3CCMS

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2611u
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
81
structure length
81
Chain Sequence
SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
total genus 20
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ccmS00
3H2UB 1YJNS 3CCRS 2CQBA 2MYFA 1WTBA 1WF1A 1FHTA 2KG1A 4TU8A 4ED5A 1OPIA 5D77A 2AYEA 1U2FA 1AUDA 4CH1A 1U1QA 1NU4A 2L41A 3THPA 3P3DA 1WI8A 3R1HA 1PGZA 3UE2A 2DH7A 4EGLA 5CYJA 5ITHA 2CQHA 1U6BA 1VQ6S 4P6QA 2CPYA 3SXLA 5LXRA 1WHWA 1HA1A 4UY8T 2YWKA 1FO1A 2E44A 3TYTA 5JVGQ 5DDQC 2D3OR 2DGXA 4C7QA 1IQTA 1VBXA 2AYBA 5LSOA 1PO6A 3SMZA 2I38A 1UFWA 3CC4S 3S6EA 2LECA 2HVZA 3I56S 3G8TA 3U1LA 3G4SS 2I2YA 2EK1A 3CD6S 2DK2A 1X4DA 5HL7Q 2BZ2A 5GADU 3CMAS 2MQLA 1WHVA 5JVHQ 1A7GE 4QU7A 2CPIA 2DO0A 1H2TZ 1VC5A 3VAHA 1M1KT 2FHOB 1JMTA 1YITS 2A3JA 4CQ1A 4QPTA 2FC8A 2FY1A 1RK8A 4OZ0A 2OTJS 1SJQA 2K3KA 1HL6A 4QU6A 2FPHX 1WI6A 4IOAQ 4U67Q 3MUMP 2X1FA 3BEGB 3PIPQ 5LSLA 1N52B 2M9KA 2DHSA 3CCVS 2SXLA 1X4EA 2LA6A 3CMES 2Q79A 1R8HA 5D78A 1Q82T 3CCES 2YH0A 4WCEQ 3CF5Q 2QFJA 3BO3A 3V4MA 2DNRA 4RU2A 1ZH5A 3JB9k 2KYXA 2CQGA 2CQCA 2J76E 3MD1A 2QA4S 3MOJB 2CQ3A 2OSQA 3PIOQ 2RS8A 3Q2SC 2MZRA 2MZ1A 3MURP 3CCMS 5IFMA 2L9WA 4IUFA 3CULA 4PKDB 1FJCA 1VQOS 2RS2A 1NO8A 2RUGA 1P1TA 3BO2A 5GMKa 1YHQS 1X4HA 4YB1P 1YTYA 2MZTA 2PE8A 3CPWR 2F9JA 2M4MA 2KU7A 2DISA 3B4DA 3P6YC 3S01A 5GAGU 1SJ3P 5H1SV 1VQ7S 2KXHA 2J0QD 3CC7S 4C0OC 1S72S 4WFBQ 1U1RA 1K73T 1P27B 1VQ4S 2EK6A 1H2VZ 1L3KA 4W92B 4LJMA 1VQMS 3U1MA 3CCUS 1VC6A 2MQOA 3CTRA 5CXTA 2DH9A 2AD9A 3VAIA 1ZZNA 2LQ5A 1NJIT 2MKHA 2U2FA 2V94A 1X4AA 1X5SA 2E5HA 3G6ES 4QQBA 2RQCA 2VODA 2B0GA 1M5VC 1VQNS 2CPZA 1M5OC 1D9AA 2HGNA 1N8RT 1VQKS 2DNNA 2F9DA 2DNYA 3UCZP 4Y00A 3VAKA 3MI7X 1VQ8S 1WEXA 2MQNA 3CC2S 1DZ5A 1QVGR 3BS9A 3S8SA 2LXUA 2CQIA 2JX2A 2MMYA 3IWNC 2MSSA 1WG4A 3VAJA 1YWXA 1M90T 2G4BA 2XS5A 2OSRA 2XS7A 1FXLA 2OJ3A 1KD1T 1WG5A 3THTA 1U1PA 1DBDA 2G1DA 4OZ1A 3VF0B 3UD3P 2M0GB 3LQVA 3MD3A 1Q86T 3DXBA 3G71S 2E5IA 4WIIA 3BO4A 4LMZA 4W90B 2ZJQQ 2MKSA 5DETA 2J8AA 3CCSS 5GAHU 4F26A 2DGOA 2LXIA 1URNA 2RRAA 2J0SD 3HHNB 1WF2A 2KHCA 2ADCA 1U1NA 2BOPA 3NMRA 3TP2A 4IO9Q 3UCUP 1HD1A 2MQMA 3LPYA 2DGUA 2DIVA 1H6KX 1ZZFA 2LEAA 1WHYA 2XS2A 2CPDA 2MPUA 5DDPC 2PEHA 4IOCQ 1X5PA 3SDEA 3FEXB 1HD0A 1YI2S 1X0FA 2JWNA 4TLQA 2HZCA 2DGQA 5IM0B 2ZJPQ 3K0JA 1VBZA 1WEYA 2DNZA 2MXYA 5MLCV 4WF9Q 2OTLS 2DNKA 3ZZZA 1WF0A 2MHNA 3MXHP 1KC8T 1QVFR 2M8DB 2X1BA 2CPFA 2AYMA 3MUTP 1WG1A 2MB0B 2CPXA 2KRRA 1SJFA 1RKJA 1CVJA 3TO8A 2LA4A 3CCLS 2KM8B 2HGMA 4WKRA 2F3JA 3G9CA 2DIUA 2LYVA 4CIOA 2KI2A 3P49B 1VC0A 4A8XA 1N54B 4YOEA 2MGZB 3RW7A 2MKKA 2VOOA 3R1LA 1FJ7A 2OIHA 2JVRA 1FT8A 3CCQS 2KXNB 3UWTA 1YJWS 1G2EA 2CQDA 1U1OA 1QM9A 2GHPA 4LIRA 1UP1A 2ERRA 2M8HA 2CPJA 2DNLA 2XSFA 1YJ9S 2LEBA 5HO4A 1D8ZA 1K9MT 2DB1A 5IM0A 1KQSR 2HGLA 4TU9A 3J7YU 3VALA 2MJUA 2G0CA 2CQ1A 2M70A 3EGNA 2M2BA 1X4GA 2QEXS 2DNGA 2KT5A 2KH9A 5CA5A 4FXVA 2EVZA 1U1MA 1VQ5S 2DGVA 3L3CA 4F02A 2KXFA 1JJHA 2JRSA 1BY9A 5GAEU 2K8GA 4PR6A 2CQ4A 3OW2R 3NNHA 1JJ2R 2CQ2A 1M5KC 1OIAA 2DGTA 3IRWP 1FNXH 5DM7Q 1KOOA 1U6FA 3UCGA 2M88A 2DHAA 3MUVP 2MZQA 2UP1A 5LJ5Y 1XN9A 2YKAA 2MZSA 2M7SA 4YUDA 2RNEA 2VOPA 2JVOA 2MKIA 2DHGA 2LKZA 3SDEB 1VQPS 3NNAA 3ULHA 2X1AA 2E5JA 1S79A 3I55S 1F9FA 2MY7A 3NS6A 4M5DB 3VAMA 1W2BR 1X4FA 2DH8A 2DNPA 1H2UX 3CCJS 1YIJS 5DDRC 2E5GA 1U1LA 2DHXA 3VAGA 2FC9A 2DNQA 2RRBA 2DNHA 1SJRA 5BJRA 1R8PA 2D9PA 1Q7YT 3G96A 2DNMA 4F25A 1O0PA 2DNOA 1VBYA 4WFNQ 2CQPA 2VONA 2YH1A 4Z2XA 1UAWA 2MSTA 1SXLA 1N88A 2KFYA 2N3LA 1DRZA 4V19X 2GO9A 2KVIA 3CUNA 1JJ4A 2RU3A 1WHXA 2KN4A 2HYIB 3H2VE 1B7FA 2LCWA 1SJ4P 2KRBA 1K8AT 1VQLS 2YTCA 4BS2A 4FXWA 2KM8C 2XB2D 2AYGA 2U1AA 3FEYB 3P5TL 5LJ3Y 2CPEA 3HI9A 2D9OA 4ERDA 1FJEB 2DITA 2NLWA 1OO0B 2NZ4A 1A9NB 2XNQA 3CXCR 2ADBA 2DGSA 2L08A 1KOHA 3US5A 4ZKAA 3N9UC 5DDOC 3DLLQ 2MJNA 1UW4A 1X4CA 5FJ4A 1DHMA 4J5OA 2M52A 1X5OA 2LMIA 2X1GA 2MY8A 2N7CA 3B4MA 3ZZYA 2N3OA 3NNCA 1VQ9S 3UD4P 2DO4A 2MKJA 3J7ZT 3EGZA 1WELA 2O3DA 2MQQA 3NS5A 2MGZA 2XNRA 2CJKA 1X4BA 1Q81T 2MZJA 3EX7B 2RQ4A 2CQ0A 2DGWA 1M5PC 2RT3A 1WWHA 4C4WA 2MKCA 3R27A 4CH0S 2N82B 3S7RA 1WEZA 4WFAQ 4Y0FA 2WBRA 2KG0A 3Q2TC 5EN1A 1X5TA 3MDFA 4PRFA 5LXYA 5DM6Q 2RVJA 3G8SA 4UQTA 1U1KA 3VAFA 4TU7A 1OWXA 3D2WA 2ZJRQ 3RW6A 2CPHA 5IQQA 5GVQA 2MQPA
chains in the Genus database with same CATH superfamily
4MT1A 4DSJA 2K1RB 2YKMB 3CCRS 1RAEB 3CDBA 4CO3A 4UZBA 5B0EA 3I9ZA 1T03A 5AJ3J 1UFLA 3MMAA 1GEHA 5IC6B 5ADZA 2FTRA 3PV8A 3VGTA 1VRQC 2RQKA 4TU8A 1IKWA 2OLWA 2E7WA 3FK4A 4ELUA 1OPIA 3H90A 4HDGA 5H9EJ 5D77A 2AYEA 2JEIA 4MIBA 1R89A 1LKZA 2HFVA 3M6UA 4DCPB 4JBCA 1RAFB 3UR0A 4RNNA 1AUDA 4PQUA 4JI8F 1WI8A 4IH6A 4GC6A 1ZAVA 1UL3A 4KH0B 2DH7A 3PY8A 2NREA 1ICEB 2W9BA 4A46A 1TU0B 2BE7D 4FDFA 4LF2A 4TYBA 2CQHA 4AQYF 1Q5VA 2BJEA 3J80Y 1VS3A 3PG9A 4RJVA 3GE9A 4P6QA 2CPYA 3BJYA 2AEFA 4HLBA 1RQ0A 3PRVA 1UKUA 2C3YA 1WDDA 5E3CA 4QYZJ 3ENWA 1C4AA 2EFNA 2D69A 1W26A 2R8JA 3J7AN 1V3ZA 2E44A 4OV6A 4OI3A 3SFGA 3TYTA 1Y11A 4EWTA 2IHR1 2DGXA 2D3OR 1IQTA 1VBXA 2FGCA 3Q83A 4QWCA 1CJVA 4AXIA 3W9IA 3SMZA 4IQMA 3CDWA 3FBEA 2UUCJ 2GX8A 3ADAC 2IMWP 3J81Y 3DMJA 4KY3A 3EDQB 2UXDJ 1N5QA 2CADA 3HPOA 2I9SA 2XMKA 2RU9A 1IBLJ 2R2SA 1IWAA 3G8TA 5CD4H 3ISZA 4R0JA 3H59A 4Q8FA 3TEHB 2XWXA 3JSBA 4PXDA 4JI6F 2W8KA 4NLOA 2I2YA 3C15A 4WU3A 2X51A 5L39A 5J2MA 4DSKA 5HL7Q 1AFJA 4Q8EA 3AHPA 3CMAS 4K4UA 4O3PA 1BWVA 1IR1A 1D09B 1Y7PA 1R3NA 2FQQB 4CZCA 3TOQA 4RUCA 2CPIA 3M8SA 1VC5A 3UVJB 3KXDA 3M6WA 3W2WB 3KKFA 1DURA 4DR5J 1WORA 4DS5A 5HP1B 3K8WA 4J9UE 5J2QA 1ZBTA 2GVDA 1TL5A 2CZ4A 3D0IE 1YZ6A 2FC8A 4ANCA 1XTZA 1LW2B 3EZOA 4FBUA 4OZ0A 2MDAA 3OPKA 5C42A 2ZM6F 4NXMJ 4DG1A 7AT1B 3CDUA 1TELA 1WOSA 3MECB 4OYWA 4ECVA 1F1BB 4ZVPB 1CC7A 1PJ7A 4DR6J 4QU6A 1GX5A 3QZ8A 1FXDA 4R0EA 2VPYB 2X1FA 3QJPA 1KLMA 1KNZA 5J1EA 5LL6d 4DL5A 4B02A 3HSGA 5LSLA 2M9KA 5HMWA 1F0XA 2H3EB 2HWTA 4USHA 1EJ7L 1S9EA 1UMJA 4CLWA 2UUTA 3CMES 1RTIB 2GZOA 2QGFB 3ZC4A 1NKBA 4IRCA 3PTWA 1J5EJ 3DHWC 2PSZA 4UUWA 1Y0HA 4MKYA 5KG2A 1R6VA 3CEDA 2CZ9A 1FX2A 3OQ2A 4QR1A 3CCES 3RB0A 3BO3A 2JEGA 3RB3A 5K14A 4ELTA 3DLEA 1OQ3A 2G2ZA 3Q86A 1IKVB 3GSIA 4IDKA 4DHVA 4K4VA 3UDCA 4CLLA 1HR0F 1RB0A 1Z1ZA 2J76E 2FLOA 3CDEA 1HWUA 1MU2B 1TUVA 1LWEA 2W2MP 2YNFA 3MD1A 3AD7C 4PCQA 2OFGX 4NLTA 3PDNA 5AJ3F 2GGPB 4DF8A 3DRSB 4PWUA 4IG3B 4E2FB 2ALZA 3RRHA 2QT7A 1T05B 4LF5J 2RJZA 1FRLA 2XI3A 4CTAB 2HQFA 3K5NA 1R0AA 5I42A 3MAHA 4M1KA 3QRRA 1T05A 4CRJA 1R8CA 2LU2A 4DR3F 4KRWA 1EP4A 1PBUA 5GMKa 1RT6B 4A8WA 1X4HA 3O8WA 2YY3A 1TKTB 1LWFA 5A0YA 3QJJA 2NPIA 4Z7YA 3MPDA 2P2CB 1IWGA 5HI7A 2ZZMA 2M4MA 2NXEA 1I51B 1QDUB 2DISA 2G0JA 4ICLB 3PKMA 3S01A 3R5BA 4O3RA 4RBVA 5ETPA 4F0MA 4CO1A 3RU0A 4LRDA 2XBPA 2F4FA 3QYYA 3GB0A 4C0OC 2XSJB 4DLEA 4ZN1A 4GO5X 5ETNA 2EK6A 2BM1A 5LMUF 1XMBA 3EVOA 3RBXA 3TWZA 3DLHA 1GMUA 4JYAF 2UXBF 1MN7A 2QFIA 3Q8YA 4USVA 4M95A 3RZAA 2W9BB 3BBBA 4DSLA 1IUJA 5B0DA 1LNQA 1WC6A 4OYOA 1YIJS 3CTRA 4FPRA 1DQ9A 4OJHA 4GKJJ 4PXCA 3HT3A 4NOHA 5AE3A 5M2PA 3D5MA 3BDPA 1EQMA 3GFZA 2V94A 3ENQA 3V81B 1DQAA 1X4AA 4G1IA 4ECWA 2EXUA 2ZFHA 4A8KA 4B9VA 3C14A 2PN6A 2ACMA 4RWXA 3M9NB 1MMDA 2RF2B 3Q89A 2RQCA 3K5MA 4IH5A 4DR1J 2BDPA 3IMQJ 5AXMA 2QMXA 2CPZA 1U0SA 3RAQA 4NI2A 4KPYA 1VQNS 3NKYA 2H5JB 3AQPA 3GV5B 5IWAJ 3N6LA 5HJYA 4OI0A 2F40A 1TL7B 1IR2A 4B3RF 2QMUB 3RGIA 2F9DA 2OI2A 4UUXA 2G2OA 1S1UA 5H9FJ 4ZITA 3IG1B 4LT6A 3VAKA 3MI7X 1WC1A 3I9V9 1WEXA 3R7BB 2ALYB 3CJQA 3UN3A 3ZZTA 3KLFA 3CC2S 3CULA 3BS9A 1OY8A 2R7QA 3DLEB 2VU5A 1KONA 2JX2A 4ILRA 2NYHA 4UOHA 2MSSA 1WG4A 5HBMB 4IFVA 3K0JA 2FVPA 1U0HB 4MK7A 3VR1A 3T1HF 3MTKA 1RHQB 2XS5A 1K0VA 3D3CJ 3FUYA 1FXLA 1SQEA 4C97A 4DOZA 3KJVB 2OJ3A 4UF4A 4NCAA 1U1PA 4CM2A 1DBDA 4YHHF 1KFSA 3H7HB 1P1LA 4OZ1A 1ZAXA 2AJFE 5T7LA 1JKHA 3GIKA 1FNOA 1NAQA 2PGCA 2YNGA 1OYEA 3MD3A 1Q86T 2RDDA 4GC7A 3DXBA 2C2NA 2LU1A 2W8LA 4A8FA 3MZIA 1F3VA 1HNVA 2GMLA 2MKSA 4JB8B 1RE1B 3TVZA 4DPUA 2J8AA 5DETA 4X65F 1MU2A 4AL7A 1QSSA 3QRQA 2C3UA 1PKUA 4PPDA 1SKRA 3EVMA 3BGUA 1B7YB 2ZEJA 3H2LA 1S77D 4PQAA 3OUYB 1VK3A 1QAXA 2ZH5A 4K2XA 1VDHA 2ZVSA 3GWCA 2RUSA 3LA0A 3ZO7A 3ZTRA 3ZZPA 1MWZA 1RTIA 2XYGB 1PCAA 5A2QU 4IO9Q 4I2PA 2B6AA 3KUGA 2PD1A 3CNQP 4Q7AA 4Y3CA 4DL3A 4LF9F 1HD1A 2MQMA 2YKNA 3IP0A 3VVUA 3IBCB 4CNZA 2DIVA 2HWHA 2OD4A 1ZZFA 4OFZA 2LEAA 1K47A 2WOMB 2MPUA 5M2RA 2XS2A 4H4MA 2AWZA 2ZC4A 2HS0A 3ZTQA 4YDDB 1VLYA 3HHKA 1D9FA 2XMVA 1S10A 3FBBA 1HYSA 2ZOMA 1IXKA 1O8BA 1TVRA 1U24A 1Y00A 2A18A 2JWNA 3D4JA 3FQLA 3MMAB 1X0FA 4LF7F 1NLKL 3CJSA 3QT6A 5EGYA 1VBZA 2I6WA 4WJBA 1WEYA 2IDLA 1YGYA 2MXYA 3FKBA 2P5VA 1S4EA 2BA9A 3X3UA 3BB5A 3H25A 5J2QB 2IAJB 3RBEA 3TAPA 3ZTSA 5MLCV 2D41A 2JC0A 1LW0B 4J9LA 3W2WA 2OTLS 3BBFA 3PEHA 3ZZZA 1UVMA 1KQKA 4DV2J 4QWBA 2HFSA 4CLZA 4U95A 3MR6A 5FLXY 1RT1B 1QVFR 1NHKL 2HHQA 3BN7A 3FQKA 4UZCA 2XYHB 2AYMA 5CAAA 4DR6F 2JLGA 3PZPA 4NLGA 2V68A 2CPXA 2MB0B 1SJFA 3TO8A 3W60A 4EO6A 3TZYA 3T41A 3IBFB 4LREA 1WC3A 1FI4A 3M8QB 4MKVA 1TMMA 1PYTA 2DHHA 1U2RA 2FB0A 3QO9A 4ZVTB 3Q8PB 3MR7A 3PR5B 1SL2A 3DRXA 1FKPA 2F3JA 3M8QA 2W2PP 1FRKA 3VQSA 1VOMA 4X4SA 3QO9B 3K58A 2YQ0A 4HYKA 3RRKA 2HURA 1VC0A 1N32F 4OYZA 4PG4A 3NG8A 4XTTA 2MKKA 4I6WA 3SFUA 4DL0C 2V9WA 4OJ1A 3D67A 3DGPA 4KGXB 2YKNB 1VFJA 2E1AA 4KQZA 1OS5A 1KQFB 1FJ7A 2JVRA 4GVBA 1RT4B 3CJKA 1FT8A 3CCQS 5DQGA 5HVFA 3R97A 1ZETA 1UWAA 1HARA 1G2EA 3MCNA 2DRAA 1E6VB 1U1OA 4CNYA 4MFBA 1VK8A 4QBUA 2H1YA 2HRYA 1TP7A 1UP1A 1O5JA 2YWFA 4A8MP 3OTBA 4X4PA 2M8HA 4U9RA 2GA7A 2DNLA 2RQMA 1TR0A 4TLRA 2F5GA 4UOGA 2FVQA 1K9MT 2DB1A 3LPEA 4CLPA 2AKWB 2HGLA 3GCXP 4TU9A 4C6AA 4RW4B 1YKWA 1J2VA 1Q4RA 2XWYA 3I0RB 4LFAF 2AX0A 2MJUA 3FMBA 1IM4A 1NNDA 1YJ7A 4ES3A 2HIQA 3Q8RB 1HHTP 1KRPA 4LRAA 5ETQA 4TN2A 1HQUB 1RWNB 1S7HA 3PX4A 5DRKA 1VJWA 1NPKA 1X4GA 4QIWD 2R42A 3R7NB 4C2MA 3CCZA 2P8IA 3RB4A 2FJVA 1H73A 2V6AA 1OSCA 2KT5A 4HL9A 4OYIA 2KH9A 4KV8B 5CA5A 4ZLLA 3BZQA 4ZVFA 2EVZA 3CW2C 2W25A 3UW1A 1U1MA 5HVHA 1U0HA 2FJEB 1YK9A 2OP5A 4X4TA 4WTOB 4F02A 3IXQA 2R9LA 4PUOB 4KSEB 5GAEU 2DKOB 2DR6A 2N7YA 2QO3A 2R8IA 2EFOA 3OW2R 2E1MC 1F5CA 2CVIA 3K7RA 1U45A 2BM0A 4G1PA 4RO0A 1OIAA 3IRWP 5CHCB 3OFGA 3T9ZA 3TA1A 4D3GA 2FHMA 1JLBB 1TZ0A 1TL7A 3QIPB 3UCGA 5DM7Q 2W4CA 1F9HA 4LQ9A 2DHAA 4ES1A 4ZP7A 2ZD1B 3I4HX 3KDOA 2UP1A 4NYZA 5J2MB 2NSBA 3PACA 3LP1A 4HH0A 4DFKA 4K4ZA 1FRXA 5E3PA 2M7SA 3HFVA 4TVAB 4KHPF 2BW2A 2VOPA 2GHVC 4TY8B 3IFEA 3KUEA 1NBEB 1S6OA 2I5JA 3I0SB 2ZOGA 2YKPA 4FYYB 5KG0A 1HNXF 3N28A 4CO4A 5BXIA 3NNAA 5HQ8A 4KKOB 3EYZA 1AFIA 3M2RA 3I55S 1F9FA 3OL9A 1HWJA 3HT0A 2IA6A 3ET6A 2I1RA 4M5DB 4OHYA 4I2QB 1X4FA 3OSNA 5BYSA 3KMSA 2DXEA 2DNPA 1RYSA 3H8YA 3CCJS 3MCMA 1GTHA 1NPPA 1FXRA 4K8RA 4O23A 2E5GA 1S6PA 3DOKA 4KAIA 3A3NB 4QPXA 1FRMA 1BUXA 2ZNYA 4WFYA 4ZVEA 2FC9A 3R5AA 3R2DJ 4ZHRB 2Z0GA 2W24A 1RYRA 3Q24A 5KG3A 1SC4B 4OI2A 1K1QA 1U8SA 4EMDA 5F3ZA 1VJQA 3T19A 5KFCA 1S0NA 4F36A 2HVHA 3OVAA 3DI6B 2J5AA 2K2PA 4DV5J 2DR9A 3F44A 2QA4G 2JJ4D 4YB6A 2QSWA 5F8IA 3L7PA 5DZ6A 3RR8A 4WFNQ 3D6TB 3HVTB 1JKHB 2ILZA 1ZA1B 4LF1A 2PI5A 2VONA 4FKXA 3HVTA 3SQOP 4XPEA 4ZVUB 1R8AA 4RNFA 3OVSA 3Q0AA 1S0MA 4F3QA 3W9HA 3D68A 2C2MB 4DL4A 4NXNJ 4JP8A 2GGPA 3HKWA 4IFYA 5D6GA 1LWXA 2FJWA 4AUKA 1DRZA 3NAHA 4DFMA 4I64A 2V8PA 4J7CA 2IVYA 4V19X 2B5JB 2HFNA 3CUNA 4LF5F 5L1KA 2KN4A 3KYLA 3P8BB 2WVBA 3DOMB 4JOUA 4HR2A 2E1CA 3NBPB 3DU6A 4PG7A 3G86A 3UNGC 1YBAA 3GYXB 4DV1F 1Y9OA 3N0VA 4RL1A 2BQ3A 5A6PA 4WXOA 1NK6A 3P5TL 9ATCB 5LJ3Y 5IV3A 1QTNB 3DMJB 4YB7A 2CPEA 3MMBA 1R8BA 2CJXB 3MAAB 2KJVA 1S1XB 2KDOA 2NUUG 3DGVA 3PCOB 2IJRA 3DDNA 3CXCR 2ADBA 4CCHA 1OQ6A 4ED2A 3DRSA 3US5A 1XMOF 2HS3A 1RBOB 1WNEA 2B9YA 1BMQB 3PNIA 3D6HB 5KFYA 2IMOA 1Q8KA 4CP5A 5CD4A 1HBMB 2IPOB 3T1YJ 5A8KB 1K1SA 3PO4A 5U47A 3L7OA 1X60A 1UWBA 1YZ7A 5C25A 2VBXA 2AX1A 2H5EA 4Y2AA 3IN5A 3AA9A 1DHMA 5I3UA 2NXCA 4EEYA 2FJXA 2I8EA 1FX4A 1WOPA 1GMVA 2WHOA 1HIYA 3QAUA 5K14B 4F2RA 2ZKTA 4F4KA 2VFTA 2JLEA 3ET6B 3AD9C 3L7UA 5L38A 5F9NA 4DXLA 3MM6B 4ZPWR 1RTZA 3QWUA 4FYXB 3J7ZT 3P49B 1WELA 3LTOA 3HDSA 3M6VA 3P4UB 2MGZA 3KHRA 4GO7X 2B9WA 5K9FA 2C42A 4J9RA 4HHHA 4I1TA 2KFZA 5LT5A 5D4OA 2QSFA 2HQCA 5HJXA 4OL8A 2LXFA 4B9TA 1T3OA 1WWHA 1AZSA 1PJ5A 1RWXB 3VVTA 4C11B 1BQMA 3CJTA 3CJ3A 2ZH6A 4C4WA 1SC1B 2Z30B 4M8LA 4ANDA 1SC3B 1PYOB 2R2UA 3QGPA 4M5GA 4DV3J 2WBRA 3BH6B 4KYZA 4ECZA 2OPSB 3IM8A 1MLAA 5CZVA 2GO8A 3GLJA 1UETA 2CJ9A 1KWMA 2WVEA 2YNHB 2EG2A 3CD0A 2XMTA 4PEOA 5LXYA 1SIZA 4DR1F 1ZYQA 1NKEA 1N36J 2UVWA 2DEIA 1IBLF 1CQMA 4R8UB 2V2VA 1UFKA 2BABA 2CJBA 4RZRA 3NGTA 1V5IB 2HQIA 3VAFA 4EBEA 2Y8YA 2ZJRQ 2QA1A 4P9SA 3TANA 3FVYA 1T3NA 2KT3A 1IBMF 2MQPA 2UU9F 5GVQA 4OI1A 2E7VA 5IZHA 1IM6A 2A6MA 4X4VA 1YRXA 3MR3A 1ZOTA 3R8YA 4CYUB 2F4VJ 3HHLB 2HIYA 4NLWA 1HI1A 3DLKA 3A8EA 3T5KA 2CQBA 2AJQA 3ZZOA 1TKXB 2MYFA 5HQMA 3KLEB 4B3TJ 1EETA 4U96A 3WIUA 6FD1A 3FNNA 1KS2A 1C0TA 2VG7A 1X8DA 2ZBQA 2YXLA 4CWBA 4X64F 2VH7A 3FJ2A 1HWKA 2P9EA 4AQYJ 1T02A 1UJ5A 1F9EB 4ECSA 2D3O1 5E33A 2VG5A 2D3UA 3SI8A 1JNZB 4TNOA 4DSIA 3FSYA 2ZHOA 5AT1B 2KVQE 3P3DA 2CA9A 5CYQA 3R1HA 2KTQA 3MM8A 2KZMA 3KDNA 4YEAA 3UE2A 1RTHB 5ETTA 4WBFA 3W2VB 3BPDA 2VBYA 4TQSA 1RTHA 1Q8IA 1RKIA 2WTFA 1VQ6S 3MEDB 2J9DE 4DUZJ 4QIFA 5DG9A 1DY3A 4WK1A 5GAHI 2K06A 1WHWA 2VFRA 1PILA 1RT4A 4NPOA 4J9OA 1Y10A 1CEZA 2QTWA 3M05A 1RT3A 5DG8A 1FO1A 2RIJA 1TUWA 5IV4A 5JVGQ 1SKSA 5DDQC 2AHOB 1IBKF 3GR1A 3HO1A 4YR0A 3TARA 1FF2A 1XK8A 5RUBA 1S0OA 1PO6A 2HHUA 1UFWA 4ILLA 1RA6A 2JH3A 2K3IA 5E7OB 1PBAA 2LECA 2B6AB 1YBTA 4ED6A 1Q7LB 2OPRB 4OLOA 4IRKA 1SL0A 3G4SS 3VHQA 4FBTA 4X62F 4PXEA 3CD6S 2EK1A 1NSKL 1SH0A 2WOMA 2DK2A 3HCXA 2H51B 2VQEJ 2BZ2A 3DDKA 5T14A 2LQJA 1SJ1A 3UN5A 3WC0A 3NXZA 4JI7F 3PEJA 1A7GE 1S1UB 3BQ1A 2J9CA 3CE8A 3P45B 3CCTA 3CIMA 5IOLA 3VWSA 1S7IA 2GS8A 2XM3A 4O4GB 4RW9B 2C1EB 4BBYA 6FDRA 3G82B 2RDJA 1RI7A 3C19A 2W2NP 3W3SA 4QPTA 3HX9A 2GC8A 3HHDA 5D4LA 1UJ6A 3KK3A 5J2NA 2FY1A 2PI4A 2PA3A 3IO1A 2N4DA 4FYVB 3UPFA 1S9FA 2K3KA 3LAMA 5AE2A 1N56A 2XZWA 4S0MA 3HJFA 4U67Q 1YG0A 3MM5B 2ATCB 4AYBD 3BEGB 2HVDA 3ZTPA 3LALA 1T11A 5FLXU 5KFSA 4DQPA 3DYAA 1KLNA 4JI2J 1X4EA 2V63A 2J7KA 2Y1LB 3PFOA 4A8OA 3O1LA 3ISNC 1WKLA 4OHXA 2XO7A 2IRYA 4JI5J 5A8WA 1Q82T 4OMFG 3PYEA 3DLKB 4WCEQ 3OTEA 3NGUA 4Y28C 3CF5Q 5HAOA 1DFDA 3V4MA 2DNRA 5JUMA 1QJHA 2OPQA 2C2EA 2KYXA 2B3TB 5A8RA 5KFIA 4WK3A 5EX0A 4D3HA 4YFUA 2UXDF 2CQGA 2BKOA 3M2RB 3DLJA 1FTCA 2UUBJ 4ILMA 3TJAA 2ZITA 2CVEA 2UUCF 1GMWD 2HSEB 2MTLA 3KOAA 3NGRA 2CIMA 2QA4S 2CQ3A 2OSQA 2RS8A 3QFWA 3OT9A 1AYEA 2MZRA 1N4LA 2W7AA 7FDRA 4LVOP 2L9WA 3AQOA 3JSMA 3H5UA 3D7SB 3CJ5A 1IJEB 5KFNA 3Q8QB 2PMHA 3GV8B 4DUZF 1SKWA 1XNQJ 1FJCA 2V5HG 1TUGB 4G1QB 1VQOS 2ROGA 2RS2A 2HBZB 2P6SA 4QJVA 2QL5B 3SQGA 1P1TA 4MIAA 4K4YA 3KLHB 4OIXA 1TFWA 3BO2A 3W63A 2ZH3A 3R6GB 2HLTA 5FDLA 5L8RC 4YB1P 1EAYC 1TL3A 2PE8A 3AODA 3B6BA 3JQMA 3KLVA 4I7FB 2Q3PA 5JMNA 4NYPA 2O01C 1H38A 1SJ3P 4G65A 5H1SV 1NK8A 5HMZA 1EKSA 2IBOA 3H98A 3GPAA 3BSNA 5K8MA 2J0QD 3CC7S 1JNRB 1UVJA 2UV8A 2L9DA 2ROEA 5D4PA 1FKOA 4ZPDA 4C8OA 1GQEA 3KLIA 4NLXA 3OHAA 5F3TA 2KT2A 1RA7A 1S9EB 1HYSB 3RB6A 1VQYA 1XR6A 2W9CB 2GQCA 1NZ8A 1KDNA 5L1IA 2WZ1A 4PPZA 2Q1LA 2XMWA 2DH9A 1HWIA 1QE1A 3HLUA 4DJBA 5K20B 2UV8G 5F41A 5HBMA 1S6QA 2FHKA 2J6SA 1FD2A 1X5SA 2EW9A 1R6YA 4P72A 2E5HA 2QN6B 4ED1A 1HHQA 3GR0A 3BM7A 3L09A 3MAAA 2ABYA 4QQBA 3T6JA 3H5YA 4CH7A 2RHQB 3QBCA 1Y4ZB 3L4BC 1WD6A 3NL0A 1E6YA 3QIDA 4BWJA 1BXNA 3FGVA 3CDAA 1Q78A 5KFVA 2ASYA 2QC3A 3MWBA 1S1VB 3DLGB 3PJ9A 5LM7E 1N8RT 2DY1A 1RSCA 4ETZA 3THVA 3UCZP 3SCKE 4NEYA 1V9OA 3D1OA 1WACA 3TJ9A 5HMYA 3G6YA 1DZ5A 3MR5A 2F65A 2EKYA 2DTJA 4PABA 2LXUA 1LWFB 1H72C 2CQIA 3HD1A 3HZGA 2B7CB 5A0YB 5LMUJ 2XY5A 4B3TF 4ECXA 4YP3A 5MAOA 3U27A 4J9PA 1M90T 1TAUA 1BQXA 1NK5A 3G87A 1PAUB 3AT1B 2FYXA 4KO0B 2DPJA 2E5LF 3W62A 3M32B 3K89A 1NSAA 2EKNA 2IIHA 1HQEA 3E8OA 3D54A 4DFJA 3LQVA 4NLRA 3OXGA 4ALZA 2Z4PA 3AJ2A 1FDAA 1U48A 4WIIA 3BO4A 3M7VA 1UEVA 3LW5C 5HMXA 4QWAA 4CLUA 2Z2ZA 2ZJQQ 1UEUA 5DGAA 4W90B 1N36F 4B9UA 2R7TA 1H7XA 3GJTB 4Y2CA 3CCSS 1F2GA 3SSQA 2ZDPA 3KK1A 2DGOA 3A4TA 3AY0A 2H54B 2DT9A 3VCDA 2X3GA 3TUZC 1BLUA 2OPPA 2J0SD 2GIRA 4E98A 4HHJA 5L9NA 1S6PB 4M5NA 1VBKA 2XZDB 1E6VA 2EBGA 4AE5A 4DDFA 4YY3F 1H98A 3K8VA 1WF2A 1IBCB 2KHCA 2ADCA 1DJ0A 1UA0A 1IBKJ 4LSZB 4LSLB 1Y3KA 1Z2LA 2L3MA 1UA1A 2VDHA 2UVVA 3EPIA 2AP6A 3OTOF 2ZBPA 3AH6A 2VA2A 5L1LA 2CPDA 1R0BG 4X66F 3OL6A 2ZH7A 2VBZA 2YX4A 4LFCF 5C7PA 3W1YC 4RUAA 1ELOA 1X5PA 1GNKA 3CJ2A 3FEXB 3IA0A 4EO8A 3W8GA 2HFZA 3AB2B 3MECA 3HVRA 2YWGA 4WKYA 1T03B 4TLQA 2DGQA 5IM0B 4X65J 3RBZA 2ZJPQ 2OH2A 4NA1A 3WC2A 2WCXA 4M5HA 3TUJC 3EE3A 3FC9A 1U2CA 3T1YF 2BOAA 2XULA 4O44A 4LSNA 4EFAC 4ES2A 3KK2A 1GXLA 1N6QB 4DWIA 2KZZA 1HI0P 1RTJA 2DNKA 4Y6IA 3HSDA 3ZXWA 3PKYA 4C9DA 4JI1F 5CQGA 1KEKA 4AD6A 2V8HA 1HNWJ 2X1BA 3EXYA 1NJXA 2KRRA 1RKJA 1WKKA 1F60B 4OYAA 3F41A 1CSJA 1FK9B 2XTJP 4OZ2A 4PAAA 3OXFA 5KAKA 4ED0A 1NJZA 1FCAA 2HHVA 5H9FK 4BHQA 4QR0A 2HGMA 4KFBA 5C2GA 1IBMJ 4ZCMA 2DIUA 1SQFA 4F4YA 2LYVA 2C2RA 4Y65A 4CIOA 1ROFA 2ILYA 3I4PA 3R6LB 4HT5A 4OLPA 2MGZB 2OAUA 3RW7A 4QWEA 4KE5A 3IGNA 4LFBJ 3R1LA 1S59A 2AW0A 1VIXA 1HW8A 1EHWA 4M5IA 2D3ZA 4Z37A 4RPFA 4JI6J 3D0HE 1FE4A 3OFEA 4NXNF 2KXNB 4NA3A 1JLAA 4K59A 2JHEA 4DLGA 4ECTA 1LW0A 4XDCA 3M8PB 3OR2B 5HLFB 5F8HA 3HZEA 1QM9A 1GT8A 2GHPA 4NCGA 4QIGA 4YR2A 3SV4A 4USIA 4JV2A 1A6LA 5ETKA 2JDJA 2VASA 1CG2A 2CPJA 1RWVB 2XSFA 3C8YA 4ATNA 4CO5A 4ETXA 3A3PB 2DY9A 5HO4A 2LEBA 3SBMA 1GFWB 1N0UA 3IC1A 1KQSR 3DLBA 4J9MA 4R5PB 2EG1A 4Y2IA 3C6TA 5L1JA 4WP3A 4DV0F 1B64A 3DGPB 3TR5A 1RHKB 2M70A 3QLHA 4X4NA 3A8JA 3EXCX 3EVWA 3UDEA 2K7JA 1PC4A 4TXSA 3OBIA 4QIVA 1AZSB 3JS9A 4C11A 3D0GE 3KLEA 4KHMA 4M5LA 1FWLA 2CJYB 3DRPB 1NDCA 4U8YA 3QWPA 1DLOB 4ED8A 1OYDA 1RAHB 3PJWA 1QUVA 2JRSA 1BY9A 1CJTB 3N5BA 3EDRB 3UI3A 4B3OB 2UUWA 2CQ4A 1LV5A 1XNRJ 5K8PA 4P7TA 1JX4A 3MTJA 4L73A 4DR3J 4F04B 2YWHA 2H65B 4HVZA 1S1TA 2WONB 3AFGA 1PYSB 1SH3A 2AGQA 1M5KC 1WOOA 1FFWB 1KOOA 1U6FA 4USJC 3BREA 5KFPA 3WIVA 1UZDA 2M88A 3UFCX 2E9ZA 2R7VA 3MUVP 1EP4B 3BPSP 1PSDA 4Q44A 3OLBA 2XCAA 3BQ0A 2UUBF 3QJLA 5LJ5Y 1S12A 1WKJA 2YKAA 5HROB 4U7UD 2YQ3A 3LF0A 1LWCA 2A0FB 4YUDA 1ZPVA 3G2XA 2JVOA 2LEPA 1BE4A 2P6TA 4H4OA 2MKIA 4DQQA 2DHGA 4BDPA 2Q6CA 4J9QA 4ZPAA 5K5MA 1NXIA 4C3KA 4AL5A 3BKTA 3ULHA 4LRFA 2IYIA 4DX7A 4P74A 4MIWA 3POTB 2CWXA 2E29A 4K4WA 1SH2A 2AQ4A 2HZVA 3JTPA 1W2IA 2COLA 4RW7B 1JLFB 3RYLA 2DH8A 4O0IA 3O44A 3O5TB 3NOCA 2DD8S 4YDXA 1S1VA 3DLGA 4Q2LA 1N0VC 4X64J 1CJKA 5CZXA 2P9CA 4ZMMA 5DDRC 4DCJB 4USKA 4WYLA 4K50A 4W98A 1C0UA 3OR1A 4EBDA 1T9VA 1K0TA 2RRBA 2G9OA 1N5VA 5L46A 3DYAB 3KTQA 1XNQF 1KVIA 1MG7A 3HKZD 4C48A 3EUNA 4FS2A 3PJXA 1RHJB 2DRBA 3G96A 2Z2MA 5AXNA 8RUCA 4HEA9 1VCTA 2A10A 1GMWA 3D1HA 1O0PA 2DNOA 3GG0A 4YMEA 1MMNA 4WE1A 1HQEB 2CQPA 3NOGA 3J7YI 3LOUA 1RAIB 4CTAA 4I56A 2DYAA 1NZAA 4LF8J 1CC8A 1VR6A 2DRDA 3JSYA 3HD2A 4WWSA 1SL1A 2HRUA 2JZ5A 1CJUA 1U6ZA 2VG6B 3IAS9 2KFYA 2N3LA 2X7IA 3DM2B 5HK4A 4CLSA 2ZH4A 2HMIA 2K1RA 1YLXA 3GMGA 2BQRA 4JI2F 3RG6A 2R4FA 2VKZG 2OEMA 2MLYA 3HXMA 2D74B 3K5PA 4ED3A 1SIWB 1IKVA 2BACA 3HSJA 3EPGA 3TA0A 2RHSB 2XYPB 1WC0A 2V2ZA 1TL1B 3H2VE 1B7FA 5CYMA 1CJTA 1RZMA 2FGOA 4A47A 3R3TA 1M5SA 1E6YB 2IVMA 3Q23A 2YTCA 1HNZF 1VRTA 2AYGA 5B7WA 1JLFA 2U1AA 5FD1A 1ULRA 1QAJA 1HMVA 1HNWF 5E3AA 3A12A 1R0CB 2B8QA 3HI9A 5KFUA 1D1UA 1FJEB 4DQIA 2DITA 5I42B 4CO0A 4ECUA 2C2ZB 1HQUA 3SSRA 3IR7B 5KFKA 5F9LA 2XNQA 3MM5A 3NGDA 3MCSA 2F7VA 2RAQA 2L08A 2CNLB 1RWMB 1TV6A 1RAAB 3QT8A 3CWJA 1O51A 5DDOC 3DLLQ 4M5KA 4ZS6A 2VQFJ 4DS4A 4DR4J 1UW4A 4L75A 3CMQA 2B7BB 2QJ3A 3GU0A 1RHUB 5J2NB 3KK3B 2BJ3A 1REVB 4DPOA 4B9MA 4J5OA 2MY8A 3FCHA 3QNWB 3B4MA 4LIWA 3UR3C 2XGQA 1LEOA 2GIFA 1LOUA 1JLGA 1HBNA 2VC1A 2VD3A 4IOBA 5KT4A 5KT3A 4FF3A 5KFJA 4DUYJ 4DI6A 1D3WA 2R7XA 2MKJA 2FHJA 1WTFA 4CO2A 3KK1B 3PX6A 3BGRA 2A2DA 2B8PA 2RKIB 3QQCD 2MQQA 1YJRA 4LF9J 2BMBA 4YY3J 4RW8B 3V2UC 2CJKA 3PO5A 1HPZA 1T9YA 1L3TA 4X2BA 1RDRA 2CQ0A 3SSSA 2YNIB 1SV5B 4A48A 1M5PC 1CULB 2RT3A 2R2RA 3ZNUA 4K5RA 1R0AB 2BBEA 2MQ8A 4UT4A 2R8HA 4CH0S 2W9AA 1K73T 4LQ3A 3S7RA 1UVLA 2FVCA 4A4JA 4WFAQ 2KG0A 4YB5A 1C0UB 3OR1B 4KGVB 3MDFA 1T9TA 2ZDOA 2EFQA 4MH8A 2VFSA 2GVDB 4NCGB 2NR0A 1BWEA 2RVJA 4DZDA 3QMQA 5EDWA 4UOCA 1I5OB 1JXVA 1OJ4A 3I32A 4M5DA 1Y3JA 3ILOA 4TU7A 4JI0J 2GQ2A 3L9ZA 5KT5A 1U47A 2CPHA 5IQQA 4KR0B 5DS7A 4F4WA 4ZP6A 3TVYA 2HHHJ 3DOKB 2GW8A 2J0XA 3NP5A 4GMKA 4H4KA 3H2UB 4OJ3A 3R5GA 1AROP 5LMNF 2VL1A 2CUYA 1NHVA 1RT5B 1YRTA 2A1BA 1F5AA 2BVZA 4L74A 4F4XA 1GH8A 4ZPTR 1WF1A 5SZTA 2LDIA 3D6FB 4GVBB 1Q5YA 1T9UA 1FHTA 4J9NA 1LK5A 5J2PB 2ATLA 1RADB 4P73A 5CABA 5B0GA 2DR5A 4ED5A 1XERA 4X84A 1KVJA 3K57A 4J90A 1XBWA 1QE1B 2QIFA 4WXWA 1D8YA 4J9SA 1IKWB 4F2SA 2OMOA 3AB4B 4H4OB 4CH1A 1U1QA 3F56A 4CLFA 1NU4A 1W7WA 2QLFB 2ZH9A 1JLEB 2CRLA 1S1TB 2GMJA 2E66A 1S9GA 2ZH1A 1MW7A 1VYAA 2BW7A 2C3PA 3LWLA 1X9MA 5DGBA 1U6BA 4L72B 4BC7A 4DR2F 5E5NA 2H48B 3KLIB 3V4IB 1T0TV 3W9JA 3SXLA 4P7VA 4ECYA 3BDEA 2XLIA 4HACB 5LXRA 5HP1A 1C1BB 1CQNA 4I2QA 2ZVIA 2YWKA 2PT0A 2WBMA 1JLAB 1G7CB 2B4UA 3DFEA 4KV8A 4OYMA 4OYXA 5G0RA 2UZAA 2LVWA 3CJKB 3P5BP 3V5RA 1NKCA 1VRUB 1CLFA 2EFGA 5KG7A 2ZNZA 2KB2A 3R5JB 3AJ1A 2I38A 3DHXA 3TVKA 4DMZA 3CC4S 1FWKA 3MEEA 2PC6A 3O2IA 5F8MA 3S6EA 1RTDA 3KJVA 4LSLA 4R25A 4UQGA 3MEEB 3VZHA 2HVZA 1RCOB 1RTDB 3U1LA 2Y1RI 4CYUA 3KLGA 1R7IA 3DDIA 4HH1A 4ENOA 4KJIA 2ROPA 4J9VA 2ZD1A 5GADU 1V6HA 2KKHA 4LR7A 5IC4B 2MQLA 1WHVA 3TA2A 2UVRA 2AGOA 4DU8A 4QU7A 2BYCA 3OD2A 3R5CA 3ZZUA 2ASLA 2DO0A 4OI4A 1H2TZ 4OX7A 4ITSA 2JOQA 3SYZA 1JMTA 4IFYB 1T95A 5D0RA 1YITS 2A3JA 4X66J 2ZZNA 2LLZA 5GAEI 4U6PA 2E9RX 4B3OA 2RF2A 3KG4A 3MF5A 2BRLA 4DN0A 2Y1JA 3MFIA 1S9GB 3O6QA 3N01A 1FNMA 1RK8A 2OTJS 2ZKUA 2LQ9A 1SJQA 2XMJA 3H40A 5F8LA 1HL6A 3S1TA 4EK2A 3NCRA 2FPHX 2QLXA 1V3SA 3QZ7A 2XCPA 2OHDA 3B8HA 3LANA 4ZCIA 4K5SA 2OFHX 3MUMP 4FXDA 2UVUA 3PW4A 2HHWA 2Z8QA 2YKOA 4DV6J 3HP6A 4H4MB 5LSRA 5IWAF 5D4NA 2C2OB 2CZVC 3HVAA 5D3GB 1N52B 4G3IA 4C98A 2HK3A 2DHSA 4FF1A 2SXLA 3BGRB 3JQKA 4P2XA 4ZHRA 2Q79A 4KFBB 4PQUB 3RJMB 1R8HA 2BE9B 2NZCA 2AIRB 1RACB 2RILA 5E2QA 4A8QA 2AU0A 2LFVA 5IT4A 2CYYA 4OV1A 1RAJA 1RT5A 3OLAA 3FRZA 4ZCLA 2QFJA 3T3FA 2DR8A 4MJKA 4RU2A 3WQPA 5KFHA 1Q1KA 4K4XA 2J6UA 4KTQA 5KT2A 3A8KA 5KG1A 3POTA 2CQCA 2VV5A 3WX4A 2M3DA 4ZPVR 2QG9B 5C25B 3GIJA 3C6UA 5GMEA 4QIEA 3JYTA 4I7FA 2OEKA 2NSCA 2ACYA 1KSPA 1HNVB 3MOJB 3PIOQ 2ZM6J 3DOLA 3CCMS 3MURP 2UXBJ 1N5SA 3WDOA 5B08A 4EYHB 2Z2LA 4DV2F 4UY85 4O3SA 3NWGA 3I5CA 1IKYB 2QLBB 1NO8A 3D6MB 2IBKA 1C0TB 1NB2A 2RUGA 1T9XA 1HWLA 2J9DA 2VG7B 4MK9A 5KTQA 1LXJA 4DR5F 2AMCB 4JI7J 4WYWA 4ZP9A 5DZ7A 2J7UA 2YNIA 2GQQA 4I68A 5B09A 4YR3A 1YTYA 5F8GA 1FA0A 3CPWR 4LF7J 2V2KA 2KU7A 5L9XA 3B4DA 2B43A 1L3SA 4RBTA 5GAGU 4DL6A 4F3OA 4C8KA 4I2PB 5A8RB 2FHJD 3RBDA 1D0EA 2KXHA 2AZ1A 1QSLA 1M0SA 3GJQB 3QGGA 1JLGB 2VG6A 3F0NA 4ED4A 1U1RA 1S57A 1IKXA 1P27B 3MEDA 3SEOA 3A13A 4X4QA 1VQ4S 4NLDA 1SI9A 4LR9A 2HS4A 2DJWA 1L3KA 4W92B 4JV1A 4M94A 2MLXA 1DAXA 3C16A 1B0PA 2AT1B 2EI5A 3OFFA 4LJMA 4MKBA 3KHGA 4LMZA 1SQGA 1HBMA 3CCUS 3OTCA 2ZWPA 4G1QA 2MQOA 2VPXB 5CCLA 1T8EA 4XAKA 4NYOA 5BYRA 4P52A 5CXTA 2AD9A 3A8IA 2FZCB 2FZGB 3VAIA 2FJDB 4TKTA 1NB7A 1NJIT 1FESA 2U2FA 3W66A 2EFPA 1RWWB 4ZLPA 2RMLA 3MPYA 2KHDA 3BGOP 3K5OA 5M2UA 5A2QY 4N41A 4FF2A 3AXMA 3PFEA 4ZIWA 4DR4F 2RH3A 3H5SA 1M5OC 3JSMB 3OJUA 5HLFA 1D9AA 2HGNA 4GKKJ 3MM9A 4MAKA 1LWEB 2YNFB 2QLWA 2W1BA 4YHHJ 2DNYA 4O3OA 2RB7A 4ZVQB 2B5JA 4Y00A 1RT2A 2WB1D 1VQ8S 1RUSA 2MQNA 4K4SA 4NLQA 2MMYA 1MWYA 2J6TA 2JFKA 3BN4A 3VAJA 4PZVA 4C0HA 1YWXA 1KQGB 2Z56B 2DCUB 3DM2A 5E0OA 2YNHA 4X4RA 1Q16B 4J91A 2XS7A 3BYRA 4WFZA 1QAYA 1SCJB 2QYGA 1RP5A 1WSRA 2YNGB 5HQLA 1ZM4A 3THTA 1CS4B 2CG4A 4B3RJ 3D28A 3BSCA 3MMBB 3NS7B 3PHEA 4P2MA 3UD3P 1QSYA 3BF4A 3NCPA 2M0GB 5I3QA 1NDLA 3QFHA 2C2KB 2F8MA 2E5IA 4DFPA 3SCIE 3JTNA 1HPZB 4V19J 3QGIA 1QAIA 1EX8A 4RR5A 4NA2A 3JYTB 2XQCA 4HACA 1FJGF 2WONA 2OEJA 3AXKA 5K8NA 1URNA 2RRAA 4N8NA 1QY7A 4IQXA 1BQNA 1C1CB 4IR9A 3EJMA 5IT0A 3BR8A 4IYQA 4OZ5A 4N5SA 3MEKA 3I82A 3NMRA 1FTRA 2J8SA 3TP2A 1SPBP 1KHWA 3E3XA 1B0TA 2HNDA 4KIAA 5DO2A 2V4JA 3IBWA 3LPYA 3IRXB 2UU9J 1XR7A 1HLWA 1KLMB 1WHYA 2EPIA 3ZFVA 3EICA 1CJVB 3VZIA 5J1EB 5DDPC 3PX0A 3IRXA 1ACMB 2C22A 4OYBA 3C6TB 4IOCQ 3GQCA 3SDEA 3I0RA 1UTAA 1HD0A 2BJ7A 4DZ6A 5D8HB 4LBIA 1MSWD 2IJNA 3OVBA 2RSQA 1SB6A 2IM2A 2C2DA 2HZCA 3AOCA 3QSIA 4I6YA 2CWKA 1GXUA 1AB8A 1MN9A 3J7A1 1KP6A 5DLGA 3MCOA 2DXFA 4DPWA 1UVKA 4ZDNA 4MFBB 4ZCKA 2V9KA 4LBHA 3DN9A 4QYRA 5IXUA 1F2HA 2Z58B 3AA8A 1KR4A 1WF0A 1EARA 2MHNA 3MMCA 2WRMA 3T1HJ 1KC8T 4C8ZA 3K17A 4AT1B 1OPZA 3EGWB 2CPFA 4KKOA 3UDVA 2KM8B 3MUTP 1WG1A 2V8DA 2AGPA 3CJ8A 3W2VA 1CVJA 5T7LB 2GMHA 2LA4A 1YX2A 3GCWP 1MROB 5JXSA 4N76A 2IM3A 3HFKA 1JWWA 2QV6A 3W8PA 3NLCA 1JLCA 4DU7A 4KPCA 3QPIA 2IFXA 4DG1B 2VHGA 2E9TA 3G9CA 1Q95G 4E0DA 1JLCB 5E3RA 5SUHA 1FFGB 1SUQB 4UOFA 1N54B 3M6XA 1S48A 4DQRA 4JI3J 3E2EA 2YKMA 4YOEA 1R31A 1RXOB 3SV3A 4A8YA 2Q6BA 2LP4A 3G82A 1RU2A 1RABB 3BGLA 3OL8A 4DSEA 1FWPA 5CCMA 5H9EK 2OIHA 4KBIA 4USTA 5BYQA 3W65A 1NJYA 5EHHA 2HG4A 3C6UB 4EI2A 3J81j 1U49A 4ZVSB 5LOQA 4LIRA 3PHTA 1U26A 1A0OB 2V34A 5I3UB 5KFOA 2HHSA 5D0HA 2OMLA 4DV0J 1PIEA 2Q66A 1DLOA 1YJ9S 1D8ZA 1YVFA 5IM0A 3X1LB 2CFXA 1Z2ZA 2VF3A 3J7YU 3BSOA 3VALA 1ZTWA 9RUBA 2AJ4A 2YWWA 3TRGA 1MWQA 4ZJLA 2JSXA 2F4VF 1HBUA 3E51A 5KFDA 2CQ1A 4ZVRB 1OY9A 1S1WA 2I0XA 3FBCA 4I6AA 1DTQA 2QEXS 4PG6A 2DNGA 2QRRA 3CO0P 3ETMA 3KWMA 2W9CA 3H42A 2ZUGA 2V4JB 3QT5A 1N5YB 2ZH8A 3KJQB 4XK8C 4FXVA 3QT7A 4OZNA 1RISA 3HULA 5KFTA 4MK8A 3PW2A 1HBNB 2DGVA 3CD5A 1VQ5S 1LWCB 1N5TA 3L3CA 3NGKA 2IVFB 1XR5A 2KXFA 3V6HA 4YS2A 1RT7A 2K8GA 2CXEA 1NDPA 2VKRA 2XEXA 2IC3B 3BQ2A 4DPXA 5B0BA 5JJBA 2FLPA 2CQ2A 2HWIA 2MHEA 2GIQA 3GV7B 4R8UA 4KGZB 5B0CA 3FSXA 1N33J 2ASJA 1QTMA 3DC2A 4P71A 1V5VA 4L76A 4C3MA 2IM1A 3GIRA 2MZQA 1AXQA 4OX8A 2IAJA 3CJ4A 3HF5A 4WP9A 2B9EA 3O3LA 5C24A 4GKJF 3SQGB 1XN9A 3EZUA 4H54A 1J5OB 2RNEA 1FERA 3CGIA 2YX7A 1GAOA 3ETOA 1EETB 3NMAA 4O0NA 4P10A 4OI6A 2ZUAA 2HHHF 3MAQA 2LDYA 4HT7A 4OQJA 2LKZA 4P75A 2NXNA 4OJGA 3BYPA 3M8WA 3N6NA 5KFQA 2FVRA 4HKQA 2E5JA 2HNDB 2PIIA 5ETVA 4ANEA 3DU5A 5EWEA 3RTVA 3GYNA 4OZJA 2FIUA 3MM6A 2WW4A 2KL8A 2Y0BB 3NS6A 4WU2A 1IJFB 4LF6J 3MM9B 1XMOJ 2HBQB 1H2UX 3ENVA 7FD1A 4JI3F 4LSNB 1N6QA 4Q0BA 4BWMA 4DPTA 4LFCJ 2ZHAA 3KUHA 1SKUB 1FDDA 3WZ0A 2DHXA 3M2VB 2HLUA 4LBPA 3T1AA 4IRDA 3LGHA 3CVKA 4FP9A 4Q5VA 4U7UK 2D9PA 1DQ8A 2HNYA 4DR7J 1AA1B 3TZWA 2F63A 4EBCA 4IH7A 1Q7YT 3NY0A 1G6BA 2O66A 3UQSA 4F25A 4ID5A 3M8RA 1YJUA 2PA8D 4DUYF 4NX9A 1TK0A 4JI4F 5CH7B 4DV4J 3AD8C 4CT8A 4RNOA 4X4UA 1T94A 2M8DB 1XJWB 5KOWA 1H0HB 2WVDA 3AAWB 3G8QA 3IGVA 3TAMB 3TAQA 1SV5A 1SC6A 2MSTA 3HJVA 1RAGB 4Z2XA 3K5LA 1SXLA 2A6OA 4ZK7M 3PVXA 1XC9A 4FVCA 2V0NA 1FKAF 1IVZA 4K0KJ 2N4CA 4I69A 3GJRB 2VQFF 2KFNA 1JLBA 3HHLA 3QIPA 4NRTA 2WSFC 2VFVA 2CJQA 3CSKA 3MMJA 1U09A 1U7LA 2ZC3A 3GFXA 3IG1A 3GJSB 2GO9A 5KFAA 3HHLD 5EUHA 3TJ8A 1JJ4A 2UXCJ 3QGHA 2HYIB 4BLGA 3RR7A 4AFFA 1RT7B 2OO4A 1SJ4P 5D0GA 1TKTA 4PUOA 2KRBA 1K8AT 2DBBA 2IJFA 2MEWA 2F8EX 2QZ8A 3EMTA 3LP0A 1PAEX 1VQLS 4NXMF 4FXWA 1ZA2B 3H0PA 3I0SA 2NUHA 1FD8A 1N34F 3C14B 3D3BJ 1MMLA 4RW7A 4ECRA 1APSA 4ERDA 2D9OA 3K59A 2CAJA 1VIOA 3IS9A 4LR8A 4URQU 2ZHBA 1RHMB 3KJNB 3OL7A 1TFYA 1OO0B 4K7QA 1A9NB 1M1GA 1KBRA 2YPZA 3DOLB 2DGSA 2VB6A 5F0WA 4ZKAA 1RT3B 2O5DA 3T9NA 4BC9A 4ER8A 1S1XA 2FD2A 3FRYA 4FS1A 2XG8A 1FVSA 2MJNA 5KFFA 4X62J 2XLJA 1VHFA 3KLFB 3T5JA 1Q8BA 1ZTTA 4RW6A 1HBOB 3V6JA 1X4CA 2QA2A 3LP1B 3CO9A 1RBLA 3FBFA 2V4RA 5C24B 3IWXA 2M52A 2R7SA 3ENAA 1HNXJ 2N7CA 2E1RA 1XMQF 5KG6A 3I5AA 1FKOB 3ZZYA 1Y5NB 5EWFA 3QATA 5DQIA 1LFPA 3GONA 1NPRA 4AL6A 4KHPJ 2DO4A 4NWBA 3T6BA 4XO0A 1JQGA 1VISA 2RD5C 2EWHA 1RAOA 3EGZA 2ZBIA 2IY5B 2O3DA 1RLCL 3KG0A 3NS5A 2XNRA 1HW9A 2HMIB 4ZP8A 1UPMB 4L3NA 5KFLA 1FRJA 1X4BA 3FZ2A 4M5JA 4HTIA 3EX7B 8ATCB 2RQ4A 5F8NA 1UPPA 3AJDA 2DGWA 3RUBL 4WTYA 3GP9A 2POKA 1P9YA 2MKCA 3N6MA 3R27A 4FNIA 4QR2A 2N82B 2JL9A 2VPWB 2YX1A 1DTQB 4WPAA 1DARA 2OGUA 3M2VA 3Q2TC 2O1PA 5EN1A 4HI2A 1X5TA 4FVMA 5DM6Q 4PWDB 1YSJA 4M5MA 2RRNA 4JI8J 1I94J 3G8SA 1K44A 3NBPA 2J9EA 2HNYB 3ONQA 3DXSX 4UQTA 5HATA 1Y5LB 1U1KA 1YQHA 1L3VA 4C8LA 1S76D 1YDLA 3T5HA 4U8VA 2Y3YA 3D2WA 2CJAA 3R5DA 4RUHA 3I31A 3TX0A 2IC3A 1UJ4A 2HBRB 4ZVOB 3LGMA 4KC5A 3G6VA 3EZ5A 1YJNS 4DX5A 1NM2A 1Z4UA 2KO1A 3DNCA 4LFAJ 4F0HA 3HMJG 2R8GA 1CBKA 1WTBA 1HNIA 1RJJA 1FKPB 5B0AA 4HHUA 2XO6A 3PR4A 2GVZB 4XDDA 4B17A 2KG1A 4NRUA 2V2QA 3MEGA 4NASA 4O3NA 4DR2J 1WDTA 5E41A 6AT1B 1RHRB 1PJ6A 3H5XA 1QD1A 1S99A 1U2FA 3GFHA 3OJSA 2W2OP 4OHVA 5DLFA 5GMDA 3VGVA 2XLKA 1XNRF 3UN2A 1I3OB 4XPCA 1S4FA 2JC1A 3UD5A 5GADI 2L41A 2H9ZA 3THPA 1WJ9A 1P6TA 1NSQA 4N8OA 1RLDA 3R7SB 3CB4A 5C42B 1PGZA 4EGLA 2NCKL 2VZ9A 5CYJA 2QMWA 3C16B 5ITHA 5IT9Y 4XIUA 4ZPBA 2AV5A 1R27B 4Q43A 1UEKA 3UVJA 4O4GA 4RW9A 4PG8A 5A8KA 1RWKB 1HA1A 3H4DA 1OY6A 4PWWA 4UY8T 2H5IB 2KYZA 2ZZTA 1MNEA 3RAXA 4JYAJ 1XIQA 1H3DA 1WUUA 4C7QA 1VHIA 3C66A 4EYIB 4PXBA 5LSOA 3TQ1A 2AYBA 1VQSA 5BR8F 2K7KA 3E01A 3MPUB 4H4KC 4JI0F 2CG8A 3HSZA 1FRHA 1UZHA 4KO0A 4TY8A 2PFFB 4GRSA 4FKYA 2WVFA 3E01B 4P2SA 3TZZA 2ZBCA 3I56S 3GIIA 2DVIA 3LP0B 4E8UA 2W7PA 1JXLA 2FJAB 1EKRA 1LQ9A 1TKZB 1NMEB 1X4DA 2ZBRA 2LQ8A 3FFIB 3DKDA 4Y2KA 4CLTA 4IG3A 3LH2S 5C5JA 4Q45A 3Q8UA 3KJFB 3VV2B 4Y2MA 4RW4A 4C8NA 5JVHQ 2BR0A 4NLUA 3WBZA 3VAHA 1M1KT 2DEJA 2FHOB 2IA0A 4CQ1A 4AXJA 3D1QA 1C2PA 1U8WA 5HSPA 2FUG9 2FZKB 1YBUA 1SVDA 4UTGA 3LP2A 4WIQA 5KFEA 4JV5J 4QCLA 3I87A 1RGVA 3HHEA 1HBOA 5T41A 4DR7F 1JLEA 1NCLA 5ETLA 1CS4A 2GJFA 2HQGA 2PO4A 1T7PA 1TVRB 2UUAJ 3KMQA 4ID5B 1WI6A 2XMAA 4IOAQ 3DI6A 3IM9A 3IR5B 1UCNA 2BKNA 4F3MA 1X9SA 1D9DA 3C2PA 3W5XA 3PIPQ 1JK9B 3QLHB 3ZZ0A 1JLQA 3MM7A 2HQ3A 2GVZA 5KOXA 2G2YA 3B82A 3M2UB 3CCVS 1QUPA 4F50A 3SZ2A 2GHWA 2LA6A 5G0RB 2XI2A 3A1YG 5D78A 3M4XA 2W4DA 1BGXT 1VI7A 1NSPA 1TKXA 2YH0A 4NLSA 1DTTA 3GG1A 3ITHA 1FFSB 4DPYA 4WFXA 1WSVA 3PXGa 3PYFA 4V1Ak 5BR8J 4NZ0A 1F6TA 3JB9k 3GFYA 1ZH5A 4DV5F 5DG7A 4U7CA 1JJCB 4WP8A 5F0UA 4DL2A 4EZ6A 3CCWA 4USWA 3ILJA 3MM8B 4ICLA 2M5YA 1RTJB 2Y1IA 2DR7A 1HNZJ 2VG5B 3TUPA 2Y8WA 3PRDA 3C46A 3Q2SC 2MZ1A 4FF4A 1O6XA 2IDEA 3FDSA 4OZLA 5IFMA 4IUFA 4NI2B 3OSPA 2VJVA 3JAMU 3EGVA 4PKDB 2FVSA 3IS9B 2HQDA 1QLNA 3JTOA 1BQMB 2HPUA 3NCQA 2OELA 3W5YA 4BCAA 2P9GA 1GTEA 5J2PA 2FLLA 4B3MF 3EWGA 4I67A 5K8OA 4F4ZA 2V69A 3BV8A 1ITPA 1IR0A 4ZN3A 2C3OA 1NEEA 3FSIA 1YJVA 3G6XA 1YHQS 4F4AA 2VJUA 4B9NA 2MZTA 4QYZK 2HVIA 3WX8A 1VGYA 2F9JA 3R9LA 2J0WA 3P6YC 4C8MA 4DX8H 3M9OB 2IYGA 3Q8SB 2RDIA 4PWDA 1VQ7S 5HANA 1LXNA 1NUEA 2XZTB 2Y0SD 1FEHA 3GTYX 3ZTOA 4ZLNA 1S72S 5F8JA 4WFBQ 2HAIA 4ID8A 2HRTA 4NLVA 3BR9A 1CJUB 2XHWA 1H2VZ 2GCFA 2VICA 2NQPA 1VMBA 4C3LA 2V50A 1X31C 2NS1B 1VQMS 3FCWA 3U1MA 4OX6A 1VC6A 4F67A 5LMNJ 1I1GA 1UVNA 1Q79A 2AJ0A 5KFMA 1S6QB 1TV6B 4L3KA 2R8KA 3B78A 5ETSA 4P2FA 3I6PA 1U02A 4NMLA 1ZZNA 4GKKF 2LQ5A 2MKHA 2O67A 2PEBA 4FN5A 2BUNA 3MEGB 4CLKA 3G6ES 1J5OA 4LF4J 1HMVB 4RKUC 2VODA 4LVNP 3VGUA 2B0GA 2YBVA 1G1XA 5HROA 1M5VC 4Q2MA 4DSFA 1LFWA 1RWOB 4WZQA 5HVGA 5AXKA 2C3MA 1LK7A 1CJKB 2QE5A 2QL7B 3M1VA 3LAKA 1B4SA 3Q22A 1VQKS 2GAHC 2DNNA 2OPPB 3P96A 3MPVA 3J7Z5 3OUYA 3PW0A 4B9SA 2BJDA 4RW6B 3I96A 2UUAF 1UVIA 4RU9A 1V3RA 5KFBA 3T5LA 1QVGR 1PG5B 1TKZA 2L9NA 3FFIA 4N7TA 1BD6A 4KGMA 2X3DA 3IWNC 4HTJA 1ZPWX 3UNYA 2XGPA 2I5JB 4J9KA 1RCXB 4W4MA 3RRGA 3N4WA 4NCBA 4USMA 2G4BA 2OSRA 2HKEA 2HBYB 3U02A 1KHVA 3M9MB 1NK7A 2VBWA 1HR0J 1KD1T 1WG5A 2BE2A 4G6VB 2BRKA 2CDRB 2G1DA 3W61A 1Q0NA 1MROA 2W4PA 3BH7B 5G4DA 3VF0B 4CT9A 1KN6A 2BE2B 2BKPA 4ZPCA 3SCJE 4IR1A 1S0VA 4DV7J 3LP2B 4OX9J 3DCAA 4KHRA 2GNKA 3MGJA 2JFDA 4MTPA 3G71S 2BANA 4C0BA 1XWLA 2V67A 4JI5F 4QW9A 4NEZA 1J5EF 4K2JA 1EIYB 3CIZA 4LF4F 2HHTA 4QWDA 5AXLA 1B0VA 4IO1A 1N32J 3PYGA 2HZAA 3D66A 3LGNA 5J1NA 4F26A 5GAHU 3KK2B 1KTVA 1X9WA 3OHBA 2H4WB 4NLYA 5DJBA 4USUA 1BHNA 2LXIA 3PM9A 4IKAA 4CDIA 2XY6A 1RBAA 3MFHA 1TK8A 4Q0BB 2B56A 2G1HA 3BKUA 3S8SA 4NZ6A 2R7OA 4DN9A 3HHNB 1N48A 4ELVA 2NPFA 3BKFA 4FYWB 1U1NA 2BOPA 4RBUA 3KHHA 3UCUP 1HQ2A 1UWBB 3V6DB 5KFRA 1WC4A 2VIHA 3JSRA 3V6KA 2J7WA 3IR6B 4K4TA 5THWA 2DGUA 1H6KX 2HK2A 4KB7A 3HM9A 3ELHA 1Q53A 2R3VA 3C15B 3M8YA 4OHWA 3V81A 4KT0C 2PEHA 3C3LA 3NEKA 5E3QA 4R5PA 2BQUA 1I6JA 4QZVB 1P8GA 1YI2S 2XMUA 1XMQJ 5D3GA 1JB0C 1S49A 2D7SA 4K0KF 3OXLA 3I5BA 4NLPA 4QOTA 2R7RA 1B70B 1NH7A 1UW9A 1KVKA 1RWUA 4QW8A 1BQNB 1C1CA 1NH8A 2WVCA 5J1PA 1NK4A 3J80U 3V4IA 3HK2A 2DNZA 2EEYA 3VTIA 2XHCA 1GX6A 1X7VA 4CM0A 4YQWA 4LF8F 4N56A 4RNMA 4JI4J 4Z7CA 4WF9Q 1SBRA 2YQ1A 2Y9HA 3MXHP 4Y34A 2BJ8A 3ICLA 1JXEA 1VLOA 3PYDA 3ISND 3KNGA 4LUBA 3KG1A 4DCOB 3TNVA 2G13A 2DXDA 3M8ZA 3TI0A 1S97A 2PFDA 2WB4A 5EWGA 3DRYA 2HFUA 2QLJB 2IRXA 3CCLS 2HEKA 8AT1B 2BXJA 4LRBA 5CYQB 4JI1J 2ZE2B 5KFXA 1CULA 4ZIVA 3KLHA 4WKRA 3BBCA 2DCLA 3TAMA 3ZZRA 1FK9A 2WSEC 2ZE2A 1J27A 4LF6F 2KI2A 1TTHB 1JLQB 4A8XA 3TEGA 4O3QA 3U7JA 2XC9A 1VRUA 2VDIA 2VOOA 2C28A 4JUZA 5IS2A 4F0KA 4B3SJ 1FE0A 1H74A 1HBUB 1RT1A 2D1CA 2QL9B 2VQEF 1HNIB 3GSDA 3UWTA 4PYDA 1YJWS 2HNZB 2CQDA 2E7XA 4OX9F 5A76A 4DV7F 2GJIA 1Y5IB 2OPQB 2ERRA 4NZ7A 1XQIA 3OFHA 4URSA 4DV4F 2AF6A 2WK4A 3OR2A 2HHXA 2BX6A 2OPRA 3KHLA 1S6UA 5KFGA 2MLZA 1R43A 4L6V3 4TYAA 3H4BA 3QSYB 2KJWA 2HHPA 3FEZA 3K2YA 4RX6A 5KT6A 4JV5F 2G0CA 3W7BA 2CDQA 2L48A 3TQEA 2VUGA 3NWRA 1ZM3A 2JLFA 2M2BA 2OPSA 3EGNA 2NXUA 1SUQA 2YVSA 4RW8A 3V6DA 1JIHA 2B9XA 1EQ0A 3QRPA 2EFVA 4O4RA 2DPIA 3JXOA 4CLYA 2BJ9A 1G4CA 4LRCA 4HI1A 5I4MA 2HW3A 3QAEA 1KKHA 2LQBA 1JJHA 2YWEA 2GAGC 4PR6A 3D9BA 2FLNA 4B3MJ 2HFOA 1HI8A 1U25A 4KH1B 3R2CJ 3SCLE 5KG4A 5IT9U 1FDBA 1NDKA 3M8PA 3MOZA 2GJ2A 1JJ2R 3NNHA 3OV7A 2E5LJ 3F73A 1C1BA 2DGTA 3JQJA 4RNHA 1FRIA 2Z2YB 1FNXH 3RAMA 3M1VB 3MPWA 2BANB 1RT6A 3H20A 1N34J 2PDAA 5ETRA 3LO3A 2Q43A 4O44B 4N47A 3GIMA 2ZWOA 1ZM9A 4EUVA 4ZOSA 2B4PA 2F8HA 2YPYA 2MZSA 1URRA 3N79A 1M5HA 2XY7A 4OYPA 2R7UA 1T9WA 3TX8A 5DQHA 3J81U 4YN3B 1OSDA 4I4BA 1N5YA 1VRTB 3LWMA 5KG5A 3SDEB 1FVQA 2H4YB 5KFWA 1VQPS 4NE9C 2MKYA 2X1AA 2RKIA 1NJWA 1TK5A 1S79A 4IDKB 1F5BA 1F3FA 1B3TA 1FDNA 2MY7A 2YKQA 3OTDA 1EB0A 4PYAA 2ZH2A 4NL5A 4JV0A 4LFBF 4IG0A 3CT9A 3VAMA 1W2BR 4A8SA 1GXTA 1WC5A 4EU0A 4I0WA 2VC0A 5FIIA 2APOA 3B54A 4DV6F 2B51A 1U1LA 1IN0A 2VA3A 2FY8A 5CYMB 5ETOA 2IM0A 3VAGA 2EC0A 1ZAWA 2A2CA 2DNQA 2OKQA 1REVA 2W2QP 2WAQD 4MYUA 3M2UA 3W5ZA 2DNHA 3ZNJ1 4N77A 3FZBA 1SJRA 4ZVGA 2BJ1A 4DQSA 5BJRA 1R8PA 1EZZB 4F7VA 2VPZB 5KT7A 3PRBA 3VGSA 2R2TA 3L95X 4WE1B 5D15A 1TL3B 2PMZD 2CNOB 2QX0A 2DNMA 2IRUA 3ILLA 3KFWX 2VFUA 1VBYA 3BSAA 1H7WA 4FZVA 4MMOA 4ZJQA 3MHYA 3MR2A 3N5FA 4UW2A 4B08A 1UAWA 2YH1A 4B3SF 1YRUA 1N88A 1YJTA 4OHZA 4URGA 4IFVB 3LUYA 4DBQA 4ED7A 1GK8A 3NRBA 2CNNB 2AZ3A 5AE1A 5IQ6A 3VQTA 3JAMY 4C8YA 1CPZA 1TL1A 2BEFA 5A8WB 1M1HA 4DL7A 1NK0A 4B9LA 4DUTA 3BGFA 1TQLA 2EBEA 3HFZB 4J37A 4DV3F 4NMXA 1P9QC 2KVIA 4DV1J 2AJ2A 1HHSA 4X4OA 4TQRA 2RU3A 2F1FA 1TAQA 1FEEA 1WHXA 3TW0A 3W64A 2LCWA 3TZXA 5C2CA 2AEMA 5ETMA 3UO0A 1NRKA 1ZS6A 5KFZA 2CNKB 3OTOJ 1DTTB 5GAGI 2B4VA 1NK9A 4BS2A 1REGX 2E1PA 2JEFA 1XEZA 3DRPA 2KM8C 2XB2D 3IWLA 4PG5A 4IG0B 3FEYB 3DRRB 4ZLJA 1BC6A 2ZOFA 1IKYA 1HFEL 2WW8A 4MKAA 2W7OA 4MYTA 1ZM2A 1N33F 2GV1A 4M63A 3DRRA 2NLWA 2RE1A 5B0FA 1KFDA 1S1WB 2NZ4A 3M30B 5EX3A 1NHUA 2V8GA 1S5ZA 4ECQA 4FYDA 1AT1B 2G0IA 3FCVA 2GFFA 3A3OB 1KOHA 3GYGA 3UDLA 3M30A 5A6WA 3N9UC 2V4QA 2HVEA 4RWWA 2OUGA 4DF4A 4OZ3A 3U1NA 1OMSA 3Q8VA 1LW2A 3CJ0A 3PW5A 2FDNA 1Q8LA 4FPIA 2ASDA 5FJ4A 1B99A 3ILIA 1X5OA 1G3OA 1PC5A 2LMIA 2X1GA 3ITHB 3GZ7A 1AW0A 1IKXB 4GVLA 2N3OA 2HNZA 3SIPB 2BV3A 2XSJA 3NNCA 1VQ9S 5HN0A 3UD4P 2W01A 3WHIA 2B4OA 4CI0B 3HHLC 3IAM9 3HVWA 3PW7A 1TL4A 1W25A 3MM7B 2JEJA 4RUBA 1KTQA 1U4BA 1X0PA 5D0EA 4ZVHA 1AUSL 3KLGB 5FDLB 1Q81T 2WSCC 2MZJA 3NGSA 2HAFA 3AOBA 5I3PA 2V8VA 2UXCF 1RWPB 1L5UA 3TUIC 4HDHA 1I94F 3CJRA 1HKAA 2OD6A 2XMMA 2AEJA 1TMJA 3AOAA 1WEZA 3M32A 2PMWA 2EC2A 2JNJA 4Y0FA 4RLEA 1FJGJ 2FJBB 2QYCA 3NAIA 2NYIA 1C4CA 2R7WA 3GILA 4PRFA 2NXJA 4WZMA 4FNHA 3CD7A 2CKWA 2AJ1A 3MMCB 3FMWA 3KNAA 3DOMA 4F8RA 4KGKA 1TKDA 4TY9A 4DEZA 2Z57B 1OWXA 1IQZA 3RW6A 1RT2B 1RU1A 3EM1A 4ZA1A 4DX6A 4ZJOA 1L3UA 4EZ9A
chains in the Genus database with same CATH topology
4DSJA 2K1RB 2YKMB 3CCRS 3CDBA 4CO3A 5B0EA 3I9ZA 1T03A 1UFLA 3MMAA 3PV8A 5ADZA 2FTRA 2RQKA 4TU8A 1IKWA 2OLWA 2E7WA 4ELUA 1OPIA 4HDGA 5H9EJ 5D77A 2AYEA 2JEIA 4MIBA 1R89A 1LKZA 3M6UA 3UR0A 4JBCA 4RNNA 1AUDA 4PQUA 4JI8F 1WI8A 4IH6A 4GC6A 1ZAVA 1UL3A 2DH7A 3PY8A 2NREA 2W9BA 4A46A 4TYBA 4AQYF 2CQHA 2BJEA 3J80Y 1VS3A 3GE9A 4P6QA 2CPYA 3BJYA 4HLBA 1RQ0A 1UKUA 2C3YA 5E3CA 4QYZJ 3ENWA 1C4AA 2EFNA 2R8JA 1V3ZA 2E44A 3SFGA 4OI3A 3TYTA 4EWTA 2IHR1 2DGXA 2D3OR 1IQTA 1VBXA 2FGCA 4QWCA 4AXIA 3SMZA 4IQMA 3CDWA 2GX8A 3J81Y 3DMJA 1N5QA 3HPOA 2I9SA 2XMKA 2RU9A 2R2SA 3G8TA 5CD4H 3ISZA 4R0JA 3H59A 4Q8FA 2XWXA 3JSBA 4PXDA 4JI6F 2W8KA 4NLOA 2I2YA 4WU3A 5L39A 2X51A 5J2MA 4DSKA 1AFJA 5HL7Q 4Q8EA 3AHPA 3CMAS 4K4UA 4O3PA 1Y7PA 1R3NA 4CZCA 3TOQA 4RUCA 2CPIA 3M8SA 1VC5A 3M6WA 3W2WB 3KKFA 1DURA 4DS5A 5HP1B 3K8WA 5J2QA 1ZBTA 1TL5A 2CZ4A 3D0IE 2FC8A 1XTZA 1LW2B 4FBUA 4OZ0A 2MDAA 3OPKA 5C42A 2ZM6F 4DG1A 3CDUA 3MECB 4ECVA 4QU6A 1CC7A 1GX5A 3QZ8A 1FXDA 4R0EA 2VPYB 2X1FA 3QJPA 1KLMA 1KNZA 5J1EA 5LL6d 4DL5A 4B02A 5LSLA 2M9KA 5HMWA 1F0XA 2HWTA 4USHA 3CMES 1S9EA 1UMJA 1HYSA 2UUTA 1RTIB 3ZC4A 4IRCA 1NKBA 3DHWC 2PSZA 4UUWA 1Y0HA 4MKYA 5KG2A 3CEDA 3CCES 3OQ2A 4QR1A 3RB0A 3BO3A 2JEGA 3RB3A 5K14A 4ELTA 3DLEA 1OQ3A 1IKVB 4K4VA 4IDKA 4DHVA 3UDCA 1HR0F 1Z1ZA 2J76E 2FLOA 3CDEA 1HWUA 1MU2B 1TUVA 1LWEA 2YNFA 3MD1A 4PCQA 5AJ3F 5D3GB 2OFGX 4NLTA 3PDNA 1SKRA 2GGPB 4DF8A 3DRSB 4PWUA 4IG3B 2ALZA 3RRHA 2QT7A 1T05B 2RJZA 1FRLA 2XI3A 4CTAB 3K5NA 1R0AA 5I42A 3MAHA 4M1KA 1T05A 1R8CA 2LU2A 4DR3F 4KRWA 1EP4A 5GMKa 1RT6B 4A8WA 1X4HA 3O8WA 2YY3A 1TKTB 1LWFA 5A0YA 3QJJA 2NPIA 5HI7A 2ZZMA 2M4MA 2DISA 4ICLB 3PKMA 3S01A 3R5BA 4O3RA 4RBVA 4CO1A 3RU0A 2XBPA 3QYYA 3GB0A 4C0OC 2XSJB 4DLEA 4GO5X 2EK6A 2BM1A 5LMUF 1XMBA 3DLHA 4JYAF 2UXBF 4M95A 3RZAA 2W9BB 4DSLA 1IUJA 5B0DA 3CTRA 4FPRA 1DQ9A 4OJHA 4PXCA 3HT3A 4NOHA 5AE3A 5M2PA 3D5MA 3GFZA 2V94A 3ENQA 3V81B 1DQAA 1X4AA 4G1IA 4ECWA 2ZFHA 4A8KA 4B9VA 2PN6A 3K5MA 4RWXA 3M9NB 1MMDA 2RF2B 2RQCA 2BDPA 4IH5A 5AXMA 3RAQA 2QMXA 2CPZA 4KPYA 1VQNS 3NKYA 3AQPA 3GV5B 4OI0A 3N6LA 2F40A 4B3RF 2F9DA 5H9FJ 4UUXA 1S1UA 3IG1B 4LT6A 3VAKA 3MI7X 3I9V9 3ZZTA 1WEXA 3CC2S 3KLFA 3CULA 3BS9A 2R7QA 3DLEB 5HBMB 1KONA 2JX2A 4ILRA 3S8SA 2MSSA 1WG4A 4IFVA 2FVPA 4MK7A 3VR1A 3T1HF 3MTKA 2XS5A 1K0VA 1FXLA 1SQEA 4C97A 4DOZA 3KJVB 2OJ3A 4NCAA 1U1PA 1DBDA 4YHHF 1KFSA 1P1LA 4OZ1A 1ZAXA 2AJFE 5T7LA 1JKHA 3GIKA 1FNOA 1NAQA 2PGCA 2YNGA 3MD3A 1Q86T 3C3LA 4GC7A 3DXBA 2LU1A 2W8LA 4A8FA 3MZIA 1HNVA 2GMLA 2MKSA 3TVZA 5DETA 4AL7A 2J8AA 4X65F 1QSSA 1MU2A 2C3UA 4PPDA 3BGUA 3H2LA 1S77D 4PQAA 3OUYB 1VK3A 1QAXA 2ZH5A 4K2XA 2ZVSA 3GWCA 3ZZPA 1MWZA 1RTIA 4IO9Q 4I2PA 2B6AA 2PD1A 4Q7AA 4DL3A 4Y3CA 4LF9F 1HD1A 2MQMA 2YKNA 4CNZA 2DIVA 2OD4A 2HWHA 1ZZFA 4OFZA 2LEAA 2XS2A 2WOMB 2MPUA 5M2RA 4H4MA 2AWZA 2ZC4A 2HS0A 4YDDB 1VLYA 3HHKA 1D9FA 2XMVA 1S10A 2ZOMA 1IXKA 1O8BA 1TVRA 1U24A 1Y00A 2A18A 2JWNA 3MMAB 3FQLA 1X0FA 4X4NA 4LF7F 5EGYA 1VBZA 4WJBA 1WEYA 1YGYA 2MXYA 3X3UA 2P5VA 5J2QB 2BA9A 3H25A 3BB5A 2IAJB 3RBEA 3TAPA 5MLCV 2D41A 2JC0A 1LW0B 4J9LA 3W2WA 2OTLS 3PEHA 3ZZZA 1UVMA 1KQKA 4QWBA 1QVFR 3MR6A 5FLXY 1RT1B 2HHQA 3BN7A 3FQKA 4DR6F 2AYMA 2JLGA 3PZPA 4NLGA 2MB0B 2CPXA 1SJFA 3TO8A 4EO6A 3M8QB 2KM8B 2FB0A 1U2RA 3QO9A 3Q8PB 3PR5B 1SL2A 3DRXA 1FKPA 2F3JA 3M8QA 3VQSA 1FRKA 4X4SA 1VOMA 3K58A 3QO9B 4HYKA 3RRKA 1VC0A 1N32F 4PG4A 3NG8A 2MKKA 4I6WA 3SFUA 4DL0C 2V9WA 4OJ1A 3DGPA 2YKNB 1VFJA 2E1AA 4KQZA 1OS5A 1KQFB 1FJ7A 2JVRA 1RT4B 3CJKA 1FT8A 3CCQS 5DQGA 1ZETA 1G2EA 1HARA 2DRAA 1E6VB 1U1OA 4CNYA 4MFBA 1VK8A 4QBUA 2HRYA 1TP7A 1UP1A 1O5JA 2YWFA 4A8MP 3OTBA 4X4PA 2M8HA 4U9RA 2GA7A 2DNLA 2RQMA 1TR0A 4TLRA 2FVQA 1K9MT 2DB1A 2HGLA 4TU9A 4RW4B 2XWYA 1J2VA 1Q4RA 3I0RB 4LFAF 2AX0A 2MJUA 3FMBA 1IM4A 1NNDA 4ES3A 2HIQA 3Q8RB 1HHTP 1KRPA 3PX4A 4TN2A 1HQUB 1S7HA 5DRKA 1VJWA 3RB4A 1X4GA 4QIWD 4C2MA 2FJVA 3PO5A 3CCZA 1OSCA 2KT5A 4HL9A 2KH9A 4KV8B 5CA5A 3BZQA 4ZVFA 2EVZA 1U1MA 2W25A 3UW1A 2FJEB 2OP5A 4X4TA 4F02A 3IXQA 2R9LA 4PUOB 4KSEB 5GAEU 2N7YA 2QO3A 2R8IA 3OW2R 2EFOA 2E1MC 1F5CA 2CVIA 3K7RA 1U45A 2BM0A 4G1PA 1OIAA 3IRWP 5CHCB 3OFGA 3T9ZA 3TA1A 4D3GA 2FHMA 1JLBB 1TZ0A 3QIPB 5A8WA 3UCGA 5DM7Q 2W4CA 4LQ9A 2DHAA 4ES1A 4ZP7A 2ZD1B 3I4HX 2UP1A 4NYZA 5J2MB 2NSBA 3PACA 3LP1A 4HH0A 4DFKA 4K4ZA 1FRXA 5E3PA 2M7SA 4KHPF 2BW2A 2VOPA 2GHVC 4TY8B 3IFEA 3I0SB 1S6OA 2I5JA 2ZOGA 2YKPA 5KG0A 1HNXF 3N28A 4CO4A 3NNAA 5HQ8A 4KKOB 3EYZA 1AFIA 3M2RA 3I55S 1F9FA 3OL9A 1HWJA 2IA6A 2I1RA 4M5DB 4OHYA 4I2QB 1X4FA 3OSNA 5BYSA 3KMSA 2DNPA 1RYSA 3H8YA 3CCJS 1GTHA 4O23A 1FXRA 1YIJS 4DL7A 2E5GA 1S6PA 3DOKA 4KAIA 4QPXA 4GKJF 1FRMA 4WFYA 2ZNYA 4ZVEA 2FC9A 3R5AA 4ZHRB 2Z0GA 2W24A 1RYRA 3Q24A 5KG3A 4OI2A 1K1QA 1U8SA 5F3ZA 3T19A 5KFCA