R5GA 3I0RA 4QPTA 1FJCA 2CVEA 4LF7F 1F9EB 1YRXA 2Z2ZA 4N5SA 2RQCA 4FDFA 1PCAA 1RT3B 2DR9A 1RT4A 3UD3P 4KAIA 5GAGI 2I38A 5CYQB 5DG7A 2HRTA 4ZVRB 2F4VF 1O5JA 5CYQA 1Q1KA 4ZP7A 2AX1A 2DKOB 1KFDA 4K4SA 2HFOA 3CNQP 3VZHA 1R8CA 1T9VA 1N52B 3N01A 4QYRA 4ER8A 5GAEI 1VRTA 1UKUA 3N4WA 1LWFB 3KLFA 1RWVB 1U0SA 3D1HA 4KT0C 3HI9A 4CWBA 3GIIA 4YHHJ 3DMJA 2AJQA 3AQPA 4ZPBA 3G2XA 1AXQA 4ZKAA 5KG5A 4P71A 4RW4A 3NMAA 1FF2A 1Q4RA 3HVRA 2RDIA 5JVHQ 3CMAS 1N6QA 2BW7A 2XSJA 4NOHA 4TYAA 2HG4A 1PYSB 4HTJA 5JMNA 3CCJS 4PKDB 1S9EA 1HD0A 2GGPA 1L3KA 2D7SA 5CZVA 4C2MA 4NLVA 1NEEA 2OFGX 2Z58B 5FIIA 3PW2A 4JI2J 1KHVA 1KLNA 5KT5A 1E6VA 2E7VA 1LW2B 5I4MA 2ZH9A 3CIMA 3HDSA 4FYYB 3TEHB 1F3VA 3GV8B 4DR1F 1RHUB 1XIQA 1XMBA 2BJ7A 3UNYA 2EC0A 1V6HA 1NKCA 4C3MA 3PVXA 4QIEA 4CLLA 3PIOQ 3ILOA 1WKKA 4NI2A 3MUTP 2OH2A 3CCQS 4RJVA 2E66A 1VQ7S 2JC0A 1APSA 4DF4A 3I9V9 5A6PA 3KXDA 1G7CB 4NASA 1VJWA 5T41A 4RNFA 5J2MB 1RA6A 4DV3F 1D1UA 2PI5A 1QY7A 5D3GA 2MQ8A 1MLAA 2KHDA 5HLFB 2IFXA 4Q2MA 3EVWA 1SC4B 3CJTA 3M8SA 4PYAA 4C48A 2CNOB 2V50A 2B8QA 4NRUA 2JHEA 4USJC 1O0PA 2FC9A 5D78A 2ZVSA 1OQ3A 3H5XA 4P7VA 2HRUA 2IMOA 4C6AA 3M8PA 3D3CJ 8ATCB 5AJ3F 1RA7A 1QUVA 5D6GA 2OMLA 3DOKA 3E01B 3NP5A 3NS7B 3DN9A 3MMBB 5B0GA 4ZJQA 4L73A 3W3SA 3HXMA 4I2QA 3DLEB 1WELA 4HH1A 3MMBA 4FNHA 1SB6A 3O3LA 1EARA 3R7SB 3G6ES 2VKRA 2YQ1A 5IV3A 1HIYA 3IO1A 2W9CB 1VC6A 2WVDA 2IM2A 3FKBA 1CC7A 4QU7A 1CS4A 1FWPA 2V8VA 1YGYA 2W9CA 1H38A 1FJGF 2BJEA 4CLSA 3BM7A 3H8YA 4G1QA 3J80Y 4FBTA 1HWJA 2DIVA 1UEKA 4WFYA 1EX8A 2FPHX 1RTHA 1DY3A 2E44A 2J8AA 4QIGA 4GKJJ 2VFTA 3DRYA 1SH0A 3I4HX 4RNMA 2VPZB 1XQIA 4K4YA 4ZPAA 2X7IA 5F9LA 3V6HA 2AJFE 1PJ6A 3M2VA 3TUIC 2OPSA 3M6XA 2EG2A 1C0TA 3LWMA 3ZZRA 1NDKA 3CJ2A 3I82A 3EGZA 1S1TB 4OMFG 4DV5J 3K5NA 1YJ7A 4Q7AA 3G71S 4JV5J 2ZH2A 1N54B 2ZM6J 1TKDA 1PKUA 1W2BR 3GP9A 1LWXA 3K7RA 2N3LA 3PHEA 3PYFA 1HNWF 1WSRA 4ECXA 2HHHF 2NLWA 2DCUB 3R7NB 2H5JB 4KHMA 3A13A 4DN9A 2KT3A 2XY5A 1UVIA 3FFIB 3GV5B 2EFNA 1TK0A 2E9ZA 1TFYA 1HBOA 2E5HA 4X84A 5IFMA 3JSRA 3RU0A 1XMQF 4BC7A 1SL2A 1H2TZ 2G2YA 3MI7X 3H90A 5IV4A 3B4DA 2VQFF 2HQDA 3T5JA 4OJ3A 2WW4A 5HROA 4USVA 1AROP 2XMMA 4RNNA 2Q1LA 3MXHP 1N33J 3C6TB 4HDGA 4N56A 3JYTB 2RU3A 1RT6A 1HW8A 4H4OB 4CYUB 6AT1B 3TAQA 2QLWA 5KFRA 4QIWD 4WFAQ 2C42A 3HVAA 3MM7B 2VFRA 1M5SA 1X4GA 2G0IA 2PE8A 1WDTA 4I1TA 3VWSA 2UXDF 4IO9Q 1HBNB 1U6ZA 1Q8KA 5JUMA 4MKAA 5HP1A 4OLPA 3HHLA 5HJYA 2A18A 4NA3A 1KVIA 4DG1A 2XMAA 1EKSA 4J9QA 3AA9A 3TX8A 2Q66A 3VQTA 3LGMA 5F41A 4H4KA 4TYBA 4J9RA 2UXDJ 2DXDA 1TR0A 1SUQB 1O6XA 2IYIA 3GJQB 2YNFA 3AY0A 2ZE2A 1T9XA 3VGUA 2HGNA 2X1FA 4FVMA 1HMVB 1LQ9A 1RHJB 3I0SB 4F04B 2ZE2B 2YQ0A 2YKPA 1U4BA 1ICEB 4BDPA 2VH7A 2ROPA 3DLKA 2R7TA 3QJJA 2HFUA 1GFWB 2XSJB 3EZUA 4NLUA 2Z4PA 4IDKB 1BMQB 2DHXA 2DNQA 4HEA9 2W7OA 2RSQA 2XS5A 1YG0A 4L76A 1Z4UA 3KHHA 5DLFA 2IBOA 3AJ1A 3C15A 5IT4A 3OJUA 4WXWA 1ZA2B 2E1RA 4KFBA 4DR2F 2AGQA 3MTKA 1N0VC 2CPZA 3EGVA 3TZXA 2N7CA 2FJAB 3RAQA 3MM5B 4AL6A 3LH2S 4LFBF 3D6HB 3BSNA 3S6EA 2CQHA 5ETLA 5IC4B 1H72C 2QV6A 2GJFA 4FNIA 2U2FA 1SPBP 1RGVA 1T0TV 2HHPA 1OQ6A 1FWLA 3MEEB 1Y4ZB 1S6PB 1TAQA 3BGRB 1FKPB 3BQ2A 2UUWA 4NLWA 5CXTA 4QW8A 1VLOA 2VODA 2HFVA 2M9KA 1WORA 1RTIA 2W2NP 2ZOGA 3NXZA 2UV8A 3DU5A 3DDNA 1HHSA 1MW7A 2DR6A 2GQ2A 2J6TA 4U7UD 4J5OA 2XTJP 2ILYA 2HS0A 3FCVA 3JQMA 3LGHA 1DJ0A 3HHEA 4KV8A 1W7WA 3ITHA 5E3AA 2QL5B 3EVMA 1Y3JA 5BXIA 2A3JA 3UVJB 4CLKA 3CC4S 4NLGA 3DLHA 3ITHB 3CJQA 5IT9U 1ULRA 2BANB 4M94A 3BGOP 5E0OA 1VQOS 1IKXB 2HPUA 1I5OB 2LEBA 3EX7B 4FF3A 2K06A 4ED7A 2C1EB 2DGUA 1UFKA 2IPOB 1UA0A 5HBMB 2MKJA 4UY8T 2GAHC 3DRRA 4JI8J 2CZVC 2HS4A 2ZJPQ 2J0SD 4OI2A 3D9BA 2CDRB 4ECZA 2ROGA 1BWEA 1UPMB 3VVUA 1KLMB 2MY7A 4MK8A 4RW8B 1HWLA 1OS5A 2YWKA 4RO0A 5K20B 4W92B 3LQVA 4NCAA 2CXEA 3WX8A 5KFMA 1FI4A 1TZ0A 3I9ZA 3M30B 3OD2A 5F8IA 4OI6A 1RHRB 1X4FA 3D4JA 4ZVGA 1GTHA 3TQ1A 3ICLA 1D8ZA 2H1YA 1HPZA 3ONQA 2F9DA 4F36A 3J81j 4J91A 2J9EA 3RBEA 3RTVA 2DNZA 2DVIA 4MMOA 3EYZA 2ZUAA 4ED5A 1BXNA 4R8UB 1RABB 2CJYB 3IS9A 1ZOTA 3CO9A 2VQEF 1HBMA 4FF1A 5DRKA 5HANA 4Z7CA 5BR8F 4ED4A 2ZH5A 4Y28C 4ELUA 1KVKA 1K73T 1REGX 4C8LA 2E9RX 2XB2D 1V3RA 3SEOA 1FXDA 1ZAWA 2OPSB 3DOMB 4DX7A 4M5KA 3CCTA 2BX6A 1C0TB 1WHYA 3GJSB 1LK5A 1TV6A 2DNHA 1RWUA 1UJ4A 3LP0B 4P74A 4J9OA 4LR7A 4ID8A 3PG9A 2KO1A 3IRXB 4URSA 3WX4A 4C3LA 4TU7A 1SJ4P 3UR3C 3MFHA 1KR4A 2JFDA 5ETVA 3IRXA 4XTTA 3KFWX 2V9WA 5K5MA 4ZCLA 3NNCA 4FXVA 2XG8A 2MDAA 3IC1A 4USKA 2YNHB 4LBIA 4CLUA 2YKNB 1KKHA 4LQ9A 3UN5A 1N5TA 1GX5A 4JYAJ 1HARA 1XR5A 4J9SA 2VG6B 2ZOMA 5AE1A 2CPYA 4B17A 3C46A 2V4JA 2XC9A 3BO3A 1Y3KA 1AZSA 4BWMA 3GIMA 4HKQA 1NM2A 1IQZA 2QEXS 2QMUB 4CI0B 5K8PA 1XC9A 4O23A 5E33A 3BREA 1M1GA 2RU9A 3HFKA 5EX3A 3QT7A 2PGCA 4ALZA 2FGOA 3GB0A 5IQQA 2ZNZA 2XGQA 2AQ4A 5A8WA 1N32J 2QYGA 1RT6B 4H4OA 3N9UC 4ANCA 1IBKF 2RHQB 2DTJA 4YHHF 4DV2J 4J9MA 3M2UA 2E5GA 5L1JA 1TUGB 5THWA 3CD6S 2FY8A 3KK1A 3GFYA 2FYXA 3TW0A 2B7CB 2KI2A 1B70B 2QIFA 4Y2MA 3IXQA 1QVGR 4LUBA 4ZIWA 3KK1B 2G1HA 2H51B 3UN3A 3MDFA 4C3KA 1QAYA 3GG0A 3G96A 4YB6A 3ZTQA 4Z37A 2QRRA 3GJTB 3OBIA 2IYGA 2DO4A 4YR3A 4FZVA 1C1CB 3UO0A 3RW6A 4X65J 5CA5A 3R2DJ 2HVEA 5C2GA 3M7VA 2W9BB 3VTIA 1WOPA 5KFFA 4OFZA 3V2UC 3AD8C 3HF5A 4NXMJ 5LXYA 4UOCA 4WIQA 3B4MA 1VHFA 2OEMA 2O66A 2FQQB 1FK9B 1D3WA 3FMWA 3GCXP 4I4BA 4ED6A 3A1YG 3VAMA 5DDQC 2P6SA 1RT7B 5KFDA 1VI7A 3M05A 4DQIA 3QJLA 2COLA 4I2PA 3V4MA 1HNVA 4MFBB 3MPYA 4Q45A 3O2IA 4EYHB 4EMDA 4JI1F 4DUYF 3MAHA 2H9ZA 2IJNA 2YWWA 4G3IA 1PC4A 1RYRA 3QFHA 4O3NA 1KQKA 1UEVA 4O44A 1N0UA 2L41A 3OSPA 1UVJA 3Q8UA 2ASJA 4AT1B 3ZTSA 3PIPQ 5D0EA 2CJ9A 4OYXA 1JLAA 2NUHA 3HPOA 2M8DB 1N5SA 3LA0A 4JYAF 2GS8A 3LW5C 2QSWA 2MKYA 4PAAA 2J7WA 1IKWB 1JLGA 2POKA 4HACB 5J2MA 2NZCA 2C2ZB 4IRCA 1EQ0A 2EFQA 3NY0A 5KFVA 2CNLB 3Q89A 3CD5A 5T7LA 4CTAA 3CJ3A 2LMIA 1YJTA 4KKOB 5J1EA 2V69A 1SI9A 4OJ1A 2AP6A 2QZ8A 4GKKJ 3SI8A 1JLQA 2H5EA 2PDAA 3FEXB 4WPAA 3KHRA 4OHZA 1NJWA 1F9HA 4EK2A 4WJBA 5D15A 2EI5A 3JAMU 3V6KA 1V9OA 2CG8A 2PD1A 2NPFA 4KGZB 2ZBIA 4OYZA 5ETTA 1ZZNA 2L48A 1VOMA 2BE2A 4ID5A 1TL5A 4GVLA 1X0FA 1BC6A 2XULA 4HDHA 2KZMA 1SC3B 4IG0B 2VHGA 3LF0A 3VAJA 1B7YB 1GQEA 1RHQB 2FVRA 1EZZB 1JXEA 4WE1A 1WHVA 4I64A 4OHVA 4ED8A 2M5YA 2IA6A 3ENAA 3RUBL 4JI0J 2CAJA 2FZGB 2DNNA 2QLBB 2DNMA 3NCRA 3PEJA 4Y2IA 2MKKA 1M5OC 2ZC4A 2PFFB 3M1VA 2JNJA 5E2QA 3CJKA 4YS2A 2XLKA 3W9HA 1SKSA 4KB7A 4P2MA 2GIRA 1IBLF 3CWJA 2QYCA 3HKWA 4PYDA 2MHNA 3A8KA 3DHXA 2HQIA 3IWXA 5CCMA 4X4TA 2VJUA 3R1HA 3PTWA 1XNRF 5AXMA 2RS2A 1CJKB 4C4WA 3IA0A 2YKQA 2M70A 4PQAA 1UEUA 3W9IA 2BYCA 2BABA 4FYXB 3OLBA 3AD9C 1VS3A 1T05A 4OX6A 4DV0F 2Z2MA 1KN6A 1TUWA 4NCGB 3H42A 1D9AA 3OLAA 2OELA 4PG8A 5KFHA 4NCGA 4DU8A 4NLQA 2MKSA 5D0RA 3BO4A 1VQSA 2B4PA 2OPQB 3VGSA 4RUHA 1Z1ZA 5G4DA 1VGYA 3CCRS 1K0TA 2V2KA 2K2PA 3D1QA 2M2BA
chains in the Genus database with same CATH topology
4DV4F 2Z8QA 1UL3A 2PMHA 4WIIA 3AB4B 4K2XA 2B3TB 2VG6A 4MIAA 4OI4A 1UFWA 5KT2A 3Q22A 3UCZP 2FHOB 2XO7A 5A6WA 4N8OA 2MPUA 3KG1A 5A8KA 5KFSA 1B0PA 2N7YA 1U1LA 1FJ7A 2BVZA 4ELVA 1XEZA 4ZPDA 4WYWA 3JSYA 5K14A 1KQFB 3GQCA 2WTFA 2V94A 5KFCA 3CC7S 2C3MA 1HNIA 2RNEA 3JTPA 4R0EA 3UWTA 4PQUB 2P5VA 1X5OA 5B0EA 5KFXA 1P1LA 5KG0A 3AQOA 3TRGA 1VQ9S 2MMYA 4URQU 3POTA 4GC6A 1V3ZA 2M0GB 4F4WA 1YJRA 2IHR1 4EZ9A 2O3DA 1IXKA 2AX0A 4F26A 5LSRA 2MGZA 2JLGA 2ZC3A 4MJKA 3UW1A 5J2NB 1IQTA 3K57A 1S4FA 1LV5A 4OQJA 1UW4A 1L3SA 3BN7A 1WG5A 2JX2A 5DDOC 4PXEA 2D74B 1GXUA 4OI3A 1FE0A 2UVUA 2B51A 1KOHA 4YB1P 4I2PB 5D77A 5KG3A 4DV1F 4QWCA 2GV1A 2MZJA 1S9EB 3H5SA 3BJYA 4HVZA 3VF0B 2XGPA 4IRDA 1VIOA 2R7RA 1U2RA 2XI2A 2CJAA 4IQXA 3KK2A 4N77A 3VZIA 1UA1A 2DBBA 1FRJA 2XZWA 1GAOA 2G0CA 4O3OA 2LA4A 2XEXA 3DXBA 1Z2ZA 3KG4A 2R8KA 4R5PA 1NK4A 1H3DA 4Q8EA 1FCAA 4H4KC 2K7KA 3D54A 2B43A 5EX0A 4ECSA 1OIAA 4KO0A 2K1RB 5KFAA 2ADCA 2HGLA 5E3CA 2O1PA 5D3GB 2NSBA 2K1RA 2QA4G 2R7VA 4ZP8A 3ETOA 5JXSA 3NS6A 2JFKA 1IKXA 2MB0B 1TL1A 2V8DA 2J6UA 2ZFHA 2V5HG 2VBZA 3M8RA 4C9DA 3QLHA 4Z2XA 1HBUB 3QLHB 5D4NA 2F8EX 4IG0A 3B8HA 1YBAA 1HL6A 4I56A 4DWIA 2XNRA 3M6VA 1JLBA 3QO9B 5DJBA 3BQ1A 4RW6B 5E41A 3I0RB 1L3VA 4ERDA 3S7RA 1WTFA 2VA3A 2PC6A 2X1GA 5HN0A 2MKCA 3IFEA 1N88A 1MMLA 3H2VE 4NL5A 1Q7LB 4ZK7M 4ECVA 1RKJA 2R7WA 3NCQA 3VAFA 5GAEU 3FSIA 2WSEC 3WC2A 4JI6F 4K59A 5KFGA 4C8MA 2RT3A 4QQBA 3MEGB 3MEKA 5GAHI 4MKBA 3JB9k 2B56A 4M95A 4NZ0A 3HK2A 4TKTA 2XY7A 3P49B 2FHMA 4EWTA 2X3GA 1YRUA 1BD6A 1JLCB 1RJJA 2ZH7A 1UJ6A 2AYBA 3N6NA 1IKYA 3LALA 1NKBA 1JLCA 1FXRA 1Y5LB 1IKYB 1IR0A 4P6QA 4QWAA 4IUFA 2YH1A 1S9GA 5EN1A 3OR2B 4I68A 1Q82T 2HHSA 1JJ2R 3D0IE 4F8RA 3GG1A 4F02A 4EGLA 4PPDA 4DQRA 1AW0A 5KFBA 1U25A 2B9WA 3OQ2A 2CQDA 1F0XA 3FFIA 3T1YF 4NA2A 1VQPS 2O01C 4BC9A 1YQHA 4CH7A 3M4XA 3HZEA 1C1BA 2HNYB 1OO0B 3MR2A 2WW8A 3EGWB 2BOPA 2XCAA 3PKYA 4NZ7A 1HQUA 3KHLA 2R8JA 5A8WB 1FNXH 2VBWA 2XS2A 1W25A 1XMOF 3HP6A 4OHWA 2Z0GA 4ZOSA 3CF5Q 4ECRA 2R4FA 2E5LF 2YWHA 5GADI 4IR1A 4OZ0A 4KGKA 2LQBA 3CDWA 1UVMA 2HLUA 2DRBA 3MUMP 1S1XB 4AYBD 2JOQA 1EP4A 1YRTA 3DDKA 3T3FA 4ZDNA 4YFUA 1ZAXA 3MM9B 4Y00A 3WZ0A 5T14A 3K5MA 2R2SA 4RU2A 5GAGU 3DOKB 3E01A 3RAMA 4JBCA 3BF4A 4GO7X 1CPZA 4PXDA 2RQMA 2VFUA 3DLEA 3GE9A 2EW9A 1KHWA 4L6V3 5E5NA 4Q5VA 2V9KA 2HS3A 4M1KA 4B9TA 2OSQA 2RRAA 3TO8A 4ECTA 4M8LA 2IBKA 2RB7A 2X1AA 2ERRA 4OV1A 2YY3A 1FERA 5J2PB 4PUOB 4ICLA 4MFBA 1JNZB 1S1UB 3CTRA 4YDDB 1YJWS 3THTA 3M2RA 3W2VA 3OUYB 2ZHBA 3OFFA 1U2FA 3AA8A 5KFZA 4B3MF 2CQ2A 2KFZA 2BW2A 5HMYA 2EK1A 1EETA 2L9WA 2UXBF 5DG8A 5K9FA 1N32F 2HYIB 2XMTA 2UXCF 1DLOB 1JMTA 2RKIA 1FE4A 2DITA 3J7A1 3O44A 2IVYA 4DLEA 3MM8B 2VA2A 1WACA 2EG1A 4LMZA 5GVQA 1DURA 3P96A 1ZM9A 2XHWA 2O5DA 2HHTA 1MNEA 5CCLA 3HT3A 3JSMB 2PIIA 1U1MA 4BWJA 5CYJA 2XWXA 3CCWA 2KTQA 1I1GA 4J9NA 2BANA 1YJVA 2VG7B 2D1CA 2AF6A 2KJWA 4ED0A 3RB4A 4WK3A 2HLTA 4I0WA 2KT5A 2RRBA 3RAXA 1P8GA 4NLDA 3UD4P 1H2VZ 2GHVC 1WTBA 1VC0A 1Z2LA 5LMUF 2HAIA 4IG3A 1B0TA 3KNGA 4RW7B 5DGBA 4B9LA 2DPIA 4C8YA 4Y65A 2WHOA 4X4RA 4NXMF 2X1BA 4P7TA 1XR6A 3THVA 3C8YA 1QLNA 3MM7A 3T19A 2OIHA 3I96A 3M1VB 3CJKB 4X65F 2CQGA 4HHJA 3H2LA 1S99A 1Y7PA 2LCWA 2GQQA 2LXFA 3UI3A 4DG1B 1SL1A 2VFSA 4K4ZA 4J9LA 1C4CA 1S48A 4KGMA 4WU3A 1HQEB 3DHWC 2JEFA 1VK8A 2M8HA 5CQGA 1S6OA 1N34F 1VRTB 2HWHA 4LF4F 3I0SA 2V8GA 1A9NB 2CZ4A 4C98A 4YR2A 3DLKB 4A8WA 1NJYA 4XPCA 1X5SA 1SJQA 3HMJG 3TA0A 4ES2A 1RDRA 1H6KX 5DDPC 4XDCA 2CRLA 2RILA 4CH1A 1K1QA 2BBEA 2ZITA 4B02A 2Q6CA 4A4JA 2N4DA 5K8OA 1UVKA 3S8SA 4DF8A 2XNQA 3ZZPA 4EFAC 2HMIB 3T5KA 1Q7YT 5CYMB 2KG1A 1U8SA 3W2WB 3PX0A 3DFEA 3FEZA 2LYVA 3E51A 3OFGA 3HHLC 2OO4A 3MECB 1BQNB 1WNEA 4HL9A 3SCKE 2FJWA 1J5EF 3M8QA 4LQ3A 2CPEA 1UP1A 4D3GA 1U6BA 3K58A 2PN6A 3DLGB 4B3RF 3MOJB 2JDJA 5KT4A 3KK3A 3CDEA 2R8GA 1UVNA 1HI0P 4MH8A 2J76E 3C6UB 5K8NA 2R2UA 1S1XA 4DV2F 1DFDA 3NG8A 2E29A 4FPRA 3MR3A 2YNIA 4AXIA 4ZCKA 2GMJA 4FS1A 1DRZA 4NA1A 1FESA 3R5BA 4PXCA 3QAUA 5F8GA 3LP2A 3RRHA 1RTDB 4QBUA 1FTRA 3N6MA 5B7WA 5KFKA 3KYLA 4LF6F 3ZZUA 3N6LA 1S1WA 4ES1A 5JVGQ 2CQ1A 4V19J 4EO8A 5L1IA 1FRHA 3TP2A 2W7PA 1FD8A 3NWGA 5SZTA 3T9ZA 3M2RB 3DLJA 1N5YB 2FVPA 1KSPA 5DO2A 1U48A 4TY9A 3L3CA 3NGDA 2XWYA 2PO4A 3HM9A 4DSEA 1TK5A 3KTQA 3BSCA 3I87A 1VQ5S 1P1TA 2DHGA 4NRTA 4IOBA 4R5PB 3VALA 2MZRA 3M2VB 1XTZA 4RKUC 4DEZA 1MU2A 3PW0A 3MM8A 3PXGa 2ZUGA 3L09A 5K8MA 2JSXA 4H4MA 2Y0SD 5J1PA 3KLHA 5KAKA 1YSJA 3MTJA 5ITHA 2DNOA 4X4QA 4H4MB 3QWUA 5BJRA 5C24B 3JSMA 2DR8A 3BDPA 2WCXA 2OD4A 2HGMA 3GIKA 3PW7A 5C24A 3GR1A 1D8YA 2CPIA 2PI4A 1W2IA 3RB0A 1X4EA 4ECWA 4N47A 3OV7A 1TL1B 2AYEA 1HHTP 1MROB 2UV8G 2B6AB 3CT9A 5C25B 4X4SA 3CD7A 4GMKA 2B6AA 2XMJA 5C25A 2FLOA 5H1SV 2C2RA 4OJHA 2IVMA 1J5OB 5HROB 1Y5NB 1LW0A 1F5CA 3DRPA 4OL8A 4PG6A 1HI1A 2NYIA 2F9JA 2FHJA 4DS4A 3HLUA 1R3NA 3CXCR 1KEKA 4DDFA 5A0YB 2DIUA 2K8GA 2FVCA 3PRBA 5DQGA 3K8VA 3LWLA 2KFNA 1IN0A 1VIXA 1FRLA 1HBNA 4M63A 3CCLS 1ZAVA 4K4VA 5KOXA 4C7QA 4B3OA 4NMLA 2UUCF 1TP7A 3DGPA 4J37A 5F3TA 4DUZF 3CCUS 1G2EA 5EWFA 2WB4A 1SUQA 2JC1A 4ECYA 2OLWA 1OWXA 1S7HA 1HNXF 1T05B 2JEIA 2HWTA 1LWFA 3KLFB 2VONA 2VD3A 3DI6B 4X4PA 2KJVA 4HT5A 2C3YA 4C8NA 2YKOA 3FRZA 3TNVA 4F4KA 2MQLA 4F3QA 3KHGA 1RT5B 2GC8A 2OPQA 2RJZA 1X9SA 2C3UA 2EBGA 3IG1B 2LU1A 4U7UK 2RH3A 5BYSA 3KWMA 2J0QD 3HVTA 5I3UA 1TKXA 3HVTB 3SDEA 1QSYA 3QIDA 1AFJA 2RQ4A 2HWIA 3LANA 1FJEB 5CD4H 2M88A 4ZVEA 5B08A 2GIQA 3M9NB 3H4BA 4Y2AA 2KH9A 2CKWA 2KKHA 2J0WA 3KKFA 4WTYA 5KFUA 1X9WA 5F3ZA 4ZP6A 2E9TA 5A8RA 2HIQA 3VAIA 4K4TA 1ROFA 2NSCA 5KTQA 3DC2A 3SV3A 1R27B 2BUNA 1X9MA 4K4XA 4A8QA 3MWBA 1NK7A 1RT1A 3FSYA 2CYYA 3O1LA 1QUPA 2KRRA 4QW9A 1X4BA 4A8OA 2ADBA 4CTAB 4LSLB 3C6UA 3ISZA 4O4GA 4RLEA 2RUGA 4DS5A 4DFKA 1YJ9S 3IWNC 1CQMA 1X4CA 2R7OA 2YNIB 2YWFA 1JLQB 3POTB 4WU2A 1EP4B 4JV1A 2HVHA 3MCSA 2D3ZA 1S0OA 1ZM4A 1REVA 1WEZA 2YKMA 3DRSA 2FLNA 4ID5B 4PWUA 2XY6A 2IM0A 3DRSB 5E3QA 3T5LA 2YH0A 3JSBA 4RW8A 1CC8A 5B0CA 5AXLA 1IJFB 3BR9A 3TARA 1MSWD 2CQIA 3QGIA 4I67A 1T3NA 4MIWA 3FCHA 1NH8A 2OPRB 4ELTA 3HHNB 5DQHA 1SJRA 2HRYA 4WYLA 4NYOA 2HVIA 4NYPA 4I7FA 3QIPB 3UCGA 4JV0A 3OFEA 1EETB 1S79A 3FGVA 3PACA 4DBQA 2JL9A 3MMCB 1FD2A 2CPDA 2RQKA 4CO1A 4WZMA 3I6PA 3VQSA 3KLHB 2ZH4A 1TV6B 1U1NA 4RUAA 3DLBA 3T6JA 1DQAA 4CIOA 1WEYA 3DOLA 2Z2LA 4NZ6A 3I5CA 4IO1A 4DQQA 2P6TA 2JVOA 4WFXA 3BS9A 3OPKA 2CVIA 4OX9F 2MQPA 2HNDB 2K7JA 4DOZA 2BACA 4IRKA 4C0BA 2HVZA 4ZPWR 1L3UA 2FJEB 2AYGA 1S77D 1K0VA 4CZCA 3MD1A 2B7BB 1L5UA 1QSLA 1U26A 1P6TA 3OFHA 3TVZA 5K14B 4CO2A 4FVCA 2J5AA 3IGVA 4FF2A 1CLFA 3DM2A 4AUKA 3ZC4A 4CNYA 5G0RA 2J9CA 2CG4A 1HNIB 4QIFA 3PR4A 1Y0HA 3JYTA 4GKKF 2W9AA 3SMZA 1RT3A 1FVSA 1WG1A 3PJXA 2IRXA 1A6LA 4ZPCA 1ZTWA 5CHCB 5HQ8A 1IUJA 2IC3A 5I3QA 1JLEA 1VRUB 5BYRA 3HHLB 2B4VA 1KOOA 4KR0B 1T03B 3BB5A 2F3JA 2RD5C 3T1HF 1HQEA 4BCAA 2CPXA 4DPOA 2BR0A 2C3PA 3MD3A 2OJ3A 3HHKA 2LEPA 1NO8A 2RVJA 5L38A 3RR7A 3ZZZA 1Q8LA 1UWBA 1P27B 4KE5A 4OHXA 5LSLA 2HHXA 3DCAA 1BQMB 1HI8A 2XBPA 3IWLA 1FK9A 1UWBB 3K8WA 4HI2A 4YB5A 3TYTA 4ATNA 4ECQA 2VASA 1N6QB 3N5BA 2KHCA 2DGQA 4LT6A 2EFOA 1ZZFA 3D1OA 3MR5A 1LWEA 3NCPA 3EUNA 3OR2A 3F41A 2DISA 3J7Z5 2RMLA 3CDUA 4M5DA 5EWGA 2P9EA 3OVAA 3O5TB 1HWIA 1FVQA 3H20A 4DLGA 3NGKA 3SDEB 3JTNA 2YTCA 4DQPA 4V19X 4BHQA 4WFNQ 3FVYA 5J1NA 1B0VA 5EWEA 3FZBA 3J81Y 3V81B 1T94A 3I31A 2FC8A 4D3HA 1P9QC 1RT2A 1R8PA 2ZD1B 2KXFA 1RT2B 1QE1B 2VG5A 4RX6A 1WF2A 4CO5A 2D41A 5M2UA 3OHAA 4A8YA 1URNA 3SCLE 3QMQA 4QR2A 3G8SA 1KD1T 5FJ4A 1KVJA 1WI6A 4BS2A 2VPWB 4LVNP 2K3IA 2KB2A 3BR8A 1S6UA 3GILA 2LA6A 5T7LB 3CCMS 3EPGA 2BRLA 3EXYA 3K5LA 1F2GA 3KLIB 3SV4A 2GO9A 1Q78A 4IOAQ 1NK9A 1QAXA 3VAGA 2YKMB 2YQ3A 4CO3A 4RW9A 2KT2A 5F0WA 1T3OA 3OL7A 4B9SA 1QAIA 2L08A 3DNCA 6FDRA 2B5JA 1OPZA 2CIMA 2B5JB 4LFAF 4NXNF 2AGOA 2ZH6A 2WOMB 3CULA 1F60B 2M4MA 2YWGA 2D9OA 4F50A 4J9PA 1FKOB 3D5MA 3MEGA 2OTJS 4AXJA 3TR5A 3IS9B 1FKOA 1Q8BA 2KVIA 3HX9A 2DNPA 2N82B 5GAHU 2I5JA 4TNOA 2A1BA 4L72B 5EGYA 4RNOA 4MK7A 4EYIB 4ETXA 2I5JB 2W4DA 3H2UB 1DTTA 1R43A 5BYQA 3KLVA 4HTIA 2GJIA 2IMWP 2ZDPA 1S9GB 3M6WA 4TXSA