3CCMS

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2611u
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
81
structure length
81
Chain Sequence
b'SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L2P
molecule tags Ribosome
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 20
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ccmS00
3U1LA 1URNA 4FXVA 2O3DA 4YUDA 1D8ZA 3R1HA 4CH1A 2LA4A 3SMZA 1FO1A 3J7YU 2CPXA 2DGUA 2BZ2A 2MQMA 1VC0A 4FXWA 3TP2A 2CPYA 4LJMA 1VBZA 3HHNB 2RS8A 2KG1A 5BJRA 3CF5Q 3MUMP 2CQGA 2MKJA 2CQ1A 2YKAA 2DO4A 1U1QA 2KM8C 3UD3P 3IRWP 3MOJB 3P6YC 3G8TA 2E5HA 1HA1A 3G8SA 2DHAA 1QM9A 2MJNA 2CPIA 3U1MA 1WF2A 3CXCR 4RU2A 3G4SS 1SJFA 3P49B 2MXYA 1BY9A 2KRRA 1Q81T 2HGMA 1UW4A 1H2UX 1U6FA 3MD1A 5CA5A 1DZ5A 1WG4A 3CPWR 3SXLA 5ITHA 1Q86T 4IUFA 2EK1A 3SDEA 4QPTA 2J0SD 3NNHA 2RRBA 2DHXA 1OPIA 2LKZA 2A3JA 4QU7A 3DLLQ 1S72S 1FXLA 3R27A 2KFYA 5HL7Q 1WEZA 1Q7YT 5DDRC 4V19X 2ADCA 2YH1A 2M8HA 2CQCA 2X1BA 4UY8T 4QQBA 1WI8A 4A8XA 3VALA 1VBYA 2I2YA 2MQLA 3FEXB 3RW7A 1K9MT 1U1NA 1B7FA 2HGNA 5IM0A 5GAHU 4WCEQ 1VQPS 4IOCQ 2B0GA 5DM7Q 3UD4P 1WTBA 2LCWA 5LSOA 3V4MA 4Z2XA 1FJ7A 1SXLA 4OZ1A 1WEYA 2DGQA 3DXBA 3HI9A 2DISA 1U1KA 3VF0B 4QU6A 2MJUA 2JVRA 2RVJA 1SJ3P 2J0QD 3MDFA 1R8PA 2DH7A 3CTRA 2FC8A 5D78A 2QFJA 5JVHQ 2CPJA 2D3OR 2OSQA 2LEAA 3B4MA 2DNLA 1A7GE 3ZZZA 1JJHA 3Q2TC 2AYGA 4OZ0A 1L3KA 1YJ9S 2KXFA 2DNMA 4Y00A 5CXTA 2CPZA 3BO3A 5H1SV 3ZZYA 3CCUS 3MI7X 2BOPA 4WF9Q 2M9KA 1K8AT 2G4BA 3TO8A 2YTCA 2KI2A 4CH0S 3LPYA 1YIJS 1H2TZ 1X4FA 2KT5A 4F25A 2OTJS 2DGVA 1VC6A 3G6ES 1M5KC 3NS5A 1UAWA 4F02A 2KN4A 2U2FA 3VAJA 1KQSR 1YHQS 1VQ5S 2DHGA 2GHPA 2DB1A 5IM0B 2PE8A 2N3OA 1HD0A 5D77A 1VQMS 1DHMA 1WG1A 2LQ5A 2MZJA 1Q82T 2OJ3A 2QEXS 1U2FA 2FC9A 3Q2SC 2CPFA 2DIVA 1VBXA 3CC7S 2KYXA 2DNYA 4UQTA 3CC4S 3S7RA 1X4GA 1X5TA 1WHWA 2ERRA 3EX7B 1PGZA 2DITA 2KRBA 1DRZA 1M5OC 2N3LA 3BS9A 2N7CA 2RS2A 2MB0B 2J76E 3THPA 2XNQA 2D9PA 2AYEA 3UCUP 1KOOA 2Q79A 1NJIT 2E44A 2L08A 2X1GA 2RQ4A 1X5PA 3K0JA 2MGZA 1U1LA 2FY1A 4CIOA 1WF0A 2E5JA 5LXYA 1VQ8S 1YITS 3CCVS 3N9UC 4TU9A 1HL6A 1N54B 4WFBQ 2CQ0A 1S79A 2L9WA 4F26A 2N82B 2MZ1A 1ZH5A 3MD3A 4C4WA 4LMZA 1P1TA 2MQQA 3LQVA 2FHOB 2LXIA 2F3JA 1DBDA 2CQBA 2V94A 2MGZB 2CJKA 2PEHA 1IQTA 1FT8A 3FEYB 2DNGA 3G71S 1NO8A 3NS6A 4C7QA 5CYJA 1WHVA 1QVFR 1YJWS 2NLWA 1CVJA 3G96A 1M5VC 1YJNS 1XN9A 2NZ4A 4TU7A 1M1KT 2LEBA 1X5OA 3P3DA 2JX2A 5HO4A 1JJ4A 3NNAA 1H6KX 2U1AA 3VAKA 2YWKA 1G2EA 2UP1A 1PO6A 2X1FA 2HYIB 1F9FA 2MQPA 2MZSA 2YH0A 1VQLS 4TLQA 2MPUA 5LJ5Y 5FJ4A 2AYBA 5LSLA 1VC5A 1U1OA 5GADU 1JJ2R 1OWXA 2LMIA 2ZJPQ 5GAGU 3PIOQ 2MSTA 2VOPA 2M88A 1X4HA 2OIHA 2KG0A 3L3CA 4LIRA 2KH9A 2CQIA 1D9AA 2DNZA 4WFAQ 4PRFA 4M5DB 3CUNA 1U6BA 3BO4A 1X4BA 4PR6A 2F9DA 2CPEA 1R8HA 2CQPA 1OO0B 5IQQA 3ULHA 2DNQA 2ZJRQ 4IO9Q 5GMKa 2J8AA 4CQ1A 3CCRS 2DGTA 1YWXA 2LXUA 4EGLA 1X4DA 3CCLS 2G1DA 2DNOA 5DETA 1ZZNA 1AUDA 3IWNC 1JMTA 1YI2S 5MLCV 3VAHA 3S01A 5DM6Q 2AD9A 3NMRA 5JVGQ 2DH9A 2MY7A 1X4AA 2MMYA 2ZJQQ 1UFWA 1RKJA 2LYVA 3B4DA 4U67Q 1VQ4S 2VOOA 2RUGA 5DDOC 3G9CA 2FPHX 4J5OA 2DGXA 4ZKAA 1NU4A 2HVZA 1X0FA 2MHNA 2MKKA 3UWTA 2RT3A 3UCGA 3EGZA 2JVOA 2CQ2A 2MZRA 2KVIA 1X5SA 4ERDA 1OIAA 3H2VE 2I38A 3PIPQ 2F9JA 2RRAA 2LECA 1WHXA 2DNHA 2M7SA 4YOEA 2XS5A 3VAFA 2EK6A 2WBRA 1N8RT 1VQKS 5IFMA 2DNRA 4PKDB 1K73T 3CCJS 2KXHA 2HGLA 5DDQC 2E5GA 1KD1T 1QVGR 2MZTA 2G0CA 3THTA 3VAIA 3CCES 1FJEB 1YTYA 4BS2A 4WIIA 1RK8A 3MURP 2OTLS 2ADBA 2QA4S 3CD6S 2DHSA 4IOAQ 1ZZFA 1SJ4P 1X4EA 3UCZP 2RNEA 1WG5A 3MXHP 3NNCA 4P6QA 1WWHA 3TYTA 5DDPC 3CC2S 4W90B 3EGNA 4TU8A 2LA6A 2KM8B 2JRSA 3RW6A 1O0PA 3D2WA 3CCQS 1A9NB 3CCMS 2XS2A 5LJ3Y 2VONA 5LXRA 2KXNB 1M90T 2GO9A 2L41A 3I56S 2CQDA 2M52A 3BEGB 1WI6A 3H2UB 2M4MA 1FNXH 3BO2A 3S6EA 1X4CA 2D9OA 3MUTP 2MSSA 3I55S 1WELA 2DGWA 3SDEB 3US5A 2DH8A 3CMES 2CQHA 2DIUA 5GVQA 1WHYA 2X1AA 2CQ3A 1FJCA 1N88A 4Y0FA 3J7ZT 2XS7A 4WKRA 2M70A 1WEXA 2XNRA 4W92B 1VQ9S 4ED5A 3S8SA 2K8GA 3MUVP 2AYMA 1P27B 3UE2A 2DNKA 2XSFA 4WFNQ 3VAGA 2XB2D 2MYFA 3OW2R 1W2BR 2KHCA 1KOHA 1KC8T 2KU7A 2M8DB 1M5PC 2DNNA 2HZCA 1N52B 2MQOA 2M2BA 2CPDA 3CMAS 2RU3A 1H2VZ 2DNPA 2RQCA 1U1PA 5GAEU 2DGOA 2JWNA 3CULA 2DGSA 3JB9k 1UP1A 1WF1A 1U1RA 2CQ4A 1VQ7S 2K3KA 2DK2A 2E5IA 4C0OC 3R1LA 2MY8A 3VAMA 2SXLA 1VQOS 2DO0A 2MKHA 2MKCA 2VODA 3CCSS 2OSRA 2CPHA 2MQNA 1VQNS 1U1MA 1VQ6S 5EN1A 2MKSA 2M0GB 1SJRA 1HD1A 2MKIA 1FHTA 1SJQA 2MZQA 4YB1P 3P5TL 2EVZA
chains in the Genus database with same CATH superfamily
2J9DE 4KH0B 4KKOB 4DZDA 1Q8BA 4CI0B 2CWKA 3SV3A 2NREA 3TOQA 3DRYA 4GC6A 2O67A 3DNCA 1N5QA 4LF6J 3OHBA 2UV8A 1BXNA 3FSYA 4LRBA 1FKOB 1PBUA 2MQMA 3TARA 4XDCA 4LF5F 1VC0A 1JLQA 2VQEF 3DHWC 5D4NA 4AL5A 1S57A 2B9XA 4RW6B 3M9OB 3H5YA 4DSIA 1VBZA 1FKOA 3ONQA 1SH3A 1KFSA 2BRLA 3MTJA 4LQ9A 4WFYA 1JLQB 3KLIA 4USMA 4YB5A 1WOPA 2CIMA 2KG1A 5BJRA 2UZAA 2QLFB 4O0NA 5ETQA 1YBUA 2P5VA 2JFKA 3BQ0A 1W7WA 3T5LA 1ZTWA 2MKJA 3O2IA 2R2SA 5C24A 2YKAA 3TQEA 5EGYA 5IT4A 2DO4A 1RLCL 2P8IA 3UQSA 2FLOA 3HT3A 3H4DA 3PEHA 3PW5A 5C2CA 3M9MB 2HHWA 1N36J 4PABA 4RJVA 3IN5A 1NSKL 5AJ3F 3IRWP 1VJWA 3AJ1A 3BKTA 1CG2A 3ILJA 3HSJA 3G82A 4DDFA 1IR1A 2KZMA 1OMSA 3KDNA 1G2EA 2P9CA 4RU2A 4J9SA 1WF2A 2WRMA 3DLHA 2WW4A 3CDAA 3M2VB 4C2MA 5HLFB 1SJFA 1P9QC 4DFPA 2ZD1A 1WC1A 3TAMB 1KS2A 1BY9A 3QFHA 5KG1A 1P6TA 2QN6B 2YPZA 3CVKA 3TZWA 4ZLNA 1V3ZA 3CJ3A 1Y0HA 3GR0A 2VBWA 3N5FA 4IH5A 1F5BA 3MMJA 4ELUA 3KLIB 1S1VB 2CG4A 2EG1A 2XMVA 1HWUA 1DQ8A 4MKAA 4NA1A 1KVKA 4NXMJ 1FWLA 1DZ5A 1WG4A 1TL7B 1NK8A 1TAQA 1SC3B 2C2OB 1RXOB 1RISA 4IUFA 1IKXA 2NSBA 4DCPB 4CYUA 2VKRA 5AE1A 4GKKJ 2V50A 2B4PA 1WSVA 1HR0J 1TUGB 1ULRA 1DAXA 2FZKB 2HQ3A 2XM3A 1R6YA 1CQMA 3QJJA 1VS3A 3G82B 3ADAC 2A3JA 3DDNA 2OKQA 2C3YA 5AJ3J 1LXNA 3TANA 1NDKA 4GRSA 3MM5B 3OR1B 2XLKA 2EC2A 5B0EA 1KR4A 5HL7Q 1N36F 2KFZA 1CEZA 2J9EA 3Q0AA 2VJVA 4JI4F 3H2LA 3TAMA 2AJ0A 2HNYA 4V19X 2XMUA 3R5GA 1ZM4A 2M8HA 3TNVA 5FD1A 2VICA 4A8QA 5SUHA 1N5YA 2XBPA 2E9ZA 2AX1A 2FY8A 4L75A 3FMBA 2XULA 2Z2LA 3LP0A 5KFAA 1QUPA 3SCLE 5J2MA 4LFCJ 1G4CA 3MMBB 4XAKA 4A8OA 5C7PA 1U1NA 3CMQA 2HGNA 1YLXA 3MTKA 4WCEQ 4F2RA 3A12A 1RLDA 1BQNB 1W26A 1WDTA 3D3CJ 3NS7B 2B8QA 4FYYB 1B70B 4B9VA 1LWFB 1REVB 5KG4A 4NLDA 1N0VC 3HULA 1ITPA 3DRRB 4GO7X 3VGUA 1X0PA 4LF9J 1OSDA 5CABA 4QIGA 4I2PA 2HHHJ 1HBUA 2W7OA 3QIPA 2JHEA 3VVUA 2C28A 1I1GA 1MMLA 3BR9A 3CJ0A 1WEYA 4PG6A 5DQGA 4C8LA 2C2RA 3QGGA 1S49A 1RTJA 3I5BA 1CBKA 4QU6A 1N5YB 2JVRA 2FB0A 1B7YB 1DFDA 1IVZA 2FIUA 3AA9A 2F1FA 4DUZF 2VFTA 3ILIA 1T7PA 1YRXA 3W5YA 5KFMA 4YFUA 3MR3A 4C8KA 5KFOA 2WCXA 3TA1A 1T94A 1AB8A 2WVFA 1R8PA 3AXMA 4X66F 2FVRA 5D78A 2CZ4A 1D9DA 4J9LA 1S6QB 4EO6A 3DRRA 1MWYA 4K2JA 5JUMA 1VQMS 4QWBA 2HKEA 2NZCA 2J8SA 1VQYA 1SH2A 4M5HA 3ZZZA 2XY6A 3KK3B 4B3OA 4QR1A 3SSSA 2NR0A 3D1QA 5E3PA 4DG1B 4ZVRB 2KJVA 1L3KA 4NI2A 4OJ3A 1HQEA 2KXFA 2Q43A 2DNMA 3MCSA 4B9UA 4JYAF 2NUHA 1FRKA 1WC0A 2XYHB 5KFZA 3BO3A 4ATNA 2XZDB 4DR3F 2OUGA 4TY9A 3ZZYA 3CCUS 2G9OA 4HYKA 2BOPA 4DQPA 3DLBA 5BYRA 3PX0A 3QJPA 1V5VA 3R97A 1T03B 4J9NA 3ISZA 5L1JA 2YX7A 5JJBA 3DGPB 2KI2A 1FVQA 1BE4A 2ZBRA 4OHVA 4EK2A 2HQCA 2OD6A 3JSRA 3IMQJ 4G6VB 4UW2A 3BYPA 4ES1A 1R7IA 2VFRA 1X4FA 3QO9B 4F25A 3FSIA 4HHUA 4QYRA 5KFKA 2KFNA 5IT0A 5HMXA 4N8OA 5AXLA 3G6ES 4LF5J 3K8VA 4WP3A 3BSCA 1UAWA 4X66J 1G7CB 2KN4A 1T9WA 2E29A 2U2FA 4OZLA 4LR8A 2VIHA 4DG1A 4M1KA 3LP1A 3ZNUA 5KFPA 3HSGA 1PYOB 5E3AA 5E33A 1H38A 4CZCA 1RWUA 5T14A 1CJTB 2D3O1 1JLFA 4IFYA 1RACB 5DLGA 3MPUB 1UVIA 5IM0B 1FFSB 2PE8A 3M4XA 4OJ1A 4CTAA 4OI1A 1HD0A 1DHMA 3OPKA 2CNNB 1CJTA 2WK4A 1S1XB 1Q82T 2HHVA 2QLWA 4ZPAA 4BC7A 3VZIA 1RAGB 1S1UB 5AXMA 5D3GA 1Z4UA 4CO1A 2HWTA 2DIVA 3OSPA 3JSYA 3QO9A 2DNYA 4RW9B 5E7OB 1DTTB 2HFNA 4P2FA 3PXGa 3S7RA 9ATCB 2BM1A 1S0NA 4E2FB 2F8MA 4EMDA 5D6GA 4DL5A 3PO5A 4RW9A 4MKVA 1CC8A 2KRBA 3OJSA 4DWIA 1TU0B 2J6SA 2OPSB 2O1PA 4NCGA 1J5EJ 2N7CA 1L3TA 3THPA 1ZTTA 2IA6A 2Z8QA 3HVTA 3LH2S 2BJ8A 4U9RA 3QT5A 4DQRA 2L08A 3D3BJ 2GMHA 4NCGB 2IHR1 3QWUA 2BACA 4YY3F 3M6WA 2EFQA 2J7WA 1B7FA 3LAMA 1T0TV 1R31A 3D0IE 4X65F 5IT9U 1X5PA 3E51A 3NOGA 2MGZA 4M5GA 3ETMA 4PYAA 1U1LA 2R3VA 4A8FA 2VH7A 1F3FA 3DXSX 4W98A 4AXJA 3PY8A 5LXYA 4JV5F 4DV0J 1YITS 1Q8KA 3KJVB 3N9UC 5CD4A 1HL6A 4D3HA 5IC6B 5KFVA 3KG1A 4W90B 2CJAA 4OQJA 1JLBA 4ICLA 1WACA 4H4KC 1CS4A 1EB0A 4NWBA 1I6JA 2L9WA 4IO1A 4EBDA 2JEIA 2HHSA 2N82B 1VRQC 3Q8PB 2DY9A 4DFJA 1EARA 1M5SA 1P1TA 1UZDA 2IC3A 3K17A 2MQQA 3LQVA 3OLBA 2ASDA 4LMZA 5C42B 3GP9A 2F3JA 4LFBJ 1DBDA 2CQBA 2B4OA 1U6ZA 2MGZB 2AGPA 3NKYA 1OPZA 2GIRA 2HWHA 5SZTA 4YR3A 3I0SA 3NS6A 2R7UA 4P2MA 1RTIA 5C42A 5CYJA 1YJWS 2NLWA 5E0OA 4F0HA 1RT4A 3M1VA 4AQYF 2V5HG 3IAS9 1YRUA 3M8QA 2IMWP 2DXEA 1HYSA 3JAMY 3O1LA 1BQMA 2V4QA 4ZP7A 1Q4RA 4ENOA 5LMNJ 2QLXA 5HI7A 3GFYA 3IR5B 2ZM6J 5DS7A 1HPZB 3LF0A 5M2PA 3A3NB 3P3DA 1UPMB 2RDDA 3KUEA 3KUHA 4JV0A 4DR1F 2UXBF 1KN6A 1FNOA 1FX2A 2RF2B 2W2QP 2V9WA 4WFZA 2W2OP 2U1AA 3GSIA 4DPTA 2ZH1A 2D7SA 1PO6A 4N47A 4OZ3A 3P4UB 4DFKA 2ROPA 2V68A 2LFVA 2B51A 2MZSA 3EPGA 2CJQA 1VQLS 4CP5A 3RB3A 2LU2A 3AFGA 3DLEB 3GR1A 4JV5J 1BWEA 1IKWA 4Z7CA 5FJ4A 3DOLA 4UOCA 5E3CA 3NGDA 5I42B 2VQEJ 2ZBQA 1IKVA 1SIZA 2AMCB 2IA0A 1S99A 2IDLA 2WSEC 2EBEA 4OX6A 1NSQA 4KIAA 4XK8C 4RZRA 3G2XA 2BRKA 2ZHOA 4B9MA 4EU0A 3EMTA 2JH3A 2W4PA 1OYEA 3DLGB 1CULA 3R7SB 3SSQA 2HHQA 2QSFA 3BPDA 4AXIA 4A8KA 3UDEA 1TKZB 3DI6A 4GKJJ 2V34A 4H4OB 4ANDA 1RAIB 3SV4A 4P73A 3PW2A 2OIHA 3J81U 2UUWA 4F7VA 6FDRA 2CQIA 2DNZA 2HFSA 4PRFA 1R6VA 3BBCA 3CUNA 3BGRA 4MYTA 4W4MA 1CC7A 1Y7PA 2HK2A 3BO4A 4IR9A 5KFEA 3R2CJ 4G1QA 2KT3A 4YHHF 1DTQA 1RWMB 1AT1B 2CPEA 3BV8A 2UUAJ 1R8HA 2CQPA 1HQEB 2QLBB 3J80U 3C2PA 3PYDA 3PHEA 3U1NA 1IWAA 2FVCA 5GMKa 1K47A 1T9VA 4WXOA 1MNEA 2PFFB 3FGVA 2HEKA 2UUBJ 4PYDA 5KG5A 5FLXY 3P45B 3CO9A 2E9RX 4A46A 1Q8LA 2XSJB 2IFXA 5A8RB 1QE1B 1AUSL 4E0DA 3ITHA 4K4WA 4LQ3A 3TUZC 2PMWA 3QYYA 4LF7F 1QJHA 2V8VA 3VAHA 3SCKE 3NMRA 4CCHA 5D0HA 1VYAA 3C16B 5DZ6A 3ITHB 2R42A 3H42A 2ZC4A 2ZJQQ 1AYEA 3CD0A 3DCAA 4UZBA 6FD1A 4LBHA 1VRUB 2LYVA 1BD6A 2FZGB 3PEJA 1F5AA 1RT5A 2VOOA 4Y2MA 1U24A 3R8YA 3G9CA 5DQHA 2V8DA 2DGXA 5IOLA 4ZCMA 4A8MP 2HVZA 1S1XA 1X0FA 4K50A 1RU2A 1TFWA 3UWTA 2RT3A 4WZMA 1S1UA 2D74B 3UCGA 2MLXA 1RHRB 2CQ2A 2FHMA 5CH7B 1NJZA 4JYAJ 3PW0A 4ITSA 4DR7F 1TV6A 5A0YB 1HNXJ 4LF7J 3H2VE 1J5OA 2I38A 2PMHA 1CQNA 3KHHA 4JI5J 1PG5B 1HBOA 3N6NA 2F9JA 5ETSA 4CT9A 2VG7A 3PIPQ 3KLHB 3HVRA 4OX9J 2HNZB 1GNKA 2DNHA 4HDHA 1C0UA 1FRXA 4HTJA 1X31C 2CNOB 3F0NA 3H20A 3I82A 4ZVOB 2Y8WA 1JWWA 2WBRA 4I69A 1TUWA 2JEFA 3A8JA 4N41A 3I5AA 4PWDB 2DNRA 3H4BA 1OY6A 4QZVB 4N76A 4NX9A 3OXLA 3CCJS 4Y6IA 4Q5VA 5A2QY 2IDEA 3N79A 2E5GA 1QVGR 1G3OA 1RUSA 3CJ2A 1RWPB 4YHHJ 4DQIA 1GXTA 2G0CA 4USHA 5CAAA 1XMBA 1HNWJ 2JEJA 4Q43A 2E1PA 4A4JA 1FE0A 2V8GA 4WIIA 2BJ1A 3UVJA 1Y5LB 1FRHA 2AJFE 2HPUA 2OI2A 3KHRA 2C3OA 3OR2A 2OFGX 1N5SA 4F0KA 4U7UD 1TAUA 1IM4A 2CA9A 2HHHF 1H74A 3UCZP 1Q5YA 2RNEA 3NRBA 4JI5F 4C8ZA 2X51A 4P6QA 4J90A 3WIUA 2I9SA 2FJAB 2K1RA 2UU9J 3E2EA 2IM3A 3F44A 1EJ7L 1H73A 2A18A 1HIYA 2LA6A 1B3TA 3SFGA 2FGOA 4B3OB 2Y1IA 2IM2A 4RNNA 5EDWA 3Q23A 4KGXB 1RWOB 5HQMA 1WOOA 1H98A 1LK7A 3DRPB 4DR5F 1KDNA 1U09A 5MAOA 4AE5A 2GMLA 4HLBA 2VL1A 5LXRA 3U02A 2CQDA 1WI6A 3H2UB 2QA4G 1GMVA 1Q8IA 3DRPA 3KWMA 3S6EA 3BO2A 2C22A 1FNXH 5D4PA 5F9LA 3I55S 2YKPA 2WBMA 2DGWA 5J1NA 2WSFC 3T5JA 2BDPA 3GB0A 1MN9A 1ZYQA 3FDSA 3W8GA 2O66A 3EDRB 2UUCJ 4KGKA 3FFIA 3KNAA 2Z2YB 3D1HA 3DLKB 2CQ3A 1HNIB 4FPRA 2QA1A 5IQ6A 3HP6A 2EEYA 5L1KA 4DV5F 3HM9A 5DG7A 2JEGA 4K4UA 2OEMA 2PT0A 1U49A 2HZAA 2CJYB 1RYSA 1HNIA 3M7VA 4OLOA 3CCTA 4ECVA 5A8KA 2V4RA 1MN7A 2BKPA 3CDEA 1VQ9S 5I3PA 1U0HB 4YP3A 3V81B 2QJ3A 2WW8A 4ANEA 1RWNB 4TQSA 3BSNA 2AU0A 3UFCX 4KH1B 4ZVHA 4YR2A 3JQKA 1C0TB 2AYMA 2EXUA 3DMJB 5KFWA 3C46A 2XSFA 2XB2D 2C2MB 1WDDA 4TY8B 3JTOA 4WPAA 3V6DA 2R8KA 1RAJA 2KZZA 1RYRA 1W2BR 2KHCA 1C0TA 3D6TB 4PWUA 3PKYA 1M5PC 1R27B 5LMUJ 4RX6A 1KKHA 2EKYA 2W25A 3R6LB 1VQSA 2EKNA 1QUVA 2HZCA 4FYXB 5J1PA 2R2TA 4DV0F 5GAHI 4B9SA 3B82A 2H51B 1CSJA 3PACA 3T41A 2DNPA 3UR0A 1JNZB 2B5JA 1CJUA 2Q3PA 3OL7A 2B4VA 2EFNA 5F8MA 2FJWA 3HF5A 2FLNA 1TVRA 5F8JA 2ZUAA 2DGOA 4F4AA 2JWNA 4NYPA 4WXWA 3ZNJ1 4YY3J 1H72C 4LF6F 1VQNS 3CJRA 4ZDNA 4YN3B 2C2EA 3PYEA 4WZQA 2ASLA 3MM7A 5HROA 2HVHA 1VJQA 1AA1B 4NE9C 1DLOA 4TY8A 3JXOA 2JC1A 3V6DB 3GYNA 3R1LA 3RRHA 3VAMA 3L9ZA 2SXLA 4FVMA 3NG8A 4IDKA 3JYTB 2VODA 5HQLA 2OSRA 5B0BA 2R9LA 2QMUB 1MW7A 1YQHA 2BJ9A 1S59A 4Y2KA 3RRKA 1R89A 3W7BA 3UNYA 4EI2A 2G1HA 4F50A 5J2QB 5EN1A 1KVJA 1SJRA 2Z0GA 1L3SA 4I67A 1LXJA 5KT3A 4DFMA 2W4DA 3T5KA 3WX4A 5DG8A 4X2BA 4JI1J 1URNA 4GKKF 1MWQA 4FXVA 5E5NA 2MHEA 1D8ZA 3UN2A 1BQXA 2J9DA 3KFWX 1FFGB 3D54A 4OMFG 5GAGI 2LA4A 4O44A 5HATA 1RT5B 3M2UB 3M32B 4CH1A 2HHPA 1VHFA 3SMZA 4JI7F 3LWLA 4ZCIA 4ZITA 4ED7A 5KTQA 2FDNA 3IBFB 4I6YA 2Y9HA 4FXWA 3PX4A 2BUNA 4ZN1A 4NZ6A 4Q7AA 4HL9A 2W9BB 1I3OB 4IQMA 4LJMA 1RCXB 3QRRA 4ZP8A 1LWCA 2FGCA 4C3KA 3V6HA 4DL2A 4OYMA 2AGOA 3QAEA 3SFUA 3A3OB 3C66A 3FVYA 3TAQA 2HRTA 3GYGA 4NMLA 3MUMP 1HBMB 2NYIA 3BPSP 3R5CA 2HLTA 4NCBA 2XTJP 5F0UA 1HARA 2XY7A 4B17A 1OJ4A 2ZZMA 1RTHA 3G8QA 1XC9A 1OY9A 4Y65A 4C11A 4QW8A 4DCOB 3G6VA 4WF9Q 2AHOB 4NLPA 1UPPA 3POTB 1F6TA 1MWZA 5HK4A 3RGIA 4LF4J 2AEFA 2HFVA 2JLEA 1FRIA 4LVNP 4HH1A 2VASA 1BMQB 1RQ0A 1SC1B 5KFYA 4AUKA 5KFBA 4PAAA 4DUTA 5EWFA 3G4SS 1QSLA 3MEEB 4MK8A 4XO0A 2P9EA 3P49B 1S10A 1NBEB 3NGUA 1TK0A 1AFIA 5HQ8A 2ZHAA 1BGXT 2KRRA 3LGNA 4I56A 2VF3A 1Y5IB 1F9HA 2OELA 3MEEA 4GVBB 5KFLA 1Q81T 1HHTP 1NPPA 5ETOA 1EQMA 3MD1A 4M5DA 4DPXA 2Y1LB 2XMKA 3CPWR 2E7WA 2VPZB 4FVCA 2R8GA 3SDEA 4UF4A 3VQTA 1SCJB 4QPTA 3W65A 1X9SA 3M2RA 2YNHB 4KV8A 2QTWA 4PPDA 4OI2A 3D0GE 2ZZNA 3GZ7A 3TUPA 3C6TB 1TKTB 3VQSA 3DLLQ 4OLPA 3GCWP 3KXDA 3MMCA 1T3OA 3R5AA 3HMJG 2RKIB 3HX9A 1WEZA 5CYQB 3GIMA 2F8EX 4I2QA 2K2PA 3FZ2A 3HDSA 4JP8A 1RAFB 2ADCA 4WWSA 2YH1A 2CQCA 3KKFA 3A3PB 4KO0A 1FDNA 3H5XA 1T95A 4QQBA 1FRJA 4A8XA 3THVA 2QMXA 4DQQA 1AZSB 4Y2CA 3ZZUA 3FEXB 3LANA 5IC4B 1TL5A 1K9MT 4L3KA 1PAUB 2Y3YA 3HZGA 5GAHU 3OFEA 2XMAA 1VQPS 2IVMA 4FF1A 1GX5A 1ELOA 2DR7A 4ILMA 4KJIA 4LF9F 4OYPA 3BM7A 1TP7A 4DSLA 1RT2B 1TKTA 2ZH6A 3UD4P 4HH0A 2LCWA 4LF8J 2RKIA 4ZCLA 5CHCB 3MM8B 5LSOA 3V4MA 4Z2XA 1S0MA 3LAKA 4RW7A 1IWGA 1REGX 3TA0A 1OS5A 2L9DA 3MFHA 1FEEA 2JZ5A 2ZFHA 1SKUB 4ZVUB 3W8PA 3IRXA 2J7KA 4HACA 4OZ1A 4JI4J 2XHWA 3MM8A 4ECRA 2RIJA 4O4GB 5C24B 1U1KA 3HFKA 1K44A 2QLJB 2QV6A 4NLUA 5LSRA 1B4SA 4AL7A 1NPRA 1MLAA 4PCQA 3P96A 3OHAA 1S1WB 4LSLB 1XMQJ 1SJ3P 5KFTA 1VRTB 2XO6A 1LV5A 2UUTA 2J0QD 3M2VA 1NPKA 1R0AB 4ETXA 2VA2A 3MDFA 1UVLA 4DV5J 4X4UA 3IG1B 2FC8A 4CLUA 1RT2A 2YNGB 5J1EB 2QFJA 4ALZA 2CPJA 3AOBA 1RCOB 3DYAB 2D69A 4RKUC 3HJFA 1RWXB 1VLYA 1UZHA 2O01C 2QMWA 3B4MA 3UNGC 5CCLA 2W1BA 3OD2A 1JJHA 1XK8A 2YKQA 1VBKA 3EPIA 2VQFJ 2UVUA 3Q2TC 3V4IB 3IP0A 3CJ8A 4O4GA 5CXTA 2CPZA 2FD2A 5HANA 1IUJA 2ZDOA 3V6KA 3RU0A 3MI7X 2BW7A 2Y0BB 3IXQA 4Y2AA 4LSNA 3CJSA 1S1WA 1XTZA 2VFSA 3T1AA 2VDIA 4ZOSA 3TO8A 1WD6A 4YMEA 3HJVA 4DR5J 3WIVA 4PUOA 4Q0BB 4RW4B 3KHGA 4TQRA 3HVWA 1ZAWA 4CH0S 2DCUB 5H9EJ 3LPYA 2H5JB 2ZE2A 4ZVEA 1H2TZ 2W9CA 1PSDA 4RW6A 4X65J 3VHQA 1S1VA 3PJ9A 4HHJA 1IJFB 2OPRB 1BWVA 3DYAA 4RPFA 1JQGA 3BB5A 5HMYA 1NK0A 2IM1A 1TL7A 3PRBA 3V2UC 4O23A 4F02A 1IQZA 1J2VA 5E3QA 3VAJA 2ZH7A 4Z7YA 1SKRA 3V4IA 4B3RJ 1KQSR 4QYZJ 2EC0A 1EX8A 3FBEA 5KFQA 3LP0B 3ZTOA 1S9EB 1VQ5S 1RT1B 2IJNA 4G1IA 4XDDA 4DSKA 2DB1A 1NCLA 4O3QA 4K7QA 1BLUA 3KJFB 3W9JA 5CZXA 3LOUA 2GVZB 4JB8B 4K0KF 1WG1A 2ASJA 1SL1A 4ZJQA 4LBPA 4K4SA 1RABB 3WQPA 4MFBA 2FC9A 4ZVSB 4DR6J 2CPFA 2CRLA 2OEJA 2YKOA 4D3GA 2ZD1B 4DPUA 2KYXA 5EUHA 3BSAA 1KWMA 4ZPVR 1ACMB 3EE3A 2OPRA 2W4CA 2FTRA 3DOKA 5A2QU 2B7BB 2P6SA 5EX3A 1X5TA 1KP6A 1WHWA 2AGQA 1YGYA 3FCHA 4X62J 3EX7B 2DITA 1VGYA 4U96A 3LP2A 4J9RA 1DRZA 4FF2A 3OFGA 4CNZA 2RS2A 2JJ4D 3AB4B 4NLRA 2KHDA 2XNQA 4CO5A 5FLXU 4FYWB 2C3MA 4Q2MA 1XBWA 5F41A 4ZA1A 1SQGA 1C1BB 3GJQB 4DN9A 1D8YA 1XNQF 2V69A 3HHLA 2R7TA 2RQ4A 2FHKA 1KLMB 3K0JA 1SUQB 2GHVC 2V2QA 3IWLA 3NEKA 1C1BA 4P9SA 4KE5A 1S6QA 4BWJA 2HNDB 4DU7A 2ATCB 2RHQB 3KK1A 4CIOA 1WF0A 4Q44A 4DLGA 4KPYA 2RJZA 3KNGA 1T11A 2CG8A 2HNYB 3FC9A 3MAHA 4ED3A 4TU9A 3RR8A 3KK2A 3K89A 4DR3J 1O5JA 1SI9A 2CQ0A 3FCVA 1MMNA 3ZZTA 1HBNA 4Y3CA 2YXLA 3PRVA 3T6JA 1NJYA 1KTQA 2XMJA 3LO3A 3LUYA 4OZ5A 4F26A 5ETRA 1TL4A 4YR0A 2C2NA 4U7CA 1MSWD 2YNHA 2ZVIA 4KV8B 3A13A 1QDUB 2MZ1A 1ZH5A 4IRKA 1XWLA 3MD3A 3QIDA 1U4BA 3J7A1 3ZTQA 2UUBF 2FHOB 3GTYX 1OQ3A 4KTQA 2CJKA 1SUQA 2PEHA 4N77A 1IQTA 1NDPA 2KJWA 2QRRA 3BN7A 3FEYB 2DNGA 3LWMA 3MEKA 1NSAA 2NUUG 1QVFR 1UMJA 1GEHA 2CNKB 3W9HA 1NJWA 2Q6CA 4B3TF 3DOMB 1CVJA 3RZAA 4ZPDA 1YJNS 3AA8A 1M0SA 4C97A 4KHPJ 1FDBA 2Z56B 3Q8SB 1Q0NA 3MPYA 2LEBA 4OI0A 3T19A 4X64J 5HN0A 3FBBA 1C1CA 2GJ2A 4QCLA 5KFNA 1EQ0A 5KFJA 3DDIA 1H6KX 2A1BA 4LRFA 4HHHA 4WTOB 2DKOB 3K5NA 2YWKA 3VAKA 5JMNA 2UP1A 5HMZA 3BH6B 2HYIB 3GIKA 2JC0A 2YWFA 1GQEA 2I5JA 5LM7E 4F4ZA 2YH0A 3UN3A 3BQ2A 2CFXA 2OHDA 3LA0A 4KC5A 3J7YI 1Z2ZA 1NHKL 2BE9B 1NK4A 2E5LJ 4FPIA 4F36A 1HW9A 4RR5A 4X4RA 3OVAA 4B9TA 1MG7A 4OYZA 1TFYA 5LSLA 4J9VA 1VC5A 1U1OA 2LQJA 5GADU 4DUYJ 1QD1A 5KG6A 5KOWA 3IGVA 3OTCA 3SQGA 2IMOA 1XMOJ 5GAGU 2RD5C 5L8RC 5KT5A 2K06A 3PIOQ 2ZH3A 4HKQA 3EZUA 2M88A 1J27A 1NK7A 3SQGB 2KG0A 3L3CA 4A8SA 4LIRA 4P2XA 2YQ0A 2HQIA 3V6JA 1GMWD 1S9FA 4WFAQ 3RUBL 4V1Ak 4DR1J 2UXBJ 4X4PA 2L9NA 1PIEA 2POKA 2ROEA 4IKAA 1HHSA 1X4BA 1N48A 3OJUA 3I96A 1ZA1B 2F9DA 4FDFA 1APSA 4WP8A 2ALZA 3HHLC 4DL0C 3W60A 1OO0B 1S1TA 3EUNA 2XMTA 1NUEA 4TYAA 5IQQA 2WONB 2DNQA 3WBZA 1GH8A 1XJWB 4PPZA 2VFVA 4CQ1A 5RUBA 4X4QA 4CLLA 2NXUA 4L3NA 2WVCA 4CM0A 2IPOB 3SBMA 4EGLA 5A8WA 4URGA 1UTAA 2DNOA 2J9CA 3LTOA 2IC3B 5B0DA 5DETA 3IWNC 1YRTA 1JMTA 2B8PA 3QMQA 4WJBA 4M5NA 3S01A 5JVGQ 3HFVA 3FUYA 1SH0A 2MDAA 4Q8FA 3WZ0A 3C6UB 3PHTA 3ZZPA 1JLBB 4ICLB 4ILRA 5LT5A 4ID5B 4ED6A 1RKJA 4IRDA 2F4VF 3FQKA 3O44A 5THWA 2DVIA 1FDDA 3TUIC 1S9GB 4K4YA 1EETB 5T7LA 2WONA 3MECB 4CYUB 3QFWA 4J5OA 4RW8A 3TRGA 4B9LA 2WSCC 1UJ4A 5T7LB 2X7IA 2E1RA 2MHNA 3AQOA 4I2PB 1ZM2A 4MFBB 2ZNYA 4LRAA 3J81Y 2JVOA 4LT6A 4ERDA 2C3UA 4NASA 2V67A 3L7PA 1N32F 2OP5A 2XCAA 2CVEA 3W3SA 3QLHA 5F8IA 4DHVA 3MF5A 3RJMB 2LECA 2RRAA 2BKOA 4URQU 5D8HB 1LEOA 1HPZA 2HAIA 3DGVA 1UVKA 2IYIA 2M7SA 2ZOGA 3IGNA 4Q45A 3KJVA 2EK6A 4BBYA 4ECYA 4ED2A 1N8RT 4DR4J 3GCXP 1O6XA 1K1SA 4PKDB 4CDIA 4IFVA 1F5CA 2DY1A 3PTWA 3SEOA 1V6HA 2JLGA 3WDOA 2CADA 2KXHA 4JI6F 4H4OA 5DDQC 1RHKB 3FK4A 4H4MA 1E6YA 3C19A 4YS2A 4ECTA 1NDLA 5BR8F 3R7NB 1NSPA 3THTA 3CCES 3DLJA 1OY8A 4CH7A 3D28A 3PV8A 2V9KA 4ZJOA 2OTLS 2ADBA 4CLYA 1Z2LA 2B56A 2VPXB 5KFCA 2QA4S 3CD6S 3MOZA 3MPWA 2DHSA 3KJNB 3BH7B 3I0SB 4MAKA 1RWWB 2LXFA 4ZVQB 1WG5A 2FQQB 3I5CA 4DZ6A 5F8GA 1JLGA 3SYZA 1WWHA 1UVMA 3DU6A 2X3GA 1FD8A 5DDPC 3JSMA 4ANCA 3PR4A 2W24A 1U26A 2VKZG 3PVXA 4RUBA 2M3DA 3CNQP 4J9QA 4ILLA 4CLPA 3VVTA 4HEA9 4IFVB 1RWVB 4Q2LA 5HJXA 2XLIA 1O0PA 5IT9Y 3D2WA 4WK3A 3R2DJ 4BLGA 1R8BA 2KKHA 2VG5B 3JSBA 1H7XA 4NRTA 2XS2A 3MM9A 1QY7A 3MMAB 4UUWA 1A9NB 3NL0A 1LK5A 3I0RA 2HK3A 2GO9A 4OZNA 3I56S 1TKXB 2M52A 3BEGB 3LP1B 1JNRB 2XCPA 2JSXA 4R8UA 1U2CA 1X4CA 3N01A 3K5MA 3OVBA 2BQUA 2GJFA 4TN2A 2I1RA 3R9LA 1FK9B 2DH8A 4NI2B 4OI6A 3GYXB 3PG9A 4RO0A 2CQHA 3N6MA 4ER8A 4B3MJ 2DIUA 5GVQA 5ADZA 4GVLA 1LNQA 4C3LA 3W9IA 2IVFB 3SCJE 3KLFB 2K7JA 5DZ7A 5I3UA 3ZZ0A 1SB6A 2BA9A 2ZDPA 1YX2A 1N88A 2GC8A 3MGJA 1Y00A 3R5DA 1VISA 4CLFA 4K4TA 4DR2J 4K4ZA 1XR7A 3DKDA 3DGPA 1Y11A 4DV6F 4MT1A 2C2DA 3M8WA 2OH2A 2BX6A 3CW2C 3QT6A 3HSDA 3MMAA 1TV6B 3TA2A 2B3TB 3KYLA 1PAEX 4K4XA 3MR5A 3TEHB 4W92B 1TKXA 4ZP9A 5CD4H 2HG4A 3GJSB 1DQAA 1SC6A 2UV8G 4M8LA 3KLVA 3CT9A 4J9MA 2BR0A 2VFUA 1N5TA 4DXLA 2K8GA 2NPIA 1DTQB 2ZWOA 3BKUA 3HVTB 3MUVP 1ZPVA 1T02A 3OBIA 1A6LA 1P27B 4OJGA 4E98A 4EO8A 1GMUA 1ZPWX 3PX6A 1JLFB 3I4HX 3PFEA 4IFYB 4H54A 2HVDA 1CJKB 3OW2R 3QSYB 2UXDF 1KOHA 5KG3A 2KU7A 4WP9A 1WC5A 2ZEJA 1N33J 2PA8D 1KBRA 4JI3F 2M2BA 4DF8A 2CPDA 3KMSA 3EDQB 4DV4J 4J9OA 3CMAS 4P2SA 4UTGA 2RU3A 5KT2A 3B8HA 2VG7B 3CO0P 1TK5A 4A48A 2UXCJ 3I31A 1P9YA 1UL3A 3ILLA 1C4CA 4P75A 4YQWA 2RQCA 2FLPA 1XNRJ 3DM2A 3I6PA 4MIBA 4DU8A 2WZ1A 3ELHA 2YX1A 3CULA 2PO4A 3D9BA 1X9WA 3GV7B 1FKPB 4QWCA 3PCOB 3U27A 1UP1A 3JB9k 2QYGA 3HZEA 2OPSA 1FRLA 1YDLA 3DN9A 3HHDA 4C0OC 3RBZA 2NS1B 3H7HB 3UD5A 4DV6J 4OX8A 1JXEA 4ZPWR 1VQOS 2MKCA 4K8RA 3W62A 3TUJC 3CCSS 4OYBA 2WHOA 2NXNA 3N4WA 2E1AA 3UVJB 3GU0A 2ZWPA 4P7VA 2YBVA 2EFVA 2MKSA 1RA6A 2M0GB 2DRDA 4C8MA 3Q8QB 3PR5B 4C6AA 1UFKA 5JXSA 3M8QB 2MKIA 1T3NA 3NWGA 1FHTA 3IA0A 2MZQA 5F8LA 4YB1P 3HHKA 3GFXA 2D3ZA 4X4SA 5KFFA 3HHLD 2GO8A 4YUDA 1N34F 1HBOB 3E01A 1RHJB 1YJTA 2P9GA 3D5MA 1HKAA 1EETA 1WC6A 2DPIA 1HWKA 4DV3F 1FWKA 1FO1A 3FFIB 4CWBA 2CPXA 4X4NA 2BZ2A 2VC0A 3GIIA 4OHZA 4L6V3 5K20B 3HD2A 4KR0B 2CVIA 5L39A 3TP2A 4DPWA 2J6TA 3KG4A 3PNIA 4DF4A 4BHQA 3G87A 2UXCF 1HWJA 1IBMJ 3HHNB 1RE1B 4Q8EA 3DOLB 2RS8A 2AV5A 1U8WA 4AD6A 3H98A 2NYHA 4USWA 1IR0A 1LWEB 1R8CA 2CQGA 2CQ1A 2GA7A 3PO4A 1MROB 4ES3A 2UXDJ 5C25B 4JBCA 2QIFA 2HHTA 4C9DA 2OGUA 4QU7A 2HS0A 1S6PA 4DX5A 5K8OA 1S97A 3M6UA 4QIWD 1LOUA 2K1RB 2QZ8A 2E5HA 3G8TA 1HA1A 3MEDB 1Q78A 1QM9A 2DHAA 2IBOA 3U1MA 3CXCR 2UVWA 4I6AA 5A8KB 1E6YB 4OIXA 2MXYA 4JI0J 5CYMA 3A4TA 2AX0A 1HI0P 1KNZA 1HNZJ 2ALYB 4ETZA 1VK3A 2HIQA 4NLQA 3IBCB 5KFXA 1U0HA 3V81A 1FD2A 5HP1B 4NEZA 2HGMA 1UW4A 1H2UX 2QL5B 4OX7A 1PJ5A 4HTIA 2GQCA 3M9NB 1EZZB 5CA5A 2R2UA 1WKKA 3T1YJ 1UA1A 3RAMA 4C0HA 2RQKA 1VDHA 5C25A 3Q83A 2EK1A 3HT0A 1WOSA 3EGWB 2HS3A 3NNHA 5KFHA 2LQBA 2DHXA 1EHWA 3Q89A 4FYVB 4LRDA 1EIYB 2LKZA 2X3DA 1TL3B 3GV8B 1IBCB 4PG7A 5I3QA 1F9EB 3JYTA 1S72S 1FJGJ 5EWEA 4MJKA 1RT3A 4LF4F 1F0XA 1KFDA 3GQCA 1AFJA 2L48A 1Q7YT 2PGCA 5DDRC 5L1IA 2K7KA 2HFZA 3J81j 2X1BA 2YKNB 3VGVA 2PI5A 3KHLA 2QYCA 1KVIA 4G1QB 1B99A 4M95A 4UY8T 1WI8A 3NBPA 4KGZB 3D6FB 4NLSA 1VBYA 1JKHA 2CUYA 3T1HJ 1AW0A 3Q8VA 2AEJA 2GX8A 2AJQA 2DCLA 4FP9A 1C2PA 1GTHA 3TX0A 3BGLA 3L4BC 2B4UA 5AT1B 2KB2A 1FTCA 2FJXA 1XIQA 5BYSA 1AXQA 1S4FA 5D0RA 4DI6A 2H54B 8AT1B 2GQ2A 2V8HA 3K5PA 2FLLA 1TL3A 1U2RA 2G2OA 3QRQA 2ZOMA 2XSJA 1WTBA 2WAQD 2EG2A 2ILZA 3LGMA 1UJ6A 3FCWA 2ASYA 4PQUB 3MM6B 1FESA 2HNZA 3G6YA 5M2RA 2H1YA 1FJ7A 1KHWA 3J7AN 2OTJS 3BSOA 2BJDA 2OLWA 3HI9A 4CRJA 1KEKA 4B3SF 3MAQA 3VF0B 2XC9A 4QIFA 2MJUA 1ZAVA 5A76A 1FEHA 2FVQA 3OL9A 4RL1A 3GILA 5K5MA 2JNJA 2RVJA 5KFGA 2FVSA 3WHIA 4CLWA 2W8KA 4DV2F 2VB6A 3GV5B 3W64A 4KFBA 4O3OA 1VOMA 2BBEA 1HNZF 8ATCB 5K14A 2DH7A 3CTRA 1RWKB 3JQMA 1FA0A 4L72B 5L46A 3RB6A 4LVOP 2PN6A 5JVHQ 1FX4A 3JTPA 2LEAA 3CD7A 4ZIWA 3BBFA 5DG9A 4RNMA 2D3OR 1TK8A 4WE1B 1YSJA 4EYHB 5K14B 1A7GE 3KLEB 1JXLA 3K5LA 2MEWA 4KY3A 1IBLF 4OYOA 1RTHB 4UT4A 3UR3C 1NK6A 4NLWA 4OZ0A 3CJ4A 2AYGA 3QZ7A 3PDNA 4GC7A 4M94A 1XNQJ 4FNHA 4DS5A 1LW0A 1FKPA 1EP4A 4WKYA 1I51B 3HKZD 1S48A 2IRUA 4M5LA 4MTPA 5BYQA 5H1SV 2E5LF 1PYSB 5AXKA 4P71A 4PWDA 1SVDA 3M2RB 5B0FA 2G4BA 1YJ7A 2O5DA 3KG0A 4M5KA 4WIQA 3C6TA 4ECSA 5LMUF 2VPWB 2YTCA 2WTFA 2R7QA 2KL8A 4BWMA 3FZBA 4FZVA 1QAJA 4ELVA 2R8IA 2W8LA 2CJXB 2KT5A 1DURA 2HBYB 5A6PA 3NGTA 3O3LA 4X64F 1Y9OA 1C4AA 1UFLA 2AT1B 2DGVA 3PYFA 4JI8J 3PJWA 2DYAA 4YDXA 2OMOA 1IBMF 4RNFA 2HURA 1NKBA 4U6PA 1YHQS 2BXJA 2H65B 1B0TA 3JTNA 4DV2J 2DHGA 5ETLA 1JK9B 1IKYB 2GHPA 4DEZA 4TYBA 2IBKA 3FBFA 1GAOA 2RH3A 5DJBA 3W5ZA 2N3OA 5B0AA 2LQ5A 2MZJA 3H5UA 5J2PB 1T03A 5IV3A 4B3MF 1IM6A 5ETKA 3BYRA 1QTMA 3CWJA 3SQOP 4EBCA 1LW2B 3B6BA 5E3RA 3RAXA 3QGPA 1OSCA 5J2PA 2GW8A 8RUCA 4ECUA 4IH7A 3TI0A 3IRXB 4HACB 4UQTA 3C14B 2LQ9A 1N5VA 2QT7A 5F8NA 1X4GA 3BZQA 5H9EK 1ZS6A 2ERRA 3D68A 3NGSA 3OUYA 4G3IA 1RZMA 3L09A 4DLEA 1ZAXA 4TXSA 1M5OC 1HQ2A 2N3LA 3BS9A 4USUA 4DUYF 4LSLA 4USJC 2J76E 2D9PA 2Q66A 1NJIT 1TUVA 2E44A 3DLKA 3TQ1A 4XPCA 1TQLA 2CDQA 3CCZA 4DV7J 3RB4A 4NCAA 1M1HA 5L38A 4BC9A 4EYIB 4QJVA 2W7AA 1S5ZA 3J80Y 2XZWA 3NXZA 3FNNA 1O8BA 1U7LA 2E5JA 3TWZA 2ATLA 4PG4A 2QO3A 1T05A 3TEGA 3VCDA 1RHQB 1SPBP 1VQ8S 4KKOA 3CCVS 5DQIA 1RBAA 1T05B 3AOAA 2KO1A 2OEKA 2Z30B 1RBOB 5DLFA 4QPXA 3QRPA 1KTVA 1JLEB 2MQ8A 4J9KA 4JI6J 1R3NA 4WYLA 2AJ1A 2EPIA 3GJRB 4UUXA 2B43A 4DS4A 2XYPB 1UA0A 3MFIA 4O3SA 4UOGA 5HAOA 5J2QA 1I94J 4OHYA 2FYXA 3EGVA 3IS9A 4IG3B 2QL7B 4CNYA 4CT8A 4C4WA 1TELA 4LIWA 2PD1A 2A2DA 2RAQA 5I4MA 3Q24A 3IBWA 3BKFA 2AZ1A 2W9CB 2V94A 3IS9B 4IG3A 1I94F 4X4OA 4HI1A 4TLRA 3ISND 3EVOA 4C7QA 3G71S 1CJUB 1MMDA 1WHVA 2YWGA 3A1YG 2F7VA 2DT9A 1GTEA 1TVRB 3G96A 4O4RA 2XQCA 4ZHRB 3GPAA 1M5VC 2FVPA 2HMIB 3MPVA 2EW9A 2RHSB 4TU7A 5G0RA 1M1KT 1ZM9A 3H0PA 4I0WA 4DR2F 4DL7A 5B09A 2GQQA 1NKEA 4A8WA 3CSKA 1BHNA 2RRNA 4M5MA 2B6AA 1OYDA 3L7OA 2ZH4A 2VJUA 1SL0A 1HLWA 1JJ4A 4HR2A 3NNAA 3N6LA 1YZ7A 5HLFA 4B3SJ 1NKCA 1EKRA 2FJDB 2HWIA 1F9FA 2Y1RI 3FMWA 5D15A 1VR6A 3GJTB 5KG2A 4ED8A 1YJRA 2FZCB 2BKNA 1I5OB 2W2MP 3IG1A 4NA3A 1RT6A 5CYQA 3ZFVA 4DV7F 4TLQA 4DL3A 5F8HA 2R8JA 4USVA 3MEGB 2MPUA 5K8MA 5LJ5Y 1ZOTA 4OHXA 4RBTA 4CLKA 2XG8A 1NB7A 3CJQA 2AYBA 1RT1A 1QAYA 4LR9A 2H4WB 4UOHA 3QT7A 4ZPTR 4ZHRA 2DJWA 2HMIA 2GFFA 2G13A 1PYTA 2AWZA 5FIIA 5ETTA 3WX8A 4QIVA 1OWXA 5C5JA 4H4KA 3M2UA 4ZN3A 2QGFB 2XI2A 3MHYA 3DU5A 3NLCA 4FBTA 1UVNA 2MSTA 1N34J 2VOPA 1YJVA 2VPYB 1R0CB 2RUSA 3O5TB 4ZVTB 1TKDA 4NLGA 2AIRB 1FFWB 4P74A 2KH9A 4PZVA 4R0EA 3PZPA 3AODA 1P1LA 1FCAA 4M5DB 4CM2A 4Y34A 1U6BA 2F4FA 2OPQA 2VA3A 1IN0A 2A2CA 4WE1A 1GMWA 4OFZA 3SI8A 1RT6B 4YDDB 2AP6A 4PR6A 3N28A 4PXCA 3K58A 2OPQB 4MIAA 4DR4F 3W61A 3RBXA 1UEKA 3K8WA 1EP4B 4UOFA 2ZJRQ 1S12A 3HFZB 4R5PA 1IBKF 3HD1A 3CCRS 1S9EA 3TVKA 3POTA 3RR7A 4LF8F 4X4VA 5HJYA 1LWFA 1REVA 2LXUA 3RG6A 1LKZA 4C48A 2G1DA 5EX0A 4ZVGA 4O0IA 1ZZNA 3QATA 2GVZA 4WU3A 1AUDA 4NLTA 1YI2S 1F3VA 1D0EA 5MLCV 4DV1F 2AD9A 2H5IB 1PJ7A 1AZSA 3F56A 3MR6A 1ZBTA 2QFIA 2MMYA 2VBYA 1UFWA 4C8OA 4DJBA 4FYDA 4YEAA 2H9ZA 2ZNZA 4WYWA 5HVFA 2ROGA 3L95X 4KSEB 3N5BA 2H5EA 3B4DA 3GLJA 3PM9A 4U67Q 3W5XA 4OZ2A 4PEOA 5KFSA 4AL6A 4ZMMA 1G6BA 3LP2B 5DDOC 2VG6B 1RP5A 1UEUA 2PDAA 3GWCA 4NLYA 4ZKAA 5IWAF 4NXNJ 3HO1A 3CDWA 1RHMB 2WVDA 3NOCA 4PXEA 2Y8YA 1B64A 4RW7B 2MKKA 4QWEA 3ZZOA 1D1UA 1QLNA 1RA7A 1N6QA 2UVVA 2N7YA 1BQNA 3EGZA 1YBTA 3CEDA 3HHLB 3VR1A 4CO3A 2PFDA 1X5SA 4PG8A 2BANB 5KAKA 2ZM6F 1U45A 1F2HA 2LLZA 2P2CB 1TTHB 4LR7A 5LMNF 3KK1B 4DX6A 2CKWA 3DRSB 4ID5A 2B9WA 1YK9A 2VV5A 4QOTA 1BUXA 1WHXA 3PW4A 3AXKA 5KT7A 2DRAA 3NAHA 5K8NA 1VRTA 3OSNA 4KB7A 5GADI 3DC2A 5L9NA 3A8KA 4XIUA 1V5IB 3M8SA 5IFMA 1VI7A 4U8YA 1N56A 5HBMA 1IBKJ 4MK9A 4DPYA 4O3RA 4LFBF 4RWXA 1NLKL 4U8VA 1DQ9A 1HMVB 4CO4A 5T41A 3BBBA 3EM1A 4BCAA 5HBMB 4ED1A 2EFOA 2N4CA 4CO0A 2MZTA 2E9TA 2NXJA 3GG0A 4ID8A 3VAIA 1YTYA 3WC2A 1HWIA 4BS2A 1RK8A 1U02A 1NHVA 2IIHA 5M2UA 3MURP 1E6VB 2VD3A 4M63A 1WNEA 1XMOF 4NMXA 4NZ0A 1SV5A 2WOMA 3EVMA 4NA2A 2KT2A 1N4LA 4IOAQ 2NQPA 1ZZFA 3KUGA 1X4EA 1SJ4P 4OYXA 4C3MA 1WTFA 3MR7A 5HVGA 2I0XA 4LSNB 1GFWB 1HFEL 1HNVA 2A10A 2QL9B 1SV5B 1VFJA 2WOMB 3I87A 3MXHP 3CC2S 3ZTSA 4PUOB 4Q0BA 4LF2A 1NNDA 3EGNA 3N0VA 1Q95G 4JI8F 2MKYA 2BOAA 2KM8B 2AW0A 2XHCA 2FUG9 4FNIA 4USKA 3ENAA 2UU9F 4N5SA 5D3GB 4DSEA 2IRXA 5IWAJ 4NXNF 3EXYA 2A6OA 5GMDA 3CCMS 5LJ3Y 1RT7A 2VONA 4FN5A 2KXNB 4R0JA 4Z37A 2W9AA 3M8YA 1BC6A 5LOQA 4DV4F 2F5GA 1FTRA 2J0WA 4USIA 4ZIVA 2R7WA 4DSFA 3C6UA 2D9OA 1UCNA 2MSSA 3EZ5A 4B08A 1GK8A 1IKXB 3E8OA 2NXEA 1VK8A 3CMES 4KHPF 2Q1LA 3ETOA 4E8UA 5KFIA 1R8AA 4DV1J 3MECA 3QZ8A 1GT8A 3GMGA 1IBLJ 1S77D 2IY5B 1Y4ZB 1X9MA 4IYQA 3FJ2A 2Z2MA 3QBCA 4Y0FA 3J7ZT 2GCFA 4ECQA 2DR6A 4PWWA 2FJVA 2XS7A 4RBVA 2ZE2B 2GGPB 4WKRA 3TAPA 1KRPA 2HVEA 4K0KJ 3S1TA 3CIZA 3IC1A 2HQDA 3S8SA 3IFEA 2ZUGA 3K2YA 4OJHA 4MKBA 2YVSA 4URSA 3UE2A 3VAGA 4KAIA 1G1XA 3K59A 1HQUA 5DGAA 2M8DB 2EWHA 1S7HA 4QW9A 1U0SA 1FNMA 4TNOA 2DNNA 3W2WA 3EICA 3VV2B 2OPPA 3DDKA 1FDAA 2XWYA 2PEBA 2VC1A 5A8WB 2MQOA 1KLNA 2YNFA 5KG7A 4CLTA 1SIWB 3FEZA 3NCRA 4F4XA 1H2VZ 3RRGA 3ET6A 3BGFA 3C15B 3IO1A 2Q6BA 2G2YA 5GAEU 1U1PA 1HBNB 4U7UK 1O51A 4MYUA 1MU2A 3GE9A 1PC4A 3C15A 3M05A 4DMZA 4FBUA 4NOHA 1WF1A 3AHPA 3HXMA 3CDBA 1VQ7S 1LFWA 2XO7A 1S9GA 2K3KA 4IRCA 2E5IA 3IR6B 2NCKL 2YNIB 1HQUB 1WC4A 4FS1A 2IVYA 2MKHA 3FRZA 1SBRA 2DD8S 2V2KA 3MM5A 3OR1A 2W01A 4LREA 3W2WB 2CPHA 2GV1A 2MQNA 1FJGF 3IR7B 4ZP6A 3D0HE 2M5YA 3UDCA 2XZTB 3MWBA 6AT1B 4N56A 1HD1A 2Z57B 4F3MA 2RQMA 2ACMA 1FRMA 3P5TL 3R6GB 4N8NA 3ET6B 5IV4A 1JLGB 1YBAA 3U1LA 2GMJA 1ROFA 4KGMA 4DL4A 2O3DA 2GVDA 9RUBA 3R1HA 4RNOA 3KK2B 2PA3A 2VUGA 4FKXA 5B0CA 1MU2B 2HFUA 3BDEA 3I9V9 4O3PA 2F40A 2HQFA 3GFHA 3TVYA 4EUVA 4Y28C 3TJAA 3T5HA 3FKBA 3J7YU 3OL6A 2DGUA 2V4JA 1D3WA 2VG6A 3C8YA 2PC6A 3OTBA 4F04B 2MTLA 5I3UB 4BDPA 4AYBD 4QWDA 2BABA 2DTJA 1PILA 2PSZA 2YNIA 1LQ9A 2CPYA 1L5UA 2V63A 5HSPA 3GONA 3L7UA 1N6QB 2YPYA 4ECXA 1HI8A 4EFAC 2VZ9A 2AEMA 2FJEB 1T9UA 2IAJA 5G4DA 3D6MB 3R7BB 4B3RF 3X1LB 1HBUB 4QR0A 3IWXA 3QSIA 1KQFB 4JUZA 3TJ8A 3CF5Q 1XNRF 5CZVA 2IAJB 2ZBPA 5HMWA 1UVJA 3CJ5A 4F0MA 3NGKA 1TMMA 1Y3JA 2ABYA 2HZVA 1U1QA 3DLEA 1SJ1A 2GVDB 2CZ9A 2KM8C 3UD3P 3H40A 1KQGB 2R8HA 1N33F 2ZH9A 1FERA 4ES2A 4KHMA 1NZ8A 3MOJB 2VQFF 2DBBA 3RB0A 1CJKA 3JSMB 2ZKTA 1KQKA 3P6YC 1C1CB 3QPIA 3G8SA 4FF4A 2MJNA 1NAQA 2CPIA 4F2SA 4M5IA 4HT5A 3MPDA 3TZXA 4LRCA 4TKTA 5U47A 2R7SA 4MH8A 4YB7A 2CYYA 1XERA 2K3IA 2Z2ZA 3PW7A 2VG5A 2C2ZB 2QG9B 1YJUA 1U25A 1SQEA 2I5JB 2RE1A 2RILA 1U6FA 3H59A 3UW1A 3BDPA 3M30A 3QJLA 2R7OA 2QE5A 1HNVB 3I4PA 3SXLA 5ITHA 1Q86T 2LDYA 3M30B 2J0SD 2RRBA 1OPIA 3MCOA 3ICLA 3Q8YA 3ZO7A 1XQIA 4CTAB 2CJ9A 1FXLA 3R27A 2KFYA 2YWEA 5EHHA 3GG1A 3NCQA 3ZTPA 1JJCB 2R7RA 1S6OA 1J5OB 1TR0A 4J7CA 1QE1A 2BE2A 5E2QA 1FE4A 1TMJA 4F3QA 4DPOA 3KLHA 3SZ2A 1WORA 4JI3J 2HRUA 1C0UB 4I6WA 2R7XA 1K1QA 3VALA 1HWLA 2ZITA 2GJIA 2I2YA 2MQLA 3LW5C 3RW7A 5ETMA 5K8PA 4EWTA 1S1TB 2NSCA 5IM0A 4NLXA 1F1BB 3AAWB 2RU9A 1Q5VA 7FD1A 4X62F 2W7PA 1H3DA 2A0FB 2V6AA 2C1EB 4IOCQ 4V19J 2B0GA 3BR8A 1VQ6S 1Q16B 3DHXA 5KT4A 5DM7Q 4NL5A 1HI1A 2AJ2A 3LPEA 2EI5A 5F9NA 1NK9A 1XR6A 2GGPA 1RSCA 2LQ8A 4JI1F 3D66A 1JX4A 4DR6F 2ZOFA 1SXLA 1DTTA 2BE2B 2DGQA 1HYSB 1NM2A 3A8EA 3PRDA 1VIXA 5GAEI 3DXBA 3OTDA 3ENQA 4QIEA 3U7JA 2DISA 4ZK7M 1JXVA 2CNLB 4K2XA 5KT6A 5BR8J 3EYZA 1SL2A 1CJVB 3FBCA 2YX4A 3D67A 2GNKA 2V2ZA 4ZJLA 2AKWB 2E66A 5AE2A 5ETPA 1FKAF 5B0GA 1CS4B 2W2NP 4RW8B 4DQSA 2Y0SD 4F4KA 2WVBA 1FXRA 3OFFA 2BEFA 2OPPB 4RUHA 4EZ9A 2LP4A 3T1YF 5CYMB 3O8WA 2YNFB 3EXCX 2D41A 2OSQA 1KONA 2DEIA 3QQCD 3M6XA 2DNLA 3JS9A 1WC3A 3HVAA 4MK7A 3AD9C 3TZYA 3CB4A 1V9OA 1PCAA 2Y1JA 1MROA 1L3UA 3BF4A 1N32J 1CPZA 3EJMA 1YJ9S 3QLHB 1RTIB 3ENVA 4Y00A 2GAGC 4I1TA 2ACYA 4B9NA 1ZM3A 2ZZTA 2BVZA 2VDHA 3D6HB 3ZZRA 3C3LA 4WK1A 4NYZA 1CULB 4RBUA 3UPFA 1CJVA 1JLCA 1BQMB 1WUUA 3MEDA 4PXDA 5KG0A 3TW0A 2FJBB 2M9KA 3E01B 3EVWA 4Y2IA 1K8AT 1NMEB 2OAUA 2P6TA 5B7WA 3MM9B 4IH6A 1RAOA 3I0RB 1JLCB 1K0VA 4NZ7A 3NMAA 4QYZK 1GX6A 2W2PP 2BMBA 4A8YA 3BGRB 4H4MB 4I7FA 2BJ3A 3HHEA 1IJEB 1YIJS 2XEXA 4ZS6A 4C8NA 2YKMB 3FQLA 2IM0A 1Q53A 4WFXA 3UO0A 5L1LA 1RAEB 1FK9A 2V8PA 3T1HF 3BJYA 1VC6A 1QSYA 1M5KC 3NS5A 2YKNA 1RT4B 2HBZB 3M1VB 1B0PA 5EWGA 3CDUA 4ZVPB 2KVQE 1UKUA 3KMQA 2WB4A 1SQFA 3G86A 3H5SA 4KGVB 4OZJA 2D3UA 3OFHA 5I42A 2YWWA 2NPFA 1XMQF 4K4VA 1IKVB 2JLFA 2YQ1A 1NJXA 2XWXA 2V4JB 4DUZJ 3OLAA 1DY3A 1S6UA 2RF2A 4OYAA 5D77A 1RI7A 1S6PB 1RT3B 5A8RA 1S7IA 3D1OA 3RAQA 1KSPA 2OJ3A 2C42A 4NLOA 2J7UA 4O3NA 1UW9A 2B9YA 1U2FA 3OVSA 3RTVA 1SKWA 3Q2SC 2QEXS 5AE3A 3C16A 1QTNB 3P8BB 2RSQA 1ZETA 1VBXA 1Q7LB 2F8HA 1RHUB 4ZLLA 3CC7S 4OL8A 1H0HB 3KJQB 3CC4S 3T3FA 1VRUA 1IKWB 1JKHB 1A0OB 1PC5A 3K5OA 4WBFA 4R8UB 3K57A 5HP1A 2IYGA 1PGZA 1UEVA 2GZOA 1UWAA 1SC4B 4A47A 2QA2A 5IZHA 2J0XA 3K7RA 1FXDA 4OI4A 2MB0B 2A6MA 2AYEA 1X7VA 3UCUP 3DLGA 3P5BP 1KOOA 2Q79A 5C2GA 3GSDA 1S4EA 3KLFA 1PKUA 2QC3A 1TKZA 2X1GA 3DI6B 3VGSA 3TX8A 3F41A 4X4TA 3LGHA 4QR2A 2QX0A 1RBLA 2EFGA 3CJTA 1TZ0A 2FY1A 2PI4A 3DM2B 2VBZA 3DFEA 3OXGA 1J5EF 4NRUA 1T9XA 4RUCA 2AJ4A 3KLEA 1RU1A 1QAIA 5F0WA 4F3OA 2GIQA 4I4BA 3UI3A 2YY3A 5CQGA 3AD7C 1N54B 1SKSA 5DGBA 4WFBQ 2F63A 1LW0B 3DRXA 3NAIA 3M32A 4P72A 2VBXA 4C0BA 1CLFA 1S79A 1V3SA 3NBPB 4KFBB 2GS8A 4J37A 3W63A 1P8GA 1YZ6A 5DRKA 4L76A 3X3UA 3Q86A 2W9BA 4CO2A 3BGOP 4EBEA 2NXCA 3IAM9 3SSRA 2V2VA 1DLOB 4AFFA 5BXIA 4FS2A 4IR1A 2LXIA 4ZVFA 4DV3J 1JLAB 4EZ6A 1M1GA 4JV1A 2DHHA 1FT8A 2HSEB 1NO8A 2J5AA 1URRA 3NCPA 1NH8A 4OV6A 3MM6A 2UVRA 1FF2A 3I32A 2UUCF 1HNXF 3HCXA 3SCIE 4LSZB 1XN9A 4DR7J 4WTYA 2FHJD 4LFAF 2NZ4A 2XGQA 1D9FA 3TJ9A 4RU9A 1WKLA 3A8IA 1X5OA 2HLUA 1IR2A 1VCTA 2JX2A 4L73A 1TL1B 5HO4A 3RBEA 2Z4PA 4O44B 2G0IA 1ZA2B 5KOXA 5AXNA 4XPEA 2CAJA 3CJKA 4G1PA 2EBGA 3BREA 4HT7A 4LF1A 2X1FA 1NXIA 2FHJA 1LWEA 4DOZA 2MQPA 3CCWA 4GVBA 4HVZA 5A0YA 4DSJA 2XLJA 4LUBA 2MLZA 1EKSA 1LWCB 2I8EA 2OMLA 4C98A 2ZH8A 1F2GA 3M8PA 4MKYA 1B0VA 2R4FA 2WB1D 5CCMA 3OR2B 4OI3A 1DJ0A 4RLEA 5B08A 4UY85 3M8ZA 3M8PB 4F8RA 3OQ2A 1JJ2R 1RJJA 2LMIA 2ZJPQ 4PG5A 4KQZA 2G2ZA 2JOQA 7AT1B 2BE7D 2GAHC 2HHUA 2LU1A 3M6VA 1H7WA 4M5JA 4C11B 4UZCA 3Q22A 1RTZA 2HVIA 3MMCB 5KFRA 1T9TA 3I9ZA 1X4HA 1W25A 3E3XA 1RKIA 3H90A 3QNWB 2XI3A 4KYZA 4LBIA 3CJKB 2APOA 2XYGB 1RADB 2N4DA 3CIMA 4CLSA 3TR5A 4JV2A 1YG0A 1D9AA 4C8YA 3FRYA 3T6BA 1NHUA 1RAHB 3MAAB 3W1YC 2DR9A 2COLA 4DL6A 2MLYA 1NK5A 1NEEA 1YVFA 3MAAA 5D4LA 2ZHBA 1RB0A 4FXDA 3KOAA 1DARA 3ULHA 4RNHA 4IO9Q 5L9XA 2BYCA 4B3TJ 5HVHA 4FF3A 4F4YA 2J8AA 1GXLA 2L3MA 2DGTA 1YWXA 3ISNC 1UETA 2WVEA 1F60B 2HRYA 2KDOA 3FSXA 3R3TA 3VTIA 2HAFA 3NP5A 4DCJB 1X4DA 2YQ3A 3NY0A 3CCLS 2H48B 5F3ZA 3UDLA 4DX7A 2DR5A 2HBRB 2CWXA 5J2MB 2IJRA 3VGTA 3KLGB 4I7FB 3GIJA 2LDIA 4JI0F 2YKMA 5DM6Q 1Q79A 4DX8H 4OX9F 2DH9A 2XY5A 5KFUA 2MY7A 1D09B 1X4AA 4P52A 4U95A 3KLGA 4I2QB 5J2NA 4LFCF 3MCMA 1R43A 1RDRA 1JLEA 2LVWA 4JI2J 5HROB 3M8RA 3D7SB 1NZAA 5J2NB 1VQ4S 4ECZA 4WU2A 4OV1A 4HDGA 2RUGA 2ILYA 3RBDA 2FPHX 4KRWA 3DMJA 1VLOA 4J9UE 3QGHA 1NU4A 3ZXWA 1W2IA 2RDIA 1VIOA 2JDJA 5D0EA 3ZTRA 1RGVA 3OTOJ 4PQUA 3KDOA 1FWPA 2R7VA 2MZRA 2XGPA 1HR0F 2KVIA 3AT1B 2BJEA 1PJ6A 1OIAA 4KHRA 3UDVA 4AQYJ 1U48A 4I68A 4NPOA 2AQ4A 3Q8UA 4IQXA 3AOCA 4ZPBA 4LFAJ 3MEGA 1M5HA 1NRKA 2B5JB 3JQJA 1S0VA 5H9FK 2ZBCA 1LFPA 2BM0A 4X84A 5ETVA 4KPCA 4NXMF 3PKMA 1RTDB 2GIFA 4YOEA 2XS5A 3VAFA 1XR5A 3AJ2A 2B6AB 4NYOA 1T8EA 2UUAF 4FKYA 2DRBA 1VQKS 3B78A 1WJ9A 2BQ3A 3ENWA 3VZHA 1K73T 3RYLA 2ZKUA 4S0MA 4RUAA 3BQ1A 1S76D 3HKWA 4CLZA 4IG0B 2HGLA 2ZVSA 4KT0C 1KD1T 3HK2A 3TVZA 5KFDA 2C2KB 2C3PA 1N0UA 3TZZA 2ZBIA 4PXBA 4IDKB 4TVAB 1FJEB 3BGUA 4L74A 1HBMA 5ETNA 2BQRA 2JFDA 4K59A 2YNGA 5J1EA 1Y5NB 3J7Z5 2F65A 3OL8A 4QBUA 1U47A 2Z58B 4ELTA 1UJ5A 2AF6A 4K5RA 3NNCA 1U8SA 2I6WA 2E1CA 7FDRA 2LEPA 1RTDA 3TYTA 2KTQA 3MM7B 4J91A 5K9FA 4MMOA 3EZOA 3T9ZA 4DN0A 1OQ6A 1L3VA 4GKJF 5G0RB 3SIPB 3AD8C 1NDCA 4TU8A 5D0GA 5IXUA 1YKWA 1K0TA 2E1MC 2JRSA 2KYZA 5E41A 1HHQA 1QAXA 5LL6d 3RW6A 4IG0A 3Q8RB 3G6XA 3CCQS 1IXKA 3IM8A 2EFPA 1ICEB 1KHVA 2XMMA 3B54A 4GO5X 3W2VA 4RW4A 4N7TA 1JLAA 2DEJA 4USTA 2L41A 1M90T 2G0JA 4I64A 2ZH5A 2CXEA 2DXFA 4YB6A 3WC0A 3DOKB 2M4MA 3MZIA 4PQAA 1HNWF 4P7TA 3W2VB 3HPOA 2HQGA 4R25A 3MUTP 2F4VJ 1Q1KA 1IKYA 1WELA 2YWHA 4NLVA 3SDEB 3US5A 2DPJA 2B7CB 4R5PB 2JL9A 1WKJA 2J6UA 4XTTA 5H9FJ 4G65A 3QGIA 5FDLA 4EEYA 3MMBA 1FVSA 1WHYA 2X1AA 1HW8A 4OHWA 2DR8A 3D4JA 1TL1A 5A6WA 2RMLA 2CDRB 3OV7A 3QWPA 4JOUA 3HSZA 1FJCA 1X60A 1JIHA 3AQPA 3H8YA 4NEYA 5DO2A 2CJBA 3AB2B 4F67A 1V3RA 1PBAA 4ED4A 4ECWA 3C14A 2B9EA 2D1CA 1GXUA 3PFOA 2E7XA 2M70A 1WEXA 2QSWA 2XNRA 4IOBA 1Y10A 3QIPB 1NB2A 4OYWA 2OFHX 3JAMU 3MCNA 3GFZA 3OUYB 4F4WA 4ED0A 4MIWA 5F3TA 1QSSA 1UWBB 3AH6A 4AT1B 4ED5A 4J9PA 2BW2A 1RTJB 4GMKA 3UN5A 1JB0C 2ZC3A 3HLUA 1UWBA 2R2RA 3OTOF 2RDJA 2DNKA 4WFNQ 5FDLB 2ZH2A 3NWRA 2VU5A 3H25A 2MYFA 3GIRA 3OXFA 2HW3A 3AJDA 1XEZA 2OO4A 1EAYC 3CGIA 5D4OA 1KC8T 3VWSA 3ZC4A 3KTQA 2RB7A 3PYGA 3LALA 5IS2A 4K5SA 2BANA 4OYIA 1N52B 1T9YA 2VHGA 3AY0A 4JI2F 4UQGA 2HHXA 1Y3KA 2PIIA 1AROP 5GMEA 4QWAA 1LW2A 3CE8A 3BN4A 3DRSA 2HIYA 3R5BA 1E6VA 1VMBA 1WSRA 1KLMA 3PJXA 3QAUA 2V0NA 3KK3A 3V5RA 1LWXA 3DOMA 2HNDA 3O6QA 4JI7J 2BV3A 2CZVC 2BJ7A 4DBQA 3F73A 2DGSA 1RAAB 1Z1ZA 2HFOA 2IJFA 1HMVA 2H3EB 2OD4A 4KBIA 2CQ4A 2GHWA 2AZ3A 3EWGA 4ZPCA 3ILOA 1U1RA 2DK2A 3T9NA 4ZCKA 2PMZD 1R0AA 2MY8A 2H4YB 3OT9A 1NH7A 1FI4A 4HI2A 2DO0A 3QT8A 3W66A 1VHIA 3NGRA 3MR2A 4RWWA 4ZLPA 2XMWA 4P10A 4B02A 3R5JB 1RT7B 2HS4A 2HBQB 3IM9A 1R0BG 4ZLJA 1U1MA 1S0OA 3CD5A 1X8DA 2IRYA 3OTEA 1SJQA 2DXDA 2E7VA 4KO0B 2EVZA
chains in the Genus database with same CATH topology
2J9DE 4KKOB 1Q8BA 4CI0B 3SV3A 2NREA 3TOQA 3DRYA 4GC6A 2O67A 3DNCA 1N5QA 3OHBA 2UV8A 3FSYA 1FKOB 2MQMA 4LF5F 3TARA 4XDCA 1VC0A 1JLQA 2VQEF 3DHWC 5D4NA 2B9XA 3M9OB 4RW6B 3H5YA 4DSIA 1VBZA 1FKOA 3ONQA 1SH3A 1KFSA 2BRLA 3MTJA 4LQ9A 4WFYA 1JLQB 3KLIA 4YB5A 2KG1A 2CIMA 5BJRA 2UZAA 3BQ0A 3T5LA 1ZTWA 2P5VA 2R8GA 2JFKA 2MKJA 3O2IA 2R2SA 5C24A 2YKAA 5EGYA 5IT4A 2DO4A 3UQSA 2FLOA 3HT3A 3PW5A 3PEHA 3M9MB 2HHWA 3IN5A 5AJ3F 3IRWP 1VJWA 3AJ1A 4DDFA 1CG2A 2KZMA 1G2EA 2P9CA 4RU2A 4J9SA 1WF2A 2WRMA 3DLHA 3M2VB 3CDAA 4C2MA 5HLFB 4NCAA 1SJFA 1P9QC 4DFPA 2ZD1A 3TAMB 1KS2A 1BY9A 5KG1A 1P6TA 3CVKA 1V3ZA 3CJ3A 1Y0HA 3GR0A 2VBWA 3N5FA 4IH5A 1F5BA 3MMJA 4ELUA 3KLIB 1S1VB 2CG4A 2EG1A 2XMVA 1HWUA 1DQ8A 4MKAA 4NA1A 1DZ5A 1WG4A 1NK8A 1TAQA 1RISA 4IUFA 1IKXA 2NSBA 5AE1A 2VKRA 2B4PA 1ULRA 3QJJA 1DAXA 2HQ3A 1R6YA 1CQMA 1VS3A 2A3JA 3DDNA 2OKQA 2C3YA 3TANA 1LXNA 4QU7A 1B64A 2XLKA 3MM5B 3OR1B 1N36F 5B0EA 1KR4A 5HL7Q 1CEZA 2J9EA 3Q0AA 4JI4F 3H2LA 3TAMA 2AJ0A 2HNYA 4V19X 2XMUA 1ZM4A 2M8HA 3TNVA 5FD1A 4A8QA 5SUHA 1N5YA 2XBPA 2E9ZA 2AX1A 3FMBA 2XULA 2Z2LA 3LP0A 5KFAA 1QUPA 3SCLE 5J2MA 4XAKA 3MMBB 1U1NA 4A8OA 1B7FA 2HGNA 4WCEQ 3MTKA 4F2RA 1BQNB 4B9VA 1LWFB 1REVB 5KG4A 4NLDA 1N0VC 3DRRB 4GO7X 1X0PA 1OSDA 4QIGA 4I2PA 1HBUA 2W7OA 3QIPA 2JHEA 2C28A 1I1GA 1MMLA 3BR9A 3CJ0A 1WEYA 4PG6A 5DQGA 4C8LA 2C2RA 3QGGA 1S49A 1RTJA 3I5BA 4QU6A 1N5YB 2JVRA 2FB0A 1DFDA 2FIUA 3AA9A 2F1FA 4DUZF 2VFTA 1T7PA 1YRXA 5KFMA 4YFUA 3MR3A 5KFOA 2WCXA 3TA1A 1T94A 4X66F 1R8PA 2FVRA 5D78A 2CZ4A 1D9DA 4J9LA 1S6QB 4EO6A 3DRRA 1MWYA 5JUMA 4QWBA 3ZZZA 1VQYA 1SH2A 2XY6A 3KK3B 4QR1A 3SSSA 2NR0A 3D1QA 5E3PA 4DG1B 2KFZA 2KJVA 1L3KA 4OJ3A 1HQEA 2KXFA 2Q43A 2DNMA 3MCSA 4B9UA 4JYAF 2NUHA 1FRKA 5KFZA 3BO3A 4ATNA 4DR3F 3ZZYA 4TY9A 3CCUS 2BOPA 2G9OA 4DQPA 3DLBA 5BYRA 3PX0A 3QJPA 1T03B 4J9NA 3ISZA 5L1JA 2YX7A 5JJBA 2KI2A 1FVQA 4OHVA 5MAOA 2OD6A 3JSRA 4ES1A 4G6VB 4UW2A 1R7IA 2VFRA 1X4FA 3QO9B 4F25A 3FSIA 4QYRA 5KFKA 2KFNA 5IT0A 4N8OA 5AXLA 3G6ES 3K8VA 3BSCA 1UAWA 1G7CB 2KN4A 2U2FA 2E29A 4OZLA 4DG1A 4M1KA 3LP1A 5KFPA 5E3AA 5E33A 1H38A 4CZCA 1RWUA 5T14A 1UVIA 1JLFA 4IFYA 5DLGA 5IM0B 2PE8A 3M4XA 4OJ1A 4CTAA 4OI1A 1HD0A 1DHMA 3OPKA 2WK4A 1S1XB 1Q82T 2HHVA 2QLWA 4ZPAA 4BC7A 3VZIA 1S1UB 5AXMA 5D3GA 1Z4UA 4CO1A 2HWTA 2DIVA 3JSYA 3QO9A 2DNYA 4RW9B 5E7OB 1DTTB 2HFNA 1S0NA 3PXGa 3S7RA 2BM1A 2F8MA 4DL5A 5D6GA 3PO5A 4RW9A 1CC8A 2KRBA 3OJSA 4DWIA 2J6SA 2OPSB 2O1PA 4NCGA 2N7CA 1L3TA 3THPA 1ZTTA 2IA6A 2Z8QA 3HVTA 3LH2S 4U9RA 4DQRA 2L08A 2GMHA 4NCGB 2IHR1 3QWUA 2BACA 4YY3F 3M6WA 2EFQA 2J7WA 3LAMA 4X65F 1R31A 3D0IE 1X5PA 3E51A 2MGZA 1U1LA 4A8FA 2VH7A 3DXSX 4AXJA 3PY8A 5LXYA 4JV5F 1YITS 3KJVB 3N9UC 1HL6A 4D3HA 5KFVA 3KG1A 2CJAA 4OQJA 1JLBA 4ICLA 1WACA 4H4KC 4NWBA 1I6JA 2L9WA 4IO1A 4EBDA 2HHSA 2N82B 3Q8PB 1M5SA 1P1TA 2IC3A 2MQQA 3OLBA 2ASDA 3LQVA 4LMZA 5C42B 2F3JA 1DBDA 2CQBA 2B4OA 1U6ZA 2MGZB 2AGPA 3NKYA 1OPZA 2GIRA 2HWHA 5SZTA 4YR3A 3I0SA 3NS6A 2R7UA 5C42A 1RTIA 5CYJA 1YJWS 2NLWA 5E0OA 1RT4A 3M1VA 4AQYF 2V5HG 3IAS9 1YRUA 3M8QA 2IMWP 1HYSA 3JAMY 3O1LA 1BQMA 2V4QA 4ZP7A 1Q4RA 2QLXA 5HI7A 3GFYA 3IR5B 5DS7A 1HPZB 3LF0A 5M2PA 3P3DA 4JV0A 4DR1F 2UXBF 1KN6A 1FNOA 2RF2B 2V9WA 4WFZA 2ZH1A 2U1AA 2D7SA 1PO6A 4N47A 4DFKA 2ROPA 2B51A 2MZSA 3EPGA 2CJQA 1VQLS 3RB3A 2LU2A 3DLEB 3GR1A 1BWEA 1IKWA 5FJ4A 3DOLA 4UOCA 5E3CA 3NGDA 5I42B 1IKVA 1SIZA 2IA0A 2WSEC 1S99A 4OX6A 2EBEA 4KIAA 4XK8C 4RZRA 2BRKA 2ZHOA 4B9MA 4EU0A 2JH3A 2W4PA 3SSQA 3DLGB 2HHQA 2QSFA 4AXIA 4A8KA 1TKZB 3DI6A 4H4OB 3SV4A 3PW2A 2OIHA 2UUWA 6FDRA 2CQIA 2DNZA 4PRFA 3CUNA 3BGRA 4MYTA 1CC7A 1Y7PA 3BO4A 4IR9A 5KFEA 4G1QA 2KT3A 4YHHF 1DTQA 2CPEA 1R8HA 2CQPA 1HQEB 3C2PA 3PHEA 3U1NA 2FVCA 5GMKa 4WXOA 1MNEA 2PFFB 3FGVA 5KG5A 5FLXY 3CO9A 2E9RX 4A46A 1Q8LA 2XSJB 2IFXA 5A8RB 1QE1B 4E0DA 3ITHA 4K4WA 4LQ3A 3TUZC 3QYYA 4LF7F 1QJHA 2V8VA 3VAHA 3SCKE 3NMRA 4CCHA 3ITHB 2ZC4A 2ZJQQ 3CD0A 3DCAA 6FD1A 1VRUB 2LYVA 1BD6A 3PEJA 1F5AA 1RT5A 2VOOA 4Y2MA 1U24A 3G9CA 5DQHA 2V8DA 2DGXA 4ZCMA 4A8MP 2HVZA 1S1XA 1X0FA 4K50A 1TFWA 3UWTA 2RT3A 4WZMA 1S1UA 2D74B 3UCGA 5CH7B 2CQ2A 2FHMA 1NJZA 3PW0A 4ITSA 4DR7F 1TV6A 5A0YB 3H2VE 1J5OA 2I38A 2PMHA 1CQNA 3KHHA 4K0KF 4CT9A 1HBOA 3N6NA 2F9JA 3PIPQ 3KLHB 2VG7A 3HVRA 4K4SA 2HNZB 1GNKA 2DNHA 4HDHA 1C0UA 1FRXA 4HTJA 3H20A 3I82A 1JWWA 2WBRA 4I69A 2JEFA 4PWDB 4N41A 3I5AA 2DNRA 3H4BA 4QZVB 4N76A 4NX9A 3OXLA 3CCJS 4Y6IA 4Q5VA 5A2QY 3N79A 2E5GA 1QVGR 1G3OA 3CJ2A 4DQIA 1GXTA 2G0CA 4USHA 1XMBA 2JEJA 4Q43A 4A4JA 1FE0A 2V8GA 4WIIA 1Y5LB 1FRHA 2AJFE 2HPUA 3KHRA 2C3OA 3OR2A 2OFGX 1N5SA 1TAUA 1IM4A 2HHHF 3UCZP 2RNEA 3NRBA 4JI5F 4C8ZA 2X51A 4P6QA 2I9SA 2FJAB 2K1RA 3E2EA 2IM3A 3F44A 2A18A 2LA6A 3SFGA 2FGOA 4B3OB 2Y1IA 2IM2A 4RNNA 5EDWA 3Q23A 1H98A 1LK7A