1IBKF

Structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotic paromomycin
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 24
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1ibkF00
4LF5F 4LF9F 4DR5F 1XNQF 2UUBF 1F60B 2E5LF 1IJFB 4JI4F 4DV4F 1N33F 2KJVA 4LFBF 4JI0F 4YHHF 2UUAF 4AQYF 4JI8F 4JI1F 2UXCF 1N34F 2B7CB 4DV3F 4OX9F 2J5AA 2YY3A 4X66F 4DV0F 4DR4F 4JI5F 2B7BB 1IBKF 2F4VF 3T1HF 1G7CB 1CQMA 4X65F 1G1XA 3T1YF 1LOUA 4LFCF 4DR6F 2UU9F 4DV5F 1HR0F 4GKJF 1N32F 4K0KF 5LMUF 1XMQF 4GKKF 1I94F 2HHHF 3R3TA 1N36F 3ZZPA 4DUYF 2UXBF 4DV7F 4YY3F 4JI6F 2UXDF 2BVZA 4KHPF 4LF7F 1IBMF 2UUCF 5IWAF 4LFAF 1FJGF 4B3RF 4DV2F 3OTOF 2RJZA 4JI7F 2VQEF 5LMNF 1IJEB 2KJWA 1HNXF 4LF8F 4DR1F 5AJ3F 4DR3F 4JI2F 1QJHA 1HNZF 4B3SF 2ZM6F 2VQFF 4X62F 4B3TF 4DR2F 1HNWF 4DUZF 1J5EF 4LF6F 1XMOF 1B64A 4LF4F 4NXMF 4JI3F 4NXNF 2BXJA 4DV1F 1GH8A 4B3MF 5BR8F 4DR7F 4DV6F 1VMBA 1CQNA 1IBLF 1RISA 4JYAF 4JV5F 1FKAF 1XNRF 4X64F
chains in the Genus database with same CATH superfamily
5FDLB 2E5GA 3LO3A 2HNYA 5L1LA 1NBEB 1MU2B 2Z58B 4DN9A 5DJBA 2CPDA 1X60A 4HH0A 4MJKA 1H3DA 5CYQA 2BQ3A 3EWGA 3UDCA 5KFCA 1IBKF 4ED0A 4ZN1A 4ZJQA 1KC8T 4QYRA 2FZGB 3GSDA 1CQMA 1S4FA 5B0DA 1HBOA 4Q2LA 3MD3A 5CCLA 2XBPA 2IM1A 1TAUA 4P2SA 2CQHA 3PKYA 1FJEB 3PTWA 5AXKA 4WE1A 4QJVA 4J9PA 1V5VA 3JYTA 2CQPA 2EFOA 3I9V9 3OV7A 2IJFA 3GIJA 4I56A 5L1KA 3ISZA 3I4HX 2VICA 1KVIA 4C3MA 1NDKA 3L95X 2DTJA 4QIEA 1RHKB 5GADI 3GSIA 2JEJA 4RUAA 4FF3A 1JKHB 1I3OB 2IC3A 1EZZB 4N5SA 1K73T 5EX3A 1FRIA 2XSJB 2HSEB 3OTCA 2HQIA 4IRKA 5M2UA 4DR5J 3BM7A 3N4WA 1F6TA 1N0UA 2AW0A 2JC0A 3HZEA 4RLEA 3BZQA 2UU9J 2GNKA 4EEYA 3ZZOA 1ZAXA 1YITS 1RTDA 3SFGA 2FLPA 4HTIA 4QWBA 3PW2A 2ZH9A 1PG5B 3GFZA 3FZBA 3BN7A 3KFWX 4H4OB 4DLGA 2WTFA 3KLIA 4DQPA 2ILZA 2XEXA 3IR5B 3AOAA 1BQXA 2RIJA 1JJHA 1O6XA 2I0XA 3H8YA 3I0RB 1UA0A 1U24A 1WG1A 5LSOA 1IR1A 1RBOB 4F7VA 3EJMA 1S10A 4NEZA 5E3PA 5LM7E 2AYMA 4ID5A 4FP9A 3MDFA 4KBIA 2X1GA 3DGVA 1RHQB 2XZDB 4X4UA 2FVPA 3C2PA 4WPAA 4LF5F 3HVWA 4FYWB 4P2FA 2UUBF 2GV1A 4ETXA 1NRKA 4HHHA 2RSQA 5HL7Q 1VQLS 2BRLA 1NKEA 2CQBA 1U4BA 2VUGA 2CQ4A 2MZJA 4CLLA 3POTB 4DR4F 2VHGA 1U1OA 1VBZA 2JDJA 5B0AA 4JP8A 4HDHA 3O6QA 2JZ5A 1CC7A 4OYZA 4V19X 5GAGU 1SQFA 1Z1ZA 3ZNJ1 4FF2A 1VQ9S 3WC2A 4A8MP 2VQEF 4WWSA 4P7TA 3GZ7A 2HNZB 1C0TB 3ENWA 2D3UA 2HLTA 1CJTA 2C22A 2KU7A 1XMOJ 5J1EB 3MF5A 1N8RT 3VAGA 2CWXA 4NXMF 2Q43A 4YQWA 2A18A 2QO3A 3MEGB 2GQ2A 4F0MA 2FJBB 5CQGA 1NZ8A 2W1BA 1YJWS 1H38A 3PDNA 2JVOA 1IKYA 1H2UX 2RQMA 3BGFA 3HD1A 2E9ZA 3B6BA 2OPPB 1S1WA 1S7HA 3VAFA 2GJIA 2QL9B 4NI2B 2ZH3A 3PRVA 2DNMA 3LGMA 3V81B 1HWLA 2W2OP 4NLOA 4GVBA 4O44B 1S57A 1E6YA 4OHYA 1RBAA 1QAYA 3LP2B 2OMLA 3VALA 2DNNA 4OHVA 3TVKA 1OY6A 2HGMA 4PXEA 4QZVB 4X4TA 2UUCJ 2EWHA 4C98A 3J7Z5 2VC0A 1SVDA 1FRJA 3TANA 5T7LB 3TOQA 5JXSA 3AB4B 2DPIA 2N3LA 4ELUA 3PO4A 1Z2ZA 1WC6A 3U1MA 2CPYA 5ETRA 2G13A 3K8WA 1V3RA 1B7FA 2XNQA 1CQNA 3VZHA 4J91A 3SSRA 1BE4A 3ET6B 3Q8PB 2XMKA 1F5AA 3ZTSA 2GMHA 3CCWA 1T03A 4C0OC 2PE8A 3CW2C 3TX0A 4NLSA 5CXTA 2MKYA 4J9UE 4QU6A 4N56A 1OMSA 2HNDA 1LK5A 3H25A 4KKOA 2ZH5A 2KT2A 4DI6A 4ED5A 2IBOA 4I7FA 1RT7A 2RDIA 1VJQA 1CULB 1S5ZA 2OELA 3MGJA 1OIAA 1DLOA 2KZZA 1HQEA 2M70A 1ZBTA 1RAHB 2MQNA 4IG0A 4ZPAA 1N5YA 2RT3A 1T9XA 1FDBA 1C1BA 3D6MB 2RRAA 2AYBA 2DO0A 2KJWA 3PW0A 3SQGA 4KPCA 4MKVA 4CCHA 3K58A 4DUZJ 1XR6A 3EGVA 2W7OA 3AFGA 4LF4F 3DMJA 1FA0A 3A8JA 4GO7X 3G82A 4FNIA 4LRCA 3I55S 3ILOA 1PYSB 1YSJA 1PCAA 2Q1LA 4DPTA 1Q0NA 4KHRA 4NZ6A 1WEXA 2P2CB 1LXNA 3H5UA 3R1LA 1QVFR 4JI0J 2RS2A 2X51A 1C2PA 4DS5A 5KFSA 2UUWA 4WK3A 2FZCB 2H54B 3RR8A 3PJXA 2B8PA 1CS4B 4YUDA 1U8WA 4MFBA 4OJGA 3RG6A 2E5JA 3US5A 3SIPB 4RBTA 5IOLA 1H2VZ 3AT1B 2HHSA 2WSCC 3QATA 1M0SA 4OX6A 4O3RA 1VQNS 1RT5A 4I68A 2IAJB 5KFPA 5KFZA 3CVKA 1CJVA 1U6ZA 4ETZA 2E7WA 2GO8A 4IH7A 3PYEA 4IG3B 7FD1A 5LSLA 4WZQA 1M5KC 5F3TA 1BD6A 2HBRB 3A3NB 2HAFA 1UMJA 4U7CA 4L3NA 1NJZA 5LJ5Y 2Y1RI 3KMSA 1GXUA 1SJFA 1YBTA 4IH5A 2A10A 3VVTA 2LFVA 3MM7B 4YDDB 1P9QC 2KVQE 3RAMA 1S59A 3M6VA 3M05A 1X31C 2JJ4D 5KT5A 2W8KA 1QSLA 4YR2A 3JTOA 3VQSA 3VZIA 2DR9A 3UDEA 1QTNB 1RWNB 5B0FA 2VL1A 3EYZA 3GYXB 1JXVA 1U25A 2ACYA 2V8GA 5C5JA 4ZCMA 3TZYA 2E1MC 2NXNA 3QFHA 1JXEA 5L8RC 2MGZA 4HH1A 5FD1A 3QYYA 3NEKA 1WI6A 2VONA 3ZZZA 4YB7A 2YKMB 4LF9J 2VQFF 3HHNB 3KLHA 2QLFB 3UNYA 3BDPA 4IOCQ 3N6LA 2GQCA 4WIQA 3NNHA 5CYMA 3WX8A 1K1SA 3PYFA 1MMNA 5DGAA 3BDEA 4F8RA 1Q78A 5HVHA 1TU0B 3R6LB 2FQQB 2YNIB 3LP0A 4NLTA 4GO5X 4HHUA 4D3HA 3IWLA 3D68A 1VOMA 2N3OA 3DRRB 5I42B 1W2BR 4WJBA 4FBTA 3G6YA 1VC0A 2HQFA 4B9NA 1XERA 4X4OA 5KT2A 3ISNC 1GX5A 1TUVA 1DARA 3TVZA 1ZA1B 4J9VA 4OZ2A 3TUIC 1XMQF 1GMWA 3TW0A 2PEHA 3TR5A 4YY3J 4CH1A 3TZWA 3GFXA 3T9NA 1IKVB 2XMUA 2P5VA 1F3VA 1BXNA 1WHVA 2VG6B 3QGHA 4JI4J 2HMIB 1O5JA 1ZETA 5A6PA 2B9EA 3KK2A 2MZRA 5B08A 1OYDA 5K14A 4BDPA 2Q6BA 3N5BA 3TYTA 3TJ8A 3VAHA 2G0CA 3C16B 2YKQA 4J9QA 3OD2A 4C11A 2EC2A 4IFYA 4CO3A 3CIZA 3QJJA 2NUHA 5D0GA 3QT5A 1OWXA 2HFZA 5E3RA 5IC6B 2Z2MA 3T5JA 4I64A 4I0WA 4JI8J 1BQMA 2FZKB 3ZXWA 2I8EA 1P1TA 2ZNYA 2HBQB 3BH6B 3I4PA 3CJQA 1FXDA 3S6EA 1RT3B 1U1NA 5L9NA 3FK4A 1HBMB 3B8HA 1JJ4A 5RUBA 2ZBIA 2R7WA 2DNRA 2H5EA 5B09A 4F2SA 1J5EJ 3ILLA 4YOEA 2WHOA 2V2KA 1NAQA 4TLQA 2BVZA 1TV6B 5E3CA 3OTBA 3FMBA 1ZZNA 1HNXJ 2NREA 4CQ1A 3DOLB 2R7RA 1S9FA 2I6WA 4CLSA 4RNOA 3BGLA 5DO2A 5E3QA 4TY9A 1B64A 3D6FB 3QJLA 1AT1B 1N6QA 5ETLA 1X4CA 1Q8IA 2DGXA 3DN9A 1N0VC 2PA3A 3FFIA 3AA8A 3AB2B 1IVZA 1NJWA 1KLMB 2KT3A 2BM0A 2E5LF 3C15B 2C2EA 5F8MA 1REVB 3M8YA 1NKCA 4WFYA 2QT7A 1N56A 4USVA 2B3TB 4QIWD 3KUGA 2K06A 5HVFA 4NRTA 1BY9A 1RCXB 1WOPA 1HQ2A 3M2UB 5KFDA 1C0UA 3AODA 1FO1A 1FKOB 1R3NA 8ATCB 2IM3A 3SDEA 1IN0A 4GKJJ 4ES3A 3WDOA 1SQEA 3CCTA 3JS9A 4XO0A 2J8AA 4Y2KA 1QAXA 3T9ZA 3I32A 3CCJS 2HYIB 2GHPA 3QRQA 5HMZA 4ED7A 4LSLA 2FHKA 4RWXA 4N7TA 4EO8A 2DGOA 2ZKTA 2M5YA 4UZCA 1DBDA 2G9OA 2BE2A 3R8YA 3RB6A 1N33J 2C2ZB 1HD0A 1JLCA 3KDOA 3HHLA 4NYZA 3H20A 4YB5A 1TZ0A 1TAQA 2BJDA 4LFBJ 2UUAF 3CJKA 4F26A 2V0NA 2VH7A 2ADBA 1LEOA 3TZZA 3AXMA 1RWWB 3W2WA 1U2CA 2IJNA 2F4VF 4K4ZA 4OX7A 4YDXA 4ZLPA 4DMZA 1SC3B 3JTPA 1WSVA 2Z57B 4DR1J 4DR3J 2QYGA 4LF1A 1KKHA 3KOAA 3QSYB 2MJNA 4NLVA 3QGGA 2C3MA 3PIPQ 4TU9A 4FNHA 3VR1A 3OTOF 3W3SA 2DEJA 5C7PA 3RRHA 4HEA9 4PWUA 2V50A 1TMJA 4PQUB 3OW2R 4JI2F 2A2DA 4OZLA 1TUWA 1SH2A 3O2IA 4JB8B 3EZUA 1IQZA 3M2RA 3V4IB 4Y65A 4AXJA 4L76A 3QFWA 3R1HA 2CJYB 1ZM4A 4QIFA 1SJ4P 2V9WA 5IT9U 4B3OA 4RUCA 4EO6A 4IOBA 2LMIA 1KTQA 2DNKA 8AT1B 2I1RA 2R3VA 1Y5NB 1L3VA 3CT9A 1SV5A 3AA9A 4JI5F 1Q5YA 2Y1IA 1XMBA 1CJUB 1LW2B 5ADZA 4W4MA 5LXYA 2MKJA 3NAHA 4ECZA 2GGPA 3G87A 2HNYB 4DJBA 4CDIA 4X2BA 2KG0A 5HI7A 5CYQB 1SCJB 3HSJA 2UXDF 2XSFA 3GJQB 4RX6A 5IQ6A 2XNRA 4B17A 2PFDA 1UJ6A 4F4WA 4KGZB 4HACA 1QTMA 1NSAA 1HBOB 1CVJA 3CDBA 1OYEA 1JLAA 2CPJA 4JI1J 3OFGA 2XS7A 2M2BA 5CA5A 1B70B 4HVZA 4U6PA 2MQMA 4WE1B 3DGPA 3JYTB 4DSEA 1P9YA 1HW9A 3MFIA 4DV4J 2K3IA 4WYLA 3W60A 2BJ9A 2NYHA 3D67A 4IFVA 1UW4A 2IM2A 1RDRA 4DSLA 2AJQA 3PRBA 5D6GA 3OFHA 2IC3B 2MHNA 2W4CA 5HANA 2ZJRQ 1B0VA 3G2XA 4NL5A 2MKSA 2V8HA 5I3UA 1PO6A 5EDWA 3NOCA 4KE5A 4FXWA 4LSZB 1AW0A 1RTDB 2RRBA 3M6WA 1MWQA 3KLFA 5KFEA 2NR0A 1LW0A 4QR1A 3CD7A 4Y2IA 3KLIB 4LF6F 1Q8BA 3ENAA 4L6V3 3R5GA 3CD5A 3HHEA 5HK4A 3RAXA 1VR6A 4DCOB 4OI3A 1RWUA 4ANDA 2YWFA 4OI0A 2RUGA 1YI2S 4ID5B 2ZHOA 3SYZA 2FHMA 3GWCA 4NPOA 2OPRA 3M4XA 2FYXA 1HNVA 1B0TA 5E33A 1X5TA 4DFPA 4DX8H 2R42A 2IMOA 1RWKB 3LF0A 2QLJB 5KT4A 1RLCL 3QQCD 4K59A 4Y00A 4Y2AA 4GKKF 2HHHF 3FGVA 1RT1A 4I6YA 3HJVA 5KFYA 1Q5VA 4HT5A 1NK9A 5H9FK 5KFBA 3O1LA 3K57A 3QZ7A 5J2NA 4MKYA 5IXUA 4PPZA 2GJFA 3C14A 4M5GA 1R43A 2RB7A 2R7OA 4ED4A 3F44A 3DHWC 4F3QA 4C8KA 2GMLA 2NS1B 4CLPA 3HHLD 3UQSA 3LAKA 4OIXA 4NZ0A 1NJYA 5KFUA 3U02A 1R8CA 3HSGA 4LRFA 2CADA 1CJTB 4USUA 1LWEA 4LRDA 2J5AA 2LVWA 4O4GA 3BPSP 4DXLA 3KNGA 3DRXA 2HWHA 3TA2A 3MEEA 3T1YJ 2DNLA 3K8VA 4Q8FA 3KJFB 2UV8G 3H4BA 3QBCA 1IKYB 4FYYB 2KN4A 3M30A 4KR0B 4K0KF 4N47A 4DR2J 2RILA 4M63A 1S1WB 3H59A 2AEMA 4NLUA 1Y3KA 2A0FB 4LFAJ 3KDNA 3OT9A 4DPWA 2NXJA 3BSAA 4UOFA 4UOCA 1F9FA 4LF8F 1KHVA 1Q95G 4GVBB 2ZZNA 3CC2S 3RB3A 1CPZA 4X62F 3KG1A 2FVQA 3PR5B 1NK0A 1E6YB 1AA1B 4F25A 5M2RA 3PFOA 2C1EB 2XMJA 2QGFB 3H7HB 1FDDA 4EYHB 3OBIA 1D0EA 2ZZMA 3GE9A 2EFPA 4CLUA 3K5PA 1VQ6S 1Y0HA 2MZTA 3MM5A 1TR0A 2FLOA 3IWNC 4CLYA 1TK8A 2XZTB 3AJ1A 4DV7J 3HVAA 1U6FA 1NJXA 1GK8A 1S6QA 3KNAA 4USWA 1RWPB 2H5JB 4HHJA 4C3LA 4J9LA 4O3PA 5DGBA 2AZ1A 1MN7A 3TAPA 1FRMA 3F56A 5GAGI 5H9EJ 3P6YC 3CJ5A 3TAMA 5J1PA 3LP1A 2CXEA 5IZHA 5HLFA 2HNDB 1TFYA 2C2DA 1M5SA 1TUGB 2CG4A 2DYAA 1RP5A 3HFVA 4KKOB 2MLZA 1HNZF 3BO4A 1TQLA 2ASJA 4K4UA 1TL4A 5K20B 3I5CA 1HNWF 2HRUA 3EGNA 2RS8A 3I6PA 1RT7B 4I7FB 2VOOA 3EVWA 1DLOB 3DFEA 2FLNA 1HQEB 4ILLA 1UVIA 4KSEB 2XMMA 4IG0B 2XLIA 3UW1A 4QR0A 1N5YB 4H4KA 5JJBA 4YEAA 4CM0A 3IO1A 3JXOA 4ANEA 2AX1A 1YRTA 3N01A 2WW4A 4CLKA 1RA7A 1T9VA 2YXLA 3SQGB 3P4UB 4DOZA 4R5PA 1RE1B 4KY3A 2YNHA 1ZTWA 1JKHA 1AUDA 1N36J 5BJRA 3DMJB 2MQ8A 3G82B 2CJBA 1OPIA 2L08A 2XGQA 1HHSA 2WVFA 1SH3A 1QM9A 1MWYA 3QLHA 4QW9A 4ZHRA 4LR9A 1FK9A 3KYLA 1NK6A 1Y4ZB 1YZ7A 1N5SA 2HGLA 5KT6A 2DGWA 1X4FA 3FJ2A 3D5MA 1LWXA 1Q86T 4C7QA 5A2QY 3R5JB 4FBUA 2BE9B 3HJFA 4PWDA 4MFBB 4J9KA 3K5NA 2QSWA 3NG8A 3T41A 5KFNA 5CABA 1PGZA 2D74B 2ZH2A 2OAUA 3SQOP 2PMZD 1RT5B 3D6TB 4RW9A 4AD6A 1XNQJ 2H3EB 2KKHA 3MR2A 2JHEA 1CJVB 3MURP 2HQGA 2HKEA 2JFDA 3CXCR 4X66J 4O3NA 3IWXA 2ZDPA 1X0PA 3TRGA 3SEOA 3W9IA 3EPGA 3BBFA 4USKA 2RRNA 1KQSR 4J9MA 3CO9A 1G1XA 2UU9F 4U67Q 4DG1A 2OP5A 2VASA 3SCIE 4OI1A 1KONA 4FYVB 3JSMA 4BBYA 3RBDA 3MMBB 3T6BA 2VC1A 4ECSA 2MDAA 5F9NA 3TEHB 3NGKA 4CTAA 2QA4G 1GQEA 1YZ6A 4S0MA 4B3TF 2QMXA 4RUHA 3P96A 3M6UA 2JEGA 1QLNA 1HWKA 5HQMA 1E6VA 1JJCB 2A6MA 4JYAF 3TZXA 3P49B 1UJ5A 3Q23A 3CPWR 3BREA 5HN0A 3BJYA 3PX6A 2MGZB 4WFAQ 2W01A 1IWGA 4YFUA 1M90T 3DOMA 3TQEA 4QWAA 3KLHB 2BW2A 3ETOA 5L38A 3R27A 4FPIA 1KWMA 2CG8A 3NGUA 1M5VC 3RB0A 3A8KA 1VI7A 3C3LA 1GXLA 3GIRA 2YPZA 5CYMB 2DR8A 3MR5A 1JLEA 1IKXA 3PV8A 2HEKA 2P9EA 2BJEA 3MHYA 2C2OB 2M52A 3U1NA 3K0JA 2IBKA 1UZHA 3LP0B 4K4TA 4OQJA 4DUYJ 3RTVA 3H40A 3W66A 3KTQA 1T0TV 2QEXS 4NOHA 1J27A 2VKZG 1GFWB 1PAEX 3MEKA 3MCNA 4DV6J 1S6PA 2W2QP 5AJ3J 1U7LA 4C8OA 1FXLA 3P8BB 2R2TA 1AYEA 1F9HA 1FESA 3A3PB 4EWTA 2QV6A 3CCES 1AFIA 4TKTA 1TL1A 2QYCA 2ZH4A 3I82A 1G3OA 4B3MJ 4CNZA 4W92B 2W4PA 3HXMA 4OX8A 1Y5LB 3H5YA 2QL7B 4EBCA 2O67A 1HL6A 1D9FA 1EJ7L 3OFEA 2IA6A 4PEOA 3DI6A 4W90B 2FY1A 3N6MA 2AJ2A 2C2NA 2E1AA 4R0JA 3THTA 4AXIA 9RUBA 2ZHAA 2LA6A 1PBAA 3KK2B 2VZ9A 4EZ6A 3X3UA 1FXRA 5K14B 5K9FA 2HQ3A 3ELHA 2YWKA 1SL0A 3CCQS 3HHDA 4JI7J 4MH8A 4C11B 2FJAB 4IFYB 3DLKA 1OY8A 2DGSA 4L73A 3K5MA 4DPOA 1HARA 5LMUF 4U8VA 5KFAA 4WFBQ 5JVHQ 4ZCLA 1Y7PA 2KHDA 5D3GA 1ZZFA 4USHA 5BR8J 4DPUA 3EICA 5T41A 4OV1A 5AT1B 4IO9Q 2J7WA 1X9SA 1T3OA 2ZC4A 2WVEA 1HW8A 2LLZA 4ANCA 1RQ0A 2GIQA 2Z4PA 3A12A 3D6HB 2ZHBA 3D1QA 1V6HA 1EIYB 4BWMA 4HR2A 2YH0A 3ILJA 2P9CA 1VRUA 2MY7A 4LFCJ 3CJ4A 1ZYQA 1ZM2A 2N7YA 5I3QA 1N6QB 3BBBA 3OUYA 2V8PA 2CQ1A 2FIUA 2AWZA 3CMQA 3FFIB 2BE7D 5GAEU 1QSYA 1VQMS 4X4QA 3EGZA 1LFPA 3PNIA 5A8RA 1VHIA 2BJ8A 4HKQA 5A8KA 4NLDA 3HF5A 4JI3J 5H9EK 2LDIA 1T94A 3TEGA 1W26A 4UTGA 4WF9Q 2CZ4A 1FVQA 5THWA 5CAAA 1NK7A 4G1QA 3BSCA 1C0UB 2ZWOA 2DNHA 3UN3A 3BGUA 1W25A 2V8DA 3H2VE 3TAQA 1BMQB 3SDEB 5I4MA 2HW3A 1UWBA 5D4LA 3BEGB 4ELVA 1GTEA 4RU9A 1URNA 4X4NA 2JEFA 2F63A 3HSZA 5DS7A 3UCGA 2JLFA 5F8JA 3UFCX 2CYYA 5LOQA 3NY0A 3G86A 4CO0A 1S4EA 1KQFB 4PQAA 4AQYF 3NOGA 1FRXA 4ZCKA 1FI4A 2BE2B 4DF8A 4OX9F 2AEFA 1VQPS 2O5DA 1MMLA 2BJ3A 3FMWA 3M1VA 2EFGA 4Z37A 4NMXA 1XEZA 4ZVSB 3DLHA 1TKZA 1JLCB 5HATA 3HHLB 2DJWA 2ZDOA 3AXKA 1YJNS 1TFWA 4IOAQ 3ZZ0A 3CJKB 4Q7AA 2ZH6A 4LSNA 2UVRA 5IQQA 1VLOA 4FKYA 3W2WB 2NZCA 2MEWA 1C4CA 2QL5B 2GCFA 5A8WA 5DLFA 2KT5A 4K5RA 3MCSA 2QFIA 1X0FA 3PHTA 1PC5A 3HP6A 1RXOB 2V67A 3DDIA 3PW7A 4K5SA 2JWNA 4WU3A 1MROA 2J7UA 3V2UC 3BB5A 2E9RX 3RBXA 4B9SA 2BM1A 3QGIA 2I5JA 3D66A 3IA0A 3U7JA 2C3PA 3DU5A 1JMTA 3M9MB 1S49A 4DSIA 3Q24A 3Q8QB 2E7XA 2OJ3A 3GJRB 2R7TA 4ZIWA 2RDDA 1U47A 4TN2A 1HNIA 3M2RB 2NSBA 3A13A 4GMKA 2F7VA 4K4WA 5KFKA 3Q2TC 3QRRA 3BO2A 2BR0A 4B3OB 3A1YG 3EZ5A 1YIJS 1V5IB 4WKRA 4WTYA 1U1KA 1F2GA 2XWYA 2N4CA 4K4YA 2BZ2A 3DRRA 3DLGA 4PRFA 2B4VA 5AXMA 4P52A 4DX5A 1WTBA 1SV5B 3PM9A 5EHHA 3OTEA 3Q8UA 1HBNA 3V5RA 1VQ8S 4C0BA 3WIVA 5EWGA 3O3LA 2Y0BB 1AROP 2OD4A 1PJ5A 2GGPB 3R5CA 5G0RA 2XY5A 3C19A 1YJ9S 2Y0SD 3E51A 5DG8A 2H65B 4A8FA 3AY0A 4LF5J 2W9CB 4LF9F 1WHXA 3BYRA 2ALZA 1X4EA 4EU0A 1VCTA 3GR1A 4HACB 2QMWA 5IT0A 2FLLA 2AQ4A 2QLXA 4UY85 4DR4J 1XQIA 3N9UC 2MMYA 2IRUA 3W7BA 5J2PA 2Q3PA 2CQIA 3MCMA 4FDFA 3UWTA 3J80Y 3DGPB 4CLWA 2PT0A 4CO5A 3NBPB 1FVSA 3MMCA 2OEJA 3Q8YA 5BYSA 1HMVB 4CO1A 3THVA 2V34A 4IFVB 2EC0A 2UVWA 2VQEJ 2E7VA 1HWUA 4PG8A 1WF0A 4WBFA 1RT3A 4ZVEA 4YS2A 4NLYA 1D9DA 2OH2A 4IR9A 3BBCA 4NXMJ 2MB0B 2G0JA 4CP5A 4ERDA 5I3UB 2R8GA 2NQPA 5L46A 4ER8A 3DRSA 4QPTA 1S9EA 5IV3A 2DK2A 3VAJA 4KIAA 3KLFB 5EWFA 4JI4F 1Q7YT 2ZBQA 2MHEA 4P71A 4LR7A 5D0EA 5KFXA 1LW0B 3HSDA 4DSFA 3FEYB 2PO4A 4DV0F 2HVZA 4NX9A 1WORA 2XM3A 4KHPJ 2PC6A 2R8JA 1KLMA 2ZVSA 3C15A 2KG1A 2ILYA 4QCLA 2KFYA 3G6VA 4LBHA 3A3OB 3Q8VA 2OHDA 2B4UA 2ZUAA 5K8OA 5BYRA 2UZAA 2VDHA 2ZJPQ 5DM6Q 6AT1B 2IMWP 5KG0A 4M5LA 1T05A 4BC7A 3HI9A 2ZKUA 2V2ZA 2OPRB 1HNVB 1S1UA 3OL9A 3MPWA 4ZA1A 3TX8A 2FJDB 1J5EF 4ZK7M 2YKPA 3HVTA 3MM6A 1WKKA 1LWFA 1YK9A 3OR2A 2LQJA 2MJUA 1RT1B 1RAOA 5J2MA 3OPKA 5KG1A 4ECVA 4OHWA 1YHQS 5ETSA 1DTQA 2C3YA 5J2NB 1VQ5S 2H48B 3UDLA 4JV2A 4DFMA 3C14B 1NH8A 2KZMA 4NA1A 4CYUA 2QIFA 1EAYC 1U1MA 5GMEA 2MZ1A 4KGVB 5LMNJ 2EKYA 1RACB 4KH1B 3KJVA 1T3NA 3SMZA 1NHUA 3I5BA 2AMCB 2R2UA 5CD4H 1C1CB 1RLDA 1UVNA 1XR5A 2DNPA 4RZRA 1FD8A 3T5HA 2FTRA 2MKCA 2GAGC 3G8TA 2N82B 4LF7F 2KYXA 4RW7A 3RBEA 1T9TA 1H98A 2DT9A 1TMMA 2Q6CA 1ZM3A 5E41A 2XGPA 4X64J 1VK8A 3M9OB 3MEEB 4DUTA 2CPZA 4QOTA 1S1TA 3IG1A 3M30B 3HFKA 4L3KA 4F04B 1NCLA 2JC1A 1L3KA 1Y3JA 4UW2A 1HLWA 2IVMA 2MY8A 1N33F 3EX7B 2GIRA 5D4PA 4NLWA 4ED8A 2PI4A 1Y10A 3T5KA 1B0PA 1WC1A 4EGLA 1B3TA 3KHRA 3D0HE 5KFTA 3LALA 1RAGB 4IKAA 1FJGJ 1X4GA 4LJMA 1UL3A 2EG2A 1Z2LA 2DH9A 2J6UA 1WF1A 3OSNA 3VGVA 1NNDA 4ZPCA 4P74A 4ICLA 3RAQA 5KFHA 3T3FA 5FLXY 1R0CB 3MM5B 2DH7A 4R8UA 2QE5A 1VQ7S 2DR5A 2OLWA 5E0OA 1VRTA 4DR1F 4DR3F 1S6QB 4C4WA 4RBUA 2W2NP 2HRTA 1QDUB 3MR7A 2CWKA 2OEMA 2WVBA 1UP1A 5DQGA 2WB4A 2HK2A 3DM2A 4DFKA 9ATCB 2XY7A 3TAMB 1EKRA 1V3ZA 2VODA 4RNNA 3GV7B 3LP1B 2MQLA 4YP3A 2L48A 2P6TA 4J7CA 2WBRA 5HLFB 4RKUC 3NL0A 2KH9A 3L7UA 4PWWA 2V4QA 1A6LA 3R6GB 2ASLA 3EGWB 2RH3A 2H9ZA 2R8KA 3MM8B 2PFFB 2APOA 4UOGA 5I3PA 1U09A 3CCLS 1UJ4A 4NLXA 2YQ1A 2DVIA 2P9GA 4XTTA 2N4DA 4DU8A 2C3OA 1R8AA 4DL4A 4HTJA 3K2YA 5B0GA 4ECQA 1SBRA 4YN3B 3VTIA 4QWDA 3CCSS 2EPIA 4UF4A 5C25A 2PDAA 3EVOA 2GO9A 4R5PB 2AGPA 5M2PA 2KRRA 2YNHB 2ZD1A 4H4MA 2DXFA 1SKSA 1U48A 3HPOA 2M7SA 1SC1B 4P10A 3BQ2A 3CGIA 3D3BJ 5DETA 4NCAA 3CDUA 3QLHB 4ZHRB 1FK9B 2NCKL 1LFWA 3UO0A 2LP4A 1UAWA 4OZ1A 3UPFA 3QAUA 3MOJB 2QMUB 4LBPA 3I31A 3GMGA 4P72A 2KFZA 4PWDB 1JWWA 3G6XA 1RWXB 2FVRA 4JI1F 3ETMA 4AYBD 2DGVA 1YVFA 3D28A 5CCMA 2HHTA 3MZIA 4HI1A 5C2CA 2RQCA 4G65A 4TNOA 2YWGA 2W7PA 1TK0A 5ETMA 4WXOA 2HWTA 4RW9B 2E44A 1S77D 5GMDA 3MWBA 4NASA 3RUBL 4RWWA 4AL5A 1N88A 3QT6A 1N5VA 2CPHA 2RKIA 2HHWA 1TTHB 1U1PA 2QTWA 2I9SA 3PY8A 4K4XA 4B9LA 3NNCA 4Q45A 2HFSA 5G4DA 5AXLA 4DZDA 4DG1B 2PMHA 4DR7F 1ICEB 2CQGA 3JSMB 1X8DA 1SL1A 3IAS9 3PG9A 2FY8A 2DNZA 1L3UA 3F41A 4B9MA 4RW4A 4CTAB 1RYRA 5DRKA 5HO4A 3TP2A 1WD6A 4DWIA 5DZ6A 3OJUA 4U96A 2ZBPA 1E6VB 3NS7B 5AE3A 1U8SA 1SC4B 4ZPBA 2DEIA 2WSFC 4B3SJ 3AJ2A 1BGXT 3VGSA 3R3TA 2EVZA 1I6JA 2V8VA 2FJXA 1FEHA 3DOMB 1F0XA 1ZPWX 5F0UA 5HQ8A 1H74A 3GLJA 2FB0A 2HVHA 5CYJA 4ZDNA 3IAM9 4JOUA 2JLEA 3BV8A 1JLEB 1IKXB 3VHQA 1PBUA 2Q79A 2X3GA 2KL8A 3FSYA 2D9OA 2JOQA 2MTLA 2H4YB 1PC4A 4ZS6A 3EDQB 4WP3A 1WNEA 2RF2A 2V2VA 2E5LJ 2HHUA 2M8HA 1S6PB 1ITPA 5IT4A 3JQKA 1GAOA 4B9TA 1OO0B 2W4DA 3TUZC 3TUJC 3OL6A 5C24A 2ZFHA 4AL7A 1TL1B 2DPJA 1LKZA 1KN6A 3I9ZA 1ROFA 2CJAA 3A4TA 4X84A 3LGNA 1FTCA 1H0HB 2QA1A 3CJ2A 4KT0C 1WELA 3SI8A 2JRSA 5HJYA 3DI6B 2RQKA 4K50A 1FRKA 3KK1A 3CIMA 5F8NA 1DURA 3TNVA 1M5OC 4L72B 3HKZD 3M8ZA 5K5MA 1RTIA 2Z2YB 3FCWA 2QRRA 3IS9A 1R6YA 1UETA 4EYIB 4LMZA 1S0NA 4DR2F 2CKWA 2AJFE 3DLKB 1NSPA 2YNFA 3RYLA 3RZAA 1AXQA 3OHAA 4DV1F 1GH8A 1TKXA 4E98A 4Y34A 1N34J 3M8PA 3P3DA 3SV4A 5D3GB 1OY9A 1FFSB 3V6DA 1HBUB 2XLKA 2K1RA 2GIFA 2Y1LB 1F60B 5GVQA 2AGOA 4FPRA 3T5LA 1Y9OA 2UUAJ 1RHMB 5CH7B 3W61A 2D3OR 4RJVA 4IRCA 2HIYA 4OLPA 4OZ0A 3E3XA 2YY3A 2JH3A 3LWMA 2W8LA 4ED3A 2FJEB 2F4VJ 1GMUA 4IQMA 2XO6A 4EBDA 3T1HF 2ZJQQ 3MUVP 3MPVA 4CO4A 2LXIA 2COLA 2QSFA 4ED2A 3V6JA 2QG9B 4OJ3A 4OYOA 1VIXA 2DGQA 4QPXA 1VRUB 1R0AA 4DV7F 1SUQA 3MR3A 4MIWA 1KVJA 3OTOJ 1RAIB 1F9EB 2D41A 3X1LB 1HHQA 4ZPTR 4L75A 3OUYB 3HFZB 4Y2CA 3KHHA 4KFBA 2V5HG 2JVRA 2VIHA 3W5ZA 4C6AA 2V68A 3FEXB 4YR3A 1Z4UA 5A8RB 1KOOA 5A8KB 3AD7C 1DY3A 1CG2A 1KP6A 3FCVA 2AJ4A 5IM0A 4G1PA 4LIRA 1VHFA 3MECA 1W7WA 3TI0A 4AL6A 4G1QB 4TQSA 4ZP7A 2G1DA 2LU2A 3FSIA 2ROEA 3BSOA 2L3MA 2ZVIA 3EXCX 2B7CB 2Z30B 2MQPA 1HHTP 1UWBB 3EE3A 3HLUA 4KHMA 3B4DA 1MWZA 1PKUA 1QUPA 5KTQA 4ZVTB 4FYDA 1DQ9A 2DY1A 3IR6B 3P5BP 4UQTA 1OQ6A 1IUJA 3QWUA 3NAIA 1N36F 3QIDA 1HYSA 2AU0A 5KG3A 2UXDJ 1LXJA 1HQUA 3AHPA 1J5OA 4DZ6A 4DL2A 3D1HA 3M1VB 4C8LA 1K47A 3HM9A 1TKZB 1VQYA 1UWAA 3G6ES 3ISND 2MXYA 4OZNA 2AT1B 2JL9A 4NXNF 1S9GA 1UEVA 2BJ7A 3MMBA 4CNYA 5KAKA 1IQTA 5KFVA 2WW8A 1VQSA 1NK4A 3QO9A 1UFLA 4LSNB 2V63A 3DKDA 2AJ1A 1OSCA 2AP6A 1QAJA 2HHXA 2W2MP 2GMJA 3QT8A 2J9DE 5SUHA 3H4DA 4N76A 4M1KA 1WKLA 2PMWA 5A8WB 2RMLA 4K4SA 2EXUA 1WACA 2LEBA 1S6OA 1NSQA 4DBQA 2G0IA 1MW7A 3CC4S 2X1AA 1MROB 3RJMB 5GAEI 4PABA 3N0VA 2I5JB 4O0IA 3PEJA 4A48A 2W9AA 2ZOFA 2M4MA 3AQOA 2VB6A 3HCXA 1U1QA 1LNQA 2CPFA 2VBYA 3UCUP 3JQMA 1WC3A 2Z8QA 1RI7A 4OYXA 2RJZA 4URSA 1RTHA 1LK7A 2CVIA 3UCZP 4ENOA 4C0HA 4ZN3A 3R97A 1HNIB 5D77A 4M5JA 2LXUA 4LF6J 1ZAVA 1K9MT 2ASDA 5JVGQ 4KGMA 4LT6A 2GHWA 1NK8A 3DLGB 3IBWA 2XI3A 4ED1A 4KYZA 2MQQA 2DB1A 1NB7A 1F5CA 1HBNB 2R9LA 4MMOA 1OSDA 5GMKa 1SB6A 4HI2A 4P6QA 4BC9A 2XHWA 5KG2A 3RW6A 2BEFA 3CCMS 1RZMA 2DHAA 5G0RB 3K89A 3KXDA 1WDTA 2CIMA 4XPEA 1YG0A 2NXUA 2VOPA 2OPSA 4LRAA 5L1IA 1IM6A 4PUOA 4GKKJ 4QWEA 4WKYA 5L9XA 4ZP8A 2HQDA 3K7RA 2FGCA 2CVEA 1VGYA 1WWHA 1RAAB 2DGUA 1FTRA 2FC9A 3ZNUA 2FVCA 5DZ7A 3J81j 4PXDA 5EUHA 5J2PB 1WOSA 3PJWA 3PJ9A 4CLTA 4ZVPB 5KFIA 1WG4A 3MMCB 4DV6F 4DQSA 5L39A 1RISA 2XMWA 3UNGC 4NCBA 4IR1A 4C8YA 1NPRA 2KXFA 3CTRA 2CJXB 2DHXA 1DTTA 2ZWPA 3T1AA 1EKSA 2CQ0A 4NZ7A 1G4CA 1AFJA 2OTJS 4QU7A 1PSDA 3DDNA 1IWAA 5H9FJ 5B0EA 4MYTA 4G3IA 4DV2J 4PXBA 3DLEA 3DRSB 4ZVHA 1S9EB 5B0BA 1FHTA 4I1TA 1YX2A 4J9OA 4NWBA 4P75A 1GX6A 3OLBA 2UP1A 3FBCA 2GZOA 2YNGA 4JI7F 1TL3A 4LF8J 3B82A 3M2VA 3CJSA 1H6KX 2GHVC 3LW5C 2MZSA 2VDIA 4NLPA 3QGPA 2ROGA 2A1BA 4CWBA 3RR7A 1TL5A 5BR8F 3NS6A 3T19A 3L09A 2VF3A 1CJKA 3HHKA 2IDEA 3DLJA 2BUNA 2BABA 2VPYB 1T05B 4F0KA 2KDOA 4N77A 3C6TA 4GC7A 2QZ8A 1CBKA 1JLQB 3I0SA 3H5XA 1S1UB 3GV5B 2EFVA 5A6WA 4N8OA 1I94J 1ACMB 3CMES 2VA3A 3HVTB 1RCOB 3CJTA 3MM6B 2OD6A 3HZGA 1LWFB 4ZLLA 3OR2B 4Z7YA 3G96A 3SXLA 4B3RJ 5F8LA 3KHLA 5J2MB 3L4BC 3FSXA 4LREA 4ECTA 1F5BA 4LFCF 5HP1A 1RGVA 4WFZA 4X4VA 3BYPA 1DTQB 1OS5A 3NP5A 1FNOA 1WEZA 5J1NA 2HS3A 1G6BA 1WEYA 4W98A 5KFFA 3EM1A 1PJ7A 2B9XA 3M9NB 2X1BA 2SXLA 4CYUB 1HNWJ 1QD1A 3CDWA 3KJVB 4YB1P 4JI3F 3KUEA 1U0HA 3GG0A 1CLFA 1PJ6A 5MLCV 1FX2A 2OPQA 2A2CA 1WC4A 3UDVA 3R7SB 3FVYA 4RW7B 3CDAA 2E5HA 1R27B 5C2GA 4DL3A 1NEEA 2EFNA 4D3GA 3KK3A 2MYFA 4DV3F 1NU4A 3B78A 1S1TB 3D54A 3LH2S 3IG1B 4OHXA 2YH1A 3TA0A 2VJVA 5HMWA 1Q8LA 2RE1A 4Y2MA 4IH6A 1VC5A 2HHQA 3K59A 4OYMA 3CULA 2C28A 1JXLA 1O51A 1FFGB 3M8RA 3DDKA 5HVGA 2AZ3A 2YWHA 4OHZA 3ENVA 2XULA 1IBLJ 3AD9C 2OGUA 2IM0A 4TU7A 5D8HB 4NEYA 2CRLA 2XB2D 4X4RA 1RT2A 4TYAA 2B4OA 3GJSB 4KAIA 2J0SD 5ETOA 1KRPA 4B9VA 3GJTB 3MR6A 2E1CA 4RBVA 1EP4A 4UY8T 1XR7A 4ICLB 1VMBA 1U1LA 1RHUB 4U95A 3W63A 2NPIA 4R8UB 2MLYA 3KKFA 3RRKA 2EI5A 5HMYA 1IM4A 4RW8A 5DQIA 1VRTB 2KJVA 4Q2MA 2FC8A 4YHHF 3R7BB 2OMOA 3Q8SB 1R89A 2DGTA 3VCDA 3DM2B 2F5GA 5DDRC 5EX0A 2W9CA 2Z2LA 4DL6A 1VYAA 3LOUA 2HVDA 3WX4A 3GP9A 2CNLB 2CPIA 3NMAA 5U47A 1BUXA 1RHRB 3K5OA 1NXIA 1IXKA 3CD6S 2EBEA 1YJ7A 2UUTA 3BR9A 2KVIA 3CD0A 1PILA 4B3TJ 2HS0A 4FF4A 3TVYA 1VBKA 2GA7A 3NBPA 1BLUA 1HMVA 5C25B 4M5MA 1FFWB 4FS1A 4JYAJ 3OXGA 2W24A 2ZD1B 3BGRB 3IGNA 4H4MB 3B4MA 3R7NB 4E0DA 2MLXA 2YWEA 3QWPA 3K17A 1XIQA 1QVGR 2YX7A 4LR8A 2ROPA 2X7IA 1X4BA 2HQCA 3W2VA 3IM8A 3IMQJ 3THPA 3CB4A 6FDRA 5K8MA 2FHJA 3PW4A 2W2PP 2K8GA 1WSRA 2CQ2A 3DLLQ 2EG1A 5JMNA 4OJ1A 1FRHA 3GCWP 4YB6A 2ZH7A 4ALZA 3DC2A 3FBFA 4DCJB 1D8YA 1RHJB 3VV2B 4F4AA 5IV4A 1NUEA 1LQ9A 3LGHA 3KMQA 2HG4A 3WZ0A 4EZ9A 2CNNB 2E9TA 2I2YA 2EFQA 1JNRB 1TKTA 3JAMY 2FPHX 4IDKA 2R8IA 1SL2A 3C46A 3F73A 5C42A 2FHOB 1RU1A 2YX4A 3BO3A 1IR2A 2RKIB 3IBFB 2K3KA 2LECA 3PR4A 3ZZUA 2VBZA 5ETQA 2UVUA 4DV5J 7AT1B 3IM9A 4ECXA 2HURA 2EK1A 3A8EA 1Q8KA 1IBMJ 3SV3A 4KQZA 1P6TA 6FD1A 3GV8B 4I6WA 2MKHA 2R7VA 5IFMA 5LMUJ 5D0RA 4OI2A 2DO4A 3KJQB 1HKAA 5AE2A 1S1VA 5ETVA 4RW4B 3RW7A 2AD9A 4LQ9A 3J7AN 4KHPF 1ZA2B 2F8MA 1SKWA 4J37A 1U0SA 2FGOA 4TYBA 3MMAA 2BOAA 3AQPA 1XNRJ 3Q0AA 5A2QU 2ZM6F 1IKWA 3EUNA 4ELTA 1Q82T 1C1CA 2VG7A 2MSSA 1U26A 1N5TA 4F3OA 3CJ3A 4FVMA 1R8PA 3FBBA 2CZ9A 4K7QA 2B6AA 3PO5A 3QT7A 2B5JA 4JV0A 4WP8A 3AD8C 1F3FA 4O23A 3CC7S 2VBWA 2VFVA 2RDJA 4UUWA 4Z2XA 5GAHI 1YRXA 3S01A 1WJ9A 3N28A 2J6SA 2ZUGA 4R25A 1VDHA 3GIIA 2RHQB 1UPMB 3IBCB 4TLRA 4WCEQ 2FD2A 4Q44A 2RF2B 1LOUA 1D3WA 1N32F 1D09B 1MLAA 2CQCA 4FF1A 4B9UA 4NA2A 2UXBF 2F65A 5E7OB 4ECWA 1YGYA 1HPZA 1H73A 3W65A 5C24B 1EARA 1P8GA 2HWIA 1SJRA 5LMNF 1YBUA 4O0NA 3CNQP 1MG7A 4MK9A 1U02A 2XCAA 1KTVA 2XMTA 1KQKA 2CJKA 4C2MA 1DZ5A 2Y9HA 4PPDA 2DRDA 3KK1B 3HX9A 4O3OA 2YTCA 4FKXA 4X64F 2VPZB 2OUGA 1YJUA 1RTIB 4ILRA 1NHVA 1GT8A 4AQYJ 1RAFB 3IS9B 3J81U 2FDNA 5KFOA 3C66A 2UXCF 4OX9J 2YNFB 3C6UA 5L1JA 2VFTA 2DHSA 1TKXB 2HAIA 3M8PB 2AF6A 2ERRA 3V6DB 3CJ8A 2CJQA 2CJ9A 5BXIA 2K1RB 2AGQA 3ZTQA 1NDLA 2W25A 1EETA 2AHOB 1NDPA 3KWMA 3MM8A 2V4JA 4ID8A 4DPXA 4JI6F 5HMXA 2WCXA 1S97A 1FJGF 1S48A 4NCGA 2ZE2A 3J7YI 3LPYA 4UUXA 4OFZA 3GU0A 3PIOQ 3Q89A 2GJ2A 2CQDA 3OSPA 5F8IA 4U8YA 1TKDA 3MMJA 3QJPA 2EKNA 2LQ5A 2BJ1A 1R0AB 1RT6A 1SUQB 4Q43A 2XMVA 2ZH1A 1MSWD 2KI2A 4RU2A 4X65J 1DJ0A 5ETTA 1HWIA 2AYEA 3KLGA 4DR6J 4KFBB 2R7QA 2QFJA 4QW8A 3LQVA 5T14A 4CI0B 1JNZB 4NYPA 1LWCA 5J2QA 2O66A 4M95A 2VFUA 2FHJD 4EI2A 5KT7A 3TQ1A 3ENQA 1UA1A 5IM0B 3GONA 2BKOA 4I2QA 3MECB 2CZVC 1SJ1A 4CRJA 5F41A 2VU5A 1I5OB 3OXLA 3VAIA 3SFUA 3ZTPA 3LTOA 5ETKA 3EXYA 3M32A 2X3DA 1HA1A 3PKMA 4Z7CA 2NXEA 4F4XA 4OL8A 3KLEA 1HYSB 1YQHA 3OVBA 4N41A 1HQUB 4DR5F 1J5OB 3PFEA 1DRZA 4A8YA 1Y5IB 3I56S 1G2EA 1TVRA 5LJ3Y 2MPUA 2DNOA 4K2XA 1TELA 1RSCA 3O8WA 1S9GB 4DS4A 4USMA 3CEDA 4NA3A 3NCRA 3ONQA 4O3SA 4P9SA 3QO9B 2XHCA 1SQGA 1QAIA 2MKIA 4DQRA 5KFGA 4M94A 3D0GE 1NJIT 1RKJA 3OXFA 4DQQA 5B0CA 1QE1B 1SC6A 1KFDA 5KFJA 4U7UD 2GQQA 1H7WA 3UD4P 1RB0A 3WQPA 1REGX 2ATLA 3QIPA 3JTNA 3PZPA 2ZEJA 4RO0A 1XN9A 1MNEA 3ZZRA 1NH7A 4MT1A 4KB7A 1UPPA 3DYAA 4ZVUB 2XWXA 4C8NA 3J7ZT 1U45A 1U49A 4LVNP 4CT8A 4KV8A 1RTHB 1JLFA 1VISA 2IIHA 4OZJA 3W62A 1FD2A 2IHR1 1HR0J 2CPXA 1UCNA 1KR4A 4TXSA 1UEKA 1RUSA 5D78A 4DV0J 3N5FA 1KFSA 3DLBA 4GC6A 4FS2A 3IC1A 1FJ7A 3MAAA 3P45B 1VC6A 1N48A 3CCVS 4OI4A 1ZPVA 4OYBA 2RU9A 4WIIA 2DRBA 4A46A 2JEIA 1X4HA 5HJXA 2NZ4A 3PYGA 4Y28C 3FQKA 3NGDA 2KTQA 2C2KB 1A7GE 5SZTA 3ZZPA 4LVOP 1DFDA 3MUTP 2BQUA 4WFXA 4BCAA 2KXHA 2V4RA 1M5PC 1R31A 2BV3A 2HK3A 2DCLA 4GVLA 3D7SB 4JV5J 1VLYA 2Y8YA 4B3SF 4I6AA 1N52B 4USTA 1JLBA 4IO1A 1CSJA 1XMOF 5F0WA 4PG7A 2M9KA 2OPSB 3CSKA 4PUOB 3FRZA 2DXEA 4ED6A 1FNMA 3D3CJ 2AX0A 2GW8A 2CNKB 3H5SA 5A0YA 4TU8A 4B08A 4OYIA 5D4OA 4RNMA 3FUYA 1PYOB 4M5IA 1WI8A 5DG7A 4QR2A 2M3DA 5EWEA 2DXDA 2L41A 5KG7A 4H54A 3G71S 2GX8A 3ITHA 4UT4A 4ZKAA 1N5QA 1L3SA 1HBUA 4RNFA 3KUHA 4M8LA 1T9YA 1DTTB 2RD5C 3PX0A 1UZDA 5DQHA 1VQOS 2Z0GA 4C8MA 1FF2A 4LF7J 4HDGA 5LSRA 2UUCF 3R9LA 2YWWA 2YKOA 4I2PA 2IFXA 2QA4S 2E29A 3H90A 1B7YB 3DLEB 4E2FB 2YKNB 2LU1A 2GVDA 3LWLA 3KJNB 2ZH8A 1Q79A 2J0QD 2O01C 2DNQA 1EX8A 2HBZB 2YNGB 4ZCIA 3OVAA 1TL3B 3NGSA 2BKNA 3M2VB 3EDRB 5CD4A 4QQBA 4ZP9A 2CA9A 2F40A 3EPIA 1AZSA 3WBZA 3IGVA 1RADB 3CF5Q 1N34F 3AOCA 2CPEA 3BPDA 2B7BB 5IWAJ 1T9UA 3Q86A 1KLNA 3AH6A 3PHEA 5ETNA 3ZTOA 1KHWA 1X5SA 3PCOB 1CJKB 1T95A 3OR1A 2W9BA 1FNXH 3G8SA 3DRPA 3JSYA 4A8KA 1W2IA 2U1AA 3C6TB 1S99A 2XYHB 3J80U 3R2DJ 4TQRA 3I0SB 2HGNA 1H2TZ 1RT4A 4FVCA 5HQLA 2MQOA 2HHPA 1VFJA 2CDRB 1IBCB 3M8QA 3HVRA 4AUKA 4DL0C 3SZ2A 3OQ2A 2G2YA 1AUSL 1JIHA 3GYGA 4P7VA 4DUZF 3L3CA 3L9ZA 4XAKA 5HP1B 2HVEA 1S0MA 2BDPA 3ZFVA 1M1GA 2F8EX 1T8EA 4PG5A 2WOMA 1IBKJ 2B51A 3MAHA 1YWXA 5B7WA 1WKJA 1KEKA 4ECYA 2XYGB 4JI0F 5F8GA 1KD1T 3EVMA 4XDCA 4DFJA 1SKRA 3BS9A 3SSQA 1U0HB 4J9NA 4NLGA 3GIKA 2VG5A 4P2XA 4USIA 4DX6A 4LUBA 4ZJOA 1T7PA 3FNNA 2OPQB 1AB8A 4DHVA 1TL7A 4Q0BB 5DM7Q 3AJDA 1JLGB 4ZPWR 2RVJA 1EQMA 1FKPA 4Y3CA 3KK3B 1RTJA 4CO2A 1NM2A 4LF2A 1HIYA 2JNJA 2ZZTA 1GMWD 1CEZA 1H7XA 4EMDA 4CLFA 1K1QA 3CMAS 1R6VA 3FDSA 3RB4A 4AE5A 2CUYA 2AYGA 4DDFA 1FT8A 1YLXA 2BQRA 3FCHA 3U1LA 4ZJLA 2V9KA 1RK8A 1JQGA 2ZC3A 1KNZA 2P8IA 4F3MA 3KHGA 3Q22A 2F4FA 4ZLNA 1RT2B 4MAKA 3MEDA 2RQ4A 3N6NA 4RPFA 1S1XA 4M5DA 1FE0A 2QX0A 4P73A 3HO1A 3V6KA 2ASYA 2BRKA 1JK9B 1SJQA 2BMBA 1EP4B 3I96A 2KM8C 4DCPB 4PXCA 2E1RA 4BWJA 2BANA 1NPPA 4NMLA 2F8HA 3OL8A 3LAMA 4Y6IA 3JSRA 4K4VA 3W8GA 4QIGA 4RW8B 4WFNQ 4PZVA 1UEUA 1FX4A 5KG4A 5K8NA 1IJEB 2OIHA 4UOHA 2QLBB 2HZVA 1IR0A 5E3AA 3M8SA 2UUBJ 4ZMMA 5MAOA 2V94A 1YJVA 5CHCB 1BQNA 2XY6A 4DR7J 1N4LA 3BSNA 3TJAA 2B9YA 2G1HA 1ZH5A 3OLAA 2XS2A 2C42A 1EQ0A 1RAJA 2AV5A 1X4DA 3OFFA 4G1IA 1D1UA 2VFSA 2KHCA 4KH0B 2DH8A 2LQ8A 4DL5A 4YR0A 1O8BA 3W5YA 3RRGA 3G9CA 4TY8A 2D1CA 3L7PA 2WBMA 3E01A 3TJ9A 2PSZA 2WVCA 2Y1JA 4CZCA 4QWCA 3Q8RB 4RNHA 3NCPA 4XK8C 4MIAA 3PYDA 2HFUA 4BLGA 4F67A 4DSJA 3TO8A 4YY3F 2M0GB 3GIMA 3W2VB 2IY5B 4OV6A 3UN2A 2LXFA 1OPZA 2V69A 5FLXU 2PEBA 4OYPA 3FZ2A 4XPCA 2A6OA 2F3JA 1GTHA 2XTJP 3ZO7A 3VGTA 5HBMA 3NWRA 4EK2A 2C2MB 1RA6A 1X7VA 1ZOTA 2DY9A 3PACA 1J2VA 4IQXA 5IT9Y 3QSIA 4HL9A 2WONA 1WOOA 2BBEA 5EGYA 3MFHA 2CAJA 2VBXA 3UR0A 1I51B 4XDDA 4JI8F 2KYZA 3MM9A 5H1SV 1TKTB 1PAUB 4MK7A 3HULA 2OFHX 1SXLA 4IDKB 5C42B 5ITHA 1RWVB 3VF0B 3GG1A 1FWLA 4Y0FA 1JLQA 3MTJA 4NLRA 2DHHA 3QPIA 3LUYA 3UVJA 5KFQA 1OJ4A 5KT3A 4DPYA 5HROA 2YVSA 2VV5A 1M1KT 2B43A 2DD8S 1SJ3P 3MPUB 3IN5A 4DV2F 1RTZA 3CWJA 3OVSA 1HNXF 2HFOA 4URGA 2HIQA 2L9NA 1SKUB 3HK2A 2GVZA 4KO0A 3ZZTA 4KGKA 2GS8A 2OTLS 5KOWA 3WIUA 2PN6A 3HMJG 3S7RA 4RW6A 3DOKA 3ZC4A 3LPEA 4CLZA 1D8ZA 1GMVA 2XLJA 1JB0C 4O3QA 4DV1J 5E2QA 5GADU 5LT5A 3W8PA 1RBLA 1S1VB 3DU6A 3QMQA 1UW9A 1APSA 3MPDA 1QSSA 1NHKL 1K44A 3VAMA 1ELOA 3E8OA 2ZITA 5DDOC 2JFKA 3MMAB 1X4AA 4I69A 3D0IE 2BKPA 4IUFA 5CZVA 2IJRA 1WDDA 1IKWB 2NPFA 1X5PA 4LBIA 1FERA 2VG7B 1M5HA 2F1FA 3CE8A 3T1HJ 1G7CB 3IRXA 2DBBA 2MKKA 2B6AB 4GKJF 1NO8A 2B5JB 3IRWP 1I94F 5ETPA 3HHLC 4LF4J 4HT7A 1Q53A 3GQCA 3NRBA 4JBCA 1WF2A 2KRBA 3KLVA 5FDLA 1B4SA 1R8HA 2IVYA 4B3RF 2H5IB 2M88A 3W64A 1MU2A 4PYDA 1SPBP 1T03B 5D15A 3UD5A 1LV5A 4OZ3A 4WP9A 3PEHA 3M7VA 5DLGA 2GFFA 4J5OA 4ZLJA 5HSPA 2ZBCA 5CZXA 3S8SA 3A8IA 2HFNA 3NS5A 3D2WA 1PYTA 1HPZB 2AEJA 1M1HA 1U1RA 3GCXP 2YX1A 5DDQC 2BOPA 2DR7A 3E2EA 1BC6A 3T6JA 4LFBF 3TUPA 3JSBA 4BS2A 2LYVA 1FCAA 1T11A 4I67A 3NGRA 3JQJA 1UFWA 3W1YC 2QJ3A 2NXCA 1C1BB 3FEZA 1S0VA 3IP0A 4OZ5A 1WTFA 2G2OA 1NZAA 8RUCA 2HS4A 4MTPA 1FDAA 3PX4A 2RHSB 4ILMA 3U27A 2HZCA 2XSJA 2PIIA 4WU2A 4DN0A 3C6UB 1QY7A 3H98A 3UE2A 2HHVA 3Q2SC 1S72S 2D3ZA 5EN1A 2K7JA 3GR0A 4X4PA 2OI2A 4JV1A 1F1BB 4WK1A 2QA2A 3BR8A 3O5TB 4ECRA 2JX2A 4WXWA 1XK8A 4NXNJ 2WSEC 2WB1D 1EETB 4QBUA 4MKAA 1UTAA 3FRYA 1IBLF 2V4JB 4H4OA 4AFFA 5LXRA 3NGTA 4NCGB 2ZOGA 1IJFB 5AE1A 2ZE2B 1C4AA 2KFNA 4KGXB 1OQ3A 2R2RA 3TARA 3AAWB 3NKYA 1WUUA 1BWVA 3NLCA 4HLBA 3I0RA 1ZS6A 3BKFA 2Y3YA 1EHWA 5KOXA 2V2QA 4PYAA 1H72C 3BGRA 1N54B 2FVSA 1RT6B 3PVXA 1R0BG 2DNYA 1RAEB 2OO4A 2EEYA 3SCJE 2IRYA 4C97A 2IYGA 2VQFJ 4C9DA 2XMAA 4RL1A 3VWSA 1S12A 3DXBA 4WTOB 3KLGB 1FWPA 1LWCB 5J2QB 5F3ZA 4FN5A 2Z56B 2J8SA 2E1PA 3VQTA 3M6XA 2J7KA 4ATNA 1NK5A 3MXHP 2XO7A 4ZVQB 2R2SA 4I2QB 3POTA 2OKQA 2YKAA 4UZBA 4RR5A 2CFXA 4ZVGA 4NYOA 2ADCA 1I1GA 4KC5A 1KDNA 1FKAF 5GAHU 4PKDB 4C48A 3PRDA 4OJHA 4U7UK 4IYQA 3GPAA 2B9WA 3MI7X 4DV4F 4UQGA 4Q8EA 4CM2A 2PA8D 1U2RA 1XMQJ 3CUNA 3M32B 2LQBA 4CH0S 3L7OA 1K0TA 2EW9A 2PI5A 2HNZA 3K5LA 3NNAA 1C0TA 2K2PA 3KLEB 3J81Y 2RUSA 4A8WA 1X9WA 4C3KA 4ITSA 3QZ8A 5J1EA 1Q16B 2R7SA 3W9JA 2HVIA 3UR3C 4FZVA 3MEGA 2CDQA 2KM8B 1DQ8A 2H4WB 1TK5A 3W9HA 1X9MA 4PG4A 1TVRB 2B4PA 4OYWA 1S7IA 2OPPA 3TWZA 5AXNA 4ES2A 4G6VB 4NI2A 1NMEB 3V81A 2BXJA 2RU3A 3RBZA 4O44A 2JSXA 3CCZA 2BW7A 1FWKA 2DR6A 2DIVA 2FUG9 2BX6A 5KFMA 2VJUA 1KVKA 4FXDA 2DKOB 4ZPVR 3LP2A 3QAEA 4ZVFA 3QIPB 2QLWA 1HI0P 4DQIA 2R7UA 4WYWA 1F2HA 2A3JA 1UVMA 1XWLA 4F02A 1SIWB 1MN9A 5T7LA 2E5IA 2RAQA 1FEEA 3DYAB 1URRA 4ZOSA 2O3DA 4K2JA 2CQ3A 2R7XA 2LEAA 4DV5F 2WZ1A 4KV8B 3J7YU 3MUMP 1JLFB 3H42A 2HPUA 3NWGA 4WZMA 1IBMF 3ET6A 3LANA 4XIUA 3MAAB 1WHWA 3ZTRA 2LQ9A 2X1FA 4USJC 2F9JA 1BQMB 3BGOP 3KG4A 4F4YA 4C8ZA 1YBAA 3RGIA 1R8BA 3DHXA 2D69A 1XNRF 3BQ1A 1CULA 1RYSA 3W5XA 1HFEL 4HYKA 4EBEA 1T02A 3NXZA 1B99A 2XI2A 4KRWA 2LCWA 5BYQA 3DRYA 5FIIA 1JLBB 4ZITA 1NDCA 3P5TL 1UFKA 2DRAA 2AJ0A 2OEKA 3H0PA 3PXGa 3T1YF 3FBEA 4ZP6A 3CCUS 5A0YB 2GAHC 2IPOB 3BKUA 4PCQA 3GTYX 1XBWA 4U9RA 2LKZA 1WG5A 2IYIA 1DAXA 1Q4RA 4LFAF 2FJVA 3H2UB 4NRUA 2WVDA 1S6UA 3ITHB 5F9LA 2VA2A 3DNCA 5FJ4A 2CNOB 2V6AA 3CO0P 3GB0A 3ULHA 4EFAC 1CS4A 2XQCA 3ZZYA 1L5UA 2UV8A 2VPXB 1XJWB 3S1TA 4ES1A 1ZAWA 2O1PA 2J76E 3TA1A 4I2PB 1SH0A 1KS2A 1Q81T 2G4BA 4DV3J 4MKBA 1RWMB 2IAJA 3MTKA 2GVDB 2DHGA 2K7KA 2F9DA 4DLEA 1WC5A 3OTDA 2WAQD 4LSLB 1T9WA 1VRQC 1VK3A 4QYZJ 1S79A 1UVKA 3VVUA 4JI2J 4H4KC 2BACA 3V4MA 4IG3A 5HAOA 4K8RA 3I87A 2D7SA 1AZSB 1BHNA 2D9PA 3O44A 3GILA 1VJWA 5IS2A 3HKWA 3BQ0A 2KXNB 5D4NA 1GEHA 4Q5VA 3D9BA 3MM7A 3UI3A 1YJTA 3QRPA 3OR1B 2W9BB 3CJ0A 3DRPB 1DHMA 2YPYA 1XC9A 1WHYA 2XYPB 1ZTTA 3OL7A 4FXVA 3FQLA 1RT4B 4JI5J 2NYIA 4ZVOB 3ILIA 4OI6A 2C2RA 5LL6d 3M8QB 2GC8A 2C3UA 2NUUG 3J7A1 1V3SA 4YHHJ 3CJRA 4JUZA 2J9DA 4CH7A 1KOHA 4CT9A 2POKA 4KPYA 1P1LA 2HFVA 4A8SA 2HRYA 2W7AA 2ZNZA 1D9AA 1VBXA 2ZOMA 7FDRA 3V6HA 2YKMA 4X65F 4A4JA 2WOMB 1VIOA 4DR6F 3GFYA 2OSQA 4BHQA 2ABYA 4OYAA 2I38A 3D1OA 4A8XA 2E66A 3NCQA 4URQU 3RU0A 2H51B 3M8WA 4F4ZA 2YNIA 1GNKA 4GRSA 1HWJA 2J9EA 1V9OA 2U2FA 2VG5B 3B54A 4ZVRB 2VD3A 4N8NA 4LRBA 4J90A 1TL7B 5I42A 4A8QA 2B8QA 1HI8A 1QE1A 2WK4A 2DIUA 4QIVA 2YQ3A 2DNGA 3EZOA 2XG8A 5KFLA 2XZWA 1FKPB 4M5NA 4OLOA 5KFRA 4LIWA 1XNQF 3MCOA 1RTJB 4I4BA 4CIOA 1VS3A 1SI9A 1IKVA 3BH7B 4F50A 2NLWA 2EBGA 4X66F 4X4SA 4DX7A 1FRLA 2P6SA 5E5NA 3SCLE 1U2FA 1BWEA 2VPWB 2VG6A 2AKWB 3R5AA 5JUMA 2J9CA 1RKIA 4OMFG 2HMIA 1K0VA 1Y11A 2NSCA 4LQ3A 1SIZA 3C16A 1NB2A 2ZBRA 1U6BA 1YDLA 3MOZA 1JLAB 3MEDB 3MAQA 3JB9k 3H2LA 1S1XB 4M5DB 2FJWA 1RABB 3CCRS 4F36A 4J9SA 3UD3P 4M5KA 3HT3A 2DITA 1ULRA 4PAAA 3D4JA 2BANB 4MIBA 4YMEA 4DF4A 2LEPA 3BF4A 3Q83A 3VAKA 3MD1A 1HBMA 1HI1A 1GXTA 1RU2A 4B02A 2Z2ZA 2MSTA 3ICLA 3CDEA 2ATCB 2DCUB 1RWOB 4AT1B 2IVFB 2D3O1 2J0WA 3FC9A 1TV6A 2HHHJ 1CC8A 1NKBA 3GYNA 4F0HA 1BQNB 2LDYA 3IR7B 3WC0A 4O4RA 3DOLA 1A9NB 1VQKS 3VGUA 3IFEA 3MPYA 5F8HA 3G8QA 2LA4A 2QC3A 1VQ4S 1XTZA 1HR0F 2OFGX 3DCAA 2L9WA 2XC9A 5D0HA 2J6TA 4A47A 4DUYF 2PGCA 4R0EA 1RJJA 4RUBA 4V19J 4TY8B 4KJIA 2PD1A 2M8DB 3E01B 5KG6A 2HBYB 5AJ3F 1REVA 2ZM6J 1X5OA 2HZAA 1JX4A 2UVVA 2KB2A 1EB0A 2BYCA 3G4SS 2QN6B 2MZQA 2YQ0A 2B0GA 4NLQA 3SBMA 2VFRA 1P27B 2J0XA 2JLGA 3R5DA 2ACMA 4B3MF 2R8HA 3M2UA 4MK8A 4TVAB 1FKOA 4JV5F 2XS5A 4L74A 4NE9C 1Y00A 4PG6A 2DISA 4ZPDA 2YKNA 4DEZA 2HLUA 3UN5A 3PW5A 4K0KJ 4P2MA 3ADAC 1YTYA 2Y8WA 5HBMB 1UVJA 2EK6A 1S0OA 2IA0A 1WC0A 2WONB 1N32J 1QUVA 4X62J 1YJRA 2IRXA 3SSSA 3BN4A 2UXBJ 2WRMA 3MM9B 1Q7LB 2VKRA 2BA9A 1ZM9A 5IC4B 4DL7A 4MYUA 3I5AA 3EMTA 4F2RA 3HT0A 1QJHA 2ALYB 4PR6A 3WHIA 2KO1A 2N7CA 4DU7A 3KG0A 3FKBA 1KSPA 3LA0A 1TP7A 1LWEB 2L9DA 3IXQA 3QNWB 3UVJB 1FE4A 4ECUA 4IRDA 3SCKE 4ZIVA 2YBVA 5HROB 1Q1KA 1KQGB 3OJSA 4O4GB 3F0NA 3HDSA 2OSRA 1HD1A 1NPKA 5DDPC 1R7IA 4KTQA 3OHBA 2UXCJ 4DSKA 2GVZB 4KO0B 1PIEA 3GFHA 1JJ2R 4RW6B 3DOKB 2RNEA 2G2ZA 1NLKL 4FYXB 1KBRA 4J9RA 3BKTA 4PQUA 4F4KA 4M5HA 1UKUA 1FJCA 3R2CJ 3DXSX 3R5BA 1HNZJ 3C8YA 4QYZK 4EUVA 1UVLA 5K8PA 4E8UA 3V4IA 2H1YA 3AOBA 4JI6J 5A76A 2XCPA 1FDNA 5KG5A 5DG9A 3NMRA 5IWAF 1YRUA 4A8OA 4V1Ak 1YKWA 1L3TA 2IDLA 1DQAA 1S76D 4Q0BA 3IRXB 2AIRB 1NSKL 2B56A 1MMDA 5KFWA 1JLGA 2R4FA 3HD2A 1O0PA 3N79A 3JAMU 1CJUA 1A0OB 1LW2A 1VBYA 2Q66A 1K8AT
chains in the Genus database with same CATH topology
5FDLB 4G1PA 2AX1A 2E5GA 1YRTA 2B51A 3LO3A 1VHFA 3MAHA 2HNYA 3MECA 4LIRA 3N01A 5L1LA 3TI0A 1YWXA 5B7WA 1MU2B 1RA7A 4AL6A 3SQGB 4DN9A 5DJBA 2CPDA 1KEKA 4HH0A 4G1QB 4JI0F 4ECYA 4TQSA 4MJKA 4ZP7A 1H3DA 4DOZA 4R5PA 2G1DA 5CYQA 2LU2A 5F8GA 3FSIA 2BQ3A 2YNHA 2ROEA 3BSOA 2L3MA 1ZTWA 1KD1T 1JKHA 3EXCX 4XDCA 1AUDA 2B7CB 3UDCA 5BJRA 3DMJB 4DFJA 1SKRA 2MQPA 3BS9A 1HHTP 1UWBB 3SSQA 5KFCA 3HLUA 4J9NA 4KHMA 3GIKA 4ED0A 1IBKF 3B4DA 1MWZA 4NLGA 2VG5A 1KC8T 4QYRA 2CJBA 1OPIA 4USIA 2L08A 1QUPA 4LUBA 3GSDA 1CQMA 5KTQA 1T7PA 2XGQA 1S4FA 3FNNA 2OPQB 5B0DA 1HHSA 4FYDA 1SH3A 1DQ9A 1HBOA 4DHVA 4Q0BB 1QM9A 4Q2LA 1MWYA 3MD3A 5DM7Q 3IR6B 3QLHA 4QW9A 5CCLA 2XBPA 2IM1A 4UQTA 4ZHRA 1OQ6A 1TAUA 1FK9A 1IUJA 3KYLA 3QWUA 1JLGB 1NK6A 3NAIA 4P2SA 4ZPWR 2CQHA 1N36F 3PKYA 1Y4ZB 3QIDA 1FJEB 2RVJA 1HYSA 2AU0A 5KG3A 5AXKA 4WE1A 1N5SA 1FKPA 2HGLA 1LXJA 4QJVA 2DGWA 5KT6A 1HQUA 4Y3CA 1X4FA 3FJ2A 4J9PA 3KK3B 3AHPA 3JYTA 2CQPA 3D5MA 2EFOA 1J5OA 1Q86T 4C7QA 4DL2A 5A2QY 3I9V9 3OV7A 1RTJA 2IJFA 4CO2A 3GIJA 4I56A 4FBUA 3D1HA 3HJFA 4PWDA 5L1KA 4MFBB 3ISZA 3M1VB 3I4HX 1CEZA 4C8LA 1KVIA 4J9KA 4C3MA 1H7XA 3L95X 3HM9A 2DTJA 1K1QA 3K5NA 1TKZB 1VQYA 2QSWA 3CMAS 3FDSA 4QIEA 3G6ES 3ISND 2MXYA 4OZNA 5GADI 3RB4A 3NG8A 2JL9A 4NXNF 4AE5A 1S9GA 2JEJA 4RUAA 1UEVA 5KFNA 4FF3A 1JKHB 3MMBA 4CNYA 2IC3A 4N5SA 5KAKA 1PGZA 1K73T 5KFVA 1IQTA 2AYGA 4DDFA 2WW8A 1FT8A 1VQSA 2D74B 2ZH2A 1NK4A 2OAUA 2BQRA 3QO9A 1UFLA 3FCHA 3U1LA 5EX3A 2PMZD 2V9KA 1RT5B 1FRIA 4LSNB 2XSJB 2AJ1A 5IM0A 3OTCA 2HQIA 4RW9A 4IRKA 5M2UA 1RK8A 1OSCA 2AP6A 1QAJA 2ZC3A 2HHXA 3BM7A 3N4WA 2KKHA 3MR2A 1KNZA 2GMJA 1N0UA 2AW0A 2JC0A 2J9DE 4F3MA 3KHGA 3Q22A 3HZEA 5SUHA 3H4DA 4RLEA 4N76A 4M1KA 1RT2B 2JHEA 3BZQA 2RMLA 4MAKA 5A8WB 4K4SA 2GNKA 3MEDA 4EEYA 2RQ4A 3N6NA 3MURP 3ZZOA 1ZAXA 1WACA 1YITS 1S1XA 4M5DA 2LEBA 1S6OA 1FE0A 1RTDA 3SFGA 3HO1A 2JFDA 3CXCR 4O3NA 4DBQA 3V6KA 2ASYA 2FLPA 2BRKA 1MW7A 2ZDPA 1X0PA 3IWXA 1JK9B 4HTIA 3TRGA 1SJQA 3SEOA 3CC4S 1EP4B 4QWBA 3PW2A 3I96A 2X1AA 1MROB 2ZH9A 2KM8C 4PXCA 3GFZA 3FZBA 2E1RA 3EPGA 5GAEI 3BN7A 3KFWX 4H4OB 4DLGA 4BWJA 2WTFA 2BANA 3KLIA 3N0VA 2RRNA 2I5JB 4O0IA 3CO9A 3PEJA 4NMLA 4J9MA 1KQSR 4A48A 2F8HA 4DQPA 2ILZA 3OL8A 3LAMA 4Y6IA 2UU9F 4U67Q 2W9AA 2XEXA 3IR5B 2ZOFA 4DG1A 3JSRA 1BQXA 4K4VA 2OP5A 2M4MA 3AQOA 2VASA 2VB6A 1U1QA 3SCIE 4OI1A 1KONA 4QIGA 4RW8B 2CPFA 2RIJA 2VBYA 3UCUP 3JSMA 4BBYA 1JJHA 3MMBB 4WFNQ 3RBDA 2Z8QA 3T6BA 1UEUA 2I0XA 2VC1A 1RI7A 3H8YA 4ECSA 3I0RB 1UA0A 1U24A 1WG1A 5LSOA 5KG4A 2RJZA 4URSA 1RTHA 1LK7A 2CVIA 5K8NA 1IJEB 3UCZP 2OIHA 2MDAA 1S10A 5E3PA 5F9NA 4C0HA 3NGKA 1IR0A 4CTAA 1HNIB 2AYMA 4ID5A 2QA4G 5D77A 1GQEA 5E3AA 2LXUA 3M8SA 4ZMMA 4B3TF 4FP9A 2QMXA 4RUHA 5MAOA 2V94A 3MDFA 1YJVA 1ZAVA 4KBIA 5CHCB 1K9MT 1BQNA 3P96A 3M6UA 2X1GA 2XY6A 2ASDA 5JVGQ 4KGMA 4LT6A 4X4UA 2JEGA 1QLNA 2FVPA 1HWKA 1N4LA 1E6VA 3C2PA 3BSNA 2GHWA 2B9YA 1ZH5A 4JYAF 3OLAA 2XS2A 1NK8A 3DLGB 2C42A 3P49B 1UJ5A 1RAJA 3IBWA 3Q23A 2AV5A 1X4DA 2XI3A 3OFFA 3CPWR 4ED1A 4LF5F 3BREA 4G1IA 3HVWA 5HN0A 3BJYA 3PX6A 2MGZB 2UUBF 1D1UA 2GV1A 2MQQA 4ETXA 4WFAQ 1NRKA 2DB1A 1NB7A 2VFSA 1F5CA 2RSQA 1HBNB 2KHCA 2R9LA 4MMOA 1OSDA 4YFUA 1M90T 5GMKa 1SB6A 4HI2A 2DH8A 4P6QA 4DL5A 3DOMA 4YR0A 4BC9A 5HL7Q 2XHWA 4QWAA 1O8BA 5KG2A 3KLHB 1VQLS 2BW2A 3ETOA 5L38A 3RRGA 3R27A 2BRLA 1NKEA 3G9CA 4TY8A 3RW6A 2CQBA 1U4BA 2D1CA 2VUGA 3CCMS 2CQ4A 3L7PA 2WBMA 2MZJA 2DHAA 3E01A 2PSZA 3POTB 5G0RB 1M5VC 4DR4F 3RB0A 2Y1JA 1VI7A 3C3LA 1GXLA 1U1OA 5CYMB 2DR8A 3MR5A 4CZCA 1JLEA 1IKXA 2JDJA 3PV8A 1VBZA 4QWCA 2CIMA 2P9EA 5B0AA 4XPEA 2BJEA 3MHYA 1YG0A 2NXUA 3Q8RB 2M52A 2VOPA 4RNHA 3U1NA 2OPSA 3K0JA 5L1IA 2IBKA 3NCPA 4XK8C 4HDHA 3O6QA 4PUOA 3LP0B 4QWEA 2JZ5A 4WKYA 4MIAA 1CC7A 4K4TA 4OQJA 3RTVA 3H40A 3KTQA 5L9XA 5GAGU 4ZP8A 4V19X 4F67A 2QEXS 4DSJA 3TO8A 4YY3F 4NOHA 2M0GB 3GIMA 1Z1ZA 3W2VB 3K7RA 2FGCA 2CVEA 4FF2A 1VQ9S 2LXFA 2VKZG 1OPZA 3MEKA 1VGYA 3WC2A 4A8MP 2VQEF 1S6PA 1WWHA 1U7LA 2DGUA 3FZ2A 3GZ7A 4P7TA 4XPCA 1FTRA 2HNZB 4C8OA 1FXLA 2F3JA 2FC9A 1C0TB 3ENWA 2R2TA 2FVCA 1GTHA 2D3UA 2HLTA 4PXDA 1FESA 5EUHA 5J2PB 2C22A 2KU7A 4EWTA 2QV6A 3CCES 5J1EB 1AFIA 3MF5A 4TKTA 1N8RT 1TL1A 3VAGA 4NXMF 3PJWA 2Q43A 2QYCA 4YQWA 2ZH4A 3I82A 1G3OA 5HBMA 2A18A 2QO3A 3MEGB 2GQ2A 4CNZA 1RA6A 4W92B 2FJBB 2W4PA 5CQGA 1X7VA 1YJWS 5KFIA 3HXMA 1WG4A 3MMCB 4DV6F 1ZOTA 3PACA 4OX8A 3PDNA 1J2VA 1Y5LB 5L39A 1H38A 4IQXA 5IT9Y 3H5YA 1RISA 2XMWA 4HL9A 2WONA 3UNGC 4NCBA 4IR1A 4C8YA 2BBEA 2KXFA 3CTRA 4EBCA 2O67A 1HL6A 1D9FA 2JVOA 2DHXA 1IKYA 1H2UX 2RQMA 1DTTA 3BGFA 3OFEA 5EGYA 3MFHA 3T1AA 2IA6A 2E9ZA 3DI6A 2CQ0A 2VBXA 2OPPB 1S1WA 1S7HA 4W90B 3UR0A 2FY1A 4NZ7A 3N6MA 4XDDA 3VAFA 1AFJA 4JI8F 2E1AA 2KYZA 2GJIA 3MM9A 4R0JA 5H1SV 2OTJS 4QU7A 1TKTB 1PSDA 4MK7A 3THTA 4AXIA 3DDNA 2OFHX 2ZHAA 2ZH3A 1SXLA 2DNMA 2LA6A 5H9FJ 3LGMA 3KK2B 2VZ9A 4EZ6A 3V81B 4IDKB 3X3UA 1FXRA 1HWLA 5K14B 5K9FA 5B0EA 2HQ3A 4NLOA 5C42B 4MYTA 2YWKA 5ITHA 4G3IA 1SL0A 4O44B 3CCQS 3VF0B 3HHDA 4PXBA 3DLEA 4MH8A 3DRSB 4C11B 2FJAB 4IFYB 3GG1A 4ZVHA 4Y0FA 1S9EB 3DLKA 2DGSA 1E6YA 4OHYA 1JLQA 3MTJA 4NLRA 4DPOA 5B0BA 3K5MA 1FHTA 4I1TA 4J9OA 1HARA 3QPIA 3LUYA 5LMUF 4NWBA 5KFQA 1G1XA 1QAYA 5KFAA 4WFBQ 5KT3A 3LP2B 1GX6A 2OMLA 5JVHQ 3VALA 2DNNA 3OLBA 2UP1A 5HROA 4OHVA 3TVKA 2YVSA 2VV5A 2HGMA 4PXEA 1M1KT 4ZCLA 1Y7PA 4QZVB 2KHDA 4X4TA 5D3GA 2EWHA 2B43A 2DD8S 1ZZFA 4C98A 3J7Z5 1SJ3P 4USHA 2VC0A 2YNGA 3IN5A 4DV2F 4JI7F 1FRJA 3TANA 3CWJA 5T41A 1TL3A 3OVSA 1HNXF 3B82A 2HFOA 3M2VA 5T7LB 4URGA 4OV1A 3GV7B 2HIQA 4IO9Q 2J7WA 3TOQA 1X9SA 5JXSA 3AB4B 2L9NA 2DPIA 1T3OA 3HK2A 2N3LA 1H6KX 2GHVC 2ZC4A 3LW5C 2MZSA 4ELUA 4KO0A 3ZZTA 3PO4A 4KGKA 2OTLS 1Z2ZA 5KOWA 2PN6A 3HMJG 1HW8A 2LLZA 3S7RA 4RW6A 3U1MA 3DOKA 4NLPA 3ZC4A 3QGPA 1D8ZA 2XLJA 1JB0C 4O3QA 1RQ0A 2CPYA 2GIQA 2ROGA 2A1BA 2G13A 2Z4PA 5E2QA 3RR7A 1TL5A 3K8WA 5GADU 1V3RA 5LT5A 1B7FA 5BR8F 1S1VB 3NS6A 3T19A 2XNQA 3L09A 1CQNA 3DU6A 3QMQA 3VZHA 2ZHBA 1APSA 3SSRA 1QSSA 3D1QA 3HHKA 3VAMA 3DLJA 1V6HA 2BUNA 1ELOA 2BABA 2VPYB 4BWMA 3Q8PB 1T05B 3E8OA 2KDOA 2XMKA 1F5AA 2ZITA 4N77A 3C6TA 5DDOC 4GC7A 2GMHA 2YH0A 2QZ8A 1JLQB 3CCWA 1T03A 2JFKA 2P9CA 3MMAB 3I0SA 1X4AA 4I69A 3D0IE 3H5XA 1S1UB 4C0OC 1VRUA 2PE8A 3GV5B 2MY7A 3CJ4A 4IUFA 5CZVA 2EFVA 4NLSA 1ZYQA 5CXTA 1IKWB 1ZM2A 5A6WA 2NPFA 2N7YA 4N8OA 1X5PA 4QU6A 3CMES 5I3QA 4N56A 1FERA 2VA3A 2VG7B 1M5HA 2HNDA 3HVTB 1N6QB 3MM6B 2F1FA 2OD6A 3HZGA 1LWFB 1LK5A 3OUYA 3H25A 4KKOA 3OR2B 3CE8A 3G96A 3SXLA 2ZH5A 1G7CB 2KT2A 3IRXA 5F8LA 3KHLA 2CQ1A 5J2MB 2DBBA 4ED5A 3FSXA 2IBOA 2FIUA 4ECTA 2AWZA 3FFIB 4I7FA 1RT7A 2RDIA 5GAEU 1F5BA 2MKKA 1QSYA 1VQMS 4X4QA 4LFCF 2B6AB 1RGVA 4WFZA 5HP1A 3MGJA 3EGZA 1LFPA 4X4VA 1OIAA 3PNIA 4GKJF 5A8RA 1NO8A 1DLOA 2B5JB 2KZZA 1DTQB 3IRWP 4HKQA 5A8KA 1HQEA 1OS5A 2M70A 1ZBTA 1I94F 2MQNA 3NP5A 1FNOA 4IG0A 1WEZA 3HHLC 4ZPAA 5J1NA 4NLDA 2HS3A 3HF5A 1G6BA 1WEYA 4HT7A 1Q53A 1N5YA 2RT3A 5KFFA 3GQCA 3NRBA 4JBCA 2B9XA 1WF2A 2LDIA 2KRBA 3KLVA 5FDLA 1T94A 1R8HA 1FDBA 2IVYA 4B3RF 1C1BA 2RRAA 2M88A 3M9NB 2X1BA 2AYBA 4WF9Q 2DO0A 2SXLA 2CZ4A 1FVQA 2KJWA 3PW0A 1MU2A 3SQGA 5THWA 1NK7A 4G1QA 4CCHA 3BSCA 3K58A 1C0UB 1T03B 2DNHA 1XR6A 1LV5A 3BGUA 3PEHA 1W25A 2W7OA 2V8DA 3CDWA 3KJVB 3H2VE 3TAQA 3SDEB 4LF4F 3DMJA 1FA0A 5I4MA 5DLGA 4YB1P 4JI3F 2GFFA 2HW3A 1UWBA 5D4LA 4GO7X 3BEGB 4J5OA 1GTEA 4ELVA 4FNIA 3GG0A 4RU9A 3I55S 2ZBCA 1URNA 4X4NA 2JEFA 5CZXA 1CLFA 1YSJA 3S8SA 3NS5A 2HFNA 2Q1LA 5MLCV 5DS7A 2OPQA 2PFFB 3D2WA 2A2CA 3UCGA 1HPZB 2JLFA 5F8JA 1U1RA 4KHRA 3UFCX 3FVYA 4RW7B 4NZ6A 1WEXA 2CYYA 3CDAA 2YX1A 2E5HA 5DDQC 2BOPA 1LXNA 2DR7A 1R27B 3E2EA 1BC6A 3H5UA 3R1LA 1QVFR 2RS2A 2X51A 3T6JA 3G86A 1C2PA 4DL3A 4LFBF 4DS5A 4CO0A 5KFSA 2UUWA 3JSBA 1NEEA 1KQFB 4PQAA 4BS2A 4AQYF 2EFNA 2LYVA 4WK3A 1FCAA 1FRXA 4I67A 4ZCKA 4D3GA 3RR8A 2BE2B 3KK3A 2MYFA 3PJXA 4DV3F 1NU4A 1UFWA 4OX9F 4DF8A 3B78A 1S1TB 3D54A 3LH2S 3IG1B 4OHXA 2YH1A 3TA0A 4YUDA 5HMWA 1C1BB 1Q8LA 3FEZA 4MFBA 2RE1A 2O5DA 4Y2MA 1MMLA 3FMWA 3M1VA 4OJGA 4IH6A 1VQPS 1S0VA 2EFGA 2E5JA 1VC5A 2HHQA 4Z37A 3US5A 1XEZA 4OZ5A 1WTFA 3K59A