2UU9F

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gug-codon in the a-site and paromomycin.
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RRNA
total genus 23
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2uu9F00
1N36F 3R3TA 4NXNF 1RISA 2E5LF 2F4VF 1QJHA 4X64F 4B3TF 1XNRF 2HHHF 2UXDF 1HNXF 4JI2F 4DR1F 4DUZF 2UXCF 1B64A 4X65F 4KHPF 4JI3F 4DUYF 4YY3F 3T1HF 2UUAF 1F60B 4JI7F 1N34F 2KJWA 1J5EF 1XMQF 5LMNF 2UU9F 4X66F 2RJZA 4AQYF 2BXJA 4DR5F 4DR6F 1FKAF 1IBKF 2UUCF 2ZM6F 1GH8A 4LF6F 1XMOF 3OTOF 4LF8F 4JI0F 1FJGF 1XNQF 4B3MF 1LOUA 4LF9F 1N32F 4LF4F 1G7CB 4DR3F 4B3SF 1HNWF 4DV2F 4JI5F 2YY3A 4GKKF 2UUBF 4DR4F 4DV1F 4OX9F 4LFCF 1G1XA 4DV5F 3T1YF 4LFAF 4DV6F 4YHHF 2B7CB 2VQEF 4JI6F 5IWAF 5LMUF 2VQFF 4DV4F 4GKJF 4LFBF 1CQNA 4DV7F 1VMBA 2BVZA 2J5AA 4DV0F 1IBLF 3ZZPA 4NXMF 4DR7F 1IJFB 2B7BB 1IJEB 4B3RF 4X62F 1N33F 4JYAF 4JI8F 1HNZF 1IBMF 4LF5F 4K0KF 4JI4F 4JV5F 1HR0F 4DV3F 1CQMA 2KJVA 4JI1F 5BR8F 4LF7F 5AJ3F 2UXBF 1I94F 4DR2F
chains in the Genus database with same CATH superfamily
4KGMA 4NX9A 3R3TA 4F3MA 4BDPA 2K1RA 3S6EA 1XTZA 2BYCA 3CTRA 3VAGA 2E5LF 3KDNA 4PXDA 1QLNA 1GMVA 3CJ4A 2UXCJ 3DOLA 4H54A 1ACMB 1S1TA 3K89A 2MTLA 3UDLA 5RUBA 3CCJS 1CG2A 1FJEB 4Y2CA 1XNRF 3MR5A 1L3TA 2CRLA 2UXDF 1APSA 1FFSB 3HVAA 1S9GB 4DU8A 2E5LJ 2DPIA 3IR5B 3JSRA 4RW7A 1YJ9S 5KFCA 4ETZA 4DFPA 4HEA9 3CMAS 4I69A 5CA5A 3IBWA 1LWCA 1O0PA 1F60B 2C2EA 3M8ZA 4QIWD 3HX9A 4AL7A 4MH8A 1IWGA 3CDUA 3HMJG 2HHWA 3EYZA 3J7A1 1L3VA 2MY7A 3PR4A 1H3DA 1CSJA 3ENAA 8AT1B 2A1BA 2Y8WA 2OTJS 4DUTA 3OVAA 2VUGA 1JLCB 3DLJA 4XTTA 2QMUB 4B9TA 1L5UA 1YG0A 1LK7A 1VS3A 2CIMA 1SL1A 2V68A 4N8OA 2FJBB 2CPIA 3IXQA 1X7VA 2WVEA 2YKQA 1TL3A 3M8QB 2KT5A 1LOUA 2Z56B 2MGZA 5G0RB 1RBOB 3C6UB 2JLGA 4OFZA 4Q43A 4F8RA 4CLSA 1Y3JA 2XSFA 2W2MP 4NLUA 2WOMA 4USHA 3ITHB 2GAHC 3PY8A 2XLIA 4KRWA 3M6VA 3KJVA 1T02A 3OLBA 4FF3A 3DI6B 4I64A 1F9HA 2EK1A 3ZZUA 1NH7A 4DG1A 1A0OB 3ET6B 4QW8A 3R6LB 2KXHA 5ADZA 2AGPA 2A6OA 2NUUG 4QU6A 1UVJA 1XMQJ 3WHIA 4LSZB 1X9MA 2CNOB 2FY8A 3P45B 2VG6B 1IKXA 4ELVA 1IBMJ 4KPCA 1DTQA 3TOQA 1KTQA 3M8PA 3NWGA 4ZIWA 3QJLA 1RADB 3PYGA 3LA0A 2GW8A 4OYXA 5D4OA 2B0GA 5ETTA 3KHLA 1C0UB 4YB7A 2Z30B 4TU9A 1C4AA 2E1MC 4CH1A 2BX6A 2K2PA 3CCES 3N79A 3A12A 2KT2A 1NK4A 5HAOA 3TO8A 3JSBA 3SFUA 4IH7A 1SJFA 2HHHJ 4CLTA 4EWTA 5CYJA 3IM8A 4DL4A 4C8KA 5A8RB 2XS2A 1FJ7A 5DZ6A 4GVBB 2YX1A 1RT5B 1TMMA 2XGPA 2G0IA 3UN5A 3A8JA 2GMLA 1DY3A 4MKBA 3AXMA 4U67Q 3CCUS 4P10A 4HACB 3J7AN 2VKRA 3CCTA 3J7ZT 2G0JA 5D3GA 4C98A 4URQU 1IKYB 2HQCA 3IG1B 2Z2LA 4Y0FA 1T9TA 1TK0A 1WKLA 1JJ4A 1U1QA 2GO9A 3HSDA 2RKIB 1N5SA 1RP5A 1XN9A 3FKBA 3H42A 2Z2MA 4P7VA 4A8WA 3H25A 3C66A 3MFHA 4DQPA 3GJQB 3H20A 1KP6A 3D6HB 1FFGB 2V8GA 3DGPB 2RMLA 4KC5A 4UUXA 3MEEA 4URGA 2WVDA 2G2OA 2LA6A 1IKWB 5K14A 4ZCMA 3QGIA 1QUVA 4WFBQ 3TANA 4DV4J 4WYWA 4ED0A 1CEZA 2DD8S 2KB2A 2QL7B 1U2FA 1VI7A 1YBAA 2DY1A 3AQOA 4CDIA 4B3RJ 1RI7A 1RHKB 2G2YA 4WJBA 3Q8UA 1HWIA 2C2NA 3CGIA 2NYIA 3E01B 2B56A 5F41A 1TL7A 5BYSA 3UVJA 1OS5A 3CNQP 4MKAA 4Q5VA 5H9EK 1HD1A 2YTCA 4K8RA 3TQEA 3EICA 3L7UA 4PG6A 6FDRA 2E9TA 1S12A 3GFZA 3P96A 4PG5A 4Q8FA 3NCPA 5E5NA 3OTEA 5MAOA 3T5KA 2MYFA 2UUWA 3BN7A 3ISND 3QLHB 4B3OB 3TX0A 3KFWX 1U25A 3HHLD 2UVRA 2DNKA 3J81j 3TZYA 5DDOC 1QDUB 4CO4A 5HROA 1BGXT 2R7SA 1RE1B 2Q3PA 4KBIA 3VALA 2XSJB 3QRRA 1N34F 3K17A 1T95A 2DHXA 4O23A 2XO7A 1XMQF 1Z1ZA 3NS7B 3A1YG 3SI8A 2W24A 1UEVA 2V94A 2CJKA 2R7VA 4QWEA 3I0SA 3ZNUA 1RAJA 4C8MA 2IM1A 3SYZA 2DR8A 5GAEI 1KOHA 2CPZA 2YNGB 3OTCA 3M8YA 3Q8SB 2VBXA 3TW0A 5JJBA 2JEJA 1A9NB 2GMJA 2J9CA 2K7KA 2XMMA 1R8BA 5DDRC 3W62A 3KLGB 1KSPA 2BKOA 2HLUA 2G1DA 2CQ3A 5KFZA 1SL2A 4CTAA 1NHKL 3A3NB 4YP3A 1H74A 4NASA 1DZ5A 1HQEB 4HDGA 1KR4A 2GJ2A 3DXBA 4CM0A 2HBRB 3MEGB 4GVLA 3HSZA 4I7FB 5KFGA 3Q8QB 2KG0A 1HBUB 4Y6IA 3G6YA 3ZZOA 3VAIA 1WOPA 2VV5A 5J2MA 1YHQS 3R2CJ 4RLEA 4MKYA 4OYPA 1HMVB 3V2UC 5HVFA 2BRKA 3IGNA 3PM9A 4OZ0A 9ATCB 4B3SF 4OL8A 2NXNA 4TLRA 4XDDA 4DS5A 2E66A 2XCPA 2AD9A 2NS1B 5B0FA 2HFOA 5J1PA 1ZBTA 4B02A 5KFLA 1DFDA 3DDIA 2R7UA 3QZ7A 4CLKA 1M0SA 2YNGA 3ENQA 3GCWP 3GB0A 4OX6A 3DHXA 3HK2A 4KO0B 2P9EA 2D9OA 2HNZB 4GKKF 3RRGA 4Z2XA 5DDQC 4ED3A 3DNCA 1ICEB 1RAOA 4M5NA 2DNZA 5A8KA 2XM3A 2C2RA 2XS5A 2DNOA 3UD4P 1X5SA 3BN4A 5CD4H 5I3UA 1HIYA 3W5ZA 1ZPWX 3GFYA 2XSJA 1H7XA 3IAM9 4DUYJ 4KGZB 2B4PA 3FSYA 4JI1J 2MZJA 2IVFB 1YJVA 2AP6A 3RG6A 3UR3C 3PHTA 5ETSA 1N56A 1TELA 2E9ZA 1HBMA 3V6JA 1NDLA 3D6TB 1RT3B 2VODA 2F65A 2GC8A 2V2ZA 2WONA 4PPZA 4U8YA 5CQGA 3KLFB 3BQ2A 3VR1A 4CH7A 2KZZA 4WZMA 4CI0B 1TK8A 2DNYA 3HVWA 4ANEA 3PEHA 4WKRA 2KHCA 2UVWA 3Q0AA 4ECXA 4EZ6A 4IUFA 1RWOB 4OV1A 4XPEA 1N33J 4NYPA 2VOOA 4DPTA 4P73A 1GXLA 1NXIA 1ZZFA 2NCKL 2V9KA 3DU6A 3ILOA 3LPYA 2CZVC 5E3CA 5ETQA 3CXCR 4WZQA 2HKEA 3CJTA 2ZHBA 1UA0A 2YQ0A 4JI6J 4HLBA 3GIRA 5L46A 1HQUA 1N54B 1N33F 2WW4A 4TNOA 4F4XA 3MECA 2NQPA 2DNMA 1PBAA 1C2PA 2EFOA 3D54A 5K14B 4AYBD 5JMNA 4J9PA 3K5PA 4UY8T 1Q53A 5KFXA 5HVHA 5KFNA 3JSMB 4B3RF 2HW3A 1GFWB 1MWQA 1RT1B 3KUEA 4UT4A 4KTQA 1Y7PA 3HDSA 1JLGA 2R2TA 1RTHA 3C8YA 4FZVA 1D0EA 5CYMA 3J7YU 1S49A 1GXUA 3VGVA 1W2IA 2CYYA 2DT9A 2VFTA 2CZ9A 1L3UA 2MKIA 1R6VA 1FKPB 3OFHA 4P2SA 3RB4A 1IKXB 2J0SD 3H8YA 1U1LA 2CQHA 3VQSA 5K5MA 3THVA 1BD6A 1LW0A 1WG5A 3CE8A 4TYBA 3HHKA 2N7YA 5L9NA 4KSEB 4IKAA 2OI2A 1IXKA 1FJGJ 1BUXA 3MTJA 2APOA 4LVOP 1UJ4A 2CQGA 4BWMA 1NZAA 1OSDA 1R7IA 4F4WA 2YVSA 5I42B 1OJ4A 5DLGA 2M0GB 3JYTA 4M5DA 1KVJA 4IFVB 5HI7A 4J5OA 3ITHA 3AQPA 3DRPA 4PABA 5L9XA 2F7VA 3NGKA 2Z57B 1M90T 1Y00A 2CFXA 3DLLQ 3J80Y 1X9SA 3M7VA 2GMHA 2A10A 5GAGU 3HP6A 4YY3F 3FBBA 2B4VA 2I38A 3HD2A 3GIIA 4IOCQ 1RWKB 1IQTA 4QIEA 3OV7A 2CDQA 5AXNA 4IRCA 1NDCA 3EM1A 3TARA 1ZYQA 4P2XA 3OL7A 4JOUA 2QA2A 1HI8A 5F0WA 4CLLA 1NUEA 3NGUA 2HSEB 5F8IA 5KFKA 4GC7A 1JLBA 1LEOA 3AJ2A 2O01C 3IA0A 2MZTA 4G6VB 4CLFA 3TI0A 2ROEA 1FX4A 3PKMA 1JB0C 3NAIA 4X4NA 5T41A 1H2VZ 2D3ZA 3IS9A 5FLXU 1HWUA 5KT3A 3AOAA 4I2PB 2FLOA 3TR5A 2CQBA 2XC9A 3ADAC 3QT6A 2YNIA 3U02A 5LJ5Y 4FF2A 2DPJA 2FHMA 2LEPA 5KT7A 3U1NA 1SI9A 4LF9F 3IR6B 1TL3B 3M8QA 4TY8B 2EC0A 3MCSA 2W7PA 3RZAA 1G7CB 3N5FA 4EK2A 4QZVB 2FYXA 5CYQB 3NEKA 3JAMU 1FWLA 2ZDOA 4R0EA 2BW7A 1RBAA 4H4MA 5L39A 4XK8C 1NHVA 3BO2A 3PW7A 2YWHA 4LT6A 1BWVA 3GG1A 4DX5A 5AE3A 4ECQA 2ASJA 4C8OA 5ETLA 4F7VA 1FNMA 1VRTB 1YRXA 3B82A 2KFZA 3MM5A 3I87A 2C2KB 2ZH5A 3EXCX 3I31A 4OYZA 1ZM3A 4ZIVA 1ULRA 2GIQA 3MM6A 3GIMA 4DL5A 5J2QB 2X1GA 2KU7A 1X4AA 1NH8A 5KFEA 4ZPVR 1ZH5A 3VZHA 3CJQA 2FLPA 3PW5A 2NZCA 1Z2LA 2ROPA 1PG5B 1EJ7L 2ZWOA 4IH5A 3E51A 3LO3A 4ZPWR 1K47A 4ZVPB 1RWMB 3W2VB 2ZHAA 3LAMA 4NCAA 1QE1A 2F8HA 2D7SA 2YKNB 2LU2A 1X60A 4R5PA 1QSYA 1GX5A 1V3RA 1UTAA 2LQ8A 2GGPB 2MQOA 2MKKA 4M5HA 3BDPA 3CD6S 4M63A 1VQOS 1S6PA 3G86A 3UNYA 1C1CB 4CLUA 3WBZA 3SZ2A 1S9EA 2A3JA 2RF2B 3AT1B 3PYEA 4UOCA 1SL0A 5T14A 4J9KA 1B7YB 2I9SA 5D0GA 2PA3A 4CLPA 1T03B 1F5AA 1N34J 4LF7J 3RAMA 4QWBA 1RT6A 5AT1B 2J6UA 4BWJA 2RILA 4TY9A 4DPWA 4I6YA 4KYZA 5DM7Q 3GCXP 4FVCA 3H4DA 4JV0A 2BJ1A 3CEDA 1S6UA 4ZS6A 2VFUA 2P9GA 1SUQB 1Y9OA 5KT6A 2QFIA 5GADU 1RHMB 1RWUA 1VQNS 1UA1A 1M5KC 4JV5F 4K4XA 1BHNA 3M2VA 2DNLA 1GT8A 1N5TA 1QM9A 3J80U 1SJRA 4J9SA 1ZTTA 1YITS 3VQTA 4K4YA 2BQUA 1T7PA 2E9RX 1YIJS 3NOCA 2XNRA 3RW6A 1JK9B 4PQUB 1WG1A 3MM6B 5KFWA 3EVMA 2ZVIA 3HJVA 4O44B 2MQMA 3ILLA 1PJ5A 4LJMA 4MTPA 4NRTA 4YMEA 1RT7A 5KFDA 5L1LA 3DLGB 1QY7A 4RBTA 5IT9U 3RYLA 5J2NA 4LSLB 2DH7A 1VQ8S 2E5IA 3DLBA 4IG0A 4NZ0A 2ZH6A 1S0OA 2ZFHA 2YWGA 1IR1A 5EWEA 1CJKA 4GKKJ 4IYQA 1AUDA 1UMJA 1JLGB 3CDAA 5BR8J 1WC0A 4DU7A 4NEZA 4ED4A 3NMAA 3MD3A 3M8WA 4DUZF 2G13A 1V9OA 4U6PA 4JI3F 4KHPF 3I9ZA 4USMA 4EBCA 4LF2A 2M2BA 2IBKA 4JI7F 2QJ3A 4ED1A 4G1QA 2KJWA 2L48A 1BQNB 2IRUA 2DITA 1S4FA 1H73A 2YNFA 4Y34A 2YPZA 2KO1A 3GG0A 2DEIA 2DNHA 2Q43A 1F3VA 3HFVA 1UCNA 2GJIA 3IS9B 1NSPA 3L95X 3BV8A 5B09A 2FJWA 3PDNA 1U2CA 3G8QA 1FKAF 5CH7B 5ETMA 2V8HA 3ULHA 2VFSA 3H90A 5CXTA 1YJ7A 1HNXJ 3I0RA 2OPQA 5DS7A 3W5XA 5A8WA 2VB6A 4O0IA 3A8IA 5LOQA 3K59A 2AJFE 4CYUB 4AD6A 2OD4A 2HK2A 3BPDA 5D77A 5KFHA 2M52A 2WAQD 4O3NA 2DGTA 3T19A 2OPPA 3NNHA 2R2RA 2CDRB 3VAJA 3FEXB 1WHWA 4ECVA 1R0AB 3DOMA 2BANB 4J9UE 1KFSA 3TRGA 3T3FA 2CPDA 4QR2A 3CPWR 1MWZA 2MLZA 3CMQA 5KFTA 2NR0A 4C3LA 4NLXA 4M5MA 1UW9A 4ZVUB 2VICA 3KJNB 3IWNC 1TU0B 3D5MA 3H2LA 5K8OA 4OHWA 1WI6A 2W8KA 3IWLA 2HHUA 1CLFA 4ZHRB 4LSNA 2YPYA 1PCAA 3X3UA 5CABA 2VQFJ 3MM7B 4OI0A 4IDKB 5LJ3Y 2FUG9 1U8WA 2GA7A 2EFNA 2JRSA 1GXTA 2DXDA 3DM2A 1JJ2R 1D8YA 2HG4A 2DTJA 2PSZA 2PDAA 5LMUF 4DOZA 5KG4A 3JTNA 5CYMB 3ZTSA 5KFMA 1M5HA 3V4MA 2V9WA 4KB7A 1CS4A 3C16A 1FRLA 1OSCA 2B4UA 4YFUA 3CJKA 2ADBA 4JI8J 2LDYA 2PIIA 4FBTA 2QLJB 1F3FA 3MPYA 1XIQA 3PV8A 2ASLA 4ENOA 3G96A 4FBUA 2FGCA 3R7BB 1WHXA 3KG4A 3CVKA 5KFUA 3ZTOA 3OXGA 1HL6A 2DGOA 2GIRA 4G1PA 5D4PA 4ZLNA 4DPYA 4EO6A 1FTCA 3RUBL 1DLOB 1CJUB 2ZBRA 3PCOB 1HARA 2XMVA 3BR8A 3ETMA 1PJ7A 3DRRB 4LIWA 1C1CA 1SJQA 1Y10A 4DF8A 1T0TV 1UZHA 2VFRA 3J7Z5 1I51B 1S9FA 2Y3YA 1Q5YA 4EZ9A 4YS2A 2M9KA 3W9JA 4R5PB 3QLHA 1RWVB 2GAGC 3IGVA 5JXSA 4AFFA 1RT3A 2C22A 3QYYA 1IM4A 2OAUA 1U0SA 4DX7A 3N5BA 2KJVA 5HQ8A 1CPZA 1ZM4A 4KKOB 4HI1A 4NCGA 2IY5B 2DYAA 2DXFA 2JL9A 3F56A 3PKYA 4HKQA 1JNRB 3D6MB 2IAJB 5MLCV 4DFJA 1I94F 2F9JA 4F0KA 2OUGA 4B9NA 3E01A 2QN6B 2BJ7A 3GFXA 3NKYA 3UD3P 3CJRA 5HJYA 1SKSA 2BJ9A 3ZZRA 3N9UC 1RTIB 1RA6A 2AIRB 2J0QD 3HHLB 2J9DA 2BDPA 4KKOA 5F9LA 5GAGI 2L3MA 4HVZA 3UW1A 3MR2A 1XERA 4MYUA 4UF4A 4ZVEA 2N3LA 4FN5A 3GMGA 2MDAA 3EZOA 3P5BP 4HTIA 2DCLA 4S0MA 5EGYA 2FY1A 2J6TA 2GVZA 1KQFB 1PYSB 2O3DA 2Y0SD 3HSGA 1I1GA 4EBDA 1X9WA 4FF1A 4OJHA 4C11A 1OO0B 4RJVA 2EPIA 1NZ8A 3MD1A 2W7AA 3I4HX 4LFCJ 4CP5A 3D2WA 4Q7AA 3CCSS 2R8KA 1MROB 2PI4A 3QRQA 2HZCA 4Q2MA 3KLVA 2A2DA 1K1SA 2OFGX 4OI3A 3KK3B 2GV1A 3QFHA 1LWFA 1F1BB 2NXCA 4BHQA 2R7WA 5A0YA 2ZJRQ 3ENWA 3GJSB 1KD1T 3CIMA 3EXYA 4CO3A 3H0PA 5F8JA 5LXYA 1TMJA 2C2MB 2J9EA 2FJDB 2HVHA 3LWLA 1G2EA 1EETA 3OR2A 1X31C 3MAAB 1R8AA 2A6MA 2W01A 3MM8A 2LECA 1EB0A 1A6LA 2QA1A 5HP1B 2HMIA 3KK2B 3IWXA 4OI1A 3B4DA 1TKZA 3KNGA 1HPZB 4TKTA 3ZTPA 4ZVTB 3UD5A 1NSAA 4Y3CA 2OHDA 1HHTP 1WSRA 2XMUA 3AA8A 2PO4A 2DGWA 1HNWF 3M4XA 2CWXA 1RTDB 1EQMA 3BKFA 2LU1A 4ZHRA 2H48B 1MU2A 1FE4A 2Q79A 2KVIA 5IM0A 4DV2F 2XY6A 2BE9B 1AXQA 1RAAB 1WOOA 2VZ9A 1RAEB 4P71A 3ET6A 4M8LA 4RUHA 4ZLPA 4EYIB 3PZPA 1HNWJ 1BLUA 4DZDA 2IYGA 3JQJA 1QVGR 5HJXA 2WK4A 5AE1A 3PX4A 2YXLA 1ZETA 2XYPB 3W8PA 3DOMB 4LF4J 3CT9A 3P4UB 1F0XA 1U02A 4K2JA 4ECTA 4PWDB 2KFNA 2X1AA 3WQPA 4YN3B 3IN5A 1EIYB 1S1XA 3UI3A 1TKDA 4F4ZA 5ITHA 4EYHB 1SQFA 3MEEB 1SJ1A 4OMFG 4A8YA 1T05A 3NNCA 3QATA 1RT1A 2EI5A 4TYAA 1U0HA 2XI2A 3EUNA 2Q6BA 3K8WA 5ETNA 1VRQC 2J76E 5B0AA 1R8CA 2L08A 1XR6A 1FRKA 1X4HA 2J5AA 2IJFA 2BV3A 2LDIA 3OFFA 4DV0F 5AXKA 2IBOA 4EO8A 3ZZPA 4QWAA 2XI3A 2JH3A 3DOKA 1KC8T 3NCQA 4IQXA 4URSA 3HHEA 4YR2A 3PIOQ 2Q6CA 3NY0A 1U1PA 5GADI 4YUDA 1S1WB 2I5JB 2B3TB 2B7BB 1LW2A 3BGFA 4K4VA 3DOKB 1AZSB 4OZJA 2MQQA 2N82B 1WC6A 4PYDA 3QJPA 1J27A 1REVA 2JLEA 3BGRB 3M05A 4OX9J 1N5VA 4LF1A 3KLEA 1U0HB 4NZ7A 1XC9A 2WONB 3CCZA 3CB4A 1U47A 4E2FB 4ILRA 4QIFA 3BBBA 1NRKA 2BZ2A 2EVZA 2OFHX 4P72A 3OD2A 4ECYA 1DQ9A 2JDJA 2HFNA 4F25A 4CLZA 3HHLA 4RNNA 4F02A 3CDWA 3PX6A 4FNIA 4LSLA 2GZOA 3DGVA 5I3UB 5KFQA 3CD7A 1DTTB 3FCWA 3UDVA 2IRXA 1L3KA 2WBRA 4IRDA 4JI2J 3LANA 4TLQA 3CIZA 3PTWA 1KKHA 2CAJA 1U24A 3FSIA 1Y4ZB 4WK3A 5JVHQ 5K9FA 2V5HG 3IP0A 1WC1A 4UW2A 3GPAA 4DG1B 3PVXA 1WACA 4PWUA 1HWKA 4OZNA 2VH7A 5IT0A 3E3XA 3OXFA 3BYRA 1MROA 2O67A 1DJ0A 4ZPDA 4A8KA 1UWBA 4OLPA 4LBHA 2VOPA 3JAMY 2E7WA 1AUSL 1WJ9A 3WC2A 5KT2A 4X62J 1ELOA 1VBZA 1OYDA 2ERRA 5IQ6A 1FEEA 3FSXA 3VTIA 2W4PA 1LFWA 1TL1B 3ZZTA 1TP7A 3FCHA 2E29A 2GVZB 3ETOA 4ZOSA 3I55S 1T94A 1JJHA 2IHR1 2D1CA 3B78A 1GMWA 1TV6A 1EKRA 1KN6A 3TAQA 2OSRA 1NSKL 3D66A 2V4JB 4DL3A 1KHVA 3SV3A 1KVIA 3DRSA 5IT9Y 4MYTA 1FD8A 1HI1A 1RWPB 2JX2A 5KG6A 4C7QA 7AT1B 1Q5VA 4DR2J 2C3OA 2IJNA 2KM8B 1QE1B 3W2VA 2MEWA 1VRUB 5E2QA 1WI8A 4UTGA 2IAJA 3AD8C 4OLOA 5JVGQ 4J9MA 2B9EA 2AX0A 1SC6A 4WE1B 4IR9A 3TEGA 4OYIA 3TEHB 1VQSA 4RX6A 5HROB 5GMDA 3VGSA 4MK8A 3I9V9 3M30A 1B0VA 2R8GA 1IUJA 2Z2ZA 5B0EA 2KN4A 1XR7A 3EVOA 2CQ4A 4ZPTR 4EI2A 4OHVA 2J7UA 3HKWA 2IDLA 2HHSA 3FFIA 1SJ3P 1FO1A 4I0WA 2I0XA 4I4BA 2XULA 1AA1B 3FRZA 2POKA 3P3DA 1BY9A 4O3PA 3GV7B 1G1XA 4I6WA 3BO4A 3R1HA 4F36A 1S0VA 2F4FA 1FFWB 5I4MA 3QGPA 4FKXA 5KTQA 4WF9Q 3KLHB 4HH1A 1LFPA 4EEYA 2BANA 2BJ3A 3P5TL 1FXDA 5DGBA 3R6GB 3LP0B 4KFBA 1IM6A 1X0FA 3GONA 4ZVGA 4YR0A 4LFAF 3CJ5A 2PFDA 1SB6A 4YHHF 1IQZA 2MQ8A 3IM9A 3A4TA 1NNDA 1S6QA 1S4EA 3MHYA 2CPYA 2MJUA 3IRXA 5ETOA 2H1YA 3MXHP 2ZC4A 4M5GA 2ZH1A 2DY9A 3K0JA 1S5ZA 1YLXA 2ZH9A 4DV1J 4QW9A 4N77A 4Q45A 1HW8A 4WFZA 1FRIA 2VIHA 1RTZA 3K2YA 4FYXB 4ZPCA 3T9ZA 2LQBA 3ZTQA 4X4PA 2ZEJA 4IDKA 1IKYA 3QPIA 2E1PA 3C2PA 4RKUC 2YWWA 3BPSP 5GMEA 4RR5A 4WYLA 2BE2A 5IXUA 2HVZA 5M2PA 2PT0A 1UJ5A 2XTJP 1FRHA 1RT5A 2YQ1A 3MR7A 1O8BA 3N6LA 2ACYA 4A8SA 5B0CA 4ILLA 1DRZA 4L6V3 4OHZA 5KFFA 3CJKB 1JJCB 1H38A 3TA2A 3ZTRA 4K0KF 5HLFB 1QSLA 1VOMA 2ZD1A 5A6WA 4Z7YA 4CT9A 2X7IA 5I42A 4OQJA 4RU2A 2MQNA 1VQKS 3GP9A 1TUVA 4KAIA 5T7LB 3NGDA 4CYUA 4NLOA 1UPPA 3AA9A 3PW0A 3MM7A 1FKOA 3GQCA 1OPIA 1OWXA 3SDEA 1H98A 1FKPA 2QO3A 1HW9A 4IO9Q 1GNKA 4WP9A 3DDKA 3L09A 2LMIA 2VC0A 1KQKA 5E3RA 2VG5A 2KHDA 4PG8A 4PUOA 1WC3A 1K73T 2DISA 2MLYA 1N4LA 2DRBA 3T1YJ 4ZJLA 3OXLA 3FUYA 3BS9A 5L1IA 2DR6A 5F8HA 2J6SA 1ZOTA 2FJAB 4B3SJ 2ZZNA 3KNAA 3R7SB 2IC3A 4WTYA 2AEMA 1KLNA 2F4VJ 1OQ6A 1F5CA 3MMAB 2IPOB 2BE7D 4ECWA 2M70A 3QSIA 4I67A 4UOGA 1NU4A 3T1HF 2C42A 4FNHA 5K8PA 4XDCA 1X5PA 2VBWA 2PI5A 4OJGA 1RT6B 1NB2A 3RRHA 2LYVA 3OLAA 2KRRA 1JXVA 4KQZA 4C3KA 4LF8J 4X4TA 1S6PB 1W2BR 5FD1A 4QR0A 2HBQB 1E6VA 1R3NA 1HNZJ 1B7FA 1FWPA 1RT7B 2AYBA 3DLEA 1FKOB 4WBFA 3HXMA 4DJBA 3O2IA 3J81Y 2L9WA 2LKZA 2YWKA 4R0JA 4JI0F 3OJSA 1RK8A 1VQPS 1XNQF 4ZLLA 2HIYA 2RQ4A 1H2UX 4TN2A 4PQUA 3O3LA 2RRNA 3R97A 3TUJC 4F4KA 1WORA 3Q8RB 3MEDB 1XBWA 5LSLA 2HHQA 3T5LA 1IBKJ 1BQMA 2KZMA 4RNFA 2QG9B 2V69A 3DHWC 3DOLB 2W1BA 1Y5NB 3VV2B 1SKWA 2HHTA 2EK6A 1FF2A 2CQCA 2AT1B 1Y5LB 3JQKA 1VBYA 3A3PB 3CO0P 5GVQA 3MMBB 4M94A 4DV1F 1XJWB 1CC7A 2EEYA 3UDCA 1UEKA 2MZSA 3CD5A 1U45A 4L76A 4R8UB 2MZRA 1F2HA 1RWNB 2Z4PA 3BKUA 4ZLJA 1VC0A 5EX0A 3C3LA 3JSYA 4ERDA 3M30B 2DH9A 1P27B 3R7NB 3US5A 1DURA 2VQEF 1V6HA 4JI6F 2ZM6J 4GKJF 3MEGA 2YKNA 5C7PA 5CCLA 3GJTB 1URRA 1OY6A 1SIZA 3D1OA 3QGGA 4LRBA 1GMUA 4KV8B 3VF0B 2AQ4A 2CNKB 1ZS6A 5DZ7A 3IR7B 2ZE2A 2K7JA 3UDEA 1AFJA 2DIVA 4LF7F 1M5PC 5FLXY 3G9CA 2D69A 2WCXA 2ZKTA 4FDFA 4FPRA 4YR3A 4W92B 2FIUA 4IQMA 2JLFA 1WC4A 2AJ1A 2HPUA 1U1MA 1Q7YT 2FJEB 4OIXA 3UFCX 5GMKa 1RKIA 2FVPA 4IR1A 1T03A 5AE2A 3M32B 1RCOB 4DZ6A 1S9EB 2RF2A 3TWZA 3PFEA 1TZ0A 5D6GA 3X1LB 2DJWA 3V6DA 1HR0J 2J9DE 3JB9k 4JV1A 2EKYA 2F3JA 2VC1A 3H2VE 2DH8A 2BBEA 3SFGA 4Q8EA 2DK2A 4ITSA 2L9NA 1Q4RA 3KLEB 2BOPA 3QSYB 1Y5IB 3BDEA 2LQ9A 1RTJA 4NYOA 1RB0A 2YKMB 3L7PA 3LPEA 1AZSA 1WF2A 1ZA1B 2HHPA 2QC3A 1LW2B 1T8EA 1VIXA 4BCAA 3RB0A 4LF6J 1U1RA 1TL7B 3ZZYA 4QWDA 1LW0B 4YY3J 2UV8G 9RUBA 4QWCA 3R2DJ 1FJCA 1PC5A 1MN7A 4J91A 4USKA 3BJYA 3W5YA 1HNIB 2C3YA 3C14A 1DBDA 2QMWA 4NE9C 2NSBA 4DCPB 2NPFA 3M8RA 4IFYA 4J9VA 1Y0HA 1U2RA 2DXEA 5B0GA 4O4GA 5IC6B 2N7CA 2RRBA 4PYAA 1Q95G 4DF4A 1U09A 2P6TA 1HHSA 3BGUA 2MMYA 4J9OA 1Q82T 2HHHF 1BE4A 1OY9A 2QYGA 5HBMB 2QSWA 4P6QA 1R31A 3N6NA 5J1NA 4A8OA 1T9VA 4I1TA 1JX4A 3W2WB 2HRTA 1YQHA 5LL6d 2CJQA 2DHSA 3K5OA 3L7OA 1X4FA 4L73A 2B51A 4I2QB 2UUAF 2LQJA 2DR5A 2G1HA 2V67A 4NI2A 3S01A 4CIOA 3VAHA 4F4YA 2UU9F 4X66F 1HBOB 2WSCC 1YGYA 4ES2A 1LWEB 5KG5A 2YX7A 5I3QA 1PKUA 1XMOJ 4GO5X 1FHTA 4Z37A 3PX0A 2D74B 4Y65A 1RKJA 4AXJA 4RBVA 2XWYA 1SIWB 2UVVA 2R7TA 1U7LA 1EHWA 3M9OB 1XMOF 3KTQA 2DKOB 1JXEA 3KXDA 1CJTA 1HWLA 2E5JA 4OHYA 2KXNB 5T7LA 3LW5C 4B9LA 3I5CA 1T9WA 1HPZA 4USVA 1KOOA 3KK2A 4PKDB 4D3GA 2ZOGA 1TKXB 3GR1A 3GSDA 3BGLA 4NA1A 2R9LA 3CWJA 1MWYA 2A2CA 3M8PB 5K8MA 1Q1KA 1L3SA 1N5QA 4B9MA 4NLVA 1YVFA 1Q78A 5GAHU 1WHYA 1B70B 1S10A 4M5DB 2M8DB 1X0PA 1M1KT 2P9CA 1HQ2A 4NWBA 2C2OB 2QL5B 3LGNA 4OX8A 4M1KA 4DL0C 3AFGA 4QOTA 4ES1A 1E6YA 3TZXA 4U8VA 5A0YB 2FC8A 4KO0A 4O3QA 4U7CA 4MIBA 1LWFB 2V4RA 1YJNS 2UP1A 4OHXA 1RHRB 2IRYA 3EZ5A 2DO0A 3ELHA 4Q44A 3CCRS 1I6JA 2AW0A 3TA1A 5F8LA 5GAHI 4F50A 5F9NA 5DQGA 4OYAA 2J8AA 3DFEA 1RAFB 3I4PA 4RL1A 4DV5F 2V2VA 2JC1A 1IR2A 2HNYB 4IOBA 4UQGA 3HT0A 3TUPA 1TKZB 4ILMA 3W2WA 3HVTA 4ZVFA 1OPZA 1GMWD 3AJ1A 2QZ8A 1UFKA 2X1BA 3GYNA 2AYGA 4C0BA 1K44A 4CTAB 1B4SA 3HM9A 2IM2A 1HNVB 2HLTA 1HLWA 1WHVA 2ILYA 3SMZA 1K9MT 4X2BA 1M5OC 1VJWA 1AFIA 5D0HA 3TVYA 4X84A 3TVZA 2VBYA 3TAPA 2CJYB 2OEMA 2HS3A 3MCMA 2LP4A 2W2OP 3N6MA 4WP3A 4WTOB 1NCLA 1RU2A 2OEKA 4M5JA 3R5CA 3C46A 5C5JA 3KLHA 1YJUA 2CUYA 1W25A 1FX2A 3EJMA 2ZH2A 3B8HA 4QCLA 2W7OA 1W7WA 2F1FA 4Y00A 3AAWB 3VVUA 3NRBA 1EARA 1T11A 1PYTA 3B4MA 2AU0A 1Q16B 1S1UA 4W4MA 2CG4A 4EFAC 4DFMA 3PACA 1YSJA 2V6AA 1RTDA 4FS1A 2XMWA 3D1HA 1GEHA 3F0NA 4QQBA 4ELUA 4X66J 3LF0A 3C15B 1Q8KA 2RAQA 3SEOA 4JI4F 1PYOB 1VGYA 1R8HA 1H0HB 3HFKA 1VFJA 4CT8A 3OPKA 2VL1A 2PEHA 3O1LA 1WELA 3LTOA 5IFMA 1HQEA 3DRRA 3PJWA 2FZCB 3NXZA 4O0NA 1VRUA 1R27B 3M32A 2GQCA 2Y9HA 2XMAA 2EG1A 1RT4B 3CC7S 4LRCA 4NZ6A 2XB2D 2IJRA 5F8MA 4YDDB 2JOQA 5BYQA 1UETA 2PGCA 3QIPB 3R8YA 4ED7A 3M8SA 2OPRB 2NYHA 1NAQA 3NBPB 2WW8A 4MFBA 2J0WA 3I0SB 4I68A 4UZCA 2YX4A 1YKWA 4ZPBA 4U7UD 2VDHA 2MQLA 4RUBA 2XMKA 3I56S 4DSLA 3IBFB 3VVTA 1OYEA 3P6YC 5ETKA 2PA8D 3Q8YA 1S76D 4MKVA 4U95A 4C11B 4X65F 2ZH3A 5DG7A 2QGFB 1URNA 3R9LA 3R5AA 4NLTA 3OUYB 4G3IA 2H4WB 4LRFA 4FPIA 4QPTA 2OEJA 4N47A 3S7RA 2V50A 2BJ8A 2D41A 2DHAA 3C19A 3MUMP 2W9CB 3HZEA 4R8UA 1DLOA 2H9ZA 4LSNB 2HK3A 2OKQA 5CZVA 1KWMA 4DR5F 2RDDA 5H9FK 3R5JB 4DSEA 1KHWA 1KQGB 1Q8BA 2H54B 2MHNA 5D15A 3TX8A 5DG8A 3CW2C 1WD6A 2PD1A 4Q0BA 1RT4A 1N32J 3OTOF 2JVOA 2QMXA 3MEDA 5K8NA 5KAKA 5E3PA 3KWMA 1VQ7S 2DHHA 1U6FA 2H65B 5ETPA 3BR9A 1S72S 1ZZNA 4DCOB 2U1AA 4ED6A 1N32F 2KI2A 3BSCA 3W66A 3NL0A 3CJ3A 4ZA1A 4XPCA 4F2SA 1HBNA 3GE9A 3WX8A 3UE2A 3SV4A 3OR1A 3HI9A 1N52B 2W2QP 2BM0A 3MCNA 4UZBA 2QTWA 3DLEB 3MFIA 5DGAA 3TUZC 2FGOA 2OD6A 4PR6A 3ZFVA 4NXMJ 1S1UB 3VHQA 1U48A 2W4DA 3Q83A 3UCGA 4W90B 5EDWA 2FTRA 3SQOP 1V3SA 5JUMA 2HWHA 2FVSA 1KFDA 2HS0A 2RS8A 4M5KA 1FXLA 3OQ2A 5BXIA 1SVDA 2HHXA 2FHJD 1CJUA 1J2VA 2GFFA 4KY3A 5DJBA 3MPWA 3PRVA 3QGHA 1BQNA 3T1AA 3T1YF 1SJ4P 2MSSA 3RJMB 1FD2A 1WKJA 5L8RC 1SKRA 3T5JA 1PBUA 4GVBA 3F41A 1H2TZ 2OPPB 5A8RA 4J9LA 3UCZP 2BACA 2ZITA 4CLWA 5DDPC 5U47A 3GILA 2CQDA 1RGVA 2F8MA 3SCKE 3SIPB 3W64A 1CS4B 3C16B 3PO4A 4JB8B 3HFZB 3OL8A 3NGRA 3ZXWA 1T05B 4Z7CA 1W26A 3D6FB 4C97A 1C0UA 4CO5A 1JKHB 2JNJA 2XY7A 4ED8A 2KT3A 2OTLS 4ZVOB 4OI6A 3DYAA 1P6TA 3QFWA 3DKDA 5E33A 3SDEB 3BQ0A 4DR3J 1UVKA 4NCBA 2F63A 4O44A 4C48A 2YNFB 5EWFA 4RNHA 4B3MJ 3KLIA 3C6TB 2YWFA 3THPA 3U1LA 5HO4A 1M1GA 3TJAA 2WSEC 1LWCB 3GIKA 2R2UA 2OJ3A 1RHJB 2FQQB 2YKMA 3RBDA 2J7WA 3JXOA 3Q2SC 1D3WA 4ICLA 4UUWA 5LSRA 1MMDA 2CJ9A 4QJVA 4K59A 4OZ3A 3CCVS 5C42B 4PXCA 1N6QA 4IOAQ 1VC6A 5HQLA 3N0VA 3MEKA 4O3OA 4MK9A 1P8GA 1SUQA 1T9UA 4LFAJ 4G65A 3M6WA 3ZZZA 1RABB 1C0TA 3BZQA 3GLJA 4BBYA 5E41A 3KHHA 3Q23A 2OPSA 4RW9A 3HCXA 2WZ1A 4ZVSB 4USJC 1NSQA 3UR0A 2VJVA 2KDOA 2BRLA 2HBYB 4P2MA 2P8IA 3FBFA 3OJUA 1UFLA 4A48A 4CM2A 2KTQA 1TUWA 3RRKA 1K0TA 4ID5B 3DU5A 1F2GA 4NLDA 8RUCA 4ZVHA 1MLAA 4I56A 3BBCA 1OIAA 2ADCA 1QJHA 5HVGA 1WG4A 3DI6A 4X64F 1VYAA 2HGLA 4WXOA 4DV7J 2FVQA 2AV5A 4B3TF 4ANDA 3G82B 1S7HA 2RT3A 3D3CJ 2R7RA 2NXUA 4NI2B 2FVRA 4I2QA 3JQMA 2HHVA 1GX6A 3DC2A 3IBCB 3VZIA 3CCMS 5J2QA 4HHUA 1NKBA 1M5VC 5F8NA 5HATA 2DGQA 5EUHA 3OVBA 4DWIA 2M3DA 3BF4A 1WDDA 4K0KJ 4O4GB 2ROGA 5KG1A 1TR0A 5B0DA 2XZDB 3AB2B 3MMBA 5BJRA 4WXWA 1NK8A 1NO8A 3CJ0A 4FKYA 2JEIA 1EAYC 1HA1A 1IBCB 5A2QU 3K7RA 4WP8A 2R3VA 2XNQA 3MM9B 1HHQA 1VQYA 1X4EA 2HNDB 3LGMA 5EHHA 5KT4A 2XY5A 2Q1LA 2ZWPA 2XG8A 3FNNA 3MAHA 2E5GA 1QAIA 2GS8A 2HQ3A 2HURA 3FZ2A 5F3TA 1YJWS 4C4WA 1OMSA 1QVFR 2GCFA 1HKAA 1RTJB 1VLYA 3P8BB 2E7XA 4A8XA 4LF4F 2QSFA 2YKPA 1XK8A 2HWIA 1GK8A 2YNIB 4DR3F 3KG1A 1RJJA 1NKEA 1NKCA 4I2PA 1RWXB 2YNHA 1FXRA 3PYDA 3MM9A 4BC7A 4USTA 2H3EB 1S1TB 3MM5B 3AODA 4NPOA 1FDBA 4PG7A 5HK4A 2BKNA 4N7TA 1B99A 1EZZB 2QEXS 1KNZA 1Q79A 4USIA 4LRDA 3DRSB 1R89A 4TVAB 1WNEA 2K1RB 4C8ZA 4PG4A 4OX9F 2G0CA 4B9VA 2V4JA 3GJRB 1TUGB 3HKZD 3FBCA 2WVCA 3W3SA 4OYMA 1S1VA 4WU2A 4ZITA 5KFRA 4LF9J 3D1QA 3RTVA 3AXKA 4KH0B 2W8LA 2OPSB 4RW9B 4KHPJ 4WIQA 3OTBA 1DAXA 1X4CA 1C0TB 1NM2A 1TTHB 2OIHA 3GWCA 2ZJQQ 1JIHA 4J9RA 4PPDA 5IS2A 2SXLA 1S57A 2EFGA 2IC3B 5C24B 2LQ5A 3KHGA 3PFOA 3SSSA 1T9YA 2JWNA 4IFVA 3TAMB 4TU7A 1T9XA 2Y1LB 4ED2A 4CWBA 4YHHJ 5DLFA 1RLDA 2CNLB 3M2UA 3ONQA 2RS2A 4ICLB 1RCXB 2IM3A 3EGVA 4AL6A 1ZA2B 3Q8VA 2WRMA 1PGZA 1FEHA 2GIFA 2XHWA 2GQQA 3TZZA 1RYRA 2Y0BB 2D3O1 5HMYA 4Q2LA 3PW2A 3DDNA 3H5YA 2VJUA 4NLGA 5IWAJ 1MMNA 1DARA 1IJEB 2VKZG 3MURP 3G6VA 3JTOA 2CKWA 2OLWA 4X62F 2OGUA 1Q8IA 3RAXA 2LXUA 5J2PA 5DQIA 2WB4A 2BKPA 2HS4A 4DN9A 1SQGA 1X8DA 3OHAA 2A18A 4QYRA 1IBMF 1YJRA 3O6QA 1WWHA 3AD9C 3RR7A 2W9AA 4AE5A 3O8WA 3NNAA 2GX8A 4ZP6A 3I6PA 2ZC3A 2CPEA 2BQ3A 5M2RA 4GC6A 5AJ3F 4PRFA 1VK8A 4KIAA 3QRPA 2HYIB 4DR2F 3LH2S 2QX0A 3SCIE 3CF5Q 3VAMA 2JEFA 4K4SA 1F9FA 2HQFA 3ISZA 3KJFB 3MMJA 3NS6A 3QNWB 3KJQB 3M2RB 4L3KA 1CJVB 3IAS9 1VC5A 1P1TA 4J9NA 2F4VF 2JSXA 3AOBA 3I5BA 2RQMA 4NLQA 2W2NP 2VHGA 1BWEA 4J7CA 4HYKA 4DBQA 4FS2A 2XZTB 2AZ1A 1RACB 3EGWB 2VPZB 2MB0B 3KOAA 3OR1B 5L1JA 2GNKA 1FCAA 2ASYA 1SKUB 2R4FA 5LMNJ 2EWHA 3LUYA 4M95A 2QT7A 4WU3A 4F26A 5H9EJ 4K7QA 1D9AA 2P2CB 1Q7LB 2M7SA 1HD0A 3MMAA 2B9WA 1FRJA 2RIJA 3QAEA 2DEJA 1R43A 4EU0A 1U1NA 3L3CA 5AXMA 2LEAA 4NMXA 4BLGA 5LMNF 4DLGA 2RRAA 2JFKA 3JYTB 2YKOA 1FVSA 1SCJB 2KXFA 3TNVA 4ETXA 4AQYF 4JV5J 3CDEA 4A47A 4K4TA 2PN6A 1X5TA 2HNZA 1WEXA 2QV6A 3GV5B 4OI4A 3FEZA 3JS9A 1U49A 3N28A 2FPHX 5H1SV 1WSVA 2NZ4A 1UZDA 2NPIA 3FC9A 3FFIB 1ZPVA 1MU2B 2Y8YA 1C4CA 2EC2A 1C1BA 1SC3B 4NLPA 4AQYJ 2Z8QA 1N8RT 4MT1A 3KLFA 3DLKB 3HZGA 3IC1A 3MPDA 4MMOA 4B3MF 2MSTA 3V81A 1NDPA 3QWUA 2DGVA 2VDIA 4DXLA 2C2DA 1LK5A 5HANA 3EDRB 2H51B 2E7VA 2B9XA 2H5IB 4QIVA 3OR2B 4RWWA 2RU3A 2XS7A 2ALZA 2MKYA 2HWTA 3B54A 2LCWA 2ZUAA 4HHJA 2PFFB 2YWEA 1AB8A 2IA0A 4RW6B 1NHUA 4ZCKA 4WKYA 1B3TA 2BEFA 3T6JA 3KLGA 3MUTP 4Q0BB 5KG3A 3V4IB 3MECB 4MFBB 1YRUA 1UP1A 2OPRA 3NBPA 4RZRA 1U1KA 1NK7A 4O3SA 1WEYA 3ZC4A 1ZM2A 1UVMA 3NOGA 2UU9J 3QAUA 3SCLE 4RW6A 1TV6B 3K57A 2UXBJ 3EPGA 5KFVA 1MN9A 1RZMA 2BM1A 1HMVA 1U1OA 3QWPA 2RHSB 4DV6F 3OUYA 1I3OB 1NPKA 4ZJOA 1NLKL 1VHIA 3Q24A 3OSNA 2E44A 1IBLJ 4KGXB 4HT7A 3CCWA 4F0HA 1UWBB 3DLKA 3DRYA 3IRXB 4DV7F 2HFZA 2KG1A 2HQDA 4PZVA 4UY85 2LEBA 2CJXB 4K4UA 3N4WA 3QIPA 4ALZA 3J81U 4FYDA 4DQIA 2B8QA 1Y11A 4WK1A 2OMLA 5KFYA 3KG0A 1K8AT 4YOEA 1DTTA 2EKNA 2AYMA 2FVCA 2GHPA 4ID8A 5AJ3J 3KUGA 4L72B 1N88A 1QD1A 5B0BA 2CA9A 4NOHA 2RDJA 4N8NA 3LAKA 4C6AA 3I82A 4LR7A 2BJDA 4WFXA 4JI8F 4N76A 3T5HA 1VQ9S 4H4MB 4X4QA 1Z2ZA 1HNVA 2DBBA 2WTFA 1UAWA 3MGJA 3T6BA 1N5YB 3GFHA 3D4JA 1N36J 4OZ1A 4YB6A 5H9FJ 4F67A 4DMZA 3L9ZA 4XIUA 2VF3A 5LMUJ 3PIPQ 3CC2S 3FGVA 2FJVA 3Q86A 1LXJA 4ZCLA 3K5NA 2ZVSA 2MJNA 3IMQJ 4MAKA 5C2CA 3R5GA 3BO3A 1Y3KA 2WSFC 5B08A 4DSIA 2LVWA 1NK9A 1XNQJ 4KHMA 4ZCIA 2X3GA 3AY0A 3GTYX 5E3QA 4CRJA 4ZJQA 8ATCB 2XLKA 1QTMA 2AYEA 5B7WA 2ASDA 2R8IA 1T3NA 2PE8A 1VBXA 2UUAJ 2DNRA 3FJ2A 3ENVA 5K20B 2AHOB 2EG2A 4TQRA 2DRDA 3AJDA 2HZVA 2HVDA 1B64A 1TKXA 1PILA 2IYIA 3HVTB 3DM2B 2VU5A 1SQEA 5GAEU 2P6SA 2CNNB 2V2QA 5L1KA 5KG2A 1JQGA 1AT1B 3PYFA 5E3AA 2VG6A 2HRYA 4F3QA 2FLLA 2N3OA 1YDLA 5C25A 1EX8A 2XBPA 4PXEA 3PXGa 3U1MA 5D3GB 3PJXA 2LXIA 5IOLA 2CZ4A 1SH0A 3CSKA 4HR2A 5KFIA 3LP1A 4CO1A 2YH0A 2EFQA 4WPAA 4YQWA 3EPIA 4X4VA 3PG9A 3AH6A 4OJ3A 1MNEA 4A4JA 4E98A 5ETVA 5C25B 4P75A 2L41A 1RBLA 4LFBJ 4K5SA 4ANCA 1RQ0A 2QYCA 2CXEA 4I6AA 2RH3A 5C24A 4QYZJ 2DNGA 2NLWA 3TJ9A 3EGNA 3NGSA 5KG7A 4ECRA 2EBEA 4NLYA 2FD2A 2W4CA 2AEFA 3NG8A 5G0RA 2MGZB 1LWXA 1IKWA 3QJJA 4MK7A 1K0VA 3MAAA 4Y2MA 1WTBA 2XWXA 5HBMA 2F40A 2DR7A 3EDQB 4DV6J 5CZXA 1SV5B 1VIOA 3NP5A 3OFGA 1XNRJ 1RHUB 1S48A 3HHDA 3D3BJ 5F8GA 1REVB 3FMWA 3SSQA 2KH9A 4OZ2A 1RDRA 3BH6B 2B6AB 3HO1A 2BOAA 2YY3A 4IH6A 5E7OB 4F2RA 3MI7X 3CCQS 2MKJA 4B3TJ 2BQRA 2RHQB 3PRBA 3IG1A 3GR0A 5DRKA 3EWGA 4N56A 1YTYA 4K2XA 2XEXA 3OHBA 4DQQA 3PHEA 3ZNJ1 5DG9A 3LALA 4U9RA 1NK0A 3S8SA 5CD4A 1NK5A 2FDNA 4OV6A 3KYLA 2H5JB 2AEJA 5EX3A 3UWTA 3W8GA 2CQ1A 1NJXA 1QAJA 1O5JA 2DR9A 1TL4A 2H5EA 3R27A 4FP9A 4X4UA 2KL8A 2BA9A 2V8PA 2HFUA 3PNIA 1REGX 1SBRA 1S1XB 3M6XA 1QSSA 5FJ4A 3GSIA 1UVNA 1WF1A 1YZ6A 4F4AA 2DIUA 2MXYA 3DLGA 3H5UA 3WC0A 3LP2A 2G2ZA 3EE3A 3UN3A 4C0OC 3HLUA 3PO5A 1TVRA 4WWSA 2QLBB 2KYXA 2ZHOA 1NPPA 4RWXA 3W65A 3H7HB 4DUZJ 1D1UA 2G4BA 1WKKA 4HH0A 3Q8PB 4NCGB 4ZMMA 3BGOP 5IM0B 4KJIA 3M2UB 2MLXA 4RW7B 2D3OR 1ZTWA 2IA6A 3OVSA 2BUNA 1S9GA 3FZBA 3DRXA 5L38A 1VLOA 4KV8A 3W7BA 1HNZF 2CWKA 2FJXA 3EMTA 4L74A 1CULA 1J5OB 2CPHA 3C6UA 3CJ8A 1G6BA 5KOWA 2J0XA 5HP1A 2HMIB 1RSCA 2DNNA 1FE0A 1IN0A 3MM8B 1HWJA 4F04B 1EETB 1NMEB 3GZ7A 5A2QY 4CQ1A 3HSJA 1ZAVA 2O1PA 3OT9A 2V34A 1S0NA 4JI3J 1S1VB 2W25A 2QLFB 3UO0A 5D4NA 1KRPA 3EGZA 2BJEA 1JLCA 2K06A 2AJ4A 5I3PA 2UXDJ 1HYSA 2UUTA 5D0RA 1FRXA 5J1EB 4TXSA 1VISA 4TQSA 2GGPA 2RUSA 2ZBCA 2XYHB 3OW2R 2R2SA 1X4DA 2ZZMA 1AYEA 2RQCA 2VASA 1HNXF 4K50A 2GHVC 4JI2F 1RLCL 3M1VB 1J5EJ 3CO9A 1JLQA 1N0UA 2UXCF 1D8ZA 3BBFA 1X4BA 1DQ8A 4PCQA 1H7WA 3FQLA 2YQ3A 1BXNA 2AGQA 5CAAA 1CVJA 1WUUA 1J5EF 3IFEA 4B9UA 1TVRB 3VGUA 4LF5J 3K5LA 3U27A 3KKFA 3EX7B 4DV5J 3RR8A 3LQVA 4NEYA 1JMTA 1VRTA 1K1QA 1PO6A 3RB6A 5KFBA 3V6HA 1FT8A 2HRUA 2K3IA 2JJ4D 1QAXA 3POTB 2OMOA 1GTHA 1SH2A 2DCUB 3K8VA 4ZKAA 2ALYB 1H72C 2MKHA 3NS5A 3MAQA 1VQLS 1FA0A 1BQMB 1IR0A 1LKZA 3OL9A 3HPOA 3EZUA 5CYQA 2IM0A 4DR5J 3G6XA 4NXNJ 1TQLA 1TAQA 2QRRA 5E0OA 2C1EB 3MZIA 4RW8B 4UOFA 1GQEA 2CPFA 4C3MA 3MPVA 4ZVQB 5KT5A 1NJWA 3DMJB 2FZKB 1RUSA 1U8SA 4QR1A 1EP4A 1SC4B 1X5OA 2D9PA 3D28A 3D67A 3MWBA 3UPFA 1H6KX 2B5JB 2OSQA 2ZNZA 3MCOA 4P7TA 5KG0A 3VAFA 2Y1IA 2FB0A 4DL7A 1YK9A 2UUCJ 3I0RB 2PMWA 1V5VA 1FTRA 3D7SB 4KHRA 4WFNQ 2NXJA 4A8QA 1RT2B 4O3RA 1U4BA 1JLBB 1M1HA 2N4DA 2UUBF 4ID5A 5HMWA 4HT5A 4OJ1A 2FHJA 2EW9A 3EVWA 2Q66A 1VQ6S 3W61A 2RB7A 4DCJB 3JTPA 3MMCA 5IC4B 1EP4B 4G1QB 2R7OA 5LM7E 2KRBA 4HACA 3Q89A 1N0VC 4PXBA 2CVIA 2HBZB 2RQKA 2VPWB 3L4BC 2HFVA 3NCRA 4LREA 5D4LA 1NK6A 2UUBJ 2K3KA 1KTVA 2HVEA 2CQ0A 3FRYA 5HL7Q 3HT3A 4OI2A 2ZH7A 3KDOA 4DV0J 2ABYA 3U7JA 1SPBP 2EXUA 2H4YB 1TKTB 4HDHA 4OZLA 4DR7J 3B6BA 3RW7A 5FDLB 5A76A 4TU8A 2BVZA 1CJKB 4LQ9A 4B17A 1VQ5S 5HMZA 3AHPA 3HHLC 1NEEA 3POTA 3MPUB 1UW4A 3HF5A 4E8UA 3A8KA 2KKHA 4MIAA 3BKTA 4DR7F 4HTJA 3KLIB 2X51A 1KDNA 2K8GA 3E8OA 3M6UA 2ZDPA 4JI0J 4AXIA 1DHMA 2PMHA 4KGVB 1NPRA 1LV5A 3W9HA 5KFJA 4C8LA 3FBEA 2HAFA 4DSJA 4HHHA 2PMZD 2Y1JA 3UQSA 1F6TA 2V4QA 3S1TA 1BMQB 1XEZA 2GJFA 4F0MA 1JLFA 3GIJA 5DO2A 2CPXA 3H40A 2WOMB 2AGOA 3DLHA 4BS2A 2BMBA 4LF5F 3W1YC 3TA0A 1R0AA 4KR0B 2I8EA 4EGLA 5CHCB 4DV3F 1YI2S 5HSPA 1SXLA 2VBZA 4JI1F 1IKVB 2GVDB 2E1RA 3FVYA 4FYVB 5J1EA 5EWGA 4NLWA 1S0MA 1O6XA 1NJZA 3LOUA 1HYSB 4MIWA 3NGTA 5IT4A 4LRAA 4ER8A 2UXBF 1TFWA 3FQKA 4YB5A 1S59A 3OTOJ 4LUBA 2I1RA 4P9SA 4NRUA 3D0GE 4X4RA 4NXNF 1WOSA 2OO4A 4RO0A 4E0DA 4HI2A 4NLSA 1S77D 2AWZA 3WZ0A 1YZ7A 1XR5A 4ZP8A 2BW2A 4J37A 3WDOA 3PW4A 3OSPA 2XLJA 3KMSA 1CULB 2EFVA 5LSOA 2M88A 4JBCA 1RAHB 2V2KA 1HBNB 1VK3A 2GHWA 3O44A 5BYRA 1HBMB 4DSFA 4DV2J 3H2UB 4PAAA 2W2PP 2ZZTA 1V5IB 2COLA 4ZPAA 3W60A 2LXFA 4WE1A 3CD0A 1DQAA 3BEGB 3OFEA 2LFVA 3SSRA 3TZWA 3PJ9A 1FK9B 3LP0A 2RDIA 4KFBB 4H4OA 2KFYA 1UL3A 2C2ZB 1FI4A 2OH2A 1TFYA 1ZM9A 4F3OA 4C9DA 4KPYA 3G2XA 2C28A 4Y2IA 4JP8A 4EBEA 1YWXA 2BXJA 4FYWB 5IQQA 2AJ2A 4IG0B 4JYAJ 5D8HB 4DR6F 3THTA 4A8FA 1CBKA 2U2FA 5J2NB 1ITPA 2JC0A 1XMBA 3G87A 3T9NA 2J7KA 3M9NB 1FRMA 3V6KA 1JXLA 2UUCF 4ECUA 4CCHA 2QLXA 2EBGA 2Z0GA 4ZP7A 1R8PA 6FD1A 2HEKA 4RNOA 3AB4B 2CG8A 3SQGA 3BREA 1FJGF 2CQIA 2MHEA 2JHEA 4J90A 4KE5A 3LWMA 2BABA 5IV4A 2ZJPQ 4I7FA 3M2VB 4CNZA 2Z2YB 1UJ6A 4R25A 3QO9A 4K4WA 4OYWA 1FVQA 1WTFA 3DCAA 3R5BA 1QUPA 2ATCB 2RNEA 2I2YA 1ROFA 3I32A 4D3HA 4JI4J 3TVKA 1NDKA 2FHKA 3H5SA 2QIFA 4ES3A 1RXOB 1S7IA 2B6AA 4FXVA 4HL9A 3W63A 4DQSA 2X3DA 1UWAA 1G3OA 1SV5A 4RW4B 4IG3A 4DX8H 1Q81T 1O51A 1TL1A 2R8JA 4ATNA 2V63A 4ECSA 1VBKA 2IIHA 1RHQB 3SBMA 2B7CB 4CH0S 4DV4F 4KGKA 4ZN1A 3ICLA 1YRTA 3D9BA 3FK4A 5ETRA 5SZTA 4JI5J 4B3OA 3C15A 4JV2A 3DRPB 5THWA 1CJTB 1R0BG 4Y28C 3GV8B 1VMBA 5C42A 1PC4A 2IFXA 3WIUA 1N6QB 5CCMA 3ZZ0A 3GYGA 2B43A 1U6ZA 3PRDA 1RU1A 3KK1A 3IO1A 4U96A 3MUVP 3Q2TC 4K4ZA 1S99A 3A13A 3KUHA 3ILJA 4NA2A 5DQHA 1S1WA 2I5JA 3K5MA 2MKSA 3QBCA 4LBPA 4OYBA 3G6ES 3LP2B 1S97A 3DYAB 3H5XA 2MZQA 1YBTA 4WCEQ 2AF6A 2ZBPA 5HN0A 1PAUB 2CADA 4NLRA 1JLEB 1QAYA 2XZWA 4UQTA 1KLMB 4Y2AA 2LLZA 3R5DA 4DR4J 2ZUGA 4PQAA 1P9QC 4LR8A 4Y2KA 4CO2A 4ZN3A 1KEKA 4ELTA 2GQ2A 1FWKA 4DPXA 5KFOA 4ECZA 1KQSR 4FVMA 2VG7A 2WHOA 1WDTA 3MDFA 3JSMA 1MG7A 4KT0C 4V19X 4DFKA 2ZKUA 4TY8A 3BGRA 3CCLS 2BR0A 3MOJB 3NMRA 2XMTA 4C0HA 1KLMA 4USWA 2XYGB 3WIVA 2VQEJ 1U26A 1S79A 1JNZB 1ZAXA 2HQGA 1KVKA 2IVYA 3FDSA 1HNIA 4FYYB 4L3NA 1AROP 1HQUB 2ILZA 3M2RA 4RBUA 2HAIA 4DEZA 2CQ2A 2MZ1A 3TQ1A 2ATLA 4DI6A 2GO8A 2QLWA 3RGIA 3J7YI 3H59A 1F5BA 1RISA 3LP1B 3RAQA 4YDXA 1UEUA 3RBZA 3P49B 1E6YB 2AJQA 3Q22A 5KFPA 3QIDA 3OTDA 2RU9A 4WFYA 3RU0A 3FMBA 1B0TA 2JZ5A 4DPUA 4LMZA 4DR6J 3V5RA 2VG7B 2ZNYA 2CQPA 1SC1B 4B08A 2JFDA 1PJ6A 2G9OA 3D68A 3BH7B 4AL5A 2NSCA 2KM8C 2XMJA 3VAKA 4ZDNA 4QPXA 4B9SA 3G71S 4C8NA 2DGSA 2F5GA 3W9IA 3I96A 1UVLA 4PWDA 1MSWD 4RW4A 2AMCB 3HHNB 4C2MA 5HMXA 2RJZA 4LQ3A 4K5RA 4QU7A 4QIGA 2OELA 3MR6A 2ZOFA 2AZ3A 1D9FA 1V3ZA 3TJ8A 1KS2A 1QTNB 4XO0A 2X1FA 2VPYB 2UVUA 4QYZK 6AT1B 2XGQA 2R7QA 2IMWP 2IDEA 2WVBA 4LF6F 1EKSA 3KJVB 2W9CA 2V8DA 1MMLA 4FF4A 4LF8F 3G8TA 1LNQA 2JVRA 1UVIA 5IV3A 3CMES 3MTKA 1XWLA 3G4SS 4JI7J 1UFWA 3RBXA 2HZAA 1AW0A 5J2MB 3UN2A 4USUA 2R7XA 2WVFA 1RTHB 1KBRA 2F9DA 2DRAA 2VONA 2NREA 1Q86T 3GYXB 4DR1J 2WBMA 1WEZA 4IFYB 3AD7C 1VJQA 4CLYA 3UNGC 4JI5F 4DSKA 3BSOA 4DL6A 3UCUP 2EFPA 1TL5A 5LXRA 1JLEA 2HQIA 4DV3J 1NJIT 1RTIA 3KK3A 1JWWA 3K58A 3BSAA 2CVEA 4DR4F 2M4MA 2HFSA 3DXSX 3NWRA 4P2FA 2O66A 4GO7X 5AXLA 5DETA 3G8SA 5HQMA 3VGTA 4G1IA 2R8HA 4X65J 2CJBA 4H4OB 2YH1A 2D3UA 1OQ3A 3D0IE 1PAEX 3RB3A 3RBEA 2RE1A 4NYZA 4AUKA 2W9BA 5IWAF 3V81B 1BC6A 2V8VA 4W98A 2B9YA 2XO6A 4NMLA 3NLCA 1N5YA 4LFBF 4DPOA 1CQNA 2ZBQA 7FDRA 2N4CA 1FNOA 2HNDA 1D9DA 3R1LA 1KONA 4IO1A 1U6BA 1P9YA 2AKWB 4PEOA 2W9BB 4LR9A 3HVRA 1FDDA 3V6DB 4V1Ak 1WF0A 3CJSA 1IBLF 4NXMF 4N41A 3BQ1A 2E1AA 4IG3B 1YX2A 4M5LA 4O4RA 4DDFA 5A8KB 5A6PA 5EN1A 2ZH4A 4P74A 1VR6A 2QFJA 3T41A 1RA7A 1Q0NA 4DS4A 3DN9A 4EUVA 3QT7A 2CJAA 4DL2A 4JYAF 4BC9A 2QA4S 3BYPA 2DB1A 1VQ4S 1EQ0A 4PWWA 4DQRA 3D0HE 4X4SA 3DGPA 3NAHA 2FZGB 1OY8A 3CDBA 2DGXA 4LIRA 4ZP9A 2FLNA 3G82A 3CC4S 2RUGA 3I5AA 2DNPA 2NXEA 1HR0F 2JEGA 4V19J 1CQMA 5DM6Q 2M8HA 1HBUA 2LA4A 2RKIA 2V0NA 2VG5B 4UOHA 7FD1A 4PUOB 3SQGB 4CO0A 2HNYA 4FXWA 1GTEA 3WX4A 1HFEL 2PC6A 1N36F 1TAUA 2MPUA 1PSDA 2WB1D 3FCVA 1B0PA 1C1BB 1X4GA 2O5DA 3CJ2A 3KHRA 1S6OA 4EMDA 3BSNA 3T1HJ 4FXDA 4X4OA 1RAIB 3HJFA 1VCTA 3TUIC 5KFAA 1FESA 1IKVA 2GVDA 3V4IA 4J9QA 1Z4UA 3A8EA 1FERA 5FDLA 5HLFA 4KH1B 4C8YA 1TKTA 1WC5A 1JLFB 2MY8A 3BM7A 3TP2A 3VCDA 2HIQA 1CC8A 1FK9A 4YB1P 4DR1F 4ZK7M 5G4DA 2VPXB 1I94J 2R42A 3ILIA 2ACMA 2MKCA 4DUYF 2C3PA 2MQPA 3H98A 3VWSA 2BE2B 1DTQB 2DO4A 2J8SA 2YBVA 3C6TA 1R0CB 3QZ8A 5F0UA 3TYTA 1FDAA 2L9DA 1I5OB 4OYOA 4NL5A 4LBIA 2RSQA 1VHFA 1E6VB 3O5TB 2A0FB 1LXNA 2IVMA 2RVJA 3SCJE 1IBKF 2DVIA 1CJVA 1JKHA 2ZM6F 4GKJJ 1FDNA 3MF5A 3UVJB 1GH8A 1D09B 1YBUA 2AJ0A 1LWEA 3LGHA 5LT5A 4L75A 1HBOA 4GRSA 4ZVRB 1GAOA 5SUHA 3QT8A 2KYZA 4GMKA 1S6QB 2IMOA 2PEBA 3DMJA 2VA2A 1BQXA 2ZOMA 2DGUA 4DN0A 4RW8A 3HD1A 1M5SA 2QE5A 1UPMB 3N01A 2ZH8A 2OP5A 3FEYB 5KFSA 1R6YA 4JUZA 3IRWP 5KOXA 1FNXH 2UV8A 4H4KC 2OPQB 5A8WB 3CULA 2VA3A 4ED5A 1TK5A 1SH3A 1Q8LA 1ZAWA 2VFVA 1IWAA 1RT2A 3C14B 4X64J 3HULA 4LFCF 4A46A 2FC9A 3OBIA 5C2GA 1NB7A 2C3MA 2KVQE 2NUHA 2YNHB 2B8PA 3ISNC 2CPJA 4AT1B 1RWWB 3SXLA 3BB5A 3KK1B 1F9EB 2VQFF 2XCAA 2ZD1B 2RD5C 1UKUA 2P5VA 3M1VA 2XHCA 3TAMA 4RUAA 4DLEA 4QBUA 2Y1RI 3GU0A 1NJYA 2XQCA 4RU9A 4RPFA 4H4KA 4OX7A 1LQ9A 4YEAA 5M2UA 4WIIA 3F73A 2FHOB 2I6WA 5J2PB 5D0EA 2M5YA 3KMQA 1VQMS 1HI0P 2E5HA 4NA3A 2HGNA 4U7UK 3M9MB 1RAGB 1G4CA 1MW7A 2DHGA 2VD3A 3MMCB 5F3ZA 2HVIA 4A8MP 3MR3A 1IJFB 4DHVA 1RYSA 3AOCA 5FIIA 2C3UA 1A7GE 2YKAA 1XQIA 3QQCD 4OZ5A 4P52A 3ZO7A 3CUNA 2AX1A 1T3OA 4XAKA 3OL6A 2HGMA 2UZAA 4CNYA 2Z58B 2ZBIA 1JLAB 3MOZA 3PEJA 4M5IA 4WFAQ 1JLQB 5IZHA 1P1LA 2QL9B 2ZE2B 1N48A 1J5OA 2B5JA 3A3OB 3F44A 4CZCA 4N5SA 3QMQA 1PIEA 3QO9B 2DNQA 1NBEB 4DX6A 1IVZA 3E2EA 1YJTA 2B4OA 1JLAA 5BR8F 2E1CA 2F8EX 1VDHA 3H4BA 4MJKA 5D78A 2QA4G 4IRKA 3QT5A 4RUCA 4LVNP 3PR5B 4RNMA
chains in the Genus database with same CATH topology
4KGMA 4NX9A 3R3TA 4F3MA 4BDPA 2K1RA 3S6EA 1XTZA 2BYCA 3CTRA 3VAGA 2E5LF 4PXDA 1QLNA 3CJ4A 3DOLA 4H54A 1S1TA 3UDLA 3CCJS 1CG2A 1FJEB 4Y2CA 1XNRF 3MR5A 1L3TA 2CRLA 2UXDF 1APSA 3HVAA 1S9GB 2DPIA 3IR5B 3JSRA 4RW7A 1YJ9S 5KFCA 4ETZA 4HEA9 3CMAS 4I69A 5CA5A 3IBWA 1LWCA 1O0PA 1F60B 2C2EA 4QIWD 3HX9A 4AL7A 4MH8A 3CDUA 3HMJG 3EYZA 3J7A1 1L3VA 2MY7A 3PR4A 1H3DA 1CSJA 2A1BA 2OTJS 3OVAA 2VUGA 1JLCB 3DLJA 4B9TA 1L5UA 1YG0A 1LK7A 1VS3A 2CIMA 1SL1A 4N8OA 2FJBB 2CPIA 3IXQA 1X7VA 2YKQA 1TL3A 3M8QB 2KT5A 1LOUA 2MGZA 5G0RB 3C6UB 2JLGA 4OFZA 4Q43A 4F8RA 1Y3JA 2XSFA 4NLUA 2WOMA 4USHA 3ITHB 3PY8A 2XLIA 4KRWA 3M6VA 3KJVA 1T02A 3OLBA 4FF3A 3DI6B 4I64A 2EK1A 3ZZUA 1NH7A 4DG1A 4QW8A 2KXHA 5ADZA 2AGPA 2NUUG 4QU6A 1UVJA 1X9MA 2VG6B 1IKXA 4ELVA 1DTQA 3TOQA 1KTQA 3M8PA 3NWGA 3QJLA 5D4OA 2GW8A 3KHLA 2B0GA 1C0UB 4YB7A 4TU9A 1C4AA 2E1MC 4CH1A 3CCES 2K2PA 3N79A 2KT2A 1NK4A 3TO8A 3JSBA 3SFUA 4IH7A 1SJFA 4EWTA 5CYJA 4C8KA 4DL4A 1FJ7A 2XS2A 5A8RB 2YX1A 1RT5B 2XGPA 4DFPA 4U67Q 2GMLA 4MKBA 3CCUS 2VKRA 3CCTA 3J7ZT 5D3GA 4C98A 4URQU 1IKYB 3IG1B 2Z2LA 4Y0FA 1TK0A 1JJ4A 1U1QA 2GO9A 2RKIB 1N5SA 1RP5A 1XN9A 4P7VA 4A8WA 2Z2MA 3H25A 3C66A 4DQPA 3H20A 4KC5A 2V8GA 2RMLA 4UUXA 3MEEA 4URGA 2LA6A 1IKWB 5K14A 4ZCMA 3QGIA 1QUVA 4WFBQ 3TANA 4WYWA 4ED0A 1CEZA 2DD8S 2KB2A 3AQOA 1U2FA 1VI7A 1YBAA 1RI7A 4WJBA 1HWIA 3CGIA 3E01B 2NYIA 2B56A 5F41A 5BYSA 1HD1A 4Q5VA 1OS5A 4MKAA 2YTCA 4PG6A 6FDRA 2E9TA 3GFZA 3P96A 4PG5A 4Q8FA 3NCPA 5E5NA 3OTEA 5MAOA 3T5KA 2MYFA 2UUWA 3BN7A 3ISND 3QLHB 4B3OB 3KFWX 1U25A 3HHLD 2UVRA 2DNKA 5DDOC 5HROA 4CO4A 2R7SA 1BGXT 2Q3PA 4KBIA 3VALA 2XSJB 1N34F 4O23A 1T95A 2DHXA 1XMQF 1Z1ZA 3SI8A 3A1YG 2W24A 1UEVA 2V94A 2CJKA 2R7VA 4QWEA 3I0SA 1RAJA 4C8MA 2IM1A 3SYZA 2DR8A 5GAEI 1KOHA 2CPZA 2YNGB 3OTCA 3Q8SB 2VBXA 3TW0A 5JJBA 2JEJA 1A9NB 2GMJA 2J9CA 2K7KA 2XMMA 1R8BA 5DDRC 3KLGB 1KSPA 2HLUA 2G1DA 2CQ3A 5KFZA 1SL2A 4CTAA 4YP3A 1DZ5A 1HQEB 4HDGA 1KR4A 2GJ2A 3DXBA 4N5SA 2KG0A 3MEGB 3Q8QB 3VAIA 4I7FB 5KFGA 3G6YA 5J2MA 1HBUB 4Y6IA 1YHQS 3ZZOA 2NREA 2VV5A 4RLEA 4MKYA 1HMVB 3V2UC 2BRKA 3IGNA 3PM9A 4OZ0A 4B3SF 4OL8A 4TLRA 4XDDA 4DS5A 2E66A 2XCPA 2AD9A 2NS1B 5B0FA 2HFOA 5J1PA 1ZBTA 4B02A 5KFLA 1DFDA 2R7UA 3QZ7A 1M0SA 2YNGA 3ENQA 3GB0A 4OX6A 3DHXA 3HK2A 4KO0B 2P9EA 2D9OA 2HNZB 4GKKF 3RRGA 4Z2XA 5DDQC 4ED3A 3DNCA 5A8KA 2DNZA 2XS5A 2DNOA 3UD4P 1X5SA 3BN4A 5CD4H 5I3UA 1ZPWX 3GFYA 2XSJA 1H7XA 3IAM9 2B4PA 3FSYA 2MZJA 2IVFB 1YJVA 2AP6A 3UR3C 1N56A 2E9ZA 1HBMA 3V6JA 1RT3B 2VODA 2WONA 2GC8A 3BQ2A 1H38A 4PPZA 5CQGA 3KLFB 4X4VA 2KZZA 3VR1A 4CH7A 4WZMA 4CI0B 1TK8A 2DNYA 3HVWA 3PEHA 4WKRA 2KHCA 2UVWA 3Q0AA 4ECXA 4EZ6A 4IUFA 4OV1A 4XPEA 4NYPA 2VOOA 1GXLA 1ZZFA 3DU6A 2V9KA 3LPYA 3CXCR 5E3CA 2CZVC 4WZQA 1UA0A 2ZHBA 4HLBA 1HQUA 1N54B 1N33F 4TNOA 4F4XA 3MECA 2NQPA 2DNMA 2EFOA 1C2PA 3D54A 5K14B 4UY8T 4AYBD 4J9PA 3K5PA 1Q53A 5KFXA 5KFNA 3JSMB 2HW3A 1RT1B 4KTQA 1Y7PA 3HDSA 1JLGA 2R2TA 1RTHA 3C8YA 4FZVA 1D0EA 5CYMA 3J7YU 1S49A 1GXUA 1W2IA 2CYYA 2DT9A 2VFTA 1L3UA 2MKIA 3OFHA 1FKPB 4P2SA 2J0SD 3RB4A 1IKXB 3H8YA 1U1LA 2CQHA 3VQSA 5K5MA 3THVA 1BD6A 1LW0A 1WG5A 3CE8A 4TYBA 3HHKA 2N7YA 5L9NA 4KSEB 4IKAA 1IXKA 3MTJA 2APOA 4LVOP 1UJ4A 2CQGA 4BWMA 1NZAA 1OSDA 1R7IA 4F4WA 2YVSA 5I42B 5DLGA 2M0GB 3JYTA 4M5DA 1KVJA 4IFVB 5HI7A 4J5OA 3ITHA 3AQPA 3DRPA 5L9XA 2F7VA 3NGKA 1M90T 1Y00A 2CFXA 3DLLQ 3J80Y 1X9SA 5GAGU 2GMHA 2A10A 3HP6A 4YY3F 2B4VA 2I38A 3GIIA 4IOCQ 1IQTA 4QIEA 3OV7A 2CDQA 5AXNA 4IRCA 1ZYQA 3TARA 3OL7A 4JOUA 2QA2A 1HI8A 5F0WA 5F8IA 5KFKA 4GC7A 1JLBA 3AJ2A 4G6VB 2O01C 3IA0A 2MZTA 3TI0A 3PKMA 2ROEA 1JB0C 3NAIA 4X4NA 5T41A 1H2VZ 2D3ZA 3IS9A 1HWUA 5KT3A 4I2PB 2FLOA 3TR5A 2CQBA 2XC9A 3U02A 2YNIA 5LJ5Y 4FF2A 2DPJA 2FHMA 2LEPA 5KT7A 3U1NA 1SI9A 4LF9F 3IR6B 1TL3B 3M8QA 4TY8B 2EC0A 3MCSA 2W7PA 3RZAA 1G7CB 3N5FA 4QZVB 5CYQB 2ZDOA 4R0EA 4H4MA 3BO2A 5L39A 3PW7A 4XK8C 1NHVA 2YWHA 4LT6A 3GG1A 4ECQA 5AE3A 2ASJA 4C8OA 1FNMA 1VRTB 1YRXA 3B82A 2KFZA 3MM5A 3I87A 2ZH5A 3EXCX 3I31A 1ZM3A 1ULRA 2GIQA 3MM6A 3GIMA 4DL5A 5J2QB 2X1GA 2KU7A 1X4AA 1NH8A 5KFEA 4ZPVR 1ZH5A 3VZHA 2FLPA 3PW5A 1Z2LA 2ROPA 4IH5A 4ZPWR 3E51A 3LO3A 3W2VB 2ZHAA 4NCAA 3LAMA 1QE1A 2F8HA 2D7SA 2YKNB 2LU2A 4R5PA 1QSYA 1GX5A 1V3RA 2MKKA 2GGPB 2MQOA 3BDPA 3CD6S 4M63A 1VQOS 1S6PA 3G86A 1C1CB 3WBZA 3SZ2A 1S9EA 2A3JA 2RF2B 4UOCA 1SL0A 5T14A 4J9KA 2I9SA 1T03B 2PA3A 1F5AA 3RAMA 4QWBA 1RT6A 2J6UA 4BWJA 2RILA 4TY9A 4I6YA 4FVCA 3H4DA 4JV0A 3CEDA 1S6UA 4ZS6A 2VFUA 2P9GA 1SUQB 1Y9OA 5KT6A 5GADU 1VQNS 1RWUA 1UA1A 1M5KC 4JV5F 4K4XA 3M2VA 2DNLA 1GT8A 1N5TA 1QM9A 1SJRA 4J9SA 1ZTTA 1YITS 3VQTA 4K4YA 2BQUA 1T7PA 2E9RX 1YIJS 2XNRA 3RW6A 4PQUB 1JK9B 1WG1A 3MM6B 5KFWA 4O44B 2MQMA 4YMEA 4MTPA 4LJMA 5L1LA 4NRTA 1RT7A 5KFDA 3DLGB 1QY7A 4RBTA 3RYLA 5J2NA 4LSLB 2DH7A 1VQ8S 2E5IA 3DLBA 4IG0A 4NZ0A 2ZH6A 1S0OA 2ZFHA 2YWGA 5EWEA 4IYQA 1AUDA 1UMJA 1JLGB 3CDAA 3NMAA 3MD3A 4DUZF 2G13A 1V9OA 4U6PA 4JI3F 4KHPF 3I9ZA 4EBCA 2M2BA 2IBKA 4JI7F 4ED1A 4G1QA 2KJWA 2L48A 1BQNB 2IRUA 2YNFA 2DITA 1S4FA 4Y34A 4YEAA 2KO1A 3GG0A 2DNHA 2Q43A 2R7WA 3IS9B 3L95X 2GJIA 2FJWA 3PDNA 3G8QA 1FKAF 5CH7B 5CXTA 2V8HA 3ULHA 2VFSA 3I0RA 2OPQA 5DS7A 5A8WA 2VB6A 4O0IA 3K59A 2AJFE 2OD4A 5D77A 5KFHA 2M52A 2WAQD 4O3NA 2DGTA 3T19A 2OPPA 3NNHA 2R2RA 3VAJA 3FEXB 1WHWA 4ECVA 1R0AB 3DOMA 2BANB 1KFSA 3TRGA 3T3FA 2CPDA 4QR2A 3CPWR 1MWZA 2NR0A 5KFTA 4C3LA 4NLXA 3IWNC 3D5MA 5K8OA 3H2LA 2W8KA 4OHWA 1WI6A 2HHUA 3IWLA 1CLFA 4ZHRB 4LSNA 3X3UA 3MM7B 4OI0A 4IDKB 5LJ3Y 2FUG9 2GA7A 2EFNA 2JRSA 1GXTA 1JJ2R 3DM2A 1D8YA 2HG4A 2DTJA 2PSZA 2PDAA 5LMUF 4DOZA 5KG4A 3JTNA 5CYMB 5KFMA 1M5HA 3V4MA 2V9WA 4KB7A 1FRLA 1OSCA 2B4UA 4YFUA 3CJKA 2ADBA 2LDYA 2PIIA 4FBTA 3PV8A 3MPYA 2ASLA 4FBUA 3G96A 2FGCA 1WHXA 3KG4A 3CVKA 5KFUA 3OXGA 1HL6A 2DGOA 2GIRA 4G1PA 5D4PA 4EO6A 1FTCA 1DLOB 1HARA 2XMVA 3BR8A 3DRRB 4LIWA 1C1CA 1SJQA 4DF8A 2VFRA 3J7Z5 1S9FA 4EZ9A 2M9KA 4R5PB 3QLHA 3IGVA 5JXSA 4AFFA 1RT3A 2C22A 3QYYA 1IM4A 2OAUA 3N5BA 2KJVA 5HQ8A 1CPZA 1ZM4A 4KKOB 4HI1A 4NCGA 2JL9A 3F56A 3PKYA 4HKQA 1JNRB 2IAJB 5MLCV 4DFJA 1I94F 2F9JA 4B9NA 3E01A 3GFXA 3NKYA 3UD3P 1SKSA 3ZZRA 3N9UC 1RTIB 1RA6A 2J0QD 3HHLB 2J9DA 2BDPA 4KKOA 5F9LA 5GAGI 2L3MA 4HVZA 3UW1A 3MR2A 1XERA 4MYUA 4ZVEA 2N3LA 4FN5A 3GMGA 2MDAA 2FY1A 4HTIA 2DCLA 5EGYA 2J6TA 1KQFB 2O3DA 2Y0SD 1I1GA 4EBDA 1X9WA 4FF1A 4OJHA 4C11A 1OO0B 2EPIA 3MD1A 2W7AA 3I4HX 3D2WA 4Q7AA 3CCSS 2R8KA 1MROB 2PI4A 2HZCA 4Q2MA 3KLVA 2A2DA 1K1SA 2OFGX 4OI3A 3KK3B 2GV1A 1LWFA 4BHQA 5A0YA 2ZJRQ 3ENWA 1KD1T 3CIMA 3EXYA 4CO3A 5F8JA 5LXYA 2J9EA 2FJDB 2HVHA 3LWLA 1G2EA 1EETA 3OR2A 1NJIT 1R8AA 2LECA 3MM8A 1A6LA 2QA1A 5HP1B 2HMIA 3KK2B 3IWXA 4OI1A 3B4DA 1TKZA 3KNGA 1HPZB 4TKTA 1HHTP 4Y3CA 3AA8A 2XMUA 2PO4A 2DGWA 1HNWF 3M4XA 1RTDB 2LU1A 4ZHRA 5IM0A 1MU2A 1FE4A 2Q79A 2KVIA 4DV2F 1AXQA 2VZ9A 4ZLPA 4EYIB 4M8LA 4RUHA 3PZPA 1BLUA 2IYGA 1QVGR 5AE1A 2WK4A 3PX4A 1ZETA 3CT9A 4PWDB 1F0XA 4ECTA 2KFNA 2X1AA 3IN5A 1S1XA 3UI3A 1TKDA 4F4ZA 5ITHA 4EYHB 4A8YA 3MEEB 1SJ1A 4OMFG 1T05A 3NNCA 1RT1A 2EI5A 4TYAA 2XI2A 3EUNA 2Q6BA 3K8WA 2J76E 5B0AA 1R8CA 2L08A 1XR6A 1FRKA 1X4HA 2J5AA 2IJFA 2BV3A 2LDIA 3OFFA 4DV0F 5AXKA 2IBOA 4EO8A 3ZZPA 4QWAA 2XI3A 2JH3A 3DOKA 1KC8T 3NCQA 4IQXA 4URSA 3HHEA 4YR2A 3PIOQ 2Q6CA 1U1PA 5GADI 4YUDA 1S1WB 2I5JB 2B3TB 2B7BB 1LW2A 3BGFA 4K4VA 3DOKB 4OZJA 2MQQA 2N82B 3QJPA 3BGRB 1REVA 2JLEA 3M05A 1N5VA 3KLEA 4NZ7A 1XC9A 2WONB 3CCZA 3CB4A 1U47A 4ILRA 4QIFA 1NRKA 2BZ2A 2EVZA 2OFHX 4ECYA 5DM7Q 1DQ9A 2JDJA 2HFNA 4F25A 4RNNA 3HHLA 4F02A 3CDWA 3PX6A 4FNIA 4LSLA 5I3UB 5KFQA 3CD7A 1DTTB 2IRXA 1L3KA 2WBRA 4IRDA 3LANA 4TLQA 3CIZA 3FSIA 1U24A 1Y4ZB 4WK3A 5JVHQ 5K9FA 2V5HG 4UW2A 4DG1B 3PVXA 1WACA 4PWUA 1HWKA 4OZNA 2VH7A 5IT0A 3E3XA 3OXFA 1MROA 2O67A 1DJ0A 4ZPDA 4A8KA 1UWBA 4OLPA 2VOPA 3JAMY 2E7WA 5KT2A 1ELOA 1VBZA 2ERRA 5IQ6A 1FEEA 3FSXA 3VTIA 2W4PA 1LFWA 1TL1B 3ZZTA 1TP7A 3FCHA 2E29A 3ETOA 4ZOSA 3I55S 1T94A 1JJHA 2IHR1 2D1CA 3B78A 1TV6A 1KN6A 3TAQA 2OSRA 2V4JB 4DL3A 1KHVA 3SV3A 1KVIA 3DRSA 5IT9Y 4MYTA 1FD8A 1HI1A 2JX2A 5KG6A 4C7QA 2C3OA 2IJNA 2KM8B 1QE1B