1IBKF

Structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotic paromomycin
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
total genus 24
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ibkF00
2UUBF 4LF8F 1J5EF 4LF7F 2RJZA 1IBMF 4DUZF 4KHPF 2UUAF 2E5LF 1G1XA 4DV0F 5LMNF 1IBKF 4JV5F 1HR0F 4DV7F 4LF9F 1CQMA 4LF5F 1F60B 2BVZA 4X66F 4LFAF 2UXDF 4LFCF 4GKJF 1I94F 1XMQF 4DV1F 2HHHF 5IWAF 4DV2F 2UXBF 4DR3F 1IJEB 1XNQF 4DUYF 1N36F 4DV6F 2B7BB 4X62F 2J5AA 4B3RF 4JI0F 1N32F 1FKAF 2YY3A 1HNXF 4NXNF 4X65F 1XNRF 4DV3F 4LFBF 3T1YF 4K0KF 4DR4F 1FJGF 4YHHF 2ZM6F 1G7CB 1QJHA 4DR1F 1VMBA 4JI6F 1N34F 4LF6F 4DR5F 5AJ3F 2F4VF 2UXCF 1N33F 3R3TA 4DR6F 4YY3F 1B64A 1XMOF 4X64F 4B3SF 3OTOF 4B3TF 2B7CB 4NXMF 2VQEF 3T1HF 4B3MF 4JI1F 1CQNA 4OX9F 4JI2F 1LOUA 1RISA 1HNWF 1IJFB 4JI3F 4JYAF 4JI4F 4JI8F 5BR8F 4GKKF 4DV4F 4JI7F 2VQFF 1HNZF 4LF4F 2BXJA 1GH8A 2UUCF 3ZZPA 4JI5F 4AQYF 4DR7F 4DR2F 5LMUF 2KJVA 2KJWA 4DV5F 2UU9F 1IBLF
chains in the Genus database with same CATH superfamily
4RWWA 2MSTA 3K89A 4CP5A 3MDFA 3LP2A 4C0HA 2JLEA 3DMJA 4FBUA 3VCDA 4LFCJ 2ZZMA 2BVZA 3CCUS 2K1RB 3KK2B 4XTTA 2LEBA 2BYCA 3CD0A 1BXNA 2QL7B 3D9BA 1BHNA 1YGYA 1OWXA 3HSZA 1SXLA 1WG4A 2DR8A 2DHGA 4MK9A 4Z37A 2GHPA 2QN6B 4C2MA 2R7XA 3UFCX 5DGAA 2DVIA 4O23A 5C7PA 3JSBA 1MMNA 3VAFA 4N8OA 2CQHA 4OZLA 1U1PA 1FWLA 4CLTA 1N56A 2ZUAA 3VHQA 5J2MA 3RGIA 4OV1A 3SSRA 2YQ0A 2B8QA 1UFKA 3NBPA 1HW9A 1NUEA 2HLTA 4JB8B 2ZBPA 4YR2A 1RU2A 4LSNA 1RISA 4Y3CA 1FJCA 2X1FA 2X51A 2YH1A 1PSDA 1IKXB 2WB1D 4Q45A 2HHVA 1UTAA 1TMMA 4F3MA 3IWNC 3H4DA 3PYGA 4JI2J 2ZC4A 4OZ5A 4PZVA 1JX4A 3CCZA 3M2VA 1HYSA 1IWAA 3DRPA 5FDLA 5HAOA 3RR7A 4ZPVR 1AZSB 1XMQF 3CJ2A 3QQCD 2W8KA 1N32J 3OTDA 4A8OA 5HVGA 4H4KA 4F2RA 1W2IA 3HVWA 1UKUA 1LW0A 3K5NA 1EHWA 2IVYA 2VPWB 2C1EB 1OYDA 3CCMS 3BEGB 5I3PA 2D74B 4KYZA 1RAIB 1T9YA 2Q3PA 2QMUB 2PO4A 2K06A 4L6V3 2HSEB 2Q66A 2J0SD 1S4EA 2ABYA 4CIOA 3W3SA 1FVQA 4NXMF 2IIHA 4ANEA 2QC3A 1M5KC 3CJTA 4EUVA 4O3SA 4PQAA 2VC1A 4RWXA 4Q0BB 3V2UC 5DG7A 1KFDA 3HVTB 5HJYA 3AHPA 2UUBJ 2KJWA 2KM8C 2RKIB 5B0AA 1FDBA 3NLCA 5CZVA 2XLIA 2NUUG 1RCXB 2R7RA 3HM9A 2QA2A 1Q1KA 4P7VA 3W2VA 5CYQA 5J1EB 2BM0A 2LEPA 5GAEI 4MJKA 2XULA 3KJFB 4Y28C 4NCBA 5THWA 2BW2A 1TL7B 3T1AA 2EVZA 1U1NA 1VJQA 1UJ6A 1S48A 1C4CA 4DPOA 3P3DA 4QYZK 2MDAA 4HHUA 3IS9A 1TK8A 2JX2A 3HXMA 4KHMA 5E5NA 1VRQC 4D3HA 2MZ1A 5IV3A 4KTQA 4EI2A 2I1RA 1Y5NB 2CA9A 4V1Ak 2JEJA 4JI7J 1WEZA 3IC1A 2M9KA 1J27A 1S7IA 3AXKA 3M6UA 4DQSA 1FD8A 2F8EX 5HP1B 3QRRA 2HNDA 1EKSA 2MPUA 2GAGC 5AT1B 2VFRA 3DOLB 5KT2A 2XSFA 3HFZB 5KFMA 3NCPA 4CO4A 4DV7F 5KFKA 4NZ6A 2AYEA 3I55S 1U2FA 2IRXA 2G1HA 5D0GA 4ZP7A 4F4WA 4LF7J 3NS7B 3KLEA 2XZDB 2DNRA 2VU5A 3UVJB 2B6AB 2P6TA 1RWNB 5D77A 1N48A 4MK8A 3F44A 1VGYA 4TKTA 2CNLB 4KR0B 4TNOA 2AV5A 2OPSB 2A6OA 4RU2A 1X4AA 4C8MA 1T3NA 1T94A 2ACMA 1QAJA 2HGLA 4ALZA 5IS2A 3BBBA 5EWEA 3MEKA 1QTMA 1UJ4A 1FKOB 3LA0A 4B3SF 3GIRA 5DDPC 1NSQA 3ZTPA 2E1MC 3MEDA 4J9RA 3PIOQ 3P4UB 2RF2A 3P5TL 5ITHA 3M2RA 2XYPB 4IYQA 3SQGA 4M5GA 4H54A 3MCSA 4Z7CA 3QRPA 1YITS 4DSJA 1KSPA 3V4IB 1YK9A 3IMQJ 2Z2YB 3DLKA 1CC7A 3TA2A 5GAHI 2JWNA 1FJ7A 1S5ZA 4N76A 3UD4P 3G87A 4ECWA 2Y1IA 2IRUA 1IBMF 4NLYA 5A6PA 4AL7A 1U7LA 3VF0B 2MGZB 3PCOB 1VQOS 1KQSR 2CPEA 1HBMA 2F40A 2PDAA 1RAGB 8AT1B 1MLAA 1RQ0A 3CJKA 4YN3B 1UWAA 3J81j 1SQEA 2GIQA 3H90A 5K8PA 1YIJS 2ROGA 3BGFA 3IM9A 2QL5B 4DV1J 5CCMA 2ZE2A 3NGDA 3DLLQ 1X4FA 3I0RA 3C6UB 4DSIA 2CDQA 4F4XA 2Y9HA 4ZA1A 3THTA 2WVCA 4K4SA 2IJRA 2ZHOA 3H5UA 3HMJG 3TYTA 4QPXA 3WC2A 3R2DJ 4ZP9A 4EO8A 1NXIA 1P1TA 4LJMA 1T9WA 4ES1A 3DRYA 1U1LA 3HHKA 4JYAF 2JEGA 4KB7A 2JJ4D 1Q8BA 4N77A 4YY3J 5KFZA 4X4NA 5GAGU 2Z58B 1M1HA 2W9BB 1HNZF 2B5JA 4QWEA 3DLEA 2E1CA 4RO0A 3JYTB 4FF2A 1BE4A 3MCOA 3FZBA 1GTHA 2BJ8A 1X4BA 3Q23A 4B3OA 4DUZF 5D4LA 1RLDA 2B3TB 3DOMA 2V2KA 1CQMA 5K5MA 4P2MA 3D0GE 5KFPA 4LFCF 2VG6B 4P2FA 2BKPA 1B7YB 3HSGA 3LAMA 2KXNB 1T3OA 1TUVA 2JDJA 1RLCL 3VWSA 1J5OA 4GVLA 4EMDA 5M2UA 1N5SA 4GKJJ 4AXIA 4YHHF 1QJHA 4DR1F 2V8DA 2U2FA 2E29A 3EUNA 3KKFA 1RWVB 3DGPB 1YSJA 1WG5A 4DFPA 4ZDNA 1KVIA 1VC0A 2D3ZA 2RHSB 2RMLA 1F9HA 1CBKA 2Z8QA 3IAS9 5CHCB 3BGOP 4L3NA 3QLHB 1R7IA 1HL6A 1VQ8S 3TX0A 4OMFG 4JP8A 3BO4A 2YNHA 1KTVA 4OX7A 4HI1A 4LIRA 4P71A 1ZAXA 2F63A 1NU4A 4O0NA 2ZWPA 1Y7PA 4MIBA 2C3UA 1AA1B 4LRBA 3G8SA 3Q8RB 2UZAA 5EDWA 1IBKF 1SIZA 4RW9B 5KFDA 3SDEA 2JEFA 4ITSA 3MAAA 1I6JA 2WW8A 2BJDA 2GJ2A 4DR3F 1P6TA 1Q8IA 2IYGA 3QT5A 3MMAA 1N32F 2JL9A 1V3SA 2CNKB 2E1AA 4RW4A 4MK7A 3ZTRA 2CJQA 3KG4A 1SCJB 4HACB 2NYIA 2OI2A 5AE2A 1TKZA 2ALYB 1WSVA 4DR5F 1NH7A 4EYIB 3UCZP 3DYAA 2FJDB 4OLPA 1XN9A 5D8HB 1HD1A 3EXCX 1U2RA 2ZM6J 1RXOB 2BJ9A 4CH7A 1WG1A 2OTJS 1QDUB 4U6PA 5ETQA 2EFGA 3DNCA 2DGXA 4G3IA 1JLGB 3CDBA 1O51A 2F8HA 1LOUA 4PWDB 2MHNA 4ZCMA 3QGPA 3WX4A 3R5JB 4NI2A 4NCGA 3ZZYA 3GONA 1BWEA 1TKXB 1LWXA 4DDFA 3TZZA 2XNRA 1X5SA 4NMLA 2D9PA 3FBCA 2UUBF 3BGLA 4RUAA 1D9FA 1Q8LA 5DS7A 5GVQA 2O01C 2KYXA 3MECA 4P6QA 2KVIA 4DL6A 3M1VB 2E1PA 3H98A 1C1CB 2VPXB 4YDXA 2XTJP 1VQ5S 4URGA 3HLUA 3NRBA 4TQRA 4UUWA 3TA0A 3L7UA 3R97A 4HKQA 4QW8A 4GVBB 4EBEA 2E9ZA 2J7UA 2BJ1A 1H38A 4U8VA 1N54B 2M70A 4IDKA 1TKTB 4Q43A 5JJBA 1YKWA 2MQPA 1DTTA 1N34J 1M5VC 2DNLA 1XJWB 1KQGB 1XEZA 4LUBA 1JLQA 2ZJPQ 2MQQA 3TARA 2R8HA 4UTGA 5B0FA 4LF4J 3KHRA 5EX3A 2YNFB 3JB9k 4JI7F 1X5OA 4Q8FA 2G2ZA 4JI1J 4FDFA 4P10A 1U02A 5DQHA 2KZMA 2H4YB 2KRRA 5L39A 2O66A 1SH2A 4L74A 2LQ9A 3ET6A 1OSDA 1L3KA 4QW9A 3CVKA 1FRLA 1UA0A 2O67A 4U8YA 1S9GB 4WBFA 1KHWA 1S7HA 5HMXA 1GTEA 3EZUA 1FDAA 1RWPB 3MR3A 2DR6A 6FD1A 3FZ2A 2NPIA 4NXNF 3JTPA 1LWEB 2ZITA 2R2SA 1RSCA 5E2QA 4OZ0A 4F4KA 3TW0A 4NRUA 2EW9A 3SXLA 3R27A 1JLCA 1RWKB 1QVGR 1F3FA 3K5OA 5I3UA 3B4DA 1WEYA 4OZ2A 2FJVA 1FEHA 1CC8A 4IH7A 1RYRA 4ENOA 2HQGA 2P9EA 1S4FA 2KT3A 4DX8H 4JI4F 3NGUA 4EWTA 5LJ5Y 2XCAA 1JXLA 3V6JA 2MQOA 2BMBA 4DN0A 2PD1A 3UDVA 1GMWD 2Y0SD 3FUYA 2OSRA 5T7LB 1IKYA 3OL6A 3AODA 3KNGA 2C42A 4WFAQ 2ASLA 2WONA 4RU9A 1FF2A 1YJNS 3UWTA 2GO9A 4M5MA 4OI3A 5IV4A 5D3GB 1N88A 1O0PA 4IOAQ 5IC6B 2ZHAA 3P96A 3BKUA 1PC5A 4IG0B 1O6XA 2BJ7A 3PFOA 3MM8B 4ED5A 1RUSA 1B0VA 3DDNA 5DZ7A 1LFWA 1WF1A 1NPPA 3IRWP 1HWKA 5EWFA 2KFNA 5KFCA 2ZH9A 1ZZNA 2HAIA 1X31C 3A8JA 3KLHA 2ZJRQ 1FRHA 1YRTA 1TMJA 1JKHB 1Y5IB 3I0SB 5J2QA 2IBKA 3TUJC 2ILYA 1MG7A 3LWMA 1YI2S 2VBWA 3JSMB 2DTJA 3HVAA 1QE1B 3A8KA 3S8SA 2E5LJ 5L1LA 4OZ3A 1IWGA 1KHVA 5ETMA 1RTDA 2UUCJ 1R8AA 1FK9B 2QL9B 2VOPA 5IT0A 4JBCA 5E33A 2XY7A 4LFAF 3PEJA 2W7AA 1RP5A 1RHMB 2YKPA 4HL9A 2UUAJ 1KLMB 3UDLA 2DISA 3D0HE 4ZP8A 3N01A 3GP9A 2GNKA 4TY8B 4X62J 3UDCA 2L9NA 4I2QB 4UT4A 2NXEA 3CCVS 4C8OA 3KDOA 4DSKA 2PFDA 4ED7A 1VI7A 4Q2MA 4IFVB 4WFNQ 3RUBL 1UETA 2XS5A 1UPPA 2KN4A 5BR8F 5GMEA 1C0UA 3F73A 3TP2A 3PJWA 2RDJA 3MTKA 1T9XA 3LP1A 1JLAB 1J5EF 4GC7A 2IYIA 3AXMA 3AT1B 1PCAA 2JOQA 5F8MA 1NSAA 2U1AA 3KHLA 4OYWA 2B9WA 4FNHA 4LF5F 4J9UE 3QIDA 3E8OA 4PXDA 4NYOA 4XO0A 1FX2A 1UW4A 4YR0A 2K1RA 1R0BG 4QYRA 5CA5A 1VIOA 3CCJS 4TYBA 3T1YF 4K4VA 2B56A 4O0IA 3Q8QB 1S49A 4EZ6A 1YJVA 1RAHB 2ZHBA 1ICEB 1QUVA 4IRCA 1RWMB 3CWJA 1CULB 1RDRA 4RL1A 1NDPA 3WHIA 1UAWA 2ASDA 5AXMA 3P49B 4U96A 3K5MA 1URNA 3TUPA 5L1KA 2DRBA 1KNZA 4RNNA 4RPFA 5GMKa 3I87A 1ZZFA 2R3VA 4USWA 3EYZA 2V2ZA 2QX0A 3UE2A 4LF8F 4C3MA 5H1SV 2CZ9A 3WX8A 2FHJA 2YWHA 4Z2XA 4KPCA 4M5DA 3C16B 3HD1A 3C15B 2JC0A 2HRTA 1NK6A 1WOOA 5DJBA 1AZSA 3EDRB 1RKJA 4NEYA 3IBCB 3I5CA 2I5JB 5ETOA 2W4DA 2FZGB 1R43A 1RTIB 5C24B 4I7FB 1LQ9A 2HEKA 3CUNA 3OT9A 3NOGA 3PIPQ 4I6AA 2LXIA 3RAQA 4WP3A 2F4VJ 1TP7A 3QO9B 3PHTA 1WHXA 3W8GA 1HBUB 1VCTA 2GZOA 3T3FA 3MXHP 2HHXA 4LF4F 3HD2A 4DSFA 1KR4A 5B0DA 4Q0BA 4JV1A 2WVEA 3HVTA 2CJYB 2ZWOA 1PJ6A 2E7WA 4A4JA 4ZN3A 1U47A 3J7A1 2CQ4A 2X1GA 3HHNB 1PBUA 2UXBJ 1VC6A 4EZ9A 1RT2B 2RQKA 5BYSA 3HCXA 2W2NP 3DM2B 4F04B 2IM3A 2XMJA 1MROB 3Q8PB 3QRQA 2J0XA 3VAJA 5J1EA 3CO9A 3JQKA 3OJSA 4NLWA 1S9EB 4NLQA 2AW0A 4B17A 2HVZA 3CJ5A 4PG4A 2KT2A 2ROPA 4X64J 1Y3KA 2XMAA 3CE8A 1S1TB 2FJXA 1A6LA 1BQNB 3GR1A 1TAUA 2QRRA 3M8SA 4FVCA 3MMCA 2H65B 1G3OA 2CVEA 4PG7A 3HX9A 4W98A 4B02A 3PDNA 4O4RA 3DLJA 5KFJA 4M5LA 2BXJA 2J7KA 1URRA 1XK8A 4C97A 5DETA 1FDNA 5HQLA 3BO3A 2K7JA 2PSZA 4ZLNA 2B43A 5F9NA 5HP1A 2BE7D 2FB0A 2WSEC 3QATA 3RTVA 1V9OA 3TEGA 3DOLA 1RAJA 5EX0A 4ETZA 2Z2MA 1JJ2R 3OFEA 1HNIB 2GCFA 3HHLA 1L3SA 4ED2A 3UDEA 5FJ4A 1RTZA 3KUHA 2FJAB 2KG0A 4C8NA 1UP1A 3UVJA 3H2VE 4OI2A 2GFFA 1AROP 1AXQA 4ELUA 2Z57B 1H2UX 3QT6A 2ADCA 3S01A 3GILA 1RT7A 3BYRA 2Y1RI 2OPSA 2BACA 4OYAA 4DJBA 2W1BA 3M8YA 4J9KA 1FKOA 2G4BA 5AE1A 3T6BA 2V50A 2B51A 3EM1A 2EFQA 5J1PA 4BCAA 3N6NA 1IQZA 3GYGA 2A2DA 4M5IA 4RNFA 2W9CA 2EPIA 2HQIA 5DLGA 5DLFA 1CJVB 1SV5B 2BANA 2WVFA 1EJ7L 2E5LF 1SBRA 1UCNA 4WKRA 5LMNF 1MU2A 3D3CJ 1KDNA 5LXRA 4QZVB 1PJ7A 1F5AA 3TWZA 1CJTB 1RHUB 1HI0P 1RT4B 3CCQS 1RAEB 1CEZA 3BZQA 4NLDA 3KJVA 1RB0A 2XS7A 4HDGA 1S6QB 5K8OA 2MKJA 1UVMA 3NWRA 3MM6B 5GADU 5LSRA 2HZVA 3C6UA 4RX6A 4HT7A 2ZKUA 3DMJB 4X84A 3NEKA 2F4FA 1BY9A 2RQMA 2W4CA 4DPTA 4ZVRB 3FGVA 3IGVA 3U7JA 4GRSA 3GFZA 2V5HG 3T5LA 3CULA 1FXDA 1RAOA 2HBYB 5HANA 2BQ3A 1TTHB 3LO3A 1M1GA 1WC3A 3NGRA 2IFXA 2PI5A 3DU6A 1X9SA 1U0SA 1SJ3P 5C25B 4C0BA 4IRDA 2J6SA 3PJXA 1S1XA 4OX6A 3VZHA 3NBPB 1TUGB 5MLCV 2CPHA 3IWXA 2CRLA 4IH6A 3IO1A 1PO6A 1MWZA 4WJBA 5I3QA 4N56A 2GQCA 1KKHA 4PABA 4P9SA 4Y00A 4B3RJ 2FDNA 4X4RA 4DR4J 4IOBA 3AJ1A 2HWTA 2V9KA 2N3OA 3C2PA 3M2VB 4WFZA 1HYSB 1VBKA 3H5YA 3FSYA 3RB6A 2ZH2A 4PEOA 1PBAA 5ETTA 3DC2A 1E6VB 4ED3A 3UR0A 5B09A 2V63A 3ZC4A 3QLHA 2M3DA 2R7UA 3OXLA 4HHJA 3HZEA 2I6WA 1OSCA 1Q5YA 2VODA 4O3RA 4RBUA 1T11A 1FNOA 4CM2A 9RUBA 1FJEB 3M7VA 2DNHA 5C42A 4AQYJ 4AFFA 2AGQA 2GGPB 1RYSA 3GU0A 3R5GA 4WIIA 4DQRA 2Z56B 4ERDA 3TRGA 3EZ5A 2DHHA 3AA9A 2C3MA 4CNYA 2G2OA 2IPOB 1RACB 3IN5A 3HHDA 5IQ6A 2LDIA 1U49A 2HHHJ 5AXNA 4CNZA 3FKBA 1B4SA 2CQIA 2EBGA 3ZZZA 3C6TB 5L1IA 2JLGA 4F8RA 1OYEA 1D09B 5D4PA 3QT7A 2K8GA 2ZD1B 4R0EA 2EC2A 4UQTA 2AHOB 2FC9A 2LKZA 4CLUA 4LBHA 2MJNA 3CDWA 3UCGA 2HFOA 3CJRA 3UN3A 3W2VB 3EGZA 2VJVA 1JLGA 5KG3A 3GQCA 3HK2A 4PWDA 1BD6A 2SXLA 4B3TJ 1VLYA 5LMUF 2PC6A 2VDIA 3OSPA 5E3CA 3K17A 1BUXA 1LK7A 2LA4A 5HK4A 2VQFJ 4QIWD 1FKPB 3NL0A 4EBCA 5FD1A 3P5BP 3CCLS 4RZRA 4CYUB 1Y10A 2HHPA 1C4AA 2LLZA 3SEOA 3G96A 5IOLA 5KFWA 3A3NB 2UXBF 5KFGA 4P52A 3TA1A 3CMAS 5D0HA 4U9RA 3FK4A 4NLVA 1SKRA 1WTFA 4O3PA 2I38A 2W8LA 2IJNA 2HNDB 3OTOJ 5BYQA 5CD4A 3GV5B 4X4OA 2VQEJ 3W7BA 3JTNA 4X64F 2XI2A 4DLGA 1HBOA 4N47A 1TKTA 2AJ2A 3E2EA 1OY8A 2BKNA 1NJWA 2CWXA 3E3XA 2DHSA 1AFIA 2KH9A 2DD8S 2ZH5A 4TVAB 1B0TA 3KLGA 3PNIA 2YNFA 4V19J 2D3OR 2LCWA 1RTJB 2GMHA 3DRSA 1S0VA 1YBTA 1YHQS 3E01B 2HBQB 4O4GA 2FHKA 3K5LA 4C98A 2LQ5A 1HHQA 3W5YA 2DR5A 1PYSB 4OYPA 4DV6J 2XNQA 4EYHB 4WXOA 3GV8B 1OQ6A 3O44A 2XZTB 1HNXJ 2XBPA 3IWLA 3G6XA 4LF9J 1S9GA 2RF2B 2V4RA 2E5JA 2UXDJ 2HHUA 1GX5A 2XWXA 2H1YA 1LWEA 2G2YA 2CNNB 2CZ4A 1T7PA 3TAMB 2PI4A 8ATCB 1JWWA 4I0WA 2EG1A 4WIQA 3H59A 3PEHA 3V6HA 2AX0A 1H98A 3QGIA 3HPOA 1YBUA 5IT9U 4X4VA 2QLJB 3M2UB 1NNDA 5IZHA 3CJKB 1AUSL 4CWBA 3VGUA 3NG8A 4H4OA 1JB0C 3NCRA 2E9RX 2GAHC 3OR1A 3RYLA 3ZZRA 2ZE2B 1HARA 2DY9A 1H6KX 5T7LA 3I0RB 4A8FA 1RT6B 3QYYA 1U4BA 1R27B 1WC0A 3P6YC 3EWGA 3VQSA 1IVZA 3RU0A 1TQLA 5D3GA 1ZA1B 1KVJA 1VBZA 4LFBJ 4FYYB 4ZIWA 3BSAA 3PKYA 4Y2CA 5KFNA 3GFXA 1NHVA 3Q8UA 1WHVA 4ED1A 4DN9A 4R25A 3CJSA 3DLEB 3CIZA 5T41A 1KS2A 3N4WA 1T0TV 3MI7X 4ELTA 3HO1A 5KFYA 2YNIA 3UNGC 1DRZA 1Y11A 1Q0NA 2Q79A 3PY8A 4RNOA 5KG1A 4DL5A 4TU8A 2YKOA 3IBFB 2HK3A 4PYDA 1S6OA 1U1KA 3MPUB 4OLOA 1B7FA 4HHHA 2FPHX 3SFUA 4DR7F 5F8GA 1FT8A 2UU9F 2UVRA 3OLAA 4NASA 1JKHA 4DX5A 3I0SA 3M8QB 2HBZB 3JSMA 4YUDA 2AEMA 2LDYA 1Z2LA 5A8RB 2X3DA 2PT0A 2CQ0A 5GAGI 4ZJLA 4Y0FA 3PYEA 3CCTA 1U26A 1KD1T 3JAMU 3NAHA 2VPZB 4JI6F 1LWCB 5DM7Q 3IFEA 2YNHB 4QJVA 2D7SA 2L08A 2R8KA 2H54B 5ETRA 2ZC3A 1FHTA 4B9SA 4Y2MA 3CJ0A 1YRUA 4L73A 4I2QA 2IMOA 3BB5A 3X1LB 2CUYA 3GZ7A 1ACMB 1WDTA 1OJ4A 3JQJA 3WIUA 3MAAB 4CI0B 3CEDA 4EO6A 1S10A 4PQUB 3MURP 1I1GA 4IFVA 3GYXB 1VDHA 1UMJA 3NWGA 1Q81T 1N8RT 2A6MA 1N6QA 4RW4B 3CDEA 4PXEA 3Q8SB 4K4TA 1TKZB 4KRWA 1NK8A 1T05B 4J9PA 1JLAA 3D1OA 2B0GA 3DYAB 1UFLA 4MKAA 1EP4B 4M5NA 1D8ZA 2Q1LA 3AH6A 1XNQF 4DV0J 3IRXA 4HEA9 3NXZA 2YKMA 2F8MA 2NUHA 2FC8A 4K0KF 4NCGB 4NI2B 1FX4A 1NPRA 2RQ4A 1G7CB 1VISA 3AB4B 3D66A 1LKZA 1LXJA 1WF0A 2FJEB 3Q83A 2H9ZA 1UPMB 2EFPA 3PACA 1ITPA 4A8QA 1KQKA 3NNCA 2R7QA 1WF2A 1DFDA 3MEGA 3CO0P 4IR9A 4H4KC 5HQ8A 3MECB 4DU8A 3BGRB 4XAKA 2KXFA 4WPAA 5IC4B 5AE3A 5KFFA 2OJ3A 1IBLF 4B3TF 2PEHA 1C1BB 1U1QA 1RADB 5JMNA 2RILA 4ANCA 2RDIA 2JLFA 2QEXS 3FBBA 2CQDA 3EICA 3WBZA 1WHYA 4C8YA 2CAJA 1UEKA 5DZ6A 3C16A 2OD6A 3BM7A 1JLQB 2RHQB 4F2SA 4KFBB 4IG3B 5K8MA 1K9MT 4XDDA 2CPDA 1Y5LB 3BDEA 1ROFA 4NE9C 3QAEA 2I5JA 1HD0A 3C3LA 2MXYA 2DR7A 1NHUA 2CPFA 3R3TA 2WHOA 4DR6F 3HKZD 1R0CB 2F65A 1K47A 3OTOF 2AYBA 4QU6A 1RTIA 3ET6B 5C24A 2DT9A 5CYJA 2VQEF 4I7FA 1V6HA 1HKAA 1IKVB 4CLSA 4ATNA 4RUBA 4ZPDA 3M8RA 3QO9A 1X9WA 2UUWA 3NAIA 3TANA 4J37A 1HBUA 3HDSA 1UFWA 3G6VA 2XY6A 3GE9A 2UVWA 1H2TZ 4UOCA 3ZNUA 1M5SA 1LWFA 3IR7B 1VFJA 4PG6A 1V3RA 3QWPA 1LW2B 2ZFHA 2J9DE 4P2SA 4FF1A 1JLCB 3FSXA 3KMSA 4CH1A 2MQMA 4JI0J 2AJFE 4DV6F 4ZCLA 2HWHA 3MM7A 3A12A 4CO5A 1HNXF 1BQXA 4TU9A 2BRLA 7FD1A 5H9EK 3K57A 4N8NA 4FPRA 3D6MB 5B7WA 1Q8KA 2XEXA 4AXJA 4ECUA 4B08A 4Y65A 4X65J 1IKYB 1S9EA 2KDOA 2NZCA 2QG9B 2M5YA 2N7CA 4LVNP 2W2OP 4BC7A 1S1TA 1JLFA 3RAMA 5B0CA 3S7RA 1LXNA 3CJ8A 4RBTA 1U1MA 5LT5A 4DUTA 3SMZA 1UZDA 1IUJA 1NK9A 4ZP6A 1MMLA 3AOCA 2YX1A 4OX9J 1BQMB 1NZAA 2HHSA 4UY8T 3M32B 4Z7YA 1Y3JA 1YDLA 1I94J 5KOXA 1FWKA 2J76E 4NLPA 5KAKA 4CT8A 8RUCA 2BKOA 3W9IA 1IJEB 1NJIT 3DI6B 3R8YA 4CZCA 3EVMA 3SCIE 3SYZA 4ZVEA 5F8HA 2APOA 4ZLJA 3KLHB 1HNIA 4LFBF 4KY3A 3D67A 3MOZA 2XI3A 2IVFB 1UVNA 4RW8B 5J2QB 3M9MB 1ZYQA 2LU1A 1KVKA 5A0YA 1O8BA 4B9NA 2C28A 2HQDA 5JUMA 3H25A 2DXFA 5AJ3J 2EFOA 1K1QA 4QR0A 3MCNA 2XHCA 2UV8A 4F0MA 4ED8A 2AKWB 3ZTOA 3T5JA 2DXDA 1VK3A 2AZ3A 2J9DA 1RGVA 2HVIA 2GX8A 3OXGA 1SL1A 2W25A 1UVLA 2HQFA 4ZPTR 4ED4A 3J81U 4USHA 5CH7B 3U1LA 4QIEA 2DBBA 4DS4A 5L9NA 4KHPF 2PIIA 4JI5J 2W01A 4M1KA 1DY3A 2C2ZB 2OIHA 4P2XA 1CJVA 3MM9B 1OPIA 3A3OB 4QIGA 3EZOA 1WD6A 4BC9A 1HR0J 1X60A 2DNMA 1FJGF 2QMWA 4R5PB 4FXVA 4PXCA 2MSSA 3BKTA 2DH7A 3UW1A 4ZPBA 2XO6A 1SUQA 1KBRA 3UD3P 4YOEA 2ILZA 4R0JA 3MM6A 4BBYA 3LAKA 4NL5A 2WVBA 2IJFA 2ATCB 3CJ4A 3OR2B 3HT0A 1GXTA 3DHXA 1FNMA 2G0CA 1TR0A 3ENAA 4LRFA 4ZOSA 2QE5A 3KJQB 4A8MP 3I4PA 2A1BA 3CCSS 3WC0A 3AB2B 3GIIA 4QU7A 2AEFA 1EZZB 3DRXA 3FDSA 1IXKA 3D0IE 1M0SA 1S76D 4K8RA 2DNKA 1SJFA 1KP6A 4ZVTB 2C3PA 3CIMA 4ELVA 3MUTP 1HWUA 1NSKL 2D69A 2BQRA 2IAJA 2PA3A 2HHTA 2V4QA 2DJWA 1I5OB 1S1UA 3RBEA 1A7GE 5C25A 2M52A 2VZ9A 4LF6J 2HRYA 3CSKA 3L09A 2X1AA 1FD2A 1XMBA 4A8XA 1Y9OA 4I1TA 1P8GA 4P75A 1HQUA 2HNZB 2UXCF 2RSQA 3KJNB 4ZVOB 1PIEA 2DGSA 2GQ2A 1FFWB 2NQPA 4I68A 4GC6A 2RAQA 1SKUB 1IQTA 4I67A 2CPXA 1G6BA 4KGVB 1Q79A 1PILA 1NRKA 1YLXA 1HW8A 2MKSA 3B78A 4M5DB 1X8DA 2E5IA 1EAYC 3GLJA 3JAMY 2IVMA 1HNWJ 4OYIA 1SQGA 1SC1B 2LP4A 3KLVA 1E6VA 1T9UA 4CTAA 4UW2A 1QD1A 1D9AA 1RI7A 1WKLA 5ADZA 2WB4A 3AQOA 2ZH3A 3ADAC 4BWJA 1FFGB 2MQNA 1NEEA 5F8JA 2DNPA 3I4HX 2V0NA 2GGPA 1FESA 5HBMA 3FCWA 1RTHA 4LBPA 2L9DA 2N4CA 5KFBA 3GCXP 4C0OC 1QM9A 4DUYJ 2VB6A 4DI6A 2FY1A 1UVJA 3D2WA 3FEXB 3FEZA 3HULA 3QSYB 2DXEA 5LM7E 3C6TA 2EK6A 3TI0A 3H2LA 1S57A 2NXNA 2ZD1A 2QA1A 4OZJA 3PO5A 5E3QA 4OHVA 2NCKL 1F5BA 1U1OA 4DWIA 4G1QB 2EKYA 3H40A 2P2CB 1RA7A 4MYTA 3DDIA 3D6HB 1ZAWA 3CC4S 4KAIA 4QOTA 1CG2A 3AJ2A 1RKIA 3LALA 2ZOFA 5A8WA 1FKPA 4IH5A 1JJCB 2OLWA 4F4YA 2DGTA 1EQMA 3FRZA 3F56A 4DZ6A 4Q5VA 2AYMA 4DV2F 4CYUA 1BMQB 1CJKA 4JI0F 3KHGA 1W26A 3MMCB 3H5XA 2VONA 3MPDA 3GG1A 3MFHA 2OELA 2RRNA 4ILLA 3D54A 2MJUA 4K4YA 5B0GA 1Q53A 1F2HA 1PKUA 2YX7A 5D4NA 1IM4A 4K4WA 4V19X 2P5VA 4YR3A 4OI0A 5A2QY 2HS4A 1HHSA 2B8PA 2E9TA 4UZBA 5F8LA 3H20A 2WVDA 2YTCA 4UQGA 2MTLA 2DKOB 3HHLB 1ZPVA 3PR4A 3ENVA 1FRJA 1EKRA 3W2WB 3E51A 3I9V9 3HT3A 3DRRB 3QJPA 4OJ3A 4YQWA 2XWYA 3NOCA 5IQQA 4JV2A 4CM0A 2PMZD 1RTJA 1SVDA 4FP9A 5KG0A 4DL2A 5I42B 1RT7B 4OI1A 3E01A 3J80Y 1I94F 3QZ8A 3EX7B 4O44A 2BRKA 2LMIA 4K4UA 3N0VA 2M88A 3JXOA 2H48B 3KYLA 2IDEA 4DOZA 5K14B 2JFKA 4X66J 1XNRF 2HG4A 2F7VA 1N4LA 3R5CA 3IG1A 7FDRA 2RUSA 2AX1A 2VG7A 5D78A 3PRBA 2CJKA 2W9CB 3GIMA 3G4SS 3D1HA 1S0MA 3R7SB 1DARA 2C2DA 3IAM9 2BANB 3TAMA 4UUXA 4EU0A 4F25A 1MU2B 2FVPA 2XMKA 3CNQP 3CTRA 4G65A 1NK7A 3N28A 2K3IA 4I6WA 3KJVB 1UA1A 4OFZA 1QUPA 3M2UA 2OPRB 1FA0A 1YQHA 3WZ0A 4JOUA 5LSOA 3KHHA 2W7PA 1NJYA 1X9MA 4OI6A 1T8EA 2XQCA 1N5YA 3T6JA 4FVMA 3CMES 2FTRA 1RT6A 2X7IA 1T95A 5KG6A 3O5TB 1H3DA 3TEHB 1TVRB 3I6PA 3IGNA 4TU7A 2X3GA 2AGOA 2M8DB 2XCPA 2YH0A 1WEXA 4DSLA 3FFIB 1N33F 4NLSA 2FHOB 4A8YA 1FRMA 4RBVA 1WI6A 2C3OA 2HGMA 2AP6A 2VA2A 3IR5B 5D0RA 1NDKA 5DG9A 1EQ0A 3EJMA 4GKKJ 1AYEA 2YKNA 5K8NA 4DXLA 2GMJA 2GS8A 3WQPA 4ZCIA 1SC6A 3MD3A 2H5EA 3J7ZT 1S1XB 3LOUA 3RW7A 3BN7A 2DHXA 3N9UC 4ECYA 3SV4A 1GXLA 3EGNA 1DTQA 5GADI 2OKQA 2QA4S 4CRJA 2Q6CA 3ILOA 2OEKA 2VUGA 4DU7A 3M8QA 4DX6A 3G82B 1S6PB 2KT5A 3EDQB 3A1YG 2K2PA 2Y1JA 3L95X 4IQXA 5A8RA 1DQ9A 1VRUB 4ECZA 1D1UA 2WTFA 4YP3A 1WTBA 1MN9A 2WW4A 1JNZB 3ILLA 4FF3A 4LF6F 2BEFA 4HYKA 1XMOJ 4A8KA 3QFWA 2GVZA 1LWCA 4DCJB 1MMDA 2HZCA 2HHQA 1U24A 4WFBQ 3K7RA 2JEIA 2BE9B 4CO0A 5AXLA 2DCLA 5C42B 3I9ZA 6FDRA 4JI2F 1KOHA 2J6TA 3N5FA 2XZWA 4BLGA 3UD5A 2DNOA 1FO1A 2XLKA 2AQ4A 1GMWA 4QWDA 4ZVHA 3VAGA 4PQUA 3GCWP 1H7XA 2JHEA 2VC0A 2V34A 2QLXA 3K5PA 5CZXA 2YBVA 1X5TA 2QZ8A 3OVSA 4Q2LA 2VFUA 1XTZA 4HTIA 4NLGA 3FC9A 3OTCA 4WKYA 3UI3A 3FEYB 1WOSA 5KT3A 1OIAA 2OPPA 1T05A 2CJAA 4YB5A 1Y4ZB 4LQ9A 1M1KT 1F6TA 1Y00A 1EP4A 1VQ6S 2CPZA 4AT1B 3AFGA 1NLKL 1ZM3A 1KTQA 1XMQJ 3FBFA 2C2NA 1YBAA 2LYVA 2KM8B 3W64A 3JQMA 3D4JA 3TZYA 2DH8A 3NGTA 3TQEA 4B9MA 3HF5A 2HZAA 2NR0A 4HH0A 1CQNA 3EPIA 3M8ZA 4USKA 5E7OB 4WCEQ 3O6QA 2H5JB 2RH3A 2DY1A 2GA7A 4NYPA 1V3ZA 3BGRA 1JLEB 1G2EA 1RJJA 2R7OA 2GJFA 3UQSA 4JV5J 3W5ZA 4QWAA 5DDQC 2HAFA 3PW2A 1C1BA 5KFRA 3W9JA 1SKWA 3H4BA 1G4CA 1WC6A 4I64A 4NLRA 2OEMA 1HBOB 2IBOA 4AL5A 2J0WA 4DMZA 2VASA 3OL8A 1Q95G 3V6DA 1R8BA 5D15A 2ASYA 4KFBA 4IG3A 3MTJA 1F3VA 4ES2A 3KLGB 2R7VA 1VHIA 3TVKA 1B64A 1KEKA 4ID5B 4WWSA 3DRSB 4UOFA 2NS1B 4LRDA 3OFHA 1QY7A 4O4GB 4OIXA 2R2RA 4ICLA 4LVOP 1KFSA 2BX6A 1FI4A 4EFAC 1WC5A 3T19A 4UF4A 1IKVA 1S0NA 2ZDOA 1U09A 5KG7A 1AW0A 3FBEA 4LF7F 4DF8A 3SBMA 2ZNYA 4AYBD 3CCES 4LSZB 4NZ0A 1U45A 1S59A 3C14A 3SQOP 1LW2A 1RK8A 1Z1ZA 3VV2B 1XIQA 4DV7J 2GHWA 4H4MB 2CQCA 3DFEA 2IM2A 1VHFA 2A2CA 1H2VZ 1KC8T 3PKMA 4H4OB 2OPQB 3BPDA 2ZJQQ 4CT9A 2ROEA 1VQ4S 3NS6A 1LFPA 2JRSA 3OR1B 4NYZA 1YJ7A 4FYXB 2Y1LB 4CLYA 5BXIA 2YWGA 5JVHQ 4TXSA 2QTWA 4YEAA 4B3SJ 3BS9A 4DR2J 1XR7A 5D0EA 1HBNA 4HH1A 4IKAA 1X4GA 1T03A 4ZHRB 1OMSA 1JLBA 4OI4A 1O5JA 4DL7A 1FDDA 2DO0A 1BQMA 1MN7A 1VRTB 5A6WA 4QIVA 5K20B 1RT5A 4X4QA 3M32A 2AIRB 4WYLA 4USTA 1JIHA 2YNIB 4ECTA 4DV1F 1IBMJ 3GYNA 1CJUA 2QJ3A 1SI9A 2DEJA 1RHKB 1U0HB 1LK5A 4K5SA 4LIWA 3DI6A 1TV6A 5F0WA 3KLFB 4FKYA 3RB0A 2MLZA 3UPFA 3FQLA 2KI2A 4RW8A 5G4DA 2CPJA 1BWVA 4YY3F 2WK4A 3ETMA 3ZZ0A 4LSLB 1APSA 3IR6B 3TJAA 4XIUA 5HN0A 3ELHA 4J7CA 3R5DA 1ZAVA 4JI8J 4CO3A 3TUZC 5F8NA 3CDAA 4CCHA 2EG2A 4GKKF 2V67A 3ONQA 4DV5J 1D9DA 4ZIVA 1K0TA 2IC3A 2C3YA 4ZVQB 1GQEA 1HNZJ 5ETNA 2QIFA 2BDPA 2RRBA 3TQ1A 4LT6A 3BBCA 2AJ4A 4F67A 4GKJF 2N82B 4DUZJ 3DDKA 3KDNA 4RNHA 2KO1A 3RW6A 5B08A 4MTPA 1AT1B 2MY7A 2N4DA 3MM9A 4DSEA 3MR5A 1I51B 4KH0B 1TL5A 4EK2A 4NRTA 3SI8A 1NM2A 5F9LA 4YFUA 2G0JA 1YRXA 1N6QB 4R5PA 1RAFB 3IP0A 4YHHJ 1YJTA 1XMOF 4DR1J 1DHMA 2C2RA 2BBEA 1HQEA 2HW3A 4BS2A 4WE1B 2DCUB 1TFWA 3DN9A 2AD9A 5RUBA 3M8PB 1S79A 2V8HA 1FTCA 3OR2A 5M2PA 3IRXB 4K50A 2RVJA 2YKMB 3EGVA 4F0KA 4I6YA 2BA9A 2DPIA 4M5KA 4W4MA 3J7AN 4DPYA 4NLTA 3QZ7A 3O3LA 2ACYA 4BWMA 2HHWA 4FNIA 4RUHA 1YJUA 3ZZTA 3G86A 2CG4A 4IUFA 1VQYA 4ZLPA 1IBKJ 3MEGB 4F0HA 1NHKL 2MQLA 3M9NB 1HWLA 1VJWA 2BOAA 2HLUA 4OHYA 2ZM6F 3HP6A 2BV3A 1JNRB 4DR3J 2FZKB 2EK1A 3LPEA 3QSIA 2JH3A 1QVFR 3AA8A 3ITHB 3G2XA 4A8WA 1B70B 2P9CA 1GK8A 1SJRA 5FLXU 5L1JA 3LH2S 2CQPA 4YB1P 1DBDA 3PRVA 2HNZA 2QLBB 3M6XA 2QA4G 4DR5J 4JI3J 4OHWA 1DLOB 2QSWA 4ANDA 1QSYA 1JXVA 2DYAA 5MAOA 4HT5A 2HFSA 1JJHA 4HTJA 2BUNA 2ZEJA 2EXUA 2YWWA 4ZVUB 3OBIA 4YDDB 2HFVA 1E6YB 5H9EJ 2VFVA 3CW2C 2W24A 3VVUA 2ATLA 3GJSB 3HZGA 3B8HA 1HWIA 2F1FA 3K2YA 4JV5F 2DRDA 1TK5A 1Q7LB 3W5XA 3LP0A 2BZ2A 1T9VA 2KG1A 5KT4A 2QFJA 2NLWA 3RBDA 5IM0A 4PCQA 4K2JA 4R8UA 2QYGA 2YWKA 2ADBA 4G6VB 2H3EB 5DO2A 4F4ZA 4GO7X 1N34F 4N7TA 3POTA 3LQVA 3NGSA 5LSLA 4DL4A 3LGNA 1LWFB 2AJ1A 1J2VA 2R8GA 4JI1F 1NB2A 3GIKA 3KLIA 4KV8A 4ES3A 1VQKS 3BYPA 2CQ1A 4DV4J 3ICLA 3BDPA 2LFVA 3QIPA 2ZH6A 2KB2A 2MZTA 3MM7B 2R9LA 4ZPWR 3G6ES 3K0JA 2DPJA 2VJUA 3IXQA 1QAYA 4X4SA 4G1QA 4KQZA 5F0UA 3FVYA 2XY5A 3B4MA 1IR0A 1VQ9S 4E8UA 1H74A 5KFIA 2OAUA 1S1WB 3PRDA 2RT3A 1WELA 3MM5A 4KKOA 2KU7A 4LBIA 1MW7A 1JLFB 2GQQA 1KQFB 3FCVA 2V4JA 3BREA 1DAXA 4PUOA 1S77D 4MIAA 3I5AA 1FFSB 4NXNJ 2OO4A 2DGWA 3U27A 2M8HA 1GX6A 2VH7A 3VAHA 1X7VA 4YB7A 2EEYA 4RLEA 3OHBA 1VQSA 2F9JA 3B54A 3CCWA 4KGMA 3HSDA 1IKWA 5HMZA 1Z4UA 2CFXA 2HIYA 3KG1A 2NXCA 4WU2A 1WWHA 3NY0A 3LGHA 4DR2F 2KJVA 4HLBA 2HQ3A 4JI4J 3O1LA 2CADA 1CLFA 1AB8A 1NBEB 1ZM9A 4TLRA 3W2WA 1TKDA 3RB4A 1H72C 2MKCA 1UVKA 3GSIA 1YX2A 4YB6A 3DRRA 3FNNA 2B4VA 5A0YB 2HS3A 4QWCA 4NLXA 1L3TA 1W25A 1A9NB 3LPYA 4DL0C 2WOMB 2OP5A 2R4FA 3BO2A 3BR8A 1OO0B 5I42A 3NNAA 5LOQA 2RNEA 2RIJA 2OUGA 2MKHA 5H9FK 2OFGX 3HKWA 5KFHA 1GMVA 3V81A 2DITA 1VS3A 2D1CA 2D41A 5CD4H 2Y3YA 1IR2A 2V2VA 5K14A 2VBZA 2CWKA 1RT1A 3M30B 2FVSA 2VDHA 1PGZA 5KOWA 2C22A 1RWWB 1ULRA 2DIUA 4C8LA 2KFZA 5KFUA 2J0QD 7AT1B 4DPXA 1R31A 2HNYA 1T02A 3KMQA 1F9FA 1M5HA 2C2MB 2AT1B 3TNVA 2F5GA 3PV8A 4JI8F 3PW0A 1L3UA 3M6VA 3I96A 4WYWA 3NKYA 1QSSA 3MR7A 2UUCF 4FS1A 4O3OA 4DV5F 2HQCA 3N79A 4RJVA 3MR2A 1Y0HA 2EFNA 2YNGA 4XPCA 2UUAF 5HQMA 2OPRA 1K1SA 4QWBA 4MKYA 3OPKA 1R8HA 1SUQB 2V68A 2NPFA 1AUDA 4NX9A 5C5JA 2UVUA 3EVWA 1C0TB 1SIWB 3TZXA 2GV1A 3B6BA 3OFGA 4I4BA 4X62F 4DV3J 4MFBB 1S0OA 2HIQA 4LFAJ 3TOQA 4URQU 3FRYA 1SPBP 4MMOA 3R6GB 3RRKA 4OYOA 3L3CA 1TVRA 4C7QA 1RHJB 3CGIA 4B9TA 3J7YU 3M8WA 2FVQA 1ZPWX 2ZUGA 2YVSA 3FFIA 2B4UA 4DG1A 2B9EA 4PAAA 3MZIA 2NYHA 2PEBA 4ED6A 3KK1A 2RU3A 1ELOA 2P6SA 1CS4A 4I56A 4S0MA 2ZBCA 2IAJB 3BV8A 2XC9A 5HROB 1S1UB 2Q6BA 1OY6A 1M90T 1Q4RA 4TY9A 2VG5A 3UNYA 2XMMA 3M05A 3AD9C 5BR8J 5JXSA 4FXDA 4DEZA 2E7VA 1HQUB 4ED0A 4C9DA 3DLGB 3GPAA 3ULHA 1J5EJ 1F5CA 1HNVB 2K3KA 1X0PA 4QQBA 1FXRA 3ISNC 2RQCA 3G82A 1S6PA 2Z0GA 4LF5J 2R2UA 5E41A 1VRUA 1VQMS 2PMHA 2QLFB 3MEEB 4ID8A 2FHMA 3G6YA 1QSLA 2CQBA 2B4PA 1HPZB 2JFDA 3A4TA 3T1YJ 4CTAB 5KFQA 1N0UA 4IRKA 4WK1A 4BHQA 3US5A 4QYZJ 1R8PA 4JI3F 3W8PA 2HFZA 1ZH5A 3OTEA 3BBFA 1DQAA 4RW6B 2X1BA 1GMUA 3T9NA 1VBYA 3SV3A 5HBMB 3ZZUA 1RAAB 1FXLA 2I2YA 1GNKA 1RTHB 1UWBA 5HLFB 3MWBA 1RBOB 2R7WA 4OYMA 1HFEL 5F3ZA 3L9ZA 3X3UA 4KJIA 3DGVA 2GMLA 4KGXB 2FZCB 2W2QP 5EN1A 2VFTA 4LF8J 1LNQA 5E3AA 2NZ4A 2Z4PA 4NLOA 2WZ1A 2LVWA 3H0PA 2YPYA 5AXKA 2MB0B 4NA2A 3D68A 3ZZOA 2PMWA 5J2NA 3RR8A 4I2PB 2G0IA 3OHAA 3HFVA 2P9GA 5F41A 3SCLE 1NMEB 2F4VF 2Y8WA 1ZETA 1RWUA 3W63A 4CLLA 2MLXA 5SZTA 2CPIA 2LEAA 1TL3B 3THVA 2XGPA 3OJUA 2IRYA 4PWWA 4YMEA 3TUIC 5LL6d 1YTYA 3RBXA 2V8PA 5A8WB 3TJ9A 3FMWA 4DV4F 3K58A 5C2CA 2O3DA 2AU0A 2G13A 1CJKB 3MUMP 2XGQA 2VKRA 2VKZG 3TAPA 3EGWB 5E3RA 2DNGA 3A13A 5FLXY 1JLEA 4G1PA 2YX4A 3HVRA 4DFJA 2JNJA 1WC4A 5IXUA 2A0FB 3GB0A 2L48A 4KH1B 3VR1A 5EUHA 2HVHA 1H0HB 4O3NA 4DQPA 2FLPA 5SUHA 2VD3A 2PFFB 1BGXT 5KFVA 2KYZA 4LRCA 1D8YA 2R8IA 4L75A 3PYDA 5FIIA 1TZ0A 2XMUA 3CXCR 3ZXWA 1RA6A 4LREA 4OHZA 5DDOC 4ID5A 2KZZA 4J9VA 1XR6A 1SC3B 4ZJOA 3FQKA 2C2EA 4OYXA 1P1LA 1WHWA 5B0BA 1NK5A 4O44B 1VQPS 1XBWA 1WOPA 2YQ3A 5CQGA 1REVB 3EMTA 2VA3A 2OEJA 2RJZA 4C11B 3IG1B 1N0VC 2CG8A 4F3QA 5ETSA 3OVBA 2VG7B 2ERRA 3RAXA 4FF4A 2WCXA 5IWAJ 4USIA 5BYRA 4EEYA 1NO8A 1D3WA 1NKCA 2A3JA 4PXBA 1GFWB 2V8VA 2HMIB 3ENQA 1GXUA 4A46A 2KL8A 1P9QC 3PX0A 2Z2ZA 3RZAA 3OL9A 5KFTA 2DK2A 1VIXA 1VMBA 5KT6A 4H4MA 3LWLA 4EGLA 1UVIA 4X4TA 2AF6A 3QNWB 2EI5A 2CQGA 2MZQA 4J9LA 1S97A 4ZS6A 4OX8A 3TVZA 3GTYX 1HMVA 2OPQA 2POKA 3KK3B 2AYGA 4ILMA 1QTNB 4RW7A 1XQIA 4DCPB 3R7NB 2V6AA 1UEUA 1N5YB 3MMBA 2ZBIA 2CVIA 2DNZA 2FY8A 2RDDA 2D3O1 3GIJA 4OYZA 1TL1B 5DQIA 4B9VA 4ZHRA 3DCAA 2XYGB 5HVHA 3S1TA 1DQ8A 4ETXA 4IOCQ 3K8WA 3BQ1A 1VRTA 5ETKA 1N36J 3DU5A 3H2UB 5LMNJ 3H42A 3B82A 4U95A 3DHWC 4PG5A 2YKNB 4DV3F 1IBCB 3M4XA 4OHXA 4B9UA 3BF4A 3JS9A 1U0HA 1GT8A 2FD2A 4C3KA 2BR0A 4KO0B 1D0EA 2J6UA 5G0RB 3W66A 5EHHA 2R2TA 1DTQB 1XC9A 3KLFA 2N3LA 3VAIA 4DPUA 4OZ1A 3IA0A 5CYMB 3PW4A 2C2KB 5L8RC 2AJQA 3CF5Q 5J2PA 1TUWA 4WZQA 2E7XA 4LSLA 1GAOA 3C66A 4WTOB 5KFOA 2KRBA 2HFUA 2DB1A 3WDOA 3ZZPA 3TX8A 1R3NA 4ZK7M 2QYCA 2RS2A 2ZOGA 1SKSA 1TFYA 3DOKB 2DNQA 1VOMA 2OFHX 4FKXA 3ENWA 2OSQA 1REGX 1XERA 2DIVA 4UZCA 2GVZB 5KTQA 4W90B 4WK3A 3GV7B 3LW5C 4HDHA 3HSJA 1FWPA 2V8GA 2XMTA 4B3RF 4IR1A 2FLOA 4OJHA 4DR4F 3CC2S 1K8AT 2Q43A 3FJ2A 3V4MA 3AAWB 4F36A 4PYAA 3FSIA 2DEIA 4PKDB 1YZ6A 3VGSA 1PC4A 2DGOA 1WKKA 3KK2A 1B0PA 4F3OA 2VBYA 2LU2A 2FQQB 5HJXA 3EXYA 4WFYA 1N5VA 2AJ0A 4FN5A 5K9FA 3W61A 4GO5X 3ZFVA 4F50A 2OPPB 1TELA 2H5IB 3KTQA 4AQYF 4WE1A 3BSOA 1HA1A 4D3GA 2HVEA 3U02A 3M8PA 2EFVA 3TR5A 4J9SA 2IDLA 3MCMA 3TZWA 5F3TA 2LA6A 5LXYA 1VQ7S 1TU0B 3MPWA 4ZVFA 3GSDA 1ZA2B 1R0AB 1IKXA 3UN2A 2HHHF 3PR5B 2ZH8A 4ZLLA 2CYYA 4NA3A 1Q82T 1NJZA 4K2XA 3OFFA 4P7TA 4W92B 4B9LA 1CVJA 1TK0A 4UY85 1WUUA 5A8KB 1JK9B 3ZNJ1 1F1BB 1W7WA 2L9WA 1UL3A 2D3UA 3FCHA 3TAQA 3OVAA 5ETVA 3OLBA 2GIRA 4NA1A 1NJXA 2DNNA 3ITHA 1ZTWA 1EETB 3BSCA 2HK2A 1A0OB 2MHEA 4PG8A 4Q44A 4M8LA 4RUCA 4OV6A 5T14A 5C2GA 2WAQD 2IY5B 4OYBA 2WSCC 1DLOA 2VQFF 4WTYA 4O3QA 4HVZA 1TAQA 4OJ1A 5GAEU 4K4XA 1SH3A 1HLWA 3V6DB 3M9OB 4USJC 1BLUA 3HI9A 1E6YA 3I32A 3KUEA 2V9WA 1G1XA 3PXGa 1QLNA 4NMXA 1H73A 5LMUJ 3PYFA 2Z2LA 3KUGA 2GVDB 3QJJA 2YXLA 5EWGA 1T9TA 3NMRA 4ICLB 2J8SA 3G71S 1KLNA 1YZ7A 1B3TA 1RU1A 2BE2B 2RKIA 4ZKAA 4XPEA 4QCLA 1N5TA 3QMQA 1X4CA 4CO2A 1ZBTA 5JVGQ 2FLNA 2VF3A 1VC5A 3KWMA 3N5BA 2E66A 4NZ7A 2GO8A 2OMOA 4MT1A 4LR9A 4RKUC 4A48A 1TL7A 4FPIA 4DCOB 3C14B 5KFAA 2LQJA 1ZS6A 5BJRA 3U1MA 3ZO7A 3NNHA 4K7QA 3CD7A 4KSEB 1RT3B 2JC1A 4ZVGA 2KVQE 3DLBA 5D4OA 4DQQA 4LF9F 3MR6A 2VV5A 4AD6A 4KGKA 4LR8A 1F60B 2HVDA 2UXDF 3R5BA 2FVCA 5KT5A 5IWAF 2P8IA 2XLJA 3UR3C 1VR6A 4U7CA 4CO1A 4MH8A 1R8CA 4TYAA 3CCRS 1YVFA 3Q8YA 1S1WA 2HPUA 2DHAA 1N5QA 2R42A 1HBNB 2XYHB 4IFYB 1KONA 4L76A 3MPYA 2DO4A 3O2IA 3RRHA 1T03B 5GAHU 1X4HA 3K59A 3Q2SC 3MF5A 4C8KA 1JLBB 5KFEA 5CCLA 4FYDA 3LTOA 3VAMA 2B6AA 5F8IA 1RT5B 2H4WB 4Y2IA 2ASJA 5B0EA 4ZCKA 3W62A 1CJUB 2VICA 3O8WA 3BJYA 3I31A 4J9OA 2XSJB 1SB6A 2A18A 2LQBA 3NMAA 1TV6B 3D3BJ 4PPZA 2B9XA 2M2BA 2FHJD 3R6LB 3HJVA 3TJ8A 3RBZA 2F9DA 3SSSA 2R7TA 1S1VB 3Q24A 2I0XA 4CH0S 1HI1A 1Z2ZA 4DZDA 3V4IA 1N36F 3OUYB 3T9ZA 3DXBA 2ZOMA 1VK8A 2IA0A 4KIAA 2V69A 1WNEA 3P8BB 5KG5A 1X4EA 2WOMA 3ILJA 5KFLA 2MGZA 3H5SA 3PFEA 3CJQA 5M2RA 3GR0A 3QPIA 2IC3B 2YKQA 4FYVB 1EB0A 1U25A 1WSRA 4G1IA 4USUA 2B7CB 4J90A 4YS2A 2FGCA 3M30A 2ZH4A 4ECRA 3OSNA 1YWXA 3DXSX 1SC4B 3L7PA 4LRAA 3Q86A 4ZPCA 3VVTA 4AUKA 5EGYA 2DRAA 3ZTSA 2HWIA 4TQSA 3LP2B 2EWHA 1X0FA 2IM0A 4DPWA 2HFNA 5IT9Y 3JSRA 4PRFA 4Y6IA 4FYWB 3UN5A 3SFGA 2WSFC 4GMKA 1ZM4A 4DR7J 2UU9J 4N41A 4Q7AA 2M4MA 1HQ2A 4MYUA 4WZMA 1FCAA 5CABA 4Y34A 3DKDA 2W9BA 1PYOB 3D6TB 3EE3A 4JUZA 3V5RA 2ZVSA 2GC8A 1AFJA 2B7BB 1VLOA 3AOAA 4P72A 1HQEB 3MOJB 3JYTA 1PAUB 5HI7A 2NSCA 1C0TA 4RR5A 3PHEA 2AGPA 2QGFB 4MFBA 2AWZA 4NWBA 1F9EB 3RB3A 4FXWA 5J2MB 4CQ1A 4X4UA 4URSA 2XHWA 2W7OA 2CJXB 3R1HA 2VG6A 4LSNB 1B99A 1SH0A 4JI6J 2XMVA 2OHDA 3PTWA 3ZTQA 1F0XA 2MKKA 2I9SA 1Q7YT 3K8VA 3MFIA 3G8TA 1EARA 1U8WA 3EVOA 4C8ZA 3HHEA 4CLKA 3DGPA 4KBIA 1OS5A 2HGNA 1HI8A 3DRPB 1U48A 5FDLB 4C48A 2MZRA 5DQGA 4DL3A 5HROA 2HURA 1PG5B 4CLZA 4KPYA 2CJBA 1NDCA 3AJDA 1H7WA 4DV0F 3KNAA 2GJIA 4E2FB 3ETOA 3AOBA 5E3PA 1LW0B 2QV6A 2OH2A 3GJQB 3DLGA 4DX7A 3HHLD 3L7OA 1HNVA 3OQ2A 3QT8A 3GJRB 2QO3A 4AE5A 4NLUA 1XNQJ 1YG0A 1NK0A 3I82A 2DR9A 4RW9A 1JMTA 2RRAA 3PO4A 4L3KA 2VL1A 4K0KJ 2PA8D 3HFKA 4QR1A 2LECA 1R89A 4B3MJ 3MEEA 4X4PA 1HPZA 1TL4A 4WXWA 1CPZA 2XB2D 3VGTA 3LP0B 2VBXA 1DURA 4HACA 3VZIA 1Q86T 1U6BA 5ETPA 2BABA 3D1QA 5IM0B 1KOOA 1CSJA 4R8UB 4RW6A 2ZH7A 1VYAA 1LEOA 3BGUA 1FVSA 4RNMA 3POTB 5HLFA 5CYQB 1DZ5A 1MSWD 2ZVIA 1SJQA 1IBLJ 3CD5A 4ECVA 2IHR1 1WI8A 1EIYB 4U7UD 4ECSA 1TKXA 1OY9A 3QGGA 3V6KA 3KLIB 4KV8B 2O1PA 4K4ZA 3KOAA 3QIPB 3OD2A 3SIPB 3IS9B 1SJ1A 2EBEA 1ZTTA 2L41A 1IM6A 1MWQA 3U1NA 4I2PA 2FJWA 4ZVSB 1JJ4A 2RU9A 1RWXB 1OQ3A 2RD5C 3M1VA 3OV7A 3T1HJ 1PJ5A 4DFKA 3T41A 2XS2A 1TL3A 3BPSP 1C1CA 3T5HA 4WP9A 3W65A 4UOGA 4DR6J 2NXJA 5HO4A 1FNXH 4NOHA 5HATA 1RBLA 4M5HA 3R7BB 2KTQA 5H9FJ 3OTBA 3N6LA 4IQMA 4IO1A 4GVBA 1NKBA 5KFXA 3LF0A 3TO8A 3THPA 3MM5B 3CD6S 4KKOB 5KG4A 1NPKA 2CKWA 1UW9A 2MKIA 2YQ1A 2YPZA 3QBCA 1ZOTA 2V4JB 2RE1A 3LUYA 3C8YA 1RE1B 3KLEB 4PUOB 1RHQB 3GWCA 2OTLS 2RS8A 5IFMA 2BOPA 1S99A 2R8JA 4AL6A 1YJ9S 3D5MA 1SQFA 1WDDA 1OPZA 3J7Z5 1FKAF 2WBRA 5KG2A 4X65F 4KGZB 4X2BA 1RZMA 1IKWB 1FEEA 2QLWA 3AY0A 3MEDB 2CZVC 1RABB 2QSFA 3SZ2A 2B9YA 2G1DA 2JVRA 5DGBA 1NCLA 3M2RB 4Y2AA 3SQGB 2E5GA 4OX9F 4J5OA 2FIUA 1UEVA 2KXHA 3DLKB 1WJ9A 1FE4A 3D6FB 2FLLA 3BR9A 1XR5A 3Q22A 4OJGA 4LQ3A 2MMYA 2W9AA 2DGVA 3BQ2A 1HBMB 2DNYA 2JSXA 4WU3A 3UO0A 3V81B 2W2PP 4CLFA 1REVA 3MAQA 3CPWR 4P74A 1RT1B 4C11A 2BW7A 3G8QA 4USVA 2DGUA 4F26A 4XDCA 4USMA 5L38A 2VPYB 1ZM2A 2HNYB 2CXEA 1FRXA 2ZZTA 3LGMA 4TN2A 2HMIA 4FZVA 1FRKA 2OD4A 3BQ0A 3MUVP 2L3MA 5AJ3F 4J9QA 1WKJA 2G9OA 4ZITA 3MMJA 2CPYA 2GW8A 2MZSA 2PGCA 3A8IA 2YNGB 4QPTA 4MKBA 4M94A 3PW5A 3W1YC 5A76A 2B5JB 1WC1A 2WBMA 1PYTA 3KK3A 4IG0A 3MM8A 3AQPA 3ISZA 4B3OB 4JI5F 1LV5A 1NH8A 2UP1A 4KC5A 1RWOB 3SCKE 3DOMB 1NKEA 5U47A 1GEHA 4OQJA 1NAQA 4ILRA 3BKFA 2VHGA 1NB7A 1HR0F 2LQ8A 1HIYA 4QR2A 2JVOA 1R6YA 1J5OB 3MPVA 1TL1A 1RBAA 4DF4A 1RHRB 4KHPJ 3JTOA 1X4DA 1HHTP 1Q16B 3NS5A 4DG1B 3MHYA 2RB7A 1SJ4P 1MNEA 2J9EA 1QE1A 4ER8A 2QFIA 2FGOA 3T5KA 2QT7A 3KK1B 2MKYA 1U8SA 1CS4B 2Y0BB 2VIHA 2PN6A 3GMGA 4XK8C 1FK9A 1S6UA 4A8SA 2MZJA 2FVRA 4KT0C 2VG5B 2AMCB 3R1LA 1FJGJ 1N52B 3OW2R 2HBRB 2CDRB 2AEJA 4KO0A 2DH9A 1KLMA 5G0RA 3D28A 3H8YA 4ECXA 5CYMA 3A8EA 3CDUA 2FUG9 2YKAA 5ETLA 4QBUA 2FYXA 4TY8A 5L46A 5DRKA 2XMWA 2YWFA 1UZHA 2GIFA 3RRGA 1UJ5A 3J7YI 4EBDA 5DDRC 4L72B 3CJ3A 3TVYA 4C3LA 3SDEB 3MAHA 3CT9A 4A47A 4ZJQA 2VOOA 3I56S 3PJ9A 1U6FA 2O5DA 4CLWA 3D7SB 2QMXA 1P9YA 2J7WA 3MMAB 1VBXA 3I5BA 3DOKA 3QAUA 1L3VA 2FJBB 3J81Y 1FRIA 4M95A 3CB4A 2W4PA 1S12A 2HKEA 4F4AA 3PW7A 2H51B 1Q78A 3LANA 2C2OB 3CC7S 4PWUA 5CXTA 3KFWX 4UOHA 1NDLA 1F2GA 3A3PB 1MWYA 3IM8A 1UWBB 4DHVA 1K0VA 3VTIA 2NSBA 2MQ8A 2BJ3A 1NSPA 1L5UA 4B3MF 2UXCJ 3W9HA 4DLEA 4JV0A 4NPOA 1HNWF 1WORA 3BSNA 4LF2A 3VALA 3IBWA 2W2MP 3C19A 5HL7Q 4ZMMA 4WF9Q 4U7UK 1KRPA 1Q5VA 2HRUA 2KFYA 5CAAA 2NREA 2K7KA 5J2NB 1CULA 1SL2A 2OGUA 5HSPA 3JSYA 3GJTB 2MLYA 1VQLS 4K5RA 4I69A 2PE8A 3PX6A 4E98A 3G9CA 1M5OC 2R7SA 4DUYF 2IM1A 3NGKA 1X5PA 4KE5A 3F41A 1HWJA 1R0AA 2NXUA 2B4OA 5HMYA 4C6AA 2AZ1A 1NZ8A 2DGQA 4HR2A 2XM3A 4BDPA 2UVVA 4IDKB 2M0GB 5A2QU 4MKVA 5HVFA 1DTTB 2GHVC 4NXMJ 1KWMA 5D6GA 3C15A 5A8KA 1DJ0A 4Y2KA 4J9MA 3P45B 3EPGA 4NEZA 3T1HF 3Q2TC 1C2PA 1EETA 3L4BC 3UCUP 2MY8A 2F3JA 2HYIB 1SL0A 4QIFA 5E0OA 3H7HB 5GMDA 3VGVA 4FS2A 5L9XA 3J80U 4U67Q 2CNOB 3QGHA 3Q8VA 2CIMA 4TLQA 2BQUA 2RUGA 3KG0A 3VQTA 3MGJA 3SCJE 2J9CA 2ZDPA 1W2BR 3WIVA 4ZPAA 1P27B 4K59A 1FTRA 4ZN1A 1IR1A 3S6EA 1U2CA 2BJEA 2GVDA 1U6ZA 2J5AA 2JZ5A 5J1NA 2Z30B 2MEWA 4DV2J 4WFXA 1RCOB 2EKNA 1JXEA 2ZH1A 4HI2A 2XG8A 4WP8A 4ZVPB 1WACA 2BE2A 5I3UB 4OZNA 1RT2A 4PPDA 9ATCB 4LR7A 3N6MA 3DM2A 1NK4A 3PZPA 3ILIA 3BH7B 1IJFB 1MROA 2EC0A 2XO7A 4ECQA 3ISND 4NCAA 2UV8G 2WONB 3QFHA 1M5PC 3M6WA 4LMZA 4DBQA 2CJ9A 2KHDA 1BQNA 1PAEX 2E5HA 3PG9A 3NP5A 2I8EA 1JQGA 3W60A 1FERA 3DLHA 2WRMA 5DM6Q 1RT3A 4X66F 1QAIA 1IN0A 5DG8A 3R5AA 1R6VA 2D9OA 3OL7A 5KT7A 4CDIA 4KHRA 1HMVB 4N5SA 3RJMB 4DQIA 3NCQA 6AT1B 1VQNS 4RW7B 4MAKA 4MIWA 4Q8EA 3PVXA 3HHLC 1KN6A 2HS0A 3R9LA 3MMBB 4E0DA 3BH6B 2V2QA 3Q89A 2ZZNA 3AD7C 4FBTA 1XNRJ 5IT4A 3OXFA 2IA6A 2ZBRA 4PR6A 2LXUA 3QJLA 4F02A 4IFYA 1K73T 3RG6A 3MD1A 3F0NA 4LF1A 1XWLA 4M5JA 2ZNZA 4IO9Q 3R2CJ 2YWEA 4CLPA 3AD8C 2MYFA 3CMQA 1GH8A 2KKHA 2Y8YA 3PX4A 1BC6A 1RTDB 3Q0AA 2OMLA 4M63A 4J91A 2ALZA 1S9FA 2BM1A 4OL8A 3GG0A 2V94A 2XSJA 3KXDA 2CQ2A 2M7SA 2E44A 3QWUA 4C4WA 2N7YA 5LJ3Y 2J8AA 1K44A 3HJFA 2ZKTA 5J2PB 2VFSA 3GFHA 1S1VA 2YY3A 2A10A 3SSQA 4J9NA 1V5IB 2CQ3A 3OUYA 1SV5A 4DFMA 5KFSA 1FE0A 1YJWS 1V5VA 2KHCA 5HMWA 1CJTA 1U1RA 1I3OB 3FMBA 3C46A 1RT4A 3BN4A 5I4MA 3VAKA 2UUTA 2COLA 4JYAJ 1C0UB 4F7VA 1N33J 4P73A 2IMWP 1EX8A 4DS5A 2E1RA 3LP1B 3GFYA 1S72S 1QAXA 1YJRA 2LXFA 1S6QA 3PM9A 2ZBQA
chains in the Genus database with same CATH topology
3GFZA 1DTQA 4RWWA 2RS2A 5GADI 2ZOGA 2OKQA 2V5HG 2QA4S 2MSTA 2Q6CA 3MDFA 3T5LA 1SKSA 3CULA 1TFYA 1FXDA 3LP2A 4C0HA 2JLEA 3DOKB 2DNQA 3DMJA 4FBUA 2BQ3A 1VOMA 3LO3A 2VUGA 3VCDA 2OFHX 3M8QA 2ZZMA 3ENWA 2OSQA 1XERA 1S6PB 2IFXA 2PI5A 2DIVA 2KT5A 2BVZA 3DU6A 1X9SA 5KTQA 3CCUS 3A1YG 2K1RB 2K2PA 2Y1JA 4W90B 1SJ3P 3KK2B 5C25B 3L95X 2LEBA 2BYCA 4WK3A 3CD0A 3GV7B 4IQXA 3LW5C 4C0BA 5A8RA 2J6SA 3PJXA 4IRDA 4HDHA 1DQ9A 2XMTA 1VRUB 2V8GA 1S1XA 4OX6A 3VZHA 1YGYA 3NBPB 5MLCV 1OWXA 4B3RF 4ECZA 1SXLA 2CPHA 1D1UA 1WG4A 2DR8A 3IWXA 2WTFA 2CRLA 2DHGA 4IH6A 4MK9A 4YP3A 4IR1A 3IO1A 2FLOA 4Z37A 2GHPA 1WTBA 4C2MA 4OJHA 4DR4F 2R7XA 1PO6A 3CC2S 1MWZA 4WJBA 3UFCX 2Q43A 5I3QA 5DGAA 1K8AT 4O23A 2DVIA 1JNZB 4N56A 4FF3A 3JSBA 2GQCA 4LF6F 3FJ2A 3V4MA 1MMNA 4Y00A 3VAFA 3AAWB 4HYKA 4N8OA 3FSIA 4A8KA 2FDNA 2CQHA 4OZLA 4PKDB 1U1PA 4X4RA 1N56A 1LWCA 1PC4A 4IOBA 2DGOA 3AJ1A 3KK2A 1MMDA 5J2MA 1B0PA 2HWTA 2V9KA 4OV1A 3SSRA 2N3OA 4F3OA 2VBYA 3C2PA 2LU2A 2HZCA 5GADU 2HHQA 1U24A 4WFBQ 3EXYA 3K7RA 3M2VB 2JEIA 4CO0A 4WFZA 3NBPA 1HW9A 4WFYA 1HYSB 5AXLA 2DCLA 2HLTA 1N5VA 2AJ0A 5C42B 3I9ZA 4YR2A 4LSNA 6FDRA 4JI2F 1KOHA 1RISA 4FN5A 4Y3CA 2J6TA 3N5FA 3H5YA 3FSYA 3RB6A 2ZH2A 5K9FA 4GO5X 2XZWA 1FJCA 3ZFVA 2X1FA 2X51A 4F50A 3DC2A 2OPPB 1PSDA 2YH1A 1IKXB 2WB1D 4Q45A 2DNOA 1FO1A 2HHVA 1E6VB 4ED3A 2XLKA 3UR0A 2AQ4A 5B09A 4QWDA 3KTQA 4ZVHA 4F3MA 3IWNC 3ZC4A 3H4DA 3VAGA 4WE1A 3BSOA 4AQYF 3QLHA 1HA1A 4PQUA 2ZC4A 4OZ5A 4D3GA 2M3DA 2R7UA 1H7XA 2JHEA 3OXLA 1JX4A 2VC0A 4HHJA 3HZEA 2QLXA 3CCZA 3U02A 1OSCA 3M8PA 2EFVA 2VODA 4O3RA 4RBUA 3K5PA 5CZXA 1FNOA 1X5TA 3TR5A 4J9SA 3M2VA 2QZ8A 3OVSA 4Q2LA 1HYSA 1FJEB 2DNHA 5C42A 3DRPA 5F3TA 2VFUA 1XTZA 2LA6A 4HTIA 4AFFA 5FDLA 4NLGA 5LXYA 3OTCA 2GGPB 4WKYA 2AGQA 1RYSA 1VQ7S 3UI3A 3RR7A 4ZPVR 3FEYB 3MPWA 4ZVFA 3GSDA 4WIIA 1OIAA 5KT3A 1XMQF 2OPPA 3CJ2A 4DQRA 1R0AB 1IKXA 2CJAA 1T05A 4YB5A 2HHHF 3PR5B 4ERDA 1Y4ZB 4LQ9A 2W8KA 1M1KT 2ZH8A 1Y00A 3OTDA 3TRGA 3EZ5A 1EP4A 3AA9A 4A8OA 2C3MA 1VQ6S 4CNYA 2CPZA 2CYYA 4NA3A 4H4KA 4F2RA 1W2IA 3HVWA 1Q82T 3IN5A 1UKUA 1LW0A 4K2XA 1ZM3A 1NJZA 3OFFA 3K5NA 1KTQA 4P7TA 4W92B 3HHDA 5IQ6A 1YBAA 2LDIA 1U49A 2LYVA 2IVYA 5AXNA 4B9LA 2VPWB 2KM8B 1CVJA 4CNZA 3CCMS 1TK0A 4UY85 3BEGB 5A8KB 2CQIA 1JK9B 5I3PA 2EBGA 3ZZZA 3C6TB 5L1IA 2L9WA 2JLGA 1UL3A 2D3UA 2D74B 4F8RA 3FCHA 3TAQA 2Q3PA 2DH8A 2PO4A 3OVAA 3OLBA 2GIRA 4B9MA 4L6V3 5D4PA 4NA1A 2Q66A 2K8GA 2ZD1B 1NJXA 4R0EA 2J0SD 2DNNA 3ITHA 3HF5A 2ABYA 4CIOA 1EETB 1ZTWA 3W3SA 1FVQA 4NXMF 2NR0A 4HH0A 3BSCA 4UQTA 1M5KC 2FC9A 2LKZA 2MHEA 4PG8A 4Q44A 1CQNA 3EPIA 4EUVA 4O3SA 4M8LA 4RUCA 2MJNA 3CDWA 4PQAA 5E7OB 5T14A 2VC1A 3UCGA 2HFOA 4RWXA 4Q0BB 3W2VB 2WAQD 3V2UC 4WCEQ 3EGZA 1JLGA 5DG7A 1KFDA 3O6QA 2WSCC 3HVTB 1DLOA 5KG3A 3GQCA 3HK2A 2VQFF 2RH3A 4PWDA 2GA7A 1BD6A 4WTYA 2SXLA 4O3QA 3AHPA 4HVZA 4NYPA 1V3ZA 1TAQA 1VLYA 4OJ1A 5GAEU 4K4XA 5LMUF 2KJWA 2PC6A 3BGRA 1SH3A 1JLEB 1G2EA 2KM8C 2RKIB 3OSPA 5E3CA 1RJJA 3V6DB 3M9OB 1LK7A 2R7OA 2LA4A 4USJC 5B0AA 1FDBA 3UQSA 1BLUA 3HI9A 4QWAA 1E6YA 1FKPB 4QIWD 3I32A 5DDQC 2V9WA 3NL0A 4EBCA 5FD1A 1G1XA 3CCLS 3NLCA 3PXGa 5CZVA 1QLNA 3PW2A 2XLIA 1C1BA 4RZRA 2NUUG 2R7RA 3HM9A 2QA2A 2Z2LA 1Q1KA 4P7VA 5KFRA 2HHPA 3W2VA 1C4AA 3QJJA 1SKWA 3H4BA 2LLZA 3SEOA 3G96A 5CYQA 5KFWA 2UXBF 5EWGA 4I64A 5J1EB 3NMRA 2BM0A 4NLRA 1HBOB 2LEPA 5KFGA 5GAEI 4ICLB 3G71S 2IBOA 4MJKA 2XULA 1KLNA 3TA1A 4AL5A 4Y28C 4NCBA 2J0WA 4DMZA 5THWA 2BE2B 2BW2A 2RKIA 2VASA 3OL8A 3V6DA 3CMAS 3T1AA 2EVZA 4ZKAA 4U9RA 1R8BA 4XPEA 4QCLA 1N5TA 1U1NA 4NLVA 1SKRA 1WTFA 3QMQA 4O3PA 1UJ6A 1S48A 2I38A 2ASYA 1C4CA 4DPOA 4KFBA 3P3DA 4IG3A 2MDAA 2W8LA 3MTJA 2IJNA 1X4CA 4CO2A 4ES2A 1ZBTA 3KLGB 2HNDB 3IS9A 5JVGQ 1TK8A 5BYQA 2FLNA 2JX2A 3HXMA 2R7VA 3TVKA 3GV5B 4X4OA 4KHMA 1B64A 5E5NA 1KEKA 1VC5A 4ID5B 3W7BA 3JTNA 4X64F 3DRSB 3KWMA 2XI2A 2NS1B 4DLGA 4D3HA 3N5BA 2E66A 3OFHA 4NZ7A 2MZ1A 1QY7A 2GO8A 4KTQA 4O4GB 1HBOA 4OIXA 4N47A 2R2RA 4ICLA 1TKTA 2I1RA 4LVOP 1Y5NB 2OMOA 1KFSA 2JEJA 3E2EA 4RKUC 4A48A 4EFAC 1NJWA 3T19A 3E3XA 2DHSA 1WEZA 3IC1A 2M9KA 1AFIA 5KFAA 1IKVA 3M6UA 2LQJA 2KH9A 2DD8S 2ZH5A 4DQSA 2ZDOA 1FD8A 1U09A 2F8EX 5KG7A 1S0NA 5HP1B 5BJRA 1B0TA 3U1MA 3KLGA 2HNDA 3PNIA 1AW0A 2MPUA 2YNFA 4V19J 2D3OR 2LCWA 3NNHA 2VFRA 4LF7F 1RTJB 2GMHA 3DRSA 1S0VA 3DOLB 3CD7A 4KSEB 4DF8A 1RT3B 2ZNYA 2JC1A 1YHQS 3E01B 5KT2A 4AYBD 2XSFA 4O4GA 5KFMA 2FHKA 3K5LA 4ZVGA 3NCPA 3DLBA 5D4OA 3CCES 4CO4A 4DV7F 5KFKA 4DQQA 4NZ0A 4LF9F 1U45A 3MR6A 4NZ6A 2AYEA 2VV5A 4C98A 3I55S 2LQ5A 4KGKA 1F60B 1U2FA 2UXDF 3R5BA 2IRXA 4ZP7A 4F4WA 2FVCA 2DR5A 3KLEA 1LW2A 5KT5A 2XNQA 1RK8A 2DNRA 4EYHB 4WXOA 5IWAF 3GV8B 1Z1ZA 1OQ6A 3O44A 2XLJA 3UR3C 4U7CA 4CO1A 2B6AB 2P6TA 4MH8A 1R8CA 2XBPA 3IWLA 4TYAA 2GHWA 3G6XA 4H4MB 1S9GA 5D77A 2RF2B 3CCRS 2V4RA 2E5JA 1N48A 2CQCA 1YVFA 3DFEA 4MK8A 2IM2A 1S1WA 3F44A 2HHUA 2HPUA 1GX5A 2DHAA 1N5QA 1VGYA 1VHFA 4TKTA 4TNOA 2A2CA 2XWXA 4KR0B 1H2VZ 2AV5A 2OPSB 1LWEA 1KC8T 4RU2A 1HBNB 1X4AA 4C8MA 4IFYB 1KONA 1T3NA 1T94A 2CZ4A 1T7PA 3PKMA 1QAJA 3MPYA 4H4OB 3TAMB 2DO4A 3O2IA 2OPQB 2HGLA 3RRHA 5GAHU 1T03B 4ALZA 2PI4A 1JWWA 5IS2A 2ZJQQ 5EWEA 1X4HA 3MEKA 4I0WA 2EG1A 4CT9A 3K59A 1QTMA 2ROEA 1UJ4A 1VQ4S 3Q2SC 1FKOB 3NS6A 1LFPA 2JRSA 3MF5A 4C8KA 4B3SF 1JLBB 3OR1B 5KFEA 5CCLA 4FYDA 3VAMA 3H59A 4NYZA 5DDPC 2B6AA 2E1MC 3MEDA 4J9RA 3PIOQ 3PEHA 5F8IA 3V6HA 1RT5B 2AX0A 1H98A 2YWGA 2RF2A 3QGIA 3HPOA 5JVHQ 3P5TL 5ITHA 4TXSA 3M2RA 4IYQA 4YEAA 4X4VA 3SQGA 4Y2IA 4H54A 2ASJA 3M2UB 3MCSA 3BS9A 1NNDA 5IZHA 1YITS 4DSJA 5B0EA 4ZCKA 3CJKB 1KSPA 1XR7A 3V4IB 1HBNA 4HH1A 4IKAA 3DLKA 3NG8A 3O8WA 1CC7A 3TA2A 5GAHI 4H4OA 3BJYA 1X4GA 1T03A 2JWNA 1FJ7A 3I31A 1JB0C 3NCRA 4ZHRB 2XSJB 4J9OA 4N76A 3UD4P 1SB6A 2A18A 2LQBA 4ECWA 2Y1IA 2E9RX 3NMAA 1TV6B 1JLBA 3OR1A 3RYLA 2IRUA 4OI4A 1O5JA 3ZZRA 4NLYA 4DL7A 1IBMF 1FDDA 2DO0A 5A6PA 1BQMA 1VRTB 2ZE2B 4AL7A 1HARA 1U7LA 4PPZA 5A6WA 3VF0B 2MGZB 4QIVA 1H6KX 2B9XA 5T7LA 1VQOS 3I0RB 1RT5A 2M2BA 2FHJD 1KQSR 2CPEA 4X4QA 3M32A 4A8FA 1RT6B 3QYYA 1HBMA 2F9DA 4WYLA 1U4BA 1JIHA 3SSSA 2F40A 2R7TA 2PDAA 1R27B 2YNIB 3P6YC 1S1VB 3Q24A 1RQ0A 4ECTA 2I0XA 4CH0S 4DV1F 1HI1A 3VQSA 1Z2ZA 3CJKA 3RU0A 1TQLA 3GYNA 3V4IA 1N36F 5D3GA 3OUYB 1SQEA 1KVJA 2GIQA 1VBZA 3T9ZA 5K8PA 1SI9A 3DXBA 2ZOMA 1YIJS 2ROGA 1VK8A 2IA0A 3BGFA 4KIAA 1LK5A 3BSAA 4K5SA 3PKYA 4Y2CA 5KFNA 4LIWA 1WNEA 3DI6A 3GFXA 1TV6A 1NHVA 5KG5A 1X4EA 2WOMA 5F0WA 5CCMA 1WHVA 4ED1A 2ZE2A 4DN9A 3KLFB 5KFLA 2MGZA 3NGDA 3DLLQ 3H5SA 1X4FA 3I0RA 3PFEA 3C6UB 4R25A 3DLEB 3RB0A 3CIZA 5T41A 5M2RA 4DSIA 2CDQA 4F4XA 1KS2A 4ZA1A 3UPFA 3N4WA 3MI7X 3THTA 3GR0A 3QPIA 3FQLA 2IC3B 2YKQA 4ELTA 4K4SA 2KI2A 4RW8A 5G4DA 2CPJA 2YNIA 5KFYA 3HO1A 2ZHOA 3H5UA 3HMJG 3UNGC 4YY3F 2WK4A 3TYTA 4QPXA 1U25A 4G1IA 1DRZA 2B7CB 3WC2A 3ZZ0A 2FGCA 4LSLB 4ZP9A 3IR6B 2Q79A 1APSA 3M30A 4EO8A 2ZH4A 4ECRA 3PY8A 4RNOA 4XIUA 5HN0A 3OSNA 1YWXA 1P1TA 3R5DA 5KG1A 1ZAVA 3DXSX 4LJMA 4DL5A 4ES1A 3DRYA 4TU8A 3HHKA 4CO3A 2YKOA 1U1LA 2JEGA 4JYAF 4KB7A 2JJ4D 3TUZC 1Q8BA 4N77A 5F8NA 3CDAA 4CCHA 3L7PA 5KFZA 1S6OA 2EG2A 1U1KA 4ZPCA 4X4NA 4GKKF 4AUKA 5GAGU 4OLOA 3ONQA 5EGYA 1B7FA 2W9BB 2DRAA 1HNZF 2B5JA 4QWEA 1D9DA 2FPHX 3DLEA 3SFUA 2E1CA 1K0TA 3JYTB 2HWIA 4TQSA 4FF2A 3LP2B 4DR7F 2EWHA 1X0FA 5F8GA 1FT8A 2IC3A 2IM0A 2UU9F 2UVRA 2C3YA 3OLAA 2HFNA 1JKHA 3FZBA 5IT9Y 1GTHA 3I0SA 3M8QB 1GQEA 1X4BA 3JSRA 4PRFA 3Q23A 4B3OA 4Y6IA 4DUZF 5D4LA 3JSMA 3SFGA 4YUDA 2WSFC 4GMKA 2LDYA 1Z2LA 1ZM4A 2QIFA 5A8RB 2BDPA 2B3TB 2RRBA 3DOMA 2V2KA 3TQ1A 4LT6A 1CQMA 2PT0A 5K5MA 4N41A 3D0GE 4Q7AA 5KFPA 4LFCF 2CQ0A 2AJ4A 2M4MA 4F67A 4GKJF 2VG6B 4MYUA 2N82B 5GAGI 4WZMA 1FCAA 3DDKA 4Y0FA 4Y34A 3LAMA 2W9BA 4RNHA 2KXNB 1T3OA 2KO1A 4JUZA 3V5RA 5B08A 3RW6A 1TUVA 2GC8A 2ZVSA 3CCTA 4MTPA 1AFJA 2B7BB 2MY7A 2N4DA 2JDJA 1HQEB 3MOJB 3MM9A 3JYTA 1U26A 3VWSA 4DSEA 1J5OA 3MR5A 5M2UA 1KD1T 1N5SA 1TL5A 5HI7A 2NSCA 1C0TA 4AXIA 4YHHF 3PHEA 3NAHA 2AGPA 1QJHA 4DR1F 2V8DA 2VPZB 2U2FA 4MFBA 2AWZA 2E29A 3EUNA 4NRTA 4JI6F 4NWBA 1LWCB 5F9LA 3KKFA 4YFUA 3SI8A 3RB3A 4FXWA 5DM7Q 3IFEA 5J2MB 4CQ1A 1YRXA 2YNHB