2UU9F

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gug-codon in the a-site and paromomycin.
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RRNA
total genus 23
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2uu9F00
4DV4F 4LFBF 2UXBF 4LF7F 1IBKF 2RJZA 5LMNF 4B3TF 4DR7F 1N33F 1G7CB 2E5LF 3ZZPA 4LF6F 4LF9F 4X64F 4DV1F 4LFAF 2HHHF 4DUYF 2UXCF 1LOUA 2J5AA 1CQNA 3T1YF 4DR6F 3OTOF 4DR2F 4X65F 4DV0F 2KJVA 4GKKF 4DR3F 1HNXF 2B7BB 1I94F 4DUZF 3R3TA 4YY3F 1CQMA 4X62F 4DR5F 4X66F 1IBLF 4JI8F 1HNWF 4LFCF 1FKAF 4YHHF 4NXNF 2UXDF 1XMQF 1XMOF 4DR4F 2BVZA 1XNQF 4JI3F 4DV2F 2UUBF 1VMBA 1FJGF 1IJFB 2VQEF 1J5EF 2UUCF 2UUAF 4B3SF 4LF5F 1HR0F 4B3MF 4JI6F 5AJ3F 4JI7F 3T1HF 4JI0F 4KHPF 2ZM6F 1F60B 4DV3F 4AQYF 2BXJA 2YY3A 4NXMF 4LF4F 1IBMF 4DV6F 2VQFF 4JI5F 4JYAF 1B64A 1XNRF 1QJHA 4DR1F 1IJEB 1N32F 1N36F 4LF8F 2B7CB 4DV5F 4JV5F 2F4VF 4JI2F 4DV7F 1N34F 1HNZF 5IWAF 1GH8A 5BR8F 5LMUF 2UU9F 1G1XA 4GKJF 2KJWA 4OX9F 4JI4F 4K0KF 1RISA 4JI1F 4B3RF
chains in the Genus database with same CATH superfamily
1HBUB 3JXOA 4AL6A 5IM0B 1NBEB 3OV7A 1DURA 1MMDA 2AIRB 4EBCA 1RQ0A 4DQRA 4M5MA 3I5BA 3NY0A 1RT7A 1WC3A 2IDLA 1TAQA 4NLOA 4OX7A 2GGPA 3OHAA 1I51B 2R8IA 1PO6A 4MK9A 1JLQB 3OFHA 2PC6A 1NB2A 2ACYA 2HS4A 3QGHA 3NKYA 3R5BA 4O4RA 2ZOGA 5H9EJ 1LK7A 3K89A 2XZWA 3A3NB 4ZVPB 1XMOJ 1XK8A 3C6UB 2W1BA 4OYIA 4C11A 4AL7A 3PNIA 4Z2XA 3MXHP 1VI7A 1Q78A 4ZCLA 4F4ZA 1L3SA 2DR9A 4OHWA 1C2PA 2E1AA 2CPDA 2MJUA 2I8EA 3BJYA 2ZNZA 1RT6B 1S57A 4BC9A 2G0JA 2XMWA 2JRSA 3LUYA 2R7SA 1WDDA 3QO9A 4C8KA 3I82A 1DHMA 2ILYA 4C0HA 2J0SD 3RBDA 4IFYA 5IXUA 2KO1A 3DRRA 4DCPB 4KHMA 3D68A 3T41A 2XS5A 1RP5A 3CC4S 2ATCB 1VQOS 5KFZA 4YR0A 2ADBA 1SUQB 4MKBA 1NAQA 2DGUA 4YHHF 2R7WA 1SIWB 2UVWA 4PAAA 2VV5A 1R7IA 5KT2A 2B6AA 5HLFB 1CVJA 1UAWA 4QWBA 3BSOA 3A4TA 5KFUA 2E66A 4ZVTB 3MEDA 1PGZA 2ZJQQ 2VODA 2AYGA 1PBUA 1RABB 4WKYA 1FERA 2QTWA 3OTEA 4LVOP 4GKKJ 4EZ9A 1P9YA 4EI2A 3QGIA 2XCPA 2FJVA 1EB0A 2C2NA 3DLEB 2XZTB 3N6NA 3DXSX 4OHZA 3MR6A 2ZZMA 5F8HA 2IJNA 2MKSA 4C8ZA 1U0SA 3VF0B 3MUTP 2U1AA 4EUVA 3SDEB 4QJVA 5F9NA 2BJDA 3L4BC 3W63A 1P8GA 5DDQC 1MNEA 3MZIA 4RO0A 3RJMB 2ZUAA 2MZSA 1YBAA 2XNQA 3D54A 2AT1B 2G0IA 4ZVQB 3JAMY 5JMNA 3U1LA 1NO8A 4CWBA 2CNKB 2H65B 2YH0A 3OFEA 5F8IA 1DZ5A 4X4OA 2CJYB 3G96A 3BKTA 1EP4B 5IQ6A 1T03A 5KG3A 3OVBA 2V2VA 1K8AT 3LPYA 5J1EA 3JQKA 4O3SA 5IT9U 1YZ7A 4PKDB 4WCEQ 1X60A 1M90T 4FF4A 1S12A 5FD1A 1FK9B 2GVDB 2CA9A 2R2UA 1SL2A 2HHQA 1JLEA 3MHYA 2HFUA 4TU9A 2W9BA 1VQ7S 3VHQA 4JI5F 1N5SA 3UNYA 1GFWB 1ZPVA 2D1CA 4G65A 4LR8A 3PZPA 1CC7A 3CCWA 5ETSA 4F8RA 2HKEA 1DTQA 2P6TA 5C2GA 5I42B 2CNOB 4O23A 4DSLA 3PO5A 3OJUA 1RU1A 2UVVA 3CCUS 3M30B 2J0XA 3HP6A 3BO2A 3FFIB 1GXTA 1X4BA 3M8WA 1WC0A 4NLDA 2XM3A 3TARA 2OMLA 2F1FA 1K47A 2GIFA 3O2IA 2DR8A 1G1XA 3X3UA 1ACMB 2JC1A 3MECB 4ECZA 1UKUA 1U0HB 2N4DA 3AD8C 4C7QA 1PILA 2WZ1A 3VAGA 3PX4A 1U1QA 3C46A 3ELHA 3LP0B 2BABA 2BMBA 2V69A 3L09A 1HPZA 1UMJA 2LQBA 2AW0A 3B6BA 3VVTA 4R25A 2FJXA 2LU1A 4YHHJ 2WAQD 3QMQA 2QLJB 2DB1A 5IZHA 4KKOA 2VL1A 4LBHA 4PG5A 1IBKF 2IJRA 5DG8A 3H5SA 2W4DA 2OPPB 4E2FB 3MD1A 4FYVB 4C9DA 2MY7A 4WZQA 1S77D 3I0RB 1G7CB 1S9GB 3UCZP 1S59A 2DXFA 4DN0A 2BA9A 4DV1F 2YH1A 3IM8A 1YRXA 1KFDA 4I6YA 4F3QA 1FE4A 1S1TB 3ENVA 3WDOA 4ZLLA 5EHHA 5GMKa 1BWEA 2KYXA 1NHUA 4DOZA 2HHUA 4KIAA 2AD9A 2KXFA 3GWCA 4KAIA 1W7WA 3E8OA 1VRQC 2WSCC 2MQ8A 4M5NA 2KFYA 2UUCJ 1BQNA 2EK6A 3DU6A 4IRKA 2FDNA 2QYCA 4GMKA 1AUDA 1WOPA 4UTGA 2FZKB 4ZN1A 2AJ2A 2VBXA 3KK1A 1U0HA 4C97A 2KG0A 3BPDA 4M5IA 5D0RA 4CYUA 3KHHA 2ZFHA 3FEYB 4OYAA 5J1NA 3W5ZA 3IGNA 1NPRA 5KFDA 4GC6A 1HBOA 4NZ7A 2OPSB 4RR5A 3DLGA 4WFYA 4OHYA 4KGMA 3W8PA 3W9JA 1S6OA 2BV3A 2R8HA 2RDDA 1SB6A 3W2VB 1FKAF 1KDNA 3QZ8A 2QG9B 1HARA 3V4MA 4P2XA 1HNVB 1VQ8S 3QJJA 1AUSL 2DCLA 3FQKA 2J0WA 5D0HA 4LSNA 4ED7A 5KFYA 3NS6A 2ZE2A 4IH6A 5BYSA 4LF9J 2MQNA 2E5LJ 4U7UK 3NS7B 2WBRA 4UZCA 2DPJA 3QIPA 1TVRA 1S6PB 2DGTA 2GQQA 4J9UE 2YWEA 2CZ4A 4Q8EA 2W24A 1HQEA 4JI8J 5CH7B 1CJTB 1V5IB 2V6AA 4I7FA 4TKTA 3BBBA 5CHCB 1TKZA 4H4OA 4DPUA 3BN7A 4RUHA 2BE2B 1UWBB 5D78A 5EWGA 2CZVC 3IRXB 2XY6A 3W9IA 1HR0F 3DOMB 2AP6A 4ID8A 2J9CA 5IOLA 1H7XA 3PHTA 4EMDA 1UPMB 4NXNJ 1KLNA 2HHVA 3MEGA 3MI7X 3DYAB 2GAGC 2XHCA 2B56A 3MPDA 3PCOB 4CO5A 1WHWA 2M3DA 2MQQA 4KFBB 4ED0A 2CPFA 2RQMA 5A2QU 5C24B 3DLGB 1PC5A 2HFOA 4NEZA 1IBLJ 1KKHA 2OELA 2V5HG 5E3QA 3TJ9A 3W66A 2BYCA 4WE1A 4NCAA 2EFGA 1AXQA 2HNDA 4PG7A 1CULB 3HZEA 2IAJB 1CJVB 1UJ4A 4M1KA 3MD3A 1QVGR 1TL3A 1F9FA 4BHQA 1IM6A 1WEZA 4TY8A 1IWAA 1HIYA 2RF2A 2MQMA 2QRRA 4ZLNA 1UP1A 1S7IA 1GQEA 2ZC4A 3V81A 1Q79A 3AJ2A 3ENAA 3MM9B 3VWSA 2W7PA 3UDCA 1S0VA 3R6LB 2EFVA 1ZA1B 3ITHA 3E01B 4RBVA 1Y5NB 3ETMA 4ZN3A 1Q8BA 1S99A 4NLVA 2HQCA 1PAEX 2PT0A 1FJCA 2WSEC 2RQKA 3EYZA 5K5MA 1OQ6A 2A2DA 4Y2MA 1NXIA 3CCJS 1OSDA 5M2RA 4WYLA 5HATA 3CJKA 1VCTA 2G2OA 2B9EA 5CYJA 3NMRA 4JOUA 4ES1A 1OY9A 2OHDA 4K0KF 4J91A 4DL2A 1G3OA 4ED5A 3G82B 1BQMA 4DUYJ 3G6YA 1U1PA 3HF5A 3OJSA 4A8OA 3DXBA 2AJQA 2ROEA 4CP5A 2WVEA 2ZHBA 2RT3A 1SI9A 2APOA 4LF7F 2HBZB 2KXHA 5I3UA 2AJFE 3OLAA 2KVIA 5RUBA 3OSNA 4DR3J 4JI2J 3GIJA 1RTJB 3K7RA 2LXFA 2FC9A 2QN6B 2YNHA 3MM7A 4RW4B 4URSA 4J9SA 1A0OB 4NI2A 2GJ2A 2QIFA 1IKVB 2DGQA 3WBZA 2IIHA 1XNQJ 4HT7A 3H5XA 2XMMA 4DR6F 1NZAA 4TLRA 4KPYA 3M9NB 2N3OA 3U7JA 1N0VC 2HVDA 3KUGA 1FK9A 2GVDA 4OMFG 5D4NA 2DH8A 2RDJA 1DFDA 2KU7A 2KJVA 2XQCA 2AYEA 4KRWA 3HHKA 4C2MA 3H5YA 3CCSS 1HNXF 2FTRA 4N77A 3CW2C 4NLTA 2GAHC 4YN3B 5GMDA 4DHVA 4DUZF 2G4BA 4ECVA 2ZH1A 1IBLF 3H2LA 3IWNC 1H2TZ 2PGCA 3D0IE 5L39A 2R7UA 1JWWA 2FLPA 1RTIB 4ZHRA 3MM5A 3LALA 5GAEU 4PXDA 2DNGA 3TZWA 4F50A 4ID5A 2ADCA 1GEHA 3DDIA 5J2PB 1R3NA 1EETB 3TAQA 3R1LA 3GIRA 4ZVGA 1TU0B 5B0CA 1X5SA 5HVFA 5KT5A 3M9OB 3CDAA 4UUWA 4HHUA 2FLLA 3M4XA 1REVA 3MR5A 2CVIA 1Y00A 5ETTA 4TU8A 1TKTB 4Q43A 1AFIA 4UOGA 3PM9A 5CQGA 1H73A 1PG5B 2A18A 2HNYA 3M8PA 1WSRA 2LEBA 2D9PA 5CYQA 2ZH8A 1Y11A 3OSPA 3G8QA 4DL4A 4NLQA 4ANCA 1VHFA 3WIVA 3QZ7A 9RUBA 1HQUB 1VQKS 3ZTQA 4UZBA 1ICEB 1I6JA 3GILA 4CLFA 2XI2A 4JI0F 4M5LA 4YR3A 3JB9k 2ZM6F 3CJQA 3UWTA 5DM6Q 3FCVA 1CJVA 1HMVA 3G82A 3IBCB 5IC4B 2XEXA 2CPEA 3BGFA 3BM7A 4FBTA 2FJAB 4OX9J 3F44A 2BRLA 3Q83A 5E3PA 2KG1A 3IWLA 1Q5VA 3TNVA 3ZZTA 5C42A 2VPWB 2ZJPQ 1BD6A 1RT4A 3WZ0A 4DV2J 3HHNB 2F4FA 4E8UA 3RR8A 3CCLS 1TQLA 1VOMA 2R7TA 2VOPA 2FLNA 3HVTA 3HO1A 1Q5YA 2CADA 5KT7A 2ROGA 5C42B 1RHKB 1RAFB 2VZ9A 1ZPWX 1HBNA 3DOKB 1NDPA 4IG0B 3WQPA 4LRCA 4B17A 3VAJA 2X7IA 3J7YI 3PW7A 3THTA 2KZZA 5KG4A 1S1XA 1SQGA 2I9SA 5KG1A 4ZVHA 1K0TA 3DOLA 4LFAJ 2F4VF 4MJKA 3OR1B 1VBKA 4D3GA 2W7OA 4HLBA 1R8PA 1WEXA 2ZUGA 4F4AA 4TLQA 3W62A 3TZXA 4USWA 2ZH4A 5GAGI 1ROFA 5J1EB 2KJWA 4M5HA 2FHOB 3CMES 1T0TV 2ASDA 3CCRS 4PRFA 1F3VA 4QWEA 2CQ3A 2V8PA 3TZZA 4XO0A 1D8ZA 1RWNB 3PRDA 4QOTA 4NMXA 1JXEA 2UV8G 3QAUA 3GPAA 4CCHA 2VFSA 4MFBA 2JLEA 2WVBA 3KXDA 1GXLA 3M6UA 5IT0A 3KLVA 4NYPA 1NDCA 3H20A 4C3MA 5BXIA 4DQQA 3MFIA 3NMAA 2B8QA 1YJVA 2V34A 2W2QP 3F0NA 3BBCA 1BXNA 4DLEA 3PDNA 2IM1A 2BEFA 4QR1A 1IR2A 3V4IA 3MM8A 4QPTA 1NLKL 2EBEA 3DMJB 3W5XA 1KONA 3TVZA 3T9ZA 3DOKA 2EFPA 2HRTA 2P5VA 2VG7B 1H6KX 1XC9A 4X2BA 1FFSB 4W92B 3PW2A 4PQAA 1YWXA 3GG0A 3BKFA 2XSJB 4OHVA 4P75A 3C15A 1WHXA 4PYAA 1SL1A 2GVZB 3I0SA 2L48A 3NEKA 1MN7A 1Y3JA 5EUHA 4F0KA 1HWJA 1SL0A 3N9UC 2R2SA 4RPFA 2QLBB 2R42A 2M4MA 3MCSA 4P7TA 1TFWA 3HKZD 1T11A 2AV5A 3HHLD 2Y3YA 4DV0F 3FZBA 2BDPA 1TMMA 4NE9C 5L1LA 1QSYA 2OFHX 4ZIVA 3MEKA 4EO6A 4K7QA 5CA5A 2VU5A 3S6EA 1NSKL 2BOPA 2XB2D 1Z2ZA 3ITHB 2VUGA 1APSA 3E01A 3MMCA 3RB0A 2NXJA 1F6TA 2VG6A 2EPIA 2DGWA 3R5CA 5F3TA 3H5UA 3ZZUA 4DR4F 3PW5A 4USKA 4OHXA 4DR6J 7FDRA 1IM4A 2P8IA 4JI3F 5L1JA 2HHSA 2MEWA 1MWQA 3D0GE 4ZOSA 1S10A 2OEKA 4NLSA 1GTHA 2PEBA 2PA3A 3CUNA 4ECRA 4H4MA 4NXMJ 3GB0A 3I9V9 1FKOA 1HLWA 1UL3A 5FDLA 1RA7A 5KFLA 4URGA 5ITHA 2ZOMA 1BQMB 1S9EB 2X51A 4WU3A 1LW2A 1S1XB 4PR6A 5E33A 4QWDA 2A2CA 5J1PA 3HHLC 1VJWA 2YQ0A 5C2CA 5HMWA 3MAAB 2MZ1A 4B3MF 1WD6A 1Q7YT 2M9KA 3CSKA 1SVDA 3AODA 4XTTA 3PTWA 2P9GA 1HBMA 3TWZA 3WHIA 4X4RA 3I87A 3Q8QB 3KK2A 1LK5A 2GHPA 3OFGA 2LMIA 3P3DA 1J5OA 2YX4A 3CULA 2FHKA 4ZVUB 1SC6A 1CJTA 1RHJB 2K1RB 2KHCA 2YKNB 4ZP8A 4N47A 3TAMA 3W65A 5CCLA 4DQSA 3KYLA 2DPIA 2DY9A 1RT5A 2GMHA 2HRUA 3C14A 1YDLA 4H54A 4X4TA 1KR4A 2OSQA 4MFBB 4ANEA 4Q0BB 4LREA 4AQYF 1Y9OA 4ECQA 2DGVA 3M2RA 1EP4A 4QR0A 1T03B 1D1UA 2OAUA 2VBYA 3QT6A 2BANB 5KTQA 4NXMF 4IRDA 1U7LA 2YX1A 3OL8A 3NXZA 3Q8UA 1QUVA 1CJKA 1RTHA 3FKBA 1MWZA 3T5KA 2DNNA 5ETVA 2QT7A 1C0UB 4OX6A 4JI6J 2HVHA 4IR1A 4FN5A 4LBIA 3BGLA 4WE1B 4TU7A 3V6DA 4YOEA 3PFOA 5F8LA 2CPYA 5HJXA 3ZTSA 2MGZB 2UUAJ 3RB3A 5F0WA 2LEAA 4KFBA 3QT7A 4K4WA 4TY8B 2DNRA 2JVOA 1U09A 1NJYA 1HNZF 5B0AA 4CZCA 3MMBB 3DGVA 1RAAB 2EXUA 3Q8YA 1RHMB 3ZO7A 2K7KA 5AXKA 4UOHA 4CIOA 2MHEA 1XBWA 2GFFA 1FT8A 4FNHA 2C22A 4ZVFA 1RHQB 2HBQB 3CJSA 2F63A 3M2RB 4NX9A 1YVFA 3DMJA 1HA1A 4CT8A 2W8KA 1F2HA 3PACA 5CCMA 1R0CB 3KHLA 4PUOB 1XNRJ 2NXUA 3DOMA 3BDEA 4YS2A 3KOAA 2BKOA 1T3OA 1TL4A 3VGTA 5HL7Q 5IV4A 4U7UD 1R31A 1M1KT 1BWVA 1FVQA 2V68A 3C19A 5F8GA 1TV6A 3QQCD 2ERRA 4X4VA 3ET6A 5HAOA 4TVAB 4KO0B 5KFRA 4ZK7M 1YKWA 1S6PA 5LM7E 3VGSA 4DPWA 3M8ZA 4KR0B 4XDCA 1VK3A 3W61A 4DX8H 4J9LA 4RWXA 1NB7A 1KQSR 3A8IA 2KFZA 2IVMA 2RRBA 2DIVA 5A8WA 1YITS 2GJIA 4DF4A 2RHQB 3BN4A 4ZPAA 1N56A 4DPXA 4F4WA 2JWNA 1SCJB 1FDAA 2CAJA 5BJRA 1HWKA 3S8SA 5IWAJ 1HD0A 1UWAA 4F4KA 5JJBA 2XYHB 3IBFB 3OXGA 3IR5B 2ZVSA 2EW9A 4PWWA 2E7WA 1HBMB 3SEOA 5L8RC 3J7Z5 2Q79A 1EARA 4H4KC 3U27A 2L08A 5JXSA 4DL7A 2JEIA 2DK2A 4DEZA 2CJXB 5HBMA 5A6WA 2ALYB 4KTQA 3I56S 3CJ4A 2HS3A 5KFMA 1XR5A 3T1HJ 4OZ3A 2AYMA 3SCLE 2D3ZA 1XMOF 3W2WB 1FD2A 1NH8A 3KLFB 2Y1JA 4WKRA 2EK1A 4OJ3A 2GA7A 4YDXA 5B0FA 1VK8A 4EU0A 1D8YA 4B9MA 2FGCA 1RWXB 5KFVA 2XY5A 2J8AA 4A8XA 1TL1B 4FVMA 4ANDA 4CLKA 3GCXP 2L9WA 2XGPA 2B9WA 1U6ZA 2K8GA 2ZBQA 4CLLA 3UCUP 3BR9A 5DDPC 3QATA 2E29A 2VKRA 1N0UA 2RE1A 4GVBA 4MH8A 4OZJA 4I2QB 2KYZA 1QAJA 5IC6B 2MZRA 4N56A 3HPOA 3PO4A 4LF5F 3D1HA 4CLWA 5AE2A 4G1PA 2E1CA 3EGZA 1P1TA 2HLUA 3NCPA 4YB7A 5EX0A 3TAMB 3VGVA 2YNIA 3OHBA 2IVYA 1FJ7A 1O51A 1NPKA 3MAQA 3IBWA 2IHR1 5IT4A 4C4WA 2HQDA 1C1CA 4KHPF 1XWLA 2DR6A 2NCKL 3SCJE 4X66J 6FD1A 3FCHA 3JS9A 4LSLA 4BBYA 4EWTA 2XS2A 4DG1B 2M8DB 4AL5A 3JSMB 3EZUA 2RRAA 1OO0B 2BXJA 3K8VA 4EFAC 1RCXB 4NYZA 3CD6S 3B8HA 1OJ4A 2BZ2A 2F5GA 3OR2A 5E5NA 5J2NB 2DXEA 3DRSA 4DL5A 3NCQA 2FHJD 3JSBA 1D3WA 3OPKA 4PQUA 2DO0A 3I0RA 3PEHA 1FRXA 2V0NA 1BC6A 1IJEB 3EE3A 4ED1A 4WF9Q 4X4PA 1IKVA 2MZQA 1HI8A 3GTYX 3I4PA 2DNQA 4O44B 1N6QB 1VIOA 3NP5A 2NPIA 1RADB 3HX9A 1SKSA 4DLGA 1AA1B 2Y0BB 1Y10A 2R7XA 4K4UA 2L41A 5JVGQ 1GH8A 1JLGA 3LQVA 1B0TA 3QJLA 3FBFA 4FDFA 1IQTA 4F0HA 4DX6A 1F9HA 4P72A 1RACB 4CYUB 4DCJB 2W2OP 4WWSA 5HMXA 1S97A 3UDVA 3K5MA 2HFVA 2HRYA 3QYYA 4USHA 6AT1B 3OTOJ 1OIAA 1TZ0A 2QO3A 1LWEB 3ILIA 5K20B 1B7YB 3MPYA 2VG5B 3MM6B 3CGIA 1F1BB 4X84A 1EAYC 5KFJA 3POTB 1JB0C 4DQIA 2GQ2A 3UVJA 3C6TB 1RLCL 4J90A 1CG2A 3EICA 5E2QA 3BGRB 2XMAA 4X62J 1N5QA 1QY7A 2HK3A 3CTRA 4J9VA 5HLFA 1RBAA 4X65J 3MURP 3PX6A 1I5OB 1QE1B 2OTLS 4GVLA 2X3GA 4TXSA 3DGPB 5LXRA 4OLPA 1PYOB 2JHEA 3HHDA 4ECUA 2OPRB 5T41A 5M2UA 3JYTA 1XR6A 3CIMA 3IR6B 2J5AA 3TX0A 1JJ2R 5H9EK 3DHWC 3S1TA 3RU0A 5DDRC 4ZMMA 3AA9A 3PRBA 4QIGA 2GMJA 5D15A 1MWYA 2QMWA 1LWXA 3M8QA 3ZNJ1 1FFWB 2KRBA 3KJQB 4XIUA 1OPIA 2D69A 1PKUA 4C48A 1FEHA 5F8NA 1HQUA 1G2EA 4Y3CA 1H2UX 2YX7A 2WONB 2CQBA 1WSVA 4KHPJ 3VCDA 2UXBF 1RT3B 2QA4G 2XLKA 2VONA 5LMNJ 1SV5B 3CVKA 5K8NA 3KLGA 1SH0A 3OL6A 2ATLA 4Y2IA 3TAPA 2R7QA 1KD1T 1F5BA 5HQ8A 2V9WA 4KE5A 1LW0B 3GJSB 2PI5A 4C3LA 1B99A 4M5DA 2LDYA 3M1VA 1YJWS 1X9SA 2B9YA 2H5EA 4DV2F 2IY5B 4PPZA 2IVFB 1YQHA 2XLIA 4ILLA 1G6BA 2VFVA 3SQOP 3EZ5A 2VICA 5DO2A 3ZZYA 1NK6A 3ZZRA 1NMEB 1N34J 4ZP7A 4W98A 1GXUA 2A1BA 5KFGA 1RWWB 1R89A 4C6AA 2QYGA 2R7RA 4NA3A 2EBGA 1VGYA 1AT1B 3RG6A 4CLUA 1RXOB 3TRGA 2J9DA 1SJRA 3ZTPA 5HP1B 1Q8LA 4K4XA 2KT2A 1LEOA 2CNLB 1IKXA 2ZZTA 2OGUA 3QAEA 1KQFB 4F36A 5KG2A 1EIYB 3MAHA 5HN0A 2E9RX 4I67A 3GJTB 2BW2A 5I4MA 3D6TB 1IUJA 1F60B 1S1WB 2HHTA 3M8PB 3LP0A 4ILMA 3PJ9A 1RUSA 1HNZJ 3D0HE 5CYQB 3RRKA 1S49A 3ILJA 2FJBB 3E51A 4BDPA 3HT0A 4LSNB 1U47A 3MM9A 3M7VA 4I56A 1MU2B 3J81Y 5KG6A 2H48B 3DRXA 1BLUA 2YY3A 2JOQA 1WORA 2UUTA 3M1VB 4J9RA 1UA1A 5GAGU 2BQUA 1KQGB 1XEZA 3CD0A 4IYQA 3MTKA 1RTJA 2IM0A 4TQRA 3CMAS 4QPXA 4DR1F 1FDNA 4G1IA 1SQFA 2B9XA 4Y2CA 1J2VA 5D4OA 2ASYA 1A7GE 2QJ3A 2WB4A 5DLFA 1NK5A 1RCOB 2DGOA 1N36F 2MMYA 1Q8IA 4RW8B 1YG0A 2OUGA 3AJDA 4AQYJ 1UPPA 1WF1A 1VJQA 4DV7F 2VFUA 3R8YA 1N34F 1BQNB 3ZXWA 1IR0A 1S6UA 4F4XA 2WCXA 3CWJA 3GFZA 4MAKA 4DFKA 1FDDA 1JQGA 1NHVA 2HFNA 3GR1A 1X5OA 3MMAB 4LSZB 3UN5A 5LSRA 3GQCA 2A6OA 4QU7A 2YQ3A 2EC2A 3UNGC 3IGVA 3RUBL 3K5LA 3CPWR 4OI4A 4ZPVR 1KFSA 4DL0C 3GU0A 2OD4A 2CVEA 5GADI 4JYAJ 2NSBA 1JK9B 1UETA 3FBCA 4K5SA 1UEKA 4PZVA 5IQQA 5KFAA 5A8KA 2KM8C 3OL9A 1Y5IB 1HYSB 4I68A 5D0EA 3UR0A 4B9LA 4XPCA 2CWKA 3JTPA 1V5VA 5HMZA 4UOCA 1Y7PA 4MYTA 2IC3A 4EK2A 2KXNB 4UOFA 3KHGA 1DARA 2R4FA 1RT1B 3MR7A 4QIFA 1EKSA 3SCIE 4ZITA 3DM2B 3R1HA 2LQJA 3TUZC 4K4ZA 1VC5A 2HHHF 5HJYA 3T5LA 2ZVIA 2YWHA 3CT9A 4L73A 5GAHI 5KFIA 3BQ1A 5KFQA 4HI1A 1TK0A 4V19J 1XJWB 1FVSA 1DQAA 3KUHA 4K4YA 1K1SA 1RWKB 3OTOF 3AFGA 4M5GA 4LF1A 2V4QA 4DR2F 4OV1A 4K4TA 4FKXA 4CH7A 4ZJLA 2Y8WA 3D6FB 3HFKA 2NPFA 2ZBRA 4NLGA 2FJDB 5L38A 3QGGA 5F8MA 4O3RA 2B7BB 4FXDA 2C2OB 3MEDB 2ZD1B 3ZTRA 3CDUA 1RT7B 2RILA 3ZZOA 4YY3F 4X62F 1H2VZ 1WC1A 2IBOA 3MTJA 1RAIB 5ETOA 1HMVB 4OI1A 3WX4A 1HW8A 2RD5C 3W9HA 1T05B 2IM3A 3ZZ0A 1GK8A 3QNWB 4HR2A 4YUDA 3GIMA 6FDRA 4RNOA 1OY8A 2J8SA 3ENWA 1WJ9A 5KFPA 1RWPB 1ZA2B 2GZOA 1C0TB 3J7ZT 2M52A 3OXFA 1P1LA 5CABA 1CS4A 2YWWA 2G9OA 2X1BA 2FVRA 1WG4A 4U96A 2DNYA 2SXLA 3G2XA 1TKTA 5FIIA 3BYRA 1R0BG 4GO5X 2C2RA 1Q95G 2BE7D 3LH2S 4PG6A 4CT9A 3D66A 1HPZB 3AJ1A 5B08A 1KVIA 2LA4A 1DLOA 4DI6A 5GADU 2JL9A 5CYMB 3HXMA 3NGDA 3RW6A 1I94J 4J9PA 5D3GB 2E5GA 4LF8J 2ZC3A 3VV2B 2JZ5A 2LQ9A 3Q86A 4MKYA 5SUHA 2CG4A 3D3BJ 3M8YA 3P6YC 1Q0NA 2JC0A 3V2UC 3MUMP 2DNKA 4B9SA 3KJFB 4DMZA 1RA6A 4DS4A 2LP4A 1RAOA 1EX8A 1S9GA 1AB8A 3I9ZA 3VQSA 2YVSA 1YIJS 1TELA 2K7JA 2UU9J 2BQRA 1SXLA 2Q3PA 1SPBP 3IRXA 4IUFA 3DN9A 4B9NA 1A9NB 4IH7A 1FCAA 3RB4A 1PJ5A 5IM0A 2JEGA 1RJJA 2BM0A 3ONQA 4P74A 3FSXA 4PG4A 2DNMA 2FJWA 5A0YB 2UP1A 2UXBJ 1C0TA 2F8HA 2A3JA 1R8AA 2CQ0A 2YNGB 2XMKA 3EVOA 5HQMA 3QSIA 1XNRF 1RE1B 4Q2MA 1RB0A 1W2BR 3GZ7A 2P9CA 4RW8A 5K9FA 4USVA 1S76D 3TEGA 4RU2A 2WOMA 3QBCA 1N32F 4RUCA 4ED3A 4QWAA 2MKHA 5THWA 4KV8B 3WX8A 4LF8F 3G86A 4HT5A 4ZPCA 1SJFA 3FDSA 3K2YA 2AJ1A 1SH3A 2VA3A 2KH9A 5J2NA 1R8BA 4RW6A 2LYVA 4Y00A 4ED2A 3R2CJ 2QSWA 2Z2LA 4R5PA 2UU9F 1FXLA 2VDHA 1LV5A 4OZ0A 5IT9Y 2X1AA 1Q16B 3AQPA 4CO4A 1U6BA 2UV8A 1RISA 4R5PB 4DS5A 2DH7A 3AHPA 2MZJA 4PXCA 3SQGB 4U6PA 1JLFB 1HWUA 4I69A 4RX6A 4NZ0A 5JUMA 3CXCR 2MY8A 4IKAA 1WWHA 5LOQA 2O3DA 5L9XA 4A8KA 4Q45A 4PYDA 3HI9A 3BPSP 2NYIA 3RW7A 1KQKA 3IA0A 2V4RA 3CJKB 2IMWP 2HBRB 2B6AB 3BGOP 1ZM9A 4U8YA 3MR3A 2FHJA 2ZZNA 4QIVA 4DL3A 1SUQA 2AX0A 1NH7A 3DYAA 2D3OR 1FRIA 3Q24A 1XR7A 3AB4B 1Q86T 1GX5A 2FYXA 3IXQA 5GAHU 2UXDJ 2CPIA 4KC5A 4OX8A 2HWTA 2XZDB 4HEA9 4IDKB 2RSQA 3ISZA 2Q43A 3BSNA 2DEJA 4KGZB 1X8DA 5DZ6A 2LXIA 1Y0HA 2QEXS 1TL3B 2F40A 2CNNB 3D6HB 1UJ5A 1VQ4S 4WFNQ 3QSYB 4FS1A 4ES3A 3F41A 5D4LA 1X31C 2EFNA 3DDNA 1FJGJ 2C3OA 3PXGa 2E5IA 2JEJA 4FXWA 1ELOA 1KTVA 3EDRB 2BJ1A 1OSCA 2K1RA 2YKNA 3JSRA 1CJUB 1JJHA 3UN3A 3W1YC 3EVMA 4OI0A 3P45B 1N5TA 2V4JB 3FBEA 2VF3A 2NSCA 3M32B 5DQIA 3Q0AA 2FVSA 1FKPA 5DZ7A 1UVJA 2Q6BA 1U26A 3PV8A 4RBUA 2R8GA 1GMWD 1LFPA 2JSXA 2YWFA 1YJ9S 1T9WA 1IXKA 1OPZA 4NLYA 3LO3A 4B3OB 2FY8A 3WC0A 4CDIA 3NL0A 1VMBA 1K1QA 2B4OA 2XMTA 5K8PA 2QE5A 3I4HX 5ETMA 1M5HA 2GV1A 3A3OB 4Q8FA 2FIUA 5L1IA 2RKIB 4CO0A 4L72B 4N8NA 4FKYA 2NZCA 5I3QA 5IFMA 1R6YA 2OSRA 3UD4P 4B3SF 1FNMA 4KQZA 4L3NA 4O44A 1N6QA 2ZE2B 4JI5J 2DRDA 2WHOA 3OFFA 2MDAA 5BYQA 4KB7A 4BWMA 4I2PB 3QJPA 1HYSA 2XS7A 1F2GA 2JVRA 4O3QA 1S0MA 1VFJA 4EYHB 5AXMA 1E6YB 2NLWA 1N52B 2RIJA 4L6V3 4OLOA 4RLEA 4UW2A 1VDHA 2WW4A 3MMCB 4DR4J 2RS2A 5KG0A 5ADZA 4ECSA 3HK2A 2EFOA 3ISNC 3QFHA 4ECWA 2B4UA 1OYDA 3BDPA 3BB5A 5CZVA 2HNYB 1YI2S 2NQPA 2VJVA 4TN2A 3MF5A 4F3OA 1TUVA 1QLNA 4DR7J 2AZ1A 3CF5Q 1U24A 3MPVA 2AHOB 1TUGB 1U6FA 1X4HA 2HQIA 4DG1A 4ED8A 3NS5A 1P9QC 1ZH5A 1WOOA 4QZVB 2XULA 4ZVOB 4DV6F 3B4MA 2I1RA 1RI7A 1B64A 2YXLA 1N88A 3GCWP 2MGZA 1RBLA 2DBBA 2FJEB 4OI3A 5EX3A 2POKA 3D67A 1MG7A 3HSJA 1LQ9A 4ICLA 3LANA 4KH1B 4LJMA 4ZP6A 1RT3A 3DI6A 1GMUA 2C3PA 2BKPA 4LF2A 1UJ6A 2GIRA 1TP7A 1RHRB 2D7SA 2VB6A 2J6SA 3C66A 1NJWA 3PG9A 3SYZA 4USMA 2V94A 3GJQB 4OYOA 3EPGA 1Q4RA 2VOOA 1MMLA 2HLTA 3UN2A 4A8QA 4AXIA 1CS4B 2JFDA 2O5DA 4OX9F 3G8TA 3DDKA 2IJFA 4OI6A 2ZDPA 4WJBA 1V6HA 1CLFA 1JNZB 3L7OA 3N5FA 2HZAA 2MQOA 4X4UA 2RF2B 3BYPA 5G4DA 1FEEA 3J81U 1C1BA 1JLCA 2MKJA 1RKJA 4NA2A 4PABA 3CC7S 1IBMJ 1PIEA 2B51A 2MSSA 4AXJA 1RTDA 2HAFA 2HSEB 2MKCA 3BS9A 4CM0A 5LMNF 2PN6A 1S72S 1SH2A 2HBYB 4DR7F 4QYZJ 3NOGA 4N7TA 3POTA 3CJRA 5H9FK 1B4SA 3W2VA 1UVIA 2XYPB 5HVHA 1GAOA 1LWEA 2CWXA 2IYGA 4X64F 2XCAA 2VG5A 2WW8A 3MM6A 4M63A 1PJ7A 4LFAF 4H4MB 2F4VJ 2VFTA 1T9UA 2V50A 4L3KA 4WYWA 1T94A 3G6VA 3AY0A 5C25B 4MT1A 5CXTA 2DT9A 4DV3J 2C2DA 1YBUA 4LVNP 3DLEA 2BE2A 2DJWA 4RW7B 1IKYA 1AZSB 3W60A 3RAXA 1DTTA 1N8RT 1VQ5S 2LA6A 1Q53A 1QDUB 3FC9A 3MEEA 3HVAA 2C42A 4PXEA 3MUVP 1RYSA 4ZLPA 2FVQA 3BSCA 1IWGA 3F56A 4UY85 1VQNS 1DQ8A 3HMJG 1GT8A 1U2RA 1VYAA 4LRBA 3TOQA 4DR5F 4B02A 3CDWA 2OH2A 5LJ5Y 1FRKA 1W25A 4OIXA 1R6VA 4C8MA 3NNCA 2COLA 3DLKA 4DUTA 3SV4A 4NXNF 2C2ZB 5HO4A 2OLWA 2B3TB 4ED4A 2CPHA 4CO2A 4DR2J 4FF3A 3RRHA 2ZEJA 2EVZA 3BH6B 4YB5A 4AE5A 4EEYA 3P5TL 3DLHA 2G13A 2JDJA 3O5TB 1FWPA 3IG1A 3VAMA 1RGVA 1WF0A 2PMZD 2XO6A 3T9NA 3KFWX 1R27B 3O6QA 1IKWB 1RDRA 2EKNA 3SQGA 2GC8A 5F9LA 2E9ZA 1UFKA 2WBMA 2V8HA 3EGVA 2U2FA 5LXYA 3LWMA 2DNHA 4DUZJ 4CLTA 2I38A 2MJNA 2HFSA 3EXCX 3BR8A 2PE8A 1RAHB 3LAKA 3MDFA 3HHLB 3M05A 3R7BB 4NZ6A 4CNYA 4QW8A 4CTAA 4ETZA 1N33J 2CPZA 4ZVEA 1PYSB 2HNZB 3P96A 1DAXA 2OO4A 3D7SB 4IO1A 4Y2AA 3SCKE 2CYYA 4LFCJ 3HCXA 3G4SS 5KFFA 3V81B 3PYGA 4J9KA 3U1NA 1VHIA 2F65A 3VTIA 2IA6A 2ILZA 3TUPA 1RT2B 2V63A 3I32A 1SC3B 4IDKA 4YB1P 1U1KA 3PR5B 4DV3F 3IC1A 3OBIA 1QAIA 1WNEA 4KBIA 1NU4A 1M5VC 1PSDA 2UUBJ 1HWLA 3GFHA 3I6PA 3IM9A 1UZHA 4NLUA 1JKHB 1KS2A 3G71S 3DOLB 1ZETA 1FDBA 3DLLQ 2XLJA 4OZ1A 2YNFB 3KLIA 3BGRA 1X4EA 1U8WA 2G0CA 4OYMA 3Q2TC 1T05A 3KDNA 4YEAA 3P4UB 2CDQA 3UI3A 3V5RA 2DRAA 3OT9A 2NUUG 5A76A 2DEIA 1RAGB 2B7CB 2E44A 3M32A 4HACB 2YNHB 1YJTA 3TO8A 3QWUA 4MK8A 2MKIA 3VR1A 3TQEA 2DCUB 4IRCA 2I0XA 2IYIA 1SC1B 2YNIB 3SDEA 3AXKA 3RBZA 4CLZA 5B7WA 3V6KA 3SSSA 2XSFA 4WK1A 4FYXB 1S79A 1VRTA 2GS8A 5IV3A 1QM9A 2Y0SD 1YZ6A 3J7AN 4Q0BA 1LXNA 2CJ9A 4JI4F 1S1UB 3IMQJ 3Q8RB 4DV6J 3RZAA 1UW9A 3GG1A 1UEVA 4ZP9A 2F8MA 3KG4A 2H4YB 2LFVA 3DKDA 4NI2B 3H2VE 1DQ9A 4WP3A 5L9NA 4U8VA 5ETQA 3CJ5A 3H8YA 3I5CA 2Y8YA 2PDAA 2YWGA 5K14B 1S4FA 4CI0B 4YMEA 2GHWA 1X0PA 3UW1A 1ZAWA 2C1EB 3FEZA 2WOMB 3MMAA 4O4GB 4B3TF 4K2XA 2RVJA 4ZCIA 4RW9B 3GV7B 2RUGA 3GIIA 2PMWA 3P49B 1N33F 1JMTA 3H40A 3ZZPA 4DU7A 2ALZA 3KTQA 3NGSA 5B0DA 4NCBA 4LF9F 2AJ0A 2DHGA 4J7CA 4P73A 3OLBA 2PFFB 5SZTA 1XN9A 3HT3A 4QW9A 1ZM4A 1TL1A 4LFBJ 2UZAA 1VRUB 2FQQB 3BEGB 3BKUA 1X4GA 2CXEA 2HK2A 2W2MP 4R8UA 3RYLA 3HVWA 1KEKA 1DLOB 3TEHB 4YP3A 3BO4A 1M1GA 5AE1A 2HGMA 1VRUA 2W9AA 3R5AA 1NK4A 3KNAA 2L9DA 4ID5B 4K59A 2MKKA 1NK9A 1MW7A 2VG7A 3Q8PB 4A8MP 5B09A 1J5EJ 1RWUA 4RUAA 3W8GA 3MECA 4M95A 1SJ4P 5DQHA 1HR0J 3KG0A 1GTEA 4ZJQA 2ZH2A 2Q66A 1Q7LB 8RUCA 4IR9A 1NNDA 2QFIA 1OYEA 3CDBA 2IA0A 1BHNA 2J6TA 2PA8D 3FRYA 4RU9A 2ZH3A 2OD6A 2VPYB 4KKOB 5KT3A 3KHRA 1D0EA 3DLBA 1KWMA 3CB4A 4LQ9A 4RNMA 1XMQF 1TL7A 3MCNA 2KB2A 2OPQA 4XDDA 4DPYA 2DISA 1G4CA 2AEMA 4MIWA 2J76E 1U1RA 1ZS6A 1ZZNA 2DY1A 1X5PA 3CJ0A 2CKWA 4HHHA 2J7UA 1KBRA 1HNWJ 1QVFR 4MYUA 3FEXB 4TYBA 4PQUB 3AXMA 1WG1A 4OI2A 3GLJA 3LF0A 2B43A 1T9TA 2WK4A 5E0OA 1JXVA 4EYIB 5DG7A 2UUCF 2CZ9A 2EG1A 2AMCB 2IRUA 3ENQA 3N6LA 3GIKA 4WP8A 3LGHA 3FCWA 2DVIA 4HH0A 4J37A 1R43A 1E6VA 3LP1A 1T7PA 2E9TA 4IG3B 4PUOA 2XO7A 1EQMA 2XG8A 1TFYA 3TJ8A 1FESA 2MLZA 4DXLA 1U45A 2BKNA 2V4JA 5IS2A 4YQWA 4K8RA 5LSLA 1S9EA 1D9FA 2AEJA 2ZKTA 3DRYA 3MMJA 4FYYB 4IH5A 1L3UA 1NK0A 3HKWA 2BJ8A 3LAMA 3NG8A 3UD3P 3C2PA 1EHWA 2DNZA 2MPUA 2RNEA 4U95A 4M5DB 4KGKA 4GO7X 3FMWA 5KG5A 4IFVB 2W9CB 1AYEA 1MROB 4WIQA 4FF2A 4DV4J 2HHXA 4JYAF 4HHJA 4WFXA 4QU6A 1B3TA 3I96A 3L9ZA 1CC8A 3CO9A 3MM7B 4RW4A 4YB6A 2EI5A 4NLPA 4WU2A 2FHMA 3H4DA 1MN9A 3QLHA 4NPOA 4LT6A 3HJVA 4LF5J 3PW0A 4NASA 4P9SA 2GHVC 2FVCA 2BRKA 2C3UA 2OPRA 2YKQA 7AT1B 3ISND 2CDRB 3SZ2A 4GC7A 3AD7C 2DHAA 3I5AA 3HZGA 3QWPA 4J5OA 2ZNYA 2Q1LA 3EXYA 4KT0C 4WFBQ 3VAIA 4KV8A 3SBMA 4NLWA 2PSZA 4ITSA 3BQ2A 4DSFA 3IAM9 3NLCA 1SKRA 2DNLA 4I6AA 2NZ4A 3LW5C 5B0EA 5A8RB 3OW2R 3PRVA 1B0PA 3PJWA 3BO3A 2LVWA 1HFEL 1WG5A 1N5VA 1HI1A 1OWXA 3JSYA 3D3CJ 4JB8B 2AGQA 1IVZA 1FWLA 3OR2B 3NAHA 2Z8QA 1JLBA 1EZZB 5MAOA 3US5A 3M6WA 1HQ2A 3PIPQ 1MU2A 2JX2A 4DV4F 2QL5B 3HDSA 3PYEA 4XAKA 2WVCA 4ZHRB 4FBUA 1T95A 3NWRA 3M8SA 3V6DB 1FO1A 3PYFA 3TX8A 1M0SA 1NDKA 1OMSA 2A10A 2M88A 2HVZA 3J80U 3J81j 2WTFA 4MK7A 4EO8A 3D4JA 2RQCA 4DSJA 2HEKA 5A2QY 2MXYA 2XI3A 4ELVA 4OZ5A 3EUNA 4JUZA 3NRBA 5A6PA 1FJEB 1O5JA 1X7VA 1SJQA 2N4CA 2V67A 5KG7A 1YLXA 2B4PA 1RTDB 1KVKA 3TA1A 3T1YF 1FRMA 4FNIA 3AB2B 4D3HA 1RWVB 2HAIA 3D6MB 3LPEA 1S1VA 3RGIA 3M6XA 2JFKA 3WIUA 3CCMS 1URNA 1Z1ZA 1RU2A 4ZLJA 5KFCA 1M5SA 1H7WA 2DITA 3Q23A 2Q6CA 2XMVA 2AU0A 3A8JA 2YTCA 2QL7B 4FXVA 4B3SJ 2E5HA 1P6TA 2FZCB 2B5JB 4B08A 2ZBCA 3H25A 4ELTA 3MEGB 3P5BP 1VIXA 3PEJA 3KLHB 3JYTB 1CQMA 3ZC4A 2DO4A 4ES2A 3PIOQ 3VAKA 2J7WA 2IPOB 1VC6A 2O01C 5GVQA 4ZCMA 2JH3A 1K0VA 1QE1A 3GONA 2YWKA 4LRFA 2KZMA 1LW2B 1YGYA 3LWLA 3QRQA 2WVDA 1LWFA 3HLUA 1NCLA 4UY8T 2F7VA 1BGXT 1RT4B 4G6VB 1YTYA 2VC1A 2WONA 3L3CA 3GYGA 4C8NA 5A8WB 4V1Ak 3M8RA 3NAIA 4HI2A 4WPAA 1S1TA 1IJFB 1PCAA 4DFJA 2F3JA 4USTA 2L3MA 4B9VA 1J5EF 2NYHA 2AGOA 3P8BB 5F41A 4Z7CA 4HYKA 1NUEA 4ALZA 3VALA 1OS5A 2YQ1A 1UVLA 4UQTA 3OXLA 4ZPTR 2FGOA 4JBCA 3ILLA 3QFWA 4JI6F 1U48A 5L1KA 2CPJA 5HQLA 3TZYA 4TY9A 1N32J 4GKKF 4WBFA 4ENOA 1XMQJ 2DIUA 3CE8A 3DLKB 1LNQA 5T7LA 3G9CA 5FJ4A 4I2PA 1ZAVA 2CQGA 2E1RA 2M2BA 2W25A 3AH6A 4DPOA 1Q82T 1N5YA 4G1QA 2XNRA 4KGXB 4EGLA 2E5LF 1MROA 4KGVB 4X4SA 4Q5VA 1JX4A 5EN1A 4R8UB 4CM2A 3IG1B 5HANA 2DGXA 2NXCA 2QLWA 1EETA 2HWHA 2MTLA 3K17A 1UTAA 5KT6A 5D8HB 3FFIA 4DF8A 1MLAA 3H98A 4BWJA 2VQFF 3UE2A 1U2FA 1CBKA 2KI2A 4F0MA 1WC5A 4LQ3A 4QYZK 3RBEA 1MSWD 3RTVA 3Q22A 2LQ5A 3JSMA 3K8WA 1EQ0A 1ZAXA 3ZNUA 1RT1A 2BUNA 1UWBA 3DM2A 4DV5F 1ZYQA 2VBZA 4JV5F 4N8OA 3UD5A 4MKVA 4WFZA 1TV6B 1WI6A 3MPUB 2CQIA 2R2TA 1JKHA 1W2IA 4LUBA 1CJKB 2EG2A 4RNNA 3PKYA 2ZH6A 2F8EX 2R7OA 4IOAQ 4DJBA 4LF4J 2JJ4D 3MWBA 4OZNA 2I2YA 1SJ1A 1FI4A 4NRTA 4WXOA 2ZM6J 3AA8A 3OL7A 1WOSA 2LEPA 3F73A 1H72C 1WDTA 3LP2A 3Q8VA 3OVAA 3C14B 2H4WB 1WHVA 2RHSB 1JLAB 4PG8A 2MQPA 1U1NA 1QUPA 2YKAA 3MOZA 3E2EA 1JIHA 1HHSA 1VLOA 2YKMB 4K4SA 3MFHA 1VR6A 1Y3KA 2EEYA 2Z57B 4F26A 5EGYA 4Y28C 2ZDOA 4NWBA 4BCAA 2OPSA 3FRZA 3W2WA 4IG3A 3KLFA 4J9QA 2FZGB 4IG0A 2AEFA 4OQJA 4C98A 2I6WA 5J2PA 4HH1A 4ZA1A 1S7HA 3OTCA 3M2UB 1C1BB 1JLCB 2XGQA 2HHPA 2VH7A 1BE4A 3EMTA 1BMQB 1IQZA 1HKAA 4DN9A 1LWCA 1CQNA 3C6TA 3UVJB 4IOCQ 3PKMA 2BJEA 2BM1A 4NOHA 4USUA 3W64A 4AFFA 4YFUA 1ITPA 1SC4B 4KH0B 4PCQA 4Q2LA 4NMLA 3EX7B 4ECXA 3HSDA 4X65F 2P6SA 2E1MC 2D9OA 3CJ2A 1HNVA 4A8WA 3A13A 3O3LA 2XY7A 3Q8SB 3PW4A 3EDQB 1XERA 3LP2B 5I3PA 5DDOC 1FXRA 4J9MA 3V6JA 3CCTA 1WKLA 4O4GA 5F8JA 1B0VA 2MQLA 4RW9A 2XYGB 4XK8C 1SKWA 4F2SA 1YK9A 1HNIB 3PYDA 2QLXA 4DSEA 4BC7A 4DL6A 4LFCF 4G3IA 1W26A 2IC3B 3NWGA 3QRPA 1S4EA 4P2SA 4NA1A 2DNPA 2O1PA 3J7YU 2QMXA 1U2CA 3D28A 4WTYA 2RDIA 1XNQF 3M2VA 3CJ3A 1QTMA 4OYPA 5KFOA 2ACMA 4NCGB 3SSRA 3M9MB 4CQ1A 4DSIA 4O3PA 4LF6J 2HNDB 2ZD1A 3BSAA 1VRTB 3TVKA 4ZS6A 1CULA 1RAJA 2Y1RI 4MTPA 2LXUA 3EGNA 3HD2A 1H74A 3T19A 4USIA 3L7UA 4F25A 1VQMS 2D3O1 1T9YA 2CPXA 2HQFA 1T3NA 2B4VA 2BE9B 1VQSA 3I31A 1FTCA 3FUYA 5C24A 4ECYA 1H38A 1HNXJ 1VQ9S 2DHSA 3EJMA 1FFGB 2CQPA 4HACA 3UQSA 1XIQA 4URQU 3TJAA 4OYWA 2A0FB 4FYWB 3HVRA 2FVPA 2DD8S 1NKEA 1ZTTA 3UCGA 4IQMA 3FJ2A 3HM9A 3PVXA 1N5YB 4V19X 4QCLA 1U1OA 1KHVA 2LDIA 5J2QB 1VBZA 4DR1J 2FY1A 3ZFVA 1JLEB 3TA0A 2W9BB 1HQEB 3DLJA 1CJUA 3GFXA 3N28A 3AT1B 5BYRA 4XPEA 2DGSA 1HW9A 4OJGA 5BR8J 2RU3A 2N7CA 3IR7B 2HIQA 3CO0P 1FF2A 5HSPA 2J9DE 2V2KA 4JI4J 2Z58B 3ZTOA 4ZKAA 3VGUA 2DYAA 2OTJS 2MHNA 1NK8A 4NYOA 1KP6A 4FZVA 5DM7Q 1BUXA 2OP5A 2XTJP 2HZVA 1Z4UA 3OR1A 2CRLA 1YBTA 1H0HB 3NGKA 4CNZA 4F02A 1JLGB 2HS0A 2QZ8A 2D3UA 2VKZG 5ETLA 4C0BA 4F3MA 1HBOB 5EWFA 5GAEI 4DFPA 4OYZA 1SQEA 3B4DA 4OZLA 1RLDA 2BACA 3DGPA 3GV8B 4F67A 1UA0A 1AFJA 1GMWA 2RS8A 2IFXA 3NBPB 5CZXA 1SBRA 5ETNA 5T14A 3R7SB 5HP1A 3FK4A 2DHHA 4JV0A 3R5GA 4USJC 4LIRA 4JI2F 3UPFA 1N4LA 4K5RA 3KK2B 1IN0A 1CSJA 3KNGA 3MAAA 1KC8T 2HHWA 2DTJA 4AD6A 5BR8F 3KJVA 4LF7J 1HBNB 2KKHA 2CJBA 2QGFB 1A6LA 4BLGA 5HVGA 1X0FA 3LGNA 2MB0B 4ED6A 2DR7A 4RJVA 2Z56B 3RB6A 2BX6A 3EPIA 1HD1A 4P52A 1L3VA 2CJAA 4FF1A 1S6QA 2IBKA 2B8PA 2KRRA 4PEOA 3D5MA 4B9TA 1RTZA 3FMBA 4I4BA 2M8HA 1T8EA 1FHTA 3UFCX 1E6VB 3C16B 5K14A 3NCRA 3GFYA 2H5IB 5T7LB 2PMHA 2BJ7A 4Q7AA 1S0OA 4ILRA 3QRRA 1CPZA 2YBVA 4P2FA 2QA4S 2PD1A 3BQ0A 2CQCA 2RB7A 3H7HB 2KN4A 1UEUA 4RW7A 1D9AA 2J0QD 4YR2A 1DTTB 3O44A 1LOUA 3TW0A 5KFNA 4DUYF 4FS2A 2NR0A 2UXCF 3BV8A 4MKAA 2V8VA 3CCVS 4A8FA 2JNJA 4GVBB 3G6ES 1M5KC 2HFZA 2KT3A 3N79A 1P27B 1JLBB 4ZCKA 3NOCA 3TA2A 3KK3B 4DV1J 3SI8A 3D9BA 4DR3F 2XBPA 4A46A 2H5JB 2QL9B 2GCFA 1NDLA 1E6YA 2YPYA 2P2CB 3S7RA 1SKUB 4HL9A 5KOXA 2ZH9A 1RWMB 1TR0A 2XSJA 1TK8A 3MOJB 1F5AA 4CLPA 2GIQA 2LCWA 1WC6A 2HZCA 3M2VB 3I55S 2DKOB 2XHWA 2BR0A 4DQPA 2I5JB 2X1GA 1KHWA 4OJ1A 4WK3A 3JTNA 1Q1KA 2ZH7A 1TKZB 4H4OB 5KFHA 3KMSA 2VBWA 3CD7A 3CCQS 3V4IB 4U67Q 2BVZA 1WUUA 2ZWOA 2V2QA 1NZ8A 3HFVA 4R0JA 2Z2YB 2H1YA 2OKQA 3QPIA 1N54B 5U47A 5DETA 1WACA 5D3GA 2B5JA 2KM8B 3FVYA 1UW4A 4K50A 3G87A 1RTHB 1WEYA 4I6WA 3KLEA 1FJGF 4DZDA 4C11B 2QMUB 4IOBA 3GJRB 1TL7B 1LXJA 2UUAF 2XWXA 3KLEB 4NLXA 4RNFA 5AXNA 3DI6B 1UZDA 1D09B 4L74A 4RL1A 2HHHJ 2OEJA 2H54B 3GSIA 4MMOA 3NNAA 1XTZA 7FD1A 5HROA 1NKCA 1Q8KA 3OD2A 3H59A 3MCMA 4ERDA 1UFWA 1AW0A 1R0AA 3W5YA 2KFNA 3M2UA 1KLMB 2IMOA 2LQ8A 1RK8A 1L3KA 5HBMB 1L3TA 4A47A 4IO9Q 4K0KJ 3TANA 3LP1B 3SFUA 1LWCB 2K3IA 2V2ZA 3LA0A 3CC2S 2X3DA 2W4CA 4GKJJ 2YNFA 4DV5J 5DLGA 4JV5J 5DG9A 3TVYA 1H98A 2DR5A 1FRJA 4W90B 2KHDA 3ADAC 3UO0A 4U9RA 2NXEA 1QSSA 5KFWA 2J6UA 3QIPB 1K9MT 4B3MJ 3MMBA 4K4VA 3IAS9 3HFZB 2BW7A 1QAXA 2GO8A 2H51B 2ZBPA 3IS9A 4ZIWA 4ER8A 3D1QA 3ET6B 4HVZA 2MKYA 1HWIA 4KO0A 5DRKA 1VC0A 1KOOA 5F3ZA 1YJNS 3RR7A 4J9OA 3BF4A 4RBTA 3AQOA 2EKYA 3AOAA 5LT5A 1RHUB 1HHTP 5HROB 4DU8A 2HNZA 5DJBA 4L76A 3M6VA 5AT1B 2AGPA 5KOWA 2AKWB 2RAQA 4Y6IA 2Y1LB 2CUYA 3HJFA 1REVB 3T6BA 5G0RB 2BANA 5H1SV 1ZOTA 2B0GA 8AT1B 3T3FA 4B3RF 3EZOA 1KN6A 3A12A 2WB1D 4QR2A 2QA1A 4RW6B 3R7NB 3T1YJ 3GYNA 3C8YA 4I64A 3PJXA 4UQGA 1JLQA 2QSFA 2Z2MA 3C15B 1SIZA 2R3VA 3MCOA 2GVZA 2ZOFA 2J9EA 3I0SB 4HDGA 4OYXA 5B0GA 3L95X 2UVRA 3SSQA 4YY3J 1FRLA 1JJCB 2QLFB 1V9OA 2IDEA 3S01A 4DFMA 1FTRA 1RTIA 1F9EB 4AYBD 2ZJRQ 3SV3A 3CMQA 2H9ZA 3OUYA 1IKWA 5GMEA 3JTOA 3VQTA 5KFEA 1HI0P 2YKMA 2FD2A 4ZVSB 1R8CA 3BREA 2M0GB 2VA2A 4RWWA 2NREA 1KNZA 4I7FB 4LIWA 2R9LA 5KFBA 1FD8A 4AUKA 3KJNB 2VQEJ 1JLAA 1FKOB 2C3YA 1DY3A 5FDLB 1VQ6S 3H4BA 4Y2KA 4CO1A 3PR4A 4ELUA 1TUWA 1S1UA 3K5OA 3KWMA 1FX4A 2N3LA 2W2PP 4ZJOA 1WF2A 3ULHA 4DDFA 3G6XA 1TKDA 1S0NA 1IBKJ 4AT1B 2QV6A 4L75A 4X66F 3CEDA 3VVUA 2Z4PA 1KVJA 4W4MA 1ZZFA 4ZPWR 4P7VA 2E1PA 3H0PA 3H2UB 4O3NA 3FSIA 1J5OB 2LU2A 2Z30B 3CNQP 2CQ1A 2UXDF 3W3SA 2R2RA 2EWHA 3AD9C 2GW8A 4I0WA 2PO4A 4IFVA 2P9EA 4OL8A 2UXCJ 2R7VA 2E5JA 1JJ4A 3JQJA 5E3RA 4NEYA 4Y34A 1T02A 2EFQA 3MR2A 2CJQA 3R5DA 3SIPB 5KFSA 3C6UA 1ZBTA 5E7OB 5KFTA 1DJ0A 1TMJA 3A8EA 3VZIA 4UF4A 2VQEF 2QC3A 4LRDA 4DV7J 3GMGA 2KL8A 2CG8A 3KKFA 2JLFA 3VZHA 2W8LA 3AAWB 5E3AA 2UUBF 3FGVA 1TKXB 4NCGA 2K2PA 2ZBIA 1KTQA 3IWXA 3R27A 2W7AA 5AJ3F 3K5PA 4JI7F 2K06A 2HGNA 4JI3J 4R0EA 1TKXA 2AF6A 2HURA 5DQGA 3T1HF 1U1MA 4Y0FA 4FPIA 2RKIA 3IN5A 1PC4A 3BZQA 1O8BA 1X4CA 2ZHOA 3DNCA 3J80Y 2EC0A 4U7CA 2CQ4A 3LGMA 4OYBA 4RZRA 2G2ZA 4O3OA 2V8DA 4DWIA 3GR0A 3N6MA 3FSYA 1C4AA 2OIHA 3BBFA 4KYZA 3L7PA 2QFJA 2R8JA 1X5TA 5M2PA 2WRMA 1YRTA 4LF4F 1MMNA 2RQ4A 1NRKA 3DHXA 3IO1A 3N0VA 2VFRA 5H9FJ 4QWCA 3C3LA 2IM2A 1WC4A 3W7BA 2KTQA 1RT5B 3HHLA 4FPRA 1FNOA 2NUHA 3OUYB 1TK5A 2HGLA 4ZPDA 5ETPA 4CRJA 5CYMA 5L46A 5AJ3J 4JI7J 4JV2A 3K59A 1UVNA 2W4PA 1U1LA 1C4CA 1RWOB 1YJRA 2JEFA 1CEZA 1T9XA 1FE0A 1HBUA 2I5JA 3IFEA 4NLRA 1NSAA 5LSOA 2VQFJ 3R9LA 3OQ2A 4ZVRB 4CH0S 2MYFA 5DS7A 3DU5A 2GMLA 4GKJF 4PPDA 2RUSA 4DV0J 1V3RA 2D41A 2OJ3A 2ASJA 1ZM3A 4Z7YA 2G2YA 2VD3A 2FLOA 4I1TA 1NK7A 4JI1F 1RT6A 4C8LA 3Q2SC 2KDOA 4DX7A 4N76A 2VJUA 3J7A1 2JLGA 2IAJA 1WTFA 4LR7A 4P71A 4TQSA 1JXLA 4LFBF 4BS2A 2DH9A 2BOAA 2VC0A 2V9KA 4M8LA 2RJZA 4ICLB 2HIYA 3DRRB 3UR3C 1U02A 2OPQB 3DRPA 4OV6A 4QBUA 4WIIA 4WZMA 2V8GA 3HSZA 1H3DA 1PBAA 2YKOA 1VQYA 1ZM2A 1XQIA 1QAYA 2VG6B 1N36J 3MEEB 1JLFA 2QX0A 3GP9A 2N7YA 3ICLA 3QIDA 4X4QA 4EBDA 2BQ3A 4NRUA 1NM2A 3UDEA 5LJ3Y 2GX8A 2MZTA 4DX5A 4HDHA 4OJHA 3K5NA 1M5OC 1B70B 2ZHAA 3UDLA 1VQPS 3K58A 1GX6A 3KG1A 3VAHA 4B3OA 2D74B 1NHKL 3KK1B 3PHEA 3QGPA 3K57A 1VQLS 1TTHB 5CD4A 4FP9A 3GE9A 1FKPB 2K3KA 5D4PA 5DGBA 3TYTA 3R6GB 3SMZA 1X4AA 4M94A 1NPPA 1YSJA 3LOUA 1PJ6A 2KVQE 3VAFA 1I94F 2W2NP 2HW3A 3N4WA 3X1LB 4RUBA 3R3TA 2Z0GA 2ZH5A 1FNXH 4EZ6A 2HVIA 3KUEA 3C16A 4B3TJ 1LWFB 1J27A 4G1QB 1HNWF 5A8KB 3QT8A 3DC2A 4J9NA 1RKIA 1PAUB 2AWZA 3A3PB 4LBPA 5C7PA 4WFAQ 3V6HA 2X1FA 3CDEA 3MM8B 2RU9A 2DNOA 2OPPA 1Y4ZB 3Q89A 3HULA 4QIEA 1HNIA 4A48A 3GV5B 1TVRB 1WKJA 1YRUA 4UT4A 1QSLA 5A0YA 2BJ3A 2VIHA 2DHXA 4CTAB 2AYBA 2LKZA 1BQXA 2BJ9A 3A8KA 3BH7B 4YDDB 2KT5A 1DRZA 3K0JA 3LTOA 3RRGA 3TI0A 1BY9A 4P6QA 1S1VB 1C1CB 1URRA 5K8OA 1HL6A 2RRNA 1VBYA 4PXBA 4QYRA 2FB0A 1LFWA 2IRYA 4H4KA 1V3ZA 3FQLA 3TP2A 4JV1A 3R5JB 5ETKA 1FWKA 2GGPB 5E3CA 3ZZZA 3CCZA 2HYIB 3PY8A 1B7FA 3M30A 3IP0A 2AJ4A 1LKZA 2OFGX 3NNHA 4DBQA 2MLXA 2YPZA 2UUWA 5EWEA 3JQMA 5LMUJ 3EM1A 2FPHX 4KJIA 3O8WA 1DTQB 5I42A 2HWIA 2G1HA 3HHEA 1WELA 2HPUA 2AZ3A 5D0GA 4CLYA 4CLSA 3G8SA 2C28A 4LR9A 4NL5A 1QD1A 5KFKA 1M1HA 3N5BA 1VISA 3SFGA 3GSDA 2AQ4A 3R2DJ 1IKXB 1VS3A 3H90A 3U02A 3TR5A 2LECA 1SJ3P 4HKQA 2PIIA 3CIZA 4F04B 1K73T 3TUJC 1RT2A 3AOCA 4S0MA 4ZDNA 3PFEA 3SXLA 5FLXY 2C3MA 3RBXA 4N5SA 1HHQA 4IFYB 2WSFC 4HTJA 3TQ1A 1S9FA 2F9JA 2R8KA 4PWUA 2PFDA 1RYRA 3TUIC 3CD5A 3THVA 4E0DA 3FNNA 3HSGA 4F2RA 1KOHA 4C3KA 1TAUA 2HVEA 3DRSB 3U1MA 3T5HA 5MLCV 3OTDA 1UVMA 4MIAA 1NSQA 2E7XA 2VASA 2IRXA 5LMUF 5I3UB 1ZTWA 4F7VA 4E98A 3T6JA 2O66A 4Z37A 3HD1A 1Q81T 1O0PA 5J2MA 4JI0J 4X4NA 1QTNB 2FUG9 2RH3A 2Y9HA 1S1WA 4OFZA 1OQ3A 2J7KA 1RZMA 4CO3A 1M5PC 5HK4A 3GYXB 1F5CA 2VPZB 5EDWA 2ZKUA 2HMIB 4C8YA 3FBBA 4KSEB 3KJVB 1YX2A 4M5KA 1NJIT 4F4YA 4M5JA 3IS9B 4DPTA 2CQDA 4DR5J 3A1YG 1REGX 3NGTA 3E3XA 3O1LA 1EJ7L 2H3EB 2OMOA 2XMJA 3R97A 1YHQS 4LF6F 3M8QB 4UUXA 1S6QB 3QT5A 1ULRA 3B54A 4KHRA 1U8SA 3THPA 1WKKA 2GQCA 2UVUA 2CIMA 4C8OA 1VBXA 1L5UA 2PEHA 4JI1J 5AE3A 4A8SA 3EVWA 2Y1IA 4TNOA 4KPCA 4MIBA 1GNKA 1X4DA 2W9CA 3DFEA 1FX2A 2WVFA 1V3SA 4C0OC 1LW0A 3B78A 1FRHA 2ROPA 5CAAA 3JAMU 3ETOA 4B9UA 4ZPBA 3CCES 2LLZA 5B0BA 5J2MB 4CH1A 1IBCB 4WXWA 1D9DA 1R0AB 5C25A 4LRAA 3N01A 4O0IA 1FXDA 4DZ6A 5KFXA 3WC2A 4JI8F 3NGUA 1UVKA 2GNKA 2ZWPA 3H42A 2PI4A 2F9DA 4FVCA 3RAMA 3EGWB 1JNRB 1DBDA 2ZITA 2A6MA 3KK3A 1NJXA 1YJUA 1S48A 1O6XA 4ETXA 4OZ2A 2CFXA 4Q44A 1UFLA 3T5JA 3EWGA 1U4BA 2C2KB 1EKRA 2DXDA 3ILOA 2Z2ZA 3KLHA 5F0UA 1NJZA 1X9WA 3FZ2A 1I1GA 3KLIB 4PWDB 1I3OB 1RSCA 3BGUA 2M7SA 4GRSA 4RNHA 1WTBA 5ETRA 1KSPA 5JVHQ 1NEEA 2XC9A 1F3FA 5AXLA 1KRPA 2GJFA 1IKYB 1AZSA 2OEMA 5KAKA 4PWDA 5J2QA 1RBOB 5KT4A 3D2WA 4DSKA 2OI2A 3DRPB 5DGAA 2M70A 3AOBA 1U25A 1U49A 1WHYA 2M5YA 4K2JA 4RKUC 3KMQA 1F0XA 3CJ8A 1R8HA 4HTIA 3T1AA 1X4FA 9ATCB 2YNGA 2AX1A 3OVSA 3HVTB 1XMBA 4A8YA 2NS1B 1X9MA 3CJTA 8ATCB 2GO9A 1Y5LB 5G0RA 1TL5A 1Z2LA 3KDOA 5CD4H 4ECTA 4QIWD 4LMZA 2HMIA 1IR1A 2O67A 3OTBA 2CJKA 2VHGA 1OY6A 1N48A 4KY3A 2CQHA 1AROP 1S5ZA 4B3RJ 4EBEA 2HG4A 3B82A 1KLMA 1IBMF 1UCNA 4WP9A 4DCOB 1NKBA 2MLYA 1NSPA 1QJHA 2G1DA 2XWYA 3NBPA 3DCAA 3NGRA 5HI7A 4FYDA 1VLYA 2YKPA 4P10A 4TYAA 2XMUA 5A8RA 2C2MB 2RMLA 1SV5A 2MSTA 4JP8A 4WTOB 5HMYA 2FC8A 4ATNA 5E41A 3KLGB 3PX0A 2ASLA 2CQ2A 2ABYA 1C0UA 5D77A 4X64J 2C2EA 4I2QA 3MM5B 5C5JA 4N41A 3MPWA 4Y65A 5D6GA 4A4JA 1T9VA 1WI8A 2HQ3A 1PYTA 5LL6d 3MGJA 1GMVA 4O0NA 2N82B 4P2MA 2W01A 2NXNA 2E7VA 5IWAF 5FLXU 3IRWP 2DRBA 3QLHB 1YJ7A 2QA2A 3D1OA 2VPXB 2L9NA 2VDIA 1FA0A 3QO9B 4IQXA 4QQBA 5K8MA 2HQGA 4LSLB 1K44A 3RAQA 2BBEA 1RAEB
chains in the Genus database with same CATH topology
1HBUB 4AL6A 5IM0B 3OV7A 1DURA 1MMDA 4EBCA 4DQRA 1RQ0A 3I5BA 1RT7A 1TAQA 4NLOA 4OX7A 2GGPA 3OHAA 2R8IA 1PO6A 4MK9A 1JLQB 3OFHA 2PC6A 2HS4A 2ACYA 3QGHA 3R5BA 3NKYA 4O4RA 5H9EJ 2ZOGA 1LK7A 2XZWA 1XK8A 3C6UB 4C11A 4AL7A 3PNIA 4Z2XA 3MXHP 1VI7A 1Q78A 4ZCLA 4F4ZA 1L3SA 2DR9A 4OHWA 1C2PA 2E1AA 2CPDA 2MJUA 2I8EA 3BJYA 2ZNZA 1RT6B 4BC9A 2XMWA 2JRSA 3LUYA 2R7SA 3QO9A 4C8KA 3I82A 1DHMA 2ILYA 4C0HA 2J0SD 3RBDA 4IFYA 5IXUA 2KO1A 3DRRA 4KHMA 2XS5A 1RP5A 3CC4S 1VQOS 5KFZA 4YR0A 2ADBA 1SUQB 4MKBA 1NAQA 2DGUA 4YHHF 2R7WA 1SIWB 2UVWA 2VV5A 1R7IA 5KT2A 2B6AA 5HLFB 1CVJA 1UAWA 4QWBA 3BSOA 5KFUA 2E66A 3MEDA 1PGZA 2ZJQQ 2VODA 2AYGA 4WKYA 1FERA 3OTEA 4LVOP 4EZ9A 3QGIA 2XCPA 2FJVA 3N6NA 3DLEB 4OHZA 3MR6A 3DXSX 2ZZMA 5F8HA 2IJNA 2MKSA 3VF0B 2U1AA 4EUVA 3SDEB 4QJVA 5F9NA 2BJDA 1P8GA 5DDQC 1MNEA 3MZIA 4QWEA 2MZSA 1YBAA 2XNQA 3D54A 3JAMY 3U1LA 1NO8A 2YH0A 3OFEA 5F8IA 1DZ5A 4X4OA 3G96A 1EP4B 5IQ6A 1T03A 5KG3A 3OVBA 1K8AT 3LPYA 5J1EA 4O3SA 4PKDB 4WCEQ 1M90T 4FF4A 1SL2A 5FD1A 1FK9B 2R2UA 2HHQA 1JLEA 3MHYA 4TU9A 2W9BA 1VQ7S 4JI5F 1N5SA 1ZPVA 2D1CA 3PZPA 1CC7A 3CCWA 1DTQA 2P6TA 5I42B 4O23A 4DSLA 3PO5A 3OJUA 2UVVA 3CCUS 3M30B 2J0XA 3HP6A 3BO2A 3FFIB 1GXTA 1X4BA 4NLDA 3TARA 2OMLA 2F1FA 3O2IA 2DR8A 1G1XA 3X3UA 2JC1A 3MECB 4ECZA 1UKUA 2N4DA 4C7QA 3PX4A 1U1QA 1PILA 3VAGA 3C46A 3LP0B 2BABA 3L09A 1HPZA 1UMJA 2LQBA 2AW0A 4R25A 2FJXA 2LU1A 2WAQD 3QMQA 2DB1A 5IZHA 4KKOA 2VL1A 4PG5A 1IBKF 5DG8A 3H5SA 2W4DA 2OPPB 4C9DA 3MD1A 4WZQA 2MY7A 1S77D 3I0RB 1G7CB 1S9GB 3UCZP 4DN0A 2BA9A 4DV1F 2YH1A 1YRXA 1KFDA 4I6YA 4F3QA 1FE4A 1S1TB 3ENVA 3WDOA 5EHHA 5GMKa 1BWEA 2KYXA 1NHUA 4DOZA 2HHUA 4KIAA 2AD9A 2KXFA 3GWCA 4KAIA 3E8OA 2WSCC 1BQNA 2EK6A 3DU6A 4IRKA 2FDNA 2QYCA 4GMKA 1AUDA 2VBXA 3KK1A 4C97A 2KG0A 3KHHA 2ZFHA 3FEYB 5J1NA 3IGNA 5KFDA 4GC6A 1HBOA 4NZ7A 2OPSB 3DLGA 4WFYA 4OHYA 4KGMA 1S6OA 2BV3A 2R8HA 1FKAF 1SB6A 3W2VB 3QZ8A 1HARA 3V4MA 1HNVB 1VQ8S 3QJJA 2DCLA 3FQKA 2J0WA 4ED7A 4LSNA 5KFYA 3NS6A 2ZE2A 4IH6A 5BYSA 2MQNA 4U7UK 2WBRA 2DPJA 3QIPA 1TVRA 1S6PB 2DGTA 2GQQA 4Q8EA 2YWEA 2CZ4A 2W24A 1HQEA 5CH7B 4TKTA 4I7FA 5CHCB 3PX6A 1TKZA 4H4OA 4RUHA 3BN7A 5EWGA 2BE2B 1UWBB 5D78A 2CZVC 3IRXB 2XY6A 1HR0F 2AP6A 4ID8A 2J9CA 1H7XA 2HHVA 1KLNA 3MEGA 3MI7X 3DYAB 4CO5A 4N56A 2B56A 3NNAA 3KOAA 4ED0A 1WHWA 2M3DA 2MQQA 4KFBB 1FHTA 2CPFA 2RQMA 5C24B 3DLGB 1PC5A 2HFOA 2V5HG 5E3QA 2BYCA 4WE1A 4NCAA 2EFGA 1AXQA 2HNDA 4PG7A 3HZEA 2IAJB 1UJ4A 4M1KA 1QVGR 3MD3A 1TL3A 1F9FA 4BHQA 1WEZA 4TY8A 2RF2A 2MQMA 2QRRA 1UP1A 1FJCA 1GQEA 2ZC4A 3V81A 1Q79A 3AJ2A 3MM9B 3VWSA 2W7PA 3UDCA 1S0VA 2EFVA 3ITHA 3E01B 4RBVA 1Y5NB 1Q8BA 1S99A 4NLVA 2PT0A 2WSEC 2RQKA 3EYZA 5K5MA 1OQ6A 2A2DA 4Y2MA 3CCJS 1OSDA 5M2RA 4WYLA 3CJKA 3NMRA 5CYJA 4JOUA 4ES1A 4K0KF 4DL2A 1G3OA 4ED5A 1BQMA 3G6YA 1U1PA 3HF5A 3OJSA 4A8OA 3DXBA 2AJQA 2ROEA 2ZHBA 2RT3A 1SI9A 2APOA 4LF7F 2KXHA 5I3UA 2AJFE 3OLAA 2KVIA 3OSNA 3GIJA 1RTJB 3K7RA 2LXFA 2FC9A 2YNHA 3MM7A 4RW4B 4URSA 4J9SA 2GJ2A 2QIFA 1IKVB 2DGQA 3WBZA 4HT7A 3H5XA 2XMMA 4DR6F 1NZAA 4TLRA 4KPYA 3M9NB 2N3OA 3U7JA 1N0VC 4OMFG 1DFDA 1FK9A 5D4NA 2DH8A 2RDJA 2KU7A 2KJVA 2AYEA 4KRWA 3HHKA 4C2MA 3H5YA 3CCSS 1HNXF 2FTRA 4N77A 4NLTA 4DHVA 2G4BA 4DUZF 4ECVA 2ZH1A 1IBLF 3H2LA 3IWNC 1H2TZ 2PGCA 3D0IE 5L39A 2R7UA 2FLPA 1RTIB 4ZHRA 3MM5A 3LALA 5GAEU 4PXDA 2DNGA 4F50A 2ADCA 4ID5A 5J2PB 1R3NA 1EETB 3TAQA 4ZVGA 5B0CA 1X5SA 5KT5A 3M9OB 3CDAA 4UUWA 2FLLA 3M4XA 1REVA 3MR5A 2CVIA 1Y00A 4TU8A 1TKTB 4Q43A 1AFIA 3PM9A 5CQGA 2HNYA 2A18A 2LEBA 3M8PA 2D9PA 5CYQA 2ZH8A 3OSPA 3G8QA 4DL4A 4NLQA 1VHFA 3QZ7A 1HQUB 1VQKS 1I6JA 3GILA 2XI2A 4JI0F 4YR3A 3JB9k 2ZM6F 3UWTA 5DM6Q 1HMVA 2XEXA 2CPEA 3BGFA 3BM7A 4FBTA 2FJAB 3F44A 2BRLA 5E3PA 2KG1A 3IWLA 3TNVA 2ZJPQ 3ZZTA 5C42A 2VPWB 1BD6A 1RT4A 3WZ0A 3HHNB 4E8UA 3RR8A 3CCLS 1TQLA 1VOMA 2R7TA 2VOPA 2FLNA 3HVTA 3HO1A 5KT7A 2ROGA 5C42B 2VZ9A 1ZPWX 1HBNA 3DOKB 4IG0B 4B17A 3VAJA 3PW7A 3J7YI 3THTA 2KZZA 5KG4A 1S1XA 2I9SA 5KG1A 4ZVHA 1K0TA 3DOLA 2F4VF 4MJKA 3OR1B 4D3GA 2W7OA 4HLBA 1R8PA 1WEXA 2ZUGA 4TLQA 2ZH4A 5GAGI 1ROFA 5J1EB 2KJWA 3CMES 2FHOB 2ASDA 3CCRS 4PRFA 2CQ3A 4XO0A 1D8ZA 3PRDA 4QOTA 1JXEA 2UV8G 3QAUA 4CCHA 2VFSA 4MFBA 2JLEA 5IT0A 3KLVA 1GXLA 3M6UA 4NYPA 3H20A 4C3MA 4DQQA 3NMAA 2UXBF 3MFIA 1YJVA 4DLEA 3PDNA 2IM1A 4QR1A 3V4IA 3MM8A 4QPTA 2EBEA 3DMJB 1KONA 3TVZA 3T9ZA 3DOKA 2EFPA 2P5VA 2VG7B 1H6KX 1XC9A 4X2BA 4W92B 3PW2A 4PQAA 1YWXA 3GG0A 2XSJB 4OHVA 1WHXA 1SL1A 3I0SA 2L48A 5EUHA 1Y3JA 1HWJA 1SL0A 3N9UC 2R2SA 1TFWA 3MCSA 2M4MA 4P7TA 3HKZD 2AV5A 3HHLD 4DV0F 3FZBA 2BDPA 5L1LA 1QSYA 2OFHX 3MEKA 4EO6A 5CA5A 3S6EA 2BOPA 2XB2D 1Z2ZA 3ITHB 2VUGA 1APSA 3E01A 3MMCA 3RB0A 2VG6A 2EPIA 2DGWA 3R5CA 5F3TA 3H5UA 3ZZUA 4DR4F 3PW5A 4OHXA 7FDRA 1IM4A 4JI3F 5L1JA 2HHSA 3D0GE 4ZOSA 1S10A 4NLSA 1GTHA 2PA3A 3CUNA 4ECRA 4H4MA 3GB0A 3I9V9 1FKOA 5FDLA 1UL3A 5KFLA 1RA7A 5ITHA 4URGA 2ZOMA 1BQMB 1S9EB 2X51A 4WU3A 1LW2A 1S1XB 4PR6A 5E33A 4QWDA 2A2CA 5J1PA 3HHLC 1VJWA 2MZ1A 4B3MF 5HMWA 1WD6A 1Q7YT 2M9KA 3CSKA 4X4RA 3MUTP 3KK2A 2P9GA 1HBMA 2E1CA 3I87A 3Q8QB 1LK5A 2GHPA 3OFGA 2LMIA 3P3DA 1J5OA 2YX4A 3CULA 2FHKA 1SC6A 2K1RB 2YKNB 2KHCA 4N47A 4ZP8A 3TAMA 2ZH2A 4DQSA 5CCLA 2DPIA 3KYLA 1RT5A 2GMHA 2HRUA 4H54A 4X4TA 1KR4A 2OSQA 4MFBB 4Q0BB 4AQYF 1Y9OA 4ECQA 2DGVA 3M2RA 1EP4A 4QR0A 1T03B 1D1UA 2OAUA 2VBYA 4NXMF 2BANB 5KTQA 4IRDA 1U7LA 2YX1A 3OL8A 1QUVA 1RTHA 1MWZA 3T5KA 2DNNA 2QT7A 1C0UB 4OX6A 2HVHA 4IR1A 4FN5A 3BGLA 4WE1B 4TU7A 3V6DA 4YOEA 3PFOA 5F8LA 2CPYA 2MGZB 3RB3A 5F0WA 2LEAA 4KFBA 4K4WA 4TY8B 2DNRA 2JVOA 1U09A 1NJYA 1HNZF 5B0AA 4CZCA 3MMBB 2K7KA 5AXKA 4CIOA 2MHEA 1XBWA 2GFFA 1FT8A 4FNHA 2C22A 4ZVFA 3M2RB 4NX9A 1YVFA 3DMJA 1HA1A 4CT8A 2W8KA 3PACA 5CCMA 3KHLA 4PUOB 2NXUA 3DOMA 3BDEA 1T3OA 1TL4A 5HL7Q 1R31A 1M1KT 5F8GA 1FVQA 2ERRA 4X4VA 1TV6A 4KO0B 5KFRA 4ZK7M 1S6PA 4J9LA 3R1LA 4XDCA 4KR0B 4DX8H 1VK3A 1NB7A 2KFZA 4RWXA 1KQSR 2IVMA 2RRBA 2DIVA 5A8WA 1YITS 2GJIA 4DF4A 3BN4A 4ZPAA 1N56A 4F4WA 2JWNA 5BJRA 1FDAA 1HWKA 3S8SA 4F4KA 1HD0A 5JJBA 3OXGA 3IR5B 2ZVSA 2EW9A 2E7WA 1HBMB 3SEOA 5L8RC 3J7Z5 2Q79A 4H4KC 3U27A 2L08A 5JXSA 2JEIA 2DK2A 4DEZA 5A6WA 5HBMA 4KTQA 3I56S 3CJ4A 2HS3A 5KFMA 1XR5A 2AYMA 3SCLE 2D3ZA 1XMOF 3W2WB 1FD2A 1NH8A 3KLFB 2Y1JA 4WKRA 2EK1A 4OJ3A 2GA7A 4YDXA 5B0FA 1VK8A 4EU0A 1D8YA 4B9MA 2FGCA 5KFVA 2XY5A 2J8AA 4A8XA 1TL1B 4FVMA 2L9WA 2XGPA 2B9WA 1U6ZA 2K8GA 3UCUP 3BR9A 5DDPC 4MH8A 2E29A 2VKRA 1N0UA 2RE1A 4OZJA 4I2QB 2KYZA 1QAJA 2MZRA 3HPOA 3PO4A 4LF5F 3D1HA 5AE2A 4G1PA 3EGZA 1P1TA 2HLUA 3NCPA 4YB7A 5EX0A 3TAMB 3OHBA 2YNIA 2IVYA 1FJ7A 1O51A 3MAQA 3IBWA 2IHR1 5IT4A 4C4WA 1C1CA 4KHPF 1XWLA 3SCJE 6FD1A 2JEFA 4F2RA 3FCHA 4BBYA 4LSLA 4EWTA 2XS2A 4DG1B 2M8DB 4AL5A 3JSMB 3EZUA 2RRAA 1OO0B 2BXJA 3K8VA 4EFAC 4NYZA 3CD6S 3B8HA 2BZ2A 3OR2A 5E5NA 5J2NB 3DRSA 4DL5A 3NCQA 2FHJD 3JSBA 1D3WA 3OPKA 4PQUA 2DO0A 3I0RA 3PEHA 1FRXA 2V0NA 1BC6A 1IJEB 4ED1A 4WF9Q 4X4PA 1IKVA 2MZQA 1HI8A 3I4PA 2DNQA 4O44B 1N6QB 1VIOA 3NP5A 2NPIA 1SKSA 3HX9A 4DLGA 2R7XA 4K4UA 2L41A 5JVGQ 1GH8A 1JLGA 3LQVA 1B0TA 1IQTA 5HMXA 1S97A 3K5MA 3QYYA 2HRYA 4USHA 1OIAA 1TZ0A 2QO3A 1LWEB 3MPYA 2VG5B 3MM6B 3CGIA 4X84A 5KFJA 3POTB 1JB0C 4DQIA 2GQ2A 3C6TB 1CG2A 2WTFA 5E2QA 3BGRB 5HLFA 1N5QA 1QY7A 2E5LF 3CTRA 4LMZA 2OTLS 3MURP 1QE1B 2X3GA 4TXSA 5LXRA 4OLPA 2JHEA 3HHDA 4ECUA 2OPRB 5T41A 5M2UA 3JYTA 1XR6A 3CIMA 3IR6B 2J5AA 1JJ2R 3DHWC 3S1TA 3RU0A 5DDRC 4ZMMA 3AA9A 3PRBA 4QIGA 2GMJA 1MWYA 2QMWA 3M8QA 2KRBA 4XIUA 1OPIA 5F8NA 1FEHA 1HQUA 1G2EA 4Y3CA 1H2UX 2YX7A 2WONB 2CQBA 3VCDA 1RT3B 2QA4G 2XLKA 2VONA 1SV5B 3CVKA 5K8NA 3KLGA 1SH0A 3OL6A 2ATLA 4Y2IA 3TAPA 2R7QA 1KD1T 1F5BA 5HQ8A 2V9WA 4KE5A 1LW0B 2PI5A 4C3LA 4M5DA 2LDYA 3M1VA 1YJWS 1X9SA 2B9YA 2H5EA 4DV2F 4PPZA 2IVFB 1YQHA 2XLIA 4ILLA 1G6BA 2VFVA 3EZ5A 5DO2A 3ZZYA 1NK6A 3ZZRA 4ZP7A 1GXUA 2A1BA 5KFGA 1R89A 2R7RA 4NA3A 2EBGA 1VGYA 3TRGA 2J9DA 1SJRA 5HP1B 1Q8LA 4K4XA 2KT2A 1IKXA 1KQFB 3QAEA 5KG2A 4I67A 3MAHA 5HN0A 2E9RX 2BW2A 5I4MA 1IUJA 1F60B 1S1WB 2HHTA 3M8PB 3LP0A 4ILMA 3D0HE 5CYQB 3RRKA 1S49A 2FJBB 3E51A 4BDPA 4LSNB 1U47A