5ETTA

S. aureus 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase complexed with ampcpp and inhibitor at 1.55 angstrom resolution
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
157
structure length
157
Chain Sequence
MIQAYLGLGSNIGDRESQLNDAIKILNEYDGISVSNISPIYETAPVGYTEQPNFLNLCVEIQTTLTVLQLLECCLKTEECLHRIRKERWGPRTLDVDILLYGEEMIDLPKLSVPHPRMNERAFVLIPLNDIAANVVEPRSKLKVKDLVFVDDSVKRY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosph
publication title Structural Basis for the Selective Binding of Inhibitors to 6-Hydroxymethyl-7,8-dihydropterin Pyrophosphokinase from Staphylococcus aureus and Escherichia coli.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 43
structure length 157
sequence length 157
chains with identical sequence B
ec nomenclature ec 2.7.6.3: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.
pdb deposition date 2015-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01288 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 5ettA00
3HSGA 3KUEA 3ILIA 4M5HA 1TMJA 2BMBA 4CYUA 4PZVA 1HQ2A 1RU2A 3HD2A 1EX8A 3KUHA 2F65A 3HSDA 3HCXA 5ETKA 1Q0NA 1CBKA 1IM6A 5ETMA 1RTZA 3ILOA 4CRJA 1EQ0A 1F9HA 3HD1A 4M5JA 4AD6A 1RU1A 3ILJA 5ETTA 4CYUB 4M5NA 5ETOA 1G4CA 1TMMA 3MCOA 4M5GA 2F63A 4M5IA 2QX0A 3ILLA 3MCMA 4M5KA 3IP0A 5ETSA 5ETRA 3MCNA 3HSZA 3QBCA 4M5LA 5ETLA 5ETNA 4F7VA 5ETPA 1RAOA 5ETQA 2CG8A 1HKAA 3UDEA 1EQMA 3UD5A 4M5MA 5ETVA 4CWBA 1RB0A 3HSJA 3HT0A 3UDVA 3KUGA 1KBRA 1DY3A
chains in the Genus database with same CATH superfamily
3TNVA 1T9TA 4C8YA 2GFFA 1Q0NA 5CZXA 3EUNA 3UCGA 1XNRJ 1Q7LB 2BE2B 1Q16B 2RQKA 4DFPA 1R0AB 2JRSA 5LSRA 2ASJA 5KFMA 3FQLA 2BUNA 3DI6B 3NWRA 4ED3A 1K73T 4AL7A 3TA2A 1VHIA 4U96A 3NGTA 1RAAB 2AIRB 2RSQA 1LQ9A 2AGPA 4LF2A 1HHTP 3PW2A 3DLKA 1YRTA 4USHA 4CCHA 4OI0A 5J1NA 1U7LA 2MLXA 2XLJA 3NWGA 4I68A 5FJ4A 2FHOB 3VCDA 2ZH5A 5IFMA 2RMLA 2EVZA 3BKTA 2FZCB 1PYSB 2H9ZA 1XMOJ 4I64A 4XK8C 1N33F 5DDPC 1F6TA 1SKSA 5ETRA 4J9UE 4F7VA 3GZ7A 3AJ2A 2JNJA 2HSEB 3H98A 3CF5Q 2J7UA 1RP5A 2YKQA 1U1QA 4RX6A 2PO4A 3FEXB 1OQ3A 2F4FA 1S1TA 3JYTB 3I87A 3S01A 1EKSA 2WW4A 3OFGA 3B8HA 2NXJA 4QOTA 2CNLB 1MMLA 2R7WA 3GV5B 4NLTA 3PYEA 1FERA 2R7QA 1IXKA 2DGOA 2I5JB 3BN7A 1B70B 4ZHRB 1RTHA 4S0MA 2PMHA 5D15A 4NXNJ 1HQUB 1NSAA 5KFEA 1HNWF 1QVFR 3KMSA 4IR9A 4N47A 2DXDA 2L9WA 2ZD1B 1XQIA 2D3O1 1X5OA 4KGZB 3DRXA 4DCOB 4H4MA 3HSDA 1C4CA 5KFAA 1RWNB 1YQHA 2OFGX 1VQSA 1TV6A 4TQSA 1BLUA 4X4UA 2IC3B 2WVCA 3CJ0A 3CCSS 3OTEA 2XMVA 2LDIA 3R7SB 2OSRA 4O4GA 4KJIA 3UNYA 3P6YC 3ZZ0A 2F1FA 4CYUB 4CO4A 2B6AB 1S97A 3C66A 4LRDA 4R5PB 2CQGA 4YP3A 2BOPA 4RJVA 1RT3A 3GIIA 1CJVB 1UTAA 5K8MA 3O8WA 5KFSA 3CMES 2BQ3A 1IWAA 1RAJA 2B5JB 2CPDA 4GKJJ 3GG0A 4DL5A 4JI0F 2JLFA 4QJVA 1F3VA 1UFWA 3OXLA 2VDHA 1Q82T 1G6BA 3BV8A 5J1EB 2ZUGA 3O2IA 2BV3A 2DNHA 2BA9A 1X4HA 2R7RA 2Q66A 2CQIA 1HARA 2B4UA 3OJUA 2A2DA 5LSOA 1RWPB 4QR0A 1GAOA 3GG1A 3GONA 5G4DA 4CH7A 5DG9A 3R6LB 3R3TA 2HW3A 1DURA 1W26A 1QSLA 4FVMA 1UJ6A 4C8MA 1RKIA 4X4SA 4CLZA 1KQGB 4MAKA 3GYXB 1LNQA 3TYTA 2DNQA 3MFHA 2I9SA 4DR7F 2V8VA 4DUZF 3C6UB 2VPWB 2HQDA 2J0WA 1U1LA 3UN2A 2FHKA 2IY5B 4B3MF 1RTJB 4X65J 1EKRA 2ZEJA 4ICLA 3EE3A 1B4SA 1IJFB 1KVKA 5KFZA 4F50A 4BWMA 2F9JA 1SQGA 4DPYA 1C0UA 4DSFA 1MROA 2RUGA 2B7BB 3EZ5A 2JLEA 4C4WA 3AFGA 1S0VA 4OLPA 3VAHA 4B08A 3ETOA 3M30B 2HHUA 3GV8B 2YNIA 4U8YA 1RAOA 4V19X 2HZCA 1I94J 3TW0A 3R5AA 1KHVA 5KFIA 3V2UC 3D1HA 1FEEA 3NP5A 1FRIA 3UO0A 4DR4F 1M5KC 2QO3A 4ED7A 3PR4A 4ECTA 1RYRA 1HQEA 2MQOA 4KY3A 3HKZD 2EK6A 2XHCA 4USWA 3B6BA 3BDPA 4DV5F 3HHNB 2XSJA 2FVQA 1HI8A 2W4DA 1TR0A 4U8VA 3WIVA 3PO4A 4HDHA 4DL4A 2RF2A 4K5RA 4DV4F 1H6KX 3ADAC 5HO4A 4LBHA 4EZ6A 5IC6B 3JSMB 5E3PA 4RKUC 3G8SA 5CYMB 3UDVA 4EO6A 2DIUA 1FJGJ 5LL6d 1XWLA 2FJXA 4KHPF 1L3SA 2ZITA 3ILJA 1TKTB 1WG1A 2GHPA 3C15B 3EJMA 5BR8F 3FDSA 3PEJA 3EZOA 1A9NB 3R9LA 3R1HA 3T6BA 3VWSA 1GTHA 4OV6A 5GVQA 1EJ7L 2E1AA 3AB4B 3CMAS 5J2PB 1RTDB 2RT3A 3IG1B 3NNCA 4NPOA 4ECYA 2GNKA 5F9LA 2CJYB 1UPPA 2QLJB 2P6TA 2ZKUA 1G2EA 5D8HB 2DNMA 3BSNA 1FNOA 2EEYA 1SC1B 4Z7CA 2XSFA 3QPIA 3GB0A 4R25A 3CC4S 1NH7A 4HHJA 5KFRA 1RBAA 3PYGA 2FC8A 4RNHA 2E5HA 4IRKA 1S10A 5HMXA 4NCGA 3I0SB 1WC4A 2DEIA 4PXBA 4PZVA 3HFZB 5KT7A 4HTIA 1WACA 2MQ8A 3NMAA 3IP0A 2JSXA 3W5ZA 1U0HA 3RRGA 2N7YA 2HQIA 5AXNA 4DMZA 3OFEA 3BR9A 2XYPB 2QA4G 2GMLA 1S1UA 4XTTA 3HVRA 1N6QB 3RGIA 2L08A 3KUGA 3JSRA 4UZCA 1NCLA 3OR1A 3DDKA 4P2SA 4I2PA 1JKHA 5KFHA 1UVNA 3D28A 2VZ9A 1CJTA 3OD2A 3CO0P 4DL2A 2J76E 4LREA 1WC1A 4DV1J 3IR7B 2UUWA 2ATCB 4QIFA 1BY9A 2JLGA 1EIYB 2KKHA 2P2CB 1M5VC 1BHNA 3W9HA 2DR8A 3FNNA 3KG1A 4YHHJ 4DQIA 2FZGB 1YJ9S 4DSIA 1VQYA 3VALA 3RBEA 2OO4A 1GQEA 4L6V3 4FYYB 3V6HA 4DWIA 1Q86T 2JH3A 1RT4A 2EW9A 4RR5A 3MMJA 1U47A 2L9DA 2BJ8A 1UKUA 1U09A 3Q2SC 2HHHF 2VFRA 4ZVGA 1S9EA 1NK5A 2BM1A 2YWWA 1KTVA 5KFGA 1NDLA 1RE1B 1XR5A 1ZM3A 3D1QA 3T9NA 2R7VA 3R5CA 4NYPA 2CQPA 1TQLA 2HFNA 2PA8D 3MI7X 4TY8A 4DUYJ 1N0VC 2G1HA 3L7PA 3H2UB 1T3NA 2GQCA 3CDUA 5FDLA 4OZ0A 3A8EA 1BQMB 2CQ1A 2CZ9A 2FHMA 4DG1A 4CTAA 1VQNS 3KYLA 5THWA 1CS4A 3EDQB 4Y2KA 1N32J 5B7WA 4U7UD 2KYXA 2B9YA 4KKOB 3DGVA 4OHXA 4L3NA 4CRJA 1JXVA 2D9PA 4PWUA 1L3KA 5K9FA 2HHQA 3NGSA 5T7LB 5A8WA 4JV0A 1FJCA 1KQFB 1LWFB 4A8MP 1RHMB 3QO9A 3DXSX 1FK9B 2DXFA 2NUHA 3M8RA 2HK2A 1WELA 4DFJA 3PX4A 4J9NA 1I3OB 2R8JA 3ZZRA 3HHLD 4NXMJ 1U02A 3MGJA 2OH2A 2EFQA 4JI7J 2MKYA 3KUHA 1D9FA 2XS7A 1D9DA 1CBKA 4WXOA 2RHSB 2DJWA 1VCTA 5FLXU 1FKPB 2CPHA 3IBFB 2EC0A 2DR5A 4KAIA 1HQ2A 2VOPA 1OPIA 3MEEB 4TU8A 4J9SA 5JJBA 3G4SS 4LFBF 2AD9A 3GJSB 4MIAA 4CLWA 2VD3A 2WK4A 1E6YA 4ZN1A 2XEXA 1L3UA 3MM6B 4F3QA 4JI1J 2C42A 3NAIA 3W2VA 4ZA1A 3OL8A 2UUCJ 3OUYB 5KFNA 2CNKB 2A6OA 3MAHA 4WF9Q 2QRRA 3R5GA 4B9UA 1HNZF 1UPMB 1NHVA 3DGPA 4MIBA 4RW7A 3V6DA 2E1RA 3DMJB 4BLGA 2ZBIA 5HQMA 2D7SA 3ZNJ1 5CABA 2LEAA 5KFXA 2H3EB 2CQDA 3SCKE 1TFYA 1WC0A 4DX7A 3AXMA 2R8GA 3DOLB 2O67A 3DHWC 1OY8A 1K0VA 2WHOA 3PX6A 1DQAA 3GCWP 2HBYB 2HWTA 3QFHA 4RBUA 3TRGA 3MXHP 3DU5A 2YKPA 2DNGA 4ANEA 4QCLA 4WFZA 3K0JA 4NLSA 1I51B 1HYSA 4NRTA 3X1LB 3FC9A 5AT1B 2WOMB 3LWMA 4M94A 2QMUB 1NLKL 5HQ8A 1EAYC 3HXMA 2BKOA 3W9JA 3PJXA 1SVDA 2GVZA 4Y6IA 1REVB 3LPYA 1VS3A 2XGPA 3UDCA 1TKZB 2E1CA 2IM3A 3B4MA 1DJ0A 5CCMA 3W2WB 2JEIA 3J7AN 3BBBA 3MR2A 1UP1A 1VQ8S 3SV4A 2DGQA 3VAKA 4USJC 1LWXA 5K14A 1B64A 3MMAB 1FNMA 2COLA 5JVGQ 3M2RA 4ZOSA 2YX7A 2PI5A 3CDAA 2RRNA 3M8QB 5DRKA 3PX0A 1TK0A 1TELA 4DX6A 3MUMP 3GYNA 1WF1A 5CHCB 2LDYA 4KR0B 2V2ZA 4P52A 3DU6A 1KQSR 1X0PA 4YDDB 3CB4A 4HTJA 4PYDA 5FLXY 2V4RA 2K1RA 2M4MA 4ENOA 1UW9A 5KFUA 5BJRA 3L7UA 1S0NA 1TL1B 2W4PA 1Y9OA 3R5DA 3V81B 3NMRA 1SH3A 2RIJA 2YKAA 3DRPA 2FY1A 2V9WA 2MZJA 5A2QU 2GCFA 2DGWA 1B7FA 1M90T 3SSSA 2L3MA 5HMYA 4TU7A 4QPTA 4ZLNA 4DS4A 1VRUB 1IKXB 3TP2A 4A8WA 1IKWA 3Q89A 1E6VB 4O3SA 3KWMA 2ZBQA 3DNCA 2DGTA 3DRRA 2F8MA 4UUXA 3NS6A 1Y5LB 2EFGA 4WK1A 3HVTB 1HHSA 4C48A 2RKIB 3TUZC 5LMUF 3LP1B 2XLKA 1R43A 5DQHA 1HNXJ 1NZ8A 2KFYA 2FJWA 2E5LF 4U6PA 4M1KA 1VRQC 3VGSA 1TU0B 4OJGA 4Q5VA 2EK1A 3W66A 3FEZA 3N6LA 5E41A 4JYAF 1JB0C 3T1AA 2W1BA 2R8HA 2HIQA 2G13A 4FP9A 1QE1A 2X51A 2RRBA 3OLBA 1V6HA 1FRHA 2NXEA 1S6UA 2FVSA 7FDRA 2J9EA 2DHXA 3WIUA 3EGWB 2VIHA 3UI3A 1B0VA 1M0SA 2OFHX 1F5CA 3NAHA 2Y1IA 1U2RA 3CIZA 2W9BA 1GK8A 2L9NA 3T9ZA 3CC2S 1RA7A 3K5LA 1AYEA 5D0RA 2CIMA 1KC8T 4X62J 2CQCA 3QT6A 1F9EB 3RAMA 1IWGA 3TZZA 4RW8A 5HANA 4JI4J 2B4PA 1U1RA 2BYCA 5H1SV 2VG6A 2DHAA 3K8VA 3Q23A 4YR0A 2C2MB 3ZTRA 3RYLA 1HWUA 2KHDA 2MHNA 2EFOA 5KT5A 4OJ3A 3AY0A 1KD1T 1X5PA 4DV0J 1KWMA 2JFKA 2AQ4A 3A12A 4F2RA 4FXWA 1RABB 4C3MA 3M8YA 3TJ8A 1CULB 3QNWB 5KG6A 3OSPA 2QFIA 1N5TA 1UVKA 1ITPA 2DNRA 2HRTA 1SXLA 2G9OA 3S7RA 1WD6A 1NJXA 2CKWA 4X4TA 4GVLA 4ED0A 4K0KJ 1GMUA 4M5IA 1UVIA 1VGYA 4E98A 1UCNA 3ZXWA 3D68A 2GO8A 3ZNUA 1LWEA 3W9IA 5C5JA 1U1OA 1VQKS 3QYYA 3DOMB 3ILOA 5KFYA 5D0HA 4TYBA 1RGVA 1SKUB 4YY3F 2V4JB 1FESA 1NNDA 2G0JA 2HVDA 4OX8A 4PWDB 4RWXA 1PG5B 3H20A 3M9NB 1C0TA 4OIXA 2LU1A 1TKDA 2JEFA 2E5IA 3BGRA 3BO2A 4WCEQ 2R8IA 1NKEA 3KHLA 1HHQA 2OTJS 2AX0A 1RHJB 3JQKA 3NCRA 2QN6B 3CJKA 2RU3A 5I42B 2XHWA 4KIAA 1WF2A 1S1VB 4PR6A 1C1BA 5IC4B 2PEBA 3BS9A 2DPJA 3AA9A 3J7A1 3KLVA 2W7OA 2C2KB 4LF8J 3U02A 3FCWA 4FN5A 4J9PA 2QA2A 1Y7PA 4LSZB 2JEJA 2L41A 4RW9A 1F0XA 4JI5F 5J2QB 3PW0A 1YZ6A 3WX4A 1RWUA 3KK1A 3V4IB 1J5EJ 3RW6A 3RB4A 1HBMB 3MAQA 4ED1A 3LP2B 2YXLA 3R97A 3R2DJ 2RS8A 5D0EA 2RS2A 5DZ6A 2N7CA 1RHQB 4DR5J 1BC6A 1A6LA 3J7YU 2ILYA 3Q8PB 1RHUB 3KTQA 5L1KA 1U45A 2J6SA 3MMCB 2Q1LA 2AYEA 1YBUA 3GQCA 2HVIA 1JLGB 4KH0B 1UVMA 4J9RA 2UUAF 1F9HA 2PI4A 3R5JB 4UTGA 3GPAA 3AA8A 3AQOA 2C2OB 4L74A 3G2XA 2HFOA 5A6WA 3M32B 5AJ3F 4XIUA 2F65A 4B3OA 1LW2B 1LK5A 3W60A 3M8PA 3JYTA 1U6BA 5KFFA 4NLOA 1U24A 1SC4B 2BE7D 1FJEB 1F9FA 4LF4J 2XMUA 2V8HA 3IRXA 3H4BA 2FPHX 3A4TA 1NHKL 1QLNA 1IBLF 4QPXA 3FUYA 3I5AA 2I5JA 1Y11A 3CULA 3A8KA 1KFSA 3WX8A 1HQUA 3KHGA 2VFUA 2EFPA 2MGZB 5E3RA 3GIKA 3RTVA 2BDPA 2X1FA 2ZD1A 1FFSB 3JTNA 3E8OA 4QIEA 4J9OA 1XK8A 1S12A 3SDEB 4DUTA 1H2VZ 2BX6A 4MK8A 3MEGB 2RNEA 2KT2A 2WZ1A 2BQUA 5E3AA 3G6XA 2B4OA 4FF4A 2DNLA 4OI2A 2HHSA 2BVZA 3W3SA 1S59A 1RT5B 7AT1B 4OZ2A 4BHQA 4WWSA 3TUPA 4BS2A 2LCWA 1F2HA 3BN4A 1R6YA 3IS9B 3BKUA 3ILIA 3LAKA 2HGNA 2A1BA 2QJ3A 1VBKA 2B6AA 2AHOB 3WZ0A 4R5PA 1OY6A 3HHDA 4K4UA 1KOOA 2H5JB 3EGZA 3A8IA 3QZ7A 1AUDA 2BZ2A 2Q6BA 4WFNQ 5AXMA 2HHPA 1Y0HA 3SSRA 3J7YI 4IYQA 5KFVA 4UY85 2B5JA 3HD1A 1UETA 1HLWA 1GXUA 2KN4A 5K8NA 1RK8A 4O44A 2H4WB 2KJWA 1DBDA 4IG0A 1SKRA 3ZZZA 1R3NA 3UWTA 4C8KA 1GT8A 2V50A 1RZMA 4PPZA 2AEFA 4B9SA 5J1EA 2KXHA 5F3ZA 2I6WA 2XB2D 3U1NA 2CFXA 4OHVA 4U95A 4NLQA 5GMKa 5E3QA 5CYJA 3UVJA 4F4ZA 3K89A 1RBOB 2FVCA 1XC9A 2ZOMA 4OYIA 5B09A 4OHYA 3G8QA 2V94A 1JLFA 4K4WA 5EGYA 4FNHA 1WC6A 2XQCA 2DNYA 4OZJA 1FVQA 1AZSB 4J9VA 2I1RA 4Q0BB 3UD3P 4A8OA 4LT6A 1U8SA 1R0CB 2BJEA 4PQAA 5DDRC 2HQCA 4CDIA 2E1MC 2NXUA 3D9BA 1NMEB 2FQQB 2FYXA 2KFZA 4LIRA 3BPSP 1T95A 2RU9A 5DG8A 3C8YA 4A8FA 1YVFA 4HYKA 3I9V9 3IR5B 3VQTA 1Q5YA 4X4VA 2DBBA 4OX6A 2CPZA 3MECA 1WF0A 3SI8A 2DB1A 3QIPB 1N5QA 3H5UA 4E0DA 3MEDB 4NYZA 3GIRA 3KLIA 1W2IA 2W24A 3FGVA 4IG3B 4LRBA 4CLFA 1T11A 2AMCB 5T14A 2YKNB 1NB2A 3OBIA 3BH6B 3LF0A 5F41A 3G82B 1WEYA 4LR7A 3AT1B 3ZTSA 3IXQA 1W25A 2CG8A 3QLHA 1FX2A 1OIAA 1J27A 2AYMA 3M2UB 2YWHA 1OS5A 4X64F 4ANDA 2QYCA 1P6TA 3CCVS 5ETVA 3UCUP 1RTIB 2GVDA 1U26A 4ZVRB 5U47A 3HULA 3JSMA 3QRPA 2ASYA 5CYMA 2OHDA 1APSA 1X4BA 2M7SA 4XO0A 1LWCA 4I56A 4LF6J 3IMQJ 1KTQA 2VFSA 1TKTA 1KONA 2WW8A 1FWLA 3C15A 3HK2A 5ADZA 2DT9A 2E9TA 5E0OA 1V3ZA 4M5DA 4DV3F 4OYWA 2BM0A 2LA4A 1S76D 3Q83A 4LIWA 5J2PA 5CXTA 1RTDA 1KQKA 3IG1A 3BYPA 4Q45A 2OPRB 4P7TA 5E33A 3T1HF 3RAXA 4GO5X 5CH7B 3KLGB 2ZH1A 3KG0A 4OHWA 4MKVA 5D3GB 1WKKA 4KFBB 2P8IA 4A47A 2J8AA 1ZZNA 3H42A 1GNKA 4JV5F 1SQFA 4ECZA 4RW4A 1AROP 2C2NA 2HNYB 1KVIA 3K8WA 3I0SA 1DHMA 3B78A 2MKSA 3OQ2A 1JLBB 3HKWA 3IRWP 1FVSA 4N41A 3JTPA 1T94A 4WYWA 2VQEJ 3CW2C 2ZBRA 4Q44A 1HNVB 2IHR1 2KG1A 3BO4A 4DR6F 4A8KA 2MXYA 2QFJA 2FY8A 2EG1A 3Q8QB 4Q7AA 2HVHA 3T1YF 2CJQA 1CC7A 1C1CA 3CCZA 1N6QA 3VV2B 2FVRA 3HMJG 5M2UA 3JS9A 5J2NB 2AJ4A 3OSNA 1EQMA 1N5SA 4MKBA 4ID8A 4WE1A 4DX5A 1N34J 4NI2B 4QU6A 2ZH6A 4B9LA 1N88A 1RWOB 2UU9F 3ET6A 4LFCJ 3LW5C 1FXRA 3VAJA 3N01A 1QY7A 4AYBD 1HR0F 5D4PA 2VICA 2FTRA 4FF2A 3CWJA 4IQXA 2W4CA 5A8KB 5GADU 2M0GB 5H9EK 4CM0A 1HD1A 3DC2A 3NGKA 1X5TA 2XULA 4RNMA 3CSKA 3NCPA 1SUQB 2FC9A 1X4AA 2D3OR 5KFDA 1VMBA 1CSJA 3OR2A 4RU9A 4ZIVA 4EBEA 2G1DA 4PG5A 5C24A 3MPUB 4DDFA 4V1Ak 3HP6A 1PCAA 3EVMA 4CH0S 4IO1A 4I1TA 2VQFF 2BQRA 2BW2A 3NBPB 2LXFA 9ATCB 1Q78A 3QZ8A 3HHLC 4N76A 2Z2YB 1Y4ZB 2OLWA 4KSEB 2QV6A 4TN2A 2R7OA 3BZQA 1X60A 2R4FA 5F9NA 3CCJS 2XWXA 4B3RF 3MM5B 2ZH2A 1HW9A 1YBAA 1BD6A 4KGMA 1TVRB 1R8AA 2VONA 1TAQA 4TLQA 2QA1A 2DY9A 2WBRA 4IO9Q 4F4AA 4RBTA 2DPIA 4KKOA 3GFYA 2HBRB 1N48A 4OZ1A 3H90A 1U1MA 2LLZA 4J9LA 2NLWA 5A0YA 2MQNA 4MKAA 1LWFA 5IQ6A 2CYYA 2OPPB 2LP4A 1FK9A 3TJAA 3RB0A 2YNGB 2KO1A 4KHRA 2J8SA 5I3PA 1I6JA 1YBTA 4LR8A 2QC3A 4LSLB 3KLHB 4YB6A 1SBRA 2RHQB 3G8TA 4ERDA 4K8RA 3KNAA 5KG5A 2P9CA 1JXLA 3MOZA 5GMDA 3MMBB 5B0FA 1HMVB 2M52A 3G6ES 4YOEA 2LA6A 5GADI 4CO2A 5F8GA 1S48A 1ZOTA 3J81U 4P75A 4H4KC 3HHKA 4JUZA 3QIDA 4USTA 1FKOA 2FD2A 1URNA 5K8OA 1EQ0A 3TUJC 1S6QB 4GVBB 2LXUA 1FO1A 1H2UX 1T3OA 3MM6A 1HKAA 2YX4A 2RILA 3MFIA 1IBMF 3RBDA 4OMFG 2ADBA 5LSLA 3THTA 1U0SA 3OUYA 5KFLA 4RW6A 3CDEA 3J7ZT 4IFYA 4PPDA 2KM8B 2UVUA 3HFVA 1MN7A 3FBBA 3L4BC 4J9MA 3HHLA 3DMJA 3SQGA 2B9WA 4PG7A 2E9RX 3D0HE 4K7QA 4PG8A 3DOLA 2M8HA 4X66F 1EP4B 1X9WA 4F2SA 2ZFHA 3CJ4A 1XNRF 2EPIA 3A13A 3CT9A 2M5YA 2XZWA 3E3XA 3L7OA 1NK0A 3SZ2A 4DR1J 2B43A 4IDKA 2C3PA 1CVJA 5HJYA 4I7FB 3K58A 4FBTA 4X4NA 2R7TA 4ZLJA 4ZVQB 4ZPWR 2XWYA 1YK9A 3VGVA 4QWDA 3DDIA 1GMVA 4WTOB 2QZ8A 3VTIA 3LO3A 4PG4A 3MCMA 4CH1A 4KT0C 1N0UA 2DEJA 3DM2B 2KRRA 3N5BA 1UFLA 4EU0A 3ZTQA 2D69A 4C3LA 3OVSA 1JLCB 3EVWA 1IR1A 4FVCA 3FBCA 3CD0A 2GJFA 4WZQA 2QE5A 2C3YA 3KLFB 1XMOF 1OYDA 3SEOA 3MMAA 3NLCA 2OPQB 4ZPCA 4QR2A 2YWKA 3MCSA 3PIPQ 5HROA 4HR2A 3QAUA 2MJNA 2XY6A 4H4KA 2BJ3A 1AA1B 4KTQA 4FF3A 2G2YA 2XMTA 4M95A 5AXLA 1VQ7S 1IR2A 1A7GE 3VF0B 3PV8A 3K5MA 3FBEA 3C19A 4HHHA 1JLQB 1GXLA 3DLKB 4R0JA 2RH3A 3J81Y 3DLBA 2R2UA 3DKDA 1QSYA 1HBUA 4L76A 2QTWA 3EDRB 1TMMA 3PKYA 4NCAA 2RUSA 4OZ5A 1F5BA 4ELVA 3V81A 5HMZA 3MOJB 2GV1A 3OFFA 1SJ4P 1V5IB 4PXDA 4ECXA 2YKMB 2W8LA 3LGHA 4ED5A 3GFZA 2P9EA 4X2BA 1CPZA 4OZ3A 4LQ9A 1VQ4S 1H73A 1AXQA 1U1PA 1RXOB 5DDOC 6AT1B 4K2XA 5T41A 4DU7A 1VISA 5KG3A 4C9DA 4PXCA 2BE9B 4N7TA 1S1TB 1L3TA 3HVTA 3HJFA 2PMZD 4P74A 3I56S 4FYWB 4O4RA 2ZJRQ 2OMOA 2A3JA 4C11A 4RZRA 2OD6A 2H4YB 4NASA 2F4VJ 1JNZB 2J7WA 2H65B 4FNIA 1F1BB 1LXNA 1OYEA 3HDSA 2N3OA 1RTHB 1Z2ZA 2ALZA 2WSFC 2LQBA 5KG0A 3V6KA 1O0PA 3CIMA 3KK2B 3H0PA 3BGFA 1OJ4A 4HI2A 3J81j 2IFXA 1HBNB 3O44A 1N36J 1TZ0A 4H4MB 3IM8A 2ZUAA 4RPFA 2XI3A 3G86A 4CLYA 5CAAA 1TV6B 4C0BA 3P8BB 2DHSA 4CLSA 3UN5A 1NK9A 3NNAA 3M1VA 5JMNA 1XMQJ 1WOOA 2J9DA 4MKYA 4W90B 5IT4A 2ZDOA 4WBFA 3UR0A 2KVIA 5A76A 3DCAA 1RT3B 3AOBA 1X5SA 1Q79A 4F04B 4CO0A 1RYSA 2KB2A 2OEJA 2JOQA 2EFVA 2D3UA 2HZAA 1VDHA 4X65F 3HSGA 2DRBA 2ROGA 4CT9A 4FKXA 1J2VA 3GYGA 3BKFA 3TAMA 1WHXA 2DYAA 4ZIWA 1FE0A 3BQ0A 1CULA 3M2VA 3VGTA 2FJDB 4WP8A 1RT1A 2ZH4A 4LF9J 2MKCA 3N0VA 1ZS6A 3U1LA 3FMBA 4ED8A 2BXJA 3R2CJ 1NB7A 2QT7A 4ZJQA 1FI4A 5KT6A 3D3BJ 2A6MA 1FDDA 1HNIB 2XTJP 2ZBCA 3C14B 2LECA 4F0MA 5L1JA 2BRKA 4F0KA 3T6JA 2AGOA 2IAJB 3I96A 4G1QA 1CJUA 4DQPA 1KBRA 1U2CA 3DOMA 4IH5A 1RT2B 3SCIE 3PRDA 5KFBA 3CE8A 4ZPTR 4CO5A 4HL9A 2RQCA 3FCHA 4RUCA 2DCLA 3F0NA 4DL3A 1YJTA 1DARA 2D3ZA 3MHYA 4MT1A 3IWNC 4PWDA 4KO0A 2W01A 2IMOA 3PJ9A 3V5RA 3JQJA 4O3PA 1JJ2R 1C0UB 2F8EX 5KOXA 1FJGF 2HQ3A 4J7CA 4JV2A 1VFJA 4Y00A 4QQBA 2HFSA 3LP0B 4WFBQ 5I42A 5B0BA 4DS5A 3PYDA 1UFKA 4MJKA 6FDRA 5L9NA 3KHHA 2JX2A 2AV5A 3SIPB 4NCBA 1LFWA 1FRMA 2FJEB 4DL6A 2VA2A 4A8XA 4ZCLA 3KDOA 5E2QA 1VQPS 2XI2A 2M9KA 3AOCA 2MPUA 3VVUA 5J2QA 3MR6A 3V4IA 3G6VA 2X7IA 2Z2ZA 4NMLA 5FIIA 3SFGA 4DR3J 3CNQP 2AP6A 4R0EA 2DK2A 5B0GA 4RNFA 2YTCA 3H2VE 1HWIA 2XCPA 4ZPBA 4U7UK 3HZGA 3TO8A 2WVEA 4X4QA 1LW0A 1CQNA 1VRTB 2ZZMA 1JLAB 3ITHA 4DN0A 2X1BA 3K59A 1P9YA 4AQYJ 4JB8B 1FWPA 4KGVB 3CJ5A 1JLGA 3FRYA 1YJNS 4E8UA 1JQGA 1G7CB 2JHEA 4LBIA 1L3VA 7FD1A 2DH7A 3H2LA 1ZM9A 2G2ZA 3PW7A 2X3DA 4NMXA 2F7VA 3QWPA 4RBVA 3SCLE 1TKXA 1RT6B 4LR9A 1OWXA 1HWJA 3RJMB 4NLGA 3UE2A 1XIQA 2ASLA 5DZ7A 2YWGA 1K0TA 5ETQA 4NLRA 1I5OB 3NEKA 2YH0A 4ZJOA 4Q8FA 1RCOB 4ELTA 3ICLA 3PNIA 4DV1F 2MGZA 4X4RA 3SBMA 2CWKA 2IBOA 3MEKA 3LGMA 2UP1A 2CPXA 2MQMA 4O3OA 1RSCA 5BYQA 2NPFA 1FRLA 4DR2J 4NCGB 4I2QB 2K06A 1Q95G 2V8GA 5GMEA 3O1LA 4YHHF 1KOHA 2IM0A 3MEGA 4DPXA 4QIGA 1SIWB 1MLAA 3D0GE 1NPPA 1VBZA 2BACA 1RT5A 2QLFB 2I2YA 1JK9B 3KJVA 3TA0A 1U0HB 1S0MA 2CXEA 4KBIA 1X8DA 3IS9A 1S7IA 2YNHB 3O5TB 1S1UB 1K1QA 1YJWS 4CIOA 3LQVA 4DFMA 3I5CA 4Y3CA 1YG0A 2AEMA 2PDAA 4Q2LA 3R27A 2KH9A 4DUYF 2B9XA 4I2PB 4NLYA 4ED6A 4EEYA 1IBLJ 1KVJA 2NPIA 1C4AA 1CJTB 2OAUA 2QYGA 1IKYB 1ZPWX 1UVJA 3FZBA 1XR6A 5E7OB 4B3TJ 2FLOA 1TK8A 4HVZA 1B0TA 3PHEA 2FGOA 4C8LA 3BB5A 3PXGa 2H48B 2E9ZA 3DYAB 1M5HA 4WKRA 2V8PA 4C0OC 1MN9A 1H7WA 4NRUA 4JI6J 3PW4A 3VZIA 1N32F 4OYZA 4ID5A 4L75A 2HRYA 3A3NB 5C42A 1RT4B 1DTTB 4PABA 2Y0BB 1S77D 1S57A 1S9EB 3LUYA 4TU9A 4ZITA 3KG4A 3BGOP 4DOZA 1RISA 4HHUA 4WYLA 3NXZA 4DL7A 3B4DA 3ISZA 3WQPA 1DRZA 1NRKA 2ZWOA 1N54B 4NXMF 5D4NA 3MM8A 1JJHA 2DISA 3U7JA 3I5BA 4JI7F 4C8OA 3VHQA 2DCUB 2CUYA 2YQ0A 2UXBJ 4NLPA 1KSPA 4UF4A 5FDLB 3UN3A 4LF7J 3OHAA 2V68A 5A8RA 3ZO7A 4QBUA 4DXLA 2YX1A 1S9GA 4DG1B 3TZXA 4Z2XA 4B9NA 1JWWA 1KP6A 2XMAA 3Q8RB 4N8OA 1ZH5A 3QIPA 3QFWA 2M70A 2YQ3A 4DV2J 3MEDA 3EM1A 1SB6A 2G0CA 3KLEA 4IG3A 4O23A 4JI1F 2ACMA 5ETNA 5L1IA 1NK6A 4WFAQ 3OFHA 2UUCF 3CMQA 1RT7A 3FSXA 2SXLA 5H9FK 4GMKA 3NGUA 4PRFA 3PACA 2CNOB 3QO9B 4YFUA 1R7IA 2DGUA 3A8JA 2IVFB 1CLFA 4FDFA 3QT8A 4J9KA 2HKEA 2OSQA 3R8YA 1ZPVA 3ENQA 3QSIA 5DLFA 1RDRA 4UOGA 3B82A 1FT8A 1H3DA 3GE9A 4LFAJ 2LQ8A 3T5KA 2DXEA 1SV5A 4URSA 5G0RB 2HGMA 4AL5A 4W92B 2PMWA 1H72C 2MDAA 4GC7A 4D3HA 5CD4A 2HFZA 2BJ1A 4N5SA 4GKKJ 4ES1A 3H8YA 1N4LA 3G9CA 2NUUG 3FSYA 1IBKJ 4MTPA 4PQUA 2HS3A 5D0GA 3RG6A 5MAOA 3IGVA 3VQSA 4GC6A 1S6OA 1E6YB 3GU0A 3M8ZA 1RI7A 2IDEA 4P9SA 1P1TA 3IBWA 1YJVA 3P4UB 2DITA 3SQOP 2OPRA 4MK9A 5F8LA 4WIIA 1VHFA 2GA7A 1EZZB 2OI2A 4RW7B 3V6DB 1YLXA 3BR8A 2JWNA 5D3GA 2HG4A 3THPA 4ES3A 1YJUA 5KT2A 4URQU 2VFVA 1VR6A 1RA6A 1GX5A 1QJHA 1X4FA 3CDWA 4F02A 5HBMB 3P96A 1DLOB 2BANA 4USKA 2YVSA 1RU2A 4XDDA 4DV7F 3VAGA 3QGHA 2HNZA 5HJXA 2R9LA 4FS2A 2M2BA 2VKRA 2UXCJ 1FCAA 1VQLS 2C3OA 1B3TA 1NAQA 1KS2A 1N5VA 2ATLA 3OV7A 1X4EA 4OX9J 3EXYA 2LU2A 5IV4A 3PO5A 4YN3B 2WAQD 2X1AA 4P10A 2KZMA 2IM1A 1FD2A 4RL1A 2OTLS 4UT4A 1T9XA 8ATCB 4WFYA 5J2NA 3F41A 1AUSL 4EYHB 4ZVEA 3SCJE 5K14B 4IH7A 4NI2A 3LWLA 2YPZA 1KDNA 4DHVA 5HVHA 3V4MA 4LQ3A 1NK4A 1WJ9A 4MK7A 5F8JA 4OFZA 1JJ4A 1S7HA 2XGQA 4OZNA 3MR7A 4EBDA 2VPZB 2JC1A 2XCAA 3TANA 1TL3A 1FDNA 2D1CA 2NS1B 3T5JA 2PE8A 5GAGU 3ZC4A 3UD5A 5A8KA 4H4OB 2EBGA 3FJ2A 4WPAA 3GSIA 1FWKA 8AT1B 1PO6A 2GZOA 3DRSA 3CCWA 5HI7A 1HNXF 1WC3A 2YNFA 1SUQA 5I4MA 2M8DB 1S1XB 4K59A 1WOPA 2K1RB 4I4BA 1M5SA 1KNZA 3PG9A 2AF6A 1VK3A 2JL9A 4P72A 2NZCA 2MKIA 2GX8A 4TYAA 3US5A 4ED2A 1KHWA 3OVBA 1TL5A 3KMQA 2UUBJ 2Y0SD 3CXCR 4YQWA 4L72B 1SH0A 3M6VA 1WKLA 3TQ1A 4DSJA 1AW0A 4C98A 3GLJA 3OXGA 1WWHA 4NLDA 3RU0A 1NPKA 4J9QA 4P2MA 3NBPA 2FB0A 1IJEB 3AJ1A 3KK3A 1U2FA 2A18A 2I8EA 3H5SA 3H7HB 4EO8A 2BJDA 1GTEA 4U9RA 3ZZYA 3EGVA 1NZAA 2AJ1A 1QSSA 1VOMA 2CQ4A 1IKWB 1HR0J 2V9KA 5CYQA 3MM5A 3VVTA 1NK8A 4ANCA 2HWIA 4X62F 4OL8A 3IBCB 3MPYA 4C97A 3L09A 2ZZTA 3CEDA 4F4WA 3ZTOA 2OPSA 3X3UA 1P9QC 3T19A 3QJJA 2DO4A 4R8UB 3SXLA 1NKBA 4JI8J 2WVFA 3C6TA 1PIEA 1TL4A 3F56A 4ZVHA 3D6MB 4J91A 2O01C 4I6YA 3Q24A 1RAHB 4DV0F 1URRA 3AXKA 4C2MA 1NM2A 1Z4UA 3SFUA 2IM2A 1KKHA 2OPPA 5FD1A 1MWZA 1TUGB 3MCNA 1QE1B 1WNEA 2M88A 2MEWA 3P5TL 1HW8A 5ETKA 2Y9HA 4IOCQ 4LSLA 5F0UA 5CZVA 3I9ZA 1G4CA 3P49B 3IAM9 1X4DA 2PIIA 4QWCA 6FD1A 2V5HG 2JVOA 4CLLA 5GAGI 4CWBA 4K0KF 1ICEB 2E7WA 2ZM6J 1HMVA 1HPZA 1V3SA 4B3RJ 2ZVIA 4UW2A 1REGX 2DVIA 1D1UA 4OYMA 1Y3KA 5EHHA 2NYIA 5HL7Q 1FE4A 5J2MA 2CADA 1MWYA 2BOAA 4RW8B 2OJ3A 3POTB 2PSZA 1JJCB 4ZS6A 1S6QA 3DLLQ 4GVBA 2VG6B 2Y3YA 4C8NA 4M63A 3KHRA 2F8HA 2HIYA 3FK4A 2DRAA 4ILRA 5DETA 3Q8UA 4ECQA 1RWVB 4LVNP 4CP5A 4CO3A 5M2PA 4OYXA 1JLEA 2KG0A 2IVMA 5LMNJ 3V6JA 1XTZA 4KPYA 2WSCC 1XNQJ 4I6WA 5L1LA 2HMIB 3TX0A 1GXTA 4KYZA 3G6YA 5F8MA 2GGPB 4ZMMA 1S79A 2FJBB 4EYIB 4CLKA 1QM9A 2MY8A 2WVDA 3UD4P 3SMZA 3S6EA 3OTCA 3OL7A 4UUWA 1BQNB 4LF8F 3GIMA 3MM7B 1FJ7A 4W4MA 4EUVA 5DQIA 2HHXA 1M5OC 2Y1RI 4LF5J 3N6NA 2UXDJ 3RZAA 3GTYX 1IVZA 4MH8A 2MJUA 1LWEB 4JP8A 4IFVB 3W1YC 1U49A 2MZSA 3P5BP 1J5EF 2HLUA 4NA3A 2RDJA 4FYVB 1OY9A 1TMJA 3CCRS 3DLGB 1T05B 2R2RA 1SJ1A 2ZH8A 2GIQA 2RQ4A 3OL6A 1JLCA 2DKOB 3CCUS 1YIJS 2X1GA 4DZDA 3CJTA 1C0TB 2W2MP 4RUAA 4Y65A 2ZHBA 2CJAA 3BGRB 3ISND 4PG6A 3DLHA 2HS0A 3KLFA 3EX7B 1V3RA 1D09B 1O8BA 2FIUA 4WP9A 1HBOA 1UZDA 3CJKB 4O0IA 1WDTA 1RB0A 2IJNA 1U4BA 1KLMB 4RNNA 3HPOA 2Y8YA 1C1BB 4JI3J 3MPVA 1PJ7A 2VJVA 4X66J 4Y2CA 4F4XA 3QRRA 1R6VA 3JSBA 4B3SJ 2DGSA 1BE4A 4WU3A 2QA4S 1ZAVA 3RW7A 3Q8SB 4RW9B 3BQ1A 3UR3C 4NLUA 4LF4F 3W8GA 1XN9A 1RUSA 2C28A 4Q2MA 2ACYA 1JLQA 2DTJA 1EETA 3TAQA 3KK1B 3M9MB 4ZVPB 2WB4A 5E5NA 2AZ1A 2HFUA 3I6PA 4HLBA 2GHVC 4IRDA 1H38A 3Q0AA 3K7RA 4EI2A 3QT5A 2KU7A 3M6XA 2HYIB 3NOCA 2QSFA 2VBYA 4K4SA 1VJWA 3KJNB 4HDGA 2YKMA 1S9FA 2MZ1A 1WG5A 1J5OA 1SL0A 2PC6A 3CO9A 1MU2A 3GP9A 3TZWA 2KXNB 1IM6A 2KXFA 3BJYA 2MHEA 2CDQA 1X4CA 4I6AA 1K1SA 5IQQA 1DTQB 4B3OB 3M8PB 2HLTA 4ATNA 1S5ZA 5AXKA 5HP1B 2ZH7A 3HD2A 5JVHQ 3IRXB 4F36A 2ZJQQ 1VC6A 3I0RB 2HNDB 3UCZP 4QW9A 1Q8BA 4M5GA 3O3LA 1ZTWA 4GO7X 1IBCB 2XMKA 2BRLA 3ZTPA 2W25A 4OV1A 4NE9C 2CA9A 3GR1A 1H2TZ 3KK2A 4QYZJ 4ILLA 1UA1A 2R2SA 2FLNA 2D41A 1HBNA 4MFBB 2YY3A 3BEGB 2R7UA 4M5JA 1N5YB 4HH1A 3EWGA 3JAMU 5GAEU 2Z0GA 4ETZA 4PYAA 2G0IA 4KGKA 4USIA 2ZKTA 1IKVB 4HACA 1MWQA 3I55S 1WHWA 4QW8A 4WTYA 1YGYA 4LBPA 3MPWA 2CPFA 3MUVP 2AKWB 4URGA 1K9MT 1RJJA 1FTCA 4L73A 2F3JA 3PM9A 1YSJA 1ZBTA 4W98A 2UVWA 2MTLA 5KFPA 5A2QY 1UEVA 2GW8A 3OHBA 4PCQA 5KT3A 2VKZG 5LT5A 4O44B 2NREA 2O1PA 4IG0B 3KJFB 1OQ6A 3MR5A 4NEZA 4ZVTB 3GIJA 5ETOA 4EWTA 5CQGA 3SYZA 3MCOA 4BDPA 4YS2A 3DOKA 3GJTB 2HFVA 2O66A 4KRWA 3IAS9 3TVYA 4HEA9 4DF8A 3W63A 1RTZA 4P2XA 2IJFA 3VZHA 1UWBB 4K4ZA 2KL8A 2G4BA 4G65A 3UVJB 1QD1A 2E5GA 2E66A 3FRZA 2ZJPQ 5B0DA 3AAWB 2U2FA 1HNIA 3C14A 1ELOA 1JLFB 4OQJA 1S1WB 2IAJA 2MLYA 1EB0A 1RT2A 5ETLA 4F26A 1OSCA 1S49A 2XMMA 3NS7B 2BE2A 4ECUA 1FDBA 1RWXB 3WBZA 1R0AA 2E44A 2QL7B 4CLPA 4QWAA 3DI6A 4KB7A 4QWBA 1R8CA 1FDAA 2CVIA 1U1NA 2YBVA 4I67A 1P1LA 4A4JA 1XERA 2I0XA 1PSDA 2CJ9A 1KRPA 4K5SA 3JXOA 4A8YA 4LF6F 3A3OB 4F3MA 5ETSA 3MECB 3LP0A 3E51A 5GAEI 3RRHA 3R1LA 4ZVOB 2WBMA 4Y2MA 1RLCL 2QLWA 2ZC4A 3KLIB 3ENAA 1WUUA 4RLEA 4AFFA 3IC1A 3OTOJ 4CNZA 3RR7A 1Q53A 1WI8A 2MLZA 3BBFA 1DZ5A 2YQ1A 2W9CB 3JAMY 1UAWA 5IWAJ 3QLHB 3TUIC 4DV6J 4WZMA 2DH9A 3TVZA 4K2JA 4YB5A 2KJVA 2HAFA 3W61A 3NL0A 3U1MA 3FZ2A 3R5BA 4D3GA 2GHWA 3H40A 1VQ6S 4LVOP 4USUA 1RWKB 4AD6A 2GVDB 4RWWA 5KG2A 1NSQA 2ZOGA 1HWKA 4NLXA 1SJRA 3HVAA 4PUOB 1VRTA 1JLAA 3JQMA 5HLFB 2QL5B 3KDNA 1LWCB 2EC2A 4X4PA 3FFIB 2W2PP 2VQEF 4ZHRA 2HPUA 2CZVC 4TNOA 4I0WA 1FD8A 2QGFB 3PY8A 4M5DB 2DRDA 3PFOA 1C2PA 4U67Q 2JC0A 2IRUA 1BWVA 3W8PA 1SJFA 2QLBB 3IR6B 2NCKL 1RT6A 3RBXA 2EFNA 2C22A 3TA1A 2HBQB 4OI1A 1N33J 3PW5A 3N5FA 1CQMA 5EX0A 2J0QD 4QYRA 1PBUA 4BWJA 5I3UB 2HHWA 1N34F 2XZDB 2IC3A 3T5LA 3MM9B 4TXSA 4YB7A 4LFCF 1QDUB 5BYSA 4FYXB 4CYUA 3K17A 2Q6CA 4DQSA 4RW4B 1H0HB 5AE1A 2NXCA 4OJHA 3LAMA 1YKWA 3UDEA 1SKWA 1CJVA 1GMWD 2GJ2A 4DPTA 3CJSA 4I2QA 1VQ5S 3PDNA 2CPJA 1PGZA 1FX4A 2LQ5A 2Z4PA 3E01B 4USVA 2J6UA 3RUBL 5ETTA 5L39A 2XYHB 2JFDA 1T02A 2KZZA 1HNWJ 4NA2A 3TR5A 4MYTA 1HI1A 8RUCA 4ALZA 5KTQA 2E7VA 4OI3A 5L9XA 4LF1A 4ZVUB 2YNHA 2VOOA 1UEKA 3IO1A 1C1CB 1HL6A 1Q8KA 4XDCA 3W62A 1TP7A 1AT1B 2WCXA 2ZE2B 2W7AA 4C8ZA 5HVGA 4O3RA 3M4XA 4OZLA 4WE1B 3TEHB 1D3WA 1NSKL 1ZETA 3ET6B 1IKYA 3MWBA 4K4YA 2DGVA 1FRKA 3EZUA 3C6UA 3DYAA 2A2CA 1HFEL 5IT0A 1PILA 3VAIA 4A8SA 5IT9U 2V8DA 1TFWA 4FKYA 2LXIA 1RTJA 5L8RC 2KFNA 3BH7B 4K4TA 2G2OA 3PZPA 1Q8IA 5EDWA 3H59A 4JI0J 2VBZA 3Q8YA 1RWMB 2UVRA 3CVKA 1DTTA 3BQ2A 3OR2B 2DNOA 4HT5A 4WK3A 2VB6A 4WFXA 1NEEA 2Y1LB 2BKPA 5C24B 4GRSA 3M30A 2AW0A 4UOCA 5EWEA 1QAXA 3GMGA 5KFOA 3VR1A 5IM0B 2AEJA 3Q2TC 1VIOA 3RB3A 1TTHB 4FXVA 4OJ1A 4J90A 5JUMA 2VG5B 3W5YA 1CJKB 4YR3A 2VASA 2CPIA 4ZLPA 1NJYA 3UPFA 4DR7J 4NZ6A 2OD4A 4DUZJ 1YHQS 5CD4H 3HO1A 2EG2A 3ILLA 4TKTA 1YJ7A 2XY7A 3CCTA 1GH8A 4B3MJ 4DPWA 1F5AA 2XMWA 2A0FB 4CLTA 1FXDA 1S4EA 2B9EA 1QAIA 1D0EA 2MQQA 1UEUA 4USMA 1B0PA 3L95X 4ZP9A 4NYOA 2DGXA 2IRYA 4CQ1A 4ZJLA 1VYAA 5A0YB 4Y28C 2CWXA 4TY9A 2ROPA 3QT7A 1T03B 1DAXA 2MY7A 1BWEA 3AHPA 3C16B 3PCOB 4ZVSB 2CVEA 4DR4J 5C2CA 3D6FB 1PBAA 1ULRA 2PFDA 4LRFA 2CQBA 4AUKA 2E5JA 4U7CA 5EX3A 2CAJA 5EN1A 1ZAWA 3P45B 2LQJA 2D74B 4MIWA 3CD5A 1BGXT 4DV5J 2XY5A 5G0RA 4DR1F 1YTYA 2UVVA 3J7Z5 2OGUA 2B0GA 1GFWB 2Z8QA 4OLOA 1FKOB 4CT8A 3FSIA 3ENWA 4O3NA 4FS1A 2RDDA 4ZCIA 4IR1A 4CI0B 3IM9A 4DV4J 3PJWA 2IDLA 2KI2A 3MAAB 3QQCD 3WC0A 3F73A 2DHGA 3LGNA 5IT9Y 4ZCMA 5HQLA 2QL9B 3GWCA 2QX0A 1LK7A 1XR7A 2DO0A 4LSNB 4KHPJ 4RW6B 4C3KA 3BO3A 4IFYB 1NJWA 3W5XA 3CJ3A 2IYIA 2KRBA 2FVPA 3DFEA 4A46A 3HHLB 5BR8J 3SQGB 1N52B 4FPIA 5BXIA 4OI4A 1NDKA 2E1PA 3HT0A 4FPRA 2VH7A 2AJ2A 2KTQA 4LRCA 2WVBA 5H9FJ 2LKZA 3H4DA 1PAEX 3LTOA 5HBMA 1DLOA 1RU1A 1R89A 2CJBA 1TK5A 3EMTA 1FFWB 1QAYA 4IDKB 2MMYA 2W8KA 2W2OP 3AB2B 5DS7A 2EKNA 4ECWA 4Y0FA 1VQMS 2P5VA 3AH6A 1D8YA 3FCVA 2FHJD 1LEOA 1Q7YT 4BC7A 3CCMS 1RAGB 5F0WA 4ECVA 1JX4A 2YWFA 2IRXA 4G1PA 4EBCA 2UV8A 1NSPA 2XZTB 4QR1A 4DX8H 3HX9A 4OYPA 1WORA 3C46A 5DLGA 3PVXA 4Z37A 1PYTA 3DLJA 4AT1B 3W7BA 2IYGA 2W2QP 1H7XA 2WONB 4OYBA 3OXFA 5HROB 1PJ6A 4J5OA 2IMWP 5DGBA 1XBWA 3THVA 1P8GA 1FXLA 1UWAA 2CRLA 4F8RA 3NGDA 3PFEA 4H4OA 3K57A 4LUBA 4DV7J 2U1AA 4IQMA 3H5XA 2FGCA 2VU5A 3OT9A 1S1XA 3J80U 2XYGB 2F4VF 2LYVA 1WTBA 1BQMA 1HWLA 3BBCA 3BSAA 4ZPDA 4AL6A 1HBUB 3IWXA 1UL3A 1XMBA 3E2EA 1S6PB 4Q8EA 4G3IA 3S1TA 5HAOA 2CQ3A 1ZA2B 4JI2F 1W7WA 4QU7A 1DQ8A 1O6XA 3PTWA 1KEKA 2MB0B 4M5LA 1M1GA 3D54A 5CCLA 3QBCA 1N36F 1VQOS 4M5HA 2NSBA 1VBYA 2FDNA 3ZZUA 3MZIA 3QMQA 2VF3A 5HVFA 1WG4A 1QUPA 5T7LA 2HHHJ 2ASDA 5KFQA 1SC3B 2E7XA 5K8PA 3GV7B 2KYZA 3I82A 5J1PA 3JTOA 2KT5A 2R7SA 3CCQS 3G87A 1Y3JA 1XMQF 5I3QA 5LXRA 4ZKAA 4PAAA 1LV5A 2ADCA 4JV1A 1F60B 3M6WA 4C11B 1YRUA 3BGLA 1H98A 4ZDNA 1FKPA 2GJIA 2V34A 2K3IA 4R8UA 2H54B 1WKJA 2ZDPA 3VAMA 5AE3A 3MEEA 1O5JA 4WKYA 2WRMA 1UW4A 1MMNA 2AU0A 3OLAA 2GMHA 5C7PA 1DQ9A 2BEFA 5B0AA 4LF9F 2DNNA 2MZTA 2QSWA 4NZ0A 1HI0P 4DLGA 5F8HA 3LALA 3KKFA 1B7YB 2ZHOA 2C2RA 2ZVSA 1H74A 3T41A 2WTFA 2H1YA 3M1VB 5MLCV 3HSJA 3OPKA 2NYHA 2AWZA 2XO6A 2CQHA 3LANA 2AGQA 5DO2A 3HF5A 1XJWB 1NDPA 3POTA 2OMLA 1OSDA 1FNXH 3DLEB 4EGLA 2VG7B 4M5MA 1UJ5A 2R2TA 3H5YA 2B7CB 2N4DA 3RBZA 4N8NA 5C25B 1TL7B 1SCJB 1Q4RA 5KFTA 4M5NA 4ER8A 4X84A 3CJQA 5DQGA 5KAKA 2HQFA 1M5PC 3TAMB 5D78A 3J80Y 2WOMA 2EI5A 1LOUA 4DSEA 4LFBJ 4I69A 3HLUA 1X4GA 3M2VB 2HMIA 1RT1B 1X0FA 2GGPA 3ISNC 2RD5C 2KHCA 2IIHA 5HK4A 1REVA 2EWHA 2NSCA 1TKZA 1N8RT 3UNGC 3W2WA 1BQNA 4FZVA 3MM7A 1HNZJ 2Z58B 1B99A 4KV8B 2BJ7A 5L38A 3TOQA 1VBXA 1U6ZA 2VJUA 2CZ4A 3A1YG 2BMBA 4IFVA 3C3LA 1Q5VA 4G1QB 1CJUB 3M8QA 4IRCA 4N77A 3PRBA 4DR3F 3DLGA 1T05A 2CQ0A 2H51B 1NK7A 1FRXA 3CPWR 4NX9A 1SIZA 5IXUA 1ZTTA 1K8AT 4KO0B 1U48A 1WHVA 2VA3A 4YMEA 1IM4A 3MD3A 2PA3A 1IR0A 1KR4A 4DCPB 1R8PA 2E29A 1T9VA 4AQYF 4DL0C 4DZ6A 1F3FA 3S8SA 2H5EA 2BABA 3GJRB 2B56A 4BC9A 1SJQA 4NXNF 3ZFVA 1TL1A 5IS2A 2UZAA 4AXIA 1F2GA 4DQQA 1KLMA 3OW2R 2XM3A 1AFIA 2J5AA 5ETPA 2GIFA 5L46A 3EGNA 3RAQA 1V5VA 4MMOA 2ZH9A 2FLLA 2C2ZB 4KC5A 2RVJA 2PD1A 3NY0A 2O5DA 2K7KA 1QTNB 2PEHA 2ALYB 4F0HA 2V2VA 1FEHA 3QSYB 3D3CJ 4UQGA 2XMJA 3ETMA 4NL5A 2NZ4A 1CG2A 3BF4A 1VRUA 2KVQE 4OX7A 1IKXA 1D9AA 4CO1A 1E6VA 2LVWA 3EICA 2JEGA 3CUNA 1NKCA 2HRUA 3UDLA 3NS5A 2FJAB 1ZAXA 2RKIA 3LP1A 2DR9A 3D66A 4DR2F 3GFHA 4WIQA 1LW0B 1KN6A 2AJQA 2QIFA 1HA1A 3ITHB 5KG1A 4F3OA 4OHZA 2FJVA 3MF5A 3N9UC 1FFGB 4GKJF 2VV5A 2MSTA 2QMXA 2PT0A 4ECRA 3RRKA 1IQTA 4ELUA 3KFWX 3CCES 4BBYA 2HS4A 4ZP7A 2GC8A 3TAPA 2ZNYA 4ZPVR 2QG9B 2W7PA 2K3KA 4DPOA 1DTQA 5DJBA 4YDXA 1MMDA 1TKXB 1VI7A 2V63A 2MQLA 4NA1A 1ZM4A 5HP1A 5ITHA 1VC5A 2B3TB 3Q22A 1OMSA 5GAHU 1Y5NB 2B4VA 3I0RA 3CD6S 3RR8A 2HNDA 4Y2AA 2KDOA 4CLUA 4PEOA 2J7KA 3MURP 1SL1A 3KNGA 4HT7A 4O4GB 5A6PA 4FXDA 3P3DA 2RE1A 4DJBA 3D1OA 4B3TF 4KH1B 3G96A 4OI6A 2DY1A 2ZBPA 4QIVA 3KUEA 3ENVA 1VLOA 4WU2A 5LMUJ 2M3DA 2OUGA 4P7VA 1FKAF 5SUHA 1WOSA 2E5LJ 3BGUA 4ES2A 4JI6F 1UA0A 4ZCKA 2Q43A 4MFBA 1SH2A 4AE5A 3HJVA 5LM7E 1IN0A 4HKQA 2C1EB 2OEMA 1N5YA 3D4JA 1N56A 4JYAJ 4DSLA 3QJLA 3D6TB 1TAUA 1Z1ZA 3W65A 3KJVB 2V2QA 3H25A 4LRAA 1SL2A 1M1KT 4IOAQ 1K47A 4YUDA 3FBFA 4RNOA 3WC2A 1IKVA 2Z30B 2RJZA 4B17A 4P6QA 3ONQA 1PYOB 1I94F 3QGGA 3AD8C 1LFPA 5B0EA 2XO7A 1T9WA 5DDQC 4G1IA 1RHKB 3C2PA 2UXBF 3CJ2A 1NPRA 4NOHA 2NQPA 3CJRA 3HVWA 3MD1A 2CPYA 4PWWA 4LF7F 1Q81T 1ACMB 1BUXA 4UOHA 1EARA 1UZHA 3EVOA 3KOAA 3L9ZA 3VGUA 2J0SD 1NH8A 2ZC3A 4V19J 1A0OB 3DN9A 1NJZA 2GQ2A 4TLRA 1FRJA 2V4JA 2PGCA 4DV2F 4ID5B 5F3TA 2DIVA 4ICLB 2HK3A 1VK8A 1UWBA 2MKJA 3VAFA 5C42B 5IOLA 1NDCA 4H54A 1MROB 2APOA 1MW7A 2LMIA 4XAKA 1OO0B 3HSZA 3MTJA 3BSOA 5KFWA 4YEAA 2K8GA 1S99A 2YNIB 5GAHI 1S1WA 2CNNB 1S1VA 5LJ3Y 5KT4A 4DI6A 2LFVA 1PJ5A 2Y1JA 3MM8B 3QATA 1HQEB 5EWFA 1YWXA 4LFAF 2VPYB 3HFKA 2LEBA 3M6UA 3N4WA 1KLNA 4O3QA 5D4LA 1NU4A 2JVRA 1GX6A 4Y34A 2XSJB 2MQPA 4QIWD 5A8RB 3K5OA 2K7JA 1S9GB 2Q3PA 3N28A 3Q86A 2YH1A 1HBMA 3LP2A 3UW1A 4GKKF 5C2GA 2HEKA 4YY3J 1IBKF 2RF2B 3LH2S 1ZM2A 3AD7C 1S4FA 1R0BG 1R27B 1RLDA 3AQPA 3EPIA 3KLEB 4IUFA 1YRXA 2D9OA 4YR2A 3MMCA 2W9AA 1FHTA 3SSQA 1KFDA 2AJ0A 1RT7B 1HIYA 2F63A 4M5KA 1AB8A 2IA0A 4DN9A 3QGIA 2W9CA 3LOUA 2N3LA 3TQEA 2AT1B 1JIHA 1AFJA 4M8LA 2ZH3A 5M2RA 1JNRB 2BKNA 4QZVB 4NZ7A 3WDOA 2WSEC 1R8BA 3M32A 4ZP8A 4P73A 5HSPA 2HQGA 3TZYA 1LW2A 3HI9A 4DCJB 3MR3A 4JI5J 2XNQA 2HHTA 2LEPA 3PKMA 1SV5B 3T3FA 3QAEA 4PUOA 1T0TV 2HBZB 2XS2A 3QWUA 5HLFA 2HVEA 4RU2A 4CNYA 1EHWA 4K50A 2L48A 2AYGA 3FFIA 3D6HB 2PN6A 2R3VA 2UXCF 5ETMA 2VHGA 2XS5A 1L5UA 4PQUB 4DPUA 1ROFA 4CM2A 4Z7YA 1NO8A 4OX9F 3F44A 1UJ4A 2OKQA 3PIOQ 2CDRB 1RWWB 4EZ9A 3K5PA 3D5MA 2GS8A 1M1HA 4KQZA 3SDEA 1YX2A 5LJ5Y 1R31A 2FZKB 2K2PA 3MDFA 2GMJA 1ZZFA 4HI1A 1NUEA 3IN5A 2XC9A 3OVAA 4B9MA 2UUAJ 5KG7A 4B02A 5I3UA 4NLWA 2OIHA 3NGRA 4F67A 3MM9A 2MZQA 1T7PA 1WDDA 5AJ3J 2GO9A 3D0IE 2ZNZA 3L3CA 5KFCA 2AJFE 3K2YA 4WJBA 3BSCA 4C0HA 2BANB 2B51A 3OR1B 3D67A 2R7XA 1JKHB 1G3OA 1R8HA 2EKYA 3UFCX 3IFEA 2JDJA 1U8WA 2CJXB 2HNZB 3M9OB 1QAJA 1TUWA 1YITS 3E01A 3BM7A 2V69A 4EFAC 2R42A 2X3GA 3GJQB 3FEYB 1Y10A 4UZBA 5LOQA 3MPDA 1MNEA 2UUBF 2VL1A 3QJPA 3HZEA 1Q1KA 4F25A 1XEZA 1YI2S 1RKJA 4DF4A 4DQRA 2ZHAA 1PKUA 4NWBA 2ZE2A 2V2KA 4ZLLA 3NCQA 3KJQB 1K44A 2XG8A 1RHRB 4UY8T 4PXEA 3NG8A 1MSWD 3LPEA 3N79A 2KT3A 4DEZA 2MZRA 4OYAA 3ZZPA 1NXIA 4ZK7M 3ZZTA 3HM9A 5EWGA 3D7SB 3LA0A 1TL3B 2ABYA 1GMWA 4DFKA 2HVZA 2NR0A 1RBLA 1AZSA 2CJKA 4TY8B 3TEGA 4Q0BA 2AX1A 2VC1A 2OELA 2DNZA 4UQTA 3D2WA 3DRSB 1PC4A 2YNFB 2IVYA 2RDIA 1EX8A 2DR7A 2XNRA 4JI8F 1CEZA 3CD7A 3AOAA 3NRBA 4P2FA 2C3MA 1BQXA 2J0XA 2MSSA 4CTAB 2N82B 1X9SA 1RCXB 1CS4B 5CA5A 1T8EA 4PKDB 2HZVA 4RUBA 3W64A 5IM0A 5D77A 1WHYA 2YKNA 4ILMA 5IZHA 3KK3B 1CC8A 1VIXA 3G82A 2VG5A 1G1XA 5A8WB 1CJKA 4DU8A 3CGIA 2ZM6F 3ELHA 4KE5A 5CYQB 1BXNA 5AE2A 2CQ2A 1QTMA 3B54A 1X7VA 3M2UA 3BPDA 4JOUA 2A10A 1WEZA 3CCLS 3R6GB 9RUBA 1T9UA 4O0NA 2OPSB 1RTIA 3MTKA 1UMJA 4OYOA 1SPBP 3FVYA 1NJIT 3QRQA 3G71S 4N56A 2ERRA 3IGNA 3EPGA 3C6TB 3KXDA 3PYFA 4B9TA 2YPYA 1LKZA 3DRYA 3ZZOA 2Z2LA 3PRVA 2IPOB 4ITSA 5LMNF 1T03A 4UOFA 1XNQF 4LMZA 2W2NP 3FMWA 3C16A 2F40A 1Z2LA 3AODA 4KHMA 3BYRA 3W2VB 2MYFA 1WEXA 4Y2IA 1VQ9S 2V0NA 2FLPA 3NNHA 1QUVA 4LF5F 3KLGA 3K5NA 1FF2A 1HPZB 2C3UA 2H5IB 5HATA 3DGPB 2UXDF 5JXSA 3PR5B 5KFJA 2RQMA 1VC0A 4DBQA 4KFBA 5J2MB 4AXJA 2UUTA 4X64J 5E3CA 2XBPA 4MYUA 3TX8A 1Q8LA 2LQ9A 5DG7A 3OL9A 1U1KA 4E2FB 3TI0A 3DHXA 2HNYA 2ZWPA 1D8ZA 3MAAA 2AZ3A 5SZTA 3U27A 2VFTA 2C2DA 1JLBA 1HYSB 4LSNA 1JLEB 3PHTA 5F8NA 4G6VB 5KFKA 5HMWA 1HD0A 5B08A 3CDBA 2O3DA 2J9DE 3AJDA 5KG4A 3A3PB 2AYBA 2GAHC 4DLEA 1HNVA 4EK2A 2HURA 1X31C 4P71A 4DV3J 2EBEA 2GVZB 4F4KA 2CPEA 2P6SA 4NEYA 5D6GA 4JI3F 2BW7A 2VC0A 1SI9A 4B3SF 5D4OA 2V67A 2R8KA 3T1HJ 3T5HA 3BDEA 3GR0A 4C7QA 3O6QA 4IH6A 4TQRA 1SQEA 1NBEB 2ILZA 2F5GA 3WHIA 3M2RB 2F9DA 5K20B 4X4OA 4JV5J 3FQKA 1ZA1B 1V9OA 1U25A 3OJSA 4ZN3A 3DDNA 2C2EA 2VPXB 3OTBA 4IKAA 2V4QA 2YWEA 2BBEA 1DFDA 2MKKA 2ROEA 4F4YA 3GFXA 5HN0A 3HT3A 1TUVA 3ULHA 4FYDA 1WSVA 2DH8A 1JMTA 1PAUB 3CJ8A 2QMWA 1HBOB 3GILA 1T9YA 1VJQA 2EXUA 2WONA 4DR6J 1RAEB 3M7VA 2ZZNA 1RAIB 2QEXS 4A48A 3T1YJ 3JB9k 1YDLA 1BMQB 3TJ9A 1YJRA 3DRPB 1SC6A 4CZCA 2KM8C 3EXCX 3UQSA 2PFFB 3M8WA 1FTRA 4ZVFA 3I4PA 2FHJA 4QYZK 2UU9J 2Z2MA 1EETB 4A8QA 3DRRB 2J6TA 3N6MA 3TWZA 1WTFA 3I32A 2HHVA 1TVRA 2B8PA 1Y00A 1S6PA 4RUHA 2IA6A 4JI4F 1Y5IB 2DR6A 5IV3A 4KGXB 5DM6Q 1O51A 3GCXP 5RUBA 3DXBA 5K5MA 2GAGC 3Q8VA 4KPCA 5KOWA 2OP5A 2FUG9 1RADB 3CC7S 1IQZA 4LJMA 4ZPAA 1MG7A 2CG4A 1J5OB 4B9VA 4Q43A 2ZOFA 2GQQA 3FKBA 1MU2B 5H9EJ 4L3KA 5EUHA 2Y8WA 3GSDA 2I38A 2OEKA 2YNGA 4WXWA 2WB1D 2RRAA 1UVLA 1P27B 1WI6A 2VQFJ 3M8SA 1RAFB 2JZ5A 3KLHA 2VODA 1PC5A 3HHEA 3JSYA 1SJ3P 2RAQA 2N4CA 2P9GA 2V6AA 3MMBA 3IA0A 2W9BB 1DY3A 4YB1P 5F8IA 2JJ4D 1NHUA 2Z57B 2Q79A 2VDIA 2B8QA 2MKHA 1S72S 4ZP6A 3QGPA 3R7NB 4C6AA 3I4HX 4JI2J 5DM7Q 1IUJA 2GIRA 4DSKA 4HH0A 3NOGA 1S0OA 3AD9C 2DD8S 3M05A 2XLIA 4FF1A 1OPZA 5B0CA 4K4VA 4TVAB 1VLYA 5DGAA 1X9MA 4RO0A 4NLVA 1QVGR 2RB7A 3HCXA 4ECSA 1U6FA 4BCAA 3CTRA 3PEHA 1I1GA 2VUGA 4XPEA 3RB6A 4HACB 4EMDA 3IWLA 4K4XA 5BYRA 2YKOA 3DLEA 1LXJA 1EP4A 1YZ7A 2VG7A 2DNKA 1RACB 2J9CA 3SV3A 5C25A 2VBWA 4JBCA 1TL7A 1WSRA 3EYZA 4QWEA 4I7FA 3BREA 2HGLA 3OTDA 2UV8G 4ETXA 1W2BR 4FBUA 2IJRA 4IOBA 4WP3A 3MUTP 3DOKB 2HAIA 3I31A 4ED4A 2BJ9A 3TVKA 3DM2A 4DR5F 1IBMJ 1JXEA 1GEHA 2IBKA 2DHHA 3NKYA 1RQ0A 2HWHA 2POKA 4J37A 3OTOF 1ZYQA 2Z56B 1FA0A 1WC5A 2VBXA 4KV8A 4XPCA 3TARA 2BR0A 2OPQA 5IWAF 4DV6F 5LXYA 3R7BB 2DNPA 2QLXA 2NXNA
chains in the Genus database with same CATH topology
3HSGA 3KUEA 3ILIA 4M5HA 1TMJA 2BMBA 4CYUA 4PZVA 1HQ2A 1RU2A 3HD2A 1EX8A 3KUHA 2F65A 3HSDA 3HCXA 5ETKA 1Q0NA 1CBKA 1IM6A 5ETMA 1RTZA 3ILOA 4CRJA 1EQ0A 1F9HA 3HD1A 4M5JA 4AD6A 1RU1A 3ILJA 5ETTA 4CYUB 4M5NA 5ETOA 1G4CA 1TMMA 3MCOA 4M5GA 2F63A 4M5IA 2QX0A 3ILLA 3MCMA 4M5KA 3IP0A 5ETSA 5ETRA 3MCNA 3HSZA 3QBCA 4M5LA 5ETLA 5ETNA 4F7VA 5ETPA 1RAOA 5ETQA 2CG8A 1HKAA 3UDEA 1EQMA 3UD5A 4M5MA 5ETVA 4CWBA 1RB0A 3HSJA 3HT0A 3UDVA 3KUGA 1KBRA 1DY3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HSG A;  3KUE A;  3ILI A;  4M5H A;  1TMJ A;  2BMB A;  4CYU A;  4PZV A;  1HQ2 A;  1RU2 A;  3HD2 A;  1EX8 A;  3KUH A;  2F65 A;  3HSD A;  3HCX A;  5ETK A;  1Q0N A;  1CBK A;  1IM6 A;  5ETM A;  1RTZ A;  3ILO A;  4CRJ A;  1EQ0 A;  1F9H A;  3HD1 A;  4M5J A;  4AD6 A;  1RU1 A;  3ILJ A;  5ETT A;  4CYU B;  4M5N A;  5ETO A;  1G4C A;  1TMM A;  3MCO A;  4M5G A;  2F63 A;  4M5I A;  2QX0 A;  3ILL A;  3MCM A;  4M5K A;  3IP0 A;  5ETS A;  5ETR A;  3MCN A;  3HSZ A;  3QBC A;  4M5L A;  5ETL A;  5ETN A;  4F7V A;  5ETP A;  1RAO A;  5ETQ A;  2CG8 A;  1HKA A;  3UDE A;  1EQM A;  3UD5 A;  4M5M A;  5ETV A;  4CWB A;  1RB0 A;  3HSJ A;  3HT0 A;  3UDV A;  3KUG A;  1KBR A;  1DY3 A; 
#chains in the Genus database with same CATH topology
 3TNV A;  1T9T A;  4C8Y A;  2GFF A;  1Q0N A;  5CZX A;  3EUN A;  3UCG A;  1XNR J;  1Q7L B;  2BE2 B;  1Q16 B;  2RQK A;  4DFP A;  1R0A B;  2JRS A;  5LSR A;  2ASJ A;  5KFM A;  3FQL A;  2BUN A;  3DI6 B;  3NWR A;  4ED3 A;  1K73 T;  4AL7 A;  3TA2 A;  1VHI A;  4U96 A;  3NGT A;  1RAA B;  2AIR B;  2RSQ A;  1LQ9 A;  2AGP A;  4LF2 A;  1HHT P;  3PW2 A;  3DLK A;  1YRT A;  4USH A;  4CCH A;  4OI0 A;  5J1N A;  1U7L A;  2MLX A;  2XLJ A;  3NWG A;  4I68 A;  5FJ4 A;  2FHO B;  3VCD A;  2ZH5 A;  5IFM A;  2RML A;  2EVZ A;  3BKT A;  2FZC B;  1PYS B;  2H9Z A;  1XMO J;  4I64 A;  4XK8 C;  1N33 F;  5DDP C;  1F6T A;  1SKS A;  5ETR A;  4J9U E;  4F7V A;  3GZ7 A;  3AJ2 A;  2JNJ A;  2HSE B;  3H98 A;  3CF5 Q;  2J7U A;  1RP5 A;  2YKQ A;  1U1Q A;  4RX6 A;  2PO4 A;  3FEX B;  1OQ3 A;  2F4F A;  1S1T A;  3JYT B;  3I87 A;  3S01 A;  1EKS A;  2WW4 A;  3OFG A;  3B8H A;  2NXJ A;  4QOT A;  2CNL B;  1MML A;  2R7W A;  3GV5 B;  4NLT A;  3PYE A;  1FER A;  2R7Q A;  1IXK A;  2DGO A;  2I5J B;  3BN7 A;  1B70 B;  4ZHR B;  1RTH A;  4S0M A;  2PMH A;  5D15 A;  4NXN J;  1HQU B;  1NSA A;  5KFE A;  1HNW F;  1QVF R;  3KMS A;  4IR9 A;  4N47 A;  2DXD A;  2L9W A;  2ZD1 B;  1XQI A;  2D3O 1;  1X5O A;  4KGZ B;  3DRX A;  4DCO B;  4H4M A;  3HSD A;  1C4C A;  5KFA A;  1RWN B;  1YQH A;  2OFG X;  1VQS A;  1TV6 A;  4TQS A;  1BLU A;  4X4U A;  2IC3 B;  2WVC A;  3CJ0 A;  3CCS S;  3OTE A;  2XMV A;  2LDI A;  3R7S B;  2OSR A;  4O4G A;  4KJI A;  3UNY A;  3P6Y C;  3ZZ0 A;  2F1F A;  4CYU B;  4CO4 A;  2B6A B;  1S97 A;  3C66 A;  4LRD A;  4R5P B;  2CQG A;  4YP3 A;  2BOP A;  4RJV A;  1RT3 A;  3GII A;  1CJV B;  1UTA A;  5K8M A;  3O8W A;  5KFS A;  3CME S;  2BQ3 A;  1IWA A;  1RAJ A;  2B5J B;  2CPD A;  4GKJ J;  3GG0 A;  4DL5 A;  4JI0 F;  2JLF A;  4QJV A;  1F3V A;  1UFW A;  3OXL A;  2VDH A;  1Q82 T;  1G6B A;  3BV8 A;  5J1E B;  2ZUG A;  3O2I A;  2BV3 A;  2DNH A;  2BA9 A;  1X4H A;  2R7R A;  2Q66 A;  2CQI A;  1HAR A;  2B4U A;  3OJU A;  2A2D A;  5LSO A;  1RWP B;  4QR0 A;  1GAO A;  3GG1 A;  3GON A;  5G4D A;  4CH7 A;  5DG9 A;  3R6L B;  3R3T A;  2HW3 A;  1DUR A;  1W26 A;  1QSL A;  4FVM A;  1UJ6 A;  4C8M A;  1RKI A;  4X4S A;  4CLZ A;  1KQG B;  4MAK A;  3GYX B;  1LNQ A;  3TYT A;  2DNQ A;  3MFH A;  2I9S A;  4DR7 F;  2V8V A;  4DUZ F;  3C6U B;  2VPW B;  2HQD A;  2J0W A;  1U1L A;  3UN2 A;  2FHK A;  2IY5 B;  4B3M F;  1RTJ B;  4X65 J;  1EKR A;  2ZEJ A;  4ICL A;  3EE3 A;  1B4S A;  1IJF B;  1KVK A;  5KFZ A;  4F50 A;  4BWM A;  2F9J A;  1SQG A;  4DPY A;  1C0U A;  4DSF A;  1MRO A;  2RUG A;  2B7B B;  3EZ5 A;  2JLE A;  4C4W A;  3AFG A;  1S0V A;  4OLP A;  3VAH A;  4B08 A;  3ETO A;  3M30 B;  2HHU A;  3GV8 B;  2YNI A;  4U8Y A;  1RAO A;  4V19 X;  2HZC A;  1I94 J;  3TW0 A;  3R5A A;  1KHV A;  5KFI A;  3V2U C;  3D1H A;  1FEE A;  3NP5 A;  1FRI A;  3UO0 A;  4DR4 F;  1M5K C;  2QO3 A;  4ED7 A;  3PR4 A;  4ECT A;  1RYR A;  1HQE A;  2MQO A;  4KY3 A;  3HKZ D;  2EK6 A;  2XHC A;  4USW A;  3B6B A;  3BDP A;  4DV5 F;  3HHN B;  2XSJ A;  2FVQ A;  1HI8 A;  2W4D A;  1TR0 A;  4U8V A;  3WIV A;  3PO4 A;  4HDH A;  4DL4 A;  2RF2 A;  4K5R A;  4DV4 F;  1H6K X;  3ADA C;  5HO4 A;  4LBH A;  4EZ6 A;  5IC6 B;  3JSM B;  5E3P A;  4RKU C;  3G8S A;  5CYM B;  3UDV A;  4EO6 A;  2DIU A;  1FJG J;  5LL6 d;  1XWL A;  2FJX A;  4KHP F;  1L3S A;  2ZIT A;  3ILJ A;  1TKT B;  1WG1 A;  2GHP A;  3C15 B;  3EJM A;  5BR8 F;  3FDS A;  3PEJ A;  3EZO A;  1A9N B;  3R9L A;  3R1H A;  3T6B A;  3VWS A;  1GTH A;  4OV6 A;  5GVQ A;  1EJ7 L;  2E1A A;  3AB4 B;  3CMA S;  5J2P B;  1RTD B;  2RT3 A;  3IG1 B;  3NNC A;  4NPO A;  4ECY A;  2GNK A;  5F9L A;  2CJY B;  1UPP A;  2QLJ B;  2P6T A;  2ZKU A;  1G2E A;  5D8H B;  2DNM A;  3BSN A;  1FNO A;  2EEY A;  1SC1 B;  4Z7C A;  2XSF A;  3QPI A;  3GB0 A;  4R25 A;  3CC4 S;  1NH7 A;  4HHJ A;  5KFR A;  1RBA A;  3PYG A;  2FC8 A;  4RNH A;  2E5H A;  4IRK A;  1S10 A;  5HMX A;  4NCG A;  3I0S B;  1WC4 A;  2DEI A;  4PXB A;  4PZV A;  3HFZ B;  5KT7 A;  4HTI A;  1WAC A;  2MQ8 A;  3NMA A;  3IP0 A;  2JSX A;  3W5Z A;  1U0H A;  3RRG A;  2N7Y A;  2HQI A;  5AXN A;  4DMZ A;  3OFE A;  3BR9 A;  2XYP B;  2QA4 G;  2GML A;  1S1U A;  4XTT A;  3HVR A;  1N6Q B;  3RGI A;  2L08 A;  3KUG A;  3JSR A;  4UZC A;  1NCL A;  3OR1 A;  3DDK A;  4P2S A;  4I2P A;  1JKH A;  5KFH A;  1UVN A;  3D28 A;  2VZ9 A;  1CJT A;  3OD2 A;  3CO0 P;  4DL2 A;  2J76 E;  4LRE A;  1WC1 A;  4DV1 J;  3IR7 B;  2UUW A;  2ATC B;  4QIF A;  1BY9 A;  2JLG A;  1EIY B;  2KKH A;  2P2C B;  1M5V C;  1BHN A;  3W9H A;  2DR8 A;  3FNN A;  3KG1 A;  4YHH J;  4DQI A;  2FZG B;  1YJ9 S;  4DSI A;  1VQY A;  3VAL A;  3RBE A;  2OO4 A;  1GQE A;  4L6V 3;  4FYY B;  3V6H A;  4DWI A;  1Q86 T;  2JH3 A;  1RT4 A;  2EW9 A;  4RR5 A;  3MMJ A;  1U47 A;  2L9D A;  2BJ8 A;  1UKU A;  1U09 A;  3Q2S C;  2HHH F;  2VFR A;  4ZVG A;  1S9E A;  1NK5 A;  2BM1 A;  2YWW A;  1KTV A;  5KFG A;  1NDL A;  1RE1 B;  1XR5 A;  1ZM3 A;  3D1Q A;  3T9N A;  2R7V A;  3R5C A;  4NYP A;  2CQP A;  1TQL A;  2HFN A;  2PA8 D;  3MI7 X;  4TY8 A;  4DUY J;  1N0V C;  2G1H A;  3L7P A;  3H2U B;  1T3N A;  2GQC A;  3CDU A;  5FDL A;  4OZ0 A;  3A8E A;  1BQM B;  2CQ1 A;  2CZ9 A;  2FHM A;  4DG1 A;  4CTA A;  1VQN S;  3KYL A;  5THW A;  1CS4 A;  3EDQ B;  4Y2K A;  1N32 J;  5B7W A;  4U7U D;  2KYX A;  2B9Y A;  4KKO B;  3DGV A;  4OHX A;  4L3N A;  4CRJ A;  1JXV A;  2D9P A;  4PWU A;  1L3K A;  5K9F A;  2HHQ A;  3NGS A;  5T7L B;  5A8W A;  4JV0 A;  1FJC A;  1KQF B;  1LWF B;  4A8M P;  1RHM B;  3QO9 A;  3DXS X;  1FK9 B;  2DXF A;  2NUH A;  3M8R A;  2HK2 A;  1WEL A;  4DFJ A;  3PX4 A;  4J9N A;  1I3O B;  2R8J A;  3ZZR A;  3HHL D;  4NXM J;  1U02 A;  3MGJ A;  2OH2 A;  2EFQ A;  4JI7 J;  2MKY A;  3KUH A;  1D9F A;  2XS7 A;  1D9D A;  1CBK A;  4WXO A;  2RHS B;  2DJW A;  1VCT A;  5FLX U;  1FKP B;  2CPH A;  3IBF B;  2EC0 A;  2DR5 A;  4KAI A;  1HQ2 A;  2VOP A;  1OPI A;  3MEE B;  4TU8 A;  4J9S A;  5JJB A;  3G4S S;  4LFB F;  2AD9 A;  3GJS B;  4MIA A;  4CLW A;  2VD3 A;  2WK4 A;  1E6Y A;  4ZN1 A;  2XEX A;  1L3U A;  3MM6 B;  4F3Q A;  4JI1 J;  2C42 A;  3NAI A;  3W2V A;  4ZA1 A;  3OL8 A;  2UUC J;  3OUY B;  5KFN A;  2CNK B;  2A6O A;  3MAH A;  4WF9 Q;  2QRR A;  3R5G A;  4B9U A;  1HNZ F;  1UPM B;  1NHV A;  3DGP A;  4MIB A;  4RW7 A;  3V6D A;  2E1R A;  3DMJ B;  4BLG A;  2ZBI A;  5HQM A;  2D7S A;  3ZNJ 1;  5CAB A;  2LEA A;  5KFX A;  2H3E B;  2CQD A;  3SCK E;  1TFY A;  1WC0 A;  4DX7 A;  3AXM A;  2R8G A;  3DOL B;  2O67 A;  3DHW C;  1OY8 A;  1K0V A;  2WHO A;  3PX6 A;  1DQA A;  3GCW P;  2HBY B;  2HWT A;  3QFH A;  4RBU A;  3TRG A;  3MXH P;  3DU5 A;  2YKP A;  2DNG A;  4ANE A;  4QCL A;  4WFZ A;  3K0J A;  4NLS A;  1I51 B;  1HYS A;  4NRT A;  3X1L B;  3FC9 A;  5AT1 B;  2WOM B;  3LWM A;  4M94 A;  2QMU B;  1NLK L;  5HQ8 A;  1EAY C;  3HXM A;  2BKO A;  3W9J A;  3PJX A;  1SVD A;  2GVZ A;  4Y6I A;  1REV B;  3LPY A;  1VS3 A;  2XGP A;  3UDC A;  1TKZ B;  2E1C A;  2IM3 A;  3B4M A;  1DJ0 A;  5CCM A;  3W2W B;  2JEI A;  3J7A N;  3BBB A;  3MR2 A;  1UP1 A;  1VQ8 S;  3SV4 A;  2DGQ A;  3VAK A;  4USJ C;  1LWX A;  5K14 A;  1B64 A;  3MMA B;  1FNM A;  2COL A;  5JVG Q;  3M2R A;  4ZOS A;  2YX7 A;  2PI5 A;  3CDA A;  2RRN A;  3M8Q B;  5DRK A;  3PX0 A;  1TK0 A;  1TEL A;  4DX6 A;  3MUM P;  3GYN A;  1WF1 A;  5CHC B;  2LDY A;  4KR0 B;  2V2Z A;  4P52 A;  3DU6 A;  1KQS R;  1X0P A;  4YDD B;  3CB4 A;  4HTJ A;  4PYD A;  5FLX Y;  2V4R A;  2K1R A;  2M4M A;  4ENO A;  1UW9 A;  5KFU A;  5BJR A;  3L7U A;  1S0N A;  1TL1 B;  2W4P A;  1Y9O A;  3R5D A;  3V81 B;  3NMR A;  1SH3 A;  2RIJ A;  2YKA A;  3DRP A;  2FY1 A;  2V9W A;  2MZJ A;  5A2Q U;  2GCF A;  2DGW A;  1B7F A;  1M90 T;  3SSS A;  2L3M A;  5HMY A;  4TU7 A;  4QPT A;  4ZLN A;  4DS4 A;  1VRU B;  1IKX B;  3TP2 A;  4A8W A;  1IKW A;  3Q89 A;  1E6V B;  4O3S A;  3KWM A;  2ZBQ A;  3DNC A;  2DGT A;  3DRR A;  2F8M A;  4UUX A;  3NS6 A;  1Y5L B;  2EFG A;  4WK1 A;  3HVT B;  1HHS A;  4C48 A;  2RKI B;  3TUZ C;  5LMU F;  3LP1 B;  2XLK A;  1R43 A;  5DQH A;  1HNX J;  1NZ8 A;  2KFY A;  2FJW A;  2E5L F;  4U6P A;  4M1K A;  1VRQ C;  3VGS A;  1TU0 B;  4OJG A;  4Q5V A;  2EK1 A;  3W66 A;  3FEZ A;  3N6L A;  5E41 A;  4JYA F;  1JB0 C;  3T1A A;  2W1B A;  2R8H A;  2HIQ A;  2G13 A;  4FP9 A;  1QE1 A;  2X51 A;  2RRB A;  3OLB A;  1V6H A;  1FRH A;  2NXE A;  1S6U A;  2FVS A;  7FDR A;  2J9E A;  2DHX A;  3WIU A;  3EGW B;  2VIH A;  3UI3 A;  1B0V A;  1M0S A;  2OFH X;  1F5C A;  3NAH A;  2Y1I A;  1U2R A;  3CIZ A;  2W9B A;  1GK8 A;  2L9N A;  3T9Z A;  3CC2 S;  1RA7 A;  3K5L A;  1AYE A;  5D0R A;  2CIM A;  1KC8 T;  4X62 J;  2CQC A;  3QT6 A;  1F9E B;  3RAM A;  1IWG A;  3TZZ A;  4RW8 A;  5HAN A;  4JI4 J;  2B4P A;  1U1R A;  2BYC A;  5H1S V;  2VG6 A;  2DHA A;  3K8V A;  3Q23 A;  4YR0 A;  2C2M B;  3ZTR A;  3RYL A;  1HWU A;  2KHD A;  2MHN A;  2EFO A;  5KT5 A;  4OJ3 A;  3AY0 A;  1KD1 T;  1X5P A;  4DV0 J;  1KWM A;  2JFK A;  2AQ4 A;  3A12 A;  4F2R A;  4FXW A;  1RAB B;  4C3M A;  3M8Y A;  3TJ8 A;  1CUL B;  3QNW B;  5KG6 A;  3OSP A;  2QFI A;  1N5T A;  1UVK A;  1ITP A;  2DNR A;  2HRT A;  1SXL A;  2G9O A;  3S7R A;  1WD6 A;  1NJX A;  2CKW A;  4X4T A;  4GVL A;  4ED0 A;  4K0K J;  1GMU A;  4M5I A;  1UVI A;  1VGY A;  4E98 A;  1UCN A;  3ZXW A;  3D68 A;  2GO8 A;  3ZNU A;  1LWE A;  3W9I A;  5C5J A;  1U1O A;  1VQK S;  3QYY A;  3DOM B;  3ILO A;  5KFY A;  5D0H A;  4TYB A;  1RGV A;  1SKU B;  4YY3 F;  2V4J B;  1FES A;  1NND A;  2G0J A;  2HVD A;  4OX8 A;  4PWD B;  4RWX A;  1PG5 B;  3H20 A;  3M9N B;  1C0T A;  4OIX A;  2LU1 A;  1TKD A;  2JEF A;  2E5I A;  3BGR A;  3BO2 A;  4WCE Q;  2R8I A;  1NKE A;  3KHL A;  1HHQ A;  2OTJ S;  2AX0 A;  1RHJ B;  3JQK A;  3NCR A;  2QN6 B;  3CJK A;  2RU3 A;  5I42 B;  2XHW A;  4KIA A;  1WF2 A;  1S1V B;  4PR6 A;  1C1B A;  5IC4 B;  2PEB A;  3BS9 A;  2DPJ A;  3AA9 A;  3J7A 1;  3KLV A;  2W7O A;  2C2K B;  4LF8 J;  3U02 A;  3FCW A;  4FN5 A;  4J9P A;  2QA2 A;  1Y7P A;  4LSZ B;  2JEJ A;  2L41 A;  4RW9 A;  1F0X A;  4JI5 F;  5J2Q B;  3PW0 A;  1YZ6 A;  3WX4 A;  1RWU A;  3KK1 A;  3V4I B;  1J5E J;  3RW6 A;  3RB4 A;  1HBM B;  3MAQ A;  4ED1 A;  3LP2 B;  2YXL A;  3R97 A;  3R2D J;  2RS8 A;  5D0E A;  2RS2 A;  5DZ6 A;  2N7C A;  1RHQ B;  4DR5 J;  1BC6 A;  1A6L A;  3J7Y U;  2ILY A;  3Q8P B;  1RHU B;  3KTQ A;  5L1K A;  1U45 A;  2J6S A;  3MMC B;  2Q1L A;  2AYE A;  1YBU A;  3GQC A;  2HVI A;  1JLG B;  4KH0 B;  1UVM A;  4J9R A;  2UUA F;  1F9H A;  2PI4 A;  3R5J B;  4UTG A;  3GPA A;  3AA8 A;  3AQO A;  2C2O B;  4L74 A;  3G2X A;  2HFO A;  5A6W A;  3M32 B;  5AJ3 F;  4XIU A;  2F65 A;  4B3O A;  1LW2 B;  1LK5 A;  3W60 A;  3M8P A;  3JYT A;  1U6B A;  5KFF A;  4NLO A;  1U24 A;  1SC4 B;  2BE7 D;  1FJE B;  1F9F A;  4LF4 J;  2XMU A;  2V8H A;  3IRX A;  3H4B A;  2FPH X;  3A4T A;  1NHK L;  1QLN A;  1IBL F;  4QPX A;  3FUY A;  3I5A A;  2I5J A;  1Y11 A;  3CUL A;  3A8K A;  1KFS A;  3WX8 A;  1HQU A;  3KHG A;  2VFU A;  2EFP A;  2MGZ B;  5E3R A;  3GIK A;  3RTV A;  2BDP A;  2X1F A;  2ZD1 A;  1FFS B;  3JTN A;  3E8O A;  4QIE A;  4J9O A;  1XK8 A;  1S12 A;  3SDE B;  4DUT A;  1H2V Z;  2BX6 A;  4MK8 A;  3MEG B;  2RNE A;  2KT2 A;  2WZ1 A;  2BQU A;  5E3A A;  3G6X A;  2B4O A;  4FF4 A;  2DNL A;  4OI2 A;  2HHS A;  2BVZ A;  3W3S A;  1S59 A;  1RT5 B;  7AT1 B;  4OZ2 A;  4BHQ A;  4WWS A;  3TUP A;  4BS2 A;  2LCW A;  1F2H A;  3BN4 A;  1R6Y A;  3IS9 B;  3BKU A;  3ILI A;  3LAK A;  2HGN A;  2A1B A;  2QJ3 A;  1VBK A;  2B6A A;  2AHO B;  3WZ0 A;  4R5P A;  1OY6 A;  3HHD A;  4K4U A;  1KOO A;  2H5J B;  3EGZ A;  3A8I A;  3QZ7 A;  1AUD A;  2BZ2 A;  2Q6B A;  4WFN Q;  5AXM A;  2HHP A;  1Y0H A;  3SSR A;  3J7Y I;  4IYQ A;  5KFV A;  4UY8 5;  2B5J A;  3HD1 A;  1UET A;  1HLW A;  1GXU A;  2KN4 A;  5K8N A;  1RK8 A;  4O44 A;  2H4W B;  2KJW A;  1DBD A;  4IG0 A;  1SKR A;  3ZZZ A;  1R3N A;  3UWT A;  4C8K A;  1GT8 A;  2V50 A;  1RZM A;  4PPZ A;  2AEF A;  4B9S A;  5J1E A;  2KXH A;  5F3Z A;  2I6W A;  2XB2 D;  3U1N A;  2CFX A;  4OHV A;  4U95 A;  4NLQ A;  5GMK a;  5E3Q A;  5CYJ A;  3UVJ A;  4F4Z A;  3K89 A;  1RBO B;  2FVC A;  1XC9 A;  2ZOM A;  4OYI A;  5B09 A;  4OHY A;  3G8Q A;  2V94 A;  1JLF A;  4K4W A;  5EGY A;  4FNH A;  1WC6 A;  2XQC A;  2DNY A;  4OZJ A;  1FVQ A;  1AZS B;  4J9V A;  2I1R A;  4Q0B B;  3UD3 P;  4A8O A;  4LT6 A;  1U8S A;  1R0C B;  2BJE A;  4PQA A;  5DDR C;  2HQC A;  4CDI A;  2E1M C;  2NXU A;  3D9B A;  1NME B;  2FQQ B;  2FYX A;  2KFZ A;  4LIR A;  3BPS P;  1T95 A;  2RU9 A;  5DG8 A;  3C8Y A;  4A8F A;  1YVF A;  4HYK A;  3I9V 9;  3IR5 B;  3VQT A;  1Q5Y A;  4X4V A;  2DBB A;  4OX6 A;  2CPZ A;  3MEC A;  1WF0 A;  3SI8 A;  2DB1 A;  3QIP B;  1N5Q A;  3H5U A;  4E0D A;  3MED B;  4NYZ A;  3GIR A;  3KLI A;  1W2I A;  2W24 A;  3FGV A;  4IG3 B;  4LRB A;  4CLF A;  1T11 A;  2AMC B;  5T14 A;  2YKN B;  1NB2 A;  3OBI A;  3BH6 B;  3LF0 A;  5F41 A;  3G82 B;  1WEY A;  4LR7 A;  3AT1 B;  3ZTS A;  3IXQ A;  1W25 A;  2CG8 A;  3QLH A;  1FX2 A;  1OIA A;  1J27 A;  2AYM A;  3M2U B;  2YWH A;  1OS5 A;  4X64 F;  4AND A;  2QYC A;  1P6T A;  3CCV S;  5ETV A;  3UCU P;  1RTI B;  2GVD A;  1U26 A;  4ZVR B;  5U47 A;  3HUL A;  3JSM A;  3QRP A;  2ASY A;  5CYM A;  2OHD A;  1APS A;  1X4B A;  2M7S A;  4XO0 A;  1LWC A;  4I56 A;  4LF6 J;  3IMQ J;  1KTQ A;  2VFS A;  1TKT A;  1KON A;  2WW8 A;  1FWL A;  3C15 A;  3HK2 A;  5ADZ A;  2DT9 A;  2E9T A;  5E0O A;  1V3Z A;  4M5D A;  4DV3 F;  4OYW A;  2BM0 A;  2LA4 A;  1S76 D;  3Q83 A;  4LIW A;  5J2P A;  5CXT A;  1RTD A;  1KQK A;  3IG1 A;  3BYP A;  4Q45 A;  2OPR B;  4P7T A;  5E33 A;  3T1H F;  3RAX A;  4GO5 X;  5CH7 B;  3KLG B;  2ZH1 A;  3KG0 A;  4OHW A;  4MKV A;  5D3G B;  1WKK A;  4KFB B;  2P8I A;  4A47 A;  2J8A A;  1ZZN A;  3H42 A;  1GNK A;  4JV5 F;  1SQF A;  4ECZ A;  4RW4 A;  1ARO P;  2C2N A;  2HNY B;  1KVI A;  3K8W A;  3I0S A;  1DHM A;  3B78 A;  2MKS A;  3OQ2 A;  1JLB B;  3HKW A;  3IRW P;  1FVS A;  4N41 A;  3JTP A;  1T94 A;  4WYW A;  2VQE J;  3CW2 C;  2ZBR A;  4Q44 A;  1HNV B;  2IHR 1;  2KG1 A;  3BO4 A;  4DR6 F;  4A8K A;  2MXY A;  2QFJ A;  2FY8 A;  2EG1 A;  3Q8Q B;  4Q7A A;  2HVH A;  3T1Y F;  2CJQ A;  1CC7 A;  1C1C A;  3CCZ A;  1N6Q A;  3VV2 B;  2FVR A;  3HMJ G;  5M2U A;  3JS9 A;  5J2N B;  2AJ4 A;  3OSN A;  1EQM A;  1N5S A;  4MKB A;  4ID8 A;  4WE1 A;  4DX5 A;  1N34 J;  4NI2 B;  4QU6 A;  2ZH6 A;  4B9L A;  1N88 A;  1RWO B;  2UU9 F;  3ET6 A;  4LFC J;  3LW5 C;  1FXR A;  3VAJ A;  3N01 A;  1QY7 A;  4AYB D;  1HR0 F;  5D4P A;  2VIC A;  2FTR A;  4FF2 A;  3CWJ A;  4IQX A;  2W4C A;  5A8K B;  5GAD U;  2M0G B;  5H9E K;  4CM0 A;  1HD1 A;  3DC2 A;  3NGK A;  1X5T A;  2XUL A;  4RNM A;  3CSK A;  3NCP A;  1SUQ B;  2FC9 A;  1X4A A;  2D3O R;  5KFD A;  1VMB A;  1CSJ A;  3OR2 A;  4RU9 A;  4ZIV A;  4EBE A;  2G1D A;  4PG5 A;  5C24 A;  3MPU B;  4DDF A;  4V1A k;  3HP6 A;  1PCA A;  3EVM A;  4CH0 S;  4IO1 A;  4I1T A;  2VQF F;  2BQR A;  2BW2 A;  3NBP B;  2LXF A;  9ATC B;  1Q78 A;  3QZ8 A;  3HHL C;  4N76 A;  2Z2Y B;  1Y4Z B;  2OLW A;  4KSE B;  2QV6 A;  4TN2 A;  2R7O A;  3BZQ A;  1X60 A;  2R4F A;  5F9N A;  3CCJ S;  2XWX A;  4B3R F;  3MM5 B;  2ZH2 A;  1HW9 A;  1YBA A;  1BD6 A;  4KGM A;  1TVR B;  1R8A A;  2VON A;  1TAQ A;  4TLQ A;  2QA1 A;  2DY9 A;  2WBR A;  4IO9 Q;  4F4A A;  4RBT A;  2DPI A;  4KKO A;  3GFY A;  2HBR B;  1N48 A;  4OZ1 A;  3H90 A;  1U1M A;  2LLZ A;  4J9L A;  2NLW A;  5A0Y A;  2MQN A;  4MKA A;  1LWF A;  5IQ6 A;  2CYY A;  2OPP B;  2LP4 A;  1FK9 A;  3TJA A;  3RB0 A;  2YNG B;  2KO1 A;  4KHR A;  2J8S A;  5I3P A;  1I6J A;  1YBT A;  4LR8 A;  2QC3 A;  4LSL B;  3KLH B;  4YB6 A;  1SBR A;  2RHQ B;  3G8T A;  4ERD A;  4K8R A;  3KNA A;  5KG5 A;  2P9C A;  1JXL A;  3MOZ A;  5GMD A;  3MMB B;  5B0F A;  1HMV B;  2M52 A;  3G6E S;  4YOE A;  2LA6 A;  5GAD I;  4CO2 A;  5F8G A;  1S48 A;  1ZOT A;  3J81 U;  4P75 A;  4H4K C;  3HHK A;  4JUZ A;  3QID A;  4UST A;  1FKO A;  2FD2 A;  1URN A;  5K8O A;  1EQ0 A;  3TUJ C;  1S6Q B;  4GVB B;  2LXU A;  1FO1 A;  1H2U X;  1T3O A;  3MM6 A;  1HKA A;  2YX4 A;  2RIL A;  3MFI A;  1IBM F;  3RBD A;  4OMF G;  2ADB A;  5LSL A;  3THT A;  1U0S A;  3OUY A;  5KFL A;  4RW6 A;  3CDE A;  3J7Z T;  4IFY A;  4PPD A;  2KM8 B;  2UVU A;  3HFV A;  1MN7 A;  3FBB A;  3L4B C;  4J9M A;  3HHL A;  3DMJ A;  3SQG A;  2B9W A;  4PG7 A;  2E9R X;  3D0H E;  4K7Q A;  4PG8 A;  3DOL A;  2M8H A;  4X66 F;  1EP4 B;  1X9W A;  4F2S A;  2ZFH A;  3CJ4 A;  1XNR F;  2EPI A;  3A13 A;  3CT9 A;  2M5Y A;  2XZW A;  3E3X A;  3L7O A;  1NK0 A;  3SZ2 A;  4DR1 J;  2B43 A;  4IDK A;  2C3P A;  1CVJ A;  5HJY A;  4I7F B;  3K58 A;  4FBT A;  4X4N A;  2R7T A;  4ZLJ A;  4ZVQ B;  4ZPW R;  2XWY A;  1YK9 A;  3VGV A;  4QWD A;  3DDI A;  1GMV A;  4WTO B;  2QZ8 A;  3VTI A;  3LO3 A;  4PG4 A;  3MCM A;  4CH1 A;  4KT0 C;  1N0U A;  2DEJ A;  3DM2 B;  2KRR A;  3N5B A;  1UFL A;  4EU0 A;  3ZTQ A;  2D69 A;  4C3L A;  3OVS A;  1JLC B;  3EVW A;  1IR1 A;  4FVC A;  3FBC A;  3CD0 A;  2GJF A;  4WZQ A;  2QE5 A;  2C3Y A;  3KLF B;  1XMO F;  1OYD A;  3SEO A;  3MMA A;  3NLC A;  2OPQ B;  4ZPC A;  4QR2 A;  2YWK A;  3MCS A;  3PIP Q;  5HRO A;  4HR2 A;  3QAU A;  2MJN A;  2XY6 A;  4H4K A;  2BJ3 A;  1AA1 B;  4KTQ A;  4FF3 A;  2G2Y A;  2XMT A;  4M95 A;  5AXL A;  1VQ7 S;  1IR2 A;  1A7G E;  3VF0 B;  3PV8 A;  3K5M A;  3FBE A;  3C19 A;  4HHH A;  1JLQ B;  1GXL A;  3DLK B;  4R0J A;  2RH3 A;  3J81 Y;  3DLB A;  2R2U A;  3DKD A;  1QSY A;  1HBU A;  4L76 A;  2QTW A;  3EDR B;  1TMM A;  3PKY A;  4NCA A;  2RUS A;  4OZ5 A;  1F5B A;  4ELV A;  3V81 A;  5HMZ A;  3MOJ B;  2GV1 A;  3OFF A;  1SJ4 P;  1V5I B;  4PXD A;  4ECX A;  2YKM B;  2W8L A;  3LGH A;  4ED5 A;  3GFZ A;  2P9E A;  4X2B A;  1CPZ A;  4OZ3 A;  4LQ9 A;  1VQ4 S;  1H73 A;  1AXQ A;  1U1P A;  1RXO B;  5DDO C;  6AT1 B;  4K2X A;  5T41 A;  4DU7 A;  1VIS A;  5KG3 A;  4C9D A;  4PXC A;  2BE9 B;  4N7T A;  1S1T B;  1L3T A;  3HVT A;  3HJF A;  2PMZ D;  4P74 A;  3I56 S;  4FYW B;  4O4R A;  2ZJR Q;  2OMO A;  2A3J A;  4C11 A;  4RZR A;  2OD6 A;  2H4Y B;  4NAS A;  2F4V J;  1JNZ B;  2J7W A;  2H65 B;  4FNI A;  1F1B B;  1LXN A;  1OYE A;  3HDS A;  2N3O A;  1RTH B;  1Z2Z A;  2ALZ A;  2WSF C;  2LQB A;  5KG0 A;  3V6K A;  1O0P A;  3CIM A;  3KK2 B;  3H0P A;  3BGF A;  1OJ4 A;  4HI2 A;  3J81 j;  2IFX A;  1HBN B;  3O44 A;  1N36 J;  1TZ0 A;  4H4M B;  3IM8 A;  2ZUA A;  4RPF A;  2XI3 A;  3G86 A;  4CLY A;  5CAA A;  1TV6 B;  4C0B A;  3P8B B;  2DHS A;  4CLS A;  3UN5 A;  1NK9 A;  3NNA A;  3M1V A;  5JMN A;  1XMQ J;  1WOO A;  2J9D A;  4MKY A;  4W90 B;  5IT4 A;  2ZDO A;  4WBF A;  3UR0 A;  2KVI A;  5A76 A;  3DCA A;  1RT3 B;  3AOB A;  1X5S A;  1Q79 A;  4F04 B;  4CO0 A;  1RYS A;  2KB2 A;  2OEJ A;  2JOQ A;  2EFV A;  2D3U A;  2HZA A;  1VDH A;  4X65 F;  3HSG A;  2DRB A;  2ROG A;  4CT9 A;  4FKX A;  1J2V A;  3GYG A;  3BKF A;  3TAM A;  1WHX A;  2DYA A;  4ZIW A;  1FE0 A;  3BQ0 A;  1CUL A;  3M2V A;  3VGT A;  2FJD B;  4WP8 A;  1RT1 A;  2ZH4 A;  4LF9 J;  2MKC A;  3N0V A;  1ZS6 A;  3U1L A;  3FMB A;  4ED8 A;  2BXJ A;  3R2C J;  1NB7 A;  2QT7 A;  4ZJQ A;  1FI4 A;  5KT6 A;  3D3B J;  2A6M A;  1FDD A;  1HNI B;  2XTJ P;  2ZBC A;  3C14 B;  2LEC A;  4F0M A;  5L1J A;  2BRK A;  4F0K A;  3T6J A;  2AGO A;  2IAJ B;  3I96 A;  4G1Q A;  1CJU A;  4DQP A;  1KBR A;  1U2C A;  3DOM A;  4IH5 A;  1RT2 B;  3SCI E;  3PRD A;  5KFB A;  3CE8 A;  4ZPT R;  4CO5 A;  4HL9 A;  2RQC A;  3FCH A;  4RUC A;  2DCL A;  3F0N A;  4DL3 A;  1YJT A;  1DAR A;  2D3Z A;  3MHY A;  4MT1 A;  3IWN C;  4PWD A;  4KO0 A;  2W01 A;  2IMO A;  3PJ9 A;  3V5R A;  3JQJ A;  4O3P A;  1JJ2 R;  1C0U B;  2F8E X;  5KOX A;  1FJG F;  2HQ3 A;  4J7C A;  4JV2 A;  1VFJ A;  4Y00 A;  4QQB A;  2HFS A;  3LP0 B;  4WFB Q;  5I42 A;  5B0B A;  4DS5 A;  3PYD A;  1UFK A;  4MJK A;  6FDR A;  5L9N A;  3KHH A;  2JX2 A;  2AV5 A;  3SIP B;  4NCB A;  1LFW A;  1FRM A;  2FJE B;  4DL6 A;  2VA2 A;  4A8X A;  4ZCL A;  3KDO A;  5E2Q A;  1VQP S;  2XI2 A;  2M9K A;  3AOC A;  2MPU A;  3VVU A;  5J2Q A;  3MR6 A;  3V4I A;  3G6V A;  2X7I A;  2Z2Z A;  4NML A;  5FII A;  3SFG A;  4DR3 J;  3CNQ P;  2AP6 A;  4R0E A;  2DK2 A;  5B0G A;  4RNF A;  2YTC A;  3H2V E;  1HWI A;  2XCP A;  4ZPB A;  4U7U K;  3HZG A;  3TO8 A;  2WVE A;  4X4Q A;  1LW0 A;  1CQN A;  1VRT B;  2ZZM A;  1JLA B;  3ITH A;  4DN0 A;  2X1B A;  3K59 A;  1P9Y A;  4AQY J;  4JB8 B;  1FWP A;  4KGV B;  3CJ5 A;  1JLG A;  3FRY A;  1YJN S;  4E8U A;  1JQG A;  1G7C B;  2JHE A;  4LBI A;  1L3V A;  7FD1 A;  2DH7 A;  3H2L A;  1ZM9 A;  2G2Z A;  3PW7 A;  2X3D A;  4NMX A;  2F7V A;  3QWP A;  4RBV A;  3SCL E;  1TKX A;  1RT6 B;  4LR9 A;  1OWX A;  1HWJ A;  3RJM B;  4NLG A;  3UE2 A;  1XIQ A;  2ASL A;  5DZ7 A;  2YWG A;  1K0T A;  5ETQ A;  4NLR A;  1I5O B;  3NEK A;  2YH0 A;  4ZJO A;  4Q8F A;  1RCO B;  4ELT A;  3ICL A;  3PNI A;  4DV1 F;  2MGZ A;  4X4R A;  3SBM A;  2CWK A;  2IBO A;  3MEK A;  3LGM A;  2UP1 A;  2CPX A;  2MQM A;  4O3O A;  1RSC A;  5BYQ A;  2NPF A;  1FRL A;  4DR2 J;  4NCG B;  4I2Q B;  2K06 A;  1Q95 G;  2V8G A;  5GME A;  3O1L A;  4YHH F;  1KOH A;  2IM0 A;  3MEG A;  4DPX A;  4QIG A;  1SIW B;  1MLA A;  3D0G E;  1NPP A;  1VBZ A;  2BAC A;  1RT5 A;  2QLF B;  2I2Y A;  1JK9 B;  3KJV A;  3TA0 A;  1U0H B;  1S0M A;  2CXE A;  4KBI A;  1X8D A;  3IS9 A;  1S7I A;  2YNH B;  3O5T B;  1S1U B;  1K1Q A;  1YJW S;  4CIO A;  3LQV A;  4DFM A;  3I5C A;  4Y3C A;  1YG0 A;  2AEM A;  2PDA A;  4Q2L A;  3R27 A;  2KH9 A;  4DUY F;  2B9X A;  4I2P B;  4NLY A;  4ED6 A;  4EEY A;  1IBL J;  1KVJ A;  2NPI A;  1C4A A;  1CJT B;  2OAU A;  2QYG A;  1IKY B;  1ZPW X;  1UVJ A;  3FZB A;  1XR6 A;  5E7O B;  4B3T J;  2FLO A;  1TK8 A;  4HVZ A;  1B0T A;  3PHE A;  2FGO A;  4C8L A;  3BB5 A;  3PXG a;  2H48 B;  2E9Z A;  3DYA B;  1M5H A;  4WKR A;  2V8P A;  4C0O C;  1MN9 A;  1H7W A;  4NRU A;  4JI6 J;  3PW4 A;  3VZI A;  1N32 F;  4OYZ A;  4ID5 A;  4L75 A;  2HRY A;  3A3N B;  5C42 A;  1RT4 B;  1DTT B;  4PAB A;  2Y0B B;  1S77 D;  1S57 A;  1S9E B;  3LUY A;  4TU9 A;  4ZIT A;  3KG4 A;  3BGO P;  4DOZ A;  1RIS A;  4HHU A;  4WYL A;  3NXZ A;  4DL7 A;  3B4D A;  3ISZ A;  3WQP A;  1DRZ A;  1NRK A;  2ZWO A;  1N54 B;  4NXM F;  5D4N A;  3MM8 A;  1JJH A;  2DIS A;  3U7J A;  3I5B A;  4JI7 F;  4C8O A;  3VHQ A;  2DCU B;  2CUY A;  2YQ0 A;  2UXB J;  4NLP A;  1KSP A;  4UF4 A;  5FDL B;  3UN3 A;  4LF7 J;  3OHA A;  2V68 A;  5A8R A;  3ZO7 A;  4QBU A;  4DXL A;  2YX1 A;  1S9G A;  4DG1 B;  3TZX A;  4Z2X A;  4B9N A;  1JWW A;  1KP6 A;  2XMA A;  3Q8R B;  4N8O A;  1ZH5 A;  3QIP A;  3QFW A;  2M70 A;  2YQ3 A;  4DV2 J;  3MED A;  3EM1 A;  1SB6 A;  2G0C A;  3KLE A;  4IG3 A;  4O23 A;  4JI1 F;  2ACM A;  5ETN A;  5L1I A;  1NK6 A;  4WFA Q;  3OFH A;  2UUC F;  3CMQ A;  1RT7 A;  3FSX A;  2SXL A;  5H9F K;  4GMK A;  3NGU A;  4PRF A;  3PAC A;  2CNO B;  3QO9 B;  4YFU A;  1R7I A;  2DGU A;  3A8J A;  2IVF B;  1CLF A;  4FDF A;  3QT8 A;  4J9K A;  2HKE A;  2OSQ A;  3R8Y A;  1ZPV A;  3ENQ A;  3QSI A;  5DLF A;  1RDR A;  4UOG A;  3B82 A;  1FT8 A;  1H3D A;  3GE9 A;  4LFA J;  2LQ8 A;  3T5K A;  2DXE A;  1SV5 A;  4URS A;  5G0R B;  2HGM A;  4AL5 A;  4W92 B;  2PMW A;  1H72 C;  2MDA A;  4GC7 A;  4D3H A;  5CD4 A;  2HFZ A;  2BJ1 A;  4N5S A;  4GKK J;  4ES1 A;  3H8Y A;  1N4L A;  3G9C A;  2NUU G;  3FSY A;  1IBK J;  4MTP A;  4PQU A;  2HS3 A;  5D0G A;  3RG6 A;  5MAO A;  3IGV A;  3VQS A;  4GC6 A;  1S6O A;  1E6Y B;  3GU0 A;  3M8Z A;  1RI7 A;  2IDE A;  4P9S A;  1P1T A;  3IBW A;  1YJV A;  3P4U B;  2DIT A;  3SQO P;  2OPR A;  4MK9 A;  5F8L A;  4WII A;  1VHF A;  2GA7 A;  1EZZ B;  2OI2 A;  4RW7 B;  3V6D B;  1YLX A;  3BR8 A;  2JWN A;  5D3G A;  2HG4 A;  3THP A;  4ES3 A;  1YJU A;  5KT2 A;  4URQ U;  2VFV A;  1VR6 A;  1RA6 A;  1GX5 A;  1QJH A;  1X4F A;  3CDW A;  4F02 A;  5HBM B;  3P96 A;  1DLO B;  2BAN A;  4USK A;  2YVS A;  1RU2 A;  4XDD A;  4DV7 F;  3VAG A;  3QGH A;  2HNZ A;  5HJX A;  2R9L A;  4FS2 A;  2M2B A;  2VKR A;  2UXC J;  1FCA A;  1VQL S;  2C3O A;  1B3T A;  1NAQ A;  1KS2 A;  1N5V A;  2ATL A;  3OV7 A;  1X4E A;  4OX9 J;  3EXY A;  2LU2 A;  5IV4 A;  3PO5 A;  4YN3 B;  2WAQ D;  2X1A A;  4P10 A;  2KZM A;  2IM1 A;  1FD2 A;  4RL1 A;  2OTL S;  4UT4 A;  1T9X A;  8ATC B;  4WFY A;  5J2N A;  3F41 A;  1AUS L;  4EYH B;  4ZVE A;  3SCJ E;  5K14 B;  4IH7 A;  4NI2 A;  3LWL A;  2YPZ A;  1KDN A;  4DHV A;  5HVH A;  3V4M A;  4LQ3 A;  1NK4 A;  1WJ9 A;  4MK7 A;  5F8J A;  4OFZ A;  1JJ4 A;  1S7H A;  2XGQ A;  4OZN A;  3MR7 A;  4EBD A;  2VPZ B;  2JC1 A;  2XCA A;  3TAN A;  1TL3 A;  1FDN A;  2D1C A;  2NS1 B;  3T5J A;  2PE8 A;  5GAG U;  3ZC4 A;  3UD5 A;  5A8K A;  4H4O B;  2EBG A;  3FJ2 A;  4WPA A;  3GSI A;  1FWK A;  8AT1 B;  1PO6 A;  2GZO A;  3DRS A;  3CCW A;  5HI7 A;  1HNX F;  1WC3 A;  2YNF A;  1SUQ A;  5I4M A;  2M8D B;  1S1X B;  4K59 A;  1WOP A;  2K1R B;  4I4B A;  1M5S A;  1KNZ A;  3PG9 A;  2AF6 A;  1VK3 A;  2JL9 A;  4P72 A;  2NZC A;  2MKI A;  2GX8 A;  4TYA A;  3US5 A;  4ED2 A;  1KHW A;  3OVB A;  1TL5 A;  3KMQ A;  2UUB J;  2Y0S D;  3CXC R;  4YQW A;  4L72 B;  1SH0 A;  3M6V A;  1WKL A;  3TQ1 A;  4DSJ A;  1AW0 A;  4C98 A;  3GLJ A;  3OXG A;  1WWH A;  4NLD A;  3RU0 A;  1NPK A;  4J9Q A;  4P2M A;  3NBP A;  2FB0 A;  1IJE B;  3AJ1 A;  3KK3 A;  1U2F A;  2A18 A;  2I8E A;  3H5S A;  3H7H B;  4EO8 A;  2BJD A;  1GTE A;  4U9R A;  3ZZY A;  3EGV A;  1NZA A;  2AJ1 A;  1QSS A;  1VOM A;  2CQ4 A;  1IKW B;  1HR0 J;  2V9K A;  5CYQ A;  3MM5 A;  3VVT A;  1NK8 A;  4ANC A;  2HWI A;  4X62 F;  4OL8 A;  3IBC B;  3MPY A;  4C97 A;  3L09 A;  2ZZT A;  3CED A;  4F4W A;  3ZTO A;  2OPS A;  3X3U A;  1P9Q C;  3T19 A;  3QJJ A;  2DO4 A;  4R8U B;  3SXL A;  1NKB A;  4JI8 J;  2WVF A;  3C6T A;  1PIE A;  1TL4 A;  3F56 A;  4ZVH A;  3D6M B;  4J91 A;  2O01 C;  4I6Y A;  3Q24 A;  1RAH B;  4DV0 F;  1URR A;  3AXK A;  4C2M A;  1NM2 A;  1Z4U A;  3SFU A;  2IM2 A;  1KKH A;  2OPP A;  5FD1 A;  1MWZ A;  1TUG B;  3MCN A;  1QE1 B;  1WNE A;  2M88 A;  2MEW A;  3P5T L;  1HW8 A;  5ETK A;  2Y9H A;  4IOC Q;  4LSL A;  5F0U A;  5CZV A;  3I9Z A;  1G4C A;  3P49 B;  3IAM 9;  1X4D A;  2PII A;  4QWC A;  6FD1 A;  2V5H G;  2JVO A;  4CLL A;  5GAG I;  4CWB A;  4K0K F;  1ICE B;  2E7W A;  2ZM6 J;  1HMV A;  1HPZ A;  1V3S A;  4B3R J;  2ZVI A;  4UW2 A;  1REG X;  2DVI A;  1D1U A;  4OYM A;  1Y3K A;  5EHH A;  2NYI A;  5HL7 Q;  1FE4 A;  5J2M A;  2CAD A;  1MWY A;  2BOA A;  4RW8 B;  2OJ3 A;  3POT B;  2PSZ A;  1JJC B;  4ZS6 A;  1S6Q A;  3DLL Q;  4GVB A;  2VG6 B;  2Y3Y A;  4C8N A;  4M63 A;  3KHR A;  2F8H A;  2HIY A;  3FK4 A;  2DRA A;  4ILR A;  5DET A;  3Q8U A;  4ECQ A;  1RWV B;  4LVN P;  4CP5 A;  4CO3 A;  5M2P A;  4OYX A;  1JLE A;  2KG0 A;  2IVM A;  5LMN J;  3V6J A;  1XTZ A;  4KPY A;  2WSC C;  1XNQ J;  4I6W A;  5L1L A;  2HMI B;  3TX0 A;  1GXT A;  4KYZ A;  3G6Y A;  5F8M A;  2GGP B;  4ZMM A;  1S79 A;  2FJB B;  4EYI B;  4CLK A;  1QM9 A;  2MY8 A;  2WVD A;  3UD4 P;  3SMZ A;  3S6E A;  3OTC A;  3OL7 A;  4UUW A;  1BQN B;  4LF8 F;  3GIM A;  3MM7 B;  1FJ7 A;  4W4M A;  4EUV A;  5DQI A;  2HHX A;  1M5O C;  2Y1R I;  4LF5 J;  3N6N A;  2UXD J;  3RZA A;  3GTY X;  1IVZ A;  4MH8 A;  2MJU A;  1LWE B;  4JP8 A;  4IFV B;  3W1Y C;  1U49 A;  2MZS A;  3P5B P;  1J5E F;  2HLU A;  4NA3 A;  2RDJ A;  4FYV B;  1OY9 A;  1TMJ A;  3CCR S;  3DLG B;  1T05 B;  2R2R A;  1SJ1 A;  2ZH8 A;  2GIQ A;  2RQ4 A;  3OL6 A;  1JLC A;  2DKO B;  3CCU S;  1YIJ S;  2X1G A;  4DZD A;  3CJT A;  1C0T B;  2W2M P;  4RUA A;  4Y65 A;  2ZHB A;  2CJA A;  3BGR B;  3ISN D;  4PG6 A;  3DLH A;  2HS0 A;  3KLF A;  3EX7 B;  1V3R A;  1D09 B;  1O8B A;  2FIU A;  4WP9 A;  1HBO A;  1UZD A;  3CJK B;  4O0I A;  1WDT A;  1RB0 A;  2IJN A;  1U4B A;  1KLM B;  4RNN A;  3HPO A;  2Y8Y A;  1C1B B;  4JI3 J;  3MPV A;  1PJ7 A;  2VJV A;  4X66 J;  4Y2C A;  4F4X A;  3QRR A;  1R6V A;  3JSB A;  4B3S J;  2DGS A;  1BE4 A;  4WU3 A;  2QA4 S;  1ZAV A;  3RW7 A;  3Q8S B;  4RW9 B;  3BQ1 A;  3UR3 C;  4NLU A;  4LF4 F;  3W8G A;  1XN9 A;  1RUS A;  2C28 A;  4Q2M A;  2ACY A;  1JLQ A;  2DTJ A;  1EET A;  3TAQ A;  3KK1 B;  3M9M B;  4ZVP B;  2WB4 A;  5E5N A;  2AZ1 A;  2HFU A;  3I6P A;  4HLB A;  2GHV C;  4IRD A;  1H38 A;  3Q0A A;  3K7R A;  4EI2 A;  3QT5 A;  2KU7 A;  3M6X A;  2HYI B;  3NOC A;  2QSF A;  2VBY A;  4K4S A;  1VJW A;  3KJN B;  4HDG A;  2YKM A;  1S9F A;  2MZ1 A;  1WG5 A;  1J5O A;  1SL0 A;  2PC6 A;  3CO9 A;  1MU2 A;  3GP9 A;  3TZW A;  2KXN B;  1IM6 A;  2KXF A;  3BJY A;  2MHE A;  2CDQ A;  1X4C A;  4I6A A;  1K1S A;  5IQQ A;  1DTQ B;  4B3O B;  3M8P B;  2HLT A;  4ATN A;  1S5Z A;  5AXK A;  5HP1 B;  2ZH7 A;  3HD2 A;  5JVH Q;  3IRX B;  4F36 A;  2ZJQ Q;  1VC6 A;  3I0R B;  2HND B;  3UCZ P;  4QW9 A;  1Q8B A;  4M5G A;  3O3L A;  1ZTW A;  4GO7 X;  1IBC B;  2XMK A;  2BRL A;  3ZTP A;  2W25 A;  4OV1 A;  4NE9 C;  2CA9 A;  3GR1 A;  1H2T Z;  3KK2 A;  4QYZ J;  4ILL A;  1UA1 A;  2R2S A;  2FLN A;  2D41 A;  1HBN A;  4MFB B;  2YY3 A;  3BEG B;  2R7U A;  4M5J A;  1N5Y B;  4HH1 A;  3EWG A;  3JAM U;  5GAE U;  2Z0G A;  4ETZ A;  4PYA A;  2G0I A;  4KGK A;  4USI A;  2ZKT A;  1IKV B;  4HAC A;  1MWQ A;  3I55 S;  1WHW A;  4QW8 A;  4WTY A;  1YGY A;  4LBP A;  3MPW A;  2CPF A;  3MUV P;  2AKW B;  4URG A;  1K9M T;  1RJJ A;  1FTC A;  4L73 A;  2F3J A;  3PM9 A;  1YSJ A;  1ZBT A;  4W98 A;  2UVW A;  2MTL A;  5KFP A;  5A2Q Y;  1UEV A;  2GW8 A;  3OHB A;  4PCQ A;  5KT3 A;  2VKZ G;  5LT5 A;  4O44 B;  2NRE A;  2O1P A;  4IG0 B;  3KJF B;  1OQ6 A;  3MR5 A;  4NEZ A;  4ZVT B;  3GIJ A;  5ETO A;  4EWT A;  5CQG A;  3SYZ A;  3MCO A;  4BDP A;  4YS2 A;  3DOK A;  3GJT B;  2HFV A;  2O66 A;  4KRW A;  3IAS 9;  3TVY A;  4HEA 9;  4DF8 A;  3W63 A;  1RTZ A;  4P2X A;  2IJF A;  3VZH A;  1UWB B;  4K4Z A;  2KL8 A;  2G4B A;  4G65 A;  3UVJ B;  1QD1 A;  2E5G A;  2E66 A;  3FRZ A;  2ZJP Q;  5B0D A;  3AAW B;  2U2F A;  1HNI A;  3C14 A;  1ELO A;  1JLF B;  4OQJ A;  1S1W B;  2IAJ A;  2MLY A;  1EB0 A;  1RT2 A;  5ETL A;  4F26 A;  1OSC A;  1S49 A;  2XMM A;  3NS7 B;  2BE2 A;  4ECU A;  1FDB A;  1RWX B;  3WBZ A;  1R0A A;  2E44 A;  2QL7 B;  4CLP A;  4QWA A;  3DI6 A;  4KB7 A;  4QWB A;  1R8C A;  1FDA A;  2CVI A;  1U1N A;  2YBV A;  4I67 A;  1P1L A;  4A4J A;  1XER A;  2I0X A;  1PSD A;  2CJ9 A;  1KRP A;  4K5S A;  3JXO A;  4A8Y A;  4LF6 F;  3A3O B;  4F3M A;  5ETS A;  3MEC B;  3LP0 A;  3E51 A;  5GAE I;  3RRH A;  3R1L A;  4ZVO B;  2WBM A;  4Y2M A;  1RLC L;  2QLW A;  2ZC4 A;  3KLI B;  3ENA A;  1WUU A;  4RLE A;  4AFF A;  3IC1 A;  3OTO J;  4CNZ A;  3RR7 A;  1Q53 A;  1WI8 A;  2MLZ A;  3BBF A;  1DZ5 A;  2YQ1 A;  2W9C B;  3JAM Y;  1UAW A;  5IWA J;  3QLH B;  3TUI C;  4DV6 J;  4WZM A;  2DH9 A;  3TVZ A;  4K2J A;  4YB5 A;  2KJV A;  2HAF A;  3W61 A;  3NL0 A;  3U1M A;  3FZ2 A;  3R5B A;  4D3G A;  2GHW A;  3H40 A;  1VQ6 S;  4LVO P;  4USU A;  1RWK B;  4AD6 A;  2GVD B;  4RWW A;  5KG2 A;  1NSQ A;  2ZOG A;  1HWK A;  4NLX A;  1SJR A;  3HVA A;  4PUO B;  1VRT A;  1JLA A;  3JQM A;  5HLF B;  2QL5 B;  3KDN A;  1LWC B;  2EC2 A;  4X4P A;  3FFI B;  2W2P P;  2VQE F;  4ZHR A;  2HPU A;  2CZV C;  4TNO A;  4I0W A;  1FD8 A;  2QGF B;  3PY8 A;  4M5D B;  2DRD A;  3PFO A;  1C2P A;  4U67 Q;  2JC0 A;  2IRU A;  1BWV A;  3W8P A;  1SJF A;  2QLB B;  3IR6 B;  2NCK L;  1RT6 A;  3RBX A;  2EFN A;  2C22 A;  3TA1 A;  2HBQ B;  4OI1 A;  1N33 J;  3PW5 A;  3N5F A;  1CQM A;  5EX0 A;  2J0Q D;  4QYR A;  1PBU A;  4BWJ A;  5I3U B;  2HHW A;  1N34 F;  2XZD B;  2IC3 A;  3T5L A;  3MM9 B;  4TXS A;  4YB7 A;  4LFC F;  1QDU B;  5BYS A;  4FYX B;  4CYU A;  3K17 A;  2Q6C A;  4DQS A;  4RW4 B;  1H0H B;  5AE1 A;  2NXC A;  4OJH A;  3LAM A;  1YKW A;  3UDE A;  1SKW A;  1CJV A;  1GMW D;  2GJ2 A;  4DPT A;  3CJS A;  4I2Q A;  1VQ5 S;  3PDN A;  2CPJ A;  1PGZ A;  1FX4 A;  2LQ5 A;  2Z4P A;  3E01 B;  4USV A;  2J6U A;  3RUB L;  5ETT A;  5L39 A;  2XYH B;  2JFD A;  1T02 A;  2KZZ A;  1HNW J;  4NA2 A;  3TR5 A;  4MYT A;  1HI1 A;  8RUC A;  4ALZ A;  5KTQ A;  2E7V A;  4OI3 A;  5L9X A;  4LF1 A;  4ZVU B;  2YNH A;  2VOO A;  1UEK A;  3IO1 A;  1C1C B;  1HL6 A;  1Q8K A;  4XDC A;  3W62 A;  1TP7 A;  1AT1 B;  2WCX A;  2ZE2 B;  2W7A A;  4C8Z A;  5HVG A;  4O3R A;  3M4X A;  4OZL A;  4WE1 B;  3TEH B;  1D3W A;  1NSK L;  1ZET A;  3ET6 B;  1IKY A;  3MWB A;  4K4Y A;  2DGV A;  1FRK A;  3EZU A;  3C6U A;  3DYA A;  2A2C A;  1HFE L;  5IT0 A;  1PIL A;  3VAI A;  4A8S A;  5IT9 U;  2V8D A;  1TFW A;  4FKY A;  2LXI A;  1RTJ A;  5L8R C;  2KFN A;  3BH7 B;  4K4T A;  2G2O A;  3PZP A;  1Q8I A;  5EDW A;  3H59 A;  4JI0 J;  2VBZ A;  3Q8Y A;  1RWM B;  2UVR A;  3CVK A;  1DTT A;  3BQ2 A;  3OR2 B;  2DNO A;  4HT5 A;  4WK3 A;  2VB6 A;  4WFX A;  1NEE A;  2Y1L B;  2BKP A;  5C24 B;  4GRS A;  3M30 A;  2AW0 A;  4UOC A;  5EWE A;  1QAX A;  3GMG A;  5KFO A;  3VR1 A;  5IM0 B;  2AEJ A;  3Q2T C;  1VIO A;  3RB3 A;  1TTH B;  4FXV A;  4OJ1 A;  4J90 A;  5JUM A;  2VG5 B;  3W5Y A;  1CJK B;  4YR3 A;  2VAS A;  2CPI A;  4ZLP A;  1NJY A;  3UPF A;  4DR7 J;  4NZ6 A;  2OD4 A;  4DUZ J;  1YHQ S;  5CD4 H;  3HO1 A;  2EG2 A;  3ILL A;  4TKT A;  1YJ7 A;  2XY7 A;  3CCT A;  1GH8 A;  4B3M J;  4DPW A;  1F5A A;  2XMW A;  2A0F B;  4CLT A;  1FXD A;  1S4E A;  2B9E A;  1QAI A;  1D0E A;  2MQQ A;  1UEU A;  4USM A;  1B0P A;  3L95 X;  4ZP9 A;  4NYO A;  2DGX A;  2IRY A;  4CQ1 A;  4ZJL A;  1VYA A;  5A0Y B;  4Y28 C;  2CWX A;  4TY9 A;  2ROP A;  3QT7 A;  1T03 B;  1DAX A;  2MY7 A;  1BWE A;  3AHP A;  3C16 B;  3PCO B;  4ZVS B;  2CVE A;  4DR4 J;  5C2C A;  3D6F B;  1PBA A;  1ULR A;  2PFD A;  4LRF A;  2CQB A;  4AUK A;  2E5J A;  4U7C A;  5EX3 A;  2CAJ A;  5EN1 A;  1ZAW A;  3P45 B;  2LQJ A;  2D74 B;  4MIW A;  3CD5 A;  1BGX T;  4DV5 J;  2XY5 A;  5G0R A;  4DR1 F;  1YTY A;  2UVV A;  3J7Z 5;  2OGU A;  2B0G A;  1GFW B;  2Z8Q A;  4OLO A;  1FKO B;  4CT8 A;  3FSI A;  3ENW A;  4O3N A;  4FS1 A;  2RDD A;  4ZCI A;  4IR1 A;  4CI0 B;  3IM9 A;  4DV4 J;  3PJW A;  2IDL A;  2KI2 A;  3MAA B;  3QQC D;  3WC0 A;  3F73 A;  2DHG A;  3LGN A;  5IT9 Y;  4ZCM A;  5HQL A;  2QL9 B;  3GWC A;  2QX0 A;  1LK7 A;  1XR7 A;  2DO0 A;  4LSN B;  4KHP J;  4RW6 B;  4C3K A;  3BO3 A;  4IFY B;  1NJW A;  3W5X A;  3CJ3 A;  2IYI A;  2KRB A;  2FVP A;  3DFE A;  4A46 A;  3HHL B;  5BR8 J;  3SQG B;  1N52 B;  4FPI A;  5BXI A;  4OI4 A;  1NDK A;  2E1P A;  3HT0 A;  4FPR A;  2VH7 A;  2AJ2 A;  2KTQ A;  4LRC A;  2WVB A;  5H9F J;  2LKZ A;  3H4D A;  1PAE X;  3LTO A;  5HBM A;  1DLO A;  1RU1 A;  1R89 A;  2CJB A;  1TK5 A;  3EMT A;  1FFW B;  1QAY A;  4IDK B;  2MMY A;  2W8K A;  2W2O P;  3AB2 B;  5DS7 A;  2EKN A;  4ECW A;  4Y0F A;  1VQM S;  2P5V A;  3AH6 A;  1D8Y A;  3FCV A;  2FHJ D;  1LEO A;  1Q7Y T;  4BC7 A;  3CCM S;  1RAG B;  5F0W A;  4ECV A;  1JX4 A;  2YWF A;  2IRX A;  4G1P A;  4EBC A;  2UV8 A;  1NSP A;  2XZT B;  4QR1 A;  4DX8 H;  3HX9 A;  4OYP A;  1WOR A;  3C46 A;  5DLG A;  3PVX A;  4Z37 A;  1PYT A;  3DLJ A;  4AT1 B;  3W7B A;  2IYG A;  2W2Q P;  1H7X A;  2WON B;  4OYB A;  3OXF A;  5HRO B;  1PJ6 A;  4J5O A;  2IMW P;  5DGB A;  1XBW A;  3THV A;  1P8G A;  1FXL A;  1UWA A;  2CRL A;  4F8R A;  3NGD A;  3PFE A;  4H4O A;  3K57 A;  4LUB A;  4DV7 J;  2U1A A;  4IQM A;  3H5X A;  2FGC A;  2VU5 A;  3OT9 A;  1S1X A;  3J80 U;  2XYG B;  2F4V F;  2LYV A;  1WTB A;  1BQM A;  1HWL A;  3BBC A;  3BSA A;  4ZPD A;  4AL6 A;  1HBU B;  3IWX A;  1UL3 A;  1XMB A;  3E2E A;  1S6P B;  4Q8E A;  4G3I A;  3S1T A;  5HAO A;  2CQ3 A;  1ZA2 B;  4JI2 F;  1W7W A;  4QU7 A;  1DQ8 A;  1O6X A;  3PTW A;  1KEK A;  2MB0 B;  4M5L A;  1M1G A;  3D54 A;  5CCL A;  3QBC A;  1N36 F;  1VQO S;  4M5H A;  2NSB A;  1VBY A;  2FDN A;  3ZZU A;  3MZI A;  3QMQ A;  2VF3 A;  5HVF A;  1WG4 A;  1QUP A;  5T7L A;  2HHH J;  2ASD A;  5KFQ A;  1SC3 B;  2E7X A;  5K8P A;  3GV7 B;  2KYZ A;  3I82 A;  5J1P A;  3JTO A;  2KT5 A;  2R7S A;  3CCQ S;  3G87 A;  1Y3J A;  1XMQ F;  5I3Q A;  5LXR A;  4ZKA A;  4PAA A;  1LV5 A;  2ADC A;  4JV1 A;  1F60 B;  3M6W A;  4C11 B;  1YRU A;  3BGL A;  1H98 A;  4ZDN A;  1FKP A;  2GJI A;  2V34 A;  2K3I A;  4R8U A;  2H54 B;  1WKJ A;  2ZDP A;  3VAM A;  5AE3 A;  3MEE A;  1O5J A;  4WKY A;  2WRM A;  1UW4 A;  1MMN A;  2AU0 A;  3OLA A;  2GMH A;  5C7P A;  1DQ9 A;  2BEF A;  5B0A A;  4LF9 F;  2DNN A;  2MZT A;  2QSW A;  4NZ0 A;  1HI0 P;  4DLG A;  5F8H A;  3LAL A;  3KKF A;  1B7Y B;  2ZHO A;  2C2R A;  2ZVS A;  1H74 A;  3T41 A;  2WTF A;  2H1Y A;  3M1V B;  5MLC V;  3HSJ A;  3OPK A;  2NYH A;  2AWZ A;  2XO6 A;  2CQH A;  3LAN A;  2AGQ A;  5DO2 A;  3HF5 A;  1XJW B;  1NDP A;  3POT A;  2OML A;  1OSD A;  1FNX H;  3DLE B;  4EGL A;  2VG7 B;  4M5M A;  1UJ5 A;  2R2T A;  3H5Y A;  2B7C B;  2N4D A;  3RBZ A;  4N8N A;  5C25 B;  1TL7 B;  1SCJ B;  1Q4R A;  5KFT A;  4M5N A;  4ER8 A;  4X84 A;  3CJQ A;  5DQG A;  5KAK A;  2HQF A;  1M5P C;  3TAM B;  5D78 A;  3J80 Y;  2WOM A;  2EI5 A;  1LOU A;  4DSE A;  4LFB J;  4I69 A;  3HLU A;  1X4G A;  3M2V B;  2HMI A;  1RT1 B;  1X0F A;  2GGP A;  3ISN C;  2RD5 C;  2KHC A;  2IIH A;  5HK4 A;  1REV A;  2EWH A;  2NSC A;  1TKZ A;  1N8R T;  3UNG C;  3W2W A;  1BQN A;  4FZV A;  3MM7 A;  1HNZ J;  2Z58 B;  1B99 A;  4KV8 B;  2BJ7 A;  5L38 A;  3TOQ A;  1VBX A;  1U6Z A;  2VJU A;  2CZ4 A;  3A1Y G;  2BMB A;  4IFV A;  3C3L A;  1Q5V A;  4G1Q B;  1CJU B;  3M8Q A;  4IRC A;  4N77 A;  3PRB A;  4DR3 F;  3DLG A;  1T05 A;  2CQ0 A;  2H51 B;  1NK7 A;  1FRX A;  3CPW R;  4NX9 A;  1SIZ A;  5IXU A;  1ZTT A;  1K8A T;  4KO0 B;  1U48 A;  1WHV A;  2VA3 A;  4YME A;  1IM4 A;  3MD3 A;  2PA3 A;  1IR0 A;  1KR4 A;  4DCP B;  1R8P A;  2E29 A;  1T9V A;  4AQY F;  4DL0 C;  4DZ6 A;  1F3F A;  3S8S A;  2H5E A;  2BAB A;  3GJR B;  2B56 A;  4BC9 A;  1SJQ A;  4NXN F;  3ZFV A;  1TL1 A;  5IS2 A;  2UZA A;  4AXI A;  1F2G A;  4DQQ A;  1KLM A;  3OW2 R;  2XM3 A;  1AFI A;  2J5A A;  5ETP A;  2GIF A;  5L46 A;  3EGN A;  3RAQ A;  1V5V A;  4MMO A;  2ZH9 A;  2FLL A;  2C2Z B;  4KC5 A;  2RVJ A;  2PD1 A;  3NY0 A;  2O5D A;  2K7K A;  1QTN B;  2PEH A;  2ALY B;  4F0H A;  2V2V A;  1FEH A;  3QSY B;  3D3C J;  4UQG A;  2XMJ A;  3ETM A;  4NL5 A;  2NZ4 A;  1CG2 A;  3BF4 A;  1VRU A;  2KVQ E;  4OX7 A;  1IKX A;  1D9A A;  4CO1 A;  1E6V A;  2LVW A;  3EIC A;  2JEG A;  3CUN A;  1NKC A;  2HRU A;  3UDL A;  3NS5 A;  2FJA B;  1ZAX A;  2RKI A;  3LP1 A;  2DR9 A;  3D66 A;  4DR2 F;  3GFH A;  4WIQ A;  1LW0 B;  1KN6 A;  2AJQ A;  2QIF A;  1HA1 A;  3ITH B;  5KG1 A;  4F3O A;  4OHZ A;  2FJV A;  3MF5 A;  3N9U C;  1FFG B;  4GKJ F;  2VV5 A;  2MST A;  2QMX A;  2PT0 A;  4ECR A;  3RRK A;  1IQT A;  4ELU A;  3KFW X;  3CCE S;  4BBY A;  2HS4 A;  4ZP7 A;  2GC8 A;  3TAP A;  2ZNY A;  4ZPV R;  2QG9 B;  2W7P A;  2K3K A;  4DPO A;  1DTQ A;  5DJB A;  4YDX A;  1MMD A;  1TKX B;  1VI7 A;  2V63 A;  2MQL A;  4NA1 A;  1ZM4 A;  5HP1 A;  5ITH A;  1VC5 A;  2B3T B;  3Q22 A;  1OMS A;  5GAH U;  1Y5N B;  2B4V A;  3I0R A;  3CD6 S;  3RR8 A;  2HND A;  4Y2A A;  2KDO A;  4CLU A;  4PEO A;  2J7K A;  3MUR P;  1SL1 A;  3KNG A;  4HT7 A;  4O4G B;  5A6P A;  4FXD A;  3P3D A;  2RE1 A;  4DJB A;  3D1O A;  4B3T F;  4KH1 B;  3G96 A;  4OI6 A;  2DY1 A;  2ZBP A;  4QIV A;  3KUE A;  3ENV A;  1VLO A;  4WU2 A;  5LMU J;  2M3D A;  2OUG A;  4P7V A;  1FKA F;  5SUH A;  1WOS A;  2E5L J;  3BGU A;  4ES2 A;  4JI6 F;  1UA0 A;  4ZCK A;  2Q43 A;  4MFB A;  1SH2 A;  4AE5 A;  3HJV A;  5LM7 E;  1IN0 A;  4HKQ A;  2C1E B;  2OEM A;  1N5Y A;  3D4J A;  1N56 A;  4JYA J;  4DSL A;  3QJL A;  3D6T B;  1TAU A;  1Z1Z A;  3W65 A;  3KJV B;  2V2Q A;  3H25 A;  4LRA A;  1SL2 A;  1M1K T;  4IOA Q;  1K47 A;  4YUD A;  3FBF A;  4RNO A;  3WC2 A;  1IKV A;  2Z30 B;  2RJZ A;  4B17 A;  4P6Q A;  3ONQ A;  1PYO B;  1I94 F;  3QGG A;  3AD8 C;  1LFP A;  5B0E A;  2XO7 A;  1T9W A;  5DDQ C;  4G1I A;  1RHK B;  3C2P A;  2UXB F;  3CJ2 A;  1NPR A;  4NOH A;  2NQP A;  3CJR A;  3HVW A;  3MD1 A;  2CPY A;  4PWW A;  4LF7 F;  1Q81 T;  1ACM B;  1BUX A;  4UOH A;  1EAR A;  1UZH A;  3EVO A;  3KOA A;  3L9Z A;  3VGU A;  2J0S D;  1NH8 A;  2ZC3 A;  4V19 J;  1A0O B;  3DN9 A;  1NJZ A;  2GQ2 A;  4TLR A;  1FRJ A;  2V4J A;  2PGC A;  4DV2 F;  4ID5 B;  5F3T A;  2DIV A;  4ICL B;  2HK3 A;  1VK8 A;  1UWB A;  2MKJ A;  3VAF A;  5C42 B;  5IOL A;  1NDC A;  4H54 A;  1MRO B;  2APO A;  1MW7 A;  2LMI A;  4XAK A;  1OO0 B;  3HSZ A;  3MTJ A;  3BSO A;  5KFW A;  4YEA A;  2K8G A;  1S99 A;  2YNI B;  5GAH I;  1S1W A;  2CNN B;  1S1V A;  5LJ3 Y;  5KT4 A;  4DI6 A;  2LFV A;  1PJ5 A;  2Y1J A;  3MM8 B;  3QAT A;  1HQE B;  5EWF A;  1YWX A;  4LFA F;  2VPY B;  3HFK A;  2LEB A;  3M6U A;  3N4W A;  1KLN A;  4O3Q A;  5D4L A;  1NU4 A;  2JVR A;  1GX6 A;  4Y34 A;  2XSJ B;  2MQP A;  4QIW D;  5A8R B;  3K5O A;  2K7J A;  1S9G B;  2Q3P A;  3N28 A;  3Q86 A;  2YH1 A;  1HBM A;  3LP2 A;  3UW1 A;  4GKK F;  5C2G A;  2HEK A;  4YY3 J;  1IBK F;  2RF2 B;  3LH2 S;  1ZM2 A;  3AD7 C;  1S4F A;  1R0B G;  1R27 B;  1RLD A;  3AQP A;  3EPI A;  3KLE B;  4IUF A;  1YRX A;  2D9O A;  4YR2 A;  3MMC A;  2W9A A;  1FHT A;  3SSQ A;  1KFD A;  2AJ0 A;  1RT7 B;  1HIY A;  2F63 A;  4M5K A;  1AB8 A;  2IA0 A;  4DN9 A;  3QGI A;  2W9C A;  3LOU A;  2N3L A;  3TQE A;  2AT1 B;  1JIH A;  1AFJ A;  4M8L A;  2ZH3 A;  5M2R A;  1JNR B;  2BKN A;  4QZV B;  4NZ7 A;  3WDO A;  2WSE C;  1R8B A;  3M32 A;  4ZP8 A;  4P73 A;  5HSP A;  2HQG A;  3TZY A;  1LW2 A;  3HI9 A;  4DCJ B;  3MR3 A;  4JI5 J;  2XNQ A;  2HHT A;  2LEP A;  3PKM A;  1SV5 B;  3T3F A;  3QAE A;  4PUO A;  1T0T V;  2HBZ B;  2XS2 A;  3QWU A;  5HLF A;  2HVE A;  4RU2 A;  4CNY A;  1EHW A;  4K50 A;  2L48 A;  2AYG A;  3FFI A;  3D6H B;  2PN6 A;  2R3V A;  2UXC F;  5ETM A;  2VHG A;  2XS5 A;  1L5U A;  4PQU B;  4DPU A;  1ROF A;  4CM2 A;  4Z7Y A;  1NO8 A;  4OX9 F;  3F44 A;  1UJ4 A;  2OKQ A;  3PIO Q;  2CDR B;  1RWW B;  4EZ9 A;  3K5P A;  3D5M A;  2GS8 A;  1M1H A;  4KQZ A;  3SDE A;  1YX2 A;  5LJ5 Y;  1R31 A;  2FZK B;  2K2P A;  3MDF A;  2GMJ A;  1ZZF A;  4HI1 A;  1NUE A;  3IN5 A;  2XC9 A;  3OVA A;  4B9M A;  2UUA J;  5KG7 A;  4B02 A;  5I3U A;  4NLW A;  2OIH A;  3NGR A;  4F67 A;  3MM9 A;  2MZQ A;  1T7P A;  1WDD A;  5AJ3 J;  2GO9 A;  3D0I E;  2ZNZ A;  3L3C A;  5KFC A;  2AJF E;  3K2Y A;  4WJB A;  3BSC A;  4C0H A;  2BAN B;  2B51 A;  3OR1 B;  3D67 A;  2R7X A;  1JKH B;  1G3O A;  1R8H A;  2EKY A;  3UFC X;  3IFE A;  2JDJ A;  1U8W A;  2CJX B;  2HNZ B;  3M9O B;  1QAJ A;  1TUW A;  1YIT S;  3E01 A;  3BM7 A;  2V69 A;  4EFA C;  2R42 A;  2X3G A;  3GJQ B;  3FEY B;  1Y10 A;  4UZB A;  5LOQ A;  3MPD A;  1MNE A;  2UUB F;  2VL1 A;  3QJP A;  3HZE A;  1Q1K A;  4F25 A;  1XEZ A;  1YI2 S;  1RKJ A;  4DF4 A;  4DQR A;  2ZHA A;  1PKU A;  4NWB A;  2ZE2 A;  2V2K A;  4ZLL A;  3NCQ A;  3KJQ B;  1K44 A;  2XG8 A;  1RHR B;  4UY8 T;  4PXE A;  3NG8 A;  1MSW D;  3LPE A;  3N79 A;  2KT3 A;  4DEZ A;  2MZR A;  4OYA A;  3ZZP A;  1NXI A;  4ZK7 M;  3ZZT A;  3HM9 A;  5EWG A;  3D7S B;  3LA0 A;  1TL3 B;  2ABY A;  1GMW A;  4DFK A;  2HVZ A;  2NR0 A;  1RBL A;  1AZS A;  2CJK A;  4TY8 B;  3TEG A;  4Q0B A;  2AX1 A;  2VC1 A;  2OEL A;  2DNZ A;  4UQT A;  3D2W A;  3DRS B;  1PC4 A;  2YNF B;  2IVY A;  2RDI A;  1EX8 A;  2DR7 A;  2XNR A;  4JI8 F;  1CEZ A;  3CD7 A;  3AOA A;  3NRB A;  4P2F A;  2C3M A;  1BQX A;  2J0X A;  2MSS A;  4CTA B;  2N82 B;  1X9S A;  1RCX B;  1CS4 B;  5CA5 A;  1T8E A;  4PKD B;  2HZV A;  4RUB A;  3W64 A;  5IM0 A;  5D77 A;  1WHY A;  2YKN A;  4ILM A;  5IZH A;  3KK3 B;  1CC8 A;  1VIX A;  3G82 A;  2VG5 A;  1G1X A;  5A8W B;  1CJK A;  4DU8 A;  3CGI A;  2ZM6 F;  3ELH A;  4KE5 A;  5CYQ B;  1BXN A;  5AE2 A;  2CQ2 A;  1QTM A;  3B54 A;  1X7V A;  3M2U A;  3BPD A;  4JOU A;  2A10 A;  1WEZ A;  3CCL S;  3R6G B;  9RUB A;  1T9U A;  4O0N A;  2OPS B;  1RTI A;  3MTK A;  1UMJ A;  4OYO A;  1SPB P;  3FVY A;  1NJI T;  3QRQ A;  3G71 S;  4N56 A;  2ERR A;  3IGN A;  3EPG A;  3C6T B;  3KXD A;  3PYF A;  4B9T A;  2YPY A;  1LKZ A;  3DRY A;  3ZZO A;  2Z2L A;  3PRV A;  2IPO B;  4ITS A;  5LMN F;  1T03 A;  4UOF A;  1XNQ F;  4LMZ A;  2W2N P;  3FMW A;  3C16 A;  2F40 A;  1Z2L A;  3AOD A;  4KHM A;  3BYR A;  3W2V B;  2MYF A;  1WEX A;  4Y2I A;  1VQ9 S;  2V0N A;  2FLP A;  3NNH A;  1QUV A;  4LF5 F;  3KLG A;  3K5N A;  1FF2 A;  1HPZ B;  2C3U A;  2H5I B;  5HAT A;  3DGP B;  2UXD F;  5JXS A;  3PR5 B;  5KFJ A;  2RQM A;  1VC0 A;  4DBQ A;  4KFB A;  5J2M B;  4AXJ A;  2UUT A;  4X64 J;  5E3C A;  2XBP A;  4MYU A;  3TX8 A;  1Q8L A;  2LQ9 A;  5DG7 A;  3OL9 A;  1U1K A;  4E2F B;  3TI0 A;  3DHX A;  2HNY A;  2ZWP A;  1D8Z A;  3MAA A;  2AZ3 A;  5SZT A;  3U27 A;  2VFT A;  2C2D A;  1JLB A;  1HYS B;  4LSN A;  1JLE B;  3PHT A;  5F8N A;  4G6V B;  5KFK A;  5HMW A;  1HD0 A;  5B08 A;  3CDB A;  2O3D A;  2J9D E;  3AJD A;  5KG4 A;  3A3P B;  2AYB A;  2GAH C;  4DLE A;  1HNV A;  4EK2 A;  2HUR A;  1X31 C;  4P71 A;  4DV3 J;  2EBE A;  2GVZ B;  4F4K A;  2CPE A;  2P6S A;  4NEY A;  5D6G A;  4JI3 F;  2BW7 A;  2VC0 A;  1SI9 A;  4B3S F;  5D4O A;  2V67 A;  2R8K A;  3T1H J;  3T5H A;  3BDE A;  3GR0 A;  4C7Q A;  3O6Q A;  4IH6 A;  4TQR A;  1SQE A;  1NBE B;  2ILZ A;  2F5G A;  3WHI A;  3M2R B;  2F9D A;  5K20 B;  4X4O A;  4JV5 J;  3FQK A;  1ZA1 B;  1V9O A;  1U25 A;  3OJS A;  4ZN3 A;  3DDN A;  2C2E A;  2VPX B;  3OTB A;  4IKA A;  2V4Q A;  2YWE A;  2BBE A;  1DFD A;  2MKK A;  2ROE A;  4F4Y A;  3GFX A;  5HN0 A;  3HT3 A;  1TUV A;  3ULH A;  4FYD A;  1WSV A;  2DH8 A;  1JMT A;  1PAU B;  3CJ8 A;  2QMW A;  1HBO B;  3GIL A;  1T9Y A;  1VJQ A;  2EXU A;  2WON A;  4DR6 J;  1RAE B;  3M7V A;  2ZZN A;  1RAI B;  2QEX S;  4A48 A;  3T1Y J;  3JB9 k;  1YDL A;  1BMQ B;  3TJ9 A;  1YJR A;  3DRP B;  1SC6 A;  4CZC A;  2KM8 C;  3EXC X;  3UQS A;  2PFF B;  3M8W A;  1FTR A;  4ZVF A;  3I4P A;  2FHJ A;  4QYZ K;  2UU9 J;  2Z2M A;  1EET B;  4A8Q A;  3DRR B;  2J6T A;  3N6M A;  3TWZ A;  1WTF A;  3I32 A;  2HHV A;  1TVR A;  2B8P A;  1Y00 A;  1S6P A;  4RUH A;  2IA6 A;  4JI4 F;  1Y5I B;  2DR6 A;  5IV3 A;  4KGX B;  5DM6 Q;  1O51 A;  3GCX P;  5RUB A;  3DXB A;  5K5M A;  2GAG C;  3Q8V A;  4KPC A;  5KOW A;  2OP5 A;  2FUG 9;  1RAD B;  3CC7 S;  1IQZ A;  4LJM A;  4ZPA A;  1MG7 A;  2CG4 A;  1J5O B;  4B9V A;  4Q43 A;  2ZOF A;  2GQQ A;  3FKB A;  1MU2 B;  5H9E J;  4L3K A;  5EUH A;  2Y8W A;  3GSD A;  2I38 A;  2OEK A;  2YNG A;  4WXW A;  2WB1 D;  2RRA A;  1UVL A;  1P27 B;  1WI6 A;  2VQF J;  3M8S A;  1RAF B;  2JZ5 A;  3KLH A;  2VOD A;  1PC5 A;  3HHE A;  3JSY A;  1SJ3 P;  2RAQ A;  2N4C A;  2P9G A;  2V6A A;  3MMB A;  3IA0 A;  2W9B B;  1DY3 A;  4YB1 P;  5F8I A;  2JJ4 D;  1NHU A;  2Z57 B;  2Q79 A;  2VDI A;  2B8Q A;  2MKH A;  1S72 S;  4ZP6 A;  3QGP A;  3R7N B;  4C6A A;  3I4H X;  4JI2 J;  5DM7 Q;  1IUJ A;  2GIR A;  4DSK A;  4HH0 A;  3NOG A;  1S0O A;  3AD9 C;  2DD8 S;  3M05 A;  2XLI A;  4FF1 A;  1OPZ A;  5B0C A;  4K4V A;  4TVA B;  1VLY A;  5DGA A;  1X9M A;  4RO0 A;  4NLV A;  1QVG R;  2RB7 A;  3HCX A;  4ECS A;  1U6F A;  4BCA A;  3CTR A;  3PEH A;  1I1G A;  2VUG A;  4XPE A;  3RB6 A;  4HAC B;  4EMD A;  3IWL A;  4K4X A;  5BYR A;  2YKO A;  3DLE A;  1LXJ A;  1EP4 A;  1YZ7 A;  2VG7 A;  2DNK A;  1RAC B;  2J9C A;  3SV3 A;  5C25 A;  2VBW A;  4JBC A;  1TL7 A;  1WSR A;  3EYZ A;  4QWE A;  4I7F A;  3BRE A;  2HGL A;  3OTD A;  2UV8 G;  4ETX A;  1W2B R;  4FBU A;  2IJR A;  4IOB A;  4WP3 A;  3MUT P;  3DOK B;  2HAI A;  3I31 A;  4ED4 A;  2BJ9 A;  3TVK A;  3DM2 A;  4DR5 F;  1IBM J;  1JXE A;  1GEH A;  2IBK A;  2DHH A;  3NKY A;  1RQ0 A;  2HWH A;  2POK A;  4J37 A;  3OTO F;  1ZYQ A;  2Z56 B;  1FA0 A;  1WC5 A;  2VBX A;  4KV8 A;  4XPC A;  3TAR A;  2BR0 A;  2OPQ A;  5IWA F;  4DV6 F;  5LXY A;  3R7B B;  2DNP A;  2QLX A;  2NXN A; 
#chains in the Genus database with same CATH homology
 3HSG A;  3KUE A;  3ILI A;  4M5H A;  1TMJ A;  2BMB A;  4CYU A;  4PZV A;  1HQ2 A;  1RU2 A;  3HD2 A;  1EX8 A;  3KUH A;  2F65 A;  3HSD A;  3HCX A;  5ETK A;  1Q0N A;  1CBK A;  1IM6 A;  5ETM A;  1RTZ A;  3ILO A;  4CRJ A;  1EQ0 A;  1F9H A;  3HD1 A;  4M5J A;  4AD6 A;  1RU1 A;  3ILJ A;  5ETT A;  4CYU B;  4M5N A;  5ETO A;  1G4C A;  1TMM A;  3MCO A;  4M5G A;  2F63 A;  4M5I A;  2QX0 A;  3ILL A;  3MCM A;  4M5K A;  3IP0 A;  5ETS A;  5ETR A;  3MCN A;  3HSZ A;  3QBC A;  4M5L A;  5ETL A;  5ETN A;  4F7V A;  5ETP A;  1RAO A;  5ETQ A;  2CG8 A;  1HKA A;  3UDE A;  1EQM A;  3UD5 A;  4M5M A;  5ETV A;  4CWB A;  1RB0 A;  3HSJ A;  3HT0 A;  3UDV A;  3KUG A;  1KBR A;  1DY3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...