2UU9F

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gug-codon in the a-site and paromomycin.
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RRNA
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
molecule tags Ribosome
total genus 23
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2uu9F00
1HNWF 4LF4F 4OX9F 4JI3F 4NXMF 4LF5F 1LOUA 1RISA 2KJWA 2KJVA 2VQFF 4JI1F 4JYAF 4DR5F 1CQNA 4YY3F 4B3RF 2UUAF 2RJZA 2B7BB 4JI4F 4DUZF 4DV3F 4DV6F 4B3MF 4JI8F 4LF6F 4GKKF 1VMBA 4DV4F 4K0KF 4LFCF 4YHHF 4DV7F 1HNZF 3ZZPA 4JI6F 1HNXF 1N36F 4NXNF 1B64A 1QJHA 5IWAF 3R3TA 1IBLF 4DV1F 4JI7F 1XNQF 2UXCF 1GH8A 2E5LF 1G7CB 1FKAF 4GKJF 2YY3A 1F60B 4DV2F 2UXDF 4DR1F 2B7CB 4KHPF 4JI0F 4LFAF 5AJ3F 4JI5F 2HHHF 1I94F 1J5EF 4DUYF 4DR2F 3T1YF 1N34F 4LF7F 1IJEB 2ZM6F 5BR8F 4LFBF 2J5AA 4B3TF 1XNRF 1XMOF 5LMNF 4LF9F 4B3SF 4DR7F 1G1XA 4X64F 4DR3F 4DR4F 2UXBF 1HR0F 4X66F 4DR6F 1IBKF 1FJGF 1XMQF 2BVZA 1IBMF 4AQYF 1CQMA 4DV5F 5LMUF 2BXJA 2F4VF 4X65F 4JV5F 1N32F 1IJFB 2VQEF 3OTOF 3T1HF 2UUCF 4DV0F 1N33F 4X62F 2UU9F 4LF8F 4JI2F 2UUBF
chains in the Genus database with same CATH superfamily
1NK4A 3BDEA 2CRLA 2E44A 4OJ1A 2B8PA 1WC1A 4RW9B 3DLHA 2IMOA 4RU2A 1Y0HA 2E1RA 4DMZA 4AXJA 3D54A 3DYAA 4OV6A 2OIHA 2ZJRQ 2H5JB 4TQRA 1QDUB 4DR6J 2G9OA 2YX7A 3B4DA 2NPIA 2G1DA 2E9ZA 2GJFA 3MF5A 4YP3A 4K4ZA 1NUEA 2M4MA 2IMWP 4IOAQ 1XWLA 3OFEA 3VGTA 2DNRA 4NMXA 2KH9A 4NLSA 1HHQA 1QD1A 1Y3KA 2D9PA 1PC5A 2E66A 4OI1A 1S7IA 3PW7A 3K89A 2P9EA 4A8MP 5KFQA 2BW7A 3ZZTA 4I56A 4ZJOA 2C2OB 3GPAA 1R6VA 2V34A 4ZVRB 2AJQA 1HQ2A 2YNHA 3LOUA 2I6WA 3CEDA 1SUQB 4IRKA 2XNRA 1ZA1B 1S5ZA 3TR5A 5GAGU 3GCXP 2VH7A 4B02A 1TUVA 3HDSA 2DTJA 1IQTA 2QSFA 1UFWA 2RUGA 1ZPVA 1B0VA 3TUZC 4DEZA 3AQPA 4CYUB 2BR0A 3KMSA 1H3DA 4ED6A 1R31A 2EFOA 2LXUA 1HNXF 5LXRA 4HTJA 4QZVB 1ZM4A 3TX0A 2DR8A 4EGLA 3UDCA 2NSBA 4KO0B 3O44A 3FKBA 1IM6A 2FTRA 1L3KA 1F6TA 4UZCA 2GVZA 3E3XA 2N4CA 2AX0A 3BN4A 4JI1J 5CD4A 2UUAJ 1H98A 3HHEA 1T05B 5IC6B 1TKTB 3O3LA 2GMJA 3W8GA 5DQIA 4R8UA 4TN2A 2VHGA 2VA3A 2ZBQA 3RR7A 3QIPB 4PG6A 4RZRA 3PW5A 1T03B 2XHWA 1EETB 2CPIA 1MW7A 2WHOA 2DXDA 2HBRB 1N54B 1NBEB 3MPDA 4OX6A 1FKOB 3EYZA 3WC0A 4BWMA 3PW4A 3C2PA 3DGVA 1UZDA 4KY3A 4RR5A 4B9LA 3KLFB 3M2VA 4NZ6A 5DG9A 1CJUA 1HI1A 1QE1B 4F4YA 2VICA 3D0IE 3EWGA 1PYSB 1WEYA 2ZH3A 3R3TA 1H0HB 4P52A 4RLEA 3H2UB 3BPDA 2QMXA 3BM7A 1X31C 5A8RB 5L1KA 4TYBA 2XZWA 4D3GA 4DV3J 4C8NA 4B9TA 4JP8A 5T41A 2VA2A 5C42B 4CWBA 1SKUB 3MCNA 2DY9A 2WW4A 2HFOA 3RW7A 4J91A 3FZBA 1RWKB 1LOUA 1RKIA 1HD0A 2ZE2B 4K0KJ 1SH3A 3D66A 4EO8A 2HQDA 3QAEA 2KYZA 3HMJG 1HNZJ 3BQ1A 4GKKF 3EGVA 2DY1A 3JTPA 4O4GA 2UUTA 1E6VA 4M94A 3HI9A 4YUDA 1JNRB 3CIMA 5A0YA 3QATA 4LMZA 1U1KA 3SMZA 4FBTA 4CP5A 3AOCA 2CG4A 1LWEB 3BF4A 3CCSS 3EDRB 4URQU 3EGZA 4DR2F 2DHAA 2GQCA 3W63A 3NS6A 1UJ5A 3VCDA 3CD0A 3GIRA 2NXCA 4IOBA 4DFKA 4ZPAA 2H1YA 4Q43A 4NA3A 3IFEA 2ILYA 4BWJA 4FVMA 2DCUB 2VG7A 5IXUA 4QIWD 3HZGA 4H4KC 1FVQA 1KONA 2W24A 1S99A 3F0NA 3LW5C 4X62F 2BANB 2HFZA 3ZZOA 5K8PA 2M8HA 1X4CA 3HP6A 5HO4A 3DLKB 4A4JA 3HM9A 2ZH9A 2EXUA 5E41A 2DCLA 3EXYA 1RA7A 3OVBA 5KT7A 2IJNA 2LEAA 1SV5A 5FD1A 2BV3A 2AZ1A 1NEEA 3SDEB 5DG8A 2DHHA 2YKAA 1UPPA 5GMDA 4ER8A 1NXIA 3H5UA 2QYGA 1DQAA 2KT3A 1IBMJ 4HI2A 2AYEA 5D4NA 1S9EB 2GZOA 4IR1A 4GKJF 2B7CB 4J7CA 2O67A 3N4WA 3S6EA 4RW8B 2DXEA 2X3GA 4NZ7A 4DL0C 5A76A 2CNOB 1RT2B 3MPUB 3LP1A 4Q7AA 2ZKUA 4FYDA 2XO7A 5BYSA 1W2BR 4YMEA 1DJ0A 4ZVHA 1SQFA 1LFPA 2D7SA 1SH2A 5HVFA 3DM2A 3KMQA 2JH3A 1RWNB 5IT9Y 3ADAC 3PR5B 2WTFA 2C3YA 5L46A 2QLXA 4NWBA 3V6HA 2C2RA 3LAKA 4ES3A 1V5VA 1G4CA 2GIRA 3KHHA 3MZIA 2QLJB 2NREA 2E1PA 4B3MF 2VV5A 3FRZA 2MZJA 4AL6A 2CQDA 2B6AA 3CJQA 1ROFA 4J5OA 2GC8A 4UOCA 4U6PA 1LW2B 2OEJA 5KG7A 3IAM9 1YIJS 4X4TA 3WBZA 1FRXA 1QAXA 3KUHA 3GG0A 1HBOA 3WC2A 1RAGB 2CWKA 5F8NA 2CJXB 4YDDB 2DR6A 3PO5A 1GXUA 2IBOA 2QEXS 5DO2A 4DG1A 2CPJA 4C6AA 4KBIA 2RDJA 1P9QC 1F5AA 4C0BA 3C6TA 5MAOA 4OI0A 5I3UA 3PJWA 4BDPA 4OX9F 5ETKA 4ZCIA 3DRSB 2CJBA 2VOOA 1NM2A 3EPIA 5SUHA 1XJWB 5J2PB 1FEHA 3AJ2A 3NLCA 4RUBA 1G3OA 3Q2TC 1EQMA 3T3FA 2BKPA 3M8WA 4DR7J 2CQHA 2XYPB 2LFVA 3LAMA 4C8LA 2OEMA 4OZ1A 4CH0S 1IBKJ 5T7LA 3DU6A 1IKXA 4N56A 3PV8A 3KOAA 1ACMB 2P8IA 1OQ3A 5A6WA 2I1RA 4F0KA 2FLPA 2AJFE 5CZXA 3JAMU 4RWWA 2QL5B 4RU9A 4EBEA 1GT8A 1HNIA 4NLDA 3KXDA 1OWXA 2MSSA 2BEFA 1RWWB 2IM1A 4WXOA 2R7UA 3TARA 1WG1A 4Q5VA 4C97A 4QIEA 5H9EK 3GCWP 2EKYA 1OJ4A 1V3SA 3DDIA 4NLVA 1T9VA 3N6MA 2XCAA 3TQEA 4NRTA 3DOMA 5B0FA 1S4EA 3JSMB 4PPZA 3TA1A 2AWZA 2WBMA 2F8MA 1OSDA 1RTDA 1D9DA 4LRAA 3GIKA 2JLFA 1SQGA 1UA0A 2V4JA 2DNGA 1S59A 2JSXA 1NU4A 1F3VA 3DGPB 3HVTA 2OI2A 4IH6A 1UCNA 3HKWA 2YNIA 2DNMA 5DLGA 2UVVA 3DLLQ 3QGHA 2QRRA 3H25A 4R0EA 2BE9B 4MIWA 1FJGJ 5E7OB 2AX1A 2ERRA 2AEJA 2D41A 2UUWA 2EWHA 1TAQA 3NS7B 3OJUA 2UXDF 4JI5F 5BYQA 2VASA 4P6QA 3LP0B 4IG3B 4NOHA 3TEGA 1S1TA 4L6V3 3T6JA 3GV5B 2PI4A 1P8GA 3H90A 2YH1A 3PRBA 2HZCA 1NCLA 2LU2A 4L3KA 2J76E 5IZHA 4CO2A 1Z2ZA 2CPFA 3N5FA 1CQMA 1XERA 1FDDA 2LQBA 3I55S 1RT1A 1WEXA 1RAIB 5F8MA 4LF8F 3HHLD 4CIOA 3PDNA 1IKVB 4WBFA 2PD1A 3MEDA 3UD4P 2DEIA 5KFKA 2ZVSA 1WF1A 3VVTA 3PEJA 4I4BA 4ZP7A 3ILOA 1B3TA 4HR2A 3H4BA 3K5PA 2FZKB 2KFYA 5HBMA 1SKWA 4I67A 4IOCQ 3QGIA 1EB0A 1JNZB 1H7XA 1YZ6A 3B4MA 1S79A 4QU7A 1WHWA 4AL5A 2BJ9A 5F8IA 5KFPA 5KG5A 3VGVA 3AD7C 3NNAA 1R0AB 3DI6A 1FRKA 2V9WA 1VK8A 2ZWPA 1RCXB 2YWEA 4YB7A 4RW9A 4HEA9 1F3FA 2CQ2A 1X0PA 5KFYA 1TUWA 1BC6A 1VHFA 2OLWA 5B7WA 5KFAA 3HFVA 1X9MA 2X1GA 5C2GA 3DOKB 1TVRA 3GYNA 5D15A 1MWQA 1BWEA 3TX8A 3FGVA 4MKBA 2EFPA 2JLGA 4DZ6A 2Z56B 5LSRA 4DR5J 4DFPA 1FO1A 5CYMB 2OSRA 3KNAA 3HD1A 2AGQA 2R7OA 1PBAA 3ISND 5L9XA 2V4QA 4LFCJ 1VC6A 1FTCA 3SQGB 3G4SS 1Y5IB 1PAUB 2AGPA 2MKKA 2GNKA 1KD1T 3NWRA 4HDGA 5KFGA 5BXIA 3FMBA 2YWKA 2PMZD 3D3BJ 1YJ9S 3SSSA 2L48A 5IT0A 1C1BA 3UCZP 2KO1A 4K4XA 4A8SA 2VU5A 2FB0A 3IN5A 4UOHA 3QT7A 3ZZYA 2XY6A 2IIHA 3NOGA 1RCOB 3OTDA 5GMKa 4JB8B 2KG1A 2Y1IA 4LRDA 4URGA 4CH7A 3BEGB 3VAMA 5KFTA 3CE8A 4JV2A 4CYUA 4B3TF 2MZTA 3C66A 1SC6A 2WOMB 3MAAB 1R0CB 4KTQA 2MHEA 4NYZA 6AT1B 2VKRA 3I96A 2OH2A 2VPYB 2GO9A 4RW6A 3PKYA 1F2HA 2RD5C 4HACA 3K57A 2AW0A 1KN6A 2DITA 1N4LA 3K0JA 1XN9A 4KO0A 2X7IA 4USKA 3R27A 1UW9A 1YLXA 4WKRA 2UVWA 1KTQA 1C0TA 1PJ5A 2VQFF 1BQXA 4USTA 1EIYB 3OVSA 4OJGA 2DXFA 1ZBTA 4H4MB 5KG2A 3ZTRA 1T05A 2E7XA 3IG1B 1XMBA 3MECB 4YHHF 2XMAA 2F9DA 3BPSP 3CCTA 1KWMA 1EETA 1L3UA 3GSDA 3BGRB 1DRZA 1SQEA 4KGKA 1FKOA 2YTCA 2E5LF 3VHQA 4DV2F 5AJ3F 1FX2A 5L8RC 4ZK7M 2I5JB 4ID5B 2C22A 2X1FA 4J9LA 4JYAJ 4X64F 1M0SA 3AY0A 3GMGA 1PYOB 1FE0A 1A6LA 1QE1A 2ZHAA 2JEIA 4DU7A 3LWMA 1K0VA 4AQYF 4DHVA 1REVB 2LP4A 2PE8A 2OSQA 1HD1A 4QYRA 2F9JA 3FQLA 2XGPA 5ETSA 3PX4A 4N41A 4P7VA 4URSA 4DQPA 2HQCA 4CLTA 4K4TA 4A8KA 1U0SA 4LFAJ 1BUXA 4QR1A 2HYIB 2Z2YB 1T3OA 2DK2A 4V19J 5C42A 1JLAB 4F4KA 1LV5A 4C8KA 4DWIA 3CIZA 3CXCR 3JQKA 4DR1J 4KHPJ 2C2NA 3BBFA 1Y10A 1JXLA 2XMUA 1IXKA 4TQSA 2RF2A 2B9EA 1BLUA 3IR7B 3KK3B 3GV7B 1J27A 2ZE2A 3VAJA 4WU2A 1EP4B 2CQCA 4CRJA 1TV6B 3M6WA 2H54B 4ZLNA 3MCSA 4RBVA 1VDHA 4FYYB 4P2XA 4WFNQ 5HMYA 3GJRB 2JEFA 4B3RJ 1BY9A 2YNFB 3D7SB 3GONA 3F73A 4FF1A 3P8BB 3UD5A 4EYHB 2LA6A 2IAJB 2Q79A 1Q16B 2LXIA 1VQMS 4Q0BB 3PRDA 3V5RA 1WC6A 3Q8YA 1RA6A 3TVYA 3HHLB 4EI2A 5DQHA 2WVBA 5U47A 2RS2A 1WTFA 2JNJA 2Z58B 3AFGA 5KFVA 1AUSL 3DHXA 5CYQB 3AHPA 1QM9A 3L3CA 3CF5Q 4O23A 3CCRS 4WU3A 3K5OA 2BACA 2MQ8A 4C7QA 4DOZA 1N8RT 1VRTB 2IM0A 1QUVA 3IA0A 5L1JA 1QUPA 2CA9A 3UN5A 3CCVS 3SXLA 2ZH2A 1XMQJ 1GNKA 1BWVA 3W9IA 2ATLA 3SDEA 4KJIA 3S7RA 2N4DA 1U1NA 4P73A 5HP1A 3BBBA 2RAQA 4Y65A 5KG1A 1S9EA 3TZWA 3NGDA 4ZA1A 4ZVOB 1RJJA 3MEGB 1DY3A 1VQKS 9ATCB 3I5CA 1PO6A 4HVZA 5A8KB 4RW8A 3GFXA 1RAOA 2XMTA 4DSLA 3TAQA 4RNOA 1E6YB 1KVJA 2ROEA 2B9YA 4BS2A 3BGFA 1RT2A 2B8QA 2XYHB 3T1YJ 1NK8A 3B78A 4ILLA 4WCEQ 2DGXA 1CJVB 2V8DA 4DPXA 3VAKA 3M32B 3L4BC 2C1EB 3T1HJ 1RT6B 1FKAF 5HMXA 3DHWC 2R7QA 2XZDB 2WSFC 2K1RB 3TI0A 5LOQA 1XC9A 1TR0A 2KFNA 4DR4F 2GJIA 3I87A 3RR8A 2HVEA 3D0GE 4JI8J 1LW2A 3BR9A 2J7UA 4ED2A 2MKCA 1VS3A 3J80Y 4KGZB 3S1TA 3HXMA 2C42A 1B70B 1KNZA 3OR1B 3U27A 4NASA 1OY6A 2HHXA 4K2XA 3LANA 1WKLA 4WF9Q 2DISA 4DX5A 1S76D 1RWUA 3N28A 1SIWB 1OO0B 4C8MA 3D9BA 1T8EA 2MZ1A 2H9ZA 4IDKA 4EBDA 2LEBA 2RDDA 3TYTA 3BS9A 4ECUA 4WJBA 1KC8T 2Q6CA 2C3OA 2AMCB 2D3OR 1FA0A 2V94A 4U96A 1SJRA 4NI2B 4DR3J 3TZZA 4NYOA 2CPYA 2HAFA 1Y3JA 1FWLA 2RT3A 4WE1B 1B64A 1WJ9A 4N5SA 1HQEB 3K59A 5KFDA 3EE3A 2FVSA 1HPZB 5J2PA 1WF2A 3SZ2A 5A8WB 4F0HA 1JLGB 1XR7A 4RL1A 1CS4B 2XMMA 4ZP9A 2NYIA 4LR7A 3QRRA 4L3NA 3CMAS 1FNXH 4LRFA 2PGCA 3CJTA 2J6UA 1S48A 4CO4A 1QSYA 2XLKA 3MTKA 1WOPA 4ECVA 1R0BG 4FS2A 4UOFA 3QPIA 3MR6A 1WI6A 4GC7A 3FBCA 4KKOA 1S1WB 4JI2F 3NP5A 4OZLA 3OTCA 4QWAA 2R2RA 1UL3A 1KKHA 5DM6Q 1V3RA 4C0OC 3RRHA 5KFBA 1L5UA 3TJAA 1VQOS 5E3RA 3MCOA 1S1UB 3OW2R 1GXTA 4K0KF 3PW2A 2V63A 1TKDA 4OYIA 1HNZF 2PO4A 2ZBCA 3KTQA 4DFJA 4H54A 2K06A 4OHZA 2MLZA 4WTYA 4PWDB 3JSMA 4LRBA 4IQXA 3SV4A 4OHVA 1XNRJ 2DNQA 3I6PA 1U6ZA 2VC0A 5B08A 2VB6A 1NDKA 4F4ZA 1J5EF 4DUYF 3DFEA 1IJEB 3IM8A 3CC7S 3DGPA 1JWWA 1AUDA 3LA0A 3OD2A 3NXZA 2LQ9A 3GFYA 5LM7E 1SBRA 4USMA 2AF6A 1RLDA 4ZIWA 1LFWA 1TK5A 2XI2A 2OMOA 5D3GB 3OVAA 1LEOA 3UCUP 3TEHB 2GCFA 3LP0A 4IG3A 5A6PA 4K5RA 2ZDOA 3PX0A 2Z2LA 1YITS 2HWTA 3UNGC 1N5YB 4JV0A 1EZZB 4I68A 5L1LA 2GA7A 1ZPWX 3DRYA 2HZVA 3BSNA 3JSRA 4CH1A 1IKVA 3P6YC 2QO3A 5HATA 2J0QD 5KOWA 3AOAA 4F4XA 3BJYA 2D3O1 2V2VA 4LF2A 1WACA 4CO1A 4YEAA 3KLHB 3K7RA 3J7YI 1KLMA 1MSWD 1U1RA 1JJHA 3OXLA 4J9RA 4OHXA 4Y2CA 2LDIA 4QR2A 1PGZA 3DLGB 4ELVA 2XNQA 1CPZA 4ZPDA 5E3PA 3LP2A 1N5VA 4ZPCA 1CBKA 2ZH8A 4WP8A 4NCBA 3U7JA 2GAHC 3M7VA 1R0AA 3RG6A 2CJYB 1JK9B 4KGXB 2ZVIA 4IYQA 1S0MA 2VPWB 1GQEA 3IR6B 4G3IA 3W9JA 2HVZA 4DLGA 2W8LA 2F8HA 3OL9A 1RWVB 4GVBB 2W8KA 3RBDA 2B5JB 1S1XA 4ZLJA 1H7WA 3DOKA 3OV7A 1PCAA 2YKOA 5IOLA 3ILLA 4NLUA 4YN3B 2RRAA 2B4VA 4ECTA 3GILA 3D1OA 4GC6A 4XO0A 4F36A 3MURP 1FFWB 5GMEA 5CYMA 4I6YA 1GK8A 3W61A 2RRBA 2VBZA 1URNA 1G7CB 4DDFA 3SQGA 3T41A 1NB7A 2RMLA 3HSDA 4CT9A 1RABB 2YQ1A 3KK2B 5KFZA 2OPPA 2Y1JA 4E0DA 3PO4A 2VG5A 1Q7LB 3RB0A 4F25A 2E29A 4Q2MA 1O8BA 4W90B 3TP2A 4GKKJ 4I6WA 1UKUA 3E8OA 3AODA 1HW9A 1HNVA 3I5AA 4PWUA 4OHYA 1UP1A 4FP9A 4V1Ak 2HVHA 3CD5A 2WOMA 3KLVA 1R8PA 3I0SB 3MAAA 1IM4A 1JLCB 1DLOB 1VQ4S 4QYZK 3K17A 4P72A 3QFHA 4RW4A 2MZSA 3KLGA 2B56A 1GXLA 2GQQA 2PN6A 4DV7F 1XR6A 1R3NA 2AZ3A 2OJ3A 3T9NA 3V4IB 4MYTA 4DF4A 3GE9A 4LFBJ 4Z7CA 2UXCF 3R1HA 4DN0A 5DDOC 2QFJA 2FHJD 2HW3A 3OSPA 3J7A1 2XMWA 5FLXY 4USHA 5L39A 1WD6A 1X4FA 1SJQA 3R7BB 1RP5A 3IG1A 4FZVA 1BQNB 2U1AA 5KFNA 2O1PA 2NSCA 1GX5A 4ZDNA 3T19A 5KFLA 4KH0B 3UD3P 1NK0A 4CLZA 2FLNA 2UV8A 2R7TA 2GX8A 3THVA 1K9MT 1KHVA 1SCJB 1WC0A 2W9BB 3GG1A 2UU9F 3ITHA 2DPJA 1J5OA 5CQGA 5LT5A 4ID5A 3R7NB 1TELA 2VDIA 2LVWA 3CD7A 3MM7A 2JVOA 2B7BB 4BLGA 1X5SA 2JOQA 3SI8A 1IWAA 2ZZMA 3SBMA 3P96A 4TNOA 1VR6A 1OQ6A 2XHCA 5ETMA 3AXKA 4DQRA 4U9RA 1T9TA 4DL5A 4WFBQ 4GO7X 3KFWX 4I2QA 4CO5A 2AV5A 2HGNA 3TZXA 3QZ7A 2BOPA 1O6XA 1FI4A 4HH0A 3GR1A 1JLAA 1JXVA 2PSZA 1O0PA 4RBTA 2XWXA 2QA2A 2VC1A 1U1OA 5CCLA 5D6GA 2KKHA 4B3MJ 1UTAA 2XMKA 2CJQA 3KK3A 4EFAC 4RNHA 5ETTA 1RHJB 3H8YA 3NBPA 3BSOA 1YWXA 3VZIA 3O8WA 4WP9A 3T5JA 1VYAA 4ECYA 2KXFA 2KJVA 1CSJA 5KFXA 2R8GA 3DC2A 5HROA 4BCAA 1RTJA 5F3ZA 1NKBA 4X4QA 1NNDA 2CVEA 3X1LB 1D9FA 3OLBA 3M6VA 5M2PA 2J0WA 4Q0BA 1UEKA 2WONA 2CJ9A 2CVIA 3TUJC 3NGRA 4NA1A 2LCWA 1Z1ZA 2L9WA 4N7TA 2FJAB 1G2EA 5A2QY 2HFSA 1WELA 3ISZA 2HRTA 3UVJB 1X5OA 2UZAA 3PJ9A 1KFDA 2QLBB 4B9UA 4OX9J 1Y5NB 4PYDA 3O5TB 1JKHB 3PNIA 5CYQA 3DRPA 5FJ4A 1W26A 1Q95G 3AD9C 3I82A 1GFWB 4J9VA 4K4UA 3ILJA 5ETOA 4KPCA 2PC6A 1NJWA 1VBKA 2I2YA 3NMAA 2LECA 3PCOB 1MU2B 1YZ7A 3ZZUA 3CCZA 2ZD1B 1QSSA 1IWGA 2VBYA 3CC4S 4DR5F 1HMVB 4HH1A 4CLSA 3OSNA 2BQ3A 5DGAA 2C2DA 2FGOA 1UEUA 4IH5A 1AROP 4LFCF 3VWSA 1U2FA 2OTLS 4Y2AA 4O0IA 3MM8B 4RNNA 3GYGA 1NJYA 2APOA 2J8AA 3CDUA 3IWXA 3MPYA 2JEGA 3M8PB 5EHHA 4UUXA 4NLOA 5A8KA 1Q5VA 2IJFA 4PABA 3UW1A 4ECXA 2QE5A 4NEYA 2VFVA 1PIEA 1APSA 1K1QA 2QTWA 4M5LA 4X66J 4KV8B 5K5MA 5ETNA 2E5GA 2BM0A 2C2MB 1X60A 1RSCA 4QIGA 4B3OB 1NDCA 5I3QA 4PR6A 1AXQA 3FCVA 2MKSA 5CXTA 3GIMA 2W9CB 3M32A 1M1GA 1RT6A 3IGNA 3R5DA 3V6KA 1FWPA 1C1CB 5H1SV 5KFRA 2CYYA 1YBAA 4AFFA 3JYTA 1CVJA 4LBIA 4UF4A 2MKIA 1XR5A 3VR1A 2HIYA 5CHCB 3M8QB 1AA1B 4M5MA 1WDDA 4OMFG 3VALA 5AE3A 5LJ5Y 3F56A 4ELUA 3SQOP 1NK5A 3DOLA 4PG5A 3KUEA 5JVHQ 1IBCB 4OYZA 1ZH5A 2J9CA 4KQZA 4LUBA 1HL6A 2GJ2A 1HYSB 4LF8J 1D8YA 1XBWA 3V81B 2W1BA 4I2PB 2BMBA 1KVKA 1U26A 4Q44A 2HBYB 1AW0A 2N7YA 1HI8A 4NI2A 4EK2A 1TZ0A 4MJKA 1HIYA 4LF1A 3GZ7A 1NRKA 2BJDA 3WIVA 1NAQA 4WE1A 4OV1A 3L9ZA 4NL5A 2F63A 2IRUA 1Y7PA 1HPZA 5EN1A 1AFIA 2R7RA 4QYZJ 3GYXB 4I1TA 1S6PB 4FBUA 1JLGA 4J9QA 2AKWB 2BZ2A 1CS4A 3N5BA 2HHTA 5D0RA 4X4OA 3M2RA 3CJKB 4C11A 3QSIA 2ROGA 1Z4UA 1O5JA 3SFGA 5JXSA 1WUUA 4AYBD 1LKZA 4MMOA 5H9FJ 1S1WA 2ABYA 3MM9B 1BHNA 2KU7A 2NZ4A 2ZJPQ 1VQ7S 4DR1F 4KHPF 1IR0A 2V8GA 3T5LA 3I0RA 1FKPB 1S1UA 4XTTA 3HJFA 2VPXB 2V8HA 4DV5J 3Q89A 4A46A 1D0EA 4CTAB 3BH7B 2VQEJ 1HWUA 2A6OA 5A2QU 2XSJB 4OYPA 4EYIB 2VZ9A 1SI9A 5E0OA 3T9ZA 5JJBA 3BQ2A 4PWDA 2W25A 4Y2IA 1N33F 1RB0A 4USUA 2V69A 1FJ7A 1HBNA 3FFIB 4N47A 2POKA 4F2RA 4EMDA 4IG0B 2VONA 4CQ1A 1NJZA 3QJLA 2V50A 1MN9A 1WOSA 2CKWA 1VISA 2JZ5A 4NLWA 4W92B 1RTIB 4WFZA 5DZ6A 2IHR1 1B4SA 2CQIA 1P1TA 4OI3A 3NGSA 3LH2S 2G0JA 3RGIA 1HBUB 3M2UB 4JBCA 4F04B 1XNQF 1VBXA 3W64A 4NLPA 2KRRA 1YQHA 3DXSX 1FRMA 5HLFB 2M7SA 1KS2A 4OI6A 3IRXB 3A8JA 4RW7A 5GAHI 4C8OA 5CYJA 2CZVC 3CWJA 1K1SA 1XMQF 4YHHJ 2JVRA 1HBMB 1WOOA 4YOEA 3ILIA 4R0JA 3WDOA 4ECZA 3T1AA 3KLHA 2DGQA 1K0TA 5CH7B 3K8VA 1REGX 2DGVA 4C4WA 3G6YA 4DUZJ 2A10A 2XS2A 2OPSB 1UPMB 4DV2J 2OKQA 3ULHA 2K7KA 4P2FA 3TAMB 3RRGA 1M5SA 2LU1A 4AL7A 2DNZA 2GV1A 3OTBA 4X64J 2DO4A 3FQKA 5HMWA 2OPRA 2GS8A 5HJYA 4UQGA 2UP1A 1VQNS 2BUNA 2P9GA 3JXOA 4HHHA 8AT1B 4Z7YA 1U1QA 3CPWR 2CNKB 2B5JA 1VFJA 2R42A 3H98A 1TKXB 4QW8A 4USJC 3BSAA 3PHEA 2HFUA 4V19X 4LSLB 2RU9A 3VGSA 1HR0F 4PQUA 2NQPA 3M6XA 1URRA 4LQ3A 1V5IB 4HDHA 1ZA2B 2CQ3A 2BM1A 1HNWJ 3QWUA 1RDRA 5EWFA 2AJ4A 4E2FB 3CJRA 4OX7A 4NEZA 1UFLA 2IDEA 4CLWA 3OBIA 2J9EA 1KFSA 3G2XA 4NCGB 1KQGB 4DV6J 4K4WA 3KJNB 3KK2A 3BQ0A 2XGQA 2MKYA 2JHEA 3W60A 1U7LA 5IQ6A 2W2OP 2RJZA 2HS0A 5G0RB 5KTQA 2QT7A 5HVGA 1BQMB 1EJ7L 4RUHA 1VLOA 3CJ3A 3UDLA 1WG5A 1AT1B 3E01A 4ETXA 4DX7A 4OZ2A 4J9SA 1Q8LA 4PXCA 4YR3A 5LSLA 4ZMMA 2ZFHA 4ECRA 3D1QA 1CEZA 3HCXA 2BX6A 2CPXA 2AHOB 1EAYC 4N76A 2JJ4D 3I0SA 2GHVC 5CD4H 4X84A 3Q22A 5BR8F 2EEYA 3M05A 2F4VJ 5C24A 2X1AA 4Y28C 2QIFA 1GAOA 2HBQB 1TK8A 3V4IA 2OAUA 2YNGA 2X3DA 2ZNYA 3KUGA 1D09B 2JC1A 4ZN1A 5C5JA 4OYBA 4F8RA 4L74A 1WHVA 5D4LA 1NMEB 1TL1B 3Q0AA 4NXMF 2P2CB 4CNZA 3GJQB 1BQNA 3M8RA 4M5NA 5J2QB 3EX7B 1M90T 4FPIA 5L38A 3BR8A 3QQCD 3FEYB 5BYRA 2QMUB 5EGYA 3RZAA 1SC3B 1NO8A 1VRUA 2W9BA 1KQFB 1N5SA 3BGUA 4UT4A 2R7VA 2ZOGA 2W7PA 3D4JA 4GMKA 1NB2A 1ICEB 2B4UA 4M8LA 4M5GA 5KFCA 1ITPA 3TVKA 1HWKA 3J7Z5 4JUZA 1XNRF 4Y2KA 3PY8A 2GQ2A 3TWZA 4CLYA 1RT4B 4Y34A 1F0XA 3FZ2A 4IFYB 4YB1P 2HQFA 3F41A 3OTOF 4DV0F 2QL7B 1JLBB 3LO3A 3PKMA 4OYXA 1UJ4A 5BJRA 3QRQA 2ASYA 1OPZA 3RB3A 2ZHOA 2K7JA 4PG4A 2NCKL 3PACA 2GFFA 2ACMA 4DUTA 2Q6BA 5DM7Q 3KLEA 2JFDA 2Q3PA 1MWYA 2FJEB 2QGFB 4QIFA 3P5BP 4DR4J 4M5HA 2I38A 2RE1A 4QIVA 4MFBB 2QA4S 3HSJA 5C25B 3RU0A 2OP5A 2QA4G 4A47A 1Q0NA 2FZCB 4ILMA 2OD6A 3H42A 5K20B 3EICA 4G1PA 3KHGA 5D0HA 1AB8A 3TUIC 3POTB 2FLLA 2FJDB 5HJXA 1TL3A 3QMQA 1PG5B 2BRLA 1C2PA 2Y1RI 3VGUA 2R8HA 2EFGA 2GVDB 3RBEA 1DZ5A 3F44A 1R89A 3MPVA 3J81U 1NHVA 1FE4A 3UVJA 3M8SA 1KVIA 2J8SA 4NLXA 4Y0FA 3OFHA 2XY7A 3R7SB 4X2BA 3KG1A 2JFKA 4RNMA 2EK1A 5B0DA 1M5PC 1SJ3P 4ETZA 1Q7YT 4Y2MA 3DYAB 1YJ7A 2IJRA 2L3MA 3IP0A 2CIMA 2YX4A 2M52A 2OELA 4F2SA 2YPZA 3GSIA 3HSZA 3ZTOA 1F5BA 4RKUC 4IO1A 1HLWA 4JI6F 2BBEA 2EC0A 2KYXA 1N6QB 3CT9A 3BN7A 3K5LA 2Z2ZA 1FHTA 2ZD1A 3TOQA 4BHQA 3VAIA 1HMVA 2CPDA 4JI2J 1UVIA 3ENQA 4K2JA 2RRNA 2R2UA 4ZVPB 3IS9B 3QT6A 4XDDA 4QU6A 3MM8A 3B54A 2YH0A 2LKZA 4OYWA 2RH3A 2XWYA 3M8PA 3T5HA 4ZPVR 4ZVTB 2B0GA 4B9NA 3H2LA 1S6QB 3QO9B 3R5CA 1RACB 2B51A 1VQLS 2F5GA 1DHMA 4HL9A 4JI3F 5D0EA 2J6SA 1RHMB 4K4VA 3A3NB 3ETMA 4JV1A 1KBRA 4DQSA 2BE7D 2XG8A 4B3OA 1J5EJ 4DUYJ 2OPQB 3KLIB 5J1PA 3Q8SB 2XS7A 5IV4A 1RT3B 1R7IA 1L3VA 2Q43A 4LREA 1DTTB 1GX6A 1P27B 2IA6A 4XPEA 2V9KA 2CDRB 2VKZG 2DRDA 3DDKA 3BBCA 4FYXB 3CCJS 4DQIA 1MROA 2F65A 1VJWA 3G8TA 4LFBF 2R8JA 3M8QA 1FDNA 5HL7Q 1S12A 1IN0A 3CDWA 2RQCA 1I51B 1FNOA 1MWZA 1NDPA 4PAAA 1FRJA 2ZUAA 4ZVQB 3M9NB 4I2PA 3H5XA 1CC7A 1X5PA 3H0PA 1Z2LA 3D2WA 4WK1A 2ZH6A 3A8KA 1JIHA 3A12A 2B3TB 4WP3A 2QJ3A 4QBUA 4X4RA 2Z8QA 2RSQA 3EZUA 1QTNB 4ICLA 2G2YA 3VAGA 2A0FB 1RAJA 2MQQA 3TJ9A 2YWFA 1HQUB 1S6PA 4LF7J 3IM9A 4DPWA 3CJ5A 2ILZA 4LRCA 3HKZD 2PI5A 2HNZA 1M5OC 3GIJA 3W5YA 3HLUA 3CJKA 1DARA 3ZC4A 5JVGQ 2RKIB 2E7WA 2VPZB 3H20A 3D3CJ 2CADA 1VQ8S 4CCHA 4DCJB 5HSPA 4I7FB 3FC9A 3THPA 5AE1A 1RAHB 2KT2A 1KQSR 3MM9A 1PKUA 3LWLA 2WVEA 5HMZA 4OFZA 2A18A 1Q1KA 4QPXA 1WHXA 2NXEA 2IVMA 3OHBA 2FJVA 4WTOB 2FLOA 1B7YB 1X0FA 3VF0B 2XSJA 4RX6A 3ZTSA 3KG0A 3G9CA 3JS9A 3I9ZA 3D1HA 1UVNA 2HS3A 3MMBB 4ZLPA 3I56S 3AD8C 4ZVEA 3FBBA 2KL8A 3FFIA 3KNGA 3ENAA 1IUJA 3HT3A 2ZUGA 3Q24A 3C14A 3BGLA 4LBPA 3K2YA 2DR9A 3C16B 2EK6A 2AQ4A 3ENWA 3AJDA 2DGSA 4ECQA 1RTIA 5IS2A 2R8KA 1RAEB 1NHUA 1ZZFA 4X4VA 3ZZZA 4MK7A 2DNOA 3A3OB 4USIA 1H74A 1FF2A 2FVRA 3R5JB 2DRBA 4DV7J 2KZZA 3S01A 4F50A 1RAFB 3PYFA 1Q8IA 1FT8A 3NCQA 3JSBA 4F26A 4A8XA 5RUBA 2ADBA 3C46A 2UXCJ 3D6TB 4KAIA 3SCLE 4K7QA 3IRXA 5J2MA 2DNPA 2QMWA 3WQPA 1SIZA 4FS1A 3KWMA 4TVAB 2MGZB 4MIAA 3MMAB 1LWFA 3NKYA 1I94J 2DNKA 2BRKA 1VJQA 4ZVGA 1AFJA 2OD4A 4FXVA 4IRDA 2WAQD 2UU9J 4CLKA 2HHHF 1R6YA 1YBTA 2CQ1A 3TAMA 4A8FA 3HD2A 2EC2A 1NJXA 2V8PA 1IKWA 4CLLA 4KHRA 1WF0A 2CNNB 1X4GA 2N3LA 2FHOB 1SVDA 1FVSA 2ZH5A 4X66F 2G1HA 2AGOA 4DCOB 4Z2XA 2CQGA 3DKDA 4ED8A 2BXJA 4LF4J 2CPHA 1TUGB 3B6BA 2VFRA 1HWJA 4W4MA 1ZETA 1TKXA 4NLTA 2EI5A 3M30B 4Q2LA 3SFUA 4LSLA 1KTVA 4L72B 2V6AA 5ETRA 4DPTA 5EWGA 2B6AB 3EZ5A 2LQ5A 2QL9B 3G86A 2RS8A 4KB7A 3PEHA 4U8YA 4YR0A 4PYAA 1Q53A 1N36F 2HRUA 2FYXA 2HRYA 3AJ1A 1XK8A 4FYVB 2H51B 4NCGA 2PMHA 4K4YA 2M88A 3MUMP 4LF9J 2L41A 4CM2A 3ZZ0A 5G0RA 4B9SA 4E8UA 1F2GA 2BJEA 3CJ2A 3U1LA 5LMUJ 4DF8A 3IBCB 2QG9B 4ED7A 4DL6A 1NZ8A 2U2FA 1WEZA 4N8NA 3LPEA 2N7CA 5GAHU 3TANA 1AZSB 1RHQB 3QGPA 4IRCA 5IT9U 2HAIA 2LMIA 4LQ9A 2JX2A 4FYWB 3CO9A 2BKNA 4YB6A 1VCTA 4ERDA 1ZYQA 4EEYA 5T7LB 3CSKA 2EG1A 4Y6IA 1S7HA 1TKZB 2YBVA 3IAS9 5K9FA 5B09A 2PA8D 1QAIA 2B4PA 2IDLA 3AXMA 2BJ7A 1TL1A 1S4FA 3MI7X 4B9VA 3P49B 3AAWB 5J2QA 4O0NA 4X4SA 2WSCC 4QWBA 3N6NA 2HHPA 2VOPA 3SCJE 2MY7A 4FF3A 2B9XA 1ZOTA 2XULA 2OMLA 1S1VB 3OXGA 1HWIA 1ZTTA 3P3DA 4X4PA 4DV5F 4IH7A 1RU1A 2GMHA 2VQEF 2E5IA 4J9UE 4M5DB 2DHXA 2HHSA 1U6BA 4UY85 1VQ6S 2V4JB 2ASDA 2ZZTA 1SUQA 3EZOA 2MMYA 4MKAA 2ZBIA 1RT4A 1WG4A 2KFZA 4IFYA 4OZNA 3GB0A 1RWMB 1YRTA 3ELHA 4JI7J 1U45A 1WSVA 5F0UA 4QWCA 2PEHA 3FK4A 1ZM9A 4ZCMA 3HK2A 1JLBA 2G0CA 1N52B 2QLFB 3A13A 3ISNC 1PJ6A 1JX4A 3D5MA 1UMJA 1F1BB 2DEJA 1LK7A 1S10A 1KR4A 1UAWA 3RRKA 5DETA 2ZWOA 3ZNUA 2HPUA 3MR2A 2IVFB 4M5KA 4DL4A 3KHRA 4NZ0A 2IFXA 1RT1B 1YHQS 2Z30B 2D1CA 3KKFA 2VDHA 1U47A 5C25A 2XEXA 4RNFA 3QAUA 1IJFB 1WSRA 3TUPA 3KDOA 1TKTA 2D9OA 3FVYA 2R9LA 3EGNA 3POTA 4FNIA 1YJTA 5HBMB 5GADI 3QIPA 2DGUA 2PFDA 1LNQA 4C8ZA 2KM8B 1N56A 1T03A 4IR9A 3QLHB 2EFNA 1FJEB 4ILRA 2I9SA 2BQRA 4DUZF 2GVDA 2X51A 2R7XA 2VFSA 3DI6B 2DRAA 1W25A 3ZXWA 3KLFA 3CNQP 2G2OA 4XDCA 1TP7A 2GGPB 3G8SA 4P2MA 1N48A 4JI0J 3L95X 3NGUA 3ENVA 5HN0A 5IWAF 4LT6A 1DQ8A 2FJBB 2HQGA 3DRRB 1N88A 1X4DA 3MDFA 1NSPA 3OT9A 3S8SA 4DX6A 3LUYA 3H7HB 5KT5A 1RAAB 1TVRB 1XMOF 1C0UB 5D0GA 2EVZA 3EVMA 3KG4A 4G1IA 5B0BA 2E1MC 3KJVB 5IM0B 3NMRA 3AH6A 2XZTB 2IRYA 5A8RA 1T02A 1N6QA 3DLEB 3FNNA 3K5NA 1TMMA 5K8NA 1M1KT 1SKRA 1VHIA 2KG0A 2K3KA 3PFOA 3MFHA 3D6FB 5GAEI 4G6VB 2IVYA 3T6BA 4DN9A 4TLRA 1HNWF 3ZO7A 4LF5F 4ZHRB 4DV4J 1VQ9S 4Z37A 3IS9A 4S0MA 2W2PP 4ATNA 1C1BB 2W2QP 4DV6F 1H6KX 1MN7A 1VMBA 1VOMA 3D67A 3MGJA 4OI2A 2HGLA 4KPYA 1S6QA 4QOTA 2O01C 4ED0A 3QO9A 5KG4A 3Q83A 2XLJA 1YJVA 2CWXA 4PRFA 1R8CA 1P1LA 2ZJQQ 4B17A 2AU0A 1N33J 3BKTA 4CLUA 2UXBJ 3DN9A 2OPQA 3KLIA 4RW6B 1N34F 2HGMA 3NGTA 3EDQB 4HACB 2MJNA 1LWEA 1RT3A 1EQ0A 3FCWA 1DQ9A 2Z0GA 3H59A 3BZQA 3HFZB 3A1YG 1DTTA 1D3WA 2CQBA 2Y3YA 3MHYA 3MCMA 1NH8A 3QIDA 3OLAA 2F4VF 3C8YA 3NAIA 1N32F 4LSNB 1GTEA 1C0TB 4IUFA 3FCHA 3VAFA 2BDPA 1KOOA 2ZH1A 3KK1B 1XNQJ 3CO0P 2MLYA 1NSQA 4I6AA 1UFKA 2BANA 2IRXA 4JOUA 2DHSA 2OO4A 1QTMA 3PTWA 2HSEB 2AYBA 4EZ9A 2HS4A 4KGMA 4R25A 3DLKA 4TY8B 3OL7A 2XYGB 2HNDB 1S6UA 1U02A 3MMCB 3BB5A 5C2CA 1HW8A 1T0TV 3LPYA 5HK4A 4ZJLA 3A8EA 4TXSA 1U2CA 2EBEA 1R8BA 4P71A 1R8HA 4P10A 3GTYX 3ZZRA 2YY3A 3DMJB 1BXNA 3HVWA 5B0CA 2AJ2A 3U1NA 3JQJA 4MH8A 1Q86T 3CCMS 4B3SF 3IR5B 2XB2D 5F9LA 3IWNC 2A3JA 2DIUA 1HQUA 4DBQA 3MFIA 3TJ8A 5KT4A 2MY8A 2MQLA 2WVCA 2K8GA 3CCES 4OLPA 1ZAXA 2MDAA 2NXJA 3VVUA 3AQOA 4EUVA 2PEBA 1VBZA 2HVIA 4YS2A 1RBOB 2RKIA 4DQQA 1O51A 4C9DA 2A2CA 2UVRA 1U8WA 3CJSA 3GV8B 5KT3A 4I7FA 3RB4A 1SXLA 2KVQE 3NOCA 3HZEA 4DL7A 5M2RA 4HLBA 5J1EB 3N01A 2RF2B 3FSYA 1HR0J 2WB4A 1IR2A 3R5GA 3UQSA 3W2VB 4OQJA 1RWOB 3R8YA 4F4WA 1QSLA 9RUBA 4NXNF 4I64A 1X4EA 1Q8BA 1VQPS 3EM1A 5B0GA 3IO1A 2MLXA 2WW8A 3JAMY 2ZHBA 4KE5A 2BE2B 2OGUA 3H40A 4USVA 4ES2A 3US5A 2VL1A 4QW9A 1NPRA 1MNEA 3QSYB 1EHWA 4ALZA 3MMBA 1KDNA 4PXDA 1FD2A 3NG8A 4DCPB 1X7VA 3NRBA 4DX8H 4X65F 3L7PA 1M1HA 4JV5F 3QT5A 4PEOA 2W7OA 3UPFA 2NLWA 4C48A 1U4BA 4O3RA 2R2TA 1RHKB 3C16A 3VAHA 5CABA 2NXUA 2K2PA 4YB5A 4OJ3A 1CQNA 1FRIA 2QFIA 3H5SA 2OFHX 1IKYB 5BR8J 1T3NA 2YXLA 3DRSA 2RHSB 2WB1D 3NS5A 3EVWA 1EARA 4LR9A 3IWLA 2DH9A 4USWA 4QCLA 1UA1A 4BBYA 1WC5A 2CPZA 5KFFA 1ELOA 2H5EA 5CZVA 4MYUA 5LMNJ 4G1QB 1D9AA 5EUHA 1F9EB 5CA5A 5HP1B 2J6TA 4NXMJ 4PZVA 2MGZA 2XO6A 1TL5A 3MPWA 5DG7A 3R5BA 1Y5LB 1SKSA 3WHIA 2N82B 3MMAA 1WHYA 1KRPA 4NLYA 2YPYA 4O3NA 3UI3A 2RQKA 2KHDA 5IV3A 1SL0A 4OZ5A 3G6ES 1KOHA 4NRUA 1U49A 3JB9k 3PM9A 4HHJA 2CQ4A 3PXGa 3ZNJ1 4O3SA 4PXEA 1RHRB 2BJ8A 2V67A 2W4CA 3IRWP 4K4SA 5KG3A 4L75A 1KEKA 5I4MA 1MG7A 1N0VC 3B82A 2DYAA 5DRKA 5KFMA 4KRWA 2EFQA 4ELTA 2W2NP 3G8QA 3CCLS 1FRLA 5D4OA 1TFWA 5AE2A 2WBRA 3LF0A 3UR3C 3X3UA 1OY8A 3M30A 4WXWA 4DSKA 5EDWA 3OTOJ 3GR0A 4DV0J 3NNCA 3HVRA 3C6UB 1S97A 2IM2A 2MHNA 4FXDA 2YX1A 3JTOA 2A1BA 2ROPA 5CCMA 1S77D 3CDBA 2P9CA 2BVZA 2HFNA 2SXLA 2FHKA 1MMDA 5LJ3Y 2F8EX 3EJMA 2C3UA 1SB6A 2E9RX 3JSYA 2F3JA 4IFVB 3FRYA 4IDKB 6FD1A 1EKSA 3SSQA 2FDNA 3OTEA 4CI0B 4LF6J 2RB7A 3UFCX 4WYLA 4JI4F 1NPPA 3J81j 1GMWD 3KJFB 4EBCA 2A6MA 1NLKL 3M8ZA 4DPUA 1RE1B 3MM6B 2UV8G 2AJ1A 4ED3A 2HHWA 5HAOA 1YJUA 1AZSA 1PBUA 3EXCX 5B0EA 4BC9A 4DFMA 2C3PA 3WX8A 2ZEJA 5IT4A 3FJ2A 1Q81T 1VLYA 2CDQA 1Y4ZB 3V6DB 4J90A 1S57A 2ZC3A 1G6BA 2CPEA 3AA9A 4LF7F 4CLPA 1T11A 3M4XA 4OZ3A 4ANDA 1B7FA 1JQGA 3T5KA 1TKZA 2QZ8A 5CAAA 3JTNA 4K8RA 4ZLLA 4KKOB 2AIRB 1H72C 3NNHA 3IMQJ 2YKNB 2KDOA 2VG6B 2Y8YA 4PXBA 5KG0A 1X8DA 3QJPA 3J80U 4JI6J 3LTOA 3R1LA 2KI2A 2Z57B 1HFEL 2DGTA 4FKXA 2MEWA 1YK9A 3C3LA 4RBUA 4XIUA 4YY3F 4OYAA 3W7BA 4YR2A 2E5HA 2V4RA 2VFTA 1S1VA 4LVOP 1S6OA 3RAMA 4RUCA 3PVXA 1Y00A 2E1CA 1XIQA 4M5DA 1MLAA 1SJ4P 1P9YA 2F7VA 4FNHA 7FDRA 2Q66A 1LXJA 4ID8A 1IBLF 4G65A 4HKQA 2FUG9 3I5BA 5KFIA 2I8EA 1RT7B 3NCRA 2ASLA 2LYVA 4JI3J 4NLRA 4QQBA 4K50A 1OYEA 1HA1A 1TU0B 2M8DB 2AD9A 4J37A 5T14A 4LBHA 2HZAA 3GLJA 3CB4A 4OHWA 4YDXA 4U7UK 1ZAVA 1UETA 3G82B 5LXYA 4RPFA 4D3HA 2JRSA 2GW8A 5FIIA 4ED5A 4KYZA 3KJQB 1K44A 3RTVA 4OJHA 2E1AA 1R27B 5F8HA 2NXNA 2H4YB 5EX0A 4TLQA 4ZVUB 2DNNA 4H4MA 5H9FK 3UE2A 3ZZPA 4L76A 3WX4A 4OI4A 1RUSA 3BO3A 2B4OA 2Z4PA 1KLMB 3MECA 3Q8VA 4C98A 5F8JA 5K8OA 4U67Q 1RTHB 1U09A 3QLHA 3PYDA 1C4AA 3LP2B 1I94F 3BGRA 2ZM6F 2J5AA 1HI0P 1V6HA 1H2VZ 1LW0B 5LL6d 3THTA 4EO6A 1A9NB 1RZMA 2A2DA 2DR5A 2GGPA 1YG0A 3IXQA 2I5JA 1QY7A 3MD3A 4LSZB 3DRRA 3QRPA 2HLTA 2H65B 1QLNA 1S1XB 1X4HA 1REVA 4PG7A 2BJ1A 2IYGA 3HVAA 4LF4F 1X4AA 4WYWA 3M6UA 3TW0A 2FVPA 1C0UA 4IQMA 3SIPB 2CFXA 2LEPA 1CJKB 3QT8A 4UTGA 3CUNA 2PFFB 4FN5A 3KJVA 5IM0A 2ZBRA 4ZITA 3DLEA 3RBZA 4WFAQ 3GIIA 2DJWA 4ANCA 4DS4A 2FZGB 1UWBB 1N5QA 1SL1A 1UVLA 3G6XA 3CC2S 2Q1LA 5DLFA 2E7VA 1VI7A 2DO0A 1VBYA 4NPOA 4F4AA 4ZHRA 2HFVA 1NSAA 5F8LA 2OPPB 2H48B 2ZBPA 3MOJB 2VG5B 2M3DA 2NPFA 1NSKL 1T9UA 2H5IB 3PIOQ 4LF9F 1EP4A 4TU9A 2JDJA 4OYOA 1T9YA 1TV6A 3JQMA 4U7UD 4Y3CA 3MAQA 1HNVB 4PCQA 5LMUF 1ZM2A 3IBFB 3CCQS 2YNFA 1XQIA 1A7GE 1BMQB 4KR0B 3MUVP 3TA2A 3K8WA 2IAJA 4RW4B 1A0OB 3KLGB 3R2DJ 3O6QA 2IM3A 3CW2C 3PYEA 3WZ0A 3PR4A 7FD1A 2Y0SD 5GADU 2XBPA 2WSEC 3HHLA 2C2ZB 2UVUA 3Q8QB 3MOZA 4DXLA 3GFHA 3BSCA 4DV1J 5DS7A 1JLFB 4LSNA 1HKAA 4PKDB 2RVJA 5MLCV 2Y8WA 1NK6A 3R5AA 3BKFA 1CC8A 3H5YA 1U8SA 3KK1A 4ZCLA 4CNYA 1JXEA 2M70A 2CUYA 2IC3B 4ZS6A 1U6FA 3NL0A 5FDLB 1VRTA 4TY8A 1FTRA 1LWCB 5KFHA 3MMJA 2FY1A 2HNDA 4HTIA 5E5NA 2JEJA 4LJMA 3MMCA 1AYEA 5DQGA 4L73A 1K73T 3ITHB 2UUBJ 5F0WA 2HNYB 3PZPA 1J5OB 5JUMA 3GQCA 2EG2A 2UUCF 3G87A 3I32A 3DMJA 3MM7B 3R2CJ 3BREA 1M5VC 1DAXA 2RQMA 2W7AA 1JLEB 3MEGA 2DPIA 4C3MA 2YKQA 2XTJP 2KRBA 4UQTA 1V9OA 2HHHJ 5GAEU 1FDBA 4CDIA 2G0IA 1E6YA 1IR1A 3UO0A 2VJVA 1WNEA 1VIOA 1RWPB 1CULB 1YVFA 4ZCKA 3SYZA 1ZTWA 3NEKA 1UZHA 3H2VE 4I2QB 2MQOA 3N0VA 2YKMB 2W4PA 4ECSA 3PW0A 4PUOB 3AA8A 4HT5A 3W5ZA 4JI7F 3K5MA 5ETQA 2MYFA 2NUUG 1CJVA 4RJVA 4OLOA 4PPDA 1VIXA 4MKVA 5FLXU 5J1EA 1U1MA 3O2IA 4R5PB 1FFSB 2HWIA 3HT0A 2K1RA 3W66A 3W2VA 2HK3A 2MXYA 4FF4A 3TRGA 4DZDA 1LK5A 2E5JA 3RYLA 4NLGA 2NYHA 3NBPB 1RTZA 5H9EJ 2XS5A 2V5HG 1PYTA 4C3KA 1PSDA 1N36J 3ZTPA 2BE2A 5HROB 1RLCL 2MTLA 2V2KA 2ALYB 1RTJB 3OR1A 1Y11A 2ZKTA 3OHAA 3NCPA 1U0HB 2WONB 1ZS6A 3MWBA 4KGVB 4WIIA 2EBGA 2BA9A 1FWKA 4TY9A 1PC4A 3W2WB 1JJ2R 1Q79A 4J9KA 2EPIA 1X4BA 4DPOA 2C28A 2RQ4A 4AXIA 3VV2B 4JI0F 3FMWA 2YWWA 1WC4A 4QWEA 1IKYA 1GMVA 3DRPB 1HQEA 2AEFA 3MR3A 2QX0A 3HHKA 4ECWA 1OIAA 5A8WA 4NX9A 1I3OB 4DR6F 2IBKA 3QBCA 4X4NA 3BO2A 2D74B 2VBWA 3VTIA 2FPHX 3KHLA 4G1QA 5EWEA 3D68A 3I31A 1H38A 2P5VA 3PFEA 2AJ0A 1U2RA 1HHTP 3GP9A 1TK0A 2V2ZA 1LQ9A 3CGIA 2AYMA 4DV4F 3RJMB 2WVFA 3NWGA 2M2BA 2J0SD 3ETOA 3GJSB 3J7ZT 3BV8A 5E3CA 4F67A 2ATCB 3B8HA 2MJUA 2LQ8A 3V4MA 1SC1B 5E3QA 2MQMA 1RI7A 3P45B 5F3TA 4AT1B 1RADB 1C4CA 2ALZA 2JLEA 2XCPA 1RYSA 2IA0A 1SJ1A 1UVMA 3W9HA 2UXBF 4DSFA 3N6LA 2WCXA 4C3LA 2DGWA 5E33A 2P6SA 2W2MP 4ZVFA 3JYTB 4U8VA 3TA0A 1RGVA 3D6MB 2M0GB 2QYCA 4HHUA 3C6UA 3M1VB 2ZNZA 1NH7A 4WFXA 1UVJA 1FXLA 5D3GA 3W8PA 2LA4A 1N0UA 4JI1F 2XI3A 2UUAF 2GO8A 4MT1A 2QLWA 3DOLB 1FERA 2FHMA 2VODA 4FKYA 1FCAA 2BYCA 2ZDPA 3MD1A 3RBXA 4IFVA 4H4OB 4A48A 3I4HX 4YQWA 1N5YA 2HK2A 5KOXA 3QFWA 2J9DE 2BQUA 1VQYA 4EWTA 3W65A 1JJCB 1FXDA 2VUGA 3MEKA 2WRMA 1U25A 1YX2A 3C19A 5HQMA 3HF5A 2KN4A 4GVLA 3BGOP 1RU2A 3MM6A 4DJBA 3OL8A 3UNYA 1FFGB 2HLUA 3CULA 4TU8A 3HHNB 1YJWS 3DLGA 1CJTB 4ZP8A 1IQZA 4ENOA 5J2NB 4ITSA 3CCUS 2XY5A 4Q45A 3C15B 4F0MA 1FESA 4C0HA 5HANA 2KXHA 3V6DA 3M2RB 4HT7A 4C11B 3OUYB 5IWAJ 2MB0B 2OUGA 4DU8A 4FDFA 5LSOA 4O3QA 4O44B 5AXMA 3MR7A 4FVCA 2KXNB 4DV3F 1NHKL 3RB6A 1RT5B 4GVBA 1XMOJ 1GEHA 1DTQB 1YRUA 3IC1A 2YKNA 1B0PA 2DKOB 2VG6A 2CAJA 5IC4B 2XMVA 4WFYA 5DZ7A 2IYIA 3FDSA 2J7WA 1QJHA 4F7VA 3GWCA 5ETPA 2DVIA 3I0RB 3NGKA 1WORA 3U1MA 3ET6B 2L9DA 3V6JA 1EX8A 4C8YA 1RWXB 3RAXA 4LF5J 1GMUA 3QGGA 2NR0A 1DURA 1RK8A 2HEKA 4C2MA 4OIXA 1HBNB 4EZ6A 2OTJS 4FPRA 4Q8EA 1RT7A 2YQ0A 1FDAA 4H4KA 4A8YA 4QPTA 1Q82T 2XSFA 1N34J 3D28A 1HNXJ 3TNVA 5KFJA 3LALA 2VF3A 1JLCA 2R8IA 3MM5B 1DLOA 2ZC4A 3G82A 1Y9OA 3E2EA 2PIIA 3Q86A 3HFKA 1FRHA 2HKEA 1RBLA 1N32J 3J7YU 4HI1A 5K14B 1HHSA 1VK3A 2LXFA 1WDTA 3CDAA 4RW7B 1JB0C 1S9GB 2DD8S 5LMNF 2R3VA 1OY9A 2CZ4A 5ADZA 1OMSA 2D69A 3TO8A 3CVKA 4N77A 2HQIA 1IBMF 1FJCA 1ZAWA 1RTHA 1D1UA 4NCAA 1XTZA 4DS5A 5IQQA 3P4UB 4ZOSA 1WKKA 3TZYA 5I42B 4CM0A 5K8MA 4FXWA 3QNWB 2XM3A 1SJFA 3HHDA 2VFUA 2FC8A 4TKTA 1LW0A 3QYYA 1N5TA 3LQVA 1UW4A 2YQ3A 2LQJA 2VJUA 4KFBB 1YDLA 2OPRB 2O5DA 4B3SJ 2RNEA 2NS1B 1FK9B 1Q5YA 4U95A 4PWWA 2YVSA 1TAUA 4IKAA 4KHMA 3AT1B 3R6GB 2BABA 3FSIA 4XAKA 1YBUA 1NK7A 1GTHA 4LVNP 1EKRA 1SL2A 1K8AT 3W3SA 1CJKA 4ZPWR 2KB2A 4PQUB 1I6JA 4QJVA 1QAJA 2HMIB 3GFZA 4WZMA 2IY5B 4CLFA 2LDYA 4MK9A 3W62A 2C3MA 1S0NA 1UWBA 2F40A 3D0HE 1YJRA 1YI2S 5GAGI 1PAEX 2QC3A 1TL7B 4K5SA 2MPUA 3AB4B 3UR0A 2G2ZA 5DDRC 2CQPA 4GO5X 2KHCA 3BKUA 4NXNJ 5F8GA 3HPOA 3RW6A 3MEEB 3UWTA 2R7WA 5DJBA 2DR7A 2ZH4A 3E01B 2RILA 3OR2B 3HX9A 4TU7A 1ZZNA 2HWHA 3CTRA 4ZVSB 5G4DA 5KFSA 1BD6A 4P9SA 5AXLA 3HJVA 4A8QA 2D3ZA 4LF6F 3SV3A 1JLQB 3P5TL 3Q8UA 3R6LB 3OPKA 5KAKA 2ZH7A 4U7CA 4DR2J 4MAKA 4X65J 2DT9A 4JV5J 4RUAA 3MXHP 1W7WA 4BC7A 2H4WB 5C24B 2BW2A 2CNLB 1ULRA 1LWXA 3DLBA 2MKJA 3A4TA 4DR7F 2WVDA 2YNGB 3EMTA 2Y9HA 1JLFA 3L09A 1RKJA 4ED4A 1GMWA 4EU0A 2IPOB 3OQ2A 1IBKF 4X62J 1FXRA 4B9MA 4ES1A 1KP6A 1JKHA 1Q8KA 1WKJA 3UN3A 3PJXA 2XMJA 2HIQA 2R2SA 4OZJA 3CMES 2IC3A 1V3ZA 5IFMA 5FDLA 1S9FA 1LWCA 4XPCA 2VIHA 2QN6B 1PILA 1QVGR 2B9WA 1VRUB 1TTHB 1WWHA 1MU2A 1BE4A 1NKEA 3FUYA 2PMWA 3TQ1A 4Q8FA 3OFGA 2HNYA 1TFYA 3A8IA 4GKJJ 3PHTA 2CJKA 4WWSA 2H3EB 1YSJA 3I4PA 2DH7A 3OJSA 2YNHB 2F4FA 2YWHA 2DNYA 5AT1B 1JLEA 1RQ0A 1T9XA 3SCIE 1P6TA 4DI6A 3G96A 2FJWA 4OX8A 2R4FA 5L1IA 5EX3A 4P7TA 4A8WA 3DLJA 4OZ0A 4A8OA 1U48A 2ZITA 1CULA 4J9OA 3QZ8A 4KV8A 1FJGF 1KSPA 5HVHA 2YKMA 4NE9C 3MAHA 4PUOA 3G71S 3QWPA 4ZP6A 2HHVA 1OPIA 4F3OA 4O3PA 4DL3A 2JC0A 5B0AA 3A3PB 4ZKAA 5GVQA 3MTJA 4ED1A 3HULA 2G4BA 1UJ6A 4HYKA 2W9CA 1MMLA 3KLEB 4YFUA 5HI7A 4AUKA 4ZIVA 4R5PA 3M9OB 1C1CA 2BJ3A 2RDIA 4CZCA 3BH6B 4UUWA 1T7PA 1M5HA 2GVZB 1YRXA 2RIJA 1X9SA 3DCAA 2WZ1A 4F3QA 5F41A 1CLFA 3PYGA 2RUSA 5M2UA 1L3TA 3EPGA 3D6HB 2PT0A 1QVFR 4R8UB 2I0XA 1DFDA 1GH8A 3CMQA 3Q2SC 2ADCA 1TL3B 2FJXA 3CJ8A 1U1PA 1WTBA 1SC4B 3LGHA 4XK8C 4QWDA 1U0HA 3M8YA 2DH8A 1T95A 2BKOA 4N8OA 2CQ0A 1HYSA 3OXFA 3V81A 2DGOA 4NLQA 4JI4J 3W2WA 2FHJA 4WK3A 3M2VB 2F1FA 5DDPC 3U02A 2EFVA 1CJUB 2COLA 5KFUA 4FF2A 5KFEA 2DNLA 2XQCA 3UN2A 2DHGA 2MZQA 1S0VA 2XC9A 4PQAA 4DSJA 2MQPA 2V2QA 4TYAA 3EVOA 4J9PA 2C2KB 3ONQA 2HHQA 2BOAA 1FX4A 4WKYA 3K58A 1WC3A 2P6TA 4KSEB 5KFOA 2GHPA 3FEXB 1S49A 4WIQA 3W5XA 1VQ5S 2LLZA 3V2UC 1F60B 3TAPA 1HWLA 2R7SA 5SZTA 3OFFA 1NKCA 4KH1B 1H73A 4OYMA 2FY8A 1IVZA 2FGCA 1SPBP 3GJTB 1F5CA 2OEKA 3DRXA 2XLIA 4DL2A 2FC9A 2HURA 4PG8A 4YY3J 2RHQB 3VQTA 3OL6A 4UY8T 1U1LA 1F9HA 1FKPA 4UOGA 2FD2A 2ASJA 2ZOFA 2GIQA 3IBWA 4CTAA 4O4GB 1E6VB 3TVZA 1CG2A 1OYDA 2K3IA 5ETVA 5JMNA 4GRSA 5E2QA 1JMTA 2M9KA 5A0YB 4K59A 1IBLJ 4KC5A 1RYRA 2MZRA 2Y1LB 2Z2MA 8RUCA 3DNCA 4LIRA 4RO0A 4P75A 4F02A 1I5OB 5ETLA 2KJWA 4X4UA 2AYGA 4P2SA 1TMJA 2GIFA 3HO1A 3DXBA 3WIUA 2FVQA 5D77A 4IG0A 1UWAA 1S72S 4M95A 4J9MA 1B0TA 4MTPA 1RBAA 2JWNA 3PIPQ 1T94A 2UXDJ 4JI5J 1TL4A 2VG7B 3M1VA 1MROB 1VC0A 2W9AA 2YWGA 4DV1F 3CCWA 1HBUA 3M2UA 1JJ4A 5D78A 3M9MB 1BGXT 1NJIT 1YGYA 3N79A 3KDNA 4MK8A 2QA1A 5HLFA 1KLNA 4P74A 2QSWA 1SV5B 4H4OA 1KQKA 4LIWA 4ZN3A 3CD6S 2J0XA 2OFGX 2G13A 1B99A 3R97A 2YKPA 4I69A 1MMNA 2UUBF 1TQLA 1HBMA 2PDAA 1RISA 5KT6A 5DDQC 4JYAF 4ICLB 2N3OA 1YTYA 6FDRA 2ZM6J 1SH0A 3ZFVA 3LGMA 1CJTA 2OPSA 2MKHA 4AE5A 5J2NA 3O1LA 3C15A 2KM8C 3LP1B 2KTQA 2HNZB 2HVDA 4ZJQA 4Y00A 4MIBA 3OUYA 1H2TZ 1L3SA 3DM2B 2O66A 4LFAF 1UVKA 4M5IA 2W01A 2WK4A 4O44A 3RUBL 2J7KA 1VGYA 3N9UC 1RT5A 1DTQA 3SCKE 4W98A 5J1NA 2L9NA 1U24A 4OL8A 3BYRA 2KZMA 2JL9A 3ICLA 2CXEA 2DBBA 2Y0BB 5AXNA 3ET6A 1R43A 3HSGA 1X5TA 1NDLA 5D4PA 2OHDA 1PJ7A 1D8ZA 1X9WA 2HHUA 3UDVA 2QV6A 2V68A 5HQLA 3PRVA 2GMLA 1Q78A 4B3RF 2KT5A 2C2EA 2MSTA 1UEVA 1HBOB 2W4DA 4B08A 4WZQA 8ATCB 3Q23A 3GU0A 4AD6A 3IGVA 2V8VA 3EGWB 1FEEA 1RHUB 1VQSA 5E3AA 1K47A 3E51A 2AT1B 3RAQA 1OSCA 1BQMA 1HARA 1DBDA 3FEZA 4NMLA 4DG1B 3FBFA 3C14B 4RWXA 1S0OA 2EW9A 4M63A 4B3TJ 3NAHA 4WPAA 2L08A 3C6TB 5I3UB 2EKNA 2CJAA 3FBEA 4ANEA 1RXOB 1G1XA 3L7UA 5F9NA 3MM5A 4DLEA 1NK9A 4ZPTR 3EUNA 3G6VA 4DSIA 5KG6A 3BDPA 2GAGC 3W1YC 5AXKA 5K14A 1OS5A 2VQFJ 5J2MB 1F9FA 1NPKA 3Q8PB 1IKXB 4F3MA 1S9GA 3HHLC 2PA3A 4CO0A 5DGBA 3AB2B 1YKWA 3FSXA 1VC5A 3NY0A 3CJ4A 4J9NA 3Q8RB 5C7PA 5HQ8A 1LWFB 4M1KA 2FQQB 1HNIB 2AP6A 4CT8A 4UZBA 2KVIA 3SSRA 2E5LJ 1Q4RA 4CO3A 5AJ3J 4QR0A 4DSEA 5I42A 1VRQC 4NA2A 3MR5A 3L7OA 2E9TA 2UUCJ 1IKWB 2CG8A 3CDEA 3H4DA 4KFBA 3DOMB 3T1YF 2B43A 1M5KC 3ZTQA 1RTDB 3VZHA 4AQYJ 1FK9A 2O3DA 3UDEA 2DIVA 5THWA 4LR8A 2CZ9A 2NZCA 4MKYA 1FNMA 1XEZA 3HVTB 5D8HB 3J81Y 2M5YA 2YNIB 1R8AA 1QAYA 2DNHA 5KT2A 4DPYA 3T1HF 3DDNA 2FVCA 4UW2A 4NYPA 1W2IA 3QJJA 3SEOA 1H2UX 5I3PA 3BYPA 5ITHA 2HMIA 4KIAA 2HQ3A 1YJNS 4O4RA 3KYLA 3PX6A 2ACYA 3I9V9 1S1TB 3DU5A 2GHWA 4JI8F 1LXNA 5L9NA 2D3UA 1TL7A 2VD3A 4E98A 2NUHA 2AEMA 4ZPBA 7AT1B 4M5JA 3MEEA 2V0NA 1WI8A 2HBZB 5KFWA 4O3OA 2ZOMA 2HG4A 4MFBA 3AOBA 3OR2A 2X1BA 3MUTP 3MEDB 1FD8A 2VBXA 3VQSA 1ZM3A 3LGNA 1JLQA 2RU3A 1T9WA 4IO9Q 3PG9A 2MQNA 1KHWA 2ZZNA 4DR3F 3BO4A 2FIUA 3UCGA 2DB1A 1I1GA 4KT0C 4I0WA 1J2VA 3CJ0A 1NZAA 2J9DA 3R9LA 3J7AN
chains in the Genus database with same CATH topology
3LP0A 1NK4A 4IG3A 5A6PA 2IVMA 1DAXA 2RQMA 2W7AA 1JLEB 4K5RA 3MEGA 2ZDOA 3OHBA 2FJVA 3BDEA 2DPIA 3PX0A 2CRLA 2E44A 4C3MA 2YKQA 4OJ1A 2KRBA 2FLOA 4UQTA 4RW9B 1V9OA 5GAEU 2Z2LA 2IMOA 1FDBA 3DLHA 4RU2A 1X0FA 3VF0B 1Y0HA 1YITS 2E1RA 2XSJA 4DMZA 2HWTA 4RX6A 1E6YA 3UNGC 3KG0A 3G9CA 1N5YB 1WNEA 3I9ZA 3D1HA 1VIOA 4JV0A 1YVFA 4AXJA 4ZCKA 1UVNA 3D54A 3DYAA 2HS3A 2OIHA 4I68A 2ZJRQ 5L1LA 2GA7A 3SYZA 1ZPWX 3DRYA 3MMBB 1ZTWA 3H2VE 4TQRA 4I2QB 4ZLPA 2G9OA 2MQOA 3I56S 2YX7A 3JSRA 3N0VA 3BSNA 2YKMB 2W4PA 3B4DA 4ECSA 4CH1A 1IKVA 3PW0A 3P6YC 2QO3A 4PUOB 3AA8A 2NPIA 2G1DA 4HT5A 4ZVEA 2J0QD 2E9ZA 4JI7F 3FFIA 3KNGA 3MF5A 4YP3A 3K5MA 5KOWA 4K4ZA 1IUJA 2M4MA 2IMWP 4F4XA 4IOAQ 2MYFA 1XWLA 3BJYA 3OFEA 1WACA 2DNRA 4CO1A 2NUUG 4YEAA 3KLHB 2KH9A 3K7RA 3HT3A 4NLSA 2ZUGA 3Q24A 4OLOA 3J7YI 1KLMA 3BGLA 1MSWD 1Y3KA 1U1RA 1JJHA 2D9PA 1VIXA 4PPDA 3K2YA 3OXLA 1PC5A 2E66A 2DR9A 4OI1A 4J9RA 4OHXA 4Y2CA 2LDIA 4QR2A 1PGZA 5J1EA 1U1MA 3DLGB 4ELVA 2EK6A 2AQ4A 2XNQA 3PW7A 1CPZA 2P9EA 3ENWA 4A8MP 4ZPDA 3O2IA 5E3PA 4R5PB 5KFQA 3LP2A 2DGSA 1N5VA 3ZZTA 4ZPCA 2HWIA 1RTIA 4I56A 5IS2A 2ZH8A 2K1RA 4ECQA 2R8KA 1NHUA 1ZZFA 4X4VA 3ZZZA 4NCBA 3W2VA 3U7JA 4MK7A 2DNOA 4USIA 2MXYA 4FF4A 3TRGA 1FF2A 1LK5A 2FVRA 2AJQA 1R0AA 2E5JA 2YNHA 3RYLA 3LOUA 4NLGA 2DRBA 2KZZA 3NBPB 1JK9B 3S01A 4F50A 3CEDA 5H9EJ 1Q8IA 1FT8A 1SUQB 2XS5A 4IYQA 1S0MA 4IRKA 3NCQA 2XNRA 2V5HG 4C3KA 3JSBA 3TR5A 1PSDA 5GAGU 2VPWB 2VH7A 1GQEA 2BE2A 4B02A 4F26A 5HROB 3IR6B 4A8XA 4G3IA 2HVZA 4DLGA 2W8LA 2V2KA 1TUVA 2F8HA 2ADBA 3HDSA 3C46A 3OL9A 1RTJB 2W8KA 3RBDA 2B5JB 2DTJA 3OR1A 4KAIA 3SCLE 1IQTA 1S1XA 2QSFA 1UFWA 3IRXA 5J2MA 1H7WA 2RUGA 2DNPA 2QMWA 1ZPVA 1B0VA 2ZKTA 4U6PA 3TUZC 4DEZA 1SIZA 3AQPA 3OHAA 3DOKA 3NCPA 2BR0A 2WONB 3OV7A 2YKOA 3MWBA 3KMSA 4FS1A 4WIIA 2EBGA 3KWMA 4NLUA 1H3DA 4ED6A 2MGZB 2BA9A 2RRAA 1R31A 2B4VA 2EFOA 4MIAA 3GILA 4ECTA 3D1OA 4TY9A 1PC4A 2LXUA 3W2WB 4XO0A 4GC6A 1JJ2R 1Q79A 1HNXF 4J9KA 3MURP 2EPIA 3MMAB 1LWFA 3NKYA 4HTJA 4QZVB 5LXRA 1ZM4A 2DR8A 1X4BA 5CYMA 4I6YA 2DNKA 2BRKA 2RRBA 4DPOA 4ZVGA 4EGLA 2C28A 1AFJA 3UDCA 2RQ4A 2VBZA 1URNA 2OD4A 1G7CB 4FXVA 4AXIA 2NSBA 4IRDA 2WAQD 4KO0B 4DDFA 4JI0F 3O44A 3FMWA 3SQGA 1NB7A 2HHHF 1R6YA 4QWEA 2FTRA 1L3KA 1IKYA 2CQ1A 3TAMA 3DRPB 1HQEA 4A8FA 2RMLA 4CT9A 3E3XA 3MR3A 1NJXA 1IKWA 2N4CA 3HHKA 4KHRA 2AX0A 3KK2B 1WF0A 3BN4A 4ECWA 5KFZA 2OPPA 1OIAA 1X4GA 2Y1JA 4E0DA 2N3LA 5A8WA 2FHOB 4NX9A 3PO4A 2VG5A 1Q7LB 3RB0A 1FVSA 2ZH5A 1H98A 3HHEA 4X66F 4F25A 1T05B 4DR6F 2AGOA 2IBKA 1TKTB 3O3LA 2E29A 2GMJA 1O8BA 4Q2MA 4Z2XA 5DQIA 4W90B 3TP2A 2CQGA 4R8UA 2BXJA 4I6WA 4TN2A 4ED8A 4X4NA 1UKUA 3E8OA 2VA3A 3RR7A 2CPHA 3BO2A 2D74B 3QIPB 2VBWA 4PG6A 3VTIA 1HW9A 2FPHX 4RZRA 3KHLA 4G1QA 5EWEA 1HNVA 3I5AA 2VFRA 1HWJA 3PW5A 1T03B 2XHWA 3I31A 1EETB 2CPIA 1H38A 1MW7A 2P5VA 4PWUA 1TKXA 3PFEA 2WHOA 4NLTA 1ZETA 2EI5A 4OHYA 1UP1A 1N54B 4FP9A 2HVHA 3CD5A 3M30B 4OX6A 1FKOB 3EYZA 4Q2LA 3WC0A 2AJ0A 3SFUA 4BWMA 3PW4A 2WOMA 3C2PA 3KLVA 1U2RA 1HHTP 1R8PA 3I0SB 4LSLA 1IM4A 1TK0A 1KTVA 1JLCB 4L72B 1DLOB 1VQ4S 4B9LA 3KLFB 5EWGA 2B6AB 1LQ9A 2MZSA 4RW4A 2LQ5A 3M2VA 3EZ5A 4NZ6A 3KLGA 2B56A 3CGIA 1GXLA 3G86A 2AYMA 4DV4F 2GQQA 2RS8A 4KB7A 2PN6A 5DG9A 3PEHA 4DV7F 1XR6A 1R3NA 3NWGA 1HI1A 1QE1B 2M2BA 4YR0A 2OJ3A 3T9NA 2J0SD 4F4YA 3ETOA 3D0IE 1Q53A 3J7ZT 1N36F 3V4IB 5E3CA 4MYTA 2HRUA 4F67A 4DF4A 3B8HA 1WEYA 2ZH3A 2HRYA 3GE9A 3R3TA 2MJUA 3AJ1A 1XK8A 4NCGA 2PMHA 2UXCF 3R1HA 1H0HB 4DN0A 3V4MA 5DDOC 2QFJA 2FHJD 4K4YA 4RLEA 2HW3A 5E3QA 2M88A 3H2UB 3OSPA 2MQMA 3J7A1 2XMWA 3MUMP 5FLXY 2L41A 4USHA 1RI7A 5L39A 1WD6A 3ZZ0A 5G0RA 5F3TA 4B9SA 1X4FA 2QMXA 4E8UA 1SJQA 1F2GA 3BM7A 1C4CA 1RP5A 3IG1A 2ALZA 2JLEA 2BJEA 3CJ2A 3U1LA 4FZVA 5A8RB 1BQNB 2XCPA 4DF8A 1RYSA 2IA0A 5L1KA 1SJ1A 2U1AA 5KFNA 1UVMA 2UXBF 4TYBA 2O1PA 4ED7A 4DSFA 2XZWA 3N6LA 2WCXA 4C3LA 4D3GA 2NSCA 2DGWA 1GX5A 4C8NA 4ZDNA 3T19A 5E33A 4DL6A 5KFLA 2P6SA 4B9TA 2U2FA 3UD3P 1NK0A 1WEZA 5T41A 2FLNA 2UV8A 4N8NA 4ZVFA 2VA2A 5C42B 3JYTB 2R7TA 2GX8A 3THVA 1K9MT 2N7CA 3TA0A 1KHVA 2W9BB 1RGVA 5GAHU 3GG1A 2M0GB 2QYCA 2UU9F 3TANA 3C6UA 3M1VB 3ITHA 3QGPA 2DPJA 2ZNZA 4IRCA 2HFOA 3RW7A 3FZBA 1NH7A 1J5OA 5CQGA 5LT5A 4ID5A 4WFXA 1LOUA 1RKIA 2HAIA 2LMIA 1UVJA 1FXLA 2LVWA 1HD0A 4LQ9A 2ZE2B 2LA4A 2JX2A 5D3GA 1N0UA 3CD7A 4JI1F 3MM7A 1SH3A 2XI3A 3CO9A 4EO8A 2JVOA 2UUAF 3QAEA 4YB6A 2B7BB 2GO8A 2KYZA 4ERDA 3HMJG 1X5SA 2QLWA 1ZYQA 2JOQA 3SI8A 4EEYA 3BQ1A 3DOLB 1FERA 2FHMA 5T7LB 2VODA 4GKKF 2ZZMA 1FCAA 3CSKA 2EG1A 4Y6IA 1S7HA 1TKZB 3JTPA 4O4GA 3P96A 2BYCA 2UUTA 1E6VA 3IAS9 5K9FA 4M94A 2ZDPA 3HI9A 3MD1A 4YUDA 1JNRB 4TNOA 3CIMA 4IFVA 5A0YA 5B09A 2PA8D 4H4OB 4A48A 1OQ6A 2B4PA 3I4HX 4YQWA 1N5YA 1QAIA 5KOXA 2J9DE 4DQRA 4U9RA 2BQUA 4LMZA 1TL1A 1U1KA 4DL5A 1VQYA 1S4FA 3SMZA 4EWTA 4FBTA 3MI7X 4WFBQ 4B9VA 3P49B 1FXDA 4GO7X 3KFWX 4I2QA 2CG4A 1LWEB 2VUGA 3BF4A 3MEKA 4CO5A 2WRMA 3AAWB 1U25A 3CCSS 5J2QA 2AV5A 4URQU 4X4SA 3EGZA 4DR2F 3HF5A 2DHAA 2GQCA 2WSCC 3NS6A 1UJ5A 3N6NA 4QWBA 2HGNA 2HHPA 3VCDA 2VOPA 2KN4A 3CD0A 3QZ7A 2BOPA 3SCJE 2MY7A 4IOBA 4FF3A 4HH0A 4DFKA 2B9XA 1ZOTA 4ZPAA 3GR1A 4Q43A 3MM6A 4NA3A 1JLAA 2XULA 3IFEA 2PSZA 4DJBA 1O0PA 2ILYA 4RBTA 2OMLA 2QA2A 2XWXA 4BWJA 3OL8A 4FVMA 1S1VB 2VC1A 3OXGA 2HLUA 2DCUB 5CCLA 4TU8A 1U1OA 3CULA 1HWIA 1ZTTA 3HHNB 1YJWS 5D6GA 2VG7A 2KKHA 3DLGA 3P3DA 4ZP8A 4X4PA 1IQZA 5IXUA 4DV5F 4QIWD 4IH7A 5J2NB 4ITSA 3CCUS 2XMKA 2XY5A 3HZGA 2GMHA 4H4KC 4Q45A 1FVQA 2CJQA 2VQEF 1KONA 3KK3A 2E5IA 1FESA 2W24A 4M5DB 1S99A 4EFAC 2DHXA 3LW5C 4C0HA 4RNHA 2KXHA 4X62F 2BANB 2HHSA 1U6BA 3V6DA 2HFZA 4UY85 1VQ6S 3M2RB 4HT7A 3ZZOA 5K8PA 3H8YA 4C11B 3OUYB 2M8HA 1X4CA 2V4JB 3HP6A 5HO4A 3NBPA 2ASDA 3DLKB 3BSOA 4A4JA 1YWXA 3VZIA 3O8WA 3HM9A 2ZH9A 3T5JA 2MB0B 4ECYA 2KXFA 1SUQA 5E41A 2KJVA 1CSJA 5KFXA 5LSOA 2R8GA 2MMYA 2DCLA 4O3QA 4O44B 5AXMA 3EXYA 4MKAA 1RA7A 2ZBIA 3DC2A 1RT4A 1WG4A 5HROA 2KFZA 4IFYA 3OVBA 4FVCA 4OZNA 2KXNB 5KT7A 4DV3F 4BCAA 3GB0A 2IJNA 2LEAA 3RB6A 1RTJA 1SV5A 1RT5B 5F3ZA 1NKBA 1YRTA 1DTQB 4X4QA 1NNDA 2CVEA 1YRUA 3IC1A 5FD1A 1D9FA 2YKNA 3X1LB 3OLBA 1B0PA 2BV3A 2VG6A 1U45A 1NEEA 5F0UA 3SDEB 5DG8A 4QWCA 2XMVA 2YKAA 3M6VA 2PEHA 5M2PA 4WFYA 2J0WA 4Q0BA 2IYIA 2WONA 3FDSA 3H5UA 1ZM9A 2CJ9A 2CVIA 1DQAA 3TUJC 2KT3A 4ZCMA 1JLBA 2J7WA 4NA1A 3HK2A 2LCWA 1Z1ZA 1QJHA 2AYEA 4HI2A 3GWCA 2G0CA 2L9WA 1N52B 2FJAB 5D4NA 3ISNC 2DVIA 1S9EB 1G2EA 5A2QY 1JX4A 3I0RB 3D5MA 3NGKA 1WELA 1UMJA 3ISZA 1LK7A 1S10A 4IR1A 3U1MA 4GKJF 1KR4A 1UAWA 3RRKA 1X5OA 5DETA 2B7CB 2UZAA 3CC7S 2O67A 1KFDA 2L9DA 3V6JA 3N4WA 3S6EA 4B9UA 4C8YA 2HPUA 4RW8B 1Y5NB 2X3GA 3MR2A 2IVFB 3RAXA 3O5TB 3KHRA 4DL4A 4NZ7A 4NZ0A 1JKHB 4DL0C 3PNIA 3QGGA 5CYQA 2IFXA 1RT2B 2NR0A 1RT1B 1DURA 1YHQS 3LP1A 1RK8A 2D1CA 3DRPA 5FJ4A 3KKFA 4Q7AA 2ZKUA 4FYDA 4C2MA 2XO7A 5BYSA 4OIXA 1W2BR 1U47A 3I82A 5C25A 4YMEA 1DJ0A 2XEXA 4ZVHA 4RNFA 4K4UA 1HBNB 1LFPA 3QAUA 1IJFB 2D7SA 1SH2A 2PC6A 1NJWA 3DM2A 4EZ6A 3KMQA 2OTJS 1TKTA 2JH3A 2D9OA 2I2YA 4FPRA 4Q8EA 3NMAA 5IT9Y 1RT7A 3FVYA 2LECA 2R9LA 3EGNA 3POTA 3PR5B 2WTFA 4FNIA 1YJTA 1FDAA 1MU2B 2C3YA 2QLXA 4H4KA 5HBMB 4NWBA 3QIPA 5GADI 3V6HA 2DGUA 2C2RA 3ZZUA 3CCZA 2ZD1B 4C8ZA 2KM8B 3LAKA 4ES3A 4A8YA 1N56A 1QSSA 2VBYA 2GIRA 4QPTA 3CC4S 3KHHA 4DR5F 1T03A 1HMVB 3MZIA 3QLHB 4HH1A 4IR9A 1Q82T 2EFNA 2XSFA 1FJEB 4ILRA 2I9SA 2BQRA 4DUZF 3OSNA 2BQ3A 3D28A 2NREA 3TNVA 4B3MF 5DGAA 2X51A 2FGOA 2VV5A 2C2DA 5KFJA 1UEUA 2R7XA 2VFSA 3LALA 4IH5A 1AROP 3FRZA 1JLCA 2R8IA 3DI6B 3MM5B 4LFCF 2DRAA 2MZJA 1DLOA 3VWSA 2ZC4A 1U2FA 1W25A 4Y2AA 3KLFA 2OTLS 4AL6A 2CQDA 2B6AA 4XDCA 1Y9OA 1TP7A 3MM8B 4RNNA 4O0IA 1NJYA 2GGPB 3G8SA 1ROFA 2APOA 2J8AA 3CDUA 1N48A 4J5OA 3E2EA 3IWXA 3MPYA 3L95X 2PIIA 2GC8A 4UOCA 2JEGA 3M8PB 3ENVA 1LW2B 4UUXA 4NLOA 5EHHA 5HN0A 3HFKA 5A8KA 4LT6A 5IWAF 1DQ8A 2FJBB 1FRHA 5KG7A 3IAM9 3DRRB 3J7YU 1N88A 1X4DA 2IJFA 3MDFA 1YIJS 4X4TA 3S8SA 4HI1A 5K14B 3LUYA 1HHSA 3WBZA 1VK3A 1FRXA 3UW1A 2LXFA 5KT5A 4ECXA 2QE5A 1QAXA 2VFVA 3CDAA 1APSA 1K1QA 4RW7B 3GG0A 1HBOA 3WC2A 4KV8B 1JB0C 1S9GB 1TVRB 1XMOF 1FJGF 1C0UB 2DD8S 5K5MA 5LMNF