5ETTA

S. aureus 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase complexed with ampcpp and inhibitor at 1.55 angstrom resolution
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
157
structure length
157
Chain Sequence
MIQAYLGLGSNIGDRESQLNDAIKILNEYDGISVSNISPIYETAPVGYTEQPNFLNLCVEIQTTLTVLQLLECCLKTEECLHRIRKERWGPRTLDVDILLYGEEMIDLPKLSVPHPRMNERAFVLIPLNDIAANVVEPRSKLKVKDLVFVDDSVKRY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for the Selective Binding of Inhibitors to 6-Hydroxymethyl-7,8-dihydropterin Pyrophosphokinase from Staphylococcus aureus and Escherichia coli.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transferase/transferase inhibitor
molecule keywords 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosph
total genus 43
structure length 157
sequence length 157
chains with identical sequence B
ec nomenclature ec 2.7.6.3: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.
pdb deposition date 2015-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01288 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 5ettA00
4CYUA 2CG8A 5ETQA 3UDEA 3ILLA 3IP0A 1EQ0A 1EQMA 4M5LA 1RU2A 1EX8A 3ILOA 5ETOA 1RTZA 4CYUB 2F63A 3HD2A 3KUHA 1CBKA 5ETVA 1TMMA 1G4CA 2BMBA 3HT0A 3UDVA 4PZVA 1RB0A 4M5JA 5ETNA 3HD1A 1F9HA 3MCOA 4M5HA 5ETPA 4M5GA 1KBRA 3UD5A 1HKAA 3MCMA 1Q0NA 3HCXA 4M5MA 1TMJA 5ETRA 1RU1A 3KUEA 2F65A 3MCNA 4M5IA 3HSZA 3HSGA 3KUGA 4M5NA 3ILJA 3QBCA 5ETTA 3HSDA 5ETKA 4AD6A 1HQ2A 3ILIA 1RAOA 4CWBA 2QX0A 5ETLA 5ETMA 5ETSA 4CRJA 1IM6A 4M5KA 1DY3A 3HSJA 4F7VA
chains in the Genus database with same CATH superfamily
2YX1A 1MROA 3M6VA 4NX9A 4G1PA 4AQYF 2POKA 3DGPA 2A2DA 5AJ3F 3IBWA 3T3FA 3FRYA 4MMOA 1RWUA 2W4CA 1T94A 3FSXA 3DRXA 2CUYA 1Q86T 4H4KC 1NRKA 5EN1A 1WUUA 2GO9A 2NUHA 4NWBA 2R3VA 4OFZA 2DNZA 3F41A 5E3RA 1VQYA 3EPGA 3BBBA 2VB6A 2U2FA 2GVDB 4DSJA 4DSLA 5A76A 3M30B 1P27B 4RNMA 4UOGA 3RBEA 3HHLD 3L9ZA 4M1KA 3HZGA 1F6TA 2E7WA 4ALZA 4A8MP 1PC5A 4KIAA 1E6VB 2OPQA 4J9VA 3SQGA 3UVJB 4NLXA 5DM6Q 2MQNA 1TKXB 2RKIA 3KK3B 1L5UA 4F8RA 2CJYB 4MAKA 5IT4A 1LWFA 4M5KA 2XMUA 3G2XA 3QMQA 4ZA1A 1T3OA 5L39A 3KK3A 4LT6A 4UTGA 4ZDNA 4CYUA 2I0XA 4YB1P 5J2PA 1XC9A 4FF2A 2HHTA 3OFEA 4CLSA 3L3CA 1I51B 2OH2A 2ROGA 3BM7A 1YJNS 3JXOA 2DGOA 3W64A 3W5ZA 4M8LA 3M2UA 2FLOA 4K59A 4DPYA 2YWGA 2RD5C 3T41A 4M5JA 4AL6A 3MCOA 1RT4B 3VGSA 2VH7A 2WSFC 5BYSA 1NK4A 1NB7A 4J9NA 3OD2A 1RWPB 2XSJB 4NASA 4IRKA 2AEFA 1RT4A 3M8QA 3TVKA 4DUZF 4AQYJ 1OPIA 4LBPA 2DHSA 1WTFA 2CPHA 4A47A 5B0EA 4OHYA 3M8QB 2L3MA 1J2VA 4LR7A 5AT1B 5JXSA 2HMIA 4ECXA 1R89A 1RTIA 2YKNA 1M5OC 2QLXA 5IT0A 5DQHA 4GRSA 4U8VA 1MU2B 4LQ9A 5C25A 4LF5J 5GMKa 2OEJA 5DZ6A 5GMDA 1ZPWX 4RR5A 3GPAA 3SCIE 4WFXA 3LWMA 3GQCA 1IQZA 1HWUA 2ZH3A 1TK5A 4NLGA 1S9GB 2BM1A 4GC6A 1M1GA 4K0KF 3JSBA 1VBKA 2BW2A 4KAIA 4NMLA 2WBRA 1PGZA 2DY9A 2CZ4A 1RBAA 3DI6B 2NSBA 4WYLA 4TU8A 3QGPA 2SXLA 1KQFB 1FVQA 4FPRA 3KYLA 5IFMA 1IKXA 2KM8B 1HNZF 4IQXA 3U1LA 3X1LB 1MWYA 1N0UA 5C24A 2XWYA 3D1OA 4ES3A 2OAUA 3KHGA 2F3JA 4OI3A 2VQEF 2XCPA 3D1HA 2K7KA 1S9GA 5LJ3Y 3CJ0A 3O6QA 1NPKA 4KH0B 3UD5A 2WB1D 2PEBA 1FWLA 1X7VA 3TUPA 1R0BG 1TV6A 1Z4UA 3LW5C 4ZPVR 2K3IA 4NZ0A 4EWTA 3H5YA 3RB0A 2MB0B 3LGMA 1S1UA 2HW3A 2FYXA 1XIQA 2J0XA 2BRKA 3FNNA 3RYLA 1VIXA 4X4TA 1NLKL 1SJ3P 1VC6A 4JI0F 2GA7A 4A8KA 2UUAF 1R8CA 4DPOA 2DNOA 1HWKA 3CCUS 2EG1A 4WP8A 3BDPA 1XNRJ 1FKOB 3GR0A 5AE3A 5DQIA 2ABYA 2YQ3A 3W5YA 5D3GB 5E7OB 2AYMA 2OI2A 1JLEB 2NUUG 1FERA 1PYOB 2EFVA 5F8HA 2NXUA 2FPHX 2DH8A 4WFNQ 2DXFA 4RJVA 3CCWA 3M9MB 4Y2MA 1BLUA 1O0PA 2WVEA 1UW4A 2F4FA 1TK0A 4ILMA 2ROEA 5BYQA 3NWGA 3MR5A 1AYEA 2HPUA 2FVSA 1NDLA 3QIPB 1FT8A 1JXLA 2ZVIA 3MTJA 1GFWB 2HQGA 4I2QB 3DLKA 2CPJA 1IUJA 1HNZJ 2MZTA 4R5PB 2X7IA 5B0BA 1VQNS 4MIWA 4X2BA 3CD6S 4L73A 1VHFA 2RS2A 4ZLNA 3KJVA 3D28A 4NCBA 2YWWA 5GAHI 2QA1A 3N6NA 2U1AA 4DLEA 4HHJA 5EWGA 4QIFA 3W8GA 1Q5VA 4LJMA 1X4HA 2WOMB 1HWLA 2DISA 1U1RA 1S6PB 1CJKA 1SKUB 4YMEA 3P6YC 1TL3A 2ZHOA 1R7IA 3M05A 3N9UC 2X51A 1HPZB 4L75A 4ZLJA 4LF7J 3FSIA 1CJKB 4TY9A 1KOOA 2HNYA 3KKFA 2IA6A 4PRFA 2VHGA 1LNQA 1P9YA 1V3RA 3ILLA 2EC0A 1B0TA 1FJEB 1LW0B 3VZIA 3OLAA 4DUYJ 2Y0SD 1TTHB 2LEPA 1NEEA 1KHVA 2W7AA 3W5XA 4O3OA 5L9NA 2ZOFA 3T1HJ 4ETZA 3PY8A 4HTJA 4I6AA 3RR7A 1UJ6A 4H4MA 3PFOA 3QT8A 1VBZA 2HWIA 2HYIB 3R2DJ 5HBMA 3VR1A 3LP2B 4F0MA 5HMXA 1JLBA 4ZN1A 3OR1B 2P9CA 2FVCA 3B8HA 5MLCV 1UVIA 5K8PA 4M5GA 4N47A 2EEYA 2VG5B 4M63A 2CQPA 5A8RA 1SJFA 5B0AA 1B7FA 1S10A 2DNRA 1SI9A 1U0SA 1UL3A 1HBMB 2C42A 3KHLA 2ZJRQ 4DMZA 4AL7A 1XN9A 3TR5A 3DLJA 2VKZG 3GLJA 4TKTA 4UF4A 5I3PA 1QY7A 3AXMA 2DGXA 3U27A 4LQ3A 4DR2F 1YRXA 2F7VA 1FFGB 3J7Z5 3Q0AA 1RA7A 3EVOA 5CXTA 4HI1A 1FXDA 2G13A 4F4ZA 2JSXA 1JNRB 2L9WA 4DR1F 4K4UA 3CDAA 2VOPA 2VC1A 4NMXA 3FJ2A 1O51A 3MM6A 2QFIA 3GE9A 3UD3P 2VL1A 2VOOA 3I9V9 3GR1A 2X1AA 3MCMA 1HNIA 2BJ9A 4PKDB 2JLEA 2K1RA 1U1PA 2GS8A 3FCVA 2Q43A 1RLDA 2BKPA 1ZAWA 2GQ2A 4IH7A 4Y34A 2W25A 3AXKA 1OY9A 3W2VB 3I96A 4WE1B 1WHWA 1GNKA 1RA6A 2IY5B 3JTNA 1Q4RA 4DBQA 4QR0A 1C1BB 4DV5J 2D69A 2OPRB 1RTJB 4C8ZA 4WE1A 1VDHA 3IS9B 3Q83A 3NS6A 3W61A 4DCJB 4F4YA 3CB4A 3VVTA 3EX7B 1HR0J 2UU9J 1JXVA 2XY5A 1I1GA 3NCPA 4OLOA 4YN3B 1Y0HA 1IQTA 2JC1A 3DM2A 3NY0A 2OUGA 2P5VA 3G6ES 4NPOA 4DJBA 4LMZA 3D6MB 1UWBA 2GQCA 2B5JB 4C9DA 2ZNYA 1XR7A 2W7PA 2M8DB 3CDEA 1U26A 1EAYC 4C7QA 1VLOA 4F3OA 2FTRA 3LALA 5IWAF 2MMYA 2ADCA 2VPXB 1KQSR 3Q22A 2J9DA 4J91A 4TYBA 1FVSA 1JLFA 2W9AA 3P3DA 1U24A 2AMCB 2BABA 3M32A 1Y9OA 2DH9A 2BR0A 1F3FA 3P4UB 1IM4A 4PG6A 5KFXA 5EHHA 2J6TA 4RW6A 4IG3B 1UMJA 3DMJA 3V6DA 1RWOB 2IAJA 4I69A 1NK5A 2RSQA 3I0SB 4H54A 1FTCA 4RW9A 2VF3A 4PG8A 3FMWA 4Q2LA 2V2VA 4KQZA 1JKHA 3LP0B 4L72B 4LRBA 3T9NA 1RT5B 2EI5A 4RW9B 3L7PA 4IFVA 1GXTA 3BKFA 3S6EA 3W9HA 3AHPA 4LBIA 3MMBB 3H2UB 3THVA 1I6JA 5H9EK 2ZC3A 3IAM9 4OYAA 3CD7A 2XMJA 2CJXB 2D3O1 5A8KB 2HFOA 4ZP6A 4LSNB 1QD1A 3MPDA 1RAEB 4LF5F 1HR0F 3CE8A 4DV4J 2H5IB 1LFPA 2VFSA 1FDDA 3HSZA 4RWWA 3FKBA 4G1QA 4KV8B 3T1AA 2HFZA 4DV6F 2HGNA 3GYNA 3J81Y 4RU2A 4WU2A 5J2MB 3MM7B 1NAQA 4WPAA 1OQ3A 2ZITA 1MSWD 4ZJQA 2M2BA 1RAHB 2BRLA 3W7BA 4LF6J 2E9RX 4K4SA 1X8DA 2CQ3A 5D0GA 2F8EX 2M3DA 1R8PA 4DQQA 2M9KA 2VIHA 2UVWA 2WOMA 2FGOA 1F2HA 1RKIA 2ZKUA 3K7RA 2B9YA 2M8HA 4Y2CA 3HM9A 4QYZK 5IM0A 1P1TA 3JSMB 5MAOA 3DDIA 1RUSA 2XMVA 3F0NA 3T9ZA 2J0QD 1I5OB 1RISA 1S4FA 4UQGA 2DPJA 3GWCA 3W3SA 1TU0B 1DTTA 1OO0B 3TWZA 4WIIA 2OEMA 2N4DA 3KUEA 4F04B 4IOAQ 2R42A 4MT1A 3WHIA 4JOUA 4OI2A 4X4VA 1FCAA 1VQ6S 1WORA 1RTIB 1HHQA 4DV2F 1Q78A 3HZEA 3WZ0A 1AA1B 4U9RA 4CNZA 3V81B 2Y1IA 1JIHA 3BV8A 1NO8A 5GAHU 4ZP7A 2BQUA 4R0JA 4JBCA 1FXRA 4O23A 2NQPA 2QMUB 3TAMB 1MMNA 3H4BA 3PJ9A 1R8BA 2ZZNA 2OPPB 1DFDA 2XYGB 4PXEA 3N5BA 4KHPF 1KLMB 1XR5A 3UCZP 2XYHB 1R0AA 5E3QA 2Q3PA 2AX0A 2DHGA 2HRTA 4RPFA 3M8RA 4F2SA 4O3QA 4P7TA 2UXDF 3HHDA 1XNQF 1TKTB 2A1BA 4QIWD 4KHRA 2ILZA 1FA0A 3M2RB 1VFJA 2C3UA 1N48A 4YDXA 4NCGA 1VC0A 2LA4A 2XS2A 2N7YA 4MK9A 4GKJJ 1MW7A 4C3KA 2YPZA 2LCWA 1OWXA 2JHEA 5IOLA 2E9TA 2QV6A 2ROPA 2C2NA 2VG7B 6FD1A 3OW2R 3T1YJ 2D3OR 4J9UE 1JJHA 1YJRA 4ZCIA 1RAGB 2E5IA 4E2FB 1A6LA 1EIYB 1S1UB 4B17A 1TKTA 4ZJLA 1HNIB 3G9CA 2HQFA 2XWXA 3EUNA 1FRHA 3IG1A 3IAS9 4CI0B 2IYGA 4NXNJ 3PKMA 2PIIA 3L7OA 4B3TF 3U1MA 2CDQA 1N5SA 1BD6A 1WOOA 1VIOA 4ATNA 2R7RA 3BQ1A 1FEEA 5LL6d 2MKIA 3HVTB 2JJ4D 3TZZA 5CD4A 1RWXB 2BANA 3DXBA 4M5DB 3CCRS 1V6HA 2QSWA 4M5NA 2V34A 3AA8A 4UOFA 3KJQB 2I2YA 4CTAA 3QT5A 3I5BA 2BE2A 1CC8A 4X66J 1YLXA 1NSKL 2G9OA 2GMHA 3LANA 5LJ5Y 2APOA 3TP2A 1SVDA 2CG8A 5KTQA 3DLKB 3NOCA 2DO4A 2HHPA 4NZ6A 4DX8H 5C2CA 4ER8A 1XNQJ 3P8BB 2LKZA 3ZNJ1 2V68A 3UDCA 3QLHA 1WOSA 3IC1A 4ZMMA 4WFAQ 2RUSA 1VQ5S 1NSPA 3T5JA 1UEKA 2AIRB 2FHOB 6AT1B 4IO1A 3C14B 3SDEA 2KG0A 3TARA 2ZOGA 2V5HG 1WG4A 2BA9A 4C3LA 2WSEC 5AXMA 1QTNB 3TVYA 1SB6A 1J5EJ 4DR3J 1FDBA 2HHSA 4DFKA 4X4UA 1TMJA 2WCXA 2R8JA 2VG6B 4BLGA 1AUDA 1JKHB 3RBXA 1HNVB 3HHLC 4ECYA 4C11B 1UA0A 1PG5B 2HGLA 2KDOA 4O4GB 1ULRA 1VLYA 1Y5NB 3ETOA 5EDWA 5B09A 1P9QC 4ECTA 4MKBA 4FVCA 3OQ2A 5M2UA 3UVJA 1L3SA 4C97A 1UVJA 4K5SA 2KO1A 2LDIA 2ZDOA 2UV8G 3M2VB 4H4MB 4O4RA 2XG8A 4OYIA 5HJYA 1U1KA 2DTJA 4ELUA 2MQLA 3G4SS 3QATA 2WZ1A 2XMTA 3QYYA 2VQFJ 1KEKA 3OT9A 1IR1A 3CJKB 3IXQA 3FEZA 4LRDA 2AJ1A 4ANCA 2DNMA 1CJTA 1Q16B 1TMMA 3AFGA 5GAGU 3JYTA 2ZH1A 1DARA 3BYRA 4RO0A 2WVBA 2R8KA 2YKPA 5ETPA 1B4SA 3THPA 2D41A 3M9NB 1CJVB 2R8IA 3CC7S 3ZXWA 1UJ4A 3Q8QB 3KMSA 2FD2A 3W2WB 4HEA9 5KFKA 3RAQA 2WBMA 3EWGA 5KG6A 3C6UA 3W66A 2CVEA 4DS5A 1FRXA 2QMWA 3NXZA 9ATCB 2VDHA 2KJVA 3CJQA 3MR2A 2Y1JA 4IRCA 3DC2A 3C6UB 4I4BA 2E1CA 3I5AA 2HQCA 1UJ5A 4CO1A 2QA4G 1QSSA 3HT3A 5K14A 1U48A 4JB8B 3OR2B 4PWWA 2JEGA 4IFYB 4YB7A 1S0VA 2Q1LA 2V4JB 1WI6A 2IJRA 4U95A 3H25A 3KWMA 2GGPB 2V4QA 4LUBA 1LV5A 1AFJA 4WF9Q 4IFYA 3M6WA 3MECA 2UUBJ 1VQLS 4WXWA 5J2QA 4O3NA 2KYXA 1C4CA 5F8LA 1TKZA 3DOKA 1L3UA 1IBMF 2J76E 1OMSA 2QGFB 4PABA 2GAGC 3K89A 1O6XA 2N3OA 1RTHB 1X5TA 4CLYA 3CCSS 2OPSA 1IKVB 4ID5A 1V5IB 2VJUA 2RB7A 2BBEA 3PR5B 2ZBRA 3KLHB 5L1IA 1KVIA 1ELOA 1IM6A 3IRXA 3LPYA 4J7CA 4ZVTB 3HSJA 5KFGA 5L46A 4QWDA 2XCAA 3EM1A 4YR0A 3UR0A 1U1NA 1RHUB 2EK6A 2X3DA 4MIAA 1RTZA 3EVMA 3MMJA 3GV8B 2R9LA 2MKKA 3UQSA 1N33J 3HD2A 1NCLA 2Q6CA 2OPSB 4ID5B 2BJ8A 3HDSA 4P2XA 5SZTA 2ZC4A 1HD0A 2H1YA 2C3MA 3TUZC 3KLHA 1JJ4A 1N52B 3BPSP 3NOGA 4Q0BA 1LW2B 2XY7A 5KFVA 2OELA 3C15B 1NK6A 3U7JA 1IWAA 2LQJA 3A3PB 3HHLA 3G6VA 1FX4A 1VQ4S 4LF1A 3HXMA 2CQ0A 4TXSA 1S79A 1QLNA 3ENWA 3ONQA 1HBNB 4ZVSB 4I6YA 4LFAJ 4J9OA 4NA2A 4DX5A 2IVYA 4JI3J 2JFDA 4UT4A 2XLKA 2ATCB 2GAHC 4OIXA 1BWVA 3EGZA 3B54A 1CPZA 5EUHA 2Q66A 3BBCA 4P9SA 1FFSB 3G96A 3GYXB 2XSFA 2FVPA 3FQKA 2ZZTA 4LR9A 4ZVPB 2F63A 3HHKA 4YY3F 3DOMA 1F2GA 1YX2A 1Z1ZA 3RRKA 4CTAB 1BY9A 3CMAS 5J1PA 3J80U 4DR5F 1S9FA 4NA1A 3TRGA 2F4VJ 3TEHB 2L48A 2GO8A 4JV5J 2I8EA 3WIVA 1HKAA 4CO3A 1FJGF 5HANA 5KFIA 5KG3A 2HQ3A 2UUWA 2M5YA 4DEZA 4I2PA 4UZBA 1YJWS 3P49B 2HNYB 1NNDA 1S0OA 4RNFA 2VFUA 2IYIA 5KFMA 2P9GA 4OYZA 4ED4A 2NZ4A 3JTOA 4X4PA 1HA1A 1R0CB 2E44A 2QX0A 4X62F 2FHKA 2PI5A 4DSKA 1KS2A 5ETNA 4Q8FA 3GU0A 2CJ9A 3I4HX 2CQCA 3HJVA 4YP3A 4OYOA 2V63A 1WOPA 3D67A 3K5PA 4PXBA 3OL8A 2EFGA 3HVAA 4HL9A 1PAEX 2H48B 4RBUA 1TL3B 1WC5A 1JLCB 1FNOA 2R7WA 2EFQA 5DDQC 4OYXA 3AODA 1OIAA 4QIVA 3S1TA 2IM3A 2RRBA 4CH7A 3TX8A 2W8LA 5H9EJ 3BO3A 5LT5A 2ZH9A 1UFWA 3KK1A 2M0GB 3F44A 4FP9A 1YIJS 4DUYF 1K8AT 2AJ4A 3DLEA 5AXLA 1S1XB 2MZJA 3A1YG 2F1FA 4V19J 2YX7A 1KLMA 1BGXT 3D66A 3DKDA 4HACB 4QWBA 4JI1F 3VAMA 3G71S 1Q8KA 5LMUJ 4X65F 1O5JA 4DSIA 1TAQA 2MSSA 3MPUB 5ETSA 2MYFA 3BF4A 3M1VB 5DJBA 4F7VA 4ERDA 1YJUA 4JI2F 1YWXA 4K2JA 2PA8D 3VAGA 2C3YA 2YNFA 1EQMA 3GFHA 4RZRA 4KSEB 7AT1B 2YH1A 3M1VA 4JV5F 4JUZA 4QYZJ 2FZKB 3QFHA 3ZO7A 1D0EA 1RAFB 3TVZA 3W1YC 2PFFB 2GCFA 2I9SA 2XGQA 1HBMA 3J81j 2WK4A 2XO6A 1HHTP 4QU7A 2CWKA 2AZ1A 1RHQB 4OX9F 1F9HA 4O44A 5FIIA 4I1TA 4NZ7A 3O44A 5C7PA 3H59A 1MNEA 3EGVA 4URSA 1X0PA 4OJ1A 4X4OA 1H2VZ 5JVGQ 3G8TA 5BYRA 3GCXP 1KTQA 5DZ7A 4DL5A 3PJXA 1WTBA 1M5VC 4N8NA 3WC0A 3J7YI 1M90T 4IR9A 4LF6F 4PWDB 1NDCA 1U1LA 4LIWA 3CULA 4AL5A 3OVSA 4LF9F 3KTQA 3EZUA 4K4XA 2V6AA 3OTCA 4KO0A 2R2SA 2NS1B 5E33A 5KFYA 4G65A 4QBUA 4CT9A 4U6PA 1FD8A 5F8IA 2GQQA 2VODA 1GTHA 2A6OA 3MZIA 3CF5Q 3NP5A 1NU4A 3CJRA 4M5DA 5A2QY 2AQ4A 1RYRA 3MHYA 4L74A 2VQEJ 1QJHA 5A2QU 1CVJA 2DEIA 2BQ3A 4YHHJ 1TFWA 2I38A 5C2GA 1RBOB 5A6PA 5RUBA 2MGZA 1XMBA 3O1LA 1REVA 4NYPA 4B3SJ 3DGVA 3T5LA 1VHIA 4ZITA 4CP5A 1UWBB 2B5JA 4Y65A 5B0CA 2PI4A 3DGPB 1BQMA 2BJ1A 3HVWA 5ETRA 1W2IA 3RGIA 2KHCA 4P52A 3V6KA 5KG0A 3DM2B 2CNNB 1KHWA 2O1PA 2WW4A 5HROA 1SKRA 2EVZA 2CQ2A 3FBCA 1MMDA 3UCUP 1FD2A 3RB3A 4JYAF 3DRPA 4ILRA 1T8EA 1YRTA 4MK8A 1VQKS 4F25A 3GTYX 4MKYA 1IVZA 4NLRA 2DK2A 2O3DA 1NXIA 3DOLB 4IFVB 5DO2A 2WTFA 2EKNA 1RACB 2F40A 2KRRA 3I32A 4B9UA 4ELTA 4XO0A 3BZQA 1QSLA 3QNWB 2QJ3A 2NCKL 2V8GA 3MEGA 4K2XA 4LSZB 4URQU 1NK0A 4DQIA 3FBFA 3OBIA 5FD1A 2KZMA 2GVZB 2DXEA 3LWLA 3D6FB 2ZBIA 3PO4A 2V67A 2Z57B 3IRWP 4ZVQB 3QRPA 2HRUA 3ZTPA 5CHCB 1Y11A 1NJIT 4TY8B 1U8SA 5KT3A 2YQ0A 3HKWA 3TO8A 4JI4F 2V8VA 2JFKA 2KVQE 4U7UK 1FRIA 2JVRA 4QWCA 2CQDA 1AT1B 2WONB 1JLAA 4J37A 4YEAA 2V2ZA 5GAGI 3NCQA 4HI2A 3H42A 2JOQA 4Q2MA 3UD4P 5J1NA 3TAQA 1D8ZA 1ZTWA 1FI4A 4CLUA 2BJ7A 4ZS6A 3C19A 4B3MF 3CJKA 5A6WA 4W90B 1LWFB 4JI8J 3I6PA 5J2PB 1TAUA 1DLOA 3IR6B 3MD3A 4Q5VA 4ES2A 2OFHX 1FNXH 3TX0A 3MD1A 4G1QB 1C1CA 2CJBA 2F9JA 2MLZA 4KV8A 4DG1A 2QLBB 2VV5A 3PDNA 4USUA 5D4NA 3LTOA 3ENQA 4RW7A 4EK2A 1AZSA 1VJQA 1U0HA 5KFZA 4H4OA 3EXYA 4DG1B 3LA0A 5IM0B 3OUYB 1MU2A 1UVKA 3GIRA 3MEEB 1FX2A 3G82B 2XC9A 1HW8A 2CZVC 5LSLA 5CYMB 4HYKA 4UW2A 3K0JA 3TZXA 2KFYA 3KLIA 2NR0A 3OUYA 4ITSA 2J0SD 4KPCA 2AYGA 3CO0P 2B8PA 5J2QB 5ETLA 3K17A 3MEDA 1Q53A 3RJMB 2FJWA 3KLFB 2V4JA 3PO5A 5L38A 1SL1A 2EC2A 1UEUA 4FF1A 1H3DA 1PJ5A 1T0TV 2DGWA 3MEDB 3PYDA 3QO9A 2AX1A 3HVRA 4EBDA 2IRUA 4GKJF 3J7AN 3EDQB 1S1WA 4G1IA 2CRLA 4P2MA 1N5YA 1PJ7A 2K2PA 4NLOA 3ENVA 2Z58B 2HVHA 2OHDA 1W26A 2OD4A 1N5YB 2KRBA 1S48A 2QO3A 3CDUA 3PM9A 2AJ2A 5AJ3J 1WHXA 1S9EB 1TVRB 3DRRA 3OFHA 2AHOB 2CWXA 4ED5A 3AOBA 1XMOJ 1UVLA 1J5OB 2AZ3A 1RDRA 2VC0A 2NYHA 2FY1A 3BS9A 8AT1B 1VISA 3FZBA 5AXKA 3POTA 1WF0A 3LH2S 3O2IA 1X4DA 3UDLA 4A8FA 1Q7LB 3PX6A 3C15A 4U7CA 1PIEA 3Q8PB 1XNRF 2RQMA 1UFKA 4ECUA 5KT7A 3V6HA 2HHVA 5F8JA 2JNJA 1H74A 3DYAA 1FKAF 2CPZA 2GJIA 4N5SA 1PJ6A 4OX7A 2ZOMA 5HMZA 1F5BA 2BMBA 4AXIA 4DV0J 1CQNA 1HQUB 3IG1B 3Q8VA 2DH7A 5H9FK 1DURA 2R8GA 2OTJS 5T7LB 1FRMA 2OMOA 4IRDA 1M5HA 1N5QA 3GONA 3D7SB 1FWPA 3C2PA 1S99A 1A9NB 3ENAA 2Z2LA 4N41A 1D9AA 5T7LA 3D3BJ 2DNLA 1RT2A 3MAAA 2AGOA 1U1OA 3OL9A 3D1QA 2GMLA 3JSRA 5H9FJ 3H0PA 2FJAB 2KJWA 4EO8A 1PYTA 1T05A 4RW8B 1JLEA 4LF8F 4CRJA 4TNOA 1HQUA 1TFYA 2CVIA 4MYTA 4CO0A 2KXFA 1RHRB 3U1NA 4USMA 4FYVB 4I2PB 4F36A 4GVBB 2XS5A 3IWNC 5HQ8A 2VA3A 3PHEA 1GXUA 2GHPA 4I68A 3ZNUA 2XLIA 3CMES 1UKUA 3KJVB 1FK9B 3TQ1A 2B6AA 4X65J 3BREA 3HHEA 2GJ2A 1T9UA 3B4DA 1VQSA 3CNQP 3QLHB 2HHWA 2YXLA 2UXCF 2KZZA 5CCMA 3OJUA 3T6JA 2D9PA 4K8RA 3OHAA 1WDDA 2VFTA 3KHHA 3DLHA 4RUAA 1LK5A 5KFAA 3GMGA 3MMCB 5KT6A 3I55S 4OYMA 1HBUB 1GX5A 2DR6A 1DAXA 3KUGA 5CQGA 3PCOB 5KFSA 1VMBA 4R8UB 1YRUA 3FMBA 4WYWA 1Q79A 3H98A 4Y2IA 3GYGA 2BE7D 3AD7C 4OX9J 4JP8A 5K8NA 1CJUB 2FGCA 4U67Q 3R27A 1RWMB 2MEWA 2ZH6A 1UVMA 3VAHA 3DNCA 3PJWA 4OQJA 4X84A 3B78A 2BEFA 1RJJA 2JLFA 2PGCA 1MG7A 2QIFA 3HT0A 4A8QA 3JAMY 4LF7F 5GADU 3M8ZA 2EBEA 4KGXB 5K5MA 4ID8A 1DZ5A 4WIQA 2VDIA 1KBRA 4YDDB 1B3TA 4RBTA 2GX8A 3B4MA 1Y3KA 4K5RA 5G4DA 1KOHA 1T9XA 1UWAA 1YBTA 2DNGA 4KFBA 4NYZA 5C5JA 3CCLS 4EYHB 1ZTTA 5EX0A 1U4BA 1RAIB 5HSPA 3A13A 2IM1A 3AD9C 3BQ2A 1SIWB 2DR5A 2M7SA 4NLVA 2M52A 1C1CB 1VGYA 4HT7A 2FUG9 3MPVA 4Z7YA 1DY3A 2J0WA 3QGGA 4V1Ak 4EO6A 3SYZA 3UO0A 1OQ6A 2YH0A 2BW7A 1RGVA 2DT9A 1XWLA 5D77A 3RUBL 4Q44A 1N5VA 3H8YA 3NNCA 4F50A 2YKNB 2HBQB 2I6WA 3GG0A 1UPMB 5FDLB 4EGLA 3J81U 1WACA 4ZVUB 3FCHA 1S76D 2AYBA 2A18A 4ZP8A 2E66A 1SV5A 1K9MT 1RE1B 4XIUA 4ETXA 2GGPA 1CC7A 1NSQA 5FDLA 1L3TA 4B02A 4AFFA 3JSYA 1NKCA 4J9RA 1BXNA 4FF4A 5FJ4A 2CQGA 1G6BA 2A10A 1N8RT 2YPYA 1AFIA 1B0PA 1NM2A 3CW2C 3GV5B 4A8WA 5I3UA 3K5OA 3R97A 5IQ6A 3QWUA 1F60B 5IC4B 2MGZB 1ZA1B 3GSIA 3OLBA 3SI8A 3LAKA 3AT1B 4GVLA 4W92B 2IBOA 3H4DA 1UA1A 3FUYA 4ZHRA 2JDJA 1U49A 3KK2B 1RABB 1S6QB 2XMAA 1SC1B 3BSNA 1R8HA 4CM0A 3BGUA 1BQMB 3OVBA 2FHMA 1NB2A 5BR8F 3F56A 4KYZA 4USWA 5D0EA 5HMYA 5LXRA 3CC4S 4RLEA 2DBBA 4R0EA 4LBHA 5I42B 4JI3F 5C24B 3DHXA 4AUKA 5DQGA 2E5LJ 1F3VA 1YITS 2COLA 4DV5F 3RW7A 2RQKA 1WC3A 5HQLA 3NKYA 4F0HA 2B9EA 3QAUA 1TV6B 1IBCB 4P7VA 2UVVA 1BQXA 4ZP9A 1N88A 4NE9C 3OL7A 1UAWA 2R2UA 2B4OA 2AW0A 3EVWA 1N32J 2BJDA 4KHPJ 2VKRA 4QOTA 1C4AA 1VJWA 2MJUA 3M6UA 2F4VF 2W9CB 2HBYB 1HL6A 4NL5A 3LGNA 4JV1A 3LP0A 4H4KA 1T9VA 4ECVA 1S0NA 1LWCB 1WEXA 4C6AA 1RT5A 1A7GE 2DHHA 3AOAA 4RBVA 3UDEA 2HNDA 3G6YA 1ZAVA 3CJ3A 2CNLB 5DRKA 1WDTA 3NBPB 4DV4F 4C8OA 3ICLA 2Y1LB 5EWFA 2ZDPA 1S77D 3H40A 4HDGA 2J6UA 3I56S 3GZ7A 4HHHA 5HJXA 3NS5A 3UNGC 1I3OB 2P6SA 5KG5A 5AXNA 4EUVA 3NWRA 5KT2A 1Q7YT 4R25A 2E9ZA 2XZWA 3UNYA 2RHQB 5E3CA 2V8PA 5D0HA 5IV4A 3NRBA 3R2CJ 2A6MA 1LKZA 4IOCQ 3TAPA 1KD1T 2KG1A 3C8YA 2UZAA 5KFLA 5KAKA 2VQFF 3CCZA 1N0VC 2RHSB 3PRBA 2KI2A 5G0RB 3J80Y 1KNZA 2LP4A 2NSCA 5HI7A 2OO4A 3D68A 1RTDA 2FVQA 4B9TA 1YDLA 2BQRA 2XSJA 2VBWA 4Z7CA 1FJGJ 2K06A 1HWIA 3WX4A 4EMDA 5DDRC 1HMVA 3U02A 1XEZA 1VQMS 2MSTA 1LW0A 2WRMA 4URGA 1C0UA 2IJFA 3TANA 4Y3CA 2QT7A 3BN4A 1AZSB 4UOCA 5B0FA 4MKVA 3D0GE 5KFJA 3V6JA 1QAYA 1F5AA 4K4YA 3AB4B 3KLGB 1WEYA 2DCLA 2W2PP 2YKMB 4G3IA 2C2RA 4UOHA 1JLCA 3T1HF 4HLBA 4EBEA 1RTDB 2BOPA 5B0GA 4QPXA 2QE5A 4LFCJ 2R7XA 3D0IE 5GMEA 1WHYA 4ECRA 2AWZA 2V9WA 1CULA 1RK8A 3GSDA 1Z2ZA 5IC6B 5E41A 3GJQB 4Q43A 3NGUA 2BM0A 3HF5A 1VQ8S 4OYBA 3BKTA 2DO0A 2HBRB 5KT5A 1R31A 3TAMA 2A2CA 1RT3A 2NLWA 3V2UC 3N79A 4CLTA 1EARA 5D78A 2JRSA 4YB5A 3NMAA 1KSPA 3T5HA 3CJ2A 1PILA 1U25A 3IWLA 4OLPA 1D09B 5LXYA 1CQMA 3S8SA 4P74A 4C0HA 2HNZB 4OX6A 1WC1A 1FWKA 3DLLQ 2CAJA 2Q6BA 4PWUA 2QL5B 1FFWB 3R7SB 1U09A 1P8GA 3N4WA 3O3LA 4LFAF 3DCAA 3CDBA 2CIMA 1URNA 1PCAA 2CQ4A 1LXJA 2C22A 4B3RJ 4RNNA 4PWDA 2DYAA 3GV7B 2BDPA 2W4PA 4USJC 2IM2A 1ZOTA 2FZGB 3MTKA 4B9VA 2AF6A 2GHVC 1BHNA 1ROFA 2XYPB 1NUEA 1OYEA 2XHWA 5I4MA 4M94A 2R7VA 3PV8A 1GXLA 2QYGA 4ZPDA 4J5OA 5HATA 1N6QA 1GT8A 3ILIA 3JQMA 2C2OB 2C3OA 4ENOA 5DLGA 4UY8T 1F0XA 2FLPA 4B9MA 9RUBA 2IIHA 4ANDA 4BCAA 4DR5J 2HS4A 3UN2A 1HQEB 4I64A 1NMEB 2G1DA 4OZ3A 5ETOA 4GKKJ 3UR3C 1BQNB 2W01A 2XZDB 4JYAJ 5F9NA 4DI6A 3WBZA 3W2VA 4ED8A 1ZPVA 2PEHA 5A0YA 1IR2A 4IG0A 2J6SA 5DGAA 2I5JB 5DDPC 3M8PB 2GW8A 3HFKA 2XQCA 3V4IB 2AU0A 4DX6A 3MAQA 1UP1A 2V2KA 3KG4A 2E1AA 1D1UA 2B9WA 4I67A 2MLXA 1OY6A 2XY6A 1QE1A 3EMTA 3W60A 2YY3A 2B4UA 4LR8A 5BJRA 1LWEA 3GILA 5KFWA 3HVTA 3PEHA 4OX8A 2DR9A 1MN9A 3I0RA 3LPEA 5DS7A 4ZOSA 2EFNA 2GHWA 5CABA 4X4QA 1H7WA 2B4VA 2D74B 4TQSA 2EW9A 1JK9B 1TL7B 1DTQB 4CO2A 1GH8A 3DU6A 3F73A 4WK1A 2NXJA 3IA0A 1N36J 4WKRA 2ZEJA 2ACMA 1X4FA 2UUTA 3BH6B 4LF2A 3VTIA 2HQDA 1JB0C 2D1CA 3SDEB 1MROB 2OP5A 2ZE2A 2R2RA 2ZFHA 3ITHB 4L6V3 2DB1A 2JEJA 4MJKA 2XLJA 4Y6IA 4X66F 1W25A 3QSYB 2KFNA 1E6YA 3MMCA 4PPZA 3TA2A 4QYRA 3FVYA 1HNVA 1LWCA 1KR4A 2XI3A 1T03A 1SUQB 1L3KA 1S1TB 1LXNA 3N6LA 2XGPA 1RLCL 3AOCA 1UFLA 1IBLJ 3QT7A 3JYTB 1RKJA 2O67A 4DR7J 5ETKA 3MEGB 2KYZA 1CSJA 3L7UA 1YJVA 4MTPA 3ZZ0A 2C2EA 2KVIA 2YX4A 2QN6B 4K4ZA 2HG4A 1N4LA 1LOUA 2DR8A 3K8VA 4QR2A 3IP0A 2HLUA 4DWIA 4RX6A 2RQ4A 4RUHA 4FKYA 2QFJA 4DV6J 1T03B 1SH2A 2HLTA 4CYUB 2LQ5A 2L9NA 2DRAA 2WVCA 3PIPQ 2A0FB 2J7UA 3GFXA 3R5AA 3PTWA 1HYSA 2RF2A 2LDYA 1S57A 2RKIB 1LQ9A 1APSA 3HD1A 4ICLA 2DGUA 3A3OB 1ZM3A 1WD6A 3CJ8A 4KY3A 4YS2A 3GFYA 1FTRA 1KFDA 1RT7B 1UZHA 2OSRA 2PD1A 4W98A 3WX8A 3FGVA 3MWBA 3SEOA 4NXNF 4LF4J 3HP6A 2XB2D 1VRUB 2MZRA 1CJVA 4HDHA 4HR2A 1DTTB 1DJ0A 1OS5A 4PG4A 4WKYA 2VFRA 1YJTA 2LMIA 1XERA 3M7VA 4KRWA 3IGVA 3IO1A 4CT8A 3JSMA 3OFFA 4C2MA 3MM9A 4ILLA 1PBAA 2HFNA 4GO5X 4J9KA 4PAAA 3CJ5A 2V9KA 2YWFA 5J1EB 4JI1J 4NYOA 4DOZA 5CYMA 2IHR1 2VD3A 3HLUA 4Y2AA 4JV0A 2MZQA 3KNGA 5FLXY 2ZH7A 1B7YB 2BOAA 4RWXA 2HHHF 4QR1A 2XBPA 3KK2A 2JZ5A 2OPPA 2XULA 4N56A 1I94F 3MOJB 3KHRA 2C2ZB 4OZ0A 1NHVA 2EPIA 3ISZA 4RW4A 5F3ZA 2YNGB 1RTHA 1RT3B 3EE3A 3HCXA 3VF0B 4Z37A 1CG2A 3JB9k 3IBCB 3MUTP 4HKQA 1AROP 4KJIA 2CQ1A 3CJTA 1TKZB 3DOKB 2J7WA 3H2LA 3Q8YA 5BR8J 3PR4A 1ZYQA 1VK8A 2O01C 2FC9A 4AYBD 3DXSX 4DL2A 2HWHA 3M4XA 4NEZA 5D0RA 4F67A 4QWEA 2IMWP 3NNAA 2Z2YB 3CTRA 3V4MA 4IH5A 3PFEA 4C0BA 3UN5A 4MH8A 2YNGA 4LIRA 4MYUA 5K8MA 1H2UX 2ZM6J 4ZVGA 1NH7A 2BX6A 3RRGA 3WC2A 4B9LA 5LMUF 2VONA 1GMWA 1SH3A 3QAEA 4U7UD 2ZH5A 4IG3A 4ZJOA 3UDVA 2PFDA 4C4WA 1S59A 2PMWA 3UE2A 1REGX 3A8KA 2GMJA 1WF2A 2IVMA 1DBDA 2BE9B 3KFWX 1FXLA 4MKAA 2HZAA 3MMAB 1PSDA 3NBPA 4WP3A 4EZ6A 2HS3A 2CG4A 5F8MA 3ELHA 2Z30B 3W9IA 5M2RA 3NCRA 5HVHA 4C8LA 4ZPWR 4R5PA 1N33F 1IKWB 1HNXF 1RADB 3CWJA 3N0VA 2N7CA 2IDEA 3FFIA 3QFWA 5DG9A 4EBCA 3PHTA 4ECSA 5HLFA 3QIPA 2DR7A 3NS7B 4D3GA 1P6TA 4O3PA 3R1LA 4KTQA 3KOAA 4FNHA 2FJVA 5C42A 3HFZB 4KT0C 3PRVA 3ZZUA 3AQPA 4IYQA 4KKOB 3PW0A 2HVEA 1S6PA 3NEKA 4XAKA 2XTJP 4DV7F 2C1EB 3ISNC 3BQ0A 2XMMA 5L9XA 3FK4A 2A3JA 5U47A 3D6HB 1FKPB 1VRTA 2NXCA 4NA3A 4NI2B 3D4JA 3T5KA 1G4CA 1SXLA 2V94A 3AD8C 1SH0A 2CDRB 3AQOA 3ZZYA 1U1QA 1YZ6A 4I2QA 4CH0S 1U1MA 4FYWB 2Z56B 4WP9A 4LREA 3QRRA 1MMLA 2MJNA 1IJFB 1JJCB 4Z2XA 1GX6A 4TVAB 3KJFB 1DQAA 4IDKB 4RUCA 4B3MJ 1RCXB 2M88A 4YQWA 2RU3A 4ED2A 4WXOA 4CLPA 1FDAA 4BBYA 1HLWA 1OYDA 2DITA 3OSNA 4IO9Q 1T9TA 1YJ9S 5L1LA 1M5PC 3R7BB 1RP5A 3EXCX 3QZ7A 1EHWA 2B6AB 3G86A 4ZVEA 2AV5A 2QA4S 3PYEA 4PQUA 2CNKB 3BR9A 5F41A 3RB6A 1S1XA 3TI0A 1JWWA 3LF0A 1UTAA 3EJMA 5F0UA 2RQCA 2E5HA 2HGMA 3PG9A 1U2FA 2Z8QA 4FYYB 1VQ7S 2J7KA 2RH3A 3V81A 3ZTRA 2LECA 1XBWA 3H5XA 2VASA 4KFBB 4P71A 5JJBA 2FDNA 4X64F 1RSCA 1CULB 5E3PA 3OPKA 2O66A 1SBRA 5HQMA 3M2VA 5ITHA 4O0NA 1SJRA 5EWEA 3JAMU 3MCNA 2UVRA 4I7FA 1AW0A 1URRA 1AB8A 1Y5IB 2E1MC 3ULHA 2LQ8A 3ET6A 1CJTB 1OSCA 4I7FB 4AXJA 5CYJA 4DF8A 2XMWA 4DQPA 2MZ1A 1HNWF 3IM8A 4J9PA 2PMZD 2UVUA 1RT7A 4XDDA 4LRFA 4OJHA 4NLUA 3CEDA 4IKAA 1V5VA 1N6QB 4DV3F 3EGWB 3SCLE 3HPOA 1RTJA 3PX0A 4ZCMA 2LU2A 4OI4A 2BJEA 1GTEA 4O0IA 2FZCB 3PIOQ 5SUHA 5I3UB 4DXLA 3ZZRA 2PDAA 2MQOA 4RL1A 4NLTA 1RU1A 2ALZA 5C25B 1JQGA 3Q8UA 1EP4A 1A0OB 5KFPA 3OXGA 2H65B 5KG2A 3E8OA 3W8PA 2LQBA 5J2NB 4FNIA 4DZ6A 4B3SF 3MM8A 5LSRA 3VAKA 2RU9A 1SV5B 3FBBA 1N34J 5LOQA 3CJ4A 4OZJA 2LXUA 3VAIA 3C46A 1X9WA 2IMOA 3H7HB 1N5TA 3BGRA 4L3NA 4RW4B 2B0GA 2QG9B 4ECQA 4NLWA 1KVKA 1ZZNA 3IFEA 1REVB 5CD4H 3QRQA 2HEKA 4GO7X 3BGRB 1X0FA 4ZCKA 1K73T 2H51B 4X62J 1XJWB 1MWZA 1RT1B 2W4DA 1M1HA 2BE2B 3VHQA 4NXMF 4DR7F 2R2TA 2NXEA 3V6DB 3TZYA 2J9EA 3CIMA 3PYGA 2B51A 4YR3A 2IVFB 4OYWA 1H72C 2F8HA 4Q7AA 2PSZA 4PXDA 3UWTA 2KT5A 4Q0BB 2FQQB 4OHXA 2DNHA 2YQ1A 5KFFA 3QZ8A 1VOMA 2E7VA 3LP1B 2KB2A 2DPIA 3ZTSA 1KTVA 2LYVA 5I42A 2CJAA 3R6GB 2DD8S 5GVQA 1H2TZ 1TL1A 2L9DA 1VCTA 2BJ3A 2LA6A 4GMKA 5HK4A 1YVFA 3MOZA 4OHZA 2ZKTA 3VGTA 3ZTOA 2AGQA 2VZ9A 1RXOB 1UETA 2PE8A 3GP9A 2N3LA 1XK8A 2AEJA 2XS7A 4OV1A 1K47A 3FC9A 4BHQA 4B3RF 2GVZA 4DV2J 1N32F 1R6YA 4O4GA 3WDOA 4ZLLA 4DL6A 4Q45A 3OXFA 4BDPA 3TJAA 2PC6A 1OSDA 3LP1A 3MM7A 4LVNP 1IKWA 3P96A 4WBFA 2EKYA 5HN0A 4N76A 1W2BR 3T6BA 3HKZD 1Y7PA 5KFHA 1U8WA 2RT3A 2IAJB 3DHWC 3LAMA 3SQGB 1Q8IA 3TA1A 2J8AA 3VWSA 5KOXA 3OHBA 1ITPA 3G8SA 1WG1A 5G0RA 1WKLA 2P2CB 5K9FA 3KNAA 2MKJA 3BEGB 2NYIA 3HSDA 4C98A 3HK2A 1R43A 4MK7A 2UXDJ 4ICLB 3LQVA 3MMBA 4F2RA 2R7TA 5GAEI 1NHKL 2DNNA 2HKEA 3OFGA 4KGKA 3Q23A 2CQIA 1ZM9A 2NZCA 5A8WA 3M2UB 3QJPA 2GZOA 3G8QA 2MDAA 3KG0A 3MI7X 2ZVSA 3H2VE 3M9OB 1KRPA 2BACA 1NBEB 2D9OA 2G0CA 3CDWA 1FE4A 2YKQA 3KXDA 3N6MA 4FPIA 3MCSA 8RUCA 3KLFA 1NJZA 5JUMA 1PO6A 2XNRA 2CNOB 3G87A 3KLIB 1SL2A 4FYXB 1WF1A 2IDLA 1UEVA 4JI8F 1X5OA 2CQHA 1M5SA 3K8WA 3KK1B 1T11A 2FLLA 1O8BA 3GJRB 1NSAA 4HVZA 4FBUA 3R8YA 1KWMA 3GG1A 3MUMP 1X4EA 1PYSB 1FRKA 2G0IA 3D2WA 5IS2A 5GAEU 2KL8A 2FLNA 2DHAA 3OR1A 4ZN3A 4K0KJ 3DRRB 4QU6A 4CQ1A 3AJDA 5DDOC 1IBKJ 3CXCR 1Y10A 2W1BA 3SIPB 2H3EB 2XZTB 1U2CA 3QGHA 4OHVA 3R7NB 3MEKA 1EZZB 3DLEB 3GCWP 1K1QA 2ZNZA 4K7QA 4YB6A 2ACYA 4B08A 5JMNA 1NKEA 2VPYB 5KG7A 4LRCA 4TU7A 4DS4A 3PW7A 2GNKA 1QM9A 1X31C 3C66A 3CCES 3RZAA 3NAHA 3NMRA 2EWHA 2DXDA 2QLJB 4DN0A 1Q8BA 4DR6J 2W2MP 2XNQA 5KFBA 3DYAB 4BC7A 4F4WA 4FKXA 4TN2A 1GK8A 1TVRA 2LLZA 3HSGA 4BC9A 2Y8WA 3UI3A 2AP6A 4B3OA 5CA5A 1AXQA 2G1HA 1R0AB 2UUCF 3FCWA 3MM6B 5ETMA 2QYCA 1YGYA 3HHNB 2RRNA 4WFZA 3WQPA 4OZLA 4KC5A 5D3GA 4PQAA 2UXBJ 2BANB 4O3RA 1YKWA 3B82A 4F4AA 5E3AA 2V4RA 2O5DA 3C3LA 4ECWA 1C0TA 1HI1A 1HQEA 2HRYA 4EZ9A 4B3OB 1S4EA 4DPXA 4PZVA 5J2NA 3KMQA 2G2OA 4CLWA 3KLEA 1T95A 1HD1A 1H73A 2YWKA 1WSVA 2DIUA 4J90A 5M2PA 1WJ9A 1FJ7A 2K8GA 4O3SA 4KHMA 2YNHA 1KONA 4RW8A 3MUVP 1S97A 1HBOB 3L09A 4OZ5A 3MPWA 3QPIA 2H4WB 3PYFA 5D6GA 1WKKA 2Y1RI 3OJSA 2WAQD 4PYAA 2Q79A 1N56A 1HBOA 1ACMB 4DR4J 4XPEA 3QIDA 3R3TA 3KLEB 2BKNA 3E51A 4QPTA 1RU2A 3ILOA 1ICEB 3FZ2A 3CCTA 1QE1B 3BSAA 3R5BA 2IA0A 5HO4A 2VBYA 4EEYA 4LFBF 1QVFR 1FRJA 1M0SA 3BYPA 1U6FA 1ZS6A 1XQIA 4P10A 2E7XA 2R4FA 5BXIA 2E1PA 3AJ1A 3LO3A 1BC6A 1MLAA 2VG6A 3T19A 1G2EA 2MTLA 2CQBA 1TL5A 5K20B 3P5TL 2ALYB 4C11A 1FRLA 4N7TA 4NLDA 1Y3JA 3RW6A 4DZDA 2V8DA 4UUXA 3VVUA 3K5MA 2ZWOA 1XMQF 4JI7J 1KFSA 4E8UA 1S1TA 2ZUAA 4FDFA 2DJWA 2LEAA 3B6BA 1HBUA 3CIZA 1H98A 3OTDA 4ZCLA 1Y4ZB 4A8OA 3K5LA 1JLAB 3KDOA 5L8RC 1E6YB 3PRDA 3MPYA 2C2MB 7FDRA 4DSEA 2MKYA 1SKWA 1M1KT 1RT6A 5AE1A 3BO2A 1ZBTA 3O5TB 2HS0A 1SUQA 4LFCF 2CA9A 3NLCA 4TQRA 1E6VA 2OPQB 4WJBA 3Q24A 1SKSA 3L95X 3MFIA 1NHUA 2B43A 3SQOP 3L4BC 4C3MA 1X5SA 3K2YA 3MF5A 3ZC4A 3OTOJ 4ZVFA 2DNQA 4DPUA 5DM7Q 1SJ4P 1U0HB 3KJNB 4NRTA 5CCLA 3A4TA 4LSLA 2XHCA 2VA2A 3Q86A 4USHA 2YVSA 2H4YB 1Q1KA 2H5JB 2PA3A 3H5UA 4I6WA 5K14B 4F3MA 1FHTA 3IGNA 4CZCA 1VBXA 4K50A 2GIRA 2JVOA 1UCNA 2P6TA 1UW9A 2YTCA 4WFBQ 4UUWA 1H7XA 1KDNA 2H5EA 5HP1A 3AB2B 4H4OB 1ZA2B 3DRSB 1BE4A 4A48A 3DN9A 5AE2A 1EX8A 3MEEA 3E2EA 3ZZZA 1L3VA 1YBUA 5HP1B 4DR3F 3RTVA 2MKSA 2QSFA 3FBEA 4A46A 3HFVA 4Y0FA 2ZHBA 4J9QA 2EG2A 2GIQA 4RUBA 3ZZPA 3CCVS 2UXBF 2GFFA 3PW2A 4QIGA 3DLGB 4N77A 1VYAA 3TZWA 3DRSA 1TUGB 3MURP 3IRXB 5FLXU 1S6QA 2ZH4A 2KT2A 2FJEB 5E0OA 1HI8A 2QLFB 3PXGa 3RBZA 2HFSA 2HHHJ 4ZVRB 4E0DA 3EDRB 2DGTA 2YWEA 1IKVA 2DKOB 3AAWB 4OI6A 4Y2KA 4DL4A 3MAHA 1HFEL 2HK2A 4PXCA 1CEZA 2BKOA 1KQKA 4OI0A 4MFBB 1HI0P 2LVWA 4DLGA 1NPRA 5ADZA 4QIEA 3CCMS 2OGUA 1TQLA 2RAQA 2BV3A 3DMJB 2Z0GA 1B70B 3TYTA 3ZZOA 2MQQA 2ERRA 1YBAA 2H54B 3OL6A 1SQFA 4FXWA 4CCHA 2EXUA 3DOLA 1JLGA 5KFEA 4FZVA 2QRRA 4NEYA 2ZUGA 2Y8YA 4DR2J 2MQPA 3QJJA 3FFIB 2PN6A 1KN6A 2W9CA 1HARA 4WU3A 1SJ1A 3W63A 4ECZA 3OSPA 1RYSA 2IC3B 2MKCA 3P5BP 3I0SA 2HFUA 2XMKA 4WCEQ 2R7SA 2V2QA 1RT2B 3MAAB 4JI0J 1YTYA 1HBNA 2X1BA 2VPZB 1QTMA 2Z4PA 3Q8SB 2YKOA 2RE1A 2HZCA 4IOBA 4JI6J 4UY85 3MMAA 1YHQS 3HHLB 3MFHA 3KG1A 2HSEB 5C42B 1IBMJ 1NZ8A 2HNDB 2ILYA 3MR6A 1YI2S 3US5A 1FE0A 2OIHA 2E1RA 3CC2S 2IC3A 2ZWPA 4LSNA 4WZMA 4LVOP 3SFGA 1ZH5A 4PG7A 1EKRA 1YK9A 2J5AA 4KR0B 2QC3A 4S0MA 2KFZA 4FS2A 1PAUB 2LEBA 1FO1A 3CCQS 1X9MA 3NL0A 3DRYA 3QBCA 2JEIA 3DOMB 3KLGA 1FK9A 4DPTA 4RW7B 3D54A 3QWPA 3UCGA 1MWQA 4CNYA 2HIQA 2ZBQA 3ZTQA 1C0UB 5IXUA 1SC6A 4BWMA 4EI2A 2FVRA 3K57A 4HT5A 1EETA 1FDNA 1RWKB 2JH3A 2WHOA 3PNIA 4A4JA 2HIYA 3VAJA 1JJ2R 2W8KA 4QJVA 3GIKA 4CLKA 1KVJA 3FEYB 4QW9A 1EB0A 4DUZJ 2MY7A 3CVKA 1GQEA 4P75A 4YFUA 4LF8J 1RQ0A 2QTWA 2DHXA 1SIZA 1TELA 3KDNA 2FHJA 3VGVA 4WFYA 5HBMB 2JLGA 2Z2MA 4ED0A 3UN3A 2MHEA 1HNWJ 1T02A 1UPPA 2HAIA 3QO9B 2QA2A 3OVAA 3BGOP 3D6TB 2YKMA 1SL0A 3IMQJ 4DV1J 3PW5A 4X4RA 3ET6B 2CYYA 1RT6B 2RVJA 2ZM6F 1IBKF 2MPUA 5D15A 2KM8C 5KFRA 2VG5A 4ZLPA 5E2QA 1QAIA 3LP2A 5DETA 2HWTA 4K4TA 2Y0BB 3NGTA 4HACA 2CPEA 1SQEA 5D4OA 3SSRA 4ZPCA 5F8NA 1JLQA 1Q8LA 2HNZA 3CO9A 3NNHA 3I4PA 4LRAA 2MLYA 2IBKA 2B56A 3TA0A 5A8RB 4HH1A 4UZCA 2P9EA 2QLWA 4P6QA 4KO0B 1G1XA 5B0DA 5DLFA 2MY8A 1RBLA 2FJDB 3PZPA 2RMLA 2WVDA 2C3PA 3PW4A 3D5MA 3BH7B 2ZJQQ 1NKBA 1BQNA 4O44B 2IPOB 2W2OP 1RHKB 2V0NA 4I56A 2D3UA 2F9DA 4EYIB 3GIIA 2K1RB 3IS9A 3K5NA 2DGQA 5L1JA 1FESA 2I5JA 3VZHA 4AD6A 5CAAA 4CLFA 4DV3J 3CGIA 4PG5A 2G4BA 3MECB 4L3KA 3TJ8A 2ASYA 1C0TB 2KN4A 2ZBCA 1VC5A 1JX4A 4MIBA 4C48A 2YNHB 2BUNA 2GIFA 1J27A 1S6UA 2JC0A 2OLWA 3SZ2A 2XM3A 2RS8A 2V50A 4JI5F 1ZM4A 2HBZB 3I9ZA 2C2DA 2XO7A 3CCJS 1AUSL 2CZ9A 4B9SA 2B8QA 3MM8B 3TOQA 1NPPA 2EFOA 2FY8A 1GMVA 4J9LA 4ED7A 5F9LA 3HULA 1S5ZA 5KFCA 4JI2J 2ZD1B 3SFUA 2E5LF 1RAAB 1TUVA 2VU5A 4U8YA 2FJBB 1KQGB 3A8JA 1S12A 1FJCA 1X4CA 2DY1A 1HWJA 1RAOA 4NXMJ 1LWEB 2L08A 4NLYA 1NDKA 3NG8A 2RDDA 5HROB 5IQQA 3I0RB 3VAFA 3R5DA 4J9MA 5HL7Q 1VQOS 2DCUB 2VBXA 2AJFE 1LW2A 1B99A 3OTEA 1TL1B 1NJXA 2KHDA 3VCDA 3J7YU 2WONA 3SCKE 1QUVA 1TKXA 2DNYA 2J9CA 3DU5A 4NLPA 3RG6A 4CLLA 8ATCB 2L41A 1NDPA 1M5KC 2M4MA 2Y9HA 2ZH8A 1H6KX 2MZSA 4M5HA 4E98A 4IQMA 2E5GA 3VGUA 3ITHA 1HW9A 2D7SA 2UUCJ 1GMUA 3EICA 2FIUA 4KGMA 4M5MA 4W4MA 3HO1A 4ZPBA 5K8OA 1KC8T 4C0OC 2GVDA 2RDJA 1X60A 4C8YA 4EU0A 4USVA 2KKHA 4YR2A 2JX2A 2RF2B 1RZMA 2UV8A 2AEMA 2RUGA 4KB7A 4YHHF 4DU8A 3GFZA 3GJTB 4DDFA 2YNIA 4U96A 4OZ1A 2HK3A 1G3OA 4FBTA 4LF4F 3PACA 5GADI 4DX7A 4F02A 4AE5A 2RIJA 2LFVA 2W24A 2YNIB 3C6TB 4TY8A 3H20A 1HIYA 5A8KA 2YKAA 2GV1A 3TQEA 2ZHAA 1RWVB 5ETVA 1HNXJ 2E5JA 3LOUA 1IBLF 2MKHA 2AYEA 1WNEA 2B3TB 2Y3YA 2V8HA 3R5GA 3BSOA 2CADA 4F3QA 2DIVA 1PC4A 5D8HB 2B7CB 1EKSA 2OD6A 4X4SA 3RB4A 4F26A 1T3NA 5J1EA 4DR4F 1IR0A 2CPFA 2LXIA 1HHSA 3E3XA 4OJ3A 5H1SV 4J9SA 2IJNA 1Z2LA 3C6TA 4QQBA 4C8KA 2OJ3A 1TR0A 2RNEA 3TNVA 1TUWA 3VV2B 2KH9A 1SQGA 4CWBA 4DR1J 4FF3A 2C2KB 4FVMA 3RRHA 2HAFA 3H5SA 3OV7A 5HVFA 1S1WB 4USIA 2PO4A 5ETQA 4CDIA 4ZIVA 1VQ9S 1QVGR 3MM9B 5LMNF 1J5EF 4WZQA 3BN7A 2HZVA 4BS2A 2BXJA 2HVDA 3KUHA 3NGRA 3E01B 4M95A 4XTTA 3MDFA 3SSQA 1QDUB 1IKXB 4QZVB 4DUTA 3G6XA 4DCPB 5CYQB 1OJ4A 4CO5A 1JLQB 2E29A 4F4KA 1VI7A 3MR7A 4P73A 2VPWB 4M5IA 5KG1A 2BZ2A 1KLNA 3J7A1 5CYQA 4RNOA 2B4PA 4OHWA 3EGNA 2CPYA 3W62A 3RAMA 2JEFA 5F3TA 3M8SA 4PUOB 2HVIA 2CXEA 3ZFVA 1H0HB 4DU7A 3CD5A 3CSKA 3I82A 3JQKA 3HJFA 4PUOA 5DG8A 4Q8EA 4ED3A 4DFPA 1J5OA 3QQCD 1CBKA 4PCQA 1OPZA 5T14A 1DHMA 5I3QA 4DHVA 1T9YA 1FEHA 1Y00A 3POTB 2C28A 1U2RA 1NJYA 5IZHA 3VALA 3FSYA 2K7JA 4EFAC 4KKOA 1QSYA 2ATLA 4DV7J 4OI1A 4IUFA 5KFTA 3BDEA 3UW1A 2OSQA 4OJGA 2OEKA 4NI2A 1WC0A 1LWXA 2IRXA 2VJVA 1WHVA 1T7PA 3R1HA 1P1LA 2ASLA 3RU0A 1NK8A 3DDNA 2BVZA 2W7OA 1QAJA 4IR1A 3AJ2A 2UUAJ 4KH1B 2DGSA 1K44A 3CUNA 1VRTB 4IDKA 5HLFB 2WSCC 1DTQA 1F1BB 1TL7A 3TEGA 4ZKAA 3SV3A 3A12A 1YZ7A 3BB5A 4V19X 1S1VB 2DNPA 2YBVA 1DQ8A 4TYAA 4TLRA 4USTA 1RWWB 3DRPB 3HMJG 2ZH2A 1LEOA 4YOEA 1T05B 1S1VA 4KBIA 1PKUA 1WEZA 2HQIA 2ZE2B 4CO4A 2R8HA 1RAJA 1NJWA 4PYDA 4FXDA 2W2NP 3O8WA 4GKKF 1YQHA 4CM2A 3BGFA 3PKYA 3ZZTA 2F5GA 5D4LA 4NCAA 2VFVA 3IM9A 1RWNB 5B08A 5LSOA 2CFXA 1I94J 1S7HA 2PT0A 5E5NA 5IV3A 2NPFA 1BWEA 1K0TA 4X64J 3P45B 2UP1A 1EETB 5KT4A 5IWAJ 5F0WA 5F8GA 2V69A 2N4CA 4DQRA 1W7WA 2J9DE 4OMFG 4ZK7M 4PQUB 5D4PA 2LQ9A 2R7UA 3TJ9A 1RI7A 1CJUA 4QWAA 5L1KA 1S7IA 3A3NB 1XMQJ 4A8SA 4ELVA 2F8MA 4RKUC 4OV6A 4JI7F 1WELA 4OL8A 1TL4A 2AT1B 2RDIA 3W2WA 5EX3A 1HYSB 2YNFB 5KFUA 3HX9A 1Q0NA 1Q5YA 2ZBPA 1D3WA 3IWXA 4LSLB 3A8EA 3SBMA 4UQTA 3PX4A 2QL9B 4USKA 1JNZB 1DQ9A 1S72S 2KU7A 2WVFA 2QL7B 4NLQA 1VR6A 3N01A 3BPDA 1FNMA 1UZDA 3OR2A 1V3ZA 4KGVB 4KPYA 4KE5A 4XK8C 3FDSA 3TW0A 1WSRA 4F4XA 3BJYA 4B9NA 1WKJA 1Q95G 2PMHA 3QGIA 2IM0A 2UXCJ 3ISND 3G82A 5T41A 3OTOF 1B0VA 1XR6A 4F0KA 4G6VB 4KGZB 2VICA 1X4BA 3I87A 3OTBA 1IKYA 1YJ7A 2OPRA 2H9ZA 3Q8RB 3QJLA 2VBZA 4LF9J 1K0VA 2EBGA 1SC4B 3MXHP 2FJXA 1KKHA 2DGVA 2OMLA 4K4VA 3VQSA 4C8MA 2HHQA 1IWGA 1U7LA 3ADAC 1CLFA 1S6OA 1ZETA 1UVNA 3D3CJ 3DLGA 4IG0B 5ETTA 1IXKA 2G2ZA 2X1FA 3E01A 2UUBF 3S7RA 2KTQA 3ILJA 2AGPA 1NZAA 4FXVA 3CD0A 1TP7A 3PEJA 2ZD1A 1F9EB 2MHNA 2OFGX 2ZJPQ 2DRBA 4C8NA 1VQPS 3NGDA 2MQ8A 4DV1F 3C16B 4ZPAA 4CLZA 4RW6B 5KFOA 1JLGB 1U02A 2JWNA 4IH6A 4MFBA 4ZVHA 4OZ2A 4TU9A 4TLQA 1RB0A 1IN0A 3R5CA 4PPDA 3SV4A 1NH8A 4ZHRB 3D9BA 1RT1A 3H90A 1JLFB 1YSJA 3BKUA 1N34F 1B64A 1S49A 5IT9U 2ASJA 2GC8A 2B7BB 4RNHA 4ED6A 3RR8A 3QSIA 1WC6A 3ETMA 3GB0A 1X4AA 4ZIWA 3QT6A 2RILA 1V9OA 4ZVOB 3S01A 1FKOA 1X4GA 2MXYA 4I0WA 4BWJA 1DRZA 2NXNA 1HQ2A 3C16A 3RBDA 2AKWB 7FD1A 3BBFA 2WB4A 5LM7E 1F5CA 1OY8A 3D0HE 1K1SA 5KOWA 3AH6A 3MM5A 3IR5B 4ES1A 4YUDA 2RRAA 5HAOA 1Q82T 2RJZA 4DR6F 4QCLA 1EQ0A 4M5LA 4X4NA 2EK1A 2I1RA 3A8IA 2CJQA 5DGBA 4XDCA 1R6VA 2R7QA 2J8SA 3K58A 3JQJA 4JI4J 1IJEB 2CPDA 2BYCA 5J2MA 3CMQA 4Y00A 3K59A 2ADBA 2VUGA 1T9WA 4DN9A 4DL0C 4WTYA 1FKPA 4ED1A 5DG7A 1RHMB 4FYDA 1PBUA 3FEXB 3SSSA 2YWHA 3MM5B 1R8AA 2X3GA 4GC7A 4A8XA 4GVBA 2DEJA 2MQMA 3X3UA 4RU9A 3EZ5A 4B3TJ 1VRQC 2LXFA 2DVIA 3JTPA 3DDKA 1QAXA 2Z2ZA 5A8WB 4DFMA 1SPBP 4QW8A 1BMQB 1HMVB 3R6LB 4WWSA 1HPZA 2CPIA 1DLOB 2D3ZA 2G2YA 2KXHA 2N82B 4CIOA 1X9SA 1FF2A 2K3KA 2QEXS 1SCJB 3M8WA 1RCOB 1VRUA 4K4WA 1WG5A 1CS4B 3KLVA 1SJQA 5KG4A 1X5PA 3NAIA 5THWA 3W9JA 1JXEA 4DL3A 4R8UA 3OXLA 1CS4A 3NGSA 4JV2A 3IR7B 1V3SA 2HMIB 2NREA 3FRZA 1VBYA 3MGJA 2UU9F 2AJQA 4HTIA 3JS9A 2HFVA 1ZAXA 2AJ0A 4WTOB 2M70A 1NK7A 2QMXA 4DPWA 3BO4A 1WI8A 2B9XA 3M8YA 1XTZA 1R27B 3BSCA 4P2SA 4Y28C 4AT1B 2IFXA 2XEXA 3IBFB 1D8YA 3AA9A 4DSFA 4LFBJ 3UPFA 5LMNJ 5IT9Y 3SXLA 2W9BB 5EGYA 4OZNA 1JLBB 3BGLA 4HH0A 4P2FA 3TUJC 3IN5A 6FDRA 3Q2TC 1JMTA 2CPXA 2KT3A 1R3NA 1ZZFA 3DI6A 1TZ0A 5CH7B 3UFCX 4ANEA 5KFDA 2W9BA 2HHUA 4L76A 4WK3A 3N28A 5HVGA 2X1GA 4P72A 2OKQA 1U6BA 1SC3B 3EYZA 2GJFA 2HURA 3DLBA 3BR8A 1TK8A 1C2PA 4DFJA 1XMOF 1S9EA 1EJ7L 1WC4A 2HVZA 3Q2SC 3R5JB 5CZVA 4A8YA 3M2RA 3T1YF 3I31A 2IRYA 1N36F 1Y5LB 1WWHA 3MR3A 1BUXA 4NCGB 2HHXA 4NRUA 4DF4A 3J7ZT 1D9FA 1LFWA 5JVHQ 4PEOA 4JI6F 3VQTA 2F65A 4JI5J 2VG7A 1ZM2A 5CZXA 4NLSA 2FHJD 3GIJA 2AD9A 5A0YB 1TKDA 2P8IA 4YY3J 3EZOA 2CJKA 3CJSA 1F9FA 4ZPTR 3M8PA 1D9DA 1IKYB 3NGKA 1U6ZA 2OTLS 1GMWD 3M6XA 4PR6A 1U47A 4FS1A 4NOHA 4DV0F 3GJSB 2CKWA 5KFNA 1S0MA 1LK7A 1QUPA 2EFPA 3R9LA 3LUYA 3V5RA 3W65A 3RAXA 2G0JA 1NK9A 1GEHA 4DL7A 4DCOB 3V4IA 4HHUA 5HMWA 3N5FA 1H38A 1EP4B 3GIMA 3EPIA 2DRDA 2ASDA 2FB0A 3DFEA 3FQLA 2NPIA 4D3HA 1C1BA 1RHJB 1MN7A 3CT9A 3HI9A 3WIUA 3CPWR 2ZZMA 1N54B 1YG0A 2FC8A 2W2QP 3I5CA 1Q81T 4OYPA 3SMZA 2R7OA 2KXNB 3LGHA 4DQSA 4XPCA 1U45A 1VS3A 3Q89A 1G7CB 2JL9A 3AY0A 4N8OA 2XI2A 5KFQA 4FN5A 2QZ8A 3C14A 2WW8A 2DNKA 5B7WA 1VK3A 3TUIC 3PVXA 3THTA 4CH1A 1GAOA 3M32B 3SCJE 2LU1A 3M30A 1KP6A
chains in the Genus database with same CATH topology
4CYUA 2CG8A 5ETQA 3UDEA 3ILLA 3IP0A 1EQ0A 1EQMA 4M5LA 1RU2A 1EX8A 3ILOA 5ETOA 1RTZA 4CYUB 2F63A 3HD2A 3KUHA 1CBKA 5ETVA 1TMMA 1G4CA 2BMBA 3HT0A 3UDVA 4PZVA 1RB0A 4M5JA 5ETNA 3HD1A 1F9HA 3MCOA 4M5HA 5ETPA 4M5GA 1KBRA 3UD5A 1HKAA 3MCMA 1Q0NA 3HCXA 4M5MA 1TMJA 5ETRA 1RU1A 3KUEA 2F65A 3MCNA 4M5IA 3HSZA 3HSGA 3KUGA 4M5NA 3ILJA 3QBCA 5ETTA 3HSDA 5ETKA 4AD6A 1HQ2A 3ILIA 1RAOA 4CWBA 2QX0A 5ETLA 5ETMA 5ETSA 4CRJA 1IM6A 4M5KA 1DY3A 3HSJA 4F7VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CYU A;  2CG8 A;  5ETQ A;  3UDE A;  3ILL A;  3IP0 A;  1EQ0 A;  1EQM A;  4M5L A;  1RU2 A;  1EX8 A;  3ILO A;  5ETO A;  1RTZ A;  4CYU B;  2F63 A;  3HD2 A;  3KUH A;  1CBK A;  5ETV A;  1TMM A;  1G4C A;  2BMB A;  3HT0 A;  3UDV A;  4PZV A;  1RB0 A;  4M5J A;  5ETN A;  3HD1 A;  1F9H A;  3MCO A;  4M5H A;  5ETP A;  4M5G A;  1KBR A;  3UD5 A;  1HKA A;  3MCM A;  1Q0N A;  3HCX A;  4M5M A;  1TMJ A;  5ETR A;  1RU1 A;  3KUE A;  2F65 A;  3MCN A;  4M5I A;  3HSZ A;  3HSG A;  3KUG A;  4M5N A;  3ILJ A;  3QBC A;  5ETT A;  3HSD A;  5ETK A;  4AD6 A;  1HQ2 A;  3ILI A;  1RAO A;  4CWB A;  2QX0 A;  5ETL A;  5ETM A;  5ETS A;  4CRJ A;  1IM6 A;  4M5K A;  1DY3 A;  3HSJ A;  4F7V A; 
#chains in the Genus database with same CATH topology
 2YX1 A;  1MRO A;  3M6V A;  4NX9 A;  4G1P A;  4AQY F;  2POK A;  3DGP A;  2A2D A;  5AJ3 F;  3IBW A;  3T3F A;  3FRY A;  4MMO A;  1RWU A;  2W4C A;  1T94 A;  3FSX A;  3DRX A;  2CUY A;  1Q86 T;  4H4K C;  1NRK A;  5EN1 A;  1WUU A;  2GO9 A;  2NUH A;  4NWB A;  2R3V A;  4OFZ A;  2DNZ A;  3F41 A;  5E3R A;  1VQY A;  3EPG A;  3BBB A;  2VB6 A;  2U2F A;  2GVD B;  4DSJ A;  4DSL A;  5A76 A;  3M30 B;  1P27 B;  4RNM A;  4UOG A;  3RBE A;  3HHL D;  3L9Z A;  4M1K A;  3HZG A;  1F6T A;  2E7W A;  4ALZ A;  4A8M P;  1PC5 A;  4KIA A;  1E6V B;  2OPQ A;  4J9V A;  3SQG A;  3UVJ B;  4NLX A;  5DM6 Q;  2MQN A;  1TKX B;  2RKI A;  3KK3 B;  1L5U A;  4F8R A;  2CJY B;  4MAK A;  5IT4 A;  1LWF A;  4M5K A;  2XMU A;  3G2X A;  3QMQ A;  4ZA1 A;  1T3O A;  5L39 A;  3KK3 A;  4LT6 A;  4UTG A;  4ZDN A;  4CYU A;  2I0X A;  4YB1 P;  5J2P A;  1XC9 A;  4FF2 A;  2HHT A;  3OFE A;  4CLS A;  3L3C A;  1I51 B;  2OH2 A;  2ROG A;  3BM7 A;  1YJN S;  3JXO A;  2DGO A;  3W64 A;  3W5Z A;  4M8L A;  3M2U A;  2FLO A;  4K59 A;  4DPY A;  2YWG A;  2RD5 C;  3T41 A;  4M5J A;  4AL6 A;  3MCO A;  1RT4 B;  3VGS A;  2VH7 A;  2WSF C;  5BYS A;  1NK4 A;  1NB7 A;  4J9N A;  3OD2 A;  1RWP B;  2XSJ B;  4NAS A;  4IRK A;  2AEF A;  1RT4 A;  3M8Q A;  3TVK A;  4DUZ F;  4AQY J;  1OPI A;  4LBP A;  2DHS A;  1WTF A;  2CPH A;  4A47 A;  5B0E A;  4OHY A;  3M8Q B;  2L3M A;  1J2V A;  4LR7 A;  5AT1 B;  5JXS A;  2HMI A;  4ECX A;  1R89 A;  1RTI A;  2YKN A;  1M5O C;  2QLX A;  5IT0 A;  5DQH A;  4GRS A;  4U8V A;  1MU2 B;  4LQ9 A;  5C25 A;  4LF5 J;  5GMK a;  2OEJ A;  5DZ6 A;  5GMD A;  1ZPW X;  4RR5 A;  3GPA A;  3SCI E;  4WFX A;  3LWM A;  3GQC A;  1IQZ A;  1HWU A;  2ZH3 A;  1TK5 A;  4NLG A;  1S9G B;  2BM1 A;  4GC6 A;  1M1G A;  4K0K F;  3JSB A;  1VBK A;  2BW2 A;  4KAI A;  4NML A;  2WBR A;  1PGZ A;  2DY9 A;  2CZ4 A;  1RBA A;  3DI6 B;  2NSB A;  4WYL A;  4TU8 A;  3QGP A;  2SXL A;  1KQF B;  1FVQ A;  4FPR A;  3KYL A;  5IFM A;  1IKX A;  2KM8 B;  1HNZ F;  4IQX A;  3U1L A;  3X1L B;  1MWY A;  1N0U A;  5C24 A;  2XWY A;  3D1O A;  4ES3 A;  2OAU A;  3KHG A;  2F3J A;  4OI3 A;  2VQE F;  2XCP A;  3D1H A;  2K7K A;  1S9G A;  5LJ3 Y;  3CJ0 A;  3O6Q A;  1NPK A;  4KH0 B;  3UD5 A;  2WB1 D;  2PEB A;  1FWL A;  1X7V A;  3TUP A;  1R0B G;  1TV6 A;  1Z4U A;  3LW5 C;  4ZPV R;  2K3I A;  4NZ0 A;  4EWT A;  3H5Y A;  3RB0 A;  2MB0 B;  3LGM A;  1S1U A;  2HW3 A;  2FYX A;  1XIQ A;  2J0X A;  2BRK A;  3FNN A;  3RYL A;  1VIX A;  4X4T A;  1NLK L;  1SJ3 P;  1VC6 A;  4JI0 F;  2GA7 A;  4A8K A;  2UUA F;  1R8C A;  4DPO A;  2DNO A;  1HWK A;  3CCU S;  2EG1 A;  4WP8 A;  3BDP A;  1XNR J;  1FKO B;  3GR0 A;  5AE3 A;  5DQI A;  2ABY A;  2YQ3 A;  3W5Y A;  5D3G B;  5E7O B;  2AYM A;  2OI2 A;  1JLE B;  2NUU G;  1FER A;  1PYO B;  2EFV A;  5F8H A;  2NXU A;  2FPH X;  2DH8 A;  4WFN Q;  2DXF A;  4RJV A;  3CCW A;  3M9M B;  4Y2M A;  1BLU A;  1O0P A;  2WVE A;  1UW4 A;  2F4F A;  1TK0 A;  4ILM A;  2ROE A;  5BYQ A;  3NWG A;  3MR5 A;  1AYE A;  2HPU A;  2FVS A;  1NDL A;  3QIP B;  1FT8 A;  1JXL A;  2ZVI A;  3MTJ A;  1GFW B;  2HQG A;  4I2Q B;  3DLK A;  2CPJ A;  1IUJ A;  1HNZ J;  2MZT A;  4R5P B;  2X7I A;  5B0B A;  1VQN S;  4MIW A;  4X2B A;  3CD6 S;  4L73 A;  1VHF A;  2RS2 A;  4ZLN A;  3KJV A;  3D28 A;  4NCB A;  2YWW A;  5GAH I;  2QA1 A;  3N6N A;  2U1A A;  4DLE A;  4HHJ A;  5EWG A;  4QIF A;  3W8G A;  1Q5V A;  4LJM A;  1X4H A;  2WOM B;  1HWL A;  2DIS A;  1U1R A;  1S6P B;  1CJK A;  1SKU B;  4YME A;  3P6Y C;  1TL3 A;  2ZHO A;  1R7I A;  3M05 A;  3N9U C;  2X51 A;  1HPZ B;  4L75 A;  4ZLJ A;  4LF7 J;  3FSI A;  1CJK B;  4TY9 A;  1KOO A;  2HNY A;  3KKF A;  2IA6 A;  4PRF A;  2VHG A;  1LNQ A;  1P9Y A;  1V3R A;  3ILL A;  2EC0 A;  1B0T A;  1FJE B;  1LW0 B;  3VZI A;  3OLA A;  4DUY J;  2Y0S D;  1TTH B;  2LEP A;  1NEE A;  1KHV A;  2W7A A;  3W5X A;  4O3O A;  5L9N A;  2ZOF A;  3T1H J;  4ETZ A;  3PY8 A;  4HTJ A;  4I6A A;  3RR7 A;  1UJ6 A;  4H4M A;  3PFO A;  3QT8 A;  1VBZ A;  2HWI A;  2HYI B;  3R2D J;  5HBM A;  3VR1 A;  3LP2 B;  4F0M A;  5HMX A;  1JLB A;  4ZN1 A;  3OR1 B;  2P9C A;  2FVC A;  3B8H A;  5MLC V;  1UVI A;  5K8P A;  4M5G A;  4N47 A;  2EEY A;  2VG5 B;  4M63 A;  2CQP A;  5A8R A;  1SJF A;  5B0A A;  1B7F A;  1S10 A;  2DNR A;  1SI9 A;  1U0S A;  1UL3 A;  1HBM B;  2C42 A;  3KHL A;  2ZJR Q;  4DMZ A;  4AL7 A;  1XN9 A;  3TR5 A;  3DLJ A;  2VKZ G;  3GLJ A;  4TKT A;  4UF4 A;  5I3P A;  1QY7 A;  3AXM A;  2DGX A;  3U27 A;  4LQ3 A;  4DR2 F;  1YRX A;  2F7V A;  1FFG B;  3J7Z 5;  3Q0A A;  1RA7 A;  3EVO A;  5CXT A;  4HI1 A;  1FXD A;  2G13 A;  4F4Z A;  2JSX A;  1JNR B;  2L9W A;  4DR1 F;  4K4U A;  3CDA A;  2VOP A;  2VC1 A;  4NMX A;  3FJ2 A;  1O51 A;  3MM6 A;  2QFI A;  3GE9 A;  3UD3 P;  2VL1 A;  2VOO A;  3I9V 9;  3GR1 A;  2X1A A;  3MCM A;  1HNI A;  2BJ9 A;  4PKD B;  2JLE A;  2K1R A;  1U1P A;  2GS8 A;  3FCV A;  2Q43 A;  1RLD A;  2BKP A;  1ZAW A;  2GQ2 A;  4IH7 A;  4Y34 A;  2W25 A;  3AXK A;  1OY9 A;  3W2V B;  3I96 A;  4WE1 B;  1WHW A;  1GNK A;  1RA6 A;  2IY5 B;  3JTN A;  1Q4R A;  4DBQ A;  4QR0 A;  1C1B B;  4DV5 J;  2D69 A;  2OPR B;  1RTJ B;  4C8Z A;  4WE1 A;  1VDH A;  3IS9 B;  3Q83 A;  3NS6 A;  3W61 A;  4DCJ B;  4F4Y A;  3CB4 A;  3VVT A;  3EX7 B;  1HR0 J;  2UU9 J;  1JXV A;  2XY5 A;  1I1G A;  3NCP A;  4OLO A;  4YN3 B;  1Y0H A;  1IQT A;  2JC1 A;  3DM2 A;  3NY0 A;  2OUG A;  2P5V A;  3G6E S;  4NPO A;  4DJB A;  4LMZ A;  3D6M B;  1UWB A;  2GQC A;  2B5J B;  4C9D A;  2ZNY A;  1XR7 A;  2W7P A;  2M8D B;  3CDE A;  1U26 A;  1EAY C;  4C7Q A;  1VLO A;  4F3O A;  2FTR A;  3LAL A;  5IWA F;  2MMY A;  2ADC A;  2VPX B;  1KQS R;  3Q22 A;  2J9D A;  4J91 A;  4TYB A;  1FVS A;  1JLF A;  2W9A A;  3P3D A;  1U24 A;  2AMC B;  2BAB A;  3M32 A;  1Y9O A;  2DH9 A;  2BR0 A;  1F3F A;  3P4U B;  1IM4 A;  4PG6 A;  5KFX A;  5EHH A;  2J6T A;  4RW6 A;  4IG3 B;  1UMJ A;  3DMJ A;  3V6D A;  1RWO B;  2IAJ A;  4I69 A;  1NK5 A;  2RSQ A;  3I0S B;  4H54 A;  1FTC A;  4RW9 A;  2VF3 A;  4PG8 A;  3FMW A;  4Q2L A;  2V2V A;  4KQZ A;  1JKH A;  3LP0 B;  4L72 B;  4LRB A;  3T9N A;  1RT5 B;  2EI5 A;  4RW9 B;  3L7P A;  4IFV A;  1GXT A;  3BKF A;  3S6E A;  3W9H A;  3AHP A;  4LBI A;  3MMB B;  3H2U B;  3THV A;  1I6J A;  5H9E K;  2ZC3 A;  3IAM 9;  4OYA A;  3CD7 A;  2XMJ A;  2CJX B;  2D3O 1;  5A8K B;  2HFO A;  4ZP6 A;  4LSN B;  1QD1 A;  3MPD A;  1RAE B;  4LF5 F;  1HR0 F;  3CE8 A;  4DV4 J;  2H5I B;  1LFP A;  2VFS A;  1FDD A;  3HSZ A;  4RWW A;  3FKB A;  4G1Q A;  4KV8 B;  3T1A A;  2HFZ A;  4DV6 F;  2HGN A;  3GYN A;  3J81 Y;  4RU2 A;  4WU2 A;  5J2M B;  3MM7 B;  1NAQ A;  4WPA A;  1OQ3 A;  2ZIT A;  1MSW D;  4ZJQ A;  2M2B A;  1RAH B;  2BRL A;  3W7B A;  4LF6 J;  2E9R X;  4K4S A;  1X8D A;  2CQ3 A;  5D0G A;  2F8E X;  2M3D A;  1R8P A;  4DQQ A;  2M9K A;  2VIH A;  2UVW A;  2WOM A;  2FGO A;  1F2H A;  1RKI A;  2ZKU A;  3K7R A;  2B9Y A;  2M8H A;  4Y2C A;  3HM9 A;  4QYZ K;  5IM0 A;  1P1T A;  3JSM B;  5MAO A;  3DDI A;  1RUS A;  2XMV A;  3F0N A;  3T9Z A;  2J0Q D;  1I5O B;  1RIS A;  1S4F A;  4UQG A;  2DPJ A;  3GWC A;  3W3S A;  1TU0 B;  1DTT A;  1OO0 B;  3TWZ A;  4WII A;  2OEM A;  2N4D A;  3KUE A;  4F04 B;  4IOA Q;  2R42 A;  4MT1 A;  3WHI A;  4JOU A;  4OI2 A;  4X4V A;  1FCA A;  1VQ6 S;  1WOR A;  1RTI B;  1HHQ A;  4DV2 F;  1Q78 A;  3HZE A;  3WZ0 A;  1AA1 B;  4U9R A;  4CNZ A;  3V81 B;  2Y1I A;  1JIH A;  3BV8 A;  1NO8 A;  5GAH U;  4ZP7 A;  2BQU A;  4R0J A;  4JBC A;  1FXR A;  4O23 A;  2NQP A;  2QMU B;  3TAM B;  1MMN A;  3H4B A;  3PJ9 A;  1R8B A;  2ZZN A;  2OPP B;  1DFD A;  2XYG B;  4PXE A;  3N5B A;  4KHP F;  1KLM B;  1XR5 A;  3UCZ P;  2XYH B;  1R0A A;  5E3Q A;  2Q3P A;  2AX0 A;  2DHG A;  2HRT A;  4RPF A;  3M8R A;  4F2S A;  4O3Q A;  4P7T A;  2UXD F;  3HHD A;  1XNQ F;  1TKT B;  2A1B A;  4QIW D;  4KHR A;  2ILZ A;  1FA0 A;  3M2R B;  1VFJ A;  2C3U A;  1N48 A;  4YDX A;  4NCG A;  1VC0 A;  2LA4 A;  2XS2 A;  2N7Y A;  4MK9 A;  4GKJ J;  1MW7 A;  4C3K A;  2YPZ A;  2LCW A;  1OWX A;  2JHE A;  5IOL A;  2E9T A;  2QV6 A;  2ROP A;  2C2N A;  2VG7 B;  6FD1 A;  3OW2 R;  3T1Y J;  2D3O R;  4J9U E;  1JJH A;  1YJR A;  4ZCI A;  1RAG B;  2E5I A;  4E2F B;  1A6L A;  1EIY B;  1S1U B;  4B17 A;  1TKT A;  4ZJL A;  1HNI B;  3G9C A;  2HQF A;  2XWX A;  3EUN A;  1FRH A;  3IG1 A;  3IAS 9;  4CI0 B;  2IYG A;  4NXN J;  3PKM A;  2PII A;  3L7O A;  4B3T F;  3U1M A;  2CDQ A;  1N5S A;  1BD6 A;  1WOO A;  1VIO A;  4ATN A;  2R7R A;  3BQ1 A;  1FEE A;  5LL6 d;  2MKI A;  3HVT B;  2JJ4 D;  3TZZ A;  5CD4 A;  1RWX B;  2BAN A;  3DXB A;  4M5D B;  3CCR S;  1V6H A;  2QSW A;  4M5N A;  2V34 A;  3AA8 A;  4UOF A;  3KJQ B;  2I2Y A;  4CTA A;  3QT5 A;  3I5B A;  2BE2 A;  1CC8 A;  4X66 J;  1YLX A;  1NSK L;  2G9O A;  2GMH A;  3LAN A;  5LJ5 Y;  2APO A;  3TP2 A;  1SVD A;  2CG8 A;  5KTQ A;  3DLK B;  3NOC A;  2DO4 A;  2HHP A;  4NZ6 A;  4DX8 H;  5C2C A;  4ER8 A;  1XNQ J;  3P8B B;  2LKZ A;  3ZNJ 1;  2V68 A;  3UDC A;  3QLH A;  1WOS A;  3IC1 A;  4ZMM A;  4WFA Q;  2RUS A;  1VQ5 S;  1NSP A;  3T5J A;  1UEK A;  2AIR B;  2FHO B;  6AT1 B;  4IO1 A;  3C14 B;  3SDE A;  2KG0 A;  3TAR A;  2ZOG A;  2V5H G;  1WG4 A;  2BA9 A;  4C3L A;  2WSE C;  5AXM A;  1QTN B;  3TVY A;  1SB6 A;  1J5E J;  4DR3 J;  1FDB A;  2HHS A;  4DFK A;  4X4U A;  1TMJ A;  2WCX A;  2R8J A;  2VG6 B;  4BLG A;  1AUD A;  1JKH B;  3RBX A;  1HNV B;  3HHL C;  4ECY A;  4C11 B;  1UA0 A;  1PG5 B;  2HGL A;  2KDO A;  4O4G B;  1ULR A;  1VLY A;  1Y5N B;  3ETO A;  5EDW A;  5B09 A;  1P9Q C;  4ECT A;  4MKB A;  4FVC A;  3OQ2 A;  5M2U A;  3UVJ A;  1L3S A;  4C97 A;  1UVJ A;  4K5S A;  2KO1 A;  2LDI A;  2ZDO A;  2UV8 G;  3M2V B;  4H4M B;  4O4R A;  2XG8 A;  4OYI A;  5HJY A;  1U1K A;  2DTJ A;  4ELU A;  2MQL A;  3G4S S;  3QAT A;  2WZ1 A;  2XMT A;  3QYY A;  2VQF J;  1KEK A;  3OT9 A;  1IR1 A;  3CJK B;  3IXQ A;  3FEZ A;  4LRD A;  2AJ1 A;  4ANC A;  2DNM A;  1CJT A;  1Q16 B;  1TMM A;  3AFG A;  5GAG U;  3JYT A;  2ZH1 A;  1DAR A;  3BYR A;  4RO0 A;  2WVB A;  2R8K A;  2YKP A;  5ETP A;  1B4S A;  3THP A;  2D41 A;  3M9N B;  1CJV B;  2R8I A;  3CC7 S;  3ZXW A;  1UJ4 A;  3Q8Q B;  3KMS A;  2FD2 A;  3W2W B;  4HEA 9;  5KFK A;  3RAQ A;  2WBM A;  3EWG A;  5KG6 A;  3C6U A;  3W66 A;  2CVE A;  4DS5 A;  1FRX A;  2QMW A;  3NXZ A;  9ATC B;  2VDH A;  2KJV A;  3CJQ A;  3MR2 A;  2Y1J A;  4IRC A;  3DC2 A;  3C6U B;  4I4B A;  2E1C A;  3I5A A;  2HQC A;  1UJ5 A;  4CO1 A;  2QA4 G;  1QSS A;  3HT3 A;  5K14 A;  1U48 A;  4JB8 B;  3OR2 B;  4PWW A;  2JEG A;  4IFY B;  4YB7 A;  1S0V A;  2Q1L A;  2V4J B;  1WI6 A;  2IJR A;  4U95 A;  3H25 A;  3KWM A;  2GGP B;  2V4Q A;  4LUB A;  1LV5 A;  1AFJ A;  4WF9 Q;  4IFY A;  3M6W A;  3MEC A;  2UUB J;  1VQL S;  4WXW A;  5J2Q A;  4O3N A;  2KYX A;  1C4C A;  5F8L A;  1TKZ A;  3DOK A;  1L3U A;  1IBM F;  2J76 E;  1OMS A;  2QGF B;  4PAB A;  2GAG C;  3K89 A;  1O6X A;  2N3O A;  1RTH B;  1X5T A;  4CLY A;  3CCS S;  2OPS A;  1IKV B;  4ID5 A;  1V5I B;  2VJU A;  2RB7 A;  2BBE A;  3PR5 B;  2ZBR A;  3KLH B;  5L1I A;  1KVI A;  1ELO A;  1IM6 A;  3IRX A;  3LPY A;  4J7C A;  4ZVT B;  3HSJ A;  5KFG A;  5L46 A;  4QWD A;  2XCA A;  3EM1 A;  4YR0 A;  3UR0 A;  1U1N A;  1RHU B;  2EK6 A;  2X3D A;  4MIA A;  1RTZ A;  3EVM A;  3MMJ A;  3GV8 B;  2R9L A;  2MKK A;  3UQS A;  1N33 J;  3HD2 A;  1NCL A;  2Q6C A;  2OPS B;  4ID5 B;  2BJ8 A;  3HDS A;  4P2X A;  5SZT A;  2ZC4 A;  1HD0 A;  2H1Y A;  2C3M A;  3TUZ C;  3KLH A;  1JJ4 A;  1N52 B;  3BPS P;  3NOG A;  4Q0B A;  1LW2 B;  2XY7 A;  5KFV A;  2OEL A;  3C15 B;  1NK6 A;  3U7J A;  1IWA A;  2LQJ A;  3A3P B;  3HHL A;  3G6V A;  1FX4 A;  1VQ4 S;  4LF1 A;  3HXM A;  2CQ0 A;  4TXS A;  1S79 A;  1QLN A;  3ENW A;  3ONQ A;  1HBN B;  4ZVS B;  4I6Y A;  4LFA J;  4J9O A;  4NA2 A;  4DX5 A;  2IVY A;  4JI3 J;  2JFD A;  4UT4 A;  2XLK A;  2ATC B;  2GAH C;  4OIX A;  1BWV A;  3EGZ A;  3B54 A;  1CPZ A;  5EUH A;  2Q66 A;  3BBC A;  4P9S A;  1FFS B;  3G96 A;  3GYX B;  2XSF A;  2FVP A;  3FQK A;  2ZZT A;  4LR9 A;  4ZVP B;  2F63 A;  3HHK A;  4YY3 F;  3DOM A;  1F2G A;  1YX2 A;  1Z1Z A;  3RRK A;  4CTA B;  1BY9 A;  3CMA S;  5J1P A;  3J80 U;  4DR5 F;  1S9F A;  4NA1 A;  3TRG A;  2F4V J;  3TEH B;  2L48 A;  2GO8 A;  4JV5 J;  2I8E A;  3WIV A;  1HKA A;  4CO3 A;  1FJG F;  5HAN A;  5KFI A;  5KG3 A;  2HQ3 A;  2UUW A;  2M5Y A;  4DEZ A;  4I2P A;  4UZB A;  1YJW S;  3P49 B;  2HNY B;  1NND A;  1S0O A;  4RNF A;  2VFU A;  2IYI A;  5KFM A;  2P9G A;  4OYZ A;  4ED4 A;  2NZ4 A;  3JTO A;  4X4P A;  1HA1 A;  1R0C B;  2E44 A;  2QX0 A;  4X62 F;  2FHK A;  2PI5 A;  4DSK A;  1KS2 A;  5ETN A;  4Q8F A;  3GU0 A;  2CJ9 A;  3I4H X;  2CQC A;  3HJV A;  4YP3 A;  4OYO A;  2V63 A;  1WOP A;  3D67 A;  3K5P A;  4PXB A;  3OL8 A;  2EFG A;  3HVA A;  4HL9 A;  1PAE X;  2H48 B;  4RBU A;  1TL3 B;  1WC5 A;  1JLC B;  1FNO A;  2R7W A;  2EFQ A;  5DDQ C;  4OYX A;  3AOD A;  1OIA A;  4QIV A;  3S1T A;  2IM3 A;  2RRB A;  4CH7 A;  3TX8 A;  2W8L A;  5H9E J;  3BO3 A;  5LT5 A;  2ZH9 A;  1UFW A;  3KK1 A;  2M0G B;  3F44 A;  4FP9 A;  1YIJ S;  4DUY F;  1K8A T;  2AJ4 A;  3DLE A;  5AXL A;  1S1X B;  2MZJ A;  3A1Y G;  2F1F A;  4V19 J;  2YX7 A;  1KLM A;  1BGX T;  3D66 A;  3DKD A;  4HAC B;  4QWB A;  4JI1 F;  3VAM A;  3G71 S;  1Q8K A;  5LMU J;  4X65 F;  1O5J A;  4DSI A;  1TAQ A;  2MSS A;  3MPU B;  5ETS A;  2MYF A;  3BF4 A;  3M1V B;  5DJB A;  4F7V A;  4ERD A;  1YJU A;  4JI2 F;  1YWX A;  4K2J A;  2PA8 D;  3VAG A;  2C3Y A;  2YNF A;  1EQM A;  3GFH A;  4RZR A;  4KSE B;  7AT1 B;  2YH1 A;  3M1V A;  4JV5 F;  4JUZ A;  4QYZ J;  2FZK B;  3QFH A;  3ZO7 A;  1D0E A;  1RAF B;  3TVZ A;  3W1Y C;  2PFF B;  2GCF A;  2I9S A;  2XGQ A;  1HBM A;  3J81 j;  2WK4 A;  2XO6 A;  1HHT P;  4QU7 A;  2CWK A;  2AZ1 A;  1RHQ B;  4OX9 F;  1F9H A;  4O44 A;  5FII A;  4I1T A;  4NZ7 A;  3O44 A;  5C7P A;  3H59 A;  1MNE A;  3EGV A;  4URS A;  1X0P A;  4OJ1 A;  4X4O A;  1H2V Z;  5JVG Q;  3G8T A;  5BYR A;  3GCX P;  1KTQ A;  5DZ7 A;  4DL5 A;  3PJX A;  1WTB A;  1M5V C;  4N8N A;  3WC0 A;  3J7Y I;  1M90 T;  4IR9 A;  4LF6 F;  4PWD B;  1NDC A;  1U1L A;  4LIW A;  3CUL A;  4AL5 A;  3OVS A;  4LF9 F;  3KTQ A;  3EZU A;  4K4X A;  2V6A A;  3OTC A;  4KO0 A;  2R2S A;  2NS1 B;  5E33 A;  5KFY A;  4G65 A;  4QBU A;  4CT9 A;  4U6P A;  1FD8 A;  5F8I A;  2GQQ A;  2VOD A;  1GTH A;  2A6O A;  3MZI A;  3CF5 Q;  3NP5 A;  1NU4 A;  3CJR A;  4M5D A;  5A2Q Y;  2AQ4 A;  1RYR A;  3MHY A;  4L74 A;  2VQE J;  1QJH A;  5A2Q U;  1CVJ A;  2DEI A;  2BQ3 A;  4YHH J;  1TFW A;  2I38 A;  5C2G A;  1RBO B;  5A6P A;  5RUB A;  2MGZ A;  1XMB A;  3O1L A;  1REV A;  4NYP A;  4B3S J;  3DGV A;  3T5L A;  1VHI A;  4ZIT A;  4CP5 A;  1UWB B;  2B5J A;  4Y65 A;  5B0C A;  2PI4 A;  3DGP B;  1BQM A;  2BJ1 A;  3HVW A;  5ETR A;  1W2I A;  3RGI A;  2KHC A;  4P52 A;  3V6K A;  5KG0 A;  3DM2 B;  2CNN B;  1KHW A;  2O1P A;  2WW4 A;  5HRO A;  1SKR A;  2EVZ A;  2CQ2 A;  3FBC A;  1MMD A;  3UCU P;  1FD2 A;  3RB3 A;  4JYA F;  3DRP A;  4ILR A;  1T8E A;  1YRT A;  4MK8 A;  1VQK S;  4F25 A;  3GTY X;  4MKY A;  1IVZ A;  4NLR A;  2DK2 A;  2O3D A;  1NXI A;  3DOL B;  4IFV B;  5DO2 A;  2WTF A;  2EKN A;  1RAC B;  2F40 A;  2KRR A;  3I32 A;  4B9U A;  4ELT A;  4XO0 A;  3BZQ A;  1QSL A;  3QNW B;  2QJ3 A;  2NCK L;  2V8G A;  3MEG A;  4K2X A;  4LSZ B;  4URQ U;  1NK0 A;  4DQI A;  3FBF A;  3OBI A;  5FD1 A;  2KZM A;  2GVZ B;  2DXE A;  3LWL A;  3D6F B;  2ZBI A;  3PO4 A;  2V67 A;  2Z57 B;  3IRW P;  4ZVQ B;  3QRP A;  2HRU A;  3ZTP A;  5CHC B;  1Y11 A;  1NJI T;  4TY8 B;  1U8S A;  5KT3 A;  2YQ0 A;  3HKW A;  3TO8 A;  4JI4 F;  2V8V A;  2JFK A;  2KVQ E;  4U7U K;  1FRI A;  2JVR A;  4QWC A;  2CQD A;  1AT1 B;  2WON B;  1JLA A;  4J37 A;  4YEA A;  2V2Z A;  5GAG I;  3NCQ A;  4HI2 A;  3H42 A;  2JOQ A;  4Q2M A;  3UD4 P;  5J1N A;  3TAQ A;  1D8Z A;  1ZTW A;  1FI4 A;  4CLU A;  2BJ7 A;  4ZS6 A;  3C19 A;  4B3M F;  3CJK A;  5A6W A;  4W90 B;  1LWF B;  4JI8 J;  3I6P A;  5J2P B;  1TAU A;  1DLO A;  3IR6 B;  3MD3 A;  4Q5V A;  4ES2 A;  2OFH X;  1FNX H;  3TX0 A;  3MD1 A;  4G1Q B;  1C1C A;  2CJB A;  2F9J A;  2MLZ A;  4KV8 A;  4DG1 A;  2QLB B;  2VV5 A;  3PDN A;  4USU A;  5D4N A;  3LTO A;  3ENQ A;  4RW7 A;  4EK2 A;  1AZS A;  1VJQ A;  1U0H A;  5KFZ A;  4H4O A;  3EXY A;  4DG1 B;  3LA0 A;  5IM0 B;  3OUY B;  1MU2 A;  1UVK A;  3GIR A;  3MEE B;  1FX2 A;  3G82 B;  2XC9 A;  1HW8 A;  2CZV C;  5LSL A;  5CYM B;  4HYK A;  4UW2 A;  3K0J A;  3TZX A;  2KFY A;  3KLI A;  2NR0 A;  3OUY A;  4ITS A;  2J0S D;  4KPC A;  2AYG A;  3CO0 P;  2B8P A;  5J2Q B;  5ETL A;  3K17 A;  3MED A;  1Q53 A;  3RJM B;  2FJW A;  3KLF B;  2V4J A;  3PO5 A;  5L38 A;  1SL1 A;  2EC2 A;  1UEU A;  4FF1 A;  1H3D A;  1PJ5 A;  1T0T V;  2DGW A;  3MED B;  3PYD A;  3QO9 A;  2AX1 A;  3HVR A;  4EBD A;  2IRU A;  4GKJ F;  3J7A N;  3EDQ B;  1S1W A;  4G1I A;  2CRL A;  4P2M A;  1N5Y A;  1PJ7 A;  2K2P A;  4NLO A;  3ENV A;  2Z58 B;  2HVH A;  2OHD A;  1W26 A;  2OD4 A;  1N5Y B;  2KRB A;  1S48 A;  2QO3 A;  3CDU A;  3PM9 A;  2AJ2 A;  5AJ3 J;  1WHX A;  1S9E B;  1TVR B;  3DRR A;  3OFH A;  2AHO B;  2CWX A;  4ED5 A;  3AOB A;  1XMO J;  1UVL A;  1J5O B;  2AZ3 A;  1RDR A;  2VC0 A;  2NYH A;  2FY1 A;  3BS9 A;  8AT1 B;  1VIS A;  3FZB A;  5AXK A;  3POT A;  1WF0 A;  3LH2 S;  3O2I A;  1X4D A;  3UDL A;  4A8F A;  1Q7L B;  3PX6 A;  3C15 A;  4U7C A;  1PIE A;  3Q8P B;  1XNR F;  2RQM A;  1UFK A;  4ECU A;  5KT7 A;  3V6H A;  2HHV A;  5F8J A;  2JNJ A;  1H74 A;  3DYA A;  1FKA F;  2CPZ A;  2GJI A;  4N5S A;  1PJ6 A;  4OX7 A;  2ZOM A;  5HMZ A;  1F5B A;  2BMB A;  4AXI A;  4DV0 J;  1CQN A;  1HQU B;  3IG1 B;  3Q8V A;  2DH7 A;  5H9F K;  1DUR A;  2R8G A;  2OTJ S;  5T7L B;  1FRM A;  2OMO A;  4IRD A;  1M5H A;  1N5Q A;  3GON A;  3D7S B;  1FWP A;  3C2P A;  1S99 A;  1A9N B;  3ENA A;  2Z2L A;  4N41 A;  1D9A A;  5T7L A;  3D3B J;  2DNL A;  1RT2 A;  3MAA A;  2AGO A;  1U1O A;  3OL9 A;  3D1Q A;  2GML A;  3JSR A;  5H9F J;  3H0P A;  2FJA B;  2KJW A;  4EO8 A;  1PYT A;  1T05 A;  4RW8 B;  1JLE A;  4LF8 F;  4CRJ A;  4TNO A;  1HQU A;  1TFY A;  2CVI A;  4MYT A;  4CO0 A;  2KXF A;  1RHR B;  3U1N A;  4USM A;  4FYV B;  4I2P B;  4F36 A;  4GVB B;  2XS5 A;  3IWN C;  5HQ8 A;  2VA3 A;  3PHE A;  1GXU A;  2GHP A;  4I68 A;  3ZNU A;  2XLI A;  3CME S;  1UKU A;  3KJV B;  1FK9 B;  3TQ1 A;  2B6A A;  4X65 J;  3BRE A;  3HHE A;  2GJ2 A;  1T9U A;  3B4D A;  1VQS A;  3CNQ P;  3QLH B;  2HHW A;  2YXL A;  2UXC F;  2KZZ A;  5CCM A;  3OJU A;  3T6J A;  2D9P A;  4K8R A;  3OHA A;  1WDD A;  2VFT A;  3KHH A;  3DLH A;  4RUA A;  1LK5 A;  5KFA A;  3GMG A;  3MMC B;  5KT6 A;  3I55 S;  4OYM A;  1HBU B;  1GX5 A;  2DR6 A;  1DAX A;  3KUG A;  5CQG A;  3PCO B;  5KFS A;  1VMB A;  4R8U B;  1YRU A;  3FMB A;  4WYW A;  1Q79 A;  3H98 A;  4Y2I A;  3GYG A;  2BE7 D;  3AD7 C;  4OX9 J;  4JP8 A;  5K8N A;  1CJU B;  2FGC A;  4U67 Q;  3R27 A;  1RWM B;  2MEW A;  2ZH6 A;  1UVM A;  3VAH A;  3DNC A;  3PJW A;  4OQJ A;  4X84 A;  3B78 A;  2BEF A;  1RJJ A;  2JLF A;  2PGC A;  1MG7 A;  2QIF A;  3HT0 A;  4A8Q A;  3JAM Y;  4LF7 F;  5GAD U;  3M8Z A;  2EBE A;  4KGX B;  5K5M A;  4ID8 A;  1DZ5 A;  4WIQ A;  2VDI A;  1KBR A;  4YDD B;  1B3T A;  4RBT A;  2GX8 A;  3B4M A;  1Y3K A;  4K5R A;  5G4D A;  1KOH A;  1T9X A;  1UWA A;  1YBT A;  2DNG A;  4KFB A;  4NYZ A;  5C5J A;  3CCL S;  4EYH B;  1ZTT A;  5EX0 A;  1U4B A;  1RAI B;  5HSP A;  3A13 A;  2IM1 A;  3AD9 C;  3BQ2 A;  1SIW B;  2DR5 A;  2M7S A;  4NLV A;  2M52 A;  1C1C B;  1VGY A;  4HT7 A;  2FUG 9;  3MPV A;  4Z7Y A;  1DY3 A;  2J0W A;  3QGG A;  4V1A k;  4EO6 A;  3SYZ A;  3UO0 A;  1OQ6 A;  2YH0 A;  2BW7 A;  1RGV A;  2DT9 A;  1XWL A;  5D77 A;  3RUB L;  4Q44 A;  1N5V A;  3H8Y A;  3NNC A;  4F50 A;  2YKN B;  2HBQ B;  2I6W A;  3GG0 A;  1UPM B;  5FDL B;  4EGL A;  3J81 U;  1WAC A;  4ZVU B;  3FCH A;  1S76 D;  2AYB A;  2A18 A;  4ZP8 A;  2E66 A;  1SV5 A;  1K9M T;  1RE1 B;  4XIU A;  4ETX A;  2GGP A;  1CC7 A;  1NSQ A;  5FDL A;  1L3T A;  4B02 A;  4AFF A;  3JSY A;  1NKC A;  4J9R A;  1BXN A;  4FF4 A;  5FJ4 A;  2CQG A;  1G6B A;  2A10 A;  1N8R T;  2YPY A;  1AFI A;  1B0P A;  1NM2 A;  3CW2 C;  3GV5 B;  4A8W A;  5I3U A;  3K5O A;  3R97 A;  5IQ6 A;  3QWU A;  1F60 B;  5IC4 B;  2MGZ B;  1ZA1 B;  3GSI A;  3OLB A;  3SI8 A;  3LAK A;  3AT1 B;  4GVL A;  4W92 B;  2IBO A;  3H4D A;  1UA1 A;  3FUY A;  4ZHR A;  2JDJ A;  1U49 A;  3KK2 B;  1RAB B;  1S6Q B;  2XMA A;  1SC1 B;  3BSN A;  1R8H A;  4CM0 A;  3BGU A;  1BQM B;  3OVB A;  2FHM A;  1NB2 A;  5BR8 F;  3F56 A;  4KYZ A;  4USW A;  5D0E A;  5HMY A;  5LXR A;  3CC4 S;  4RLE A;  2DBB A;  4R0E A;  4LBH A;  5I42 B;  4JI3 F;  5C24 B;  3DHX A;  4AUK A;  5DQG A;  2E5L J;  1F3V A;  1YIT S;  2COL A;  4DV5 F;  3RW7 A;  2RQK A;  1WC3 A;  5HQL A;  3NKY A;  4F0H A;  2B9E A;  3QAU A;  1TV6 B;  1IBC B;  4P7V A;  2UVV A;  1BQX A;  4ZP9 A;  1N88 A;  4NE9 C;  3OL7 A;  1UAW A;  2R2U A;  2B4O A;  2AW0 A;  3EVW A;  1N32 J;  2BJD A;  4KHP J;  2VKR A;  4QOT A;  1C4A A;  1VJW A;  2MJU A;  3M6U A;  2F4V F;  2W9C B;  2HBY B;  1HL6 A;  4NL5 A;  3LGN A;  4JV1 A;  3LP0 A;  4H4K A;  1T9V A;  4ECV A;  1S0N A;  1LWC B;  1WEX A;  4C6A A;  1RT5 A;  1A7G E;  2DHH A;  3AOA A;  4RBV A;  3UDE A;  2HND A;  3G6Y A;  1ZAV A;  3CJ3 A;  2CNL B;  5DRK A;  1WDT A;  3NBP B;  4DV4 F;  4C8O A;  3ICL A;  2Y1L B;  5EWF A;  2ZDP A;  1S77 D;  3H40 A;  4HDG A;  2J6U A;  3I56 S;  3GZ7 A;  4HHH A;  5HJX A;  3NS5 A;  3UNG C;  1I3O B;  2P6S A;  5KG5 A;  5AXN A;  4EUV A;  3NWR A;  5KT2 A;  1Q7Y T;  4R25 A;  2E9Z A;  2XZW A;  3UNY A;  2RHQ B;  5E3C A;  2V8P A;  5D0H A;  5IV4 A;  3NRB A;  3R2C J;  2A6M A;  1LKZ A;  4IOC Q;  3TAP A;  1KD1 T;  2KG1 A;  3C8Y A;  2UZA A;  5KFL A;  5KAK A;  2VQF F;  3CCZ A;  1N0V C;  2RHS B;  3PRB A;  2KI2 A;  5G0R B;  3J80 Y;  1KNZ A;  2LP4 A;  2NSC A;  5HI7 A;  2OO4 A;  3D68 A;  1RTD A;  2FVQ A;  4B9T A;  1YDL A;  2BQR A;  2XSJ A;  2VBW A;  4Z7C A;  1FJG J;  2K06 A;  1HWI A;  3WX4 A;  4EMD A;  5DDR C;  1HMV A;  3U02 A;  1XEZ A;  1VQM S;  2MST A;  1LW0 A;  2WRM A;  4URG A;  1C0U A;  2IJF A;  3TAN A;  4Y3C A;  2QT7 A;  3BN4 A;  1AZS B;  4UOC A;  5B0F A;  4MKV A;  3D0G E;  5KFJ A;  3V6J A;  1QAY A;  1F5A A;  4K4Y A;  3AB4 B;  3KLG B;  1WEY A;  2DCL A;  2W2P P;  2YKM B;  4G3I A;  2C2R A;  4UOH A;  1JLC A;  3T1H F;  4HLB A;  4EBE A;  1RTD B;  2BOP A;  5B0G A;  4QPX A;  2QE5 A;  4LFC J;  2R7X A;  3D0I E;  5GME A;  1WHY A;  4ECR A;  2AWZ A;  2V9W A;  1CUL A;  1RK8 A;  3GSD A;  1Z2Z A;  5IC6 B;  5E41 A;  3GJQ B;  4Q43 A;  3NGU A;  2BM0 A;  3HF5 A;  1VQ8 S;  4OYB A;  3BKT A;  2DO0 A;  2HBR B;  5KT5 A;  1R31 A;  3TAM A;  2A2C A;  1RT3 A;  2NLW A;  3V2U C;  3N79 A;  4CLT A;  1EAR A;  5D78 A;  2JRS A;  4YB5 A;  3NMA A;  1KSP A;  3T5H A;  3CJ2 A;  1PIL A;  1U25 A;  3IWL A;  4OLP A;  1D09 B;  5LXY A;  1CQM A;  3S8S A;  4P74 A;  4C0H A;  2HNZ B;  4OX6 A;  1WC1 A;  1FWK A;  3DLL Q;  2CAJ A;  2Q6B A;  4PWU A;  2QL5 B;  1FFW B;  3R7S B;  1U09 A;  1P8G A;  3N4W A;  3O3L A;  4LFA F;  3DCA A;  3CDB A;  2CIM A;  1URN A;  1PCA A;  2CQ4 A;  1LXJ A;  2C22 A;  4B3R J;  4RNN A;  4PWD A;  2DYA A;  3GV7 B;  2BDP A;  2W4P A;  4USJ C;  2IM2 A;  1ZOT A;  2FZG B;  3MTK A;  4B9V A;  2AF6 A;  2GHV C;  1BHN A;  1ROF A;  2XYP B;  1NUE A;  1OYE A;  2XHW A;  5I4M A;  4M94 A;  2R7V A;  3PV8 A;  1GXL A;  2QYG A;  4ZPD A;  4J5O A;  5HAT A;  1N6Q A;  1GT8 A;  3ILI A;  3JQM A;  2C2O B;  2C3O A;  4ENO A;  5DLG A;  4UY8 T;  1F0X A;  2FLP A;  4B9M A;  9RUB A;  2IIH A;  4AND A;  4BCA A;  4DR5 J;  2HS4 A;  3UN2 A;  1HQE B;  4I64 A;  1NME B;  2G1D A;  4OZ3 A;  5ETO A;  4GKK J;  3UR3 C;  1BQN B;  2W01 A;  2XZD B;  4JYA J;  5F9N A;  4DI6 A;  3WBZ A;  3W2V A;  4ED8 A;  1ZPV A;  2PEH A;  5A0Y A;  1IR2 A;  4IG0 A;  2J6S A;  5DGA A;  2I5J B;  5DDP C;  3M8P B;  2GW8 A;  3HFK A;  2XQC A;  3V4I B;  2AU0 A;  4DX6 A;  3MAQ A;  1UP1 A;  2V2K A;  3KG4 A;  2E1A A;  1D1U A;  2B9W A;  4I67 A;  2MLX A;  1OY6 A;  2XY6 A;  1QE1 A;  3EMT A;  3W60 A;  2YY3 A;  2B4U A;  4LR8 A;  5BJR A;  1LWE A;  3GIL A;  5KFW A;  3HVT A;  3PEH A;  4OX8 A;  2DR9 A;  1MN9 A;  3I0R A;  3LPE A;  5DS7 A;  4ZOS A;  2EFN A;  2GHW A;  5CAB A;  4X4Q A;  1H7W A;  2B4V A;  2D74 B;  4TQS A;  2EW9 A;  1JK9 B;  1TL7 B;  1DTQ B;  4CO2 A;  1GH8 A;  3DU6 A;  3F73 A;  4WK1 A;  2NXJ A;  3IA0 A;  1N36 J;  4WKR A;  2ZEJ A;  2ACM A;  1X4F A;  2UUT A;  3BH6 B;  4LF2 A;  3VTI A;  2HQD A;  1JB0 C;  2D1C A;  3SDE B;  1MRO B;  2OP5 A;  2ZE2 A;  2R2R A;  2ZFH A;  3ITH B;  4L6V 3;  2DB1 A;  2JEJ A;  4MJK A;  2XLJ A;  4Y6I A;  4X66 F;  1W25 A;  3QSY B;  2KFN A;  1E6Y A;  3MMC A;  4PPZ A;  3TA2 A;  4QYR A;  3FVY A;  1HNV A;  1LWC A;  1KR4 A;  2XI3 A;  1T03 A;  1SUQ B;  1L3K A;  1S1T B;  1LXN A;  3N6L A;  2XGP A;  1RLC L;  3AOC A;  1UFL A;  1IBL J;  3QT7 A;  3JYT B;  1RKJ A;  2O67 A;  4DR7 J;  5ETK A;  3MEG B;  2KYZ A;  1CSJ A;  3L7U A;  1YJV A;  4MTP A;  3ZZ0 A;  2C2E A;  2KVI A;  2YX4 A;  2QN6 B;  4K4Z A;  2HG4 A;  1N4L A;  1LOU A;  2DR8 A;  3K8V A;  4QR2 A;  3IP0 A;  2HLU A;  4DWI A;  4RX6 A;  2RQ4 A;  4RUH A;  4FKY A;  2QFJ A;  4DV6 J;  1T03 B;  1SH2 A;  2HLT A;  4CYU B;  2LQ5 A;  2L9N A;  2DRA A;  2WVC A;  3PIP Q;  2A0F B;  2J7U A;  3GFX A;  3R5A A;  3PTW A;  1HYS A;  2RF2 A;  2LDY A;  1S57 A;  2RKI B;  1LQ9 A;  1APS A;  3HD1 A;  4ICL A;  2DGU A;  3A3O B;  1ZM3 A;  1WD6 A;  3CJ8 A;  4KY3 A;  4YS2 A;  3GFY A;  1FTR A;  1KFD A;  1RT7 B;  1UZH A;  2OSR A;  2PD1 A;  4W98 A;  3WX8 A;  3FGV A;  3MWB A;  3SEO A;  4NXN F;  4LF4 J;  3HP6 A;  2XB2 D;  1VRU B;  2MZR A;  1CJV A;  4HDH A;  4HR2 A;  1DTT B;  1DJ0 A;  1OS5 A;  4PG4 A;  4WKY A;  2VFR A;  1YJT A;  2LMI A;  1XER A;  3M7V A;  4KRW A;  3IGV A;  3IO1 A;  4CT8 A;  3JSM A;  3OFF A;  4C2M A;  3MM9 A;  4ILL A;  1PBA A;  2HFN A;  4GO5 X;  4J9K A;  4PAA A;  3CJ5 A;  2V9K A;  2YWF A;  5J1E B;  4JI1 J;  4NYO A;  4DOZ A;  5CYM A;  2IHR 1;  2VD3 A;  3HLU A;  4Y2A A;  4JV0 A;  2MZQ A;  3KNG A;  5FLX Y;  2ZH7 A;  1B7Y B;  2BOA A;  4RWX A;  2HHH F;  4QR1 A;  2XBP A;  3KK2 A;  2JZ5 A;  2OPP A;  2XUL A;  4N56 A;  1I94 F;  3MOJ B;  3KHR A;  2C2Z B;  4OZ0 A;  1NHV A;  2EPI A;  3ISZ A;  4RW4 A;  5F3Z A;  2YNG B;  1RTH A;  1RT3 B;  3EE3 A;  3HCX A;  3VF0 B;  4Z37 A;  1CG2 A;  3JB9 k;  3IBC B;  3MUT P;  4HKQ A;  1ARO P;  4KJI A;  2CQ1 A;  3CJT A;  1TKZ B;  3DOK B;  2J7W A;  3H2L A;  3Q8Y A;  5BR8 J;  3PR4 A;  1ZYQ A;  1VK8 A;  2O01 C;  2FC9 A;  4AYB D;  3DXS X;  4DL2 A;  2HWH A;  3M4X A;  4NEZ A;  5D0R A;  4F67 A;  4QWE A;  2IMW P;  3NNA A;  2Z2Y B;  3CTR A;  3V4M A;  4IH5 A;  3PFE A;  4C0B A;  3UN5 A;  4MH8 A;  2YNG A;  4LIR A;  4MYU A;  5K8M A;  1H2U X;  2ZM6 J;  4ZVG A;  1NH7 A;  2BX6 A;  3RRG A;  3WC2 A;  4B9L A;  5LMU F;  2VON A;  1GMW A;  1SH3 A;  3QAE A;  4U7U D;  2ZH5 A;  4IG3 A;  4ZJO A;  3UDV A;  2PFD A;  4C4W A;  1S59 A;  2PMW A;  3UE2 A;  1REG X;  3A8K A;  2GMJ A;  1WF2 A;  2IVM A;  1DBD A;  2BE9 B;  3KFW X;  1FXL A;  4MKA A;  2HZA A;  3MMA B;  1PSD A;  3NBP A;  4WP3 A;  4EZ6 A;  2HS3 A;  2CG4 A;  5F8M A;  3ELH A;  2Z30 B;  3W9I A;  5M2R A;  3NCR A;  5HVH A;  4C8L A;  4ZPW R;  4R5P A;  1N33 F;  1IKW B;  1HNX F;  1RAD B;  3CWJ A;  3N0V A;  2N7C A;  2IDE A;  3FFI A;  3QFW A;  5DG9 A;  4EBC A;  3PHT A;  4ECS A;  5HLF A;  3QIP A;  2DR7 A;  3NS7 B;  4D3G A;  1P6T A;  4O3P A;  3R1L A;  4KTQ A;  3KOA A;  4FNH A;  2FJV A;  5C42 A;  3HFZ B;  4KT0 C;  3PRV A;  3ZZU A;  3AQP A;  4IYQ A;  4KKO B;  3PW0 A;  2HVE A;  1S6P A;  3NEK A;  4XAK A;  2XTJ P;  4DV7 F;  2C1E B;  3ISN C;  3BQ0 A;  2XMM A;  5L9X A;  3FK4 A;  2A3J A;  5U47 A;  3D6H B;  1FKP B;  1VRT A;  2NXC A;  4NA3 A;  4NI2 B;  3D4J A;  3T5K A;  1G4C A;  1SXL A;  2V94 A;  3AD8 C;  1SH0 A;  2CDR B;  3AQO A;  3ZZY A;  1U1Q A;  1YZ6 A;  4I2Q A;  4CH0 S;  1U1M A;  4FYW B;  2Z56 B;  4WP9 A;  4LRE A;  3QRR A;  1MML A;  2MJN A;  1IJF B;  1JJC B;  4Z2X A;  1GX6 A;  4TVA B;  3KJF B;  1DQA A;  4IDK B;  4RUC A;  4B3M J;  1RCX B;  2M88 A;  4YQW A;  2RU3 A;  4ED2 A;  4WXO A;  4CLP A;  1FDA A;  4BBY A;  1HLW A;  1OYD A;  2DIT A;  3OSN A;  4IO9 Q;  1T9T A;  1YJ9 S;  5L1L A;  1M5P C;  3R7B B;  1RP5 A;  3EXC X;  3QZ7 A;  1EHW A;  2B6A B;  3G86 A;  4ZVE A;  2AV5 A;  2QA4 S;  3PYE A;  4PQU A;  2CNK B;  3BR9 A;  5F41 A;  3RB6 A;  1S1X A;  3TI0 A;  1JWW A;  3LF0 A;  1UTA A;  3EJM A;  5F0U A;  2RQC A;  2E5H A;  2HGM A;  3PG9 A;  1U2F A;  2Z8Q A;  4FYY B;  1VQ7 S;  2J7K A;  2RH3 A;  3V81 A;  3ZTR A;  2LEC A;  1XBW A;  3H5X A;  2VAS A;  4KFB B;  4P71 A;  5JJB A;  2FDN A;  4X64 F;  1RSC A;  1CUL B;  5E3P A;  3OPK A;  2O66 A;  1SBR A;  5HQM A;  3M2V A;  5ITH A;  4O0N A;  1SJR A;  5EWE A;  3JAM U;  3MCN A;  2UVR A;  4I7F A;  1AW0 A;  1URR A;  1AB8 A;  1Y5I B;  2E1M C;  3ULH A;  2LQ8 A;  3ET6 A;  1CJT B;  1OSC A;  4I7F B;  4AXJ A;  5CYJ A;  4DF8 A;  2XMW A;  4DQP A;  2MZ1 A;  1HNW F;  3IM8 A;  4J9P A;  2PMZ D;  2UVU A;  1RT7 A;  4XDD A;  4LRF A;  4OJH A;  4NLU A;  3CED A;  4IKA A;  1V5V A;  1N6Q B;  4DV3 F;  3EGW B;  3SCL E;  3HPO A;  1RTJ A;  3PX0 A;  4ZCM A;  2LU2 A;  4OI4 A;  2BJE A;  1GTE A;  4O0I A;  2FZC B;  3PIO Q;  5SUH A;  5I3U B;  4DXL A;  3ZZR A;  2PDA A;  2MQO A;  4RL1 A;  4NLT A;  1RU1 A;  2ALZ A;  5C25 B;  1JQG A;  3Q8U A;  1EP4 A;  1A0O B;  5KFP A;  3OXG A;  2H65 B;  5KG2 A;  3E8O A;  3W8P A;  2LQB A;  5J2N B;  4FNI A;  4DZ6 A;  4B3S F;  3MM8 A;  5LSR A;  3VAK A;  2RU9 A;  1SV5 B;  3FBB A;  1N34 J;  5LOQ A;  3CJ4 A;  4OZJ A;  2LXU A;  3VAI A;  3C46 A;  1X9W A;  2IMO A;  3H7H B;  1N5T A;  3BGR A;  4L3N A;  4RW4 B;  2B0G A;  2QG9 B;  4ECQ A;  4NLW A;  1KVK A;  1ZZN A;  3IFE A;  1REV B;  5CD4 H;  3QRQ A;  2HEK A;  4GO7 X;  3BGR B;  1X0F A;  4ZCK A;  1K73 T;  2H51 B;  4X62 J;  1XJW B;  1MWZ A;  1RT1 B;  2W4D A;  1M1H A;  2BE2 B;  3VHQ A;  4NXM F;  4DR7 F;  2R2T A;  2NXE A;  3V6D B;  3TZY A;  2J9E A;  3CIM A;  3PYG A;  2B51 A;  4YR3 A;  2IVF B;  4OYW A;  1H72 C;  2F8H A;  4Q7A A;  2PSZ A;  4PXD A;  3UWT A;  2KT5 A;  4Q0B B;  2FQQ B;  4OHX A;  2DNH A;  2YQ1 A;  5KFF A;  3QZ8 A;  1VOM A;  2E7V A;  3LP1 B;  2KB2 A;  2DPI A;  3ZTS A;  1KTV A;  2LYV A;  5I42 A;  2CJA A;  3R6G B;  2DD8 S;  5GVQ A;  1H2T Z;  1TL1 A;  2L9D A;  1VCT A;  2BJ3 A;  2LA6 A;  4GMK A;  5HK4 A;  1YVF A;  3MOZ A;  4OHZ A;  2ZKT A;  3VGT A;  3ZTO A;  2AGQ A;  2VZ9 A;  1RXO B;  1UET A;  2PE8 A;  3GP9 A;  2N3L A;  1XK8 A;  2AEJ A;  2XS7 A;  4OV1 A;  1K47 A;  3FC9 A;  4BHQ A;  4B3R F;  2GVZ A;  4DV2 J;  1N32 F;  1R6Y A;  4O4G A;  3WDO A;  4ZLL A;  4DL6 A;  4Q45 A;  3OXF A;  4BDP A;  3TJA A;  2PC6 A;  1OSD A;  3LP1 A;  3MM7 A;  4LVN P;  1IKW A;  3P96 A;  4WBF A;  2EKY A;  5HN0 A;  4N76 A;  1W2B R;  3T6B A;  3HKZ D;  1Y7P A;  5KFH A;  1U8W A;  2RT3 A;  2IAJ B;  3DHW C;  3LAM A;  3SQG B;  1Q8I A;  3TA1 A;  2J8A A;  3VWS A;  5KOX A;  3OHB A;  1ITP A;  3G8S A;  1WG1 A;  5G0R A;  1WKL A;  2P2C B;  5K9F A;  3KNA A;  2MKJ A;  3BEG B;  2NYI A;  3HSD A;  4C98 A;  3HK2 A;  1R43 A;  4MK7 A;  2UXD J;  4ICL B;  3LQV A;  3MMB A;  4F2R A;  2R7T A;  5GAE I;  1NHK L;  2DNN A;  2HKE A;  3OFG A;  4KGK A;  3Q23 A;  2CQI A;  1ZM9 A;  2NZC A;  5A8W A;  3M2U B;  3QJP A;  2GZO A;  3G8Q A;  2MDA A;  3KG0 A;  3MI7 X;  2ZVS A;  3H2V E;  3M9O B;  1KRP A;  2BAC A;  1NBE B;  2D9O A;  2G0C A;  3CDW A;  1FE4 A;  2YKQ A;  3KXD A;  3N6M A;  4FPI A;  3MCS A;  8RUC A;  3KLF A;  1NJZ A;  5JUM A;  1PO6 A;  2XNR A;  2CNO B;  3G87 A;  3KLI B;  1SL2 A;  4FYX B;  1WF1 A;  2IDL A;  1UEV A;  4JI8 F;  1X5O A;  2CQH A;  1M5S A;  3K8W A;  3KK1 B;  1T11 A;  2FLL A;  1O8B A;  3GJR B;  1NSA A;  4HVZ A;  4FBU A;  3R8Y A;  1KWM A;  3GG1 A;  3MUM P;  1X4E A;  1PYS B;  1FRK A;  2G0I A;  3D2W A;  5IS2 A;  5GAE U;  2KL8 A;  2FLN A;  2DHA A;  3OR1 A;  4ZN3 A;  4K0K J;  3DRR B;  4QU6 A;  4CQ1 A;  3AJD A;  5DDO C;  1IBK J;  3CXC R;  1Y10 A;  2W1B A;  3SIP B;  2H3E B;  2XZT B;  1U2C A;  3QGH A;  4OHV A;  3R7N B;  3MEK A;  1EZZ B;  3DLE B;  3GCW P;  1K1Q A;  2ZNZ A;  4K7Q A;  4YB6 A;  2ACY A;  4B08 A;  5JMN A;  1NKE A;  2VPY B;  5KG7 A;  4LRC A;  4TU7 A;  4DS4 A;  3PW7 A;  2GNK A;  1QM9 A;  1X31 C;  3C66 A;  3CCE S;  3RZA A;  3NAH A;  3NMR A;  2EWH A;  2DXD A;  2QLJ B;  4DN0 A;  1Q8B A;  4DR6 J;  2W2M P;  2XNQ A;  5KFB A;  3DYA B;  4BC7 A;  4F4W A;  4FKX A;  4TN2 A;  1GK8 A;  1TVR A;  2LLZ A;  3HSG A;  4BC9 A;  2Y8W A;  3UI3 A;  2AP6 A;  4B3O A;  5CA5 A;  1AXQ A;  2G1H A;  1R0A B;  2UUC F;  3FCW A;  3MM6 B;  5ETM A;  2QYC A;  1YGY A;  3HHN B;  2RRN A;  4WFZ A;  3WQP A;  4OZL A;  4KC5 A;  5D3G A;  4PQA A;  2UXB J;  2BAN B;  4O3R A;  1YKW A;  3B82 A;  4F4A A;  5E3A A;  2V4R A;  2O5D A;  3C3L A;  4ECW A;  1C0T A;  1HI1 A;  1HQE A;  2HRY A;  4EZ9 A;  4B3O B;  1S4E A;  4DPX A;  4PZV A;  5J2N A;  3KMQ A;  2G2O A;  4CLW A;  3KLE A;  1T95 A;  1HD1 A;  1H73 A;  2YWK A;  1WSV A;  2DIU A;  4J90 A;  5M2P A;  1WJ9 A;  1FJ7 A;  2K8G A;  4O3S A;  4KHM A;  2YNH A;  1KON A;  4RW8 A;  3MUV P;  1S97 A;  1HBO B;  3L09 A;  4OZ5 A;  3MPW A;  3QPI A;  2H4W B;  3PYF A;  5D6G A;  1WKK A;  2Y1R I;  3OJS A;  2WAQ D;  4PYA A;  2Q79 A;  1N56 A;  1HBO A;  1ACM B;  4DR4 J;  4XPE A;  3QID A;  3R3T A;  3KLE B;  2BKN A;  3E51 A;  4QPT A;  1RU2 A;  3ILO A;  1ICE B;  3FZ2 A;  3CCT A;  1QE1 B;  3BSA A;  3R5B A;  2IA0 A;  5HO4 A;  2VBY A;  4EEY A;  4LFB F;  1QVF R;  1FRJ A;  1M0S A;  3BYP A;  1U6F A;  1ZS6 A;  1XQI A;  4P10 A;  2E7X A;  2R4F A;  5BXI A;  2E1P A;  3AJ1 A;  3LO3 A;  1BC6 A;  1MLA A;  2VG6 A;  3T19 A;  1G2E A;  2MTL A;  2CQB A;  1TL5 A;  5K20 B;  3P5T L;  2ALY B;  4C11 A;  1FRL A;  4N7T A;  4NLD A;  1Y3J A;  3RW6 A;  4DZD A;  2V8D A;  4UUX A;  3VVU A;  3K5M A;  2ZWO A;  1XMQ F;  4JI7 J;  1KFS A;  4E8U A;  1S1T A;  2ZUA A;  4FDF A;  2DJW A;  2LEA A;  3B6B A;  1HBU A;  3CIZ A;  1H98 A;  3OTD A;  4ZCL A;  1Y4Z B;  4A8O A;  3K5L A;  1JLA B;  3KDO A;  5L8R C;  1E6Y B;  3PRD A;  3MPY A;  2C2M B;  7FDR A;  4DSE A;  2MKY A;  1SKW A;  1M1K T;  1RT6 A;  5AE1 A;  3BO2 A;  1ZBT A;  3O5T B;  2HS0 A;  1SUQ A;  4LFC F;  2CA9 A;  3NLC A;  4TQR A;  1E6V A;  2OPQ B;  4WJB A;  3Q24 A;  1SKS A;  3L95 X;  3MFI A;  1NHU A;  2B43 A;  3SQO P;  3L4B C;  4C3M A;  1X5S A;  3K2Y A;  3MF5 A;  3ZC4 A;  3OTO J;  4ZVF A;  2DNQ A;  4DPU A;  5DM7 Q;  1SJ4 P;  1U0H B;  3KJN B;  4NRT A;  5CCL A;  3A4T A;  4LSL A;  2XHC A;  2VA2 A;  3Q86 A;  4USH A;  2YVS A;  2H4Y B;  1Q1K A;  2H5J B;  2PA3 A;  3H5U A;  4I6W A;  5K14 B;  4F3M A;  1FHT A;  3IGN A;  4CZC A;  1VBX A;  4K50 A;  2GIR A;  2JVO A;  1UCN A;  2P6T A;  1UW9 A;  2YTC A;  4WFB Q;  4UUW A;  1H7X A;  1KDN A;  2H5E A;  5HP1 A;  3AB2 B;  4H4O B;  1ZA2 B;  3DRS B;  1BE4 A;  4A48 A;  3DN9 A;  5AE2 A;  1EX8 A;  3MEE A;  3E2E A;  3ZZZ A;  1L3V A;  1YBU A;  5HP1 B;  4DR3 F;  3RTV A;  2MKS A;  2QSF A;  3FBE A;  4A46 A;  3HFV A;  4Y0F A;  2ZHB A;  4J9Q A;  2EG2 A;  2GIQ A;  4RUB A;  3ZZP A;  3CCV S;  2UXB F;  2GFF A;  3PW2 A;  4QIG A;  3DLG B;  4N77 A;  1VYA A;  3TZW A;  3DRS A;  1TUG B;  3MUR P;  3IRX B;  5FLX U;  1S6Q A;  2ZH4 A;  2KT2 A;  2FJE B;  5E0O A;  1HI8 A;  2QLF B;  3PXG a;  3RBZ A;  2HFS A;  2HHH J;  4ZVR B;  4E0D A;  3EDR B;  2DGT A;  2YWE A;  1IKV A;  2DKO B;  3AAW B;  4OI6 A;  4Y2K A;  4DL4 A;  3MAH A;  1HFE L;  2HK2 A;  4PXC A;  1CEZ A;  2BKO A;  1KQK A;  4OI0 A;  4MFB B;  1HI0 P;  2LVW A;  4DLG A;  1NPR A;  5ADZ A;  4QIE A;  3CCM S;  2OGU A;  1TQL A;  2RAQ A;  2BV3 A;  3DMJ B;  2Z0G A;  1B70 B;  3TYT A;  3ZZO A;  2MQQ A;  2ERR A;  1YBA A;  2H54 B;  3OL6 A;  1SQF A;  4FXW A;  4CCH A;  2EXU A;  3DOL A;  1JLG A;  5KFE A;  4FZV A;  2QRR A;  4NEY A;  2ZUG A;  2Y8Y A;  4DR2 J;  2MQP A;  3QJJ A;  3FFI B;  2PN6 A;  1KN6 A;  2W9C A;  1HAR A;  4WU3 A;  1SJ1 A;  3W63 A;  4ECZ A;  3OSP A;  1RYS A;  2IC3 B;  2MKC A;  3P5B P;  3I0S A;  2HFU A;  2XMK A;  4WCE Q;  2R7S A;  2V2Q A;  1RT2 B;  3MAA B;  4JI0 J;  1YTY A;  1HBN A;  2X1B A;  2VPZ B;  1QTM A;  2Z4P A;  3Q8S B;  2YKO A;  2RE1 A;  2HZC A;  4IOB A;  4JI6 J;  4UY8 5;  3MMA A;  1YHQ S;  3HHL B;  3MFH A;  3KG1 A;  2HSE B;  5C42 B;  1IBM J;  1NZ8 A;  2HND B;  2ILY A;  3MR6 A;  1YI2 S;  3US5 A;  1FE0 A;  2OIH A;  2E1R A;  3CC2 S;  2IC3 A;  2ZWP A;  4LSN A;  4WZM A;  4LVO P;  3SFG A;  1ZH5 A;  4PG7 A;  1EKR A;  1YK9 A;  2J5A A;  4KR0 B;  2QC3 A;  4S0M A;  2KFZ A;  4FS2 A;  1PAU B;  2LEB A;  1FO1 A;  3CCQ S;  1X9M A;  3NL0 A;  3DRY A;  3QBC A;  2JEI A;  3DOM B;  3KLG A;  1FK9 A;  4DPT A;  4RW7 B;  3D54 A;  3QWP A;  3UCG A;  1MWQ A;  4CNY A;  2HIQ A;  2ZBQ A;  3ZTQ A;  1C0U B;  5IXU A;  1SC6 A;  4BWM A;  4EI2 A;  2FVR A;  3K57 A;  4HT5 A;  1EET A;  1FDN A;  1RWK B;  2JH3 A;  2WHO A;  3PNI A;  4A4J A;  2HIY A;  3VAJ A;  1JJ2 R;  2W8K A;  4QJV A;  3GIK A;  4CLK A;  1KVJ A;  3FEY B;  4QW9 A;  1EB0 A;  4DUZ J;  2MY7 A;  3CVK A;  1GQE A;  4P75 A;  4YFU A;  4LF8 J;  1RQ0 A;  2QTW A;  2DHX A;  1SIZ A;  1TEL A;  3KDN A;  2FHJ A;  3VGV A;  4WFY A;  5HBM B;  2JLG A;  2Z2M A;  4ED0 A;  3UN3 A;  2MHE A;  1HNW J;  1T02 A;  1UPP A;  2HAI A;  3QO9 B;  2QA2 A;  3OVA A;  3BGO P;  3D6T B;  2YKM A;  1SL0 A;  3IMQ J;  4DV1 J;  3PW5 A;  4X4R A;  3ET6 B;  2CYY A;  1RT6 B;  2RVJ A;  2ZM6 F;  1IBK F;  2MPU A;  5D15 A;  2KM8 C;  5KFR A;  2VG5 A;  4ZLP A;  5E2Q A;  1QAI A;  3LP2 A;  5DET A;  2HWT A;  4K4T A;  2Y0B B;  3NGT A;  4HAC A;  2CPE A;  1SQE A;  5D4O A;  3SSR A;  4ZPC A;  5F8N A;  1JLQ A;  1Q8L A;  2HNZ A;  3CO9 A;  3NNH A;  3I4P A;  4LRA A;  2MLY A;  2IBK A;  2B56 A;  3TA0 A;  5A8R B;  4HH1 A;  4UZC A;  2P9E A;  2QLW A;  4P6Q A;  4KO0 B;  1G1X A;  5B0D A;  5DLF A;  2MY8 A;  1RBL A;  2FJD B;  3PZP A;  2RML A;  2WVD A;  2C3P A;  3PW4 A;  3D5M A;  3BH7 B;  2ZJQ Q;  1NKB A;  1BQN A;  4O44 B;  2IPO B;  2W2O P;  1RHK B;  2V0N A;  4I56 A;  2D3U A;  2F9D A;  4EYI B;  3GII A;  2K1R B;  3IS9 A;  3K5N A;  2DGQ A;  5L1J A;  1FES A;  2I5J A;  3VZH A;  4AD6 A;  5CAA A;  4CLF A;  4DV3 J;  3CGI A;  4PG5 A;  2G4B A;  3MEC B;  4L3K A;  3TJ8 A;  2ASY A;  1C0T B;  2KN4 A;  2ZBC A;  1VC5 A;  1JX4 A;  4MIB A;  4C48 A;  2YNH B;  2BUN A;  2GIF A;  1J27 A;  1S6U A;  2JC0 A;  2OLW A;  3SZ2 A;  2XM3 A;  2RS8 A;  2V50 A;  4JI5 F;  1ZM4 A;  2HBZ B;  3I9Z A;  2C2D A;  2XO7 A;  3CCJ S;  1AUS L;  2CZ9 A;  4B9S A;  2B8Q A;  3MM8 B;  3TOQ A;  1NPP A;  2EFO A;  2FY8 A;  1GMV A;  4J9L A;  4ED7 A;  5F9L A;  3HUL A;  1S5Z A;  5KFC A;  4JI2 J;  2ZD1 B;  3SFU A;  2E5L F;  1RAA B;  1TUV A;  2VU5 A;  4U8Y A;  2FJB B;  1KQG B;  3A8J A;  1S12 A;  1FJC A;  1X4C A;  2DY1 A;  1HWJ A;  1RAO A;  4NXM J;  1LWE B;  2L08 A;  4NLY A;  1NDK A;  3NG8 A;  2RDD A;  5HRO B;  5IQQ A;  3I0R B;  3VAF A;  3R5D A;  4J9M A;  5HL7 Q;  1VQO S;  2DCU B;  2VBX A;  2AJF E;  1LW2 A;  1B99 A;  3OTE A;  1TL1 B;  1NJX A;  2KHD A;  3VCD A;  3J7Y U;  2WON A;  3SCK E;  1QUV A;  1TKX A;  2DNY A;  2J9C A;  3DU5 A;  4NLP A;  3RG6 A;  4CLL A;  8ATC B;  2L41 A;  1NDP A;  1M5K C;  2M4M A;  2Y9H A;  2ZH8 A;  1H6K X;  2MZS A;  4M5H A;  4E98 A;  4IQM A;  2E5G A;  3VGU A;  3ITH A;  1HW9 A;  2D7S A;  2UUC J;  1GMU A;  3EIC A;  2FIU A;  4KGM A;  4M5M A;  4W4M A;  3HO1 A;  4ZPB A;  5K8O A;  1KC8 T;  4C0O C;  2GVD A;  2RDJ A;  1X60 A;  4C8Y A;  4EU0 A;  4USV A;  2KKH A;  4YR2 A;  2JX2 A;  2RF2 B;  1RZM A;  2UV8 A;  2AEM A;  2RUG A;  4KB7 A;  4YHH F;  4DU8 A;  3GFZ A;  3GJT B;  4DDF A;  2YNI A;  4U96 A;  4OZ1 A;  2HK3 A;  1G3O A;  4FBT A;  4LF4 F;  3PAC A;  5GAD I;  4DX7 A;  4F02 A;  4AE5 A;  2RIJ A;  2LFV A;  2W24 A;  2YNI B;  3C6T B;  4TY8 A;  3H20 A;  1HIY A;  5A8K A;  2YKA A;  2GV1 A;  3TQE A;  2ZHA A;  1RWV B;  5ETV A;  1HNX J;  2E5J A;  3LOU A;  1IBL F;  2MKH A;  2AYE A;  1WNE A;  2B3T B;  2Y3Y A;  2V8H A;  3R5G A;  3BSO A;  2CAD A;  4F3Q A;  2DIV A;  1PC4 A;  5D8H B;  2B7C B;  1EKS A;  2OD6 A;  4X4S A;  3RB4 A;  4F26 A;  1T3N A;  5J1E A;  4DR4 F;  1IR0 A;  2CPF A;  2LXI A;  1HHS A;  3E3X A;  4OJ3 A;  5H1S V;  4J9S A;  2IJN A;  1Z2L A;  3C6T A;  4QQB A;  4C8K A;  2OJ3 A;  1TR0 A;  2RNE A;  3TNV A;  1TUW A;  3VV2 B;  2KH9 A;  1SQG A;  4CWB A;  4DR1 J;  4FF3 A;  2C2K B;  4FVM A;  3RRH A;  2HAF A;  3H5S A;  3OV7 A;  5HVF A;  1S1W B;  4USI A;  2PO4 A;  5ETQ A;  4CDI A;  4ZIV A;  1VQ9 S;  1QVG R;  3MM9 B;  5LMN F;  1J5E F;  4WZQ A;  3BN7 A;  2HZV A;  4BS2 A;  2BXJ A;  2HVD A;  3KUH A;  3NGR A;  3E01 B;  4M95 A;  4XTT A;  3MDF A;  3SSQ A;  1QDU B;  1IKX B;  4QZV B;  4DUT A;  3G6X A;  4DCP B;  5CYQ B;  1OJ4 A;  4CO5 A;  1JLQ B;  2E29 A;  4F4K A;  1VI7 A;  3MR7 A;  4P73 A;  2VPW B;  4M5I A;  5KG1 A;  2BZ2 A;  1KLN A;  3J7A 1;  5CYQ A;  4RNO A;  2B4P A;  4OHW A;  3EGN A;  2CPY A;  3W62 A;  3RAM A;  2JEF A;  5F3T A;  3M8S A;  4PUO B;  2HVI A;  2CXE A;  3ZFV A;  1H0H B;  4DU7 A;  3CD5 A;  3CSK A;  3I82 A;  3JQK A;  3HJF A;  4PUO A;  5DG8 A;  4Q8E A;  4ED3 A;  4DFP A;  1J5O A;  3QQC D;  1CBK A;  4PCQ A;  1OPZ A;  5T14 A;  1DHM A;  5I3Q A;  4DHV A;  1T9Y A;  1FEH A;  1Y00 A;  3POT B;  2C28 A;  1U2R A;  1NJY A;  5IZH A;  3VAL A;  3FSY A;  2K7J A;  4EFA C;  4KKO A;  1QSY A;  2ATL A;  4DV7 J;  4OI1 A;  4IUF A;  5KFT A;  3BDE A;  3UW1 A;  2OSQ A;  4OJG A;  2OEK A;  4NI2 A;  1WC0 A;  1LWX A;  2IRX A;  2VJV A;  1WHV A;  1T7P A;  3R1H A;  1P1L A;  2ASL A;  3RU0 A;  1NK8 A;  3DDN A;  2BVZ A;  2W7O A;  1QAJ A;  4IR1 A;  3AJ2 A;  2UUA J;  4KH1 B;  2DGS A;  1K44 A;  3CUN A;  1VRT B;  4IDK A;  5HLF B;  2WSC C;  1DTQ A;  1F1B B;  1TL7 A;  3TEG A;  4ZKA A;  3SV3 A;  3A12 A;  1YZ7 A;  3BB5 A;  4V19 X;  1S1V B;  2DNP A;  2YBV A;  1DQ8 A;  4TYA A;  4TLR A;  4UST A;  1RWW B;  3DRP B;  3HMJ G;  2ZH2 A;  1LEO A;  4YOE A;  1T05 B;  1S1V A;  4KBI A;  1PKU A;  1WEZ A;  2HQI A;  2ZE2 B;  4CO4 A;  2R8H A;  1RAJ A;  1NJW A;  4PYD A;  4FXD A;  2W2N P;  3O8W A;  4GKK F;  1YQH A;  4CM2 A;  3BGF A;  3PKY A;  3ZZT A;  2F5G A;  5D4L A;  4NCA A;  2VFV A;  3IM9 A;  1RWN B;  5B08 A;  5LSO A;  2CFX A;  1I94 J;  1S7H A;  2PT0 A;  5E5N A;  5IV3 A;  2NPF A;  1BWE A;  1K0T A;  4X64 J;  3P45 B;  2UP1 A;  1EET B;  5KT4 A;  5IWA J;  5F0W A;  5F8G A;  2V69 A;  2N4C A;  4DQR A;  1W7W A;  2J9D E;  4OMF G;  4ZK7 M;  4PQU B;  5D4P A;  2LQ9 A;  2R7U A;  3TJ9 A;  1RI7 A;  1CJU A;  4QWA A;  5L1K A;  1S7I A;  3A3N B;  1XMQ J;  4A8S A;  4ELV A;  2F8M A;  4RKU C;  4OV6 A;  4JI7 F;  1WEL A;  4OL8 A;  1TL4 A;  2AT1 B;  2RDI A;  3W2W A;  5EX3 A;  1HYS B;  2YNF B;  5KFU A;  3HX9 A;  1Q0N A;  1Q5Y A;  2ZBP A;  1D3W A;  3IWX A;  4LSL B;  3A8E A;  3SBM A;  4UQT A;  3PX4 A;  2QL9 B;  4USK A;  1JNZ B;  1DQ9 A;  1S72 S;  2KU7 A;  2WVF A;  2QL7 B;  4NLQ A;  1VR6 A;  3N01 A;  3BPD A;  1FNM A;  1UZD A;  3OR2 A;  1V3Z A;  4KGV B;  4KPY A;  4KE5 A;  4XK8 C;  3FDS A;  3TW0 A;  1WSR A;  4F4X A;  3BJY A;  4B9N A;  1WKJ A;  1Q95 G;  2PMH A;  3QGI A;  2IM0 A;  2UXC J;  3ISN D;  3G82 A;  5T41 A;  3OTO F;  1B0V A;  1XR6 A;  4F0K A;  4G6V B;  4KGZ B;  2VIC A;  1X4B A;  3I87 A;  3OTB A;  1IKY A;  1YJ7 A;  2OPR A;  2H9Z A;  3Q8R B;  3QJL A;  2VBZ A;  4LF9 J;  1K0V A;  2EBG A;  1SC4 B;  3MXH P;  2FJX A;  1KKH A;  2DGV A;  2OML A;  4K4V A;  3VQS A;  4C8M A;  2HHQ A;  1IWG A;  1U7L A;  3ADA C;  1CLF A;  1S6O A;  1ZET A;  1UVN A;  3D3C J;  3DLG A;  4IG0 B;  5ETT A;  1IXK A;  2G2Z A;  2X1F A;  3E01 A;  2UUB F;  3S7R A;  2KTQ A;  3ILJ A;  2AGP A;  1NZA A;  4FXV A;  3CD0 A;  1TP7 A;  3PEJ A;  2ZD1 A;  1F9E B;  2MHN A;  2OFG X;  2ZJP Q;  2DRB A;  4C8N A;  1VQP S;  3NGD A;  2MQ8 A;  4DV1 F;  3C16 B;  4ZPA A;  4CLZ A;  4RW6 B;  5KFO A;  1JLG B;  1U02 A;  2JWN A;  4IH6 A;  4MFB A;  4ZVH A;  4OZ2 A;  4TU9 A;  4TLQ A;  1RB0 A;  1IN0 A;  3R5C A;  4PPD A;  3SV4 A;  1NH8 A;  4ZHR B;  3D9B A;  1RT1 A;  3H90 A;  1JLF B;  1YSJ A;  3BKU A;  1N34 F;  1B64 A;  1S49 A;  5IT9 U;  2ASJ A;  2GC8 A;  2B7B B;  4RNH A;  4ED6 A;  3RR8 A;  3QSI A;  1WC6 A;  3ETM A;  3GB0 A;  1X4A A;  4ZIW A;  3QT6 A;  2RIL A;  1V9O A;  4ZVO B;  3S01 A;  1FKO A;  1X4G A;  2MXY A;  4I0W A;  4BWJ A;  1DRZ A;  2NXN A;  1HQ2 A;  3C16 A;  3RBD A;  2AKW B;  7FD1 A;  3BBF A;  2WB4 A;  5LM7 E;  1F5C A;  1OY8 A;  3D0H E;  1K1S A;  5KOW A;  3AH6 A;  3MM5 A;  3IR5 B;  4ES1 A;  4YUD A;  2RRA A;  5HAO A;  1Q82 T;  2RJZ A;  4DR6 F;  4QCL A;  1EQ0 A;  4M5L A;  4X4N A;  2EK1 A;  2I1R A;  3A8I A;  2CJQ A;  5DGB A;  4XDC A;  1R6V A;  2R7Q A;  2J8S A;  3K58 A;  3JQJ A;  4JI4 J;  1IJE B;  2CPD A;  2BYC A;  5J2M A;  3CMQ A;  4Y00 A;  3K59 A;  2ADB A;  2VUG A;  1T9W A;  4DN9 A;  4DL0 C;  4WTY A;  1FKP A;  4ED1 A;  5DG7 A;  1RHM B;  4FYD A;  1PBU A;  3FEX B;  3SSS A;  2YWH A;  3MM5 B;  1R8A A;  2X3G A;  4GC7 A;  4A8X A;  4GVB A;  2DEJ A;  2MQM A;  3X3U A;  4RU9 A;  3EZ5 A;  4B3T J;  1VRQ C;  2LXF A;  2DVI A;  3JTP A;  3DDK A;  1QAX A;  2Z2Z A;  5A8W B;  4DFM A;  1SPB P;  4QW8 A;  1BMQ B;  1HMV B;  3R6L B;  4WWS A;  1HPZ A;  2CPI A;  1DLO B;  2D3Z A;  2G2Y A;  2KXH A;  2N82 B;  4CIO A;  1X9S A;  1FF2 A;  2K3K A;  2QEX S;  1SCJ B;  3M8W A;  1RCO B;  1VRU A;  4K4W A;  1WG5 A;  1CS4 B;  3KLV A;  1SJQ A;  5KG4 A;  1X5P A;  3NAI A;  5THW A;  3W9J A;  1JXE A;  4DL3 A;  4R8U A;  3OXL A;  1CS4 A;  3NGS A;  4JV2 A;  3IR7 B;  1V3S A;  2HMI B;  2NRE A;  3FRZ A;  1VBY A;  3MGJ A;  2UU9 F;  2AJQ A;  4HTI A;  3JS9 A;  2HFV A;  1ZAX A;  2AJ0 A;  4WTO B;  2M70 A;  1NK7 A;  2QMX A;  4DPW A;  3BO4 A;  1WI8 A;  2B9X A;  3M8Y A;  1XTZ A;  1R27 B;  3BSC A;  4P2S A;  4Y28 C;  4AT1 B;  2IFX A;  2XEX A;  3IBF B;  1D8Y A;  3AA9 A;  4DSF A;  4LFB J;  3UPF A;  5LMN J;  5IT9 Y;  3SXL A;  2W9B B;  5EGY A;  4OZN A;  1JLB B;  3BGL A;  4HH0 A;  4P2F A;  3TUJ C;  3IN5 A;  6FDR A;  3Q2T C;  1JMT A;  2CPX A;  2KT3 A;  1R3N A;  1ZZF A;  3DI6 A;  1TZ0 A;  5CH7 B;  3UFC X;  4ANE A;  5KFD A;  2W9B A;  2HHU A;  4L76 A;  4WK3 A;  3N28 A;  5HVG A;  2X1G A;  4P72 A;  2OKQ A;  1U6B A;  1SC3 B;  3EYZ A;  2GJF A;  2HUR A;  3DLB A;  3BR8 A;  1TK8 A;  1C2P A;  4DFJ A;  1XMO F;  1S9E A;  1EJ7 L;  1WC4 A;  2HVZ A;  3Q2S C;  3R5J B;  5CZV A;  4A8Y A;  3M2R A;  3T1Y F;  3I31 A;  2IRY A;  1N36 F;  1Y5L B;  1WWH A;  3MR3 A;  1BUX A;  4NCG B;  2HHX A;  4NRU A;  4DF4 A;  3J7Z T;  1D9F A;  1LFW A;  5JVH Q;  4PEO A;  4JI6 F;  3VQT A;  2F65 A;  4JI5 J;  2VG7 A;  1ZM2 A;  5CZX A;  4NLS A;  2FHJ D;  3GIJ A;  2AD9 A;  5A0Y B;  1TKD A;  2P8I A;  4YY3 J;  3EZO A;  2CJK A;  3CJS A;  1F9F A;  4ZPT R;  3M8P A;  1D9D A;  1IKY B;  3NGK A;  1U6Z A;  2OTL S;  1GMW D;  3M6X A;  4PR6 A;  1U47 A;  4FS1 A;  4NOH A;  4DV0 F;  3GJS B;  2CKW A;  5KFN A;  1S0M A;  1LK7 A;  1QUP A;  2EFP A;  3R9L A;  3LUY A;  3V5R A;  3W65 A;  3RAX A;  2G0J A;  1NK9 A;  1GEH A;  4DL7 A;  4DCO B;  3V4I A;  4HHU A;  5HMW A;  3N5F A;  1H38 A;  1EP4 B;  3GIM A;  3EPI A;  2DRD A;  2ASD A;  2FB0 A;  3DFE A;  3FQL A;  2NPI A;  4D3H A;  1C1B A;  1RHJ B;  1MN7 A;  3CT9 A;  3HI9 A;  3WIU A;  3CPW R;  2ZZM A;  1N54 B;  1YG0 A;  2FC8 A;  2W2Q P;  3I5C A;  1Q81 T;  4OYP A;  3SMZ A;  2R7O A;  2KXN B;  3LGH A;  4DQS A;  4XPC A;  1U45 A;  1VS3 A;  3Q89 A;  1G7C B;  2JL9 A;  3AY0 A;  4N8O A;  2XI2 A;  5KFQ A;  4FN5 A;  2QZ8 A;  3C14 A;  2WW8 A;  2DNK A;  5B7W A;  1VK3 A;  3TUI C;  3PVX A;  3THT A;  4CH1 A;  1GAO A;  3M32 B;  3SCJ E;  2LU1 A;  3M30 A;  1KP6 A; 
#chains in the Genus database with same CATH homology
 4CYU A;  2CG8 A;  5ETQ A;  3UDE A;  3ILL A;  3IP0 A;  1EQ0 A;  1EQM A;  4M5L A;  1RU2 A;  1EX8 A;  3ILO A;  5ETO A;  1RTZ A;  4CYU B;  2F63 A;  3HD2 A;  3KUH A;  1CBK A;  5ETV A;  1TMM A;  1G4C A;  2BMB A;  3HT0 A;  3UDV A;  4PZV A;  1RB0 A;  4M5J A;  5ETN A;  3HD1 A;  1F9H A;  3MCO A;  4M5H A;  5ETP A;  4M5G A;  1KBR A;  3UD5 A;  1HKA A;  3MCM A;  1Q0N A;  3HCX A;  4M5M A;  1TMJ A;  5ETR A;  1RU1 A;  3KUE A;  2F65 A;  3MCN A;  4M5I A;  3HSZ A;  3HSG A;  3KUG A;  4M5N A;  3ILJ A;  3QBC A;  5ETT A;  3HSD A;  5ETK A;  4AD6 A;  1HQ2 A;  3ILI A;  1RAO A;  4CWB A;  2QX0 A;  5ETL A;  5ETM A;  5ETS A;  4CRJ A;  1IM6 A;  4M5K A;  1DY3 A;  3HSJ A;  4F7V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...