1Y00A

Solution structure of the carbon storage regulator protein csra
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
61
structure length
61
Chain Sequence
MLILTRRVGETLMIGDEVTVTVLGVKGNQVRIGVNAPKEVSVHREEIYQRIQAEKSQQSSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Carbon storage regulator
publication title Solution structure of the carbon storage regulator protein CsrA from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
total genus 6
structure length 61
sequence length 61
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02599 CsrA Global regulator protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1680 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1y00A00
1Y00A 4KJIA 4KRWA 4K59A 1T3OA
chains in the Genus database with same CATH superfamily
4HHJA 3FVYA 5HMZA 1DQ9A 2MHNA 1TVRA 2CJYB 4TQRA 4KSEB 3DKDA 2DVIA 2VFUA 1F6TA 1N33F 1T9UA 3MOZA 2PMWA 5LXRA 4HT7A 4F3QA 3CMAS 3NOGA 3HM9A 5ETLA 5IZHA 3B8HA 3PJ9A 4ANEA 2W2NP 2PI4A 2KT3A 3M9MB 1YRTA 1JX4A 5I4MA 4V19X 5ETOA 3W60A 2CPXA 3O6QA 2VV5A 4LF8J 1IUJA 2EKYA 3E3XA 2G4BA 5KFVA 4I6WA 1B0PA 2RUSA 1CQMA 3MR7A 5IT0A 4GO5X 2LDYA 3EJMA 7AT1B 1T95A 2DGUA 2MPUA 3ILJA 5IM0A 3GTYX 1F9EB 1JLQB 3NRBA 5GMEA 3LALA 5C2GA 2Z0GA 5A2QY 3DLLQ 4F0KA 5J2PA 4Y34A 2BRLA 3BBFA 4RW8B 3OTOF 4NE9C 4WYWA 1RT7A 2V4JA 3MTKA 3C6TB 3HZEA 4EK2A 4LBHA 1X5OA 3T5HA 5LSOA 1UP1A 2ZH9A 2HHVA 3I6PA 3RYLA 1HL6A 2FQQB 1H73A 4QIVA 4IDKA 5I3PA 1FTCA 1LW2A 1HI1A 4YUDA 3FK4A 2UZAA 2U2FA 4DU7A 1SH0A 1TMMA 2KL8A 4DR6J 4JI5J 3TW0A 2LMIA 5DRKA 2QFJA 2BX6A 3GMGA 2BANA 3MMCB 3GFXA 4CO2A 2GV1A 4ICLA 3KLVA 3H59A 2J0XA 4JI4F 1PYSB 3MEGA 3MTJA 1HYSA 4I2PA 2NSCA 1YGYA 2BJ8A 1BWEA 2YX7A 2UVWA 3A8EA 2KI2A 2HQGA 1U25A 4TY8B 3TYTA 2J0WA 2FJDB 2DNKA 2OJ3A 2H51B 3R5CA 1QSYA 4DFPA 3ETMA 4QJVA 4X4SA 2D74B 2Q43A 3UDLA 2M8DB 4F04B 3ZTRA 1RT1A 1KDNA 1LW0A 4CLUA 4GKKJ 1R0AA 3NLCA 1U0SA 5KG3A 2KT2A 1H7WA 2CPIA 2LA4A 1ZOTA 2VBXA 1JJ2R 3MM9B 3CJ5A 5C42B 3S7RA 3FQLA 3QGHA 3LW5C 2E5LF 3FEYB 2AJFE 2HEKA 2JEIA 1ZPWX 2C3UA 1FDBA 4WK1A 3KK1B 1Y10A 3VAGA 3CDEA 3QO9B 3P3DA 5KFUA 1GH8A 2IJFA 2HVZA 3DNCA 2BJ1A 2HWTA 2DR7A 3R6GB 4X65F 2F5GA 1HLWA 4DX8H 3L7OA 5K9FA 1X9WA 1VHFA 2AZ1A 2QEXS 5L39A 1S6QA 2RUGA 2ZNYA 3M8QA 1TUVA 1CULB 2FJAB 2CQDA 1X4EA 1QTMA 1G7CB 4CYUB 5K5MA 2R8KA 4CLZA 1P6TA 1HQ2A 2FD2A 2K1RA 2A6MA 3HCXA 1HA1A 4ZN3A 2QO3A 3GJRB 2LECA 4TLRA 3KJQB 4P7VA 1TKDA 4ZIVA 5C2CA 4LRFA 2FY1A 3D1OA 3IXQA 1C1BA 3M9OB 1VK3A 2YWWA 1FEHA 4DN0A 1BQXA 2RU3A 3N6LA 3EZOA 2F4VJ 3NGUA 1IBKF 4ECXA 4P6QA 4K4YA 2RVJA 2AKWB 2VFRA 4DSFA 4DL0C 4DCOB 2OSQA 1NCLA 4OZ5A 2Q1LA 2RDIA 3TUZC 1OSCA 1SKUB 2W4DA 1YDLA 2B8PA 4JYAJ 2Z2YB 2HHXA 2O5DA 5CD4H 3IS9B 1LWCA 3RAMA 4OYOA 1NK9A 1CJUA 3T1YJ 1FX2A 1VQPS 1QDUB 2W25A 3EPGA 1DHMA 4OI6A 3DCAA 1OQ3A 2W7PA 2DRDA 2MKHA 2MGZA 3KLFA 2D3OR 1HI0P 2E5IA 5CZVA 1UW9A 4LF5F 5D4LA 3V6JA 3RW6A 4QWCA 2JL9A 4X4NA 5A2QU 3BQ1A 4MIAA 4DCPB 1NSAA 4CO4A 1ZAVA 3W2VB 2A18A 1L3TA 1U0HB 3O2IA 3BH6B 4A4JA 3M6VA 1YRXA 2IJRA 2OGUA 4A8XA 1QUVA 1UFKA 1KBRA 2WHOA 2HWHA 5E41A 1C4AA 2PDAA 1QAXA 1VQLS 2GZOA 4WFYA 4K4TA 5GMDA 3GSIA 3AQPA 4PAAA 2CKWA 1WKKA 4ECSA 4H4KA 4KGMA 3KHLA 2DXDA 1JXEA 2B3TB 3V4IA 4LF4F 2QC3A 3W66A 1IBLJ 1KWMA 4LFAJ 2JLGA 4CCHA 4LF1A 1L3UA 2ZH5A 1O8BA 1RA6A 5KAKA 4MIWA 1JQGA 2ACYA 3R1HA 3HLUA 4HACA 2ATLA 1FF2A 2XSFA 1UCNA 1NK4A 1EETA 1Q8LA 3MDFA 3N6NA 1FKOB 5F8IA 4KH1B 2MJNA 5DM6Q 2CQGA 3B4MA 4A8SA 4DI6A 3NCQA 1NJIT 1AFIA 4RBTA 3OR1A 4ZPDA 3MWBA 1O5JA 4J9SA 1YLXA 2KO1A 1SC1B 2RS2A 2NPFA 2H5JB 2W9CA 3JSYA 1TZ0A 2DCLA 5DDQC 4QWEA 4QCLA 5M2PA 3O44A 4U9RA 2ASLA 4RU9A 2PD1A 5GADI 1VISA 2FHOB 3H4DA 3B6BA 1FXDA 5HMXA 3X1LB 3R1LA 2Y8WA 3P49B 3BSAA 3CCUS 2OKQA 1FA0A 1KC8T 1VOMA 2HNYA 3OLAA 1YI2S 2B4PA 4DX6A 2QLBB 3PRBA 2RDDA 2GVDA 4IH6A 2OPQB 2XZDB 2B7BB 3AOBA 1S7HA 3KTQA 2ZD1A 4JV5F 4RW9B 1PJ7A 2AEJA 1GX5A 1YJUA 2VD3A 4B3OB 3IAS9 1CG2A 4N8NA 2J0SD 1RT2A 2O67A 3W5ZA 5B0FA 3MAHA 2XZWA 2CWKA 3PW2A 3KJVB 2HAFA 1XK8A 3T6JA 3IO1A 2ZOFA 4O23A 4KHRA 1UA0A 3IBFB 2ZH4A 3KG4A 3QGPA 2KT5A 5EHHA 2U1AA 5G4DA 1V5VA 1YJ9S 1U47A 2BE9B 3NCRA 1WF2A 2HYIB 4C4WA 1VQ9S 4UQGA 2E5JA 2V2ZA 3EVWA 4QYZJ 3THTA 2JC0A 3CO9A 1JLAB 3CSKA 1RHJB 4MKBA 3R7SB 4KFBB 2Y1RI 5HI7A 4F26A 1KVJA 2V69A 2C2MB 1U2CA 2E5GA 1MNEA 4O0IA 2POKA 4F0HA 3VGUA 4MKVA 2A10A 3O1LA 2LLZA 4DCJB 2GQQA 4NX9A 2JRSA 3CCRS 2YNHA 3GYNA 3GSDA 2QSFA 3QT6A 2QJ3A 2IRXA 2J7UA 3KNGA 2BZ2A 4AYBD 3SV4A 3Q8VA 4ED5A 4USMA 1FJCA 1N36J 1P27B 3H5SA 4I2QA 2YWHA 4DV2J 2X51A 2VQEJ 3VAIA 1GAOA 2BM1A 2ZZNA 4KJIA 1TKTB 5CAAA 4DS5A 4H4OB 2ZC3A 1LKZA 3EZUA 2YKMB 3HPOA 1S1UA 4F67A 1Y4ZB 4XAKA 4X4UA 2DXFA 2KFZA 2YPYA 2UXBJ 2GC8A 3K5PA 5CH7B 4NMXA 3C3LA 2KXNB 3UE2A 1P9QC 2DY1A 2H1YA 1OPZA 3M1VB 4XPEA 3AAWB 5I42B 3HFVA 4DX5A 1T9YA 3G8SA 5B0EA 4JI8F 1OS5A 2HRYA 2VL1A 2BJ9A 4J9RA 3ETOA 1S6PA 1VRTB 1CC8A 3VQSA 4DFMA 4RZRA 4DX7A 1X4AA 1SXLA 4JBCA 2UUCJ 3BQ2A 3PYEA 2D3UA 1XJWB 2QL9B 3HT3A 3MUTP 2DRAA 2HHQA 2RF2B 2MHEA 3NS5A 5K8NA 3DGPB 4C0OC 1IKWA 4EEYA 4F02A 2LXFA 3QIDA 4P2XA 4J9KA 3AY0A 2HBQB 3LAKA 2MY7A 3DLHA 1T7PA 2M3DA 4DPOA 4WYLA 4DMZA 1DLOA 5LMUJ 1V5IB 1H2TZ 2D1CA 2AT1B 3B54A 1U8SA 4F2SA 3NXZA 3M32A 4ZP9A 4Y0FA 1EIYB 2EXUA 4WBFA 3MM6B 2W2MP 3I0RA 1UWAA 4ZVRB 3RR8A 4JI5F 4J9MA 3KHGA 4OJGA 4F25A 3FBEA 2LEBA 3C15A 3G8QA 3ZZYA 1YRUA 5HO4A 2BMBA 4X4PA 1VQ4S 5J2MB 1X4DA 2CQCA 4KO0B 2XMKA 1ZPVA 4R0EA 3DOMB 2WRMA 5KFJA 4A46A 2DNGA 1S1TA 1B0TA 5L8RC 2H4YB 2ZNZA 2YX4A 2LQ5A 3G82A 3OVSA 2F9JA 1N88A 3I9ZA 1RHRB 1EKSA 2CPJA 2Z2ZA 1U49A 1ZA2B 2PO4A 4RNOA 5RUBA 4ECVA 2W4PA 3IN5A 1WSRA 1FCAA 2B9XA 2MXYA 2KRBA 4YY3F 4UW2A 4Y2CA 1IQZA 4ILLA 2BYCA 4R5PA 1Y3JA 4ZVOB 1BQMA 4ES3A 2YKOA 1LFWA 5AT1B 1WWHA 4HL9A 1XBWA 4NASA 4DPYA 2ZH1A 4K0KJ 2VPZB 4ZVPB 5B0DA 3G6ES 1N32F 3J80Y 2ZHBA 1X4FA 2R7SA 3TAMA 4ES1A 3FGVA 3H8YA 2H48B 2ALYB 1QY7A 2GJ2A 5BXIA 3M30A 3GIKA 3S01A 2HZVA 1JLBA 2AEFA 2XY5A 1VMBA 1S4EA 2LEPA 3FJ2A 2E1RA 3MD3A 3KKFA 1ZS6A 2BA9A 2ZC4A 4QYZK 3KYLA 2HIYA 3CCWA 1QSLA 3BQ0A 3WZ0A 2IC3A 1SJ4P 2RT3A 4I67A 1WHWA 1SQEA 4CLTA 2X1AA 2ASDA 3NBPB 4QR0A 2IDEA 2QYCA 4NLYA 1KHWA 1RQ0A 2CQ3A 1BXNA 5D8HB 3EGNA 2P9GA 3M2RA 5D6GA 4F8RA 2RDJA 3K5OA 2MDAA 2R2SA 4YHHJ 2AIRB 1RTDB 1TUWA 3KXDA 1C1CB 2V5HG 3GV5B 5C7PA 4BWMA 1YZ6A 1S0NA 4P2MA 1Q95G 3RJMB 3HVTA 2XSJB 4HH0A 3LH2S 2R4FA 2K3KA 4WWSA 1NMEB 3WDOA 2CPYA 1H2VZ 2HRUA 1L5UA 2FGCA 5ETQA 4LFCJ 2IAJB 3D1QA 2HZAA 1F1BB 1QUPA 3GYXB 5KT6A 3KK3B 3H2VE 1SV5B 3QGIA 4DV0J 3QRQA 3UDEA 3X3UA 3A3OB 1CS4A 3CC2S 3SCLE 4YDDB 4DL7A 3POTA 1LNQA 2MEWA 4JP8A 4C3LA 2V8PA 1WKJA 4OIXA 1WHYA 1F3FA 3PACA 1S9GA 3EX7B 5DGBA 3K5LA 2ILYA 3SEOA 5KTQA 4W92B 4P73A 4BHQA 2GQ2A 5ETTA 3ULHA 2AEMA 1WD6A 2FHJD 3QIPA 5AJ3F 3MPDA 2FJBB 4ZITA 4LIRA 5A8RB 2V4QA 4FF2A 1FDNA 4NLUA 1V3SA 1OQ6A 3SYZA 3CCVS 1WI6A 3FBFA 4DV5F 1S1WA 3UN5A 4NA3A 4JI3J 4JV2A 1S48A 3D66A 3LP1B 2O3DA 3QFHA 3EVMA 1MW7A 1ZM3A 4E98A 2JWNA 5J2QA 1VS3A 3PW4A 2GS8A 1FJEB 1U1PA 1AW0A 4KE5A 2G0CA 1FJ7A 1RHUB 1RT3B 1IBLF 4RW7B 1KTVA 4M8LA 2HQ3A 3N4WA 1UWBB 1WORA 2VFSA 2GO9A 1PYTA 5L1KA 2J9CA 4RWXA 1VQOS 1KKHA 4ECWA 1AUSL 2IDLA 2W8KA 2YKAA 4CLFA 4LQ3A 1TL7A 1TR0A 1VRQC 2GHVC 2HGMA 4MAKA 1LWFA 2UXDJ 1BC6A 3HHEA 3W9HA 3AA9A 4ED8A 3CJTA 2WBMA 2CZVC 4O3OA 4ELUA 3PDNA 3IR6B 3ZC4A 1M1KT 1NDKA 1N0VC 1SC6A 2KYZA 3OW2R 2VQFJ 4LQ9A 1Y9OA 5DDRC 1NJYA 2V2VA 1C0TA 4DV7F 4LSZB 1BHNA 4IDKB 1JWWA 4O3PA 2VG6B 4E0DA 3PX6A 5HMYA 4TN2A 2UVUA 5BYQA 3PW7A 3MMAA 2EKNA 4K8RA 4J9PA 4PPZA 4J5OA 3DOKA 1KONA 1T03A 2WSEC 3ZZTA 1DZ5A 3IWLA 5E3RA 3MMJA 4MKAA 3HXMA 1YTYA 1GMVA 4QIFA 1N54B 2LA6A 3TP2A 1DAXA 3KLGA 1BE4A 2UV8G 4Q45A 3CF5Q 2DGSA 4ID5B 1R8AA 2B51A 4X4OA 4X2BA 4CM0A 1H72C 4CNZA 4LR8A 3OR2B 3LGHA 3UW1A 2CQIA 3FMBA 3GFYA 1ACMB 3VVUA 1HFEL 2EI5A 2V34A 2XB2D 1VLOA 3OFFA 3JSMA 2CADA 1R0AB 2Z56B 4ECQA 1GK8A 1ICEB 4CM2A 1FDDA 2L08A 4NEZA 2L9DA 4DSKA 3JS9A 4PCQA 3PKYA 1S99A 1AROP 2OTLS 1N34J 4IOAQ 1NJZA 1YBUA 1AZSA 1YIJS 1KOHA 3OL7A 4WIQA 1SKRA 2AQ4A 4G65A 4N5SA 4NLWA 4EBCA 2UUBF 2LYVA 5LM7E 1S76D 1GTEA 4K2JA 1T02A 1N36F 9ATCB 4P10A 4ZOSA 4DV2F 4U7CA 2NXEA 3CC4S 2KN4A 3JQJA 2VQEF 1S6QB 1LV5A 4RW6B 4OHXA 1WJ9A 2QV6A 3ENQA 4L76A 1S57A 1K73T 4AFFA 1REGX 3BZQA 2OPSA 2CRLA 5ETSA 3AFGA 2XI3A 3J7YU 3G71S 1FFWB 1V9OA 4A47A 1FESA 4BDPA 2E29A 1ZZNA 1ZYQA 1P9YA 3TJ8A 1ZH5A 5EX0A 1MN9A 5FD1A 2KB2A 2D69A 3AB2B 4LSNA 3JSBA 4ELTA 4CTAB 2B5JB 3KOAA 4U96A 3L4BC 4QIGA 4DEZA 2RQCA 1EAYC 2W7AA 3OVAA 2NPIA 2H9ZA 3M8YA 2XYGB 1D8ZA 1Y5LB 4LF2A 2NLWA 1CBKA 2QGFB 4YMEA 3HK2A 2E7VA 3C6TA 3Q2SC 4KAIA 3P4UB 1KVIA 1BWVA 2FTRA 2HVIA 1CJUB 5ITHA 2G2ZA 4RW4B 2RHSB 2EWHA 4QR2A 3W9JA 1C0UB 1RADB 3TZWA 5ETMA 2MGZB 2FIUA 3OHAA 1E6VB 2ZHAA 4XO0A 3NS7B 1RWMB 1NRKA 2UUAJ 2GMLA 3CJ2A 2ALZA 1FVSA 2DITA 2C2KB 3IRXB 1N5TA 2NXCA 3OXGA 3TAPA 3TANA 2JLEA 1VQ7S 2CJAA 3MMCA 4U95A 3QRRA 1Q7YT 1P8GA 1I94J 3BYPA 3KWMA 4ZLLA 1K0VA 4ID8A 2K7JA 4FBTA 1WC3A 1IKYA 4CZCA 2V4RA 3C14A 1NK0A 2DH9A 3OLBA 1XIQA 2CQBA 3D6MB 5DDPC 5B7WA 5M2RA 2N4CA 2WB1D 5L1IA 1VC5A 3BDPA 2Y8YA 2WVDA 1PILA 1KHVA 3QZ8A 2XGQA 2I0XA 3I4PA 1SCJB 5ADZA 2CAJA 3LAMA 3OJUA 1Y5NB 5F8NA 1SH2A 4HACB 3MM9A 1W2IA 1S49A 1KOOA 2ZWOA 4Q5VA 1IWAA 2XMUA 3TNVA 5C42A 2XO6A 2FLLA 3AD9C 3FSYA 3OFHA 1R27B 4A8WA 4I68A 3K2YA 2DR5A 1IWGA 3QGGA 2Q3PA 4DV4J 3GYGA 4PUOB 3VAJA 3V4MA 2VDHA 4HKQA 4HDGA 1IKXB 3LPEA 1FXRA 2GJIA 3NGSA 5DLGA 3WX8A 3CC7S 2F3JA 4LRBA 1EQMA 4DG1B 1XWLA 1UMJA 2QT7A 4CYUA 4KGXB 3D1HA 4OZ2A 2HNYB 3VAKA 1YBAA 5DG9A 1DJ0A 3FC9A 3UQSA 2KDOA 5DO2A 2F7VA 2H3EB 2FGOA 3BB5A 2OPPB 5KG4A 2C22A 1RT2B 5HMWA 4YQWA 3OD2A 3P45B 1IM6A 2XLKA 1HI8A 3TR5A 3M6WA 4OQJA 3TX0A 1BMQB 3OJSA 3H4BA 5FLXY 3KFWX 4ED4A 1P1TA 2F40A 1WC5A 1RA7A 1ZAWA 3ITHB 3JQKA 2AYBA 3UD3P 2CJKA 3M4XA 5KFCA 1CC7A 2YY3A 3M6UA 4OX6A 4O4RA 3CPWR 4B9VA 3QYYA 3VV2B 3J7ZT 4NZ6A 5H9EJ 2MZJA 4NLSA 5MAOA 3TA0A 4DV0F 3BM7A 3MR3A 5D77A 2W1BA 3DDIA 6AT1B 2XGPA 3ZNUA 2MKKA 3SSSA 3R6LB 4Y2MA 4ZJQA 2WOMB 2YNFB 2DTJA 5DQGA 2KXFA 3CNQP 2M9KA 2K8GA 3W2VA 4J90A 1U0HA 2DR6A 2WVBA 1U24A 1RCXB 2NR0A 1IM4A 1MG7A 4NOHA 2OO4A 1VHIA 3KNAA 2JEGA 4KPYA 1UPMB 3DLKB 5LT5A 2MZRA 5KFPA 3N28A 2RQMA 1W2BR 5DZ7A 4YN3B 2K7KA 2OAUA 1XR7A 2C3PA 3E2EA 2BXJA 3ICLA 3ZZRA 4C8YA 2IRUA 3HFKA 1DTQB 2L9WA 1O0PA 5LL6d 2LDIA 4FVMA 5IT9Y 1TL1A 1ZTTA 2R7WA 1SH3A 1RWKB 3QLHB 5EGYA 5CCMA 1U8WA 2XG8A 3Q8PB 4OZ0A 4OI1A 2XYPB 1CJVA 4EUVA 4DXLA 5DG7A 5D0HA 1AFJA 4FVCA 4OJHA 5MLCV 2P6SA 2GNKA 3EPIA 3MM5B 4IH7A 4KGVB 3VZHA 1IJEB 2UXDF 3CD5A 2VA2A 2NYHA 1HARA 4DL3A 2GO8A 1F3VA 1ZA1B 4P7TA 2OP5A 3W3SA 1XMQF 2E1CA 1F0XA 4QPXA 3AD8C 2IMWP 5CCLA 1PKUA 5DDOC 4F4WA 4CH7A 2NREA 3FFIB 4TU8A 3OL9A 5CYMA 1UJ6A 1Q8BA 2NCKL 1VGYA 3IAM9 3QBCA 2XS5A 4X4RA 3M32B 3KUEA 5HQMA 1UJ4A 2AX0A 3I0RB 1PAUB 1UL3A 4AXIA 3HSZA 2EBEA 4RW9A 3VR1A 2YH1A 2LCWA 2ZKUA 4B3OA 4PWDB 3PFEA 3H90A 4DR3F 4KIAA 4CI0B 3CCSS 2R3VA 3BGLA 4O3SA 2D3O1 3KJVA 3JQMA 2X3GA 2XMWA 1CQNA 1NZ8A 3KG1A 1HNWJ 3I55S 4K4XA 3NL0A 4ZVEA 2MQPA 3DYAB 3I87A 1EB0A 9RUBA 2MZ1A 1R6YA 1EZZB 2XHCA 3RGIA 1FWPA 4CH0S 1IBCB 1JLAA 2ABYA 3FEXB 1TAQA 4DZ6A 4KFBA 1WG4A 2DHXA 4R0JA 1T8EA 2W4CA 2Y9HA 1OPIA 3D54A 1S6OA 2MJUA 1I3OB 4R5PB 2R2RA 4AL6A 3RBEA 3OBIA 5FLXU 3N6MA 3D5MA 4RO0A 2KM8C 4DSEA 4ES2A 1DURA 5IV4A 2F8HA 1B3TA 3AT1B 2R8HA 1H6KX 1RT4A 2CZ9A 2DNZA 1N34F 2OIHA 3D4JA 4XPCA 2VOOA 4QU6A 1U6ZA 5D15A 3GJSB 3SMZA 1LXNA 3FQKA 4L74A 5IWAJ 5LSRA 2UU9J 3D67A 1TKTA 4P72A 1X0FA 1SC3B 4WFAQ 2VICA 3M8RA 4JI0J 1QVFR 3VCDA 4F4ZA 2B6AB 2YKMA 4MK8A 3TUIC 4K7QA 1HNZF 1JKHB 4PR6A 5B0GA 3R8YA 5H9FJ 5E2QA 3W63A 1S72S 5A8WA 1VBYA 4JI6F 5C25A 4FF1A 2E1PA 3DM2A 2AYGA 1FXLA 1WUUA 3CMES 2MKJA 4DL5A 1FK9A 3QSYB 3D6TB 5H9EK 4M5IA 2FC9A 2OEKA 3M1VA 4FKXA 4Q2LA 3ZZPA 1QD1A 1RWXB 1CJTB 3AXKA 5HVGA 3MXHP 3AHPA 4OI4A 3IR5B 3E01A 5CYJA 2V68A 2LXIA 1VRTA 3LPYA 4OX8A 2EG2A 1S0VA 3W2WA 4LBIA 4O44A 3KMQA 3LANA 3PYGA 4DR5J 1VQSA 3A1YG 4YB5A 2G1HA 4QWAA 3CCQS 3WHIA 4H4MA 1SQFA 4LF9J 3DGPA 4LRCA 1RBLA 4WU3A 3DFEA 4UZCA 2VB6A 4DPUA 1M1HA 3SFGA 2DNQA 2WB4A 4DV6F 2WAQD 3M2VB 2CDRB 3MM8B 4ZJOA 4E8UA 3OSPA 3KDOA 5KG7A 1CS4B 2G0JA 4NXNJ 2XEXA 4F4YA 3ELHA 3BH7B 2BW2A 1TAUA 2C1EB 2UVVA 3OUYB 1RGVA 3SBMA 1R43A 3RW7A 1NPPA 1S4FA 2P2CB 4PKDB 5LOQA 2FVCA 3ISNC 1FNMA 4ED3A 3P96A 1TUGB 1WC6A 4PPDA 4Q7AA 3QIPB 5J2MA 2VASA 4M5DB 3NGKA 1PBAA 4J9OA 3ZZ0A 3DOMA 2VIHA 1Y3KA 4Z7CA 3I5CA 3BGUA 2XCAA 2FHKA 2ROEA 4X62F 1OYEA 3T5LA 5KT2A 3FRZA 3PR4A 1U09A 1HD0A 5KOXA 3TVYA 2ZVIA 3VAFA 1RAHB 5J2QB 3RU0A 4DPTA 1Q78A 5DLFA 4HEA9 5HK4A 2VHGA 2YQ3A 4RL1A 3BREA 3LF0A 3MFIA 2CNOB 3RG6A 5SZTA 2XNQA 1KQSR 1EX8A 1DQAA 1T3OA 1TFYA 2HNZB 3G4SS 2FLOA 1OSDA 1VQKS 1RHKB 5AXMA 3OTEA 1DBDA 1ZM9A 3SSRA 2XMTA 4DU8A 3IWXA 3W64A 3G8TA 4IO9Q 4USJC 1X7VA 3C6UB 2ZM6J 4OYWA 2HW3A 4ETXA 1FKAF 2MZTA 2QE5A 4DV4F 4LIWA 4DJBA 1BLUA 5LJ3Y 2OSRA 2DNNA 1U6FA 2XYHB 4WP3A 3OL6A 5IQQA 3M8WA 1PO6A 1WEYA 3CCTA 2WBRA 1HWLA 2LEAA 2IYGA 3MMAB 3Q23A 3NBPA 4N56A 2LVWA 2HBZB 5GAEU 4IOCQ 2G1DA 3PTWA 3DMJB 4X64J 2LFVA 4DOZA 2RNEA 3F44A 2HFSA 2RU9A 3SV3A 1IBMJ 2HLUA 4HYKA 2BUNA 3RUBL 2IA0A 3Q8YA 1RTDA 3UWTA 3KLGB 1X5PA 1VBZA 2CXEA 1R6VA 3F0NA 4FZVA 4KRWA 1NNDA 3AH6A 1NJWA 4O3RA 3BKUA 3CJ0A 1SJFA 4AL7A 4DS4A 3DLEA 1WSVA 4C8KA 2IAJA 3KG0A 3W5YA 1HMVB 2AZ3A 2E7WA 2WK4A 2PC6A 1AB8A 4KQZA 2CJQA 3KK3A 4MK9A 3GP9A 3DI6A 5H9FK 2HBRB 1OY9A 2XC9A 2DO4A 3HVWA 4NLVA 3NGDA 3RTVA 1FJGJ 3NG8A 1Q81T 3KUGA 3RB6A 3GFHA 4K4WA 3THVA 4RKUC 3EXYA 1QSSA 3IM9A 2DO0A 4U8VA 4LF6J 4ENOA 2GVZB 3RBDA 1Y7PA 4DF4A 2AWZA 4KC5A 5D0EA 4ZVTB 4KHPF 3MAAB 5AXLA 1M5VC 3L7UA 2B9EA 1KVKA 2AYEA 5A8RA 2NUHA 3VGSA 3IBWA 3N0VA 2QMXA 4WE1B 2BE2A 1RBAA 3BN7A 3BYRA 5KFYA 5DETA 5HQLA 4F4AA 3KJFB 4DFJA 5F8GA 1IR2A 2IBOA 3LP1A 2OPSB 4HT5A 1RKJA 1JLGA 3TQ1A 1AXQA 5J1NA 2M4MA 3D68A 1RT3A 2XMVA 3M8ZA 4RW7A 1NDPA 2YH0A 1UWBA 4WFZA 5C5JA 1M90T 2KZZA 3EDRB 4LSNB 4V1Ak 3F41A 4CNYA 2EEYA 3PR5B 3DRSA 4RNHA 1BD6A 3LWMA 3UD5A 3EE3A 2NXUA 4OYIA 4NYOA 3U27A 5F9NA 4IFVB 4WKRA 4ALZA 3MCOA 4C3KA 1VCTA 3KLEB 3UCUP 1Y11A 3TZXA 4AQYF 2PE8A 2BABA 3SCIE 4DUYJ 4DR7J 3M9NB 1GEHA 2FVRA 4DV1J 1HHTP 2HQCA 5B0BA 4LFBF 1VK8A 4L3NA 4ZP8A 1U45A 1PC4A 2WONA 1NK6A 2CIMA 4OYXA 3GLJA 3EICA 4ZS6A 4RX6A 3MOJB 2GIFA 2PMZD 2QL7B 2VG6A 1ITPA 1J5EF 3PO4A 4PZVA 3T19A 3T3FA 4WXWA 1NLKL 3F73A 3A12A 4NI2A 4HTJA 1S7IA 4QIWD 1OO0B 2RHQB 1IKVB 3GZ7A 3GJQB 2W7OA 3GIJA 4LJMA 3TQEA 2I5JB 1U1NA 2CQ0A 3HSDA 4MTPA 1Q79A 2LU1A 4W90B 4CRJA 1IKYB 2M0GB 3C14B 2ZJQQ 3IGVA 5IQ6A 1S5ZA 5J2NB 4ID5A 4B3MF 3OR2A 2DBBA 2V50A 2Z2MA 3N9UC 2RRBA 4XDCA 4F3OA 4J37A 4KV8A 3GU0A 2XQCA 2VODA 3MEDB 3HX9A 2OLWA 5HVHA 4NPOA 2QLFB 4FXVA 4P74A 2K2PA 3CDBA 1VC6A 2AJ0A 4KGKA 2GX8A 2HHHJ 2PA8D 3A8JA 1SKSA 4RBUA 1G6BA 2M2BA 1B99A 5LMNJ 1VRUB 4YS2A 1UZDA 2EFGA 4BBYA 2HKEA 2M52A 3BSNA 4DR1J 3CD6S 3R97A 3A13A 2Q66A 1GXTA 1UW4A 4X84A 4NRTA 3L9ZA 4FYWB 4WP8A 2E1AA 4DSLA 1FERA 2XZTB 1Q4RA 3Q8UA 4DHVA 4DUZF 3DHWC 3MMBB 2AJ4A 5B0AA 3TARA 1LFPA 5A0YA 2IMOA 1UA1A 1H74A 3C16A 3OV7A 3R3TA 2NSBA 3BBBA 1J5OA 2UXCJ 4ZDNA 2E9ZA 4LF7F 1EP4B 2UU9F 3R5DA 4Y28C 4C6AA 3FZBA 4RW6A 5BJRA 3MGJA 3FRYA 3SIPB 2HVHA 2DNOA 2O01C 2ZH3A 1N33J 3M2UA 2GHWA 3Q83A 4UOGA 3IWNC 3BO2A 2ZKTA 5LJ5Y 2B9YA 1LWEB 2XMJA 2C2DA 4C97A 2AJQA 2R8IA 1HIYA 3R7BB 1VQ6S 3ILIA 2EFPA 3A3NB 3R2CJ 3N5BA 4B3TF 4CTAA 2DNMA 2J9DA 2B5JA 4Q44A 2PMHA 3KDNA 4I0WA 2V67A 1JNZB 4NA1A 1TU0B 4IR9A 1BQNA 2OH2A 2N4DA 1D9DA 3QJLA 2WVEA 1RHQB 4M5MA 4DQQA 3GV8B 4ZA1A 1XMOJ 3D0IE 2N82B 2HS4A 4M5KA 2QN6B 2UUWA 5E3CA 3T5KA 1XNRF 2FVQA 3DRXA 2CNNB 2QA4S 5E33A 4RW4A 3OTOJ 2JOQA 2GJFA 3T5JA 5B09A 1UVMA 1C0UA 2QA1A 2M88A 3NNAA 3HULA 4X4VA 3RAQA 1N5YB 2HG4A 1E6VA 1S0OA 4J7CA 2VOPA 5JMNA 2BQUA 2ZBPA 4OV1A 1RHMB 1SKWA 2BEFA 3ISZA 1KEKA 4DR4F 3DDKA 2R2UA 2RD5C 1JXLA 4NXNF 4JI2J 2KTQA 3IRXA 2RQKA 4ED6A 2FPHX 4EYHB 2A1BA 4RNFA 3CJRA 4CLWA 3B78A 2RMLA 2IVMA 2BKOA 1HPZB 3H5YA 2OPRB 1UVIA 1B4SA 1X31C 2DJWA 1NDCA 3GCXP 4DL6A 1I6JA 2KHDA 4MKYA 2NS1B 4JI4J 4OV6A 1Z2ZA 2W9BB 4WTYA 8RUCA 2VUGA 1H2UX 2MKSA 5IC6B 5DQIA 2K3IA 4N8OA 3TA1A 3H20A 5KT5A 5D3GB 4EO8A 4KY3A 2Y1IA 2OFHX 2VG5B 1R0BG 3CUNA 2AV5A 3CVKA 2DNYA 1URNA 3PIPQ 5KFRA 3M8SA 4WZMA 1TL1B 4JI1F 4I56A 1X5TA 1PIEA 2B43A 4ZPWR 4FS1A 4USHA 4WFXA 3TJ9A 2HVDA 3MAQA 2HMIA 2W2PP 1LK7A 1D9FA 1IN0A 1JLFB 4ZCIA 2APOA 1CJVB 4PXCA 1KQFB 2WW4A 1SQGA 2IVFB 4AE5A 4J9QA 3LO3A 1HQEB 2F63A 1GMWD 4PUOA 1MN7A 3MM7B 4IQMA 1X60A 1IVZA 2JH3A 5BR8F 2EVZA 3OQ2A 1IKXA 2RB7A 3A8KA 4YOEA 5EDWA 1HHQA 2ZM6F 3LQVA 3BN4A 5GADU 1YJRA 1J27A 3LP0B 1VJQA 3NGRA 4B3RJ 5IS2A 4DG1A 4X65J 4RJVA 2JEJA 1GQEA 5CYQB 4ZPCA 1SL0A 5CYMB 1JLEB 1OYDA 2FVSA 4X4TA 3SXLA 3PEJA 4I6AA 2H5EA 5J1EA 4F0MA 1U1RA 2PFDA 4IH5A 1FNOA 4GKJF 1RABB 2AGQA 3OFEA 4YEAA 1KQKA 2CPEA 2Z58B 4OZNA 2OPPA 2RIJA 1RT5B 4I69A 4QW8A 2GQCA 4Y65A 4FF4A 3NOCA 4OYPA 4PYDA 1FDAA 1R31A 4DL2A 3CDWA 1RWUA 3MR5A 2J5AA 4R8UA 4W4MA 3V6KA 3Q22A 3NAHA 1IBKJ 3ITHA 2AJ2A 1WC0A 2PIIA 4F36A 1VBKA 2F1FA 1NUEA 1GFWB 3R27A 4C0BA 2EPIA 4NLOA 5KFKA 2NUUG 2RKIB 3NGTA 2UV8A 5GMKa 3BO4A 3VZIA 2O66A 3RZAA 2AJ1A 5E5NA 2W8LA 5HP1B 2RQ4A 3TWZA 4UTGA 1ZBTA 4B17A 1KQGB 3PW5A 1JK9B 2HHUA 3UFCX 4CT8A 3DLBA 4BC7A 4K5RA 3QJPA 2IM2A 3D2WA 3SQOP 4OX9J 2WCXA 3SSQA 3VGTA 1YJVA 4HI1A 1SUQB 1NK5A 4URQU 1RT4B 5LXYA 2J0QD 2WOMA 2YNFA 4H4KC 1UJ5A 2HWIA 2KKHA 4IG0A 2ZZMA 5HL7Q 1WC4A 1LQ9A 3MHYA 1TKZA 2FJWA 1I1GA 2JLFA 1BUXA 1W25A 4CO0A 5HROB 4YR2A 1SB6A 1F9FA 5JJBA 1VFJA 4P52A 1SPBP 2SXLA 3DLKA 1D0EA 2FDNA 3LOUA 3AJ2A 3CCMS 4M95A 3H7HB 2XS7A 1GMUA 1X9MA 4YDXA 3FEZA 2VC0A 7FD1A 5A8WB 1SVDA 5C25B 1R8BA 2YNIB 3MZIA 3DM2B 4EBDA 3I32A 4KGZB 4DBQA 1UVJA 1DTQA 2YWFA 4P75A 2ZOMA 1NO8A 1FK9B 3CJSA 1RYRA 1RAEB 1B7YB 2MY8A 3CGIA 3HDSA 3NNHA 4LF4J 1FRLA 1SL2A 1UVLA 1NK8A 3QMQA 3QLHA 2EBGA 3E01B 1N6QA 1EKRA 1RLCL 4LF8F 3W2WB 4O44B 3V6DB 2J6TA 3ZNJ1 4NLQA 2CUYA 4ZN1A 3TI0A 2HK3A 2HK2A 5ETKA 2MQNA 2H54B 1V6HA 2IJNA 3MM5A 4H4MB 5D78A 3HVAA 4FKYA 5GAHI 4DQPA 1HNXJ 4J9LA 2BJ3A 2VJUA 4Q8EA 1FX4A 4DV1F 2YXLA 1T05B 3NP5A 1MMDA 3K8WA 3FFIA 4MFBA 4PRFA 1UPPA 3DC2A 3UCZP 3CDAA 1PG5B 1ZZFA 4ECYA 3ILOA 3IG1B 2DXEA 5KFMA 4CQ1A 2MSTA 1F60B 2WSCC 3D3BJ 5FDLA 5D4OA 4DR6F 1HHSA 4CIOA 2CVIA 4NLGA 4PWDA 2C28A 1NKBA 2HGLA 5AXKA 2GHPA 1JLCB 4NCGA 5D0GA 1HBUB 5HBMA 7FDRA 3PM9A 4PXBA 3MF5A 1M5OC 3UPFA 2C3MA 4RNNA 4ER8A 4Z37A 5KOWA 4ILMA 5LSLA 4TU7A 1TK8A 4ECTA 1QE1A 2OD6A 2KU7A 3Q2TC 3DYAA 4IOBA 5CD4A 5L46A 1RZMA 3OXFA 2VG7B 4Q0BB 3UD4P 4USTA 2YX1A 2YVSA 3G2XA 5CQGA 3MR2A 2HHHF 4GKKF 2XCPA 3JB9k 1MWQA 1YX2A 2J6SA 5GAGI 3EXCX 4IRKA 2FLNA 1NZAA 4B9MA 4K59A 5E3QA 4ATNA 1U1LA 2V0NA 2EK1A 4LVNP 2DEJA 2E66A 2HVEA 2QIFA 1NPRA 1KLMA 4ITSA 2DD8S 4ZJLA 3BJYA 3BGFA 2BKPA 2R7QA 3G87A 2ASJA 4ED1A 3I4HX 1NHUA 3DU5A 2XI2A 2R2TA 3DOLA 3MECA 2V9WA 3L09A 2B6AA 5J1PA 1TL3A 3FUYA 1XN9A 3EMTA 4NCAA 1JKHA 2UXCF 2KFYA 1TL4A 1R0CB 1H38A 2DISA 3MFHA 4X4QA 5L9NA 4NLDA 2ZDPA 3PW0A 1NK7A 1Q1KA 2KXHA 1OWXA 4PWWA 4BC9A 2OMLA 2DT9A 4P2SA 3O8WA 2ZUGA 3HKWA 5C24B 4ZCLA 5KFXA 2MZQA 1S9FA 1CJTA 2P9EA 1MMLA 4TKTA 2DHGA 4ZP6A 1KFSA 1N5SA 3BGOP 4GRSA 1RU2A 1SBRA 4JI8J 5HAOA 4LSLA 2F4VF 1Y00A 1D3WA 3PHEA 4C8NA 5AE1A 2DIUA 1FWKA 1FTRA 2GA7A 3CW2C 4P9SA 2CNLB 3DLEB 1NSPA 3FKBA 2VKRA 2DPJA 1KTQA 3ENVA 1XMOF 3D0GE 1T11A 1K1QA 4ILRA 4JYAF 3ZZOA 1YHQS 1D8YA 3M2VA 3DI6B 3MM8A 3GR0A 3T1YF 1LK5A 1H3DA 2G9OA 1M5SA 3E51A 4WIIA 3QQCD 1OY6A 4ZP7A 5EWGA 1RTZA 1T3NA 4P2FA 4UT4A 3OUYA 2PFFB 4C3MA 4HVZA 3J81j 1CJKB 4PEOA 2K06A 3HP6A 4FYYB 1QTNB 3CJKB 4JI2F 3IM8A 3HSGA 1SC4B 4L73A 1HBNB 2BQRA 5AE3A 2CPZA 3BPSP 2DPIA 4M5DA 3IMQJ 2C2NA 4TU9A 3VGVA 3FSIA 4MJKA 2KVIA 4C11B 3KLHA 2BE2B 4F50A 1HW8A 1NAQA 3HHLB 1Q5VA 4J9VA 4CP5A 5DQHA 1RI7A 1R8PA 5G0RB 5L1LA 4ED0A 1T9VA 3PNIA 3NAIA 4LBPA 5DJBA 3BDEA 1JLGB 4G1PA 3OHBA 2JJ4D 4Y00A 2ZITA 1XTZA 4A8QA 5E0OA 4B9LA 4KR0B 1SIWB 1S1XA 4LFAF 2XTJP 1K0TA 4NLPA 4I1TA 3CCLS 2ATCB 1CPZA 5ETRA 3DRSB 2HNZA 5B0CA 3MURP 1M1GA 2R9LA 1S9EB 1T9TA 4YY3J 2FLPA 2ZFHA 2W01A 4RUAA 4LT6A 4UF4A 4K5SA 1A7GE 2RJZA 4JV1A 3C6UA 1M5PC 4PG5A 1VQ8S 2IA6A 1YJTA 1JMTA 1N32J 3VHQA 4HH1A 4ZPBA 2ZWPA 4FXWA 3CB4A 1TQLA 2WONB 1KS2A 2M5YA 2VFVA 5KG2A 4NA2A 4CO5A 1RBOB 3ADAC 3W5XA 1T0TV 3UN3A 3TZYA 2ERRA 4B3RF 1TK5A 1VLYA 2MLXA 2XO7A 3D9BA 2KVQE 4KPCA 5KFSA 2ZBQA 2DY9A 6FD1A 2MLYA 5KFQA 1F2GA 4C8LA 1FRIA 4NI2B 1M5HA 1NSKL 1T9WA 2P6TA 3DMJA 4IFYB 3J80U 2DGOA 4I4BA 3K17A 4PXDA 3WBZA 4RU2A 2OHDA 2A6OA 1N4LA 1G3OA 3DLGB 2WZ1A 2HFVA 2BVZA 5A8KB 3HHLD 3V81B 1PAEX 1SJ1A 2OELA 2LQ9A 5DZ6A 1WTFA 2PA3A 1RAAB 3SQGB 3P5TL 2NZ4A 3CCZA 3CXCR 5AXNA 4O4GB 4JUZA 2MQQA 4ZPVR 2Q6BA 5IFMA 1PJ5A 2MSSA 1NJXA 3Q8RB 3R7NB 3W61A 4KT0C 2L3MA 4YFUA 4KV8B 5ETNA 1MLAA 5KFDA 5K14A 5CZXA 1RE1B 4NCBA 1HMVA 1IQTA 3K57A 2IBKA 4B08A 5U47A 4IR1A 2E9TA 3BGRA 5T41A 2J7WA 4YR3A 4WPAA 1P1LA 2BJEA 2ZJPQ 1C2PA 3PO5A 1TK0A 3M8PA 3WC0A 2QA4G 4OJ3A 4DV3J 4ZHRA 1RWWB 2CPFA 1TKXA 3BSOA 4PABA 5FJ4A 2C3YA 3RR7A 2DGXA 3HFZB 4KBIA 1MWZA 1ULRA 3ZTQA 4OX9F 2NQPA 2GVZA 2CPDA 4NYZA 3EVOA 4U7UK 5BYSA 2AX1A 2X1BA 1RP5A 1FT8A 3I56S 3MAAA 4LRDA 5A0YB 1U1KA 1X4BA 2UUTA 3C16B 2QRRA 4ERDA 3G6YA 2B0GA 2D9PA 1RTIA 4WE1A 3U1MA 1J5OB 1K8AT 5AJ3J 3GILA 3SDEB 4TVAB 4NLXA 3V6HA 3UCGA 1ZETA 3CULA 4JOUA 4CLYA 3P6YC 2XMMA 4DSJA 4GVLA 1HKAA 4OI3A 3Q8QB 3CMQA 4Y2AA 3M2UB 4TY9A 4DV5J 3BBCA 3HSJA 3JTNA 1GTHA 4M63A 5E3AA 3VWSA 1K44A 3C8YA 3ONQA 5F8LA 1WNEA 2UXBF 3HJVA 3TJAA 2BE7D 2I9SA 2KM8B 1REVB 2EFQA 1JJCB 4AT1B 5SUHA 4M94A 4CLKA 5I3UA 3ET6A 2LP4A 1HNIA 1FWLA 1HQUB 3VAMA 1HBOB 4ED2A 1BY9A 4CWBA 1BQNB 1TL5A 3GQCA 4OHYA 4IFVA 4I6YA 3KLEA 2UUCF 5KFZA 2R42A 4EGLA 1FRJA 3T1HJ 1SJQA 2JC1A 3LA0A 3TUJC 3QAEA 1RLDA 4ANDA 3BO3A 4YB1P 3HO1A 2MKCA 3PFOA 3HKZD 4L72B 1HNXF 1XQIA 4LR7A 3B82A 5D0RA 1KD1T 1FI4A 2Y0SD 1L3KA 3DRPB 2R7RA 4GVBB 4DV7J 3H25A 3NWRA 2KJWA 5LMUF 3GCWP 5T7LB 2I1RA 2L48A 3GE9A 4TYAA 3DDNA 2DHSA 1IKVA 1RKIA 2I5JA 3R5GA 2G0IA 1WG5A 4YR0A 1WDDA 3LWLA 2R8JA 1NH7A 4URGA 2LQJA 2J8AA 5J2NA 1NHVA 4Y2IA 3CE8A 2BW7A 2IIHA 4DZDA 3H40A 2ZH6A 4TYBA 3MPYA 1X0PA 1L3SA 3MUMP 3I0SA 3MEDA 1VJWA 3AXMA 3MEEA 4L6V3 4Q2MA 1URRA 1LOUA 3IRWP 5EX3A 3U1NA 4TNOA 4EZ9A 3KLIA 1FE4A 3HZGA 5EUHA 2BJDA 3EZ5A 4QWDA 1X9SA 3R9LA 3TVZA 3GR1A 4ZLJA 2IY5B 1MWYA 3ENAA 1VRUA 2NZCA 2WVFA 3J7A1 4EFAC 2Z57B 1RTJA 4USVA 3WX4A 4I7FB 4M5GA 1MROB 4J9NA 1F2HA 4DR2J 2HMIB 2N3OA 1TP7A 1NKCA 2Z4PA 3E8OA 1NXIA 2A2DA 3FNNA 3JYTA 2VZ9A 4PG6A 3M6XA 3J7Z5 3I82A 2V8VA 3IGNA 3MMBA 3CJQA 2E1MC 2BDPA 4BCAA 4K0KF 4FNHA 3RBZA 1LXJA 2XM3A 1KN6A 5HJXA 4FBUA 4LRAA 2GW8A 3FZ2A 4YB6A 4KKOB 2UUBJ 3LGNA 1UETA 1EP4A 5AE2A 3PX4A 4OHVA 4RUCA 1U48A 1F9HA 5HQ8A 1HWJA 4OZLA 1Q86T 4UOCA 3ILLA 5J1EB 5F8JA 4DF8A 1FKPB 1LWEA 3GG0A 2OUGA 4PWUA 1HW9A 5KT3A 3KK2B 4PQUA 2IRYA 1PYOB 2HFNA 5CXTA 2DCUB 4K50A 4K4UA 5KFIA 4J91A 1HNVA 2MQ8A 2MMYA 5K8PA 8AT1B 1KSPA 2V2QA 1T94A 2YBVA 1UAWA 1B64A 4YHHF 3NS6A 4IYQA 3SCKE 4R8UB 2QTWA 5EWFA 2L41A 4NYPA 1OJ4A 4N41A 3QAUA 4ANCA 2FJVA 1NEEA 3NY0A 4KH0B 1UKUA 5KFAA 4EMDA 2MQLA 2DGTA 3HHLC 2YNGB 1YK9A 2DR9A 4MMOA 5KG1A 2B4UA 2C2ZB 3AJDA 5M2UA 1GMWA 4LFCF 5HLFB 2ZZTA 2AGPA 2V9KA 3ISND 1NSQA 5B08A 1RK8A 3OL8A 2HBYB 1WOPA 1PC5A 1N5YA 4U8YA 4XTTA 1HR0J 5IC4B 3VAHA 1ZAXA 1WTBA 4S0MA 3AA8A 4F4KA 3FBCA 3PEHA 3W1YC 1E6YB 4IG0B 3QSIA 4QU7A 1HPZA 2OPRA 1TKZB 4Z2XA 1N5VA 2YKNB 4K2XA 3K0JA 2OFGX 3BSCA 2VDIA 2HIQA 2CZ4A 2F9DA 3W8GA 4DLEA 4ZLPA 1F5AA 4GC6A 2HNDB 4GO7X 2XLJA 4FYXB 1W26A 1C4CA 4LVOP 1RWOB 4EI2A 1WACA 4IKAA 3CJ4A 3Q89A 2W9BA 2D9OA 1WEXA 1G1XA 4IUFA 2JEFA 3L3CA 2RAQA 5D3GA 3T41A 1HWIA 1UEKA 1Y0HA 3G86A 2VG5A 1V3ZA 1B70B 3CDUA 4JI3F 2ZEJA 2COLA 4MH8A 4PG7A 4A8YA 4UY85 2PGCA 1RAJA 2JNJA 3AOCA 4ZCMA 4IO1A 2D7SA 1S12A 3TA2A 3J81Y 3WIVA 3PXGa 1N6QB 4J9UE 1OY8A 3MCMA 3QWPA 5BYRA 4V19J 1RDRA 1QJHA 5IXUA 1JLFA 2GMHA 4FP9A 2CJBA 2IM1A 1U02A 2EC0A 3V5RA 3JXOA 2AU0A 1HQEA 2CQPA 1EJ7L 3ZZUA 4Y6IA 3MM7A 1RTHB 2YKQA 2EC2A 4OLOA 3NMRA 1NHKL 1PJ6A 3RB3A 1FRXA 2I8EA 2BRKA 4QR1A 3LP0A 2MKIA 4AXJA 3FMWA 2N3LA 2C2EA 2HQFA 1V3RA 4F4XA 4CLSA 1TMJA 5CYQA 4MFBB 2VQFF 1JLEA 5HVFA 4ETZA 5F3TA 2OD4A 3UVJB 1RWNB 2WVCA 1HD1A 4FN5A 1Q53A 1FRHA 1TV6B 1GXUA 5FDLB 4WZQA 4ECZA 1S1VA 1RWVB 5HANA 4OX7A 2E7XA 4YP3A 4CDIA 1YZ7A 1XERA 3H2LA 4OHZA 1RT5A 1WC1A 2JSXA 2BR0A 1RT6A 1Y5IB 1U7LA 2VKZG 3FCHA 2DR8A 2J7KA 4NCGB 1Z2LA 2DNLA 3KHRA 1FD2A 2QLWA 4B02A 5HBMB 2Y0BB 4IG3B 5F8HA 1U26A 3VTIA 4UY8T 4RR5A 2GGPB 5I3QA 4ZIWA 3NWGA 4HR2A 2ZDOA 2EK6A 1EHWA 3IA0A 2Y1LB 2JX2A 2RKIA 1QE1B 5KT7A 3QJJA 1IXKA 3R5AA 4IRCA 1Q0NA 2DB1A 3CIZA 5HP1A 2DGWA 4DWIA 1R8HA 2JFKA 3DRRB 4OZ3A 2DGVA 2V8HA 2R7XA 4N76A 2B8QA 3BV8A 2W9AA 4PG4A 3GV7B 1X4GA 4RPFA 4QZVB 2DGQA 2BQ3A 3TO8A 3L95X 3W7BA 3Q0AA 3ZTOA 1UVNA 4ZCKA 4ZKAA 3NNCA 1YBTA 3BR8A 4UOFA 1SUQA 5A6WA 2Z8QA 2FVPA 4DV3F 3PG9A 5F0UA 2V94A 2CWXA 4RBVA 4O3NA 1UTAA 2ZE2B 1KLMB 3HHNB 2KFNA 3LP2A 3HHKA 1XNQJ 1R89A 2VJVA 2O1PA 3QPIA 5HROA 2J9DE 4ZVQB 4URSA 3D6HB 3KUHA 3DOLB 3MECB 4WCEQ 3RRGA 1TL3B 2CFXA 2CQHA 1JXVA 4F2RA 4WFNQ 1R3NA 4MYUA 1TVRB 2YNIA 1MU2A 2HRTA 2AP6A 4PYAA 1VR6A 1UEVA 1FVQA 2UP1A 1YVFA 5JVHQ 3QATA 2DHHA 5KFEA 2F8EX 4IQXA 1I51B 2IPOB 2IM0A 3UI3A 4OZ1A 2I38A 4UZBA 5KFBA 1DTTA 1HWUA 4ZLNA 2DRBA 3UN2A 1RB0A 1HBMA 3V6DA 4K4VA 2H5IB 4FPRA 4LSLB 3QRPA 5D4NA 2VPXB 2VU5A 4Y2KA 2CJXB 3C2PA 2BV3A 4NLRA 1FO1A 3GWCA 3OFGA 1K1SA 3N5FA 2OEMA 3R5BA 3CCES 4CT9A 4ELVA 2FY8A 2KG1A 5IM0B 3DHXA 1VIXA 2R7VA 4G1QA 5IT9U 3T1HF 3NEKA 1FRMA 1GNKA 5J2PB 2ASYA 4OFZA 3JAMY 1RAGB 3NKYA 3J81U 1T05A 4FDFA 1RT7B 3WIUA 4OMFG 2Y3YA 1XMQJ 2F4FA 2N7YA 2V4JB 3TUPA 4UUXA 2DHAA 1VQMS 2B9WA 1H7XA 4KTQA 1RJJA 2B56A 3IG1A 3K59A 3DLJA 3PVXA 3T1AA 4L75A 4OHWA 2EFVA 3HD1A 2UUAF 2C2RA 2YTCA 3WC2A 3QT5A 3UDVA 1LW2B 1X4CA 2FJEB 1QVGR 5CA5A 2V63A 5GVQA 3HHDA 3TVKA 3UNYA 1I94F 1Q82T 1JLCA 2CQ2A 3KLHB 3K7RA 4JV0A 1A0OB 1HBUA 3UO0A 4X66J 4A48A 3RB4A 4FXDA 2BANB 1YWXA 1CLFA 1U4BA 4DR3J 3ZO7A 4DLGA 2ZOGA 4NL5A 4ICLB 4HHHA 4NXMJ 4PQAA 5DGAA 4CO1A 3MEGB 1WDTA 1F5CA 1HYSB 4I2PB 1CEZA 2LXUA 2A3JA 1RYSA 4ZVSB 2M8HA 2CG8A 2AW0A 2HPUA 3C19A 4USUA 1WHVA 2KJVA 2LU2A 1FNXH 4AL5A 3LGMA 2VG7A 1U1OA 2R7UA 4Q0BA 2HQIA 5IT4A 2WW8A 3MEKA 4C8MA 2YKPA 4O3QA 2FYXA 1S1XB 2W2QP 4CLPA 2MB0B 2WSFC 3QT8A 4H54A 1RT1B 5CHCB 1LW0B 2W24A 4HI2A 1U1QA 1NKEA 4FS2A 3FCVA 4ZPTR 4U67Q 1NB2A 3EUNA 4DR2F 3JSRA 1W7WA 5F3ZA 1SL1A 4C2MA 1ELOA 3HJFA 5THWA 3C46A 4HHUA 1N5QA 2QX0A 2QLXA 1ROFA 4ECUA 2HFUA 4U7UD 1K9MT 1PGZA 1KNZA 1ZTWA 2QLJB 4E2FB 2CG4A 5JXSA 2DK2A 3GIIA 1RACB 2QA2A 4M5JA 2CA9A 4RNMA 3TOQA 3PCOB 4ZVFA 1HNZJ 1I5OB 1QAYA 3GPAA 1S59A 1U2RA 2PN6A 2HZCA 5C24A 3M8QB 4JI6J 2WTFA 3TZZA 2LKZA 1Z4UA 3VQTA 2K1RB 2P5VA 3J7YI 1ZM4A 3RB0A 1YJ7A 4WXOA 2IHR1 2NXNA 2FZKB 3US5A 4DUTA 4FYDA 3HVRA 2FZGB 1AUDA 2XY7A 3EM1A 2ZHOA 4MT1A 1A9NB 3T6BA 5K8MA 1VI7A 4USKA 1C1BB 1RWPB 2LQBA 5KFOA 1WELA 4B9NA 2QMWA 5KG0A 3D28A 5K14B 4UOHA 1JLQA 2IM3A 4KYZA 1OIAA 3BGRB 2J76E 3CTRA 5CABA 4F3MA 1YSJA 4O0NA 1WI8A 3PY8A 4OYBA 2JZ5A 4RW8A 2CNKB 4DV6J 3A3PB 3RRHA 1TFWA 1FRKA 4WFBQ 3M8PB 2BOAA 2MQMA 1LWCB 5KFLA 4WP9A 4ZHRB 1TKXB 3P8BB 1Q5YA 4NRUA 6FDRA 1CJKA 1HR0F 2D3ZA 2ZVSA 3UR0A 3TAQA 5ETPA 3TEGA 4N47A 4B3SJ 3CJKA 1EQ0A 1RCOB 2VBZA 3KLFB 1X4HA 1HBNA 1S6UA 2W2OP 2E44A 1QAIA 1AA1B 2BBEA 1DRZA 1NDLA 2HGNA 2YPZA 4LR9A 1RTIB 4C11A 3EDQB 3DN9A 3HHLA 3JAMU 3H5UA 2CQ4A 4WKYA 4C8OA 4KHMA 4OI2A 3G96A 5KFWA 2GIRA 1QAJA 3QWUA 2AYMA 5G0RA 5F0WA 2FHMA 3TRGA 1WHXA 2C2OB 4WJBA 2M70A 1R8CA 4LUBA 2FUG9 3CEDA 4TY8A 3I96A 1JNRB 4X62J 1SIZA 3HMJG 3J7AN 1M5KC 1GX6A 2HLTA 2QZ8A 3OXLA 2RE1A 2KH9A 3AODA 1JB0C 1IJFB 1Q8IA 5T14A 3F56A 3V4IB 5I3UB 3ET6B 3SCJE 3QFWA 1HNIB 4EYIB 5F8MA 1MMNA 1S9EA 3EYZA 2VPWB 5KFHA 4DPXA 4ZMMA 3FCWA 2GMJA 2X3DA 3V2UC 4DL4A 4FF3A 1VQ5S 2JVOA 2DNPA 5K8OA 3GIRA 2BOPA 1EETB 2DKOB 4LMZA 3PRVA 3OR1B 1YKWA 2XNRA 1Z1ZA 3VF0B 2ADBA 4MIBA 1KFDA 4NMLA 4UQTA 2ZBIA 2HFZA 1L3VA 3KK1A 3PJWA 5FIIA 2RS8A 2W9CB 1GT8A 1NB7A 3QO9A 1UEUA 2QG9B 3CIMA 3A8IA 5KG5A 5EWEA 4KB7A 2J9EA 3BPDA 2YWEA 1BGXT 1D1UA 3S6EA 1Q7LB 1CULA 4IFYA 1LWXA 2KG0A 2XWYA 3EWGA 3T9ZA 4RUHA 3DLGA 3MUVP 2EFNA 4JB8B 4YB7A 1NM2A 3WQPA 5A8KA 1XC9A 1SJ3P 2DIVA 3V81A 3MCSA 1UFLA 3OTDA 2X1FA 2VC1A 3D6FB 2GVDB 3SQGA 2ZH2A 4NZ0A 4Q43A 4FYVB 2GAHC 4O4GA 3FDSA 2ZD1B 3Q8SB 4HLBA 4B9UA 4DSIA 2B4OA 3I0SB 2AMCB 3MEEB 4EO6A 3Q86A 3U1LA 4GMKA 2YQ0A 3KLIB 1IR0A 2ZBRA 1PBUA 1AT1B 4N77A 1HNWF 3M05A 4G1IA 2CPHA 3GONA 1S0MA 1LEOA 5HN0A 4DDFA 3O3LA 4EU0A 2QSWA 1H0HB 4CO3A 3TX8A 3O5TB 2KHCA 5KFFA 1RTJB 2GCFA 1XR5A 3IS9A 1XMBA 4G6VB 2GIQA 4ZVGA 4WTOB 1KR4A 1PSDA 2Z2LA 4A8KA 4DQIA 5H1SV 2C42A 3JYTB 1G4CA 1J2VA 4ZPAA 1SJRA 1TELA 2CJ9A 4QPTA 4OJ1A 1UFWA 2OI2A 2DNHA 1H98A 2B4VA 1VC0A 3PYFA 1IR1A 2VH7A 3OPKA 2AF6A 2R7TA 2YNHB 3N79A 3EGZA 5IWAF 4KHPJ 3L7PA 1XNQF 3SDEA 2DH8A 2VBWA 4JI7J 5DS7A 5DM7Q 4JI0F 5HJYA 4QQBA 3S8SA 4M5HA 3GJTB 2HSEB 3ZTPA 4OLPA 1ZM2A 4I2QB 4P71A 4QIEA 3LUYA 2YWKA 1S10A 4A8OA 2RSQA 4PQUB 3M7VA 1S1UB 5EN1A 1REVA 3PV8A 2FC8A 4FPIA 1WF0A 2ZJRQ 1N56A 1HNVB 4D3HA 1O51A 1QLNA 1HWKA 1YJNS 1HQUA 1YG0A 3PJXA 1HBOA 4IRDA 2VONA 2JVRA 4C98A 2LQ8A 2B7CB 2QYGA 1VYAA 4PG8A 4DR5F 4U6PA 2VBYA 4C0HA 1VDHA 2HAIA 1S6PB 2L9NA 3OVBA 4QW9A 3IC1A 3MPUB 4QBUA 1FKOA 3UR3C 4DPWA 4HDHA 4HTIA 2HS3A 2HS0A 4LF9F 2GFFA 3MI7X 2EFOA 4N7TA 5IV3A 1RAIB 4AQYJ 3PHTA 1RAOA 2GAGC 3BKFA 2BM0A 2RRAA 1RU1A 1WEZA 3MCNA 1XEZA 4C9DA 1B0VA 1IKWB 2PI5A 4LFBJ 5E3PA 4L3KA 3DXSX 3DRPA 4RUBA 4ZK7M 3MPWA 4GVBA 3MR6A 3U7JA 4K4SA 2RILA 1D9AA 4XIUA 4DQRA 5T7LA 5DG8A 1J5EJ 2ROGA 3QNWB 3AD7C 5K20B 1FEEA 3H2UB 1KLNA 3W65A 1DLOB 2KRRA 1OMSA 2HURA 2P9CA 2V2KA 2Q6CA 3VALA 4LREA 4NLTA 3OTCA 3MD1A 2OPQA 3LTOA 1WKLA 2OEJA 3U02A 4OYZA 4CLLA 3AQOA 2DNRA 3C15B 4X66F 8ATCB 1YJWS 3KMSA 3HT0A 4B3MJ 4TQSA 5JVGQ 2Y1JA 2HHWA 3HD2A 4NXMF 1WG1A 3R5JB 4NEYA 5JUMA 1S1TB 2J6UA 2JFDA 4W98A 2HQDA 4ZVHA 3G82B 1N0UA 3Q24A 3DRYA 5KFGA 4I7FA 1MROA 4ZVUB 3I31A 2XWXA 4A8MP 1DQ8A 2ZUAA 5KG6A 4BWJA 3BF4A 5L38A 2NXJA 3OT9A 4Y3CA 3I5BA 3K5MA 2JDJA 2ROPA 1CSJA 3IR7B 3UNGC 4QOTA 2PEBA 2E5LJ 2FZCB 1QM9A 1BQMB 1KRPA 3S1TA 2XULA 2IFXA 4DUZJ 3CD0A 4B9TA 4C8ZA 4KKOA 3EGVA 1SI9A 3N01A 3QT7A 4NWBA 3BS9A 2D41A 2AGOA 1U6BA 1R7IA 2MKYA 3GB0A 1U1MA 3TAMB 3W62A 2HHTA 2OMOA 4LF7J 3D3CJ 3B4DA 2XHWA 5D4PA 4G3IA 5KFTA 1X8DA 3CWJA 2AHOB 4TXSA 3M30B 2XS2A 1JLBB 2CVEA 4H4OA 1FKPA 3BR9A 4OZJA 5L1JA 3DU6A 3KK2A 1S1VB 2X7IA 3CD7A 1KP6A 2Z30B 3IP0A 1XR6A 2ZH7A 3AB4B 3DXBA 4B9SA 2YWGA 2XBPA 1RT6B 1YQHA 4USWA 3KHHA 3SI8A 4X64F 2IC3B 1T9XA 1S79A 1IBMF 4RLEA 3CJ3A 5I42A 1APSA 4B3TJ 3M2RB 2ZH8A 2JHEA 3GFZA 4USIA 4M5NA 2YNGA 4ECRA 3C66A 3THPA 2G2OA 4D3GA 2YQ1A 1YITS 2I2YA 1JIHA 2BKNA 5HLFA 2CQ1A 3HVTB 1N52B 4C7QA 2UVRA 2RF2A 1XNRJ 2HHPA 1K47A 3SZ2A 3IBCB 2ACMA 4OI0A 3R2DJ 3IFEA 3PX0A 2F65A 2F8MA 1FE0A 1FFGB 2I6WA 1RAFB 4GC7A 1FJGF 1S77D 3T9NA 1CVJA 2CYYA 3JTOA 4XDDA 4LF5J 4DR4J 3RRKA 1E6YA 4Z7YA 5A76A 5KFNA 1MSWD 3W8PA 3LP2B 2YKNA 5IOLA 3EGWB 3POTB 4B3SF 4LF6F 2DYAA 1S9GB 1NH8A 2HNDA 2DH7A 3MM6A 3H98A 3ZXWA 2R7OA 2AD9A 4EZ6A 3H42A 1NU4A 2QMUB 3SFUA 3RAXA 1UVKA 1WOOA 1O6XA 5HSPA 4KO0A 1VQYA 3ENWA 2MYFA 3H0PA 4AD6A 1U2FA 2HHSA 3OTBA 1MU2B 1B7FA 4DFKA 4TLQA 3UDCA 2VPYB 1NBEB 2P8IA 2MTLA 2VF3A 3D0HE 1DY3A 4PXEA 1S1WB 2XMAA 1RSCA 3KJNB 1JJHA 3I9V9 1G2EA 4JI1J 1DTTB 3W9IA 1S97A 1HBMB 2H65B 2XY6A 4ED7A 1TTHB 3I5AA 2G2YA 2EW9A 4R25A 1RISA 4BS2A 2A2CA 2BACA 3QZ7A 1RXOB 3NCPA 1WF1A 1FHTA 4EWTA 4F7VA 1RTHA 5GAHU 2X1GA 3HI9A 5A6PA 3PKMA 2V6AA 3PRDA 1TL7B 4G1QB 1WOSA 2MQOA 2R8GA 4MYTA 4DUYF 4DR7F 1LWFB 4UUWA 3GIMA 5BR8J 3AJ1A 2G13A 3ZTSA 3K5NA 3G6VA 4I64A 5L9XA 3UVJA 1N48A 1PCAA 5E7OB 1FFSB 2FHJA 4WU2A 3OSNA 1TV6A 3MPVA 1X5SA 2N7CA 1VQNS 2EG1A 1C0TB 5F9LA 3H5XA 1Q8KA 2MZSA 1Q16B 2OTJS 1M0SA 3TEHB 2V8GA 3VVTA 4CH1A 1FD8A 4GKJJ 3DGVA 2ADCA 4JV5J 4WF9Q 5HATA 2H4WB 2IYIA 3DOKB 5GAEI 2NYIA 4IG3A 1VBXA 1DARA 2M7SA 1GXLA 4M5LA 3PZPA 2GGPA 5F41A 4OYAA 1T03B 4QYRA 3RBXA 2RH3A 2E9RX 3BKTA 1JJ4A 1C1CA 2ZBCA 2E5HA 2Q79A 3K89A 4MK7A 2VFTA 2C3OA 4AUKA 3DRRA 5ETVA 2PT0A 3K58A 2XSJA 4OYMA 3A4TA 1A6LA 3CT9A 4DQSA 3FBBA 1EARA 1UZHA 1VIOA 1RUSA 2RRNA 3FSXA 3ZFVA 2J8SA 2PSZA 3K8VA 4C48A 2VA3A 4Q8FA 2A0FB 4M1KA 5GAGU 1N8RT 5LMNF 3JSMB 1NPKA 3P5BP 3CO0P 4BLGA 3G9CA 1SV5A 3CJ8A 2FJXA 1D09B 4OL8A 4FNIA 1AYEA 2MLZA 4DR1F 4XK8C 3JTPA 2QFIA 3D7SB 4A8FA 4RWWA 2ZE2A 2FB0A 5KT4A 3NMAA 2DEIA 3GG1A 3CCJS 2CDQA 2ILZA 2HFOA 2XLIA 3PYDA 2KZMA 2QL5B 1AZSB 3PIOQ 4EBEA 3AOAA 3HF5A 4QWBA 4DN9A 3ZZZA 3BEGB 4NZ7A 1F5BA 1DFDA 2V8DA 4K4ZA 2BJ7A 2PEHA 2KYXA 4WK3A 4JI7F 2IVYA 3G6XA
chains in the Genus database with same CATH topology
1C0UB 4HHJA 5I3QA 3FVYA 5HMZA 2HMIA 1DQ9A 2MHNA 1TVRA 1LK7A 1D9FA 4TQRA 3NWGA 4KSEB 2MGZB 1IN0A 2FIUA 2ZDOA 2DVIA 2EK6A 3OHAA 1JLFB 2VFUA 4ZCIA 1E6VB 2ZHAA 2APOA 4XO0A 3IA0A 4PXCA 1KQFB 1NRKA 2IVFB 4AE5A 2GMLA 2JX2A 3CJ2A 1N33F 2RKIA 1QE1B 5KT7A 4J9QA 3MOZA 3QJJA 1IXKA 2ALZA 5LXRA 1FVSA 2DITA 4HT7A 4F3QA 3LO3A 3R5AA 4IRCA 3CMAS 1HQEB 2DB1A 3IRXB 3CIZA 5HP1A 3HM9A 2DGWA 1N5TA 3TAPA 3OXGA 4DWIA 1R8HA 2JFKA 4PUOA 3TANA 3DRRB 3MM7B 2JLEA 4IQMA 5IZHA 1VQ7S 3B8HA 2CJAA 2DGVA 2V8HA 2R7XA 4N76A 3MMCA 1Q7YT 2JH3A 2W9AA 5BR8F 2EVZA 1P8GA 3OQ2A 1IKXA 2RB7A 4PG4A 3GV7B 4YOEA 1X4GA 5EDWA 3KWMA 2ZM6F 3LQVA 3BN4A 4QZVB 5GADU 2PI4A 2KT3A 1K0VA 1YJRA 3M9MB 2DGQA 4ID8A 3LP0B 2BQ3A 2K7JA 3TO8A 1YRTA 1JX4A 4FBTA 3L95X 3W7BA 5I4MA 3Q0AA 1IKYA 4CZCA 4V19X 2V4RA 1NK0A 2CPXA 5IS2A 3O6QA 4DG1A 1UVNA 2VV5A 4ZCKA 4ZKAA 3NNCA 1IUJA 2DH9A 2JEJA 2EKYA 3E3XA 2G4BA 5KFVA 4I6WA 3BR8A 3OLBA 1B0PA 1GQEA 1CQMA 5IT0A 5CYQB 1SUQA 4GO5X 4ZPCA 2Z8QA 5A6WA 1SL0A 2FVPA 5CYMB 1JLEB 2CQBA 2LDYA 2FVSA 5DDPC 5B7WA 5M2RA 4X4TA 4DV3F 5F0UA 3SXLA 2N4CA 2V94A 3PEJA 4I6AA 2H5EA 2WB1D 1T95A 5J1EA 4RBVA 2DGUA 5L1IA 1VC5A 4O3NA 1U1RA 2MPUA 3BDPA 5IM0A 4IH5A 1JLQB 3NRBA 2ZE2B 1FNOA 1KLMB 4GKJF 2AGQA 3HHNB 3LP2A 1PILA 2KFNA 3HHKA 3LALA 3OFEA 1KHVA 4YEAA 1KQKA 2CPEA 3QZ8A 2Z0GA 5A2QY 2XGQA 3DLLQ 1R89A 5J2PA 4OZNA 2O1PA 2OPPA 4Y34A 2I0XA 1RT5B 2RIJA 3QPIA 4I69A 5HROA 3I4PA 4QW8A 2J9DE 5ADZA 2BRLA 4URSA 4RW8B 3OTOF 4WYWA 1RT7A 2GQCA 3LAMA 4Y65A 3DOLB 3MECB 4WCEQ 3RRGA 3OJUA 2V4JA 1Y5NB 4FF4A 3MTKA 1TL3B 3C6TB 3HZEA 1FDAA 1X5OA 5F8NA 1R31A 5LSOA 3T5HA 1SH2A 2CFXA 4DL2A 3MM9A 2CQHA 3CDWA 1UP1A 2ZH9A 1RWUA 3MR5A 1W2IA 2HHVA 2J5AA 1S49A 4R8UA 1KOOA 3V6KA 4F2RA 3Q22A 4WFNQ 3I6PA 1R3NA 4Q5VA 3NAHA 3RYLA 1HL6A 4MYUA 2XMUA 3TNVA 5C42A 3ITHA 1TVRB 2PIIA 2YNIA 2FLLA 4QIVA 1MU2A 4IDKA 5I3PA 3FSYA 2F1FA 1FTCA 3OFHA 1LW2A 3R27A 4C0BA 1HI1A 1R27B 4A8WA 4YUDA 4I68A 2EPIA 4NLOA 3K2YA 2AP6A 2UZAA 2DR5A 2U2FA 5KFKA 2NUUG 1UEVA 1FVQA 3QGGA 2RKIB 1SH0A 2UP1A 2Q3PA 1YVFA 5JVHQ 2UV8A 5GMKa 3BO4A 3VZIA 2O66A 3TW0A 2LMIA 5DRKA 3RZAA 2AJ1A 5E5NA 5KFEA 2F8EX 2W8LA 5HP1B 2RQ4A 4PUOB 4IQXA 2IM0A 2QFJA 3VAJA 3UI3A 4OZ1A 3GMGA 2BANA 3MMCB 2I38A 1ZBTA 3V4MA 3GFXA 4B17A 5KFBA 1DTTA 4CO2A 1HWUA 4HKQA 1KQGB 1IKXB 2GV1A 4HDGA 1FXRA 2DRBA 3PW5A 4ICLA 3KLVA 1HBMA 1JK9B 3H59A 2GJIA 3V6DA 2J0XA 4JI4F 4K4VA 3UFCX 4CT8A 5DLGA 2HHUA 4FPRA 3CC7S 2F3JA 3MEGA 4LSLB 4BC7A 3DLBA 5D4NA 3MTJA 4K5RA 3QJPA 2VPXB 1HYSA 4I2PA 4Y2KA 2NSCA 1YGYA 2IM2A 1BWEA 3C2PA 2YX7A 2UVWA 3A8EA 2KI2A 2BV3A 4DG1B 3D2WA 4NLRA 1U25A 4TY8B 1FO1A 3TYTA 2WCXA 2J0WA 3GWCA 1K1SA 3OFGA 3SSQA 1XWLA 1UMJA 2QT7A 2FJDB 3N5FA 1YJVA 4HI1A 1SUQB 1NK5A 2DNKA 2OJ3A 4URQU 3D1HA 1RT4B 3R5CA 5LXYA 2WOMA 2YNFA 2J0QD 4H4KC 3R5BA 3CCES 1QSYA 1UJ5A 2HNYB 4DFPA 4CT9A 4ELVA 3VAKA 2KG1A 2HWIA 1YBAA 2KKHA 4IG0A 5DG9A 4QJVA 5HL7Q 2ZZMA 4X4SA 1LQ9A 1DJ0A 2D74B 5IM0B 3UQSA 3MHYA 1TKZA 3DHXA 1VIXA 2Q43A 2KDOA 2FJWA 5DO2A 2R7VA 1I1GA 2F7VA 4G1QA 3T1HF 1FRMA 3UDLA 2JLFA 2M8DB 2FGOA 1GNKA 1W25A 4CO0A 5J2PB 2ASYA 4OFZA 3BB5A 1RT1A 2OPPB 5KG4A 3JAMY 3NKYA 1LW0A 5HROB 4YR2A 1SB6A 1T05A 1R0AA 1F9FA 2C22A 3NLCA 5JJBA 1VFJA 1RT2B 1RT7B 5KG3A 5HMWA 2SXLA 4OMFG 4YQWA 3DLKA 2XLKA 2KT2A 1HI8A 1H7WA 2N7YA 2V4JB 3M6WA 3TR5A 1D0EA 2FDNA 4UUXA 2CPIA 2DHAA 2LA4A 3LOUA 1VQMS 2B9WA 1ZOTA 1H7XA 2VBXA 3AJ2A 3CCMS 1JJ2R 4OQJA 4KTQA 3MM9B 3OJSA 1RJJA 3H4BA 2B56A 3IG1A 5FLXY 4M95A 3K59A 3DLJA 3PVXA 3T1AA 3KFWX 4OHWA 2XS7A 2EFVA 1X9MA 1P1TA 2UUAF 2F40A 4YDXA 3FEZA 1RA7A 2VC0A 1ZAWA 7FD1A 5A8WB 3CJ5A 5C42B 3ITHB 2C2RA 3S7RA 5C25B 2YTCA 1R8BA 3WC2A 2YNIB 3FQLA 3MZIA 3DM2B 3QGHA 4EBDA 3I32A 4DBQA 1LW2B 3LW5C 3UD3P 2AYBA 2CJKA 1DTQA 2YWFA 1UVJA 1X4CA 2FJEB 2ZOMA 3FEYB 1NO8A 2E5LF 1QVGR 2AJFE 5CA5A 1FK9B 1RYRA 3M4XA 5KFCA 2JEIA 1CC7A 1ZPWX 2YY3A 2MY8A 3CGIA 5GVQA 3HHDA 3TVKA 3M6UA 3HDSA 3NNHA 2C3UA 1I94F 1Q82T 1FDBA 4OX6A 1JLCA 4WK1A 2CQ2A 1FRLA 4O4RA 1SL2A 3KK1B 1UVLA 3KLHB 3K7RA 3CPWR 1NK8A 4JV0A 1HBUA 3QMQA 4A48A 3QLHA 2EBGA 3RB4A 4B9VA 3VAGA 3CDEA 3QO9B 3E01B 3P3DA 1N6QA 2BANB 4FXDA 1YWXA 5KFUA 1CLFA 1U4BA 1GH8A 2IJFA 2HVZA 3DNCA 2HWTA 4DLGA 2DR7A 3QYYA 2ZOGA 4NL5A 3W2WB 4X65F 4ICLB 4LF8F 3J7ZT 4O44B 4DX8H 3V6DB 4NZ6A 4PQAA 5H9EJ 5DGAA 4CO1A 3L7OA 3MEGB 2MZJA 4NLSA 2J6TA 5K9FA 1X9WA 5MAOA 1F5CA 1VHFA 1HYSB 4I2PB 3TA0A 2QEXS 5L39A 4NLQA 1CEZA 4DV0F 2LXUA 3BM7A 2A3JA 1RYSA 3MR3A 1S6QA 2M8HA 2RUGA 2ZNYA 5D77A 3M8QA 3TI0A 2AW0A 1TUVA 2XGPA 2MQNA 2HPUA 2FJAB 2CQDA 1X4EA 1V6HA 2IJNA 1QTMA 1WHVA 1G7CB 2KJVA 3MM5A 4H4MB 5K5MA 2R8KA 5D78A 2MKKA 2LU2A 3HVAA 1P6TA 1FNXH 3SSSA 2FD2A 3LGMA 2K1RA 2VG7A 4Y2MA 5GAHI 4AL5A 1U1OA 2R7UA 2WOMB 2YNFB 4Q0BA 2DTJA 1HA1A 2HQIA 4DQPA 5IT4A 5DQGA 2KXFA 2WW8A 3MEKA 2M9KA 2K8GA 3W2VA 4C8MA 2QO3A 2YKPA 4O3QA 4J9LA 1S1XB 2LECA 2MB0B 4TLRA 4P7VA 1TKDA 1U24A 4Q8EA 2NR0A 1IM4A 4NOHA 2WSFC 2OO4A 4H54A 1RT1B 3D1OA 2FY1A 5CHCB 4DV1F 1LW0B 2W24A 3KNAA 3IXQA 4HI2A 2JEGA 1T05B 1U1QA 1C1BA 1NKEA 4FS2A 3NP5A 4KPYA 1MMDA 4ZPTR 1VK3A 3M9OB 1FEHA 4DN0A 4U67Q 3K8WA 1BQXA 3FFIA 2RU3A 3DLKB 4MFBA 5LT5A 3N6LA 3EUNA 4PRFA 2MZRA 1IBKF 4DR2F 4ECXA 5KFPA 4P6QA 3DC2A 3N28A 4K4YA 3JSRA 3UCZP 5F3ZA 2RVJA 1SL1A 2RQMA 2VFRA 4C2MA 3CDAA 4ECYA 1ELOA 1ZZFA 1W2BR 3HJFA 4DSFA 4DL0C 5THWA 3IG1B 3C46A 5KFMA 2K7KA 2OAUA 2OSQA 2MSTA 4CQ1A 1F60B 2WSCC 1N5QA 1XR7A 2C3PA 4OZ5A 5FDLA 2QLXA 2Q1LA 2RDIA 1ROFA 3TUZC 4ECUA 2BXJA 3E2EA 1OSCA 5D4OA 4DR6F 3ICLA 3ZZRA 4C8YA 1HHSA 4CIOA 1K9MT 2IRUA 2CVIA 4NLGA 3HFKA 1DTQB 2L9WA 1O0PA 5LL6d 2W4DA 2LDIA 4FVMA 1PGZA 4PWDA 2C28A 1KNZA 1NKBA 5IT9Y 2HGLA 1ZTWA 5AXKA 1TL1A 2GHPA 2HHXA 1ZTTA 2O5DA 5CD4H 2R7WA 3IS9B 1JLCB 1LWCA 3RAMA 1NK9A 1SH3A 4NCGA 2CG4A 1VQPS 5JXSA 2DK2A 1HBUB 3QLHB 5HBMA 7FDRA 3GIIA 3PM9A 4PXBA 5EGYA 3MF5A 2W25A 2QA2A 5CCMA 3EPGA 1M5OC 1DHMA 4OI6A 3UPFA 3DCAA 1OQ3A 4RNMA 2C3MA 3TOQA 4RNNA 2W7PA 2XG8A 4Z37A 5KOWA 2MKHA 3Q8PB 4ZVFA 2MGZA 4OZ0A 4OI1A 3KLFA 2D3OR 4ILMA 5LSLA 4TU7A 1QAYA 1HI0P 4EUVA 2E5IA 1U2RA 5DG7A 1TK8A 4ECTA 2PN6A 1AFJA 4FVCA 4OJHA 5MLCV 5CZVA 2HZCA 1QE1A 5C24A 3M8QB 4LF5F 5D4LA 2OD6A 2KU7A 2P6SA 3V6JA 3RW6A 3Q2TC 3DYAA 2WTFA 4IOBA 4QWCA 2GNKA 3EPIA 2JL9A 3MM5B 2LKZA 4X4NA 1Z4UA 3OXFA 2K1RB 2VG7B 3VQTA 3BQ1A 4MIAA 2P5VA 4IH7A 4Q0BB 3UD4P 3VZHA 1IJEB 1ZM4A 2YX1A 3J7YI 2YVSA 3RB0A 2UXDF 3CD5A 4CO4A 1ZAVA 4WXOA 2VA2A 2IHR1 3W2VB 5CQGA 3MR2A 2HHHF 1HARA 2A18A 4GKKF 4DL3A 1L3TA 3US5A 2GO8A 2XCPA 3JB9k 4FYDA 3O2IA 2J6SA 3HVRA 1AUDA 4P7TA 2OP5A 3W3SA 1XMQF 4A4JA 2XY7A 5GAGI 2E1CA 3EXCX 2ZHOA 1F0XA 3M6VA 4QPXA 2FLNA 4IRKA 1YRXA 1A9NB 1NZAA 3T6BA 5K8MA 4B9MA 4K59A 5E3QA 4A8XA 2IMWP 1QUVA 1VI7A 5CCLA 4ATNA 5DDOC 1U1LA 1C1BB 4F4WA 2LQBA 4CH7A 2WHOA 2V0NA 2NREA 5KFOA 2EK1A 3FFIB 4TU8A 4LVNP 3OL9A 1WELA 2HWHA 5CYMA 4B9NA 5E41A 1UJ6A 2E66A 2QMWA 5KG0A 1Q8BA 1C4AA 1VGYA 2PDAA 3D28A 3IAM9 5K14B 2XS5A 1QAXA 1VQLS 4X4RA 4WFYA 4K4TA 3M32B 2QIFA 3AQPA 1JLQA 2CKWA 1KLMA 4ITSA 2IM3A 2DD8S 4ECSA 1UJ4A 4H4KA 4KGMA 1OIAA 2AX0A 3I0RB 3KHLA 1UL3A 3BGRB 1JXEA 2B3TB 2J76E 4AXIA 3V4IA 2EBEA 4LF4F 4RW9A 3VR1A 3BJYA 3CTRA 3BGFA 2YH1A 4F3MA 1YSJA 2LCWA 2R7QA 2ASJA 4ED1A 2ZKUA 1WI8A 3PY8A 2JLGA 4CCHA 2JZ5A 3I4HX 4RW8A 4B3OA 1NHUA 4PWDB 3DU5A 3PFEA 2XI2A 3RRHA 2R2TA 3DOLA 1TFWA 1FRKA 3MECA 2V9WA 3L09A 4WFBQ 3M8PB 2ZH5A 2B6AA 4KIAA 5J1PA 4DR3F 1L3UA 1TL3A 1O8BA 4CI0B 3CCSS 1RA6A 1XN9A 3BGLA 5KAKA 4MIWA 2MQMA 4O3SA 1LWCB 5KFLA 3R1HA 2ACYA 4NCAA 3HLUA 3KJVA 4ZHRB 2X3GA 1TKXB 1JKHA 2ATLA 2UXCF 2KFYA 1TL4A 4NRUA 6FDRA 1H38A 1FF2A 2D3ZA 1HR0F 2XSFA 2DISA 2XMWA 1NK4A 2ZVSA 3UR0A 1CQNA 1EETA 1Q8LA 3MFHA 3MDFA 3TAQA 3N6NA 4N47A 1FKOB 3CJKA 5F8IA 4X4QA 3KG1A 2MJNA 5L9NA 5DM6Q 4NLDA 2CQGA 2ZDPA 3B4MA 4A8SA 3NCQA 3PW0A 2VBZA 1NJIT 3KLFB 1AFIA 4RBTA 1NK7A 3OR1A 1Q1KA 4ZPDA 2KXHA 1OWXA 1X4HA 1HBNA 4BC9A 3I55S 1S6UA 2OMLA 2DT9A 4K4XA 3MWBA 4P2SA 1O5JA 2E44A 3O8WA 2ZUGA 3HKWA 3NL0A 5C24B 1QAIA 2BBEA 1DRZA 4ZVEA 4ZCLA 4J9SA 5KFXA 2MQPA 3DYAB 2KO1A 2MZQA 3I87A 2HGNA 2MZ1A 2RS2A 1R6YA 2NPFA 1S9FA 1RTIB 2P9EA 4C11A 2W9CA 1MMLA 4TKTA 2DHGA 4ZP6A 4CH0S 1KFSA 3JSYA 3DN9A 1JLAA 1N5SA 1TZ0A 2DCLA 5DDQC 2ABYA 4QWEA 3HHLA 4QCLA 5M2PA 3FEXB 1TAQA 3H5UA 2CQ4A 4WKYA 3O44A 4KFBA 4C8OA 4U9RA 4KHMA 2ASLA 1WG4A 2DHXA 4R0JA 4OI2A 4RU9A 1T8EA 2W4CA 5KFWA 3G96A 2GIRA 2PD1A 5GADI 1QAJA 2FHOB 1SBRA 3QWUA 2AYMA 1OPIA 5F0WA 5G0RA 4LSLA 2FHMA 3TRGA 3H4DA 2F4VF 1Y00A 3D54A 1D3WA 1S6OA 2MJUA 1WHXA 4WJBA 1FXDA 2M70A 1R8CA 3PHEA 4LUBA 4R5PB 5HMXA 4C8NA 2R2RA 4AL6A 3RBEA 3X1LB 3OBIA 2FUG9 3CEDA 3R1LA 4TY8A 3I96A 3N6MA 5AE1A 3D5MA 2KM8C 4DSEA 4ES2A 1JNRB 2DIUA 1DURA 1FTRA 1SIZA 2GA7A 3P49B 3BSAA 3HMJG 2F8HA 3CCUS 2R8HA 2OKQA 1M5KC 1GX6A 1H6KX 1FA0A 3DLEB 2HLTA 1RT4A 1KC8T