1Y00A

Solution structure of the carbon storage regulator protein csra
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
61
structure length
61
Chain Sequence
MLILTRRVGETLMIGDEVTVTVLGVKGNQVRIGVNAPKEVSVHREEIYQRIQAEKSQQSSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carbon storage regulator
publication title Solution structure of the carbon storage regulator protein CsrA from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Rna binding protein
total genus 6
structure length 61
sequence length 61
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02599 CsrA Global regulator protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1680 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1y00A00
1Y00A 4K59A 1T3OA 4KJIA 4KRWA
chains in the Genus database with same CATH superfamily
2UXCJ 4I0WA 1FDDA 4LFBF 1VQLS 1HHSA 1HR0J 2XYHB 4EBCA 4LF1A 3ELHA 2J76E 2FGCA 1JKHB 2I5JA 3C8YA 1N32J 3KWMA 4CIOA 4USKA 5HBMA 4E8UA 1RDRA 5CZXA 5BYRA 1URRA 3IG1B 3RB6A 4OX6A 3KLFA 2YNFB 4LF9J 3MF5A 4DCOB 3DC2A 2FY1A 2C3UA 4DPUA 5KFRA 5G0RB 4FYYB 2RD5C 2XZWA 3AT1B 2VUGA 2WVEA 4H4KA 3SV4A 2CKWA 3A3PB 1J27A 1VLOA 4NA3A 3R1HA 3V5RA 4YMEA 3ZTQA 5IT0A 3G9CA 1WKKA 4NOHA 1YJTA 4ITSA 2PFDA 1YJRA 4FXWA 4ED4A 3H42A 3R3TA 1P1TA 1J5EJ 2LDYA 3KK1A 2XI3A 4NE9C 2M2BA 1X4CA 4OV1A 4Q8FA 3FRZA 3MM6B 3MEEB 1KP6A 1U48A 3JTNA 4N56A 3R2DJ 2E5LF 1LWXA 2LQ8A 1KLMA 2VIHA 2UUCF 4N41A 1PIEA 1I1GA 3UDVA 3BQ0A 2POKA 2WVBA 2ROEA 3PIPQ 5HAOA 4PQAA 3BO3A 3CTRA 2W2OP 2ILYA 1SV5A 3GV7B 2CQ4A 3L4BC 2Y9HA 4CYUB 4DG1B 1W7WA 1QE1B 2IPOB 3PJXA 1JKHA 4IG0B 4DQQA 1GQEA 2M7SA 4U7UD 4LT6A 2CUYA 4QW9A 3M8SA 1IJFB 1REGX 3W8GA 4TQSA 3KUHA 5K8PA 1XR6A 3N5FA 2ZH4A 2JSXA 1A7GE 1P9QC 3H59A 2VBWA 4WYLA 3ICLA 2CZVC 3C6UB 3NNCA 5G0RA 4ZVOB 2I6WA 2QLXA 2F9JA 5K8MA 1BWEA 3VAFA 3IRXB 2YNHB 2J9EA 3NCRA 3PW5A 1TVRB 3OLBA 3OXLA 4WIQA 1J5OA 1JK9B 3G8SA 4MFBB 4M95A 4FKXA 3PXGa 3PKMA 2BXJA 1AXQA 3DNCA 3C16B 1FRHA 5KT3A 3OQ2A 5RUBA 4DS4A 5JMNA 3RB4A 3MM6A 3MEEA 1WKLA 1TL1B 1HNWJ 5M2UA 3GIIA 2IDLA 3TA0A 3HJVA 2GMJA 2W01A 3HJFA 2N3OA 3G6YA 3G6VA 2W2MP 5AXMA 3TO8A 1VRQC 4USTA 1AT1B 3MCMA 1IKXA 1JLEB 3BKUA 2HZAA 2ZH6A 3M2VA 2ZBIA 5J1PA 4BDPA 2HQIA 1TMJA 4CYUA 4DG1A 3B8HA 2QGFB 3S6EA 1QE1A 5ETKA 4EU0A 3BQ1A 1TK8A 4HTJA 2B4VA 1CJTA 5F8LA 2QLJB 4OYOA 1ZTWA 1JXEA 3J80U 4V19J 3U27A 1LV5A 5DQIA 3CD0A 3UDCA 5J2PB 1QLNA 1FNMA 2CNKB 1M1HA 4JI7J 4O3PA 3NAHA 2Y1IA 2OHDA 3SEOA 4IFVB 4JV5F 2WVDA 7FD1A 4DX5A 1N5QA 3EZUA 3MM5B 4I6WA 3EVWA 3M8ZA 3D2WA 2RRBA 1TKDA 1YJWS 3IRXA 5F3TA 3Q8VA 1H2UX 2Z8QA 1FWLA 1VBKA 5IV4A 2QYGA 2V69A 1IJEB 5LJ5Y 3W2VA 1UEKA 3ENWA 1HWUA 2WOMB 2CADA 1UA0A 3PRBA 4MFBA 4P7TA 5KG4A 1K73T 5EHHA 1HMVA 4J9QA 4X66J 3BGRB 1RWXB 2UXDF 3TZZA 3J81Y 2HKEA 5HQ8A 5EWFA 2IMOA 4OJ1A 3OVSA 2CYYA 3C16A 2RILA 4UTGA 1CLFA 4DR5F 2ZHOA 2XZDB 2HFUA 3NBPB 2BE9B 3MMJA 1TL1A 3G2XA 4OI6A 1S0NA 4NCAA 1MN9A 1GEHA 1OJ4A 1IBLF 1KNZA 4YEAA 1X4HA 3TANA 4FS2A 1ICEB 2YWHA 1L3VA 4P74A 3ZTOA 4MIAA 2H54B 1Q7LB 4BC9A 3SSRA 3KHHA 3X1LB 4Q0BA 2PT0A 1JLEA 3PM9A 4ZPAA 4ECUA 2PIIA 4PG4A 4MK9A 1N8RT 3MPWA 2WSEC 3R7NB 3HD2A 4U96A 4K0KJ 3CMQA 2DY1A 1WTBA 4MTPA 4PUOB 4HEA9 2B9XA 4JBCA 1JJ2R 4B02A 4X4QA 4MKVA 4QR0A 1S79A 1Z4UA 5J2PA 1QUPA 1VRTA 2DIUA 3BGUA 1WOSA 2QJ3A 5HMXA 4XPEA 4WTOB 2KVIA 3NMRA 3ZZPA 2BQ3A 4OHZA 2UXBF 3UWTA 3QO9B 4IFVA 2HRTA 4FS1A 4ENOA 3R97A 5DDPC 3MM5A 1N6QB 2WK4A 2BW2A 3GIJA 4EUVA 1RAHB 3OR2B 1K44A 1H0HB 4AQYF 1PO6A 2Z58B 1SC1B 2ZWOA 1UZHA 5ETQA 1FE0A 1N5VA 2WOMA 4OYMA 2EKNA 1X4GA 4K4TA 2YPYA 3BGRA 4IOAQ 4H4KC 4UF4A 1RT1B 1X9WA 5CD4H 2AJ0A 4OI3A 3H7HB 4FF1A 1JLAB 2F63A 2F8HA 2WB1D 2F3JA 3NBPA 2LQBA 2VHGA 4E2FB 1ZM3A 4HHJA 3UN5A 1FRMA 5F8NA 5IT9Y 2OFGX 2F8MA 4A8WA 3OJUA 4IH6A 5AJ3F 3ZO7A 3AXKA 2V2KA 3NGUA 3MI7X 2H65B 2XM3A 3EWGA 3ENVA 4JV0A 2R2RA 3BDEA 1N88A 2WBRA 3R27A 4IR1A 4ES1A 3A4TA 3LP2A 2DB1A 3TA1A 1UEUA 2GAHC 3K17A 1ZPWX 3NRBA 4XIUA 2ZHBA 1QAIA 3MM7A 1NHVA 3S8SA 3NKYA 3M8WA 2HBQB 2JEFA 4C8YA 3HULA 1D3WA 2ZE2B 3EUNA 2MQQA 2FVRA 1DQ9A 3E01B 1L3SA 4K4WA 2BKNA 2HLUA 3MFHA 1T0TV 4DV0J 2RS8A 4L3NA 4IOCQ 4PUOA 4UT4A 1NM2A 1RACB 3QIPB 4MIBA 5KG0A 1JLFB 1HARA 1I51B 3QO9A 4RWWA 2F4VJ 3WHIA 1FE4A 3CXCR 3UPFA 2G13A 2DRBA 4ZVGA 1LKZA 3D6FB 3DRXA 1N6QA 4YQWA 3CSKA 4N47A 2IRUA 3OR2A 5E2QA 4ICLB 4KHPF 2HAIA 2FLNA 4OYBA 2LLZA 2E5HA 2NXNA 3P6YC 2M5YA 4DV7F 1KFSA 4QIFA 2OEMA 1DFDA 4ATNA 1OY8A 2EG1A 2BJ1A 4RW8B 2MZSA 1YWXA 1NSQA 2AJFE 4CH0S 1RT1A 3PX4A 1D8YA 1QSYA 2HS0A 4CRJA 3DLHA 2BA9A 1JLAA 3T1HF 4F4KA 3V6DB 2OPSB 3MAHA 2GHWA 2R7RA 5LSLA 4PG6A 1NK7A 2M8DB 3IO1A 2QX0A 3MECB 4KV8A 3M8PB 1XMQF 2GQQA 2HHPA 2A3JA 5FLXY 1G6BA 1LK5A 2IBOA 1S77D 2XS7A 3L3CA 3H2LA 3FCWA 4DV4J 1V3RA 2HIQA 1MWYA 2KRBA 1DQ8A 3PACA 1BMQB 5K20B 3LGHA 2H5IB 5E3PA 2DGTA 2ZE2A 2W4CA 3E01A 2FB0A 2W9CA 3OSPA 3CB4A 3FEXB 3D6HB 4HL9A 4ZITA 3QWUA 2CJBA 4X4SA 2GJIA 1XR5A 1ZZFA 1S1WB 3LGMA 4RW6A 1UFWA 5D4OA 3WX8A 1RYRA 1JLFA 4DX8H 2VDHA 2HBRB 4EYHB 4JI0F 3IBCB 1ZETA 5K14B 3AQPA 3BYPA 4B3SF 1FO1A 2M0GB 2XMMA 5C25B 4F0HA 1YJ9S 2YBVA 2AHOB 2D9OA 4AL5A 4ICLA 3DN9A 1LWEA 2YPZA 1WTFA 3JYTB 4LBIA 3MUTP 4LF8F 4B9LA 3MCOA 2VL1A 1WHWA 2MJNA 2BJEA 4I4BA 2OIHA 4QU6A 5B09A 1VQYA 2ZZNA 1M1GA 4ZP7A 2KH9A 2OPSA 3KUEA 1RCOB 5DM6Q 5LXYA 5KFZA 4M5KA 3MECA 3M8PA 3OXFA 4WWSA 2D69A 2IIHA 2EFPA 4M5JA 3MTKA 4MT1A 2O01C 2VBYA 2CQ3A 3ULHA 4UY85 3ZFVA 2LVWA 4DFJA 2VJUA 4A8YA 3KFWX 2KFZA 2MTLA 2Q79A 4DR7J 4YB6A 3OT9A 2J7WA 3HVWA 3AOBA 2CPEA 4FN5A 5DO2A 2D74B 1S7IA 1JJ4A 2DR8A 3R2CJ 2DXFA 4OYZA 1RAAB 4UZCA 3OXGA 3HT0A 3BDPA 1IBMJ 3I5AA 5F8IA 3UFCX 2P9GA 4USIA 4NYZA 5H1SV 4O0NA 2Y8YA 2UV8G 4YB7A 2DCLA 2BRKA 1XNQF 3W5ZA 3QMQA 2K2PA 2QLFB 2KG0A 3RR7A 1H7WA 1NLKL 2AYBA 4DQSA 4GO7X 3KHRA 5HI7A 1H98A 2GIRA 2MZ1A 1S1WA 3VVTA 2W7AA 1PAEX 3ILOA 4ERDA 1ZZNA 4C11B 3HVTB 3IMQJ 1T7PA 5K14A 3FCHA 5C25A 1WHVA 4ER8A 3NG8A 2GC8A 2E7WA 1QAYA 4ED1A 1RWWB 3JYTA 3FZ2A 2HVEA 3KK3B 4Q7AA 3TWZA 4OI1A 1F9FA 3CGIA 2KL8A 4DHVA 3OV7A 4JB8B 2V2ZA 4A8XA 1XC9A 3FBFA 3A3OB 3P8BB 3MAAB 4M5HA 1HWLA 4QQBA 1TZ0A 1EAYC 5CA5A 2CQHA 2UU9F 4ANDA 2YX7A 2ZNYA 2MQPA 3CD7A 4LF4F 5KFIA 3C15A 3M6WA 1FK9A 3O2IA 2JLGA 2UVWA 2PE8A 3F73A 2R7VA 1IUJA 1XTZA 4GVBB 2DO4A 2A2DA 3RG6A 3GFXA 3WC2A 3IGNA 1IM4A 2X1FA 4OHVA 3VAKA 2CJQA 4J9SA 1U2CA 3BH7B 4ZVRB 5LOQA 3IRWP 3ZTRA 3EM1A 3EVOA 2WRMA 2DCUB 3RB0A 5EX3A 3PW2A 3BH6B 5FDLB 1FJEB 4XO0A 1TAQA 3H90A 2CPHA 1Z2LA 3FMBA 1G7CB 2W8LA 4ZCLA 2Y0BB 2BOAA 1Y10A 1XNRJ 3CJKB 2XLJA 4NWBA 1DY3A 3G8QA 2AGQA 4O3RA 2OMLA 1S6PB 3F44A 1CVJA 1KEKA 3D4JA 4OV6A 2KM8B 4DR2F 1HWIA 3FCVA 2CVEA 1VQ7S 4E98A 3J7AN 3B6BA 4ZCKA 3BBFA 4U7UK 1HKAA 4C11A 3BSNA 3HVTA 1Y9OA 5IM0B 4YUDA 4DLEA 1GXUA 1FXLA 3VV2B 3I5CA 4DL6A 3U02A 4X64J 1MG7A 5IQQA 1URNA 1VLYA 3JQMA 2M88A 3CIMA 2Z4PA 3KK3A 4ILRA 1K47A 3AJDA 1ZAWA 1NEEA 3EPIA 4C8MA 5KTQA 1Q95G 2HHUA 4TVAB 2ZKUA 1FNXH 3BB5A 3DCAA 1N0VC 3MAAA 2KJWA 3OTEA 3H4BA 4OQJA 4MYUA 2U1AA 4KPCA 1CEZA 1F1BB 3HCXA 1GX6A 3UN3A 2IJFA 1HNIB 2M9KA 2JHEA 1S9EB 4GVBA 3GR1A 4PEOA 3GCWP 4H4MB 4ID5B 3V4MA 1VIOA 3HFKA 2H9ZA 2J8AA 1GXTA 1AZSB 1X7VA 2CPDA 4TYBA 1DAXA 2IM1A 1FRKA 3IR5B 5FDLA 5AE3A 2MKCA 4J9RA 2VPZB 2O66A 4DFPA 2HWTA 4B3TJ 2IFXA 4DV1J 3CJKA 3W7BA 1DLOB 4JI8F 3CE8A 5LMUF 3HMJG 1R8CA 5CYJA 1KHWA 2ZUAA 2DNGA 2UUBJ 3CCLS 1UWBB 3BR9A 3EXCX 3Q8SB 4ZPTR 1ZS6A 2YQ3A 3KHGA 3LTOA 3TYTA 3CC2S 2GCFA 4OHXA 2VG5B 5IM0A 1Y3JA 2Z30B 2BE7D 2ZEJA 2DPJA 1QD1A 4ED6A 2HBZB 3TJAA 2O3DA 2LA6A 1NK6A 4YS2A 4FNIA 4W92B 2XNRA 4OX8A 2RU9A 2XMKA 1NDCA 4C3LA 1W2BR 2A6OA 5KT7A 5ETSA 1NB2A 2ZDOA 1HNXF 4QWEA 1YRXA 5K8OA 4P10A 1Y3KA 1U7LA 2ZBQA 5ETVA 1E6VB 4CCHA 2K06A 1YZ6A 2KFNA 4NXMF 1IKVA 2MY8A 2QTWA 3IXQA 5H9EK 4LF6F 4KGXB 3SIPB 4A46A 1TUVA 2VZ9A 1B0VA 1JLCB 4RNMA 5D4PA 1UVMA 1ELOA 1HBUA 3M8RA 5H9EJ 2KN4A 4D3GA 4DX6A 4H4MA 2ERRA 3GYNA 4ID5A 1WDTA 4FYXB 2IYIA 2G2YA 4ZVTB 2J0WA 5D77A 3TEGA 2P9CA 4ZN3A 1N5SA 5CCMA 2B3TB 1U1OA 3MM8B 2XB2D 4ZIVA 4WZQA 1Z2ZA 2ZBCA 1REVB 1UJ6A 3GG1A 2PI4A 1BWVA 4RNOA 4P73A 1R0AA 1IBKJ 1DLOA 1U6FA 4FYDA 2XY5A 4I2PB 4FP9A 4OX7A 1RWKB 3A8EA 4DL0C 4LR8A 2RIJA 3Q83A 2L08A 4TYAA 1UWBA 3C46A 2QEXS 1XERA 2OI2A 4FVCA 2CJXB 3QLHB 3FUYA 3P4UB 2K8GA 3C3LA 2OSQA 2DNNA 2JEGA 3SBMA 3C14B 1RT2B 4KH1B 2VG5A 1NH8A 1VHIA 4OZLA 4Y0FA 3CJ2A 4EYIB 3CDBA 3DMJA 4NLPA 3KNGA 4ZS6A 2CFXA 4Q44A 4HHHA 4K2JA 1VK3A 2GS8A 3MM9B 1R8HA 2E44A 2KYZA 5CYMB 4ZJLA 3MTJA 4LRAA 1H7XA 4F02A 2F40A 1KTQA 1FKPB 1U8WA 3TUIC 2CNNB 1FKAF 4KH0B 1TUWA 4PKDB 2W4DA 3G8TA 2COLA 3HHLD 4AD6A 2QSWA 1NDLA 1RABB 3MEDB 2EFVA 2MKYA 1UFKA 1NZ8A 4GKKJ 4C0HA 1XBWA 4NPOA 1DHMA 4DR3J 1JLCA 4G1PA 8AT1B 5EN1A 3NGSA 3A1YG 1S4FA 3HHLA 1WOPA 3G87A 3KLGB 2OP5A 4N76A 3PR5B 2MLYA 1YJUA 3R7SB 5JVHQ 1ZM2A 2B7CB 2ACMA 3GFYA 3VHQA 2R8HA 3KJFB 3CF5Q 2D3ZA 4OIXA 2LXUA 3N6NA 1CSJA 2SXLA 2J8SA 2FJVA 3JSYA 4AL7A 3M30A 2W2QP 2WTFA 3AFGA 1O8BA 4I1TA 3OTBA 4ZHRB 1REVA 3QJLA 4HH0A 2ZH7A 3HKWA 3P45B 1KOHA 1C4AA 1JWWA 4OYPA 4CLYA 3LANA 3KDOA 1B4SA 5GADI 4OJ3A 5AE1A 1Q4RA 3OHAA 4LF2A 4I2PA 1RTJB 2A1BA 2C2NA 4RX6A 1FERA 2EWHA 3QIDA 5KFWA 3DOLB 4OLPA 1T8EA 2YXLA 3PO4A 1NPPA 3QLHA 2RHSB 5B0GA 3DM2A 2XYPB 3O1LA 2HHHJ 5KG1A 1BE4A 2Z2YB 5DRKA 3C66A 4CO3A 3OFFA 1UVJA 2ZH5A 1RT2A 2HVDA 5I3PA 3HHNB 3PHTA 1NB7A 1FFWB 1PYSB 1S48A 1N36J 3BREA 1RHJB 3MM9A 3J81U 3GV8B 3JSBA 5CYMA 4F8RA 3PW0A 1NHUA 4CNZA 3VAMA 4QW8A 2HQDA 1SKWA 4A8OA 1SL2A 1FKPA 4BC7A 2DGOA 2JX2A 2K7JA 3UQSA 3G4SS 3V6HA 2Y0SD 4USUA 3L7OA 2DEIA 5DZ6A 5KFEA 1GMUA 5D6GA 3R5AA 1MMDA 2P8IA 5A6PA 1YBAA 3MEDA 4QWCA 2DXDA 4K4ZA 2Q6BA 3H25A 2DNKA 2DYAA 2FLLA 2AEJA 2PSZA 3V81A 3Q2TC 2DHAA 3EXYA 1SH2A 2EW9A 4HT7A 1RTDB 3KLGA 5GAEI 1H73A 2OPPB 3TUJC 2A18A 1VBZA 3TAQA 5D8HB 3FEZA 4DUTA 2I1RA 2NXUA 5HL7Q 1BD6A 2DGSA 5HATA 2BX6A 3TRGA 1S6OA 4B08A 5EUHA 4ED5A 2XY7A 3GCXP 3N5BA 3PR4A 5IS2A 3KMQA 5A2QU 2W8KA 3E8OA 3RGIA 1U1QA 4ZPBA 2XWYA 1QY7A 4USWA 3MEGB 4LFAJ 1MNEA 5F3ZA 4KYZA 3GYXB 1RTJA 3SCJE 2ADBA 3C19A 3CC7S 2J9DE 1VDHA 2AJ4A 1Q8BA 3CC4S 1NCLA 4ZCMA 3B54A 4UUXA 4F3MA 3UN2A 2YX1A 4IG3B 3ZTSA 5LM7E 1PBAA 2CPIA 3NP5A 2GZOA 4N77A 2KM8C 1TELA 2OTJS 1GMVA 1D09B 1RU2A 1R3NA 3SMZA 3OLAA 1K9MT 3T5KA 3O8WA 4FYWB 4QWBA 2DHHA 2B5JB 3ETMA 4NZ0A 2DNLA 4DPYA 3OL6A 1BLUA 2GHVC 4JYAJ 1F9HA 1JXLA 4FZVA 3CDAA 1CC7A 3FMWA 5ETPA 1SH0A 3M4XA 1TTHB 3V4IB 5IT9U 1EQ0A 3LPYA 2IBKA 1VBYA 4IFYB 2OH2A 2VONA 5D3GB 1O0PA 2GQCA 4TLQA 3CDEA 3I4HX 2DNPA 4I6YA 1RSCA 1LWCB 2NS1B 1RTDA 2ALYB 2YWGA 4Y34A 4V1Ak 5BXIA 4C8NA 2OPPA 4F3OA 2VODA 2XZTB 4NEZA 4Q8EA 1PJ5A 5SUHA 1CG2A 4MYTA 2YKQA 2QMXA 3VALA 3QAUA 3FSXA 4CLFA 3A3NB 3BS9A 3HSJA 4K4YA 1CJKB 2QL5B 4RBVA 4JI5F 2CQGA 2XMUA 1SJQA 1SJFA 3H40A 4ECRA 3CNQP 4F36A 3BO2A 5B08A 4UQTA 4LRDA 5L38A 4J9KA 4F25A 1BQMB 4NRUA 1MMLA 4UZBA 4IQMA 2LXFA 2PC6A 3MEGA 3T5LA 2JNJA 3BKTA 2ZVIA 4LFCF 2XEXA 2HFSA 3VGUA 2RVJA 4Z2XA 4UOHA 2A10A 2EEYA 1AROP 3PDNA 4NLYA 1S0VA 1WI6A 2DNHA 5D0EA 1OIAA 4NI2B 1FRXA 4F0MA 4IG3A 5GAHU 3DU5A 4OX9J 2UXCF 1OPIA 4Y65A 1HR0F 2Z56B 4JI6J 2P6SA 4P9SA 4LQ9A 1RAJA 2VFTA 4P2FA 2B5JA 1NSAA 3VQTA 1QDUB 2HS3A 3OL7A 1VHFA 4K2XA 1A0OB 1CS4B 1SPBP 3I0SB 4NLRA 3R7BB 4HT5A 2CZ4A 1ULRA 1HIYA 2QLBB 1WG1A 4ID8A 3TW0A 3AH6A 3DGVA 3BGOP 2J5AA 4CO2A 4CNYA 2ZC3A 3G71S 5D3GA 4JV5J 2DITA 2MY7A 2WONB 2RU3A 4R0JA 1LWCA 2QIFA 3OSNA 1SQGA 1Q86T 4FF3A 3FBBA 4YDDB 2MZTA 3I55S 2IMWP 4IH5A 1F9EB 1CPZA 6FD1A 4ECVA 5HVHA 1O51A 5HMYA 4HH1A 4LQ3A 4K50A 1LNQA 1P27B 2FYXA 2PGCA 4EEYA 2V0NA 1T11A 1BQMA 1KONA 1U1LA 3GWCA 1PG5B 1EQMA 3R5BA 4B3RF 4AYBD 4B3OB 2YKAA 3NEKA 3FNNA 3OTOF 4R5PB 3CVKA 2NZCA 4EBEA 2KXNB 5B0CA 4FDFA 3T1AA 3W66A 2M52A 2DIVA 3QGIA 4HYKA 3ETOA 5KFSA 1MWZA 4ECWA 3CD6S 2F9DA 3Q24A 2EK1A 5U47A 4R0EA 2H4YB 2DH7A 1PGZA 2O67A 4LUBA 4LF7J 4EK2A 4F26A 4OI2A 4K7QA 1C0UB 1FVSA 1WC1A 3NGKA 3GE9A 3P96A 3NWGA 4KGZB 1NRKA 1CS4A 4JI1J 2ZITA 2VA3A 1LOUA 1B0TA 3FRYA 4WFBQ 3ZZZA 5A8WB 1YDLA 1CJUB 2OMOA 2ZDPA 3QQCD 3H8YA 1EKRA 3K89A 3CMES 3NWRA 4ZK7M 4V19X 2HZVA 4YY3J 3A8IA 1PJ7A 3QWPA 1R43A 1RAIB 3LOUA 1RQ0A 1SI9A 4RU2A 3T5HA 4KGKA 4F4ZA 3HX9A 5IXUA 2RQKA 2CQ2A 3I5BA 5GVQA 2B9WA 3K59A 4J9UE 4LR9A 3SI8A 4USJC 2DR5A 5KT4A 3NL0A 1T9TA 1ZM9A 2WVFA 3CW2C 1UVIA 4EO8A 4AUKA 5IC4B 1NPRA 3IFEA 1NK9A 2JVRA 2BYCA 3P5BP 2PD1A 3TOQA 4HHUA 3EGNA 3BBBA 4WZMA 4WFYA 4ZVHA 2YQ0A 4U8VA 1AUDA 4CLTA 5DQGA 3H4DA 2B6AB 2E5GA 2BV3A 4RU9A 2NREA 3QNWB 3FDSA 4J9PA 3GZ7A 1SJRA 2GGPA 1YGYA 1SL0A 2DGVA 4P7VA 2ZH9A 2MSTA 2DPIA 1WKJA 1NUEA 4OZ2A 2MDAA 1XQIA 3NCQA 1YSJA 2MSSA 3QJPA 4DN9A 1B64A 3BN4A 4B3OA 4M1KA 4LBPA 5L46A 4R5PA 2BEFA 2E66A 4M5GA 2ZBPA 1BGXT 2KFYA 1HYSB 5KFCA 1RP5A 1FHTA 4RKUC 4BS2A 1N52B 3DLEB 1CJVB 4RWXA 3R5CA 3UR3C 1NAQA 3CDWA 1FF2A 4NCGB 1KFDA 3HD1A 2KZZA 3AJ2A 4BHQA 3ZZ0A 4TU9A 3KLIB 2YWFA 2D3OR 1C0UA 3RAQA 5KAKA 1FRIA 3QGPA 5AXNA 3V2UC 4A48A 4Q45A 3K57A 3L09A 3MR2A 4JI7F 4Y2IA 1TV6B 5A8WA 1EB0A 4HI2A 1NJXA 2HSEB 1R89A 3NNHA 2OSRA 2YKPA 1JLGB 1T02A 1W2IA 2V68A 2AD9A 2GJ2A 3MMBA 5HVGA 1N5TA 2R8GA 1X5PA 1FJ7A 4N7TA 2IM0A 2VQEJ 3MXHP 2R7XA 2W4PA 3PG9A 4X66F 3RTVA 1H2VZ 3R8YA 3HKZD 2MGZB 3NOCA 2XC9A 1TQLA 1ZAVA 1R27B 1KHVA 1X60A 4C6AA 3T1YJ 5DDOC 2J0XA 1FESA 2B6AA 1S1TB 1MU2B 3RW6A 5F8JA 2GMLA 3LP1B 3TNVA 4P72A 1V5IB 3J7ZT 1RT6B 2HFNA 1IR2A 3MUVP 2CQIA 3CPWR 4ELTA 3VR1A 2DHXA 2R2TA 1NDKA 3PJWA 5KFPA 3KK2B 4PABA 1HYSA 1VQOS 2UUWA 3DLEA 2EFNA 1CJVA 1F3FA 1BXNA 4OL8A 4DSKA 4DR4J 2B43A 1BY9A 4NCGA 1DTQB 2HGNA 1DARA 5HBMB 4OLOA 3N6LA 1CULA 3KLIA 4J90A 1RYSA 3GTYX 2IRXA 3MD3A 4P75A 2EFQA 3PTWA 3BV8A 4WJBA 2L3MA 3SQGB 4IRDA 3KLFB 1WSRA 3RR8A 2R7OA 1C1CB 3BF4A 1Y7PA 2MZJA 1FFGB 1M90T 4WPAA 2CJKA 5HVFA 3BEGB 3AOAA 1UP1A 3EGZA 3HFVA 1QVGR 5ETTA 4DPTA 2HWHA 3T6JA 2V2QA 3WIUA 1UZDA 1FXDA 1O5JA 3UCZP 2QYCA 4DUYF 1HQEB 3G96A 3LH2S 5KFVA 2Y1RI 2M4MA 3RBDA 2R7TA 4JI3J 4IDKA 4RW9B 3TAPA 3W9IA 4H54A 2LXIA 4UUWA 1L5UA 3PO5A 3IN5A 4LVOP 3MOZA 3CCMS 2MGZA 3FSYA 3I9ZA 1TFWA 1TR0A 3QRPA 3FEYB 4LVNP 4UY8T 2YQ1A 1FD8A 1RWPB 2AP6A 2LEBA 2CPYA 3AY0A 4Y2MA 1S1TA 2PFFB 1MU2A 1RJJA 3LP1A 2DK2A 3K58A 2DBBA 1S1VB 2E9RX 1RBAA 2BDPA 2Z57B 2L9DA 4F3QA 3FBEA 1W25A 2QL7B 2XULA 1SKUB 3EVMA 1RGVA 2VPXB 4JUZA 3PNIA 3CUNA 1WG4A 1LXNA 4DZ6A 2G4BA 3LAKA 4EZ6A 2XMVA 1P1LA 3J7A1 3GJSB 4Y28C 2IM2A 5JVGQ 5IZHA 1K0TA 3TQEA 3W5XA 4NASA 3I56S 1DTQA 1UL3A 2BMBA 2MKIA 3SCLE 2QG9B 1WWHA 2OPQA 3T19A 4DV0F 2LCWA 4Z7CA 2IYGA 1KWMA 1ZTTA 3SQGA 3FQLA 2KU7A 4K4UA 2P6TA 2DVIA 3ITHA 1C1CA 4YHHJ 2VKRA 3W2WB 2AV5A 3MPYA 1T9VA 2F4VF 4M63A 3QT5A 2RT3A 3Q8UA 1Q53A 3QT6A 2WW8A 4PZVA 5B0DA 1MSWD 5SZTA 4Q2MA 2XSFA 4I7FA 2JJ4D 2QFJA 4CZCA 4DQRA 2Z0GA 4ES2A 4DV6J 4ZCIA 4OMFG 2C2KB 4LIWA 1HQEA 1VQKS 3DOMA 4YOEA 3H0PA 4RW9A 3V6KA 1FTRA 2QA1A 4NLOA 1J5OB 3W8PA 2MKSA 4C8ZA 1WF1A 1YX2A 2EBEA 3L7PA 1TKZA 1APSA 1F60B 3TZXA 3BO4A 1T3NA 2LMIA 1PC5A 1X4AA 1FRLA 3FBCA 2DNOA 3LW5C 3ZC4A 2HVHA 2VV5A 3SZ2A 4MAKA 2CQDA 2H1YA 1ZYQA 4LF4J 1S1VA 1KS2A 3I32A 1QM9A 1S9GB 3TAMB 3G6XA 4WE1B 3RYLA 1IKXB 1F2GA 4HR2A 2KT3A 3M2VB 3Q22A 2QC3A 1DZ5A 4X4NA 2ZM6F 2NYIA 2KO1A 1X0PA 4F50A 3I82A 1YKWA 3PYEA 2KT2A 1CJTB 2ZFHA 2XHWA 2E9ZA 4ECZA 2C42A 3SCIE 1B7FA 2PA3A 2N4DA 2EI5A 3HFZB 1RI7A 2HG4A 3BPSP 2E1MC 1VMBA 1T95A 4WK3A 1JQGA 1S99A 2HVIA 3W2WA 1BQNB 2HW3A 5D4LA 4LSNA 2UVVA 2JDJA 1UCNA 3CJTA 1TL7B 2ZBRA 3VAHA 4CO4A 2V9WA 1XWLA 2HIYA 3W2VB 2H5EA 3BM7A 5K5MA 3DDKA 1HW9A 1KR4A 3OL9A 4F4WA 3E2EA 1HMVB 5ETRA 4Q43A 5L1JA 4A8MP 2I2YA 5HN0A 2ATLA 1RKJA 4CWBA 1YITS 5HJXA 1N4LA 3TQ1A 4KE5A 5D0HA 2BJDA 4WFNQ 8RUCA 1GMWD 8ATCB 4PPZA 1S10A 5KFQA 1B99A 3PX0A 1SQFA 3SDEB 1HD1A 2E1PA 4CTAB 1FWPA 1RZMA 3IS9B 2VPWB 6FDRA 2QT7A 2AEMA 4KO0A 3M8QB 1GMWA 1R31A 4CLLA 2RRNA 4DV2J 4BWJA 2FTRA 4NX9A 4DMZA 1S9GA 3TAMA 1U4BA 3K0JA 4WE1A 3W65A 2D3UA 1M0SA 5AT1B 4Q0BB 1UJ4A 2CQ1A 4RNHA 1FEEA 3JXOA 1S97A 2PO4A 1Z1ZA 3KDNA 2YY3A 2HK2A 2UUAJ 4IUFA 1S0OA 3U7JA 1VQPS 1IBMF 4ECQA 4N5SA 2FDNA 2ZOFA 2AJ1A 3T6BA 4U6PA 4PXDA 2NZ4A 4KRWA 1VQ9S 3TP2A 1VRTB 1C0TA 3AA9A 1HHQA 2B8PA 1BQNA 1X5TA 1WUUA 4J91A 5HROB 2VJVA 1TL7A 5ADZA 4IQXA 1S57A 1IQTA 3KXDA 4P2MA 2OUGA 7AT1B 4U9RA 1F6TA 4Y3CA 2FHJD 4OI4A 4ETXA 2ATCB 4O4GA 1UKUA 1Q82T 1HBMB 2FLPA 1AW0A 2LQ5A 3RW7A 1GAOA 4YB1P 4KPYA 1TP7A 5HJYA 3TEHB 4FPIA 2F8EX 2RE1A 4F2SA 3UDEA 2FHJA 4DCPB 3Q8YA 2MHNA 4CLSA 4ZP6A 4NXNF 4DPWA 5T14A 1HNXJ 4RBTA 4A8QA 1X5OA 5F9LA 3SDEA 5E5NA 4M5MA 1TK5A 2CA9A 5EWEA 4CTAA 3IS9A 2CQCA 3QSIA 2DJWA 2BJ8A 2L9NA 1N54B 4N8OA 1V3SA 2AX0A 1VQSA 3ILIA 3M8QA 3M6UA 4ECTA 2IA6A 3MEKA 3HSDA 4TU8A 1RU1A 2V67A 1T9YA 2HGLA 3TZWA 3BN7A 2F4FA 3ZZTA 4ZLPA 1WDDA 4W4MA 1S5ZA 1U8SA 4XK8C 3LP2B 2VQFJ 1IKYA 2C2ZB 5J2QB 2EXUA 2NSBA 4KQZA 3PVXA 2ILZA 1VK8A 3MM7B 1PC4A 1RT7B 2HURA 4ZPDA 1FT8A 5KFLA 3VGTA 5DDRC 3NNAA 1XNRF 4DR1F 4NZ7A 4DL7A 3PV8A 4RPFA 5DQHA 2E7XA 3PY8A 4YFUA 3OVBA 1I6JA 1X31C 2B9EA 3MURP 3EICA 3CCZA 1FX4A 1XIQA 4K59A 3AA8A 2BKOA 2QZ8A 4F67A 4DV3J 1PYOB 2CAJA 1N0UA 3D5MA 3RB3A 1RT3A 4TXSA 4U8YA 2ZHAA 5HROA 2E7VA 2FVPA 1WC0A 2VA2A 5KT2A 3DLLQ 4HVZA 4ZMMA 4TLRA 1YJ7A 2W7OA 1RA6A 1SL1A 2M70A 3EGVA 3F56A 3ISZA 4A8SA 3DRRA 1HBMA 3UNYA 3THPA 1M5KC 4HKQA 3DRPA 3HPOA 1AFIA 1TUGB 2Y1JA 3R5DA 5DJBA 3GFZA 2QN6B 3GILA 3IR7B 2KJVA 1R8AA 2XWXA 3H5YA 3T41A 2IJRA 1UWAA 4R8UA 5A8RB 3US5A 3KLHA 2C2OB 1NO8A 3IBWA 2GAGC 4KV8B 3G82B 1G1XA 2HAFA 2RAQA 1WF2A 2FVCA 1IR0A 1Q5VA 1VGYA 3D3BJ 1PBUA 4QYZK 2DTJA 4NA1A 4CP5A 2DH8A 1KD1T 1N33J 2CZ9A 1C1BB 5E3AA 4GRSA 1HNZJ 2CQBA 2EBGA 5J2QA 4QYZJ 2HNYB 2IC3B 2XMWA 5JXSA 4QCLA 1RT7A 5KFYA 3J7YI 3EX7B 2FJBB 4DV1F 2W9CB 4O23A 2CWXA 1VOMA 1FWKA 2J0QD 2X1BA 5BR8J 2H5JB 2ZOMA 3J81j 5LL6d 2HEKA 1D9FA 2V4JB 4RW6B 2KB2A 1Y00A 5D15A 2XMTA 3BJYA 1SVDA 2DR7A 3MDFA 1FFSB 2BUNA 1OO0B 2AGOA 2UV8A 1M1KT 1KC8T 4OHWA 3VZIA 2APOA 2H4WB 4E0DA 3D0GE 1LWEB 2GFFA 4NMLA 5F0UA 2F65A 4RL1A 3HP6A 4YB5A 2JC1A 3R5GA 1WEYA 2V34A 4AXJA 4CO5A 5L1LA 3ZNJ1 5J1EA 4NLUA 3QZ7A 5C2CA 3CCRS 1PKUA 4P2XA 1GK8A 4X4TA 2X7IA 5A8RA 3H2UB 2CG8A 4CLUA 1U02A 3OL8A 4I2QB 3G82A 3ZZUA 1OYDA 1FRJA 2W9BB 3AODA 4U95A 2ZH3A 1IVZA 3KNAA 1RT5B 4QPTA 1SBRA 4LF5J 3DLBA 4K8RA 4WU3A 1C1BA 1DTTB 5IFMA 3J7Z5 2E29A 1JJCB 4UOGA 2HNYA 4CI0B 5E3CA 2IC3A 4CM2A 4X62J 5LSRA 3JQKA 4OZ1A 1W26A 1IBKF 1ZPVA 3PX6A 2A0FB 4QR1A 5KG2A 1N5YB 1RBLA 1IQZA 2ASJA 4FKYA 1K1QA 2V4JA 2XNQA 3HZGA 5KFKA 2RKIB 3QRQA 1IR1A 4CLKA 3OTCA 2I0XA 4O0IA 2VBZA 1S1UA 4I64A 3TZYA 3K7RA 2GX8A 1QVFR 3CCJS 2DO0A 3D6MB 2XY6A 5ETMA 3U1MA 2DR6A 4F0KA 3NOGA 2N7YA 3VAGA 3M05A 2N82B 2RNEA 4UOFA 3TVKA 2DHGA 1LQ9A 1XMBA 2DNQA 1NBEB 5E7OB 1Y0HA 2B0GA 4XTTA 1M5HA 1TL3B 4KR0B 5I4MA 4WKYA 2FJAB 3HSGA 2MXYA 2W9AA 5KFUA 3GR0A 1TU0B 2JLEA 3PW4A 4RUAA 4WBFA 2HHQA 4GKKF 2AU0A 3HZEA 4X4UA 5KFFA 3C15B 3D28A 2JFDA 4AXIA 1FK9B 4I2QA 3PEJA 4L74A 4JI2J 1RAGB 1SJ3P 2W9BA 1OQ6A 2LYVA 1WC5A 3S01A 2D7SA 1KQKA 1MROB 1SC3B 4YDXA 1RT5A 1NZAA 4ZVPB 3M2RB 4WP8A 4F4XA 3B82A 1DTTA 2FC9A 4DOZA 2QA4S 3QT8A 3GIKA 4EZ9A 2FJXA 1SKRA 2XG8A 2B4UA 4WCEQ 3QYYA 4RLEA 1I94J 1WC3A 1O6XA 3MR5A 3GSDA 4DWIA 2GO9A 1U09A 3I31A 3GU0A 1N5YA 4FXDA 4DUZJ 1LEOA 4J37A 1YTYA 3NMAA 4NEYA 2HBYB 2OTLS 2G1HA 2RKIA 1S0MA 5EGYA 1OPZA 2FY8A 1NU4A 1RUSA 4DL2A 2HHHF 2D3O1 1UA1A 2J7KA 3K5LA 1WNEA 2CXEA 3WIVA 2HRUA 1M5SA 3VAIA 1YI2S 4PG7A 3QPIA 2VFRA 1WHXA 2G0JA 2VH7A 3BPDA 9RUBA 3RAMA 1AUSL 1N36F 5KFMA 4PG5A 2M3DA 2HHVA 1PJ6A 2V8PA 5D4NA 4ZVQB 1BC6A 5DGBA 1QAXA 5CYQB 3VZHA 5LMNJ 4WP9A 3I6PA 2NPIA 4HTIA 1NMEB 2VFUA 1TL3A 2KXHA 4B9TA 3I0RA 1VS3A 2KZMA 1RLDA 1N34J 1B0PA 3RRHA 3ZZRA 3DLKA 2ZKTA 3M32B 4O3NA 2MQOA 4EWTA 5L1IA 4KGVB 1NJWA 2G2ZA 4AE5A 1NKEA 4ECYA 3NGRA 4ZOSA 2AZ1A 4YN3B 3WDOA 2ASYA 4ZPWR 2DNMA 3VWSA 2B7BB 1SXLA 1MROA 2F1FA 5HO4A 1AFJA 1HNVA 3M2RA 4A8FA 2C3YA 2DY9A 3CMAS 4IRCA 5MLCV 4I68A 4LIRA 2NXJA 2HS4A 1ZOTA 1KN6A 1KKHA 4ZJQA 2NXEA 5AXLA 5GAGI 5LJ3Y 2AWZA 4X4PA 2OEKA 5J2NB 1WHYA 5B0BA 4LFAF 2AZ3A 1SIWB 4G1QB 4B3MF 1H74A 1H3DA 2GVDB 3BZQA 1R7IA 4URQU 3WC0A 4B3RJ 4M8LA 2HHSA 2NYHA 3OTOJ 3GIRA 3UVJA 1RTHB 4P6QA 5HQMA 3ZTPA 4F4AA 1NNDA 2R42A 3ZNUA 1GT8A 2PI5A 1M5VC 4DV5J 1VC6A 2Q1LA 1VQ6S 4ZN1A 4ZP9A 2AIRB 3H20A 1FDAA 4JYAF 2VC1A 5CYQA 2FD2A 2PMWA 2HK3A 3IG1A 5ETNA 3F0NA 4QR2A 1UTAA 3DGPB 2YNFA 1IKVB 5BYSA 4IR9A 1ZAXA 3LUYA 1RWUA 4ZVEA 4Y6IA 4M5LA 2Z2ZA 4KT0C 1ZA2B 1V6HA 1OY9A 3M32A 2C3PA 4WP3A 4DN0A 1HBUB 2DGXA 1FCAA 1N48A 3EGWB 1RA7A 4USMA 2YVSA 3GV5B 4X2BA 1RB0A 2LKZA 2KYXA 2R7SA 1RCXB 5F9NA 1RWVB 1XK8A 2AX1A 1L3KA 4LJMA 5L9XA 3UI3A 1FDBA 1V9OA 5HMZA 3OVAA 2PMZD 2ROPA 4FXVA 1UVLA 4IOBA 4RUCA 1NSKL 2G0IA 1U26A 2NXCA 3O5TB 4N8NA 1MLAA 1R0AB 1RKIA 4MKAA 4IRKA 5J2NA 4B9NA 4LRFA 2KTQA 1HBNB 4S0MA 2AJ2A 2D41A 1F5BA 4G1QA 3CJQA 1UPMB 3HSZA 4JOUA 3D6TB 2YWEA 5A6WA 5KFDA 5KFNA 2RMLA 3M9OB 2GVDA 4ECSA 2FZCB 1NHKL 3CCQS 2Y3YA 3MD1A 5KG7A 3OBIA 1GX5A 1Q8IA 3GJTB 2YWWA 2OAUA 2HHWA 4F04B 1J2VA 4L73A 4X65F 1HI8A 4TKTA 5C7PA 3KHLA 4OX9F 5CHCB 4NLTA 1RTHA 2B8QA 1YHQS 3DMJB 1IM6A 3DI6B 4JI6F 3GONA 2V4QA 1KOOA 1HA1A 1NXIA 4MK8A 1HI1A 3I9V9 4EMDA 2ZUGA 2MQMA 4IG0A 1Q8LA 2VBXA 4CM0A 1X5SA 2FZGB 2VG7B 1VJQA 3PZPA 1SC4B 1WEXA 4DDFA 2PN6A 5KFJA 1SQEA 1RAFB 3DGPA 3GYGA 1A6LA 3A8JA 4WK1A 2GNKA 3C6UA 3OJSA 2NUUG 1ZA1B 4HDHA 1SCJB 3CJ8A 5B0EA 1HLWA 2BJ3A 3HHLB 2OD6A 1Y4ZB 2AW0A 3CULA 3HHEA 2KVQE 3AOCA 4LMZA 2YNHA 3Q89A 1JIHA 1FTCA 1GTEA 2E5IA 4FNHA 4XPCA 4F4YA 2VC0A 2UVRA 1TVRA 2MMYA 5F8GA 4J7CA 3POTB 5CAAA 3OUYB 3JSRA 3M30B 1NPKA 2NR0A 1OMSA 4ILLA 1NK8A 2ROGA 4WXOA 1F3VA 5L8RC 3PEHA 2PEHA 1WI8A 2Z2MA 3BSCA 3M8YA 2G1DA 4QOTA 4RZRA 2AMCB 1HBNA 2IHR1 3ILJA 3H98A 1UFLA 5KG3A 4NYOA 1C4CA 1R6VA 4NA2A 1WG5A 5K8NA 1VQNS 3DM2B 3GB0A 1SH3A 1WD6A 3MCNA 3IGVA 5BYQA 4KKOB 2BQUA 2AQ4A 2FPHX 1R8BA 2J7UA 1U1MA 4XDDA 3LWLA 5DDQC 5G4DA 2XCPA 2K7KA 3OHBA 3MMAB 1LFWA 2JFKA 1S1XB 3DI6A 4KJIA 3CCSS 4B9VA 3THTA 2E9TA 4USHA 2XMAA 4L6V3 5KFTA 4KSEB 1F5AA 3CJ3A 4JI4J 4NLXA 3NGTA 4LF7F 4DR6J 2X3DA 1K0VA 2AJQA 5A2QY 3MAQA 1FJGF 1YQHA 5E41A 4DSEA 2VG7A 4PCQA 4IH7A 4W90B 4DU7A 4JI1F 3NLCA 3DDNA 3P49B 4C0BA 2XLIA 1Q8KA 3Q8QB 3ENQA 2YKOA 3A8KA 4DCJB 4K5RA 2ABYA 3D1QA 1N56A 3TARA 3Q23A 4BCAA 3V81B 5T7LB 4O3OA 1KQFB 2GA7A 4YY3F 5ETLA 5HLFB 2FVSA 4X4OA 1JNZB 2W1BA 4KHMA 1IXKA 3UCUP 5D0RA 1S4EA 3GQCA 4LSZB 2AYMA 2BABA 2QRRA 4DUYJ 2L41A 2QLWA 3POTA 3OUYA 1Y11A 4UQGA 4P71A 1E6YB 5LXRA 3H5SA 2R8KA 1KRPA 1U1NA 2YKNB 5HQLA 2AEFA 2QV6A 4ANCA 1F0XA 2C2EA 1FVQA 3RU0A 2AYEA 5DG7A 4O3QA 2MHEA 4XAKA 3BKFA 4GKJF 4OZNA 2MKHA 2NQPA 3SSSA 3CDUA 4X84A 1JLQB 3AAWB 2YKMB 3TR5A 2GW8A 4MJKA 1QTMA 3QATA 1FKOB 2QE5A 3L9ZA 2Q6CA 1X9SA 4WFXA 3VGVA 2DNZA 4KKOA 3FK4A 1RT4B 1Q16B 3OFEA 3RBZA 4C8KA 2VDIA 2DGWA 3MMAA 4LFBJ 1S1XA 1VC5A 3FGVA 3RRKA 1OSDA 3B78A 3JAMY 4WKRA 3HF5A 4WFAQ 2QSFA 2GIFA 1H38A 2OD4A 2DGQA 3JSMB 1VC0A 2ZH1A 2RQMA 1WOOA 5HMWA 4ES3A 4A8KA 4OHYA 3PKYA 2E1AA 5THWA 1UEVA 5KT5A 4DFKA 2WSFC 1NK5A 2LQ9A 2IDEA 1VRUB 3K5OA 4OZ5A 3GJRB 2DKOB 1U1RA 4QJVA 1VQMS 5T7LA 3MMCB 2CG4A 5HLFA 1YJNS 4KB7A 2R2UA 3J7YU 5FD1A 2VQEF 2NUHA 1RHUB 3G6ES 2M8HA 4PQUB 2FHMA 4G3IA 4PWDB 5H9FK 3KKFA 3NAIA 4KGMA 1KVIA 2CIMA 1E6YA 2LU2A 3T1YF 3KOAA 2YKNA 2NSCA 4IO9Q 2OKQA 5H9FJ 3TVYA 1FJCA 4C7QA 2CDRB 3HVRA 4IYQA 3HXMA 2CPFA 2V6AA 2MJUA 2HQFA 4PR6A 2XSJB 1T3OA 2E5LJ 5KFGA 2ZH8A 2UUCJ 3W62A 1JLQA 3JS9A 2WZ1A 2YKMA 2V5HG 2LQJA 4F7VA 2XCAA 2VG6B 1VIXA 1C2PA 1FKOA 4ELUA 3AD8C 2Q66A 1RT4A 3FKBA 5L39A 3ONQA 3QZ8A 4ZA1A 2XQCA 1MN7A 3BBCA 4ETZA 2ZM6J 4DR4F 2V63A 4DQPA 4M94A 2MQ8A 2RQ4A 3PJ9A 2MYFA 5JUMA 3H2VE 4TY9A 2BBEA 1NJYA 3DYAB 3JSMA 1HPZB 1HWJA 5EWGA 4QWDA 5E3RA 3HK2A 2FHKA 2WW4A 1QUVA 2DT9A 1M5PC 3UD4P 3H5UA 9ATCB 1Q78A 4DSJA 4O4RA 3FQKA 3IM9A 1PSDA 3HLUA 2I9SA 4PXEA 3QIPA 3P3DA 1S76D 5DG8A 3CCUS 5JJBA 1VRUA 2CNLB 5DZ7A 1XEZA 1LW0A 3LF0A 3W5YA 3M6VA 4ELVA 3MMCA 1JNRB 1R0BG 3KYLA 4JV1A 3FSIA 4CT8A 1RAEB 2WSCC 3HVAA 4JI3F 2C2DA 1FX2A 4ZPVR 2OFHX 2C2MB 2BM0A 4RUHA 3GG0A 4PQUA 1L3TA 5GAHI 4B9MA 4PWDA 1UVNA 3U1NA 4PWUA 3ENAA 1X8DA 2W24A 3EPGA 1R6YA 3CJ4A 3LO3A 3TX0A 2KI2A 4RW8A 3ZZOA 2JL9A 4OZJA 4GC6A 5IWAF 2PA8D 1SUQB 4GC7A 2LU1A 3V6DA 5J2MB 5I3QA 2KKHA 1SC6A 2XSJA 1XMOF 2VOPA 2UVUA 2WHOA 1HWKA 2JEJA 2HRYA 2JVOA 2VG6A 2F5GA 1ZM4A 3CT9A 5BJRA 2P5VA 3KTQA 3NY0A 1HL6A 4CLWA 1GH8A 2ZD1B 1KLNA 3FFIB 2B56A 1N32F 1S9FA 1LWFB 2R7QA 5EX0A 3CJ5A 1Q5YA 3MUMP 2FVQA 4HLBA 2KT5A 2XYGB 1XR7A 2Y8WA 3D1OA 3DYAA 1HPZA 2AGPA 5IOLA 4OYAA 4LF9F 4YHHF 5DLFA 3PW7A 4BBYA 4CH7A 4DI6A 1UW4A 3TUZC 3NS7B 5CQGA 5KFBA 2BE2B 3NGDA 2FZKB 1CBKA 2FHOB 3T5JA 2UUTA 4I69A 5FLXU 3O6QA 4W98A 5KOXA 3TUPA 4DV6F 2JH3A 4J9VA 4KIAA 2C3OA 1YBUA 2R2SA 2KHDA 2HMIB 1TMMA 2MKKA 1S6UA 3HHLC 5CABA 3I4PA 1G4CA 4DF4A 3OFGA 2V8DA 1J5EF 2UXDJ 4IO1A 3QGGA 2VKZG 2WB4A 3N0VA 4QBUA 3FZBA 4DR5J 4NXNJ 4WIIA 4GMKA 3H5XA 3DFEA 1SUQA 2R3VA 2GGPB 5KG5A 5GMDA 2XGQA 5J2MA 1IWGA 5DM7Q 3BSAA 1RE1B 1T9XA 1IBLJ 3LP0B 3UNGC 5DETA 1YIJS 6AT1B 3D7SB 4CT9A 4RBUA 3C2PA 1G3OA 2IAJB 4PG8A 1JMTA 2O1PA 3IP0A 2N4CA 2ZD1A 2K3KA 3BGFA 4ZKAA 3FFIA 3N4WA 1UPPA 1K8AT 1CQNA 4WTYA 1LWFA 3N01A 4Y2KA 4DR1J 3QAEA 3JB9k 1Q79A 3K8WA 1JX4A 1EHWA 1D9DA 4WYWA 4C8LA 3OFHA 3D3CJ 2MLZA 2BVZA 4ZLNA 3VGSA 4EO6A 1NKCA 5A8KB 2JLFA 2OEJA 2BE2A 1V3ZA 2UXBJ 3WBZA 4JV2A 2B51A 2DEJA 1TFYA 1VI7A 2X1AA 2CPXA 3EZ5A 3W1YC 3SYZA 3MMBB 4MH8A 1RK8A 5IT4A 4NCBA 2MZQA 4AQYJ 5EDWA 2G2OA 4DSFA 2P9EA 2HMIA 5GAGU 4DPXA 3EE3A 3MPUB 3Q86A 4ED2A 1MMNA 2CNOB 3SFGA 4CQ1A 5D0GA 3D67A 4CLPA 2W2PP 4RW4B 4AFFA 5LT5A 2DXEA 1NJZA 3VAJA 3M7VA 3HDSA 2XBPA 3KLEB 4C97A 2CRLA 1HNWF 3M6XA 5E33A 4C3KA 5GMKa 2AF6A 3K8VA 1ITPA 1HBOB 4ED3A 3VCDA 4O44B 2N7CA 4DX7A 2IY5B 4XDCA 3KG0A 3LP0A 4DV2F 3DRYA 2V94A 2MQNA 2ZJRQ 3CJRA 1R0CB 1NKBA 2OO4A 1HD0A 2JWNA 5AJ3J 1GXLA 2ZJQQ 2IAJA 5M2RA 4P2SA 2UUAF 1WC6A 2H51B 3M9NB 4TU7A 5C24B 1EETB 4X4RA 2XO6A 2RSQA 3ISND 3N28A 4RR5A 1JJHA 3R6LB 2J9DA 5KFOA 4F2RA 4KHRA 2G9OA 1CULB 1HQUB 1VR6A 2B4PA 4DS5A 3TVZA 2XI2A 2YWKA 5C42B 4A47A 1S6PA 1NH7A 3M9MB 2N3LA 3I87A 3EMTA 5A8KA 5CXTA 1WC4A 5HK4A 5A76A 2BZ2A 3FVYA 1SJ1A 4RO0A 3DOKB 2V2VA 3FJ2A 3CCVS 4OFZA 1RTIB 2MQLA 3B4DA 4KHPJ 3CD5A 4IDKB 2RUGA 3A12A 2YNGB 5B0AA 1KQSR 1T05B 2QFIA 3IA0A 3IBFB 4DV7J 4ZDNA 4L76A 4QIGA 2W7PA 2VPYB 1G2EA 1QTNB 4RW4A 4ZVUB 5CZVA 4RNNA 1FA0A 4J9LA 3MFIA 3W63A 3KLEA 1RXOB 1ZH5A 2WVCA 4YP3A 3T1HJ 3MR3A 2BJ9A 1RAOA 1HBOA 2X1GA 3O3LA 2PMHA 4O44A 3VQSA 4FPRA 4MKBA 2PDAA 4PXCA 3PYDA 1HFEL 3PCOB 1HNIA 2MB0B 2D1CA 2BQRA 1XMQJ 4ZIWA 1S9EA 2ZZTA 3AHPA 2BM1A 2ALZA 1IN0A 3DXSX 1FEHA 3LGNA 3MZIA 3VVUA 2FJDB 2R9LA 2VQFF 1U6BA 1TKXB 4FF4A 3GMGA 2HHTA 3KJQB 1AZSA 4DSIA 1EP4B 5C24A 1EETA 4FF2A 3ADAC 1RWNB 3DU6A 5T41A 3NS6A 3LPEA 4K0KF 2YH1A 3D54A 1HQUA 2OPQB 3MR6A 3EJMA 1DRZA 1KDNA 1WACA 2LFVA 3ITHB 5E3QA 5C42A 3HHKA 4DV3F 1B7YB 1L3UA 3X3UA 4EGLA 4WU2A 3WX4A 4Q5VA 4DFMA 2U2FA 3M1VB 1S72S 4JI0J 4I7FB 3DOKA 3MCSA 1T9UA 4B3SJ 4TQRA 1FI4A 2RF2B 3W9JA 3HO1A 1YG0A 1RTIA 3K5PA 1HQ2A 2OPRB 2VFVA 3DOMB 1S59A 3S7RA 2AKWB 2QA2A 4QWAA 2CQ0A 2OJ3A 4OI0A 1LXJA 2YNGA 1JXVA 1TKZB 4LF8J 1T05A 2H3EB 4C0OC 1GNKA 3CO9A 1Y5LB 4RUBA 2BW7A 2VD3A 1OYEA 2HZCA 5F8MA 4M5NA 2HFVA 4DQIA 2BKPA 4DPOA 3D66A 1E6VA 4DEZA 3R5JB 2XTJP 3KG1A 1BHNA 3D1HA 1LK7A 1NJIT 3HM9A 2DRDA 3W64A 3JTPA 4NMXA 1UW9A 3EZOA 4YR2A 4DSLA 1BQXA 1OSCA 2DD8S 1SIZA 2YH0A 3IWNC 4HDGA 3ET6B 1VCTA 3KJNB 3RUBL 1N33F 3UO0A 4PPDA 3LAMA 4QU7A 4L75A 4L72B 3ZXWA 3DDIA 1HNZF 1V5VA 3QFHA 1TKXA 2E1RA 3W61A 3DXBA 2ACYA 2RH3A 3IAM9 1EP4A 2IVMA 2DISA 3CCTA 2ZWPA 1I3OB 3MM8A 2ASLA 4TN2A 2BR0A 4OYWA 1RTZA 2EG2A 1PYTA 3QSYB 4NLVA 2R8IA 1XNQJ 3GFHA 5BR8F 3MR7A 4G1IA 1TK0A 3DLGB 4DU8A 3MOJB 4M5DB 4LSNB 3IWXA 1RHQB 2LECA 2XS5A 3UDLA 1R8PA 1U24A 2HPUA 3E51A 5C2GA 3SXLA 3M1VA 4J9MA 2XS2A 5DGAA 3C14A 4OZ3A 2RF2A 2RDIA 2OPRA 3KJVB 3QT7A 2MEWA 1EIYB 3CO0P 3QFWA 5F41A 4GO5X 1TAUA 1RWMB 2RHQB 1OQ3A 5GADU 1TKTB 2JZ5A 1ZBTA 3W3SA 2IVFB 1TL4A 3WZ0A 3BGLA 3RRGA 3J80Y 3RJMB 2G0CA 4OYXA 1U6ZA 1S49A 3IWLA 2HLTA 2UU9J 4MMOA 4KO0B 4C8OA 2QMWA 4AL6A 4BLGA 4NL5A 3D68A 2GVZB 2XHCA 2DNYA 1VQ4S 2V8VA 1SJ4P 3ET6A 3NS5A 3WQPA 4LF5F 3SQOP 2J6UA 3UD3P 3K5MA 1YRTA 2VASA 2QMUB 4FYVB 4NLSA 2A2CA 3KUGA 4DV4F 5D78A 1X9MA 2W25A 2HWIA 5ITHA 1ROFA 4X62F 3EDRB 2I38A 4ZHRA 3MWBA 2J9CA 1I5OB 1AB8A 4IKAA 4B17A 5AE2A 2R7WA 5CCLA 5IV3A 5DS7A 2HNDB 4EFAC 3DLGA 3P5TL 4KY3A 4I6AA 2GV1A 1C0TB 1S6QB 2UZAA 4B3MJ 2IM3A 1RHRB 5GAEU 1HI0P 4M5IA 3HHDA 4M5DA 4K4XA 4DR2J 5GMEA 1IBCB 3DLJA 1H72C 2XMJA 3D0IE 3DOLA 1RHKB 2LEAA 2J6SA 1U47A 4HI1A 3ISNC 2JC0A 4KFBB 3HI9A 3UCGA 3PHEA 2FQQB 5FJ4A 1H2TZ 5M2PA 1VISA 4O4GB 3KJVA 3SFUA 1MW7A 3R1LA 5A0YB 5CH7B 1UVKA 4C3MA 2WAQD 2K1RB 2KG1A 3CJ0A 1BUXA 1RWOB 4Y2AA 2FGOA 3RBEA 2FUG9 1TKTA 1TL5A 3IR6B 2EK6A 4UOCA 4QZVB 1YRUA 3NXZA 4C2MA 3BQ2A 2KHCA 2C2RA 1EX8A 1OS5A 5KFXA 1XN9A 1M5OC 4OJGA 3OR1B 2OLWA 1ACMB 2EKYA 1NDPA 2BOPA 2HFZA 3N79A 3THVA 4PYDA 2RDDA 4JI2F 2NLWA 3BYRA 2GVZA 2EFGA 3CCWA 2EC0A 5IQ6A 4U7CA 2C3MA 3AJ1A 4PRFA 3PFOA 1EZZB 4DR7F 2DRAA 2V50A 2LDIA 2CDQA 3UD5A 1IKYB 2MKJA 4DL3A 4PAAA 2QO3A 4LRCA 3JAMU 3N9UC 1WEZA 1KVJA 4K5SA 1U0HB 4YR0A 2V4RA 3EYZA 2R4FA 2X51A 1I94F 2ZJPQ 2GMHA 3CIZA 2R8JA 4Q2LA 1FXRA 4CH1A 4JI8J 2D9PA 3MPVA 4DUZF 2HNDA 5LMUJ 3W60A 2FJEB 2V8GA 4ZVSB 1S6QA 1U2FA 4C98A 4ED7A 1RT3B 2KRRA 1JB0C 3TJ9A 1RBOB 1YK9A 3AB2B 4QIVA 3W9HA 2QL9B 2X3GA 3GLJA 5HP1B 3AD9C 4NLWA 4X65J 2YNIB 4URSA 4KFBA 1Q7YT 1WF0A 2FIUA 5E0OA 3QBCA 3TA2A 1Y5IB 2NCKL 3JQJA 1KSPA 3GPAA 2AYGA 3OTDA 3DRRB 4ZLJA 5A0YA 4PXBA 2K1RA 3AXMA 2DGUA 1KQGB 4Y00A 2EPIA 1U45A 3DRPB 4DXLA 1UJ5A 1T03B 4NLGA 2L9WA 2DR9A 5I3UB 5LMNF 4QYRA 4ECXA 1FD2A 3QJJA 2EVZA 2VFSA 2ZZMA 4KAIA 4PWWA 3RAXA 3K5NA 2XO7A 1RLCL 3G86A 5F0WA 1KVKA 4R8UB 3NCPA 4NXMJ 1N34F 3KLHB 4LF6J 3OR1A 3V4IA 1EARA 2GJFA 1UMJA 5FIIA 3AB4B 4IFYA 4RW7B 3PRDA 4JP8A 4KBIA 3DHWC 4HACB 3Q8PB 1DBDA 3L7UA 2IA0A 2FLOA 4U67Q 3ZZYA 4H4OB 3L95X 2IVYA 5DG9A 3MHYA 4L3KA 5F8HA 1SB6A 3PRVA 2BANB 3O44A 4DBQA 1CJKA 3LA0A 1VYAA 1U0HA 2LEPA 1D9AA 4WXWA 4KTQA 3LWMA 2WBMA 4DJBA 4YR3A 1QSSA 4P52A 4LSLB 4NRTA 4B9UA 2XGPA 3S1TA 5IC6B 2E5JA 4OJHA 2BACA 3CEDA 1DURA 4RNFA 3MGJA 4NYPA 2FC8A 4NZ6A 4QPXA 4ZJOA 1WELA 1D1UA 1F2HA 3N6MA 3QGHA 1UAWA 1GTHA 4G65A 4ALZA 2FJWA 5ETOA 5HP1A 4NI2A 1AA1B 2VB6A 2YNIA 5CD4A 3DRSB 3FC9A 2BJ7A 1FNOA 1GFWB 3K2YA 4X64F 1K1SA 1DQAA 1YJVA 1YZ7A 4DLGA 2Z2LA 4DV5F 2OELA 2HQGA 5C5JA 3TJ8A 3TX8A 2KDOA 2ZVSA 1B70B 1HW8A 1A9NB 4LBHA 5K9FA 1T03A 4B9SA 3RZAA 2HHXA 2HQ3A 3JTOA 5I3UA 5J1EB 2CJYB 3RBXA 1PILA 2V8HA 2IRYA 2HFOA 2HYIB 1FJGJ 2WCXA 7FDRA 3U1LA 4ZP8A 2Y1LB 1UETA 3I0SA 1LW2B 4NLDA 2EFOA 1VQ8S 2CPZA 5DLGA 4A4JA 3GJQB 1HHTP 1YBTA 1B3TA 1OWXA 2A6MA 2GHPA 4RW7A 2RDJA 5B7WA 1X4EA 2WONA 4HACA 2V9KA 4H4OA 2GO8A 1P8GA 3CJSA 2MLXA 4CDIA 2BANA 2J6TA 4TNOA 5KOWA 1Q0NA 3PYGA 1VBXA 4MK7A 3PYFA 2YX4A 4EBDA 5HANA 5I42B 4B3TF 2CJAA 2RUSA 4FBUA 2B9YA 4J9OA 3HT3A 4ZVFA 2JOQA 2CJ9A 1X4DA 4ZPCA 1H6KX 4LSLA 3T9NA 1NK0A 4GKJJ 3TI0A 2CPJA 1X0FA 2YTCA 1EKSA 4AT1B 2UUBF 3KLVA 1X4BA 2ASDA 4URGA 2L48A 3BSOA 4TY8B 4BWMA 2XLKA 3DKDA 3SV3A 2CVIA 3UR0A 1S1UB 2NPFA 1NSPA 1X4FA 2RJZA 1F5CA 3SCKE 3DRSA 1SKSA 4OYIA 1LFPA 3E3XA 1P6TA 2F7VA 3SSQA 4C48A 1D8ZA 2Q43A 3I96A 1XJWB 2ADCA 1T94A 4C9DA 2HGMA 2K3IA 3T3FA 4RJVA 2HVZA 1RHMB 3VTIA 5KFHA 4C4WA 4R25A 4ANEA 4DZDA 3PIOQ 1IKWB 3R9LA 3V6JA 1LW2A 3OPKA 5KG6A 4O3SA 2ZC4A 1CC8A 1JLBB 2VF3A 1Y5NB 1QAJA 1CJUA 2RQCA 4DL5A 1OY6A 1FDNA 4FBTA 1YLXA 2E1CA 2QA4G 2CQPA 1U1KA 4MKYA 4DL4A 1S7HA 3OD2A 3UE2A 3T9ZA 5J1NA 4J9NA 3M2UB 4Z7YA 3OW2R 2Q3PA 2O5DA 1VFJA 1EJ7L 1KTVA 3Q8RB 1PCAA 4ED0A 2HNZB 3GSIA 2GIQA 2BRLA 2MZRA 2ZOGA 2VICA 1S12A 5I42A 2UP1A 3KG4A 1NK4A 2LA4A 3Q2SC 2VOOA 2VU5A 3IM8A 4FVMA 3GIMA 5MAOA 2PEBA 4EI2A 3A13A 4LREA 4DF8A 1WJ9A 4ZLLA 3F41A 4TY8A 3UW1A 3KMSA 1YVFA 3B4MA 5HSPA 4CO1A 1U49A 3PFEA 2MPUA 1WSVA 4I67A 4PYAA 2EC2A 1AYEA 1LW0B 3C6TB 2B4OA 1DJ0A 3AQOA 2P2CB 3LALA 2IJNA 1RADB 3GP9A 3CCES 4X4VA 2GQ2A 2CWKA 2JRSA 4JI4F 1RISA 1MWQA 5B0FA 3ILLA 2I5JB 3LQVA 2I8EA 4DR6F 2C1EB 3EDQB 3QRRA 1IWAA 2JEIA 2AT1B 2C22A 3VF0B 3AD7C 1PAUB 3Q0AA 1WORA 2H48B 3DHXA 1IKWA 4I56A 3I0RB 4ED8A 4QIEA 4J5OA 5KFAA 2J0SD 4CO0A 1JLBA 1TV6A 2DNRA 3DLKB 4D3HA 3CWJA 1U2RA 2RRAA 3D0HE 4DR3F 1Q81T 2OGUA 4LRBA 1U1PA 4K4VA 5KT6A 1JLGA 1QJHA 2ZNZA 4Z37A 4ILMA 2LP4A 2DH9A 4QIWD 1CQMA 4CLZA 1Q1KA 5AXKA 2RS2A 2W2NP 1HNVB 3M2UA 5L9NA 4JI5J 4WF9Q 1D0EA 2HNZA 2HQCA 4NLQA 3IC1A 4UW2A 3KK1B 1KBRA 3MPDA 5L1KA 4K4SA 2R7UA 4MIWA 2C28A 5IWAJ 4LR7A 4OZ0A 1U0SA 4KC5A 3BR8A 2KXFA 1VJWA 1KLMB 2DHSA 4GVLA 4LFCJ 2ZH2A 1RT6A 1XMOJ 5LSOA 4G6VB 1QSLA 4WFZA 1U25A 1VQ5S 3D9BA 4USVA 3IAS9 1P9YA 3UVJB 3KK2A 3R6GB 4Y2CA 1SV5B 1T9WA 2RB7A 3C6TA
chains in the Genus database with same CATH topology
1JLCA 4G1PA 3MURP 5EN1A 4DF4A 3OFGA 2V8DA 4I0WA 1FDDA 3CCZA 1J5EF 4IO1A 1VQLS 4LFBF 3A1YG 1S4FA 1HHSA 3HHLA 4K59A 3KLGB 3AA8A 2OP5A 3QGGA 4EBCA 4N76A 3PR5B 2VKZG 2WB4A 3N0VA 2QZ8A 4F67A 1YJUA 2J76E 4QBUA 2FGCA 1JKHB 3FZBA 5JVHQ 1N0UA 3D5MA 1ZM2A 2I5JA 3RB3A 2B7CB 4WIIA 1RT3A 3C8YA 4TXSA 3GFYA 3KWMA 4GMKA 2ZHAA 4CIOA 2R8HA 5HROA 3H5XA 2FVPA 3DFEA 1SUQA 2GGPB 5KG5A 2XGQA 5J2MA 5HBMA 4E8UA 5KT2A 3CF5Q 2D3ZA 5DM7Q 4OIXA 2LXUA 3N6NA 1CSJA 3BSAA 1RDRA 4HVZA 5CZXA 3DLLQ 2SXLA 5BYRA 4ZMMA 4TLRA 2FJVA 1URRA 3IG1B 3JSYA 4AL7A 3RB6A 3LP0B 3M30A 2WTFA 2W7OA 4OX6A 1O8BA 1RA6A 1SL1A 4I1TA 3UNGC 3OTBA 5DETA 3KLFA 2YNFB 1YIJS 2M70A 4ZHRB 3MF5A 1REVA 3F56A 3ISZA 4A8SA 3DC2A 2FY1A 3QJLA 4HH0A 2ZH7A 3DRRA 3HKWA 1HBMA 2C3UA 1KOHA 4CT9A 1C4AA 1JWWA 5KFRA 5G0RB 3THPA 1M5KC 3LANA 4RBUA 5GADI 3C2PA 1G3OA 2IAJB 4PG8A 4OJ3A 5AE1A 4HKQA 3DRPA 1Q4RA 3HPOA 3OHAA 1AFIA 4I2PA 1RTJB 1JMTA 2O1PA 2RD5C 2Y1JA 2XZWA 3R5DA 2N4CA 5DJBA 3GFZA 2A1BA 2VUGA 3GILA 4RX6A 3IR7B 2ZD1A 1FERA 2K3KA 3BGFA 2EWHA 3QIDA 2KJVA 1R8AA 2XWXA 4H4KA 4ZKAA 3SV4A 3FFIA 5KFWA 2CKWA 3N4WA 3H5YA 1K8AT 3DOLB 4OLPA 1T8EA 1CQNA 3PO4A 4WTYA 4NA3A 3R1HA 3V5RA 3QLHA 5B0GA 1LWFA 3N01A 4YMEA 3DM2A 4Y2KA 3O1LA 5IT0A 3G9CA 5KG1A 4R8UA 5A8RB 3US5A 5DRKA 3C66A 4NOHA 3OFFA 4CO3A 3QAEA 1UVJA 3KLHA 2ZH5A 3JB9k 1RT2A 1I6JA 1NO8A 1Q79A 1YJTA 3IBWA 3K8WA 4KV8B 4ITSA 1G1XA 5I3PA 1WF2A 1JX4A 3HHNB 1NB7A 1D9DA 2FVCA 1YJRA 4FXWA 1IR0A 4WYWA 4C8LA 3OFHA 3R3TA 1P1TA 2BVZA 2LDYA 1VGYA 3KK1A 1S48A 4EO6A 1NKCA 2XI3A 2M2BA 5A8KB 1X4CA 2JLFA 3BREA 4OV1A 4Q8FA 2DTJA 3MM9A 2BE2A 3FRZA 4NA1A 1V3ZA 3GV8B 3JSBA 3MEEB 3MM6B 2DH8A 1KD1T 3WBZA 5CYMA 4JV2A 2B51A 4F8RA 3PW0A 1TFYA 1C1BB 1NHUA 1VI7A 2X1AA 4CNZA 1U48A 2CPXA 5E3AA 3VAMA 4QW8A 3EZ5A 3JTNA 1SKWA 4N56A 2E5LF 2CQBA 1KLMA 4A8OA 1SL2A 2EBGA 1FKPA 4BC7A 2UUCF 5J2QA 2DGOA 3SYZA 4N41A 2JX2A 3MMBB 2K7JA 3UQSA 4QYZJ 3G4SS 2HNYB 3V6HA 4MH8A 1RK8A 2Y0SD 2IC3B 2XMWA 1I1GA 5JXSA 5IT4A 3L7OA 3BQ0A 4NCBA 4QCLA 1RT7A 5KFEA 2POKA 5KFYA 3J7YI 3EX7B 2MZQA 2ROEA 5D6GA 3PIPQ 2FJBB 5EDWA 4DSFA 4DV1F 3R5AA 1MMDA 4PQAA 2W9CB 5A6PA 1YBAA 2P9EA 3MEDA 4QWCA 3BO3A 2HMIA 4K4ZA 4O23A 5GAGU 2Q6BA 3H25A 3CTRA 1VOMA 2DNKA 2ILYA 4ED2A 2FLLA 1MMNA 3SFGA 2J0QD 2X1BA 4CQ1A 1SV5A 3GV7B 2CQ4A 2ZOMA 2PSZA 3V81A 5LL6d 4RW4B 3Q2TC 2DHAA 3EXYA 1SH2A 2V4JB 2EW9A 4HT7A 4RW6B 1D9FA 4AFFA 2KB2A 5LT5A 1Y00A 1RTDB 4DG1B 1NJZA 2XMTA 5GAEI 3KLGA 3VAJA 2OPPB 3BJYA 3TUJC 1QE1B 3HDSA 2XBPA 2DR7A 2A18A 3KLEB 3MDFA 1VBZA 3PJXA 1JKHA 3TAQA 5D8HB 4C97A 2CRLA 2BUNA 1OO0B 3M6XA 3FEZA 1HNWF 5E33A 2AGOA 4C3KA 4IG0B 5GMKa 4DQQA 1GQEA 2M7SA 2UV8A 3JSMA 2I1RA 2NXUA 1KC8T 2AF6A 3K8VA 4LT6A 4OHWA 1M1KT 1HBOB 5HL7Q 4ED3A 4QW9A 3VCDA 1BD6A 4O44B 2DGSA 2N7CA 3M8SA 1IJFB 3TRGA 4XDCA 3KG0A 1S6OA 3VZIA 2APOA 4E0DA 3LP0A 4B08A 4TQSA 4DV2F 3DRYA 5K8PA 5EUHA 4ED5A 2V94A 2XY7A 2MQNA 2ZJRQ 3N5BA 3PR4A 3D0GE 1LWEB 1XR6A 2GFFA 3N5FA 4NMLA 5IS2A 3KMQA 5F0UA 2ZH4A 2W8KA 2JSXA 1A7GE 1P9QC 1NKBA 3E8OA 2OO4A 3H59A 1HD0A 2VBWA 2JWNA 3ICLA 4WYLA 2CZVC 3HP6A 4YB5A 3C6UB 2JC1A 1U1QA 1WEYA 3NNCA 1GXLA 4ZPBA 5G0RA 2ZJQQ 4AXJA 4CO5A 2XWYA 1QY7A 2IAJA 5M2RA 3MEGB 1MNEA 5F3ZA 2QLXA 4P2SA 2UUAF 3GYXB 1RTJA 5L1LA 3M9NB 4TU7A 3SCJE 2F9JA 5C24B 5J1EA 1EETB 4X4RA 5K8MA 2ADBA 1BWEA 2RSQA 3VAFA 3ISND 3IRXB 3N28A 3CC7S 1JJHA 2J9DE 2YNHB 4NLUA 2J9DA 2J9EA 3NCRA 5KFOA 4F2RA 3QZ7A 2AJ4A 1Q8BA 3PW5A 3CC4S 3CCRS 4KHRA 2G9OA 4ZCMA 1HQUB 1TVRB 3OLBA 4UUXA 3OXLA 4F3MA 2B4PA 4X4TA 4DS5A 1JK9B 3H2UB 4MFBB 5A8RA 3G8SA 1J5OA 2YX1A 4IG3B 3OL8A 3TVZA 4M95A 2XI2A 4I2QB 2CPIA 3NP5A 2YWKA 3PXGa 3PKMA 4N77A 2BXJA 5C42B 2KM8C 3ZZUA 2OTJS 1AXQA 4A47A 1S6PA 3DNCA 1R3NA 3SMZA 1FRJA 3OLAA 1NH7A 2W9BB 3M9MB 2N3LA 1K9MT 1FRHA 3I87A 5KT3A 3OQ2A 3T5KA 5A8KA 2ZH3A 4DS4A 3KNAA 3O8WA 3RB4A 4QWBA 2B5JB 1RT5B 3MEEA 3MM6A 4QPTA 4NZ0A 2DNLA 5CXTA 1TL1B 1SBRA 2BZ2A 3OL6A 3FVYA 1SJ1A 3DLBA 4WU3A 5M2UA 1C1BA 1BLUA 2GHVC 3DOKB 1DTTB 3GIIA 3FJ2A 3CCVS 3TA0A 5IFMA 1JXLA 4OFZA 4FZVA 3J7Z5 1RTIB 2E29A 2MQLA 2GMJA 3B4DA 3HJFA 2HNYA 3CDAA 4CI0B 5E3CA 2N3OA 3G6YA 2IC3A 3G6VA 1CC7A 5LSRA 3FMWA 5AXMA 3TO8A 3CD5A 4IDKB 2RUGA 4OZ1A 1SH0A 2YNGB 1IBKF 3M4XA 3V4IB 5B0AA 3LPYA 1KQSR 1T05B 2IBKA 1ZPVA 1VBYA 3IA0A 3PX6A 4IFYB 2OH2A 4QR1A 1IKXA 2VONA 1JLEB 4ZDNA 5KG2A 1N5YB 2ZH6A 5D3GB 1O0PA 2GQCA 4QIGA 1IQZA 3CDEA 4TLQA 2W7PA 2ASJA 3M2VA 2VPYB 1K1QA 3I4HX 1G2EA 2DNPA 4I6YA 4RW4A 2ZBIA 1LWCB 5J1PA 4BDPA 2V4JA 2XNQA 3HZGA 2HQIA 2NS1B 1RTDA 4DG1A 5CZVA 4RNNA 3B8HA 2YWGA 4Y34A 5KFKA 2RKIB 1FA0A 4J9LA 4C8NA 2OPPA 3S6EA 4F3OA 1QE1A 3MFIA 2VODA 4EU0A 3BQ1A 1TK8A 4HTJA 3KLEA 3OTCA 2B4VA 4Q8EA 1ZH5A 5F8LA 5SUHA 2I0XA 4O0IA 1CG2A 4MYTA 2YKQA 4YP3A 2QMXA 3MR3A 3VALA 2VBZA 3QAUA 3FSXA 1S1UA 1ZTWA 1HBOA 2X1GA 1JXEA 3O3LA 4I64A 2PMHA 3BS9A 4O44A 3VQSA 4K4YA 4FPRA 3K7RA 4MKBA 2PDAA 4V19J 4RBVA 4PXCA 4JI5F 2GX8A 1QVFR 2CQGA 3U27A 2XMUA 1SJQA 1HFEL 3CCJS 1LV5A 5DQIA 1SJFA 3CD0A 2DO0A 3UDCA 1HNIA 2MB0B 2D1CA 5J2PB 2BQRA 2XY6A 3H40A 1QLNA 1S9EA 4ECRA 3U1MA 3BO2A 3AHPA 2BM1A 5B08A 1FNMA 4UQTA 2ALZA 2N7YA 4O3PA 5L38A 1IN0A 3DXSX 1FEHA 3VAGA 3M05A 2N82B 2RNEA 4J9KA 4F25A 3NAHA 3LGNA 2Y1IA 3TVKA 3SEOA 3MZIA 2DHGA 4IFVB 4JV5F 2FJDB 1BQMB 1LQ9A 4NRUA 1MMLA 4IQMA 1XMBA 2LXFA 7FD1A 2PC6A 2R9LA 3MEGA 1N5QA 2DNQA 3EZUA 2VQFF 3MM5B 3T5LA 1U6BA 1TKXB 4I6WA 4FF4A 3D2WA 3GMGA 2HHTA 2RRBA 5E7OB 1Y0HA 2B0GA 1TKDA 4LFCF 2RB7A 2XEXA 4DSIA 1EP4B 5C24A 1EETA 4FF2A 1M5HA 1TL3B 1YJWS 4KR0B 3IRXA 5F3TA 4WKYA 5I4MA 2FJAB 1H2UX 2Z8QA 2RVJA 2MXYA 3DU6A 4Z2XA 2W9AA 5KFUA 2A10A 5T41A 3NS6A 1AROP 3PDNA 4NLYA 1IJEB 3GR0A 5LJ5Y 3W2VA 2YH1A 2JLEA 1S0VA 1WI6A 3D54A 4K0KF 2DNHA 3PW4A 3ENWA 1HWUA 1HQUA 2OPQB 4RUAA 1OIAA 2HHQA 2WOMB 4GKKF 3MR6A 2AU0A 1UA0A 1FRXA 3PRBA 1DRZA 4MFBA 3HZEA 4P7TA 4X4UA 5KG4A 5KFFA 1K73T 5EHHA 3D28A 1HMVA 4IG3A 2JFDA 3DU5A 4AXIA 5GAHU 4J9QA 1FK9B 3BGRB 1WACA 4I2QA 2UXCF 1OPIA 3ITHB 3PEJA 4Y65A 5E3QA 2UXDF 3J81Y 5C42A 5HQ8A 5EWFA 2IMOA 4OJ1A 1HR0F 3OVSA 2CYYA 1SJ3P 2P6SA 2RILA 3HHKA 4DV3F 2W9BA 1OQ6A 2LYVA 1CLFA 4DR5F 1L3UA 4LQ9A 3S01A 3X3UA 4EGLA 1RAJA 2D7SA 4WU2A 1KQKA 2ZHOA 3WX4A 2VFTA 4Q5VA 1MROB 4YDXA 4DFMA 2B5JA 1RT5A 3VQTA 3NBPB 3MMJA 1TL1A 1NZAA 2U2FA 4OI6A 3M1VB 2HS3A 3OL7A 1S0NA 1S72S 4NCAA 4I7FB 3M2RB 1VHFA 3DOKA 3MCSA 4F4XA 3B82A 1IBLF 1DTTA 4K2XA 1KNZA 4YEAA 4TQRA 2FC9A 2RF2B 1X4HA 3TANA 4DOZA 3HO1A 1YG0A 4FS2A 2QA4S 1RTIA 2YWHA 3K5PA 1L3VA 3I0SB 2OPRB 2VFVA 3GIKA 4NLRA 4MIAA 4HT5A 4EZ9A 3S7RA 2QA2A 2FJXA 2CZ4A 4QWAA 1ULRA 1SKRA 2XG8A 2CQ0A 1WG1A 4ID8A 2B4UA 4WCEQ 3TW0A 1Q7LB 3QYYA 2OJ3A 4BC9A 4OI0A 4RLEA 3SSRA 1LXJA 3AH6A 3KHHA 2YNGA 1TKZB 3X1LB 2J5AA 4CO2A 1T05A 3MR5A 3GSDA 4DWIA 4C0OC 1GNKA 2GO9A 4Q0BA 3CO9A 1Y5LB 4CNYA 2PT0A 1JLEA 1U09A 2ZC3A 3I31A 3PM9A 3G71S 1N5YA 5D3GA 4ZPAA 2DITA 2MY7A 4FXDA 2VD3A 4ECUA 2WONB 4J37A 1YTYA 3OVBA 2PIIA 2RU3A 2HZCA 4R0JA 4PG4A 3NMAA 1LWCA 4MK9A 2OTLS 5F8MA 1N8RT 2QIFA 3OSNA 4DQIA 2RKIA 1S0MA 3MPWA 5EGYA 1Q86T 4FF3A 1OPZA 4DPOA 1NU4A 4DL2A 4YDDB 2MZTA 2WSEC 3I55S 2HHHF 1E6VA 4DEZA 2IMWP 4IH5A 1CPZA 1UA1A 2J7KA 3KG1A 3K5LA 3D1HA 1WNEA 6FD1A 1LK7A 4ECVA 1NJIT 3HM9A 1WTBA 2HRUA 1M5SA 3JTPA 4MTPA 1O51A 5HMYA 4PUOB 4HEA9 2B9XA 4JBCA 3VAIA 1YI2S 4PG7A 4HH1A 1JJ2R 3QPIA 4B02A 4X4QA 2VFRA 4LQ3A 4QR0A 1WHXA 4YR2A 2VH7A 1S79A 4DSLA 4K50A 1BQXA 1Z4UA 1P27B 5J2PA 1QUPA 3RAMA 1VRTA 1OSCA 2DD8S 1SIZA 2DIUA 2PGCA 2YH0A 3BGUA 1N36F 3IWNC 4HDGA 5HMXA 4XPEA 5KFMA 4EEYA 2KVIA 3NMRA 3ZZPA 2BQ3A 2V0NA 4OHZA 4PG5A 2UXBF 3UWTA 2M3DA 3QO9B 1N33F 2HHVA 4PPDA 5D4NA 4IFVA 1BQMA 3LAMA 4FS1A 4QU7A 4L72B 1KONA 1BC6A 5DGBA 1QAXA 5DDPC 1HNZF 5CYQB 3VZHA 3MM5A 1TKXA 2E1RA 1N6QB 2WK4A 1U1LA 2BW2A 3GIJA 3I6PA 2NPIA 4EUVA 3DXBA 4HTIA 2ACYA 2RH3A 3GWCA 3IAM9 1EP4A 2IVMA 2VFUA 3R5BA 2DISA 3OR2B 1TL3A 3CCTA 4B3RF 2KXHA 4B9TA 1H0HB 1PO6A 3MM8A 4AYBD 4TN2A 4AQYF 2YKAA 2ASLA 2BR0A 4B3OB 3I0RA 3FNNA 1VS3A 3OTOF 2KZMA 4R5PB 1FE0A 1N5VA 2EG2A 2WOMA 1B0PA 3RRHA 3CVKA 4NLVA 3ZZRA 2R8IA 4EBEA 3DLKA 2ZKTA 3GFHA 5BR8F 1X4GA 2KXNB 4K4TA 3M32B 4G1IA 5B0CA 1TK0A 4O3NA 3T1AA 2M52A 2DIVA 3BGRA 3QGIA 2MQOA 4EWTA 3DLGB 4IOAQ 5L1IA 4HYKA 1NJWA 4H4KC 3ETOA 5KFSA 4AE5A 1MWZA 3MOJB 4ECWA 3CD6S 1RT1B 1NKEA 4ECYA 1X9WA 2F9DA 5CD4H 2AJ0A 4M5DB 4ZOSA 4LSNB 3WDOA 2ASYA 2EK1A 3IWXA 3Q24A 2LECA 2XS5A 3UDLA 5U47A 4OI3A 4ZPWR 4FF1A 1JLAB 2DNMA 2F8HA 2WB1D 3VWSA 2B7BB 1SXLA 2F3JA 1MROA 4R0EA 2F1FA 1R8PA 2DH7A 1U24A 2HPUA 1PGZA 2O67A 3E51A 3NBPA 4LUBA 2LQBA 4F26A 3SXLA 5HO4A 3M1VA 4OI2A 4J9MA 1AFJA 2XS2A 5DGAA 1C0UB 1FVSA 1HNVA 1ZM3A 3M2RA 4A8FA 4HHJA 3NGKA 3GE9A 3P96A 3NWGA 5F8NA 1FRMA 2C3YA 3CMAS 2RF2A 4IRCA 5MLCV 5IT9Y 1NRKA 2RDIA 2OPRA 2ZITA 4I68A 3KJVB 2OFGX 4LIRA 2HS4A 2VA3A 2F8MA 1ZOTA 1KN6A