2DGWA

Solution structure of the second rna recognition motif in rna-binding protein 19
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
91
structure length
91
Chain Sequence
GSSGSSGTTCHTVKLRGAPFNVTEKNVMEFLAPLKPVAIRIVRNAHGNKTGYIFVDFSNEEEVKQALKCNREYMGGRYIEVFREKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of the second RNA recognition motif in RNA-binding protein 19
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords Probable RNA-binding protein 19
total genus 10
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2006-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2dgwA01
2CQCA 4WFNQ 1DBDA 2MXYA 3P49B 1U2FA 3ZZYA 3CULA 3R1HA 2KM8B 4J5OA 2MQOA 3OW2R 1VBZA 1Q86T 4F02A 1P1TA 1RK8A 2DNRA 2G1DA 3U1LA 2N3OA 2DK2A 1Q81T 3S8SA 2I38A 1SJRA 2OJ3A 4V19X 1B7FA 1UAWA 2HGNA 4WCEQ 2DNLA 2L9WA 2KXFA 1YIJS 3CXCR 2DNNA 3CUNA 3SMZA 3BO3A 3FEYB 2M9KA 2M52A 1FT8A 5D78A 5LSLA 2M8DB 2KHCA 2PE8A 4IUFA 1VQ6S 2OSRA 3L3CA 3K0JA 2DNOA 2CQIA 2RRAA 3CCSS 2DGQA 2JWNA 2RVJA 1X5TA 1VQ5S 1KQSR 3CC7S 5GAEU 2E5IA 2CQ3A 1YI2S 1OPIA 1R8PA 3UWTA 3MUTP 3VAJA 2U1AA 1WG5A 2F3JA 1X4AA 4OZ0A 1WF1A 2ADCA 4A8XA 3MXHP 5GVQA 3NS6A 1H2UX 4WFAQ 2FC8A 1YITS 1S72S 3SDEB 4W90B 1U6FA 3R27A 3TO8A 3UCUP 2DHSA 4TU9A 1WI6A 1M5VC 2RS8A 4PRFA 1M90T 2MZJA 1UFWA 3B4MA 2CPFA 2A3JA 1WHYA 1X5SA 3CC2S 1JJ4A 1X5OA 3VAHA 2M8HA 2CQPA 1YTYA 1WF0A 1SJFA 2PEHA 1FJ7A 2DNHA 2DNMA 2KXNB 3G6ES 3ULHA 2L08A 1NU4A 1DHMA 3IRWP 3P3DA 3UE2A 3UD4P 2MQPA 3NMRA 2DGXA 2LECA 4QU6A 5GADU 5DM6Q 2GO9A 2MQLA 1YJNS 1U1QA 2KRBA 2NZ4A 1WHXA 1XN9A 3VAIA 3UCZP 2MKJA 1JJ2R 2E5GA 3TP2A 2HVZA 4IOCQ 1U1PA 3LPYA 2YH1A 2RRBA 2CQ2A 5LXRA 1M5PC 1VC6A 1VQ8S 2J0SD 1HL6A 4IO9Q 2CPHA 2DGTA 2CPYA 2K3KA 1SJQA 4PR6A 5GAHU 2F9JA 3RW6A 2D3OR 2FHOB 1WG1A 2KFYA 1Q7YT 2J8AA 2XSFA 2AYGA 1QM9A 1DZ5A 3CCVS 1WEZA 4C0OC 5D77A 4CH0S 3VAGA 2G4BA 4RU2A 4QQBA 2KYXA 3EX7B 3J7YU 1X4EA 3P5TL 2KU7A 2DHXA 4YUDA 3TYTA 1PGZA 3MUVP 5LJ3Y 1WHWA 2X1GA 1VQLS 2MSTA 4WFBQ 2LXIA 3I56S 1X4BA 2CPZA 1U1NA 3FEXB 1VQKS 4W92B 1FHTA 2XS2A 1JMTA 5HL7Q 2CQ4A 3VAFA 2MKCA 2MHNA 5H1SV 3MUMP 3D2WA 3Q2SC 1ZZNA 4TU8A 1FJEB 2DHAA 2MKKA 1OIAA 4P6QA 3CF5Q 1O0PA 3MOJB 2ZJPQ 4IOAQ 2CQGA 3CC4S 3MD3A 3VALA 2DNQA 2DITA 1D8ZA 1M5KC 4YOEA 5LJ5Y 2LEAA 5DDOC 5DDPC 1UW4A 2MQMA 2BZ2A 2LQ5A 2O3DA 1PO6A 2QFJA 1A7GE 2FPHX 3RW7A 2MQQA 2V94A 3CTRA 2M88A 3BO2A 3THPA 2LKZA 2LEBA 2RS2A 5IM0A 1X4CA 1BY9A 2SXLA 4Y0FA 1Q82T 2XB2D 4FXWA 1OO0B 4ED5A 2DIVA 1QVGR 2FY1A 2LMIA 3EGZA 3B4DA 4C7QA 2VOPA 2OIHA 3G96A 2DH7A 1WHVA 1H2TZ 1YWXA 2Q79A 2KH9A 1U1OA 3CMAS 3BS9A 1P27B 2CPIA 3MI7X 3G71S 2CQHA 5DETA 5IM0B 2NLWA 3LQVA 3HHNB 1NJIT 5HO4A 2D9PA 2AYMA 2MKSA 4Z2XA 3CCLS 2OTLS 3P6YC 1SJ4P 2MKHA 2QA4S 1FXLA 2E44A 2DISA 4M5DB 1QVFR 1HA1A 2MKIA 2LXUA 1U6BA 1G2EA 3DXBA 1YHQS 1VQOS 2FC9A 1K73T 2MJNA 4WIIA 1SXLA 2EVZA 2D9OA 2DO4A 3G8SA 4CH1A 3IWNC 4OZ1A 3H2VE 1KD1T 4Y00A 2MY8A 2N7CA 5GAGU 5IQQA 2N82B 2MSSA 4LJMA 3CCJS 1WI8A 2RQ4A 5FJ4A 4LIRA 2QEXS 2KT5A 1ZZFA 2CQDA 3MURP 2HGLA 3SXLA 1VC5A 3I55S 5CA5A 1K9MT 2MYFA 3EGNA 3S01A 1ZH5A 1IQTA 3US5A 3MDFA 1H6KX 2CQBA 3VAMA 1WTBA 4F25A 2JRSA 2M0GB 2MZRA 5CYJA 1W2BR 3CCMS 2MMYA 5DDQC 4LMZA 1N88A 2YKAA 4QU7A 2HGMA 1U1KA 5LSOA 1DRZA 4ERDA 2AD9A 1N52B 2XS5A 3DLLQ 5CXTA 2KI2A 2LCWA 2KN4A 2WBRA 2DHGA 2XNRA 1OWXA 1UP1A 2LA4A 2MQNA 1WEYA 3UD3P 2X1AA 2UP1A 3CCQS 1RKJA 3G9CA 5EN1A 2YH0A 3H2UB 4BS2A 2MB0B 3MD1A 4UY8T 1WEXA 2KRRA 2KG1A 2CPJA 4TLQA 1X4DA 4WF9Q 2MY7A 2RT3A 1WF2A 2F9DA 3VAKA 3G8TA 1X4HA 3G4SS 2MZSA 2MPUA 1N8RT 1FJCA 2E5HA 2LA6A 2YTCA 2OTJS 2RNEA 3ZZZA 4CQ1A 5IFMA 1U1LA 3VF0B 2EK6A 5LXYA 1KOOA 4UQTA 2CQ1A 2B0GA 2DH9A 2MZTA 1FNXH 2OSQA 1N54B 1X5PA 1JJHA 2GHPA 2M70A 1U1RA 1D9AA 2RU3A 4PKDB 1K8AT 2J0QD 2DNPA 3CCUS 1X4FA 2E5JA 1M1KT 2DGOA 3NNCA 3R1LA 2MGZA 2HZCA 1R8HA 2M4MA 1S79A 1VC0A 1FO1A 2DO0A 2CPXA 2XNQA 1X0FA 3NNAA 4FXVA 3CCRS 2X1BA 5BJRA 4TU7A 2DH8A 2CJKA 4YB1P 2M2BA 2KM8C 2VODA 3S6EA 3PIPQ 1YJ9S 4QPTA 2ADBA 1VQMS 3CPWR 4EGLA 2M7SA 1U1MA 2VONA 2KVIA 1AUDA 2DNGA 1VQ9S 4ZKAA 2DNYA 2EK1A 3NS5A 2KG0A 2XS7A 3J7ZT 5DM7Q 2DGWA 1WELA 1F9FA 4U67Q 1X4GA 1URNA 4C4WA 3PIOQ 2N3LA 3BO4A 4CIOA 1VQPS 2VOOA 3JB9k 2K8GA 1NO8A 1M5OC 2DGUA 1A9NB 5JVGQ 2DNZA 2JVRA 5JVHQ 1HD1A 3U1MA 3UCGA 5MLCV 2HYIB 4WKRA 3CCES 3THTA 2I2YA 2DGVA 3CMES 2DB1A 2BOPA 2J76E 3HI9A 1WWHA 2DNKA 1VQ7S 2ZJRQ 2JVOA 2G0CA 4F26A 5ITHA 2RUGA 3N9UC 2YWKA 2ERRA 2U2FA 2MZ1A 5DDRC 1YJWS 2MJUA 2MZQA 1H2VZ 5GMKa 2CPEA 3NNHA 2CPDA 2DIUA 2JX2A 3V4MA 2L41A 2X1FA 1L3KA 2ZJQQ 1KC8T 2AYBA 2DGSA 1CVJA 1KOHA 2CQ0A 2KXHA 2AYEA 1VBXA 3CD6S 1WG4A 3BEGB 2MGZB 2RQCA 1SJ3P 3S7RA 1VQNS 1VQ4S 3SDEA 2LYVA 3Q2TC 1HD0A 1VBYA
chains in the Genus database with same CATH superfamily
1S48A 1CJKA 1SKUB 2OD4A 4RUBA 3RGIA 1U6ZA 3D6HB 1KHWA 2VZ9A 1U2FA 4KHMA 2MXYA 3P49B 2EI5A 3CW2C 4ZVSB 3EXYA 3CULA 2D3ZA 1RHKB 2LQ9A 1KTVA 1UVIA 2MDAA 1VMBA 2NZCA 5T41A 1LXNA 2QL9B 2HHTA 2M5YA 3KDNA 2VKZG 1NHUA 1P1TA 3D66A 6AT1B 2V34A 2VPWB 5KFSA 2DNRA 4MK7A 3QSIA 2XC9A 3T9ZA 2OPQB 1J27A 3V6KA 4X65F 3W9HA 4B3MJ 1UTAA 5GAEI 2OJ3A 3TAPA 2EW9A 3D9BA 3TAQA 3EYZA 4V19X 2YPZA 1UAWA 1B7FA 3BQ2A 5T7LA 4M5HA 2I6WA 4DX7A 4NZ6A 3KHRA 1Y7PA 4J9MA 4ECRA 2QLJB 4IRKA 4DUZJ 5E0OA 4YB6A 2DNNA 3CXCR 3CUNA 2EKNA 2M9KA 1HR0F 3IFEA 5ETTA 1FT8A 1U0HB 2PN6A 4DF8A 2QFIA 4B17A 3IMQJ 1CC8A 1SI9A 2KHCA 4IUFA 2EG1A 3BPSP 3JQMA 2OSRA 2B7CB 1DFDA 3MAQA 4OHXA 3OJUA 2CQIA 2OAUA 3N4WA 1H98A 1WJ9A 2JWNA 4R0EA 1BD6A 2GAHC 1X5TA 2J9EA 4F7VA 2IVYA 1TAUA 4NLSA 3HVTB 3LGHA 2AV5A 2RKIA 1KQSR 4M94A 1IKVB 1CSJA 2E5IA 5GAEU 3SI8A 2R3VA 2V63A 3RRKA 3UNGC 4YFUA 4O0IA 4DXLA 2IA6A 4WYLA 3DMJB 2RSQA 2BE7D 5IWAF 1ZM4A 2AJ0A 2ZKTA 3JSBA 2VFSA 4DJBA 3SCLE 3NMAA 2F8MA 2CRLA 4R5PB 4P2SA 5J2QB 2U1AA 2DY1A 2R7UA 3W61A 5IT0A 1NSKL 1FD8A 3CJ8A 3CO0P 3G82B 4USVA 3FGVA 4O0NA 3UDCA 1Q4RA 3VVUA 1XEZA 2BMBA 3W64A 3MR2A 2B4OA 2IYGA 4E2FB 4A8XA 6FD1A 1JXVA 5GVQA 4I6AA 1C0UA 1H2UX 3NY0A 4FP9A 2XBPA 5A8RA 3T3FA 1S72S 2R42A 5KOXA 3JS9A 1UJ4A 3SDEB 2ZH1A 3R5DA 3TO8A 4U7UD 2DHSA 3ZZPA 1WI6A 3PG9A 3Q23A 2B5JA 2VFRA 1U0SA 2GVDA 2XLIA 1JX4A 5HQMA 1UFWA 3B4MA 4JYAJ 4H4MA 1L5UA 2CPFA 3SQGB 2LDIA 3QATA 1SH3A 4EBEA 3D28A 3V6DA 3P96A 4IRCA 3KDOA 1TL1A 3GG1A 4P9SA 2OFHX 2P6SA 1T3NA 2M8HA 4JI8J 5FD1A 4QW9A 5K8MA 1T94A 1VRTA 2AJFE 3MECB 4LSZB 4OX6A 3O3LA 1SJFA 3LP2A 3HJVA 4OJ1A 4U7CA 3OTCA 2PEHA 2G2ZA 1EKRA 1P1LA 2DXEA 2DNHA 3SEOA 3J81U 3E51A 4XIUA 1S1XB 4OIXA 4LF1A 3PEHA 4ICLA 4RW4A 3P3DA 5EX0A 5DLGA 1URNA 2MQPA 3WBZA 1KVKA 4GVLA 4FXDA 4QU6A 4ZPVR 2NSBA 3DCAA 2L3MA 3UFCX 2HQCA 4X66F 3Q22A 1HI1A 2MQLA 2RD5C 1B3TA 2IBKA 3KG1A 1MN9A 2HFZA 3UCZP 1JLQA 2YQ0A 4IFYB 4MMOA 1N5QA 3ETOA 2XG8A 3C66A 2HNDB 2RKIB 2BM1A 4JI3F 4HHHA 3WDOA 3M9NB 3ISNC 2PA8D 2HK2A 3GB0A 4ZCIA 3LPYA 4M5GA 2YH1A 1JNZB 1F9EB 1T02A 1JNRB 4N76A 2RRBA 2E1RA 1Y11A 4MKAA 5L46A 2BVZA 1VC6A 2OH2A 2C3YA 5EUHA 2VG6B 4NL5A 3G82A 3T1AA 5IT9Y 4GVBA 2CPYA 4DOZA 4YY3F 2K3KA 3GFZA 1IKYB 3A13A 4PR6A 5AJ3J 1ZM3A 2F9JA 4PPZA 3VGVA 1FFSB 1CJUA 2Y3YA 1RGVA 3O8WA 1B4SA 1KRPA 3CE8A 2QV6A 4FF1A 5J1PA 1FD2A 2R7VA 2BQ3A 4ZDNA 1MU2B 2IPOB 2IM3A 2AYGA 2NS1B 3W65A 3VAGA 1TMJA 5D77A 1C0TA 2V9KA 1IKXA 3PYGA 2B8QA 1NPRA 5D4OA 5IOLA 2F4VF 4AD6A 4YUDA 2CWKA 1HBUA 1PGZA 4OHYA 2MKYA 5LJ3Y 3PW2A 4DV6F 3MR3A 2ZUGA 1QJHA 1VQLS 4NLOA 2UUCF 1RAIB 3I4HX 1W26A 4JI8F 1FKOB 3CCZA 2DVIA 4EFAC 4CO0A 3GONA 4K2XA 1RWPB 1X4BA 4DR5J 5J2MB 1R0BG 3W5XA 3CDAA 3T5KA 2WSCC 3GILA 1RWKB 5E3RA 5IC6B 4ZHRB 1TKTA 1RADB 3MMBA 1Q79A 4P52A 4W92B 3CJKA 4NCBA 3K89A 5HROA 4J91A 1RSCA 1YQHA 4XDCA 5J2PB 3QIPA 1JMTA 1U8WA 1H3DA 3BF4A 1S59A 5HL7Q 1N36J 1XMBA 1KONA 2MKCA 3O1LA 4WXOA 1CLFA 3H98A 4J7CA 1CQNA 1XQIA 4YP3A 1XK8A 1S9FA 2POKA 3FCVA 4KRWA 2CNNB 4CO3A 1FE0A 2VPXB 3CGIA 3HFZB 4OFZA 4TU8A 1BQNB 2CKWA 3QRPA 2DHAA 1Y3KA 2HPUA 2VL1A 2VQFF 1OIAA 3QNWB 2IJNA 1IKWA 4KKOB 1VIXA 3FBBA 5IS2A 3N6MA 3MOJB 1M1HA 4FPRA 2CQGA 3X3UA 5KG1A 2BE2B 2ZH7A 3NXZA 2DR5A 4IOAQ 3PTWA 2JL9A 5J1NA 1QAJA 4MYUA 4CNYA 4YR0A 2J7UA 3OHAA 1JXEA 1T9XA 2DR6A 4O4GA 4WP3A 5LJ5Y 2O67A 1UW4A 2MQMA 5DDOC 3TZYA 1X9SA 4WFYA 1ZA2B 2O3DA 1PO6A 2R8GA 5C2GA 2FPHX 3N6LA 2Q66A 1WACA 2MQQA 3KUGA 3A8KA 4G1QB 1HPZB 2QRRA 3CTRA 3HFVA 1NDCA 2R7TA 4DQIA 5HVHA 3THPA 3TZWA 3KLHA 4IR9A 1N0UA 4HI2A 3PFOA 3QIDA 1X4CA 5BYQA 4JI6F 1M1GA 5IM0A 4HDHA 1UETA 3HD2A 1HR0J 1XNQJ 3VTIA 1VHIA 1Q82T 4CM0A 3L7OA 2HG4A 4M5NA 3NGUA 4FXWA 2WVBA 3C2PA 2ZDOA 3AA8A 4ED5A 3W7BA 2AJ1A 1FJGJ 2BRLA 4Y2KA 4EMDA 1TKXB 1QVGR 1HNZJ 4C11B 2MTLA 1JWWA 4DU8A 4C48A 1BE4A 2CA9A 2ZC4A 1Q8KA 4E98A 4CM2A 3TZZA 2VOPA 3G96A 4B3OA 4O3RA 1WHVA 2YQ3A 4BC7A 4B3SF 3CMAS 3VGTA 5HATA 2C3MA 3QT7A 4DR7J 1F5AA 5KT6A 2VFVA 1XR6A 1PYTA 4USUA 5DETA 4A8FA 2ILZA 2KT3A 3R6GB 4LSNB 2AJ4A 4Y34A 2HMIB 2PD1A 4ECVA 3QQCD 1AUSL 2FIUA 4Z2XA 3NL0A 1JLGB 2ZE2A 3JSYA 1SJ4P 2J9DE 2MKHA 2QL5B 2QA4S 2AJ2A 2P6TA 3AD8C 2F1FA 2DY9A 2E44A 5E3AA 1UVNA 2GMLA 1W25A 2K7KA 2ATCB 3IXQA 4C8KA 2Z57B 2FHJD 4OX8A 2HFUA 1FDAA 4N56A 1N33J 4DCOB 4QPXA 1IBKF 2MKIA 3CJTA 2Q6BA 3IM9A 2OPQA 1G2EA 2I1RA 1EHWA 1PAEX 4H54A 3JAMU 4I2PA 4NI2A 4KPCA 3MMAB 3HD1A 1NK0A 4U7UK 1RHMB 2APOA 1SL0A 2D9OA 3PJXA 2CJXB 1WKKA 2IIHA 3HFKA 4CH1A 3GLJA 1RT1A 4OZ1A 4Q7AA 3T1YF 4Y00A 1QD1A 4F4XA 3RB4A 2PDAA 3DRRB 4A8MP 4X4RA 2QZ8A 2N82B 2VHGA 1WUUA 3QGGA 4DPYA 2KL8A 4IG3B 3BSOA 1JLBB 1N0VC 5ETNA 5FJ4A 1JLEB 2CIMA 3Q89A 4LIRA 2KT5A 1TTHB 3QZ8A 1UEKA 1R89A 1N5SA 2XWXA 4OI3A 1RDRA 1RBAA 4MKBA 4QIFA 4CH7A 3QGIA 3E01B 2WHOA 2YKMB 3BGRB 4UUXA 2CWXA 3HHDA 4J9RA 5B08A 2RHSB 3US5A 4X66J 2HVIA 3WIVA 4LBHA 3JTPA 2VG7B 3OFHA 1LKZA 3DKDA 4EYIB 4A8SA 2DBBA 2XY7A 2R2SA 4NRTA 2BUNA 2QN6B 3Q8PB 4NXMF 2M0GB 2NYIA 4PQAA 1CG2A 5KFAA 2MZRA 5CYJA 4CYUB 2W8LA 3N79A 5A2QU 4K5RA 4OI1A 4XAKA 4R8UB 2WVDA 4PQUB 1JLFB 2OPSA 5LT5A 4YQWA 1N4LA 4P2MA 4DPWA 1REGX 2GCFA 1DRZA 3QIPB 4ERDA 5LMNF 1MROB 2AX1A 3IC1A 4O3OA 1N52B 2YWHA 2XS5A 1I6JA 1WORA 3CCTA 1J5OB 2NXCA 2L48A 1VIOA 3DRYA 2KN4A 5F8HA 3MM8B 3FBCA 1RISA 3D6FB 2WW4A 3VZHA 4CLPA 5AXLA 1WEYA 4PABA 4ES3A 3S1TA 4IQXA 3ET6A 1S9GB 1RCOB 3CCQS 1RKJA 1QUVA 2UUTA 3GV5B 3GV7B 3OFFA 5D6GA 5ETMA 3DOKA 2P5VA 3JQJA 1EAYC 5DO2A 1RYSA 4OYXA 3BSNA 2RH3A 3QGHA 4KBIA 1F9HA 2GW8A 3IN5A 4DV4J 4RWXA 4RLEA 2QGFB 3IP0A 2HQDA 2HWTA 4OZJA 1HWKA 1MLAA 2RT3A 4HEA9 4R8UA 1D0EA 3G8TA 2VJVA 4ANCA 7AT1B 3H4BA 2Q6CA 1X4HA 5HQ8A 2F5GA 2RDJA 2PT0A 1SC6A 3IWXA 4PYDA 5L38A 2MPUA 1N8RT 1UZDA 2E5HA 2WW8A 2YTCA 3LTOA 2WZ1A 2KB2A 2OTJS 1LQ9A 2RNEA 2R8JA 5CD4H 3VF0B 2EK6A 1OYEA 5E41A 4TVAB 1IKYA 3SQOP 2C2RA 2HAFA 5KFTA 1FNXH 1OQ3A 2OSQA 1VLYA 5B09A 1APSA 1DQAA 2GHPA 2P9CA 2YX4A 2Z2YB 1T05B 1S0OA 2OPRA 4QR0A 3TAMB 4Y28C 1JXLA 1G7CB 2DR7A 4PKDB 3F73A 3M05A 2A6MA 2RE1A 4OZNA 4ZVRB 2V2ZA 4X84A 2XSJA 1K8AT 3O6QA 1ZS6A 2NPFA 2HNYA 2DNPA 2UV8A 3CCUS 4ZPCA 3OXGA 1BQXA 1HQ2A 3MECA 4JI2J 5H9EJ 1OS5A 4OV1A 3DRSB 4YB7A 2HZCA 1HNVA 1R8HA 2HVHA 3EMTA 3MR7A 5HMZA 5AXMA 4ECWA 1D1UA 2YNGB 1FO1A 3HCXA 4JI5F 2DO0A 9RUBA 5I4MA 2YNFA 2CPXA 3RU0A 3FQLA 1SUQA 4FXVA 4RR5A 5ETQA 1NB2A 2DRDA 2QA2A 3M2UB 1SB6A 3CJQA 4OX9F 2FDNA 4CTAB 2DH8A 2RDDA 2XZDB 4CZCA 4TU7A 4OLPA 3QMQA 1Q78A 2VJUA 3LGNA 1PCAA 4DX6A 1WC3A 1YJ9S 4QZVB 3I87A 2MEWA 3PDNA 4YR3A 2LP4A 1WD6A 2QL7B 1VQMS 4RW7B 2YKQA 4YN3B 4ENOA 2M7SA 1DJ0A 2V4JB 3OFEA 4IG0B 3EDQB 4PG5A 3JXOA 5I3UA 3HHKA 2B9XA 2B3TB 4KC5A 4ZP7A 1VRTB 4PYAA 3DLJA 4G3IA 4K8RA 4LT6A 2XS7A 4QOTA 4W4MA 3I0RA 4USHA 1U49A 1R0CB 1X7VA 4RU9A 3J7ZT 1FKPA 4NLTA 1NRKA 4C0BA 4RW6B 2DGWA 3RTVA 4CLKA 4QWCA 5JMNA 2ZC3A 3BYPA 4OZ5A 2XMUA 3DRXA 2HQGA 2IRUA 4QIVA 3VWSA 5HANA 4BC9A 4CIOA 4JI4F 1T11A 5IQ6A 1XNRF 1W7WA 3Q8QB 4OHWA 4ECQA 4J9VA 4DI6A 4A46A 1JLCA 1NO8A 3C14B 3IM8A 4DR3F 3MGJA 3MM7B 4MTPA 1Y3JA 1UWAA 2EG2A 4FZVA 4JP8A 4Z7CA 2DNZA 4LFAJ 1T0TV 5A76A 1YX2A 4NLUA 3BH6B 4DHVA 5K14A 1T7PA 4M95A 4CLWA 1RT7B 5DGAA 5KFBA 4WKRA 1MU2A 2I2YA 4F67A 3ISND 3LF0A 2DGVA 3OQ2A 4N5SA 1TUWA 2RJZA 3M6UA 4MKVA 3FQKA 2KHDA 2RRNA 3A4TA 3ISZA 2R8IA 2XZWA 2KZMA 3OTEA 2YKOA 4O3PA 3GR1A 1QLNA 4X64J 2ASYA 1U09A 2J76E 2WVFA 4Y2AA 2ZHBA 1WWHA 2K2PA 3WIUA 3K59A 4GVBB 3GFHA 1B0TA 4LSLA 4Y2MA 3OLAA 4ZLPA 1GEHA 4URGA 2HS4A 2RUGA 1HNIA 3UI3A 1KQKA 2B9EA 5KFFA 1UVMA 1VQYA 2HIYA 3CDEA 3MCOA 1HMVB 5E3PA 4ECZA 3HMJG 4DL5A 1U48A 4LFCJ 5DDRC 1FDDA 1Q5YA 3G8QA 3BQ0A 2KVQE 1H2VZ 5GMKa 5H9EK 4B3RF 2CPDA 2DIUA 1S1TB 1V3SA 3R6LB 3DGPB 2L41A 3PYDA 5JXSA 2X1FA 3KK2B 4B9NA 4ZVGA 3EICA 2ZJQQ 1H38A 5LMUF 3VVTA 4FF2A 1UPMB 2YKNA 5DRKA 3IBFB 4DV5J 1P9QC 4MAKA 4NYPA 4ED8A 3FFIB 5I3QA 2PI5A 1Y5LB 2CQ0A 3D3CJ 5DGBA 3GR0A 1VBXA 3DNCA 3LGMA 2I0XA 5FLXU 2I8EA 2ABYA 2AWZA 2RQCA 3SFGA 2BANA 4JV5F 3LOUA 1TP7A 5CHCB 4FNIA 1YDLA 3SDEA 5LXRA 4RW8A 4FBUA 1HD0A 4G6VB 1FXLA 4KO0B 4WFNQ 5C25A 4FS1A 4GMKA 2WONA 4P2XA 4PCQA 4WTOB 1RAGB 1SJ1A 1CJVA 2E5LF 3ZZUA 2ALYB 3OBIA 1HQEB 2BX6A 1FDBA 3P45B 3M30B 2MQOA 3OW2R 3QYYA 1Q86T 2PO4A 3H25A 4FNHA 3KG0A 3U1LA 3NKYA 2N3OA 4CLTA 3KJVB 4WFZA 5A6PA 3OVBA 1R0AB 4YS2A 1GXLA 1FDNA 2YKNB 2ZH2A 1T03B 2UU9J 4HKQA 3S8SA 2I38A 4OI0A 2QMWA 2IM0A 4NOHA 4DV5F 3SV3A 4TY8B 3SBMA 1YZ7A 1VOMA 3NCPA 4L6V3 3EM1A 2H1YA 1YJRA 3H0PA 2HGNA 4WCEQ 2L9WA 4TY9A 2KXFA 3KMSA 1SH0A 3ZZTA 3MM5B 3CJ5A 4QIWD 5HMYA 3PHTA 2ZOMA 3FDSA 3O5TB 2ZH6A 2UXDJ 5M2RA 5D78A 2J7WA 1F0XA 3RBEA 2HMIA 2C2NA 3CIZA 3IAS9 1AT1B 4DQPA 2DNOA 3BJYA 3TZXA 3HVAA 1GMWD 4LF4J 1RT6A 2DGQA 2ZM6J 1IWGA 2XGQA 3M1VB 3CCSS 2RVJA 3HT0A 5HVFA 3PW5A 4B9VA 1DTTA 1SL2A 5K8PA 3RRHA 2Z2ZA 5CABA 1E6YA 3JQKA 1HLWA 4X64F 2BEFA 1S1UB 1WC4A 2C2OB 2OEKA 2NR0A 5HVGA 2AEFA 3VCDA 2GIQA 2V8DA 5KFKA 2GA7A 2YY3A 3SCKE 3R2DJ 5MAOA 5LM7E 5L39A 1KVIA 3VGUA 4Q8EA 2V4JA 1RTZA 1LFWA 2VH7A 1X4AA 1U2CA 2RU9A 3MM7A 1PILA 4OZ0A 2JSXA 4URSA 2W25A 4FS2A 1L3UA 4JI7F 2IDLA 4N7TA 1CJTB 1R43A 1XERA 2D69A 3CEDA 5KFXA 4Y2IA 3UDVA 4C3LA 2HHQA 3RAMA 3GCXP 2HBRB 3RG6A 4CO5A 4NX9A 2FC8A 4WK3A 1E6VA 2G2OA 1S1VA 4OLOA 1YITS 1YJTA 1TKDA 4JI1F 4G1QA 4TU9A 1ZOTA 2G0JA 4F3QA 1M5VC 1WDDA 2HFOA 4PRFA 2MZJA 4U96A 3UN2A 3TQEA 5DG9A 2V8VA 3ZZOA 2WVCA 1XC9A 1IBLJ 2BKNA 1FWLA 3HHLD 3PW4A 4RW9A 4TNOA 1DURA 4ZCKA 4DLEA 1ACMB 3VAHA 1AYEA 2XMMA 3MAAA 3D5MA 2QLFB 3BKFA 1X60A 4EBDA 2UUCJ 1YTYA 3MCMA 1A0OB 1Y00A 2F8EX 3AOAA 3KLEA 1W2IA 5A8RB 3D3BJ 1FJ7A 3G6ES 4C6AA 1HARA 4M5JA 1Q0NA 4I56A 3CSKA 5B0AA 3MMAA 3UR3C 1NJYA 4HR2A 4LVNP 4DL3A 1S1WB 1BUXA 1VRQC 2AW0A 4LF7J 3NOCA 2E5LJ 4QR1A 5AE3A 3FSYA 4QJVA 4UQGA 1KNZA 4PWUA 1WHXA 1O5JA 3TVYA 2R2UA 2GX8A 1HHQA 4X4UA 4JI5J 3VQTA 1S1TA 3KLVA 2IMOA 2C2EA 2ZM6F 4F2RA 4UT4A 4NLQA 2HVZA 4IOCQ 5IZHA 3M8PB 4DBQA 3FKBA 1ITPA 3PV8A 1TK5A 1ZPVA 1RA7A 1UEVA 2O01C 2XSJB 4F3OA 1ZM9A 4PG4A 2CQ2A 5KFPA 4RUCA 1M5PC 4LVOP 3QLHA 2DRAA 2EFQA 2VF3A 2BXJA 4C2MA 3LANA 1U26A 2CVEA 4WE1B 2CPHA 2DGTA 1S5ZA 2XYHB 3ENAA 2F40A 2GGPB 1EZZB 3M8WA 5G4DA 5HMWA 2W9CA 3GSIA 1IKXB 2HEKA 5GAHU 2GV1A 2D3O1 3MEGA 1QSLA 4I67A 2ZH5A 3RW6A 4WP9A 1KTQA 1NSPA 3RBZA 1N6QA 2JOQA 3AH6A 1KQGB 1YJUA 3N01A 4NLVA 1FE4A 1HQUB 4PXEA 1XIQA 5KT4A 3PVXA 2Z58B 1RUSA 3BPDA 2BYCA 1R8CA 5B0BA 1Q7YT 1S9EA 4UY85 5IT9U 1MROA 1QM9A 3MF5A 4GC7A 3OL9A 2XYGB 3AHPA 2E7VA 3P8BB 2ROEA 4GKKJ 4ALZA 2OPSB 2KYXA 1TKZA 2YX1A 3CD0A 3DYAB 3P5TL 3PHEA 2NUHA 4PG6A 1S7HA 2ZOFA 3J7YU 2VUGA 4LF2A 4M8LA 3OL8A 1URRA 3TYTA 3GIJA 3MUVP 1ROFA 2BM0A 2OLWA 1WHWA 4CLFA 1RAFB 2X1GA 3DOKB 4IG0A 3PKMA 1VS3A 1FVQA 4WFBQ 3OLBA 3GG0A 2CYYA 1OY8A 1N32F 2GJIA 2K1RA 4HTJA 4JUZA 5KFRA 2CPZA 5T7LB 1VRUA 3HVRA 3TRGA 4V19J 3F44A 5D4PA 1MSWD 3FSXA 1VQKS 3AJ2A 2A18A 4LRFA 4QIEA 4ED2A 5HSPA 1FXRA 2H5JB 1JLEA 2QG9B 2J6SA 1S49A 3MM9A 2W9AA 3DRPA 4LRBA 1EP4B 4DSJA 4ECSA 5FIIA 1HNVB 4FYXB 4WXWA 4AQYF 5H1SV 4J37A 3V6HA 3I5BA 3AQOA 1DLOA 4WP8A 1R7IA 4LFCF 2V8PA 4Q8FA 2GHVC 3K2YA 4F4ZA 5AT1B 4XPEA 4AFFA 4A8KA 4X62J 3LP1A 4P6QA 2EFGA 4LBIA 1TK8A 2JDJA 1O0PA 2WBMA 3I82A 3MFHA 1FRJA 3J7A1 1HBOB 4Y2CA 3DN9A 3MD3A 5A8WB 3VALA 2DITA 2PC6A 1D8ZA 1M5KC 4YOEA 3SZ2A 5KFOA 1XMQJ 2FHJA 2YWEA 3W60A 5L1JA 1TUGB 4ILRA 2DTJA 3KLFB 2FHMA 1FKOA 3BZQA 2HZVA 2QE5A 2QFJA 4DUYJ 1A7GE 4WJBA 2VBWA 3QT8A 2BV3A 3RW7A 5RUBA 2BR0A 4Q0BB 1UEUA 1FA0A 2V94A 1L3VA 2R2RA 3NRBA 2OUGA 2Y8YA 1DTQA 3GQCA 3DYAA 4K4UA 2DXDA 1FFGB 4NA2A 4R0JA 1BY9A 2W2MP 1NXIA 4EZ6A 2WOMA 4Y0FA 4DV7F 3GMGA 1SKWA 4KPYA 1DARA 1IM6A 1NH8A 1H0HB 3OJSA 2FGCA 3PCOB 4PZVA 5EWGA 1GAOA 2BJEA 3NGTA 2FY1A 2LMIA 2VFTA 1J2VA 3ENVA 1AW0A 4WU2A 2DH7A 4RPFA 4CT8A 4E0DA 1C1CA 1YWXA 2CNKB 2Q79A 3LPEA 2KH9A 1T9WA 1U24A 3LUYA 4FYVB 4JBCA 4RNMA 4OI4A 3NCQA 1IXKA 1GK8A 3G71S 1XR7A 3DHWC 2B9WA 2NPIA 3KFWX 3QLHB 4HACB 2HHVA 2HHPA 2ZD1B 2R4FA 3R5GA 1D3WA 3LQVA 1Q16B 3DOLB 3CJ3A 1I94J 3IR7B 2PI4A 1FWPA 4GRSA 2QA4G 5J2NB 1I94F 1SH2A 3RYLA 2MKSA 1I3OB 2IBOA 1REVB 5GMEA 2OTLS 1TL7A 2QO3A 1B64A 4DR7F 4CO2A 4MKYA 2ACMA 2VDHA 2DISA 4NEZA 2UXBF 4M5DB 2JNJA 2CG4A 3IBWA 2PFDA 5KT3A 1KFDA 3VZIA 1LK5A 5IXUA 2ZH9A 3OXFA 3H40A 1HBOA 1VJWA 2GJFA 4U8VA 1U6BA 1QTNB 4LRDA 4M5LA 4KV8B 2QX0A 1RBLA 2FC9A 2ZZTA 5LSRA 4DSFA 3M2VA 3FRYA 1SXLA 2O66A 2B8PA 2EVZA 5FDLB 1H73A 2DRBA 3PO4A 1CC7A 5KFMA 2I5JA 2LQBA 2HNZB 4Q5VA 3V81B 4Q2MA 3OTBA 2XMWA 5JJBA 3HSZA 2WONB 3CCJS 1WI8A 2RQ4A 3H2LA 4K4TA 4KO0A 2PMHA 3DLKB 5K9FA 2F63A 1S10A 1TQLA 2Z30B 3QRQA 4C8YA 1TL1B 3ILJA 1XMOJ 4DUYF 5DG7A 5D4LA 4ED6A 5KG5A 1TL3A 4F50A 2CQDA 2L9NA 4I2PB 4NI2B 2C2KB 2GO8A 3C6TB 3SXLA 3OL6A 5CA5A 7FDRA 1Q8BA 3JYTA 2RF2A 1HKAA 1Y0HA 2K06A 1ZH5A 1IQTA 2LLZA 2E1MC 3MDFA 2Q43A 4K7QA 3M8RA 2CQBA 4ZVQB 4CLUA 4P73A 1K0TA 3KK2A 3Q8VA 1WTBA 5DS7A 2QYGA 2VPYB 2ZITA 3FNNA 4BWMA 5HI7A 4PWWA 1W2BR 4O44A 1U4BA 4G1PA 3NBPA 1R6YA 3TUJC 1NZ8A 1R27B 5CD4A 1RWVB 3NGRA 1N88A 3TJ8A 4XPCA 1FKAF 3DLEA 4QU7A 2HGMA 3K58A 4I2QA 4ZLJA 2XY5A 1J5EF 1N36F 4IOBA 2NYHA 2H51B 1JLAA 4OJ3A 4XO0A 1IBMJ 5AXNA 1T9TA 2G13A 3FC9A 3GJQB 2YKPA 5CYQB 1VHFA 1EARA 2KI2A 2LCWA 1WKLA 2WBRA 2OO4A 3LH2S 2DHGA 5GMDA 4EUVA 1C1CB 1UL3A 1N34J 2WRMA 3H59A 2MQNA 1GFWB 5KG3A 2R9LA 4RBTA 1N34F 3IRXB 4IDKB 1GMVA 2UP1A 3DOMA 4WPAA 1HBMB 3G6XA 2EFVA 3L7UA 5LL6d 3KTQA 3H2UB 4DR4J 4UY8T 3BN7A 2JFDA 3KJNB 4NA3A 1HBUB 4I6WA 5F8JA 3PX0A 3DI6B 2KG1A 2CPJA 2ZVIA 3L09A 1QAXA 1AFIA 2OELA 5E5NA 2BACA 4L3NA 1KSPA 4WF9Q 2KZZA 3MM5A 1WF2A 2F9DA 4K4SA 4NXMJ 1F5CA 3TUIC 4RX6A 3AQPA 3AD9C 4ZS6A 4GKKF 1CEZA 3BR8A 1RBOB 1FJCA 1NEEA 3SSQA 2V0NA 3A3PB 1G4CA 2V50A 5HLFA 3IBCB 1NPPA 2AEJA 3HKWA 4BBYA 3DM2B 3KKFA 2BBEA 3TA2A 4UOGA 2B0GA 3EVMA 4I1TA 2NXNA 1SCJB 4NYOA 1CS4B 5CZXA 4ZIVA 4RZRA 1XMOF 1FKPB 4QIGA 2JFKA 3ILOA 5KFIA 2M70A 2Y1IA 1U1RA 2RU3A 4OMFG 4ZP6A 2C3PA 2R7WA 5HAOA 1S1XA 3CVKA 3PO5A 3NGDA 3I32A 3QO9A 4DX8H 1K44A 2PEBA 4DR2F 1T8EA 2A0FB 4ECYA 1CBKA 1VYAA 3NBPB 2LDYA 2OGUA 2OD6A 1YRTA 2CNOB 1RT3B 2M4MA 3P5BP 3OUYA 4JI3J 3BN4A 1IVZA 3W1YC 2YBVA 2GC8A 2O5DA 1IBKJ 4MIBA 4KY3A 1RI7A 3CCRS 3GTYX 2BKPA 3MFIA 2EWHA 4LF9J 3HPOA 4NRUA 1VFJA 3KUEA 3OFGA 2W1BA 3K17A 4HT7A 2BJDA 2VC0A 2VKRA 3AB4B 4LQ9A 1KWMA 2ADBA 2HLUA 3DRSA 1VBYA 3BKUA 4ITSA 4EGLA 1YKWA 1HMVA 5E7OB 4KYZA 1KFSA 2ZEJA 2GQ2A 3DLBA 2JEIA 4NYZA 3BQ1A 2J0WA 2IRXA 1WC6A 3JTOA 3WQPA 4DU7A 3GYNA 3RJMB 2OMLA 2C1EB 3NS5A 2KG0A 4OI6A 2OPRB 3TAMA 3EZ5A 2E9ZA 5I3PA 2QT7A 4KB7A 4FF3A 3MCNA 2WVEA 3HZEA 5IC4B 3JSMA 1X4GA 4FPIA 1UZHA 3QFHA 4M5IA 3F0NA 3KNGA 4DG1B 3TARA 2FJWA 4C4WA 1LWFA 2VD3A 3HHLA 3PEJA 3OPKA 3OHBA 1RT6B 5KAKA 4ECUA 3TQ1A 1XTZA 2J6UA 4BDPA 4DV3J 2K8GA 5KFLA 2ASDA 4O3SA 4UOFA 3ICLA 1M5OC 2ZWOA 1KR4A 4YHHJ 2F7VA 3WC0A 4DS4A 2KJVA 1JLGA 1OY9A 2ZE2B 4P74A 3G86A 3ZTPA 1JKHA 5FLXY 2VB6A 5JVGQ 2DPIA 1TKZB 4WZMA 5JVHQ 2X51A 4PXBA 3V4IB 2RUSA 3A12A 1HD1A 4DL7A 4Q2LA 5MLCV 2HYIB 2XO6A 1S9EB 3THTA 2CZVC 3EUNA 4ZVTB 5K8OA 1QAIA 1ZAWA 2EC0A 4LF5J 2WB1D 4BHQA 1HWJA 3TOQA 4CLYA 2Y1RI 4B08A 5F41A 1RZMA 3QWPA 1FI4A 4IRDA 1Q8LA 2Y0BB 4IH6A 4M63A 2DNKA 4HVZA 4CNZA 1VQ7S 3D1OA 5KFQA 2A10A 1HNXF 1QAYA 2VG5A 3IR6B 4F4AA 3M32B 1SVDA 4A47A 3LP0B 4X62F 1YJ7A 5ITHA 3TJAA 4AYBD 2O1PA 2UXCJ 2ERRA 5BR8F 3DLGA 4N77A 3DLEB 5ETPA 1KEKA 5F0UA 4J9QA 3TANA 4DSKA 2W24A 2MZ1A 1ELOA 4J9UE 2MJUA 3WHIA 4YHHF 1VDHA 3UVJB 3NNHA 5BYRA 1BMQB 3BM7A 2A6OA 5I42A 2BJ9A 4TY8A 2ZH8A 4O4RA 4C8NA 5C24B 1S7IA 2AQ4A 2AYBA 1F2GA 4ZVOB 2DGSA 3VQSA 1WOSA 3KLFA 3CD5A 4QWEA 3PIPQ 2UU9F 1KOHA 2NXJA 3DDKA 2AYEA 1FK9A 2ZBIA 3H7HB 4JV0A 1GTEA 1Z2ZA 3NGKA 2A2CA 3D6MB 3PXGa 1AA1B 4ES1A 2MGZB 2HS3A 1LNQA 1B99A 2NCKL 5ETRA 4CP5A 2B4VA 2YVSA 4OHVA 2LXUA 2LYVA 4ZK7M 3Q24A 3GSDA 5D0HA 5ETVA 4A8WA 4M1KA 1HBNA 2CQCA 4USWA 2V4RA 3T1HF 3G2XA 3P4UB 1CJKB 4WTYA 5H9FJ 4OYMA 4UZCA 3W8GA 4KSEB 3ZZYA 3HHEA 2DYAA 2HBYB 5KFWA 5BXIA 3IWLA 2KM8B 1GH8A 4J5OA 2DR8A 1VBZA 4J9KA 3QT6A 1NB7A 1RB0A 4F04B 1C0TB 3MMCB 2HBQB 4H4MB 4E8UA 2V68A 1X0PA 2D1CA 3CJ0A 1H74A 3EVOA 3I9ZA 2DK2A 3L7PA 2L9DA 1VI7A 5ETSA 3T19A 1Q81T 4AT1B 1SJRA 2HQFA 1AZSA 3K5OA 5LMUJ 5AJ3F 1S1VB 1RT4A 4KQZA 5KT7A 4HL9A 2KJWA 5KOWA 1C1BA 1T9VA 2OPPB 4I0WA 1HW8A 1VJQA 3SMZA 3BO3A 2KKHA 3MMJA 4ECTA 2VG6A 1I51B 1H7WA 2HFVA 4O3QA 5HJYA 3HVWA 2M52A 1F6TA 3B54A 1U0HA 1RT5B 3ETMA 1ZPWX 1JJCB 1PSDA 2QC3A 1RAEB 4EBCA 3J80Y 4ZVEA 1VQ6S 5HP1B 3L3CA 1FX2A 1OJ4A 4ANEA 2V6AA 4MK9A 4UZBA 2RAQA 4FYYB 1RP5A 2AGPA 3QFWA 1VQ5S 4FBTA 3CDWA 5DQGA 2W7PA 4F2SA 1S1UA 5DLFA 3MM8A 3D67A 4ZMMA 3CC7S 2VFUA 1LFPA 5E2QA 4JI0F 3ZTOA 1IJEB 4J90A 4IFYA 4LR9A 2WAQD 4YB5A 4DCPB 3AB2B 3BV8A 4JV2A 5F8NA 4RO0A 5A2QY 1NHKL 1CJUB 1G3OA 4FKYA 2CQ3A 1FVSA 3I4PA 3OT9A 2Z56B 4DLGA 3OVSA 3UWTA 4ZN1A 3UN3A 2C2DA 3C3LA 3UW1A 3VAJA 2GGPA 3K8VA 1GMUA 4PG8A 2W9CB 4ZP9A 3C6UB 1WG5A 5KFCA 3X1LB 4URQU 4ZVPB 1KQFB 4ICLB 4RW4B 4BWJA 5HMXA 2R7RA 4K59A 1NK7A 2UUAJ 2OEJA 3MPWA 4I7FB 1UW9A 2IAJB 2ZNZA 4C3KA 1HYSB 2E1AA 5F9NA 2XQCA 3NS6A 1DQ9A 2CZ4A 3IG1A 3E3XA 1HHSA 4Z7YA 4GKJJ 1IR0A 2FYXA 4BLGA 3R27A 4W90B 4CTAA 1XNRJ 1N48A 4NLYA 3JYTB 1SUQB 4KGZB 4P72A 4KGXB 5CQGA 2GS8A 1M90T 2XLKA 3M9MB 1IBLF 1FK9B 1LOUA 1FFWB 3KUHA 1WHYA 2A3JA 1LW2A 3HLUA 4N8NA 5D0RA 3SQGA 3CC2S 3GYXB 1K1SA 3OD2A 1PC4A 2R2TA 4DPUA 1RT3A 1B0VA 1FESA 1X5OA 2A1BA 1UMJA 2I9SA 1F3FA 2FJEB 1JIHA 1QE1A 2CQPA 1C4AA 3VHQA 1G1XA 1HNWF 5U47A 2EKYA 4BCAA 2HRTA 1E6VB 2DXFA 2ILYA 3NLCA 5I3UB 1RHRB 2HNYB 3M8ZA 3T41A 2ASLA 1PKUA 2LXFA 2I5JB 3ULHA 1F5BA 1LW0A 2QLXA 3KHGA 4JI7J 2HSEB 2L08A 3DU6A 3EWGA 1TZ0A 1NU4A 1LWEA 2GMHA 2YNIA 1T05A 3IRWP 4N41A 3UE2A 1LV5A 3NMRA 2GNKA 2H54B 2DGXA 1LEOA 3SCIE 3W66A 3KLGA 1ULRA 5GADU 4K5SA 2LECA 1UA1A 4QYRA 4RNOA 3D0HE 4F0HA 1FNOA 3MAAB 5DM6Q 2XGPA 1TL5A 4LF6F 4LSLB 2FGOA 4DV0F 2NZ4A 2HBZB 3W2WB 1TKTB 1XN9A 1VR6A 3MMBB 3VAIA 3WX8A 4NLGA 2VPZB 5KFGA 4QCLA 2XULA 2MKJA 5C2CA 2DJWA 4AL7A 2LU2A 4J9SA 1TL7B 2C3UA 3TP2A 3Q8RB 1WOPA 3CJSA 4HT5A 3SIPB 3W5YA 4LF4F 4FYDA 1GXTA 3C16B 3I9V9 2YNHB 1BQMB 2ZDPA 1Z2LA 5C25B 4HYKA 2V4QA 1RT7A 4ZP8A 4AUKA 1RWMB 1UJ6A 3CJRA 3MWBA 4FN5A 1S6PA 3ZNJ1 4ECXA 2UVVA 2HZAA 3SSRA 4MIWA 1VQ8S 2CJQA 1NMEB 2QA1A 1S4EA 4LRAA 4ED1A 2J0SD 3E2EA 4EO6A 1HL6A 1RCXB 3IS9A 2H5IB 3EXCX 1SJQA 3JSRA 2NREA 4L72B 4ELUA 4B3OB 1TV6A 1Z4UA 2JC1A 3FJ2A 5A0YB 3C15B 2BE9B 4KT0C 1PBUA 2J5AA 1WC5A 3VGSA 2D3OR 1RWOB 5KG0A 2BQUA 4CO4A 4DSIA 4DV0J 3TUPA 1TKXA 3NCRA 4NASA 4IH7A 4Y3CA 3FBEA 1JLAB 3LWLA 3A3NB 2J8AA 1IKVA 4I4BA 2HRUA 2ZWPA 3JSMB 2UXBJ 3M9OB 1RACB 1WEZA 3MEGB 4C0OC 3GYGA 3CCVS 3IO1A 4QQBA 5KG7A 4MJKA 1X4EA 2XMKA 2YPYA 3T9NA 3W5ZA 2DHXA 4L76A 1DTQB 4QR2A 3K5NA 4DQQA 1GXUA 2YXLA 3FZBA 1WNEA 2HFSA 2Y9HA 4ZVUB 3CDUA 2W9BB 2FLLA 2FZKB 1YVFA 2QJ3A 1JLCB 4OJHA 3G87A 1TU0B 1SPBP 2J9DA 3MTJA 2MSTA 3K5LA 3M8PA 4B02A 2ASJA 3HULA 4NLDA 2OPPA 3I56S 1VLOA 4ZPAA 5KG2A 1D8YA 5H9FK 4C0HA 2X7IA 2WSFC 4USMA 1CPZA 3GU0A 2BJ8A 4G1IA 1TMMA 3MR5A 2N4DA 3FEXB 2AKWB 1S6QA 2FJAB 5EX3A 4ETZA 3IGVA 3CWJA 3EVWA 4OL8A 3PX6A 2XS2A 4H4OA 3F41A 5C24A 2CQ4A 4DX5A 3VAFA 4OYPA 1P9YA 4OYZA 3DDNA 4HHUA 3AT1B 3EGWB 3DRRA 3PJ9A 2MHNA 3QAEA 2H5EA 3MUMP 3D2WA 3Q2SC 3M30A 4TLRA 1ZZNA 2HHUA 3J7Z5 1LWEB 1HQEA 2OMOA 2Y1LB 1YSJA 2YNIB 3R7NB 1IM4A 1QSYA 2PFFB 3MAHA 4CLSA 1FJEB 2MKKA 2FTRA 2VG7A 1KS2A 4KV8A 3CF5Q 2FD2A 1V3RA 2H3EB 3I96A 2OHDA 4DDFA 4C98A 2BANB 4FVMA 3CNQP 4ZITA 2C2ZB 3BGRA 4S0MA 3K8WA 1GQEA 1Y9OA 2LEAA 5C42B 3CDBA 4F0KA 4YDXA 5DDPC 3GV8B 1LW2B 1NZAA 4OYBA 3V6DB 1WKJA 2AGQA 2LQ5A 1XMQF 3HSGA 1NKCA 2CJ9A 3FMWA 3EDRB 4M5MA 3MPYA 2NUUG 3BBBA 3HHLC 1T95A 5F8GA 2VBZA 3QT5A 2XCAA 4HHJA 2DR9A 2LKZA 2LEBA 3MEDB 2DD8S 5K14B 3M8YA 2ZNYA 2B6AA 3UR0A 2R8HA 2RS2A 3U1NA 1FRHA 3DLGB 4K4ZA 4MFBA 4AQYJ 1XJWB 2V2KA 2LEPA 1RTDA 1OQ6A 1BLUA 4DL4A 2RHQB 4ANDA 2DIVA 4USJC 2CJAA 5KT5A 2XCPA 3QBCA 1RWXB 4WK1A 4B9UA 3DFEA 4WIQA 1I5OB 1S9GA 1DY3A 3B4DA 2CAJA 4JI4J 4HI1A 3R97A 5C5JA 3MR6A 2OIHA 1IUJA 4DR1J 3W63A 2UVWA 1H2TZ 2LQ8A 5CZVA 3D0IE 1U1OA 2FJBB 2AZ1A 2LVWA 4DWIA 5DQHA 3BS9A 3FMBA 1VK8A 1P27B 2CPIA 2WOMB 1EB0A 3M1VA 1MWQA 2CQHA 3MI7X 3TVZA 4DPOA 1ZTTA 3PY8A 2NLWA 3NOGA 1K47A 4QYZK 1F60B 3N6NA 4LF8F 3J7YI 1Q95G 1JLFA 5LOQA 2MLYA 3TA1A 4ZCMA 3PNIA 1R8BA 2AYMA 2FZGB 1RWUA 2W2NP 3LWMA 3CCLS 1HBMA 4Y65A 4J9OA 3ET6B 1S57A 3PZPA 1NAQA 2Z0GA 4NCAA 2W4PA 5GAGI 2Q3PA 5CAAA 4B3SJ 3HSJA 2HWIA 5CYMB 3T6BA 5D8HB 3RRGA 5JUMA 5F3ZA 3GJSB 3NS7B 3ADAC 4OYAA 1GNKA 3K5MA 3A8EA 2YKMA 4F4KA 2KYZA 1YHQS 2ZFHA 3ILIA 7FD1A 1K73T 4WIIA 4WU3A 4Z37A 3MEEA 2YWFA 4PQUA 2EFOA 4X2BA 3BH7B 2D41A 1JK9B 3GIIA 4X4SA 3IWNC 2C22A 1O6XA 2MY8A 4NWBA 1EJ7L 2UZAA 5SUHA 5GAGU 1YRXA 1Y5IB 3CMQA 3O2IA 5IQQA 5BR8J 2MSSA 4KJIA 2N7YA 1U45A 4ZJQA 2BJ3A 1HBNB 3ZC4A 1N5VA 4TN2A 4AL6A 1T9YA 3D4JA 3GE9A 3KK3B 3H8YA 3OV7A 1HNXJ 1ZZFA 3L95X 2FJDB 3OR1B 2Y1JA 5F3TA 1NHVA 1NSQA 3E01A 1VC5A 2IJRA 2KFZA 3DM2A 3W9IA 3S01A 4DN0A 1VISA 1UWBA 5KG6A 1SL1A 4LF5F 2HHXA 2E9TA 5DJBA 2Z2MA 3DGVA 4ZVFA 4NLPA 2DEJA 2AU0A 4X4QA 3VAMA 4OYWA 4F25A 1R31A 2JRSA 3OUYB 2VQFJ 4X4TA 3BDPA 2HW3A 2N4CA 3AAWB 3T5LA 3GWCA 3BSAA 5F8IA 3KWMA 1XWLA 2KDOA 4KGKA 3D1QA 3CCMS 2MMYA 5DDQC 2FVRA 2RILA 2YX7A 1UFKA 2R7OA 3I6PA 4K0KF 1NJZA 1RAHB 1FEEA 1RABB 3W62A 5HQLA 5LSOA 4H4OB 1ZTWA 1U1KA 4LSNA 2AD9A 2JZ5A 3DLLQ 3LALA 3C8YA 3QGPA 1QDUB 3RB6A 1X9MA 4OI2A 4D3GA 3RB0A 3IRXA 4IDKA 1OWXA 5J2MA 2LA4A 3AOBA 4DL6A 2YWGA 2HFNA 4ZJLA 3UD3P 2JEGA 4A48A 5F9LA 2CDRB 4J9PA 4WE1A 4XK8C 1GX5A 5CYQA 4DCJB 4GKJF 1O51A 4MT1A 2GAGC 4TXSA 5ETLA 1WTFA 4JI1J 2MB0B 1OSCA 3MD1A 2IC3B 1Y5NB 3HJFA 2Z8QA 4DV6J 4I2QB 3CCWA 4NMXA 2ROPA 5GAHI 4RNNA 4NXNF 3I5AA 2YNHA 2FUG9 1C1BB 1Q1KA 1H72C 1X31C 4U8YA 4I64A 3FSIA 2F4VJ 2P2CB 2W8KA 3PW0A 2FVCA 3B6BA 3NGSA 3HXMA 3RB3A 2FQQB 2CVIA 3TEHB 1HI8A 3GIMA 1U7LA 4LF9F 3FEZA 2EBGA 1RKIA 3ONQA 4QWDA 2B4PA 2V2VA 5IFMA 1U1LA 1GTHA 4JI0J 5LXYA 1ZM2A 5M2PA 1KOOA 2CQ1A 3G6YA 2DCLA 1AXQA 1QUPA 2DH9A 2MZTA 2V8GA 3DDIA 3D1HA 2D3UA 4ZPDA 1JJHA 2EFPA 3ZTSA 3J7AN 1RE1B 2UVRA 1D9AA 2QSWA 3M2RA 3R5CA 4DFPA 1LW0B 3ZFVA 4UUWA 2B6AB 4NPOA 1KBRA 3TX0A 2GVZB 3AXKA 3FRZA 2FVSA 3H4DA 2ACYA 3UDLA 4HLBA 4DR2J 1NPKA 1FERA 4NLWA 1RTJA 3KMQA 1K0VA 3GJRB 2H4YB 5K8NA 2W7AA 3W9JA 4ZLLA 1MMNA 2GZOA 1RT1B 3R1LA 3U27A 4OV6A 4TQSA 4GO5X 1Q8IA 4U95A 2Q1LA 3T5HA 4N8OA 2KT2A 4C8MA 2XM3A 1WC0A 4MYTA 1S79A 3R7BB 4DEZA 4DV2F 1HI0P 3DRPB 3QJLA 3W2WA 2R7QA 3HO1A 1SC4B 3SYZA 3RR7A 3QWUA 2BJ7A 5KFUA 4ZPWR 1RLDA 4HTIA 4DZDA 3R2CJ 1N33F 2MQ8A 2X1BA 1G6BA 9ATCB 2CJKA 2P9GA 4KH1B 2KM8C 3OR1A 2V2QA 1YBTA 3LP1B 2CUYA 2K1RB 2MLZA 2W2PP 1PJ6A 5D0EA 3UVJA 1OSDA 1JB0C 4KHRA 4AXIA 3JAMY 1PYOB 4QPTA 2IAJA 3UN5A 4L3KA 1MWZA 3N5FA 1UCNA 5G0RA 5KFJA 4FF4A 2HHHF 4IO1A 4HDGA 2FJVA 5THWA 4EZ9A 3GIRA 3ILLA 3M8QB 1GT8A 4QWAA 2AEMA 4UOCA 1NK5A 2K3IA 1UVLA 2R7XA 2BRKA 1EP4A 4DR4F 1N5TA 4C3MA 1PJ5A 1MMLA 2DT9A 2EK1A 4KGVB 5E3CA 3BKTA 3MEEB 4P75A 4PXDA 3BGFA 3J81j 3ITHA 1P6TA 3PW7A 4LQ3A 4QYZJ 5DM7Q 3LA0A 4JV5J 1KN6A 4PUOA 1WELA 4GC6A 1SC1B 3M6XA 2V69A 3KLIA 2VV5A 4KH0B 5K5MA 1NLKL 2GQCA 2PGCA 2J8SA 4U67Q 2N3LA 3PIOQ 1NKBA 3QJJA 5M2UA 4JYAF 3BO4A 1AFJA 3OTOJ 3Q0AA 1HNZF 5CYMA 5AE1A 3NWRA 2EXUA 1IBMF 5A0YA 2BJ1A 2IRYA 5CCLA 1FJGF 3JB9k 1U47A 1SC3B 1RQ0A 1RWWB 1J5EJ 1CJTA 1YJVA 2JLGA 4ILMA 1REVA 2M3DA 4JI6J 1XNQF 3OSNA 4G65A 1Q53A 4PXCA 4U6PA 1B7YB 3M7VA 2DPJA 3LAKA 3KLHB 2YWWA 3BGLA 2QLBB 1SKRA 3CCES 3IGNA 3PACA 3C16A 2VU5A 1LWFB 1IWAA 2GFFA 3DHXA 3EPGA 3C46A 3CMES 3TI0A 2HAIA 2DB1A 2G9OA 4DUTA 2EBEA 3R7SB 1N6QB 2KFNA 4RW6A 4TKTA 3HKZD 1YG0A 5CH7B 3HI9A 3JTNA 1D9FA 4KE5A 2BABA 1Q5VA 5SZTA 2JVOA 2G0CA 1TFYA 3D6TB 3SFUA 2FY8A 4F26A 4DFMA 1IJFB 4O3NA 3M4XA 3OR2B 1S1WA 1IKWB 1CJVB 1ZETA 3TEGA 3B8HA 3MM6A 4C8ZA 1NSAA 4LFAF 4P71A 3EPIA 2WSEC 2IM2A 1S6UA 1L3TA 2A2DA 2U2FA 2VA2A 4X4VA 3GZ7A 3OXLA 4AL5A 3CJ4A 1NK8A 4KTQA 3V6JA 2JX2A 1NBEB 3V4MA 1HWLA 2IY5B 3NAHA 1F3VA 5AXKA 5HJXA 3M2UA 2FLNA 2GMJA 1U25A 4X65J 4ETXA 3KJVA 4DR5F 3MMCA 1CVJA 2YNGA 3CJ2A 4ED3A 2KXHA 4O4GB 4P2FA 1O8BA 3KLGB 2BOAA 5F8MA 4DFJA 3PRDA 3CD6S 3BEGB 1SJ3P 2D74B 1TL4A 3S7RA 2FLOA 1VQNS 2UXDF 1MW7A 2J7KA 4RNHA 3UO0A 4ZLNA 1VQ4S 1D09B 3ZTRA 3TX8A 1S12A 3BREA 4IFVA 1ZYQA 4USIA 4CCHA 1YK9A 3MM6B 1DBDA 1IQZA 4I7FA 3R5JB 1IN0A 4FYWB 3R1HA 1UFLA 2UVUA 3TNVA 3BBFA 4YMEA 3VR1A 3T6JA 4IKAA 4RW9B 5J2QA 4ELTA 4F02A 5KFYA 4R5PA 1H7XA 1RK8A 2G1DA 2ZUAA 3EJMA 2HHSA 4OX9J 4LREA 3K5PA 4RUHA 2VBYA 2ZVSA 3U7JA 1KLNA 2OFGX 3M6VA 1RT2A 1UVJA 4F3MA 3Q8SB 1TK0A 3CB4A 5I42B 2XLJA 1WSRA 3DU5A 2DNLA 2AF6A 1YIJS 4YY3J 3KK1A 2XEXA 4KHPF 1FEHA 4AXJA 4DV7J 2QSFA 4DF4A 2P9EA 4DMZA 3T5JA 3FEYB 4XDDA 5LSLA 4GO7X 3SCJE 3QJPA 2M8DB 2PE8A 2WCXA 4PWDB 1RAOA 3K0JA 4FKXA 2AHOB 2IFXA 2RRAA 1RXOB 1B0PA 1FRKA 4ZJOA 1LWCA 4RBUA 2AP6A 5A8KA 4OZLA 4DPXA 2HQ3A 1RT4B 3MHYA 3Q8UA 4C97A 5F0WA 3HVTA 1WDTA 3MPUB 2DKOB 4MK8A 3J80U 3ZXWA 3HT3A 2AGOA 3D7SB 4ELVA 1R0AA 4J9LA 1T03A 4B3TJ 3C15A 2FVPA 2W01A 1OPIA 1R8PA 1U02A 1YI2S 1S97A 2FZCB 1TR0A 3H90A 4Q45A 3MUTP 1VCTA 1FCAA 2Z4PA 3H5SA 1M5HA 4H4KA 4V1Ak 4ZA1A 2F3JA 3N5BA 1TUVA 1RTDB 1WF1A 2ADCA 1NUEA 2GHWA 2CNLB 4EYHB 1L3SA 3V2UC 1HWUA 3MXHP 3K7RA 3GPAA 4YEAA 4A4JA 4WFAQ 2XWYA 1V3ZA 4FDFA 3LP2B 3OL7A 1BQMA 5D0GA 4NCGA 5C7PA 1U6FA 3UCUP 5BYSA 1QE1B 4Q0BA 4ER8A 2RS8A 2YNFB 5D4NA 1X5SA 2D7SA 5IT4A 3OVAA 4H4KC 1OPZA 3FFIA 4CT9A 1JJ4A 4UW2A 4IH5A 3KOAA 5CCMA 4IG3A 3ZO7A 3AOCA 1CULB 1DQ8A 2DHHA 2B43A 5LMNJ 5EWEA 3GP9A 1BWEA 2BA9A 3D68A 1WF0A 4PEOA 1PAUB 3R8YA 3MTKA 4K4VA 2KXNB 2DNMA 2VBXA 2OKQA 3H5YA 4ATNA 3ELHA 4LRCA 4RW8B 3FVYA 3V5RA 2E1PA 4WKYA 5K20B 5KFHA 2WK4A 1DHMA 3B82A 1DLOB 3UD4P 3UNYA 3THVA 1AROP 4NLRA 3OSPA 3C6UA 2DEIA 1KKHA 4DSEA 2GO9A 4B3TF 1RLCL 2FB0A 1CQMA 2VG5B 3SV4A 1UKUA 5HBMA 1YJNS 1U1QA 2KRBA 4X4NA 1VGYA 1V5IB 2IVMA 1VBKA 3BR9A 2AX0A 1S6QB 5EDWA 3Q2TC 4DFKA 2JEJA 1B70B 1JJ2R 2GVDB 2E5GA 4F36A 1DTTB 3PX4A 2ZBRA 3CIMA 3N28A 4ZPTR 4UF4A 1FRLA 4ZOSA 1U1PA 2JLEA 1NCLA 2GVZA 4KFBA 3DOLA 5A6WA 2KTQA 3U02A 4I69A 2IVFB 2IC3A 4DQRA 1HIYA 3A8JA 1EQMA 5DZ7A 4P7TA 1RU1A 2OP5A 4IO9Q 4ID5A 4DV1J 2FVQA 3QAUA 5B0FA 1X8DA 1MG7A 3NP5A 4M5KA 1UA0A 1LXJA 3KXDA 2QMUB 2XI3A 4NMLA 1S76D 4I6YA 3ZZ0A 4NA1A 2W2OP 1RYRA 1LK7A 2PSZA 2FHOB 3HHLB 2ZKUA 3H20A 4DN9A 1OY6A 1HQUA 4RKUC 4QWBA 4LR7A 1WG1A 3R9LA 4OX7A 2KFYA 4LF6J 2QLWA 3J81Y 1E6YB 2XSFA 1DZ5A 2F4FA 1GMWA 1TV6B 4CH0S 3LAMA 2G4BA 2C2MB 3RAQA 3G6VA 3UPFA 2XHCA 2JEFA 2W4CA 4F8RA 2R7SA 4RU2A 3M8SA 3EX7B 1NH7A 1JKHB 2KU7A 2EFNA 2NXUA 3IR5B 3MEDA 4NXNJ 3ZNUA 1KLMA 3WZ0A 3PR5B 2C28A 5L1LA 2V67A 4OQJA 2B51A 2HWHA 4IFVB 8AT1B 1YLXA 4DQSA 1ZA1B 4PPDA 1HNWJ 2XMTA 1FRXA 2LXIA 4LBPA 1BC6A 4NZ7A 1DAXA 1FTRA 2MHEA 5J1EA 1NK6A 1HFEL 1YZ6A 1ZAXA 3KLIB 1RTIA 2ZH3A 3C6TA 1U1NA 3KG4A 4LFBJ 4PUOB 1SIZA 2G2YA 3IAM9 2VQEJ 2BE2A 2QMXA 2W4DA 3I0RB 3RBDA 5HBMB 3QRRA 1R8AA 3DLKA 1FHTA 3RZAA 3LW5C 2IJFA 4IYQA 3FUYA 5EHHA 1ICEB 4X4PA 4NE9C 4KGMA 4P7VA 3M8QA 5B7WA 3TVKA 5IV3A 1NDPA 1FNMA 5IV4A 2FJXA 3HX9A 2YQ1A 5G0RB 4C9DA 3Q83A 5FDLA 3KHLA 1S6OA 2ZH4A 6FDRA 3SSSA 1V9OA 1FRMA 4CLLA 3W3SA 1FXDA 3FCWA 1RWNB 2ZJPQ 3CC4S 2P8IA 2C42A 2RF2B 2DNQA 4EU0A 2V5HG 4ZHRA 2BQRA 2ZBCA 1UJ5A 1Y4ZB 3A8IA 5E33A 4DZ6A 1TL3B 5EWFA 5T14A 2BZ2A 4K4WA 1N56A 2XYPB 5DQIA 3HDSA 1BHNA 1VK3A 3AA9A 1PBAA 3HZGA 3Q8YA 5KG4A 3ZTQA 1EIYB 2HURA 3QSYB 1NNDA 4IR1A 2M88A 3CD7A 4RJVA 3AY0A 3KHHA 3BO2A 3IG1B 2HNZA 3V81A 1VQSA 2IA0A 3POTB 1TFWA 2FLPA 2ZD1A 2JHEA 5B0CA 2COLA 4K4XA 2SXLA 3AJDA 3HF5A 3AD7C 3W2VA 3EZUA 2XB2D 1HNIB 1HW9A 2RIJA 2XMJA 3PR4A 3OR2A 1OO0B 2XO7A 4ED0A 3C14A 5B0DA 1SKSA 1F2HA 1FTCA 2CADA 3KJQB 3OTOF 1V6HA 3EGZA 3DOMB 4C7QA 3HSDA 4B9MA 1MWYA 4U9RA 4N47A 4C11A 4K50A 3MEKA 3AXMA 4K4YA 2BDPA 3DXSX 4WYWA 1N32J 3AODA 4ES2A 2CDQA 4WBFA 4LIWA 2XZTB 3PYFA 3H5XA 4MFBB 3ITHB 4EO8A 1KHVA 3I31A 5KFDA 2V8HA 5IM0B 2LFVA 3HHNB 1NJIT 5HO4A 1PG5B 4F0MA 1AB8A 4LF8J 1OMSA 2D9PA 3DLHA 1EKSA 5KTQA 4WZQA 2ZHAA 2HHHJ 1PYSB 1RTHB 3T1HJ 3FCHA 2HRYA 5F8LA 5HP1A 3P6YC 5AE2A 5KFZA 4RW7A 4Q44A 3PRBA 4R25A 3PYEA 2H9ZA 2LU1A 4ZIWA 4K2JA 2IYIA 3I0SA 1JLQB 2EPIA 2X3DA 1YGYA 4HH1A 2UUWA 3A3OB 1FX4A 2ROGA 4WWSA 4OYIA 4DR1F 1HA1A 2JH3A 3NAIA 1QVFR 4FVCA 1RT2B 2GQQA 3FK4A 3LO3A 5HK4A 1SQGA 2CFXA 3DXBA 4DV2J 1VQOS 4KKOA 2E1CA 2ATLA 3E8OA 4D3HA 2AIRB 2MJNA 3R3TA 3VV2B 4HH0A 1BQNA 3G8SA 2DO4A 3BSCA 1JLBA 1IR1A 2VASA 2FHKA 3H2VE 2OI2A 4AE5A 1KD1T 2Y8WA 5B0EA 1QSSA 1PJ7A 1I1GA 3GJTB 2B4UA 5E3QA 4LJMA 2EEYA 1CULA 1RHJB 2CJBA 3ENQA 3QO9B 4QW8A 5KFVA 3AJ1A 3MM9B 3PKYA 2E7WA 2PA3A 5HROB 3TR5A 4CDIA 2QEXS 1YBUA 1FRIA 2GJ2A 3MPDA 1CS4A 3PRVA 4TYBA 3TW0A 2ZHOA 5D15A 4EI2A 2HGLA 8ATCB 3MURP 1RAAB 3I55S 1N5YB 1K9MT 1SV5A 1TVRA 1UPPA 2MYFA 2B5JB 4NLXA 1IR2A 2F8HA 4P10A 3EGNA 4PAAA 2ZBQA 4YDDB 5A8WA 2UXCF 2HHWA 5DZ6A 4PG7A 4OZ2A 1H6KX 2EC2A 2XMVA 4LF7F 1C0UB 1BWVA 2E29A 4F4WA 1BXNA 1M0SA 2HKEA 1OYDA 1S0NA 3TJ9A 1SQEA 3AFGA 5DG8A 2IM1A 1K1QA 4ILLA 2LQJA 1SIWB 1V5VA 3PJWA 4KIAA 1RTJB 2BKOA 4JB8B 2JC0A 1EX8A 2YKAA 3GCWP 4MH8A 4DR3J 1NJXA 4L74A 3DC2A 3NEKA 4ZN3A 1RHQB 4TYAA 3MZIA 5B0GA 5J2PA 3I5CA 3M2RB 4OZ3A 1JQGA 4Q43A 4DV3F 3KYLA 1KP6A 3DMJA 1MNEA 3M32A 5L8RC 5CXTA 3K57A 4DR6F 2XY6A 2XNRA 3H42A 1S99A 1UP1A 5A8KB 4DR6J 3FBFA 2W7OA 3I0SB 3R5BA 1LWCB 4XTTA 1NDLA 3UD5A 4DPTA 5KFNA 2AMCB 2X1AA 2NQPA 3D0GE 3IS9B 3G9CA 4LUBA 2WB4A 2G1HA 2XHWA 3TUZC 1J5OA 4PWDA 5EN1A 2YH0A 2F65A 3EZOA 1LWXA 3L4BC 4BS2A 3BGUA 1EQ0A 5J2NA 1U2RA 3N0VA 1HHTP 1WEXA 2HLTA 2KRRA 3FZ2A 2B56A 3QZ7A 3V4IA 1PIEA 3BB5A 4K0KJ 1QY7A 4TLQA 1X4DA 2PMWA 3C19A 4OHZA 1QTMA 4HACA 2MY7A 4ZCLA 2W2QP 4O44B 3OTDA 2HQIA 1F1BB 4A8OA 4QBUA 3VAKA 4NZ0A 3BYRA 3H5UA 3G4SS 2MZSA 1HPZA 2G0IA 3KJFB 2ALZA 3M6WA 4RWWA 5IWAJ 2AZ3A 2LA6A 2VC1A 5ADZA 3A1YG 2RMLA 3ZZZA 4CQ1A 4JOUA 1U8SA 1GX6A 1RA6A 4UQTA 1RAJA 1SV5B 1TVRB 3RUBL 1NK9A 1NKEA 2OEMA 3BGOP 3D54A 1XBWA 5L9XA 1RJJA 4ED4A 1N54B 1X5PA 2E66A 1YBAA 5HN0A 2VICA 3TWZA 4DV1F 4KAIA 1SBRA 2HIQA 3TA0A 1XR5A 4JI2F 3POTA 3EGVA 4KFBB 1ZAVA 2J0QD 1MN7A 1SQFA 1UVKA 3PFEA 2E5JA 1NDKA 1X4FA 1M1KT 1FWKA 2DGOA 1RU2A 1PC5A 1T3OA 4OJGA 4B9SA 3NNCA 3MCSA 1MMDA 4UTGA 2MGZA 2H4WB 4O23A 4DUZF 2IHR1 4ED7A 1HYSA 4USKA 3L9ZA 4USTA 3M2VB 2J0XA 2X3GA 2J6TA 1R3NA 1VC0A 1ZBTA 3GFYA 4ID8A 5C42A 4YR2A 4RNFA 1KDNA 2RQMA 3QPIA 4Y6IA 2RB7A 3HP6A 3CJKB 2XNQA 1S0MA 2XI2A 1X0FA 2WTFA 1FF2A 4B3MF 3NNAA 1M5SA 4F4YA 1C2PA 5BJRA 4DS5A 5KT2A 5GADI 1WC1A 4L73A 4UOHA 4YB1P 2M2BA 2PIIA 4CO1A 3ENWA 1N5YA 2B9YA 3RR8A 3BBCA 3S6EA 4M5DA 2DCUB 2N7CA 1IBCB 2NXEA 2JJ4D 3O44A 5D3GA 3MPVA 2QTWA 4RL1A 3CPWR 3EE3A 1Y10A 1RTHA 3KLEB 1U1MA 2VONA 2KVIA 2Y0SD 4DV4F 4WFXA 1AUDA 5L1KA 2DNGA 1VQ9S 4ZKAA 3LP0A 2DNYA 4CRJA 3R5AA 4A8QA 5HLFB 5KFEA 4NEYA 2GIFA 2J9CA 2UV8G 2KO1A 4TQRA 2AJQA 2CZ9A 1EETA 2K7JA 1F9FA 2GIRA 2MLXA 1RTIB 3W8PA 3WC2A 1C4CA 2VA3A 5J1EB 4I68A 4CLZA 3Q86A 2B7BB 1TAQA 4ZVHA 1VQPS 4DSLA 1RHUB 3NWGA 4RUAA 1T9UA 4X4OA 1P8GA 2E7XA 2VOOA 2HVDA 4MIAA 2HVEA 2XTJP 4EWTA 2Z2LA 2ZOGA 5ETKA 2XMAA 2VDIA 2QIFA 1A6LA 1S77D 1S0VA 4B3RJ 2RQKA 1RT5A 2RDIA 2DGUA 2C3OA 2W9BA 1KLMB 2UUBJ 1A9NB 3PM9A 2UUAF 3KNAA 1NK4A 2JVRA 2H48B 2CG8A 3IA0A 2JLFA 4KR0B 3DI6A 3W2VB 3U1MA 3GIKA 3UCGA 2ZZMA 3ZZRA 4CI0B 1AZSB 2VIHA 4B9LA 4DL2A 4JV1A 4DG1A 1BGXT 4C8LA 2BW7A 2HNDA 5EGYA 2BOPA 3RAXA 4LMZA 1EETB 4RBVA 1X9WA 1NM2A 3MOZA 4IQMA 2IMWP 2ZJRQ 1D9DA 4ID5B 4L75A 2AT1B 3RBXA 5L9NA 1HWIA 8RUCA 1Z1ZA 2HS0A 4W98A 3HM9A 2V9WA 3CO9A 3WX4A 2H65B 1KVJA 1S6PB 2IDEA 3BDEA 2YWKA 3N9UC 2CJYB 4ZPBA 4DL0C 3UQSA 3F56A 1Q7LB 3T1YJ 4OYOA 5D3GB 2QYCA 1YJWS 2MZQA 2UUBF 3KK1B 4CYUA 2CPEA 2R8KA 4KHPJ 2PMZD 4EK2A 4B9TA 1WOOA 1L3KA 3GFXA 3NG8A 3B78A 1KC8T 2VODA 2ZZNA 1R6VA 2NSCA 5ETOA 3CT9A 2VQEF 2ZBPA 1UWBB 4LFBF 1YRUA 4EEYA 2BW2A 4CWBA 1S4FA 2HK3A 1NJWA 3DGPA 2CXEA 1VRUB 4LR8A 1WG4A 3UDEA 4J9NA 2E9RX 1TELA 4A8YA 3HK2A 3KK3A 4NCGB 4C8OA 1WSVA 5L1IA
chains in the Genus database with same CATH topology
1S48A 2OD4A 1U6ZA 1KHWA 2VZ9A 1U2FA 4KHMA 2MXYA 3P49B 2EI5A 3EXYA 3CULA 2D3ZA 2LQ9A 1KTVA 1UVIA 2MDAA 1VMBA 5T41A 1LXNA 2HHTA 2M5YA 2VKZG 1NHUA 1P1TA 2VPWB 5KFSA 2DNRA 4MK7A 2XC9A 3T9ZA 2OPQB 3V6KA 4X65F 5GAEI 2OJ3A 3TAPA 2EW9A 4V19X 3TAQA 3EYZA 1B7FA 1UAWA 3BQ2A 5T7LA 4J9MA 3KHRA 4NZ6A 4IRKA 1Y7PA 4ECRA 5E0OA 4YB6A 2DNNA 3CXCR 3CUNA 2M9KA 1HR0F 3IFEA 1FT8A 4DF8A 2PN6A 4B17A 1CC8A 1SI9A 2KHCA 4IUFA 2EG1A 2OSRA 2B7CB 3MAQA 4OHXA 3OJUA 2CQIA 2OAUA 3N4WA 1H98A 2JWNA 4R0EA 1BD6A 1X5TA 2J9EA 2IVYA 1TAUA 4NLSA 3HVTB 2AV5A 2RKIA 1KQSR 4M94A 1IKVB 1CSJA 2E5IA 5GAEU 3SI8A 3RRKA 3UNGC 4YFUA 4O0IA 2IA6A 4WYLA 3DMJB 2RSQA 5IWAF 1ZM4A 2AJ0A 2ZKTA 3JSBA 2VFSA 4DJBA 3SCLE 3NMAA 2F8MA 2CRLA 4R5PB 4P2SA 5J2QB 2U1AA 2R7UA 5IT0A 1FD8A 3FGVA 3UDCA 1Q4RA 1XEZA 3MR2A 2B4OA 2IYGA 4A8XA 6FD1A 5GVQA 4I6AA 1C0UA 1H2UX 4FP9A 5A8RA 2XBPA 3T3FA 1S72S 5KOXA 1UJ4A 3SDEB 2ZH1A 3R5DA 3TO8A 2DHSA 3ZZPA 1WI6A 3Q23A 2B5JA 2VFRA 2XLIA 1UFWA 3B4MA 4H4MA 1L5UA 2CPFA 3SQGB 2LDIA 4EBEA 1SH3A 3V6DA 3D28A 3P96A 4IRCA 1TL1A 3GG1A 2OFHX 2P6SA 1T3NA 2M8HA 5FD1A 4QW9A 5K8MA 1T94A 1VRTA 2AJFE 3MECB 4OX6A 3O3LA 1SJFA 3LP2A 4OJ1A 4U7CA 3OTCA 2PEHA 3SEOA 1P1LA 2DNHA 3E51A 4XIUA 1S1XB 4OIXA 5EX0A 3PEHA 4ICLA 4RW4A 3P3DA 5DLGA 2MQPA 3WBZA 4FXDA 4QU6A 4ZPVR 2NSBA 3DCAA 2L3MA 3UFCX 4X66F 3Q22A 1HI1A 2MQLA 2RD5C 2IBKA 3KG1A 2HFZA 3UCZP 1JLQA 4IFYB 4MMOA 1N5QA 3ETOA 2XG8A 3C66A 2HNDB 2RKIB 2BM1A 4JI3F 3WDOA 3M9NB 3ISNC 2PA8D 3GB0A 4ZCIA 3LPYA 2YH1A 4N76A 1JNZB 1T02A 1JNRB 2RRBA 2E1RA 4MKAA 2BVZA 1VC6A 2OH2A 2C3YA 5EUHA 2VG6B 4NL5A 3T1AA 5IT9Y 2CPYA 4DOZA 4YY3F 2K3KA 3GFZA 1IKYB 4PR6A 1ZM3A 2F9JA 4PPZA 1RGVA 3O8WA 1KRPA 3CE8A 2QV6A 4FF1A 5J1PA 1FD2A 2R7VA 2BQ3A 4ZDNA 1MU2B 2IM3A 2AYGA 2NS1B 2E5LF 3VAGA 3W2VB 5D77A 1C0TA 2V9KA 1IKXA 5D4OA 2F4VF 4YUDA 1HBUA 1PGZA 4OHYA 5LJ3Y 3PW2A 4DV6F 3MR3A 2ZUGA 1QJHA 1VQLS 4NLOA 2UUCF 3I4HX 4JI8F 1FKOB 3CCZA 2DVIA 4EFAC 4CO0A 4K2XA 1X4BA 5J2MB 3CDAA 3T5KA 2WSCC 3GILA 5E3RA 4ZHRB 1TKTA 3MMBA 4W92B 1Q79A 3CJKA 4NCBA 5HROA 1YQHA 4XDCA 5J2PB 3QIPA 1JMTA 1H3DA 3BF4A 5HL7Q 1XMBA 1KONA 2MKCA 3O1LA 4WXOA 1CLFA 3H98A 1CQNA 4YP3A 1XK8A 1S9FA 2POKA 4KRWA 4CO3A 1FE0A 2VPXB 3CGIA 4OFZA 4TU8A 1BQNB 2CKWA 2DHAA 1Y3KA 2HPUA 2VL1A 2VQFF 1OIAA 4KKOB 1IKWA 2IJNA 1VIXA 5IS2A 3N6MA 3MOJB 4FPRA 2CQGA 3X3UA 5KG1A 2BE2B 2ZH7A 2DR5A 4IOAQ 5J1NA 2JL9A 1QAJA 4MYUA 4CNYA 4YR0A 2J7UA 3OHAA 1JXEA 4X4VA 4O4GA 5LJ5Y 5DDOC 2O67A 1UW4A 2MQMA 1X9SA 4WFYA 2O3DA 1PO6A 2R8GA 2FPHX 3N6LA 2Q66A 1WACA 2MQQA 4G1QB 1HPZB 2QRRA 3CTRA 2R7TA 4DQIA 3THPA 3KLHA 4IR9A 1N0UA 4HI2A 3PFOA 3QIDA 1X4CA 5BYQA 4JI6F 5IM0A 2UXDF 4HDHA 1UETA 3VTIA 1Q82T 3L7OA 2HG4A 4FXWA 3C2PA 2ZDOA 3AA8A 4ED5A 3W7BA 2AJ1A 2BRLA 4Y2KA 1TKXB 1QVGR 4C11B 1JWWA 2ZC4A 4E98A 2VOPA 3G96A 4B3OA 4O3RA 1WHVA 2YQ3A 4BC7A 4B3SF 3CMAS 2C3MA 1F5AA 5KT6A 2VFVA 1XR6A 5DETA 4A8FA 2ILZA 2KT3A 4LSNB 2AJ4A 4Y34A 2HMIB 2PD1A 4ECVA 2FIUA 4Z2XA 3NL0A 1JLGB 2ZE2A 3JSYA 1SJ4P 2J9DE 2MKHA 2QA4S 2P6TA 1UVNA 2F1FA 2E44A 5E3AA 2GMLA 1W25A 2K7KA 3IXQA 4C8KA 2FHJD 4OX8A 1FDAA 4N56A 4QPXA 1IBKF 2MKIA 2Q6BA 2OPQA 1G2EA 2I1RA 4H54A 4I2PA 3MMAB 1NK0A 4U7UK 2APOA 1SL0A 2D9OA 3PJXA 3HFKA 4CH1A 1RT1A 4OZ1A 4Q7AA 3T1YF 4Y00A 3RB4A 4F4XA 2PDAA 3DRRB 4A8MP 4X4RA 2QZ8A 2N82B 3QGGA 4IG3B 3BSOA 1JLBB 1N0VC 5FJ4A 1JLEB 2CIMA 4LIRA 2KT5A 3QZ8A 3RTVA 1R89A 1N5SA 2XWXA 4OI3A 1RDRA 4MKBA 4QIFA 4CH7A 3QGIA 3E01B 2WHOA 2YKMB 3BGRB 4UUXA 3HHDA 4J9RA 5B08A 3US5A 2HVIA 3JTPA 2VG7B 3OFHA 1LKZA 4EYIB 4A8SA 2DBBA 2XY7A 2R2SA 4NRTA 2BUNA 3Q8PB 4NXMF 2M0GB 2NYIA 4PQAA 1CG2A 5KFAA 2MZRA 5CYJA 2W8LA 3N79A 4K5RA 4OI1A 4XAKA 4R8UB 4PQUB 1JLFB 2OPSA 5LT5A 4YQWA 1N4LA 2GCFA 1DRZA 3QIPB 4ERDA 5LMNF 1MROB 2AX1A 3IC1A 4O3OA 1N52B 2YWHA 2XS5A 1I6JA 3CCTA 1J5OB 2L48A 1VIOA 3DRYA 2KN4A 5F8HA 3MM8B 3VZHA 1RISA 5AXLA 1WEYA 4ES3A 4IQXA 3S1TA 1S9GB 3CCQS 1RKJA 1QUVA 2UUTA 3GV5B 3GV7B 3OFFA 5D6GA 3DOKA 2P5VA 5DO2A 1RYSA 3BSNA 2RH3A 3QGHA 4KBIA 2GW8A 3IN5A 4RWXA 4RLEA 2HWTA 4OZJA 1HWKA 4HEA9 2RT3A 4R8UA 1D0EA 3G8TA 3H4BA 2Q6CA 1X4HA 5HQ8A 2RDJA 2PT0A 1SC6A 3IWXA 5L38A 2MPUA 1N8RT 2E5HA 2WW8A 2YTCA 2KB2A 2OTJS 1LQ9A 2RNEA 2R8JA 5CD4H 3VF0B 2EK6A 5E41A 2C2RA 1IKYA 5KFTA 1FNXH 1OQ3A 2OSQA 1VLYA 5B09A 1APSA 2P9CA 2YX4A 1DQAA 2GHPA 1T05B 1S0OA 2OPRA 4QR0A 3TAMB 4Y28C 1JXLA 1G7CB 2DR7A 4PKDB 3F73A 3M05A 2RE1A 4OZNA 4X84A 2XSJA 1K8AT 3O6QA 2NPFA 2HNYA 2DNPA 2UV8A 3CCUS 4ZPCA 3OXGA 1BQXA 3MECA 5H9EJ 1OS5A 4OV1A 3DRSB 4YB7A 2HZCA 1HNVA 1R8HA 2HVHA 5HMZA 1D1UA 5AXMA 4ECWA 2YNGB 1FO1A 4JI5F 2DO0A 5I4MA 2YNFA 2CPXA 3RU0A 3FQLA 1SUQA 4FXVA 3WC2A 2ZZNA 2QA2A 3M2UB 4ED2A 4OX9F 1SB6A 4CTAB 2FDNA 4CZCA 2DH8A 4TU7A 4OLPA 3QMQA 1Q78A 3LGNA 1YJ9S 4QZVB 3I87A 3PDNA 4YR3A 1VQMS 1WD6A 4RW7B 2YKQA 2M7SA 1DJ0A 2V4JB 3OFEA 4IG0B 4PG5A 5I3UA 3HHKA 2B9XA 2B3TB 4KC5A