2DGWA

Solution structure of the second rna recognition motif in rna-binding protein 19
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
91
structure length
91
Chain Sequence
GSSGSSGTTCHTVKLRGAPFNVTEKNVMEFLAPLKPVAIRIVRNAHGNKTGYIFVDFSNEEEVKQALKCNREYMGGRYIEVFREKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein
molecule keywords Probable RNA-binding protein 19
publication title Solution structure of the second RNA recognition motif in RNA-binding protein 19
rcsb
source organism Homo sapiens
total genus 10
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2006-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2dgwA01
2KFYA 2RS2A 2M7SA 5DDPC 1M1KT 5DDRC 1L3KA 2MSSA 2CPYA 4F26A 2ZJQQ 3CD6S 2CQ0A 2DNYA 1YHQS 2O3DA 3BO4A 1VQ6S 1WHVA 4QU6A 3G8SA 3DXBA 3CCRS 1HL6A 2CPDA 2MYFA 5HO4A 3NS6A 3CCUS 4WCEQ 3G4SS 5LXYA 3RW6A 1YI2S 1FNXH 1HD1A 2DNLA 5DDOC 1ZZFA 3NS5A 3TYTA 1RK8A 1YTYA 2HYIB 3N9UC 1PO6A 2VODA 2D9PA 2KN4A 2DHGA 4WKRA 1WELA 1Q7YT 4FXVA 2J8AA 4CIOA 5FJ4A 1DBDA 1VBZA 4M5DB 2N82B 1HD0A 4PR6A 2AD9A 2J0QD 3CC7S 2GHPA 1X4EA 3THTA 1NJIT 1B7FA 1VQKS 3THPA 4A8XA 2FC9A 5DM7Q 2MJNA 2A3JA 2SXLA 1SJ3P 1U1OA 4YB1P 2CPZA 2LKZA 1YJNS 1HA1A 4UY8T 4C0OC 5GVQA 1WF2A 2M52A 3R1HA 2DGWA 2RQ4A 5JVGQ 2MQQA 1VBXA 2B0GA 2HVZA 2E5GA 1U1QA 3H2VE 2BOPA 2CQDA 2MPUA 2NLWA 3SDEA 2OJ3A 1JJ2R 1N88A 2RU3A 4RU2A 1N54B 2DO0A 3TP2A 4ZKAA 2KH9A 4WIIA 2M0GB 3ULHA 2CQBA 3EGNA 2LEBA 2DNMA 3BO3A 1X5TA 1Q86T 1VQ8S 2XSFA 1WF1A 3HHNB 3JB9k 3LPYA 1K9MT 3G6ES 2AYBA 1VQ9S 1A9NB 1FJ7A 2XS7A 1WG1A 2RS8A 3P6YC 1H2VZ 2KT5A 1QVFR 2MQOA 1G2EA 4W92B 2MQLA 2YWKA 1X4FA 1P1TA 2DGOA 2I38A 3NNHA 3BEGB 2MKJA 2KXFA 2MZ1A 1X4HA 3ZZYA 2ZJPQ 2LMIA 3UCZP 2K3KA 2DNPA 1DRZA 3MUVP 1YITS 1URNA 3CXCR 5DM6Q 4W90B 2DIVA 2DISA 1YJWS 1FHTA 1A7GE 2RUGA 2X1AA 3I56S 1Q82T 2XNRA 2DHXA 2DNQA 2MB0B 1WEYA 3US5A 1FT8A 5IQQA 1X4AA 1F9FA 2LCWA 3S7RA 3UD4P 2DH9A 5H1SV 1AUDA 1NU4A 2E5JA 2MQMA 1W2BR 3IRWP 1WHWA 4WFBQ 3CPWR 1U1RA 2U1AA 2VOPA 4Z2XA 1M5PC 2CQ3A 4PKDB 5CA5A 2DHAA 2VOOA 3CMES 2LEAA 1VQ5S 3CCQS 2LA6A 2CQGA 1UAWA 2AYGA 1U6FA 2AYMA 2MQPA 3I55S 2V94A 1YIJS 3VAJA 2MKIA 2M8HA 1VC0A 2JWNA 1WI6A 2MMYA 4V19X 4QPTA 2OSRA 5IM0A 2DH7A 2UP1A 3NNCA 4F02A 5GADU 4TU7A 1QVGR 4CH0S 2VONA 5GMKa 4YUDA 1VQPS 3VAHA 5JVHQ 2CQ4A 3VAMA 1O0PA 3Q2TC 1QM9A 1JJHA 2QA4S 2X1BA 2MGZB 1WI8A 3DLLQ 3MURP 1X5SA 1SJFA 2HZCA 1S72S 2E44A 2M2BA 5D77A 4ED5A 2CQIA 2MKSA 4TLQA 1RKJA 1R8PA 3U1LA 2DNOA 4UQTA 2MKKA 1X4GA 4WFAQ 2CQ2A 4J5OA 3G9CA 2RQCA 2DK2A 2KG0A 4BS2A 2DNGA 1H2TZ 3VF0B 2ZJRQ 2OTJS 2G4BA 2XNQA 2JVOA 1P27B 3D2WA 3MXHP 2X1GA 1VQ4S 1X4DA 2F9DA 2L9WA 1FXLA 1M5VC 1FJEB 3NMRA 3P3DA 5GAHU 1YJ9S 1KQSR 3S01A 3MUMP 1M90T 2OIHA 1VQ7S 3B4DA 2KRRA 4Y0FA 1DHMA 1N52B 3CMAS 3V4MA 5MLCV 3MDFA 3G8TA 5IFMA 1U1LA 1SXLA 3ZZZA 1BY9A 3K0JA 1H6KX 3CTRA 2CPJA 2M9KA 3FEYB 3G96A 1WWHA 1X5OA 5DDQC 2KXNB 5CXTA 4TU8A 1DZ5A 1U2FA 2F9JA 3CCJS 1WTBA 2AYEA 2G1DA 4C7QA 1X0FA 1VC5A 4U67Q 2DH8A 1WHXA 4QU7A 3CCLS 2RVJA 1YWXA 3IWNC 1D8ZA 2DIUA 3B4MA 4LJMA 2YTCA 2YH1A 3UCGA 4C4WA 4IOCQ 3MD1A 2ADBA 2CPXA 2KG1A 2M88A 1K73T 2MZTA 4QQBA 1XN9A 1OIAA 1WEZA 4TU9A 2JX2A 1JJ4A 4CH1A 1KD1T 4YOEA 2MKHA 2FC8A 1WEXA 4F25A 3VAKA 2MZSA 2DGQA 1VQNS 1X5PA 2WBRA 1WF0A 2QFJA 5LXRA 4IUFA 4IOAQ 4LMZA 5ITHA 2DITA 5LSOA 2CPIA 2OTLS 2DNNA 1WG5A 1NO8A 2CPEA 2MJUA 2KI2A 1CVJA 2HGMA 3R1LA 2PEHA 2EK1A 3SDEB 5HL7Q 2MXYA 1U1KA 3S6EA 3CCMS 1S79A 1VQLS 3P5TL 2CPHA 2RRBA 3HI9A 3MUTP 4OZ0A 2DGUA 3NNAA 3SXLA 2DGTA 3EGZA 1M5OC 3J7ZT 2KM8B 1KC8T 2CQPA 3VAIA 3VALA 1U6BA 2EK6A 5DETA 3TO8A 2I2YA 1WG4A 2DGXA 4P6QA 1VQMS 3BO2A 3CCSS 2FY1A 2CQCA 1JMTA 1UP1A 3H2UB 2DNZA 3PIOQ 4WF9Q 3G71S 2KYXA 3R27A 1K8AT 3EX7B 2J0SD 3UCUP 2HGLA 1N8RT 2M4MA 3FEXB 3UWTA 2CQ1A 2D9OA 2DNKA 2MHNA 2DNHA 3VAFA 2E5HA 2GO9A 2RT3A 5LJ3Y 1U1PA 3MOJB 2DB1A 2OSQA 2MQNA 3CC4S 1M5KC 2XS5A 2L41A 4IO9Q 2EVZA 2MZJA 1UW4A 1WHYA 2JVRA 3CF5Q 2MSTA 1IQTA 1R8HA 2LA4A 1UFWA 4LIRA 3LQVA 1PGZA 4EGLA 2KM8C 1SJ4P 3Q2SC 2LECA 3CULA 2LQ5A 3SMZA 1OO0B 1U1MA 3CCVS 3L3CA 1KOOA 1VC6A 2MY8A 1SJRA 2J76E 1FJCA 1D9AA 2FPHX 1Q81T 2M70A 2KVIA 2DGSA 2F3JA 2YH0A 1KOHA 2KHCA 2RNEA 2MY7A 2FHOB 2E5IA 2JRSA 5IM0B 2KU7A 2XB2D 2ERRA 2CJKA 3CUNA 4OZ1A 1ZZNA 5LJ5Y 2G0CA 1H2UX 1VBYA 1OWXA 2MZQA 2YKAA 3P49B 2ADCA 3J7YU 5LSLA 1FO1A 1X4BA 2LXIA 3S8SA 2QEXS 2Q79A 4PRFA 2PE8A 4WFNQ 2XS2A 2L08A 2MGZA 2K8GA 3VAGA 5EN1A 2MKCA 4CQ1A 3U1MA 2LYVA 2DNRA 5GAGU 2CQHA 2U2FA 2DHSA 2N3OA 2KRBA 1SJQA 5CYJA 1U1NA 2M8DB 2NZ4A 3MI7X 2HGNA 3CC2S 2N3LA 3OW2R 2D3OR 3PIPQ 3UD3P 2KXHA 4FXWA 2DGVA 5D78A 3MD3A 3UE2A 1VQOS 3RW7A 5GAEU 2X1FA 3CCES 3BS9A 4ERDA 2MZRA 4Y00A 2DO4A 1OPIA 2RRAA 2BZ2A 2N7CA 1ZH5A 5BJRA 2LXUA 1X4CA 2CPFA
chains in the Genus database with same CATH superfamily
2WVDA 3NWGA 1GXUA 1HI0P 2Y0SD 4C8OA 1HL6A 4G3IA 1O8BA 1H98A 2B9EA 1RCXB 3I87A 4ED0A 1PO6A 1OYDA 3ICLA 3MWBA 3HHLB 3K17A 3T5HA 4ZJOA 2EBEA 4OI4A 2VG6B 4FYVB 4RW8B 4K5RA 2OD4A 8RUCA 4QW9A 3N4WA 1RHUB 5ETSA 3KNAA 4N5SA 5A8RB 5KFUA 2IVFB 1V3SA 4PQUA 3ZZ0A 4IR1A 1KLNA 4F67A 1H38A 1R7IA 3CO9A 3IBCB 3TZZA 5KFGA 3KXDA 2RU3A 2UUBF 3JSMA 2D1CA 3C6UB 4DL0C 1U47A 1X8DA 3GJQB 5HVFA 1KLMA 3FCHA 1VQ9S 2HRUA 4DR5J 3HHLC 4DV1F 2ZH4A 1NK9A 1Y7PA 1WKJA 1X4FA 4DN9A 1TL1A 2QRRA 5F8MA 2BQ3A 4KO0A 3ITHA 4DR2F 4U6PA 1TUWA 2ZH3A 1FNOA 4YQWA 4CLSA 4F36A 5KFCA 1FNMA 3RB0A 3QQCD 5A0YA 2WVFA 1T11A 4KBIA 3HD1A 3EZOA 1YBTA 1TMJA 1QAYA 2WSEC 1AW0A 3M8WA 4X62F 4OJ1A 1RAFB 3H20A 2XO7A 4DL5A 3DOKB 3DLKB 1KWMA 4ZVGA 3F41A 3CDEA 3GQCA 3DRXA 4DS5A 4J9SA 2Z58B 5KFJA 3VAJA 1VC0A 1HIYA 2FZCB 3AT1B 5J2NB 1FDNA 3I0RA 1S76D 5L9NA 2VONA 2YKQA 3C16A 3OD2A 3MF5A 1E6VB 2FVSA 4B9UA 2CNNB 4ES1A 3G9CA 4JI6F 1JJCB 2KG0A 3MR5A 4PEOA 3TVZA 3QSIA 1VQ4S 4CO2A 4LQ3A 1REGX 4I7FB 3ENVA 4LQ9A 4EI2A 3GV7B 2C3UA 3RB6A 1RWOB 1SVDA 1L3TA 4F4YA 2UUBJ 3B4DA 2ZNYA 1KHVA 2YKOA 2B5JB 2CPJA 1S48A 4P2MA 1VRUB 4DV1J 2LP4A 3ZZTA 5D4PA 1BXNA 2R8HA 3MEGA 1Q5VA 3ONQA 1K1SA 3QMQA 1IBKF 3ETMA 4N77A 1NNDA 1OSCA 1IM6A 3N28A 3ZTRA 1HR0F 3AXKA 4DX7A 4JV5J 2CZVC 3FCWA 3TAMB 1XMBA 2MJUA 4FDFA 1VHIA 1V3ZA 1N5YA 2Z2MA 3LGNA 1UWBA 1G7CB 5K8MA 3PR4A 4O23A 1KC8T 5D4LA 1NEEA 2DCLA 1LEOA 4WE1A 1MW7A 1WORA 2CWXA 3B8HA 2DGXA 1RAEB 3BDEA 4FKXA 2OEMA 2YKMA 1VIOA 3M8ZA 2V4RA 5G0RA 2XLJA 5C2GA 3U7JA 2ASJA 1HBNA 4UZCA 2BKOA 3BB5A 4JI6J 5HMZA 3KOAA 2IRUA 3JSRA 3H4BA 3MTKA 1H7XA 2DYAA 3Q8QB 3CF5Q 3NGDA 3VZIA 1UFWA 4LF2A 4LF5F 3LUYA 3I82A 3MHYA 4GKKJ 3PV8A 4FF3A 1U1MA 4X2BA 3AB2B 2QTWA 3OHBA 2FPHX 1JKHA 2GCFA 5K8PA 2KVIA 5B09A 5FDLA 4YB7A 1Y5NB 1OPZA 2G2ZA 3FNNA 4QIWD 4KKOA 1U6ZA 3SV3A 4X4OA 3QT5A 4LFAJ 2XS2A 4IH6A 3K8VA 3QLHA 1FRMA 1IBKJ 1DLOA 1F1BB 2LVWA 4K4WA 1HR0J 4LT6A 4OYWA 4RW9A 3OR1B 5DLGA 3ZNJ1 4RLEA 4ZJQA 2X1FA 2N7YA 3OL7A 4NPOA 3R6GB 2MZRA 3MECA 2RRAA 1ZH5A 1RTIA 2PN6A 1V6HA 2MSSA 2Q3PA 3T1YJ 2F7VA 3FBCA 4F3QA 4GKJF 2G0IA 5D6GA 1EP4B 3NS6A 2DNLA 3BYRA 2PO4A 1F0XA 2OGUA 2OH2A 1F5BA 3CJ3A 4K0KF 2N82B 2HQ3A 5KT5A 1HD0A 1VMBA 4CZCA 5D4NA 2C2ZB 1TMMA 3MM8A 3THPA 5DM7Q 1JLQB 2MJNA 1HW9A 3C46A 4C0OC 4ZVHA 1TFWA 1Q4RA 4LF5J 4NE9C 4K50A 1T9TA 3K5MA 2UXBF 3DOLA 1MN9A 3DMJA 1J5EF 1FERA 1IKVA 3ULHA 3ET6A 3CJ2A 1Q86T 4K2XA 5C24A 3LPYA 5D4OA 2VKRA 2NXCA 1LXNA 1JXVA 2VBWA 1QJHA 1HBOA 2WK4A 4HI2A 3Q8UA 3P4UB 5E41A 2XY5A 4K4VA 2PGCA 3MUVP 4DBQA 2YX4A 3RB3A 5DG8A 1Q82T 1OS5A 2FLLA 2HMIA 1H0HB 3SQGA 1WEYA 5CHCB 2NS1B 4NWBA 4H4KA 1X4AA 1FKPB 3AH6A 2EC0A 5B0EA 1RDRA 3MEEB 3GV8B 2G13A 3ENWA 3DLBA 5CA5A 2VOOA 3CMES 2K7KA 3T9NA 3O1LA 4DXLA 5IM0A 2FHJA 4DS4A 2ILYA 4GKJJ 4TU7A 1S1TB 1KQGB 2E1MC 5KG1A 4H4OB 1S1UB 2AF6A 4DLGA 2HVEA 2MKSA 4WBFA 1SQEA 3MOZA 2HHPA 4UQTA 1U8WA 3H5UA 5EX3A 4WFAQ 3DU5A 4USMA 2J6TA 5AE3A 3R5DA 4A8KA 1P27B 4AE5A 3FVYA 2X1GA 2F9DA 2L9WA 4A4JA 1RT5A 5KOWA 2AZ1A 4J9OA 2JNJA 1M90T 2QL5B 1SH0A 1J5EJ 3I0SB 3V6JA 5MLCV 3DRSA 1QUPA 1BY9A 4CLFA 1HYSB 1FRXA 2XCPA 5M2RA 1DZ5A 1DTTB 4C7QA 3GYGA 4U67Q 2VB6A 4Q2MA 5KFTA 4CH7A 3LTOA 1FWPA 3UCGA 3UN3A 3TJAA 2B4VA 3HHLA 3J81U 1OIAA 2JHEA 2IPOB 2JX2A 4RW8A 4IKAA 4WXOA 1HWJA 3IWXA 1GEHA 4Y2KA 3G2XA 5A8RA 1KP6A 4O0IA 1ZAVA 3C15B 1EB0A 1N5SA 4DV7F 1XNQJ 2F8HA 3C6UA 2DXDA 4LSNB 2EEYA 1WJ9A 1NHKL 3TUZC 5F3TA 1B0VA 1H73A 1DQAA 3GR0A 3HKWA 3KLHB 3QRRA 5HBMA 2BJ9A 1ZYQA 1Z4UA 4IG3B 4JUZA 2YWHA 4X4TA 4B9MA 2GNKA 2HZVA 1U1PA 5FIIA 1C0TB 2UUCF 2MSTA 3QSYB 1PGZA 2EG1A 1SJ4P 3C3LA 4F4ZA 2YNIB 1ZAXA 5ETQA 4OHWA 4C8YA 3DOKA 4USVA 1QE1A 2VHGA 3DLKA 3OR2B 1IKXB 2DRAA 1HARA 2Q1LA 5B0BA 3VGSA 2KU7A 4NLQA 1RT7B 5F8LA 1S77D 4ZVOB 1ZZNA 1RGVA 1S7HA 1P1LA 5J2NA 4M95A 3P49B 1FKOB 1FO1A 2UV8A 3GE9A 3BQ2A 1Q78A 3P8BB 4NZ6A 3U1MA 4MKYA 5GAGU 1AA1B 2U2FA 4Y2CA 3R8YA 3LW5C 3RR7A 3O2IA 2XMKA 3MI7X 2HGNA 2FQQB 3HHEA 3CO0P 2Y1JA 3PJ9A 4I7FA 4U7UK 4EBEA 2BANB 2BE9B 4ZLLA 3DOMB 1JLCB 4TNOA 4ILRA 1KDNA 2R2UA 1U4BA 3TA0A 1UVKA 1T02A 1ZAWA 4ZPDA 3I9V9 5T7LA 2B5JA 3F73A 2O3DA 4BWMA 1N5VA 2JLEA 1T3OA 3CSKA 1YTYA 2QN6B 5E3PA 1Q7YT 4RNFA 2W2MP 2OPQB 4ID5B 2XYHB 1MNEA 3RJMB 2PEBA 4CYUB 2DGWA 3ILLA 3TAMA 3VTIA 2GIQA 5IZHA 1XQIA 4I0WA 4X4QA 2LEBA 1MWZA 1S57A 2O66A 2XGPA 3IR6B 5DS7A 5D8HB 5THWA 3H5SA 1SUQB 4NLTA 1HBUA 2ZHOA 2GJFA 1S49A 1RT4B 4LUBA 3SSRA 1YLXA 3BSAA 2H4YB 4DPTA 1NK6A 3PR5B 1S9GB 2ZVSA 4KY3A 1VRTB 3IN5A 4QJVA 1PILA 2A0FB 2HQCA 2WB1D 1FCAA 4P2FA 1IXKA 2ZM6F 2FVRA 1B64A 4IFVB 3DLGB 4F0MA 5DGBA 3WIUA 1TV6B 3DDKA 4I69A 3K57A 3TA2A 3PTWA 3NMAA 2IC3B 3NGUA 4K8RA 2OSRA 1SH2A 4C11B 3G8QA 4NA2A 1QSSA 2VPWB 1BD6A 2QA4S 2UXDF 3M9NB 3MURP 2E44A 2M2BA 1U8SA 4P52A 2C28A 4MFBB 2HNZA 3CT9A 1D9FA 1IJFB 2F4FA 4QOTA 2FJVA 3OR1A 1F3VA 4AL7A 3SYZA 3AJ2A 1N5TA 1NDLA 1TKZA 3CJRA 3V6DB 1T9XA 4DUTA 1KSPA 1UTAA 2QA4G 1LK7A 3G8TA 3EGVA 4ZCLA 3GIMA 1NZAA 3EICA 1RTJB 3VWSA 2V6AA 3PDNA 2NR0A 1CJUB 4H4MB 4QCLA 3KLIB 2G9OA 2CWKA 1EP4A 1X0FA 3GSDA 2P9EA 2CUYA 4OFZA 3BGLA 3DRRB 3KLFB 4QQBA 1XN9A 3J81Y 1YZ7A 3ZC4A 4F25A 1X5PA 1WF0A 1RT2A 3DRPB 3ZTQA 2ZM6J 2GHWA 5CABA 3P45B 3QPIA 1YRUA 1FRIA 3CCMS 3DC2A 3HI9A 2NXEA 4YN3B 2C2EA 1R43A 4Y2IA 5J1EB 5HSPA 1KRPA 5A8KB 2JFKA 5KFQA 2QO3A 5HI7A 4DR6F 4TY9A 3W61A 1X9SA 2I2YA 4O44B 2B8PA 1F5CA 4X66F 2UUAF 2X51A 3D7SB 2HBYB 1UEKA 1NUEA 3W60A 2C22A 5KFPA 3OFGA 3D6FB 3FEXB 2D9OA 2FD2A 2HQGA 1C4CA 5K8NA 1I1GA 2VG7B 4CI0B 4QWEA 3AOBA 3KLEA 4O3PA 2VBYA 1IBMF 3FK4A 3ELHA 3OVSA 2HFZA 3PHTA 4EGLA 2UZAA 3QIPB 5H9EK 2AJ1A 1KOOA 3MEEA 1RWVB 4ZP6A 2PT0A 3ISZA 2F3JA 2R7VA 2FHOB 3CUNA 2G0CA 2PI5A 2ADCA 5B0DA 1LWEB 4H4OA 2LXIA 2DXFA 5KFDA 1S1UA 1U0HB 1C2PA 2D3ZA 3Q0AA 4NLSA 2Q66A 1HNVB 1BE4A 4IFYB 1Y4ZB 3K58A 3VV2B 3OW2R 4FF4A 3KWMA 2KXHA 2B3TB 2XHCA 3MD3A 5GAEU 5CQGA 3OTCA 1EIYB 2H48B 3HT0A 3I0SA 2H5JB 4WYWA 4AQYF 4B9VA 3RBXA 2M7SA 1APSA 4QR0A 4JYAF 4UTGA 1PJ7A 1HYSA 2RHQB 3H25A 2UUWA 1DTTA 4X66J 1RWWB 2UUAJ 4DFJA 3CCTA 3RG6A 4O3OA 2Z4PA 2HYIB 3FZBA 2VDHA 2D41A 3PRBA 2Z8QA 1UETA 1RP5A 1BC6A 3OUYA 2XYPB 2XY6A 1UVJA 1B7FA 1RSCA 1RHJB 3C2PA 1RJJA 2A3JA 2SXLA 1WC1A 1LW0B 1WOPA 5GVQA 2BQRA 4A46A 2RQ4A 1X7VA 1TELA 5IT0A 4PXCA 2OAUA 3C15A 1N88A 2CNOB 3Q23A 2CQBA 3L09A 3IA0A 5D3GB 1WG1A 2Z30B 1XJWB 1G2EA 2O67A 4OX6A 3CVKA 3NNHA 1YZ6A 4IG3A 3OLAA 5K20B 1X4HA 1UWAA 3T41A 4OHZA 4OMFG 5IV3A 4O3RA 4ZCMA 4CNYA 4W90B 1NK8A 3DHXA 3WC0A 1C0TA 2ROEA 3Q8VA 1NJZA 5IQQA 1N56A 2O1PA 3D67A 1F9FA 2I5JB 2UU9J 1AUDA 3H0PA 1IM4A 4FBUA 2CAJA 4C8MA 3HSDA 4KGZB 1U1RA 2QA1A 3G6VA 2QMWA 4AQYJ 1P9YA 2NXUA 3GFXA 3OR2A 5C7PA 1IKXA 2BR0A 4DR7J 1SKWA 4F8RA 2VPXB 5HP1A 1FKOA 3DCAA 4K5SA 2ZH6A 3DLLQ 1MMNA 2HZCA 5D77A 3P5BP 3HO1A 3OFFA 5CH7B 3PACA 1WDDA 1UL3A 1JXLA 2PIIA 3R9LA 3P3DA 1UZHA 3RU0A 4NEYA 2BANA 3GWCA 3DOMA 1JLCA 3AODA 1KN6A 2F5GA 1SXLA 2ZH1A 2J9DA 1IKYB 1ZM3A 2W9AA 1RU2A 1X5OA 2HWHA 3T1HJ 1U2FA 4C9DA 1P8GA 2DH8A 1DFDA 1MWQA 1UJ5A 2RVJA 1LWCB 1T3NA 2DIUA 1NZ8A 1HBMB 4RUBA 1EETB 1IUJA 3A8JA 2NSCA 3OJSA 2OPQA 4PWWA 1CJTB 4ZPTR 4DX6A 5L39A 1WEXA 4KGXB 4ID5A 3IBFB 1RZMA 4LMZA 5KFKA 2HGMA 1JLFB 3PW7A 5BYQA 3D28A 3NS7B 3GIKA 1HLWA 3CJ4A 3HSJA 4DV6F 3E01B 2OPSB 1AUSL 4NXMF 1S6PB 3J7AN 3CJ0A 2DBBA 4WFYA 3CD7A 4RBTA 4C0HA 5DETA 3TO8A 4QW8A 2BACA 5HQ8A 1BQNB 1NJXA 2FY1A 3BBCA 1SUQA 4DV4F 1I6JA 1RT4A 3G71S 1XR5A 2PFFB 3AD7C 1N8RT 2CNLB 1XK8A 1S9GA 2J8SA 3TVYA 1VRTA 1WHYA 4HACA 1I94J 1U26A 3HZEA 4IFVA 3DLGA 4XPCA 5DJBA 1UJ4A 1RBOB 1TV6A 2F1FA 4QYZK 3JAMU 1BWVA 1CULB 3B82A 1ZPVA 2IC3A 2RNEA 3HCXA 4JV1A 2BJ8A 1U25A 5CYMB 5ADZA 1OWXA 2F4VJ 4CM2A 5B0CA 2PE8A 2OD6A 4PXDA 4TYBA 9RUBA 2ILZA 2RD5C 4MIBA 2NUHA 4DF8A 3QIDA 1Q53A 4O3NA 2KRBA 4MFBA 1N34F 2NZ4A 1XIQA 2FUG9 3CC2S 3PIPQ 3UE2A 2QJ3A 2QMXA 3ZZRA 4DJBA 4ZVSB 1WC5A 3V6DA 4GC7A 3DLHA 2HAFA 2KB2A 3JQKA 4DV6J 4OI3A 3R2CJ 2P6SA 4NXMJ 5F9NA 2ZJQQ 3KUHA 1RTJA 2B4PA 1NMEB 4C8NA 3LWLA 5KOXA 4KSEB 5HO4A 1FRJA 1RTDB 1EKRA 2BJDA 3ETOA 5GMDA 3JYTB 1WELA 5FJ4A 4JI0J 2W9CB 2YNHB 4PR6A 3HLUA 3DRRA 2QIFA 3CC7S 1Y0HA 3KLFA 3W2WB 1IBLF 1PJ5A 2EG2A 3T6BA 1CQNA 3DRPA 3M1VB 3CDWA 1Y11A 3RR8A 3KNGA 2V68A 3CIZA 4JI5F 3HVTA 4FN5A 2XMWA 2NLWA 2IHR1 4JI4F 3CJSA 4KYZA 4RJVA 3HJVA 3K2YA 5J1EA 4HH0A 1NK4A 1Y3KA 5A8KA 4MIWA 1WF1A 3QGIA 2XEXA 4FPIA 2AYBA 4M5HA 1WSRA 2V8HA 4O44A 1T7PA 4RW6A 2DR5A 2I38A 3C14A 2VH7A 4IR9A 2ZHAA 4JP8A 3EVMA 4B3SJ 2V9WA 3K8WA 5DM6Q 1UVIA 2DISA 1N34J 1A7GE 1BGXT 5A8WB 2VG7A 2UVUA 3LF0A 1S12A 3G6YA 4RBUA 3R97A 3US5A 3ZZOA 2YXLA 3I5BA 3S7RA 4AD6A 3W66A 4OI1A 1T94A 2W7OA 2A18A 3QIPA 1WHWA 3CPWR 3EZ5A 3FFIB 1U6FA 5CCMA 2MKIA 4NOHA 3IG1A 2UP1A 3I31A 1XNRJ 4CNZA 1N4LA 1U2RA 4ZPWR 2MHEA 2XMTA 4FNHA 1LWEA 3FCVA 2ZH2A 4URQU 4DV0F 2XMVA 2PSZA 1SJFA 1U0HA 3LAMA 2HBQB 3GZ7A 1U0SA 2FZGB 1LFPA 1R3NA 1HNVA 3MMCB 4DUZJ 4PAAA 4IFYA 4L76A 3SEOA 1X4DA 1M5VC 1VIXA 3CDUA 2X3GA 3O5TB 4EUVA 5AE2A 4FPRA 4LBIA 4ZVEA 1RAHB 1S9FA 1R0BG 4JI4J 3EUNA 4M5KA 1NBEB 2HFNA 3UR0A 5DGAA 4X64J 3BYPA 2QLWA 1TL7B 2NREA 1V5VA 1N33F 1YWXA 1N5QA 3TI0A 4WTYA 3W2VB 3SSQA 4DV3F 3U1NA 1Q0NA 2R7QA 4RWWA 2BQUA 4CH1A 4BHQA 1C1BA 1N48A 2WBRA 3MEKA 1LW0A 3RUBL 4U9RA 3OTEA 2C2NA 4OHYA 3DLJA 2HNDB 1FXDA 2XQCA 3GILA 1B70B 2DGUA 3MM5B 1ICEB 3W64A 2KM8B 1ZTWA 1QTNB 3EXCX 2VU5A 1HMVA 2EK6A 5D3GA 2EFOA 3QATA 2UVWA 4ZP8A 2E1CA 4U8VA 2DNZA 2BRKA 2HFOA 4LRDA 5KG7A 3PYFA 3T1AA 2J0SD 1Y5IB 3UWTA 3GP9A 5IC6B 1TVRA 4OYBA 3MCNA 2L41A 3IP0A 2AGOA 2D74B 3IGNA 1NH7A 2I5JA 3R5JB 2KM8C 4LFBJ 1FFGB 4LF1A 5EX0A 2FJXA 1FFSB 2C3YA 1JNRB 3C66A 2J7UA 3D6HB 1O5JA 3BR8A 1Y3JA 2YQ3A 3JAMY 2JRSA 3H7HB 3CCZA 3RRHA 3ENQA 2XB2D 4X4NA 4OZ1A 2YKAA 5IC4B 5E3CA 3KG1A 1Q5YA 1N33J 2FLOA 4A8OA 1LWFB 4ZLNA 2P5VA 2FJAB 3DM2B 4FYYB 4DV3J 4LBHA 2L9DA 1GMVA 3HFVA 3RAXA 2DEIA 1F9HA 3NEKA 5HJYA 3IR5B 4I2QB 4B3MF 4QBUA 2VD3A 4WWSA 2GVZA 5C42B 1S4EA 1HKAA 2W24A 1M1GA 1VJWA 2DPJA 3BQ0A 4USHA 4I2PB 1IKYA 2CADA 3HT3A 3G4SS 4IRDA 4WP9A 2HHVA 3G82B 5LT5A 2XWYA 1C0UB 2YBVA 2LQJA 3QZ8A 1EETA 1SH3A 3BKFA 3POTA 3UI3A 1VQKS 2E7WA 1Q95G 1CJTA 4LF4F 1XBWA 2HVZA 1SIWB 2KYZA 4CT9A 2LLZA 3A1YG 3FEZA 3OL8A 4A48A 1JLFA 3X1LB 1JJ2R 4URGA 4ZKAA 4WIIA 4M94A 4ER8A 3JB9k 1YJVA 1IWGA 4E2FB 1S6PA 3M2RB 2L9NA 2NYHA 4G1PA 2XS7A 2ZBPA 2KT5A 1BQNA 1N0UA 2E1RA 1HHTP 1JLGB 4YMEA 2N4CA 2ZJPQ 3O6QA 3OTOF 4XIUA 2HHHJ 4G1IA 1RWMB 3N5FA 2G2OA 1YJWS 1RWPB 2OFHX 2W1BA 3GCWP 3BGRA 4ZIWA 2HPUA 4ILMA 3DLEB 3UD4P 4B3MJ 3R7SB 4ZK7M 1RT3A 2MQMA 5IV4A 1S0VA 4P71A 4OHVA 2U1AA 2WW8A 4ZP9A 4Z2XA 4KB7A 2FLPA 1CULA 4WIQA 2AYGA 2GAHC 3SCLE 4DF4A 4QPTA 4OI6A 2J0XA 1WKKA 5CYMA 1AYEA 2FHJD 5M2PA 2XGQA 1O0PA 1HWIA 2WCXA 1AXQA 4ZPCA 4F7VA 2RJZA 1X5SA 2BJ3A 4EFAC 4YY3J 2CQIA 5K8OA 5AXKA 2MKKA 5H9EJ 1NPRA 5JXSA 1FWKA 3BN4A 2RF2A 3VF0B 2ZJRQ 2JZ5A 3MAQA 1FJEB 4RBVA 4LF4J 2AU0A 1D0EA 1RHKB 3H8YA 3GJSB 1S0OA 4M63A 1JXEA 2IJRA 4G6VB 2M9KA 2MEWA 2MKYA 4M5GA 2HVHA 1V9OA 4P10A 1E6YB 2F9JA 3CCJS 2GGPB 2E66A 4F04B 1VC5A 3IM9A 2XM3A 2BRLA 1S4FA 1HNZF 1S1XA 1S97A 3GYXB 2YH1A 1FI4A 2WTFA 3OTOJ 3JYTA 3MD1A 1Q8KA 2KG1A 2BMBA 4HKQA 2AWZA 2R7RA 3W5YA 3HHLD 2W9CA 5KT6A 2YNHA 2ACMA 1KD1T 3Q24A 5EHHA 1S7IA 3MEDB 1VQNS 2V63A 4V1Ak 5LXRA 4J9MA 2ZKTA 1R6YA 3R1LA 1XC9A 3M1VA 3W1YC 5KT2A 3KHGA 2CJ9A 1VISA 2OPPA 2DGTA 3RZAA 2WONB 5EWEA 2CG8A 2YX1A 3CDBA 2PDAA 1M0SA 3UVJB 4XDDA 3BO2A 5I3UB 4HHHA 2LEPA 5F3ZA 4X4UA 3KYLA 1V3RA 2RKIB 3KJFB 4EZ9A 2V67A 2QMUB 3DYAB 4GVLA 2CQ1A 2JLFA 2O01C 2GO9A 3I5AA 3E2EA 2ZVIA 5M2UA 4GVBB 2XS5A 4K4TA 2C2DA 5A8WA 4ICLB 1F6TA 4QIGA 3QJJA 2LA4A 3HVAA 4LIRA 2W8LA 4NZ7A 1YGYA 3SMZA 1WC4A 3C19A 4ZPVR 3NKYA 7FD1A 1S9EA 3CEDA 5B08A 3FFIA 2R2TA 5HAOA 2ZEJA 3R3TA 4Q44A 2HS4A 3RTVA 1XMQF 1KOHA 2B7BB 1EQ0A 5J1PA 5FLXU 2LQ9A 1TFYA 1B7YB 4ZLJA 3BM7A 1HHSA 4R5PB 5LSLA 2FVQA 3GB0A 2QEXS 2DY9A 2JEJA 4K4ZA 4N7TA 1HNZJ 2MKCA 1UMJA 4UUWA 2CJBA 2K7JA 4X4SA 4J9NA 3MMAA 1EAYC 5DO2A 3MMCA 7FDRA 2M8DB 5IXUA 3ZTPA 3ISNC 3VQTA 2ZE2A 2DGVA 1U7LA 2CIMA 4DCJB 3KDNA 3CW2C 4F2SA 4DCPB 2VA3A 5KAKA 1NSPA 2CPFA 3SIPB 2ZZTA 3EMTA 4F2RA 3LA0A 4DQQA 3WDOA 1UPPA 4CLUA 1S0MA 2VG5A 2E5LF 4QU6A 1VRQC 1VYAA 2MYFA 2ASDA 4O4GA 1RK8A 1RXOB 1GXTA 5KFZA 1J27A 1REVB 2R7SA 4CIOA 5IT9U 1X31C 4ELUA 4C8ZA 2V2QA 4F0KA 3W2VA 2ZZNA 2A1BA 3CCWA 4DR4F 1C1CB 1A6LA 4ZVQB 4YB1P 5KFNA 3KTQA 5JVGQ 1YK9A 4DEZA 1VBXA 2XO6A 3AQOA 4NEZA 1MN7A 1PCAA 4DV2F 2HNDA 4CTAB 2VICA 1U2CA 1CEZA 4TQSA 2NYIA 3BF4A 4DL7A 1FTCA 2GZOA 1XMQJ 3DI6B 2YPYA 2HG4A 3I4HX 4E8UA 4FF2A 4IG0B 1QVFR 1O6XA 3SI8A 1Y10A 5FD1A 3GYNA 3ZZYA 1SKSA 3UNGC 4Y28C 1R27B 2JOQA 2C3MA 4G1QB 1RLCL 1NHUA 4WP3A 1NJWA 4TVAB 3NLCA 5DLFA 3OHAA 3MZIA 4B17A 1HFEL 4DLEA 2D3O1 1HNIB 2E5JA 1S6OA 2OLWA 4C3MA 1U45A 1UVNA 2KHDA 2K2PA 1VQ5S 4KPCA 3AAWB 5DQGA 3RB4A 2CQGA 3FBEA 1NRKA 2FHKA 4DQRA 4LVNP 1WI6A 3JTNA 3T5KA 2E5LJ 1A0OB 4UZBA 4RUHA 5IS2A 3CJ8A 3PRVA 2FJEB 1IR0A 1CJKB 1LWFA 4GC6A 3N0VA 4RL1A 2ROPA 4E0DA 3IRXB 1ZBTA 3DM2A 1QSYA 4QYZJ 1VBKA 4ATNA 4DL3A 5LOQA 1OY6A 3HULA 5C2CA 2YWEA 1KQSR 4I2QA 4NYZA 1FA0A 3S01A 5C42A 2OIHA 4ZOSA 4RW4B 4YHHJ 4HVZA 4Y0FA 1N52B 2ALYB 3MDFA 4OV6A 4RWXA 3I96A 4LF8F 2GW8A 1TKDA 1BHNA 4AL5A 5CXTA 1FKAF 4I2PA 4IRKA 4MKVA 1ITPA 5F8IA 3MPDA 1FWLA 1D1UA 5DZ6A 2Z57B 3HD2A 3G82A 5HQLA 4LF9F 1S99A 4QZVB 1MLAA 3H5YA 2EW9A 1C0UA 2LQ8A 2M88A 2J7WA 2MZTA 3BR9A 3AA8A 4NLUA 3ZZPA 2QZ8A 4O3SA 2VF3A 5H9FJ 3GTYX 1ZETA 3QZ7A 3UNYA 2CG4A 2V50A 2R8GA 3QGPA 3DGPB 2OHDA 2IYGA 4DR3F 3ZTOA 3KK2B 2C2KB 2GO8A 3H98A 4NMLA 4P2XA 2KT3A 1WG4A 3GR1A 3MCMA 1T03A 2WVEA 1MU2A 2QLXA 2OEKA 4Q7AA 4QWAA 1GH8A 1JLGA 4WF9Q 2RDJA 1FXRA 4EMDA 3UPFA 3MTJA 3IGVA 3UCUP 1BLUA 3HFZB 2MHNA 3O3LA 1CSJA 2XSJB 2CZ4A 2E5HA 3OVBA 4QIEA 5K14A 3TWZA 1DAXA 2DB1A 2HAIA 1NKCA 2IM0A 5BXIA 2FYXA 3LPEA 4J9VA 3T19A 2GFFA 4CP5A 1R8HA 2C1EB 4PG8A 2GMHA 2LFVA 1ACMB 2BM0A 1SB6A 4U7UD 2D7SA 3QO9B 4NCGA 1KONA 2YNFA 4ED4A 4EZ6A 2YH0A 4KV8A 2KHCA 4ED3A 2E5IA 4LF8J 1KR4A 5I42B 1SC4B 2GIRA 3QAUA 3W5XA 4ZVFA 4JB8B 5LJ5Y 3MAHA 5FLXY 2MZQA 3U27A 4WFNQ 4MK7A 4KHPF 3BN7A 1SL2A 3MGJA 4LF9J 4ECVA 3NL0A 3TX8A 3CMQA 2JC0A 5CYJA 1U1NA 1S1WB 2ZKUA 3GIIA 4B08A 4ECRA 4L74A 1KFDA 3QT8A 2WSCC 2AEFA 3GIRA 4ETZA 4ERDA 2WVBA 2DO4A 1HWLA 5C5JA 4DR3J 1X4CA 3EYZA 3A3OB 4IQMA 5HQMA 1L3KA 2DHHA 4LF7F 3N6NA 2PFDA 2GHVC 1WHVA 4HDHA 1RT1A 1E6YA 3R5CA 3B6BA 2CZ9A 1HD1A 3QFWA 1ZZFA 2CJYB 1UFKA 4CM0A 1JX4A 3N9UC 2WAQD 4WKRA 4X4RA 2UV8G 3R7NB 5IT9Y 1IBCB 1WC0A 3VVTA 1SJ3P 1U1OA 3MEDA 3D1HA 4NMXA 2CXEA 3R2DJ 1U1QA 1SQFA 3OTDA 1OMSA 4ZVPB 3GJTB 3OT9A 1Z2ZA 3EGNA 2YVSA 6FD1A 2QLJB 4P74A 2WONA 2DEJA 3FRZA 2BDPA 1DJ0A 2Z0GA 3TARA 4X84A 2GS8A 1PIEA 4TQRA 3UVJA 4PWUA 3IBWA 5I3UA 4B3OB 5F8NA 1P1TA 1HPZB 1CG2A 3KJQB 2ZBCA 2MZ1A 3UCZP 3GG0A 2ZH8A 4DR2J 4X65F 2J7KA 1IR2A 2V8PA 4C3LA 4GVBA 4ICLA 5A2QU 3A8EA 1LWXA 2XZWA 5J2MA 5HMYA 1WOSA 1QAIA 4X62J 3NCPA 1N6QA 1PC5A 4DI6A 3CCQS 2WW4A 2B4UA 2KDOA 1PG5B 1RTHB 2W7AA 4LF7J 1IWAA 4DL4A 3IWLA 3KG4A 3PO5A 3VAHA 4R5PA 4QIVA 2VJVA 5KFEA 4B9LA 2VASA 3U1LA 5T14A 2HVDA 3NGRA 1X4GA 3O44A 3VGUA 2CQ2A 4LF6F 3QT6A 4J5OA 4DV5F 4L75A 3M8YA 3QRQA 2ZH9A 2ZHBA 3MR7A 4Q0BB 3A12A 3BSNA 2QE5A 5HMWA 1DARA 3NY0A 2KRRA 1HNXF 2JFDA 3ILOA 1NDPA 1LK5A 1CQMA 3BZQA 4NLVA 3GG1A 2BYCA 4CO4A 1X0PA 2B43A 2G1DA 2JLGA 4LSLB 4BDPA 2DY1A 1WC3A 3IFEA 1QAJA 1D8ZA 5IT4A 1REVA 1F5AA 4RX6A 2ADBA 1NK7A 5E3QA 3LP2B 2MZSA 2DGQA 1S6QB 3EVWA 4J91A 4XDCA 1C1CA 2OTLS 3GFHA 1MG7A 2LU2A 1WG5A 1T9UA 2KI2A 1CVJA 2PEHA 3S6EA 3EPIA 2CPHA 3MUTP 3VQSA 2ZWPA 3V4IB 4ENOA 2XI2A 1M5OC 3FQLA 3MMJA 4DDFA 4ZS6A 3K5LA 4YB6A 3DI6A 2E29A 1IN0A 3TZWA 2FGOA 1FJGF 3G87A 1SKRA 4LBPA 2IVMA 1FTRA 1JMTA 5J1NA 4B3RF 4BCAA 4FYXB 4JI1F 3V5RA 4NYPA 3AJ1A 3BREA 1HQUA 3VAFA 3MR3A 2FHMA 3V2UC 1HWUA 2Z2YB 4DV5J 3LGHA 4FYWB 3EZUA 3PCOB 3WQPA 3E51A 3H4DA 1KBRA 2IYIA 3M32A 3TOQA 2R7OA 3D0IE 1HNIA 1D8YA 1NHVA 2ZDPA 1OO0B 4WFZA 1D9AA 5A76A 4BBYA 3AQPA 4J9QA 5GADI 2CJKA 1FD8A 4S0MA 1FEEA 3HPOA 3M6WA 3D5MA 3NXZA 2A2DA 3M8PB 3CD5A 3SCJE 4HTJA 1M5SA 4M5NA 5KT3A 3M7VA 2HNYB 4JOUA 4QIFA 4OX9F 4PQUB 3W7BA 5IWAF 1SV5B 3UD3P 4HH1A 5KFIA 4L3KA 1Q79A 3IS9A 3NG8A 1JLBB 3JTOA 2VDIA 1RWUA 3ENAA 3CCES 2KT2A 2RQMA 4F50A 1LXJA 3VZHA 3Q22A 4PG6A 1VQ6S 1TL1B 3N5BA 2GA7A 3HSZA 3LOUA 3FKBA 4WCEQ 1LW2B 1XWLA 4B3RJ 2YX7A 4KHMA 1Z2LA 1X9WA 4JI1J 1HNWF 3K5OA 4CRJA 2E7XA 2J0QD 2AEMA 4K0KJ 3D0GE 3M30B 1YJNS 3HXMA 3KLGB 3H90A 2M52A 4A8FA 2F65A 4PCQA 4QR2A 2OJ3A 4B3TF 2UXBJ 2H5EA 3BO3A 1NK0A 3DGPA 4XPEA 2IRYA 2WZ1A 4C8KA 1RAIB 3H42A 2MDAA 2JDJA 3MMBB 1R8CA 3IXQA 2G0JA 2BE2B 1W26A 3OXFA 2KXFA 1MWYA 4OLOA 5KT7A 3TEHB 3CXCR 3OFHA 4J90A 2DIVA 5ETLA 4KGVB 2XSJA 2POKA 4OX9J 5IWAJ 4PUOB 2VG6A 1WSVA 2BKPA 2PC6A 5A2QY 2FTRA 2V8DA 2N4DA 4CDIA 5LMNF 2AT1B 3QO9A 1SJ1A 2R7XA 1CLFA 4Y6IA 2NZCA 5U47A 2B9YA 2M8HA 2MMYA 4V19X 3IAM9 4ALZA 1LOUA 5B7WA 5I42A 4F02A 2Z56B 5GMKa 4FXDA 2YKNB 2AGPA 4I6AA 3JSYA 4KFBB 5HROB 4WPAA 2JSXA 2UXCF 1FESA 3D3CJ 3EJMA 1HNWJ 3NAHA 1RACB 1R8PA 5ETNA 2DNOA 2C42A 1TL3B 2ZFHA 3BH7B 2RQCA 1LV5A 2G1HA 4NLYA 4HHJA 4LSZB 3NOCA 3D2WA 1S1WA 1NH8A 2A6OA 5C25B 2HVIA 3OXLA 2ZOMA 5GAHU 2XTJP 4ZPBA 4EO8A 1OJ4A 3NGSA 3M6XA 1Y00A 2R8JA 1VQSA 2XC9A 3THVA 4WE1B 4KT0C 5L1JA 2Y0BB 2GJ2A 3GPAA 3Q8RB 3OVAA 2YNGB 4M1KA 4USTA 5G0RB 5LMUF 2V5HG 3VGTA 3IWNC 3KJNB 1NSAA 3M6UA 3NGTA 1S1VB 1WOOA 1E6VA 3TUPA 2XMJA 4YOEA 3TANA 2VBXA 4IUFA 3GMGA 5ITHA 5LSOA 2IM2A 3G6XA 3NAIA 4ZMMA 4X4VA 1JK9B 2J6SA 5D0RA 5BR8F 4PWDB 2MXYA 1JKHB 1S79A 3VR1A 1DURA 2APOA 1FDBA 3TZYA 4DV7J 1TL4A 3VALA 2PA3A 1U6BA 1NXIA 4DSIA 2CQCA 3QLHB 2UVVA 1UP1A 3R5GA 3KUEA 4B3OA 1VRUA 4YB5A 4DOZA 2UXCJ 1HPZA 4P2SA 1W7WA 1X9MA 1XR6A 2HLUA 2VUGA 4RW9B 5LJ3Y 2ASYA 3PW0A 3UR3C 3ZXWA 1T8EA 4TN2A 2HIQA 3JS9A 3T3FA 4FP9A 3LO3A 4R8UB 2ZDOA 3WX4A 2UUCJ 4UY85 4QR1A 4Z7CA 1SC3B 4KR0B 2J76E 1N32F 3H59A 1R8AA 4W4MA 2V8VA 5D0GA 2QT7A 4ZN1A 4JI3F 2HLTA 1YBAA 2GAGC 2DKOB 4Q2LA 1AROP 1X4BA 5L1IA 2HBRB 1WDTA 3KJVB 2H54B 1RQ0A 4OYXA 2LYVA 2NSBA 2E9TA 4M8LA 3MM8B 5ETVA 1QTMA 1R31A 4FNIA 2AJQA 4ECQA 3TR5A 2VL1A 4RUAA 4NA1A 4KGKA 2E1PA 4J9PA 3HMJG 4AFFA 2W2OP 1VOMA 3M2UB 4Q0BA 5J2PB 2HQIA 5BR8J 3ET6B 3PJWA 1NCLA 2V69A 4USIA 4Y00A 5IOLA 1OPIA 5I3QA 2BW7A 4EWTA 4YP3A 2RS2A 2Q43A 2CQ0A 1HBOB 4BWJA 3G8SA 1GTHA 3FJ2A 2VPZB 2AP6A 3CCUS 1FNXH 1VLOA 1H3DA 2QYCA 3RRKA 4PG4A 3X3UA 2VODA 1XTZA 3D3BJ 2D69A 3SQGB 4LRBA 2AD9A 2AZ3A 3LP2A 1TZ0A 2LKZA 1S6QA 2CVEA 4ECYA 3R1HA 3VGVA 3QWPA 1VR6A 2L48A 2P8IA 4EYHB 1N32J 2M0GB 4Q8EA 2DNMA 3MPWA 4USKA 2UVRA 2XSFA 3HHNB 4V19J 4ANEA 1JQGA 1TK0A 1H2VZ 2ABYA 1NM2A 2QA2A 3CDAA 2DGOA 2K1RB 3AOAA 4I68A 1RABB 5KFLA 1DRZA 1YITS 2RILA 5I4MA 4OYIA 4ELTA 4E98A 1RT5B 4B9TA 4I6WA 1NK5A 2XNRA 4FS2A 3ZFVA 3PZPA 1TKXB 3MM7B 1JLQA 1TK8A 2KJVA 3SBMA 2MLZA 1CJVB 3DRSB 3SFGA 1Q16B 2PI4A 4N56A 3WC2A 3OPKA 1FE4A 1YIJS 5HATA 1UVMA 4KC5A 3J7YI 1IR1A 4RZRA 1VLYA 5JVHQ 3BJYA 3OTBA 4DFPA 3N6LA 4IH7A 4N8OA 3R5AA 3W8GA 2EKNA 3M8PA 5HANA 2W4DA 2UXDJ 3B78A 4ANDA 1T0TV 1U24A 2JJ4D 5ETKA 4TY8B 1RWKB 5EWGA 2LDIA 3DHWC 2HNYA 1HQEB 2Z2LA 3BBBA 4YR3A 1FXLA 3KFWX 1SV5A 1I5OB 4OZ2A 1YJ9S 1HQ2A 4O3QA 1G4CA 3GV5B 1JLBA 4A8WA 3MUMP 1FKPA 3QJLA 2V4JB 3HK2A 2BABA 2NXNA 3V4MA 3ZZZA 4N76A 5CZVA 5AE1A 1TR0A 3CTRA 1GMWA 5HBMB 2V34A 5F8JA 1QSLA 2XLIA 2H51B 5DZ7A 1LW2A 4QU7A 1S1TA 3TAQA 2OELA 4LR9A 2XZDB 2MLXA 3CJKB 4LFCF 4JV0A 5KFRA 2ALZA 3LP0B 4JV5F 3KHHA 2IVYA 3M30A 2GJIA 2DNNA 1NO8A 3KLGA 2EI5A 2IJFA 1S59A 3NP5A 3OQ2A 2EK1A 1QE1B 2EC2A 2XMUA 2RRBA 4N47A 1ZM9A 1KS2A 1P6TA 5KFXA 4ETXA 3PX6A 1KVJA 4DR6J 3FMBA 3PKMA 1GMUA 1RTZA 3H2UB 3MMBA 2BE2A 5EDWA 3EE3A 3R27A 2GVDB 3AJDA 4QWBA 2J9CA 4HT5A 2MQ8A 3PXGa 1SL1A 2MQNA 4DHVA 2CA9A 2W01A 2MZJA 2JVRA 4PUOA 4DPYA 2DPIA 4LR8A 3TNVA 4GKKF 3MCSA 2DR8A 3BSOA 1IBMJ 3E8OA 2AKWB 3RAMA 3TEGA 3Q2SC 2CFXA 1FK9B 1NB2A 2MY8A 4EYIB 2EKYA 5T7LB 2HEKA 4KQZA 1Q81T 3D68A 3LALA 2MY7A 2AQ4A 4MT1A 2CYYA 4LFAF 5CYQB 4W98A 4LREA 4LSNA 3EDRB 2R7UA 3M9MB 2F8EX 3S8SA 4ECXA 2YKNA 2F63A 2L08A 2CJAA 4KFBA 2K8GA 4KIAA 3KLHA 5HROA 1L5UA 1F2HA 3PX0A 2AV5A 4CLTA 2X3DA 4LFCJ 4GO5X 2N3OA 2JC1A 1TL3A 2V4QA 1GNKA 6AT1B 2D3OR 1HI8A 2Y1RI 4J37A 1PAEX 1S10A 5C25A 5KG3A 1TUGB 1EHWA 2X7IA 3DN9A 2YNIA 3T1YF 1T9VA 2CPYA 4WK3A 1HBUB 4LRFA 3J81j 4O0NA 2YNGA 4JYAJ 2J9EA 4ED2A 2CDRB 4ED6A 3EM1A 1RT7A 5LXYA 1YI2S 3FC9A 2CKWA 3NS5A 3PM9A 3Q8YA 3L7UA 4OZNA 4XO0A 2DXEA 3MFIA 1S1VA 4NLWA 1RB0A 1LNQA 2GHPA 1X4EA 2Y1LB 2JEIA 2C2MB 3MM9B 3DFEA 1T95A 1VDHA 5ETTA 1FDAA 2BUNA 3TAPA 2B4OA 2E5GA 3KMSA 1WTFA 4CWBA 3H2VE 3I6PA 4PWDA 4RU2A 3TP2A 1KEKA 3PY8A 2HK3A 2DD8S 3MAAB 3NRBA 1SL0A 1K9MT 1A9NB 1JIHA 2MQLA 1ELOA 1RAJA 3BEGB 1ZPWX 2HNZB 2LMIA 1FRLA 2HFSA 5KTQA 2BKNA 2H4WB 4UW2A 1DY3A 3GLJA 3ILIA 2DHXA 1TKZB 4HLBA 3W5ZA 4FVCA 2PA8D 3BBFA 3LP1B 2DH9A 4R8UA 1NU4A 2QYGA 2ATCB 2FY8A 5JUMA 4CYUA 2H1YA 2DHAA 4USJC 3NCQA 2LA6A 2YWGA 1KQKA 3ZNUA 4OX7A 4ECWA 2VFSA 1SCJB 2HRYA 3J7Z5 1EARA 3MCOA 2HWIA 4YUDA 2CQ4A 2FDNA 3Q2TC 2MGZB 4MKAA 1Q8IA 3KJVA 2XI3A 3OFEA 4TLQA 1IQZA 3J7A1 2Y8YA 1MSWD 2VFUA 2EFVA 1P9QC 4YR0A 2FJBB 2XWXA 1RT2B 1BQMB 3PYDA 1GX5A 3M8SA 5MAOA 2UUTA 4AXIA 3M2UA 5J2PA 4GRSA 2RUSA 4AUKA 5ETMA 2HW3A 1AB8A 5E5NA 3FMWA 5IFMA 4IH5A 1ZA2B 3K0JA 1WWHA 4PXEA 3KLVA 1NPKA 3DNCA 3KK1B 1R6VA 4OYZA 4NA3A 4C11A 3W65A 1KFSA 2MLYA 3QGHA 4D3GA 1TQLA 2IM1A 4DG1B 1RA7A 3KLEB 1QY7A 4I67A 2RHSB 3EPGA 2CPXA 5KG5A 3VCDA 3HM9A 4Z7YA 2RQKA 3VAKA 2WRMA 2KKHA 4DL2A 3HJFA 4LRAA 1OY9A 2CPEA 3FSIA 1RCOB 5HL7Q 3L9ZA 1VFJA 4RO0A 2IAJB 1XNQF 3UDVA 4BC9A 1U09A 2NQPA 3H40A 2ZC3A 4YDXA 2KZZA 3R7BB 4NXNF 1VQMS 1CJUA 4H4MA 2H5IB 4P7TA 4ED1A 3K5NA 4DV4J 3KLIA 2K1RA 3CD0A 5L9XA 4KGMA 4ECUA 2JEFA 1KNZA 2R7TA 2HGLA 2DNHA 1RWXB 4XTTA 1N36F 2E9RX 2C3OA 1AFJA 5KFFA 1IQTA 2WOMB 4UOHA 1TKXA 3MM7A 4K4XA 4LR7A 3CULA 1BQXA 4TXSA 1CJVA 4Q43A 2LQBA 2VBZA 1NKBA 3RBEA 3AD8C 4NLGA 1F2GA 4RW7B 2WSFC 1H72C 4FS1A 1R0AB 3MM6B 2EFPA 4MTPA 1JNZB 5EN1A 1CBKA 3OUYB 2QC3A 4CQ1A 2CQHA 3TQ1A 3HSGA 2B9XA 3ADAC 3RAQA 4TY8A 3ZTSA 2ZBRA 2IMWP 1HQEA 4B02A 4TLRA 1NPPA 4FXWA 1FDDA 4R0JA 1VQOS 3PX4A 3NGKA 3UW1A 3T5JA 3BS9A 2AW0A 2ZBQA 4K4YA 1KHWA 2V4JA 1IVZA 1U49A 1CC8A 3BO4A 2W9BB 4HR2A 3DXBA 1D3WA 3CCRS 5BYRA 4NXNJ 4EBDA 4HYKA 3PFOA 1UCNA 4URSA 3KUGA 3RW6A 4CCHA 1SC6A 3OJUA 1EKSA 3TYTA 1R0CB 4OZ3A 5JMNA 3KMQA 2KL8A 3CJKA 2HZAA 2RE1A 3NCRA 3LP0A 1N36J 5KFWA 5F0UA 4A8XA 1GK8A 4JV2A 5F41A 2DJWA 1S0NA 2Q6BA 2CPZA 1HA1A 2RSQA 1IBLJ 2I8EA 2B0GA 4U8YA 5KFVA 3D1QA 2OO4A 4AT1B 4JI5J 2KH9A 1NJYA 3FSYA 3JXOA 1VQ8S 4TYAA 4QYRA 2VQFF 3HFKA 5HP1B 1RKIA 2J6UA 4NLRA 1HWKA 2IBOA 3UDCA 2OUGA 3DGVA 3HF5A 1NSKL 1PBAA 3PEJA 5E3AA 1JLAB 1UKUA 4HT7A 2JL9A 2FVCA 2GVDA 3RBZA 1Q8BA 4C8LA 5GMEA 3CB4A 1SBRA 5E3RA 3S1TA 3I56S 4XK8C 3BKUA 1TL5A 3M8QB 1FE0A 4OJ3A 3V6HA 1UEVA 4UT4A 5CCLA 4A8SA 5KFSA 2WB4A 1JLEB 3K5PA 1FK9A 1UJ6A 3IC1A 4Q5VA 3OL9A 5ETRA 3ISND 1NB7A 2ZUGA 4PPDA 2JWNA 3JQMA 4A8QA 3ZO7A 5GADU 3ZZUA 5CYQA 1NSQA 4CH0S 1VQPS 1QM9A 4P7VA 4NZ0A 4PQAA 1RISA 1RKJA 4DV0J 3BV8A 4H54A 2HK2A 3OXGA 5K9FA 3MR6A 1H2TZ 2XNQA 3MXHP 4K4UA 3NBPB 2HBZB 4C2MA 2AJ4A 4ZLPA 4WYLA 3FRYA 1TUVA 2HWTA 4RR5A 4NI2B 1LQ9A 3FBBA 2GV1A 1S6UA 3D9BA 4F0HA 1WD6A 5KG6A 3CMAS 1N0VC 5HJXA 2BM1A 2GX8A 2VQFJ 3G96A 4OLPA 4I1TA 3U02A 1RBAA 3UN5A 2VKZG 5LM7E 1ZOTA 3HX9A 5L8RC 2I6WA 1GX6A 4KPYA 4HACB 4NCBA 1BWEA 1WEZA 4TU9A 1PSDA 4DL6A 2HHWA 3MM9A 4ELVA 2DITA 2CPIA 1RHRB 5IQ6A 4ED8A 4HL9A 2VFVA 4DSFA 1Q8LA 1QDUB 3PRDA 4DX8H 2OMOA 3MAAA 3Q8PB 3VAIA 4OZLA 1RA6A 1UFLA 4MYTA 2XMMA 3WHIA 3GONA 4Y2MA 1UVLA 1SIZA 2BXJA 5KT4A 2JEGA 3BGOP 2NCKL 4YR2A 2RU9A 2LU1A 2M4MA 1LWCA 4C98A 3MOJB 2I9SA 1M5KC 1AFIA 1HBMA 2C3PA 5I3PA 3TUIC 3AY0A 4PYDA 2RIJA 2FB0A 2HHTA 5KG4A 3LP1A 3CCVS 4LRCA 5JJBA 2NPFA 2HQFA 3E3XA 1U02A 5ETPA 3TVKA 3E01A 1UA0A 2IJNA 2OPSA 3CWJA 2FVPA 3GIJA 1M5HA 1W25A 3UDEA 2BVZA 3PYEA 2MGZA 3VAGA 2L3MA 4BLGA 1UA1A 1TU0B 1AT1B 4P75A 5AXMA 1NKEA 3PNIA 1BQMA 1YG0A 2ZH7A 3HVTB 3BQ1A 1UW9A 2HFUA 3HDSA 3RW7A 3CNQP 2DR9A 1FFWB 5F8GA 5L1LA 3PJXA 4HI1A 9ATCB 3F44A 3W9HA 2OPRB 2KFYA 2BJEA 2VFRA 5DDRC 4F4XA 1K0TA 4F26A 2H65B 2DNYA 4OX8A 4RW6B 3N01A 5AT1B 4WU2A 3C14B 2CPDA 3KK1A 4U7CA 2BEFA 2HKEA 1ZS6A 2QL9B 3L95X 4DG1A 1RHQB 2DHGA 4FXVA 1EX8A 1DBDA 1QAXA 4FYDA 4M5DB 1NJIT 2FC9A 4DU7A 4UY8T 1Q1KA 2MQQA 1SI9A 3FDSA 1L3SA 2QSWA 2MPUA 3KG0A 2IAJA 3QFHA 3EWGA 3IG1B 3PW4A 2P2CB 1LFWA 1D09B 2IY5B 1OYEA 3G6ES 3HP6A 4N41A 2AIRB 2ATLA 2OI2A 1KKHA 5D0HA 3HZGA 3W9JA 2YWKA 4OYMA 4DFKA 1JB0C 5A6WA 2K3KA 1TAQA 4ES3A 1RTDA 3UDLA 1TKTB 4OZJA 1GXLA 3TRGA 1FHTA 4USWA 2RUGA 3QNWB 4K4SA 4HHUA 3DDIA 2M3DA 2UU9F 1TAUA 1FT8A 3W2WA 5HN0A 2WOMA 3LWMA 4C97A 3C6TB 4JI7F 1FVSA 2GMJA 4I4BA 4PPZA 1M5PC 1K1QA 2LEAA 2R8IA 2V2ZA 1UAWA 4HDGA 5HVHA 2MQPA 4DR7F 3RBDA 3BH6B 4WKYA 3NNCA 2ZNZA 2Y8WA 1B3TA 4RW7A 1WC6A 4FZVA 1R0AA 3MM6A 4MK9A 1WI8A 1I3OB 1QLNA 2QLFB 2ZH5A 2VJUA 3D66A 4ED5A 5HVGA 3W8PA 3I5CA 3OBIA 1C1BB 2H9ZA 2YQ0A 2P9CA 1FX2A 4ZP7A 2DNGA 3A3NB 2JVOA 1T9WA 2A6MA 3QAEA 1XR7A 4GO7X 3SCKE 2HHUA 3CGIA 1HMVB 4QWCA 2VV5A 2NXJA 1Q7LB 3T1HF 2QLBB 5HLFB 2B56A 2BV3A 2EXUA 4TU8A 2W9BA 3LH2S 1WTBA 4D3HA 4KJIA 2AJ2A 1I51B 2QFIA 1WHXA 2CJQA 2ROGA 4P72A 2YTCA 1T05B 4C4WA 3W63A 1TVRB 2HURA 3K89A 3N79A 1L3UA 1YRXA 1Y5LB 4ANCA 2GQQA 4WJBA 2QFJA 2R3VA 1B0PA 3KK3B 4WZQA 2V8GA 4NYOA 4JI7J 1G1XA 1NDKA 3SXLA 4Q45A 3PFEA 1J5OB 2W4PA 5KFYA 3HVWA 1SKUB 2BJ1A 2NPIA 2G2YA 3WIVA 5EUHA 4JBCA 3CCSS 3QYYA 4EEYA 4DZDA 4MAKA 1O51A 2W8KA 2V2VA 1ROFA 2HIYA 2YY3A 1K8AT 3GFZA 3GCXP 1TL7A 3EX7B 2FZKB 3M2VB 1JLAA 1RBLA 2DNKA 4X4PA 2RT3A 3DU6A 4AXJA 4DUYF 1I94F 3G86A 2CRLA 2EBGA 2GVZB 3M8QA 4DPWA 2AHOB 3LQVA 4XAKA 4NRUA 2XY7A 3TJ9A 1RUSA 1RT6B 1SJRA 4B9NA 3I4PA 1JLEA 1FJCA 3EXYA 3TQEA 1DTQB 3GFYA 4DSEA 1K44A 3MM5A 2HRTA 5L46A 3FZ2A 2F4VF 4LIWA 3J7YU 4CLWA 4PRFA 4IDKB 1URRA 2AJFE 3M8RA 2DNRA 3POTB 2PD1A 2DHSA 2B7CB 2N3LA 1MROB 4DPUA 4C48A 1XEZA 3NBPA 4ITSA 5L38A 2FLNA 4EU0A 3KHLA 1ULRA 2XG8A 4FVMA 3AOCA 3GSIA 4NI2A 4AL6A 5B0AA 2VZ9A 1U48A 5BJRA 2KVQE 3BDPA 1ZTTA 2CVIA 2R7WA 2EPIA 4M5LA 3CD6S 2IDLA 1VK8A 1K47A 1UPMB 3K59A 2W7PA 1CC7A 5CD4A 4TKTA 4N8NA 2GMLA 4Z37A 3W62A 2VC1A 4ZJLA 3OSPA 2CNKB 1SPBP 5ETOA 4JI0F 2KN4A 2R42A 2DVIA 1M1HA 1FRHA 1ZM2A 2J8AA 3BSCA 1OSDA 3BGRB 3THTA 1RYRA 1WNEA 4DUYJ 2ZD1B 2E9ZA 2HHQA 1RT3B 1H74A 4DR4J 2WVCA 5HK4A 2CQDA 4ILLA 5BYSA 2DO0A 2HS3A 1YJ7A 2QL7B 4DV2J 1X5TA 4M5MA 3M9OB 5HMXA 2GQCA 1VQYA 2H3EB 1QD1A 3K7RA 4UF4A 1Z1ZA 4ZN3A 1HHQA 4O4RA 4Y65A 1V5IB 4B3SF 1FX4A 5A6PA 3Q83A 2RF2B 5DQIA 2WHOA 2DNPA 3EGWB 2E7VA 2NUUG 3T9ZA 2VPYB 1FVQA 2J9DE 3F56A 2BW2A 3KKFA 4J9RA 4ZCIA 4CO0A 5DG9A 4C3KA 2EWHA 2DNQA 2MB0B 2KFZA 1FEHA 1FF2A 2BJ7A 4OI2A 2YWFA 4CT8A 3IR7B 5H1SV 4F4KA 2AEJA 1W2BR 3D0HE 3IRWP 3BKTA 5H9FK 2CQ3A 4KHRA 3NWRA 7AT1B 2LDYA 4PXBA 2RB7A 1BMQB 4EK2A 1XNRF 3CJTA 4F3OA 3NOGA 4MKBA 4RKUC 2OP5A 2BBEA 2AJ0A 3IM8A 4NCAA 2B6AB 4NRTA 3SCIE 1CS4B 1RHMB 1S1XB 2DR7A 3M2RA 2X1BA 3HKZD 4J9LA 1S72S 3IMQJ 2DT9A 2COLA 2I0XA 1RAGB 4DUZF 4L73A 1KQFB 2DK2A 1RLDA 2OTJS 4MYUA 1UZDA 3QT7A 3LGMA 2OPPB 4USUA 3DLEA 1VQ7S 2B9WA 4QPXA 1NAQA 2OPRA 4X64F 5SUHA 4CLZA 3M05A 2KFNA 4IO1A 2CJXB 3FBFA 1GMWD 4EO6A 1LKZA 2KO1A 3TJ8A 3ILJA 4LJMA 5KFOA 1MMDA 4RNNA 1AZSB 4ID8A 4GMKA 4M5DA 3D6TB 3PKYA 4KH1B 1YJRA 1S9EB 1VS3A 3O8WA 3J80U 3SDEB 1U1KA 4JI8F 2KZMA 2K3IA 3J7ZT 4ZHRB 2BA9A 2F8MA 3QJPA 3FQKA 4ECZA 3WZ0A 5E7OB 4P6QA 4DSLA 2PMHA 4PG5A 4BC7A 2KTQA 2GGPA 3MMAB 1YJUA 2Y1IA 3RYLA 4DU8A 2DRBA 2WBMA 1YRTA 4MMOA 1TKTA 2ZE2B 2IFXA 2OSQA 4J7CA 1L3VA 2EVZA 1UW4A 3A8KA 3RRGA 2BOAA 3A4TA 4LFBF 1XMOF 4Q8FA 1ZA1B 3C6TA 3FSXA 3AHPA 3WBZA 2VG5B 5KG0A 2M70A 2DGSA 3QGGA 2QG9B 2K06A 2ERRA 1IJEB 3LANA 1H2UX 2R2RA 1VBYA 4O4GB 1R89A 3TUJC 2AX0A 3W9IA 1VCTA 2IDEA 4UQGA 2RMLA 4KHPJ 2RKIA 3CJ5A 1PBUA 4R25A 4ZDNA 4DZ6A 3VHQA 3DYAA 4CLLA 4I64A 4WXWA 1HW8A 4PABA 2Z2ZA 3OV7A 4PG7A 2W2NP 4A8MP 4L3NA 2OFGX 5KFBA 4JI8J 2BZ2A 2N7CA 2HS0A 4A8YA 2VFTA 3FGVA 5DDPC 2W2QP 4K2JA 1M1KT 2V2KA 5J2QB 1YHQS 2QSFA 2Y9HA 5HLFA 4M5IA 2ZOFA 3D6MB 4NASA 1SC1B 2HSEB 2R4FA 5AJ3F 4DWIA 4J9UE 5F8HA 2D9PA 1T05A 3A13A 3Q86A 3V81B 1EQMA 4WFXA 2IIHA 4OL8A 1YQHA 5LL6d 3Q89A 1XMOJ 2XHWA 3KK3A 1D9DA 2Q6CA 1F3FA 2IA6A 3A8IA 4CO1A 4IYQA 1PC4A 4RNHA 8AT1B 1WKLA 1J5OA 5AXLA 1FJ7A 3CE8A 2BE7D 4DCOB 3KHRA 2C2RA 3R5BA 1B4SA 3P6YC 3JTPA 4L72B 4OYOA 4W92B 4M5JA 3UD5A 3HVRA 2MKJA 3N6MA 2HHHF 2DCUB 1URNA 4UUXA 3M2VA 1EJ7L 2R9LA 2PMWA 5GAHI 4X65J 2ZC4A 4RUCA 2O5DA 1PYOB 4UOCA 1Y9OA 2B8QA 1W2IA 1S5ZA 3B54A 1KTQA 1R8BA 3BPSP 4R0EA 2AX1A 4LVOP 4Y2AA 4IOBA 5D15A 1RT6A 3IO1A 3TW0A 1OQ6A 3D54A 2AYMA 2V94A 4CTAA 3MR2A 1DTQA 2DH7A 2AGQA 4YDDB 3UFCX 3VVUA 4WTOB 3VAMA 1JJHA 1PYSB 4G65A 5AJ3J 4YY3F 4IG0A 2FIUA 4IDKA 5GAGI 4NLXA 3MPUB 3L7PA 3AXMA 2IMOA 3I32A 2D3UA 5KFMA 2RDDA 2F40A 4PZVA 4LF6J 2AMCB 3EVOA 4IQXA 1MROA 1SQGA 3PVXA 1VHFA 4G1QA 4OI0A 1TP7A 4RPFA 4NLOA 2XULA 1IKWB 4ZITA 4P9SA 3TZXA 5DRKA 4UOFA 2XYGB 4DQIA 1RE1B 4I56A 5B0GA 3IAS9 4JI2F 1DHMA 3PG9A 1HI1A 4F4WA 1U1LA 2J5AA 1TTHB 4WP8A 1RI7A 1HNXJ 2V9KA 1T03B 2KXNB 1MU2B 3PW5A 2CDQA 3MPVA 4NX9A 2QV6A 2AYEA 3R6LB 2QGFB 2R2SA 4HEA9 3B4MA 3SFUA 5K14B 1H7WA 8ATCB 1ZM4A 4IOCQ 1CJKA 1K73T 3OLBA 1JJ4A 2XZTB 3IRXA 5SZTA 2MKHA 2ZD1A 1NLKL 5B0FA 5E2QA 3BPDA 2R8KA 4NCGB 1PKUA 4DFMA 3AA9A 2YNFB 1VQLS 2EFNA 3JSMB 2ZZMA 2ZWOA 4KV8B 3J80Y 4EBCA 4OZ0A 3NNAA 3EGZA 2PMZD 4DPOA 3F0NA 4RW4A 3AD9C 1KLMB 1XERA 4K59A 4CO3A 2W4CA 3D4JA 1G6BA 2Y3YA 1EZZB 1FJGJ 4Y34A 4NLPA 3PIOQ 4KO0B 3ITHB 3L4BC 4P73A 2V0NA 1RWNB 2KYXA 1G3OA 5A0YB 2IA0A 2M5YA 1VI7A 4OYAA 2QX0A 3CC4S 4IO9Q 1KVKA 3TA1A 4RNMA 2DR6A 2YQ1A 4ZA1A 5E0OA 1DQ8A 2IM3A 2LQ5A 3L3CA 1VC6A 3PEHA 4OJGA 3HHDA 1VK3A 4JI2J 2FJDB 2ZUAA 1DQ9A 1KTVA 2IBKA 1RT1B 5CZXA 2E1AA 5LSRA 2MTLA 1F9EB 3I0RB 3KK2A 2ACYA 3C16B 2B6AA 3PW2A 3M6VA 2ZOGA 2YWWA 1CS4A 2BX6A 2Q79A 5E33A 3SQOP 4PYAA 4OJHA 5KFHA 3SSSA 4NL5A 4KRWA 2RDIA 2C2OB 1SJQA 1B0TA 1QUVA 5D78A 4NLDA 1X60A 6FDRA 2KJWA 3CJQA 2VC0A 4FKYA 5KG2A 4OZ5A 3QRPA 4ED7A 1OY8A 4YS2A 2W25A 3MEGB 5DDOC 5DG7A 3T6JA 3CIMA 3SZ2A 4F3MA 1PAUB 1CPZA 1RAOA 1VBZA 3OL6A 1AZSA 4DMZA 2I1RA 2HHSA 5J2MB 4A47A 4KAIA 1WF2A 3WX8A 1N6QB 4KE5A 1N5YB 2BOPA 4DPXA 3SDEA 4MJKA 1UWBB 1N54B 2XCAA 5L1KA 2DRDA 3Q8SB 4B3TJ 1GT8A 1VJQA 2GC8A 3C8YA 4ZHRA 4OQJA 2EFQA 1WUUA 1NDCA 3V6KA 2RS8A 4OIXA 2ASLA 2YPZA 4DSJA 3HHKA 2MQOA 1YX2A 2YKMB 1YSJA 1RAAB 1HBNB 1YVFA 1PYTA 5D0EA 4KH0B 5DQHA 2X1AA 4L6V3 5AXNA 3D1OA 4YFUA 5CD4H 1GFWB 2HQDA 2LCWA 3UN2A 4ECTA 2LXFA 4DN0A 2YKPA 4WFBQ 2VOPA 3DRYA 2FJWA 4PKDB 3UO0A 1YJTA 5LMNJ 5G4DA 5FDLB 3I55S 5F0WA 1MMLA 1F60B 4KKOB 3TX0A 1QVGR 3DDNA 4FF1A 2RRNA 5CAAA 4KTQA 1K0VA 1DLOB 1VGYA 2XMAA 3UQSA 2XBPA 4CO5A 4BS2A 1B99A 2G4BA 2RAQA 5KFAA 3M4XA 4DR1F 5GAEI 3NMRA 3P96A 3KDOA 1GAOA 4YHHF 4OYPA 3MECB 4I6YA 1FD2A 4DQSA 4IRCA 3RGIA 1RTIB 3PO4A 3PHEA 4DSKA 5RUBA 4RU9A 2VQEF 2OEJA 3JSBA 1H6KX 4CLPA 1KVIA 3FEYB 4DX5A 4J9KA 1OQ3A 5DDQC 5J2QA 3FUYA 4WZMA 1RTHA 1RYSA 2FGCA 1RU1A 4AYBD 2ZBIA 3W3SA 5LMUJ 3PYGA 2XLKA 2EFGA 3CCLS 1HQUB 1GTEA 3L7OA 3EDQB 3LAKA 3T5LA 2W2PP 4F4AA 4ZVRB 1T9YA 3DKDA 3M32B 3V81A 1JWWA 2FC8A 4UOGA 4OV1A 4B9SA 4IOAQ 2ZITA 4RNOA 4MH8A 3DOLB 3DMJB 2OKQA 3P5TL 2OMLA 2P9GA 1IKVB 2JH3A 4U95A 1FRKA 5C24B 3MPYA 2CQPA 4ECSA 1BUXA 4ZIVA 4ZVUB 2DTJA 5K5MA 1PJ6A 4ZCKA 4MK8A 5F9LA 4LSLA 3H5XA 3SV4A 4QWDA 2B51A 2HMIB 3IS9B 3BGFA 1RADB 2GQ2A 3H2LA 4DR1J 3BGUA 4WK1A 1TK5A 3AFGA 2LECA 1YBUA 3QWUA 3GU0A 4ZPAA 1J2VA 4C6AA 4MIAA 4CLKA 4CLYA 2VQEJ 2J0WA 2A10A 5T41A 2A2CA 3V4IA 5IM0B 2HFVA 3I9ZA 4DQPA 2RH3A 3MFHA 2IRXA 4DR5F 4JI3J 4K7QA 4OHXA 5EWFA 4U96A 2VA2A 2HHXA 4YEAA 4FBTA 1UEUA 4H4KC 3OSNA 3A3PB 1YDLA 4ES2A 3DXSX 4Y3CA 1C4AA 3AB4B 2VIHA 4C0BA 1IKWA 2GIFA 4ZVTB 3JQJA 4HTIA 3QBCA 4WU3A 3GJRB 1GQEA 2LXUA 1WACA 1YKWA 2P6TA 5EGYA
chains in the Genus database with same CATH topology
2KFYA 2BJEA 1LXJA 3VZHA 2VFRA 4OI3A 5DDRC 3Q22A 4F4XA 4PG6A 1K0TA 2P6SA 4F26A 5F9NA 2ZJQQ 2DNYA 4OX8A 1RTJA 1VQ6S 3NWGA 4RW6B 1GXUA 2B4PA 1HI0P 3N01A 2Y0SD 4WU2A 4C8OA 1HL6A 1TL1B 3N5BA 2GA7A 4C8NA 2CPDA 5KOXA 3LWLA 3LOUA 3KK1A 4KSEB 5HO4A 4G3IA 4U7CA 4WCEQ 1O8BA 1H98A 1LW2B 1XWLA 1FRJA 1RTDB 2YX7A 2BJDA 4KHMA 1Z2LA 3I87A 4ED0A 1X9WA 3ETOA 1PO6A 3ICLA 3L95X 3JYTB 1HNWF 4DG1A 3MWBA 3HHLB 2DHGA 1WELA 4FXVA 3K5OA 3T5HA 5FJ4A 1DBDA 1QAXA 4FYDA 4M5DB 2E7XA 2EBEA 4OI4A 2W9CB 2VG6B 2YNHB 4PR6A 3HLUA 4RW8B 4K5RA 2J0QD 3DRRA 2QIFA 3CC7S 2OD4A 1NJIT 1Y0HA 3KLFA 4QW9A 3D0GE 3W2WB 2FC9A 3N4WA 3KNAA 3M30B 1IBLF 1YJNS 3HXMA 2EG2A 3KLGB 4UY8T 4N5SA 1Q1KA 5A8RB 3T6BA 1CQNA 5KFUA 2IVFB 2M52A 1V3SA 3DRPA 4PQUA 3ZZ0A 2MQQA 3M1VB 4A8FA 1SI9A 3CDWA 4IR1A 1KLNA 3RR8A 3FDSA 4F67A 3KNGA 4PCQA 1R7IA 3CO9A 1L3SA 1H38A 3CIZA 4JI5F 4QR2A 3HVTA 4FN5A 2QSWA 5KFGA 2MPUA 2XMWA 2NLWA 2IHR1 2OJ3A 3KG0A 2RU3A 4JI4F 4B3TF 2UUBF 2IAJA 3JSMA 2D1CA 2H5EA 3K2YA 3IG1B 5J1EA 3PW4A 4HH0A 3C6UB 4DL0C 3BO3A 1Y3KA 3DGPA 4XPEA 1NK4A 5A8KA 4MIWA 1U47A 1NK0A 1WF1A 1X8DA 3QGIA 1LFWA 2IRYA 2XEXA 1KLMA 3FCHA 3G6ES 2AYBA 1VQ9S 4C8KA 3HP6A 4N41A 2ATLA 2HRUA 3HHLC 2V8HA 4O44A 4DV1F 2MDAA 2ZH4A 1NK9A 1T7PA 1Y7PA 2JDJA 3HZGA 2YWKA 4RW6A 3MMBB 2DR5A 1R8CA 1X4FA 3IXQA 4DN9A 2I38A 2BE2B 1TL1A 3OXFA 2QRRA 5F8MA 2BQ3A 2KXFA 4KO0A 3ITHA 4DFKA 2VH7A 1MWYA 1JB0C 4DR2F 4IR9A 5A6WA 4U6PA 2ZHAA 2ZH3A 1FNOA 4OLOA 2K3KA 5KT7A 4YQWA 5KFCA 1TAQA 4ES3A 1FNMA 2V9WA 3CXCR 3OFHA 1RTDA 3RB0A 3UDLA 1TKTB 3K8WA 4OZJA 5DM6Q 1GXLA 5A0YA 1UVIA 2DIVA 2DISA 3TRGA 1FHTA 1A7GE 2XSJA 1BGXT 2POKA 2RUGA 4K4SA 4KBIA 5A8WB 2VG7A 2UVUA 3LF0A 4PUOB 2M3DA 3G6YA 4RBUA 3US5A 1QAYA 2VG6A 2UU9F 3ZZOA 1TAUA 1FT8A 2WSEC 1AW0A 3W2WA 4X62F 2PC6A 3I5BA 3S7RA 5HN0A 2FTRA 2WOMA 5A2QY 4OI1A 3LWMA 1T94A 4OJ1A 4C97A 2W7OA 2A18A 2V8DA 2N4DA 3C6TB 4JI7F 3QIPA 3H20A 2XO7A 1FVSA 1WHWA 2GMJA 5LMNF 4DL5A 3CPWR 3EZ5A 3DOKB 3FFIB 4I4BA 4PPZA 1M5PC 3DLKB 1K1QA 3QO9A 1SJ1A 4ZVGA 2R7XA 1CLFA 2LEAA 3CDEA 3F41A 3DRXA 3GQCA 2R8IA 4DS5A 4J9SA 4Y6IA 1UAWA 4HDGA 1U6FA 2MQPA 5U47A 5CCMA 4DR7F 2B9YA 5KFJA 3VAJA 3RBDA 2MKIA 2M8HA 4NOHA 1VC0A 2MMYA 4V19X 3IAM9 4ALZA 1LOUA 5B7WA 3IG1A 4WKYA 2UP1A 3I31A 5I42A 4CNZA 3NNCA 2ZNZA 5J2NB 4F02A 1FDNA 1N4LA 1U2RA 3I0RA 1S76D 4ZPWR 5L9NA 2MHEA 2VONA 2YKQA 5GMKa 2XMTA 4RW7A 4FXDA 4FNHA 4FZVA 2YKNB 2AGPA 1LWEA 4I6AA 1R0AA 3JSYA 4KFBB 3MM6A 2ZH2A 3MF5A 4MK9A 4URQU 5HROB 1WI8A 4DV0F 1E6VB 2JSXA 2XMVA 2UXCF 1QLNA 1FESA 2ZH5A 2PSZA 1SJFA 2FVSA 4B9UA 4ED5A 3NAHA 3LAMA 1R8PA 3I5CA 2DNOA 3OBIA 2C42A 1TL3B 3GZ7A 2ZFHA 1C1BB 2H9ZA 1LFPA 1R3NA 4ES1A 3G9CA 1HNVA 3MMCB 2P9CA 4JI6F 2RQCA 1LV5A 4NLYA 4ZP7A 4IFYA 2KG0A 3MR5A 2DNGA 4HHJA 2JVOA 3TVZA 3D2WA 1S1WA 1NH8A 1VQ4S 3SEOA 4CO2A 1X4DA 4LQ3A 5C25B 2HVIA 4I7FB 1M5VC 1VIXA 3OXLA 3ENVA 2ZOMA 2X3GA 3CDUA 3O5TB 4LQ9A 3QAEA 5GAHU 4ZPBA 4EUVA 4EO8A 5AE2A 3GV7B 4FPRA 1XR7A 4GO7X 4ZVEA 3SCKE 2C3UA 3RB6A 2HHUA 3M6XA 1S9FA 3CGIA 1L3TA 1Y00A 2R8JA 1VQSA 4F4YA 2XC9A 3B4DA 1HMVB 2ZNYA 3EUNA 3THVA 4WE1B 4QWCA 2HFNA 2VV5A 4KT0C 1Q7LB 5L1JA 2GJ2A 1KHVA 2YKOA 3T1HF 3UR0A 2B5JB 3Q8RB 2CPJA 3OVAA 5DGAA 5HLFB 2YNGB 2B56A 4M1KA 2BV3A 1S48A 4TU8A 2W9BA 3LH2S 1VRUB 5G0RB 5LMUF 1WTBA 2V5HG 3ZZTA 4D3HA 5D4PA 4KJIA 2QLWA 2R8HA 3MEGA 1WHXA 2CJQA 2NREA 1N33F 1YWXA 2ROGA 1N5QA 3IWNC 3ONQA 3M6UA 2YTCA 3TI0A 1T05B 1K1SA 3QMQA 4C4WA 1TVRB 1S1VB 4WTYA 3W2VB 1IBKF 3SSQA 1E6VA 4DV3F 4N77A 3U1NA 1NNDA 2R7QA 1OSCA 4RWWA 3N79A 2XMJA 1L3UA 1YRXA 1Y5LB 2BQUA 3N28A 4CH1A 1HR0F 4YOEA 4BHQA 1C1BA 1N48A 3TANA 2VBXA 2GQQA 2WBRA 4WJBA 2QFJA 4IUFA 2CZVC 3GMGA 3MEKA 5ITHA 5LSOA 1LW0A 1B0PA 3KK3B 3TAMB 2IM2A 3G6XA 4WZQA 3NAIA 4ZMMA 1XMBA 4X4VA 1JK9B 2MJUA 4U9RA 2V8GA 4NYOA 2J6SA 3OTEA 5BR8F 1V3ZA 4PWDB 2MXYA 4OHYA 1G1XA 3DLJA 1JKHB 1N5YA 2HNDB 2Z2MA 1S79A 1FXDA 3VR1A 3GILA 1DURA 2APOA 3LGNA 1UWBA 1FDBA 2DGUA 1G7CB 3SXLA 4Q45A 5K8MA 3MM5B 3PR4A 4O23A 2KM8B 3PFEA 1ZTWA 1TL4A 1J5OB 1KC8T 2W4PA 5D4LA 3EXCX 5KFYA 1HMVA 1NEEA 2DCLA 2PA3A 3HVWA 3VALA 1U6BA 4WE1A 2EK6A 2NPIA 4DSIA 5D3GA 1MW7A 2EFOA 3B8HA 5EUHA 2DGXA 4JBCA 2UVWA 3CCSS 3BDEA 3QYYA 4ZP8A 2CQCA 4EEYA 2E1CA 3QLHB 2UVVA 1UP1A 1VIOA 2YKMA 4MAKA 2DNZA 1O51A 2W8KA 1VRUA 2V4RA 4B3OA 2BRKA 5G0RA 2HFOA 2XLJA 4YB5A 1ROFA 4DOZA 5KG7A 2YY3A 1HPZA 3T1AA 4P2SA 3U7JA 2ASJA 1K8AT 3GFZA 3EX7B 1X9MA 1HBNA 3M2VB 1JLAA 2J0SD 1XR6A 2HLUA 2VUGA 1Y5IB 3UWTA 2DNKA 4X4PA 3BB5A 5HMZA 4RW9B 3KOAA 2RT3A 2IRUA 5LJ3Y 3DU6A 3JSRA 3H4BA 2ASYA 3MTKA 1TVRA 3PW0A 3UR3C 4AXJA 2L41A 4DUYF 1I94F 1H7XA 3G86A 2CRLA 3Q8QB 1T8EA 4TN2A 2HIQA 2AGOA 3CF5Q 2D74B 3IGNA 4FP9A 3T3FA 2EBGA 3M8QA 3NGDA 3LO3A 3VZIA 4R8UB 1UFWA 2ZDOA 3LQVA 4XAKA 3WX4A 4NRUA 1NH7A 4LF5F 2I5JA 2KM8C 3LUYA 2XY7A 3I82A 3MHYA 4UY85 3PV8A 4QR1A 4FF3A 1U1MA 5EX0A 2FJXA 4X2BA 1RT6B