3CCMS

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2611u
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
81
structure length
81
Chain Sequence
SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 20
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
S PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ccmS00
3CMES 2GO9A 3LQVA 1U1LA 1WELA 4OZ0A 4A8XA 1X0FA 1FJ7A 2KM8C 2RUGA 2JVOA 2M4MA 1VC0A 2YH1A 1JJ2R 1WEYA 3CCES 1D9AA 2HGNA 1RKJA 3BO3A 1VQ8S 3MUVP 3VAFA 2DGXA 1S72S 1DBDA 3BO4A 1WG1A 1YITS 1XN9A 2FHOB 2HGMA 2DNGA 2CPXA 1QVFR 4WFNQ 1WHYA 2L08A 3RW6A 2MKKA 2JVRA 1Q82T 2MJUA 4F25A 3CCMS 1SJRA 5D78A 2DNLA 1KQSR 2DNQA 1SXLA 2E5IA 1WEXA 2YWKA 3TP2A 2JX2A 3HHNB 2MZ1A 2MY7A 2LEAA 4RU2A 2FC9A 1YHQS 5CA5A 2CQ3A 4YOEA 2DHGA 3S01A 1WHXA 1URNA 2CPDA 2CQDA 2AD9A 4IUFA 1KOHA 2DISA 2KM8B 1YJNS 2KFYA 1X4HA 2LA4A 4F26A 5JVGQ 2DGWA 3PIPQ 2ADCA 2CQ2A 2MHNA 1OWXA 1X4AA 5HL7Q 1WWHA 3K0JA 2VOPA 1VQ5S 4TU9A 1NJIT 3DLLQ 4QU6A 2HGLA 3Q2TC 4OZ1A 2GHPA 2EK1A 2LQ5A 2AYMA 2O3DA 3B4MA 2KRRA 3G96A 3OW2R 3VALA 2RRBA 2AYBA 2ZJPQ 1U1PA 2MZQA 4V19X 4Y00A 2QFJA 3P3DA 3CPWR 2RVJA 1VBYA 3CF5Q 1FO1A 4WFAQ 5GADU 2KI2A 2BOPA 4P6QA 3UE2A 3B4DA 2MZJA 1N52B 2MQPA 4IOCQ 4UY8T 5DDRC 1X5PA 2CPHA 3S8SA 5LJ5Y 2JRSA 1A7GE 2U2FA 3MUTP 4Y0FA 2KN4A 1WF1A 1KC8T 1ZZFA 2X1AA 5GAEU 3MD3A 2DNHA 3FEYB 2M7SA 2NLWA 1X4DA 2FC8A 1WI6A 1DHMA 1FNXH 1X5OA 2KT5A 1X4EA 1Q86T 4QU7A 4C7QA 2XNRA 3CCJS 4F02A 3P49B 3S7RA 4Z2XA 1H2TZ 2N3LA 2VONA 5GAGU 1HL6A 2DGQA 1YTYA 3UWTA 3P6YC 2VODA 2DGUA 5CYJA 5DETA 1B7FA 1VQ4S 1ZZNA 4IO9Q 1S79A 1M5OC 2KXNB 3VAKA 2KG0A 2MQQA 3S6EA 1YI2S 4TU7A 2KVIA 2U1AA 3CCVS 3ZZZA 2F9DA 2J76E 1YWXA 2KRBA 3H2UB 2KYXA 2MZTA 1RK8A 4M5DB 2DNPA 4PKDB 2AYGA 3I55S 2G1DA 1R8PA 1NO8A 2CPIA 1PO6A 3P5TL 3UD4P 1U1QA 1NU4A 2MSSA 1UAWA 3TO8A 1QVGR 4BS2A 4FXWA 1N8RT 2OSRA 1G2EA 2CQCA 4U67Q 2OJ3A 2NZ4A 1FJCA 2DNMA 1JJ4A 2EVZA 1O0PA 2HVZA 3U1MA 5LXRA 1L3KA 1WEZA 5LSLA 1VQMS 1K8AT 3R27A 1P27B 2X1BA 2D3OR 5DDPC 4IOAQ 1VC6A 4WCEQ 2X1FA 1FXLA 2PEHA 2N7CA 1A9NB 2OIHA 4C4WA 3V4MA 5BJRA 5JVHQ 2MKJA 1U1MA 2CPJA 2LKZA 1M5PC 2KG1A 2YTCA 2MYFA 3MUMP 1P1TA 1SJFA 3UCZP 3MDFA 2E5GA 5LSOA 2J0QD 5DM6Q 1AUDA 2M8HA 3R1LA 3G71S 2ADBA 2RU3A 2G4BA 4LMZA 3IRWP 2YKAA 2CQGA 2DO4A 1FJEB 2DH9A 2J0SD 2I38A 4TU8A 3VAMA 3EX7B 1X4BA 3U1LA 3ZZYA 1VQLS 2HZCA 2F3JA 2A3JA 2CPZA 5EN1A 1N54B 1UFWA 1OIAA 1WG5A 2YH0A 5ITHA 3CXCR 4PRFA 1M1KT 2DHSA 2OTJS 5H1SV 2ZJRQ 1D8ZA 2Q79A 2M9KA 3J7YU 2D9OA 3SMZA 4PR6A 2MMYA 2MQLA 2RRAA 2E5HA 2K3KA 2DHXA 3G6ES 1W2BR 1VQPS 2M0GB 4CIOA 2DGSA 1F9FA 1UP1A 1X4FA 2FY1A 2CQBA 3H2VE 4UQTA 3DXBA 4ZKAA 2MB0B 2LA6A 4W92B 1HD0A 1WF2A 5GMKa 2KH9A 2CQ4A 2RS8A 5IFMA 2EK6A 5D77A 3L3CA 2L41A 2F9JA 4C0OC 3BEGB 2DNRA 3RW7A 2RT3A 4ED5A 4YUDA 2XS2A 2MSTA 3CC4S 5IM0B 1JMTA 3EGZA 2M8DB 1M5KC 1X5SA 2MJNA 3CD6S 3THPA 3J7ZT 2M70A 2CQHA 5CXTA 2UP1A 2K8GA 1YJ9S 2V94A 1OPIA 2CQIA 1X4CA 2RNEA 3R1HA 3CC2S 5FJ4A 2MY8A 3US5A 2DGOA 5GVQA 5LXYA 5DDOC 2DIUA 1IQTA 2XNQA 1WHVA 2FPHX 1U6FA 2E5JA 3CCUS 2ERRA 2J8AA 3NS6A 3NNHA 3SDEB 3BO2A 1FT8A 3G4SS 2CQ1A 3IWNC 2OSQA 1SJ3P 5LJ3Y 2CPEA 2KU7A 1UW4A 3G8TA 3VAJA 3MD1A 3CMAS 3SXLA 3G8SA 2G0CA 1VQNS 2I2YA 2MKSA 3MURP 3Q2SC 2DH7A 5HO4A 3EGNA 3VAGA 2MKIA 2LECA 1U1NA 2CQPA 1N88A 1VQ9S 2MQOA 1U1RA 5IM0A 2DIVA 3VF0B 1CVJA 1U6BA 5DDQC 4CH1A 4CH0S 1X4GA 2L9WA 5GAHU 2DGVA 1M90T 2RS2A 1H6KX 2DGTA 5MLCV 2LXIA 1WI8A 2DNNA 2PE8A 2M88A 1BY9A 2DNKA 2D9PA 2X1GA 2LMIA 2M52A 3CCLS 2DNYA 4YB1P 3I56S 4CQ1A 1KOOA 3MOJB 1DZ5A 3CCSS 4WIIA 2MQMA 1ZH5A 2VOOA 2KXHA 1X5TA 2KHCA 2BZ2A 1FHTA 3SDEA 4EGLA 2LCWA 3CULA 4WKRA 1QM9A 4QPTA 1HD1A 3NNCA 4ERDA 3G9CA 1K9MT 2MKHA 1WHWA 5DM7Q 1Q7YT 1SJ4P 2ZJQQ 2MGZB 1VC5A 3PIOQ 1VQ6S 2LYVA 4WFBQ 1VQOS 4TLQA 1M5VC 4QQBA 1U1KA 2MKCA 1K73T 2XS5A 3TYTA 3VAIA 2B0GA 2MZRA 2DHAA 1VBZA 1JJHA 2DK2A 3CC7S 1WTBA 2SXLA 3CUNA 2WBRA 1KD1T 1OO0B 2DNZA 5IQQA 2CQ0A 1Q81T 1VQ7S 3MI7X 2JWNA 4WF9Q 3NMRA 2HYIB 3BS9A 2XB2D 3VAHA 2CPFA 1H2UX 2DO0A 2DITA 3NS5A 1HA1A 1H2VZ 3UCGA 4LIRA 3THTA 3ULHA 2XSFA 2M2BA 3NNAA 1YJWS 3N9UC 2LXUA 2CJKA 1YIJS 3D2WA 2MGZA 2MZSA 2QA4S 2N3OA 4FXVA 1WG4A 1U2FA 2CPYA 2KXFA 4W90B 2DNOA 2AYEA 1PGZA 2E44A 2MXYA 4LJMA 2OTLS 1SJQA 1R8HA 4J5OA 1WF0A 3LPYA 2LEBA 1VBXA 3HI9A 3CTRA 1VQKS 3MXHP 2N82B 3FEXB 3CCRS 3UD3P 2MPUA 2RQ4A 2DB1A 1U1OA 2XS7A 2DH8A 3CCQS 3JB9k 2QEXS 1DRZA 3UCUP 2MQNA 2RQCA
chains in the Genus database with same CATH superfamily
3ZZRA 1U1LA 3HVTB 1SL0A 4Y65A 3TI0A 1VHFA 5E2QA 5DG9A 2XMWA 2H65B 2HGNA 2Z8QA 2IRXA 2C2KB 3FQLA 4DR5J 4B3RF 2HNDB 5HQ8A 5LSRA 1YITS 1PBAA 1JK9B 3CCMS 3CIZA 3QNWB 3FDSA 2EFPA 4Z37A 3BZQA 4N76A 2JEJA 4YOEA 3CJTA 3L95X 1R0BG 2H4WB 4L3KA 2FJVA 4ECZA 1LWXA 2QSFA 1S9EA 3MEEB 2CVEA 4AQYJ 4KKOB 2UVVA 2B51A 2AZ1A 3N6NA 2AEFA 1UJ6A 2POKA 3SSRA 4B9TA 3NWRA 5EGYA 3CPWR 3BBCA 1FCAA 4PQAA 3B78A 3JS9A 5I3QA 3NL0A 1QAJA 2HQCA 4RBUA 5HMWA 3MPVA 2XLKA 4I67A 3TANA 2Q6BA 2XNRA 5J2QB 4RO0A 1C0TA 3TR5A 2H5JB 5SUHA 2NSBA 3NGDA 3FK4A 4KHMA 4U95A 3IBCB 2WOMB 3CO9A 1TUVA 3HMJG 5E5NA 4HI2A 4D3HA 1RWNB 1O6XA 2KVIA 2NUUG 3F44A 1RWMB 2IPOB 3N4WA 4DFMA 1NU4A 2HNZB 1Y00A 1HPZB 5KFCA 3IRXA 2CJXB 4OHYA 2HVEA 2OGUA 1CBKA 3DRRB 3V4MA 3AA8A 5C25A 1UVMA 4I6AA 2LDYA 2ZBCA 2E5GA 3W61A 4WYLA 3OVAA 2ADBA 2XMAA 3FBEA 1BE4A 1OPZA 2C3OA 3IRWP 5L1JA 2J0SD 4K0KF 5I3PA 2OH2A 4KGMA 4P74A 2HRTA 2BE2A 1PC4A 3D9BA 3EXYA 3DLKA 3ETMA 4S0MA 1QTMA 3ZO7A 2MMYA 1S6PB 1JKHB 1F9FA 1OSDA 1AROP 4I69A 5JMNA 3M05A 3QJJA 4UOCA 3M32B 3DDKA 1V6HA 3BEGB 1S7HA 2RT3A 4ZVOB 3GIKA 3RBXA 3ICLA 1FRIA 4NI2B 3MHYA 3R1HA 3M2UA 4EBCA 1YK9A 4WWSA 3TZWA 5H9FK 5ETQA 3ZZPA 3JSMB 1WHVA 1IVZA 5KG1A 3CCUS 5E7OB 1HQEA 2DY9A 5A76A 3M2RA 1C2PA 3R5CA 2RE1A 2KU7A 1YRXA 3CMAS 1FI4A 5HO4A 4M5HA 4K0KJ 1MLAA 4ZVEA 4HACA 2IVYA 3M8WA 3FSYA 2E7WA 5LMNF 3KG0A 2L9WA 3LUYA 4QWBA 1RHKB 2HFUA 4UUXA 4ELUA 4NLPA 4HI1A 1UL3A 3KOAA 2XBPA 1EIYB 3T5HA 4EGLA 3SEOA 1HD1A 6FDRA 1VQ6S 2LYVA 2BKPA 3TZXA 4DL3A 2CFXA 1NBEB 1Q5VA 1HBNB 4JI6F 2SXLA 1AZSB 2IIHA 2UUAJ 5KFDA 4MMOA 3J81U 4ECRA 4B3TF 4H4MB 3ILJA 3KJVB 4JI7J 2PD1A 5J2PA 5HVFA 2GMHA 3M1VA 2MGZA 1PIEA 3G6VA 2VIHA 1RTJA 1RT1A 4U96A 3CDUA 1HW8A 2VZ9A 5F0WA 4O0IA 2YNIB 4NOHA 4K5SA 3UD3P 3TVKA 4ZCMA 3ISZA 4PEOA 3W2VB 2GO9A 2B3TB 1R43A 5KT3A 3ZFVA 1U24A 4P75A 2UXDF 1YVFA 2H5IB 5BR8J 1S7IA 3T9ZA 3PTWA 4UF4A 4RBTA 5KFKA 2AJFE 2EPIA 1FK9B 3TARA 4UOHA 5ETVA 4ZVRB 3RBDA 1TK5A 3JAMY 4CCHA 1OYEA 2HQGA 5ETOA 2YNFA 2MZ1A 3D0HE 4JI6J 4BCAA 3M6XA 1WSVA 2QFIA 2ZHOA 1JXEA 2FD2A 2JFDA 4ES1A 2KFZA 4Y2CA 2VA2A 1EZZB 4H4OA 4C98A 1NKBA 4TY8A 5JVGQ 2DGWA 1Q1KA 4DV7F 4B3TJ 4OZ5A 1FVQA 1VQ5S 3AHPA 1HBUB 4ECTA 4ER8A 2EK1A 2ZWOA 3MM8A 1FERA 3OW2R 4U8VA 1L5UA 2DD8S 3TJ8A 3DM2B 3BDEA 1HARA 4USJC 4M5LA 4W98A 2HWHA 1RBLA 2F1FA 1HMVA 4Y0FA 1AXQA 3I31A 1Z2ZA 2X1AA 1GNKA 4PXEA 1SUQA 2UXDJ 4ZVHA 4F36A 5B0GA 5CZXA 1RA7A 1RTIA 3T1YJ 3ENWA 2BW7A 4Q8FA 1TAQA 3W63A 4KB7A 2DGQA 4QBUA 4WU2A 3V2UC 3W1YC 4GRSA 4IH6A 2HIYA 2ZE2B 1KEKA 1NKEA 4MK8A 2WZ1A 4TU7A 4OHZA 2ATLA 2BR0A 3DOMA 1N5YA 2HWIA 1CC8A 3I0RB 4DR6F 4DV7J 3UD4P 3TAPA 1QVGR 4PYAA 2LFVA 2IC3A 2OJ3A 2HRYA 2LVWA 3HO1A 4ID5A 4HT5A 3ILLA 2YXLA 4DI6A 4ZJOA 1T0TV 4ICLB 1VRTA 1SV5B 2KG1A 2UV8A 4JOUA 1TV6B 2RF2B 3LO3A 4DPUA 3PX6A 1LWEB 2RQMA 4O44A 3EX7B 2F65A 4R8UA 1QSLA 5AXMA 1F1BB 3MM7A 4DL2A 2Y1IA 1Q79A 4CLTA 4AL5A 1SB6A 3CDWA 1RXOB 3D0IE 1KQFB 1JLAB 1R8BA 4CO1A 2GA7A 4W92B 5GMKa 5KFUA 5L9NA 2J6UA 2DNRA 1HHQA 3PXGa 1IQZA 1BQMB 1GAOA 4CO3A 4ILRA 2M8DB 4DUTA 3DLEA 3THPA 2CQHA 1WC0A 2AKWB 4DR4F 1X4CA 4PPZA 5I42A 1X31C 4J91A 1HLWA 2OFGX 4ELVA 1N5VA 1QE1B 2WVCA 1APSA 1DAXA 3BQ1A 3G4SS 1UETA 4IOBA 1SC6A 2RIJA 3FRYA 2Z30B 3MD1A 4GMKA 1RTHB 1VQNS 3PDNA 3FUYA 1AA1B 3DMJA 4DV5J 4F4AA 3FBFA 3O2IA 3WX8A 2VQEF 1WOOA 2ZNYA 1EHWA 2V34A 1CQNA 1U0HA 3GB0A 2B43A 4K4UA 2UUWA 2DNKA 4IFVB 2UXBF 1JLGA 3I56S 4FS2A 1KQKA 4M63A 2JHEA 3KYLA 4WKRA 1QM9A 4DQRA 1YJRA 4HLBA 2P9GA 4ENOA 1VC5A 1HQ2A 4ZHRA 1A6LA 3KLHB 1DARA 1UA1A 1TZ0A 2AHOB 3V6KA 4KV8A 3KLGB 3VAIA 3MZIA 2OMLA 4DR4J 1ZETA 3QMQA 2R7TA 1CJUB 4LSLA 2VPWB 3UFCX 3BJYA 4DS5A 4O3SA 3IR7B 3DYAA 3EWGA 3C6TB 5GAEI 2XMTA 3CJ8A 1T8EA 4CO4A 2ASYA 1JB0C 3OTBA 3D2WA 2ZDOA 1PAEX 3KLFA 3GYGA 1U2FA 4W90B 2VQEJ 1X9SA 1YZ7A 2ZC3A 1FE0A 1U47A 5KFLA 2LEBA 1S1XA 1NHVA 5DS7A 2EFOA 2YNGB 5C42A 4C8KA 1B7YB 2DH8A 1DRZA 1NK8A 3LQVA 5HBMA 2UXBJ 4A8XA 2YPZA 2KM8C 1SKSA 1LV5A 2GX8A 4ZVGA 3AOCA 1NRKA 1S9EB 5F8NA 1OY6A 1JXLA 3ZNUA 1PSDA 5IZHA 4LIWA 2P9CA 1NZAA 5H9FJ 2JJ4D 1WHYA 3PRDA 1Q82T 4ETZA 2PGCA 4C0BA 3OHAA 3TP2A 3HHNB 4URQU 2BABA 2BJ8A 1Y10A 2FC9A 4DQQA 3S01A 2ASDA 4MTPA 2FZCB 2AD9A 1RLCL 1KOHA 2DISA 2OPSA 3IAM9 1X4HA 3UNGC 2AEJA 2E9RX 1C0TB 1TL7A 4DU7A 1IBLF 4QCLA 2KRRA 3M8ZA 2IM1A 1WC1A 1U1PA 2R7WA 1FO1A 3VZHA 3W9IA 2HQDA 2PSZA 2IBKA 1T9XA 4Y6IA 2IAJB 2V4QA 5DQHA 2BOAA 3GJTB 3QFWA 1NUEA 1PAUB 4ZVUB 3E3XA 3CVKA 3AD9C 1NH7A 1IBCB 4JI8F 5CABA 8ATCB 1RZMA 2KJWA 1K47A 4RNHA 4MFBA 3OR1A 4ZLPA 3W8GA 4RWXA 3IRXB 3IWLA 3J7A1 2XLJA 4ZN3A 1FDDA 3OFFA 1MNEA 2FJDB 4A8YA 1T9WA 3KTQA 4LF8J 4E2FB 4ED8A 3WX4A 2JLEA 3C16A 1GMVA 4Q7AA 3GG1A 1VRUA 3HF5A 3PJ9A 2W2NP 2OELA 4WK3A 1FRKA 4DPWA 5AXLA 1RE1B 2GIRA 1WC5A 4U67Q 1IBLJ 3KG1A 2BE2B 2ZZNA 2ZBQA 4EUVA 2W8KA 1VQMS 1UCNA 3HKZD 3M8PA 3MTJA 2HBZB 2OIHA 4C4WA 1VK3A 4BC9A 4WFYA 3MUMP 5KFYA 2VG5A 4FKXA 1PG5B 3UCZP 1DURA 2BX6A 1VQYA 3QGGA 2K2PA 2G4BA 5F8JA 2HW3A 2YKAA 2H51B 1QD1A 1PYSB 5AXKA 1H74A 4OLOA 5EN1A 3J81j 1SKWA 4RUHA 5EWGA 2CVIA 2ZJRQ 1JNZB 3M2UB 4LVOP 3RG6A 3QIPA 2DCLA 3SFUA 2GNKA 1Y5LB 1HQEB 4RZRA 3GIMA 2WB4A 3M2RB 2XLIA 2H4YB 3NGKA 5D77A 3R2CJ 2L41A 4JV0A 4DUZF 4HDGA 3RW7A 3G86A 4AD6A 4HACB 5K20B 2QRRA 1KBRA 3CD0A 2Z2YB 5EDWA 2CQIA 4LF6F 3R5GA 3SSQA 2C2ZB 4LFBF 3ZZTA 4DLEA 4ED7A 4EBDA 3QBCA 5E3AA 1U8WA 4WKYA 2CNOB 3GONA 1IUJA 2RSQA 3CIMA 1S1UB 1UMJA 4TYBA 3U1NA 1HWKA 4KHPJ 5E33A 2YKMB 4X62F 2OPPA 3EGNA 2XHWA 4C8LA 3F0NA 3KJQB 3B54A 3JYTA 4F8RA 3CE8A 4ZP7A 1Q4RA 3G82A 1M90T 1JNRB 2K3IA 4JI1F 4DHVA 3NGUA 1CS4A 3EICA 3R6LB 4N7TA 2BZ2A 3SDEA 2ZFHA 1QSYA 1UFLA 4LF7F 2VG7A 1IBKF 2B9XA 2VFSA 1WHWA 2J7WA 3M1VB 2MGZB 1RTJB 1RT1B 3G87A 4RU9A 5T14A 2A18A 2UVUA 4B17A 2XS5A 3CB4A 1RWKB 2PC6A 1YJ7A 4LF6J 4I2PB 4LFBJ 4KO0A 2R8HA 2HNYB 2QT7A 4YB5A 1RQ0A 4P7TA 4K4VA 3KDNA 1RP5A 2CPFA 4JV5J 4PYDA 2R4FA 4ZPAA 3D6FB 1RWXB 3THTA 2OKQA 4ZLJA 2JLGA 3GSDA 2WHOA 2XULA 4GO7X 1AW0A 1PGZA 1S1WA 1X7VA 4J5OA 3R5JB 4B9LA 1YSJA 4EU0A 4F4KA 2V8VA 2QEXS 2Z58B 3CMES 4NLYA 4ANEA 1ZM9A 1AUSL 2FTRA 2EI5A 4FYXB 3R3TA 1VYAA 2UXCF 3CEDA 3CCES 4TY8B 2V9KA 4IG3A 1QAXA 3MGJA 3QT7A 2WVBA 1SJRA 2A2DA 1REVA 4HTIA 1S4FA 3DLJA 2E5IA 3KK1A 2YWKA 4CDIA 3E01A 2HHSA 2DCUB 2WSEC 1RWPB 4C48A 1SUQB 4RX6A 2KFYA 1RTIB 4LSZB 2JH3A 3ZZUA 4TU9A 1EB0A 3O3LA 4HL9A 4IDKB 4JP8A 3CJSA 3LPEA 2UUTA 1ZTWA 3SCLE 4NRUA 4IOCQ 2XYPB 4JI3J 2FVQA 3KNGA 4RW6B 4ED6A 1WACA 1NNDA 3DOMB 4CP5A 1N5YB 1CC7A 2UXCJ 2E7XA 1X4DA 3TUPA 5GMDA 8AT1B 2ZHBA 3BH6B 2VBWA 4F3MA 3CCJS 3BKTA 2IC3B 1H2TZ 2GW8A 5KT5A 1XMQF 4ID5B 4E98A 4QWEA 1ZZNA 4GO5X 1TFYA 1T3NA 3BPSP 3VAKA 1ZA1B 1VRTB 4NXNF 1EP4A 3FCHA 3PW5A 3VCDA 2F8MA 1I5OB 2C2MB 3D4JA 2CUYA 4PKDB 3O1LA 2FY8A 3NAHA 2AJ1A 2CJBA 1TFWA 4DSEA 2FHJD 3QT5A 6FD1A 1RSCA 4LVNP 4R8UB 1JJ4A 2HLTA 2HS0A 3MM6A 2XY5A 3N28A 1WEZA 3H2LA 3MM7B 4YDDB 1VGYA 1R3NA 2HAFA 1Y11A 4YR2A 4PG6A 4EK2A 5JVHQ 2MKJA 4CWBA 1HNXJ 4CM2A 3ZXWA 1RABB 4MAKA 4A8KA 3EUNA 3PHTA 3G6XA 2CQGA 3V4IA 2I38A 3VAMA 2MEWA 4PG8A 1X4BA 3DLEB 1XMQJ 4PRFA 3RB6A 3ELHA 1TKXA 5I42B 3L7OA 3BV8A 3AB2B 1M1HA 2J5AA 1BWEA 5AT1B 4HYKA 4NXNJ 2K3KA 2DTJA 5F0UA 3PW4A 4F0MA 2VJUA 3EM1A 5A2QU 2C2EA 1H7WA 2YNHA 4OL8A 1XQIA 3CNQP 3OL7A 4ECQA 3VHQA 2H54B 3L3CA 1T03A 4Q44A 3DMJB 4NMLA 1LXNA 3OLBA 4YHHF 4TLRA 1RCOB 1YJ9S 1U0HB 2QMXA 1JLGB 2DXDA 3CO0P 4F3QA 4A8FA 3V6DA 4KT0C 1WTFA 3BSAA 3I82A 4ZJLA 5JXSA 5HMXA 4ZHRB 4CLWA 5B09A 4ED2A 1HI8A 1FX2A 2BQ3A 4ZDNA 1XEZA 3ZTPA 2DGVA 2DGTA 5MLCV 1IXKA 3QRQA 4LRFA 4LSLB 4KJIA 3UPFA 4M5DA 4DL6A 3WDOA 3PR5B 4M8LA 3DYAB 1T05A 4WFXA 3C6UA 4CTAA 4J90A 1AFJA 2KL8A 4PXDA 3KLFB 5B0BA 2YKNA 3DRXA 4TLQA 4YHHJ 4V1Ak 2FHKA 3AOBA 5C42B 4F2RA 4P9SA 2DNZA 5F8GA 4C0HA 1S1TA 5A0YA 5HBMB 4C6AA 4DN9A 2HHPA 3BS9A 4OFZA 1O51A 2ZBPA 1XTZA 3TJ9A 1UTAA 3RR8A 4ZLLA 3TVZA 3KLEB 3A3OB 4QIGA 4OZ2A 1X60A 2ZZMA 3Q83A 2E44A 2Y8WA 1UZHA 1TP7A 4ZCLA 4OMFG 3CCQS 4Z7CA 2WK4A 4ECYA 4IRDA 1X0FA 1IBMJ 3FMBA 2AX0A 3H5SA 2M4MA 3NWGA 7FD1A 2YH1A 2OPSB 2H5EA 4CLZA 2AW0A 1QVFR 3I5BA 4QR2A 2OMOA 5ETTA 2DPIA 5LM7E 4L72B 1RADB 2PFFB 1KQSR 2HZVA 2DNQA 4Q45A 2WSCC 5C7PA 4TYAA 3C46A 3GIIA 5KFRA 3AXMA 3Q86A 1UA0A 1HQUA 3QSIA 2ADCA 3OTOF 4CH7A 3MAHA 2VOPA 4MFBB 3EGVA 3OR1B 4LSNB 1TKZA 4EO6A 2YKPA 2GHPA 3FZ2A 1EETB 3B4MA 2HFOA 1W25A 2ZH8A 4Y00A 4O4GA 4B9MA 3PR4A 4BHQA 2XI3A 3J7YI 4KC5A 1W7WA 3C16B 5GAEU 1VRUB 2DNHA 1JWWA 3I6PA 4ZPTR 2WONB 1E6YA 1X4EA 2FJXA 1Q95G 3DI6A 2VONA 1HL6A 2CIMA 2DGUA 3TRGA 1RHQB 1YX2A 1JX4A 2MLXA 3M8PB 3MM9B 3N5FA 3KDOA 2K7KA 1P9QC 5K8NA 4LF4F 3DN9A 1RISA 2F9DA 2MZTA 2DNPA 2VG5B 2BANA 2GC8A 2M5YA 1NO8A 3R5AA 3Q8QB 2IJNA 3OD2A 4WP9A 4GKJF 1N8RT 3GIJA 3R8YA 3E2EA 4X66F 1Y7PA 2DXEA 3ZTOA 3AB4B 3HSGA 2HBRB 1VIXA 3PM9A 2IRYA 4FKYA 4J9MA 4DQIA 4HHUA 4L76A 5DDPC 1N32J 3QIPB 2P6SA 4OI3A 3M8QA 2KT3A 2BJ7A 3E51A 3KWMA 2MYFA 5ETLA 3DLHA 1MWYA 2W2QP 5DJBA 5LSOA 4UOGA 1U02A 2X7IA 3R1LA 2GZOA 2RU3A 4DR7J 4LMZA 4HDHA 2EC2A 2BE9B 2J9CA 5GMEA 1EQ0A 3A8KA 3KLVA 4G6VB 2G2ZA 3SBMA 2LEPA 5H1SV 1D8ZA 3B82A 2M9KA 1VLOA 3PZPA 3NMAA 3KUHA 4PWWA 5HP1A 2ZNZA 1WD6A 3NEKA 4OYMA 2AF6A 3TEHB 4ZA1A 1S10A 2KH9A 2VBXA 4C3KA 2EK6A 2OPPB 2PA8D 4A48A 3JQJA 2PA3A 2CZVC 3EZOA 3J7ZT 3M4XA 4K59A 3G82B 2V94A 2W24A 1JLFA 4OI0A 4IR9A 5M2PA 2WBMA 5D4LA 4G3IA 2DIUA 1X9WA 1CS4B 5CYMB 2UUBF 3HHLC 1U6FA 3BGFA 3SDEB 5KTQA 4RBVA 2VF3A 2VG7B 1UW4A 2E1RA 3EVMA 3G8TA 1EQMA 4QYZJ 3MURP 3HK2A 4YP3A 3SQGB 4J9KA 3D6MB 1NPRA 3D1HA 1KWMA 3VV2B 4MIWA 3R97A 2XCAA 4KO0B 4LRBA 3AD7C 2E1CA 3KK2B 3HVWA 3HHEA 2MQMA 1P1LA 2ABYA 1LFWA 2EBEA 1N36J 4DQSA 1IKWA 4ERDA 1FFSB 4NLDA 1JLQB 2G13A 3IR6B 1WKLA 2B7CB 1SJ4P 4P2MA 3A8JA 5AJ3F 5DGAA 3PIOQ 3GV8B 2R8IA 3M30A 2Y1JA 1S1WB 2MKCA 1SIWB 1K73T 1R0CB 5L39A 2NREA 4WTOB 1WTBA 3BR9A 2VD3A 2UUBJ 2XYHB 1GK8A 1CG2A 4IG3B 5DO2A 2BJEA 1S0VA 4CLPA 4LIRA 5LMUF 1Z1ZA 3BBBA 4Q43A 4DPTA 1FD8A 2ACMA 2LXUA 1YIJS 3BREA 1VR6A 2BJDA 1IWGA 4WE1B 2F4VF 1V9OA 4IG0A 3J81Y 1REVB 4OJ3A 2GHWA 5D8HB 4I64A 1SC3B 4ZJQA 2ZHAA 3E01B 1VQKS 2LQBA 4RNOA 2EFGA 2QSWA 4X65J 4CYUA 1B0VA 5J2MA 2HKEA 4Y2IA 1LOUA 2DGXA 3FCVA 4NASA 3VWSA 5AJ3J 4UW2A 4CNYA 4NL5A 4LF9F 1AFIA 4WFNQ 2FDNA 2XY7A 3QQCD 5LOQA 2BUNA 4OQJA 5KFTA 5G0RB 2VC0A 2HFZA 5BYRA 2FGCA 4ATNA 5KG3A 4QIFA 2VG6A 3PO5A 3IFEA 3JQMA 2GGPA 2Y1RI 3C2PA 1YJNS 4F26A 4UUWA 3PIPQ 5AE1A 5LMUJ 1WWHA 1HHSA 3K0JA 1NJZA 3DNCA 3NGRA 4NMXA 3Q2TC 2PN6A 3CMQA 2ZJPQ 2EG1A 4V19X 2RVJA 2W4DA 2C2OB 1FTRA 3R7BB 3QRPA 3B4DA 2HHHF 4NA1A 1N52B 2MQPA 4AXIA 1EP4B 4JYAF 3I4HX 4F67A 4NXMF 2QYCA 3VVTA 3OXGA 1SC4B 2FZGB 3AQPA 4FYVB 3PW7A 3GV7B 3MM6B 5CYJA 2G0IA 2FUG9 1RBAA 1XNRF 4NLSA 2R7QA 2KG0A 2HAIA 1FRMA 2GAGC 3T6BA 1Y5IB 1V3SA 2J76E 1KRPA 1FRXA 4KR0B 2AYGA 1JLBA 4BDPA 2G1DA 2YWGA 2FLNA 2J7UA 1XJWB 1HWUA 5KFFA 2W9AA 3DHXA 2WCXA 1TKXB 5GAHI 2HHHJ 3RTVA 2CDRB 1U1MA 2CPJA 4DR1J 3DGVA 3BN4A 2FVCA 4NZ7A 1P1TA 1Y4ZB 1SJFA 3MDFA 2HPUA 2J0QD 1U8SA 1TMJA 5C2CA 2KT2A 2R7OA 2QLJB 3JQKA 4A8OA 1T03B 1IN0A 2C2NA 2CG8A 2DO4A 5DQIA 4EFAC 1VQLS 2HZCA 4P10A 1PILA 4BBYA 3GYXB 3RAMA 4CO2A 2D9OA 1XNRJ 4P71A 1RWUA 3SMZA 3GJSB 4OZJA 1ZA2B 4U6PA 2Z56B 5DRKA 3V6DB 4GC6A 5DG8A 4ZKAA 2G9OA 3N5BA 3OR2A 4WFZA 3D0GE 4MYUA 3HJVA 3FSXA 1QDUB 3V5RA 3MR7A 3P4UB 1RBOB 3DFEA 3EGZA 1Q78A 3F56A 1RDRA 2M70A 1TL1A 1N5QA 2BXJA 3GU0A 1OJ4A 3MEGB 2RNEA 2XO6A 2LQ9A 2IDEA 1UWAA 2FPHX 1S57A 1T05B 4PUOA 2V8PA 3GJRB 5F41A 3C6UB 4CTAB 2VHGA 3PV8A 3GZ7A 5L1LA 1R8AA 3J7Z5 3MM5A 2WAQD 4X2BA 1HI0P 3HULA 2YKNB 4PXBA 2GCFA 1U1RA 1WDTA 1VFJA 4CH1A 2E9ZA 1ZYQA 1RAJA 2VPYB 2M88A 3JXOA 2X1GA 3O44A 1S1TB 3TJAA 5A0YB 3LA0A 1NK0A 3CCSS 5B08A 1RTZA 3M9MB 2JFKA 2FJWA 3M6VA 1NB2A 1GX6A 3EXCX 5B0EA 1EARA 5J2NA 1G1XA 1VQOS 5I3UA 1S77D 1M5VC 3VQTA 2ILYA 5KG0A 2LQJA 3P5BP 2E1MC 3PCOB 2ZITA 4M5IA 2WBRA 3C15A 1OO0B 5CH7B 1C4AA 4O3NA 2JWNA 5ETMA 2YKOA 1TVRA 2JEIA 3DRYA 4FBTA 1H2UX 3ULHA 4LBHA 2YQ1A 1TK0A 2BE7D 4QIVA 1REGX 2O67A 2IMOA 1RU2A 2DPJA 4J9UE 2VUGA 3DOLA 4OI4A 1HQUB 2GS8A 1WEYA 3BO3A 1FD2A 1D8YA 2KO1A 2BM1A 3ZNJ1 2CG4A 1TKZB 3M8RA 5HI7A 3RW6A 4P72A 3EE3A 1OQ6A 2RRNA 5D78A 2DNLA 3D3CJ 4OYOA 1ZAVA 4O4GB 3PW0A 4NA2A 1R0AB 2MY7A 2LEAA 1YHQS 1RT3A 2VDHA 1RU1A 4F7VA 2CPDA 3H42A 3VVUA 4J9PA 4HT7A 1FWLA 1T11A 2GHVC 4YEAA 2W01A 1I51B 2KB2A 2CQ2A 1VBKA 5HL7Q 2B6AA 1E6YB 2BA9A 1QAYA 3H4DA 3NCPA 3AFGA 4R0JA 3DLLQ 2O3DA 3VALA 2MZQA 3EZ5A 1JJCB 1RAOA 1S76D 3ZTSA 1VOMA 2DEIA 3HHLA 3KNAA 2RDDA 1F2GA 3CJ0A 5FDLA 1C1CA 3N0VA 2LU1A 2ZOMA 2V68A 3VZIA 2BACA 2R3VA 1DHMA 3IBFB 4QW9A 2KT5A 4I6WA 1HR0J 4Y3CA 2APOA 2HHVA 2XGPA 3W8PA 1VQ4S 3FQKA 1KNZA 3NBPA 4OV1A 5IT4A 3S6EA 3M8QB 1M0SA 1FNMA 1L3VA 1S4EA 4CM0A 1VCTA 1R8PA 1U1QA 1T95A 1X8DA 3H25A 9ATCB 3KJNB 1U6ZA 2CQCA 1MWZA 2DY1A 2IHR1 2W7PA 1LWFA 1FDAA 1FESA 1L3KA 2BJ1A 2X1BA 2JEGA 3DCAA 3D6TB 1H72C 5BJRA 3QAUA 2DYAA 3JTOA 2VDIA 4DWIA 5J1EA 1SJ1A 4IH5A 1HHTP 3ENQA 1Y3JA 3DLGA 1UWBA 4DR5F 2CNKB 2F63A 3ZZYA 5EX0A 4YY3J 3KHLA 3T19A 5IT0A 1WOSA 1R8CA 1JLFB 3UR3C 2OPQA 3J7YU 3RJMB 3MMJA 1DTTB 4XO0A 3H2VE 3KHGA 1RT2B 5G4DA 5M2RA 1S12A 2F9JA 1U09A 3GMGA 4J9QA 5D15A 5CD4H 1TL4A 4NLUA 5KFSA 1OPIA 2UUCJ 3IS9A 1N6QA 2QGFB 2MY8A 4JI0J 3AJ2A 2XNQA 1VJWA 2X3GA 1CPZA 3KUGA 2MQ8A 1IKWB 3CJQA 5CZVA 1SQFA 4YS2A 2OO4A 4CLUA 1N5SA 3VAGA 1H98A 2PO4A 2P8IA 3CCTA 3Q23A 2I8EA 4DSIA 3VF0B 1H7XA 4M5NA 4CH0S 3T41A 4ZLNA 1CQMA 2D9PA 2QIFA 2DNYA 2BRKA 2KVQE 2XZWA 3MPUB 1ZH5A 4QR1A 3PACA 4IYQA 2XG8A 2Q3PA 4FVCA 3SQOP 2OP5A 1ZAXA 2HSEB 2BM0A 4QQBA 3CD7A 3KUEA 1G6BA 1U1KA 3FGVA 4IFYA 1HNVA 5LL6d 2JEFA 1VBZA 2OUGA 1N4LA 1AT1B 1S9GA 4HTJA 4CYUB 3D1OA 3SCKE 5J2MB 3T9NA 3OL9A 4NWBA 1FRJA 4EYIB 1YLXA 1RAFB 1YG0A 2QA2A 3CJ3A 3MCSA 1D3WA 1SJQA 1HWJA 2W25A 2CNNB 1VJQA 4CT9A 4OX8A 5H9EK 4EEYA 3RB0A 2N82B 4OHXA 2L48A 4OX7A 4DX8H 1RJJA 4MIAA 4B3OA 3D67A 2QO3A 2RQCA 2VG6B 1HI1A 2GGPB 2JC1A 2W9CA 3A3NB 2IA0A 1M5SA 5KOWA 3CDAA 4O3QA 1PJ5A 5KFWA 1S72S 3K7RA 2W4CA 2DNGA 3HSDA 3QO9A 4UQGA 1NK5A 4IO1A 3B8HA 4DBQA 3HLUA 4I1TA 3B6BA 1WEXA 5D4PA 5C24A 4OHVA 2HFNA 5AXNA 3CDEA 4H4KC 1HNZJ 4USVA 2NUHA 2V50A 1F3VA 2V2VA 4X4SA 4J9SA 1B0PA 4R0EA 4PG4A 2CJ9A 1O8BA 4U7UD 4N8NA 1HFEL 1VIOA 4NZ0A 4NPOA 2CWKA 4JB8B 4LQ3A 2CADA 3P3DA 4WFAQ 4C3MA 1YJTA 3PYGA 5DZ6A 3IGNA 5B0CA 3D5MA 3HXMA 2ROEA 1KDNA 2RB7A 3OT9A 4PPDA 4EYHB 1GTHA 2KN4A 1WF1A 2E7VA 3W5XA 1KC8T 1JLBB 4X4RA 2XMVA 3O6QA 3KG4A 1Q86T 1KHWA 3LW5C 2N3LA 3AH6A 3UN2A 2ACYA 5DETA 3Q8PB 4LFAF 2KXNB 5HROA 2CNLB 1RKIA 3Q24A 5IOLA 2UUAF 3OVSA 2A6OA 4EWTA 1PO6A 2MSSA 4CI0B 1IKYA 4Y2KA 4FXWA 2NXNA 2ZD1A 4IH7A 4JI7F 4YB6A 4PWDA 2D69A 3CJ5A 1HNWJ 2NZ4A 1FJCA 2G2YA 2Y8YA 1LKZA 4HH0A 4WZQA 4GKKF 1FNOA 5KG4A 2NSCA 9RUBA 1SCJB 5U47A 8RUCA 2HHTA 4HHHA 1TUGB 3MEDA 4FDFA 4B08A 3U02A 3LALA 3SCIE 4YDXA 3P8BB 3G71S 1SQGA 2DVIA 2R42A 5HK4A 5BR8F 1F3FA 3U27A 4W4MA 3RR7A 1I94J 5BYSA 3UO0A 5IV3A 3RB3A 1N54B 1TL1B 3IM8A 3CCZA 1RT7B 2WVEA 1VI7A 4IR1A 3M2VA 2Q79A 4LFAJ 3M7VA 2QC3A 2IY5B 4PR6A 2OPRA 2PMZD 4X4OA 1UPMB 1CEZA 5KG2A 5DLGA 2DGSA 4LF2A 3TQEA 4PUOB 3X1LB 1U48A 2KJVA 4X4TA 5E3PA 2CQ4A 2RS8A 3UVJA 4AT1B 3MM5B 3DDNA 3BDPA 4YUDA 1LW2A 1NHKL 1R31A 1YBUA 3AAWB 2IM2A 4KRWA 2MJNA 5A2QY 4EBEA 1B0TA 5CXTA 4GKKJ 4OJGA 2VBZA 2B4OA 4QIWD 3MOZA 1RAAB 2V4RA 4O23A 5DLFA 4DL5A 3VGVA 3VQSA 2M3DA 3NS6A 1NK9A 1TL5A 2OSQA 5J2QA 3DDIA 3SXLA 4ED1A 3G8SA 4DL4A 5J2NB 2V9WA 3T1YF 5T7LA 5I3UB 1FXDA 1N88A 2B4UA 3MFIA 5GAHU 1ZM2A 1UVIA 3BQ0A 2RS2A 2LXIA 2DBBA 3KXDA 3GCWP 3EDQB 5K8OA 3OV7A 3C15B 1E6VA 4KBIA 4YB1P 2FHJA 1TVRB 3GTYX 3ILIA 3EDRB 1HPZA 1W26A 4ALZA 3G9CA 5EHHA 1KSPA 1DY3A 3RRKA 2IRUA 4I2QA 3WC0A 1DTQA 4USMA 4B9NA 2BBEA 2ZOGA 2GJFA 4CT8A 1G4CA 1JJHA 4MKAA 3PRBA 1Q81T 3DXSX 3DLBA 3DOLB 2BDPA 3NMRA 2KFNA 3VAHA 5HJXA 4X4NA 2QX0A 2QA1A 3RBZA 2GFFA 1KR4A 1NPPA 4MKYA 2KXFA 2OTLS 3GPAA 1TUWA 5L9XA 3PKYA 2ZH4A 1XNQF 1B70B 2I1RA 3K2YA 1RWOB 2HIQA 4OZ0A 1D0EA 3VGUA 3IG1B 3M32A 3ZTQA 2QMWA 2B6AB 1XN9A 4PABA 1P9YA 2XZDB 3L09A 1YBAA 3BN7A 2MKKA 4F25A 3HZGA 1YQHA 2WW8A 3I9V9 2A10A 4DZDA 2OEMA 3MR3A 4O3RA 4ZMMA 1T7PA 4O3PA 3HCXA 2XGQA 4U7CA 2E9TA 5L46A 2DHGA 3TUIC 2B8QA 1ITPA 3MMBB 4ZVQB 2I6WA 3W9HA 1C1CB 4F0KA 2K06A 5DGBA 4LRDA 2YBVA 3H98A 3C14A 4OV6A 4ZCIA 2DJWA 4RNNA 2IYGA 1Y9OA 3D1QA 4DV5F 1VDHA 2AT1B 4GC7A 1XNQJ 4P6QA 3L4BC 2QN6B 3BGOP 3NBPB 4M95A 2CPHA 1QUVA 2CXEA 1PC5A 3BKFA 3OLAA 4P52A 4KPCA 3OUYA 4P2SA 2L9NA 3OBIA 1WI6A 2AEMA 4QU7A 2ZBIA 2HS4A 3R5BA 4JI4F 3S7RA 2MLYA 4DCOB 3K5NA 3OQ2A 3P6YC 2G2OA 4ZPVR 3R6GB 1M1GA 1LWFB 1Y0HA 5HATA 2XWYA 3W5ZA 3W65A 4IO9Q 1S79A 1M5OC 5F8HA 3WQPA 1YI2S 2IMWP 3R7SB 3IAS9 3ZZZA 1YWXA 5KT4A 2JSXA 3MCNA 3KJVA 5J1EB 1VLYA 3PYDA 1GX5A 1VISA 3DLGB 1UWBB 4RW4A 4RLEA 3DC2A 1WKKA 2OSRA 3H40A 5DZ7A 3MPYA 2D3O1 2GVZB 2XI2A 5CYQB 1TK8A 7FDRA 3C8YA 1HW9A 1OYDA 4ED3A 4CLKA 2FZKB 1K8AT 1XK8A 1P27B 2D3OR 3W2VA 2OPQB 3NCRA 4NLRA 2WTFA 5KFBA 1VC6A 2ZH6A 2ALYB 4OYAA 3DRSA 2R7XA 4MK7A 2BJ3A 1D1UA 4WZMA 1AUDA 1N5TA 1FK9A 4DL7A 3MAAA 4JI4J 3CGIA 2R2SA 3HHLD 1RUSA 2ZZTA 2XQCA 2VA3A 3L7PA 3U1LA 4QYRA 1TKDA 5A8KA 2CPZA 1J27A 3JSBA 5A8WA 4C9DA 1N48A 2CA9A 4Q8EA 1N6QB 2IM0A 3QZ8A 4PWUA 1RHJB 2DHXA 2YWEA 2F5GA 4F4ZA 2YX1A 1YRUA 2WVFA 2MB0B 1TL3A 1R7IA 1X9MA 2GQ2A 2OFHX 5C2GA 1QLNA 1HBUA 4DV1J 3A8IA 3GILA 1UW9A 4N41A 2CZ9A 3MFHA 2J9DE 1KONA 2UVRA 1M5KC 1QAIA 5MAOA 2CKWA 4WTYA 4N8OA 3VGSA 4Q2MA 5FD1A 3US5A 4H4KA 4OZNA 1BLUA 3BB5A 3J7AN 2E5JA 2OLWA 4WBFA 2CJYB 2KHDA 2EKNA 1Q8IA 1DLOA 1NSPA 3Q2SC 3QLHA 5KFMA 1KLMA 4L73A 5EUHA 1UEKA 2XMMA 4DR3F 4IFYB 5DDQC 1HNVB 2IDLA 2EFNA 4B02A 3IO1A 5L1KA 4ZN1A 1S9GB 2LMIA 2NYIA 1H3DA 4QOTA 4LF8F 3PEHA 4DX5A 4J9OA 1K9MT 3V6HA 2MKHA 4CZCA 1OS5A 3QYYA 4HEA9 4FNIA 4YR3A 5IS2A 3SIPB 3V81A 3TYTA 3BGLA 3I5CA 1RHUB 2DR8A 4FF1A 3MR2A 2VC1A 4B3OB 1Q8LA 1YJVA 2CQ0A 5HMYA 2W2PP 4ZOSA 1NPKA 1LEOA 1QSSA 2EG2A 3DRPA 3OTEA 1SKRA 4M94A 3SI8A 3I87A 3RZAA 4OYXA 1HBOA 4KSEB 1YJWS 2VICA 2XTJP 2QA4S 3QO9B 3KMQA 4DR3J 1R8HA 1SBRA 4ED0A 1VBXA 5E3RA 5C24B 3MXHP 2MPUA 4B3MF 1U0SA 3CW2C 1BC6A 2GVDA 2DHHA 1S0NA 1JJ2R 5C25B 1UVKA 3VAFA 1BQMA 4DV2J 5ETRA 1TELA 2CPXA 4XK8C 2B4PA 3GR1A 4Q2LA 2MJUA 3FSIA 1F5BA 1NSQA 1YKWA 1QTNB 1HBMA 2QA4G 1RAIB 3DLKB 4PXCA 4CLSA 3T3FA 1URNA 1XC9A 4IUFA 1RAEB 5KFVA 2QL5B 2I5JA 2PMHA 1XR5A 4KHPF 5KFZA 1TMMA 3PHEA 5EX3A 3TNVA 3AT1B 2ZH7A 1RCXB 2HWTA 3W5YA 2YX7A 1RI7A 2R8KA 2N7YA 2KI2A 1RAHB 2QLXA 5HROB 2MZJA 3AA9A 4C97A 4B3MJ 3H7HB 1S49A 4JBCA 5KT2A 5E3CA 3MUTP 1O5JA 4PG5A 4NYPA 2P5VA 3QT8A 4Q0BA 4DV6F 2A6MA 3OFHA 1BXNA 3OSPA 1IKYB 3HPOA 5HLFA 2ZD1B 4DV4J 2RQKA 4PWDB 2VH7A 2YX4A 3ADAC 1B7FA 2K7JA 1YJUA 4M5GA 1OQ3A 3MEDB 2AMCB 2B9EA 4DX6A 3C6TA 4ZVSB 2XM3A 2BQRA 3I55S 2C3YA 1S1VA 4FYWB 1NCLA 4JV5F 3FC9A 4ANCA 4KTQA 2D7SA 3FEZA 3R5DA 4NLOA 2YNGA 4K4WA 1U49A 3M2VB 1RB0A 2OPRB 2X1FA 2N7CA 3O8WA 2QZ8A 2V63A 3LF0A 2LKZA 3AOAA 3W2WA 4JI5F 4TVAB 5KG7A 4DV6J 4R25A 1MW7A 1RYSA 3UVJB 1T3OA 2CYYA 1PJ6A 4LR9A 4KAIA 2DH9A 1Q8KA 1LW2B 5J2PB 4DV0F 2WVDA 1ZOTA 2YH0A 3F73A 3CWJA 1FF2A 2GV1A 2MQLA 4DF8A 3MCOA 3X3UA 3NG8A 3D6HB 2R7SA 2V6AA 2VKZG 3KFWX 4UQTA 2AWZA 4TKTA 4B3RJ 3SYZA 1ROFA 4KFBA 3TA2A 1IM6A 4EZ9A 4DJBA 4ZIWA 4PAAA 5T7LB 2RDJA 1MMDA 5KT6A 4OI2A 2HG4A 2PMWA 1LFPA 3UN3A 3C3LA 1DQ9A 2C22A 2IAJA 1SQEA 4C11A 3P96A 5D3GA 3HFVA 5FJ4A 1E6VB 2GMLA 2BV3A 2YNFB 1IQTA 4NCAA 3TA1A 4YN3B 4JI3F 4JI5J 1QY7A 1D9FA 4DV3F 2IA6A 4B9UA 2XSJA 4X84A 2FVRA 3IWNC 2QE5A 1KS2A 4H4OB 3J80Y 1NJWA 4I2QB 2AX1A 1S6UA 1U1NA 2E1PA 5IT9Y 3UDVA 1DTQB 3H5YA 5IM0A 2PI5A 4DV0J 1CJVA 3MM8B 2FGOA 4NCBA 3UI3A 2DNNA 3EZUA 4USIA 1ZM3A 3MOJB 1KOOA 3IR5B 3Q8VA 5IXUA 2E5LF 1X5TA 2F7VA 2CRLA 1HMVB 3BYPA 4I6YA 3NNCA 4G1PA 1XR6A 4FZVA 4ZPBA 4U9RA 4DG1A 4WFBQ 4EMDA 5D6GA 2HEKA 2NR0A 1RTDA 3LH2S 2EFVA 1UEVA 3Q8YA 3CJKA 5M2UA 4Z7YA 3TOQA 4Q5VA 4DFKA 2OEKA 3GSIA 4B9VA 4FYDA 3H8YA 4DV3J 4AL7A 3UCGA 1SPBP 1HNXF 2QL7B 3QZ7A 1U2RA 1X0PA 3HHDA 5HSPA 2J0WA 2CJKA 3PO4A 4FXVA 2DNOA 2GIQA 3EGWB 4K7QA 3HI9A 3IMQJ 5JJBA 3FEXB 3CCRS 1KHVA 3JB9k 4DDFA 1NM2A 3UDLA 3UCUP 1IJEB 4K4ZA 1FJ7A 4E0DA 5FLXU 1ZTTA 2E5LJ 3I5AA 4NE9C 1FXRA 3G8QA 1UVJA 1V5VA 4DN0A 1UPPA 3MMCA 1WG1A 3C14B 2V8HA 5KFAA 4FPRA 1H0HB 2JVRA 3E8OA 3HSJA 4O44B 4LFCF 2FJAB 2EC0A 4WJBA 1NDCA 1XR7A 3L9ZA 4NCGA 4HKQA 2JC0A 3BSNA 2DRBA 2CQ3A 4IRKA 3Q22A 1S1UA 2AU0A 4C8ZA 3IBWA 3OUYB 3BM7A 2YKMA 2B9YA 2MHNA 7AT1B 2P6TA 1TR0A 1NJIT 3HJFA 4AXJA 1FX4A 4QU6A 1BWVA 4LREA 4ED4A 1KKHA 3TAMA 3G96A 3LGNA 2RRBA 1FE4A 3OXLA 4Y2MA 1D9DA 2HFSA 3CF5Q 1S59A 1BQXA 3K5MA 4MYTA 3NGTA 2X51A 1NK7A 2M7SA 1NSKL 2NLWA 3MECA 5KAKA 4M1KA 4KHRA 2XZTB 4LT6A 5EWFA 4RW4B 3ILOA 1S5ZA 4CO5A 1BQNA 3I9ZA 5LMNJ 2ZBRA 1WOPA 2R9LA 4LFCJ 3I4PA 4I2PA 4JV1A 2HNYA 1SL1A 4KPYA 1FEEA 3GLJA 2IJRA 4D3GA 3CJRA 2D3UA 3DRSB 3UD5A 3PJWA 3G6YA 2U1AA 4TY9A 4JUZA 2KYZA 5AE3A 4X4VA 4FYYB 3OL6A 4DS4A 1VMBA 3P5TL 2AJ2A 2BJ9A 3MAAB 4OYBA 1WDDA 2V8GA 4OI6A 3LP2A 3KLIA 5A8KB 1N34F 2YWHA 3TWZA 4ECWA 5A8WB 3JTPA 5FIIA 3R27A 3ZC4A 4KV8B 4RPFA 3JSRA 4WCEQ 2PEHA 2MDAA 3VR1A 4ZPDA 4RNMA 1GMUA 2YTCA 1IM4A 1S6OA 1TL3B 2AGQA 1IBMF 3NOCA 3OTDA 4L6V3 5KT7A 3TQ1A 3AJ1A 1T9UA 1NH8A 2XHCA 2J6SA 1TTHB 4G1IA 2KTQA 4TU8A 3HZEA 1C0UA 2J7KA 2A3JA 2V0NA 1MMNA 1UFWA 1OIAA 1WG5A 2PFDA 2K1RA 2OTJS 2B8PA 2OAUA 1Q0NA 4OHWA 1S1XB 3RGIA 4HH1A 4DZ6A 1WNEA 2E5HA 3AODA 4XTTA 5ETSA 5ETKA 3DGPA 3GFZA 2Q6CA 3K5LA 3Q0AA 2N4CA 2ZVIA 2MKYA 5IFMA 4YR0A 4LUBA 1DLOB 2YWFA 2FVSA 3QLHB 1RHMB 4IDKA 3HP6A 1KLMB 4ED5A 2DRDA 2QLBB 1MU2A 1N34J 4WIQA 4F0HA 1Q16B 2AJQA 4RUAA 3SZ2A 1FWPA 2Q66A 4RW6A 3SCJE 3HSZA 3AJDA 5GVQA 3PYEA 2ZM6F 1CSJA 1ZM4A 2V5HG 4XIUA 5CD4A 2QG9B 2ZDPA 4LR7A 3HFZB 1RT4A 2MKSA 1XBWA 1PYTA 2CQPA 3GWCA 1TL7B 4BWMA 3KHHA 3V81B 2D41A 1OSCA 2Y1LB 1WI8A 2ZUAA 4LRCA 1SH2A 2M52A 4DL0C 4P73A 3DRPB 1N56A 2N4DA 2HMIA 1HBOB 1GEHA 3NS7B 4IRCA 2ASLA 2DXFA 1WC6A 5HJYA 4R5PA 3DU6A 1FKAF 3W64A 2VBYA 3MR6A 3K89A 4PG7A 3CSKA 3W9JA 1KD1T 1KN6A 5IQQA 1DJ0A 1N32F 2VQFF 1MN9A 4Y28C 2GVDB 4FNHA 4DR6J 4LF5F 2ZM6J 2H3EB 2ZKTA 2DITA 1NJXA 4F4WA 2V2ZA 5HANA 2UU9F 2M2BA 5KFGA 3N9UC 3K8WA 1KTQA 3MR5A 4DR7F 3GIRA 5IC4B 2AYEA 5KFPA 2GIFA 5GAGI 4ITSA 4USKA 2A0FB 4DF4A 4TN2A 1NK6A 1HBMB 2XS7A 2J8SA 2ZKUA 2FLPA 3LGHA 4RW7A 1WELA 1KVKA 4ZP8A 4ETXA 3OVBA 4EO8A 2HQIA 2JVOA 5IQ6A 4QZVB 2I5JB 4O4RA 4NLWA 5E41A 2FHOB 4ELTA 1G3OA 1S9FA 5ETPA 4AFFA 3BH7B 3ET6A 3UNYA 2PDAA 4EZ6A 3G2XA 2HBYB 2VFTA 2R2UA 2C42A 3BKUA 2DR6A 4J37A 1UVLA 2VQFJ 4LF5J 3MEKA 3M8SA 4ILMA 4Q0BB 3PRVA 1NAQA 2FLLA 1EJ7L 2UU9J 3EMTA 1NB7A 5HLFB 5HVGA 4DSKA 2Y0SD 2VB6A 1ZS6A 3K5OA 3L7UA 4DFJA 3BR8A 2R7RA 1WUUA 4OLPA 4TXSA 2IJFA 2BOPA 2ILZA 3CT9A 1F5CA 2AQ4A 3KMSA 1F0XA 2WSFC 4BWJA 2JRSA 1ZAWA 1FKOA 1HIYA 1S1VB 3NP5A 2OD6A 2LXFA 2FC8A 2HHQA 1N36F 3GV5B 1GMWD 2HVDA 2HQ3A 4F3OA 1BHNA 1FKPA 4Z2XA 5KG6A 1Z2LA 1ACMB 2NXUA 3JYTB 3A8EA 4M5MA 3CCVS 1RYRA 3W2WB 1K1SA 1RK8A 2HVIA 4RW9A 2CPIA 3OL8A 4J9LA 3KLEA 5E3QA 3SV4A 3ISNC 3TZYA 2NZCA 2XY6A 3GFXA 1ZPVA 2V8DA 4ES3A 1EX8A 2RD5C 1G2EA 5F3ZA 2RMLA 1KVIA 4A47A 2HVZA 1WJ9A 3U1MA 1UJ4A 4IOAQ 1CJTA 1F60B 2V4JA 1FXLA 1FDBA 5HAOA 3WC2A 5D0GA 4X65F 3QGIA 2E66A 2NPFA 2BW2A 2M8HA 1S0MA 4DSFA 4KFBB 2B5JA 3TUJC 4ZCKA 1DQ8A 2FYXA 4A8QA 3EPGA 5ITHA 4USWA 3N01A 4C11B 5D3GB 3WIUA 2LU2A 3H4BA 1MN7A 1NLKL 3HX9A 1W2BR 4GVLA 2M0GB 3UR0A 2D1CA 3H5UA 3KKFA 2XSJB 3PEJA 1HNIA 2UVWA 4LSNA 4OYWA 4AUKA 3P45B 1EETA 3SFGA 4C2MA 3WBZA 3IA0A 3CC4S 5IM0B 4FPIA 1CJVB 1X5SA 2OEJA 3EYZA 3A12A 3BYRA 3KK1B 4NEZA 1LWCA 3RRGA 2W8LA 2ERRA 2J8AA 5K5MA 2WONA 1CULA 4ZPWR 5K14A 4MIBA 3VAJA 2YWWA 2G0CA 2R8GA 1URRA 4ZPCA 4DG1B 2DH7A 4MK9A 2XCPA 5HN0A 2AJ4A 3MM9A 1XMOF 1RTDB 3H59A 3M9OB 1UJ5A 1H73A 5HMZA 2FJEB 1RAGB 3CJKB 3CCLS 5D4NA 4A8WA 4JI8J 2L3MA 4NEYA 4J9NA 3GJQB 5KFIA 1KTVA 2ZJQQ 5E0OA 3T1AA 1JLEA 3IC1A 1Q7LB 1VQSA 2GMJA 4J7CA 1I1GA 3A1YG 4USUA 4X64F 6AT1B 5GADI 1IKVA 4N47A 4F4XA 3V6JA 1VQ7S 3M9NB 2RKIA 3NXZA 1TKTA 4H54A 3CJ4A 2ZOFA 4DR1F 2Z2LA 1U45A 1J5OA 1LNQA 4XAKA 4L3NA 3MMCB 3ENAA 1DFDA 2O1PA 4KH1B 3SSSA 3ZZOA 2N3OA 2CPYA 1UFKA 3M8YA 3QATA 4N56A 4EI2A 1XMOJ 1WSRA 4NCGB 4ZP6A 2DB1A 4UTGA 2Z2MA 3C19A 2YVSA 2XMKA 1RKJA 1VQ8S 3FBCA 3MUVP 2DR9A 1PJ7A 4CLYA 2Y9HA 3GP9A 1P6TA 2FVPA 2WB1D 3TAMB 3V4IB 1PYOB 5KFQA 3PG9A 1B99A 2ROPA 3PJXA 3TAQA 1GXLA 4KGZB 4X64J 2J6TA 5CYMA 3LGMA 1R27B 3BSCA 5CA5A 2B4VA 3SV3A 1P8GA 2H1YA 3NKYA 5KFJA 5F8MA 4URGA 2KM8B 3MECB 4DUZJ 2Z4PA 1L3TA 2AIRB 2ZH1A 3SQGA 2YNHB 2YQ0A 1BQNB 2KZMA 1OY8A 2L9DA 4M5KA 2LQ5A 2E1AA 1K0VA 1RWVB 4I68A 2YQ3A 1T02A 3THVA 3UE2A 4QPXA 3EVOA 1HYSA 3KK2A 3S8SA 4K50A 1A7GE 4HR2A 5L1IA 1JLQA 2ZH3A 2V2QA 1OMSA 4KGVB 4USTA 4X62J 4LBPA 1FNXH 2EWHA 2HRUA 2B56A 3FMWA 4PCQA 3LP2B 3KLIB 4C7QA 1U7LA 1S48A 2W7OA 2P9EA 4ZK7M 1YGYA 4DSJA 1CLFA 4JI1J 1MWQA 3N6MA 3KK3A 3W3SA 4K8RA 4Y2AA 2VFVA 2ROGA 3J80U 2PIIA 4M5JA 4LF7J 3CCWA 4M5DB 1IBKJ 5IT9U 5F9NA 3OHBA 3LAKA 1NMEB 3DOKA 5L38A 3TO8A 2NPIA 4NLQA 3LAMA 4WE1A 4BS2A 2O01C 4C8YA 2G1HA 1C0UB 3GFYA 2V67A 2PEBA 3HHKA 2K1RB 1O0PA 1ELOA 2G0JA 5CHCB 2F8EX 5LSLA 5J1PA 3RUBL 2RILA 1FVSA 4A46A 2VASA 1PKUA 3DGPB 1NZ8A 3LP1A 1S0OA 5D4OA 4ILLA 1DQAA 3PYFA 4G1QA 1IKXA 3HD2A 3D66A 1MU2B 5F8LA 3LP0A 1BD6A 3ONQA 5G0RA 2QLFB 1FTCA 2RH3A 4DX7A 1IR0A 3PX0A 3OXFA 1KFSA 2D74B 3Q8UA 2C2DA 3K8VA 4OZLA 4PZVA 3GQCA 3A3PB 5B0AA 4QWDA 2RRAA 2W4PA 3G6ES 4QWCA 1X4FA 2CQBA 3UN5A 3FRZA 1XWLA 4YFUA 1N33F 1HWLA 1RT4B 1NHUA 3FNNA 3M6UA 3TEGA 1RT6A 4GVBA 4X4UA 4U8YA 4NRTA 5CCMA 3PY8A 3CD6S 3QWUA 3QJLA 4TNOA 1T9VA 3I32A 4QYZK 3MAQA 3CC2S 2YKQA 3TA0A 2ZWPA 4DPXA 1VS3A 3D3BJ 5JUMA 1RWWB 3NNHA 3D28A 3BO2A 2HMIB 2CQ1A 3K57A 3MPDA 1OY9A 3FZBA 1VQ9S 3GG0A 4R5PB 4RR5A 1U6BA 1HR0F 1T94A 2V2KA 1S97A 3ZZ0A 2PE8A 2R7UA 4IQXA 3HVRA 1JIHA 4WP8A 4WIIA 2VOOA 1VK8A 2KXHA 2I0XA 2KHCA 1FHTA 3CULA 5KG5A 1N33J 1V3ZA 4NLTA 5DM7Q 4J9VA 1RACB 3OFEA 3LWMA 4YMEA 4ANDA 2DT9A 3DI6B 4A4JA 3HFKA 4RJVA 2IVMA 2B0GA 1NDKA 3FCWA 4NLGA 4KQZA 3FFIA 3WZ0A 4RW7B 4WP3A 2EFQA 4PQUA 2F8HA 4AL6A 1KVJA 2XYGB 4OYPA 2XB2D 3UW1A 2DO0A 1HA1A 1H2VZ 2XMJA 2BANB 3IM9A 4KGXB 4L74A 2XC9A 4WPAA 4ZVTB 2R8JA 2MXYA 3ET6B 4LJMA 1NKCA 4ZVFA 4K4YA 2CDQA 3IN5A 4YY3F 2J9DA 3KJFB 5SZTA 4DR2F 5EWEA 5A6WA 1RGVA 3NY0A 2ZUGA 1HWIA 1VC0A 2RHSB 2EKYA 3JAMU 5KFXA 1ZPWX 3AXKA 2JOQA 1GFWB 4UZBA 4F4YA 2L08A 4LQ9A 1C1BA 2NQPA 3ENVA 5KFHA 3NGSA 3MEGA 1SXLA 1FRHA 1F2HA 2JX2A 3AQOA 4RU2A 1ZBTA 5D0EA 2UUCF 1LK7A 2ZEJA 2MHEA 1JXVA 2VV5A 1WHXA 3T5KA 2QV6A 1FKOB 5K9FA 4JI0F 5HP1B 4B3SF 1F6TA 3W7BA 1OWXA 3BBFA 1X4AA 4FBUA 4FF3A 3U7JA 1LW0A 3IGVA 5LT5A 1FKPB 2HGLA 3NRBA 3H0PA 2Q43A 1VBYA 2BKNA 3NCQA 4RW8A 4UY8T 5DDRC 1X5PA 5L8RC 5LJ5Y 4DR2J 4DUYF 4IQMA 2U2FA 3K17A 5F3TA 2AV5A 5RUBA 2JNJA 3MD3A 3FEYB 4RW9B 4BLGA 4DU8A 1WORA 2JLFA 1SH3A 1NEEA 5GAGU 1JLCA 1AYEA 1EAYC 2H48B 2DEJA 2JL9A 1SL2A 3BPDA 2ASJA 4RNFA 2PI4A 5C5JA 1CJTB 3GE9A 2V4JB 5B0DA 2EBGA 3VGTA 3BGRA 2ALZA 3TX8A 4B3SJ 1FDNA 5DG7A 1B3TA 2RUSA 3PFEA 2B5JB 3OSNA 1SVDA 4K2JA 2D3ZA 2COLA 4OX9F 4A8SA 1YZ6A 2YY3A 3C66A 3M30B 4DPOA 5KOXA 3BQ2A 1GQEA 4DUYJ 3ETOA 1W2IA 1MROA 2HVHA 3QGPA 1TQLA 1HNIB 2ZVSA 1TAUA 2RDIA 3BF4A 1S6QA 1SH0A 4WU3A 5A8RA 2QTWA 2C3PA 3NAIA 3A13A 2F3JA 1R0AA 3JSYA 2DHSA 4IG0B 4DPYA 3QAEA 3HKWA 2VPXB 2DR5A 4KH0B 1LWCB 1U26A 2BKOA 2C3UA 4CIOA 1HNZF 2KDOA 3POTA 3R7NB 2FY1A 3R9LA 2X3DA 2IVFB 4FP9A 3DXBA 4P7VA 4ZVPB 1CULB 5K14B 4OYZA 2B7BB 1Z4UA 2J9EA 3R2DJ 1K44A 2UZAA 4OX9J 4ZP9A 3OTCA 3RRHA 1UKUA 4MKVA 2R7VA 1GXUA 2AGPA 4C8OA 1KLNA 2BRLA 3I0SA 4FXDA 3OTOJ 3BGUA 1FT8A 5K8PA 2OHDA 1KP6A 4USHA 3O5TB 3OFGA 2BQUA 5F9LA 1JLEB 2AZ3A 2C2RA 2BYCA 1RLDA 3D54A 1EKRA 1NK4A 1MSWD 1IKVB 3NOGA 4HHJA 1BY9A 3MPWA 2O5DA 2EXUA 2FIUA 2RKIB 1TKTB 1DZ5A 1A0OB 2HHUA 3K58A 2XEXA 2AP6A 1J5OB 1LK5A 1NDPA 1XIQA 3UQSA 4X4QA 4ES2A 1EKSA 5KFOA 3HD1A 4C8NA 1I6JA 2JZ5A 1HNWF 4V19J 5IV4A 2ZH9A 1SI9A 4L75A 4LF4J 4OZ3A 4ECXA 1B64A 4ZIVA 3MI7X 2VFRA 1F9HA 3CDBA 1Y5NB 3UDEA 2QJ3A 3NS5A 4RKUC 1R6YA 4GKJJ 2W9BA 4U7UK 4X66J 3NNAA 1SIZA 2HS3A 1N0VC 1RA6A 2HURA 4LR8A 2ATCB 2R2TA 3MMAA 2NXEA 3QGHA 4RUBA 3CTRA 1I94F 2NCKL 3ITHA 1R89A 2RQ4A 1DTTA 2VJVA 1RT2A 2Z0GA 1WC4A 4OJ1A 1YRTA 1CJKA 1D9AA 4QWAA 1DBDA 2DKOB 1LXJA 2H9ZA 2HK2A 2QLWA 4I7FA 5FLXY 4DCPB 4ID8A 3T5LA 4E8UA 2ZH2A 2V69A 5KFEA 1HYSB 4DQPA 5AE2A 1RT5A 2XO7A 3AY0A 4DLGA 3HVTA 1F5AA 2C3MA 2HZAA 3MWBA 4NYZA 1FEHA 2LA4A 2Y0BB 3RAXA 2A1BA 2VL1A 5IWAF 2HNDA 3OPKA 3OR2B 3MCMA 4OZ1A 4JV2A 2AYMA 1V5IB 5GADU 3KK3B 3T1HF 1IR1A 4WK1A 5HQMA 2OI2A 3PVXA 1ZZFA 1N0UA 3MEEA 3DOKB 4KKOA 4RL1A 2GJ2A 2HLUA 4NYOA 3P49B 3DHWC 4K4SA 1FFGB 1T9YA 3UWTA 4UY85 2VODA 1UEUA 4K2XA 3RYLA 3HT0A 1K1QA 1NDLA 1WC3A 1UVNA 2FHMA 3LP1B 2KRBA 2KYXA 3TZZA 3H90A 3D7SB 4G65A 4YQWA 4KE5A 1XERA 4G1QB 1MMLA 1U2CA 3Q8SB 1IKXB 5IWAJ 4F2SA 4YB7A 2FJBB 1VRQC 2CWXA 3LP0B 4A8MP 4FS1A 2DNMA 2EVZA 5LXRA 2WOMA 3T1HJ 1WKJA 4P2XA 5ADZA 2J0XA 2QYGA 1A9NB 5I4MA 3GCXP 1M5HA 4DXLA 4K4TA 1M5PC 1R6VA 2FLOA 5HVHA 1F9EB 3S1TA 4ECVA 4OI1A 2HNZA 1RT6B 4GVBB 2HFVA 5B0FA 2F4VJ 1FJEB 5J1NA 3K5PA 4KYZA 2GQCA 3K59A 3HVAA 3CXCR 3TVYA 2F40A 2VU5A 1U4BA 3DRRA 1VQPS 5A6PA 5HQLA 2I9SA 2IFXA 2EW9A 2LA6A 3RBEA 4NA3A 2Z2ZA 1WF2A 2HHXA 4BC7A 4LF9J 1FA0A 2OD4A 2VFUA 3FKBA 2MSTA 1JMTA 4UZCA 2CJQA 4NZ6A 2UP1A 3QRRA 2VPZB 5ETNA 4N5SA 3T6JA 2RJZA 3IP0A 1XMBA 2WW4A 1S6PA 1H38A 4QR0A 4RWWA 1RT3B 3T5JA 1JKHA 1J5EF 2CPEA 4KIAA 4NLVA 1RHRB 4XDDA 3FBBA 2I2YA 2MKIA 2LECA 4FVMA 4XPCA 4DSLA 4WXOA 2BEFA 1CVJA 2MLZA 2C1EB 3CJ2A 4NI2A 2UV8G 1H6KX 2IYIA 4JYAJ 3RB4A 2CJAA 3FFIB 3IWXA 4I4BA 4P2FA 3RAQA 4NXMJ 4PQUB 3JSMA 3IXQA 3HHLB 2LCWA 3LWLA 5FDLB 1Q7YT 1FFWB 3W62A 2GAHC 2LDIA 3LTOA 1U25A 4DMZA 4AE5A 1FWKA 2DHAA 4MT1A 2HBQB 3MF5A 2EEYA 3OJSA 2DK2A 3CC7S 1NJYA 4WF9Q 4N77A 1IWAA 2FB0A 2HYIB 4O0NA 2NXJA 1Q5YA 3W66A 2KZZA 5KFNA 1J5EJ 4CO0A 3Q89A 2MZSA 3VTIA 4B9SA 2KKHA 1WG4A 1I3OB 2NS1B 1C1BB 1V3RA 4IKAA 1RT7A 5B7WA 3QIDA 3LPYA 1NXIA 4NLXA 1HBNA 3EPIA 1U1OA 2MQNA 1AZSA 4F04B 2RUGA 5CAAA 4QW8A 5T41A 3ZTRA 2NXCA 4H4MA 2YPYA 3BO4A 1LW0B 5H9EJ 2HGMA 4DV1F 2R2RA 5K8MA 1IR2A 2YNIA 4LF1A 2C28A 4RW8B 4CLLA 3PNIA 2IM3A 1QUPA 1G7CB 4KY3A 2CQDA 4QJVA 2DR7A 4RUCA 4OX6A 1IJFB 2Y3YA 4ECSA 1JLCB 4UOFA 2AYBA 4OYIA 4ECUA 2QFJA 5THWA 3HT3A 3ISND 1BMQB 4HVZA 2HQFA 2P2CB 5D0HA 2JDJA 3IS9B 3BGRB 1B4SA 4UT4A 1TU0B 5F8IA 3RU0A 4JI2F 5CCLA 3QWPA 4K4XA 3N6LA 4TQRA 1BUXA 1KFDA 1X5OA 2CAJA 3F41A 4F02A 3PW2A 2NYHA 3QPIA 3WHIA 1YTYA 4TQSA 3FVYA 1VHIA 4F50A 3H5XA 4FF4A 2QL9B 3H20A 3DM2A 2AGOA 2LQ8A 2MQQA 2MTLA 1T9TA 2Z57B 3AD8C 3EVWA 4K5RA 3H2UB 1MROB 1C4CA 4DFPA 3I96A 2HK3A 1UAWA 1SKUB 2GO8A 1S6QB 2XWXA 1K0TA 5A8RB 4OJHA 1KQGB 1Q53A 1NSAA 2W1BA 3PX4A 1Q8BA 2A2CA 4O3OA 2ZE2A 4I56A 4WYWA 1FJGF 4LRAA 3IG1A 1J2VA 3OJUA 3MTKA 3POTB 2O66A 4JI2J 5DM6Q 3I0RA 1GH8A 2CZ4A 4AYBD 2AJ0A 4URSA 2ZH5A 2ZC4A 2QMUB 4OIXA 4DCJB 2DRAA 1ULRA 3TW0A 4DV2F 3M6WA 4C3LA 1M1KT 3LANA 3DKDA 4ICLA 3MMBA 4DOZA 3I0SB 1SV5A 2GQQA 1UP1A 1YBTA 3PFOA 5DQGA 2BVZA 2Q1LA 3D68A 1HD0A 3CD5A 2W9CB 5D0RA 2RAQA 4FF2A 1TV6A 2RF2A 4C0OC 4XPEA 1L3UA 3FJ2A 2XS2A 1LWEA 2RHQB 4MH8A 1QJHA 2K8GA 2E29A 3HDSA 2XMUA 3HM9A 4ZS6A 4CRJA 2F4FA 3N79A 2WRMA 2DGOA 2LLZA 1FJGJ 5LXYA 5DDOC 1AB8A 1GTEA 5IC6B 2VKRA 1YDLA 3BSOA 1GMWA 1JLAA 2FQQB 4KGKA 5BXIA 2IBOA 1SJ3P 5LJ3Y 3KHRA 3QJPA 4J9RA 1HKAA 2W2MP 1S99A 2PT0A 4MKBA 2MQOA 2DIVA 4DV4F 4CLFA 1X4GA 1GT8A 3W60A 2LP4A 1PCAA 3A4TA 2HHWA 4I0WA 1QE1A 3GFHA 4CQ1A 1Y3KA 4WXWA 2BMBA 4QPTA 4NX9A 4LBIA 2W9BB 3GYNA 1GXTA 3PKMA 3QT6A 1BGXT 3Q8RB 1RTHA 1UZDA 1D09B 2GVZA 5CYQA 3JTNA 3TUZC 4C8MA 2B9WA 4Y34A 3DU5A 3MMAB 3LOUA 2MZRA 3ITHB 2GJIA 3CUNA 3EJMA 1PBUA 4IFVA 5CQGA 4QIEA 1MG7A 5BYQA 1CJKB 2W2OP 3TX0A 3QFHA 4CNZA 4DEZA 4AQYF 1FRLA 2XSFA 3WIVA 1L3SA 4FN5A 1SC1B 1ICEB 3KLHA 3GR0A 4XDCA 3NLCA 4I7FB 2RU9A 1WF0A 3UDCA 3QSYB 3KLGA 1LQ9A 4X4PA 4ZITA 4MJKA 1JQGA 1RT5B 2W7AA 1CJUA
chains in the Genus database with same CATH topology
3K2YA 4ECYA 2HIQA 3ZZRA 4IRDA 1U1LA 4OZ0A 1D0EA 1X0FA 3HVTB 2Z2MA 1SL0A 4Y65A 3TI0A 3FMBA 1VHFA 2AX0A 2YVSA 3H5SA 5E2QA 3IG1B 5DG9A 2M4MA 3NWGA 7FD1A 3M32A 2OPSB 2XMKA 2XMWA 2YH1A 2HGNA 2Z8QA 2IRXA 1RKJA 1VQ8S 3FQLA 2QMWA 3MUVP 2B6AB 2H5EA 2DR9A 4B3RF 2HNDB 5HQ8A 5LSRA 1YITS 1XN9A 1P6TA 2AW0A 1QVFR 3I5BA 2FVPA 2WB1D 3L09A 1YBAA 3BN7A 2MKKA 3TAMB 1JK9B 4QR2A 2OMOA 2DPIA 4F25A 3V4IB 4L72B 3CCMS 3HZGA 2PFFB 1KQSR 1YQHA 2DNQA 3CIZA 5KFQA 2WW8A 3PJXA 2ROPA 3I9V9 4Q45A 3TAQA 3FDSA 2A10A 1GXLA 2EFPA 3MR3A 4O3RA 4ZMMA 1T7PA 2WSCC 2J6TA 4O3PA 5CYMA 3LGMA 4Z37A 3BZQA 4N76A 1R27B 3BSCA 4TYAA 5CA5A 2B4VA 2XGQA 4U7CA 3SV3A 2JEJA 3C46A 2E9TA 4YOEA 3GIIA 1P8GA 2DHGA 3TUIC 3L95X 5KFRA 3NKYA 5KFJA 3MMBB 2FJVA 4ECZA 1C1CB 5F8MA 1UA0A 2QSFA 1HQUA 4URGA 1S9EA 3MEEB 2KM8B 3MECB 5DGBA 2CVEA 2ADCA 2Z4PA 4KKOB 3OTOF 3H98A 1L3TA 2ZH1A 3SQGA 2UVVA 4CH7A 2YNHB 3MAHA 2B51A 4ZCIA 2VOPA 4MFBB 2DJWA 1BQNB 3OR1B 3N6NA 1TKZA 4LSNB 4EO6A 2KZMA 2YKPA 4RNNA 2IYGA 2L9DA 2GHPA 3FZ2A 1EETB 1UJ6A 1Y9OA 2E1AA 2LQ5A 3B4MA 3D1QA 1K0VA 2POKA 2HFOA 3SSRA 4B9TA 1W25A 4DV5F 5EGYA 2ZH8A 4Y00A 3CPWR 4GC7A 4I68A 4O4GA 2YQ3A 1FCAA 4PQAA 4B9MA 1T02A 3THVA 3PR4A 4P6QA 3B78A 3UE2A 4BHQA 4QPXA 1HYSA 3KK2A 3NBPB 2XI3A 5I3QA 4M95A 3NL0A 1QAJA 3J7YI 2CPHA 3S8SA 1QUVA 4KC5A 4K50A 1A7GE 1PC5A 3OLAA 4RBUA 5GAEU 5L1IA 1JLQA 1VRUB 5HMWA 2DNHA 3MPVA 3OUYA 3MOJB 4P2SA 2ZH3A 3I6PA 1JWWA 2L9NA 3OBIA 2XLKA 4I67A 3TANA 4ZPTR 2WONB 1WI6A 1FNXH 2EWHA 2HRUA 2B56A 1E6YA 2Q6BA 3FMWA 1X4EA 4QU7A 4PCQA 2ZBIA 3KLIB 3LP2B 4C7QA 2FJXA 1U7LA 2HS4A 3R5BA 4JI4F 2XNRA 5J2QB 1C0TA 3S7RA 3TR5A 3DI6A 1S48A 2W7OA 2VONA 1HL6A 2P9EA 5SUHA 3K5NA 4ZK7M 2NSBA 3NGDA 3OQ2A 1YGYA 4ZPVR 4DSJA 3P6YC 4KHMA 2CIMA 2DGUA 1CLFA 1LWFB 3TRGA 2WOMB 1Y0HA 3N6MA 3CO9A 3KK3A 1JX4A 3W3SA 3M8PB 2XWYA 1TUVA 4IO9Q 1S79A 1M5OC 3HMJG 5E5NA 3MM9B 4Y2AA 3N5FA 2VFVA 4HI2A 4D3HA 2ROGA 5F8HA 2K7KA 1P9QC 1YI2S 2KVIA 2NUUG 3F44A 2PIIA 5K8NA 2IMWP 3DN9A 4LF4F 3IAS9 3ZZZA 1RISA 2F9DA 1YWXA 5KT4A 2JSXA 2MZTA 3CCWA 4M5DB 2DNPA 3N4WA 2VG5B 2BANA 5F9NA 3KJVA 2GC8A 2M5YA 3OHBA 3LAKA 1NO8A 4DFMA 5J1EB 3R5AA 1NU4A 1VLYA 2HNZB 3DOKA 5L38A 1Y00A 3Q8QB 3TO8A 1GX5A 2IJNA 2NPIA 4NLQA 1HPZB 3LAMA 3DLGB 4GKJF 4WE1A 1UWBB 4RW4A 2O01C 1N8RT 4BS2A 4RLEA 3DC2A 3GIJA 2OSRA 5KFCA 3H40A 3E2EA 4X66F 4C8YA 3MPYA 1Y7PA 1C0UB 3AB4B 3IRXA 2XI2A 5CYQB 1TK8A 7FDRA 3C8YA 3GFYA 1VIXA 3HHKA 1HW9A 2K1RB 1O0PA 1ELOA 3PM9A 5CHCB 4ED3A 2IRYA 4OHYA 4J9MA 2F8EX 5LSLA 4DQIA 5J1PA 1K8AT 1XK8A 1P27B 2D3OR 3W2VA 2OPQB 3NCRA 4NLRA 5DDPC 2WTFA 5KFBA 3QIPB 1VC6A 2RILA 1FVSA 3DRRB 4A46A 2ZH6A 3DRSA 2P6SA 2R7XA 2VASA 4OI3A 3V4MA 3M8QA 3AA8A 2KT3A 5C25A 4MK7A 3E51A 3KWMA 1UVMA 3LP1A 1S0OA 2MYFA 1D1UA 4I6AA 2LDYA 3DLHA 1MWYA 2ZBCA 5D4OA 5DJBA 5LSOA 2E5GA 4WZMA 1AUDA 1N5TA 3R1LA 4ILLA 4WYLA 1DQAA 1FK9A 3OVAA 2ADBA 4DL7A 2RU3A 4G1QA 1IKXA 2C3OA 1OPZA 4LMZA 3IRWP 5L1JA 3CGIA 2R2SA 4HDHA 3HHLD 1MU2B 2J9CA 2J0SD 2VA3A 4K0KF 3L7PA 5F8LA 3LP0A 1BD6A 5I3PA 4KGMA 3U1LA 3ONQA 4QYRA 5G0RA 5A8KA 1TKDA 2OH2A 2BE2A 3KLVA 2CPZA 1PC4A 2RH3A 1FTCA 4G6VB 1IR0A 3PX0A 3OXFA 3JSBA 1KFSA 5A8WA 2D74B 4C9DA 1N48A 2C2DA 3EXYA 3DLKA 2LEPA 5H1SV 3K8VA 1D8ZA 4OZLA 4Q8EA 3B82A 2M9KA 1N6QB 3GQCA 1QTMA 2IM0A 3QZ8A 2MMYA 3PZPA 1S6PB 5B0AA 4QWDA 4PWUA 2RRAA 3NMAA 2DHXA 2YWEA 2W4PA 5HP1A 3G6ES 2ZNZA 1WD6A 4QWCA 1JKHB 1F9FA 4F4ZA 1X4FA 2YX1A 1OSDA 2CQBA 1AROP 4I69A 1YRUA 2MB0B 2AF6A 1TL3A 3M05A 1R7IA 3QJJA 3FRZA 4UOCA 1X9MA 4ZA1A 1XWLA 2GQ2A 2OFHX 1S10A 2KH9A 4YFUA 1QLNA 1N33F 1HWLA 1HBUA 2VBXA 3M32B 3DDKA 1RT4B 4C3KA 1NHUA 2EK6A 3FNNA 3M6UA 3GILA 1V6HA 1RT6A 2OPPB 4X4UA 3BEGB 1S7HA 2RT3A 4N41A 2PA8D 4A48A 3MFHA 2J9DE 4NRTA 5CCMA 2PA3A 1KONA 2CZVC 3GIKA 2UVRA 3PY8A 1M5KC 3CD6S 3ICLA 3QWUA 3QJLA 4TNOA 1FRIA 3J7ZT 1QAIA 5MAOA 2CKWA 3I32A 3M4XA 4K59A 4WTYA 2V94A 4N8OA 2W24A 3MAQA 1JLFA 4OI0A 3MHYA 4Q2MA 5FD1A 3R1HA 4IR9A 3M2UA 3CC2S 3US5A 4H4KA 5M2PA 4EBCA 4OZNA 1BLUA 2WBMA 2YKQA 3TA0A 5D4LA 4G3IA 2DIUA 1X9WA 3BB5A 5CYMB 2UUBF 1VS3A 3ZZPA 1WHVA 3HHLC 3JSMB 5JUMA 1U6FA 2E5JA 5KG1A 3CCUS 3BGFA 5E7OB 1HQEA 2OLWA 3NNHA 3SDEB 3D28A 5KTQA 3M2RA 3BO2A 2HMIB 2CQ1A 1C2PA 3R5CA 2KHDA 2RE1A 2KU7A 4RBVA 2VG7B 1UW4A 2E1RA 3G8TA 3K57A 1Q8IA 1YRXA 3CMAS 1DLOA 4QYZJ 3MURP 3QLHA 3Q2SC 5KFMA 3HK2A 5HO4A 4YP3A 3SQGB 1KLMA 3FZBA 4J9KA 1VQ9S 4ZVEA 3GG0A 2IVYA 4R5PB 5EUHA 3FSYA 1U6BA 2E7WA 2XMMA 3D1HA 4DR3F 4IFYB 5DDQC 1HR0F 1T94A 2V2KA 5LMNF 1S97A 3KG0A 1HNVB 2L9WA 2EFNA 3LUYA 4MIWA 4QWBA 3ZZ0A 2XCAA 2PE8A 4KO0B 4B02A 4UUXA 4ELUA 3IO1A 5L1KA 2R7UA 4NLPA 1S9GB 2LMIA 4IQXA 3HVRA 2E1CA 2NYIA 1JIHA 3KK2B 3HVWA 4HI1A 3HHEA 1UL3A 4WIIA 2MQMA 3KOAA 2VOOA 2XBPA 1VK8A 1H3DA 1P1LA 2ABYA 2KXHA 4QOTA 2I0XA 2KHCA 1FHTA 4LF8F