5ETTA

S. aureus 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase complexed with ampcpp and inhibitor at 1.55 angstrom resolution
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
157
structure length
157
Chain Sequence
b'MIQAYLGLGSNIGDRESQLNDAIKILNEYDGISVSNISPIYETAPVGYTEQPNFLNLCVEIQTTLTVLQLLECCLKTEECLHRIRKERWGPRTLDVDILLYGEEMIDLPKLSVPHPRMNERAFVLIPLNDIAANVVEPRSKLKVKDLVFVDDSVKRY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosph
publication title Structural Basis for the Selective Binding of Inhibitors to 6-Hydroxymethyl-7,8-dihydropterin Pyrophosphokinase from Staphylococcus aureus and Escherichia coli.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transferase/transferase inhibitor
total genus 43
structure length 157
sequence length 157
chains with identical sequence B
ec nomenclature ec 2.7.6.3: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.
pdb deposition date 2015-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01288 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 5ettA00
4CWBA 3MCMA 1IM6A 3MCOA 4M5GA 3HSGA 2F65A 3MCNA 4M5JA 1EQMA 1RAOA 1TMMA 4M5KA 3UDEA 3UDVA 3KUEA 1RB0A 5ETNA 1DY3A 1KBRA 4M5HA 1Q0NA 5ETVA 5ETTA 3QBCA 3UD5A 3HD1A 2QX0A 3HCXA 4PZVA 4F7VA 4CRJA 3HSJA 5ETLA 2BMBA 5ETKA 3KUGA 1RU2A 5ETSA 3KUHA 1HQ2A 2CG8A 3ILLA 1CBKA 5ETQA 5ETOA 4CYUA 5ETMA 4AD6A 4M5LA 4M5IA 4CYUB 3HT0A 3HD2A 1RU1A 3ILJA 1EX8A 4M5MA 5ETPA 3HSZA 1F9HA 3ILOA 3IP0A 1TMJA 1EQ0A 4M5NA 3HSDA 2F63A 5ETRA 1RTZA 1G4CA 1HKAA 3ILIA
chains in the Genus database with same CATH superfamily
4A8KA 4AXIA 3MUTP 4C4WA 4PABA 1HNWF 1VQSA 4FP9A 3KYLA 5IT9Y 2QG9B 3AQPA 2EBEA 3I82A 1T9YA 2NXNA 4X65F 3NBPB 4JUZA 3G82A 3PYFA 2FZCB 4E0DA 5K14A 3CD5A 3WBZA 1YG0A 2H5JB 2ZH5A 2OH2A 1Q53A 5MAOA 2QL7B 1RT4B 2CJ9A 1KHWA 1RE1B 5IT9U 3M32B 2W9AA 4B3TF 1IWAA 4KTQA 1KFSA 4WIQA 1GFWB 3AA8A 1XMOF 1JLFA 4DX5A 3MM7A 1FI4A 2AZ1A 2NYIA 5CXTA 1MNEA 4ECRA 4AT1B 1HNVB 1X4BA 3POTB 2ZVIA 2PI5A 1WI8A 5F3TA 2RQCA 3MDFA 1B0VA 4HT7A 4TYAA 4JV2A 3U1LA 2MQNA 2ZDPA 4USUA 3IR5B 3HSDA 3SIPB 4IKAA 1E6YA 2JVRA 2VHGA 2R9LA 3DRXA 3G2XA 2UUAF 4FBUA 1Q0NA 3RZAA 2B9YA 3SZ2A 1HA1A 3DOMA 4NYPA 4MIWA 1LEOA 4QQBA 5GAHI 3DXBA 2C3PA 3W2VB 4LFCJ 4DPUA 4FDFA 3VZIA 1FRIA 1CG2A 3AAWB 3P8BB 1G2EA 3MWBA 4LUBA 3H8YA 2YNIA 1QSYA 3KJFB 4BLGA 1JNRB 1WJ9A 3TEHB 1IBLJ 3FFIB 2V8VA 1RAOA 2EVZA 4KRWA 1T03A 3HVWA 4KJIA 1Z2LA 2YNFB 1RWXB 4PUOB 2Q43A 3V5RA 2BM0A 1KVJA 5KFVA 4DV7F 3G8TA 4ZCIA 1AROP 3ZZYA 5AJ3F 2RHSB 2A0FB 2PEHA 3KFWX 1XTZA 2ZUGA 5JVGQ 5KFQA 2XS5A 1FKPA 4RU2A 2IC3B 4JI1J 4YUDA 3DOKA 2HRUA 1FXRA 2B9EA 4ZPBA 2HFZA 2NQPA 1R6YA 5LM7E 3HK2A 1ZETA 1K0TA 4Y0FA 2PGCA 2W8KA 2QX0A 3DGPA 3CCQS 3NY0A 3VQTA 2ZVSA 1DQ8A 2JWNA 1TP7A 3AJDA 2HNZB 1NHVA 4NA3A 2P5VA 5KFWA 1RHRB 1JJHA 3IXQA 3U1MA 1HQEA 4V19J 3MEGB 3CC7S 2RNEA 4EWTA 5D3GB 4Y6IA 1HWUA 2JHEA 5KT7A 2RAQA 1F0XA 4BC9A 3CB4A 8RUCA 1OO0B 1V3SA 5A6WA 2V34A 3IGNA 2DNQA 1A7GE 2EFVA 1IBCB 1YX2A 4KSEB 2K3IA 1A9NB 1GX5A 4UF4A 1Y3JA 2XMWA 4F4YA 1TZ0A 2ZNYA 4CH0S 3GWCA 3VF0B 2WK4A 3DRSB 3DU5A 3A8EA 1NDKA 4DL7A 3ISZA 2ASDA 1KP6A 2E7WA 3SV3A 5F8MA 3SCKE 1H38A 2ALZA 4LVNP 1IQTA 2ADBA 4UTGA 4JOUA 3F56A 4UT4A 3MURP 2QA1A 2K06A 4DHVA 1VC0A 1RKJA 4YDDB 2IHR1 1PGZA 1JLGA 2RJZA 1SJRA 1IVZA 4P7VA 3OFGA 1U0SA 5EN1A 1IN0A 1GMVA 1IXKA 3BGUA 4KFBB 2EFQA 1MU2B 5KFHA 3N28A 3CJ3A 1N36J 2YNHB 2Z58B 3ZTOA 2MLZA 3MCOA 2MZQA 3HHEA 1U1RA 1CJVB 1K8AT 4DX6A 1UVKA 2J6SA 3FSYA 4IH7A 2GW8A 5HK4A 2N3OA 4N8NA 2F65A 2W2QP 3U1NA 3QMQA 2W2MP 4HVZA 3A3PB 2G0IA 1FX4A 3I0RB 5DETA 1TUWA 1Q7YT 4I7FB 2OFHX 4KV8A 5T41A 2X3GA 2V2QA 1T9TA 2LU1A 3MM5B 1RA6A 2GIFA 4WP8A 3VQSA 1J5EF 3VGTA 4JI3F 5LJ5Y 5DRKA 3Q24A 3KK1B 4L6V3 4YN3B 2GV1A 1HBOA 1HQUB 1BMQB 1Y4ZB 1WC0A 4LRBA 4K4UA 4OZ3A 2Q66A 4J37A 4I6AA 4EO8A 1VRTA 4F4ZA 2C22A 2KL8A 4MAKA 3M2RB 4OQJA 5D0HA 2V4RA 1H6KX 1BQNA 1KDNA 1CQNA 3KHGA 1S59A 3PX0A 2XGQA 2L41A 1NBEB 3IR7B 4ZP8A 3TA0A 4ECWA 2BKOA 3NS7B 4DS5A 1VR6A 4IQMA 4FYDA 4LRDA 1A0OB 2LECA 3LP1A 2RRBA 5FJ4A 3J7YI 1FNXH 1F2HA 3TI0A 4PXEA 4IH6A 3BS9A 3N5BA 5C25A 5KFJA 4YOEA 4ES2A 1HW9A 5M2RA 2MQQA 1CJTB 5KFIA 5E33A 1TELA 3QGGA 1M5HA 2DGSA 4ZA1A 4CLLA 4L76A 3CE8A 4WK1A 3HJFA 2DISA 1RAEB 1X4GA 3A8IA 4UW2A 1T05B 2DNLA 2OPPB 1R0BG 2CPHA 4CZCA 1G4CA 3ISND 4Y65A 1BQMB 1RYSA 4XDCA 3GCWP 1S48A 4RJVA 1RT4A 1O8BA 4AYBD 3V6JA 4DV6F 1RJJA 2DT9A 3M32A 3EXYA 4WCEQ 1UL3A 3OVAA 1FWKA 1QTMA 4UZBA 4PPZA 2EC0A 2VG5B 4P73A 2QJ3A 4DCPB 2MGZB 2XQCA 3IAM9 3RTVA 1LW0B 1RU1A 1HNVA 2GJFA 2GO8A 3C16A 1KTVA 2CNKB 1RAIB 4P71A 2BYCA 2C3YA 1VRQC 1WOSA 1SJFA 4QCLA 1VLOA 3G6XA 3QGHA 1CBKA 4AE5A 4N76A 4F02A 3EGNA 2B5JB 3GZ7A 2YTCA 1PG5B 4KO0B 2ZKTA 1YHQS 1M5SA 1S1VB 3D67A 4DEZA 1JB0C 1FX2A 3IM8A 5HLFB 3ZO7A 1JLEB 1I5OB 3W2VA 3NAHA 2OGUA 4YY3J 2HGLA 3DRPA 3CCSS 1YK9A 2HVHA 2MPUA 1S9GB 3OFFA 4CNZA 2ROEA 4Q0BA 2AJQA 2GGPB 2NZ4A 3GONA 3W5ZA 1KSPA 3T5LA 3W9JA 2F4VJ 4DV1F 4R0JA 3FFIA 4ZN1A 3BQ0A 4DN0A 1YJNS 1R7IA 3CJKA 2YNFA 3M8YA 2E1MC 1URRA 2LQBA 4R0EA 4H4OB 3OTOJ 3UN5A 4EUVA 2OMLA 2NSCA 3BSAA 1X60A 2UXBF 4FYWB 1C4CA 5IC4B 1FE4A 1NPRA 3SXLA 4M5LA 1KC8T 3TAMB 3CC4S 2BKNA 2FC9A 2LU2A 1EJ7L 2M88A 4ZDNA 2LMIA 4C3MA 2VFVA 1IBKJ 4RUBA 3ENWA 2PIIA 4AL7A 2FY1A 2HNZA 2MB0B 4M8LA 4IRKA 2PFFB 5A0YB 4N77A 4JV0A 3IAS9 4IYQA 4DF4A 2L48A 5I3QA 4QYRA 1OJ4A 5IXUA 4QPTA 3DKDA 1TU0B 2V6AA 2D74B 3SCJE 5L38A 5D3GA 1WWHA 4CP5A 1DTQB 2YKQA 2YWWA 4UY85 1VQOS 4ZOSA 3PKYA 4Y3CA 1KS2A 3HT3A 2V9WA 3I32A 1SC6A 3D6TB 3FMBA 3A8KA 2GIRA 3J7ZT 1OPIA 5D4OA 3QRRA 2RDJA 4B3MJ 1S1TB 4ECSA 1JXLA 2YPYA 1PJ5A 3GSIA 2W9BA 4C8OA 4A47A 5CH7B 7FD1A 2NZCA 2AHOB 1VHIA 1GH8A 1U1KA 2HNYB 3X3UA 4NZ6A 3A3OB 2RDDA 1TFYA 2HEKA 1K47A 2ZNZA 4QIWD 1UJ6A 1H0HB 4JI6F 3CJ4A 3ONQA 2UU9F 2KJWA 1NXIA 3E3XA 3J7AN 3DOLB 1NMEB 1S0VA 1UEKA 2OPQB 3PYDA 3IM9A 4KFBA 4F4AA 4U8YA 3W63A 3TQEA 1NH7A 3TNVA 1NK5A 2QLBB 4P52A 5KFMA 2FTRA 3JYTB 5C7PA 3FRZA 3T1HJ 2BVZA 2XG8A 4R8UB 4D3GA 4J90A 4DJBA 2WSCC 2ZWPA 2DIUA 1S0OA 1SIZA 3ETOA 2C2MB 2W24A 3CD0A 2CKWA 3MCSA 1P1LA 3CCVS 2H9ZA 2NXCA 3OHAA 3EDRB 4W98A 1HFEL 4QR1A 3I0RA 4C8LA 2F40A 2J9DA 2HVEA 3BKUA 2IFXA 2AP6A 2EI5A 1ACMB 3I87A 3NGUA 3BO2A 2V2VA 2VDHA 3MM5A 1NKBA 3DLEA 4KT0C 5KFKA 3SCIE 3PM9A 3N6NA 3DLBA 3RB4A 3IP0A 1XR7A 1W26A 3KK1A 3BV8A 3Q8VA 2CWKA 2CPDA 4N7TA 4LF8J 1HQUA 1ULRA 2DRDA 5EDWA 3MM9B 2R7OA 4J9RA 3KJQB 1NDPA 5ETTA 1KOOA 2XWXA 4K4SA 3M2RA 5GMDA 2E5LJ 2JNJA 5GAGI 5E3AA 3QNWB 3LF0A 3T41A 1T8EA 2VPWB 1S6QB 1RWOB 1QSLA 3OR1B 2K8GA 2AT1B 4M95A 2BOPA 3PHTA 5BR8J 3KXDA 4ZK7M 1BD6A 1GXTA 3M7VA 1H72C 3L4BC 3N6LA 2YKMA 5GAHU 1HHTP 1IUJA 3FQLA 3LTOA 4HH0A 3HM9A 1B0PA 1CJTA 2JJ4D 1L5UA 1FRLA 3QGPA 2J9CA 3M2UA 5KG6A 4ER8A 4K0KJ 4I6YA 2V68A 4DU8A 4NL5A 4RWXA 3Q22A 4H4KC 2OEJA 4NEYA 3KOAA 2ZE2B 3I96A 3NNAA 1BQMA 3CJRA 2DEJA 4CLYA 2DGUA 2HBQB 1HQ2A 2ZEJA 1EZZB 5ETMA 5KT6A 2W9CA 1YTYA 3SSQA 2VC1A 1YGYA 5KFRA 2HSEB 3J7A1 3MPYA 3NEKA 3M6XA 3R5JB 2VG5A 5H9FK 2HIQA 1UPMB 3QSIA 4EBCA 2MGZA 2CNOB 4ELTA 1OQ6A 1LW0A 2WSEC 1S10A 3BH7B 4GC7A 1YRTA 2FJVA 4LF9F 3NRBA 1TVRA 1N56A 3S1TA 5DDQC 1JJ2R 1NCLA 1TKZA 4KGVB 3S01A 1ZPVA 2ZITA 2H3EB 1HR0J 4KO0A 1V5VA 1H3DA 2QSFA 4WTYA 1U6ZA 4LR8A 1JLEA 1NB7A 2SXLA 5GADI 4NXNF 1Q82T 4UOCA 5L9NA 3PHEA 4EO6A 1NZ8A 3I56S 3D0IE 1RTHA 2VIHA 4R5PA 1YJWS 1TFWA 2GHPA 1PJ6A 4LT6A 2GGPA 1S6OA 2H4YB 4KR0B 4ZVRB 2Z2MA 3AD8C 2WOMB 4B9SA 3KLFA 4U7UD 4YQWA 4OMFG 1XMQF 1CLFA 4NRTA 1N4LA 2G2ZA 4YHHF 2DNKA 5DQHA 5I3UB 1NM2A 3M9MB 2EEYA 3LP2B 4H4OA 2V2ZA 2XY6A 3ZZPA 2QLFB 4WFZA 3CC2S 1HPZA 3MD1A 4EYHB 3TAMA 3IRXB 5HQLA 2D9OA 1XERA 5T14A 1XN9A 4NCAA 2ZKUA 1WF2A 3D4JA 2CQ2A 3HCXA 2AX1A 1TK8A 4UOGA 4K4VA 1FD2A 1R6VA 4G6VB 3G96A 2D3O1 2OKQA 3PNIA 4JI7J 4LF4J 5EX3A 2FVSA 3W8GA 5KG1A 2J7UA 2VH7A 3BEGB 2BJEA 2CJAA 5FD1A 1HKAA 1VI7A 3MR7A 4TNOA 5F8HA 1GEHA 2UVUA 1JX4A 2MZJA 5F9LA 4K4YA 1EIYB 3BGRB 4NLOA 3DRRB 3LOUA 1Z4UA 2CVEA 2EC2A 2A2DA 3HXMA 5IQ6A 3KLGB 1DTTB 5A76A 4KGZB 2P9EA 2J76E 2YY3A 1HNZF 2M52A 2RSQA 1S1TA 5KOXA 4FPRA 4IH5A 2ZH3A 2R8IA 4ETZA 1CS4B 4H4MB 2EKYA 3JAMU 2FJBB 3U7JA 2BE2A 2DB1A 2KI2A 1JWWA 2GCFA 2HNYA 1RTIB 2YWHA 1H2VZ 2C3UA 3ZFVA 4ID5B 1BGXT 5CCMA 4UUXA 2GS8A 3MEDB 1IR2A 3M9NB 2FJXA 3P6YC 1X8DA 4DSLA 3MTKA 4LIRA 3DOLA 1VK8A 3M6WA 3T6BA 1EAYC 4OI0A 5AXLA 4WXWA 5T7LB 4X62J 1OWXA 2DNRA 3VAJA 3LANA 1S12A 5HMXA 2V63A 2CNLB 2QZ8A 3PIPQ 3EX7B 5EUHA 2WAQD 3B78A 1Y11A 3PR5B 3J7YU 1WEZA 4R8UA 4NWBA 1WHVA 4NLRA 1S57A 4J9UE 2HAIA 3UD5A 1DURA 3GR1A 2HFNA 3MR6A 2A6OA 4OI6A 3OXGA 3FBCA 1Y5LB 4O4RA 1JQGA 2RQKA 5E3CA 3MUMP 4IFYB 3BO3A 4FNIA 2XYGB 3D0HE 3D0GE 3DLGB 4I2QB 2XMTA 1GXLA 1U6BA 2ZZNA 4DFPA 3K5LA 3GIKA 5DZ7A 3WZ0A 1Y0HA 2Q1LA 2PEBA 5D8HB 2H5EA 3GYGA 2PC6A 2VPZB 2AEMA 3M8RA 1HNXF 1WEXA 3GMGA 3MAHA 2G0JA 3I5BA 4M5GA 3TARA 5LMNF 4JYAJ 2UV8G 4DL3A 2Q6BA 3THVA 5HMYA 4DS4A 2WZ1A 4TYBA 3QJJA 5KTQA 4A8FA 3DYAB 2M2BA 4L73A 1X7VA 2VV5A 1XNRJ 3R6GB 4WJBA 5IM0A 3PKMA 3GJSB 4F4KA 4DUYJ 3RBDA 2X1AA 4DG1A 3PACA 3ZNUA 1LXNA 3OR1A 3NWGA 4FPIA 2XYHB 4W90B 3TVYA 3HHLC 4DSKA 4NYOA 2JRSA 3GJQB 3M05A 2R2SA 2C2NA 3OW2R 2DY9A 3KLEA 4OJHA 5KFUA 2X3DA 1GXUA 2LKZA 4ZPTR 3UCZP 4YR2A 3SQGB 2CPZA 3H5UA 4PQUB 4Y2MA 1HHSA 4K7QA 5L1KA 1SQGA 4IG0A 4PPDA 4CT9A 2DPJA 2ZE2A 4JI2F 2KN4A 2WCXA 1XK8A 2OPSB 1ZM2A 4WYLA 4N41A 1TKXB 4TU7A 1V5IB 1ICEB 3UCGA 3H59A 4YEAA 1UWAA 1N5YA 2HBZB 3DLKB 3JTOA 4ED1A 2AJ1A 3L7PA 2EFPA 4WFXA 5HO4A 2I9SA 2CPXA 4F26A 3ZZ0A 4OHWA 4USHA 5KFPA 1T9UA 4OJGA 3PW0A 1N88A 2R8JA 2PE8A 4HHJA 4DLGA 4HTIA 2HHQA 4ZHRB 3R6LB 4RU9A 1SV5B 4MYUA 1FXDA 2Z2ZA 2JLEA 4URSA 3U02A 3H20A 5AXNA 2VICA 1MN9A 5F8LA 3I0SB 4DR3J 4DPXA 5JXSA 1XEZA 3QPIA 2RRAA 3QIPA 1KNZA 4IO9Q 3OVSA 5H1SV 3UDEA 1ZYQA 3O2IA 2MZSA 2GJIA 1TV6A 2WW8A 4ZVPB 2CDQA 1B7FA 3S6EA 3H42A 4C0BA 2W4DA 1VLYA 4GO7X 2LQ9A 2E9RX 1JJ4A 2RILA 2RU9A 2I5JA 4WFYA 3BJYA 2HLUA 4EZ6A 5F9NA 1BC6A 2AU0A 4XTTA 2WOMA 5J1NA 4CO3A 3H40A 3FSXA 1Y5NB 5BYSA 3LPYA 1RHMB 3ZXWA 4FS1A 4CLKA 4QPXA 2DPIA 3WQPA 4BWMA 1FJGJ 4LF5J 1JLAB 3FQKA 3AY0A 2Q3PA 3TA2A 4KH1B 2QMUB 3OV7A 5D15A 4OJ3A 4O3QA 4MK9A 1SKRA 2B7CB 1RT7B 5IS2A 4Q44A 1FE0A 3HLUA 3MEEA 1TL4A 6AT1B 4BHQA 2P9GA 2FY8A 4LQ3A 1IKXA 2Z30B 3CUNA 1S9EA 5CCLA 5ETRA 5F8GA 3QRPA 3R5BA 3N0VA 3FBFA 2D3OR 4F2SA 4J7CA 4ES3A 3BSNA 4ZJQA 4F0KA 3PX4A 4GVBB 2XNRA 3H5SA 4O3NA 4OZ2A 1SBRA 1PCAA 3HVRA 9ATCB 3R1HA 2JEIA 4JV5J 1N34J 1FD8A 3DXSX 3W2WB 2YNGA 3BSCA 5KFTA 3QZ7A 4DPYA 2FYXA 4K59A 3PDNA 4ECYA 2G0CA 3HHDA 4ZJLA 4DR1F 2QMWA 3TRGA 4UOFA 2UU9J 2HMIB 3LAMA 1UEVA 1PILA 4LFCF 3KMQA 1IKWA 2C2DA 3R9LA 4ZCMA 2BRLA 2QE5A 1KFDA 2WVBA 2HHWA 3H4BA 3HSZA 4ZJOA 5SUHA 4GRSA 1NKCA 3TJ9A 1FK9B 3M8SA 3T3FA 2IVFB 5KT2A 3Q8RB 3HVAA 1IBLF 3ILLA 4NZ0A 4P2MA 3CCRS 5KT5A 3UVJB 1CS4A 1FDBA 3CIZA 3PFEA 4XK8C 2Z2LA 1GX6A 1H98A 4QW8A 2MDAA 3AH6A 3AOAA 3MEDA 5LSRA 2GHWA 3CJQA 4RR5A 3FSIA 3FK4A 1KWMA 1PYTA 5GAGU 1U4BA 3EXCX 1AYEA 1VQ8S 5HJXA 2R7RA 2ZC4A 4ENOA 3ZC4A 2E66A 1K44A 3T9ZA 1KQFB 2E29A 1X5SA 4OYPA 2UP1A 4IR9A 1MWQA 2ZD1B 1S72S 3R7BB 3GU0A 3NOCA 3L95X 1OQ3A 1FVQA 2H1YA 4QYZJ 2PO4A 4KBIA 4PG6A 3MHYA 2X7IA 3HZEA 3NCRA 3RB0A 3MD3A 4QW9A 1R0AB 3HPOA 1F5AA 1U6FA 1VQ4S 4JI5J 5CD4H 3J7Z5 3CDEA 4IFYA 2NXUA 1FTCA 2FGCA 4DI6A 4LFBJ 2HWIA 3DLGA 4I2QA 2LVWA 1YJRA 1TKDA 2K7JA 5D78A 3IRWP 4DR7J 3OL8A 4WZQA 5B0GA 2EG2A 2MKSA 2FLLA 1RLDA 4L72B 2UUBF 5CYMB 3N5FA 2VG6B 4QIFA 3OJUA 3CJ2A 3EUNA 2LYVA 3C19A 5K9FA 4Q8EA 4NEZA 1TAUA 2QC3A 3R8YA 1WKJA 4K4XA 2NXEA 3K7RA 3DYAA 2E7XA 4ZITA 1Q7LB 4YB1P 1FCAA 2MKYA 1Q5YA 2ZM6F 3R5DA 4U67Q 1HI8A 2OEMA 1XMBA 4ED0A 3O6QA 2Z4PA 1RQ0A 4LSLB 2RD5C 3DM2B 3ENAA 2WB1D 4OYBA 2K7KA 2GQ2A 1Q4RA 5LOQA 2JC1A 5DGAA 3CJTA 3MMCB 2K1RB 1N36F 2HHHJ 1W7WA 2IMWP 2QA4G 2ZWOA 5KG2A 4OZJA 3CCES 3V4IA 5CYQB 5B7WA 5ETQA 2XYPB 5GADU 3KG1A 2NLWA 1I51B 1UP1A 2VA2A 5FLXY 4WFNQ 3G9CA 4DL5A 3TAPA 4J9QA 3JQMA 3D6MB 4OYWA 4Y00A 3KLVA 3ILJA 3MI7X 1ZAVA 2QL5B 3I31A 3NS5A 4PWDB 3GTYX 2WHOA 2HK2A 1P9QC 2KT2A 3OL6A 3RGIA 1TKXA 3GYNA 1UCNA 4JI0J 3UN3A 5FLXU 2ALYB 2G2OA 4C9DA 2BE9B 3DLKA 2HZAA 4P2SA 3UI3A 1FT8A 5E2QA 2KTQA 4A8XA 4M5KA 4HI2A 4LR7A 4PCQA 5C42A 2XSJB 4O44B 2HAFA 4I68A 1L3SA 1RSCA 2P6SA 3UDLA 2ZBCA 1SV5A 2C42A 4W4MA 3TUIC 2F1FA 4FF1A 3BF4A 2HZVA 1NAQA 3W1YC 4FN5A 4PXDA 4DZDA 2MZTA 3DC2A 3V2UC 2ZH1A 1RTDA 1D8YA 4PWUA 4C98A 2XLJA 4CYUB 1QY7A 4TY9A 1XR6A 3ILOA 4X2BA 4Z7YA 5D4NA 4RUHA 2FVQA 1EARA 3AOCA 4O23A 3PTWA 4LF6J 4X4TA 3GIMA 1IKYB 1SL2A 3T6JA 4LSZB 2F7VA 2N4DA 3D68A 3AFGA 3G86A 3EJMA 4FXVA 2XY5A 1DRZA 3CULA 4FZVA 6FDRA 2O01C 4OYXA 4B9MA 1NSAA 3IWXA 3K17A 1NSKL 3RR8A 4ATNA 3A3NB 1S79A 4P2XA 4IOBA 1GMWD 4B3OB 5JVHQ 2HYIB 3QWPA 5EHHA 4WF9Q 1Y9OA 2VG7B 1JLAA 3HHNB 1D9AA 3BBBA 3GFZA 4ID8A 4KKOB 1ZS6A 3D1OA 1SKUB 4RO0A 1S0NA 3MEKA 1DLOB 4UZCA 1RT7A 3VVTA 4DX7A 1WNEA 3DLLQ 1U1QA 2KFZA 3W7BA 2RIJA 2DVIA 3OSNA 3F0NA 5HROB 1C1BA 2C2OB 2LXUA 2XS2A 4ES1A 2BDPA 3MOJB 2CPIA 4JI8J 1FKOA 2G1HA 2QA4S 4GVBA 3SDEA 2UZAA 2B4UA 3G6YA 3C66A 5M2UA 1U1LA 1YZ7A 3EPGA 4CQ1A 3BGLA 4OIXA 4DPTA 3LUYA 3IMQJ 2G1DA 1NHKL 4G1QB 2J6TA 1N5SA 1FWLA 4DR4J 3VGSA 3GPAA 4F67A 2EBGA 3K89A 3J81U 5IC6B 3TVZA 1B4SA 1Q5VA 2HMIA 2ATCB 1RK8A 3HJVA 2FVCA 4HLBA 1RA7A 2CJBA 4YY3F 2FVRA 2VFRA 4N5SA 3K5OA 1HWKA 2ASLA 1VQ6S 2DH8A 5H9EK 5J2PA 4QU7A 3QLHB 2AV5A 1SL1A 2MQ8A 1TL1B 2Z2YB 4NMLA 3MM6A 4FKXA 3SI8A 2F4VF 3KNAA 5K8OA 2ZHBA 3H2VE 3BDPA 2AW0A 3UVJA 2RQMA 4DDFA 3BQ2A 4TQSA 2DGVA 3GJRB 4NLQA 2OUGA 2VC0A 4LRFA 4TKTA 2C2ZB 4ZN3A 3LAKA 4Z7CA 5IQQA 1B99A 3CD6S 2C2EA 3N4WA 1WD6A 2ACMA 3Q8QB 3KK3B 3GFXA 1RAHB 2UUCJ 1FRXA 1NRKA 1SVDA 4LMZA 2AZ3A 3G87A 4U9RA 3AOBA 4IUFA 2FDNA 1IBKF 1REGX 4EZ9A 4HT5A 1JLBA 2IRYA 1X5OA 1DFDA 4TVAB 3M6VA 1T9XA 4L74A 1TUGB 3HD1A 4UQTA 1NO8A 4HDGA 5C24B 2KO1A 5HBMB 5F0WA 1SH0A 1XWLA 4A8QA 2ROGA 1YQHA 4F2RA 4RW7B 4C3KA 2B0GA 3MR3A 4NCGB 3D54A 4QWEA 3M30B 1S6UA 1T9VA 1R0AA 1NJIT 4ZP9A 3SMZA 3ZZRA 2F63A 5CZXA 4K50A 4DF8A 1U1PA 2MY8A 4CO0A 4BC7A 1NKEA 4B3SF 4MKVA 3UD4P 3JTNA 1KD1T 2DH7A 1UJ5A 3LWLA 3LW5C 2M70A 1FNMA 1U0HB 2DGTA 2JL9A 3WIUA 5IV4A 2MLXA 3C15B 1NU4A 2HWHA 5CYMA 1N5QA 2DHAA 1F2GA 3LA0A 3TX0A 3ET6B 2BZ2A 3WX4A 1RHJB 4RBVA 5L1IA 3NG8A 2MEWA 2N82B 2B51A 2D9PA 3VVUA 2YQ3A 1RT3B 4DPOA 4K4ZA 5A8RA 1FO1A 4GO5X 4M5NA 4ZVUB 5L9XA 2YKNB 4FF4A 2XI2A 4OL8A 1CQMA 4LSLA 2N7YA 1XBWA 4XAKA 2VA3A 1GT8A 1X4CA 2YWFA 3PW2A 5BYQA 4RBUA 3MMCA 2K1RA 2DXEA 1WUUA 1ZZNA 2BW7A 5CYQA 4ZPDA 2WVEA 3T1HF 1NPKA 3WHIA 1XQIA 1WSRA 3MAQA 5HN0A 1UZDA 3EM1A 2F3JA 2HW3A 3W3SA 1NJXA 5A2QU 5LL6d 2W7OA 3J80U 2F8HA 2QLXA 2OPRB 4LRCA 2E5HA 5KFNA 1VJQA 4TU9A 3IC1A 2BBEA 5ETVA 2XCPA 4O4GB 3VGVA 5HP1B 1D3WA 4CO5A 2AMCB 1Y10A 3SYZA 2IY5B 1MROB 4A8MP 4PEOA 1BWVA 1M1KT 2KHCA 3KLHB 1RAGB 2DGXA 3V4MA 1YSJA 2XSJA 1JLCB 3HF5A 3GV7B 1U7LA 4LF8F 2ZC3A 1CJKB 5F0UA 2R8HA 4Q7AA 2H4WB 2CA9A 4P75A 4Y28C 3GQCA 1S6PA 2E5LF 1YBUA 2N3LA 3EZUA 4OYAA 4CLZA 4WKYA 4Q43A 4CYUA 4ED5A 2HVZA 5CYJA 3M8ZA 1L3UA 5BR8F 5ETLA 4OX7A 3KDOA 1G6BA 2IM0A 1TQLA 1FF2A 2H54B 1KQKA 2CQPA 4F3MA 4QZVB 1S1WB 4PZVA 4OZ0A 4ZLLA 2LLZA 1J5OB 1X9WA 4JBCA 4CIOA 4K0KF 3MGJA 5J2QB 1QUVA 3B4DA 1LWFB 4B3OA 1QVFR 4JI4J 1WDDA 2EFNA 4DR1J 2VG7A 3W66A 4WFAQ 3TJ8A 1RYRA 2CQIA 1RTJB 3B4MA 3DDKA 2R7TA 2WW4A 3RBEA 4ZVTB 2PSZA 2LEBA 4HTJA 1N52B 1RT2B 1F3FA 1NPPA 5E41A 2DBBA 4QIEA 2ZH6A 3OFEA 4FYVB 5HROA 3Q86A 5KAKA 3QYYA 2CQDA 2DHSA 2VJUA 1IM6A 4ZCKA 2F8EX 3KDNA 4PYDA 2XBPA 4OZ5A 1YIJS 1SUQB 3JQKA 4DPWA 1M90T 1S76D 3HT0A 1RHKB 4A8OA 4HEA9 4LQ9A 2ABYA 5KFLA 5L39A 1NK0A 4CLWA 1HR0F 3QT5A 3A8JA 1H2UX 3KTQA 1KQSR 3LP0B 1VS3A 4IR1A 4MH8A 3M2VB 1UVLA 3W62A 4EGLA 1WHXA 2KRRA 2LFVA 3TZYA 2B9XA 2AGPA 4ZMMA 5HL7Q 4WP3A 5HSPA 3HFKA 3IN5A 2R8GA 5IT4A 1ZM9A 3PJWA 3QLHA 1TL1A 2J7WA 2OLWA 3TUPA 1C0TB 4DR2J 2WRMA 2W7PA 4WYWA 1FDAA 2PFDA 2VZ9A 1PO6A 2ZBQA 1S1UB 3KUHA 1VRUB 3R2DJ 1WI6A 4JP8A 3NL0A 4M5HA 1D9DA 2LCWA 2GVDB 4CRJA 3BZQA 1O51A 5F3ZA 3Q23A 2NS1B 2GMHA 2RU3A 2K2PA 5KFYA 3OTCA 3KK3A 2JLFA 1K9MT 3FEZA 4KE5A 3M4XA 1VC5A 4A8YA 1R8AA 1HMVB 5KT3A 3QATA 3CMAS 2HRTA 2UUBJ 4Z2XA 2BM1A 4DQPA 4LF7J 4ITSA 3ITHB 1AXQA 2FHJD 1WC1A 5C24A 3DGVA 4KY3A 1SCJB 4M5IA 1VBYA 1XNQJ 1IWGA 1M1GA 4JI7F 2KM8C 4LF4F 5EWGA 5JMNA 1SKSA 1U47A 3HHKA 2FJEB 4RW7A 5DLGA 3MTJA 2YX4A 1X5PA 1V6HA 1YJ9S 3TJAA 2CG4A 4U95A 2ZM6J 2GVZB 3LWMA 3FUYA 2E9TA 4DQIA 3MECB 3D66A 3Q8SB 1U2FA 1FFWB 4KHPJ 1R31A 4CLFA 3TA1A 3PVXA 4P9SA 2DR8A 3QJLA 2G2YA 1P9YA 3T9NA 1Y5IB 1TKTB 2DR9A 2HNDB 2OP5A 4Y2CA 1U0HA 1RT6B 1M5PC 5CZVA 5F8JA 5KFSA 2AYBA 2EFOA 2QGFB 4K2XA 3QZ8A 5DG9A 3KJVB 4DV3J 1GMWA 3W64A 2ZJRQ 3DI6B 1QVGR 3ET6A 1RI7A 4RW4A 3C6UB 3WC2A 1N5TA 3CCZA 3C6TA 1EB0A 3JTPA 3MR2A 1UWBB 4QR2A 5L8RC 1WC6A 2Q79A 1F5CA 2AYMA 1HHQA 2XGPA 1RT3A 3IG1B 2XMAA 3GFHA 1BE4A 5B08A 1MW7A 2ZOMA 4K2JA 1F9HA 4RNMA 3I4PA 1R89A 2J7KA 5IT0A 2B6AA 5F8NA 1LWCB 2V9KA 2CYYA 3UCUP 2EPIA 3CCWA 3MMAB 3FCWA 1GMUA 4DL4A 3A4TA 4Z37A 2YWKA 1S97A 4X62F 2BANB 1YJVA 3RR7A 2XM3A 4OX9J 4RW6B 3B54A 1N6QA 3QT7A 4J5OA 3Q0AA 4C8ZA 2AWZA 2IJNA 3DHWC 2MYFA 2V50A 1WF0A 4C11B 2YVSA 1M1HA 1PAEX 2QLJB 4C3LA 5L1LA 2A6MA 2XC9A 4OYOA 2RHQB 5IOLA 5IV3A 4FVCA 4X4NA 4DFKA 2BEFA 2HFUA 4DU7A 2AIRB 2YH1A 2OPRA 1WOOA 2M3DA 1OY6A 4W92B 2B43A 1T9WA 3UQSA 4ZPWR 4O4GA 4RUCA 2N7CA 4L3NA 3MMBB 4PG7A 1U2CA 2H48B 3EVMA 3GSDA 2YKPA 3K2YA 3T5HA 1IKVB 3PG9A 3GB0A 1RBOB 2WONB 4YR3A 2F8MA 3KLHA 3TR5A 1DQ9A 3PEHA 2IMOA 4DV5J 4NLTA 1H74A 3CPWR 4JYAF 2DJWA 2D41A 2RUGA 1CC8A 3OJSA 1ITPA 1FRMA 2KHDA 2IM1A 3NBPA 3P3DA 5EGYA 8ATCB 2FUG9 5B0AA 1I94J 5K14B 1VISA 2UVVA 2PA3A 1XNRF 3HMJG 4V19X 1KEKA 5DJBA 4DUYF 2O5DA 4CNYA 4B9LA 2ZH9A 4XDDA 1JLFB 2EFGA 5J2NB 2HRYA 1FKAF 5HVHA 1F6TA 1I3OB 1FJEB 1MWYA 4B9UA 3LGNA 3POTA 3K59A 3JSYA 1RWKB 2ZH2A 2RE1A 3OVBA 4LRAA 3GIRA 3IBCB 4OI1A 1J5OA 1X4EA 3NGTA 2O3DA 1OPZA 1MN7A 1LWFA 2HQ3A 4USWA 1U09A 1HI1A 2VKRA 4RBTA 4U8VA 3VTIA 4NA2A 5GMKa 2VBYA 1HWLA 2FLOA 3IBFB 4DL6A 2R7WA 2YPZA 2XI3A 2YQ1A 3TVKA 4X64J 4NX9A 2EKNA 2IIHA 4NOHA 2VJVA 4QIVA 2XULA 5LXRA 3MAAB 4U7UK 3D2WA 1WG1A 2BABA 2IAJB 1CULB 3D1HA 3V6KA 4OI4A 4QWAA 2YNIB 2YQ0A 3CNQP 4G1PA 3PIOQ 4DOZA 1SUQA 3EE3A 2MQLA 1T03B 3MPVA 2WSFC 1VJWA 3H4DA 4J9KA 4PUOA 2RS8A 2NPIA 4U96A 1ZA2B 1Q95G 4DR3F 1M5VC 1SJ4P 1D1UA 4PRFA 3LP0A 2ATLA 2YKAA 3BDEA 1VMBA 3HKWA 3BR9A 5FDLB 3M2VA 3V6HA 2IC3A 1VBZA 1RDRA 4Q5VA 4ZVHA 1IR1A 2FVPA 3BH6B 2PN6A 1RHUB 2DR6A 4BDPA 3PYGA 3AB2B 3Q8UA 3L9ZA 2XO6A 4ANCA 2QYCA 2I6WA 2KFNA 3MXHP 4NRUA 2VL1A 1HBNB 1C0TA 3Q8PB 4RW8B 4FF3A 1K73T 1R8HA 1TR0A 2HGMA 5KG0A 1S1XB 3HKZD 3MEGA 1MSWD 3DRYA 1TMJA 1FJGF 4LF5F 1VRUA 2MHNA 2DNHA 2QTWA 5GVQA 1HWIA 2X1FA 1JK9B 1PSDA 2EW9A 1QE1B 3ELHA 4DLEA 1HL6A 2O1PA 2VKZG 4B3SJ 4XIUA 3HI9A 2QFIA 1RZMA 4NA1A 4OI2A 1YLXA 5KFEA 3P5TL 2FHMA 1WACA 1MMDA 3DRSA 4DV4J 3W5YA 1HMVA 3JQJA 1FXLA 4P7TA 4B3RF 3FBBA 4NLUA 3ITHA 2CUYA 3VHQA 2P9CA 4DN9A 4JV5F 1N34F 5J2MB 4F04B 4J9LA 2DR7A 2XHCA 2B4PA 2KM8B 2HQGA 3RB6A 3OL9A 4XPEA 3G6ES 3PW4A 3MOZA 1U02A 3CDBA 1RP5A 4CLSA 3MFHA 1HYSB 4NLVA 1YJTA 3L7OA 1S7IA 2L08A 4DUTA 1GK8A 1YKWA 2CIMA 2GVZA 1PC5A 1N33F 4PXCA 2EK1A 1JLGB 2DHXA 2P2CB 2V67A 1EX8A 3K57A 1T3NA 4ED6A 1OYEA 2HS4A 1RTZA 4OJ1A 3X1LB 1UFKA 2RRNA 2DHGA 3NS6A 4I64A 1KLNA 1U1MA 2HHUA 1MU2A 4ZLPA 2RQ4A 2Y0SD 2DIVA 1SC3B 3IR6B 2YNHA 2HNDA 4QWCA 1SXLA 3PXGa 1KHVA 2CJXB 1RT6A 1MLAA 3ENQA 3QAUA 1CJVA 1SB6A 3KJVA 2HKEA 1D8ZA 2B4VA 4QR0A 3DI6A 2HK3A 1S4EA 1X0PA 2BE7D 1UWBA 2ZH4A 4PG8A 2MJNA 4A8WA 1ZAXA 4IO1A 3IG1A 1V3RA 2DO0A 3N6MA 1X4DA 3OUYB 4IOCQ 4I7FA 1LWCA 2QL9B 5KG4A 2ROPA 2XNQA 3MMAA 2I38A 5F8IA 1UTAA 3M9OB 4OYIA 4ZPAA 3OD2A 3FDSA 2BANA 5D0RA 4RNHA 4G3IA 4GMKA 3H7HB 4RW6A 3GP9A 5DDOC 4LF2A 2ZBPA 4B08A 2Y9HA 1HBOB 1V3ZA 1YITS 1ZBTA 5BJRA 3HDSA 2I8EA 2HQFA 4C11A 1VRTB 2AX0A 4I67A 4RWWA 1BQNB 2W7AA 2KFYA 2MKIA 2CJKA 4YB6A 1Y7PA 3UDVA 4NMXA 4C2MA 3RJMB 1IM4A 4JI5F 2V8GA 3W9IA 2CXEA 3ZZZA 4ED2A 3ADAC 3GIJA 1E6VB 2POKA 4DZ6A 2HHTA 4LFBF 1UKUA 1SH3A 2A2CA 2M8DB 3ZTPA 4CTAB 1EQMA 2MTLA 4DR7F 3MMBA 5KG7A 3R5GA 1FWPA 3E51A 3UNGC 3FBEA 1IKVA 1K1SA 5C25B 2NXJA 2QFJA 4ECQA 2WONA 3JSBA 3W60A 2E5IA 1RUSA 3VV2B 1T05A 1U1OA 1T95A 2OPPA 4TQRA 2V4JB 4WTOB 3A13A 4U7CA 4IG3B 5CA5A 5D0EA 2WBRA 1SI9A 3IS9B 1OYDA 4TLQA 1I1GA 4E98A 4K8RA 5LT5A 3AJ2A 3IWLA 3H5YA 2CVIA 3JSMB 1FNOA 2QSWA 2J0QD 3W61A 3CO9A 3CD7A 4LSNB 1Y00A 1FESA 3NCPA 2MMYA 5J2NA 1KRPA 3BN7A 4QU6A 4OHXA 4YDXA 2J9EA 2XMJA 2HHHF 2AEJA 3C16B 2FHJA 4WE1B 5HQ8A 2Y1LB 2CADA 2U2FA 2YWEA 5GAEI 1KLMB 4YMEA 3KJNB 3KNGA 4HYKA 3KMSA 3FCVA 2B5JA 3U27A 3PRVA 3CCTA 1LWEB 2GJ2A 2KRBA 2HVIA 5HVGA 2ZDOA 2HFSA 1EP4B 1S1VA 2OSQA 2NPFA 2MZRA 5HLFA 3UW1A 1LWXA 3Q83A 3PW7A 4O3OA 3Q89A 1L3KA 3E01B 2CZ9A 2IDEA 2Y1RI 4JI0F 1F60B 4EFAC 1RGVA 3DNCA 5LJ3Y 3MAAA 1S9GA 3DRPB 2HHVA 3NGRA 1F5BA 3QBCA 5K8PA 2HFOA 1FVSA 2EG1A 2IAJA 1CULA 2QN6B 2HS0A 3BPDA 4MFBB 3N79A 2CWXA 1HD0A 2ZBRA 4Q0BB 1UMJA 2AJFE 2B8QA 2VFTA 3OBIA 5K5MA 4MTPA 1F9FA 4USTA 1DHMA 1WG4A 4OLPA 4CH1A 5J1PA 1K0VA 3CJKB 1MWZA 2FLPA 2GO9A 2ILYA 3RAMA 5IWAJ 3T1YJ 4CCHA 5FDLA 2ACYA 1UFWA 3W5XA 4M1KA 3PV8A 4LF6F 5KG5A 1VQMS 5IFMA 2PD1A 2ADCA 2D3ZA 1H7WA 1UETA 1REVB 4ZVSB 3L7UA 2R7XA 3ULHA 2XHWA 3CO0P 3VAGA 3HULA 2GIQA 1RBLA 3T5JA 2GX8A 2QA2A 2V5HG 2D7SA 2KDOA 5A0YA 3CIMA 1HBNA 3MR5A 1WORA 4RW8A 3D5MA 2M8HA 2E1RA 1YWXA 2Y8WA 1LOUA 5CHCB 3AHPA 3PO5A 3AXMA 3D28A 1S1XA 3IGVA 3K58A 1QM9A 2OD6A 2JC0A 3VAFA 4D3HA 3H90A 2FJAB 3AA9A 2APOA 1DTQA 2XMKA 3TQ1A 2DXFA 2V94A 1DARA 3RBXA 1QE1A 2CZVC 1VQ9S 2GHVC 3JAMY 5HATA 4RUAA 2LDIA 2IBOA 2AF6A 1QAYA 4IRCA 2KYZA 1SQFA 4DV2J 2HHPA 1CSJA 2IYGA 3P45B 4JI8F 3E2EA 4MT1A 3R5CA 2FLNA 1SJ1A 4M5MA 1FDNA 3BQ1A 4J9MA 2C1EB 2X1GA 5FIIA 1Q79A 2FQQB 2W9BB 3TX8A 2OFGX 3GG0A 3G6VA 5J2MA 4H54A 3O1LA 4B02A 4X84A 2HFVA 4DR4F 3ISNC 4G65A 1VYAA 2DNZA 3P96A 1HYSA 3C14B 3GCXP 2V8DA 4HHHA 3VALA 1X9MA 4ZVFA 4HH1A 4KC5A 4RPFA 2OPQA 3AD9C 2HG4A 3PCOB 1VGYA 2Z0GA 4CT8A 3CJ8A 3EGVA 1ZTWA 2CPEA 1NK4A 3KWMA 3PY8A 1HIYA 4AL6A 4DSJA 2IDLA 4P10A 3GV5B 4QJVA 3JYTA 4I6WA 1YDLA 4C6AA 3EVOA 2W2OP 3R1LA 1GAOA 2COLA 4F7VA 1R8BA 4BBYA 2GQQA 2IA6A 3UR3C 2BKPA 1JMTA 2HIYA 2R7VA 2DGOA 2W25A 2KXHA 2F9DA 3CW2C 1WC4A 4ED7A 3BKFA 2DITA 1DY3A 4X4PA 3DDIA 1URNA 2PMHA 4DSIA 2UXCJ 1U8SA 2UUCF 3OUYA 2OSRA 1VCTA 2VQEJ 1V9OA 2IRXA 1AB8A 1B70B 1PAUB 1CVJA 3GV8B 3H2LA 4GKKJ 2BJ7A 2XMVA 4ZS6A 3OR2B 3DLEB 3PRDA 4O3PA 3WDOA 2JLGA 1RABB 3KG4A 2KH9A 5E3RA 4A8SA 3J81j 2R2TA 3NNHA 3PW5A 3QT6A 2X1BA 1S99A 3MM9A 4FVMA 1NH8A 4G1IA 8AT1B 4ETXA 5U47A 2ZFHA 2E1AA 2DHHA 2WVCA 1WTBA 5EWFA 1S6QA 3ZZOA 4ANEA 3UFCX 3OTDA 1NK9A 1UZHA 2XZTB 3TO8A 1E6VA 1J27A 5C2GA 4MIBA 3PEJA 5B0EA 3AD7C 1Q1KA 3KK2B 4CTAA 4NZ7A 4CI0B 1NEEA 2MXYA 3NXZA 2YKMB 1X4AA 2M5YA 1YBTA 4XPCA 3OLAA 1RADB 2KVIA 2YKOA 1B3TA 4BCAA 3NGSA 1S9FA 1T7PA 4PXBA 2J8AA 3M2UB 2E5JA 2CQBA 4WU3A 2UXDJ 4QWBA 2VOPA 3D6FB 4WBFA 2HURA 2V4JA 2LEPA 3K5NA 4IG3A 2GQCA 1IBMJ 1PKUA 1Q86T 3IS9A 4I4BA 2KU7A 1VQLS 3CVKA 4LFAJ 3JSMA 1HD1A 3QO9B 2W9CB 3MPDA 2BUNA 2BXJA 3MPWA 2R2RA 4LSNA 3CF5Q 2VF3A 3DLJA 3CGIA 1RWVB 4LJMA 2BMBA 3EVWA 2WVDA 4WP9A 2KB2A 3TP2A 4OYMA 4WZMA 4WE1A 1WEYA 1XIQA 4DXLA 1SKWA 2C28A 1KLMA 3RG6A 2DEIA 1TVRB 2MKCA 4P2FA 1TKZB 1TUVA 4AQYJ 4J9NA 4K4TA 1LWEA 3EGZA 1EP4A 3SSRA 4HI1A 4RW9B 4C8NA 1ELOA 3E01A 3FZBA 2Z8QA 1NDCA 4GKJJ 5HQMA 1N32F 4U6PA 2CPYA 2FZGB 3F41A 4AL5A 3TWZA 3H25A 1DQAA 1RTHB 2C2KB 1KKHA 4MFBA 4R5PB 3WIVA 2CPJA 2FGOA 1YZ6A 4C0OC 2AQ4A 1NSPA 1JJCB 1OY8A 2OEKA 3KLFB 2BQ3A 5I3UA 3LP2A 1B0TA 4F3OA 5L46A 1O6XA 4HR2A 2HS3A 3I55S 2DNOA 2DR5A 1X5TA 1BLUA 3M8PB 5EX0A 4X4VA 5CAAA 1K1QA 3V6DB 4F36A 1N0VC 2FPHX 1WC3A 3NMAA 1ZAWA 3IRXA 2NUUG 5KG3A 1HPZB 2KJVA 3P49B 2JEGA 4QYZK 1VHFA 5KFOA 4F4XA 4M63A 4ED4A 1S0MA 2VQFJ 3HHLD 5A8WB 4Q2MA 3TYTA 4ECUA 3GG1A 1REVA 1U45A 3BYPA 4NYZA 3KKFA 2AGOA 4WFBQ 2VBXA 3MPUB 4TY8B 2DNNA 4B3RJ 4B9NA 4PG4A 2GMJA 2M9KA 2J0WA 2CFXA 2CZ4A 1IJFB 1R8CA 2M7SA 1AUDA 4N8OA 3R7SB 4USJC 4JI4F 2VPYB 3VCDA 4ZVQB 2WVFA 4ICLB 3EDQB 1ZM4A 3GILA 1FHTA 2AJ4A 1N33J 3V81B 2XZDB 2B9WA 1GQEA 2FHKA 3BGRA 4OX6A 5RUBA 3DRRA 2HGNA 1UA1A 2PDAA 1UVIA 1JLQB 2DRBA 4FYYB 3PJ9A 2QLWA 3R7NB 3KHRA 2WTFA 2MKHA 3KLGA 1DTTA 3ICLA 1C0UB 5I3PA 3I4HX 2GAHC 3KUGA 1JXVA 2IBKA 3MZIA 2KYXA 2ZZTA 3US5A 4Q45A 4FXDA 3RU0A 2ZH8A 1EKRA 1RWNB 4OHVA 4H4MA 4RNOA 4DUZF 2V8PA 2V4QA 3M8WA 3SFUA 2QEXS 2BE2B 1RTIA 4PQAA 4I56A 4ID5A 3BM7A 2MSTA 4M5DB 1EETB 3C14A 3FCHA 3PFOA 2VFSA 4NLGA 1I6JA 3CMQA 2QIFA 3K5MA 3CSKA 1HNIB 5E0OA 2O66A 1S77D 5D0GA 1KVIA 3UO0A 4DCOB 1OIAA 5T7LA 1O5JA 2QRRA 3ENVA 1GTHA 1AFJA 1QJHA 3IO1A 2DTJA 1JKHB 1YRXA 3I6PA 2UUTA 1RWUA 2D1CA 2IA0A 4DR2F 2OJ3A 3D9BA 3FZ2A 4CM0A 2VONA 4N47A 2I0XA 5THWA 3AT1B 2RDIA 5G0RB 3ZTRA 2ZHOA 1VOMA 4L75A 4ILRA 3CMES 4DR5J 2LEAA 2KZZA 4FBTA 3AQOA 3MCMA 2V69A 3DHXA 1Z2ZA 1T0TV 1LXJA 4NXMJ 5E7OB 1TK0A 1NUEA 5KFAA 3MF5A 4KH0B 4S0MA 2I1RA 2DYAA 2VPXB 4ZP6A 2UUWA 3HO1A 2ERRA 1N48A 4RLEA 4DSEA 9RUBA 2Y1IA 2RT3A 3C8YA 1NSQA 2H51B 1VIOA 2DNYA 3OR2A 1NK7A 4ZLNA 1PYSB 5LMUJ 3N01A 4WWSA 5DQIA 4LF7F 2DNMA 1HNWJ 4X4OA 1CPZA 3VWSA 1XNQF 5B0BA 2MSSA 2CRLA 4RNFA 4C0HA 2HQCA 1KVKA 4LREA 2HZCA 2MQOA 4X65J 3KHHA 2ZJPQ 5ITHA 2BJ3A 1XJWB 2JDJA 2BX6A 1SQEA 5DLFA 2MKKA 1X31C 3ILIA 4ZKAA 5M2PA 5GAEU 2AKWB 4NLPA 4ECVA 2HQIA 3VZHA 3RYLA 5IM0B 2E1PA 1DZ5A 4KHPF 4B3TJ 4DG1B 3HHLB 1XMOJ 1VDHA 3KK2A 4E8UA 1SJ3P 1U25A 4OHYA 2C3OA 1ZA1B 1VQ7S 3KLEB 2IM3A 3I5AA 1IQZA 2FC8A 2DY1A 4ED3A 4DV3F 3K8WA 1N0UA 2Y3YA 4DL0C 2L9DA 3SQGA 4LBHA 3MUVP 3BO4A 4PQUA 5DG8A 2KVQE 2YWGA 3CJ5A 2QT7A 1A6LA 3CTRA 4ILMA 2XB2D 4GVLA 1RAJA 4H4KA 4IG0B 4YP3A 2IYIA 3LGMA 3NP5A 2UUAJ 4DQRA 2DCUB 2OPSA 2IPOB 6FD1A 4Y34A 2A3JA 2N4CA 1BWEA 2FZKB 3C2PA 5ETSA 3HP6A 1WOPA 2RF2B 3QO9A 3R27A 1VQ5S 4M94A 5IZHA 3OXFA 1TTHB 1Q8IA 4MIAA 1N5YB 3DMJB 4CWBA 4C8YA 2WBMA 4ANDA 5B0DA 4O3RA 4OX9F 2RUSA 3QSYB 1OSDA 4KB7A 4X66F 1AZSB 4I69A 2XMMA 2AYGA 5I42B 1RLCL 4ZHRA 3ETMA 1QTNB 4WK3A 1OY9A 1S4FA 2I2YA 4C8MA 4AXJA 3KLIB 4A4JA 1OSCA 3I0SA 2CQHA 3RRKA 2ZOFA 2CQ1A 4DV7J 3VGUA 2VFUA 2JOQA 1R0CB 2CNNB 4ED8A 5AJ3J 3GR0A 5MLCV 3QIPB 4RW9A 2B8PA 3FGVA 3QQCD 4QBUA 3QJPA 1TV6B 3QRQA 2R42A 5AE1A 1U8WA 1H2TZ 3SV4A 4HKQA 3JB9k 1AT1B 1ZZFA 2I5JB 1P8GA 4MKBA 1AFIA 3W8PA 1WHYA 1ZPWX 1TL5A 1PIEA 4A46A 4DV5F 1N8RT 2UVRA 4FYXB 1FJ7A 3H5XA 1YRUA 3ZTSA 1CC7A 1UA0A 4C7QA 5DZ6A 1RKIA 2J0SD 2E7VA 5G4DA 1I94F 2BJDA 1NZAA 1NK6A 3DCAA 5HANA 1NJZA 1N54B 2A1BA 2LDYA 3SQOP 2J5AA 3D3BJ 3M8PA 5B0CA 1G3OA 1HBUB 4MYTA 1U48A 4DV0F 1LNQA 3V6DA 4MKYA 3EZOA 4KGMA 3MEEB 4OI3A 2YBVA 1IKXB 2DNPA 5A8WA 1S9EB 1H73A 4KGXB 4OZLA 3HSGA 2ZBIA 3J81Y 4TY8A 5ETKA 3H98A 4DFJA 4NLSA 2CQ4A 2KXNB 3F73A 3W2WA 2VODA 5E3PA 1JNZB 1QD1A 2G4BA 1VBXA 4ZVGA 3S7RA 2YNGB 4KHRA 5H9FJ 4ICLA 3DU6A 1QLNA 1T94A 1RT1B 2C2RA 4ZIVA 3IWNC 1NDLA 4X64F 3V81A 4EBDA 5B09A 2XS7A 3IBWA 4V1Ak 2CQGA 2UVWA 1JLQA 1IKWB 1LV5A 4LVOP 3FNNA 4CO1A 1FK9A 3BB5A 3TUJC 1YI2S 4WPAA 1C1CB 2ZOGA 5DO2A 3WC0A 1C0UA 4OFZA 2JVOA 2V0NA 2LA4A 5AE2A 3BKTA 4FKYA 1RWPB 1TL7B 1Q8KA 3CDWA 1UFLA 3OXLA 2FD2A 1C2PA 2CQ3A 4J91A 3DDNA 4URGA 2KG0A 2L9WA 5KFDA 1D09B 2DK2A 2BJ8A 1UVMA 4NI2B 2O67A 4M5DA 1EETA 2KKHA 4IDKB 4WIIA 1BY9A 2AYEA 2JFDA 4DMZA 1HNIA 2DCLA 4R25A 2NUHA 5ETPA 4LBPA 2R7UA 2OI2A 1DJ0A 3W65A 1UVNA 1J5EJ 1XC9A 5A6PA 4CDIA 4JI3J 2ZD1A 4LBIA 1JKHA 2IVMA 3CJSA 1C4AA 3FKBA 2GZOA 4CLTA 1NJWA 1WHWA 2QO3A 3CWJA 2VDIA 3PR4A 5KT4A 1NNDA 4EI2A 2MY7A 2VD3A 1S5ZA 1L3TA 4TN2A 3G8SA 5G0RA 2W01A 2AD9A 3UR0A 1YJ7A 1LW2B 2CPFA 2XWYA 3RAQA 2AEFA 2Y8YA 2V8HA 4B17A 3FVYA 2J9DE 3G4SS 4PR6A 3AXKA 1KN6A 4EK2A 4DV4F 4HACB 7AT1B 1WELA 1N5VA 2U1AA 4ELUA 2M0GB 3VAKA 1FEEA 1BHNA 1RU2A 1HI0P 3O5TB 3VAHA 1RACB 4EEYA 2VG6A 2B56A 2KXFA 1FRJA 4FS2A 2ILZA 5DQGA 3QGIA 2DRAA 4DFMA 4NLXA 3OPKA 3SBMA 4ZPCA 4I2PB 3HVTB 4Y2KA 1HWJA 2PT0A 1KTQA 4J9SA 4C97A 1SIWB 1QAJA 4ZLJA 2HHSA 2HPUA 1NLKL 3VR1A 5ETNA 3UDCA 3E8OA 1KOHA 4DV6J 5D6GA 4BWJA 3DM2A 5A8KB 3T19A 3HHLA 3CCUS 4F4WA 1F1BB 3EGWB 2B4OA 2FJWA 2LQJA 5A2QY 2BOAA 1IJEB 2RH3A 4QOTA 3J80Y 2ZHAA 2OHDA 3V4IB 5DM7Q 5AXKA 3MFIA 1BXNA 2FHOB 4L3KA 3ZTQA 1MMLA 4B9VA 3BYRA 3UD3P 4MK7A 3GFYA 1TL3B 3QT8A 1CJUB 1PYOB 1LFPA 4PWDA 3PYEA 4K5SA 3MCNA 4M5JA 4DX8H 4EBEA 5B0FA 5CD4A 3OL7A 3TW0A 4AUKA 5D4LA 1N32J 4HDHA 1EKSA 4ZVEA 3OTBA 2RF2A 1SH2A 3OT9A 4MK8A 4I1TA 3DMJA 3BBCA 2OELA 3B82A 1Q78A 4O44A 5C42B 3NMRA 1UVJA 1AZSA 5I42A 2ASJA 4DV1J 4P72A 2EXUA 1HW8A 1LK5A 1QSSA 2XLIA 5BYRA 4OZ1A 3KLIA 2PI4A 1O0PA 3BREA 4O0NA 2CG8A 1RTDB 4DR6F 3R2CJ 4WKRA 3HD2A 2MZ1A 4LR9A 1B7YB 2UXBJ 1VK3A 2VBZA 1VIXA 1IKYA 1Q8BA 3HSJA 4USMA 2XCAA 1NK8A 1FTRA 4ERDA 4CM2A 3NLCA 1PBUA 1RBAA 3K0JA 5KOWA 4RKUC 3GE9A 4RNNA 1D0EA 3SFGA 4Q8FA 4N56A 1HLWA 5KFFA 4KAIA 3NOGA 3NCQA 5LXYA 3BSOA 4OX8A 3P4UB 2XLKA 4ZP7A 1KONA 2RB7A 1VBKA 3M8QB 1M0SA 4KKOA 2FB0A 3UN2A 2MLYA 2DGQA 3NAIA 2R7QA 4NLYA 3C46A 2VU5A 3BBFA 4URQU 4DQSA 1DLOA 2IJRA 1HBUA 5E5NA 2R3VA 2RKIB 3C3LA 4CO4A 3K8VA 3P5BP 5CABA 3RW7A 1C1BB 1B64A 1PJ7A 2Z57B 2GFFA 3CEDA 5ADZA 4LF1A 1FKOB 3ZNJ1 3LPEA 3BR8A 5JUMA 3SDEB 3HX9A 4DUZJ 5HMZA 3I9V9 3RW6A 5I4MA 2BJ9A 2BQUA 4G1QA 2DXDA 1PC4A 1TAQA 4ECZA 1M5OC 4ZPVR 1NHUA 2HBRB 3SSSA 1SL0A 2C3MA 3GYXB 1WC5A 2ZZMA 1RT1A 2DGWA 1BQXA 2GNKA 3UWTA 4MJKA 1M5KC 1F9EB 2JFKA 4JI6J 4ECTA 3KUEA 1RISA 3M1VB 1P1TA 3D1QA 1HBMB 4UQGA 3SEOA 2A18A 3DN9A 2GA7A 1C1CA 2D69A 5J2PB 4KPYA 1UAWA 1LFWA 3OSPA 3MM6B 1WKLA 5J1EB 4TU8A 3OTEA 1TL7A 4IOAQ 2ZJQQ 5DDRC 1WSVA 2DKOB 2JX2A 3O44A 1EHWA 4ILLA 1WG5A 3JXOA 5IWAF 4J9PA 3L09A 4F50A 3O8WA 3PZPA 3T1YF 4NI2A 3UNYA 1L3VA 4IDKA 2AJ0A 3AODA 4YB5A 4JI1F 3ZZTA 1U1NA 1AA1B 3CDAA 4YS2A 2FIUA 1LK7A 2LXFA 4PYAA 3D3CJ 3LO3A 2HVDA 3FEYB 2NYHA 2BW2A 1KR4A 2DD8S 2RMLA 1LQ9A 3Q8YA 1JLBB 1RAFB 3RRHA 4IQXA 4K5RA 4BS2A 1ZM3A 1G1XA 3PO4A 1SC4B 5HBMA 4LIWA 4QWDA 4X4QA 1WDTA 3T1AA 3GIIA 1FRKA 3CCLS 5HI7A 3EMTA 4NCGA 2DH9A 3M30A 1YVFA 5K8MA 1AW0A 1TK5A 4ZIWA 2BV3A 5L1JA 2D3UA 1LW2A 3G71S 1FA0A 1WF1A 3LALA 4PAAA 4USVA 4KHMA 1OS5A 4NPOA 2YXLA 5DG7A 3TZZA 4X4UA 2IVYA 2GAGC 1S7HA 2IM2A 2XSFA 1J2VA 2ZUAA 1VQYA 3PJXA 2MJUA 5GMEA 1P27B 3THTA 3TEGA 4DV2F 3RUBL 3D6HB 2OO4A 1X4FA 2W2NP 4HACA 3EZ5A 3THPA 3RB3A 3AJ1A 4DQQA 3C15A 1VC6A 1RAAB 1U24A 2E44A 5D4PA 4NLWA 2JEJA 1DAXA 3HZGA 3BGOP 3LGHA 2CDRB 3PRBA 1W2IA 1FRHA 1SC1B 5BXIA 4OLOA 1W2BR 3R97A 4I2PA 3HVTA 3M6UA 3H2UB 5HJYA 5A8RB 4FNHA 4RX6A 2YKNA 3WX8A 4IFVB 1TMMA 3QAEA 4UOHA 3MM8B 4KGKA 3B6BA 5KFXA 2MHEA 5A8KA 2PMWA 2XTJP 1ZH5A 3GLJA 4X66J 1VQNS 2BJ1A 2XMUA 4YFUA 3I9ZA 1ROFA 1X9SA 4LF9J 5KFGA 4MMOA 2OMOA 1MG7A 4WXOA 3A12A 2VBWA 4DCJB 4OYZA 3L3CA 2FJDB 1KBRA 2LP4A 1RHQB 4Y2AA 1RT5B 1TL3A 4AD6A 2RS2A 2IJFA 1VFJA 1CJUA 2Z56B 3IFEA 2VOOA 3PX6A 4CH7A 5F41A 2UXCF 1RCXB 3LQVA 1G7CB 3CXCR 2VQEF 1VQKS 1QAXA 1OMSA 3K5PA 5HP1A 4NXNJ 3F44A 1MROA 4F0HA 2IRUA 4GKKF 4OZNA 4P74A 1F3VA 3G8QA 4UUWA 2CJQA 2OD4A 2B7BB 1PBAA 1JLCA 1HARA 2Y1JA 1CJKA 4CO2A 1XMQJ 2BQRA 4E2FB 1Q8LA 2G9OA 2X51A 5AE3A 2Y0BB 4YHHJ 1LKZA 1S6PB 2Q6CA 3G82B 1RWWB 4OV6A 2XO7A 4B9TA 1YJUA 4NCBA 2P8IA 4RL1A 5D77A 5LSLA 2MQMA 5K8NA 2BACA 2HQDA 5KFBA 2UV8A 3MMJA 1FFSB 4DV0J 4TLRA 2XEXA 3EPIA 5AT1B 1APSA 3MM7B 2W4CA 4GC6A 1KQGB 4F0MA 3NKYA 1DBDA 5EWEA 1P6TA 1Z1ZA 2DO4A 1Q81T 1S1WA 2OIHA 2GMLA 4YR0A 1R8PA 5LSOA 3W9HA 5J2QA 2NCKL 5CQGA 4IRDA 4DSFA 2UXDF 1SJQA 2NR0A 3TOQA 4CLPA 1E6YB 1CEZA 1IBMF 2H65B 3M8QA 1UJ4A 2LQ5A 4EU0A 1RTJA 2OAUA 3DOMB 3DFEA 3RBZA 5DGBA 1U26A 4LFAF 4Q2LA 2VASA 1RT2A 4MKAA 2RKIA 4CLUA 3EICA 2LA6A 3H0PA 1ZTTA 1AUSL 5C2CA 1FJCA 1WTFA 4UY8T 2EWHA 4PKDB 1MMNA 2WB4A 4JV1A 5HAOA 2LQ8A 1HNZJ 4ALZA 1JXEA 2E1CA 2QV6A 4J9VA 4ECXA 2AJ2A 2MQPA 5K20B 3FMWA 1JIHA 1FERA 3TZWA 5C5JA 4P6QA 3VAMA 1W25A 2F5GA 4NLDA 2EK6A 5DS7A 2NREA 4AQYF 1FFGB 2AGQA 1U49A 2W4PA 2R8KA 3QFHA 4NE9C 5DDPC 4WU2A 3UPFA 1FKPB 1X4HA 4I0WA 3DOKB 1RCOB 2HBYB 2XY7A 4GKJF 3M1VA 1U2RA 1H7XA 3S8SA 2LXIA 3CCJS 1QAIA 2CAJA 4DL2A 1HBMA 3DGPB 3VAIA 5HMWA 1BUXA 2KT5A 3BGFA 3OFHA 4ZCLA 4USKA 2F9JA 2M4MA 3TUZC 4X4RA 4F8RA 3OHBA 2J8SA 2VB6A 3JS9A 2YX1A 5J1EA 4OV1A 2JZ5A 3O3LA 5KFZA 7FDRA 2OTJS 1S1UA 2XZWA 1R43A 1HQEB 2P6TA 2R4FA 3CCMS 3QWUA 4C8KA 2GVDA 3IA0A 3OTOF 1XR5A 5ETOA 2F4FA 2YH0A 2J0XA 2JSXA 3KG0A 2VUGA 1T11A 3ZZUA 2E9ZA 2DNGA 3I5CA 3RAXA 2NSBA 1QUPA 4F3QA 1UPPA 4HHUA 2VQFF 3QIDA 1Q16B 1YBAA 2JEFA 4DBQA 3T5KA 3EWGA 1HNXJ 2CQCA 4F25A 2PA8D 1VQPS 2ASYA 2YX7A 4FF2A 4PWWA 2GC8A 2B3TB 4PG5A 5LMNJ 1GNKA 3DLHA 1GTEA 2QYGA 3SCLE 5SZTA 3AB4B 1NJYA 2PMZD 3LH2S 4C48A 4HL9A 4DWIA 3MECA 3CDUA 4Y2IA 2HLTA 4O3SA 5JJBA 3NGKA 4KYZA 1X0FA 3TAQA 1IR0A 2BA9A 1WKKA 3EYZA 1ZOTA 1TKTA 4J9OA 3RRGA 2V2KA 3BN4A 3FRYA 4KQZA 3CJ0A 4B3MF 1UEUA 3Q2SC 4O0IA 1RB0A 2JH3A 5DM6Q 1SPBP 4NASA 4FXWA 3FEXB 2QMXA 4EYIB 3CT9A 3C6UA 2G13A 2J6UA 3HFVA 1UW4A 4RW4B 3R5AA 3C6TB 4EMDA 1R3NA 3A1YG 2KZMA 2HHXA 3N9UC 4A48A 5H9EJ 2H5IB 3QFWA 4JI2J 3TZXA 1Y3KA 2KT3A 2RVJA 2HWTA 3D7SB 4KIAA 2ZH7A 4IFVA 4K4WA 2B6AB 1T3OA 3MM8A 2K3KA 2R2UA 2BR0A 4KV8B 5E3QA 2L3MA 1RXOB 1QDUB 5AXMA 3JSRA 2CQ0A 3GJTB 4USIA 3KHLA 3NGDA 3Q2TC 4XO0A 1S49A 3UE2A 3NWRA 1N6QB 4ZVOB 4RZRA 2L9NA 2W2PP 2W8LA 1R27B 3B8HA 4DR6J 5KFCA 2BRKA 4TXSA 1FDDA 4DR5F 4QIGA 1RT5A 4JB8B 2W1BA 4X4SA 3OQ2A 3R3TA 4NXMF 5HVFA 3LP1B 3NNCA 3FC9A 2CJYB 4KPCA 1D9FA 2A10A 2R7SA 4ELVA 2MKJA 1UW9A 1FEHA 3BPSP 4OHZA 1NB2A 2KG1A 1RWMB 1T02A 3FJ2A 2E5GA 4AFFA 2OTLS 3OLBA 3HFZB 1EQ0A 5LMUF 3TANA 4YB7A
chains in the Genus database with same CATH topology
4CWBA 3MCMA 1IM6A 3MCOA 4M5GA 3HSGA 2F65A 3MCNA 4M5JA 1EQMA 1RAOA 1TMMA 4M5KA 3UDEA 3UDVA 3KUEA 1RB0A 5ETNA 1DY3A 1KBRA 4M5HA 1Q0NA 5ETVA 5ETTA 3QBCA 3UD5A 3HD1A 2QX0A 3HCXA 4PZVA 4F7VA 4CRJA 3HSJA 5ETLA 2BMBA 5ETKA 3KUGA 1RU2A 5ETSA 3KUHA 1HQ2A 2CG8A 3ILLA 1CBKA 5ETQA 5ETOA 4CYUA 5ETMA 4AD6A 4M5LA 4M5IA 4CYUB 3HT0A 3HD2A 1RU1A 3ILJA 1EX8A 4M5MA 5ETPA 3HSZA 1F9HA 3ILOA 3IP0A 1TMJA 1EQ0A 4M5NA 3HSDA 2F63A 5ETRA 1RTZA 1G4CA 1HKAA 3ILIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CWB A;  3MCM A;  1IM6 A;  3MCO A;  4M5G A;  3HSG A;  2F65 A;  3MCN A;  4M5J A;  1EQM A;  1RAO A;  1TMM A;  4M5K A;  3UDE A;  3UDV A;  3KUE A;  1RB0 A;  5ETN A;  1DY3 A;  1KBR A;  4M5H A;  1Q0N A;  5ETV A;  5ETT A;  3QBC A;  3UD5 A;  3HD1 A;  2QX0 A;  3HCX A;  4PZV A;  4F7V A;  4CRJ A;  3HSJ A;  5ETL A;  2BMB A;  5ETK A;  3KUG A;  1RU2 A;  5ETS A;  3KUH A;  1HQ2 A;  2CG8 A;  3ILL A;  1CBK A;  5ETQ A;  5ETO A;  4CYU A;  5ETM A;  4AD6 A;  4M5L A;  4M5I A;  4CYU B;  3HT0 A;  3HD2 A;  1RU1 A;  3ILJ A;  1EX8 A;  4M5M A;  5ETP A;  3HSZ A;  1F9H A;  3ILO A;  3IP0 A;  1TMJ A;  1EQ0 A;  4M5N A;  3HSD A;  2F63 A;  5ETR A;  1RTZ A;  1G4C A;  1HKA A;  3ILI A; 
#chains in the Genus database with same CATH topology
 4A8K A;  4AXI A;  3MUT P;  4C4W A;  4PAB A;  1HNW F;  1VQS A;  4FP9 A;  3KYL A;  5IT9 Y;  2QG9 B;  3AQP A;  2EBE A;  3I82 A;  1T9Y A;  2NXN A;  4X65 F;  3NBP B;  4JUZ A;  3G82 A;  3PYF A;  2FZC B;  4E0D A;  5K14 A;  3CD5 A;  3WBZ A;  1YG0 A;  2H5J B;  2ZH5 A;  2OH2 A;  1Q53 A;  5MAO A;  2QL7 B;  1RT4 B;  2CJ9 A;  1KHW A;  1RE1 B;  5IT9 U;  3M32 B;  2W9A A;  4B3T F;  1IWA A;  4KTQ A;  1KFS A;  4WIQ A;  1GFW B;  3AA8 A;  1XMO F;  1JLF A;  4DX5 A;  3MM7 A;  1FI4 A;  2AZ1 A;  2NYI A;  5CXT A;  1MNE A;  4ECR A;  4AT1 B;  1HNV B;  1X4B A;  3POT B;  2ZVI A;  2PI5 A;  1WI8 A;  5F3T A;  2RQC A;  3MDF A;  1B0V A;  4HT7 A;  4TYA A;  4JV2 A;  3U1L A;  2MQN A;  2ZDP A;  4USU A;  3IR5 B;  3HSD A;  3SIP B;  4IKA A;  1E6Y A;  2JVR A;  2VHG A;  2R9L A;  3DRX A;  3G2X A;  2UUA F;  4FBU A;  1Q0N A;  3RZA A;  2B9Y A;  3SZ2 A;  1HA1 A;  3DOM A;  4NYP A;  4MIW A;  1LEO A;  4QQB A;  5GAH I;  3DXB A;  2C3P A;  3W2V B;  4LFC J;  4DPU A;  4FDF A;  3VZI A;  1FRI A;  1CG2 A;  3AAW B;  3P8B B;  1G2E A;  3MWB A;  4LUB A;  3H8Y A;  2YNI A;  1QSY A;  3KJF B;  4BLG A;  1JNR B;  1WJ9 A;  3TEH B;  1IBL J;  3FFI B;  2V8V A;  1RAO A;  2EVZ A;  4KRW A;  1T03 A;  3HVW A;  4KJI A;  1Z2L A;  2YNF B;  1RWX B;  4PUO B;  2Q43 A;  3V5R A;  2BM0 A;  1KVJ A;  5KFV A;  4DV7 F;  3G8T A;  4ZCI A;  1ARO P;  3ZZY A;  5AJ3 F;  2RHS B;  2A0F B;  2PEH A;  3KFW X;  1XTZ A;  2ZUG A;  5JVG Q;  5KFQ A;  2XS5 A;  1FKP A;  4RU2 A;  2IC3 B;  4JI1 J;  4YUD A;  3DOK A;  2HRU A;  1FXR A;  2B9E A;  4ZPB A;  2HFZ A;  2NQP A;  1R6Y A;  5LM7 E;  3HK2 A;  1ZET A;  1K0T A;  4Y0F A;  2PGC A;  2W8K A;  2QX0 A;  3DGP A;  3CCQ S;  3NY0 A;  3VQT A;  2ZVS A;  1DQ8 A;  2JWN A;  1TP7 A;  3AJD A;  2HNZ B;  1NHV A;  4NA3 A;  2P5V A;  5KFW A;  1RHR B;  1JJH A;  3IXQ A;  3U1M A;  1HQE A;  4V19 J;  3MEG B;  3CC7 S;  2RNE A;  4EWT A;  5D3G B;  4Y6I A;  1HWU A;  2JHE A;  5KT7 A;  2RAQ A;  1F0X A;  4BC9 A;  3CB4 A;  8RUC A;  1OO0 B;  1V3S A;  5A6W A;  2V34 A;  3IGN A;  2DNQ A;  1A7G E;  2EFV A;  1IBC B;  1YX2 A;  4KSE B;  2K3I A;  1A9N B;  1GX5 A;  4UF4 A;  1Y3J A;  2XMW A;  4F4Y A;  1TZ0 A;  2ZNY A;  4CH0 S;  3GWC A;  3VF0 B;  2WK4 A;  3DRS B;  3DU5 A;  3A8E A;  1NDK A;  4DL7 A;  3ISZ A;  2ASD A;  1KP6 A;  2E7W A;  3SV3 A;  5F8M A;  3SCK E;  1H38 A;  2ALZ A;  4LVN P;  1IQT A;  2ADB A;  4UTG A;  4JOU A;  3F56 A;  4UT4 A;  3MUR P;  2QA1 A;  2K06 A;  4DHV A;  1VC0 A;  1RKJ A;  4YDD B;  2IHR 1;  1PGZ A;  1JLG A;  2RJZ A;  1SJR A;  1IVZ A;  4P7V A;  3OFG A;  1U0S A;  5EN1 A;  1IN0 A;  1GMV A;  1IXK A;  3BGU A;  4KFB B;  2EFQ A;  1MU2 B;  5KFH A;  3N28 A;  3CJ3 A;  1N36 J;  2YNH B;  2Z58 B;  3ZTO A;  2MLZ A;  3MCO A;  2MZQ A;  3HHE A;  1U1R A;  1CJV B;  1K8A T;  4DX6 A;  1UVK A;  2J6S A;  3FSY A;  4IH7 A;  2GW8 A;  5HK4 A;  2N3O A;  4N8N A;  2F65 A;  2W2Q P;  3U1N A;  3QMQ A;  2W2M P;  4HVZ A;  3A3P B;  2G0I A;  1FX4 A;  3I0R B;  5DET A;  1TUW A;  1Q7Y T;  4I7F B;  2OFH X;  4KV8 A;  5T41 A;  2X3G A;  2V2Q A;  1T9T A;  2LU1 A;  3MM5 B;  1RA6 A;  2GIF A;  4WP8 A;  3VQS A;  1J5E F;  3VGT A;  4JI3 F;  5LJ5 Y;  5DRK A;  3Q24 A;  3KK1 B;  4L6V 3;  4YN3 B;  2GV1 A;  1HBO A;  1HQU B;  1BMQ B;  1Y4Z B;  1WC0 A;  4LRB A;  4K4U A;  4OZ3 A;  2Q66 A;  4J37 A;  4I6A A;  4EO8 A;  1VRT A;  4F4Z A;  2C22 A;  2KL8 A;  4MAK A;  3M2R B;  4OQJ A;  5D0H A;  2V4R A;  1H6K X;  1BQN A;  1KDN A;  1CQN A;  3KHG A;  1S59 A;  3PX0 A;  2XGQ A;  2L41 A;  1NBE B;  3IR7 B;  4ZP8 A;  3TA0 A;  4ECW A;  2BKO A;  3NS7 B;  4DS5 A;  1VR6 A;  4IQM A;  4FYD A;  4LRD A;  1A0O B;  2LEC A;  3LP1 A;  2RRB A;  5FJ4 A;  3J7Y I;  1FNX H;  1F2H A;  3TI0 A;  4PXE A;  4IH6 A;  3BS9 A;  3N5B A;  5C25 A;  5KFJ A;  4YOE A;  4ES2 A;  1HW9 A;  5M2R A;  2MQQ A;  1CJT B;  5KFI A;  5E33 A;  1TEL A;  3QGG A;  1M5H A;  2DGS A;  4ZA1 A;  4CLL A;  4L76 A;  3CE8 A;  4WK1 A;  3HJF A;  2DIS A;  1RAE B;  1X4G A;  3A8I A;  4UW2 A;  1T05 B;  2DNL A;  2OPP B;  1R0B G;  2CPH A;  4CZC A;  1G4C A;  3ISN D;  4Y65 A;  1BQM B;  1RYS A;  4XDC A;  3GCW P;  1S48 A;  4RJV A;  1RT4 A;  1O8B A;  4AYB D;  3V6J A;  4DV6 F;  1RJJ A;  2DT9 A;  3M32 A;  3EXY A;  4WCE Q;  1UL3 A;  3OVA A;  1FWK A;  1QTM A;  4UZB A;  4PPZ A;  2EC0 A;  2VG5 B;  4P73 A;  2QJ3 A;  4DCP B;  2MGZ B;  2XQC A;  3IAM 9;  3RTV A;  1LW0 B;  1RU1 A;  1HNV A;  2GJF A;  2GO8 A;  3C16 A;  1KTV A;  2CNK B;  1RAI B;  4P71 A;  2BYC A;  2C3Y A;  1VRQ C;  1WOS A;  1SJF A;  4QCL A;  1VLO A;  3G6X A;  3QGH A;  1CBK A;  4AE5 A;  4N76 A;  4F02 A;  3EGN A;  2B5J B;  3GZ7 A;  2YTC A;  1PG5 B;  4KO0 B;  2ZKT A;  1YHQ S;  1M5S A;  1S1V B;  3D67 A;  4DEZ A;  1JB0 C;  1FX2 A;  3IM8 A;  5HLF B;  3ZO7 A;  1JLE B;  1I5O B;  3W2V A;  3NAH A;  2OGU A;  4YY3 J;  2HGL A;  3DRP A;  3CCS S;  1YK9 A;  2HVH A;  2MPU A;  1S9G B;  3OFF A;  4CNZ A;  2ROE A;  4Q0B A;  2AJQ A;  2GGP B;  2NZ4 A;  3GON A;  3W5Z A;  1KSP A;  3T5L A;  3W9J A;  2F4V J;  4DV1 F;  4R0J A;  3FFI A;  4ZN1 A;  3BQ0 A;  4DN0 A;  1YJN S;  1R7I A;  3CJK A;  2YNF A;  3M8Y A;  2E1M C;  1URR A;  2LQB A;  4R0E A;  4H4O B;  3OTO J;  3UN5 A;  4EUV A;  2OML A;  2NSC A;  3BSA A;  1X60 A;  2UXB F;  4FYW B;  1C4C A;  5IC4 B;  1FE4 A;  1NPR A;  3SXL A;  4M5L A;  1KC8 T;  3TAM B;  3CC4 S;  2BKN A;  2FC9 A;  2LU2 A;  1EJ7 L;  2M88 A;  4ZDN A;  2LMI A;  4C3M A;  2VFV A;  1IBK J;  4RUB A;  3ENW A;  2PII A;  4AL7 A;  2FY1 A;  2HNZ A;  2MB0 B;  4M8L A;  4IRK A;  2PFF B;  5A0Y B;  4N77 A;  4JV0 A;  3IAS 9;  4IYQ A;  4DF4 A;  2L48 A;  5I3Q A;  4QYR A;  1OJ4 A;  5IXU A;  4QPT A;  3DKD A;  1TU0 B;  2V6A A;  2D74 B;  3SCJ E;  5L38 A;  5D3G A;  1WWH A;  4CP5 A;  1DTQ B;  2YKQ A;  2YWW A;  4UY8 5;  1VQO S;  4ZOS A;  3PKY A;  4Y3C A;  1KS2 A;  3HT3 A;  2V9W A;  3I32 A;  1SC6 A;  3D6T B;  3FMB A;  3A8K A;  2GIR A;  3J7Z T;  1OPI A;  5D4O A;  3QRR A;  2RDJ A;  4B3M J;  1S1T B;  4ECS A;  1JXL A;  2YPY A;  1PJ5 A;  3GSI A;  2W9B A;  4C8O A;  4A47 A;  5CH7 B;  7FD1 A;  2NZC A;  2AHO B;  1VHI A;  1GH8 A;  1U1K A;  2HNY B;  3X3U A;  4NZ6 A;  3A3O B;  2RDD A;  1TFY A;  2HEK A;  1K47 A;  2ZNZ A;  4QIW D;  1UJ6 A;  1H0H B;  4JI6 F;  3CJ4 A;  3ONQ A;  2UU9 F;  2KJW A;  1NXI A;  3E3X A;  3J7A N;  3DOL B;  1NME B;  1S0V A;  1UEK A;  2OPQ B;  3PYD A;  3IM9 A;  4KFB A;  4F4A A;  4U8Y A;  3W63 A;  3TQE A;  1NH7 A;  3TNV A;  1NK5 A;  2QLB B;  4P52 A;  5KFM A;  2FTR A;  3JYT B;  5C7P A;  3FRZ A;  3T1H J;  2BVZ A;  2XG8 A;  4R8U B;  4D3G A;  4J90 A;  4DJB A;  2WSC C;  2ZWP A;  2DIU A;  1S0O A;  1SIZ A;  3ETO A;  2C2M B;  2W24 A;  3CD0 A;  2CKW A;  3MCS A;  1P1L A;  3CCV S;  2H9Z A;  2NXC A;  3OHA A;  3EDR B;  4W98 A;  1HFE L;  4QR1 A;  3I0R A;  4C8L A;  2F40 A;  2J9D A;  2HVE A;  3BKU A;  2IFX A;  2AP6 A;  2EI5 A;  1ACM B;  3I87 A;  3NGU A;  3BO2 A;  2V2V A;  2VDH A;  3MM5 A;  1NKB A;  3DLE A;  4KT0 C;  5KFK A;  3SCI E;  3PM9 A;  3N6N A;  3DLB A;  3RB4 A;  3IP0 A;  1XR7 A;  1W26 A;  3KK1 A;  3BV8 A;  3Q8V A;  2CWK A;  2CPD A;  4N7T A;  4LF8 J;  1HQU A;  1ULR A;  2DRD A;  5EDW A;  3MM9 B;  2R7O A;  4J9R A;  3KJQ B;  1NDP A;  5ETT A;  1KOO A;  2XWX A;  4K4S A;  3M2R A;  5GMD A;  2E5L J;  2JNJ A;  5GAG I;  5E3A A;  3QNW B;  3LF0 A;  3T41 A;  1T8E A;  2VPW B;  1S6Q B;  1RWO B;  1QSL A;  3OR1 B;  2K8G A;  2AT1 B;  4M95 A;  2BOP A;  3PHT A;  5BR8 J;  3KXD A;  4ZK7 M;  1BD6 A;  1GXT A;  3M7V A;  1H72 C;  3L4B C;  3N6L A;  2YKM A;  5GAH U;  1HHT P;  1IUJ A;  3FQL A;  3LTO A;  4HH0 A;  3HM9 A;  1B0P A;  1CJT A;  2JJ4 D;  1L5U A;  1FRL A;  3QGP A;  2J9C A;  3M2U A;  5KG6 A;  4ER8 A;  4K0K J;  4I6Y A;  2V68 A;  4DU8 A;  4NL5 A;  4RWX A;  3Q22 A;  4H4K C;  2OEJ A;  4NEY A;  3KOA A;  2ZE2 B;  3I96 A;  3NNA A;  1BQM A;  3CJR A;  2DEJ A;  4CLY A;  2DGU A;  2HBQ B;  1HQ2 A;  2ZEJ A;  1EZZ B;  5ETM A;  5KT6 A;  2W9C A;  1YTY A;  3SSQ A;  2VC1 A;  1YGY A;  5KFR A;  2HSE B;  3J7A 1;  3MPY A;  3NEK A;  3M6X A;  3R5J B;  2VG5 A;  5H9F K;  2HIQ A;  1UPM B;  3QSI A;  4EBC A;  2MGZ A;  2CNO B;  4ELT A;  1OQ6 A;  1LW0 A;  2WSE C;  1S10 A;  3BH7 B;  4GC7 A;  1YRT A;  2FJV A;  4LF9 F;  3NRB A;  1TVR A;  1N56 A;  3S1T A;  5DDQ C;  1JJ2 R;  1NCL A;  1TKZ A;  4KGV B;  3S01 A;  1ZPV A;  2ZIT A;  2H3E B;  1HR0 J;  4KO0 A;  1V5V A;  1H3D A;  2QSF A;  4WTY A;  1U6Z A;  4LR8 A;  1JLE A;  1NB7 A;  2SXL A;  5GAD I;  4NXN F;  1Q82 T;  4UOC A;  5L9N A;  3PHE A;  4EO6 A;  1NZ8 A;  3I56 S;  3D0I E;  1RTH A;  2VIH A;  4R5P A;  1YJW S;  1TFW A;  2GHP A;  1PJ6 A;  4LT6 A;  2GGP A;  1S6O A;  2H4Y B;  4KR0 B;  4ZVR B;  2Z2M A;  3AD8 C;  2WOM B;  4B9S A;  3KLF A;  4U7U D;  4YQW A;  4OMF G;  1XMQ F;  1CLF A;  4NRT A;  1N4L A;  2G2Z A;  4YHH F;  2DNK A;  5DQH A;  5I3U B;  1NM2 A;  3M9M B;  2EEY A;  3LP2 B;  4H4O A;  2V2Z A;  2XY6 A;  3ZZP A;  2QLF B;  4WFZ A;  3CC2 S;  1HPZ A;  3MD1 A;  4EYH B;  3TAM A;  3IRX B;  5HQL A;  2D9O A;  1XER A;  5T14 A;  1XN9 A;  4NCA A;  2ZKU A;  1WF2 A;  3D4J A;  2CQ2 A;  3HCX A;  2AX1 A;  1TK8 A;  4UOG A;  4K4V A;  1FD2 A;  1R6V A;  4G6V B;  3G96 A;  2D3O 1;  2OKQ A;  3PNI A;  4JI7 J;  4LF4 J;  5EX3 A;  2FVS A;  3W8G A;  5KG1 A;  2J7U A;  2VH7 A;  3BEG B;  2BJE A;  2CJA A;  5FD1 A;  1HKA A;  1VI7 A;  3MR7 A;  4TNO A;  5F8H A;  1GEH A;  2UVU A;  1JX4 A;  2MZJ A;  5F9L A;  4K4Y A;  1EIY B;  3BGR B;  4NLO A;  3DRR B;  3LOU A;  1Z4U A;  2CVE A;  2EC2 A;  2A2D A;  3HXM A;  5IQ6 A;  3KLG B;  1DTT B;  5A76 A;  4KGZ B;  2P9E A;  2J76 E;  2YY3 A;  1HNZ F;  2M52 A;  2RSQ A;  1S1T A;  5KOX A;  4FPR A;  4IH5 A;  2ZH3 A;  2R8I A;  4ETZ A;  1CS4 B;  4H4M B;  2EKY A;  3JAM U;  2FJB B;  3U7J A;  2BE2 A;  2DB1 A;  2KI2 A;  1JWW A;  2GCF A;  2HNY A;  1RTI B;  2YWH A;  1H2V Z;  2C3U A;  3ZFV A;  4ID5 B;  1BGX T;  5CCM A;  4UUX A;  2GS8 A;  3MED B;  1IR2 A;  3M9N B;  2FJX A;  3P6Y C;  1X8D A;  4DSL A;  3MTK A;  4LIR A;  3DOL A;  1VK8 A;  3M6W A;  3T6B A;  1EAY C;  4OI0 A;  5AXL A;  4WXW A;  5T7L B;  4X62 J;  1OWX A;  2DNR A;  3VAJ A;  3LAN A;  1S12 A;  5HMX A;  2V63 A;  2CNL B;  2QZ8 A;  3PIP Q;  3EX7 B;  5EUH A;  2WAQ D;  3B78 A;  1Y11 A;  3PR5 B;  3J7Y U;  1WEZ A;  4R8U A;  4NWB A;  1WHV A;  4NLR A;  1S57 A;  4J9U E;  2HAI A;  3UD5 A;  1DUR A;  3GR1 A;  2HFN A;  3MR6 A;  2A6O A;  4OI6 A;  3OXG A;  3FBC A;  1Y5L B;  4O4R A;  1JQG A;  2RQK A;  5E3C A;  3MUM P;  4IFY B;  3BO3 A;  4FNI A;  2XYG B;  3D0H E;  3D0G E;  3DLG B;  4I2Q B;  2XMT A;  1GXL A;  1U6B A;  2ZZN A;  4DFP A;  3K5L A;  3GIK A;  5DZ7 A;  3WZ0 A;  1Y0H A;  2Q1L A;  2PEB A;  5D8H B;  2H5E A;  3GYG A;  2PC6 A;  2VPZ B;  2AEM A;  3M8R A;  1HNX F;  1WEX A;  3GMG A;  3MAH A;  2G0J A;  3I5B A;  4M5G A;  3TAR A;  5LMN F;  4JYA J;  2UV8 G;  4DL3 A;  2Q6B A;  3THV A;  5HMY A;  4DS4 A;  2WZ1 A;  4TYB A;  3QJJ A;  5KTQ A;  4A8F A;  3DYA B;  2M2B A;  4L73 A;  1X7V A;  2VV5 A;  1XNR J;  3R6G B;  4WJB A;  5IM0 A;  3PKM A;  3GJS B;  4F4K A;  4DUY J;  3RBD A;  2X1A A;  4DG1 A;  3PAC A;  3ZNU A;  1LXN A;  3OR1 A;  3NWG A;  4FPI A;  2XYH B;  4W90 B;  3TVY A;  3HHL C;  4DSK A;  4NYO A;  2JRS A;  3GJQ B;  3M05 A;  2R2S A;  2C2N A;  3OW2 R;  2DY9 A;  3KLE A;  4OJH A;  5KFU A;  2X3D A;  1GXU A;  2LKZ A;  4ZPT R;  3UCZ P;  4YR2 A;  3SQG B;  2CPZ A;  3H5U A;  4PQU B;  4Y2M A;  1HHS A;  4K7Q A;  5L1K A;  1SQG A;  4IG0 A;  4PPD A;  4CT9 A;  2DPJ A;  2ZE2 A;  4JI2 F;  2KN4 A;  2WCX A;  1XK8 A;  2OPS B;  1ZM2 A;  4WYL A;  4N41 A;  1TKX B;  4TU7 A;  1V5I B;  1ICE B;  3UCG A;  3H59 A;  4YEA A;  1UWA A;  1N5Y A;  2HBZ B;  3DLK B;  3JTO A;  4ED1 A;  2AJ1 A;  3L7P A;  2EFP A;  4WFX A;  5HO4 A;  2I9S A;  2CPX A;  4F26 A;  3ZZ0 A;  4OHW A;  4USH A;  5KFP A;  1T9U A;  4OJG A;  3PW0 A;  1N88 A;  2R8J A;  2PE8 A;  4HHJ A;  4DLG A;  4HTI A;  2HHQ A;  4ZHR B;  3R6L B;  4RU9 A;  1SV5 B;  4MYU A;  1FXD A;  2Z2Z A;  2JLE A;  4URS A;  3U02 A;  3H20 A;  5AXN A;  2VIC A;  1MN9 A;  5F8L A;  3I0S B;  4DR3 J;  4DPX A;  5JXS A;  1XEZ A;  3QPI A;  2RRA A;  3QIP A;  1KNZ A;  4IO9 Q;  3OVS A;  5H1S V;  3UDE A;  1ZYQ A;  3O2I A;  2MZS A;  2GJI A;  1TV6 A;  2WW8 A;  4ZVP B;  2CDQ A;  1B7F A;  3S6E A;  3H42 A;  4C0B A;  2W4D A;  1VLY A;  4GO7 X;  2LQ9 A;  2E9R X;  1JJ4 A;  2RIL A;  2RU9 A;  2I5J A;  4WFY A;  3BJY A;  2HLU A;  4EZ6 A;  5F9N A;  1BC6 A;  2AU0 A;  4XTT A;  2WOM A;  5J1N A;  4CO3 A;  3H40 A;  3FSX A;  1Y5N B;  5BYS A;  3LPY A;  1RHM B;  3ZXW A;  4FS1 A;  4CLK A;  4QPX A;  2DPI A;  3WQP A;  4BWM A;  1FJG J;  4LF5 J;  1JLA B;  3FQK A;  3AY0 A;  2Q3P A;  3TA2 A;  4KH1 B;  2QMU B;  3OV7 A;  5D15 A;  4OJ3 A;  4O3Q A;  4MK9 A;  1SKR A;  2B7C B;  1RT7 B;  5IS2 A;  4Q44 A;  1FE0 A;  3HLU A;  3MEE A;  1TL4 A;  6AT1 B;  4BHQ A;  2P9G A;  2FY8 A;  4LQ3 A;  1IKX A;  2Z30 B;  3CUN A;  1S9E A;  5CCL A;  5ETR A;  5F8G A;  3QRP A;  3R5B A;  3N0V A;  3FBF A;  2D3O R;  4F2S A;  4J7C A;  4ES3 A;  3BSN A;  4ZJQ A;  4F0K A;  3PX4 A;  4GVB B;  2XNR A;  3H5S A;  4O3N A;  4OZ2 A;  1SBR A;  1PCA A;  3HVR A;  9ATC B;  3R1H A;  2JEI A;  4JV5 J;  1N34 J;  1FD8 A;  3DXS X;  3W2W B;  2YNG A;  3BSC A;  5KFT A;  3QZ7 A;  4DPY A;  2FYX A;  4K59 A;  3PDN A;  4ECY A;  2G0C A;  3HHD A;  4ZJL A;  4DR1 F;  2QMW A;  3TRG A;  4UOF A;  2UU9 J;  2HMI B;  3LAM A;  1UEV A;  1PIL A;  4LFC F;  3KMQ A;  1IKW A;  2C2D A;  3R9L A;  4ZCM A;  2BRL A;  2QE5 A;  1KFD A;  2WVB A;  2HHW A;  3H4B A;  3HSZ A;  4ZJO A;  5SUH A;  4GRS A;  1NKC A;  3TJ9 A;  1FK9 B;  3M8S A;  3T3F A;  2IVF B;  5KT2 A;  3Q8R B;  3HVA A;  1IBL F;  3ILL A;  4NZ0 A;  4P2M A;  3CCR S;  5KT5 A;  3UVJ B;  1CS4 A;  1FDB A;  3CIZ A;  3PFE A;  4XK8 C;  2Z2L A;  1GX6 A;  1H98 A;  4QW8 A;  2MDA A;  3AH6 A;  3AOA A;  3MED A;  5LSR A;  2GHW A;  3CJQ A;  4RR5 A;  3FSI A;  3FK4 A;  1KWM A;  1PYT A;  5GAG U;  1U4B A;  3EXC X;  1AYE A;  1VQ8 S;  5HJX A;  2R7R A;  2ZC4 A;  4ENO A;  3ZC4 A;  2E66 A;  1K44 A;  3T9Z A;  1KQF B;  2E29 A;  1X5S A;  4OYP A;  2UP1 A;  4IR9 A;  1MWQ A;  2ZD1 B;  1S72 S;  3R7B B;  3GU0 A;  3NOC A;  3L95 X;  1OQ3 A;  1FVQ A;  2H1Y A;  4QYZ J;  2PO4 A;  4KBI A;  4PG6 A;  3MHY A;  2X7I A;  3HZE A;  3NCR A;  3RB0 A;  3MD3 A;  4QW9 A;  1R0A B;  3HPO A;  1F5A A;  1U6F A;  1VQ4 S;  4JI5 J;  5CD4 H;  3J7Z 5;  3CDE A;  4IFY A;  2NXU A;  1FTC A;  2FGC A;  4DI6 A;  4LFB J;  2HWI A;  3DLG A;  4I2Q A;  2LVW A;  1YJR A;  1TKD A;  2K7J A;  5D78 A;  3IRW P;  4DR7 J;  3OL8 A;  4WZQ A;  5B0G A;  2EG2 A;  2MKS A;  2FLL A;  1RLD A;  4L72 B;  2UUB F;  5CYM B;  3N5F A;  2VG6 B;  4QIF A;  3OJU A;  3CJ2 A;  3EUN A;  2LYV A;  3C19 A;  5K9F A;  4Q8E A;  4NEZ A;  1TAU A;  2QC3 A;  3R8Y A;  1WKJ A;  4K4X A;  2NXE A;  3K7R A;  3DYA A;  2E7X A;  4ZIT A;  1Q7L B;  4YB1 P;  1FCA A;  2MKY A;  1Q5Y A;  2ZM6 F;  3R5D A;  4U67 Q;  1HI8 A;  2OEM A;  1XMB A;  4ED0 A;  3O6Q A;  2Z4P A;  1RQ0 A;  4LSL B;  2RD5 C;  3DM2 B;  3ENA A;  2WB1 D;  4OYB A;  2K7K A;  2GQ2 A;  1Q4R A;  5LOQ A;  2JC1 A;  5DGA A;  3CJT A;  3MMC B;  2K1R B;  1N36 F;  2HHH J;  1W7W A;  2IMW P;  2QA4 G;  2ZWO A;  5KG2 A;  4OZJ A;  3CCE S;  3V4I A;  5CYQ B;  5B7W A;  5ETQ A;  2XYP B;  5GAD U;  3KG1 A;  2NLW A;  1I51 B;  1UP1 A;  2VA2 A;  5FLX Y;  4WFN Q;  3G9C A;  4DL5 A;  3TAP A;  4J9Q A;  3JQM A;  3D6M B;  4OYW A;  4Y00 A;  3KLV A;  3ILJ A;  3MI7 X;  1ZAV A;  2QL5 B;  3I31 A;  3NS5 A;  4PWD B;  3GTY X;  2WHO A;  2HK2 A;  1P9Q C;  2KT2 A;  3OL6 A;  3RGI A;  1TKX A;  3GYN A;  1UCN A;  4JI0 J;  3UN3 A;  5FLX U;  2ALY B;  2G2O A;  4C9D A;  2BE9 B;  3DLK A;  2HZA A;  4P2S A;  3UI3 A;  1FT8 A;  5E2Q A;  2KTQ A;  4A8X A;  4M5K A;  4HI2 A;  4LR7 A;  4PCQ A;  5C42 A;  2XSJ B;  4O44 B;  2HAF A;  4I68 A;  1L3S A;  1RSC A;  2P6S A;  3UDL A;  2ZBC A;  1SV5 A;  2C42 A;  4W4M A;  3TUI C;  2F1F A;  4FF1 A;  3BF4 A;  2HZV A;  1NAQ A;  3W1Y C;  4FN5 A;  4PXD A;  4DZD A;  2MZT A;  3DC2 A;  3V2U C;  2ZH1 A;  1RTD A;  1D8Y A;  4PWU A;  4C98 A;  2XLJ A;  4CYU B;  1QY7 A;  4TY9 A;  1XR6 A;  3ILO A;  4X2B A;  4Z7Y A;  5D4N A;  4RUH A;  2FVQ A;  1EAR A;  3AOC A;  4O23 A;  3PTW A;  4LF6 J;  4X4T A;  3GIM A;  1IKY B;  1SL2 A;  3T6J A;  4LSZ B;  2F7V A;  2N4D A;  3D68 A;  3AFG A;  3G86 A;  3EJM A;  4FXV A;  2XY5 A;  1DRZ A;  3CUL A;  4FZV A;  6FDR A;  2O01 C;  4OYX A;  4B9M A;  1NSA A;  3IWX A;  3K17 A;  1NSK L;  3RR8 A;  4ATN A;  3A3N B;  1S79 A;  4P2X A;  4IOB A;  1GMW D;  4B3O B;  5JVH Q;  2HYI B;  3QWP A;  5EHH A;  4WF9 Q;  1Y9O A;  2VG7 B;  1JLA A;  3HHN B;  1D9A A;  3BBB A;  3GFZ A;  4ID8 A;  4KKO B;  1ZS6 A;  3D1O A;  1SKU B;  4RO0 A;  1S0N A;  3MEK A;  1DLO B;  4UZC A;  1RT7 A;  3VVT A;  4DX7 A;  1WNE A;  3DLL Q;  1U1Q A;  2KFZ A;  3W7B A;  2RIJ A;  2DVI A;  3OSN A;  3F0N A;  5HRO B;  1C1B A;  2C2O B;  2LXU A;  2XS2 A;  4ES1 A;  2BDP A;  3MOJ B;  2CPI A;  4JI8 J;  1FKO A;  2G1H A;  2QA4 S;  4GVB A;  3SDE A;  2UZA A;  2B4U A;  3G6Y A;  3C66 A;  5M2U A;  1U1L A;  1YZ7 A;  3EPG A;  4CQ1 A;  3BGL A;  4OIX A;  4DPT A;  3LUY A;  3IMQ J;  2G1D A;  1NHK L;  4G1Q B;  2J6T A;  1N5S A;  1FWL A;  4DR4 J;  3VGS A;  3GPA A;  4F67 A;  2EBG A;  3K89 A;  3J81 U;  5IC6 B;  3TVZ A;  1B4S A;  1Q5V A;  2HMI A;  2ATC B;  1RK8 A;  3HJV A;  2FVC A;  4HLB A;  1RA7 A;  2CJB A;  4YY3 F;  2FVR A;  2VFR A;  4N5S A;  3K5O A;  1HWK A;  2ASL A;  1VQ6 S;  2DH8 A;  5H9E K;  5J2P A;  4QU7 A;  3QLH B;  2AV5 A;  1SL1 A;  2MQ8 A;  1TL1 B;  2Z2Y B;  4NML A;  3MM6 A;  4FKX A;  3SI8 A;  2F4V F;  3KNA A;  5K8O A;  2ZHB A;  3H2V E;  3BDP A;  2AW0 A;  3UVJ A;  2RQM A;  4DDF A;  3BQ2 A;  4TQS A;  2DGV A;  3GJR B;  4NLQ A;  2OUG A;  2VC0 A;  4LRF A;  4TKT A;  2C2Z B;  4ZN3 A;  3LAK A;  4Z7C A;  5IQQ A;  1B99 A;  3CD6 S;  2C2E A;  3N4W A;  1WD6 A;  2ACM A;  3Q8Q B;  3KK3 B;  3GFX A;  1RAH B;  2UUC J;  1FRX A;  1NRK A;  1SVD A;  4LMZ A;  2AZ3 A;  3G87 A;  4U9R A;  3AOB A;  4IUF A;  2FDN A;  1IBK F;  1REG X;  4EZ9 A;  4HT5 A;  1JLB A;  2IRY A;  1X5O A;  1DFD A;  4TVA B;  3M6V A;  1T9X A;  4L74 A;  1TUG B;  3HD1 A;  4UQT A;  1NO8 A;  4HDG A;  5C24 B;  2KO1 A;  5HBM B;  5F0W A;  1SH0 A;  1XWL A;  4A8Q A;  2ROG A;  1YQH A;  4F2R A;  4RW7 B;  4C3K A;  2B0G A;  3MR3 A;  4NCG B;  3D54 A;  4QWE A;  3M30 B;  1S6U A;  1T9V A;  1R0A A;  1NJI T;  4ZP9 A;  3SMZ A;  3ZZR A;  2F63 A;  5CZX A;  4K50 A;  4DF8 A;  1U1P A;  2MY8 A;  4CO0 A;  4BC7 A;  1NKE A;  4B3S F;  4MKV A;  3UD4 P;  3JTN A;  1KD1 T;  2DH7 A;  1UJ5 A;  3LWL A;  3LW5 C;  2M70 A;  1FNM A;  1U0H B;  2DGT A;  2JL9 A;  3WIU A;  5IV4 A;  2MLX A;  3C15 B;  1NU4 A;  2HWH A;  5CYM A;  1N5Q A;  2DHA A;  1F2G A;  3LA0 A;  3TX0 A;  3ET6 B;  2BZ2 A;  3WX4 A;  1RHJ B;  4RBV A;  5L1I A;  3NG8 A;  2MEW A;  2N82 B;  2B51 A;  2D9P A;  3VVU A;  2YQ3 A;  1RT3 B;  4DPO A;  4K4Z A;  5A8R A;  1FO1 A;  4GO5 X;  4M5N A;  4ZVU B;  5L9X A;  2YKN B;  4FF4 A;  2XI2 A;  4OL8 A;  1CQM A;  4LSL A;  2N7Y A;  1XBW A;  4XAK A;  2VA3 A;  1GT8 A;  1X4C A;  2YWF A;  3PW2 A;  5BYQ A;  4RBU A;  3MMC A;  2K1R A;  2DXE A;  1WUU A;  1ZZN A;  2BW7 A;  5CYQ A;  4ZPD A;  2WVE A;  3T1H F;  1NPK A;  3WHI A;  1XQI A;  1WSR A;  3MAQ A;  5HN0 A;  1UZD A;  3EM1 A;  2F3J A;  2HW3 A;  3W3S A;  1NJX A;  5A2Q U;  5LL6 d;  2W7O A;  3J80 U;  2F8H A;  2QLX A;  2OPR B;  4LRC A;  2E5H A;  5KFN A;  1VJQ A;  4TU9 A;  3IC1 A;  2BBE A;  5ETV A;  2XCP A;  4O4G B;  3VGV A;  5HP1 B;  1D3W A;  4CO5 A;  2AMC B;  1Y10 A;  3SYZ A;  2IY5 B;  1MRO B;  4A8M P;  4PEO A;  1BWV A;  1M1K T;  2KHC A;  3KLH B;  1RAG B;  2DGX A;  3V4M A;  1YSJ A;  2XSJ A;  1JLC B;  3HF5 A;  3GV7 B;  1U7L A;  4LF8 F;  2ZC3 A;  1CJK B;  5F0U A;  2R8H A;  4Q7A A;  2H4W B;  2CA9 A;  4P75 A;  4Y28 C;  3GQC A;  1S6P A;  2E5L F;  1YBU A;  2N3L A;  3EZU A;  4OYA A;  4CLZ A;  4WKY A;  4Q43 A;  4CYU A;  4ED5 A;  2HVZ A;  5CYJ A;  3M8Z A;  1L3U A;  5BR8 F;  5ETL A;  4OX7 A;  3KDO A;  1G6B A;  2IM0 A;  1TQL A;  1FF2 A;  2H54 B;  1KQK A;  2CQP A;  4F3M A;  4QZV B;  1S1W B;  4PZV A;  4OZ0 A;  4ZLL A;  2LLZ A;  1J5O B;  1X9W A;  4JBC A;  4CIO A;  4K0K F;  3MGJ A;  5J2Q B;  1QUV A;  3B4D A;  1LWF B;  4B3O A;  1QVF R;  4JI4 J;  1WDD A;  2EFN A;  4DR1 J;  2VG7 A;  3W66 A;  4WFA Q;  3TJ8 A;  1RYR A;  2CQI A;  1RTJ B;  3B4M A;  3DDK A;  2R7T A;  2WW4 A;  3RBE A;  4ZVT B;  2PSZ A;  2LEB A;  4HTJ A;  1N52 B;  1RT2 B;  1F3F A;  1NPP A;  5E41 A;  2DBB A;  4QIE A;  2ZH6 A;  3OFE A;  4FYV B;  5HRO A;  3Q86 A;  5KAK A;  3QYY A;  2CQD A;  2DHS A;  2VJU A;  1IM6 A;  4ZCK A;  2F8E X;  3KDN A;  4PYD A;  2XBP A;  4OZ5 A;  1YIJ S;  1SUQ B;  3JQK A;  4DPW A;  1M90 T;  1S76 D;  3HT0 A;  1RHK B;  4A8O A;  4HEA 9;  4LQ9 A;  2ABY A;  5KFL A;  5L39 A;  1NK0 A;  4CLW A;  1HR0 F;  3QT5 A;  3A8J A;  1H2U X;  3KTQ A;  1KQS R;  3LP0 B;  1VS3 A;  4IR1 A;  4MH8 A;  3M2V B;  1UVL A;  3W62 A;  4EGL A;  1WHX A;  2KRR A;  2LFV A;  3TZY A;  2B9X A;  2AGP A;  4ZMM A;  5HL7 Q;  4WP3 A;  5HSP A;  3HFK A;  3IN5 A;  2R8G A;  5IT4 A;  1ZM9 A;  3PJW A;  3QLH A;  1TL1 A;  2J7W A;  2OLW A;  3TUP A;  1C0T B;  4DR2 J;  2WRM A;  2W7P A;  4WYW A;  1FDA A;  2PFD A;  2VZ9 A;  1PO6 A;  2ZBQ A;  1S1U B;  3KUH A;  1VRU B;  3R2D J;  1WI6 A;  4JP8 A;  3NL0 A;  4M5H A;  1D9D A;  2LCW A;  2GVD B;  4CRJ A;  3BZQ A;  1O51 A;  5F3Z A;  3Q23 A;  2NS1 B;  2GMH A;  2RU3 A;  2K2P A;  5KFY A;  3OTC A;  3KK3 A;  2JLF A;  1K9M T;  3FEZ A;  4KE5 A;  3M4X A;  1VC5 A;  4A8Y A;  1R8A A;  1HMV B;  5KT3 A;  3QAT A;  3CMA S;  2HRT A;  2UUB J;  4Z2X A;  2BM1 A;  4DQP A;  4LF7 J;  4ITS A;  3ITH B;  1AXQ A;  2FHJ D;  1WC1 A;  5C24 A;  3DGV A;  4KY3 A;  1SCJ B;  4M5I A;  1VBY A;  1XNQ J;  1IWG A;  1M1G A;  4JI7 F;  2KM8 C;  4LF4 F;  5EWG A;  5JMN A;  1SKS A;  1U47 A;  3HHK A;  2FJE B;  4RW7 A;  5DLG A;  3MTJ A;  2YX4 A;  1X5P A;  1V6H A;  1YJ9 S;  3TJA A;  2CG4 A;  4U95 A;  2ZM6 J;  2GVZ B;  3LWM A;  3FUY A;  2E9T A;  4DQI A;  3MEC B;  3D66 A;  3Q8S B;  1U2F A;  1FFW B;  4KHP J;  1R31 A;  4CLF A;  3TA1 A;  3PVX A;  4P9S A;  2DR8 A;  3QJL A;  2G2Y A;  1P9Y A;  3T9N A;  1Y5I B;  1TKT B;  2DR9 A;  2HND B;  2OP5 A;  4Y2C A;  1U0H A;  1RT6 B;  1M5P C;  5CZV A;  5F8J A;  5KFS A;  2AYB A;  2EFO A;  2QGF B;  4K2X A;  3QZ8 A;  5DG9 A;  3KJV B;  4DV3 J;  1GMW A;  3W64 A;  2ZJR Q;  3DI6 B;  1QVG R;  3ET6 A;  1RI7 A;  4RW4 A;  3C6U B;  3WC2 A;  1N5T A;  3CCZ A;  3C6T A;  1EB0 A;  3JTP A;  3MR2 A;  1UWB B;  4QR2 A;  5L8R C;  1WC6 A;  2Q79 A;  1F5C A;  2AYM A;  1HHQ A;  2XGP A;  1RT3 A;  3IG1 B;  2XMA A;  3GFH A;  1BE4 A;  5B08 A;  1MW7 A;  2ZOM A;  4K2J A;  1F9H A;  4RNM A;  3I4P A;  1R89 A;  2J7K A;  5IT0 A;  2B6A A;  5F8N A;  1LWC B;  2V9K A;  2CYY A;  3UCU P;  2EPI A;  3CCW A;  3MMA B;  3FCW A;  1GMU A;  4DL4 A;  3A4T A;  4Z37 A;  2YWK A;  1S97 A;  4X62 F;  2BAN B;  1YJV A;  3RR7 A;  2XM3 A;  4OX9 J;  4RW6 B;  3B54 A;  1N6Q A;  3QT7 A;  4J5O A;  3Q0A A;  4C8Z A;  2AWZ A;  2IJN A;  3DHW C;  2MYF A;  2V50 A;  1WF0 A;  4C11 B;  2YVS A;  1M1H A;  1PAE X;  2QLJ B;  4C3L A;  5L1L A;  2A6M A;  2XC9 A;  4OYO A;  2RHQ B;  5IOL A;  5IV3 A;  4FVC A;  4X4N A;  4DFK A;  2BEF A;  2HFU A;  4DU7 A;  2AIR B;  2YH1 A;  2OPR A;  1WOO A;  2M3D A;  1OY6 A;  4W92 B;  2B43 A;  1T9W A;  3UQS A;  4ZPW R;  4O4G A;  4RUC A;  2N7C A;  4L3N A;  3MMB B;  4PG7 A;  1U2C A;  2H48 B;  3EVM A;  3GSD A;  2YKP A;  3K2Y A;  3T5H A;  1IKV B;  3PG9 A;  3GB0 A;  1RBO B;  2WON B;  4YR3 A;  2F8M A;  3KLH A;  3TR5 A;  1DQ9 A;  3PEH A;  2IMO A;  4DV5 J;  4NLT A;  1H74 A;  3CPW R;  4JYA F;  2DJW A;  2D41 A;  2RUG A;  1CC8 A;  3OJS A;  1ITP A;  1FRM A;  2KHD A;  2IM1 A;  3NBP A;  3P3D A;  5EGY A;  8ATC B;  2FUG 9;  5B0A A;  1I94 J;  5K14 B;  1VIS A;  2UVV A;  2PA3 A;  1XNR F;  3HMJ G;  4V19 X;  1KEK A;  5DJB A;  4DUY F;  2O5D A;  4CNY A;  4B9L A;  2ZH9 A;  4XDD A;  1JLF B;  2EFG A;  5J2N B;  2HRY A;  1FKA F;  5HVH A;  1F6T A;  1I3O B;  1FJE B;  1MWY A;  4B9U A;  3LGN A;  3POT A;  3K59 A;  3JSY A;  1RWK B;  2ZH2 A;  2RE1 A;  3OVB A;  4LRA A;  3GIR A;  3IBC B;  4OI1 A;  1J5O A;  1X4E A;  3NGT A;  2O3D A;  1OPZ A;  1MN7 A;  1LWF A;  2HQ3 A;  4USW A;  1U09 A;  1HI1 A;  2VKR A;  4RBT A;  4U8V A;  3VTI A;  4NA2 A;  5GMK a;  2VBY A;  1HWL A;  2FLO A;  3IBF B;  4DL6 A;  2R7W A;  2YPZ A;  2XI3 A;  2YQ1 A;  3TVK A;  4X64 J;  4NX9 A;  2EKN A;  2IIH A;  4NOH A;  2VJV A;  4QIV A;  2XUL A;  5LXR A;  3MAA B;  4U7U K;  3D2W A;  1WG1 A;  2BAB A;  2IAJ B;  1CUL B;  3D1H A;  3V6K A;  4OI4 A;  4QWA A;  2YNI B;  2YQ0 A;  3CNQ P;  4G1P A;  3PIO Q;  4DOZ A;  1SUQ A;  3EE3 A;  2MQL A;  1T03 B;  3MPV A;  2WSF C;  1VJW A;  3H4D A;  4J9K A;  4PUO A;  2RS8 A;  2NPI A;  4U96 A;  1ZA2 B;  1Q95 G;  4DR3 F;  1M5V C;  1SJ4 P;  1D1U A;  4PRF A;  3LP0 A;  2ATL A;  2YKA A;  3BDE A;  1VMB A;  3HKW A;  3BR9 A;  5FDL B;  3M2V A;  3V6H A;  2IC3 A;  1VBZ A;  1RDR A;  4Q5V A;  4ZVH A;  1IR1 A;  2FVP A;  3BH6 B;  2PN6 A;  1RHU B;  2DR6 A;  4BDP A;  3PYG A;  3AB2 B;  3Q8U A;  3L9Z A;  2XO6 A;  4ANC A;  2QYC A;  2I6W A;  2KFN A;  3MXH P;  4NRU A;  2VL1 A;  1HBN B;  1C0T A;  3Q8P B;  4RW8 B;  4FF3 A;  1K73 T;  1R8H A;  1TR0 A;  2HGM A;  5KG0 A;  1S1X B;  3HKZ D;  3MEG A;  1MSW D;  3DRY A;  1TMJ A;  1FJG F;  4LF5 F;  1VRU A;  2MHN A;  2DNH A;  2QTW A;  5GVQ A;  1HWI A;  2X1F A;  1JK9 B;  1PSD A;  2EW9 A;  1QE1 B;  3ELH A;  4DLE A;  1HL6 A;  2O1P A;  2VKZ G;  4B3S J;  4XIU A;  3HI9 A;  2QFI A;  1RZM A;  4NA1 A;  4OI2 A;  1YLX A;  5KFE A;  3P5T L;  2FHM A;  1WAC A;  1MMD A;  3DRS A;  4DV4 J;  3W5Y A;  1HMV A;  3JQJ A;  1FXL A;  4P7T A;  4B3R F;  3FBB A;  4NLU A;  3ITH A;  2CUY A;  3VHQ A;  2P9C A;  4DN9 A;  4JV5 F;  1N34 F;  5J2M B;  4F04 B;  4J9L A;  2DR7 A;  2XHC A;  2B4P A;  2KM8 B;  2HQG A;  3RB6 A;  3OL9 A;  4XPE A;  3G6E S;  3PW4 A;  3MOZ A;  1U02 A;  3CDB A;  1RP5 A;  4CLS A;  3MFH A;  1HYS B;  4NLV A;  1YJT A;  3L7O A;  1S7I A;  2L08 A;  4DUT A;  1GK8 A;  1YKW A;  2CIM A;  2GVZ A;  1PC5 A;  1N33 F;  4PXC A;  2EK1 A;  1JLG B;  2DHX A;  2P2C B;  2V67 A;  1EX8 A;  3K57 A;  1T3N A;  4ED6 A;  1OYE A;  2HS4 A;  1RTZ A;  4OJ1 A;  3X1L B;  1UFK A;  2RRN A;  2DHG A;  3NS6 A;  4I64 A;  1KLN A;  1U1M A;  2HHU A;  1MU2 A;  4ZLP A;  2RQ4 A;  2Y0S D;  2DIV A;  1SC3 B;  3IR6 B;  2YNH A;  2HND A;  4QWC A;  1SXL A;  3PXG a;  1KHV A;  2CJX B;  1RT6 A;  1MLA A;  3ENQ A;  3QAU A;  1CJV A;  1SB6 A;  3KJV A;  2HKE A;  1D8Z A;  2B4V A;  4QR0 A;  3DI6 A;  2HK3 A;  1S4E A;  1X0P A;  2BE7 D;  1UWB A;  2ZH4 A;  4PG8 A;  2MJN A;  4A8W A;  1ZAX A;  4IO1 A;  3IG1 A;  1V3R A;  2DO0 A;  3N6M A;  1X4D A;  3OUY B;  4IOC Q;  4I7F A;  1LWC A;  2QL9 B;  5KG4 A;  2ROP A;  2XNQ A;  3MMA A;  2I38 A;  5F8I A;  1UTA A;  3M9O B;  4OYI A;  4ZPA A;  3OD2 A;  3FDS A;  2BAN A;  5D0R A;  4RNH A;  4G3I A;  4GMK A;  3H7H B;  4RW6 A;  3GP9 A;  5DDO C;  4LF2 A;  2ZBP A;  4B08 A;  2Y9H A;  1HBO B;  1V3Z A;  1YIT S;  1ZBT A;  5BJR A;  3HDS A;  2I8E A;  2HQF A;  4C11 A;  1VRT B;  2AX0 A;  4I67 A;  4RWW A;  1BQN B;  2W7A A;  2KFY A;  2MKI A;  2CJK A;  4YB6 A;  1Y7P A;  3UDV A;  4NMX A;  4C2M A;  3RJM B;  1IM4 A;  4JI5 F;  2V8G A;  3W9I A;  2CXE A;  3ZZZ A;  4ED2 A;  3ADA C;  3GIJ A;  1E6V B;  2POK A;  4DZ6 A;  2HHT A;  4LFB F;  1UKU A;  1SH3 A;  2A2C A;  2M8D B;  3ZTP A;  4CTA B;  1EQM A;  2MTL A;  4DR7 F;  3MMB A;  5KG7 A;  3R5G A;  1FWP A;  3E51 A;  3UNG C;  3FBE A;  1IKV A;  1K1S A;  5C25 B;  2NXJ A;  2QFJ A;  4ECQ A;  2WON A;  3JSB A;  3W60 A;  2E5I A;  1RUS A;  3VV2 B;  1T05 A;  1U1O A;  1T95 A;  2OPP A;  4TQR A;  2V4J B;  4WTO B;  3A13 A;  4U7C A;  4IG3 B;  5CA5 A;  5D0E A;  2WBR A;  1SI9 A;  3IS9 B;  1OYD A;  4TLQ A;  1I1G A;  4E98 A;  4K8R A;  5LT5 A;  3AJ2 A;  3IWL A;  3H5Y A;  2CVI A;  3JSM B;  1FNO A;  2QSW A;  2J0Q D;  3W61 A;  3CO9 A;  3CD7 A;  4LSN B;  1Y00 A;  1FES A;  3NCP A;  2MMY A;  5J2N A;  1KRP A;  3BN7 A;  4QU6 A;  4OHX A;  4YDX A;  2J9E A;  2XMJ A;  2HHH F;  2AEJ A;  3C16 B;  2FHJ A;  4WE1 B;  5HQ8 A;  2Y1L B;  2CAD A;  2U2F A;  2YWE A;  5GAE I;  1KLM B;  4YME A;  3KJN B;  3KNG A;  4HYK A;  3KMS A;  3FCV A;  2B5J A;  3U27 A;  3PRV A;  3CCT A;  1LWE B;  2GJ2 A;  2KRB A;  2HVI A;  5HVG A;  2ZDO A;  2HFS A;  1EP4 B;  1S1V A;  2OSQ A;  2NPF A;  2MZR A;  5HLF A;  3UW1 A;  1LWX A;  3Q83 A;  3PW7 A;  4O3O A;  3Q89 A;  1L3K A;  3E01 B;  2CZ9 A;  2IDE A;  2Y1R I;  4JI0 F;  1F60 B;  4EFA C;  1RGV A;  3DNC A;  5LJ3 Y;  3MAA A;  1S9G A;  3DRP B;  2HHV A;  3NGR A;  1F5B A;  3QBC A;  5K8P A;  2HFO A;  1FVS A;  2EG1 A;  2IAJ A;  1CUL A;  2QN6 B;  2HS0 A;  3BPD A;  4MFB B;  3N79 A;  2CWX A;  1HD0 A;  2ZBR A;  4Q0B B;  1UMJ A;  2AJF E;  2B8Q A;  2VFT A;  3OBI A;  5K5M A;  4MTP A;  1F9F A;  4UST A;  1DHM A;  1WG4 A;  4OLP A;  4CH1 A;  5J1P A;  1K0V A;  3CJK B;  1MWZ A;  2FLP A;  2GO9 A;  2ILY A;  3RAM A;  5IWA J;  3T1Y J;  4CCH A;  5FDL A;  2ACY A;  1UFW A;  3W5X A;  4M1K A;  3PV8 A;  4LF6 F;  5KG5 A;  1VQM S;  5IFM A;  2PD1 A;  2ADC A;  2D3Z A;  1H7W A;  1UET A;  1REV B;  4ZVS B;  3L7U A;  2R7X A;  3ULH A;  2XHW A;  3CO0 P;  3VAG A;  3HUL A;  2GIQ A;  1RBL A;  3T5J A;  2GX8 A;  2QA2 A;  2V5H G;  2D7S A;  2KDO A;  5A0Y A;  3CIM A;  1HBN A;  3MR5 A;  1WOR A;  4RW8 A;  3D5M A;  2M8H A;  2E1R A;  1YWX A;  2Y8W A;  1LOU A;  5CHC B;  3AHP A;  3PO5 A;  3AXM A;  3D28 A;  1S1X A;  3IGV A;  3K58 A;  1QM9 A;  2OD6 A;  2JC0 A;  3VAF A;  4D3H A;  3H90 A;  2FJA B;  3AA9 A;  2APO A;  1DTQ A;  2XMK A;  3TQ1 A;  2DXF A;  2V94 A;  1DAR A;  3RBX A;  1QE1 A;  2CZV C;  1VQ9 S;  2GHV C;  3JAM Y;  5HAT A;  4RUA A;  2LDI A;  2IBO A;  2AF6 A;  1QAY A;  4IRC A;  2KYZ A;  1SQF A;  4DV2 J;  2HHP A;  1CSJ A;  2IYG A;  3P45 B;  4JI8 F;  3E2E A;  4MT1 A;  3R5C A;  2FLN A;  1SJ1 A;  4M5M A;  1FDN A;  3BQ1 A;  4J9M A;  2C1E B;  2X1G A;  5FII A;  1Q79 A;  2FQQ B;  2W9B B;  3TX8 A;  2OFG X;  3GG0 A;  3G6V A;  5J2M A;  4H54 A;  3O1L A;  4B02 A;  4X84 A;  2HFV A;  4DR4 F;  3ISN C;  4G65 A;  1VYA A;  2DNZ A;  3P96 A;  1HYS A;  3C14 B;  3GCX P;  2V8D A;  4HHH A;  3VAL A;  1X9M A;  4ZVF A;  4HH1 A;  4KC5 A;  4RPF A;  2OPQ A;  3AD9 C;  2HG4 A;  3PCO B;  1VGY A;  2Z0G A;  4CT8 A;  3CJ8 A;  3EGV A;  1ZTW A;  2CPE A;  1NK4 A;  3KWM A;  3PY8 A;  1HIY A;  4AL6 A;  4DSJ A;  2IDL A;  4P10 A;  3GV5 B;  4QJV A;  3JYT A;  4I6W A;  1YDL A;  4C6A A;  3EVO A;  2W2O P;  3R1L A;  1GAO A;  2COL A;  4F7V A;  1R8B A;  4BBY A;  2GQQ A;  2IA6 A;  3UR3 C;  2BKP A;  1JMT A;  2HIY A;  2R7V A;  2DGO A;  2W25 A;  2KXH A;  2F9D A;  3CW2 C;  1WC4 A;  4ED7 A;  3BKF A;  2DIT A;  1DY3 A;  4X4P A;  3DDI A;  1URN A;  2PMH A;  4DSI A;  2UXC J;  1U8S A;  2UUC F;  3OUY A;  2OSR A;  1VCT A;  2VQE J;  1V9O A;  2IRX A;  1AB8 A;  1B70 B;  1PAU B;  1CVJ A;  3GV8 B;  3H2L A;  4GKK J;  2BJ7 A;  2XMV A;  4ZS6 A;  3OR2 B;  3DLE B;  3PRD A;  4O3P A;  3WDO A;  2JLG A;  1RAB B;  3KG4 A;  2KH9 A;  5E3R A;  4A8S A;  3J81 j;  2R2T A;  3NNH A;  3PW5 A;  3QT6 A;  2X1B A;  1S99 A;  3MM9 A;  4FVM A;  1NH8 A;  4G1I A;  8AT1 B;  4ETX A;  5U47 A;  2ZFH A;  2E1A A;  2DHH A;  2WVC A;  1WTB A;  5EWF A;  1S6Q A;  3ZZO A;  4ANE A;  3UFC X;  3OTD A;  1NK9 A;  1UZH A;  2XZT B;  3TO8 A;  1E6V A;  1J27 A;  5C2G A;  4MIB A;  3PEJ A;  5B0E A;  3AD7 C;  1Q1K A;  3KK2 B;  4CTA A;  4NZ7 A;  4CI0 B;  1NEE A;  2MXY A;  3NXZ A;  2YKM B;  1X4A A;  2M5Y A;  1YBT A;  4XPC A;  3OLA A;  1RAD B;  2KVI A;  2YKO A;  1B3T A;  4BCA A;  3NGS A;  1S9F A;  1T7P A;  4PXB A;  2J8A A;  3M2U B;  2E5J A;  2CQB A;  4WU3 A;  2UXD J;  4QWB A;  2VOP A;  3D6F B;  4WBF A;  2HUR A;  2V4J A;  2LEP A;  3K5N A;  4IG3 A;  2GQC A;  1IBM J;  1PKU A;  1Q86 T;  3IS9 A;  4I4B A;  2KU7 A;  1VQL S;  3CVK A;  4LFA J;  3JSM A;  1HD1 A;  3QO9 B;  2W9C B;  3MPD A;  2BUN A;  2BXJ A;  3MPW A;  2R2R A;  4LSN A;  3CF5 Q;  2VF3 A;  3DLJ A;  3CGI A;  1RWV B;  4LJM A;  2BMB A;  3EVW A;  2WVD A;  4WP9 A;  2KB2 A;  3TP2 A;  4OYM A;  4WZM A;  4WE1 A;  1WEY A;  1XIQ A;  4DXL A;  1SKW A;  2C28 A;  1KLM A;  3RG6 A;  2DEI A;  1TVR B;  2MKC A;  4P2F A;  1TKZ B;  1TUV A;  4AQY J;  4J9N A;  4K4T A;  1LWE A;  3EGZ A;  1EP4 A;  3SSR A;  4HI1 A;  4RW9 B;  4C8N A;  1ELO A;  3E01 A;  3FZB A;  2Z8Q A;  1NDC A;  4GKJ J;  5HQM A;  1N32 F;  4U6P A;  2CPY A;  2FZG B;  3F41 A;  4AL5 A;  3TWZ A;  3H25 A;  1DQA A;  1RTH B;  2C2K B;  1KKH A;  4MFB A;  4R5P B;  3WIV A;  2CPJ A;  2FGO A;  1YZ6 A;  4C0O C;  2AQ4 A;  1NSP A;  1JJC B;  1OY8 A;  2OEK A;  3KLF B;  2BQ3 A;  5I3U A;  3LP2 A;  1B0T A;  4F3O A;  5L46 A;  1O6X A;  4HR2 A;  2HS3 A;  3I55 S;  2DNO A;  2DR5 A;  1X5T A;  1BLU A;  3M8P B;  5EX0 A;  4X4V A;  5CAA A;  1K1Q A;  3V6D B;  4F36 A;  1N0V C;  2FPH X;  1WC3 A;  3NMA A;  1ZAW A;  3IRX A;  2NUU G;  5KG3 A;  1HPZ B;  2KJV A;  3P49 B;  2JEG A;  4QYZ K;  1VHF A;  5KFO A;  4F4X A;  4M63 A;  4ED4 A;  1S0M A;  2VQF J;  3HHL D;  5A8W B;  4Q2M A;  3TYT A;  4ECU A;  3GG1 A;  1REV A;  1U45 A;  3BYP A;  4NYZ A;  3KKF A;  2AGO A;  4WFB Q;  2VBX A;  3MPU B;  4TY8 B;  2DNN A;  4B3R J;  4B9N A;  4PG4 A;  2GMJ A;  2M9K A;  2J0W A;  2CFX A;  2CZ4 A;  1IJF B;  1R8C A;  2M7S A;  1AUD A;  4N8O A;  3R7S B;  4USJ C;  4JI4 F;  2VPY B;  3VCD A;  4ZVQ B;  2WVF A;  4ICL B;  3EDQ B;  1ZM4 A;  3GIL A;  1FHT A;  2AJ4 A;  1N33 J;  3V81 B;  2XZD B;  2B9W A;  1GQE A;  2FHK A;  3BGR A;  4OX6 A;  5RUB A;  3DRR A;  2HGN A;  1UA1 A;  2PDA A;  1UVI A;  1JLQ B;  2DRB A;  4FYY B;  3PJ9 A;  2QLW A;  3R7N B;  3KHR A;  2WTF A;  2MKH A;  3KLG A;  1DTT A;  3ICL A;  1C0U B;  5I3P A;  3I4H X;  2GAH C;  3KUG A;  1JXV A;  2IBK A;  3MZI A;  2KYX A;  2ZZT A;  3US5 A;  4Q45 A;  4FXD A;  3RU0 A;  2ZH8 A;  1EKR A;  1RWN B;  4OHV A;  4H4M A;  4RNO A;  4DUZ F;  2V8P A;  2V4Q A;  3M8W A;  3SFU A;  2QEX S;  2BE2 B;  1RTI A;  4PQA A;  4I56 A;  4ID5 A;  3BM7 A;  2MST A;  4M5D B;  1EET B;  3C14 A;  3FCH A;  3PFO A;  2VFS A;  4NLG A;  1I6J A;  3CMQ A;  2QIF A;  3K5M A;  3CSK A;  1HNI B;  5E0O A;  2O66 A;  1S77 D;  5D0G A;  1KVI A;  3UO0 A;  4DCO B;  1OIA A;  5T7L A;  1O5J A;  2QRR A;  3ENV A;  1GTH A;  1AFJ A;  1QJH A;  3IO1 A;  2DTJ A;  1JKH B;  1YRX A;  3I6P A;  2UUT A;  1RWU A;  2D1C A;  2IA0 A;  4DR2 F;  2OJ3 A;  3D9B A;  3FZ2 A;  4CM0 A;  2VON A;  4N47 A;  2I0X A;  5THW A;  3AT1 B;  2RDI A;  5G0R B;  3ZTR A;  2ZHO A;  1VOM A;  4L75 A;  4ILR A;  3CME S;  4DR5 J;  2LEA A;  2KZZ A;  4FBT A;  3AQO A;  3MCM A;  2V69 A;  3DHX A;  1Z2Z A;  1T0T V;  1LXJ A;  4NXM J;  5E7O B;  1TK0 A;  1NUE A;  5KFA A;  3MF5 A;  4KH0 B;  4S0M A;  2I1R A;  2DYA A;  2VPX B;  4ZP6 A;  2UUW A;  3HO1 A;  2ERR A;  1N48 A;  4RLE A;  4DSE A;  9RUB A;  2Y1I A;  2RT3 A;  3C8Y A;  1NSQ A;  2H51 B;  1VIO A;  2DNY A;  3OR2 A;  1NK7 A;  4ZLN A;  1PYS B;  5LMU J;  3N01 A;  4WWS A;  5DQI A;  4LF7 F;  2DNM A;  1HNW J;  4X4O A;  1CPZ A;  3VWS A;  1XNQ F;  5B0B A;  2MSS A;  2CRL A;  4RNF A;  4C0H A;  2HQC A;  1KVK A;  4LRE A;  2HZC A;  2MQO A;  4X65 J;  3KHH A;  2ZJP Q;  5ITH A;  2BJ3 A;  1XJW B;  2JDJ A;  2BX6 A;  1SQE A;  5DLF A;  2MKK A;  1X31 C;  3ILI A;  4ZKA A;  5M2P A;  5GAE U;  2AKW B;  4NLP A;  4ECV A;  2HQI A;  3VZH A;  3RYL A;  5IM0 B;  2E1P A;  1DZ5 A;  4KHP F;  4B3T J;  4DG1 B;  3HHL B;  1XMO J;  1VDH A;  3KK2 A;  4E8U A;  1SJ3 P;  1U25 A;  4OHY A;  2C3O A;  1ZA1 B;  1VQ7 S;  3KLE B;  2IM3 A;  3I5A A;  1IQZ A;  2FC8 A;  2DY1 A;  4ED3 A;  4DV3 F;  3K8W A;  1N0U A;  2Y3Y A;  4DL0 C;  2L9D A;  3SQG A;  4LBH A;  3MUV P;  3BO4 A;  4PQU A;  5DG8 A;  2KVQ E;  2YWG A;  3CJ5 A;  2QT7 A;  1A6L A;  3CTR A;  4ILM A;  2XB2 D;  4GVL A;  1RAJ A;  4H4K A;  4IG0 B;  4YP3 A;  2IYI A;  3LGM A;  3NP5 A;  2UUA J;  4DQR A;  2DCU B;  2OPS A;  2IPO B;  6FD1 A;  4Y34 A;  2A3J A;  2N4C A;  1BWE A;  2FZK B;  3C2P A;  5ETS A;  3HP6 A;  1WOP A;  2RF2 B;  3QO9 A;  3R27 A;  1VQ5 S;  4M94 A;  5IZH A;  3OXF A;  1TTH B;  1Q8I A;  4MIA A;  1N5Y B;  3DMJ B;  4CWB A;  4C8Y A;  2WBM A;  4AND A;  5B0D A;  4O3R A;  4OX9 F;  2RUS A;  3QSY B;  1OSD A;  4KB7 A;  4X66 F;  1AZS B;  4I69 A;  2XMM A;  2AYG A;  5I42 B;  1RLC L;  4ZHR A;  3ETM A;  1QTN B;  4WK3 A;  1OY9 A;  1S4F A;  2I2Y A;  4C8M A;  4AXJ A;  3KLI B;  4A4J A;  1OSC A;  3I0S A;  2CQH A;  3RRK A;  2ZOF A;  2CQ1 A;  4DV7 J;  3VGU A;  2VFU A;  2JOQ A;  1R0C B;  2CNN B;  4ED8 A;  5AJ3 J;  3GR0 A;  5MLC V;  3QIP B;  4RW9 A;  2B8P A;  3FGV A;  3QQC D;  4QBU A;  3QJP A;  1TV6 B;  3QRQ A;  2R42 A;  5AE1 A;  1U8W A;  1H2T Z;  3SV4 A;  4HKQ A;  3JB9 k;  1AT1 B;  1ZZF A;  2I5J B;  1P8G A;  4MKB A;  1AFI A;  3W8P A;  1WHY A;  1ZPW X;  1TL5 A;  1PIE A;  4A46 A;  4DV5 F;  1N8R T;  2UVR A;  4FYX B;  1FJ7 A;  3H5X A;  1YRU A;  3ZTS A;  1CC7 A;  1UA0 A;  4C7Q A;  5DZ6 A;  1RKI A;  2J0S D;  2E7V A;  5G4D A;  1I94 F;  2BJD A;  1NZA A;  1NK6 A;  3DCA A;  5HAN A;  1NJZ A;  1N54 B;  2A1B A;  2LDY A;  3SQO P;  2J5A A;  3D3B J;  3M8P A;  5B0C A;  1G3O A;  1HBU B;  4MYT A;  1U48 A;  4DV0 F;  1LNQ A;  3V6D A;  4MKY A;  3EZO A;  4KGM A;  3MEE B;  4OI3 A;  2YBV A;  1IKX B;  2DNP A;  5A8W A;  1S9E B;  1H73 A;  4KGX B;  4OZL A;  3HSG A;  2ZBI A;  3J81 Y;  4TY8 A;  5ETK A;  3H98 A;  4DFJ A;  4NLS A;  2CQ4 A;  2KXN B;  3F73 A;  3W2W A;  2VOD A;  5E3P A;  1JNZ B;  1QD1 A;  2G4B A;  1VBX A;  4ZVG A;  3S7R A;  2YNG B;  4KHR A;  5H9F J;  4ICL A;  3DU6 A;  1QLN A;  1T94 A;  1RT1 B;  2C2R A;  4ZIV A;  3IWN C;  1NDL A;  4X64 F;  3V81 A;  4EBD A;  5B09 A;  2XS7 A;  3IBW A;  4V1A k;  2CQG A;  2UVW A;  1JLQ A;  1IKW B;  1LV5 A;  4LVO P;  3FNN A;  4CO1 A;  1FK9 A;  3BB5 A;  3TUJ C;  1YI2 S;  4WPA A;  1C1C B;  2ZOG A;  5DO2 A;  3WC0 A;  1C0U A;  4OFZ A;  2JVO A;  2V0N A;  2LA4 A;  5AE2 A;  3BKT A;  4FKY A;  1RWP B;  1TL7 B;  1Q8K A;  3CDW A;  1UFL A;  3OXL A;  2FD2 A;  1C2P A;  2CQ3 A;  4J91 A;  3DDN A;  4URG A;  2KG0 A;  2L9W A;  5KFD A;  1D09 B;  2DK2 A;  2BJ8 A;  1UVM A;  4NI2 B;  2O67 A;  4M5D A;  1EET A;  2KKH A;  4IDK B;  4WII A;  1BY9 A;  2AYE A;  2JFD A;  4DMZ A;  1HNI A;  2DCL A;  4R25 A;  2NUH A;  5ETP A;  4LBP A;  2R7U A;  2OI2 A;  1DJ0 A;  3W65 A;  1UVN A;  1J5E J;  1XC9 A;  5A6P A;  4CDI A;  4JI3 J;  2ZD1 A;  4LBI A;  1JKH A;  2IVM A;  3CJS A;  1C4A A;  3FKB A;  2GZO A;  4CLT A;  1NJW A;  1WHW A;  2QO3 A;  3CWJ A;  2VDI A;  3PR4 A;  5KT4 A;  1NND A;  4EI2 A;  2MY7 A;  2VD3 A;  1S5Z A;  1L3T A;  4TN2 A;  3G8S A;  5G0R A;  2W01 A;  2AD9 A;  3UR0 A;  1YJ7 A;  1LW2 B;  2CPF A;  2XWY A;  3RAQ A;  2AEF A;  2Y8Y A;  2V8H A;  4B17 A;  3FVY A;  2J9D E;  3G4S S;  4PR6 A;  3AXK A;  1KN6 A;  4EK2 A;  4DV4 F;  4HAC B;  7AT1 B;  1WEL A;  1N5V A;  2U1A A;  4ELU A;  2M0G B;  3VAK A;  1FEE A;  1BHN A;  1RU2 A;  1HI0 P;  3O5T B;  3VAH A;  1RAC B;  4EEY A;  2VG6 A;  2B56 A;  2KXF A;  1FRJ A;  4FS2 A;  2ILZ A;  5DQG A;  3QGI A;  2DRA A;  4DFM A;  4NLX A;  3OPK A;  3SBM A;  4ZPC A;  4I2P B;  3HVT B;  4Y2K A;  1HWJ A;  2PT0 A;  1KTQ A;  4J9S A;  4C97 A;  1SIW B;  1QAJ A;  4ZLJ A;  2HHS A;  2HPU A;  1NLK L;  3VR1 A;  5ETN A;  3UDC A;  3E8O A;  1KOH A;  4DV6 J;  5D6G A;  4BWJ A;  3DM2 A;  5A8K B;  3T19 A;  3HHL A;  3CCU S;  4F4W A;  1F1B B;  3EGW B;  2B4O A;  2FJW A;  2LQJ A;  5A2Q Y;  2BOA A;  1IJE B;  2RH3 A;  4QOT A;  3J80 Y;  2ZHA A;  2OHD A;  3V4I B;  5DM7 Q;  5AXK A;  3MFI A;  1BXN A;  2FHO B;  4L3K A;  3ZTQ A;  1MML A;  4B9V A;  3BYR A;  3UD3 P;  4MK7 A;  3GFY A;  1TL3 B;  3QT8 A;  1CJU B;  1PYO B;  1LFP A;  4PWD A;  3PYE A;  4K5S A;  3MCN A;  4M5J A;  4DX8 H;  4EBE A;  5B0F A;  5CD4 A;  3OL7 A;  3TW0 A;  4AUK A;  5D4L A;  1N32 J;  4HDH A;  1EKS A;  4ZVE A;  3OTB A;  2RF2 A;  1SH2 A;  3OT9 A;  4MK8 A;  4I1T A;  3DMJ A;  3BBC A;  2OEL A;  3B82 A;  1Q78 A;  4O44 A;  5C42 B;  3NMR A;  1UVJ A;  1AZS A;  5I42 A;  2ASJ A;  4DV1 J;  4P72 A;  2EXU A;  1HW8 A;  1LK5 A;  1QSS A;  2XLI A;  5BYR A;  4OZ1 A;  3KLI A;  2PI4 A;  1O0P A;  3BRE A;  4O0N A;  2CG8 A;  1RTD B;  4DR6 F;  3R2C J;  4WKR A;  3HD2 A;  2MZ1 A;  4LR9 A;  1B7Y B;  2UXB J;  1VK3 A;  2VBZ A;  1VIX A;  1IKY A;  1Q8B A;  3HSJ A;  4USM A;  2XCA A;  1NK8 A;  1FTR A;  4ERD A;  4CM2 A;  3NLC A;  1PBU A;  1RBA A;  3K0J A;  5KOW A;  4RKU C;  3GE9 A;  4RNN A;  1D0E A;  3SFG A;  4Q8F A;  4N56 A;  1HLW A;  5KFF A;  4KAI A;  3NOG A;  3NCQ A;  5LXY A;  3BSO A;  4OX8 A;  3P4U B;  2XLK A;  4ZP7 A;  1KON A;  2RB7 A;  1VBK A;  3M8Q B;  1M0S A;  4KKO A;  2FB0 A;  3UN2 A;  2MLY A;  2DGQ A;  3NAI A;  2R7Q A;  4NLY A;  3C46 A;  2VU5 A;  3BBF A;  4URQ U;  4DQS A;  1DLO A;  2IJR A;  1HBU A;  5E5N A;  2R3V A;  2RKI B;  3C3L A;  4CO4 A;  3K8V A;  3P5B P;  5CAB A;  3RW7 A;  1C1B B;  1B64 A;  1PJ7 A;  2Z57 B;  2GFF A;  3CED A;  5ADZ A;  4LF1 A;  1FKO B;  3ZNJ 1;  3LPE A;  3BR8 A;  5JUM A;  3SDE B;  3HX9 A;  4DUZ J;  5HMZ A;  3I9V 9;  3RW6 A;  5I4M A;  2BJ9 A;  2BQU A;  4G1Q A;  2DXD A;  1PC4 A;  1TAQ A;  4ECZ A;  1M5O C;  4ZPV R;  1NHU A;  2HBR B;  3SSS A;  1SL0 A;  2C3M A;  3GYX B;  1WC5 A;  2ZZM A;  1RT1 A;  2DGW A;  1BQX A;  2GNK A;  3UWT A;  4MJK A;  1M5K C;  1F9E B;  2JFK A;  4JI6 J;  4ECT A;  3KUE A;  1RIS A;  3M1V B;  1P1T A;  3D1Q A;  1HBM B;  4UQG A;  3SEO A;  2A18 A;  3DN9 A;  2GA7 A;  1C1C A;  2D69 A;  5J2P B;  4KPY A;  1UAW A;  1LFW A;  3OSP A;  3MM6 B;  1WKL A;  5J1E B;  4TU8 A;  3OTE A;  1TL7 A;  4IOA Q;  2ZJQ Q;  5DDR C;  1WSV A;  2DKO B;  2JX2 A;  3O44 A;  1EHW A;  4ILL A;  1WG5 A;  3JXO A;  5IWA F;  4J9P A;  3L09 A;  4F50 A;  3O8W A;  3PZP A;  3T1Y F;  4NI2 A;  3UNY A;  1L3V A;  4IDK A;  2AJ0 A;  3AOD A;  4YB5 A;  4JI1 F;  3ZZT A;  1U1N A;  1AA1 B;  3CDA A;  4YS2 A;  2FIU A;  1LK7 A;  2LXF A;  4PYA A;  3D3C J;  3LO3 A;  2HVD A;  3FEY B;  2NYH A;  2BW2 A;  1KR4 A;  2DD8 S;  2RML A;  1LQ9 A;  3Q8Y A;  1JLB B;  1RAF B;  3RRH A;  4IQX A;  4K5R A;  4BS2 A;  1ZM3 A;  1G1X A;  3PO4 A;  1SC4 B;  5HBM A;  4LIW A;  4QWD A;  4X4Q A;  1WDT A;  3T1A A;  3GII A;  1FRK A;  3CCL S;  5HI7 A;  3EMT A;  4NCG A;  2DH9 A;  3M30 A;  1YVF A;  5K8M A;  1AW0 A;  1TK5 A;  4ZIW A;  2BV3 A;  5L1J A;  2D3U A;  1LW2 A;  3G71 S;  1FA0 A;  1WF1 A;  3LAL A;  4PAA A;  4USV A;  4KHM A;  1OS5 A;  4NPO A;  2YXL A;  5DG7 A;  3TZZ A;  4X4U A;  2IVY A;  2GAG C;  1S7H A;  2IM2 A;  2XSF A;  1J2V A;  2ZUA A;  1VQY A;  3PJX A;  2MJU A;  5GME A;  1P27 B;  3THT A;  3TEG A;  4DV2 F;  3RUB L;  3D6H B;  2OO4 A;  1X4F A;  2W2N P;  4HAC A;  3EZ5 A;  3THP A;  3RB3 A;  3AJ1 A;  4DQQ A;  3C15 A;  1VC6 A;  1RAA B;  1U24 A;  2E44 A;  5D4P A;  4NLW A;  2JEJ A;  1DAX A;  3HZG A;  3BGO P;  3LGH A;  2CDR B;  3PRB A;  1W2I A;  1FRH A;  1SC1 B;  5BXI A;  4OLO A;  1W2B R;  3R97 A;  4I2P A;  3HVT A;  3M6U A;  3H2U B;  5HJY A;  5A8R B;  4FNH A;  4RX6 A;  2YKN A;  3WX8 A;  4IFV B;  1TMM A;  3QAE A;  4UOH A;  3MM8 B;  4KGK A;  3B6B A;  5KFX A;  2MHE A;  5A8K A;  2PMW A;  2XTJ P;  1ZH5 A;  3GLJ A;  4X66 J;  1VQN S;  2BJ1 A;  2XMU A;  4YFU A;  3I9Z A;  1ROF A;  1X9S A;  4LF9 J;  5KFG A;  4MMO A;  2OMO A;  1MG7 A;  4WXO A;  3A12 A;  2VBW A;  4DCJ B;  4OYZ A;  3L3C A;  2FJD B;  1KBR A;  2LP4 A;  1RHQ B;  4Y2A A;  1RT5 B;  1TL3 A;  4AD6 A;  2RS2 A;  2IJF A;  1VFJ A;  1CJU A;  2Z56 B;  3IFE A;  2VOO A;  3PX6 A;  4CH7 A;  5F41 A;  2UXC F;  1RCX B;  3LQV A;  1G7C B;  3CXC R;  2VQE F;  1VQK S;  1QAX A;  1OMS A;  3K5P A;  5HP1 A;  4NXN J;  3F44 A;  1MRO A;  4F0H A;  2IRU A;  4GKK F;  4OZN A;  4P74 A;  1F3V A;  3G8Q A;  4UUW A;  2CJQ A;  2OD4 A;  2B7B B;  1PBA A;  1JLC A;  1HAR A;  2Y1J A;  1CJK A;  4CO2 A;  1XMQ J;  2BQR A;  4E2F B;  1Q8L A;  2G9O A;  2X51 A;  5AE3 A;  2Y0B B;  4YHH J;  1LKZ A;  1S6P B;  2Q6C A;  3G82 B;  1RWW B;  4OV6 A;  2XO7 A;  4B9T A;  1YJU A;  4NCB A;  2P8I A;  4RL1 A;  5D77 A;  5LSL A;  2MQM A;  5K8N A;  2BAC A;  2HQD A;  5KFB A;  2UV8 A;  3MMJ A;  1FFS B;  4DV0 J;  4TLR A;  2XEX A;  3EPI A;  5AT1 B;  1APS A;  3MM7 B;  2W4C A;  4GC6 A;  1KQG B;  4F0M A;  3NKY A;  1DBD A;  5EWE A;  1P6T A;  1Z1Z A;  2DO4 A;  1Q81 T;  1S1W A;  2OIH A;  2GML A;  4YR0 A;  1R8P A;  5LSO A;  3W9H A;  5J2Q A;  2NCK L;  5CQG A;  4IRD A;  4DSF A;  2UXD F;  1SJQ A;  2NR0 A;  3TOQ A;  4CLP A;  1E6Y B;  1CEZ A;  1IBM F;  2H65 B;  3M8Q A;  1UJ4 A;  2LQ5 A;  4EU0 A;  1RTJ A;  2OAU A;  3DOM B;  3DFE A;  3RBZ A;  5DGB A;  1U26 A;  4LFA F;  4Q2L A;  2VAS A;  1RT2 A;  4MKA A;  2RKI A;  4CLU A;  3EIC A;  2LA6 A;  3H0P A;  1ZTT A;  1AUS L;  5C2C A;  1FJC A;  1WTF A;  4UY8 T;  2EWH A;  4PKD B;  1MMN A;  2WB4 A;  4JV1 A;  5HAO A;  2LQ8 A;  1HNZ J;  4ALZ A;  1JXE A;  2E1C A;  2QV6 A;  4J9V A;  4ECX A;  2AJ2 A;  2MQP A;  5K20 B;  3FMW A;  1JIH A;  1FER A;  3TZW A;  5C5J A;  4P6Q A;  3VAM A;  1W25 A;  2F5G A;  4NLD A;  2EK6 A;  5DS7 A;  2NRE A;  4AQY F;  1FFG B;  2AGQ A;  1U49 A;  2W4P A;  2R8K A;  3QFH A;  4NE9 C;  5DDP C;  4WU2 A;  3UPF A;  1FKP B;  1X4H A;  4I0W A;  3DOK B;  1RCO B;  2HBY B;  2XY7 A;  4GKJ F;  3M1V A;  1U2R A;  1H7X A;  3S8S A;  2LXI A;  3CCJ S;  1QAI A;  2CAJ A;  4DL2 A;  1HBM A;  3DGP B;  3VAI A;  5HMW A;  1BUX A;  2KT5 A;  3BGF A;  3OFH A;  4ZCL A;  4USK A;  2F9J A;  2M4M A;  3TUZ C;  4X4R A;  4F8R A;  3OHB A;  2J8S A;  2VB6 A;  3JS9 A;  2YX1 A;  5J1E A;  4OV1 A;  2JZ5 A;  3O3L A;  5KFZ A;  7FDR A;  2OTJ S;  1S1U A;  2XZW A;  1R43 A;  1HQE B;  2P6T A;  2R4F A;  3CCM S;  3QWU A;  4C8K A;  2GVD A;  3IA0 A;  3OTO F;  1XR5 A;  5ETO A;  2F4F A;  2YH0 A;  2J0X A;  2JSX A;  3KG0 A;  2VUG A;  1T11 A;  3ZZU A;  2E9Z A;  2DNG A;  3I5C A;  3RAX A;  2NSB A;  1QUP A;  4F3Q A;  1UPP A;  4HHU A;  2VQF F;  3QID A;  1Q16 B;  1YBA A;  2JEF A;  4DBQ A;  3T5K A;  3EWG A;  1HNX J;  2CQC A;  4F25 A;  2PA8 D;  1VQP S;  2ASY A;  2YX7 A;  4FF2 A;  4PWW A;  2GC8 A;  2B3T B;  4PG5 A;  5LMN J;  1GNK A;  3DLH A;  1GTE A;  2QYG A;  3SCL E;  5SZT A;  3AB4 B;  1NJY A;  2PMZ D;  3LH2 S;  4C48 A;  4HL9 A;  4DWI A;  3MEC A;  3CDU A;  4Y2I A;  2HLT A;  4O3S A;  5JJB A;  3NGK A;  4KYZ A;  1X0F A;  3TAQ A;  1IR0 A;  2BA9 A;  1WKK A;  3EYZ A;  1ZOT A;  1TKT A;  4J9O A;  3RRG A;  2V2K A;  3BN4 A;  3FRY A;  4KQZ A;  3CJ0 A;  4B3M F;  1UEU A;  3Q2S C;  4O0I A;  1RB0 A;  2JH3 A;  5DM6 Q;  1SPB P;  4NAS A;  4FXW A;  3FEX B;  2QMX A;  4EYI B;  3CT9 A;  3C6U A;  2G13 A;  2J6U A;  3HFV A;  1UW4 A;  4RW4 B;  3R5A A;  3C6T B;  4EMD A;  1R3N A;  3A1Y G;  2KZM A;  2HHX A;  3N9U C;  4A48 A;  5H9E J;  2H5I B;  3QFW A;  4JI2 J;  3TZX A;  1Y3K A;  2KT3 A;  2RVJ A;  2HWT A;  3D7S B;  4KIA A;  2ZH7 A;  4IFV A;  4K4W A;  2B6A B;  1T3O A;  3MM8 A;  2K3K A;  2R2U A;  2BR0 A;  4KV8 B;  5E3Q A;  2L3M A;  1RXO B;  1QDU B;  5AXM A;  3JSR A;  2CQ0 A;  3GJT B;  4USI A;  3KHL A;  3NGD A;  3Q2T C;  4XO0 A;  1S49 A;  3UE2 A;  3NWR A;  1N6Q B;  4ZVO B;  4RZR A;  2L9N A;  2W2P P;  2W8L A;  1R27 B;  3B8H A;  4DR6 J;  5KFC A;  2BRK A;  4TXS A;  1FDD A;  4DR5 F;  4QIG A;  1RT5 A;  4JB8 B;  2W1B A;  4X4S A;  3OQ2 A;  3R3T A;  4NXM F;  5HVF A;  3LP1 B;  3NNC A;  3FC9 A;  2CJY B;  4KPC A;  1D9F A;  2A10 A;  2R7S A;  4ELV A;  2MKJ A;  1UW9 A;  1FEH A;  3BPS P;  4OHZ A;  1NB2 A;  2KG1 A;  1RWM B;  1T02 A;  3FJ2 A;  2E5G A;  4AFF A;  2OTL S;  3OLB A;  3HFZ B;  1EQ0 A;  5LMU F;  3TAN A;  4YB7 A; 
#chains in the Genus database with same CATH homology
 4CWB A;  3MCM A;  1IM6 A;  3MCO A;  4M5G A;  3HSG A;  2F65 A;  3MCN A;  4M5J A;  1EQM A;  1RAO A;  1TMM A;  4M5K A;  3UDE A;  3UDV A;  3KUE A;  1RB0 A;  5ETN A;  1DY3 A;  1KBR A;  4M5H A;  1Q0N A;  5ETV A;  5ETT A;  3QBC A;  3UD5 A;  3HD1 A;  2QX0 A;  3HCX A;  4PZV A;  4F7V A;  4CRJ A;  3HSJ A;  5ETL A;  2BMB A;  5ETK A;  3KUG A;  1RU2 A;  5ETS A;  3KUH A;  1HQ2 A;  2CG8 A;  3ILL A;  1CBK A;  5ETQ A;  5ETO A;  4CYU A;  5ETM A;  4AD6 A;  4M5L A;  4M5I A;  4CYU B;  3HT0 A;  3HD2 A;  1RU1 A;  3ILJ A;  1EX8 A;  4M5M A;  5ETP A;  3HSZ A;  1F9H A;  3ILO A;  3IP0 A;  1TMJ A;  1EQ0 A;  4M5N A;  3HSD A;  2F63 A;  5ETR A;  1RTZ A;  1G4C A;  1HKA A;  3ILI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...