1IBKF

Structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotic paromomycin
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
101
structure length
101
Chain Sequence
b'MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 24
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ibkF00
1XNRF 5IWAF 4B3SF 4LF9F 5BR8F 1J5EF 2BVZA 4X66F 3R3TA 4DUZF 4DR5F 2UU9F 4JI0F 1HR0F 2UUCF 5LMUF 4LFCF 1G7CB 2KJWA 1XMOF 4DR7F 4NXMF 2UXCF 4DR1F 2B7BB 2E5LF 1I94F 2J5AA 4YY3F 4LFAF 1CQNA 4B3RF 2UUAF 4JI7F 4B3TF 2VQFF 4JI1F 4JI6F 1N32F 2UUBF 4DUYF 4JI8F 1F60B 1LOUA 1CQMA 1XMQF 2ZM6F 3ZZPA 4DR2F 1XNQF 1G1XA 1FJGF 4LFBF 1HNZF 2UXBF 1HNWF 4DR3F 4JYAF 1N33F 4DV0F 1QJHA 2F4VF 5AJ3F 4B3MF 4LF5F 4GKJF 4DV5F 1IBMF 4JV5F 2KJVA 4DV3F 1HNXF 4KHPF 4JI5F 4LF4F 4DV4F 4DV1F 4X64F 4K0KF 4NXNF 4DR6F 4JI2F 4AQYF 4DR4F 1IBKF 4DV2F 4YHHF 3T1YF 4LF8F 3OTOF 4OX9F 1GH8A 1IJFB 1B64A 1IJEB 2RJZA 2YY3A 4DV7F 4GKKF 2HHHF 4LF6F 1RISA 1IBLF 2B7CB 4JI4F 1N36F 1FKAF 2UXDF 4X62F 4X65F 3T1HF 1VMBA 4JI3F 1N34F 4LF7F 2VQEF 5LMNF 4DV6F 2BXJA
chains in the Genus database with same CATH superfamily
2N4CA 5IWAF 4B9TA 1V3ZA 4JOUA 1BD6A 4N5SA 3OD2A 2W9AA 3I4PA 2AEFA 4PAAA 4QU6A 1G7CB 2CPYA 4QR1A 2XYGB 4ZLPA 2JEJA 3C6UB 1Y11A 1TFYA 6AT1B 2KXHA 4JI7F 3V4IB 1B4SA 5A8WA 2W4CA 1XMBA 2RQCA 3G4SS 3MM6A 4MFBB 3GG1A 1TQLA 2DIVA 3SSQA 2ZNZA 2ACYA 4F2SA 4ZP6A 3H4BA 2QYCA 1YRTA 2HQIA 3D9BA 2P8IA 4B9MA 1RWVB 2EKYA 4DOZA 1S1WB 4NLDA 2HNDB 4QPXA 2HVIA 2VUGA 1YX2A 2GO8A 4I1TA 2HHWA 3SYZA 3T1YF 3UN5A 4ZPTR 3CIMA 4CRJA 3VAHA 2AT1B 1HMVA 1KBRA 1XQIA 2MQPA 5CD4H 1NXIA 1QSYA 2PA3A 2LVWA 3THVA 1JXVA 1NK5A 2WTFA 1SJ4P 2UUWA 1C0UB 4DU7A 3MCOA 4HI2A 3TX0A 2DHSA 2XY7A 4LF1A 1QAXA 1YJVA 4RWXA 2ERRA 2QFJA 2JLGA 1HNZF 2VDIA 1UW4A 2XGQA 2CDRB 2Z57B 1X9MA 1V3RA 2X3GA 4RUBA 1UP1A 2K8GA 1N5YB 4WE1A 4AT1B 2IY5B 2OJ3A 4J5OA 3NS7B 4HT5A 1L3KA 5KFJA 4EZ6A 4USKA 3EE3A 1PJ7A 3DKDA 3NMAA 1MWZA 4QR0A 3PO4A 5KFUA 4F04B 1UTAA 2DNPA 1Q0NA 1X60A 4DEZA 4KHMA 2RE1A 4DZ6A 1RISA 2JL9A 5KFWA 2M0GB 3PRDA 2KVIA 4LF7F 5SUHA 4PYAA 2VODA 1KLNA 3NS6A 1FE0A 2MTLA 2OSQA 2YKNB 3BH7B 5HMYA 2XM3A 4B02A 2WVEA 2OSRA 3H20A 4Y65A 2BOPA 3FNNA 3A3OB 1ZPWX 1LWEA 1RAFB 2XMTA 2OI2A 1GMUA 4HHHA 2PE8A 1N5QA 4DX6A 2R7TA 2KM8B 1SL2A 3ELHA 4WKRA 1MG7A 5AE1A 1HW9A 3I96A 3K8WA 2UVWA 6FDRA 2XWYA 3FRZA 4RKUC 4JI0J 4JYAF 1X4GA 1U25A 4PXDA 3S01A 3BSCA 3D1HA 5F8MA 4ITSA 2DNNA 5C24A 1WHXA 4BC7A 3K5MA 3C15B 1H6KX 3THTA 4TXSA 1SJ3P 3K58A 4DF4A 3KJQB 4BHQA 4NXNF 1FJGJ 1JLQA 4J9PA 2QRRA 5DZ6A 3B4MA 3MECA 1RHQB 1CS4B 2FJWA 3ILJA 2RJZA 1M90T 2YNHB 4KTQA 3UO0A 2KH9A 4CLFA 4JV5J 4ATNA 3QIPA 4PPDA 1X4FA 1YK9A 3QJJA 1FKPA 1JJ2R 2B51A 2ABYA 2O1PA 4EZ9A 2EW9A 2QMUB 1VQYA 4EUVA 1DTTA 4KGVB 3M2UA 1Y0HA 1D8YA 4GKJJ 1FEHA 2IDLA 3HZGA 4DF8A 3FCVA 3EZOA 2GA7A 1YG0A 1RT5B 1APSA 2ALZA 1HA1A 2UXCF 2HBZB 3CDAA 1S0NA 4DV6J 1VQOS 4MKYA 1U1RA 2AJ0A 4MIBA 3AQOA 3US5A 2WHOA 1HNWF 4NCAA 4QWAA 1KN6A 2VH7A 4ZLNA 4FVCA 5KFOA 1D1UA 2RQ4A 3HKWA 1KFDA 1LW0B 4DZDA 1QUPA 1QY7A 4A8QA 3J7YI 5CYQA 3UDCA 2K2PA 1FRLA 2CNOB 2PI5A 3QRPA 1UKUA 3NWRA 4AFFA 1SV5A 4JI4F 2MXYA 5D4PA 4JI8J 1S59A 1N34F 4CT9A 2AIRB 3T9ZA 4M5HA 4U8VA 2J9DA 3AHPA 4WYWA 5KFYA 3R3TA 2KFZA 1RAEB 2CJKA 1HKAA 1H7XA 3M2RA 2BE7D 5LMNJ 2DCLA 1DTQA 4HKQA 1HHSA 2DNGA 2G1HA 1AUSL 3K17A 5HLFA 4NYOA 5HANA 2E44A 4DSKA 1UVMA 1B0TA 3HULA 2RQKA 4IG0B 4ZK7M 4OHYA 4ZLLA 2DGUA 4ZVSB 3M30A 5KFRA 5B08A 1Y5NB 2F4FA 3FCWA 2UUCJ 1IBKF 1LW2B 1Y5LB 1MROB 1M5VC 3EGNA 4UUWA 1M1KT 5GADU 2KHCA 3QRQA 4E8UA 1R7IA 2YH0A 1NKCA 2HFZA 4GO7X 1XJWB 2BXJA 2IC3A 3TAPA 2W2OP 1F9FA 3UDEA 5H9EK 1EJ7L 2EG1A 3OVAA 5A8KA 5A8RB 2PGCA 9ATCB 4DR6J 4Y28C 2J6SA 4LFAF 2CJ9A 2VG7A 3ETOA 1RWXB 1GEHA 2OAUA 3F44A 3EICA 4C8LA 2XLIA 2EG2A 1JIHA 2D69A 3MGJA 3BPSP 3UWTA 1ZH5A 4Q43A 4ID5B 2Y1LB 2J9EA 3VCDA 3QWPA 1PIEA 4F4AA 1VQSA 3TEHB 1QAYA 1IN0A 1VQ4S 3CJTA 4KO0B 4YHHF 1TKDA 4RW7B 1VRTB 3WC2A 1RT7B 2BA9A 3LOUA 2GMLA 2W9CB 5MAOA 3MFHA 1S57A 1FWLA 2M7SA 4C98A 3ZTOA 4MIWA 4LRFA 2H1YA 2MQ8A 2V8PA 4FF2A 5IC6B 3L3CA 1CPZA 3HVRA 3KNAA 3W63A 4CDIA 1VQPS 2B7BB 1WOPA 2J6TA 1ZTWA 3GMGA 3Q23A 1B0VA 3RZAA 5DGAA 2BW2A 2Y1JA 4HVZA 4UF4A 4LFBF 2MQNA 7FDRA 3EVWA 3CJKB 1KKHA 3H7HB 4ED3A 1HWJA 2ZBCA 4A8XA 4IOCQ 5I3QA 3MAAA 2JHEA 4KHPF 3BSAA 3FMBA 2CWXA 1YHQS 3BBBA 3KLHA 1XN9A 2DT9A 1PYTA 1JLEA 4RW6A 5DDQC 2F5GA 1O5JA 4KYZA 2O5DA 2XMMA 4PG4A 2GHWA 3R2CJ 2DNRA 2LECA 2XS5A 1IKWA 4IG3A 2R8KA 4XDCA 1N54B 2R7XA 4P2MA 2LYVA 4ZIWA 4KIAA 1ICEB 2W2PP 2ZDPA 5F3TA 2DGVA 1RSCA 1HI1A 4EYIB 5KAKA 1ZM9A 5KFIA 1ACMB 1CC7A 2FC9A 2EC2A 3Q0AA 4WK1A 1MN9A 1NKBA 3OTOJ 2CPDA 2HNYB 2LQJA 3ZZPA 5BJRA 3ZZZA 3CDUA 2DNLA 2YQ1A 5T7LB 2OPRA 3MCNA 3H5YA 2VJVA 5CH7B 5J1EB 5DG7A 4QYZJ 3GB0A 5LOQA 3M05A 4TLRA 2A2CA 4MAKA 3S1TA 1U1NA 4RZRA 1S1UA 2L3MA 2XZDB 3TR5A 2YKOA 2CNNB 1TVRA 1YIJS 1KDNA 2DTJA 1U2RA 4EBEA 4J37A 3ITHB 3UD3P 2ROEA 1LWFB 4OI3A 2DB1A 3NBPB 2R7RA 4LR9A 3PVXA 2NXNA 4J9VA 1QDUB 3BYPA 3T5LA 2HHHJ 2C2NA 1MN7A 2RSQA 1VDHA 2ZKTA 3OW2R 3JQKA 3MMAB 3RB4A 2W4PA 4ZCKA 4HTJA 1N32F 3BSOA 2J0XA 2BQ3A 3SZ2A 2XCAA 1WC6A 3OSNA 1S49A 4NA2A 5K5MA 1OQ6A 5B09A 2F7VA 2H5EA 3CDWA 5EHHA 3DRXA 3KKFA 3MAQA 5DETA 5CABA 3O8WA 3CO0P 3HM9A 2ZH5A 2EFGA 1PSDA 1RWNB 4RLEA 4M5MA 1BHNA 5U47A 2E5IA 2P6SA 2HKEA 2ZNYA 2ADCA 2CRLA 1KEKA 2ZKUA 1WC0A 3C6UA 3BO2A 2FZKB 3ZZ0A 3EPGA 2FC8A 3V4IA 1IR2A 2V67A 3D6MB 2K06A 3W60A 4FYVB 1S12A 4KB7A 3MEDB 4DR5F 3A13A 4MFBA 2DO4A 3EWGA 2UXDJ 2KG0A 1TKXB 2CZVC 4NMLA 2QSFA 4L76A 1F1BB 2EFPA 1S1WA 2BE9B 2HNDA 1ZBTA 5J2PA 5D3GB 2UVUA 4LRDA 3ZTSA 3THPA 3R5CA 1HWUA 2CJAA 3RBXA 3LGMA 1TP7A 2X1FA 3R7BB 5BYQA 3IMQJ 1SPBP 5LM7E 3H2VE 2AX1A 1HBUB 2ZM6J 2E29A 2GVDB 3HLUA 3AA8A 3BO3A 3R97A 2MZ1A 1U1LA 2V9WA 2KRBA 1T3OA 2YVSA 4PG6A 4WIQA 3C14B 2UUTA 5BXIA 2HSEB 2PA8D 3A3PB 2IA6A 1C0UA 1HL6A 1ITPA 1S4EA 2EWHA 4QPTA 2VA3A 2CVEA 3KJVB 3AOCA 3Q8SB 3TZYA 3M8QB 2IDEA 3TWZA 5KFTA 2OLWA 1NNDA 4PCQA 1TFWA 2ZJQQ 3OPKA 3ULHA 2VFUA 4ANDA 1S99A 3S6EA 1I1GA 5D78A 1OSDA 4M95A 4RR5A 3GCXP 4B9LA 4FDFA 2MY8A 3I31A 1N5YA 4UOCA 1WOOA 2JOQA 2D41A 4I6YA 2IIHA 2A18A 4ILLA 2DRAA 4NEZA 3H25A 4KJIA 1WHWA 1VBKA 2GJ2A 2XNQA 3F73A 3MPYA 5IQ6A 1SC4B 2YBVA 2QL5B 3CDBA 3G87A 3H8YA 3D67A 2YKNA 3A8IA 1XK8A 1LXJA 4OYPA 4LF8F 1FXLA 1FK9B 1NSPA 2BJ7A 3TYTA 4DCPB 3GSIA 2OFGX 2FPHX 5D4NA 3MM7B 4F26A 4ZVFA 4YR0A 3KWMA 4LRBA 3GJTB 2G1DA 2GQCA 5A2QU 3TJAA 3NNHA 2NLWA 5DG9A 2Z2YB 1JK9B 4ZPWR 4FVMA 1WI8A 2VU5A 5EN1A 1HPZB 2M9KA 5GAEU 3BM7A 1V3SA 4I6AA 4YB7A 2AZ3A 3V81B 4B3RF 4DX8H 3C15A 5DDRC 3BQ2A 3OTDA 3OHBA 4YDXA 2HBYB 2HS4A 2P9EA 1HD0A 2ZD1B 3MPUB 3RG6A 3RRKA 1QJHA 1CS4A 5D15A 3FSYA 5IZHA 1WNEA 2RDJA 2YNHA 1UJ5A 3FBBA 3M8PB 2R8IA 4PKDB 2YXLA 2ZUGA 3D6FB 4F0KA 2RU3A 3J81U 2D3ZA 2YWWA 1U2FA 5DQIA 2JEGA 5I3UB 4J9KA 4J9OA 1TK8A 4B3TJ 3I0RA 2X1BA 4RPFA 1H0HB 4PABA 1X9WA 2LEAA 4PYDA 2UVVA 5AXLA 2NZ4A 1UFLA 2FHMA 1X4CA 2WVDA 4U8YA 5ADZA 4TQRA 4LSLB 4HTIA 5LMUF 5D8HB 3MTKA 4V1Ak 4X62J 2JSXA 3D2WA 5L8RC 3VAIA 3G9CA 1YVFA 2MKHA 3N79A 5JMNA 4V19X 2GO9A 3DLJA 3P5TL 3VVTA 1YI2S 1RT3B 1C1BB 1LW0A 4P72A 3EX7B 1P1TA 1S72S 3OJSA 4U67Q 3KTQA 3KLGB 1JLAB 3BGFA 1JXEA 4IKAA 5IT9U 1Q5VA 1UFWA 1UWBB 3OL6A 1IR0A 2OEMA 3UNGC 3VTIA 1X4AA 4KR0B 3DYAB 2LXUA 2E9ZA 2OEJA 1HARA 4KGMA 2VFVA 3HMJG 4WKYA 4NXMJ 4ZVQB 3A8EA 1OIAA 1WC5A 2YX1A 2DEJA 3PW2A 3Q22A 4ES3A 2QL9B 3OV7A 1D8ZA 2ZE2B 3H98A 3HVWA 3BR8A 5IOLA 1M0SA 3X3UA 1WOSA 3LTOA 1IVZA 5ITHA 4IG0A 1JX4A 5KFZA 1F5AA 4DR1F 2LA6A 3QO9B 2HWTA 4U7UD 2GV1A 2HVHA 2OPSB 1AUDA 4QZVB 1H73A 2MKIA 5KFPA 1Q8LA 1DQ9A 3DDIA 2CJBA 3IGNA 2GHVC 4U96A 3QT8A 1YLXA 1LW2A 4H4KC 2KXNB 1MROA 3ISZA 4IOBA 2M2BA 2MZRA 2GVZB 2C3PA 2VHGA 2P9CA 3HFVA 3SV3A 3AAWB 5DLGA 4GVLA 1QAJA 4OMFG 1VK3A 2Y1RI 1UWAA 2K3KA 2B9XA 1VI7A 1URRA 4J90A 3AODA 2AD9A 5A8RA 3CJSA 3R27A 3GCWP 4USJC 4DLGA 4ETZA 5D6GA 2VONA 1N4LA 2HFOA 2C2KB 2QLWA 1L3UA 1T05B 2L41A 3W7BA 5E41A 1IQZA 2IM2A 2YNFB 3P8BB 3MWBA 1J27A 4WCEQ 1XEZA 3ZZYA 1KP6A 3OTEA 4OZ2A 4ID5A 5L1LA 4FF4A 2RUSA 2DGSA 1VS3A 4I67A 3BGUA 1T9YA 4NRTA 3LAMA 5M2RA 5EX0A 3DLEB 2HHUA 4ECXA 1S1VA 1XIQA 4KO0A 2DNYA 3L9ZA 4CO4A 4IFYB 4RNHA 4RW7A 4NZ6A 1VRTA 4LF5F 3KK1B 1RT7A 3B82A 2W9CA 5EGYA 3CUNA 2ZH3A 2CJXB 3PYGA 4WFZA 3MR2A 2VG6B 2IM0A 3CW2C 1UFKA 5F3ZA 4OJ1A 3AD7C 2QG9B 3DLGB 5DLFA 1X31C 2PT0A 4X4OA 5F8LA 3DRSB 4JI6J 1X9SA 1J5OB 3CJQA 1VOMA 4MIAA 1DY3A 3H40A 1RI7A 3BDPA 4O23A 1UVLA 4FNIA 5E2QA 2RU9A 4RNFA 2JFKA 3CULA 3CJKA 4IH5A 4DFKA 1JKHB 1X4DA 3DM2B 2MKKA 5G4DA 5D4LA 1X7VA 2RRBA 2QV6A 3KXDA 4JB8B 2LU1A 4TLQA 2LCWA 2Z8QA 3W62A 3BKUA 2JVOA 3JAMU 3IA0A 5IT4A 2MHEA 1X5SA 5KG3A 1Q79A 1S7IA 1UA0A 4J9NA 4GKJF 4WJBA 1B0PA 1SH2A 1ZM4A 3V6JA 2KJVA 1TELA 2V34A 2JLFA 2XSJB 4ZCIA 2Q3PA 2ZBIA 3EJMA 1IWAA 5F8JA 5KG7A 1R8PA 2DIUA 2VBZA 4JBCA 4OI2A 1VCTA 3KK2A 3OXLA 4X4SA 4P73A 2ZHAA 1XNQJ 4N76A 2ZC4A 2ZHBA 4ED0A 5L1KA 2F8EX 1DJ0A 4OZ5A 4WP3A 2HNYA 1UEUA 3W3SA 4DV5J 4MYTA 5T7LA 1Q1KA 2CPIA 5IV4A 3I5CA 2I1RA 4BLGA 4LF7J 2HQDA 5J1EA 2X1GA 4AQYJ 1ZM3A 2E1CA 2ZH4A 3W2VB 4R25A 1JJCB 4JI8F 4CP5A 1WI6A 3HHEA 2YWGA 2NYHA 5CA5A 4ZP8A 3O2IA 5DJBA 1K47A 3EYZA 4M5GA 3X1LB 3IS9B 2BM0A 1S9GA 1WG1A 2PSZA 1D0EA 4KGXB 2O66A 2K3IA 1X4BA 4WP9A 3ITHA 4BWJA 2VV5A 1RACB 1JNRB 1LWFA 4JYAJ 3QYYA 3NBPA 1SJRA 1I3OB 2EFQA 3AA9A 3R5BA 3SSRA 2QT7A 3TUZC 3PW5A 2EK1A 2WBRA 2XSFA 4OIXA 4YDDB 1D9FA 2MZSA 3GFXA 5HMWA 3C6TB 3HF5A 3MMAA 2AYMA 3VV2B 2BM1A 4B3MJ 2ZH8A 4DUTA 1RE1B 2D9PA 4GC7A 2UUCF 3N01A 1WACA 1HQEB 4NA1A 1RBOB 1F3VA 5CZVA 3NCRA 2VQFF 3ZZRA 3K89A 3BS9A 4YR3A 3RR8A 2XI2A 3ILOA 1K73T 5K8PA 4TYBA 1M5HA 4P71A 1FTCA 2JNJA 3FEXB 5HI7A 2H51B 4ECTA 2XMAA 1RTDB 5E3RA 1GFWB 2ILZA 3JSMB 1X5PA 2WK4A 3HX9A 4DR6F 3J81j 3HKZD 2GIQA 3R7NB 2IM1A 5EDWA 2CQBA 1FE4A 5HK4A 1Q7LB 3MEDA 1PBUA 2PEHA 5KT3A 1RU1A 3KG0A 1TKXA 4X65F 2HWHA 3BV8A 4WU3A 5I3PA 1UJ4A 3EPIA 3EGZA 2WONB 1P1LA 2EKNA 1FERA 4M8LA 1F9EB 2F4VJ 3A8JA 3EXCX 2V8HA 5D3GA 4JI4J 4V19J 3UDLA 3RW6A 2FVCA 3H0PA 5ETMA 5DO2A 2OFHX 1KR4A 1NK8A 3PM9A 1Z4UA 4OZ3A 4PEOA 2ZDOA 3U02A 4C8ZA 1HBUA 2GVDA 4FKXA 2ZHOA 3OFFA 1IM4A 3QPIA 3PYDA 3VGSA 2W2MP 1NH7A 5ETNA 5FJ4A 4DX7A 3C14A 2HPUA 1JJ4A 3H2LA 5B0EA 4F50A 2B9YA 2C1EB 3KHGA 1VQ6S 2AWZA 4K5SA 4KBIA 1GT8A 3PJXA 3D3BJ 2LP4A 2KVQE 3KJVA 1NPRA 1REVB 3M8QA 4FYYB 3ENAA 1CULB 4IO9Q 4RJVA 5D4OA 3KYLA 3CCMS 2GMHA 3CCQS 5F8GA 3VF0B 1WUUA 2XMUA 3PXGa 4E98A 3CEDA 4KGZB 1UEVA 2ILYA 3HFKA 2PFDA 2M4MA 2R9LA 3KHLA 1RT6B 3CD6S 9RUBA 3OL9A 2FJDB 4TY9A 2GX8A 3NNAA 2A2DA 3R6GB 5H9EJ 2OPPB 1BQNB 3ISNC 4IFVB 1TL1B 2RMLA 1RHUB 1S6OA 2QL7B 3MUTP 3SFUA 4A8FA 2XB2D 5IQQA 2EBGA 1TAQA 2JDJA 4LSZB 2FY8A 2YWFA 3SXLA 4FNHA 3KUGA 4DMZA 4K4SA 1F60B 2UZAA 2KI2A 5JJBA 3MPDA 1FK9A 2ZJRQ 2CFXA 2BZ2A 3MD1A 1F0XA 4TQSA 2ROPA 3FVYA 3MM7A 4IYQA 4ZVRB 4UZBA 3V6HA 5C2GA 2E1MC 3DN9A 5HO4A 4WP8A 3PIOQ 3OTOF 4DS5A 1U1QA 3BKFA 2YX4A 2V2ZA 2JLEA 3PX4A 3T1HF 3G2XA 2VG5B 1HPZA 3K5PA 3N4WA 3JTOA 1LFPA 3V81A 2NR0A 4YHHJ 2HW3A 2CZ4A 3E3XA 2CQPA 4NLWA 2ZD1A 2H65B 3JQJA 2VBWA 3IWLA 1HW8A 4YFUA 4W90B 3EVMA 4RL1A 2NPFA 1M1GA 3MM5B 3OTCA 2L9DA 3O5TB 4DV2J 4KQZA 3M8PA 5L9XA 2AYEA 1X4EA 2ZZMA 1JB0C 2IJNA 1NK0A 2QLFB 3FCHA 5HQ8A 4ZS6A 5I3UA 5AT1B 2V8VA 3LA0A 4CLWA 2E7WA 1C0TB 3DC2A 1RWUA 4X4QA 4LT6A 1VBXA 5FLXU 4MK8A 4QIGA 1FWPA 3IO1A 2XO7A 2KU7A 1AXQA 3CCLS 3LALA 5HSPA 3CJ5A 4RW8B 1AFIA 4LSLA 3TARA 2B7CB 1EQMA 4RUAA 3Q2SC 1JLFB 2RS8A 2V2QA 3MF5A 3UR3C 2FHOB 4QWCA 3D6HB 2Z30B 2V69A 1O8BA 2W7AA 5GAGI 2WB4A 1RT3A 1C1BA 2FLNA 2DNHA 1UVIA 3EVOA 3KLGA 1JLAA 2LEPA 4G65A 4DCOB 1S9FA 3D5MA 4QWDA 2HIQA 4ILMA 2DR5A 4OYOA 1UWBA 4Q0BB 5AE2A 3OLAA 2CQCA 2BJ3A 1SI9A 4P10A 2AKWB 1FKOB 3DYAA 4CZCA 2KFNA 4U6PA 2KT5A 3JTPA 4WYLA 3NCQA 2DNMA 4JI3J 3HCXA 3CSKA 2IRYA 2VA2A 3JQMA 1RU2A 2WAQD 2OKQA 1RJJA 2MQLA 2ZE2A 4M63A 4LMZA 4FZVA 4D3GA 1H74A 3ONQA 3OR2B 3Q8PB 1VYAA 2MKJA 1I5OB 3OFGA 2N7YA 5IC4B 4RNMA 1RT1B 2CA9A 1U45A 3UNYA 1FA0A 4KGKA 3ZTPA 4TU7A 2OD4A 2GFFA 3M6VA 3QO9A 2HHPA 4X4UA 1VBYA 3QJPA 4ED5A 2RS2A 2OPSA 5L1JA 3MMBB 3QMQA 3J7YU 1S79A 3SCLE 3WBZA 1KVKA 3M7VA 4CIOA 2W8LA 3VQSA 5KFVA 2GVZA 1H7WA 2BACA 2MLXA 3J80U 2GCFA 2CQ4A 2DGWA 3PJ9A 1YJWS 4FPIA 1HNVB 3B78A 3Q8QB 4ECSA 2RF2B 1FRHA 1S10A 2CQ2A 1R8BA 4PWDB 1LXNA 1BQXA 3ENVA 4Y2IA 4WWSA 4WXWA 1LWXA 3TX8A 1IKVB 1RHMB 2GW8A 1N32J 2BJ8A 1R43A 3UN3A 1VC0A 3IR6B 2CPJA 1SB6A 4F67A 4QW9A 4I2QB 2RDIA 1T05A 4S0MA 3CJ3A 2Q43A 2YNFA 2QA4S 3RBDA 1NK4A 4DSLA 1PG5B 2LXFA 3LWLA 2RNEA 4JP8A 2ZBQA 2G4BA 1FFGB 5M2UA 3DLEA 4P75A 4IFYA 3KK1A 1HQUB 2KHDA 5KOXA 3IWNC 2Z2ZA 1U1KA 1QVGR 4IRKA 2CVIA 4JV1A 3KFWX 2AGQA 2DHHA 4FP9A 1QLNA 2VG6A 4C3KA 2Q6BA 3GFYA 1Q7YT 3DLGA 1RKIA 3GV5B 4ECQA 1NJZA 1T9UA 3TAQA 3GJQB 3DI6B 4WFBQ 5C7PA 3DRSA 2CPEA 2IRXA 5ETQA 3PG9A 1J5OA 1W2IA 1T3NA 4GO5X 2FZCB 2D1CA 2MSSA 4FBTA 4Q5VA 4ZVGA 1QSSA 4O3NA 1ELOA 5D77A 3DGPB 4CWBA 2BOAA 4LF6F 4MYUA 5E33A 2HG4A 1PKUA 4LIRA 1JKHA 3PFOA 5MLCV 3DM2A 2HVDA 4C8YA 2C2EA 4Q8FA 1MLAA 1WTFA 5AJ3J 5HP1B 2FVSA 1Z2LA 2F8HA 1FDDA 4RW4B 2L9WA 4LQ9A 3GFZA 4LBHA 3BKTA 3WC0A 4N56A 4JI2J 4E0DA 1U1MA 4B3TF 4C11B 2XSJA 1NAQA 3T6BA 3KG1A 2VFTA 4F7VA 4LJMA 2VFSA 4NCGB 2EBEA 2GJIA 2MZTA 2LFVA 2ZOGA 3MM8B 2MZJA 1HNXF 2CQDA 4C8KA 2HLTA 1J5EJ 2XC9A 4XAKA 2P2CB 3OSPA 2KM8C 2BJ1A 4RUHA 2JC0A 3KDOA 2CQ1A 3I9ZA 1FHTA 1DLOB 5IV3A 1TMMA 4OZ0A 1KRPA 2R7OA 4ELVA 1YKWA 5F8HA 3U1MA 2NPIA 2PMHA 3KOAA 1LK7A 4CLPA 2R2TA 3W2VA 1LK5A 3MOJB 2DHGA 4X84A 3KHHA 1NCLA 3U1NA 1ULRA 2XTJP 2V6AA 2KTQA 4HHJA 4DU8A 2HIYA 4NXMF 1N5SA 2CG4A 4I0WA 4CLLA 3IS9A 2B4PA 4PG8A 2D3O1 1IM6A 3U7JA 1QSLA 2W2NP 5J2NB 2IBOA 4IR1A 4M94A 1RHRB 1FD8A 4ZIVA 1WC1A 1FDAA 1G1XA 2KRRA 2F40A 3DLBA 4ZOSA 3CXCR 1U7LA 4OV1A 3KHRA 2O01C 1W25A 4B3RJ 4DV4F 2POKA 4WFNQ 4HHUA 1WKLA 3LF0A 1WG5A 3C6TA 1TL7B 1XMOJ 4O3RA 5E3QA 3RB3A 2FGCA 3F0NA 3RB0A 3G71S 2RHSB 1HQEA 2VOPA 3ICLA 4DR2J 4K4ZA 1CJUB 3QJLA 4OHVA 2J8AA 4FN5A 2J0WA 4C3MA 3TRGA 2MKSA 4ER8A 2G9OA 3MPWA 1KWMA 1FO1A 4ZPBA 3RU0A 2UV8A 5L39A 1B3TA 1RTDA 3IP0A 4ZVOB 1HI0P 1NDLA 3JSMA 1E6YB 4OZJA 3M6XA 5DQGA 4UT4A 2CQ3A 2GQQA 4RU2A 4DL7A 4Z2XA 2VQEJ 5KFEA 2HGLA 3ETMA 4BCAA 3LP1B 1K1QA 1M5SA 1Q4RA 2WONA 2HWIA 3SQOP 4UTGA 4QBUA 3HHKA 1VQ8S 2CQIA 3MXHP 4CM2A 4NPOA 4R8UB 3TANA 1K1SA 2DNZA 2WRMA 5L1IA 1P6TA 4QOTA 3QQCD 2K7JA 3ZZOA 3UE2A 1C4AA 4F4YA 3TAMB 2C3YA 2GGPB 2M88A 2LXIA 3H5XA 3M1VB 3LAKA 1T95A 5B0FA 3HHDA 2BE2B 4NLOA 1RWMB 3GG0A 3AJ2A 3C3LA 3C16A 2XHWA 1WKKA 3SQGB 1B7YB 1KONA 3CE8A 4WK3A 1G3OA 4JI6F 2W1BA 2DHXA 1REVA 3VAKA 3AB2B 2XMWA 2R7SA 1CULA 1R6YA 3PFEA 4DR1J 2WBMA 4P9SA 3RJMB 2QJ3A 5GAHI 1KOHA 4MK9A 1RT6A 1GQEA 3MOZA 7AT1B 4A8WA 3G6VA 2UUAJ 1CLFA 2NS1B 2OPPA 1BQNA 4IFVA 1PCAA 1TL1A 2DXEA 3K5OA 2ZVIA 2HGMA 3CD7A 2MDAA 4H54A 1MNEA 1UZDA 3RUBL 1FVQA 1Q82T 1R3NA 1ZM2A 3VAGA 3RBZA 4ALZA 2CIMA 2YH1A 4ZVUB 1T8EA 5B0GA 5F41A 3ILIA 1U1OA 3MR6A 2LQ9A 4UOHA 1AFJA 1FNXH 5KG1A 1D09B 3GPAA 4I6WA 1XNQF 4B9SA 3HJFA 4HLBA 1PBAA 3OVBA 4Y34A 4YMEA 2MEWA 1Q8IA 2W7OA 2IFXA 3I87A 2XBPA 1WHYA 2HFSA 4DV5F 1WSRA 4Y2MA 1MWQA 4L73A 3NL0A 2VG5A 3GSDA 5LSRA 1NB2A 2M70A 3I6PA 2F1FA 5KOWA 4AQYF 2XS2A 4U95A 4LF5J 2E1PA 2I9SA 4HH1A 1BQMB 4MT1A 3A1YG 1FX4A 2NYIA 2XLJA 1Y00A 4X4PA 2QE5A 1UVKA 3W9IA 2EEYA 3MM5A 1W26A 2BUNA 2HQ3A 2UXBJ 1KD1T 2WW4A 2NUHA 4PG5A 3SBMA 1FESA 2DR6A 1HBMB 2ZH1A 4IH7A 2DPJA 4K4XA 5KFAA 1C0TA 4R5PB 2B4UA 4X2BA 1KTQA 2OMOA 1FD2A 2PO4A 1OY6A 1CBKA 3DGVA 1XMQF 4OHWA 4ANEA 1RUSA 1C1CB 4RW8A 1KLMB 3R5AA 4B3MF 1T11A 1S77D 4XIUA 2V9KA 2MYFA 4Y3CA 1VBZA 4A48A 1WC4A 4AUKA 4I2PB 1JLFA 4ZCMA 1FRIA 2B3TB 1NK6A 2HAIA 2CPHA 2A6MA 4DR4F 1O6XA 2P9GA 1WF2A 2AX0A 4J7CA 3TQEA 2ZC3A 1GH8A 4HT7A 5C42B 4XK8C 2NREA 2BBEA 3EZUA 4OYAA 4IRDA 3BN7A 3M4XA 3NOCA 5L9NA 4AL7A 2CPFA 4F3QA 4Q0BA 2HGNA 5I42B 5EX3A 1FKOA 2E1AA 2E5JA 3GZ7A 2CNKB 2Y0SD 4N7TA 4RBVA 3H4DA 3BQ1A 3E2EA 2R2RA 3BYRA 2YWEA 2ACMA 5J2QB 1YQHA 5DZ7A 2I38A 3OR2A 1S6PB 2BRKA 4YP3A 3LPEA 4KPCA 2MJNA 5KFMA 2F4VF 4URGA 1FJ7A 4CO1A 1RT1A 3QGPA 4B17A 5J1NA 1GMWD 4OZNA 2GIFA 2R8HA 4ZMMA 4LF9J 2XI3A 1L3SA 2QLJB 3AJ1A 3T5KA 1YJTA 2WOMB 1NM2A 5KFSA 3MMBA 3M2VB 2DXFA 2NXJA 4CO0A 3M9OB 3OT9A 3L7PA 4JI1J 4O44B 4P2FA 4JV2A 2DITA 4DQSA 4I7FB 2MHNA 2JH3A 5E3CA 4FS2A 3D0IE 1HNVA 2QTWA 1WDTA 2RF2A 1M5KC 4DPYA 3HP6A 4WTOB 3H59A 4KH1B 4PQUA 3FJ2A 4PWDA 4G6VB 1F5CA 1NJYA 1R0CB 5HJXA 1NBEB 1IKVA 4Q2MA 2WZ1A 2LEBA 1PYOB 2BANB 4CM0A 1YTYA 1NLKL 1RADB 5EUHA 1NPPA 1AW0A 2AW0A 4DV7J 5KG0A 4XTTA 4CTAB 3OVSA 2ZJPQ 3DDKA 4I2QA 5K14B 1SKRA 3M8YA 3Q2TC 3AXKA 3EZ5A 1DTTB 1PAEX 1VJQA 3P6YC 2VQFJ 1UL3A 3CCUS 4KFBB 3NGDA 2YKMB 2CKWA 3DMJB 3M6UA 3R6LB 2W2QP 3IC1A 5JXSA 1WHVA 3K59A 1HQUA 1AZSB 2B9EA 5F9NA 1VRUB 4HEA9 2V50A 3CMES 1RB0A 3T41A 2PN6A 3R2DJ 4LVNP 1RQ0A 3AQPA 2J8SA 4LSNB 1HFEL 3N6NA 2ZOMA 4QQBA 3MM9B 4X64J 4X65J 2XZTB 4K0KJ 3DI6A 2YQ3A 2ZWPA 5DDOC 3OR1B 4DUYF 4K5RA 4NLQA 2AJ2A 4RBTA 5B7WA 5D0GA 1RP5A 1EKSA 3IRXB 3DGPA 5GMEA 4URQU 3RBEA 4ZP7A 2CXEA 4CYUB 1K8AT 3BGRB 3RRGA 2Z4PA 2HRYA 1G6BA 4DV2F 1M5PC 4F8RA 5HP1A 3OUYB 4I68A 2J7KA 2FHJA 3GR1A 5K9FA 1MWYA 4RW4A 1VHFA 2RKIB 1QUVA 4PPZA 5GMDA 4Q2LA 1OS5A 3M9NB 4BC9A 3RAXA 1YDLA 4C11A 4PXEA 4DV0J 4WZMA 4I64A 2VC0A 5CYJA 4IQMA 3QNWB 4ZHRB 2VBYA 3TZWA 3GYGA 1IXKA 4NCGA 3IBWA 4WFXA 4QWBA 4YY3F 1S6QB 1NDCA 3MM8A 4W92B 1UCNA 3DXSX 2R7VA 3WDOA 4NMXA 2G2YA 4NE9C 3FKBA 4ICLB 2Q79A 1Q16B 3FGVA 3NAIA 2PDAA 3R9LA 5JUMA 3GIRA 3HVTB 1EETB 3NGTA 2EVZA 2B5JB 4LBIA 4WXOA 4IR9A 3CCVS 1DLOA 3TVYA 4FYDA 4OYXA 1V9OA 4J9MA 3P96A 2XY6A 3JSRA 3W66A 1EAYC 5A8KB 4F4WA 1PJ5A 3NKYA 5HQLA 3JB9k 4NX9A 4Y6IA 2CAJA 2GMJA 1S4FA 3MR3A 3CCTA 2AF6A 4JI3F 3HD1A 5D0HA 2MKYA 2QMWA 2C2RA 1S0OA 2B6AB 5J2NA 1SC6A 1NSQA 4C0BA 5HBMB 4O0IA 4CO2A 4YOEA 2MQMA 4RBUA 5FDLB 3MCSA 2E9RX 3I0SB 2DEIA 1XERA 4K2JA 4KC5A 4AL6A 4DL2A 3T1HJ 4TYAA 3T3FA 2MGZB 1OQ3A 2XG8A 2V63A 1SQGA 4NI2B 1E6VB 5LT5A 3FRYA 2M8HA 1TL7A 4DSEA 2PC6A 2FJAB 2B4OA 4PXCA 5FIIA 2NZCA 3NGRA 2KT3A 4OHZA 2DISA 2DY1A 4DFJA 3AXMA 4ILRA 1CJUA 1EKRA 4O4RA 2JJ4D 3PYEA 3KMQA 1WSVA 2ZFHA 4M5NA 2FJXA 2FJVA 2PMZD 1R8CA 1Z1ZA 1U8WA 4BDPA 1RAGB 1UPPA 2D3OR 2KZMA 2C3MA 3DDNA 2J9CA 4ZVHA 1JLCB 1HHTP 3VWSA 1E6YA 4DR3J 5C2CA 2BR0A 4B9NA 2EXUA 2LLZA 3B6BA 2DGQA 4AD6A 2YTCA 4L3NA 5HMXA 1WTBA 4ZJLA 3NGSA 2GQ2A 1RCOB 1T9WA 2X3DA 3RGIA 2DH7A 1YRUA 1OY9A 1W2BR 3DRYA 2CYYA 1ZPVA 4ZN1A 3LP1A 2BV3A 2YNIB 3E01B 2IRUA 1MMNA 3KLEB 2HVEA 5GMKa 2L48A 2RD5C 4DPOA 4UUXA 1N36J 5CXTA 4OHXA 4DQRA 3DU6A 5DM6Q 3MMCB 1S1XB 5HMZA 3RRHA 4R8UA 1F3FA 3MI7X 3TUIC 1TKTB 1UEKA 3VZIA 3MD3A 5ETKA 1GNKA 5KT2A 3IGVA 3AT1B 3C8YA 2C2MB 3KLFB 2J7WA 1S0MA 5HROB 2W9BB 2G0JA 1EARA 4NZ0A 4OYMA 2YKQA 5J1PA 3PRBA 3TAMA 2GGPA 3M1VA 3KNGA 4M1KA 2XLKA 3UN2A 4NLRA 3ADAC 4YB6A 4X4NA 2BE2A 4HH0A 5A0YB 1A6LA 4DN9A 1UPMB 3V5RA 2R4FA 3SQGA 3LGHA 1N33J 2YPZA 1BXNA 1ZTTA 4K4YA 2C28A 3HI9A 2JC1A 2W8KA 2WW8A 3IRWP 4DQPA 2XZWA 2ASYA 3P5BP 4DN0A 2DD8S 1VQ9S 4C97A 1PYSB 2PI4A 1RZMA 1VFJA 1CQMA 2H4YB 5ETRA 4K59A 4EBDA 2AYBA 3ZTQA 2BJEA 2IMWP 5AJ3F 1FRXA 3ZZTA 1B7FA 2Y1IA 1SXLA 2FDNA 3MCMA 4Z7YA 5KFHA 2XMVA 4DLEA 2Q6CA 1GMWA 2Z2LA 4LR7A 1VISA 4NCBA 1N52B 3D68A 3M6WA 3BPDA 2V94A 1BWEA 1P9YA 1N8RT 1ZETA 3VGVA 2IJRA 4JI2F 2J76E 1W7WA 1Z2ZA 2V2KA 2ZWOA 1TAUA 1RABB 4DQQA 3F41A 1WEZA 2OGUA 1CVJA 4H4MB 3A3NB 5IS2A 2RILA 3D0GE 4P2SA 1OJ4A 4ECWA 3CJ2A 1XR7A 2VFRA 2DH8A 1J5EF 5H9FK 2XHCA 2DR9A 1GXLA 3DNCA 2KJWA 2ZZTA 1HYSB 3OJUA 4NYZA 1L3VA 4QU7A 1HNIB 4A8KA 2XMKA 3H90A 1R31A 1WORA 2DVIA 3BH6B 3LP0B 3ILLA 5IT0A 2GAGC 2IAJB 4NYPA 3PKMA 1IKYB 2OUGA 2X7IA 4USIA 1BQMA 1D9AA 2DNQA 1Y3JA 3HFZB 1VLYA 2H48B 2EC0A 3AOAA 2RDDA 4OYZA 2XMJA 1AROP 2Z2MA 2J7UA 4NLVA 1JMTA 4CO5A 4JV0A 2KZZA 5SZTA 1IJFB 3DLLQ 2B8PA 2DBBA 3K57A 1WF1A 3POTB 3HVAA 2EFVA 3KDNA 1HBMA 1AT1B 4F4XA 5KFBA 1FI4A 5D0EA 2N3LA 4O0NA 1I51B 5J2PB 3GIKA 4R5PA 2LDYA 2BKNA 5KFNA 3C66A 5LXRA 5BYSA 5LSOA 3LGNA 2G2ZA 3L4BC 2R42A 1HR0F 4LF6J 4WPAA 4Q45A 1C1CA 1XMOF 1KLMA 1QTNB 2MSTA 3DOKB 5DS7A 1TR0A 3B8HA 3HT0A 5E3AA 4ED1A 4I2PA 3QRRA 5B0CA 1K0TA 4O3QA 4DR2F 3TW0A 3KLVA 1GX6A 2U2FA 5C42A 3GV7B 4AXJA 1RLDA 3IN5A 2YKAA 3UW1A 3UVJB 3PV8A 1X8DA 2HHVA 4QR2A 4KSEB 3VAMA 1RTHB 1RWWB 5BR8J 1RT5A 2DO0A 3QZ7A 1B70B 2BMBA 3GIIA 3GJSB 3QSYB 5I42A 3JXOA 3HPOA 3DLHA 1MMLA 3SIPB 4OX6A 3EGVA 1GK8A 2FJEB 1HNXJ 2KG1A 5KFKA 2QO3A 1G2EA 3JYTB 2Z0GA 2VQEF 3VGUA 3A4TA 1R27B 3GILA 4DSJA 3BGOP 1U24A 5J2QA 1F6TA 1YWXA 1QE1B 3ENWA 1H2TZ 1S6PA 2C22A 3HO1A 2FJBB 2SXLA 2JX2A 1WELA 4CH1A 1UA1A 3UPFA 1HBOB 4ZVTB 1EB0A 5IM0B 2QIFA 4QYRA 2DRBA 1GX5A 3DHXA 3CD5A 1CJVB 1FNMA 2WOMA 3MTJA 5GAGU 4GKKJ 3VQTA 2HMIB 1FCAA 2WSEC 3M2VA 1KSPA 5H1SV 2RAQA 2JEFA 5E0OA 3GE9A 4QIWD 2HVZA 1GAOA 5HATA 4F0HA 4O44A 1DRZA 2J0SD 2HS0A 2VASA 1O51A 2HK2A 4I7FA 4KV8B 1JLGB 1MW7A 2A0FB 4ZJQA 4AE5A 4Y2CA 4MMOA 4ECYA 2YY3A 2BKPA 1SVDA 3K5LA 1KHVA 5E7OB 3D1QA 2AU0A 1YRXA 1YZ7A 4DV4J 1U4BA 1UETA 2CPZA 4CI0B 4GC6A 4LREA 3CJRA 2BANA 3TP2A 1FFSB 5A2QY 5KTQA 5HVHA 1KOOA 3H2UB 3OXGA 4OYWA 2A10A 3TUJC 4CTAA 2LKZA 1JXLA 3CVKA 2XYHB 1JWWA 4F25A 1SL1A 1OO0B 2DGTA 5K14A 1TUVA 2F8MA 3I55S 2RB7A 2I6WA 2VBXA 2V2VA 2UUAF 2QFIA 3GWCA 4KFBA 2XO6A 3W5YA 2OO4A 3CC7S 2YKMA 4A4JA 3DMJA 2BRLA 4USWA 1NJWA 2ZH9A 3I0RB 4QIEA 3D28A 3HHLB 1T94A 3D1OA 3I82A 1AZSA 4EI2A 5LL6d 4L72B 5HVFA 1VRUA 4E2FB 3J81Y 4OX9F 3CCZA 1TMJA 4FYWB 1XWLA 4LSNA 1Y3KA 2Y3YA 1TTHB 2BDPA 1N6QB 3MM9A 3BEGB 3FZ2A 1KNZA 3QSIA 4PUOB 4G1PA 1CG2A 2IJFA 3OR1A 4N8NA 3AD8C 2N4DA 3MDFA 3QZ8A 3IXQA 3IRXA 4K4UA 3DXBA 1VC5A 3OQ2A 3MZIA 4CYUA 3BGRA 4PWWA 4GRSA 3ET6B 4K4TA 3F56A 2UXBF 3MR5A 3H42A 3OUYA 4TKTA 3QFWA 4NEYA 5IT9Y 3AOBA 1LFWA 2YNGB 2RKIA 3W9HA 4XPCA 1XNRJ 2CDQA 2OEKA 2A6OA 4ZITA 2VDHA 3CD0A 1EZZB 3SMZA 1JJHA 3QBCA 1T9TA 2ROGA 3LP2B 5KFCA 3T5HA 2QX0A 4ZHRA 4F02A 5LXYA 2CZ9A 4CLUA 1QD1A 3TZXA 2AGOA 1Q81T 1S6QA 1WWHA 4KH0B 1TL3B 3AY0A 4ICLA 1TU0B 2N3OA 4LRCA 2K7KA 3HVTA 1EETA 2FLOA 1P27B 5IXUA 2R3VA 1FRKA 2B5JA 4KRWA 1TUGB 3Q8UA 2X51A 1KS2A 3TJ9A 4O4GB 4X4TA 4A46A 4FXDA 1KVIA 3PX0A 3HHNB 3WX4A 4C7QA 3LW5C 1F2GA 3GTYX 4OZ1A 5A6PA 3KJFB 3GYNA 4C8NA 4LF4F 1X0PA 2KO1A 4F4KA 1RHKB 3A12A 2B6AA 4XPEA 1HI8A 5HBMA 2WSCC 3IAM9 2RRNA 5FDLA 4N41A 3I0SA 4CCHA 3PR4A 1RTJB 3IG1B 2L9NA 4DDFA 5LJ3Y 1S1VB 2C2ZB 2MGZA 3CNQP 5J2MB 4K4WA 4NI2A 3N5FA 1E6VA 2ZH2A 4LF9F 3A8KA 4A8MP 1V5IB 3CC2S 4IOAQ 4MJKA 4DV3J 3B54A 3BO4A 3HHLD 4LFCF 1NDKA 3S7RA 3PEHA 2WSFC 3AB4B 3W5XA 2VJUA 5M2PA 3Q83A 2BJ9A 2HZCA 2MLZA 4TU9A 3PEJA 2UVRA 4JI1F 4EU0A 3RR7A 1SKSA 5F9LA 3OBIA 1T03B 4ZJOA 3NGUA 4FS1A 2BKOA 1X5TA 3KMSA 2PMWA 4DL3A 2CWKA 3R5GA 3I4HX 1YITS 3GR0A 4BWMA 4NLXA 1S97A 1JLCA 1XMQJ 2OH2A 3W61A 3HD2A 3QGIA 3GIMA 3UCGA 4LQ3A 3UI3A 2NXEA 3AH6A 4DV7F 3CCES 2GS8A 1CSJA 4YB1P 2V8DA 4F2RA 2XULA 3PW0A 2P5VA 4TVAB 2IYGA 2NUUG 1KQKA 4DR4J 4YS2A 3ZTRA 2DCUB 2YNIA 3E01A 3CC4S 1T9XA 2HFVA 3PIPQ 3KLEA 1HLWA 4EYHB 3CCWA 3DOMB 3EDQB 1NSAA 1WJ9A 2J0QD 2ZEJA 3MMCA 1S1XA 3L95X 4NOHA 4KKOB 1U0SA 3R1HA 1U26A 1TKTA 3EGWB 1PJ6A 4I56A 1V6HA 3JAMY 1GTHA 3KLFA 2W9BA 5HROA 4RNNA 4EMDA 3KK2B 1BLUA 5E3PA 2VOOA 3UCZP 3R8YA 2LQ5A 3KG4A 1OY8A 3SCJE 1OWXA 4DSFA 4C0HA 3D4JA 3NGKA 2DNOA 3TA1A 4X64F 4QCLA 5ETPA 4K0KF 5A0YA 4X66J 1H2VZ 5HQMA 5CHCB 3QT5A 4FXWA 2CG8A 2EFNA 1ZZNA 5KG5A 2C2OB 4YUDA 1NU4A 3EMTA 1N56A 3VGTA 5KFQA 5K8NA 3W8GA 1IBLF 2H4WB 2GZOA 2IBKA 1X4HA 1BY9A 3UDVA 3SCKE 4ZN3A 3L09A 3B4DA 4KY3A 2F9DA 4M5IA 1IR1A 3UFCX 1RHJB 1S9GB 4PWUA 4ZPVR 4L3KA 3LWMA 2UU9F 2H5JB 4EK2A 2HEKA 2E66A 3G8TA 1LWCB 2AJFE 4QIFA 4DQIA 2UV8G 5KFDA 1LOUA 4TU8A 4CH0S 2QGFB 1VQNS 2V68A 4DV0F 2JVRA 1C2PA 4FXVA 1FFWB 3MEGB 4H4MA 3W64A 3RW7A 5A6WA 4KT0C 4M5DB 2VD3A 4Q44A 3KUHA 3N28A 4WFYA 4ELUA 1JQGA 1URNA 3TVKA 4DR7J 3G6ES 5CZXA 2B43A 1ZA1B 4Q8EA 4WTYA 4RX6A 3Q24A 2QLXA 3VHQA 1HYSA 4KPYA 3NG8A 3M9MB 2GAHC 1HNIA 2I8EA 3S8SA 2KXFA 2AQ4A 5GAHU 2QSWA 1U2CA 4ZP9A 2ATCB 3CT9A 3LP0A 4A8OA 4ETXA 2R2SA 2RT3A 3JTNA 2IAJA 2R7QA 1IKYA 4B3OB 4QW8A 4OV6A 4OL8A 2VB6A 1S1TB 4OYBA 4U7CA 3QIDA 3IM8A 1N5TA 2R7WA 1T7PA 2FQQB 2MPUA 3IWXA 4HDHA 4ECUA 2XS7A 5KFGA 3G86A 1PGZA 1SC3B 1ZZFA 1REGX 7FD1A 4CLTA 1KTVA 3DOLB 2E9TA 3FBFA 3POTA 5E5NA 4ANCA 3NWGA 1YJ7A 3W9JA 3TQ1A 3TA2A 4DUYJ 2BW7A 4U7UK 3NCPA 1A0OB 1RK8A 3PHEA 3TUPA 3C46A 1HWLA 1FKAF 2I0XA 3P3DA 3PY8A 4M5LA 4BBYA 1R89A 4K4VA 3NS5A 1NK9A 2F65A 3DOKA 1U0HB 3IBFB 3IBCB 4DFPA 4H4OB 2EK6A 1K0VA 3W65A 1U1PA 3DRRB 2EFOA 2PIIA 3K7RA 2PFFB 2MY7A 3IAS9 2KFYA 1RLCL 1EIYB 8ATCB 1IUJA 2E5LF 4OFZA 3UVJA 4F4ZA 3LUYA 2A1BA 2ASDA 2QA1A 1RTHA 1WEYA 2FUG9 3GQCA 1VQ7S 1EQ0A 5ETTA 3CO9A 4BS2A 4DR3F 2QA4G 3W2WB 2A3JA 2AYGA 4OX7A 2GIRA 1IBMF 2D7SA 4P74A 4YY3J 5KG4A 1HBNB 2RVJA 3JYTA 3UCUP 4DUZJ 2FZGB 2ZH7A 2AJQA 3CCSS 2Y8WA 3MMJA 5C25B 2FVQA 4K50A 3DLKB 2V4JB 1QE1A 1UVNA 3ZZUA 3H5SA 4LR8A 1N36F 1NDPA 2C2DA 1HBOA 3IFEA 1AB8A 2AMCB 1FEEA 2MQQA 1MSWD 5IM0A 2IYIA 1ZA2B 2HQGA 2DR7A 4UOFA 4ECVA 1CJVA 1TK0A 5CYMB 1CC8A 1JLBB 2BVZA 4CO3A 1S9EB 2HMIA 3G6YA 2I2YA 3TJ8A 1SIZA 2FD2A 2W01A 2ALYB 4PZVA 4DV1J 1H98A 1TZ0A 1VC6A 2P6TA 3FFIB 2RQMA 2LQBA 3OTBA 1RA7A 2WVFA 2UUBF 2M3DA 1ZOTA 1GXUA 5EWGA 4KV8A 3K8VA 1N33F 1JLGA 2DHAA 3JSBA 3PCOB 3M8ZA 5JVHQ 2WCXA 1Q8BA 4JI5F 5ETVA 4B3SJ 3BQ0A 3QLHB 1NJIT 2I5JB 1U6FA 2OPQB 3IR7B 4U9RA 4UY85 5D0RA 4M5JA 1IJEB 5HAOA 3GP9A 4IH6A 1NHKL 6FD1A 3M8RA 4LUBA 5AXKA 1VQKS 2ZOFA 1QM9A 4WIIA 4TY8B 2VPZB 3D0HE 4PQAA 1OMSA 4DJBA 1BUXA 2V4RA 1FDNA 4GVBB 1PO6A 3HHLA 3K2YA 3TA0A 3WZ0A 5A76A 2AHOB 1RTIB 4DL0C 4P7TA 2HHTA 5KT7A 1RDRA 2RRAA 5THWA 3HSDA 1ZAWA 4NLPA 2LDIA 1D3WA 4I4BA 3R5JB 1GTEA 5F8IA 2QEXS 1IWGA 1KVJA 2XQCA 3MFIA 4MK7A 1N6QA 4IDKB 3CCJS 5FLXY 4UY8T 1FXRA 4HR2A 3I32A 1HIYA 2ZBPA 2U1AA 4DWIA 3MUMP 1Q5YA 2MMYA 1NH8A 4PUOA 3QAUA 2HFUA 5HJYA 4LIWA 1SUQB 3SFGA 3BZQA 1B64A 4QWEA 1I94J 1RXOB 1FJCA 1LNQA 3DFEA 4X4VA 2KKHA 3Q8VA 2IVYA 2AJ1A 1OPZA 1XTZA 3Q86A 1FTRA 4C8MA 3J7A1 3K5NA 3OHAA 3W5ZA 1A7GE 2OD6A 2NSCA 5ETOA 4J9RA 2AGPA 3ET6A 1RAOA 2H54B 3DHWC 1RT4B 2XCPA 1CJKB 4ZDNA 2YNGA 4EFAC 2Y9HA 1VR6A 5AXNA 4RW9B 3VR1A 4F3MA 2DNKA 2NXCA 3EDRB 2IVFB 4ERDA 3N5BA 2VICA 1EX8A 1HD1A 3LP2A 3GYXB 5GADI 3T5JA 1L3TA 3UD4P 5K8MA 3TZZA 4WU2A 2XWXA 3NP5A 3R5DA 2JFDA 5KT5A 2IA0A 3VVUA 3CPWR 2YWHA 1TL3A 3SSSA 1NHVA 3L7UA 1T0TV 5KFFA 2V0NA 2FB0A 3GV8B 1FNOA 2LMIA 2JRSA 1JNZB 2COLA 1K44A 2CQHA 2B9WA 1SJ1A 4G1QB 4O4GA 4FF3A 4MTPA 5BR8F 3FSXA 2YKPA 5H9FJ 2QYGA 2OELA 1Y10A 3TI0A 3V2UC 4ED6A 2YQ0A 4ZCLA 3J80Y 2VKRA 4R0JA 1Y7PA 4P52A 1CJTB 4OZLA 2EPIA 4USHA 3SDEB 1B99A 2AP6A 2KYXA 4I69A 3PACA 3CWJA 2BJDA 5CD4A 1AYEA 2FLLA 1RTJA 4DG1B 5IWAJ 3G82B 4N8OA 3PDNA 1S48A 4ZKAA 3IG1A 2PD1A 1TKZB 3MAHA 1UVJA 2HLUA 2QMXA 4C9DA 5J2MA 1SIWB 3N9UC 2C3UA 5FD1A 3LH2S 1PC5A 1KFSA 3O44A 3WHIA 4GKKF 2QLBB 2GC8A 4JI7J 2ZBRA 1H72C 5C5JA 3U27A 1NEEA 1U6BA 4ED8A 2VPYB 4C4WA 2UP1A 2XY5A 5DQHA 2VPXB 3PRVA 1BWVA 1FDBA 2BX6A 4DI6A 4EGLA 2B8QA 3KK3B 4KAIA 4CLZA 4DBQA 3CMAS 4ID8A 2OTJS 4JI0F 1T03A 2DXDA 3WIUA 1RAHB 1EP4B 1SKUB 3ZXWA 3CF5Q 1N48A 3DCAA 4OX8A 1UJ6A 3T1YJ 3DRPB 2W7PA 1FT8A 5EWFA 4J9LA 1FJGF 2FIUA 4OLPA 3HJVA 1HR0J 2R7UA 1VRQC 2IVMA 3FQLA 4WF9Q 2NSBA 3G8SA 2DRDA 2ATLA 5K8OA 2C42A 2HZVA 4JV5F 1RBAA 4DPUA 1P9QC 2W4DA 4NZ7A 1DARA 2PEBA 1VIOA 1TV6B 4EEYA 3I5AA 4MH8A 3FK4A 1X5OA 1Q8KA 3VAFA 2MZQA 2CPXA 3DOMA 3RAQA 2L08A 4AL5A 2MLYA 4KKOA 5AXMA 2DKOB 2FVPA 2QA2A 4HDGA 4DV6F 1HNZJ 1S5ZA 2HQFA 1T9VA 4K2XA 2HZAA 1U09A 1DFDA 3I56S 1NMEB 2CJQA 1VQ5S 1DQAA 1SH3A 2E1RA 1BE4A 5RUBA 2HNZB 1RAIB 4EBCA 1VJWA 1LKZA 2BEFA 3NLCA 3NRBA 1MU2B 4J9QA 3PO5A 3KLIB 3MEKA 1GXTA 2FHJD 4PR6A 3ZNUA 4MKBA 4NRUA 1S6UA 3FEZA 1RA6A 3FQKA 3CDEA 4N47A 2ASLA 3M32B 1GMVA 2WVCA 2Y8YA 2HBQB 3UD5A 3CB4A 3VAJA 3PX6A 1U48A 1N0UA 3I9V9 3RAMA 1FX2A 3VZHA 2CQ0A 1H3DA 4ZVPB 1LWCA 3P49B 5LMNF 1BC6A 1FRJA 1RT2B 3IM9A 1XNRF 2K1RB 4ZLJA 2IMOA 2F63A 1WEXA 2JZ5A 1R6VA 2W24A 3FZBA 3MEEB 3FMWA 3BR9A 1R0AB 4NXNJ 3MEGA 4B9VA 4JUZA 4Z37A 3NXZA 1NJXA 3BREA 1QVFR 1LEOA 3GJRB 4K7QA 2JWNA 4WFAQ 2F9JA 1UMJA 4M5DA 8RUCA 2J9DE 3OL8A 2CUYA 4L74A 4D3HA 4YB5A 1OYEA 2D3UA 4OLOA 3HDSA 4CH7A 3J7Z5 3GONA 1H38A 1RAAB 1QAIA 1IKXB 2IPOB 1SCJB 2ZVSA 3ZC4A 5DGBA 4C48A 2UXCJ 2HRUA 2NCKL 3BGLA 4N77A 1NZ8A 3N6MA 4RO0A 1YJ9S 3M8WA 4UQTA 1RWPB 2X1AA 4M5KA 8AT1B 4ES2A 4B3OA 1XR5A 1OPIA 5KG6A 1RKJA 4XDDA 2HYIB 4OYIA 1WKJA 1VMBA 1HQ2A 3HSGA 4OI4A 1S1TA 3KUEA 4TNOA 3NAHA 3BB5A 1HNWJ 4J9UE 2KYZA 3BBCA 4OQJA 4OX9J 3U1LA 3PW7A 2VPWB 4O3SA 2ZZNA 1Q78A 1I6JA 1NSKL 1SBRA 2O3DA 3FSIA 5KG2A 4YEAA 1N0VC 3V6DB 2B0GA 3LQVA 1SQEA 1FJEB 5G0RB 4Y2AA 3DOLA 2V4QA 4HACB 1LQ9A 5HVGA 2E5HA 2AJ4A 3MUVP 1HWKA 1R0BG 4WZQA 2RIJA 1FXDA 1KQSR 3J7ZT 1N34J 1ZAVA 1VHIA 5I4MA 4CLKA 4O3PA 3KJNB 4FPRA 4TN2A 4DPXA 4DV3F 2E7XA 1NHUA 1SH0A 3M8SA 5A8WB 2H3EB 3TO8A 4ED7A 1U0HA 1KQGB 3MM6B 2LQ8A 5KT6A 4H4OA 4Z7CA 1TUWA 3DRRA 3C16B 4C8OA 3HK2A 4ZPDA 3D7SB 4J91A 4W4MA 2FY1A 2IM3A 3O1LA 2M52A 5F0WA 3PZPA 1S76D 2B4VA 3IR5B 2E7VA 3UQSA 4EWTA 1DZ5A 3W1YC 1NPKA 4DS4A 4IQXA 3WX8A 4UOGA 1XBWA 3SCIE 3NOGA 3W2WA 1VQLS 4B08A 1NO8A 1HMVB 5B0AA 1RWKB 3W8PA 4DFMA 1M5OC 4L6V3 4P6QA 1HBNA 1IBKJ 2IHR1 3C2PA 3NY0A 4USMA 1SL0A 5DG8A 3EXYA 2QN6B 3QWUA 1YSJA 2WVBA 4WBFA 1HHQA 4IO1A 5C25A 1D9DA 3BN4A 3DLKA 2V4JA 4DPWA 4NA3A 3HSZA 4ED4A 2YX7A 4NASA 2FHKA 1WF0A 4CQ1A 4HI1A 3PNIA 1SC1B 3BF4A 2CADA 1VIXA 3PJWA 1RYRA 4ED2A 4ZVEA 5EWEA 2DK2A 2BABA 5T41A 4CLYA 2N7CA 5CYMA 1JLBA 1S9EA 4LFAJ 3O6QA 4WE1B 4NL5A 5GAEI 4LF4J 3BBFA 4Y0FA 1J2VA 2VL1A 3G8QA 3FFIA 1S7HA 4ENOA 3H5UA 4HYKA 2H9ZA 2HFNA 3OXFA 2KT2A 4X66F 3EM1A 3T6JA 5T14A 2VIHA 1U02A 1KQFB 3RB6A 2BYCA 1CQNA 1LV5A 2MQOA 3QLHA 1SJFA 2I5JA 2OPQA 5CQGA 1LWEB 2KDOA 4LFCJ 2HHQA 3TNVA 5HN0A 4QYZK 4MKVA 4DL6A 3FBEA 3QFHA 1P8GA 4MKAA 4A8SA 1CEZA 2DH9A 5LSLA 4X4RA 2Q1LA 4LVOP 2XGPA 3GLJA 1XR6A 4OI6A 3QGGA 2Z56B 1Q53A 5B0DA 1F5BA 3VALA 3GIJA 1PAUB 3K0JA 4TY8A 4RU9A 3BDEA 1DAXA 2HHHF 2VC1A 4A8YA 1Y4ZB 5C24B 4GVBA 2VKZG 3AD9C 2R2UA 2FTRA 2AEMA 1R8AA 1RTIA 4LFBJ 1JLQB 2G13A 1IBCB 3RTVA 2DPIA 3MECB 3SV4A 4CLSA 3GU0A 2QC3A 4C3LA 2OMLA 4KHPJ 4Y00A 4OJHA 3G6XA 3QIPB 3C19A 3GFHA 4DR7F 1Q86T 1FKPB 4PG7A 3Q89A 3FEYB 2ADBA 1SKWA 1SQFA 1N88A 4QIVA 4IDKA 1Y5IB 2AZ1A 2G0CA 3M2UB 3SEOA 2MKCA 3O3LA 3CJ0A 3FUYA 1SUQA 3TOQA 4RNOA 2J6UA 2KN4A 2GJFA 4XO0A 1ZYQA 1EHWA 1U47A 4OI0A 5L38A 3V6KA 1Q95G 2FGOA 5CCLA 1V5VA 2BQRA 4DL5A 4RWWA 1FWKA 3D3CJ 2HS3A 1TL5A 3AJDA 2DJWA 2HRTA 3OL7A 2MJUA 4YN3B 4G1IA 1N5VA 1RT4A 2UXDF 4Q7AA 1XC9A 5ETLA 2GNKA 2RUGA 3V4MA 1CJKA 2ZUAA 1HWIA 2CQGA 3G96A 5CYQB 2KL8A 4RW9A 1U49A 1A9NB 2HQCA 4RUCA 1OYDA 4GMKA 4NLTA 4AYBD 3CIZA 1Y9OA 1U8SA 1SV5B 2N82B 1NB7A 1IBLJ 1F2HA 3HSJA 5KFLA 3QGHA 5B0BA 5DDPC 2HHSA 3LANA 1VLOA 3PW4A 2DGOA 4HL9A 4B9UA 2YPYA 3FC9A 2ZM6F 4DPTA 1OSCA 2RHQB 1YJNS 2UU9J 3M2RB 1VQMS 3D6TB 1R8HA 5AE3A 4L75A 1WDDA 4USTA 3BJYA 2VZ9A 3P45B 1DTQB 2E5GA 3LO3A 2H5IB 2FYXA 3FDSA 5HLFB 4UQGA 1YJUA 3HXMA 2ZITA 3D66A 4PQUB 1TL4A 4G1QA 5F0UA 3TVZA 3T1AA 1DQ8A 4DX5A 2HURA 3CCRS 4ZA1A 3TEGA 2XNRA 5F8NA 3M30B 2DGXA 2Z58B 5DM7Q 3PR5B 2JEIA 2EI5A 4KHRA 2O67A 2WB1D 1CJTA 3SDEA 4DUZF 1UAWA 1ZS6A 5LJ5Y 3JSYA 4W98A 3QAEA 1F9HA 4CNZA 4FYXB 3JS9A 2KB2A 4YR2A 2IC3B 4OI1A 4DG1A 3G82A 1YBUA 2OP5A 5CCMA 2HBRB 1PC4A 1TKZA 4UZCA 4QJVA 3MPVA 3OFEA 2LA4A 1KC8T 5DRKA 3LPYA 2DY9A 3PYFA 2M8DB 2Y0BB 2BQUA 2VG7B 3MHYA 3WIVA 5K20B 5JVGQ 2FLPA 4DV1F 4DR5J 1VGYA 3KK3A 1DURA 4ECRA 1UZHA 2OIHA 2RH3A 4FBUA 2APOA 3CTRA 3N0VA 3ENQA 2D74B 4PXBA 4K8RA 1EP4A 5KT4A 3QT7A 4Y2KA 4C0OC 3CJ8A 3DRPA 4B3SF 2HK3A 3L7OA 1TK5A 3ZO7A 2D9OA 1IQTA 4OJGA 5CAAA 1ROFA 3N6LA 4IUFA 4G3IA 1VK8A 4UW2A 3PKYA 3D54A 1U6ZA 2MB0B 1RYSA 4ZPCA 2ZH6A 4ES1A 4NLSA 1TV6A 1T02A 3CGIA 4USUA 4KE5A 1BGXT 2DYAA 3R1LA 1WC3A 2QZ8A 2HHXA 1RBLA 4EO8A 2E5LJ 4EO6A 3E51A 4FKYA 1FF2A 3MURP 3NMRA 4YQWA 4A47A 2NXUA 2V5HG 4OJ3A 2CJYB 3PTWA 4LF2A 2B56A 2AEJA 2YWKA 4IRCA 3BSNA 4URSA 4F3OA 3AFGA 4LBPA 4AXIA 2HAFA 1IBMJ 2M5YA 3MAAB 2R8GA 4X62F 3ZFVA 2XEXA 2NQPA 1SJQA 3FBCA 1DBDA 4C6AA 3WQPA 3KLHB 1QTMA 2HNZA 2ASJA 1RCXB 4P2XA 4RW6B 1JLEB 2FVRA 3R7SB 4USVA 4NLGA 2F3JA 2OTLS 4F0MA 1NK7A 4LRAA 3T9NA 2VF3A 1YBTA 1MU2A 1UW9A 4P7VA 2OHDA 3KLIA 1IKWB 4IG3B 3QATA 1I94F 1NRKA 3SI8A 1WD6A 1G4CA 4LF8J 1BMQB 3DU5A 2XYPB 3M32A 1MMDA 4O3OA 5KFXA 1O0PA 3OFHA 3OLBA 1C4CA 1FVSA 1M1HA 5HL7Q 5IFMA 4PRFA 2UUBJ 3CMQA 1YBAA 2C3OA 3UR0A 2DR8A 1K9MT 1RT2A 4ZPAA 2K1RA 2OPRB 3T19A 3EUNA 1KHWA 5L46A 1YZ6A 5BYRA 4DSIA 4JI5J 3MEEA 4DXLA 1R0AA 3HHLC 2G0IA 3P4UB 1DHMA 4DL4A 1S1UB 1RGVA 1AA1B 1H2UX 4NLYA 2G2OA 1X0FA 1RWOB 4C2MA 1WG4A 4NWBA 3Q8RB 1FRMA 1TVRB 3CJ4A 3NEKA 3RYLA 4DHVA 2AV5A 2Q66A 2J5AA 2V8GA 1YJRA 4ELTA 3ZNJ1 1NZAA 1IKXA 1RTZA 3PHTA 3ISND 2R8JA 4CNYA 4F36A 1PILA 2GHPA 3Q8YA 4NLUA 2CNLB 1L5UA 1YGYA 4CT8A 3QT6A 3HZEA 2LU2A 4DCJB 1RAJA 3HT3A 4H4KA 4FF1A 1NKEA 3E8OA 5LMUJ 4ECZA 5ETSA 2W25A 3J7AN 1ZAXA 3V6DA 3NNCA 5G0RA 3MR7A 1S0VA 4HACA 4J9SA 5GVQA 3I5BA 4R0EA 1NUEA
chains in the Genus database with same CATH topology
1DJ0A 4OZ5A 2DR7A 2N4CA 5IWAF 4B9TA 4ECVA 3CMES 2HNYA 1UEUA 2PN6A 1V3ZA 4LVNP 5CYMB 1TK0A 1CC8A 1RQ0A 1JLBB 4JOUA 2BVZA 1BD6A 4N5SA 3W3SA 4CO3A 1S9EB 2W9AA 2HMIA 3AQPA 4LSNB 3I4PA 4MYTA 1HFEL 3G6YA 2I2YA 4QU6A 3N6NA 1G7CB 2CPYA 2ZOMA 5T7LA 4QR1A 3MM9B 4QQBA 1Q1KA 1SIZA 2CPIA 2FD2A 4ZLPA 3C6UB 2JEJA 1H98A 3I5CA 1TZ0A 3DI6A 2I1RA 1VC6A 2P6TA 1TFYA 3FFIB 2RQMA 5J1EA 2LQBA 2X1GA 2KXHA 2YQ3A 1ZM3A 4JI7F 2E1CA 3V4IB 5A8WA 2HHSA 2ZH4A 5DDOC 3OTBA 3OR1B 1RA7A 3W2VB 4DUYF 2UUBF 4R25A 4JI8F 2W4CA 1XMBA 2M3DA 1ZOTA 4K5RA 2RQCA 1GXUA 4NLQA 1WI6A 3G4SS 3HHEA 2YWGA 3MM6A 4MFBB 4RBTA 5EWGA 3GG1A 1TQLA 4KV8A 5CA5A 3K8VA 1N33F 1JLGA 4ZP8A 5B7WA 3O2IA 5DJBA 3EYZA 2DHAA 2DIVA 3JSBA 1RP5A 3SSQA 2ZNZA 3IRXB 2ACYA 3DGPA 3X1LB 4URQU 3IS9B 5JVHQ 4F2SA 2BM0A 4ZP6A 3H4BA 1S9GA 2QYCA 1YRTA 2HQIA 2WCXA 3RBEA 1Q8BA 4B9MA 4JI5F 1WG1A 2EKYA 2PSZA 4ZP7A 4DOZA 1D0EA 1S1WB 4NLDA 3BQ0A 3QLHB 1NJIT 2I5JB 1K8AT 3BGRB 1U6FA 2O66A 2HNDB 4QPXA 2K3IA 3RRGA 2HVIA 2VUGA 1X4BA 2OPQB 3IR7B 2GO8A 3ITHA 2Z4PA 4BWJA 2HRYA 2VV5A 4I1TA 4U9RA 1JNRB 1G6BA 4DV2F 1LWFA 4UY85 2HHWA 3SYZA 3QYYA 3T1YF 1M5PC 4F8RA 3NBPA 5HP1A 3OUYB 1IJEB 1SJRA 4I68A 4ZPTR 2J7KA 2FHJA 3CIMA 3GR1A 4IH6A 5K9FA 1MWYA 4RW4A 1VHFA 2RKIB 2EFQA 3AA9A 6FD1A 3VAHA 3R5BA 1QUVA 4PPZA 3SSRA 2QT7A 4Q2LA 1HMVA 3TUZC 3PW5A 2EK1A 2WBRA 2XSFA 4OIXA 3M8RA 1OS5A 4YDDB 4LUBA 3M9NB 2MQPA 5AXKA 4BC9A 5CD4H 3RAXA 1VQKS 2ZOFA 1D9FA 1QM9A 2MZSA 3GFXA 5HMWA 3C6TB 3HF5A 4C11A 4WIIA 3MMAA 4PXEA 1QSYA 2PA3A 2AYMA 2LVWA 4WZMA 4I64A 2VC0A 2BM1A 2ZH8A 4TY8B 3THVA 2VPZB 5CYJA 3D0HE 4IQMA 2D9PA 4PQAA 4GC7A 1NK5A 2WTFA 1SJ4P 4ZHRB 4DJBA 2UUCF 2VBYA 2UUWA 2V4RA 1C0UB 1FDNA 3N01A 1PO6A 3HHLA 3K2YA 1IXKA 1WACA 1HQEB 4NCGA 3IBWA 4WFXA 4NA1A 3TA0A 3WZ0A 4QWBA 4YY3F 1S6QB 4W92B 3MM8A 4HI2A 1RTIB 4DL0C 4P7TA 3DXSX 2DHSA 5CZVA 2XY7A 2HHTA 5KT7A 1RDRA 2RRAA 3WDOA 3NCRA 2VQFF 2R7VA 1QAXA 1YJVA 5THWA 1ZAWA 4RWXA 2ERRA 4NLPA 2QFJA 3ZZRA 4ICLB 2Q79A 1Q16B 3BS9A 4YR3A 2LDIA 3RR8A 2XI2A 1D3WA 3FGVA 3NAIA 2PDAA 4I4BA 2JLGA 1K73T 1HNZF 1GTEA 2XGQA 1UW4A 5JUMA 3HVTB 1X9MA 1EETB 5K8PA 4TYBA 1M5HA 1V3RA 1FTCA 2X3GA 3FEXB 5F8IA 2EVZA 5HI7A 2QEXS 2B5JB 4WXOA 1UP1A 1KVJA 4IR9A 3CCVS 2K8GA 4ECTA 1DLOA 1RTDB 1N5YB 3MFIA 4WE1A 4MK7A 3TVYA 1N6QA 5E3RA 4IDKB 2ILZA 3JSMB 2OJ3A 4J5OA 4FYDA 3CCJS 1X5PA 1V9OA 2WK4A 4HT5A 5FLXY 4UY8T 1FXRA 3HX9A 1L3KA 4J9MA 3I32A 5KFJA 3P96A 4DR6F 2XY6A 2U1AA 3JSRA 4DWIA 4EZ6A 3HKZD 3MUMP 2MMYA 1NH8A 2GIQA 4PUOA 3QAUA 2IM1A 5EDWA 2CQBA 5A8KB 4F4WA 1FE4A 4LIWA 1MWZA 3NMAA 4QR0A 3PO4A 3NKYA 1SUQB 3SFGA 5KFUA 3BZQA 3JB9k 1B64A 4QWEA 4NX9A 1FJCA 1Q7LB 2DNPA 3MEDA 4DEZA 4Y6IA 4KHMA 2RE1A 2GMJA 3DFEA 4X4VA 2PEHA 1S4FA 1RISA 2KKHA 5KT3A 2JL9A 5KFWA 2M0GB 2IVYA 2AJ1A 3MR3A 1OPZA 1XTZA 3KG0A 3PRDA 3CCTA 1TKXA 4X65F 2HWHA 2AF6A 4WU3A 2KVIA 1FTRA 5I3PA 4JI3F 4C8MA 4LF7F 1UJ4A 5SUHA 3EPIA 3K5NA 3J7A1 2VODA 1KLNA 3NS6A 3OHAA 3EGZA 1FE0A 2OSQA 1A7GE 2QMWA 2YKNB 2WONB 2OD6A 2C2RA 1S0OA 2B6AB 5HMYA 1P1LA 5J2NA 1FERA 4M8LA 1SC6A 2NSCA 4B02A 4J9RA 3EXCX 2AGPA 2OSRA 4C0BA 2V8HA 5HBMB 4O0IA 3H20A 4CO2A 4YOEA 2MQMA 4Y65A 2BOPA 3FNNA 4RBUA 1ZPWX 5FDLB 1LWEA 5D3GA 2XMTA 3DHWC 3MCSA 2E9RX 1RT4B 3I0SB 4V19J 3UDLA 2XCPA 1XERA 3RW6A 4KC5A 4AL6A 4DL2A 4TYAA 2FVCA 3T3FA 5DO2A 4ZDNA 2MGZB 1OQ3A 2YNGA 4EFAC 2PE8A 1N5QA 2XG8A 2OFHX 2KM8B 1SL2A 2R7TA 4WKRA 1KR4A 5AE1A 1HW9A 5AXNA 3PM9A 1NK8A 4RW9B 3I96A 3K8WA 1Z4UA 1E6VB 3VR1A 2UVWA 2ZDOA 3U02A 4F3MA 5LT5A 4C8ZA 6FDRA 2DNKA 1HBUA 2XWYA 3FRZA 3FRYA 2M8HA 4RKUC 2IVFB 4ERDA 3N5BA 2ZHOA 4JYAF 3OFFA 2PC6A 1IM4A 4DSEA 1X4GA 2FJAB 1HD1A 3QPIA 1U25A 4PXDA 3LP2A 2B4OA 1NH7A 3GYXB 5FJ4A 3S01A 2HPUA 5GADI 1JJ4A 3H2LA 3T5JA 3BSCA 3D1HA 4PXCA 5B0EA 4ITSA 5FIIA 5F8MA 2DNNA 4F50A 5C24A 1WHXA 2B9YA 4BC7A 3K5MA 1L3TA 3KHGA 3UD4P 5K8MA 2AWZA 1VQ6S 4WU2A 4K5SA 2XWXA 1H6KX 4KBIA 4TXSA 3THTA 1SJ3P 1GT8A 3PJXA 3K58A 3NP5A 4DF4A 3R5DA 2KT3A 4OHZA 3KJVA 2DISA 2JFDA 4BHQA 4DFJA 4NXNF 4ILRA 5KT5A 1REVB 2IA0A 3M8QA 1JLQA 4J9PA 2QRRA 4O4RA 2JJ4D 3CPWR 3KMQA 2ZFHA 3B4MA 2YWHA 1TL3A 3MECA 2FJXA 4IO9Q 2FJWA 3SSSA 2FJVA 1NHVA 2RJZA 5D4OA 2PMZD 1M90T 2YNHB 5KFFA 1R8CA 1Z1ZA 2GMHA 3KYLA 3CCMS 4KTQA 2V0NA 2KH9A 2FB0A 3GV8B 1FNOA 5F8GA 3CCQS 3VF0B 2LMIA 4ATNA 3QIPA 4PPDA 2XMUA 1X4FA 4BDPA 2JRSA 3PXGa 3QJJA 4E98A 1FKPA 1JNZB 3CEDA 2D3OR 1JJ2R 2COLA 1UEVA 2KZMA 2CQHA 2C3MA 2B51A 3DDNA 2ABYA 2ILYA 2B9WA 2J9CA 3HFKA 4ZVHA 1JLCB 2M4MA 1SJ1A 2O1PA 1HHTP 4EZ9A 2EW9A 3VWSA 1E6YA 2R9LA 1VQYA 4EUVA 3KHLA 1DTTA 1RT6B 3CD6S 4G1QB 2BR0A 3M2UA 4O4GA 4FF3A 4B9NA 4MTPA 5BR8F 1Y0HA 2LLZA 1D8YA 3OL9A 1FEHA 2DGQA 2YTCA 2FJDB 4TY9A 2GX8A 4L3NA 3FSXA 3HZGA 4DF8A 5HMXA 2YKPA 5H9FJ 1WTBA 3NNAA 2A2DA 5H9EJ 2OPPB 2GA7A 1BQNB 1YG0A 2GQ2A 1RT5B 3ISNC 4IFVB 2ALZA 1APSA 1HA1A 1TL1B 2UXCF 2RMLA 1S6OA 3CDAA 3MUTP 2DH7A 1S0NA 3TI0A 3SFUA 3V2UC 1YRUA 4A8FA 2XB2D 4ED6A 5IQQA 2EBGA 1TAQA 4ZCLA 3J80Y 3DRYA 1W2BR 2JDJA 1VQOS 2CYYA 4MKYA 1ZPVA 2AJ0A 2VKRA 1U1RA 4R0JA 2YWFA 3LP1A 2BV3A 1Y7PA 4FNHA 2YNIB 3E01B 4OZLA 3SXLA 2EPIA 4DMZA 4MIBA 4K4SA 1F60B 2UZAA 2IRUA 4USHA 2KI2A 3SDEB 1MMNA 2AP6A 3KLEB 2KYXA 3AQOA 5GMKa 3US5A 5JJBA 2L48A 2RD5C 2WHOA 4I69A 4UUXA 4DPOA 5CXTA 1HNWF 4OHXA 3PACA 4NCAA 4QWAA 4DQRA 3CWJA 1KN6A 2VH7A 1FK9A 3DU6A 5DM6Q 2ZJRQ 2BJDA 3MMCB 1S1XB 2CFXA 2BZ2A 3MD1A 5HMZA 1F0XA 3RRHA 4FVCA 4R8UA 4TQSA 3MI7X 5KFOA 2ROPA 3FVYA 1RTJA 3TUIC 2FLLA 4DG1B 1D1UA 3MM7A 2RQ4A 3HKWA 1TKTB 4IYQA 3PDNA 1S48A 4N8OA 3IG1A 3VZIA 3MD3A 4ZKAA 2PD1A 3V6HA 1TKZB 3MAHA 1KFDA 1UVJA 1LW0B 2E1MC 1GNKA 3DN9A 1QUPA 1QY7A 2HLUA 2QMXA 3IGVA 5HO4A 5KT2A 4A8QA 4C9DA 5J2MA 3C8YA 3J7YI 3KLFB 1SIWB 2J7WA 5CYQA 3N9UC 1S0MA 5HROB 3PIOQ 2W9BB 2C3UA 3UDCA 3OTOF 2K2PA 4DS5A 4NZ0A 5J1PA 2YKQA 2YX4A 1U1QA 3PRBA 3TAMA 5FD1A 1FRLA 2GGPA 3LH2S 2PI5A 1PC5A 3M1VA 1UKUA 3KNGA 3O44A 1KFSA 4GKKF 4AFFA 1SV5A 4M1KA 2GC8A 2XLKA 4JI4F 4NLRA 2JLEA 5C5JA 3PX4A 3U27A 4YB6A 1NEEA 3T1HF 1U6BA 4X4NA 2BE2A 2MXYA 4ED8A 2VG5B 1HPZA 2VPYB 3K5PA 4HH0A 5D4PA 3N4WA 3JTOA 4C4WA 1N34F 2UP1A 5A0YB 1A6LA 4CT9A 2XY5A 5DQHA 4DN9A 3V5RA 1LFPA 2R4FA 2VPXB 3V81A 3SQGA 2NR0A 1FDBA 3T9ZA 4EGLA 1ZTTA 3KK3B 2HW3A 4KAIA 4K4YA 2C28A 2J9DA 3AHPA 3HI9A 2CZ4A 4WYWA 5KFYA 3E3XA 4DBQA 2JC1A 2W8KA 3R3TA 2CQPA 3CMAS 2KFZA 4NLWA 2ZD1A 4ID8A 2CJKA 4JI0F 2OTJS 1H7XA 1T03A 3M2RA 2VBWA 3IWLA 2WW8A 1HW8A 3IRWP 4YFUA 4DQPA 4W90B 2XZWA 1EP4B 2ASYA 4DN0A 2DD8S 2NPFA 3MM5B 3OTCA 3CF5Q 2L9DA 1N48A 3O5TB 2DCLA 3DCAA 1DTQA 4KQZA 4OX8A 4HKQA 1HHSA 1VQ9S 3M8PA 2DNGA 1UJ6A 5L9XA 2AYEA 4C97A 3DRPB 5HLFA 2PI4A 2W7PA 1FT8A 1X4EA 2ZZMA 1VFJA 5EWFA 4J9LA 1CQMA 4NYOA 4K59A 1FJGF 2E44A 1JB0C 2FIUA 2IJNA 1NK0A 4DSKA 4OLPA 4EBDA 2AYBA 1UVMA 2R7UA 1B0TA 2RQKA 2BJEA 2IVMA 4IG0B 3FQLA 4ZK7M 2IMWP 4WF9Q 3FCHA 2NSBA 5AJ3F 3G8SA 1FRXA 5HQ8A 4ZS6A 3ZZTA 1B7FA 2Y1IA 1SXLA 4OHYA 2ATLA 2DGUA 2FDNA 5I3UA 2V8VA 2E7WA 2C42A 5K8OA 5KFHA 2XMVA 1C0TB 3M30A 4DLEA 2Q6CA 4JV5F 1P9QC 3DC2A 1RWUA 2W4DA 4LT6A 4X4QA 2Z2LA 4NZ7A 1VBXA 4NCBA 1N52B 5KFRA 1DARA 3M6WA 5B08A 4MK8A 2V94A 1Y5NB 1BWEA 1N8RT 4QIGA 1ZETA 1VIOA 1TV6B 4JI2F 3IO1A 2XO7A 4EEYA 2KU7A 1AXQA 3I5AA 4MH8A 3CCLS 1IBKF 1LW2B 3LALA 1Y5LB 1X5OA 2J76E 3CJ5A 1Z2ZA 2V2KA 4RW8B 1MROB 3VAFA 1TAUA 4DQQA 3F41A 1M5VC 3EGNA 1WEZA 4UUWA 1M1KT 2MZQA 2CPXA 1AFIA 1CVJA 4H4MB 4LSLA 3TARA 2B7CB 5IS2A 3DOMA 5GADU 2KHCA 3RAQA 2RILA 2L08A 4RUAA 3Q2SC 4E8UA 3D0GE 1R7IA 4AL5A 1JLFB 4P2SA 2RS8A 2YH0A 4KKOA 3MF5A 1NKCA 3UR3C 5AXMA 4ECWA 2HFZA 4GO7X 2FHOB 4QWCA 2FVPA 2QA2A 3CJ2A 1XR7A 4HDGA 4DV6F 2BXJA 2IC3A 2VFRA 3TAPA 1O8BA 2W7AA 2DH8A 5GAGI 4K2XA 1J5EF 2WB4A 1U09A 1RT3A 1C1BA 2FLNA 2DNHA 1UVIA 1F9FA 1DFDA 3I56S 2CJQA 1VQ5S 2DR9A 3KLGA 1JLAA 1GXLA 1DQAA 3DNCA 2EG1A 2KJWA 2LEPA 3OVAA 5A8KA 1SH3A 5A8RB 1HYSB 2E1RA 2PGCA 1S9FA 3OJUA 3D5MA 4NYZA 4QWDA 1L3VA 4QU7A 1HNIB 2HIQA 4ILMA 4A8KA 2XMKA 4Y28C 2DR5A 1R31A 1UWBA 2J6SA 2HNZB 4LFAF 4Q0BB 2CJ9A 2VG7A 3ETOA 2DVIA 5AE2A 4EBCA 3OLAA 3LP0B 2CQCA 2OAUA 3F44A 5IT0A 1VJWA 1SI9A 1LKZA 4C8LA 3NLCA 2IAJB 4NYPA 1FKOB 3DYAA