2UU9F

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gug-codon in the a-site and paromomycin.
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RRNA
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
total genus 23
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2uu9F00
4JI8F 4YHHF 4X62F 2UXBF 4LF8F 2UUBF 2J5AA 5LMUF 4OX9F 4LFBF 2VQFF 1N36F 4X66F 4B3TF 4JI1F 2UXCF 3OTOF 4AQYF 5AJ3F 2F4VF 4DR6F 4B3SF 4LFAF 2KJVA 3R3TA 2UUAF 4JI5F 4X65F 4DR1F 2VQEF 4DR3F 4LF6F 4DR4F 4NXMF 4LFCF 2KJWA 4DV4F 4JI6F 1QJHA 1HNZF 5IWAF 2E5LF 1N33F 1FKAF 1XMOF 1HNWF 1J5EF 2RJZA 1IJEB 4JI4F 1F60B 1CQNA 1LOUA 4JV5F 2HHHF 4KHPF 4GKKF 1GH8A 4JI3F 2BVZA 4DUZF 4DR7F 4DV2F 4DV1F 2UUCF 4JYAF 2YY3A 1XNRF 1CQMA 1I94F 1IBLF 4DV0F 2B7CB 4DV3F 1N32F 4K0KF 1FJGF 1VMBA 1RISA 4JI7F 4LF7F 1IJFB 5BR8F 2BXJA 1HR0F 4B3MF 4DR2F 4LF5F 4JI2F 4DV5F 4GKJF 1G1XA 1IBKF 2UXDF 4LF4F 4DV6F 4YY3F 3T1HF 2ZM6F 3ZZPA 3T1YF 4LF9F 1XMQF 4B3RF 1HNXF 1G7CB 4JI0F 4X64F 4DV7F 1IBMF 4NXNF 1XNQF 4DR5F 4DUYF 1B64A 5LMNF 1N34F 2UU9F 2B7BB
chains in the Genus database with same CATH superfamily
5FLXY 2JWNA 4NOHA 3RW7A 1KD1T 2D9PA 5A6WA 2J9DE 2RDJA 2AEJA 3BSOA 3CDBA 2I9SA 1R8BA 1SC1B 2IM0A 1HQEB 2YWWA 2ZH5A 3ZZTA 2HQDA 1SL0A 4W92B 2DNMA 1UPMB 1Q82T 2APOA 4RNOA 3IRXA 5B0FA 1NSKL 3NCQA 4LBPA 2NS1B 4ICLB 2J6UA 2KVIA 5B0BA 1F9HA 4OQJA 4HR2A 2ZWOA 4K4VA 3MM8A 3TAPA 1T8EA 3D7SB 2KXFA 2MKYA 1FXLA 2DIUA 2AEMA 5HANA 1NDCA 4FKXA 1N6QA 2GV1A 4EO6A 1M5SA 5CQGA 2YH0A 4NLVA 4TLQA 4WKYA 3TEHB 2OPPB 2ZC3A 3QGGA 1PIEA 2V8GA 4DU7A 3GG0A 4L6V3 2KN4A 2VG6A 3MEDA 2BXJA 1MMDA 5F3TA 3CJ5A 1S1XB 1WELA 5KFFA 3MEEB 1S12A 3DU5A 4YB6A 3KDNA 2WSFC 3D1OA 1IBMF 4ZVHA 2RDIA 3LPEA 4EFAC 4K50A 1LWEB 1U7LA 1WHXA 3FQLA 2B51A 3CF5Q 5IWAJ 5J1EA 3AOBA 5BYSA 1FEEA 2QN6B 5KFEA 1QSYA 3RTVA 1MG7A 4AQYJ 3QLHA 1UVIA 3H8YA 2B5JA 4Z37A 4ZMMA 1OY9A 4J9SA 3FMWA 2ASDA 3JXOA 1SV5B 1RAEB 1MWQA 4OMFG 4PQAA 4PZVA 2YNIA 2BM1A 3D67A 2RVJA 2F4FA 2H9ZA 3BSAA 5KT7A 3GSDA 3OFGA 1S1VA 3AA8A 2BKPA 4LT6A 2IRUA 2CPFA 2N3LA 3V6DA 1XIQA 2HFSA 4F3QA 2DH8A 5H1SV 4DL0C 2YX4A 5DRKA 3TX8A 1H38A 3NAHA 1ZAXA 3HFKA 2KHDA 3FQKA 4JOUA 2MLXA 4C8OA 3H2VE 5K9FA 3EZOA 5JUMA 2XWYA 1QLNA 3HHNB 4PG8A 2I6WA 2RQKA 2O67A 2NYIA 2G2ZA 1Y0HA 1NZ8A 1S4FA 2LEPA 3HHKA 4UOCA 1FE0A 3FK4A 4LF8F 3MUMP 3NMRA 1DBDA 1HNIA 3N6LA 1ZTTA 4U7UK 4DFPA 1RT1A 4CI0B 1KQFB 4QIWD 1HW8A 1UFKA 1REGX 5AJ3F 4WE1B 4CM2A 5AXLA 3SSRA 1UEVA 2E9RX 1ZA2B 2PMZD 2XSJB 1CS4B 4GVBB 3ZZOA 4L75A 1RT4B 3B8HA 3GWCA 5D15A 4A8MP 1AZSA 3GJSB 2HHSA 4QJVA 4BWMA 1VRUA 2HLTA 3I87A 4ED8A 5B08A 2QL9B 2E7WA 2Y0BB 2VG5A 4QCLA 4KIAA 4ECYA 1RAGB 4NI2B 1TV6B 3PYFA 2MHNA 3BQ0A 4QW8A 2VDHA 3IBCB 3NEKA 2FY8A 2NSBA 5IC4B 3UD5A 1C4AA 1CJVB 4HVZA 1PYSB 1AUDA 4ZJLA 4UZCA 3KK1A 1NBEB 2DCUB 3QZ8A 2VFTA 3BH6B 4FPRA 1HQ2A 2C2EA 1YBAA 3S8SA 5ADZA 1M1GA 2DK2A 4IFVA 2ILZA 1TL3B 3NGUA 5KFTA 1WC5A 4LF6F 1FD2A 2CRLA 1RK8A 3ENAA 2E5LF 1RACB 1FKAF 4HL9A 1G6BA 4TVAB 4EWTA 3I4HX 1RWWB 4X4TA 2Y8YA 2V5HG 5CCMA 3VF0B 1HBMB 3MD3A 3DLKA 4XO0A 2R7QA 4PAAA 2XI3A 2AEFA 3KUHA 1YK9A 1CPZA 1KP6A 3JSRA 2GVDB 4ANEA 2DIVA 5HROB 2KKHA 3OR2B 4JI8J 4N8NA 3BYPA 4UW2A 3DOLA 4YMEA 1U09A 3CJSA 4WBFA 4I6YA 4DZ6A 2PFDA 3P6YC 3W2WB 4Y28C 3Q22A 3JSYA 4TU9A 5KFKA 2BKOA 3A8EA 4M5IA 2UU9J 1WDDA 4HHHA 2B7BB 2JNJA 1UFWA 2NREA 1XBWA 1VK8A 1NLKL 3M6UA 3D54A 4YB1P 2XO7A 2XLKA 2XMMA 1HNVA 1BE4A 1R0AB 4ECZA 3UCZP 2YKQA 1NSQA 2DVIA 1X4AA 3TVYA 3CO0P 2QJ3A 5KG0A 2HYIB 2PEHA 4DR3J 3LOUA 2J0SD 3AB4B 4O4GB 6AT1B 1VRTB 3GR1A 2V4JA 3HHDA 4HT5A 1JJHA 2JLFA 1S7HA 2FIUA 2KZZA 1IJEB 1SB6A 1M5HA 4Y0FA 3C15A 2UVUA 4ECVA 3NCPA 1KONA 4BC9A 1XMQJ 2PA8D 5ETLA 3I55S 3NGDA 3M4XA 1HQEA 3EPGA 4JV2A 4OHYA 3O3LA 2L9WA 1I3OB 2E44A 3KK2B 3D2WA 2GZOA 3C16A 1AUSL 4M1KA 4ZLJA 4CLKA 4RR5A 1VQOS 2BDPA 2AD9A 5ETPA 1VS3A 4LF4F 1OO0B 4BCAA 4DN0A 2BJ8A 3HHEA 4Y3CA 1R8HA 2HNZB 2Y1LB 4KR0B 3JQJA 3LP0A 5JMNA 2PI5A 2VQFF 3H4DA 1SUQB 1DURA 1TP7A 3OT9A 3KHGA 2YQ0A 3VAGA 1JLCA 2W9CA 4ECUA 4RX6A 4H54A 2Z56B 2EKNA 4RBVA 2IA0A 2DRBA 4DV5J 2FB0A 2NZCA 2HIYA 2B8PA 4FNIA 4NA1A 2HNYB 4QU6A 3HKWA 2JVRA 3PW4A 3AD7C 2BABA 4DXLA 1JLEB 5KFUA 1UVLA 4LF7F 3KG0A 2BOAA 2M0GB 4KKOA 1VCTA 2UXDF 2MEWA 1U49A 5L9XA 2QTWA 5K8NA 2W8LA 4J9RA 3PJ9A 4DR4J 2E5IA 4ECQA 1T3NA 3KLIA 2H5IB 2J9EA 2DO4A 3BR8A 3AB2B 1S48A 1Y5LB 4OZ5A 4V1Ak 2JLGA 1REVA 3KHLA 5GMKa 1WG4A 5A76A 4WFXA 5D78A 1UW4A 3EYZA 2F3JA 1FT8A 3V5RA 1WOOA 4N56A 4ZVEA 3PJXA 1LQ9A 3JSMB 1HQUB 5IM0A 4PQUA 3HD1A 3M6XA 4U8YA 2QO3A 4MMOA 5A8KA 4WE1A 1WKLA 4OJ1A 3BR9A 3M32A 4JI7J 3E51A 3IS9B 1LW0A 1WG1A 1RT4A 2OFHX 1RABB 2YKNB 2UZAA 2J7KA 3QJJA 4U9RA 2GGPA 3N5BA 3V4IA 2UVVA 2V9KA 3UDVA 3TI0A 4DX8H 3PFOA 5K14B 4DS5A 3I96A 2Y9HA 1NPRA 1TR0A 4JI1J 2DNPA 1FKPA 4NI2A 1X4CA 2DGOA 2GJ2A 2UXCF 3PW2A 1R8CA 4GC7A 1HBOB 1HLWA 4IRCA 2G0CA 3N4WA 3M8QB 1T03A 3HX9A 2ZJRQ 1NM2A 3DNCA 2HQIA 7FD1A 2LQ8A 3S7RA 4HDGA 3RJMB 3RR7A 2DHHA 5F8LA 1EX8A 3W3SA 2OFGX 3HSZA 3QWPA 3A3NB 2HVIA 3CXCR 2V2VA 4Q2MA 1HI1A 2VC1A 4C6AA 3CWJA 2W2MP 1T11A 4TY8A 3MAQA 1RU1A 4IRKA 3NGRA 2YQ3A 3VAFA 4NZ7A 4TQRA 1VR6A 2IAJB 2GX8A 1N8RT 3TX0A 2UXBF 2MJNA 4A8XA 2ZBPA 2AP6A 4RW9A 5EX3A 3BSNA 4TNOA 2O3DA 3IG1A 2AGOA 3U1NA 1UWBA 2DNRA 5IS2A 2YX1A 2WBRA 4M5JA 1S49A 4LFCJ 2XM3A 3U1LA 2E1RA 2D9OA 4FYXB 2KZMA 4PYDA 4Z7CA 5IV3A 4TLRA 3VZHA 1MMNA 4Q43A 1F1BB 1SCJB 4LSNB 2AGPA 4DV2J 3CNQP 4HH1A 1R0AA 1NPKA 3ITHA 4C8MA 4F26A 4QU7A 2F65A 3GFHA 3DM2B 4AXIA 4DSEA 1X9WA 1KRPA 3QFHA 2NLWA 1IBKF 1B0TA 2ZM6F 4C8LA 2LEBA 4E98A 1S9GB 1XNQJ 1VRQC 2MKCA 3FFIB 4NMLA 1MLAA 3BKTA 2BQ3A 4X62F 1TZ0A 3CD0A 3I4PA 1Y5NB 2IDLA 1UPPA 1LFWA 3DYAB 1G2EA 1VDHA 2CJQA 2HQCA 3KKFA 1HD1A 2RRBA 2DHSA 3BH7B 3KG1A 2KM8B 2ZZNA 3B6BA 1VQ7S 3QBCA 3F73A 2J0QD 4A8SA 4XPCA 3GJQB 2CQ2A 2XCAA 2HVEA 3FEZA 2U2FA 4ED0A 2KB2A 4U96A 1RHUB 2EI5A 4MH8A 1RT2B 3WDOA 4KPCA 3ENQA 1B70B 4I68A 1BD6A 1KWMA 1RAOA 1H7XA 4OZ3A 1DFDA 2IVYA 2DXEA 3M8WA 1SUQA 3D6MB 5JVHQ 1Q8KA 2AJ0A 3LO3A 2QSWA 1N32F 4P2MA 4C11A 1DZ5A 2WCXA 1D09B 2ADBA 3CIZA 1RHRB 1SC4B 5KFMA 2NCKL 4PWWA 2P6SA 3TA0A 1AA1B 3SV4A 2FGCA 5IXUA 1P6TA 2MKJA 2OPSA 2G1HA 3V2UC 4ED3A 5GADI 4J9KA 1JLGB 1TL1A 4LFBJ 1S5ZA 2M8DB 4DN9A 5IT4A 2E9ZA 4IG0A 2KRBA 2CPZA 1JLEA 1NK5A 1VIOA 3DOKB 2CQIA 4NXMF 4K59A 1H74A 1QE1B 4MFBB 4USUA 1S0NA 4FS2A 2ZHAA 2HGLA 2XG8A 1HWKA 1YRTA 3ZNJ1 1Q7LB 3NS5A 1WUUA 1KNZA 2R3VA 3IN5A 2VA2A 4R25A 3SI8A 4JYAF 3CIMA 4ZPDA 4NLYA 4QPXA 2CJBA 2JEIA 2GIRA 3R2DJ 1QAIA 2ZKUA 2R8JA 5JXSA 1RT5B 4C0OC 3GONA 1C1CB 5D3GB 2B6AA 4WWSA 4XDCA 5KFJA 1S9EA 2RKIB 1IJFB 2XHWA 1TKXA 2D74B 4W98A 4H4KA 4JI0J 4X64F 1KLNA 1JLQB 3BGOP 1PJ5A 1U1LA 5LJ5Y 2F9DA 2W2NP 1T9YA 4DPUA 3D68A 3FBBA 1Z2ZA 3L95X 1VC0A 3JSMA 1Q95G 5BYQA 1N52B 3SZ2A 3KLHB 3M2UA 4URGA 3T6JA 3QRPA 1Y7PA 2MQMA 4MYUA 1T05B 4LR9A 4UZBA 3CC2S 4I64A 1RBOB 5KFGA 2IJFA 3PACA 1X60A 1IBCB 3CCZA 2WHOA 5K8PA 2GVZB 3PJWA 4U7UD 3QIPA 2L08A 4OHZA 1CEZA 3JQMA 5C24A 1Y3KA 5K14A 4JV1A 3OR1B 4YFUA 1IBLJ 3SQOP 1RHMB 2XZTB 1SL1A 3IR6B 4O3SA 2CJKA 2QA2A 3AY0A 2QL7B 3IAS9 2E5GA 1X5PA 4CLPA 2D3UA 5E7OB 1CC8A 4XAKA 4EBDA 3MEGB 3MPDA 2H54B 4A8QA 1SBRA 1RA6A 2XMKA 3MM9A 4DL5A 3P3DA 3W5YA 2AU0A 4G3IA 1U0HB 2WONB 2X3GA 4LRDA 4L72B 3OFHA 4A46A 3WIVA 4OJHA 2Q3PA 2VH7A 1BQNA 1T9XA 2DKOB 4GC6A 5AXMA 5L1IA 1NMEB 1E6VA 1S59A 1H2TZ 4KFBB 3L4BC 3JAMU 1HHSA 2YKPA 1FRIA 4J9NA 3CPWR 2VFSA 1VBZA 2YNFA 4LRAA 1CJTA 5CYJA 3QQCD 3OL9A 1RHJB 4JP8A 3D0HE 3IC1A 2OKQA 5HMYA 1S0OA 4O3QA 1JJCB 2GMJA 3OVSA 3CCTA 3VGTA 1J5OB 2CPYA 5T41A 3GSIA 1EETA 4LSNA 4YB5A 4IYQA 2C2MB 3G9CA 1DTTB 1K44A 4V19J 4ZVRB 3FZ2A 4OHXA 1JKHA 4ILLA 1S10A 4G6VB 3NBPB 1R0CB 2M88A 3TUZC 2NPFA 2V2QA 1PC4A 1GQEA 1M90T 3TO8A 1PYTA 4U67Q 4DFJA 2YTCA 3A1YG 5CH7B 3GR0A 3IWNC 1VQ5S 1K0TA 4CYUA 1RB0A 4D3GA 1U6ZA 5FD1A 3DYAA 1FDAA 2CDRB 2MQQA 1FESA 3EE3A 1KOOA 4DF8A 4UQGA 5J2QB 2DNOA 3IGVA 4DU8A 2OH2A 1SXLA 4HT7A 3UR0A 1VISA 4FXDA 1U1KA 3QO9A 4EEYA 1DARA 1RT2A 3Q8QB 1URNA 4HHUA 3R1HA 2BQRA 2HHUA 2FLNA 3AODA 1GEHA 1S6UA 4RLEA 3VAKA 2KH9A 4WF9Q 3CJKB 1LK5A 2HWIA 3OQ2A 1ITPA 5J2NA 1WI8A 4B3SJ 2PN6A 5HSPA 4MAKA 3KLEA 3FBCA 5DG8A 2EBEA 2HFNA 5HLFB 3LF0A 2NXCA 3QAUA 4RW4A 1FFSB 4X4PA 3ZTOA 5E5NA 3POTB 2MY7A 5KT2A 3T5LA 4ZIVA 3MMBA 3PO4A 3W9IA 4DQIA 5AE2A 4I67A 5IT9U 4YR0A 4DV1F 4OJGA 4LF4J 1TUVA 2VHGA 4AT1B 4X4VA 4URQU 2G13A 3UDLA 1Q8LA 1VJQA 2OIHA 3TA2A 4K4SA 3A13A 5HK4A 1JIHA 3H25A 1D8YA 1A0OB 2XS5A 3CCLS 4LF5J 1S6PA 2WVEA 2J9CA 2R2UA 2VQFJ 3ENWA 3GV7B 4ER8A 1Y00A 1IKYB 3LP2A 2XS2A 1ZPVA 1TMJA 2F8EX 2XYPB 3MCNA 4ALZA 3FMBA 3ISNC 2VV5A 1ZZFA 2YQ1A 3CD5A 2AHOB 2ZJQQ 1MU2B 4X4SA 1C1CA 5D3GA 1A6LA 4ZVGA 2EKYA 2RKIA 3D3CJ 4TYAA 4P72A 3J7YU 2QZ8A 4HEA9 1FWLA 3UD4P 3KNAA 3EVMA 4Y2AA 1QTNB 2HRUA 4QYZK 1ZM9A 4NA3A 2CJ9A 4MT1A 1S7IA 3UN3A 3KHHA 2QE5A 2UXDJ 5M2RA 1Y11A 4TY9A 1SJ3P 4WXOA 5JJBA 2X51A 3KJVB 3MHYA 3TEGA 3TP2A 2BBEA 2BW7A 2DGXA 2RD5C 4FVCA 1K47A 1YJNS 3CDEA 3O6QA 1RLDA 2B56A 5D4PA 1V3RA 1M1KT 1B64A 3EZ5A 2VKZG 3SCKE 3G6VA 1MSWD 2UUBF 3D4JA 2DNGA 4NYZA 1FWPA 4CQ1A 3THTA 2DNLA 3NL0A 1YBUA 4OZNA 2FGOA 3CMAS 4LF1A 4NL5A 1T9TA 5KFDA 4DV4J 4DOZA 3LW5C 1T9UA 1NK4A 4AUKA 3KLVA 1PYOB 2JL9A 3ULHA 2IY5B 2HHHF 4HI2A 4K5SA 2VOPA 1IKVB 4K4XA 2WVBA 1RP5A 2V8DA 2FHJD 3TZYA 4MK8A 2DPIA 1RTZA 3QAEA 4ED1A 4F25A 3FJ2A 3X1LB 1IXKA 2MSSA 5A8RB 4YY3F 4YN3B 1UAWA 4LUBA 5HJYA 3OUYB 3DDNA 1G7CB 1SPBP 2QA4G 2UXCJ 3C6UA 3NWGA 3BGUA 1RTDA 3E3XA 3J7A1 3ETMA 1O6XA 1ICEB 2NSCA 2HSEB 3VGSA 1RWXB 3M8YA 1WF1A 2IIHA 2QV6A 1FDBA 2ADCA 3BPDA 1U1RA 1OSDA 2QMUB 2G0JA 3TUPA 1YZ6A 2XB2D 4DSFA 1SJFA 2OHDA 2WOMB 1L3SA 2C28A 4H4MB 1B0PA 5ETTA 5FIIA 2MPUA 2K8GA 4QR0A 3TJ9A 2NR0A 2BM0A 1J5OA 4IUFA 4KH1B 2LDYA 5KFOA 4ZPVR 1GMUA 5L39A 1YJVA 2DBBA 2W01A 5I3UB 2X7IA 3MFHA 5I42A 1LXNA 3PVXA 1RSCA 3VWSA 3RU0A 4J9QA 4DHVA 2UXBJ 5HI7A 5EDWA 1WC0A 2LXFA 1NSAA 3T9NA 1PILA 3K58A 3OJSA 2NXNA 2C2DA 2MZ1A 2AJQA 4ZP6A 4A8FA 1HBNB 1C0UA 1XERA 1MN7A 3QRQA 4LQ9A 4YEAA 2QG9B 4YHHF 3H5YA 3I0SB 5CABA 4HKQA 2JX2A 2RQCA 3W2VB 4IH6A 4X4UA 1JLBA 2LU1A 1K8AT 4S0MA 1IQTA 2JOQA 3CCRS 1AFIA 3HHLB 2CVIA 2LU2A 3C46A 4AQYF 1PBAA 4F4XA 5G0RA 3BGLA 1JLFB 5F9NA 1OWXA 5FDLB 4QBUA 4WYWA 1FXDA 3FC9A 2RJZA 5E3RA 4ILRA 3PEHA 2FHKA 4G1QB 2DXDA 1HYSA 4K5RA 3AT1B 3O2IA 3OVAA 2LKZA 1CG2A 4MKYA 1CQMA 5IOLA 1OSCA 3UCGA 2BQUA 2DR6A 2ZH4A 5MAOA 3QJLA 1WHVA 3P5BP 4OX7A 3AAWB 5E3QA 1UA0A 1WTFA 1TL5A 2LFVA 2W4PA 1EQ0A 3CE8A 4OX6A 4LF9F 1T7PA 1AROP 4J9PA 3S01A 3R5GA 2XYHB 3BS9A 4EYHB 4DL3A 2EG2A 3K57A 4OI6A 1U1OA 2Y8WA 5DDOC 4OX9F 1HA1A 4TN2A 4N76A 4K4YA 2CPJA 3ZNUA 2JEJA 3OTOJ 4O4RA 2HWHA 4O3OA 2AX0A 5KFYA 2BEFA 4FXWA 1IKYA 1XMOF 4ZN3A 1JXVA 2YKMB 3ZFVA 3IAM9 1N32J 4IKAA 3RBEA 1AXQA 3I5CA 4DL2A 2PFFB 2Z30B 4C0BA 2N7YA 3MD1A 4K2JA 2LDIA 3H5SA 1FKOB 1UVNA 4PCQA 4I6AA 1RCOB 1HI0P 1XJWB 5GAHI 4I2QB 3CCUS 2YXLA 2E1AA 4RW7B 3UVJB 9ATCB 2JFKA 4LIWA 4ZK7M 4LBIA 2P2CB 5ITHA 3BQ1A 3H59A 3G6XA 1RWKB 1FVSA 1Q4RA 2HFOA 2I38A 3I5AA 2BJ9A 1KTVA 2VJUA 3U7JA 2LYVA 1U2CA 3L3CA 2QSFA 4RO0A 2XCPA 1VJWA 4IG3A 4OI0A 4X65F 1T02A 4JYAJ 2HW3A 5D77A 3W62A 3ET6B 3B4DA 2EPIA 2MXYA 3MDFA 2KYXA 1HI8A 1N54B 1OYDA 1QD1A 2HHPA 2XMAA 3KMQA 1S97A 4R8UB 3ZTRA 5EX0A 1RUSA 2ZH1A 1N5TA 2OJ3A 3NAIA 3MM6B 1WEZA 2HS0A 4ZPAA 4X64J 4DDFA 1ELOA 3PNIA 3QGHA 4I1TA 4DV0F 2VB6A 4LRFA 3DLGB 1HBUB 4KO0A 4WCEQ 4BC7A 2RRNA 2P9CA 2YNGA 4C48A 4WIIA 4ECXA 2PGCA 3NGKA 4NASA 3TR5A 3ZZPA 1FK9B 2R8GA 2DNZA 2GQQA 7FDRA 1RT3B 2UU9F 4ELTA 3L7PA 1H2VZ 3ZZ0A 2E1MC 3Q86A 2VD3A 3MECB 4WPAA 5E0OA 3QZ7A 4EU0A 1IKVA 2PIIA 3IA0A 4RKUC 3PHTA 1Q53A 3HO1A 2DPJA 2ZH3A 2Y1IA 3WC2A 5A0YB 1KDNA 3PX6A 2J9DA 1S1TB 3OL7A 2W2PP 2HGMA 4DR3F 2AZ1A 1RI7A 3PV8A 2R7VA 3OUYA 2MDAA 4NEZA 2JZ5A 1VOMA 1F60B 3JTPA 1NDKA 2XGPA 2P6TA 3KUGA 4B08A 1RTIB 4IR1A 4NLDA 2R8HA 3SBMA 1TUGB 1P9YA 4NRTA 4OLOA 5CZVA 1TKZA 3Q8PB 4H4MA 2VC0A 2ZC4A 4ID8A 4IQMA 2MZJA 1PCAA 3I5BA 4DUYJ 4RNMA 1HPZB 3LPYA 5C7PA 5KG5A 3ILLA 2DH9A 4IDKB 3RBZA 2H51B 2XZDB 2J6SA 4CH0S 5J2MA 2ZE2A 2HWTA 2UUWA 2BJ3A 3GJTB 3GLJA 3PHEA 3RRGA 2B3TB 4I2PA 3GYXB 1RGVA 1VLOA 3FGVA 2Q6CA 4FF2A 4LF2A 1RBAA 3G8SA 3HSJA 2UV8G 2DEJA 4JI3J 3IRXB 4DUZJ 1JLAB 3G8TA 2DGWA 3Q8VA 2R7WA 3M9OB 1HD0A 4OYMA 3HJFA 3DCAA 1YSJA 5AT1B 4IRDA 4FXVA 4ANCA 2FVQA 3DI6B 1X9MA 2ZITA 3MR2A 3HCXA 1JLFA 1DTQB 4F0MA 1FJEB 2HPUA 3BBFA 1KOHA 2EG1A 4RU9A 2VG7A 4DR5F 3OLBA 2GQCA 1YQHA 1K1SA 3KYLA 2ROEA 2VG6B 3MEDB 1NKBA 1KFSA 1MNEA 1RJJA 1VK3A 2JC1A 2W7OA 1FRMA 2V0NA 5H9FK 2V8PA 2ALYB 2J76E 3AJDA 4X4OA 3NS7B 5K8MA 4DR1F 5B0EA 2MQLA 5J1EB 1HNZF 4R0EA 2ROGA 3TW0A 3RUBL 1FDDA 3QT5A 3QLHB 2GIFA 4PPDA 1NPPA 2B5JB 2FPHX 1IR0A 3UO0A 3I6PA 4U6PA 3TZZA 4P71A 1GK8A 2YNIB 3DFEA 1N56A 4AD6A 4QZVB 2EXUA 4MIWA 3U27A 4IFYA 1B3TA 3N6NA 4Q2LA 1VQ8S 4ZCKA 3DHXA 5CXTA 4JI7F 5HAOA 1S1VB 3LA0A 1TL7B 4ZPWR 3VAJA 1KTQA 3V6DB 1YITS 4KQZA 4WZQA 1LEOA 1XR7A 4NXNF 5BXIA 5CD4A 4NLRA 2HBYB 2IYGA 4UUWA 1UJ5A 1M0SA 4OJ3A 3VR1A 2LQBA 4B3OA 1VYAA 2N4DA 2RMLA 3KDOA 2C3MA 2RF2A 5A6PA 3K59A 4JI1F 5IT9Y 2F4VF 4ZVSB 1FKOA 2RE1A 3ONQA 1U6FA 4LVNP 2EFOA 4DV1J 2VUGA 4C98A 4PXBA 2IM3A 1HNIB 2JSXA 3FDSA 1Q81T 4I2QA 2IFXA 2R7TA 1RT1B 1ZETA 2CZVC 4CNYA 3A3PB 3D6TB 5H9FJ 1L3VA 2OTLS 2F9JA 3Q89A 3H4BA 1AZSB 3KJQB 2RUSA 2M5YA 1MMLA 3RAMA 4ID5A 2XWXA 1R0BG 2XMTA 2HG4A 1YDLA 2VG5B 1N5SA 3IM9A 4XK8C 3D66A 3RRKA 4R8UA 2BA9A 3MMAA 2H65B 4KC5A 2JEFA 4K4UA 2E66A 4QIEA 2R42A 1F5CA 4P7VA 2AYBA 1HBUA 1O51A 3KK1B 2J7WA 4DWIA 4LFCF 5KOXA 1D9FA 1FA0A 5DGBA 2ZKTA 2IMWP 1EAYC 4PXCA 1TL4A 3OW2R 4KB7A 3PYDA 2CPHA 1B0VA 3N5FA 5T7LA 3KXDA 1YRXA 4IFVB 4KHPF 2FC8A 4DV2F 4BDPA 2HVDA 2J0XA 2E1PA 2ZDPA 1BQMB 3WZ0A 1WNEA 1PBUA 3ZTPA 1UVKA 3P4UB 3UNGC 1V5IB 4HACA 5KFXA 3K8WA 5T14A 3ZC4A 1FERA 4YDXA 2UUBJ 4U7CA 3Q2SC 3RG6A 1LV5A 1JMTA 3T1HF 1QSLA 3TZWA 5D0RA 1RWPB 1XNQF 2X1BA 3WIUA 4ELUA 1Q78A 1FI4A 2QIFA 1K1QA 1Y5IB 3TRGA 1MWYA 2K1RA 3RB4A 3H90A 3IRWP 2QYCA 4OZJA 3K5LA 1GNKA 2PMHA 1VIXA 2HHHJ 2XC9A 3PZPA 5ETMA 1M5OC 3M2RB 1ZZNA 3GFXA 2LLZA 4Y65A 1HNVB 1U2FA 2JH3A 1TELA 1I5OB 4CO2A 3QMQA 4FDFA 3OXGA 4GKKF 2BVZA 2WVFA 2AF6A 2OEJA 2DHAA 3RW6A 3R6LB 2CQ4A 2VIHA 1AB8A 4YY3J 1JXLA 1P1LA 4HI1A 1NJZA 3HF5A 2Q79A 3N28A 3CJ4A 2VBXA 3G2XA 3QATA 4I7FB 3IWLA 4DL7A 4P6QA 1TFYA 3C15B 4HDHA 2M2BA 1BMQB 1UA1A 2MKSA 2MQNA 2YKOA 5CHCB 5HVHA 2JJ4D 4PABA 3T41A 3C16B 2QGFB 1BQXA 4PXDA 1JLAA 5HQ8A 3EXYA 5L38A 3BO2A 1TAUA 1KLMA 3ZTQA 3TVKA 5LXYA 4LFBF 2LA4A 5DQGA 3H98A 2DR7A 2VDIA 4HTIA 1NNDA 3BSCA 3DI6A 4B9LA 1WHWA 5D4LA 3HMJG 2XO6A 1VQMS 4FF4A 3LP0B 2QL5B 1DTQA 1FFWB 4DL4A 4K7QA 1U1QA 3T6BA 5HQLA 2V6AA 3QT7A 3MPYA 4RNFA 3E01A 4DCPB 2ZH2A 2D7SA 1RWOB 4RUHA 1BHNA 1JLCB 4HHJA 3DKDA 2W9CB 3UQSA 3N01A 3W9JA 2V8HA 4YHHJ 2BE2A 3EGNA 2ZEJA 2K7KA 3WX8A 2K2PA 2Z2MA 5KFVA 5HVGA 4JI0F 4I69A 1TTHB 4A8OA 1R3NA 2PI4A 3UFCX 4OI4A 2ZHOA 4KKOB 2CPXA 2BOPA 2C3OA 1N36J 3KWMA 2BRLA 2H5EA 1T0TV 2BJDA 4J7CA 2UUAJ 4DFKA 1KHWA 1TL7A 2DNNA 3R97A 2ZUGA 3KLIB 4F36A 4B9SA 1TK0A 5G4DA 1PO6A 4KY3A 4EBEA 3J7AN 5B09A 2FY1A 3DRPA 5C25A 4W4MA 3GILA 1NO8A 1REVB 4F4WA 4M5DA 4CT9A 4TYBA 3LTOA 3CTRA 2ZBCA 4LF9J 5JVGQ 1IBLF 2GCFA 3W9HA 1RAAB 1GTHA 4PKDB 3J81j 2V63A 2PC6A 1RYRA 4RJVA 4B9TA 5BR8F 3JYTA 3HFVA 2RDDA 1LKZA 4O0NA 4OX9J 5IM0B 4PQUB 1H0HB 4LR8A 3H7HB 3SDEB 3K8VA 2C3UA 4B3RJ 1HNXJ 3D6HB 3J81Y 4F2SA 2FZKB 3UDCA 5A8KB 3EDRB 3UI3A 3M32B 2V94A 1LW0B 5KFPA 2RH3A 5E3PA 4ES1A 3T1AA 2A6OA 4DQSA 1XMOJ 1DAXA 3BZQA 1ZAVA 4O23A 3PKYA 3T19A 3MZIA 1HIYA 2WB1D 4FYVB 2GGPB 3V4IB 2WBMA 4OX8A 3ETOA 1NDLA 3FBFA 4EZ6A 1XTZA 3FRYA 3L9ZA 3AOCA 2N82B 2DYAA 1FKPB 4EYIB 1Z2LA 3UE2A 2VPXB 4KPYA 3CB4A 3FRZA 2EVZA 2VBYA 4F0KA 4PG7A 3GCXP 1T03B 2XGQA 2EWHA 1N5YA 1SKRA 2NZ4A 1H6KX 5DG9A 3EPIA 1M5VC 3V6JA 2DEIA 2UP1A 3HK2A 4B3MF 2LCWA 4RW6A 3R8YA 2FJEB 3S1TA 1ZBTA 4DV6F 3ICLA 5HMWA 2GJIA 2YWEA 5KG3A 2W9BB 5HBMA 3CDAA 5L9NA 3HFZB 2VASA 5D4NA 4FF3A 3BKFA 4X65J 3AOAA 4DSLA 3DOMA 4F4ZA 3UCUP 1BQMA 3K5OA 4FNHA 3N6MA 4TY8B 2U1AA 3TARA 2BE9B 3K2YA 4KHMA 1X8DA 3BDEA 5HO4A 2ZVIA 4DZDA 1IVZA 5DJBA 5SZTA 1NHKL 5E3AA 5EUHA 5AE3A 4JI6J 4RW9B 4MIBA 4KBIA 1M5PC 3R7SB 2RIJA 2C22A 5EN1A 3IG1B 1JJ2R 5FJ4A 4DV0J 3MM7A 1GX5A 1YRUA 3K17A 1UWBB 2F7VA 4DQPA 2YWHA 3ZTSA 4WYLA 5F8GA 3MXHP 2WVCA 3Q83A 3JS9A 3VAIA 3CJ3A 2HRTA 1CJKB 5F3ZA 4KE5A 1FCAA 1F0XA 3M2RA 2FVRA 1G1XA 3MM5B 1U2RA 3T1YJ 3ITHB 2MQ8A 2VPYB 3C14A 2BRKA 4DSKA 4FF1A 5J1PA 5GAHU 3PM9A 2YNHA 4GRSA 1BWVA 1FX2A 4C8NA 1XWLA 4I7FA 4B3SF 4LFAF 1CLFA 2CQCA 4CRJA 3GB0A 3CSKA 1ACMB 3WX4A 3FNNA 1U4BA 2FDNA 2KT3A 3M7VA 4RPFA 1R89A 1WKJA 4ZPBA 5H9EJ 1FRHA 4XPEA 3EVWA 3R5JB 1IM4A 2VICA 3PX0A 5DGAA 1SH0A 3DXSX 2RRAA 1YVFA 3MPUB 2CNNB 3NLCA 1SJQA 2V67A 1NHUA 1S79A 3M30B 2ABYA 2M4MA 4DPYA 3NG8A 1RYSA 4B9MA 4LF5F 1N4LA 2ZZTA 2VL1A 4QIGA 2BV3A 3D9BA 2XYGB 4DV7F 1FRKA 1U47A 5HQMA 1PG5B 4OYPA 4AXJA 4C11B 3NWRA 1U6BA 4F67A 3B54A 1LFPA 2XQCA 3HLUA 3AXKA 3UD3P 1JXEA 2ZVSA 4CO3A 1FRLA 3CEDA 4NMXA 2OPQA 4FZVA 1DQ9A 3PCOB 1A7GE 1ULRA 5LSRA 1EZZB 2OPSB 1SIZA 2N7CA 1TL1B 3AHPA 3RBDA 2IM2A 1WD6A 4CNZA 3EGWB 4IG0B 1FTRA 5I3PA 2CG8A 5B0DA 1CQNA 3EGVA 2ZZMA 3BJYA 3WC0A 3A3OB 3W64A 4I6WA 2YKAA 3AXMA 1XNRJ 2O66A 2Q43A 1RT6A 2R2SA 4DR5J 2BANA 4RBTA 3PW0A 1Y10A 3ISZA 4LBHA 4J9MA 1TAQA 1FHTA 2FQQB 2YX7A 5THWA 2H4YB 1G3OA 2RS8A 1WACA 1FXRA 1EB0A 3OTCA 4QOTA 5K20B 2B6AB 2BMBA 1S9EB 4DR1J 5M2PA 2WW8A 3K89A 1G4CA 1TKXB 3HVWA 1HNZJ 2CQ1A 4OHVA 1EJ7L 4RBUA 1ZS6A 2M70A 3Q24A 2V4QA 1E6YB 4F8RA 2KVQE 1U48A 3SFUA 4P2SA 3K5MA 5E33A 4FYYB 4LRBA 5DM6Q 5GMEA 4DV4F 3RAXA 3SDEA 2VFRA 3M2UB 3IXQA 2CUYA 1QAXA 4DR7F 4DUTA 1S1UA 1KC8T 1AYEA 2RU9A 3HJVA 2IRXA 2XTJP 2R2TA 3GJRB 4ENOA 3KOAA 1HFEL 4NXNJ 1NK8A 3GPAA 3QGPA 1FJGF 4L3NA 1XR5A 4ED4A 1GXLA 2FJDB 2MZTA 2I0XA 3QIPB 5C24B 4DR2J 1WF0A 3DLLQ 2LQ9A 2ZH7A 2F4VJ 2R7UA 4FYWB 3M1VA 1SC3B 2Q66A 2EBGA 2G0IA 3QIDA 4WFZA 1WG5A 1OMSA 1S1WA 3P45B 3M8SA 3R5DA 2C2OB 1JK9B 4ED6A 1AW0A 4AE5A 1CJUA 1RU2A 1P8GA 1F2GA 2PMWA 3HPOA 2EW9A 3R27A 1TFWA 5F8NA 2CNKB 3MM9B 2W9BA 2XNQA 4WFAQ 2UUTA 2V34A 2JEGA 5F8JA 3QT8A 2BR0A 2R8IA 1BQNB 5CAAA 2GA7A 1NK0A 2HMIA 4OZ0A 4DLEA 3AD9C 4CCHA 2OELA 2G1DA 2WW4A 1E6VB 5KFQA 4YOEA 4RNNA 2VJVA 3I32A 1C4CA 4ED2A 1DQAA 1WKKA 1YG0A 4P7TA 1RAFB 2FZCB 2YNFB 3KJNB 1CJTB 1RTJA 1KS2A 2VFVA 5KG1A 4NPOA 4IOAQ 1X5TA 1WF2A 1VQKS 2CG4A 9RUBA 4NLQA 1RKIA 1CJKA 3O8WA 1YHQS 1U26A 5EWGA 5IV4A 1X4HA 3OSNA 4KHPJ 1EETB 2CNOB 1UZDA 1D8ZA 2MGZA 2RB7A 3MM5A 1W25A 3TAMA 5GAGI 4JBCA 3MMCA 3QGIA 1JKHB 3W5XA 4NLWA 3BREA 4OYWA 2OMLA 1NUEA 3GCWP 3JSBA 2BUNA 2HFUA 3T1HJ 3PXGa 3PG9A 2AJ2A 4ERDA 3TZXA 3EZUA 1CBKA 1SQFA 2MMYA 1WOSA 5B7WA 4D3HA 4CYUB 3R2CJ 1OY8A 1RWUA 2QMXA 4JI2J 2FTRA 2L9NA 4CLSA 1RBLA 3G82A 1H73A 3CW2C 4B9VA 1N0UA 2FLOA 4PG4A 2CPDA 1FX4A 1JB0C 3LGNA 1XC9A 4IO9Q 3RB0A 2HNDA 4B17A 2XHCA 2XLIA 3QO9B 1Q5YA 3DN9A 2VPZB 1KVJA 5LOQA 4RW8B 5EWFA 5L1LA 3GV8B 1KQSR 2ZOGA 3OTOF 4GKKJ 2KJVA 3M30A 4Y34A 3K7RA 1X4GA 3MAHA 1IR2A 2EFPA 5E2QA 1FE4A 1N33J 1C0TA 4AL5A 1CC7A 3CT9A 1HNWJ 2CIMA 5J2NB 2QC3A 4NCGA 2XSFA 1SH3A 3KLEB 3EJMA 5ETQA 4Q8EA 3UWTA 2DXFA 4OL8A 5IQQA 5F9LA 2CQBA 1LWXA 2L48A 3S6EA 5A8WB 4RW4B 4O3NA 4J9OA 2HAFA 1B4SA 1D0EA 3MMBB 4AL6A 4RU2A 1R6VA 2Y0SD 2G2YA 5KAKA 2ACYA 1S0VA 4K4WA 4ATNA 4GKJF 3H5XA 1Q16B 2H5JB 5C42B 2B9EA 1FFGB 4R5PA 1Q5VA 4ZVFA 2G2OA 3F0NA 1NCLA 1IKWA 2ZBRA 1R6YA 2ZD1A 4GO5X 1S6PB 2M52A 4ZVUB 3NOCA 4P52A 5SUHA 3LP2B 3I31A 1R43A 4KTQA 4ED7A 4K2XA 3OLAA 2NYHA 1U8SA 1X5OA 4RUBA 4WTOB 3KNGA 4KT0C 2FVPA 3CVKA 4ZHRA 2AIRB 2WAQD 2IRYA 3L09A 1J2VA 2B4UA 2A18A 2C2KB 4WK3A 3C66A 2ASJA 4MKBA 1F3FA 4DPOA 2L41A 4A8WA 1K0VA 1SQEA 4OZ2A 1E6YA 1MW7A 2BYCA 3M6VA 1PKUA 2AWZA 3W66A 8ATCB 2G9OA 4CP5A 2KM8C 3TANA 1U24A 3SCLE 3OL6A 1HR0J 1S9FA 5IT0A 3EXCX 3RBXA 4KGXB 3G96A 1NJYA 2HS3A 2FJXA 1RQ0A 4CTAA 3W5ZA 3LWMA 4NLXA 2QMWA 5HP1A 3DDKA 1FRXA 1RAJA 2LP4A 3T9ZA 5KT5A 1KQKA 1EQMA 1NKCA 2EK1A 2HQFA 1GMWA 2KT5A 3MPVA 2Z58B 4NLUA 1DHMA 5J2PA 4F4KA 1UP1A 2HBRB 3GIKA 2Z2ZA 5CYQA 1DLOA 4Y2IA 2QFJA 5KT3A 3GZ7A 4ECWA 1C1BA 2P9GA 2OEMA 5K5MA 1V3SA 5KFRA 1OPZA 3C2PA 2KO1A 2DY1A 4ZLLA 4WU3A 2MQOA 2WSEC 2AW0A 5BR8J 4PWDB 1RTHA 3BQ2A 5CYMA 2MB0B 1R8AA 1ZTWA 3FUYA 2I2YA 1QSSA 4NYOA 1NU4A 3PRVA 3OTEA 1CVJA 1PGZA 4ZITA 4F7VA 1PC5A 4ZCIA 4OI1A 2MKKA 3NNHA 2EK6A 1U8WA 4Y2MA 1UETA 2RSQA 7AT1B 3DRRA 4DUYF 4PUOA 1L3KA 1RADB 2YBVA 3M8PA 3M9MB 4Q0BB 1S99A 2J5AA 1EHWA 4UT4A 2OPRA 4G65A 3C6UB 2E9TA 2R7XA 4J9LA 1RTDB 3CD7A 4CLTA 2OUGA 1PAUB 4X2BA 3FEYB 4X84A 1KEKA 2QA4S 1YJRA 2P9EA 1IR1A 2V68A 2H3EB 5KG2A 1J5EJ 2C3PA 4FBTA 1BLUA 4PWUA 4J91A 3VAMA 5I4MA 2O01C 2ZJPQ 4JI3F 4DUZF 3PIOQ 3QSYB 2WB4A 1KVIA 4B3MJ 4DV6J 4QR1A 3C6TA 2HBZB 4KH0B 4KJIA 1Q86T 4ZVOB 4YP3A 3DU6A 3UN2A 3A4TA 1Z4UA 5I42B 1TVRA 3B78A 3NNCA 3FCWA 3EICA 2G4BA 2FYXA 2A3JA 4E2FB 5DDPC 3PW5A 1RE1B 1D3WA 3RAQA 2X1GA 1F5AA 2KI2A 1YWXA 2FUG9 2HHWA 3PKMA 4B3TF 4C3MA 1N5VA 5GAEI 1C0UB 3A12A 1EKRA 4LIRA 3SQGA 3BV8A 4DR6F 2AJFE 2MQPA 1Z1ZA 3SXLA 3I9V9 1JLBB 5L46A 2MZRA 5DS7A 4M5LA 4KHRA 3MURP 3OFFA 2E5JA 2Y3YA 5G0RB 1RKJA 2K7JA 3EX7B 1NDPA 4KV8A 4AYBD 1D1UA 2RQMA 4RW8A 2NPIA 1LW2A 1NXIA 4ZVQB 3G6YA 2ERRA 1HYSB 4DQRA 2IPOB 2A6MA 4KGKA 1X0FA 1FNOA 4F3MA 1BWEA 5KTQA 1Q79A 2LVWA 2OI2A 1FRJA 4LFAJ 5LMNF 5LXRA 4OYOA 4GMKA 4DPTA 1YI2S 1TMMA 3KLFA 3Q2TC 3CCJS 5A8WA 2A2CA 3SCJE 1OJ4A 3CULA 2HFVA 4FVMA 5DQHA 2OD4A 3R9LA 4H4OA 2CNLB 5ETSA 2B4OA 3T5JA 4JI5F 4M5MA 3ENVA 4A47A 4OYXA 5DG7A 4J37A 5C42A 1FVQA 1RWMB 2L9DA 2HK3A 2R4FA 1F9EB 2D3O1 4CT8A 3DLHA 1KN6A 4WTYA 3CD6S 1IKXB 2CA9A 4YDDB 2AX1A 3J7YI 1DJ0A 2GJFA 1FJ7A 3PRBA 3NKYA 1GH8A 3PYGA 2ILYA 2OMOA 4DV7J 4YQWA 3V6HA 3R5BA 3D0IE 4K0KF 3ZXWA 1I51B 3QSIA 2C3YA 4FP9A 2N4CA 1RISA 3CJ2A 5HATA 3TQ1A 2KFZA 3HHLD 4C0HA 2AYEA 1WSVA 1YX2A 2JRSA 1BXNA 3M8ZA 5D6GA 4IQXA 1DY3A 5F8IA 4ICLA 3TA1A 3G87A 2N3OA 4N8OA 5LMUJ 3X3UA 4WJBA 5RUBA 1XK8A 4NLGA 4NEYA 5HVFA 1U1NA 4CLLA 1ROFA 3DGVA 4USWA 2B4VA 2RUGA 3WQPA 3MMJA 3GFYA 1JX4A 2IMOA 1I1GA 2XMWA 3SSQA 4AFFA 4QWBA 4K8RA 1Q7YT 1X0PA 3JQKA 4ZP7A 2XEXA 2OPPA 3DDIA 2POKA 2WVDA 3F56A 4IG3B 1T9VA 4WFNQ 1Q0NA 2VA3A 1GAOA 1S1XA 2CWXA 2KU7A 4CLWA 2GFFA 4M63A 3RR8A 3MEEA 2MKIA 2D3OR 1I94F 4IH5A 3LUYA 2D41A 3ZO7A 3VVUA 1UCNA 2M8HA 2E7VA 1H7WA 1SJRA 3PDNA 1UKUA 1LWEA 5KFCA 4YB7A 2FVSA 4QIVA 4O3RA 2OD6A 1R8PA 1NB2A 3H2LA 4WKRA 3LAMA 4KO0B 2A0FB 4ZDNA 4PWDA 2YNGB 5LT5A 1SV5A 1W26A 1F3VA 1W2IA 4OI3A 4QWAA 1AT1B 3Q8SB 3E2EA 3HSGA 3A8KA 3KK3B 4DR7J 3E8OA 1SKUB 1JNZB 4XDDA 4IOCQ 2ZFHA 2MZQA 3DRXA 1RA7A 4PPZA 4DI6A 2MY8A 5K8OA 4Y00A 1U1MA 4K4ZA 1FJGJ 3OTDA 4QWEA 3FCVA 4ITSA 5BYRA 4LSLB 2HGNA 1EP4B 2FLPA 4Q0BA 2RAQA 2WTFA 3BPSP 3TVZA 2ASYA 4L74A 2BACA 3LP1B 4ZOSA 2JC0A 1GXUA 2R7SA 1WDTA 3CJTA 3DMJB 3UW1A 4J5OA 4OV6A 1WJ9A 3W8GA 1HWLA 2DHXA 1LXJA 1CSJA 3J7ZT 1TKZB 5DZ7A 4IO1A 1APSA 4RNHA 3W61A 3D5MA 2XSJA 1P1TA 4OZ1A 1CS4A 4GVBA 4C97A 3RGIA 4USTA 2BX6A 1YJ9S 5KFZA 2AYMA 3UPFA 3VV2B 4YS2A 4LRCA 3I0RB 2JVOA 3OFEA 1VQ6S 2FJVA 4Z2XA 3MWBA 2DNKA 2KJWA 2HVZA 1RXOB 4UOHA 3SIPB 4DSJA 3C3LA 2QA1A 5J2MB 1TV6A 8AT1B 4ZVTB 4DG1B 1LOUA 2ZE2B 3AFGA 5A2QU 4E0DA 1DQ8A 2R7OA 3C19A 4I2PB 2A1BA 2HBQB 1CJVA 4LJMA 1MWZA 2L3MA 1S4EA 3DLEB 3FBEA 4TXSA 1LWCB 2DCLA 2ZUAA 1J27A 2K3IA 4NCAA 2GO8A 1FO1A 3Q8RB 4ZKAA 1Q8IA 1WSRA 3A8JA 4Y2CA 2B9WA 1N34F 1SQGA 2BW2A 3MAAB 3Q8UA 1TL3A 3IM8A 1HW9A 2FHMA 3H2UB 5HJXA 4WFYA 3H0PA 1N36F 2VG7B 4QQBA 3JTOA 2FLLA 1HBMA 2UUAF 1TUWA 2Z57B 3I82A 2V2ZA 5KFLA 1EIYB 3D1HA 3OVBA 1KFDA 1YBTA 4L3KA 2GVDA 2R7RA 3MTJA 1EARA 2VKRA 5HROA 4F4AA 3OR2A 3HT3A 1IWGA 1NZAA 4UY85 2OLWA 4N5SA 4FKYA 2GAGC 2MLYA 3W2WA 4HH0A 2YY3A 2KFYA 1VQNS 3MGJA 2UV8A 2DRAA 2A10A 4CO5A 5KFAA 2ATLA 3Q23A 2IYIA 2LA6A 1YKWA 2UVWA 1QVGR 4OIXA 2XZWA 2HK2A 4I4BA 2W24A 4B3RF 2YWFA 1HNXF 2X3DA 1IKXA 5AXKA 1UJ4A 1X9SA 4ETXA 4Y2KA 1R31A 5GVQA 3OJUA 1S6QB 4IFYB 3J81U 3C8YA 2J0WA 2I5JB 3AD8C 3CC7S 2ZOFA 4O4GA 4CLFA 3G4SS 1VRTA 3RRHA 3IBFB 3TNVA 2NXEA 1UTAA 4WP8A 3HXMA 3R3TA 3WBZA 4M5KA 3Q0AA 4B3OB 3US5A 4USKA 3W60A 4F02A 3T5KA 3CCWA 4N41A 2RF2B 3V6KA 4N77A 1GFWB 3W63A 2DNHA 3NP5A 2IHR1 4PEOA 3KK2A 2V8VA 2GC8A 5GAGU 1AFJA 5IQ6A 4GKJJ 5DETA 3QWUA 3CJQA 3H5UA 4NLOA 3NGTA 2QLJB 2HHVA 4A48A 4USIA 4ZVPB 4BS2A 4C9DA 4C3LA 1ZM3A 1PAEX 2HNZA 3HHLC 3W7BA 1SKSA 4FYDA 4OFZA 2HZVA 1S77D 2CJYB 5DM7Q 2VU5A 4DSIA 2DGSA 4HYKA 4C8ZA 1QAJA 2VZ9A 2LXUA 4ID5B 3JB9k 4Q45A 1NB7A 1IUJA 1QVFR 4WIQA 2K06A 3ILIA 2C1EB 1JNRB 1UVMA 4UOFA 4BBYA 4NLTA 3UN5A 4NX9A 2MJUA 2NXUA 3CJ0A 3G8QA 4ZJOA 3PFEA 3MMAB 4ZJQA 4R0JA 5DLGA 3ELHA 3L7UA 4JI6F 2CQDA 2HNYA 2AT1B 2DGVA 3GQCA 1VBYA 2AV5A 2W2QP 3ISND 2H48B 2VODA 1ZH5A 3GFZA 1UVJA 1CULB 1L3TA 4MK9A 2UUCF 5EGYA 2ACMA 2RU3A 4OYZA 3QT6A 4M8LA 2VBZA 5L8RC 5CZXA 5T7LB 4L76A 3KK3A 3BBBA 2YPYA 2DR9A 3KFWX 1FD8A 1U0SA 1FWKA 2COLA 3T1YF 2DNQA 3VZIA 1IBMJ 2ZDOA 3VQTA 1HMVB 4G1PA 5GADU 4HACB 4LSLA 1EP4A 1GXTA 5LSLA 5DDQC 3TYTA 4QPTA 5F0UA 3AA9A 1VQYA 3TAQA 1X7VA 3NRBA 2YWKA 4X66F 2OGUA 3BM7A 2CPEA 2KG0A 2IDEA 3LP1A 1VQPS 1YTYA 3VGUA 4F04B 4NE9C 2K1RB 1IM6A 2F8MA 2VQEF 3QFWA 1KHVA 1OQ6A 3DMJA 2PA3A 1SIWB 1ZM4A 1HQUA 2ROPA 3BB5A 4UOGA 4URSA 4DJBA 4ECRA 3CUNA 1X4FA 1YZ7A 3IS9A 4CZCA 4PRFA 1XEZA 2O5DA 2IC3B 1NJIT 3V4MA 2YKNA 3I0RA 2NUUG 5F41A 2QLXA 3PIPQ 4X4NA 1VQ9S 2B7CB 2YPZA 3HP6A 5ETNA 3A8IA 5D0EA 3HD2A 1VHIA 2M9KA 1BY9A 4DG1A 1YJTA 4DF4A 1HBOA 4CIOA 3B82A 2ZWPA 1NK9A 4LF8J 2CDQA 1WHYA 3M8QA 3GYGA 3GYNA 2MZSA 3THPA 3SEOA 1Q1KA 2C2ZB 4LR7A 3MEKA 1HKAA 3HM9A 1T3OA 4FBUA 1XR6A 2W1BA 2QLFB 4ZCMA 3DLEA 5AJ3J 2XULA 4USVA 1SL2A 3FVYA 1LWCA 5GMDA 3BO3A 3EVOA 3IO1A 3OHBA 1KLMB 2W7PA 1X4BA 1HARA 2CQPA 2K3KA 4CO0A 1NJWA 4JI4F 1GX6A 4Z7YA 3MAAA 1GT8A 5DO2A 1ZYQA 2MKHA 3PEJA 4TKTA 3VGVA 1T94A 5LSOA 3VCDA 1XNRF 3MCMA 3E01B 3F41A 1K9MT 3WHIA 4XIUA 3MTKA 2IAJA 5F0WA 2OEKA 3HVRA 3LANA 4DS4A 2LXIA 4CH1A 4P9SA 3VQSA 3OPKA 2DNYA 2KL8A 2Z2LA 4NRUA 3EMTA 4B3TJ 2FZGB 2HZAA 2LMIA 3BYRA 2A2DA 2QYGA 4DR6J 3LAKA 2RQ4A 2IJRA 1TKDA 4KGZB 2BE2B 1GMVA 4DMZA 2GNKA 2DITA 3FZBA 2H4WB 2LEAA 3FKBA 1YLXA 3TWZA 3LH2S 4WU2A 4TQSA 2QLWA 5J1NA 1S0MA 4LVOP 4LF6J 3F44A 5M2UA 5U47A 2E5LJ 2CXEA 2FVCA 4DBQA 1S6QA 1KQGB 1FJCA 2WK4A 3DRSB 2OTJS 3P96A 2E29A 2I5JA 3DM2A 5LJ3Y 2FD2A 4ES2A 3AH6A 1S9GA 1SJ4P 1K73T 5LMNJ 2CQ3A 2LQ5A 4DFMA 2PSZA 3DRPB 3FFIA 1KVKA 5C25B 2CYYA 2DY9A 4M5DB 4DR2F 3QYYA 3MR3A 2B8QA 2W25A 1SI9A 2IJNA 4HLBA 4WXWA 1SKWA 1PJ7A 3SFGA 2BKNA 4JI5J 1T9WA 4JB8B 3I9ZA 1DRZA 2VF3A 5ETOA 2V4RA 3JYTB 2GO9A 4X4QA 1U1PA 3MI7X 4CLUA 5KT6A 2M3DA 4I0WA 4USMA 4ZPCA 5D8HB 3K5PA 2YVSA 3NGSA 4DCJB 5GAEU 2WSCC 4F4YA 3KLGB 3BO4A 2DD8S 2PD1A 1W2BR 4MTPA 1R27B 1XMBA 3CJRA 4EBCA 2CZ9A 2DTJA 2AZ3A 2QFIA 2FJBB 4U8VA 4K0KJ 4B9NA 4NZ6A 4JV5F 2GMHA 3GG1A 2EFVA 3KTQA 3KUEA 1TKTB 2EFQA 1UL3A 3CJ8A 1V9OA 3HDSA 3K0JA 1S57A 2HQGA 4BLGA 4DV3F 2M7SA 2KFNA 4OLPA 2LQJA 5KOWA 4EZ9A 3LGHA 2BJ7A 3IFEA 3CCVS 1N0VC 1JLGA 3O5TB 1N5YB 2HHQA 2GHVC 2VPWB 4QR2A 4EO8A 2AKWB 4ZIWA 3DOKA 1CULA 4RW6B 1QE1A 4MFBA 3MFIA 1P9QC 4GVLA 5HBMB 1FTCA 3AQPA 1NH7A 3FCHA 3IGNA 1A9NB 2PEBA 4P75A 3H40A 4Y6IA 2R2RA 1F2HA 3DOMB 2HQ3A 2ZHBA 4ZPTR 1I94J 2GMLA 4WP9A 2DGTA 1HMVA 2X1FA 1RT5A 2EEYA 3SMZA 3QJPA 4IOBA 3J80U 2DJWA 3LQVA 3EUNA 1VC6A 2ZBIA 4BHQA 4RWWA 1O8BA 4NWBA 3NY0A 2C2RA 4C8KA 4QWDA 3MM7B 3SSSA 1JLQA 3O44A 3PTWA 1I6JA 4LF7J 4JI2F 4IR9A 1F6TA 2QX0A 2Z2YB 3D28A 2DR5A 5AE1A 3KLHA 3Q8YA 1T05A 5D4OA 3N9UC 4UQTA 2IC3A 2B9XA 4ZP8A 3IWXA 1BUXA 2DO0A 3C14B 2Y1JA 1UWAA 2GVZA 3MUVP 1NKEA 2F40A 3FEXB 4RL1A 4ILMA 3BN7A 2YNHB 3OR1A 1N33F 1HNWF 3MR5A 1YJWS 1S6OA 2OSRA 1VBXA 2HHTA 2YH1A 2P5VA 4NCBA 3CMQA 3QNWB 1VI7A 2KT2A 4DPWA 3HVTB 1NK7A 1NK6A 1UMJA 3OTBA 2I8EA 3PRDA 3DGPB 4C2MA 3J7Z5 3MEGA 1OYEA 1VFJA 3DLBA 4CM0A 4FS1A 4Q7AA 5LL6d 2KHCA 1U02A 2DISA 5MLCV 4QYZJ 1ZOTA 3MF5A 2RT3A 5F8HA 1U0HA 2WONA 2AYGA 1BC6A 1WWHA 3CMES 2D3ZA 2KXNB 1TQLA 1KBRA 5A2QY 1WOPA 2ZH8A 1WC1A 5C2CA 4K4TA 4KFBA 4OZLA 3B4MA 3QRRA 5FLXU 1LNQA 2UVRA 2CJAA 1HL6A 5C5JA 1NAQA 2OAUA 4C4WA 2QRRA 1V3ZA 2OPQB 2SXLA 5HMZA 1NHVA 4JUZA 1Y4ZB 1B7YB 5CA5A 1VQLS 1S76D 2HKEA 4OV1A 2J7UA 5DQIA 1N34J 3L7OA 1R7IA 2B43A 2Z8QA 5CD4H 2W4DA 4EMDA 3FSYA 2V50A 2RILA 1HR0F 3R1LA 2VONA 2IM1A 2XY6A 2W2OP 1BGXT 5KFSA 2OO4A 3DHWC 1DTTA 1RT6B 3IMQJ 3PX4A 2BANB 4BWJA 6FDRA 3DRSA 1PSDA 1QTMA 2RHSB 1VBKA 2Q6BA 3BGRB 3NBPA 3D1QA 2XI2A 1UJ6A 4RZRA 2X1AA 4QYRA 5KT4A 3BN4A 5DZ6A 2C42A 1L3UA 5EWEA 4OYBA 3CDUA 1RWNB 2F1FA 1U45A 4NLSA 4JV0A 4C7QA 1ZPWX 3EM1A 4ECTA 1VHFA 5IWAF 1JQGA 3IP0A 5J2QA 1QUVA 3AQOA 4FN5A 3OD2A 4FPIA 1WC4A 1YJ7A 3NCRA 1C2PA 3KMSA 3CCES 2AGQA 3NS6A 5L1JA 1W7WA 2CVEA 3OV7A 3D6FB 2EC2A 4ZS6A 3AJ2A 3N79A 2XY5A 4WZMA 4RWXA 2ZOMA 1WORA 1O0PA 3D3BJ 1UEUA 1S1UB 2ALZA 3M6WA 2PE8A 2VFUA 3KLGA 1IBKJ 1VQ4S 4Q44A 3T3FA 2ZM6J 3CJKA 1TU0B 2OSQA 2IBKA 2DGQA 2E1CA 2KG1A 1XQIA 4IH7A 4CWBA 1URRA 2HIQA 4M5GA 4X62J 1RT7B 1TKTA 3SV3A 4MKAA 2XNRA 3IBWA 5HLFA 3ZZYA 3THVA 4PG6A 3R5AA 2KXHA 5F8MA 3POTA 1RDRA 1WC6A 4QW9A 3ZZRA 4UUXA 2DGUA 1QAYA 1YIJS 3M1VB 2CPIA 2CFXA 4EGLA 1S1WB 3GTYX 2J8SA 4A4JA 3CCMS 4ZLNA 2DT9A 2V9WA 1CJUB 3MR7A 1J5EF 5I3QA 2RHQB 1RAHB 2HEKA 3O1LA 1D9AA 2KYZA 2FJAB 5AXNA 4L73A 3HZGA 2HAIA 4OYAA 1NH8A 3GIJA 3MCOA 2EFNA 4ETZA 4F50A 1KSPA 3DXBA 4WP3A 3EWGA 3HI9A 4F0HA 3MUTP 3GP9A 2CZ4A 2GS8A 4P74A 5H9EK 5EHHA 4EK2A 1MU2A 3DRYA 1X4EA 1H98A 3DC2A 4RUCA 2HMIB 4NA2A 3OL8A 5ETRA 4OI2A 5ETKA 1YJUA 4USHA 1ZA1B 3V81B 1N5QA 1RAIB 1LK7A 3IR7B 1F5BA 1B99A 3M9NB 5LM7E 2ZBQA 2BJ1A 1RTJB 4LSZB 4ZLPA 5ETVA 4U95A 2KTQA 2UUCJ 4NXMJ 5BJRA 2PT0A 4B02A 4CO4A 4OYIA 2KRRA 1IWAA 1GMWD 3U1MA 1UEKA 3KJVA 3VTIA 4J9VA 5HN0A 2MGZB 3BKUA 2HFZA 2AMCB 3CCSS 3TAMB 3TJ8A 1M1HA 4LREA 3MMCB 3GE9A 3IR5B 4ES3A 4GO7X 2B9YA 3NMAA 2H1YA 1OIAA 4DX5A 3H42A 4LQ3A 1Q8BA 4F2RA 1FDNA 3G86A 3R5CA 4X66J 3NNAA 2GQ2A 5KG4A 2CQHA 1JWWA 3PR5B 3VHQA 5C2GA 1SH2A 2J8AA 2WZ1A 4JI8F 3KG4A 6FD1A 2VQEJ 1LWFB 2CWKA 1OS5A 3HVTA 3G82B 4QIFA 1RZMA 3DGPA 4CH7A 4G1IA 5IZHA 2HNDB 2GW8A 2FC9A 3RZAA 5E41A 4N7TA 2D69A 1T95A 4N47A 2XLJA 1Y3JA 4UF4A 4ZCLA 2MYFA 3KHRA 3G6ES 2W9AA 3NXZA 4P73A 2HS4A 3BDPA 2IA6A 1H2UX 2W4CA 1IN0A 3HT0A 4MKVA 1IQZA 2QLBB 3TOQA 3UR3C 5A8RA 1C0TB 3BEGB 2MTLA 1NRKA 3KJFB 2GAHC 3OSPA 3ADAC 2DRDA 2E7XA 2HVHA 4NCGB 5B0GA 4ECSA 4O44B 4KRWA 2YWGA 2GHPA 2BJEA 4Q8FA 1OQ3A 2EFGA 2W7AA 2ZNZA 2WRMA 1XMQF 1QDUB 1WC3A 3M8RA 4NLPA 2V69A 3MR6A 2WOMA 2HURA 2DHGA 2ZH6A 4XTTA 5KFNA 3HKZD 5LMUF 3VVTA 5E3CA 4R5PB 3OHAA 2CJXB 4JI4J 2HHXA 2AJ1A 1QM9A 1IKWB 1WTBA 2C2NA 4DL6A 5I3UA 2ZD1B 2V2KA 4ZA1A 2F5GA 3TQEA 2XMJA 3R7NB 5HMXA 1FEHA 4QWCA 1Y9OA 1MROB 3CGIA 3OXFA 3RB3A 3BGRA 3M2VB 2PO4A 3JAMY 1UFLA 1HHQA 3OBIA 2HLUA 3W8PA 3HVAA 2JLEA 3AJ1A 5CCLA 2Q1LA 4ZHRB 4CLZA 1V5VA 4DCOB 1FNMA 1HBNA 1X31C 2DB1A 3PY8A 4USJC 3PYEA 3UNYA 3GU0A 1WI6A 3VALA 3I0SA 4O3PA 3I56S 3CC4S 3W65A 2CKWA 4DV5F 4E8UA 3W2VA 2VBWA 2LECA 3GIIA 4KGMA 2GIQA 3MM8B 3HHLA 4A8KA 2DR8A 1YGYA 2XBPA 2JHEA 1ZAWA 5IFMA 2Z4PA 3NOGA 4P2XA 3CCQS 2I1RA 4MJKA 2B4PA 1N6QB 4MIAA 2JDJA 2NXJA 1QUPA 5DLFA 5FDLA 1KKHA 4CTAB 2XMVA 1HHTP 4B9UA 2P8IA 4DLGA 3T5HA 2D1CA 4HTJA 4C8YA 1HWIA 4PG5A 5HP1B 4G1QA 3HZEA 3EGZA 2R9LA 4DR4F 2HZCA 3LGMA 3N0VA 3DLJA 1RHQB 1RLCL 1TK5A 2XS7A 1FF2A 2VOOA 1RT7A 2AQ4A 5J2PB 3MOZA 2ZH9A 5CYQB 8RUCA 3RYLA 5KFHA 1DLOB 3QPIA 1C1BB 4NZ0A 3PW7A 4P2FA 2ATCB 2MSTA 1VMBA 2KDOA 3EDQB 1S72S 3TJAA 1RHKB 3ILOA 1RTHB 1UZHA 3MCSA 2F8HA 4M95A 1V6HA 2B0GA 5CYMB 5KFIA 2ASLA 3P5TL 1FNXH 4M5HA 2QEXS 3K5NA 3R6GB 3MPWA 3PR4A 1GTEA 4TU8A 2NQPA 4ED5A 3DRRB 2YKMA 2BZ2A 1NJXA 4AL7A 4JV5J 1WEYA 2BE7D 4KSEB 4PUOB 4KAIA 1P27B 2JFDA 2CAJA 5D0GA 4P10A 3M8PB 1H3DA 3OXLA 3H20A 2OPRB 2FHOB 1D9DA 1RWVB 4DV3J 2FHJA 5IC6B 4M94A 1N48A 2IVMA 2J6TA 2PDAA 3R7BB 3V81A 4KGVB 3HSDA 5DDRC 4DEZA 2XMUA 2CQ0A 2NUHA 4PR6A 4H4KC 4RW7A 4I56A 3UVJA 4Q5VA 3M05A 3GIRA 4PYAA 2F63A 1EKSA 3C6TB 3LALA 5KFBA 1HWJA 3RB6A 2FJWA 3BGFA 2W8KA 2EC0A 1PJ6A 1VRUB 3ILJA 4DX7A 4TU7A 1MN9A 3ET6A 3D0GE 1TVRB 4YR3A 1TK8A 4M5NA 3J80Y 1UW9A 4F3OA 2IBOA 1NSPA 4V19X 1VGYA 4J90A 2AJ4A 3MM6A 2MHEA 4NYPA 4C3KA 5KFWA 1QJHA 4LMZA 3W1YC 1N88A 1HWUA 1QY7A 1VLYA 3MOJB 3JTNA 3SQGB 3FSXA 3DLGA 4UY8T 1L5UA 4X4RA 1LWFA 4CDIA 2DH7A 3BF4A 2RNEA 2XY7A 1O5JA 1FK9A 1KR4A 4UTGA 5KG7A 1RT3A 4O0IA 4RUAA 3HULA 4DQQA 3CDWA 3MECA 5HL7Q 4KV8B 1F9FA 3TUJC 3PO5A 3SCIE 2MLZA 1SC6A 3VAHA 4ANDA 2OP5A 1LW2B 4DX6A 3GMGA 1JJ4A 1SJ1A 5A0YA 1H72C 3U02A 2R8KA 4A8YA 1S1TA 4ZN1A 3DLKB 3P49B 4KYZA 3G71S 4MYTA 4EI2A 4W90B 4CLYA 4ELVA 4EUVA 2Z0GA 3ZZUA 4WFBQ 2Y1RI 4O44A 1X4DA 2QT7A 5B0AA 1RTIA 3DOLB 4J9UE 4PXEA 3KLFB 2CQGA 4MK7A 3GIMA 3GV5B 3ZZZA 1NEEA 4YR2A 5L1KA 2E5HA 4YUDA 4OHWA 4CO1A 1XN9A 3SYZA 4WK1A 4H4OB 5KG6A 2GHWA 1B7FA 1ZM2A 3TUIC 1U25A 1X5SA 1OY6A 4ZP9A 1WEXA 5B0CA 3CO9A 3P8BB 3BBCA 1SVDA 3LWLA 5D0HA 3UDEA 1HPZA 1OPIA 4DPXA 4IDKA 2O1PA 2RS2A 1M5KC 3FSIA 1VQSA 1RCXB 2IVFB 2HRYA 2CADA 1MROA 2ZNYA 2V4JB 1VC5A 3M2VA
chains in the Genus database with same CATH topology
5FLXY 2JWNA 1U6BA 1EP4A 4NOHA 3RW7A 1GXTA 4F67A 3G6VA 1KD1T 2D9PA 5A6WA 5DDQC 5LSLA 3TYTA 4QPTA 1MSWD 2J9DE 5F0UA 3AA9A 2UUBF 1LFPA 2DNGA 4NYZA 2RDJA 3BSOA 4CQ1A 1VQYA 3THTA 3CDBA 3TAQA 2I9SA 1R8BA 1X7VA 2IM0A 3HLUA 2YWKA 3NRBA 2DNLA 4X66F 1JXEA 2ZVSA 3UD3P 1HQEB 2ZH5A 3ZZTA 3BM7A 2CPEA 4OZNA 2FGOA 4CO3A 2KG0A 3NL0A 1FRLA 3CEDA 3LP1A 1VQPS 3CMAS 1SL0A 4W92B 2DNMA 1YTYA 1Q82T 2APOA 2OPQA 4FZVA 1DQ9A 1A7GE 4RNOA 1ULRA 3IRXA 5B0FA 5LSRA 4NL5A 3NCQA 2K1RB 2F8MA 2NS1B 1SIZA 2OPSB 4ICLB 2J6UA 2VQEF 2N7CA 2KVIA 1KHVA 1OQ6A 5B0BA 3DMJA 2PA3A 1SIWB 1ZM4A 5KFDA 4DOZA 1HQUA 2ROPA 3LW5C 1TL1B 4OQJA 3BB5A 3AHPA 3RBDA 1NK4A 2IM2A 4K4VA 4AUKA 1WD6A 4CNZA 3MM8A 3KLVA 3EGWB 4URSA 4IG0B 4DJBA 3TAPA 1T8EA 1FTRA 5I3PA 4ECRA 2JL9A 3ULHA 5B0DA 1CQNA 2KXFA 2HHHF 3CUNA 1X4FA 4HI2A 2DIUA 2ZZMA 3BJYA 1FXLA 3WC0A 4K5SA 3IS9A 4CZCA 2VOPA 1N6QA 4PRFA 2GV1A 1XEZA 1IKVB 2O5DA 4K4XA 4I6WA 4EO6A 2IC3B 1RP5A 2YKAA 2V8DA 1M5SA 2FHJD 5CQGA 1NJIT 4MK8A 2O66A 2Q43A 2YH0A 4NLVA 1RT6A 4TLQA 4WKYA 2R2SA 2DPIA 3V4MA 2YKNA 3I0RA 2BANA 2NUUG 2OPPB 2QLXA 2ZC3A 3QGGA 5F41A 3PIPQ 4X4NA 1VQ9S 2V8GA 2B7CB 4RBTA 3QAEA 3PW0A 3ISZA 3GG0A 4L6V3 2KN4A 3HP6A 4J9MA 2VG6A 4ED1A 3MEDA 4F25A 3FJ2A 2BXJA 1MMDA 1TAQA 5F3TA 1FHTA 3CJ5A 3X1LB 1S1XB 1IXKA 1WELA 2MSSA 5A8RB 5KFFA 4YY3F 2YX7A 5THWA 1UAWA 4LUBA 3MEEB 1G3OA 3DU5A 4YB6A 3OUYB 3DDNA 1G7CB 2WSFC 2RS8A 3D1OA 2QA4G 1IBMF 3C6UA 2M9KA 1WACA 1FXRA 3NWGA 1BY9A 3BGUA 3OTCA 4QOTA 4ZVHA 4DG1A 3E3XA 1YJTA 4DF4A 1HBOA 1RTDA 2RDIA 3J7A1 4CIOA 3B82A 2B6AB 4EFAC 1NK9A 4K50A 1LWEB 1S9EB 2NSCA 5M2PA 1U7LA 1WHXA 2CDQA 2WW8A 1WF1A 2QV6A 3FQLA 1TKXB 1WHYA 2B51A 3HVWA 3M8QA 3CF5Q 2CQ1A 4OHVA 5J1EA 1FDBA 3GYNA 2ADCA 2MZSA 4RBUA 3THPA 3SEOA 1Q1KA 2M70A 3Q24A 2V4QA 1E6YB 5BYSA 1FEEA 3MEKA 1U1RA 1OSDA 3HM9A 4F8RA 1T3OA 1U48A 1XR6A 4FBUA 2NZ4A 3SFUA 4ZCMA 5KFEA 1QSYA 4P2SA 3RTVA 3DLEA 3K5MA 3QLHA 2XULA 1UVIA 2XB2D 4DSFA 1SJFA 1SL2A 2WOMB 3FVYA 3H8YA 1L3SA 5E33A 2B5JA 4Z37A 4ZMMA 4J9SA 2C28A 1LWCA 4H4MB 3FMWA 2ASDA 1B0PA 1SV5B 5FIIA 2MPUA 5DM6Q 3BO3A 2K8GA 4QR0A 3IO1A 4OMFG 3OHBA 3RAXA 4DV4F 4PQAA 3SDEA 1KLMB 2NR0A 2W7PA 2YNIA 1X4BA 2BM1A 2BM0A 2RVJA 2H9ZA 1HARA 2CQPA 2K3KA 2VFRA 3M2UB 1J5OA 4IUFA 2LDYA 5KFOA 4ZPVR 4CO0A 3BSAA 1NJWA 4JI4F 5L39A 1GX6A 5KT7A 3GSDA 3IXQA 1QAXA 1YJVA 2DBBA 1GT8A 4DR7F 5I3UB 1S1UA 1KC8T 3OFGA 5DO2A 2RU9A 1ZYQA 2MKHA 3PEJA 3MFHA 1S1VA 3AA8A 4TKTA 1T94A 2IRXA 2IRUA 4LT6A 5LSOA 2R2TA 2CPFA 5I42A 2N3LA 3V6DA 3VCDA 1XNRF 3KOAA 1HFEL 4F3QA 1NK8A 1LXNA 3E01B 2DH8A 3F41A 3PVXA 1K9MT 3QGPA 4XIUA 5H1SV 3MTKA 4DL0C 2YX4A 5DRKA 3TX8A 2IAJA 3VWSA 1H38A 1FJGF 4L3NA 3RU0A 1XR5A 5F0WA 4DHVA 4J9QA 1GXLA 3HVRA 2FJDB 2MZTA 2I0XA 3LANA 3NAHA 3QIPB 5HI7A 5EDWA 1ZAXA 4DS4A 2LXIA 4CH1A 2LXFA 2KHDA 3HFKA 5C24B 3T9NA 1PILA 3VQSA 1WF0A 3OPKA 3K58A 3OJSA 3FQKA 4JOUA 2DNYA 2C2DA 4C8OA 2Z2LA 3H2VE 4NRUA 5K9FA 2MZ1A 3DLLQ 5JUMA 2XWYA 2LQ9A 2ZH7A 1QLNA 2AJQA 4ZP6A 3HHNB 4PG8A 2LMIA 4A8FA 1HBNB 2A2DA 1C0UA 2RQKA 2O67A 2NYIA 2R7UA 3LAKA 2RQ4A 1Y0HA 1XERA 3M1VA 4LQ9A 2Q66A 2EBGA 4YEAA 1TKDA 3QIDA 4WFZA 1S4FA 2BE2B 2LEPA 3HHKA 4UOCA 4YHHF 3H5YA 3I0SB 1FE0A 1WG5A 4LF8F 3MUMP 1S1WA 3NMRA 4DMZA 4HKQA 2GNKA 2DITA 3M8SA 2JX2A 1DBDA 2RQCA 3W2VB 1HNIA 3FZBA 2LEAA 3N6LA 3R5DA 4IH6A 4U7UK 1ZTTA 4X4UA 4DFPA 1JK9B 1RT1A 1JLBA 4CI0B 4ED6A 2LU1A 1K8AT 1AW0A 1KQFB 4AE5A 4QIWD 3LH2S 1IQTA 1HW8A 4WU2A 2JOQA 3CCRS 4TQSA 2QLWA 1AFIA 3HHLB 1P8GA 2CVIA 2LU2A 5J1NA 1F2GA 3C46A 4AQYF 5AJ3F 4WE1B 1S0MA 5AXLA 4F4XA 3SSRA 1UEVA 3HPOA 2EW9A 2E9RX 3R27A 5G0RA 3BGLA 4LVOP 2PMZD 2XSJB 3F44A 1TFWA 3ZZOA 1JLFB 5M2UA 5F8NA 5U47A 1RT4B 3B8HA 3GWCA 5F9NA 1OWXA 3MM9B 5FDLB 2W9BA 2FVCA 4QBUA 4A8MP 2XNQA 4WYWA 1FXDA 4DBQA 2RJZA 5E3RA 2HHSA 4QJVA 1S6QA 1KQGB 4BWMA 1FJCA 2WK4A 3DRSB 4ILRA 2OTJS 3PEHA 4WFAQ 1VRUA 2FHKA 2E29A 2HLTA 3P96A 2I5JA 3DM2A 4G1QB 4K5RA 1HYSA 3O2IA 5LJ3Y 3I87A 3OVAA 2FD2A 2LKZA 4ED8A 5B08A 4ES2A 2UUTA 2JEGA 2E7WA 5F8JA 1CG2A 4MKYA 3AH6A 2BR0A 2R8IA 1CQMA 2VG5A 4QCLA 1OSCA 1BQNB 1S9GA 4KIAA 3UCGA 2BQUA 1SJ4P 4ECYA 1K73T 2GA7A 2CQ3A 2LQ5A 1TV6B 2ZH4A 4DFMA 1NK0A 4OZ0A 5MAOA 2HMIA 4DLEA 4CCHA 1WHVA 3QJLA 2G1DA 2PSZA 2MHNA 3AAWB 4OX7A 3BQ0A 3DRPB 3FFIA 4QW8A 5E3QA 5C25B 1E6VB 2CYYA 2NSBA 1UA0A 1WTFA 1TL5A 4M5DB 5KFQA 4YOEA 4DR2F 2W4PA 3QYYA 4RNNA 3I32A 3MR3A 1C4CA 3CE8A 1DQAA 1C4AA 4OX6A 2W25A 4ED2A 4LF9F 1T7PA 1SI9A 1AROP 2IJNA 4HLBA 4J9PA 4HVZA 1YG0A 4P7TA 3S01A 4WXWA 2YNFB 1SKWA 3SFGA 1AUDA 3BS9A 4EYHB 4DL3A 1RTJA 1KS2A 2VFVA 5KG1A 3KK1A 2EG2A 4NPOA 3I9ZA 4OI6A 2DCUB 3K57A 3QZ8A 1DRZA 4IOAQ 1X5TA 1WF2A 1U1OA 1VQKS 2V4RA 2VFTA 3JYTB 4FPRA 2GO9A 2CG4A 2C2EA 5DDOC 1YBAA 4X4QA 4NLQA 1U1PA 1RKIA 3MI7X 4OX9F 1HA1A 4TN2A 3S8SA 4N76A 3O8WA 4K4YA 2CPJA 5ADZA 5KT6A 1U26A 5EWGA 1YHQS 2M3DA 2JEJA 4I0WA 1X4HA 2DK2A 4O4RA 3OSNA 4IFVA 1EETB 4ZPCA 5D8HB 2ILZA 3K5PA 2HWHA 2YVSA 1TL3B 5KFTA 1D8ZA 2MGZA 4LF6F 1FD2A 2RB7A 2CRLA 3MM5A 5GAEU 2WSCC 4O3OA 4F4YA 2AX0A 1RK8A 1W25A 3KLGB 5KFYA 3BO4A 2DD8S 2PD1A 3TAMA 2E5LF 4FXWA 5GAGI 1W2BR 4JBCA 4MTPA 1IKYA 1R27B 4HL9A 1XMBA 1FKAF 3MMCA 1XMOF 4EBCA 1G6BA 3QGIA 4EWTA 3I4HX 2DTJA 2YKMB 1JKHB 4X4TA 2V5HG 3IAM9 3ZFVA 2FJBB 4NLWA 3BREA 5CCMA 2OMLA 4NZ6A 4B9NA 4IKAA 4JV5F 3RBEA 3VF0B 2GMHA 3GG1A 1HBMB 2EFVA 3MD3A 3KTQA 3DLKA 3JSBA 1AXQA 1TKTB 4XO0A 2EFQA 1UL3A 2BUNA 2R7QA 3I5CA 4DL2A 2XI3A 2PFFB 1CPZA 3PXGa 1V9OA 3HDSA 4C0BA 4ERDA 2N7YA 3K0JA 3EZUA 3MD1A 3JSRA 2MMYA 2LDIA 4DV3F 2DIVA 3H5SA 2M7SA 5HROB 1FKOB 2KKHA 3OR2B 5B7WA 2KFNA 4OLPA 4D3HA 2LQJA 4N8NA 4UW2A 5KOWA 3DOLA 4YMEA 4EZ9A 1RWUA 2QMXA 1U09A 3IFEA 3CCVS 1UVNA 4PCQA 4I6AA 2FTRA 1HI0P 2L9NA 4I6YA 1N0VC 1JLGA 3P6YC 3W2WB 5GAHI 3O5TB 4I2QB 4Y28C 3Q22A 1N5YB 3JSYA 2HHQA 3CCUS 4TU9A 2GHVC 4B9VA 5KFKA 2VPWB 4QR2A 4EO8A 2E1AA 4RW7B 3A8EA 1N0UA 2JFKA 2FLOA 4LIWA 4PG4A 2CPDA 2B7BB 4ZK7M 1JB0C 3LGNA 1XC9A 1UFWA 2NREA 4IO9Q 3RB0A 2HNDA 4B17A 5ITHA 3BQ1A 3DOKA 1XBWA 1VK8A 2XLIA 1URNA 3H59A 3G6XA 3M6UA 3D54A 4RW6B 4YB1P 2XO7A 1FVSA 3QO9B 2XLKA 3DN9A 1Q4RA 2HFOA 2I38A 2XMMA 1HNVA 2VPZB 1QE1A 3I5AA 1KVJA 1KTVA 4MFBA 1R0AB 4ECZA 3MFIA 3U7JA 4RW8B 2LYVA 5EWFA 3UCZP 5L1LA 3GV8B 1P9QC 3L3CA 5HBMB 2QSFA 1KQSR 2ZOGA 1FTCA 2YKQA 3AQPA 2DVIA 3OTOF 1X4AA 1NH7A 3TVYA 2KJVA 3FCHA 3IGNA 3M30A 2XCPA 1A9NB 1VJWA 5KG0A 3H40A 2HYIB 4Y6IA 2PEHA 4IG3A 4Y34A 4OI0A 3K7RA 2R2RA 1X4GA 4X65F 1T02A 3MAHA 3LOUA 2HQ3A 2EFPA 5D77A 5E2QA 2HW3A 3B4DA 2ZHBA 1FE4A 4ZPTR 2J0SD 1C0TA 3AB4B 4AL5A 1CC7A 3CT9A 4O4GB 2EPIA 1VRTB 2GMLA 3GR1A 2DGTA 2V4JA 2MXYA 3HHDA 2KYXA 3MDFA 4HT5A 1JJHA 2CIMA 2JLFA 1S7HA 2FIUA 1HMVA 2KZZA 1IJEB 1HI8A 1N54B 2X1FA 5J2NB 2HHPA 4NCGA 1RT5A 1SB6A 3SMZA 3KMQA 1S97A 4R8UB 2XSFA 3QJPA 1M5HA 1SH3A 4IOBA 3KLEB 4Q8EA 2DJWA 3UWTA 4Y0FA 5EX0A 2OJ3A 3LQVA 1N5TA 2ZH1A 5IQQA 4OL8A 2UVUA 4ECVA 3EUNA 5F9LA 3NAIA 2CQBA 3MM6B 3NCPA 1VC6A 2L48A 2ZBIA 4BHQA 1KONA 3S6EA 5A8WB 4BC9A 4RWWA 1O8BA 4NWBA 4RW4B 4O3NA 4J9OA 1WEZA 2PA8D 2C2RA 3I55S 3NGDA 3M4XA 2HS0A 4ZPAA 1HQEA 4DDFA 4C8KA 3EPGA 4JV2A 4QWDA 1D0EA 1ELOA 3MM7B 1JLQA 3PNIA 3QGHA 4I1TA 3SSSA 4DV0F 3MMBB 3O44A 3O3LA 2L9WA 2VB6A 2E44A 3KK2B 3DLGB 4AL6A 1HBUB 4KO0A 4WCEQ 4RU2A 2Y0SD 3D2WA 4BC7A 5KAKA 1I6JA 2ACYA 2RRNA 1S0VA 4M1KA 4K4WA 2P9CA 2YNGA 4JI2F 4ATNA 4IR9A 4GKJF 3H5XA 1VQOS 4WIIA 1Q16B 2BDPA 2AD9A 1VS3A 4ECXA 4LF4F 2PGCA 3NGKA 3TR5A 3ZZPA 5C42B 1OO0B 4BCAA 4DN0A 3HHEA 4R5PA 4Y3CA 4ZVFA 3D28A 2DR5A 5AE1A 1FK9B 3KLHA 2R8GA 1R8HA 2DNZA 2GQQA 7FDRA 1RT3B 1IKWA 2UU9F 4ELTA 3L7PA 1R6YA 2HNZB 1T05A 1H2VZ 3ZZ0A 2E1MC 5D4OA 3N9UC 4KR0B 2VD3A 3MECB 2ZD1A 4UQTA 5E0OA 3QZ7A 4GO5X 3LP0A 4EU0A 1S6PB 1IKVA 2IC3A 2M52A 2PIIA 2PI5A 3IA0A 4RKUC 2VQFF 2B9XA 5SUHA 1Q53A 4ZP8A 3HO1A 3LP2B 3H4DA 2DPJA 3I31A 1SUQB 3IWXA 2ZH3A 1R43A 2DO0A 4KTQA 2Y1IA 2Y1JA 1DURA 4ED7A 4K2XA 3OLAA 3WC2A 5A0YB 1U8SA 3MUVP 1X5OA 1TP7A 3PX6A 1NKEA 2J9DA 3KNGA 3KHGA 2F40A 1S1TB 3OL7A 3FEXB 2HGMA 4DR3F 4ILMA 3BN7A 2YNHB 3VAGA 4KT0C 1RI7A 3PV8A 3OR1A 1JLCA 2R7VA 2FVPA 3CVKA 1N33F 4ZHRA 3OUYA 2WAQD 2IRYA 2MDAA 3L09