2DGWA

Solution structure of the second rna recognition motif in rna-binding protein 19
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
91
structure length
91
Chain Sequence
b'GSSGSSGTTCHTVKLRGAPFNVTEKNVMEFLAPLKPVAIRIVRNAHGNKTGYIFVDFSNEEEVKQALKCNREYMGGRYIEVFREKSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Probable RNA-binding protein 19
publication title Solution structure of the second RNA recognition motif in RNA-binding protein 19
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 10
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2006-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2dgwA01
2MYFA 3R1HA 2SXLA 3BEGB 5BJRA 1QVFR 2KH9A 2MJNA 2X1FA 1WI8A 1WELA 1XN9A 2QFJA 5DDQC 5EN1A 2VODA 2X1AA 1WG5A 1U6FA 2MY7A 3UE2A 1JJHA 1N8RT 3Q2SC 2CPFA 2HVZA 3JB9k 2DNMA 1X4HA 1WF2A 1P27B 3SDEA 2HGNA 1X4EA 2V94A 2RVJA 1YJWS 2ADCA 5GAGU 3VAHA 4IUFA 2D9PA 4J5OA 2YTCA 3CCSS 4WFNQ 2CQDA 2DNGA 2MKHA 5GMKa 4FXWA 3G8TA 2OSRA 1WHWA 4OZ1A 4C4WA 2XNQA 2CQ0A 3CCQS 3K0JA 4QU6A 1H2VZ 2MKSA 2MQQA 1N54B 2F9JA 3UCZP 4M5DB 2JX2A 1Q86T 2PEHA 1G2EA 3VAFA 1B7FA 4ZKAA 2DNKA 4WFAQ 1D8ZA 3TP2A 2KVIA 3PIOQ 2DHXA 1M5PC 2YH1A 1U1OA 2MQMA 2AYGA 2FC8A 2HGMA 1KD1T 2LA4A 4EGLA 2DGTA 3H2UB 2CPEA 3I55S 3MI7X 1YI2S 2LQ5A 2XB2D 1UW4A 1WWHA 3UD3P 1QM9A 2DNNA 2KFYA 1S72S 1YIJS 4QQBA 5GAEU 3CXCR 1JJ2R 2MSSA 1FJEB 1Q81T 4LMZA 3G6ES 2DGUA 3J7ZT 2K3KA 2RUGA 1NU4A 2DGOA 2X1GA 2M8HA 3BO4A 5H1SV 2JRSA 2DNOA 2RS2A 1VQ4S 2DNZA 4PKDB 2KM8C 1JMTA 2RU3A 5IQQA 1VQ8S 2CQPA 3VF0B 2YKAA 2DK2A 2M4MA 3CF5Q 2GHPA 1WEYA 3VAGA 3P5TL 4WF9Q 5LSLA 2FPHX 2WBRA 1SJQA 3CCJS 1ZZNA 2EVZA 1Q7YT 2M70A 1OO0B 2KRBA 1HA1A 2A3JA 2D9OA 3DXBA 1U1LA 1FT8A 5DM6Q 2DGVA 3FEXB 1VBXA 2DNYA 2DH8A 2RQCA 1DRZA 3S8SA 3N9UC 3EX7B 2MSTA 1KC8T 5D77A 2FC9A 1X4FA 1WTBA 3LQVA 2KXFA 2EK1A 1ZZFA 2XS5A 3RW6A 2LA6A 5ITHA 2MZTA 1YJ9S 3I56S 4WFBQ 2ERRA 1U1MA 3NMRA 4TU7A 4ERDA 2DGWA 3NS6A 2MKKA 1U1QA 3MOJB 1M90T 1VQMS 1H6KX 2DISA 2MPUA 5LSOA 4V19X 3CCRS 2E5JA 3NNAA 2AYMA 5DDPC 2DITA 3CMES 3P6YC 1AUDA 2RNEA 1YITS 4W90B 5LXRA 2KRRA 2DGSA 2LXUA 3CC2S 1A9NB 2O3DA 3NNHA 1FXLA 1U6BA 2CQ4A 3CMAS 3UD4P 5D78A 2DNPA 2GO9A 2M8DB 1X5PA 2DHGA 4C0OC 4TLQA 1YHQS 2L9WA 1PO6A 1K9MT 2Q79A 1X4CA 3CULA 2XS7A 2MZSA 4UQTA 1SJ4P 2DGXA 1SJRA 1M1KT 3CUNA 2G1DA 1K73T 3R1LA 4QPTA 1VQNS 3B4DA 1YTYA 2DO0A 2F3JA 3D2WA 2X1BA 1F9FA 2NLWA 4Z2XA 2CQHA 1O0PA 5HL7Q 3B4MA 2CQCA 2CPIA 3MD3A 2N3LA 4Y0FA 1DZ5A 2MQNA 2AYEA 3UCGA 3G71S 2OSQA 2DIVA 1R8PA 5DDOC 1U1KA 2XS2A 2E5GA 2MHNA 3EGNA 5IM0B 2KXNB 1HD0A 1X5SA 1WI6A 3CCLS 3THTA 4ED5A 2KU7A 2XNRA 1VC6A 3HHNB 1N52B 5GAHU 2J8AA 3CC7S 2B0GA 4IOCQ 1DBDA 3S6EA 4WCEQ 2HGLA 2CQ3A 2HZCA 3CCES 5DM7Q 2CPZA 2MGZB 2LEBA 1A7GE 3MUTP 3CC4S 1FJ7A 1YJNS 2FY1A 4CH0S 2KYXA 1VQ6S 2RRAA 1NJIT 3CCVS 2RS8A 2JVRA 2MQLA 2LCWA 3TYTA 2VOOA 3TO8A 1D9AA 5IM0A 5MLCV 2D3OR 1M5OC 1VQOS 1M5KC 2DNLA 2OJ3A 1H2UX 3IWNC 2M52A 5IFMA 1URNA 1U2FA 1R8HA 3ULHA 1U1NA 3SMZA 2DHSA 3UWTA 2LEAA 3BO2A 3Q2TC 1VBZA 3RW7A 2MGZA 2DNRA 1SXLA 4U67Q 1KQSR 2ZJPQ 2CQ1A 2NZ4A 1X4GA 2CPYA 2MXYA 2N7CA 2UP1A 1UP1A 2M88A 3VAJA 3P49B 3CCUS 2QA4S 2DH9A 4LJMA 3MXHP 1UAWA 1X5OA 1VQ7S 2CQGA 3S7RA 2MZ1A 4CH1A 1W2BR 2I38A 2BZ2A 3VAKA 2MQOA 2MZJA 3BS9A 1OIAA 2JVOA 2DB1A 2DIUA 1WF1A 1Q82T 3HI9A 1KOOA 3OW2R 3VAMA 1X0FA 2KXHA 3L3CA 2N82B 3ZZZA 2OTJS 2MQPA 2DNHA 1H2TZ 4C7QA 3G9CA 4YB1P 1FNXH 1HL6A 3CTRA 3LPYA 3THPA 1HD1A 1FHTA 2MY8A 2MZQA 3PIPQ 2CQIA 1WEZA 2G0CA 2LKZA 2LECA 1SJFA 2CPXA 4P6QA 2DGQA 2CJKA 2DHAA 1RK8A 2KI2A 2I2YA 1ZH5A 5JVHQ 2U2FA 3U1LA 3G8SA 4IOAQ 3MURP 4W92B 2QEXS 5CXTA 3FEYB 2M9KA 4CIOA 4F02A 1WHYA 3CPWR 1WHVA 4PRFA 1WG1A 2CQ2A 4OZ0A 4QU7A 1VQ9S 2AD9A 3NS5A 5LJ3Y 1K8AT 4UY8T 1NO8A 2E5HA 1X5TA 3MD1A 4PR6A 3G96A 2F9DA 1VQKS 4FXVA 1OWXA 1JJ4A 2RT3A 2MJUA 5LJ5Y 3J7YU 3U1MA 1CVJA 1VBYA 1S79A 3BO3A 2M2BA 2OIHA 3US5A 1X4DA 1M5VC 2KM8B 2J0SD 2EK6A 3MDFA 2MZRA 5DDRC 5HO4A 3CD6S 3DLLQ 5CA5A 3CCMS 2LMIA 2E5IA 2YWKA 2KT5A 2JWNA 2MKCA 2N3OA 2VOPA 1KOHA 4WIIA 3P3DA 4BS2A 3VALA 2LYVA 1X4BA 2BOPA 1X4AA 5GADU 2K8GA 5DETA 1VQ5S 2FHOB 3MUMP 4IO9Q 1DHMA 2CQBA 2L08A 2KHCA 1SJ3P 4RU2A 1N88A 4CQ1A 1OPIA 2M7SA 4LIRA 2AYBA 2DNQA 5JVGQ 1WG4A 2M0GB 3V4MA 2MB0B 2DH7A 3UCUP 1FJCA 1P1TA 3VAIA 3EGZA 2MKJA 2VONA 3MUVP 1FO1A 1WEXA 4TU9A 1WHXA 2E44A 1L3KA 3IRWP 1PGZA 4F25A 2J76E 3G4SS 2LXIA 2ADBA 4WKRA 1WF0A 1BY9A 2J0QD 4F26A 1U1PA 1VQPS 2G4BA 2CPDA 2OTLS 2YH0A 2DO4A 4Y00A 4YOEA 3H2VE 4TU8A 5GVQA 5FJ4A 2ZJQQ 1VC0A 2CPHA 4A8XA 1IQTA 1YWXA 5CYJA 3R27A 3NNCA 2RQ4A 1RKJA 1UFWA 2ZJRQ 2RRBA 4YUDA 1U1RA 3SXLA 2L41A 3SDEB 2KG1A 2HYIB 2MKIA 2CPJA 2KN4A 2XSFA 2KG0A 3ZZYA 1VQLS 5LXYA 2MMYA 2PE8A 3S01A 1VC5A 2U1AA 1QVGR
chains in the Genus database with same CATH superfamily
5HLFB 4MK8A 1TFYA 5A6WA 3DM2A 4CLTA 2EEYA 1RSCA 3FNNA 2VDIA 1FWKA 4QCLA 4RUCA 1EAYC 1G7CB 2AP6A 2R2RA 3JB9k 5EWGA 1K0TA 5KFMA 1DLOB 3LGNA 5ADZA 1S77D 3KMSA 3HFVA 2IAJB 1MLAA 2VBXA 4IFVB 4EFAC 4X2BA 4M5DB 2C42A 2YNHB 1KR4A 3AFGA 2UUBF 4DL6A 1YDLA 3GFXA 2ZH6A 2I0XA 3AH6A 1M5PC 2B56A 4P2XA 2ASLA 2LA4A 1R8AA 4GVBA 2DGTA 4B08A 3QWPA 3WIVA 5DQGA 2UU9J 3LWLA 4JB8B 1UTAA 2HBZB 3CXCR 2KFNA 4ATNA 2GC8A 2JH3A 2OPQB 1RKIA 1NU4A 5FDLA 3NS7B 2DNOA 1J5EF 3OL8A 2HNZA 3HSJA 2DNZA 4IG3B 3IR7B 4ZVFA 3DLBA 3LA0A 2VC0A 5L38A 3BF4A 3HD2A 4ZIVA 3TA2A 1Q7YT 4WE1A 1NB2A 4HTIA 1HA1A 2YKMA 4PWWA 1DAXA 2DXEA 3KK3A 2EFVA 2KXFA 1WC5A 5I3UB 4EYHB 4JI6J 1KQFB 2ERRA 1SV5B 1REGX 5KOXA 3BSCA 3GILA 5RUBA 1M5SA 3AJ1A 4FBTA 4R0JA 3K8WA 2CA9A 3NNAA 3P6YC 4PPDA 4TYBA 2Z2ZA 1T94A 3TUIC 4JV1A 1B3TA 2VPWB 3BB5A 4ZPWR 3HHLB 3DGPA 1SB6A 2HRYA 3A1YG 4NZ7A 2QE5A 3M9OB 3IGNA 3IAM9 5K8MA 2HHXA 2BANB 4OX7A 3RTVA 3V81A 1RLCL 1RT4B 1O0PA 3B4MA 2CQCA 1U0HB 1DZ5A 4LF8F 2VFRA 3CIMA 4NLUA 1P9QC 1S1WA 5HMZA 3ISNC 4DPOA 4P10A 4WXWA 5L39A 2EKYA 2HZCA 1RHMB 4DS4A 4IOBA 2QJ3A 2D3O1 4OI0A 2NR0A 3GSIA 4X65J 1D9AA 2C2MB 3NOGA 2M52A 5T14A 1U2FA 3KLEA 2DHSA 2CZVC 1SC3B 1PKUA 1XIQA 4FP9A 4DQIA 4CO2A 4ZCIA 1VRQC 3P49B 4DL4A 2QA4S 5B0GA 5KFZA 2G13A 4ZVSB 2CQGA 3G2XA 1TL7A 4CLWA 1T9VA 3CIZA 1WF1A 1P8GA 1RAIB 2IRXA 5I4MA 1WORA 4NXNF 2Y1JA 2OTJS 1S9FA 4S0MA 1KN6A 2Y0SD 2W9CB 1FNXH 1OY8A 4HTJA 1B7YB 4PG5A 1YRUA 1LXJA 3DRPB 4YB5A 3LAMA 2I2YA 5KFEA 1D1UA 2A6OA 5C25A 3ITHB 3CPWR 1HFEL 3NS5A 4OI1A 4UY8T 3CDWA 2EBGA 3TZWA 1BLUA 1GEHA 3O8WA 2ACMA 4FXVA 1S10A 2JOQA 4K8RA 3FMWA 3MPYA 3T1HF 4KR0B 3WIUA 3A3OB 3RAMA 1JLCA 2FYXA 3CD6S 3O1LA 2DRBA 3ZZTA 2CFXA 2J9EA 3DRXA 3GCXP 3G6VA 3P3DA 3N5FA 1NDLA 1HWJA 2VZ9A 2YY3A 4EK2A 2BXJA 4OYWA 2GVDA 4JBCA 2LEPA 3H59A 1RWMB 3I5BA 2QZ8A 2V2VA 4DCJB 3M6XA 4EBDA 3D1OA 1WG4A 3E2EA 3G82B 3KNAA 3BGOP 4JI1F 4UY85 1Q1KA 2DKOB 1L3KA 5HANA 1AZSB 1URRA 4RW8A 3WZ0A 2CZ4A 1S6PB 2BOAA 2O01C 5GVQA 4LREA 5ETRA 3EM1A 4A8MP 3GQCA 3RRHA 2VG7B 5KG3A 2VQEJ 3ENQA 4RNNA 2BA9A 4CNYA 3CJTA 2WB1D 3MM6B 2IDLA 3J7Z5 2OUGA 3GG0A 3BPDA 2X1AA 2QYCA 4RNMA 3EXCX 4B02A 5D4PA 5BR8F 2J6SA 1P27B 3TJAA 3KJFB 3TAMA 2C2ZB 4IRDA 4X4NA 1FK9A 4WFNQ 5GMKa 3TW0A 5DG9A 2XNQA 5DQIA 3FGVA 3W61A 4C8YA 2JFDA 1CSJA 4M5MA 1KNZA 1S1XB 4ZLNA 2DNKA 1VBKA 4CYUA 4I2QB 4LRBA 1XMOJ 1KD1T 5AT1B 1S97A 2RU9A 1S0VA 4GVLA 4B3SF 4LF7J 1HR0F 1WDTA 4ICLA 1FTRA 1U02A 5C2GA 4KIAA 5B7WA 3FKBA 2QL7B 4ZVGA 5IQQA 2KZZA 5K20B 1WEYA 2A2DA 4ZMMA 4DF8A 3RBDA 4F0MA 3DC2A 2ZH8A 1JLFB 5KFFA 5KFLA 3JTNA 5D77A 4CWBA 2ZOFA 1FNMA 2WHOA 3MEEA 1U1MA 5KFKA 5HK4A 3H4DA 4J9NA 2HAIA 2AIRB 1GXUA 3D0IE 5DDPC 2RNEA 2HMIA 3D28A 3MCSA 1LW2B 2UUAJ 2FB0A 3C46A 2AX0A 1HW9A 3TVKA 1FXLA 3T1AA 3UD4P 2AJ1A 3EDQB 4NCBA 4CLFA 3I32A 3TZZA 1PO6A 1K9MT 2A0FB 2O67A 5HBMB 5D0HA 3GMGA 3ENVA 4RBUA 5L9NA 5K8NA 3K57A 1VQNS 5HP1B 4HH0A 1NNDA 3GR1A 2M5YA 4FF2A 1RTHB 1X9WA 5LMUJ 4E0DA 3K5PA 2KB2A 4CT8A 2HHPA 4Y0FA 1W25A 1SQFA 2M3DA 2H5EA 4TN2A 3DLGA 5IOLA 2KT2A 3FRYA 2B5JA 4DV5J 3H40A 3EYZA 3FSIA 2BUNA 2D41A 4ANCA 5HJYA 2PFDA 3RUBL 4LFAF 4RW4A 3KXDA 4ZVPB 2HEKA 3LALA 1QE1A 2CPYA 1Q0NA 5GMEA 2N7YA 2F4VF 2WVCA 1GNKA 2EFGA 5J2MA 2Y9HA 1N32F 2F40A 5A8WB 1FRMA 3V5RA 3JSRA 3HJFA 1B0PA 3T1YJ 3FFIA 3OVSA 2AEFA 3HKWA 2CQIA 3KUEA 2HFOA 1Z2ZA 2DGQA 3A8JA 2HFZA 4W92B 1IWAA 4UUWA 5F3ZA 2XQCA 1VI7A 3HT3A 3CE8A 2C2EA 2R7QA 2Q6CA 3DKDA 2ZH3A 1SUQA 3MD1A 4OI3A 4MH8A 3H0PA 2OLWA 1RLDA 1N48A 3M2RA 5F0WA 1NPKA 2KM8B 4ILMA 1S1UB 1VJWA 3LGHA 3DLLQ 2E5IA 2G2YA 1KBRA 1Z2LA 4MT1A 4UUXA 4J9MA 2LQJA 1Y0HA 3W5ZA 4DN0A 1RBAA 3JS9A 3ETOA 4H4OB 3AOBA 4DFKA 3FQLA 1VFJA 3TVYA 2WOMB 2FLLA 1DY3A 4A8FA 3WX8A 3TANA 2VBZA 4NXMF 4OZ2A 4J9RA 5IWAJ 3EPGA 3V6KA 5I3QA 2BJ3A 4TYAA 5IZHA 2E1CA 1XEZA 2DO4A 2GQ2A 3H2VE 2E9TA 5FJ4A 3AJDA 4TY9A 5KFVA 2VA2A 2QN6B 2XGQA 1EETB 5KFGA 2YNFB 3L4BC 3NOCA 4NLRA 2EFQA 4IR1A 2KG0A 3RB4A 1XNRJ 1U8SA 1K1SA 1QVGR 4J9PA 1BQXA 2APOA 3LPEA 4Y3CA 5LMNF 2V4RA 4F3OA 1HWKA 4K4UA 1U25A 3LUYA 2MY7A 4MFBB 3L95X 1AW0A 4NLDA 1X7VA 1RT6B 4K4VA 4B3OA 2J0WA 3SDEA 3CD0A 5A8WA 1S48A 1KONA 4ZN3A 3TVZA 2D9PA 4J5OA 2OD4A 4KQZA 4EZ6A 2ZNYA 3B78A 3PW5A 4Y65A 4FS1A 1T9WA 3K0JA 2F9JA 4ZVQB 4J9OA 1Q86T 4USTA 2QC3A 4JI8F 2XI3A 3TP2A 3UR3C 1IKVA 1TAQA 1U1OA 4GC6A 4JUZA 2QSFA 1NB7A 2AV5A 4KT0C 2WVBA 4RX6A 3KLFA 3M8RA 1GX5A 4X4OA 3BGLA 5K8PA 4CM2A 2LU2A 2VBYA 3BO4A 2NSCA 1VQYA 2NCKL 3F56A 2HS4A 2H1YA 1H7XA 1TTHB 2RKIB 1KFSA 3T5KA 3GG1A 3I0RB 4PXDA 2G9OA 2WBRA 4G3IA 1TKXA 2D69A 2M70A 3I82A 4H4OA 4PG7A 3D68A 3M2VA 3L09A 3QO9B 2CNKB 4FYXB 3KDOA 2XC9A 4FYWB 2F8HA 2GJFA 3NAHA 3SV3A 3FCWA 4OYOA 3Q8QB 1M90T 1VQMS 3KUGA 3CCRS 5AXNA 1UW9A 2AYMA 3MM9A 1U47A 1MU2A 1WOOA 3BBBA 1AUDA 4F3MA 3KOAA 3HVAA 4WKYA 2DGSA 1T05A 3FSYA 1GAOA 2WVFA 4L76A 2BW7A 2VJUA 1RT5A 4USIA 1FKAF 1HPZB 4NCGB 4I0WA 4OYXA 2ILYA 4QPTA 4P73A 4USUA 4C3KA 1F9FA 3GYXB 3KJNB 4Z2XA 1OYDA 5KG2A 5H9FJ 3MD3A 4A8YA 3M8PB 2IC3A 1S9GA 2MQNA 2AYEA 4NLWA 2XHCA 3EGNA 1HD0A 3VZHA 1HQEB 2ZBRA 3K89A 4IOCQ 3E01A 2VG6A 1FI4A 3W60A 4RPFA 1ZA2B 1HNWF 4IKAA 1YJNS 5KT5A 2IYIA 2KYXA 4DQQA 1GTEA 5KG6A 2JVRA 3QRRA 4DR4F 4MAKA 1HWUA 1S1VB 1VQOS 1M5KC 4F4KA 5LSRA 5FLXY 4OYIA 4ZVEA 2V8VA 3BO2A 2ASDA 3EZUA 3I5AA 3DRRB 1UFLA 2GNKA 2NXJA 3TQEA 1X5OA 4NRUA 1ZM9A 2XG8A 2BZ2A 1FXDA 1FKOA 3N5BA 4OZLA 2GGPB 2B8QA 4FKYA 3OW2R 1H72C 5CQGA 5CYMA 2EPIA 4LF9J 4J9KA 1NK0A 1EB0A 4KJIA 1GX6A 3GONA 4PUOB 3QGIA 2CJKA 2D1CA 2CWKA 3H98A 4KV8A 2MKYA 1IKXB 3MURP 3C14B 1HNXF 4F02A 3FVYA 3W1YC 4PG4A 1D9DA 2RD5C 3I9ZA 4J7CA 2LQ9A 3RU0A 4X4RA 3QLHA 3QYYA 3DI6B 4DQRA 5A76A 1QSLA 2M2BA 1FE4A 3W3SA 2NPIA 2QMWA 2Z30B 2HZVA 2XHWA 2B51A 3C2PA 5I42B 1KOHA 1RCXB 4IFYB 1X4BA 2BOPA 1X4AA 3QMQA 1UVMA 3JQKA 5FLXU 3CJ4A 2YPZA 2FHJA 5JVGQ 1FF2A 1FJCA 4Q5VA 3VR1A 1WEXA 1T02A 2B4UA 1U1PA 2RUSA 2CPDA 4YOEA 4R25A 3GIKA 4N56A 1YWXA 1F5CA 5E3RA 5H9FK 1WC0A 1U2CA 2E29A 3MGJA 4Y2CA 3MFIA 2MYFA 4YY3J 2XCAA 3GIIA 4NL5A 1RBLA 4F36A 3QT5A 1J2VA 2PA8D 2DBBA 1TELA 3W65A 4QIEA 3C3LA 2BRKA 1HNVB 3HSDA 1YBTA 4JI6F 1WF2A 3AT1B 2HGNA 4NI2B 3W9HA 3AJ2A 1F3VA 4OZ1A 4DJBA 3PJ9A 3DDNA 2HIQA 4PXEA 4CLZA 4ER8A 3A12A 4XAKA 4LBPA 2YH1A 1PG5B 2AYGA 4B9VA 4MK7A 2VJVA 1UW4A 1L3VA 1MSWD 2QX0A 1Q81T 2DGUA 2RUGA 4P7TA 1G1XA 3PHEA 4PKDB 3AA9A 3OTDA 1FEHA 1RT3B 3MM8A 5KFCA 4ID8A 1BQNB 4YDDB 4WF9Q 5BXIA 1QSSA 4IFYA 5B09A 4KY3A 3HHEA 1IN0A 1GMWD 5DM6Q 4R5PA 2WVEA 3UO0A 5CYQA 1EARA 2B9YA 3CJKB 1YJ7A 5F3TA 4OHWA 4E2FB 2QYGA 2QRRA 2B9EA 3Q8SB 4EWTA 1W7WA 2HHSA 2KRRA 3VVUA 3NNHA 2KO1A 4AL5A 3T9ZA 2C3UA 2DNPA 3MR6A 1N34J 4MTPA 1YHQS 3TUZC 4C8MA 4LFCJ 4B9SA 1S6UA 4Q2MA 1IM4A 4X66F 2XTJP 3AA8A 3DHXA 1UA1A 2AHOB 4WWSA 4DR6F 2G1HA 2J7WA 3OUYA 2AKWB 1REVA 5AJ3F 2FZKB 3BPSP 2DIVA 1R8PA 3TOQA 2B8PA 3HD1A 2ZH4A 4LF4J 3PRVA 1HI1A 3NGTA 2CAJA 2KU7A 3MEDB 4JYAJ 1XMQF 5GAHU 4M5NA 4BCAA 4WXOA 5HVHA 2AJ2A 3PW7A 2MQLA 2O66A 3CGIA 2VFSA 4K0KF 3ULHA 5C42A 1JLBB 3OQ2A 2LEAA 1FKPB 1VRTB 2ZE2B 1QAXA 4OL8A 3R8YA 2ZJPQ 4Q45A 1X4GA 3AXKA 1RT3A 3VGTA 1LV5A 3R6LB 4K59A 1WKJA 4ZHRB 3GJQB 4NLXA 1U24A 3IRXA 1X0PA 2AGOA 5A2QY 2YNGA 3MR2A 3AOAA 4ECRA 3C6UA 1JKHB 2J7KA 1X0FA 4LRDA 3L3CA 1RI7A 3HHLD 2ZH1A 4KO0A 5DS7A 2WSEC 4OQJA 2GIQA 2H4WB 1HHTP 4I4BA 2OKQA 3DOLA 4IDKA 3CEDA 4C8KA 1RADB 3KJVB 4FVMA 1SCJB 4NPOA 2YKNB 5KG4A 3MTJA 1YZ7A 2BRLA 2UUCF 3G6XA 2VQEF 1WG1A 3AAWB 3LGMA 1RE1B 4HACB 5LJ3Y 1TFWA 2QT7A 3R97A 1H0HB 1NHVA 4P52A 1XR6A 1JNZB 2GVZB 1HWIA 2OEJA 2E66A 2VG5B 2OIHA 3O3LA 3MM5A 1X4DA 4OJHA 1ZM4A 2COLA 2GX8A 2QLFB 2GIFA 3JQJA 3L7OA 2KT5A 3T5JA 1C0TA 4ES3A 1JLQA 2N3OA 4WIIA 1CJUA 1FWLA 4W4MA 5M2UA 5DO2A 1DHMA 3GYNA 1XMOF 3LP0A 3QT8A 2DD8S 3RYLA 1RTIA 1V3ZA 2B7CB 4G65A 3IMQJ 5B0BA 4DUYJ 5GAGI 5A2QU 1EP4B 2XULA 2FIUA 5CZVA 1KRPA 3MMBB 3PY8A 1ZOTA 2HVEA 2GHVC 4H4KC 5IS2A 3SXLA 2L41A 2KG1A 1TAUA 1ITPA 2CPJA 2XSFA 4LR9A 3PX4A 3HVTB 5K5MA 4HVZA 3R1HA 3G87A 2MJNA 2B4VA 3BKUA 2QFJA 3PW2A 1U6FA 2F63A 2YQ0A 3L7UA 4GO5X 3OHAA 3SQGA 4BDPA 2UUBJ 4ZOSA 3M2UB 1CJVB 5K14A 2PMHA 1FRLA 3OFEA 3LP2B 4KTQA 4DL7A 4CO4A 4ZPCA 4DZ6A 3HFKA 4I7FA 3FUYA 3KJVA 2UUAF 4DV0F 4PAAA 2FJVA 3JAMY 2HLTA 4RW7A 4ZVOB 5KFYA 1B7FA 1J5EJ 2H3EB 3X1LB 1LEOA 2MHEA 2FC8A 3A13A 2BKOA 4IQXA 2HFUA 2KT3A 1IXKA 1S72S 1QM9A 2DNNA 4KFBA 4QQBA 2GVZA 4AE5A 2AGQA 3QIPB 5E41A 2IM1A 2RS2A 5LMUF 4O3QA 4K4TA 2DRDA 3WBZA 3UVJA 2H5IB 4USVA 1IBLF 4PQUB 2HNDA 3SQOP 5JJBA 3P5TL 3ZTQA 4RR5A 4NA1A 1OO0B 1RT7A 4R8UA 4JOUA 4LFBF 3MAHA 2GZOA 6FD1A 3MMCA 4NEYA 5ETMA 1JLAA 3TZXA 3EMTA 4I68A 3QPIA 1HBUB 1FEEA 2V4JB 3JYTA 4ERDA 4MYTA 4Y34A 1TL1B 4XIUA 2LQ8A 1JJCB 3H2LA 4W90B 4ID5B 4RKUC 2QG9B 3TARA 1U6BA 1X5PA 3PYEA 2HZAA 4MIWA 4LF8J 2XS7A 2MZSA 3OTOF 2K7KA 2GMLA 4WYWA 1VGYA 4WPAA 1IM6A 3JAMU 1JQGA 3DDIA 4YR2A 1YTYA 4DU8A 1FVQA 3D2WA 2HWHA 4K5RA 3UI3A 3DRSB 3T1YF 3NLCA 1MWYA 3IGVA 1S1TB 4NYOA 2XS2A 2AEMA 4F50A 1HMVA 1JLGA 3KK2B 5KG0A 1MMDA 3ZC4A 2CQ3A 4OJ3A 2HNYB 4DFMA 1A7GE 2JLFA 4EU0A 4ZP6A 4NMLA 1GMUA 3DYAB 1RAAB 2QSWA 3KLIA 2LCWA 5CZXA 2ZH2A 4KHRA 4ECUA 3SI8A 2A1BA 1N56A 2OJ3A 4D3HA 2BE2B 2HHQA 5J2NB 2E7WA 1SPBP 2YNIA 4DCPB 3GP9A 2JSXA 1U45A 3OT9A 2FTRA 1RYSA 4RW9A 3MHYA 3S7RA 3CJ8A 2XY7A 3W63A 3TA0A 1Y00A 3PEJA 5JUMA 3J7YI 3H90A 1PC5A 2DR5A 1K47A 3IWXA 1LFWA 3ZZ0A 1ZA1B 2DNHA 1H2TZ 3UDVA 5J1PA 4JV2A 3WHIA 2XMMA 4J9VA 4URSA 2UV8G 4M5HA 5HATA 2DHAA 2C3PA 1OQ3A 4LVNP 2YWHA 3I31A 5GADI 3AB2B 1VJQA 1WHYA 3MPDA 3GFYA 3IG1B 1YK9A 4ECZA 4QU7A 4CLSA 3E8OA 1C2PA 1ZAXA 1K8AT 1HW8A 4C8OA 3BM7A 1TV6A 4DN9A 2QIFA 2BJDA 4WFYA 1Q4RA 2H54B 3M8QA 1F2GA 2BEFA 4JI1J 2BYCA 1ACMB 2JWNA 3MPWA 5J2QA 2AT1B 5IT9Y 1SH3A 2W9BB 3MEGA 2VFTA 3T3FA 1S0NA 2KHCA 2R7TA 5KFPA 3O44A 3V4IB 1Z4UA 4LF5F 4M94A 3UCUP 4P2SA 4DL0C 5M2RA 1WF0A 1D8YA 4DR2F 5J1EB 2CPHA 2K3IA 5CYJA 1NSPA 1CS4B 3BQ1A 3VZIA 5BR8J 1U1RA 3CDUA 1QD1A 1R0CB 1SKWA 2VFVA 2MMYA 4ZCLA 1HNZF 3PKYA 1XN9A 5C24B 5E3PA 2MTLA 4O4GA 2HRTA 1F5BA 4B3MF 1T03B 9ATCB 4L6V3 2XSJA 3QGGA 3MECB 1X4EA 2RVJA 5G0RA 1YJWS 2GAHC 3BSAA 3KLGA 1OJ4A 2R2TA 4B3SJ 4B3RF 5KOWA 4DSKA 2ATLA 3N0VA 1TMJA 4DOZA 1XERA 4NE9C 2FVCA 2JX2A 3Q8YA 3M05A 4B9NA 5D4OA 1EKRA 2ZZTA 4K4SA 1WC1A 4ZJLA 1OPZA 3MI7X 3ZTRA 5D3GA 5IT9U 3P96A 4E8UA 1R0AA 4KE5A 4G6VB 1UMJA 2QMUB 2RDIA 4I2PA 2YWEA 4DLEA 1NK8A 2JRSA 4FZVA 3VF0B 2YKAA 2HHWA 3DLEB 3BH6B 3EZOA 2PDAA 4DV3F 5LSLA 2B3TB 2C2NA 2FPHX 3UN2A 5CD4A 3DXBA 2D9OA 1U1LA 1R0BG 1M5HA 2W9BA 2YQ3A 4IH5A 4GMKA 3IA0A 3V4IA 5E7OB 4ZDNA 2LA6A 2F65A 3OFGA 1Q7LB 4MMOA 1XQIA 3THVA 1B0TA 1AXQA 1H6KX 4KH1B 3D6HB 1VYAA 3K5LA 1AT1B 1FRXA 4HLBA 2XYPB 4DR5F 4QWAA 1B0VA 1D09B 1RU2A 3CMAS 1UVLA 1DTTB 1JX4A 4ZJQA 1RTDA 1VRUB 2ZBIA 2PD1A 3BREA 4USHA 3CO0P 4C3LA 3PNIA 2W4CA 3R5DA 1S6QA 3CUNA 3UNGC 4M5JA 4TKTA 2CVEA 3R1LA 1SI9A 1R8BA 2NSBA 3NCQA 2MQ8A 3AD7C 4Y2IA 3Q8VA 2DEJA 3M8ZA 1NZAA 4HH1A 2DVIA 2B43A 1EIYB 1RUSA 2FGCA 4LF9F 1V3SA 1T11A 2ALZA 2EW9A 5B0AA 4WU3A 3UCGA 3G71S 2WW4A 2WONB 1SVDA 1N5YB 1S9EB 1UVJA 3I0SB 4U6PA 1WI6A 4FDFA 4KKOB 4NZ6A 4ZP9A 4H4MB 3U27A 1N52B 5EUHA 2XBPA 2ALYB 3GU0A 2ZD1A 4ZPAA 1DBDA 3QJPA 3KK1A 3ZZUA 4ZITA 2V63A 3CC4S 3DOMA 1SQGA 3QJJA 3FBCA 1D3WA 4LIWA 2R7VA 4NLPA 1O51A 1P1LA 3KTQA 3G86A 3EUNA 1RAOA 2EKNA 2FD2A 1CJTB 4TQSA 2YWWA 1N32J 1MWZA 2VHGA 4J9QA 1UP1A 3MCOA 5E3CA 2UUTA 3C15A 1SL0A 4ES1A 3IM8A 3OR2A 1W2BR 5LM7E 4CZCA 3R5AA 3SCLE 4ILRA 4WZMA 1OY6A 1Y3JA 3OL9A 2LP4A 1KDNA 1SBRA 4KRWA 2MQPA 2ZDOA 1IKYB 3MF5A 3THPA 2HBYB 2CJQA 2F8EX 4YEAA 1TKTB 2CADA 1RWXB 3AXMA 2L9NA 4JI4J 2GQQA 1VRUA 2HQGA 3C16A 2HHUA 4HI1A 3Q24A 2VA3A 2CG8A 3NWRA 4EZ9A 4UOFA 1S5ZA 2V0NA 2HK3A 2BJ8A 3M4XA 5DQHA 4HHHA 2UVUA 4RZRA 3CCMS 2OPRA 4J9UE 1UKUA 1RWUA 3D3BJ 1HBOB 4C48A 2BM1A 5I3PA 4BS2A 3TR5A 1NK6A 4B9LA 4X62F 2ZKUA 3ZZRA 1RJJA 1WSVA 1U26A 1BC6A 1DURA 4NLVA 4C0BA 1SJ1A 1P1TA 1FDBA 1KTVA 2WRMA 2YX4A 3FK4A 1GTHA 2C1EB 3G4SS 4WKRA 4QIVA 3UW1A 3H4BA 4O0NA 4Y00A 4C11B 3DMJB 2VDHA 3MEKA 3L7PA 4M1KA 4CP5A 1IQTA 2EWHA 1OMSA 4DQPA 2QTWA 4NASA 3U7JA 2V2QA 4A47A 2HYIB 2GJIA 2X1FA 4NLOA 3OFHA 4DR7F 2E7VA 2CYYA 4JI5J 2V9WA 1T7PA 3QBCA 3RGIA 2PFFB 1FDNA 4P75A 3CB4A 3TEGA 6FDRA 4HI2A 2DNMA 4G1QB 2N4DA 2BJ7A 4C8ZA 4JI8J 3KG4A 3FMBA 2FGOA 4IUFA 3VAHA 3CCSS 2DNGA 2MKHA 4ECYA 3RB0A 2P9GA 2AZ1A 1N54B 1R89A 3IWLA 4KYZA 2CNOB 2R8GA 4GO7X 5KFIA 1N34F 1RWPB 3QT7A 3FBBA 3I9V9 4Y2MA 3IO1A 2H65B 4LFCF 1T3OA 3Q89A 4OI2A 2XO7A 1H3DA 3KDNA 4WP9A 1SKSA 2BKNA 2RF2B 2DGOA 2X1GA 5ETSA 4UTGA 2M8HA 4PYDA 4OYZA 5H1SV 3H42A 3RB6A 3E3XA 4DSIA 2KM8C 2IIHA 1IBKF 4CTAB 2LU1A 3M1VB 3D1QA 3CF5Q 1IQZA 4E98A 3VAGA 1UEVA 2VB6A 4DX6A 3RRKA 2G2ZA 1ZZNA 1S7IA 2KRBA 1N36J 1FT8A 1Z1ZA 4XDDA 4TVAB 2DGVA 2V5HG 1IR1A 3EX7B 4Z37A 4DPXA 1WC4A 3GV7B 4PCQA 3K58A 3LQVA 4K4XA 2K7JA 4I69A 5HROB 4TU7A 2K1RB 2Z56B 4J91A 3K5NA 2XWXA 1Q5YA 1LWCB 1H74A 5LXRA 4YHHJ 2R7WA 3JSMB 2CQ4A 3OTBA 2GO9A 4LUBA 2OPSB 4LSNB 1FE0A 2FVRA 4N47A 4ECVA 1V6HA 2ZH7A 1K1QA 5A6PA 4UQTA 2GHWA 3MM7A 1CJKA 1ZAWA 2QLJB 2F3JA 1E6VA 4G1QA 2PC6A 3DXSX 1Q16B 4DF4A 5HL7Q 3FZ2A 1HNWJ 5CH7B 3CNQP 2ZKTA 4QWEA 1HQUA 2E5GA 1U2RA 1TKDA 4RUBA 1R43A 3CCLS 4KHPF 1KVIA 2YPYA 3PJWA 1RT1A 4OHXA 2FY1A 1R6VA 4TY8A 2RRAA 1LWFB 1IKWA 2LVWA 1NDKA 3M6UA 1NCLA 2NPFA 1M1GA 4CO3A 2YWFA 1EX8A 3OR1B 5F8GA 4N76A 4Z7YA 2MEWA 1QAIA 4DV2F 1KLMA 4HEA9 4O3RA 3HXMA 1IJFB 1NBEB 1F0XA 3M30A 4M95A 1VQ7S 4ED8A 1L3SA 3QZ7A 4CI0B 4ZIWA 3T41A 3BS9A 1C4CA 4F4YA 3AQPA 3HZEA 4QYZK 3ZNJ1 1HNXJ 3ZO7A 3UQSA 2HQCA 4U8YA 5HROA 1B64A 4DUYF 1D9FA 2LECA 3IXQA 4DI6A 5F8MA 5ETNA 4ECQA 4W98A 2VD3A 4XPCA 4X64F 2DTJA 1A6LA 2VUGA 2X7IA 3POTA 2CQ2A 4OZ0A 4O0IA 5KT2A 3HX9A 1NO8A 4OX9J 1X5TA 5HAOA 3D6TB 4A8SA 2FJXA 2OAUA 3VGVA 4A8KA 1OWXA 2WBMA 2RT3A 1PAEX 3QAUA 3MMAB 1HBNB 4NZ0A 3SIPB 3NBPA 3KLHB 2J0XA 1VR6A 2W8KA 2YBVA 4LF6F 4DL5A 5ETVA 3I6PA 1UJ4A 2MKCA 2CRLA 2AJQA 2MLZA 1HYSA 3G6YA 3QATA 1NAQA 3JTPA 1SJ3P 1G6BA 2P6TA 4F0KA 2BQ3A 4LIRA 1LXNA 2HHHF 2WCXA 5HQ8A 2CUYA 1N5VA 2W2PP 4QWDA 1LWFA 3IR5B 4F4WA 2Z2LA 4L3NA 4NLQA 4CO0A 4DBQA 3W2WA 4QIFA 4O44B 1RTJB 4B3TF 4WP8A 2I5JB 2RRBA 4P74A 5L46A 5BYRA 4ED2A 1VC5A 2SXLA 3R2DJ 3WC2A 3PM9A 4U9RA 5A8RB 3W2VB 1N8RT 2IYGA 2CXEA 3Q2SC 4QYRA 2B9XA 1Y5NB 3U02A 1JWWA 5HLFA 2YTCA 4KGVB 4BWJA 3F44A 3TAQA 4V19J 4EBEA 1H2VZ 1K44A 1CEZA 3V6DB 4EBCA 2PEHA 4Q44A 1DLOA 1LWEB 2HHTA 3BN4A 2R8IA 2GV1A 4LBIA 1RHUB 2IAJA 4WFZA 5DGBA 4FVCA 3MPUB 4IFVA 4M5DA 2NS1B 4IQMA 4LSLB 3GPAA 2YNHA 5BYQA 3HULA 3OPKA 3KLHA 1Q78A 4O3OA 1PAUB 4OX6A 1NKEA 4KGZB 4X84A 3JSBA 2VQFF 2OPQA 2R8JA 3NGSA 2NUHA 2FC9A 1MROB 4IG3A 1B4SA 3B8HA 2A2CA 3QNWB 3BBCA 3PR5B 3Q23A 2PSZA 2DGWA 1DARA 3ZTPA 1U4BA 3MOJB 4ZLPA 4O3PA 3R9LA 2AF6A 1OY9A 1BWEA 4X66J 4F2RA 4DR6J 3CJRA 1C1BB 3D0GE 2L9DA 5DJBA 3MAAB 5I3UA 5LT5A 5D78A 4BWMA 1UVNA 4RJVA 1SV5A 2QLXA 2XLJA 5AJ3J 1OYEA 1X4CA 3HSGA 3OD2A 1M1KT 4GKJJ 1RWNB 4CRJA 2DR6A 4WK1A 2IJNA 3AY0A 1XMQJ 3JSYA 3HHLA 2IA6A 3A4TA 3PVXA 8AT1B 5F8NA 2ZOMA 1XJWB 3BGUA 3ILIA 3NCRA 1NRKA 1Q95G 5IM0B 1F9EB 2BANA 4J90A 4K0KJ 3THTA 4A48A 4Q8FA 2B4PA 4KPCA 4K7QA 3CC7S 1DFDA 1RT4A 4OHYA 4WCEQ 2NQPA 4XPEA 5ETTA 2MGZB 1U0HA 3TI0A 3HCXA 4ILLA 1HKAA 3DOKB 3W9JA 2R7UA 4I67A 2CJXB 1RU1A 4Z7CA 2D7SA 4ZVRB 3HSZA 1T9UA 1BE4A 1R8HA 3MOZA 5IT0A 5JXSA 2ZDPA 2HVHA 3RW7A 4ZVUB 4QW9A 1SXLA 1S4EA 2CQ1A 1TK0A 2FLOA 2J9DE 1HBMB 2IA0A 1UAWA 3M8WA 2MZJA 1O5JA 4L74A 1NK4A 3CJQA 4ZK7M 3FSXA 1XR5A 2UUCJ 1ZM3A 3T5LA 3VQSA 4ANEA 4M5KA 1FX4A 1WUUA 4AL6A 2HWTA 5E2QA 2EFOA 1NKCA 1NHKL 7FD1A 2MY8A 1RT2B 3GB0A 2GFFA 1KWMA 4DR1F 3ZTSA 4HHUA 5F8LA 4M5GA 3F0NA 3M8YA 4MYUA 4P2MA 3Q8RB 1YKWA 2W9CA 4M5LA 1WD6A 2JEIA 3DRPA 3EVWA 3C6TB 7FDRA 2P9CA 3ITHA 3WDOA 4C3MA 2B6AB 5D4LA 2CWXA 2W4DA 1E6YB 4PWDB 1SIZA 3FEZA 3B54A 4F0HA 2UVVA 2IMWP 1LWXA 3SCKE 3ADAC 5DETA 2V6AA 4DG1B 5T7LB 1KHVA 4MK9A 1Q79A 1TVRB 2W7AA 3OTCA 4QIWD 3EZ5A 1C1CB 1TKZB 4ALZA 2MKJA 4A46A 1WHXA 1IR0A 3GJRB 2J76E 1SL1A 4FYDA 3JTOA 4DX7A 1JB0C 2RSQA 4JI0F 3QSYB 2EG2A 1VC0A 4DSLA 1K0VA 2R2UA 3PRDA 5KFRA 1RA7A 2H4YB 3G82A 2XMVA 2KJWA 2WK4A 1AZSA 1R31A 3HLUA 1S6PA 4PWUA 8ATCB 4M8LA 1HLWA 2R8HA 2W7PA 4DV0J 3BSOA 3J7A1 1S7HA 1LQ9A 1X4HA 2VG7A 2V94A 2AX1A 1TP7A 3MM6A 3LP1B 1X60A 5G4DA 2BABA 3T6BA 4BC7A 1VLOA 4DV1F 4ZKAA 4WFAQ 1X31C 2BVZA 3C19A 4NOHA 3D1HA 3R5JB 3FRZA 1IBLJ 4HKQA 4EGLA 4USKA 5A8KB 1YI2S 3T9NA 5E0OA 3CMQA 1WWHA 2KFYA 5AE2A 1YIJS 2GJ2A 3CJ3A 4M5IA 4Q2LA 4LFBJ 1S1XA 1B70B 4ZJOA 3RBEA 2W7OA 4I2QA 1NZ8A 1VQ4S 1DTQB 2JDJA 2DCLA 3CJ5A 2V69A 2DK2A 2M4MA 3QZ8A 2C2DA 3OV7A 4I64A 5HQLA 5A0YB 1LW0B 1SJQA 5B0DA 3CCJS 5HVFA 2FZCB 3Q83A 3CDEA 3S8SA 3N9UC 4BBYA 1N6QB 1EHWA 1TL3B 3QAEA 3QT6A 1ZZFA 4P71A 4WFBQ 1CG2A 2P5VA 2IHR1 3NMRA 2JNJA 2DJWA 3O5TB 3NS6A 3OTOJ 3VVTA 4DMZA 1JLFA 4V19X 4AYBD 3PJXA 4DSEA 2PIIA 1YITS 1UZDA 2LXUA 3CC2S 2O3DA 3GFZA 1MN7A 4WP3A 2GQCA 4L72B 1NDCA 2CDQA 3AB4B 1BGXT 3PRBA 3Q8UA 2HURA 1MWQA 2LQBA 2Y1IA 2V67A 4K5SA 2OPPB 4DV4J 4QJVA 4QIGA 3OXGA 4DX8H 3M32B 3TQ1A 1LW2A 3K17A 1NJWA 1Y5IB 3ZFVA 2CPIA 5HBMA 3DLKB 3UPFA 1UVKA 1U1KA 2MDAA 1UWBB 2AJFE 5HP1A 1UETA 4AQYF 3HHNB 2OEMA 1NXIA 1YBUA 3DHWC 2YWGA 2VIHA 4JI4F 3M9NB 1RTHA 2CPZA 3BV8A 3RAXA 3DNCA 2XO6A 1BQMB 1VQ6S 1DQ9A 1NJIT 1U09A 2VPXB 3W62A 3TRGA 2C3OA 4ZN1A 1RHJB 2OFHX 1FD8A 4ITSA 2XYGB 4LSZB 1C0UB 3ILOA 2R4FA 3KG1A 1SC4B 2PI4A 1RWWB 1KQSR 3AD8C 2MXYA 2N7CA 2L48A 1RZMA 4WFXA 1Q8KA 3DCAA 4LT6A 2AZ3A 3BGRB 3VAKA 2V9KA 2J7UA 1H38A 3FQKA 2ZZNA 2JVOA 3NY0A 1I6JA 1J5OB 3HI9A 4CLYA 5IV3A 4IG0B 1JLEB 3EICA 2IY5B 2ZVSA 3SV4A 3RRGA 1VIXA 3R5BA 3LTOA 3ISND 1WEZA 3W7BA 2C22A 3W64A 2U2FA 3G8SA 4RLEA 2LXFA 2E5LJ 4KH0B 3FEYB 5LOQA 1WHVA 2V8HA 3NGUA 4ZCMA 4BC9A 4RWXA 3PV8A 2PEBA 3OBIA 1KKHA 5E3QA 4JI5F 2JLGA 3GIJA 3QWUA 3B82A 1PC4A 2HSEB 4O3NA 2F8MA 4ZPVR 4LF5J 2I1RA 1PBAA 4RUAA 1UVIA 1FWPA 4DX5A 3BYPA 4DR2J 4OZ5A 2LDYA 3LOUA 2ASJA 2L08A 1T3NA 3CCTA 2E7XA 3HPOA 4RU2A 1S1UA 2IRUA 1YQHA 3ET6B 2FJEB 2C3YA 1OSDA 2AU0A 3MUVP 4X4PA 4TU9A 3QFHA 1NSKL 2DXFA 2I8EA 4F26A 1HNZJ 2P2CB 3DM2B 4TLRA 4YB7A 1Q5VA 2WOMA 5KTQA 4B3MJ 3IS9B 2WB4A 1RKJA 3UD5A 2ZJRQ 5EX3A 2Z58B 1F5AA 1YZ6A 3PZPA 1ZM2A 1U7LA 3VWSA 4C8LA 3GWCA 2LFVA 2KH9A 4Q0BB 4B3RJ 1N36F 5AXKA 1H98A 4EO8A 1V5VA 2QA1A 4B17A 5CABA 1PJ5A 3FC9A 1EETA 4P72A 3HMJG 2YNFA 5HN0A 4OV6A 4DFPA 4ED6A 4IRCA 1N4LA 1AFIA 1Y11A 1JLEA 3OTEA 2IBKA 2ADCA 3PX0A 2OSRA 4C4WA 5AE3A 4I6WA 3K5OA 1BUXA 1TQLA 4MFBA 4DV7F 2PO4A 4YHHF 1QUVA 1RT6A 3VAFA 1S4FA 5FDLB 2HNZB 1UJ5A 4LRAA 1CPZA 3HFZB 5HQMA 4DV3J 2LQ5A 4X4TA 4NMXA 3D6FB 4WE1B 4R0EA 2YKMB 2GMJA 1NSAA 4O4RA 3JQMA 3KK3B 2V8PA 1A0OB 2R2SA 2BDPA 1GXTA 3CDAA 3E51A 4URQU 1LOUA 2RH3A 1QAJA 1S0MA 3MZIA 4JI2F 2CVIA 3V6HA 1JXLA 1DRZA 4DR5J 1RB0A 1RWKB 1WTBA 2BM0A 1I1GA 2UXBJ 2RKIA 4LVOP 3PYFA 4DUTA 2Y8WA 3DGPB 3I0RA 3F73A 5KFHA 3BQ0A 2DISA 2E5JA 4N8OA 4CM0A 1FTCA 1UL3A 3IS9A 3TZYA 3QO9A 3D6MB 3IN5A 1HWLA 1KSPA 3V81B 2VL1A 3LWMA 3KWMA 3DN9A 5AE1A 3CULA 4Q0BA 4PABA 3CWJA 3A3PB 1K73T 1S1WB 2Q6BA 2OEKA 3B4DA 2KKHA 1V9OA 2NLWA 2KJVA 2V8DA 4OJ1A 3MCMA 4ZP7A 4CCHA 2R42A 2QLWA 1HPZA 4NCGA 2FJWA 1WKLA 2MHNA 2QA2A 2AWZA 3KLEB 4DHVA 2BR0A 5F41A 3JXOA 3M8PA 3H8YA 4OX9F 4NLSA 4QPXA 1EQ0A 4YR0A 3PG9A 1S0OA 2RAQA 1QY7A 3TO8A 4OX8A 3HKZD 5KT7A 1CQMA 1HQEA 5IFMA 2C3MA 3W8PA 1TL7B 4RNHA 3MR7A 2BX6A 1VBZA 3UN3A 2E9RX 3DGVA 2Y0BB 4F7VA 3CO9A 3VAJA 4P2FA 4PZVA 2E1MC 2O5DA 1S1VA 2XMAA 3BKFA 3R7BB 3VGSA 2A10A 2RJZA 4D3GA 5C25B 3VAMA 2N82B 3DRRA 1XTZA 3TNVA 8RUCA 4RNOA 1TL5A 1YJUA 1MG7A 2MZQA 3OHBA 1SJFA 1TUVA 1RK8A 2FY8A 2GGPA 2QEXS 3NRBA 2RILA 1U49A 2M9KA 1JLCB 3GYGA 5HMXA 5C5JA 3HVWA 4KPYA 4UOHA 2ZM6F 4PUOA 1HHQA 1NSQA 2JEGA 2CJAA 5IXUA 1JJ4A 4GRSA 4X62J 2KDOA 3AOCA 1IKXA 2W4PA 3C14A 3US5A 2GVDB 2B7BB 3WX4A 1T9YA 2CG4A 3MDFA 5ETOA 4DUZF 3J80Y 5F8HA 1IBCB 2HK2A 3NAIA 4WIQA 4JI3J 2QFIA 2FVPA 3K8VA 3D9BA 3DI6A 4PXBA 2LYVA 4ELTA 4RW8B 2CQBA 3VQTA 2UVRA 2VASA 2GAGC 3TWZA 4MIBA 2AYBA 2DNQA 2F7VA 2M0GB 3V4MA 3VHQA 2MB0B 3M9MB 4YS2A 3VAIA 3GSDA 5I42A 4OZJA 1FO1A 5DG8A 1BD6A 3IRWP 4F25A 3CSKA 1PYTA 4EUVA 4DR7J 4KB7A 1YJRA 4U7CA 3N4WA 4BLGA 4K2XA 1Y3KA 4KHMA 5ETLA 2PN6A 1ZBTA 2KN4A 4NEZA 3TAMB 2W1BA 4OYBA 4ECWA 1S49A 3H25A 3BEGB 4DSJA 1FK9B 3CT9A 2BJ9A 2ZUAA 1NUEA 3PYDA 1J27A 4FPRA 2QLBB 1RWOB 3S1TA 5F8JA 3DFEA 1NKBA 3IC1A 3TA1A 4ELUA 4JI7J 2GCFA 2HVDA 4CYUB 2Y8YA 5GAGU 2YKPA 2ILZA 2PGCA 3FJ2A 4FXWA 3R6GB 1WHWA 2VC1A 4YR3A 5D4NA 1RISA 4ICLB 2ROEA 1HNVA 3UDCA 3J80U 4NI2A 2IM3A 1FFSB 3PIOQ 2QA4G 4CDIA 1IBKJ 1I94J 3SZ2A 3N6NA 2PMWA 3RR8A 2CPEA 4GKJF 3EGVA 3UD3P 2Y1RI 3PTWA 4C0HA 3BZQA 2NXCA 3J7ZT 4PPZA 2R8KA 3CCWA 2MLYA 2ZUGA 3CD5A 1CBKA 4EO6A 4YMEA 2RU3A 4C97A 1PSDA 2CKWA 3MEEB 2POKA 3UDLA 4O3SA 2QL9B 3CDBA 2BE7D 2IDEA 3X3UA 2DH8A 2VFUA 4N8NA 3TUJC 4DEZA 2HMIB 1T9XA 1KC8T 2KFZA 5F9LA 3KHLA 3KUHA 1JXVA 3I56S 2JLEA 1BQNA 4XK8C 4O23A 4RBVA 3MTKA 1EKSA 4WYLA 4X4SA 3I4HX 1IR2A 1RABB 4L3KA 3CJKA 4XO0A 1A9NB 3NEKA 2HQDA 1VIOA 1KQGB 4TLQA 2H48B 3RR7A 3NCPA 3OVAA 2BMBA 2IM0A 2IVYA 4F2SA 4LF2A 2NXNA 1SJ4P 3DLJA 1FRHA 1L5UA 3CJSA 2DO0A 4KHPJ 1B99A 3DLGB 3IBCB 4EYIB 2FHKA 2B5JB 2IVMA 4OZNA 3C8YA 1RTZA 4F3QA 2OGUA 4I56A 3LH2S 2DY1A 4RW4B 1FDDA 2XNRA 4FXDA 1RHKB 1T8EA 5F9NA 3S6EA 1LK5A 5KG7A 3MUTP 2AGPA 1JNRB 3BKTA 4DV2J 1QE1B 2IMOA 2CJ9A 1UWAA 3TYTA 3EWGA 2HQFA 3MEDA 3KHHA 4QOTA 3AD9C 2ROGA 3SMZA 1X9SA 5J2MB 3CJ0A 2UXDJ 4CLPA 2DCUB 4U67Q 2Q1LA 2FJBB 3CCUS 2F1FA 3MCNA 3ZZOA 4ANDA 4QZVB 3FFIB 2HFSA 3PKMA 4RL1A 4OYMA 1JLBA 3HHKA 4QBUA 1FKPA 1VRTA 4CLUA 2ZE2A 2KXHA 4X64J 4NLGA 4YB1P 3M8SA 3PXGa 4ZHRA 4NYPA 3PIPQ 1SUQB 2G0CA 3I96A 2CPXA 2IPOB 1UZHA 1JKHA 2N4CA 2Z57B 2GS8A 3IM9A 3N79A 3M2RB 1RAFB 1RAEB 4UQGA 1KVJA 5KFUA 4FYVB 1VQ9S 4LF6J 3HM9A 2ZITA 2ZH5A 1VQKS 2VKRA 1UCNA 3ISZA 2BV3A 1RHQB 1UEKA 3J7YU 2YKNA 1SL2A 4KC5A 1M5VC 5ETPA 2J0SD 1QLNA 5K9FA 2V68A 3SFGA 2HHHJ 1RGVA 2A6MA 4HACA 4ZPBA 2FLNA 5K8OA 3QGHA 4ZPTR 2FQQB 5GADU 2VG5A 5KFDA 1NK5A 1N88A 4B3TJ 1ZPVA 4Y6IA 2GA7A 2VONA 2I6WA 2Q43A 4ECTA 4LQ3A 1R3NA 1PGZA 2LXIA 4OZ3A 4J37A 3IP0A 3VTIA 2OTLS 2YH0A 4WK3A 2CJYB 5IT4A 5AXLA 1ZPWX 1UEUA 5KFOA 2W01A 3NNCA 4DWIA 1TZ0A 1YRTA 4B3OB 1U0SA 1CC8A 3M6WA 3SDEB 3Q0AA 1VQLS 2XMKA 4Q7AA 1TK5A 1WELA 1EP4A 1TU0B 1LKZA 1T95A 3MMBA 4IYQA 1JJHA 2CPFA 3EJMA 1T0TV 1VQSA 3MFHA 3T6JA 5DRKA 1CLFA 3HVTA 5CHCB 1IKVB 2XMTA 5SUHA 3G8TA 1SC6A 5KT6A 4QU6A 3ELHA 4CLKA 3KLFB 2B4OA 1FX2A 2YVSA 3M2UA 1CJVA 1X9MA 1O6XA 3P5BP 3LP2A 2ROPA 3GLJA 4I6YA 4DV4F 1TKXB 5GAEU 3ENWA 4JV5J 2VQFJ 2ZBPA 2K3KA 1YX2A 2FUG9 3M2VB 1JMTA 1VQ8S 3KMQA 2RHSB 3AQOA 2HFVA 5L1IA 2GO8A 5DLGA 5F8IA 2QV6A 3MAQA 2ZHAA 3QIPA 3MM9B 1VBXA 1MU2B 1LK7A 2RQCA 4ETZA 1X4FA 1F6TA 2IFXA 1T05B 3TEHB 3RW6A 4LBHA 1YJ9S 4PQUA 4ECSA 2WSFC 5B0EA 1FRJA 1RT5B 1PILA 2XYHB 3QQCD 1P9YA 3HDSA 3O2IA 1APSA 3R3TA 1HBUA 1FNOA 1N33J 1Y4ZB 2W2MP 3N01A 2V4JA 4C0OC 1U8WA 5KAKA 3A8IA 4PEOA 2IC3B 1S9GB 1TL1A 2RDDA 2JEJA 5M2PA 4DPUA 4NA3A 1GH8A 2J9DA 2Z2YB 4ID5A 4OV1A 4A8WA 5L1JA 3NWGA 1KVKA 2F5GA 3PCOB 2CQHA 3CJ2A 3E01B 2VG6B 3HHLC 5KFAA 2OSQA 4EI2A 5L1KA 2ZFHA 1BHNA 3OXFA 2NZCA 2E5LF 4IO1A 4OHVA 3GIMA 2B0GA 4EMDA 2RE1A 1WKKA 3DRSA 1I3OB 1FJ7A 3KHRA 3I87A 3B6BA 5D0RA 1Q8BA 2DR7A 4DQSA 3NKYA 2EC2A 2RS8A 1S1TA 2JZ5A 1YJTA 5MLCV 2V50A 1M5OC 2LDIA 3IWNC 4B9UA 3KK2A 4WTYA 4KGMA 3HT0A 1FKOB 5U47A 2HVIA 3HHDA 2HNYA 1D0EA 3SFUA 1XC9A 1OS5A 3OVBA 4FF3A 3DYAA 5CYMB 2M88A 2EBEA 3IFEA 1R7IA 2BE2A 2MZ1A 3PO5A 2ZNZA 2XMJA 5J2NA 2MQOA 4DR1J 1VOMA 4KV8B 4G1PA 2DB1A 5B0CA 1Q82T 4B9TA 1NH8A 4KAIA 3ZZZA 4K4ZA 4IRKA 2Y3YA 3LPYA 1HD1A 1FHTA 2ZWOA 3QLHB 4RNFA 1YRXA 1ZH5A 1CC7A 2BJ1A 1NJXA 4N77A 2EC0A 1SH2A 1W26A 5HMWA 2F9DA 4G1IA 4TQRA 3RG6A 2MJUA 3DRYA 2BE9B 4RUHA 3EDRB 1DQAA 2XZTB 5DDRC 1V3RA 3IG1A 3M7VA 4DV6J 4LRCA 3TX0A 2UXCF 2IVFB 2QGFB 1T9TA 1YLXA 3UDEA 2FJAB 2JL9A 5J1NA 4HT5A 1WACA 2K8GA 4JI0J 2QO3A 3BDPA 4MIAA 3GR0A 4CQ1A 2G2OA 4DZDA 3PR4A 1ZYQA 3AODA 4URGA 5KFXA 4YDXA 3DU6A 2FLPA 2J0QD 2RB7A 1VQPS 3FBFA 4TU8A 2OMLA 4Q8EA 3NGRA 4N41A 4OLOA 1UFWA 3D4JA 2HPUA 2U1AA 2C2KB 3KYLA 5J1EA 3SBMA 4Q43A 1CS4A 4DV1J 1NLKL 2HVZA 1S12A 4P7VA 4MKYA 2UXBF 3T5HA 2X51A 3D0HE 3EXYA 3ETMA 4TXSA 5C24A 2YX1A 4UW2A 3UCZP 2ASYA 2OELA 1T03A 2FVQA 4DS5A 1HARA 1FCAA 2P8IA 3MECA 1D8ZA 2KVIA 2ZHOA 1XNQJ 2NXUA 3PACA 2RQKA 3H2UB 3MM8B 4FF4A 3I55S 4LR8A 4LRFA 4XTTA 1SKUB 2MSSA 4R5PB 1WSRA 5CYQB 2BACA 2HRUA 2ZBCA 3SSSA 3IR6B 3QRPA 1YG0A 1GQEA 4CO1A 4RWWA 3H7HB 2UU9F 4NX9A 2OFGX 1S59A 4MKAA 4JV0A 3RBXA 2Z8QA 3DLEA 2AW0A 2VKZG 3GCWP 2MZTA 4RU9A 4DLGA 2ZVIA 2MKKA 4J9SA 1U1QA 5LSOA 2DITA 3QFWA 3EGWB 3W9IA 1NPRA 4F67A 1PIEA 1PJ7A 4ECXA 1VCTA 2W9AA 1YSJA 4CT9A 3OUYB 4DR3J 4JP8A 1ZTTA 1REVB 2L9WA 2DGXA 2BBEA 2NUUG 3FZBA 2G1DA 2JEFA 2HIYA 4AQYJ 3OLBA 1DTTA 1NJYA 4C98A 2XLKA 4WZQA 3SYZA 5CCMA 2UVWA 3EPIA 4U7UK 4ZVHA 4ED0A 4UOGA 1FXRA 1VC6A 2Z2MA 5DG7A 5C42B 3OSNA 2HGLA 2OD6A 4FN5A 3AHPA 3N6LA 4NRTA 3ILLA 4TNOA 4OHZA 2WONA 5IV4A 3DU5A 4MJKA 2DY9A 1N5YA 1S9EA 1RXOB 1Y7PA 2R7SA 1OSCA 3I0SA 1U48A 3IRXB 1H2UX 4KKOA 4H4MA 2YNGB 3QSIA 3C6UB 1FFGB 5BYSA 4OMFG 4JI3F 4DPWA 4KO0B 2Z0GA 4X65F 4LJMA 3MXHP 3QIDA 3DOLB 2VICA 4IDKB 4AUKA 1KP6A 1R6YA 2Q66A 3RJMB 1CJTA 1OIAA 2JHEA 1KOOA 1HI8A 5IQ6A 5AXMA 3CW2C 1M0SA 5F0UA 3G9CA 1YGYA 4RW6B 1HL6A 5H9EJ 4YB6A 3R5CA 2KI2A 4MKBA 3U1LA 2BQRA 3W5XA 3MM5B 1VHIA 2A18A 2WAQD 1MW7A 2XY6A 4FF1A 1ICEB 1NK7A 1IBMJ 2AD9A 1IKYA 4KBIA 1C0TB 1JLQB 3BGFA 4U7UD 3CCZA 4PR6A 4ETXA 3G96A 2Y1LB 2QL5B 5D0GA 4ZS6A 4YQWA 1TKTA 2F4FA 1CJUB 2V4QA 2MLXA 2Q3PA 1S79A 1VHFA 1WDDA 2DPJA 2CJBA 4JI7F 3GZ7A 2EG1A 5HO4A 4QYZJ 3LP0B 1MNEA 4AD6A 4IR9A 1RTIB 4IH6A 3TUPA 3GV8B 3P4UB 5E33A 4GKKJ 1XR7A 2IJFA 1EQMA 1N5QA 3A8KA 2ZZMA 4H54A 1I94F 1SQEA 4NYZA 2DH7A 3Q8PB 4DU7A 1HBOA 2HAFA 3WC0A 5L1LA 1FDAA 1BWVA 4X4UA 3KG0A 4DDFA 1TUGB 1NK9A 4QR2A 2JFKA 3GE9A 2DEIA 1L3UA 2DR8A 3SQGB 4X4QA 2O1PA 1ROFA 4YUDA 2AJ0A 3BYRA 5K14B 3J7AN 1F9HA 3RBZA 2ZWPA 3PW4A 1QVFR 1FJGJ 4C11A 3R7SB 3DMJA 2PT0A 2ZOGA 3H5SA 1WG5A 4I7FB 4DV7J 3UE2A 3KHGA 2V34A 4A8OA 3MWBA 4RW7B 4NCAA 1RHRB 1IUJA 1NMEB 4RW6A 1TUWA 5C7PA 2CZ9A 1CULB 5EWFA 1Q8LA 3CCQS 4KFBB 3PFEA 2EXUA 2MKSA 3M6VA 1ZETA 1G2EA 5DZ7A 2PI5A 4CH7A 1U6ZA 5KFQA 1Q8IA 1SKRA 1M1HA 3UVJB 2HS0A 2DHHA 2J6UA 1HHSA 3PYGA 3CVKA 2HNDB 4ENOA 5EWEA 2ZHBA 4AXJA 2OMOA 4JI2J 1RT7B 4R8UB 3P8BB 1IVZA 2KVQE 3ILJA 4OJGA 3MMCB 2JC0A 1JLAB 4YFUA 3PEHA 5MAOA 5H9EK 2CQPA 3R7NB 2NREA 1VK8A 3FCHA 2J9CA 3JYTB 4LF7F 3ICLA 1KHWA 3MMJA 2EVZA 1V5IB 4FBUA 2A3JA 4HR2A 4FPIA 2RF2A 3GIRA 3FEXB 1WJ9A 3VV2B 3D7SB 3KLVA 4DXLA 3W8GA 2P9EA 4USJC 2YKOA 2C28A 4CTAA 4V1Ak 3M1VA 1YJVA 1TR0A 1G4CA 2GW8A 5E3AA 2KHDA 2WVDA 3CMES 2G0IA 3PDNA 1NJZA 2UXDF 5GAHI 1W2IA 2VBWA 3QGPA 2K1RA 1WOPA 3GJSB 4F4ZA 3ZNUA 1LWCA 4F4AA 1HMVB 1JLGB 3JSMA 4OLPA 5HMYA 2HBQB 2OPSA 4LSNA 4CNZA 3OL7A 1QUPA 1FD2A 2D3UA 3GV5B 1CULA 3KLIB 5DDOC 4I6AA 1WNEA 4ZPDA 1H73A 2KXNB 1O8BA 1X5SA 2WZ1A 5B0FA 1KLNA 4OYAA 3LAKA 2YNIB 1Y10A 1ZAVA 3CCES 2BQUA 2Z4PA 3W66A 1RQ0A 4AXIA 5L8RC 3CCVS 4ELVA 4RW9B 2KTQA 2D3OR 1R8CA 1DJ0A 2OO4A 2XY5A 1UFKA 1URNA 2W2QP 5DZ6A 5D15A 4DV5F 1KEKA 3K5MA 3UNYA 3LW5C 4OI6A 4ZLLA 2PA3A 4USWA 2NXEA 4CH1A 2DIUA 3NGKA 2FZGB 2W2OP 3OR1A 3PX6A 4AL7A 4C7QA 2FDNA 1AB8A 2ZM6J 1GMWA 4K4YA 4P6QA 1TV6B 5JVHQ 3PFOA 2HFNA 3MR5A 1YBAA 4CIOA 3EVMA 4DUZJ 1CQNA 4HL9A 3M8QB 4U95A 4LR7A 5T41A 2D74B 4QR0A 5KFWA 2HG4A 2W2NP 5J2QB 4AT1B 2HLUA 3U1MA 2IM2A 3H5YA 1VBYA 3MEGB 5L9XA 4HDGA 4HDHA 3TAPA 1TK8A 4B9MA 1R27B 1FA0A 2QMXA 4LQ9A 3P45B 1RBOB 3ENAA 2VOPA 5HVGA 4N5SA 4UZBA 2X3GA 1AROP 3VALA 2K06A 2ZC4A 5IC4B 2HQIA 2FHOB 3MMAA 1HBNA 1VMBA 1OPIA 4CO5A 2M7SA 3ZZPA 1PYSB 3UFCX 2DR9A 2W25A 1QAYA 4WBFA 4NXNJ 4U8VA 2YX7A 2ADBA 2VU5A 1FRKA 4JV5F 3SEOA 3RZAA 4O4GB 1G3OA 1XBWA 4ES2A 2RQ4A 3I4PA 3OFFA 5HI7A 2XSJB 4PG6A 1GFWB 5IWAF 5FIIA 3ZZYA 5G0RB 4MKVA 5EX0A 2PE8A 2OH2A 3KLGB 1HQ2A 1S57A 5BJRA 2XZWA 2XGPA 2XMUA 3KKFA 2ZC3A 5EN1A 4O44A 1RTJA 1UJ6A 4U96A 2W24A 2I5JA 3T1HJ 5CAAA 1L3TA 1XNRF 2DRAA 5KFJA 3J81j 1QSYA 2XLIA 1JIHA 5D3GB 4C9DA 5A8RA 2CQ0A 4UZCA 3W2VA 1R0AB 4DCOB 3FCVA 5C2CA 4I2PB 1F2HA 1N33F 2H5JB 1JXEA 3PHTA 3BN7A 1AYEA 2ATCB 4ZP8A 1NM2A 2FHMA 3TJ8A 2JC1A 3BBFA 1JJ2R 1FJEB 2DPIA 3V6DA 4LMZA 1LWEA 2V2KA 4HYKA 4DL3A 3CD7A 1S6OA 4OI4A 2GHPA 1PBUA 3SSQA 4K2JA 1X8DA 3LF0A 3OJUA 4LSLA 3ONQA 2E1RA 3DDKA 2RHQB 3QJLA 3SCIE 2MSTA 2VV5A 4WTOB 5DGAA 4WU2A 3ZTOA 1HI0P 2EK1A 1RTDB 5ITHA 3HF5A 4OFZA 2ZBQA 1GXLA 3R2CJ 2DXDA 2VH7A 1WC6A 1S6QB 1LNQA 3J81Y 2UZAA 4ZA1A 5J2PB 1MROA 1FRIA 2IRYA 5GAEI 4F4XA 1TMMA 2M8DB 1AA1B 2HBRB 2OP5A 5KG5A 1Y9OA 4BHQA 2Q79A 7AT1B 4LF1A 2XI2A 1RP5A 5LL6d 1HR0J 2BKPA 3RAQA 4N7TA 4UF4A 1VDHA 5KFTA 1C1BA 4X4VA 1UPPA 1ULRA 2X1BA 3MAAA 4GC7A 2ZD1B 5IC6B 4ED3A 3KK1B 2CDRB 3LANA 5ETKA 3DOMB 5HSPA 1RAJA 1QDUB 5KG1A 2CNLB 1Y5LB 3GJTB 2WW8A 3BSNA 3IBFB 2V2ZA 3BDEA 3A8EA 1HIYA 3GTYX 3Q86A 5KFBA 3FDSA 3U1NA 1UPMB 1VK3A 3BR8A 2LEBA 3BJYA 3D67A 4CH0S 3ZXWA 3HVRA 4RBTA 3GFHA 3EE3A 3C15B 2OI2A 5IM0A 5KT4A 1TL4A 3OR2B 4DSFA 1WTFA 3FBEA 1U1NA 2WTFA 4QWCA 3H5XA 3UWTA 3VCDA 2MGZA 4UOCA 4DV6F 2DNRA 3DOKA 2NZ4A 3EVOA 2KYZA 2UP1A 2C2RA 2CNNB 4Y2KA 5DLFA 1SC1B 3J81U 2VPYB 2YKQA 4DPTA 2JJ4D 5E5NA 2OHDA 2K2PA 3CTRA 1I5OB 1HBMA 4NLYA 3C16B 5HJXA 2LKZA 5KT3A 3V6JA 4M63A 3UR0A 3HP6A 5J2PA 2WSCC 3TJ9A 4Y28C 2XEXA 3KJQB 4PRFA 3NMAA 2R3VA 1VS3A 1AFJA 2OPRB 3SCJE 1RT2A 3QRQA 1WOSA 4C6AA 1CVJA 4DFJA 2EI5A 4LFAJ 4CLLA 3Q22A 1WC3A 1DQ8A 5CA5A 1IWGA 2LMIA 2AMCB 1F60B 1MMNA 1P6TA 1NDPA 1RAHB 3C66A 1EZZB 4K4WA 5B08A 3C6TA 4IO9Q 2ZEJA 2F4VJ 2G0JA 5EGYA 4FKXA 3K59A 1XNQF 2B6AA 2X3DA 2UUWA 1E6YA 4ED7A 5EDWA 4PWDA 2R7XA 2E44A 1ZTWA 2IJRA 2HW3A 4I1TA 1BY9A 2VPZB 4KGKA 4K50A 4DG1A 2ZJQQ 5T7LA 3A3NB 4A8XA 2HKEA 5THWA 1TVRA 1C1CA 1KS2A 1TKZA 2MKIA 1HNIB 6AT1B 1SIWB 3S01A 2FVSA 4FNIA 3OL6A 5D8HB 1WI8A 4QR1A 5DDQC 3OSPA 2VODA 1BXNA 1ZS6A 3MR3A 1XMBA 1RWVB 3IBWA 2E1PA 5D6GA 3K2YA 4FYYB 4YY3F 2I9SA 2CQDA 4HT7A 3HJVA 2MQQA 3HK2A 2KZMA 4C8NA 1YVFA 1IJEB 1FFWB 4DR3F 2FHJD 2DHXA 4NXMJ 2EFPA 2MQMA 2PMZD 2HGMA 1NHUA 3LP1A 2RQMA 5GMDA 1I51B 2H9ZA 1UA0A 2XB2D 4F04B 1BMQB 3OXLA 2AEJA 4J9LA 3PW0A 4ZCKA 4HHJA 1XK8A 3G6ES 2XMWA 2J8SA 5CCLA 2XM3A 3D66A 4A8QA 5A8KA 2DYAA 2W8LA 3OJSA 2R7RA 3N6MA 5LMNJ 3IAS9 2DNYA 9RUBA 4C2MA 1DTQA 2AQ4A 1ELOA 4PYAA 5KFNA 2XS5A 4AFFA 3BH7B 2RDJA 2KL8A 2R7OA 1AUSL 5A0YA 4QW8A 1LW0A 3BQ2A 3DLHA 1F3FA 1KTQA 2V8GA 1GK8A 2MPUA 3MM7B 1CJKB 2L3MA 5CD4H 2E9ZA 4DL2A 1OQ6A 1N6QA 2HQ3A 1TL3A 1E6VB 3LO3A 2NYHA 1RA6A 2DHGA 3R5GA 1HNIA 2BJEA 4QWBA 3OLAA 2ABYA 1NPPA 4OIXA 4ZLJA 2ZH9A 1SJRA 1HQUB 1KQKA 3HO1A 3G8QA 3KNGA 1KFDA 1Q53A 4FNHA 4L73A 4PXCA 1MN9A 1H7WA 1LFPA 3KFWX 4EEYA 4ZVTB 1RT1B 4KSEB 5D0EA 5KFSA 2N3LA 3VGUA 2AJ4A 2DT9A 4TY8B 2OPPA 2H51B 1IKWB 3M32A 4ED5A 4UT4A 5FD1A 3O6QA 2J8AA 2XCPA 5EHHA 1RAGB 3L9ZA 1C4AA 5JMNA 4XDCA 5DM7Q 1IBMF 2HHVA 3H5UA 4ED4A 3DLKA 2J5AA 1FVSA 2P6SA 1KLMB 2B9WA 1RDRA 1QTNB 2VOOA 1UWBA 3M30B 1N0UA 4LF4F 3H20A 2DNLA 4JYAF 2XWYA 4FS2A 3NXZA 4A4JA 3I5CA 3T19A 1VLYA 3Q2TC 1NH7A 3D3CJ 1S99A 2J6TA 1BQMA 2ACYA 2DH9A 3NL0A 4GKKF 4NLTA 2HWIA 4WJBA 2I38A 3UN5A 1C0UA 1PJ6A 4RO0A 3K7RA 3V2UC 2GIRA 3HZGA 1SH0A 3POTB 5ETQA 3WQPA 2BW2A 1JK9B 4IH7A 1VISA 4PQAA 1S76D 2YQ1A 1PYOB 3SSRA 2XZDB 1QJHA 3BGRA 2LLZA 1F1BB 2HS3A 1J5OA 3TX8A 4IOAQ 3NG8A 4YP3A 3BR9A 4IG0A 5CXTA 3NBPB 2CIMA 4OYPA 2RRNA 2UXCJ 4GVBB 4Y2AA 1RYRA 1FJGF 2GMHA 2E5HA 3NGDA 1NEEA 3PO4A 2D3ZA 2VF3A 4DR4J 1EJ7L 5LJ5Y 1HYSB 3BO3A 3F41A 4YN3B 3D5MA 4ED1A 2EK6A 4L75A 2MZRA 2IBOA 1XWLA 1PCAA 2YWKA 1N5TA 4KGXB 2C2OB 4NWBA 1N5SA 3NP5A 2UV8A 1VQ5S 3MUMP 1RCOB 2YXLA 3W2WB 3N28A 4PG8A 1N0VC 4USMA 3EGZA 1FERA 2FJDB 1GT8A 5SZTA 3RB3A 2G4BA 2E1AA 4P9SA 3W5YA 1MMLA 1FESA 3D54A 4F8RA 2NYIA 3R27A 4H4KA 2EFNA 1QTMA 2R9LA 2RMLA 3ET6A 3MPVA 5LXYA 4DPYA 1RACB 2RIJA 1GMVA 4NA2A
chains in the Genus database with same CATH topology
5HLFB 4MK8A 1TFYA 3R1HA 5A6WA 3KYLA 1R31A 2MJNA 2B4VA 3DM2A 3HLUA 5J1EA 1S6PA 4PWUA 2QFJA 3FNNA 4QCLA 4M8LA 3PW2A 4RUCA 2R8HA 1G7CB 1U6FA 2W7PA 2AP6A 4Q43A 4GO5X 3BSOA 2R2RA 3OHAA 3SQGA 2HVZA 3JB9k 4BDPA 3J7A1 1S7HA 1LQ9A 5EWGA 1X4HA 2VG7A 4P7VA 4ZOSA 5KFMA 4MKYA 2UXBF 1K0TA 1DLOB 3M2UB 2V94A 3LGNA 2AX1A 5K14A 5ADZA 2PMHA 1FRLA 3T5HA 2X51A 3D0HE 3LP2B 3OFEA 1S77D 1TP7A 3KMSA 4KTQA 3MM6A 4DL7A 2IAJB 2VBXA 4CO4A 3EXYA 4TXSA 3LP1B 5C24A 2YX1A 5G4DA 4ZPCA 3HFKA 4IFVB 4I7FA 2BABA 4UW2A 4EFAC 3KJVA 4X2BA 3UCZP 4M5DB 2C42A 2UUAF 4DV0F 2ASYA 3T6BA 4BC7A 1T03A 2FJVA 3JAMY 2HLTA 2FVQA 4RW7A 1HARA 4DV1F 4DS5A 1FCAA 2YNHB 1KR4A 2UUBF 5KFYA 1B7FA 4ZKAA 3MECA 4DL6A 3GFXA 4WFAQ 2I0XA 2ZH6A 2BVZA 1D8ZA 2KVIA 3AH6A 2ZHOA 1M5PC 3X1LB 2B56A 2MHEA 4NOHA 3D1HA 2NXUA 2ASLA 2FC8A 3PACA 2RQKA 2LA4A 3FRZA 1R8AA 4IQXA 4HKQA 4EGLA 2DGTA 4B08A 2KT3A 3H2UB 3MM8B 3QWPA 4FF4A 3I55S 5A8KB 1YI2S 3T9NA 1IXKA 5E0OA 5DQGA 1WWHA 1S72S 1QM9A 2DNNA 4KFBA 2KFYA 3LWLA 5AE2A 1YIJS 4QQBA 2GJ2A 3CXCR 4AE5A 4ATNA 2KFNA 2AGQA 2MSSA 2GC8A 3CJ3A 4Q2LA 4R5PB 3QIPB 5E41A 2JH3A 2OPQB 1S1XA 1RKIA 1NU4A 5CYQB 5FDLA 3RBEA 2BACA 2HRUA 2W7OA 2IM1A 2DNOA 1J5EF 2ZBCA 4I2QA 3SSSA 3OL8A 2HNZA 1DTQB 4O3QA 5LMUF 4K4TA 2DNZA 2JDJA 3IR6B 1VQ4S 2DCLA 4IG3B 3WBZA 3CJ5A 3IR7B 4ZVFA 2DK2A 2M4MA 3QZ8A 3DLBA 1YG0A 1GQEA 4CO1A 1IBLF 2VC0A 4RWWA 2HNDA 4PQUB 2C2DA 3OV7A 4I64A 5L38A 5JJBA 3P5TL 3BF4A 5A0YB 3TA2A 1LW0B 1SJQA 5B0DA 4NA1A 3CCJS 2UU9F 4DSIA 4NX9A 4WE1A 1Q7YT 1OO0B 4HTIA 1HA1A 1RT7A 2YKMA 4R8UA 4JOUA 1DAXA 2OFGX 3MAHA 3CDEA 6FD1A 3MMCA 3S8SA 4LFBF 3N9UC 1JLAA 4MKAA 4BBYA 3KK3A 1N6QB 2EFVA 4JV0A 1TL3B 3QPIA 4I68A 2Z8QA 2KXFA 5I3UB 4EYHB 3QAEA 3DLEA 1ZZFA 2AW0A 1HBUB 2VKZG 1KQFB 2MZTA 1FEEA 4WFBQ 4RU9A 1CG2A 1SV5B 2P5VA 2V4JB 2IHR1 3JYTA 2ERRA 3NMRA 4DLGA 4ERDA 2DJWA 3O5TB 5KOXA 4MYTA 3NS6A 3BSCA 4Y34A 2MKKA 3GILA 1TL1B 4XIUA 4J9SA 1U1QA 4DMZA 1M5SA 3AJ1A 1JLFA 5LSOA 4V19X 4AYBD 4FBTA 4R0JA 3K8WA 3NNAA 3PJXA 2DITA 3P6YC 4PPDA 4DSEA 3H2LA 4TYBA 2PIIA 3EGWB 1T94A 1YITS 4F67A 4W90B 3TUIC 2LXUA 3CC2S 4ID5B 4RKUC 4JV1A 2O3DA 3GFZA 4ECXA 2W9AA 3TARA 1U6BA 1YSJA 4CT9A 2VPWB 2GQCA 3BB5A 4ZPWR 3OUYB 4L72B 3HHLB 1X5PA 1ZTTA 3DGPA 2CDQA 1SB6A 1REVB 1BGXT 2L9WA 3AB4B 3PRBA 4MIWA 2HRYA 3A1YG 4NZ7A 2XS7A 2QE5A 3M9OB 2MZSA 3IGNA 3OTOF 2K7KA 2GMLA 2LQBA 2Y1IA 2DGXA 4K5SA 2BBEA 2NUUG 2OPPB 3FZBA 3IAM9 2G1DA 4QJVA 4QIGA 4WYWA 1VGYA 3OXGA 4DX8H 3M32B 2JEFA 5K8MA 3TQ1A 1LW2A 2HHXA 4YR2A 1YTYA 2BANB 1NJWA 4OX7A 3OLBA 3RTVA 1FVQA 3D2WA 3V81A 2HWHA 4K5RA 1DTTA 3UI3A 1Y5IB 1RT4B 1NJYA 3ZFVA 1O0PA 4C98A 3B4MA 2CQCA 2XLKA 2CPIA 3DRSB 4WZQA 3T1YF 5HBMA 3SYZA 1DZ5A 5CCMA 3DLKB 2UVWA 4LF8F 2VFRA 3NLCA 3EPIA 3CIMA 4U7UK 4NLUA 4ZVHA 1MWYA 1UVKA 3UPFA 1U1KA 3IGVA 2MDAA 1S1TB 4NYOA 4ED0A 1P9QC 1S1WA 2XS2A 5HMZA 1UWBB 3ISNC 2AJFE 4DPOA 5HP1A 4F50A 1HMVA 1JLGA 4WXWA 1UETA 1FXRA 5L39A 3KK2B 4AQYF 3HHNB 1VC6A 2Z2MA 3DHWC 2YWGA 5DG7A 2EKYA 5KG0A 5C42B 1MMDA 4JI4F 3OSNA 3M9NB 1RTHA 3ZC4A 2HGLA 2OD6A 2CQ3A 2HZCA 4OJ3A 2CPZA 2HNYB 4DFMA 4FN5A 1A7GE 2JLFA 3AHPA 3N6LA 4EU0A 4NRTA 4ZP6A 4DS4A 3RAXA 3DNCA 4IOBA 1BQMB 4NMLA 1DQ9A 4TNOA 4OHZA 2WONA 3DYAB 1NJIT 4OI0A 1VQ6S 2QSWA 3KLIA 2NR0A 3DU5A 1U09A 2VPXB 4MJKA 1N5YA 2LCWA 5CZXA 3TRGA 1S9EA 2C3OA 1Y7PA 2R7SA 1OSCA 1D9AA 3I0SA 2ZH2A 4KHRA 4ECUA 3SI8A 2A1BA 2OFHX 1FD8A 1U48A 4ITSA 1N56A 2OJ3A 3IRXB 1H2UX 4KKOA 2M52A 4D3HA 2BE2B 5T14A 2HHQA 4H4MA 1U2FA 2YNGB 3KLEA 5J2NB 2E7WA 1C0UB 3C6UB 2R4FA 2DHSA 2YNIA 2CZVC 5BYSA 3KG1A 4OMFG 4FP9A 4DQIA 2PI4A 4CO2A 1KQSR 4JI3F 2JSXA 4ZCIA 2MXYA 2N7CA 1U45A 2L48A 2FTRA 4KO0B 3P49B 1RYSA 4WFXA 4DL4A 2Z0GA 2QA4S 5B0GA 5KFZA 4RW9A 3MHYA 4X65F 4LJMA 2G13A 3DCAA 3QIDA 3MXHP 3DOLB 4LT6A 4IDKB 4AUKA 2CQGA 3S7RA 1R6YA 2Q66A 2XY7A 3BGRB 3VAKA 2V9KA 2J7UA 1H38A 3CIZA 3FQKA 1OIAA 2ZZNA 2JVOA 3TA0A 1Y00A 3PEJA 5JUMA 1WF1A 3J7YI 1P8GA 1J5OB 2IRXA 2JHEA 3HI9A 1I6JA 1KOOA 5I4MA 1HI8A 4IG0B 5IQ6A 1JLEB 5AXMA 1PC5A 2Y1JA 2DR5A 4NXNF 3IWXA 1M0SA 1S9FA 2OTJS 1LFWA 2ZVSA 3ZZ0A 1KN6A 2DNHA 5F0UA 1H2TZ 3SV4A 3G9CA 1YGYA 2Y0SD 4RW6B 2W9CB 5J1PA 4JV2A 1FNXH 1HL6A 5H9EJ 3RRGA 1VIXA 4YB6A 3R5CA 2XMMA 4HTJA 3R5BA 4URSA 4PG5A 1YRUA 3ISND 1LXJA 1WEZA 2UV8G 3DRPB 4YB5A 2DHAA 2C3PA 2KI2A 1OQ3A 3LAMA 4LVNP 3W7BA 2C22A 2I2YA 5KFEA 2YWHA 2U2FA 3I31A 4MKBA 4RLEA 3U1LA 3G8SA 2BQRA 5GADI 1D1UA 2LXFA 3MM5B 5C25A 2A18A 2WAQD 3FEYB 3AB2B 1MW7A 1WHYA 3ITHB 3CPWR 1WHVA 2V8HA 3GFYA 2XY6A 4FF1A 4ZCMA 3IG1B 4BC9A 1HFEL 1NK7A 4ECZA 4QU7A 4RWXA 2AD9A 3NS5A 1IKYA 4OI1A 3PV8A 3E8OA 1C2PA 4KBIA 1C0TB 1ZAXA 1K8AT 4UY8T 3CDWA 1JLQB 3BGFA 1HW8A 3OBIA 2EBGA 3CCZA 4C8OA 1BLUA 3O8WA 4PR6A 4ETXA 3G96A 5E3QA 4JI5F 4FXVA 4ZS6A 4YQWA 3BM7A 1TV6A 1TKTA 2JLGA 1S10A 4DN9A 2QIFA 2JOQA 3GIJA 2V4QA 3QWUA 3B82A 1PC4A 2BJDA 3FMWA 2Q3PA 3MPYA 4WFYA 1S79A