4FXWA

Structure of phosphorylated sf1 complex with u2af65-uhm domain
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
105
structure length
105
Chain Sequence
b'PLGSTEVLCLMNMVLPEELLDDEEYEEIVEDVRDECSKYGLVKSIEIPRPVDGVEVPGCGKIFVEFTSVFDCQKAMQGLTGRKFANRVVVTKYCDPDSYHRRDFW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Splicing factor U2AF 65 kDa subunit
publication title Structure of Phosphorylated SF1 Bound to U2AF(65) in an Essential Splicing Factor Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 29
structure length 105
sequence length 105
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4fxwA00
1WG4A 2CQ2A 2D9OA 3UWTA 1U1NA 3R27A 2EK6A 3VAIA 3P6YC 5GAGU 2OSRA 2RU3A 1H6KX 5HL7Q 5IM0A 2XSFA 1FJEB 3NS6A 1VQ8S 1B7FA 2DITA 3I55S 2RUGA 3MUVP 3BO4A 1N88A 1VQPS 2DIUA 3PIOQ 2CPHA 2MPUA 2LMIA 2VODA 4P6QA 3CCVS 2MJNA 4F26A 2CQ3A 2PE8A 2KHCA 2MGZB 1N54B 2DNGA 2DGSA 4CH0S 2KG1A 3CCES 1R8PA 2LECA 2MKCA 5EN1A 4QU6A 5DDPC 5LSLA 2L41A 2DNYA 1YTYA 5IQQA 1K9MT 3G6ES 2CPEA 2RQCA 1VBZA 5GVQA 1G2EA 2MHNA 3VAKA 1HD0A 2HGLA 1VQ4S 1YIJS 1DZ5A 1S79A 3CCQS 1BY9A 5LJ3Y 3VAMA 3TYTA 1M5PC 2MQLA 3ZZZA 2B0GA 3UCZP 3UD3P 4Y00A 2U2FA 1QVGR 2LYVA 1KOHA 3J7YU 2FPHX 4LIRA 1H2TZ 1X5SA 1P27B 1WHWA 3CCJS 2DIVA 2AD9A 4CH1A 5GADU 4WIIA 2LCWA 4WFBQ 1SJRA 1Q7YT 2DGVA 1RK8A 2GHPA 2HVZA 3CCMS 1WEYA 1URNA 1D9AA 2MQOA 2KU7A 2UP1A 3UCGA 2YH1A 2DHXA 1U1KA 2CPDA 2F9DA 4RU2A 1X4EA 2CPYA 2ZJRQ 1M5KC 2M2BA 1JMTA 1X4DA 3HI9A 2FHOB 2MSSA 5DETA 1R8HA 2MKSA 4OZ0A 3CC7S 3G9CA 3CC2S 3MI7X 1K8AT 1FHTA 4IOAQ 3S01A 4C0OC 4FXWA 4U67Q 3HHNB 1O0PA 2OSQA 1VC6A 1DBDA 3NS5A 1XN9A 2CQGA 2RS2A 1OPIA 3Q2SC 1X4AA 2KXFA 2X1AA 2CJKA 2I2YA 1KQSR 1RKJA 4TU7A 2NZ4A 2M4MA 5IFMA 1YI2S 1NJIT 2OJ3A 5DDOC 2DGXA 3V4MA 1CVJA 5CYJA 3SDEA 1NU4A 2M70A 1L3KA 1WEXA 4UQTA 2DH8A 1WELA 1U6BA 2KYXA 4C7QA 2LXUA 1A7GE 1VQNS 2VOPA 4F25A 3CULA 2KRBA 1SJFA 2CQBA 5H1SV 4C4WA 2O3DA 2CQHA 4ERDA 2JX2A 2I38A 3THPA 2K3KA 2YTCA 3CXCR 1Q86T 4EGLA 3VAGA 2RT3A 2KH9A 1DRZA 2J8AA 2DNNA 2GO9A 2F3JA 3CD6S 2KG0A 3U1LA 3B4DA 2KRRA 5D77A 2FY1A 3CCSS 2VONA 4IUFA 3CCLS 2D3OR 1WWHA 4ED5A 2MSTA 3N9UC 2CQIA 3LQVA 5CA5A 2CPXA 3J7ZT 2MZSA 3DXBA 3UCUP 3VF0B 2DO0A 2M9KA 3PIPQ 1KC8T 3VAFA 1WF1A 2FC9A 3MURP 2WBRA 1FT8A 5DM7Q 3P5TL 2J0QD 2J0SD 5LJ5Y 2DGWA 2DNMA 1FNXH 2XS2A 2DNRA 4WFNQ 3MUTP 2DNQA 1SJ4P 3H2VE 2RRBA 2MQPA 5JVHQ 4YOEA 2LA4A 2YH0A 1WHYA 1X4CA 1Q81T 2AYEA 2HYIB 4LJMA 2RNEA 2DISA 2CPFA 2MZRA 1U6FA 3MD3A 4WF9Q 3MUMP 3ZZYA 1WI6A 2AYMA 1YWXA 5HO4A 1H2VZ 2ZJQQ 2X1GA 1WEZA 4V19X 1VC0A 4FXVA 3SDEB 3Q2TC 3NNHA 3MXHP 2ERRA 3OW2R 3VALA 4M5DB 3US5A 2MKJA 3MDFA 2DHAA 2CQDA 3CPWR 2NLWA 1QM9A 1U1QA 1QVFR 3I56S 4YUDA 2MB0B 3ULHA 2D9PA 1VQOS 2E5JA 2QFJA 3B4MA 2N3OA 1X4BA 2DNHA 3VAJA 4WCEQ 1M5VC 1X5TA 1WTBA 4WFAQ 3G8SA 2CQ4A 1HD1A 1OIAA 2MZ1A 3IRWP 3S6EA 2XB2D 5ITHA 5IM0B 2MGZA 1X4FA 2PEHA 2ZJPQ 4WKRA 3G8TA 5DM6Q 1JJHA 1FO1A 2MQQA 1VC5A 2MZTA 1VBYA 4ZKAA 2HGNA 5D78A 2JWNA 1OWXA 2DGUA 3MOJB 2MMYA 2CPIA 2MKIA 3L3CA 2U1AA 1IQTA 1UAWA 1U2FA 2JVOA 2RS8A 3LPYA 2OTLS 2EVZA 5GAEU 1X5PA 1WF2A 2KVIA 3EX7B 3SMZA 3IWNC 1YJ9S 3BEGB 2DB1A 5MLCV 5GAHU 2F9JA 1U1OA 4IO9Q 3CTRA 2KFYA 5JVGQ 4CQ1A 1VQ5S 2XNQA 2E5HA 1U1PA 1PO6A 2DK2A 4J5OA 2QEXS 3G71S 2JVRA 2YKAA 1VQLS 1FJCA 4PRFA 2LQ5A 2BOPA 2DNLA 1W2BR 1U1RA 2KXHA 1DHMA 1H2UX 1WG1A 4TU8A 4LMZA 4W90B 1NO8A 1WF0A 5LXYA 2Q79A 3BO3A 1VQ7S 2CQPA 2DNKA 1N8RT 2LXIA 2MY8A 2QA4S 1WI8A 1YITS 2XNRA 2MJUA 4UY8T 2FC8A 3MD1A 4F02A 5DDRC 3NMRA 1M1KT 1OO0B 1YJNS 1A9NB 4CIOA 3UD4P 2RRAA 2CPJA 2N7CA 1P1TA 2OIHA 4Z2XA 1UP1A 4TU9A 1S72S 2DNOA 3CMAS 2DGOA 2EK1A 2LA6A 1HA1A 1VBXA 3R1LA 2YWKA 1YJWS 2CQ1A 4Y0FA 2M88A 3U1MA 1SJ3P 3BO2A 2KM8C 2KN4A 4A8XA 2E5GA 4OZ1A 3CUNA 1SXLA 3FEXB 4PR6A 2RVJA 1WHVA 1SJQA 3JB9k 2ADBA 2MKHA 1YHQS 2M7SA 5DDQC 3CCUS 5LSOA 5LXRA 2DHGA 2E5IA 2MZQA 1D8ZA 2LKZA 4W92B 3UE2A 3G4SS 2KT5A 3S7RA 2DH7A 1UW4A 2MXYA 2DH9A 4QQBA 3R1HA 2X1BA 2A3JA 2MQNA 3CCRS 3CF5Q 1ZZNA 1PGZA 2MQMA 1AUDA 2L9WA 3K0JA 3FEYB 1WG5A 2M0GB 2V94A 1X4HA 3D2WA 2AYBA 2M8DB 2VOOA 3CMES 3RW7A 2MY7A 1Q82T 2X1FA 3P49B 4IOCQ 2HZCA 2N3LA 2XS7A 3THTA 2LEBA 2KM8B 3H2UB 2DHSA 3NNCA 2RQ4A 4YB1P 2DO4A 3SXLA 5GMKa 3DLLQ 1VQ6S 2HGMA 1WHXA 1KD1T 2JRSA 1HL6A 2CQCA 2N82B 4PKDB 2CQ0A 1ZZFA 1JJ2R 3RW6A 2DGTA 1VQ9S 2XS5A 3EGNA 2SXLA 1N52B 4BS2A 2E44A 5FJ4A 3TP2A 1U1MA 2G0CA 1F9FA 2CPZA 2M52A 2MYFA 2KXNB 1X0FA 2DNZA 3EGZA 2M8HA 2MZJA 2OTJS 4TLQA 1VQKS 3P3DA 3TO8A 2DGQA 5CXTA 1M90T 1JJ4A 1VQMS 5BJRA 4QPTA 1X4GA 2L08A 2KI2A 2G1DA 1FXLA 2K8GA 2DNPA 1U1LA 1X5OA 3CC4S 1KOOA 1ZH5A 4QU7A 1K73T 2G4BA 2BZ2A 3G96A 2ADCA 3S8SA 3BS9A 3NNAA 2J76E 2LEAA 3VAHA 2MKKA 1FJ7A 2AYGA 1UFWA 1M5OC
chains in the Genus database with same CATH superfamily
2D9OA 2ZE2B 5F9LA 4CLPA 5BR8F 3BKFA 1TUGB 5ETPA 3W3SA 1CS4A 2PFFB 2HK2A 1H6KX 4MKYA 5IM0A 4V19J 3QIDA 3RAQA 3MECA 2XULA 2GMJA 4F26A 2B9XA 5B0FA 2LECA 3V2UC 1OQ6A 3PV8A 4DUZF 3G6ES 2CPEA 2GJFA 1S7HA 5HJXA 2A1BA 3TNVA 1DZ5A 3EPIA 4ECXA 3D6TB 2Q3PA 2YWGA 1R0AA 2W2QP 4X4RA 4KO0B 2PA8D 4OL8A 3JQMA 3DU6A 4IDKB 1Q7YT 3TA1A 1Z1ZA 2LQ8A 3H40A 5A2QU 2CAJA 4P71A 1CG2A 1S1WA 3H4DA 4CLFA 1VIXA 4FYYB 1LFPA 2M2BA 2FHOB 4PPDA 4B3RJ 4DX8H 4C0OC 4B3MJ 3PRBA 2I2YA 5KFMA 3MEDB 1IBLF 1X9SA 2DGXA 2DTJA 5E2QA 4RU9A 1ZAVA 2D69A 3HHLD 4ID5B 3UPFA 2RJZA 5AE3A 1XR5A 1FE4A 3D67A 4K2JA 3SQGB 4FNHA 4B9SA 2WRMA 4ILLA 2J9DA 3UN5A 4QR1A 2JHEA 4ZLLA 1GK8A 5D77A 4OYOA 5KFTA 4IUFA 4KV8A 3IAS9 3PTWA 3PYDA 2VG7A 4JI6F 3UO0A 5E41A 4DR5J 1IM4A 3O3LA 4URSA 2UU9F 1RAJA 3UCUP 3J80Y 2M9KA 3ZTRA 4JI8J 4CNZA 2BJ7A 5DG7A 2CWXA 5CYMB 4A46A 3UDLA 3CJ2A 4Y2CA 1U09A 2H1YA 1HI8A 1SKUB 2FLOA 5KFQA 5JVHQ 4DL0C 4PPZA 3HVTA 1X4CA 2CPFA 4FF1A 3CMQA 2BANA 1VC0A 3Q2TC 3GZ7A 4TY9A 1EKRA 2E9ZA 3US5A 1CULA 3I56S 1CC7A 3WBZA 2C2NA 3DKDA 2Q6BA 2X7IA 4QIVA 3M2VB 4F8RA 2ZH1A 1XQIA 3UD5A 1NDPA 3RRKA 4PWDB 4EFAC 4LR9A 3MOJB 1WC6A 1DQ9A 1KLMB 2MKIA 3ZZOA 1IQTA 2AP6A 2JVOA 2RKIA 4XIUA 2V9WA 2NSBA 2PDAA 1NHVA 2ZOMA 4NRUA 2XTJP 4WP9A 2DK2A 4ZPAA 1VRTA 5IV4A 4BHQA 1DHMA 4JI7J 2XHWA 5KTQA 1IKYB 4DR6F 1TL1B 2Q79A 1VQ7S 1DTQB 4NLTA 2IM0A 4YB7A 2N4CA 3TX8A 1U7LA 3A3NB 3NGDA 1RADB 2JOQA 1YJNS 4RL1A 5A8KA 2DNOA 3ITHB 5KFKA 1HIYA 3D5MA 3GB0A 3SEOA 4IFYA 2GC8A 3FEXB 4PXBA 4E2FB 3CCUS 2NXEA 2EXUA 4ECQA 2CUYA 4I4BA 3KK3B 3G4SS 2QV6A 3SQOP 4O3RA 2QN6B 3SV4A 3FK4A 3K0JA 1IJEB 1SB6A 3CMES 4OJ1A 1J2VA 2XSJB 2WCXA 4I2QA 2DO4A 3UQSA 1XK8A 4PQUA 1WJ9A 4PXDA 4GRSA 2MKYA 5K8NA 2YQ1A 2B7CB 1GT8A 1VQKS 3QRPA 3CJ5A 3TO8A 2BJ9A 4JV5J 3QT8A 4QPTA 5D4OA 1RT2A 3ILOA 3RU0A 3UDCA 1KFSA 4D3GA 1VHIA 2VL1A 1RKIA 1HFEL 3QJJA 2UZAA 3T3FA 2BABA 1WOPA 1IM6A 4DFMA 1QSSA 5HROB 1YJVA 4GKJJ 2GMHA 1FKOA 3FBEA 1NBEB 3MUVP 2IMOA 2XZDB 5KG3A 2J9CA 3CCVS 2RD5C 3M6VA 4Z7YA 2IBOA 3M2UB 2GNKA 2L41A 2BJ3A 1ZA1B 2E1CA 1Z4UA 2HNZB 1S1XA 1KLNA 2AEMA 3OVAA 2EFOA 4KHRA 1TK8A 1FK9B 5DQHA 4MJKA 3OTOJ 3VAMA 2V9KA 1OPZA 2UUAF 1CQMA 1RAEB 1U0HA 5IC6B 1Y4ZB 3ISZA 1P27B 3LUYA 2FLLA 1RK8A 1UMJA 2F40A 4KJIA 5KFZA 1YG0A 1IBKJ 4DSIA 3D28A 2Z2YB 2XZTB 2CPYA 2IY5B 2AEJA 1RYSA 1KQKA 1CS4B 4LRDA 4I7FA 4LF5J 2XY6A 2WVEA 5CZVA 1VLOA 3U02A 4UOHA 3MECB 3JQJA 1S9EA 4PG5A 4C8KA 3D6HB 2AJ0A 3THVA 3NGTA 4QR0A 2R2UA 1IVZA 3FJ2A 4XO0A 1FE0A 2NXUA 5L46A 2DRAA 1WEXA 4CH7A 4KH1B 1T11A 4H54A 1XIQA 3E51A 3CXCR 4ID8A 1C1CA 4MIBA 1HBUB 2V4QA 3C6TA 2GO9A 2EFVA 2KG0A 3MPWA 1B4SA 4K4XA 2KRRA 1QY7A 1R0AB 2RE1A 1CJTB 4DN0A 1X9WA 1I94F 4DQQA 1JLCA 3BR9A 2QL9B 4YN3B 2WVCA 2R8KA 1HPZA 3T6BA 3WIUA 2DNMA 3NXZA 4ELVA 1Q1KA 2PD1A 1RSCA 2D3UA 2HYIB 2AYMA 1HBMB 3MM5A 4Q43A 1LWCA 2WB1D 3JTNA 2B6AB 4AL6A 3EE3A 2XM3A 1D8YA 2I5JB 4KSEB 4OX9F 1KTQA 4B08A 2DHAA 4EEYA 2FZKB 2C2OB 2LQBA 3ULHA 3N79A 2W2OP 3BV8A 5IQ6A 3PJ9A 4RO0A 1K1SA 3M32B 5LM7E 1MN9A 1RWVB 1FO1A 1VOMA 4ZKAA 3W2VA 4A8SA 1I6JA 3PW0A 2YNHB 3G86A 1IWAA 4PXCA 1YJ9S 4U8VA 1N0VC 1WSVA 2KFYA 4F7VA 4CQ1A 2FJAB 3GIMA 2JVRA 1AW0A 5A8WB 1JLFA 3IO1A 1SVDA 1W2BR 3BGFA 3HVTB 2GGPB 2QO3A 2YWWA 3OSPA 5CD4A 1NSKL 1MROA 2BANB 4EMDA 1LW2A 3RTVA 1JLEA 1T03A 1U2RA 3QJPA 3PJXA 1S0OA 1UCNA 3BM7A 2ZH2A 1SQFA 2HLUA 4R0EA 2DEIA 1SUQB 4BC9A 3I4PA 3NGSA 2J5AA 4DL6A 4AD6A 4K8RA 1TAQA 5KT3A 3O44A 3MCMA 2HBRB 3QT5A 2E5GA 4RBVA 2NXNA 3CSKA 2B5JB 2BVZA 5THWA 2MKHA 4DDFA 4E0DA 4RBUA 3BQ0A 1VS3A 4DV6J 3MM9A 3H5UA 4NX9A 3OT9A 2ZDPA 1SC4B 1SPBP 1VRTB 2K2PA 2D1CA 4IOCQ 3H2UB 3WX4A 2HHXA 4Y2AA 2ZZTA 1XNRF 3W9IA 1SL0A 4P7TA 4U96A 4NMLA 3FBBA 4DS5A 2CPZA 4RBTA 2MYFA 4JI3J 5BYSA 2CNLB 4N8OA 1FD2A 4ED3A 2BZ2A 2Y1IA 2ADCA 1I1GA 2GIQA 3DYAA 2H9ZA 4JV1A 3DOMA 3ENQA 2UUTA 4Q2MA 4X65J 1EETA 1UW9A 1KQGB 2OSRA 2CIMA 1U26A 4TNOA 3OR2A 3KMQA 1VDHA 1XC9A 4I2QB 4U7CA 1WC4A 3CCES 2IJNA 5GVQA 2UUCJ 4PQUB 2XC9A 2RSQA 5LJ3Y 1B0PA 3OFHA 3UD3P 1RTIB 2HLTA 3R9LA 3F41A 2QLXA 2K1RB 1QDUB 2RB7A 2FDNA 2C2DA 2C3PA 1MU2A 1FWLA 3J80U 1L3SA 3TJ9A 1RT2B 2PSZA 2NS1B 5LOQA 1AA1B 4IR9A 1S1VB 3CCZA 3KDNA 4OZ2A 4LF8J 1T0TV 1LK7A 1X4DA 3PJWA 1FHTA 2AZ3A 2OPPB 3HHNB 1FWPA 4WK3A 3FBCA 4EBCA 2BE9B 4JI5F 1RTJA 3VWSA 4LREA 2I9SA 2V2QA 5DGAA 1RTDA 1RLCL 1A7GE 1S1XB 3S1TA 3D0GE 3A8JA 3O8WA 2I38A 4C3LA 2K3KA 4DL7A 1PBUA 5KFVA 2RT3A 1NHKL 2VBXA 2ZBPA 1VMBA 2VONA 1VISA 4X4PA 4RNMA 1B64A 1EIYB 1S1UB 5DM7Q 1FNXH 5DS7A 1SJ4P 4LF7F 4NCGA 1B0TA 3DNCA 2B8PA 2ZITA 1S9EB 2VG6B 1U6FA 1SI9A 3UDVA 3HHDA 4X66F 1HQEB 1HLWA 1YZ6A 3L7OA 1LOUA 3T1HJ 2HSEB 3MXHP 2EEYA 2QLFB 4FPIA 3VALA 1LWXA 3KHLA 1FWKA 4ILRA 6FD1A 2ZH9A 4USWA 2E5JA 4LSZB 4DLEA 4ZPWR 3BBBA 4BDPA 1S5ZA 4OHYA 1WC3A 2R4FA 4NXNF 4F36A 1TMMA 3G8TA 3NWGA 4RPFA 3PVXA 1JLCB 3LP2A 1HR0J 1RHKB 1XNQF 2DB1A 1QAIA 5MLCV 2LU1A 1HARA 3F44A 1DTTA 4K0KJ 2E5HA 1U1PA 4URGA 2VB6A 4TYAA 1PO6A 2YNFB 2KFNA 1VIOA 3VVTA 2WB4A 3FMBA 3RGIA 1WG1A 5J1EB 3CJ8A 1WF0A 1T05A 3KK1B 5JXSA 1N8RT 1FVQA 4JUZA 1DY3A 2Y0SD 2MJUA 3C6UA 1S0MA 4HT5A 3T5HA 3OFEA 3CJ0A 5FLXY 4CT9A 2CPJA 2XGQA 3QSYB 1Y5LB 1S72S 2B51A 3HSGA 2XLJA 1E6VB 1AROP 5BR8J 4IYQA 5AE2A 3M6UA 2AHOB 2CDRB 1TZ0A 1X7VA 2XMMA 5HK4A 1XMQJ 5KFRA 3HMJG 3I96A 3QO9A 1YHQS 1UJ6A 4MK8A 4L76A 2YKPA 3M8RA 2E5IA 2DXDA 4HTIA 3UE2A 4RNHA 4M5HA 5LMNJ 4UZBA 4QQBA 4DUZJ 2UXDF 4KGXB 4ED4A 2ZM6J 3CDEA 4CNYA 4NYPA 3KLGA 5F8LA 3LO3A 1RU1A 2KJVA 3PX0A 2DHSA 2V0NA 3SXLA 5GMKa 3H25A 4IOBA 4PG4A 1MROB 1LW2B 3PCOB 4IR1A 4NL5A 4XPCA 4ELUA 3FQKA 5FJ4A 4TLQA 2ILYA 2WHOA 2G1DA 3PKMA 5IC4B 1FXLA 3LGNA 2RUSA 4YR2A 3V6DA 1KS2A 5F0WA 4MTPA 2RMLA 2HHVA 4U6PA 2R42A 3PACA 3TOQA 3HVWA 4F0HA 5DDPC 2I1RA 1Y9OA 5AJ3F 5CYQA 3TVKA 2O01C 2VA2A 2H3EB 2CJBA 1N88A 5KT7A 2ZBIA 4ECRA 2OPQA 1VLYA 4RNNA 3M8PA 2LMIA 4F0KA 1TR0A 3VR1A 1C0TA 4JP8A 5U47A 4F4ZA 5HANA 2QA1A 2UUBF 4AYBD 3K58A 2FVCA 1PC4A 2Z4PA 2W4PA 3HVRA 2HZVA 1U48A 4JI6J 1F60B 3CCQS 4P75A 1M5PC 5KFEA 2VFTA 2UU9J 3RBDA 4ZIWA 3J7YU 1F3VA 2HHTA 3TAPA 5F8IA 3MGJA 1HQUB 2DIVA 4WIIA 5C7PA 3PX4A 2GHPA 2OMOA 3RJMB 2WVDA 1U02A 1H0HB 3K17A 2VFRA 4FYXB 5E7OB 2BM1A 2F9DA 2NR0A 4AQYF 1UZDA 1NEEA 2MKSA 1CJUB 3HF5A 3DRXA 1JLGA 2QX0A 3MMAB 2XI3A 1U45A 1S12A 3GJRB 4CTAA 1AT1B 4LFBF 5DO2A 2CJKA 1M5HA 1RI7A 3IGVA 3DMJA 3OTEA 2UXCJ 1V3RA 4QIEA 1T9XA 4ANCA 4QWBA 4OI6A 3SV3A 2WZ1A 1SJFA 2DD8S 4K4YA 1Q86T 4FS2A 4FXDA 5A6WA 4C8ZA 2KH9A 3AD8C 3UN3A 1RT4A 1IXKA 1YBTA 5AXLA 2E7VA 4DCPB 2NUUG 3VCDA 4RUCA 2BKPA 5CA5A 3KJVA 1QUPA 1N5YA 3M8ZA 1FDAA 2O67A 4ZCMA 3U7JA 4EK2A 2DO0A 3ADAC 3W5XA 3CJQA 1FT8A 1CBKA 3F0NA 5KFIA 1EQMA 5LJ5Y 3RB0A 2EWHA 4WFNQ 4DQIA 2VQEJ 4JV2A 4K5SA 3QFHA 1RHRB 3TAQA 4KPYA 2AYEA 3MD3A 4ZVUB 3OVSA 2HK3A 1RTJB 1ZM4A 2VZ9A 3K5PA 1RTDB 4MK7A 4CO0A 4M5JA 4CLLA 1QAJA 4X4QA 1M0SA 1EP4A 1O51A 1R43A 1BMQB 4B9UA 2N3OA 1X4BA 3PW2A 2FVSA 3LPEA 4ED2A 4DPOA 1OIAA 1Y10A 1X4FA 2W8KA 1N5SA 4Q0BA 1H3DA 2VFVA 2WW8A 1JJHA 5I3UA 1YJRA 3MR3A 2HGNA 4ETZA 4QWEA 2RRNA 5E5NA 5K8MA 3IWNC 3R7NB 3NCQA 5GAHU 5K9FA 3TZXA 3M9NB 4IO9Q 5IWAJ 2EBGA 4V1Ak 5DLGA 4O3QA 3R5BA 5C2GA 4NCGB 1RHUB 4RW7A 4P7VA 4ZVTB 2UVUA 2KXHA 4TU8A 3TR5A 1FFWB 4WFYA 3J81Y 4UQGA 2QA4S 2CJ9A 3BQ2A 2ASDA 3KLFB 4O23A 1C4CA 5HMZA 1JNZB 2BR0A 5CABA 1HWUA 1NK7A 3QSIA 2GW8A 5I3PA 1S6PA 5A76A 4M5GA 1C0UA 2YWKA 1CJVA 1HBNA 1TK5A 2LXFA 2YQ0A 5KFWA 5CHCB 2RU9A 4W98A 3NGUA 3BO2A 4ZJOA 2VIHA 2K06A 4EZ9A 1SXLA 4B3OB 2IPOB 4HDHA 1NK0A 1OMSA 3QLHB 2MZQA 1G4CA 1UWAA 4X4NA 2PC6A 3IFEA 2MQNA 3H20A 4E98A 3RW7A 2RDIA 2J6TA 4ECWA 1N5QA 1H74A 1OY6A 1B70B 1S0VA 3I0SA 4KYZA 1HL6A 4PKDB 1URRA 4WP8A 3C6UB 3AB2B 3IR6B 3LGHA 3H7HB 4NA1A 1FF2A 2E44A 2AX0A 2R2RA 1GTEA 2KXNB 5T41A 1M5SA 3P3DA 2DGQA 4UTGA 2VQFF 1WC0A 1JJ4A 4CO2A 1UFLA 2HAIA 3K59A 2C2RA 3W1YC 2GCFA 3M8QA 1NPKA 2XMKA 4YY3F 3HULA 3QWUA 1M5OC 3D66A 2DRBA 3BN7A 2RU3A 2HNDB 2J7KA 1PG5B 1VQ8S 2RUGA 3VGUA 3D0IE 4ZP7A 2EKNA 1QTMA 3W5ZA 3V6JA 2FIUA 3A1YG 2GV1A 4DS4A 2MKCA 3HO1A 3MM6B 3HD2A 3NKYA 3N4WA 3V5RA 4NI2A 4YEAA 3TEGA 1YJTA 3CWJA 3IG1B 4QYRA 1RT5A 1I94J 3ENWA 5HI7A 5LMUF 1X5SA 3MEKA 1NKEA 1N5VA 4Q7AA 2BE7D 1NK9A 3G82B 3V6DB 1FRKA 3IP0A 1AB8A 4IH7A 1Y3KA 4JB8B 3DRSA 3A13A 2FZGB 1JMTA 2MSSA 4GVLA 4OZ0A 2WOMA 4IOAQ 2WVFA 1DBDA 3IRXA 3CO0P 2GVZA 3ZNUA 2OPQB 5A8RA 2NREA 2D3O1 4TU7A 1U0SA 2JSXA 1NJIT 4ED1A 4KFBA 3MAAA 1R6VA 2CZVC 4KHMA 5SZTA 2AWZA 2GX8A 2ZUAA 5IT9Y 4F0MA 4JI0F 2MLZA 3ZZPA 2V34A 3M2RA 2XMVA 5KFXA 5J1PA 1HNXJ 2D3OR 3PY8A 4FZVA 3KLHA 1MMLA 4A8OA 3DXBA 2W7OA 4F3MA 1Q5YA 4B3SF 5JUMA 4KHPJ 1C1BA 2DNQA 2GZOA 4P72A 5E0OA 2W9BA 4NZ7A 4PWWA 2VPXB 5D4PA 4UUWA 4CTAB 1V5VA 4B02A 3OBIA 5FLXU 4FXVA 1VI7A 2IAJA 4J91A 1O5JA 4MKVA 2MKJA 3R6GB 3EGVA 4JI4F 1NKCA 4MFBA 1KHVA 3AA9A 4X4OA 5EUHA 2ZH8A 1HD1A 3C66A 2FHMA 3ZC4A 3GR0A 4WKRA 5ETRA 2MZTA 4ZVQB 2HIYA 1TKXA 1YRUA 3KJVB 4PABA 1N5YB 4K4WA 4Y65A 4DV4F 1OSDA 3KG0A 2XYGB 4USKA 5FIIA 5CZXA 4MAKA 2MDAA 2YKAA 1RXOB 2FHKA 1ULRA 2OO4A 4TN2A 4WYWA 3QGGA 2F63A 3DLKA 4C6AA 3SI8A 5KT5A 2GHVC 2BQUA 4UY8T 4FF4A 3VQSA 2FC8A 4R8UA 3DLEA 4K4SA 4DR4J 2GQ2A 1A9NB 2BRLA 3I6PA 2V4RA 2KO1A 3GCWP 1EP4B 2XMJA 1DLOA 3CMAS 5BXIA 4UW2A 5J2QB 5RUBA 1RT6A 2YQ3A 4DMZA 1UL3A 1FJGJ 5I3UB 5MAOA 3PW5A 3KXDA 4H4KC 2JEJA 4KE5A 3ELHA 5BYQA 3TWZA 3MTKA 3HFZB 3OJUA 5LXRA 1IR1A 1D8ZA 4OJ3A 2A10A 4WIQA 1F2HA 2VDIA 4RW6A 2R7SA 3LGMA 1I3OB 1AUSL 3MPVA 1U4BA 2QFIA 3UR3C 1MWZA 1Q82T 2HZCA 5IT4A 4PWUA 3GILA 2R7QA 3NNCA 2PN6A 2X51A 2AMCB 1R8CA 2AQ4A 1WD6A 3GE9A 4QYZK 2HRYA 2YKMB 2G2YA 2F8EX 3EGNA 2JNJA 1TTHB 5KFLA 2M52A 1YX2A 1BQXA 4ZPBA 2XYHB 3F56A 4WE1A 5K14B 2V8HA 5K8PA 2RDDA 4IG3A 1S6PB 3K89A 4DR2J 3FMWA 4JI2F 3DLJA 4ZP8A 2HURA 4C8NA 4PYAA 1JLBA 3BDEA 3S8SA 2ZC3A 3CGIA 4JBCA 2HQIA 3W65A 4ECVA 1UFWA 1TQLA 2WVBA 4IQXA 4JI5J 2EK6A 5EX3A 1F5AA 3H90A 2LDYA 3D7SB 3Q8SB 3OLBA 1RT7A 2VU5A 4DSLA 2F5GA 3IS9A 5B0GA 1NJZA 2QL5B 2ZNZA 4PCQA 4ED0A 1IKVB 2FJDB 2W9AA 2E1RA 1VRUA 3WZ0A 2DGSA 1PAEX 2HS4A 1RB0A 2VHGA 4DHVA 1LWEA 5A2QY 3HT0A 1LNQA 2CJXB 1BY9A 4KKOB 3B8HA 4DL3A 3QPIA 2LYVA 1H2TZ 4GC7A 3OTBA 1REVB 4PYDA 4CH1A 4UUXA 4IG0A 2MQOA 4X62J 2W4DA 4J9RA 3M8QB 5K20B 3FFIA 2QG9B 1U1KA 4K50A 3T41A 2ACMA 2H48B 2B3TB 1UETA 2CVEA 4WK1A 3A8KA 4PUOA 2HVHA 1J5OA 3PZPA 5B0CA 3NS5A 4RWWA 3GJQB 2CQGA 4TLRA 3HDSA 1N6QB 3DGPB 3PFEA 4CT8A 2FJVA 4CLWA 2M70A 1L3KA 4ETXA 2P9EA 1WELA 2KYXA 2C2ZB 3O2IA 4ANDA 2AU0A 1H7WA 4ELTA 1SBRA 3KUHA 1SKSA 4EZ6A 3AOAA 5AXKA 1P6TA 1RT5B 2B9WA 2E5LF 1RYRA 1WNEA 4DUTA 1XNQJ 3CEDA 1HNZF 4WFZA 3J7ZT 4EU0A 2Q1LA 3SCLE 3MURP 1NCLA 2WBRA 2DVIA 1Y5IB 2J0QD 5D3GA 2WOMB 4FKXA 3J81U 2MQPA 2MLXA 4NPOA 4KGKA 1WHYA 1S49A 7FDRA 3BKTA 3IN5A 3MUMP 3ZZYA 1WI6A 1T95A 2HNYA 2X1GA 1AYEA 3T9ZA 2ZE2A 4Y6IA 4DR7J 1V3ZA 4LF4J 4A8WA 1WC5A 3SCKE 3CVKA 2DNHA 1V3SA 2CQ4A 2QGFB 1S99A 3DN9A 2PMWA 3D3CJ 2NYIA 5ETTA 3M2RB 4NYZA 4S0MA 4N5SA 1NHUA 2XGPA 2UXDJ 2RS8A 3GPAA 4P9SA 2HS3A 3EX7B 3BEGB 2DRDA 3OFGA 2HIQA 4IFVB 2FJXA 2LQJA 4N47A 1O8BA 3BGUA 1S48A 2HFVA 1Q0NA 2VV5A 4KO0A 1C1BB 1RZMA 1XTZA 4ZP9A 2W9BB 3GYGA 4IDKA 4PRFA 4QWDA 3IR7B 1RA7A 4H4KA 4KAIA 4DR1J 5GADI 2QYCA 2CQPA 4OYXA 3QFWA 2C2KB 4DQSA 3I32A 3MD1A 3BKUA 3DFEA 3D3BJ 1ZAWA 5HQMA 1OO0B 2AV5A 3H5XA 3UD4P 1N33J 3HSDA 3X3UA 4NASA 5C24B 1Q8KA 3MM8B 4Y34A 3VHQA 5AJ3J 2KN4A 1TKXB 1FERA 4PR6A 2H4YB 4QWCA 2XBPA 4ZCLA 2OD4A 3NL0A 4OJHA 1BGXT 2ZFHA 4C0BA 4CO1A 2L9WA 4A8KA 1NKBA 2QA4G 2X1FA 3P49B 4NA3A 5J1NA 4DX5A 1JLAB 2Y0BB 4ZVFA 4G6VB 2EG2A 4FP9A 4YB1P 4OI3A 3EZUA 4C8LA 3KG4A 5CYMA 2N82B 1NDKA 4R8UB 3DLEB 3GLJA 1GH8A 2XS5A 2CNNB 4USIA 1YRXA 2GFFA 3RR7A 1DLOB 2RILA 3FKBA 2DXFA 3CDBA 2IM2A 5CXTA 1RT6B 4RZRA 1SV5A 3J7YI 4AQYJ 3NGKA 1RWWB 2RHQB 1EKSA 1GMUA 2A2CA 4UOGA 2MKKA 1ZBTA 4LFBJ 1RWPB 3A3OB 3UWTA 3NP5A 5C5JA 1FVSA 1TUVA 4NE9C 3H59A 1FJEB 4KT0C 2A0FB 1Y5NB 2V5HG 4PWDA 2ZH3A 3R5JB 1KLMA 3BZQA 2VPWB 2ACYA 2CQ3A 2CVIA 4RW9A 5KG1A 2V67A 1YDLA 1H72C 3TJ8A 1YTYA 5IT9U 3G8QA 2AGPA 4N76A 4NLUA 2XMWA 3VAKA 3FSIA 3V81B 3PDNA 2OPRA 3DI6A 3TYTA 1YBUA 2EFQA 3LWMA 4ZVRB 4IH6A 2IYIA 3CDAA 1J5EJ 1IKYA 2B8QA 4OYBA 1VK8A 1DTQA 4OYMA 2C3MA 5ETNA 4LSLA 3T19A 4DPWA 2AX1A 3DLGB 3DM2A 4QW9A 2Q6CA 3BH6B 1RWMB 2ZJRQ 3CC7S 3QYYA 1FRJA 4NZ6A 2GMLA 4UOCA 3AOCA 2VH7A 4WU2A 1X4AA 2KXFA 5KG4A 1KQSR 4LFAF 2NZ4A 3Q0AA 3DHXA 1V5IB 2IBKA 2HVEA 2P2CB 1TKZA 4UQTA 3EDRB 4DV7J 1U6BA 2AGOA 2HWIA 3T5JA 2VOPA 2ZNYA 5CCLA 1NJYA 2YVSA 5D4LA 3EMTA 3THPA 1TV6A 8ATCB 3VAGA 5H9EK 4YHHJ 4HHJA 1D0EA 4C2MA 1LQ9A 2FY1A 4ED8A 2CWKA 4AXJA 2IDEA 2GVDB 2FYXA 2MSTA 5T7LB 3N9UC 2CQIA 4TYBA 4A47A 1RAFB 2BMBA 4F2SA 2MZSA 5KT4A 3K5MA 2AEFA 4DEZA 4IG0B 2NQPA 2AJ4A 2R2TA 3K8WA 3VAFA 3AOBA 2RIJA 1ZS6A 5M2UA 5GAHI 3MUTP 2P5VA 1R31A 3EYZA 3HCXA 4YOEA 1R7IA 4XDCA 5AT1B 4FS1A 1W2IA 2G0IA 3CD5A 1HWLA 4LF6F 3HT3A 4EO6A 5H9FJ 3CIZA 5HROA 4Q2LA 2UUWA 1QVFR 4ZCIA 3MR2A 2D9PA 3BN4A 1HWKA 1ZETA 2MZ1A 2XB2D 1MMDA 2HRTA 1CLFA 3JYTA 1VBYA 3M2UA 5D78A 4X4SA 4C3MA 3ISNC 2B4UA 2W2PP 1FK9A 2EVZA 4F4AA 3TVZA 2XNQA 5D3GB 3R5GA 1KVKA 1R0CB 3T1YJ 2NSCA 1RHMB 1H2UX 3BSOA 5HN0A 1NO8A 1GX5A 1CJKB 2P6SA 2XNRA 1OSCA 1NK8A 5G4DA 2XHCA 4PZVA 3POTA 1D3WA 1ZTWA 3FVYA 3HFVA 4J9UE 3CJKA 2HQFA 1RWNB 2GO8A 2F8HA 4Z7CA 1L3VA 2N4DA 3OTCA 1YKWA 3N28A 2X3GA 3GFZA 4Y0FA 4LBHA 5KFYA 4JI1J 1UWBB 2W25A 3U1MA 1SJ3P 2XLKA 4ER8A 1SL2A 1S6QB 4B3RF 4I6WA 3LWLA 1HBUA 1NPRA 4N56A 3VGSA 4B3MF 1CJTA 4EYIB 5DZ6A 2M0GB 4DOZA 4AXIA 2FVPA 3IXQA 4ES3A 4KQZA 4KRWA 4X4TA 2ATLA 1KBRA 2IJFA 4K4VA 4FF2A 5HLFB 1RBLA 2ALZA 4LF9F 1JJ2R 4LVOP 1VQ9S 3OHBA 4Q45A 3KUEA 4P73A 2ASLA 3IWXA 1TFYA 1JKHB 4J9MA 2AW0A 1X0FA 3GIRA 2DNZA 2YWFA 1BQNA 4QWAA 5KFUA 3P8BB 4DR5F 1HBMA 4CO5A 3FRZA 2B6AA 2ZBCA 3CNQP 4JI8F 3W8PA 2I5JA 1HYSB 1U1LA 4RR5A 3R2CJ 1T9YA 3KJQB 4FPRA 3VAIA 4DWIA 3SBMA 3W62A 3M32A 4EWTA 1B7FA 1SIZA 2H54B 2DIUA 2W4CA 4QIGA 1NK5A 2YNHA 3SCJE 5KFJA 5IS2A 2QC3A 1TP7A 2MGZB 2BX6A 1R8PA 5EN1A 4M94A 4FKYA 5IQQA 5F9NA 2C2MB 1VQYA 1VQ4S 3DOKA 2QZ8A 5A8WA 2FQQB 5HQLA 2KDOA 5SUHA 1IR0A 2GGPA 2VFUA 3EVMA 3R8YA 1DJ0A 3TJAA 1SV5B 4LFCJ 3UR0A 1GTHA 1K47A 5FDLB 2IM1A 3K2YA 4DL2A 4Q8FA 4USTA 1GMWD 4CLTA 2UP1A 3UCGA 2UV8A 1YZ7A 1SUQA 2VDHA 2CA9A 4LRCA 2Y1JA 2DY9A 4USUA 1VFJA 5F3ZA 1KEKA 3I5AA 4JI7F 4U67Q 3SCIE 1X31C 3CJ3A 3FSXA 3Q2SC 2Z8QA 2HS0A 5H9FK 2B5JA 4OYWA 4RW9B 3TVYA 3RB6A 3V4MA 2OEJA 4P2MA 4UF4A 2OEMA 4W4MA 2O3DA 4ILMA 1D9DA 2OPRB 5ETLA 3DI6B 2OI2A 1N56A 1UPPA 2HWTA 5M2RA 3I5CA 5KT2A 1C2PA 1FDNA 4I56A 2H5JB 1KP6A 2V2ZA 4C97A 1Q8IA 5ETMA 2FUG9 3M7VA 1ZAXA 3OHAA 2DXEA 4L6V3 4LSLB 2Z2ZA 3DM2B 3IBCB 4Q44A 2R7XA 1FX4A 3TQEA 2XS2A 3NG8A 2ABYA 4WU3A 3VZIA 3AXKA 4GVBB 2DISA 3BBCA 4Y3CA 3KOAA 2JLFA 1TKZB 3CJSA 4USJC 5KFNA 1PKUA 2ZOGA 4YUDA 3CO9A 1TV6B 2HVDA 3B4MA 2QSWA 1M5VC 1MSWD 3HPOA 2ZJPQ 1KFDA 5L1IA 2MQQA 1NZ8A 2V4JB 2NXCA 2MMYA 1HQ2A 1RWOB 2OFHX 1UAWA 1U2FA 4GKJF 2VPZB 1U1OA 1RTIA 2D74B 2K1RA 4JYAJ 3VTIA 1PYSB 3IGNA 2IVMA 4YB5A 3ZNJ1 2DNLA 1TL3A 1Z2ZA 4W90B 3NAIA 1S1VA 1LEOA 1N32J 1YJ7A 2BW2A 1YITS 1GAOA 3VVUA 3OTOF 2BBEA 4M5MA 1IKXA 4DV2J 4AFFA 4CLKA 1T9TA 4CM2A 2OPPA 4F50A 3EWGA 4J90A 4NXMJ 2UVVA 3R97A 1AZSA 2OAUA 2HBQB 3JYTB 2HZAA 3TUZC 1H7XA 5GMDA 4K4UA 3TUPA 3GSDA 3M30B 2Z2LA 3G2XA 2VA3A 4ES1A 7AT1B 1S76D 1WHVA 2OEKA 2HMIA 4LF5F 1R89A 2UVWA 3ZZTA 3OD2A 2BQ3A 3PG9A 1M1HA 2KT5A 3AXMA 3QGHA 1HNWF 2X1BA 1R0BG 4FBUA 4ICLB 4RNFA 3QATA 3ZTPA 1LWFB 2NYHA 1K1QA 5I3QA 3DLLQ 4ZITA 4ANEA 3FCVA 2ZKTA 4O4GA 3M1VA 4M5NA 2JRSA 3MFHA 2FVQA 2CQCA 1XMOJ 1S1UA 3POTB 2DGTA 3EGWB 3QIPA 1FKPB 3CJKB 2DR9A 1FI4A 2G0CA 1F9FA 2KB2A 2QMUB 2VG6A 4ZVHA 3KHGA 1QSLA 1HQEA 1HNIA 2KI2A 2K8GA 1ZH5A 4YDXA 3V4IB 2LEAA 2J9EA 2ASYA 5BYRA 3PX6A 1Q16B 4OX8A 4R0JA 2QTWA 2ZHAA 3DLBA 2HW3A 5GAGU 3C15A 1AFJA 4ZIVA 4LF1A 2LP4A 1VQPS 3PIOQ 2CPHA 3GJSB 2MPUA 4P6QA 4NLXA 4J9LA 5AXMA 2NCKL 2B4PA 3N6NA 2DNGA 3GFYA 3RR8A 4PG6A 2E5LJ 3KLEA 4QU6A 3NLCA 2EW9A 1HNZJ 4DN9A 3HHEA 2YNFA 1HNVA 1S79A 2A6MA 3FSYA 5C42B 3PYGA 1NJXA 1GQEA 2FJBB 3HSJA 4M5KA 1QVGR 1BQNB 4UOFA 5J1EA 1KOHA 4Z37A 4B3TJ 3KK1A 4H4OA 4ZA1A 3MEGB 4ZVOB 4BWJA 4WFBQ 4I67A 3ZZRA 1UPMB 2XMUA 2J6SA 4CDIA 3FEZA 2VASA 3GJTB 2JFDA 2V63A 1T3NA 5HP1B 4M5LA 3SZ2A 4DXLA 1R8HA 5EWEA 4DQRA 3G9CA 2KVQE 3MI7X 1ZTTA 3M8SA 2IC3A 2JLEA 2QMXA 1E6VA 4FVMA 3AA8A 1K0VA 3E3XA 3PNIA 2E66A 1RKJA 2M5YA 3QAEA 1B99A 2YWHA 4A48A 1NNDA 2O1PA 3R7BB 3FRYA 1WDDA 3JTOA 5L39A 2LXUA 1WKLA 1SJ1A 1P1LA 1HMVB 3Q8QB 3AQPA 3IC1A 3QWPA 4I2PA 2Y9HA 4OLPA 3GP9A 2OGUA 3KLIA 3DOKB 1JX4A 4GKKJ 4G1IA 4DUYF 3DCAA 4IRDA 3GSIA 3E01A 4RW8B 1DFDA 1HHQA 1Q5VA 3T9NA 3CCSS 1FKAF 3VV2B 4TXSA 2YKNB 4ED5A 3LQVA 2XMTA 1RACB 2CRLA 3NCRA 4TQRA 4CLSA 3PIPQ 2QSFA 1WF1A 3DDNA 2EFGA 4B17A 4ZLNA 2KFZA 2FJEB 4WTYA 1KR4A 4WPAA 2YX4A 2XO7A 3H2VE 3PRDA 5D4NA 5HMYA 3W64A 2WTFA 4A8FA 5CQGA 3A3PB 2MZRA 1H2VZ 3TX0A 2VC0A 4XK8C 3OW2R 4DV0J 1GEHA 4M5DB 3TANA 4JI3F 1VQOS 1GMVA 2ROPA 2PT0A 4DFKA 1U25A 2ZH7A 1SIWB 4P2SA 2BW7A 4HYKA 2EBEA 3JSBA 4OHZA 2CPIA 4X65F 4RJVA 3ZXWA 1GFWB 3LPYA 3M9OB 1PIEA 1B7YB 2KVIA 2MQ8A 2JLGA 1UA1A 1GXTA 5E3CA 2EFNA 3WC0A 1SQGA 3G71S 1HQUA 7FD1A 4OV1A 3PXGa 1S4FA 4PEOA 2OH2A 4ZP6A 4MYTA 1S1TB 4OIXA 3ZTSA 3QGIA 6AT1B 1T9VA 3E8OA 1JLQA 4QR2A 1IBMF 1CJUA 2WSFC 3PYEA 3IAM9 2K7JA 3OXGA 5C25A 3Q23A 1YJUA 4HI1A 3MMAA 2OIHA 3D6FB 3NMAA 1T3OA 2DGOA 1L3TA 4ECSA 4OQJA 5L9XA 4LF8F 3NGRA 4L3NA 4B9NA 1RBOB 2JFKA 1NB2A 4BBYA 3IBFB 1DAXA 2RVJA 2QT7A 2F4VJ 3HP6A 4ZPCA 5DDQC 4BWMA 1SKWA 1VRQC 2QYGA 2CZ9A 2WK4A 4OYZA 2POKA 3GONA 1Q95G 4OZLA 4NLRA 3CCRS 2V94A 2EG1A 2V68A 4DFJA 3N5BA 1SC1B 1F2GA 1TL3B 1TKTA 2H5EA 3I9V9 3MMCB 5HMWA 1GXLA 2X3DA 1GNKA 1HWIA 2COLA 3RW6A 1IKXB 1HW8A 4WYLA 2XCPA 1Q78A 4XTTA 5HSPA 2M8HA 4RLEA 5KOWA 2JEIA 1AZSB 3Q8UA 3TA0A 4L75A 1ITPA 3PHTA 5HMXA 3MEEB 2DJWA 1OY8A 3ETOA 1F9HA 3QAUA 3I82A 3BS9A 2E1PA 3PR4A 3LANA 1FJ7A 2PFDA 2AYGA 2HMIB 4GO7X 1WG4A 2FB0A 2EFPA 3HXMA 2VKZG 3TAMA 2AKWB 1U24A 3NS6A 1RA6A 3I55S 4C0HA 3GV7B 3RZAA 3T1HF 2VG5B 4NYOA 2Y3YA 4ZLPA 2CADA 3D9BA 4DZ6A 1KQFB 2GIRA 2KG1A 4LSNB 4O4GB 3M1VB 3LP1A 4RUBA 5GAEI 1G2EA 2QRRA 1UJ5A 2VBWA 1YIJS 4B9VA 3QIPB 4ZOSA 3ZZZA 1Z2LA 1FRMA 2DT9A 1FRLA 4YR3A 3PEJA 3W61A 1HR0F 2VJUA 1FEEA 1Q4RA 1HNIB 5L9NA 3KLFA 4X84A 3CCWA 2ZHBA 1X60A 4LR8A 1NB7A 1MG7A 1T02A 1WEYA 4DFPA 3BPDA 4K0KF 2BKOA 4YS2A 2AT1B 2LU2A 4LBIA 1N34J 2UV8G 4O0NA 5DQIA 4K4ZA 1ZPVA 4G1QB 3C15B 1K8AT 3S01A 5KFGA 3LAMA 5E33A 2E7WA 1LW0B 2R8IA 2LLZA 3C16B 1UFKA 3OQ2A 2DKOB 3UVJB 4B3OA 3FGVA 3GCXP 2BOAA 5IFMA 2HFOA 3QLHA 2OJ3A 2APOA 3P4UB 1TUWA 4RW4A 3OL6A 3KLEB 2IVYA 2VICA 1VQNS 4MKAA 4F25A 3CULA 2KRBA 1PJ5A 2MHEA 4C4WA 4LQ3A 1HNVB 3IA0A 1DRZA 1UA0A 2CG8A 2G13A 2RH3A 4FNIA 2UXBJ 4H4OB 3CCLS 1XMQF 1RISA 1S0NA 1HI1A 3UN2A 5CD4H 3I0RA 3ILJA 1ZPWX 5EHHA 5LMNF 2ZM6F 2IJRA 3KLVA 2IA6A 4TQSA 1XWLA 2A6OA 5ETKA 3VGTA 2YY3A 2IC3B 3DOLA 4CRJA 2RRBA 2HHWA 5F3TA 1UVJA 2XWYA 4OZ3A 1XMBA 3BYRA 1WEZA 4V19X 2GJIA 4AL5A 3QRQA 3UDEA 4N7TA 2PIIA 4K59A 2HNDA 4KY3A 3AFGA 4I2PB 4CLYA 3KLIB 2XI2A 1GXUA 2QFJA 2HHPA 4WCEQ 4FBTA 1BQMB 3E01B 3IRWP 4DG1B 2RQKA 2XMAA 4U95A 2M3DA 3MM6A 3KYLA 4OV6A 1RT1A 4BLGA 3NCPA 2OTLS 2KYZA 4RUHA 3IG1A 4YDDB 2E1AA 2BEFA 3QNWB 4J5OA 2QEXS 3A4TA 2N7YA 4LF9J 2QA2A 1U47A 1KTVA 2LQ5A 3G82A 4NEZA 4DBQA 1NRKA 2EKYA 4DX6A 4ZN3A 2LXIA 3OL8A 1N4LA 3BGRB 2NZCA 3C14B 3TZWA 4USVA 4HI2A 1IBLJ 3O1LA 5DRKA 5I42B 1P1TA 5K8OA 3OLAA 2DBBA 2OFGX 2ZZMA 2LA6A 1IKWB 2DR6A 3AQOA 1HA1A 3L4BC 1K44A 2YBVA 5JJBA 2Y8WA 2JZ5A 4H4MB 2F7VA 2IRUA 3PEHA 3GQCA 3BJYA 1NJWA 3DHWC 3DXSX 1SJQA 4ZVPB 2KL8A 3GFHA 3K7RA 2P6TA 2YNGB 2YPZA 1QLNA 4D3HA 5B0DA 3J7Z5 1QTNB 2LKZA 2H51B 3TA2A 3UW1A 3S7RA 5B0BA 2V8PA 1RHJB 5ETSA 4KC5A 2UXCF 2YXLA 1RTHA 1AUDA 1WG5A 1RE1B 3JTPA 2VOOA 3EUNA 3EXCX 4DSEA 3UNYA 3RAMA 5IXUA 4OI1A 2VFSA 5DLFA 4DPTA 3RRHA 4IH5A 1KSPA 1JLQB 1QUVA 1RQ0A 5C25B 1FRIA 1WORA 4R25A 5HQ8A 1Q8LA 2O66A 4DCJB 4LRBA 2W8LA 1SQEA 1X5OA 2CZ4A 2ZHOA 3AH6A 1VGYA 2J76E 3NBPA 2HFNA 2HQGA 4WP3A 4QW8A 3W7BA 3R27A 2VQEF 1N36F 2VBYA 2XSFA 4R5PB 4DX7A 1AXQA 2DITA 3MF5A 1ROFA 1EB0A 1YRTA 4NLOA 2C3OA 3G6YA 1QE1B 1TKTB 2XYPB 2IDLA 4C11A 3N0VA 1NSQA 4DR6J 2MHNA 4ES2A 3EICA 1KONA 3RBZA 3V6KA 3GIIA 4A8QA 1Q8BA 1WSRA 2BQRA 1A6LA 4I64A 1PILA 3GMGA 2ZZNA 4FN5A 2Z57B 1CEZA 1NSAA 1WHWA 4ZVEA 4FYVB 1TL4A 1SKRA 2NUHA 1RHQB 3ET6B 5IWAF 3BSCA 4L74A 4ZK7M 2DHXA 1M1GA 1M5KC 1RAOA 3TAMB 5J2QA 4GMKA 2ZD1B 3DU5A 4OI4A 2BYCA 4CYUA 1AFIA 4OX7A 1EAYC 2M4MA 3KMSA 4OX6A 1NUEA 3GU0A 4C48A 3LP1B 4WXWA 5H1SV 2WSCC 2E29A 2RAQA 2JX2A 4TVAB 3R3TA 2BJ8A 2J8AA 2V6AA 2DNNA 3U1LA 2YKQA 4NMXA 3AY0A 2GIFA 5ETOA 4CZCA 4IRKA 3T5KA 3TUJC 3IM9A 2P8IA 3CE8A 2YKMA 2YX1A 3G6XA 1YLXA 4X4VA 4IKAA 4J9VA 4LIWA 3H5YA 4CWBA 2F4FA 3R6LB 4NCAA 5KFDA 5K14A 2J0SD 2E1MC 3B6BA 2HQ3A 1QD1A 2IM3A 2PI4A 3JS9A 5LL6d 4KIAA 4LJMA 2RNEA 4WF9Q 1XEZA 1YWXA 1TMJA 4YB6A 3QMQA 2FHJA 5G0RB 4RW4B 3RUBL 2ERRA 2W24A 1D09B 4NLGA 1U1QA 3AD9C 4X2BA 3FCHA 3VAJA 1UVMA 4WFAQ 2ZBQA 1IKVA 5ITHA 5IM0B 2PEHA 1VC5A 2UUAJ 2R8GA 3FC9A 1VYAA 3HK2A 1GMWA 2CJAA 2DGUA 3I0RB 4B9LA 2JDJA 3JAMY 3RB3A 4EO8A 4P10A 1HNWJ 3LP0A 2U1AA 3R2DJ 5L1LA 1VCTA 4KKOA 2ZH5A 2Z58B 1IR2A 2BKNA 2QE5A 5D0EA 4X64F 3DOLB 3HJVA 1REVA 1U1RA 4USHA 5LXYA 3DRYA 5HVGA 2DHHA 1QJHA 3Q89A 3BH7B 1H98A 3PKYA 5B08A 1IBCB 4YR0A 3QRRA 3ZTQA 3NMRA 3CDUA 1NK4A 4WTOB 1V9OA 2RRAA 3ZFVA 1S1WB 2QL7B 1TL5A 3R5AA 1UP1A 1N48A 3EJMA 3M8WA 1N6QA 3DGPA 1KHWA 2Z56B 1P9QC 2CQ1A 3J7A1 1UKUA 3ISND 1F0XA 4F67A 2J6UA 4A8XA 2HKEA 1HHSA 2WSEC 4CLUA 4O4RA 1LXNA 1RT1B 4P2FA 3JB9k 5J2MA 3ILLA 4QYZJ 3HZGA 3M8YA 3MCNA 5IV3A 3FBFA 2WAQD 5KG0A 1HI0P 5GAGI 3BQ1A 2B4OA 4LRAA 1RAHB 9ATCB 3CT9A 2AYBA 2AJ1A 2N3LA 3JSMA 3HZEA 3ZO7A 4KV8B 3B82A 1WHXA 2W7AA 2VG7B 2KZMA 1RAIB 4B9TA 1MWYA 1MMNA 4ZPVR 4I0WA 4BS2A 4QOTA 3NWRA 1HNXF 4OX9J 3QT7A 1WACA 4K4TA 2VUGA 4CI0B 1FESA 4ZVGA 2DY1A 4DQPA 1XERA 2GQQA 2OP5A 2J7UA 3M05A 3NNAA 3VAHA 4KHPF 3D1OA 3K5NA 3GR1A 2R8HA 2CJQA 4OYAA 4Y28C 5ADZA 1CULB 3TARA 5DG8A 3HFKA 1TKDA 4WXOA 1RTHB 4NRTA 1SC3B 2CG4A 2W2NP 2ZC4A 1CSJA 3EVWA 2XY7A 4DUYJ 1SCJB 5T14A 3NOCA 5LSLA 4IFVA 4FF3A 3HKWA 1R8AA 2RKIB 4DL4A 2HAFA 2GS8A 4Y2KA 2L9NA 1E6YA 3NRBA 3H0PA 3BREA 1G1XA 1WKJA 2BM0A 3NAHA 5M2PA 4P52A 5A6PA 3K57A 3NBPB 2BDPA 3EDQB 2Z0GA 5HATA 3DGVA 4XPEA 3CC2S 5C24A 5E3RA 1X8DA 1EZZB 3BPSP 3A8IA 3LAKA 3MM8A 5A8KB 4DV3F 1WUUA 2BA9A 1HKAA 3CW2C 3BBFA 4HLBA 5KFAA 2IIHA 4DR4F 4C11B 2Z2MA 3SDEA 4UT4A 2BJ1A 3E2EA 4IFYB 4ERDA 2GA7A 3MWBA 1XNRJ 2DPIA 3PFOA 5DQGA 1FJGF 4I6YA 1JLAA 4DV5F 3OUYA 3GWCA 1FXRA 5JMNA 2OPSA 1TVRA 4N77A 4G1PA 4NOHA 4I68A 5HAOA 3MHYA 1YQHA 1NLKL 2I6WA 2J9DE 2ROGA 3P5TL 4DSKA 1Y11A 2FZCB 3P45B 1HW9A 4QPXA 4P2XA 1P9YA 5KFCA 4OZ5A 3CD7A 1IBMJ 1F5CA 4LR7A 4CYUB 2LA4A 3QBCA 1L5UA 3TQ1A 3IMQJ 4O3SA 1PC5A 4P74A 2R7TA 2ZVSA 2ZJQQ 3KHRA 1TFWA 1U8SA 5F8MA 4F4KA 1JQGA 1Q7LB 4J37A 1QM9A 1J27A 2MB0B 4DR2F 3AHPA 2RF2A 3OTDA 1X5TA 1BUXA 3TUIC 2R7VA 4I69A 3OVBA 1FKOB 1SC6A 2JWNA 2P9GA 1ZM9A 1JXEA 1RP5A 4Q8EA 3B78A 3L7PA 3V81A 3GYXB 3FZBA 3SMZA 1C4AA 3M6XA 1IN0A 3CJ4A 3MZIA 3FZ2A 4U9RA 5B0AA 2CNKB 4LRFA 1Y0HA 8RUCA 2C3UA 3CJRA 4RNOA 3W60A 1BXNA 1U0HB 4U7UK 2H5IB 3DLGA 2MY8A 1S7IA 1WI8A 5IT0A 1BC6A 1VHFA 3DRRA 1ACMB 4F02A 4EI2A 2BXJA 2KZZA 1B3TA 1RLDA 2OD6A 4HHHA 3GG0A 4NLPA 4HEA9 1JJCB 3U1NA 4G65A 3F73A 4YFUA 3JXOA 3ENVA 1FDDA 4I7FB 4N41A 2EI5A 1QAYA 2C22A 4X62F 1T94A 2AJQA 3CUNA 2RDJA 1QSYA 3TW0A 3LP0B 1OYDA 3PW7A 1NK6A 2CYYA 4RUAA 1KVJA 2DH7A 1RAAB 3BR8A 2C28A 1JWWA 2PI5A 3X1LB 1OS5A 1PGZA 1C1CB 2GVDA 2Q43A 5KG6A 3C6TB 5T7LA 4PXEA 1DARA 4OJGA 2F1FA 2MY7A 3BGLA 4DR3F 3SIPB 4LF7J 1IQZA 3KFWX 2RQ4A 3SSQA 1Q79A 4ZLJA 3GG1A 2HGMA 1ZOTA 4HVZA 3KNAA 3KUGA 4X66J 2PGCA 3M4XA 4A8MP 2SXLA 1PYTA 3WX8A 3TP2A 1HPZB 3CJTA 1BD6A 3EZ5A 4J9NA 3OJSA 2IMWP 2L08A 3ZZUA 3Q83A 3KG1A 1XJWB 4O0IA 3CC4S 1NDLA 4NXNJ 1EX8A 3HHKA 3MM5B 3NS7B 3H98A 3D68A 1LWCB 5J2MB 2CQ2A 2NXJA 2HRUA 1U1NA 2FGOA 1RCOB 4M5IA 1O6XA 3BO4A 1LK5A 3IBWA 4RX6A 1JXVA 3GIJA 1NSPA 2KHDA 4DR7F 3H42A 1SL1A 2ROEA 3JSMB 4LF4F 1U8WA 3W2VB 5KG2A 4EBDA 3WIVA 2DCLA 2DR7A 1T9WA 2PMHA 4L3KA 3HHLC 3HJFA 3ZTOA 1G3OA 2ZEJA 4Y00A 1OJ4A 1I51B 4YP3A 4DV1F 1RUSA 2CKWA 3RYLA 1CJKA 4DZDA 5KFFA 1BWVA 3CCJS 3D1QA 3QQCD 1JLFB 5GADU 1IWGA 2CXEA 4EBEA 2HVZA 2VF3A 2KU7A 2YH1A 2ALYB 4GC6A 2CPDA 1JLEB 1X4EA 3BB5A 3FUYA 3HI9A 1T03B 4NWBA 3ILIA 2B43A 4ZVSB 4DR1F 4FXWA 1O0PA 1UWBA 1UVNA 3W9JA 5H9EJ 3M6WA 3TZYA 3EZOA 5HJYA 1S6QA 5E3PA 2VBZA 2Q66A 5DDOC 3RG6A 5CYJA 3MPDA 1FNMA 1N33F 3EPGA 2DH8A 4C7QA 3L7UA 4XDDA 2CQHA 4DPXA 2ZOFA 1SH0A 1G6BA 1WTFA 4EGLA 3PRVA 3HSZA 1S6UA 3B4DA 1E6YB 3MM9B 1ICEB 5B09A 4XAKA 3JAMU 1SH3A 1S97A 5HLFA 2XY5A 1IUJA 4ZPDA 3KDOA 2G2ZA 3AB4B 3GYNA 3W2WA 3LF0A 1D9FA 1JKHA 2FC9A 3DDKA 4DPYA 3H2LA 1YGYA 3QGPA 3LA0A 2ZKUA 2L3MA 2ZWOA 1MW7A 4KB7A 1HYSA 2V8DA 1Q81T 3MAHA 4F4YA 5FD1A 1RABB 3CIMA 3I5BA 3SDEB 2HHHF 4DSJA 2HFUA 1QAXA 3MPUB 3DYAB 2UUBJ 3DOMB 2IYGA 5KFOA 2PMZD 1WTBA 1EETB 5F8JA 1R6YA 3OUYB 2MGZA 3G87A 2OPSB 4IQMA 4AT1B 1TVRB 2A18A 2ZVIA 3D1HA 1NXIA 3OR2B 3H4BA 4JV0A 2B7BB 1X5PA 4U7UD 1F9EB 2HFSA 3BDPA 1PAUB 2KT2A 4J9PA 2HPUA 1FJCA 4PG8A 1WOSA 5FDLA 1S59A 4MK9A 2KJWA 1CC8A 2NPFA 1MU2B 2W7PA 2Y1RI 5F8GA 1FTRA 5DGBA 1A0OB 3MR6A 1J5EF 1I5OB 3WDOA 1FDBA 3W63A 2RF2B 2EK1A 3J81j 4DJBA 5LT5A 4ATNA 3N6MA 2ZUGA 2ASJA 1BWEA 4ED7A 1N36J 3FNNA 2KM8C 2OKQA 4OZ1A 3Q24A 3I9ZA 5EWFA 4ZMMA 2DHGA 5A0YA 2NPIA 4W92B 5AXNA 3DRPA 2MTLA 1UW4A 3L95X 3OSNA 2MXYA 1FFSB 5B0EA 3N5FA 3GFXA 3R1HA 2A2DA 3Q8RB 2FJWA 4LT6A 1MN7A 2QLBB 3L09A 4DV7F 1S6OA 4UZCA 1F3FA 1ZM2A 2V50A 3GV5B 3DRRB 1ZZFA 4YHHF 4X4UA 4F4WA 2IRYA 2JJ4D 1N52B 4ECUA 2LFVA 3JQKA 4GVBA 3C3LA 2E7XA 2OTJS 1UJ4A 1VQMS 1CQNA 5BJRA 1HHTP 3LTOA 1KOOA 3FDSA 4QU7A 3WQPA 1K73T 2G4BA 3HHLA 4WBFA 2D41A 3SYZA 2VKRA 4MYUA 4HTJA 2J7WA 3P6YC 2JC1A 5DG9A 2WW4A 4OHXA 4J9KA 1SH2A 1FRHA 2VD3A 2E9TA 2V4JA 3Q8YA 3CDWA 3JSYA 3W9HA 1BLUA 2MJNA 3PR5B 5K5MA 1T7PA 4HKQA 1N54B 4KBIA 1BE4A 4C8MA 2ATCB 2DNYA 1K9MT 3PW4A 1XR7A 3LP2B 3I31A 2FTRA 4LQ9A 4NLSA 1NH7A 1GX6A 2B0GA 5AE1A 1BHNA 4ZJQA 1DTTB 4G3IA 4O3NA 4LIRA 2DR8A 3MMJA 3OPKA 3A12A 4KGMA 4IRCA 4L72B 1SJRA 2ZDOA 1FCAA 3C2PA 4I1TA 4OHVA 3B54A 1URNA 2AF6A 1T05B 1KWMA 3W66A 3T1YF 5F8NA 3C19A 1D1UA 1VC6A 5ETVA 1XN9A 2DEJA 5EDWA 1FNOA 2RS2A 1S9GA 2C3YA 3M30A 5KG5A 5IZHA 3OXFA 5J2NA 4MIWA 1PSDA 2DPJA 1YI2S 2AJFE 1CVJA 1UEKA 4BCAA 3TZZA 1S4EA 4OZJA 4ENOA 3QO9B 2O5DA 4ICLA 4JI1F 4HACA 3CD6S 2BACA 1NDCA 2F3JA 3NOGA 2V2KA 2QJ3A 3I4HX 1LWFA 1WC1A 5L1KA 2HQDA 1NM2A 1APSA 1WWHA 3GIKA 2V69A 3KLGB 3MM7A 3JSRA 2CPXA 3MTJA 5EX0A 4LVNP 1H73A 4X64J 1RJJA 2VQFJ 4O44A 1FKPA 1FRXA 5EWGA 3PHEA 1EQ0A 4J9QA 3VZHA 2GJ2A 2C1EB 2DNRA 4NCBA 4YY3J 3D4JA 3RRGA 4RKUC 3CD0A 3K8VA 1VJWA 3V4IA 3TRGA 1OQ3A 1T9UA 2IA0A 1YSJA 2CDQA 3DLHA 1RWKB 4K7QA 2JL9A 2CQDA 4WZMA 3KKFA 4L73A 3KJFB 1X0PA 3G8SA 1DURA 5CAAA 3S6EA 5CYQB 3ETMA 3BSAA 1OWXA 2E9RX 2RHSB 5LMUJ 3M8PB 1U6ZA 2ILZA 3L3CA 1TL7A 3QZ8A 2JEFA 4CCHA 1C0TB 5F41A 3W2WB 1ELOA 2WBMA 4TY8A 5B7WA 5C42A 1DQAA 1HWJA 2MLYA 1TU0B 1VQ5S 2JEGA 3RBEA 4QIWD 3MEGA 1Y7PA 2R7RA 4FVCA 4URQU 4ZCKA 1EHWA 2XCAA 2HHSA 2BOPA 4I6AA 4N8NA 3I87A 2F8MA 1U49A 1UTAA 3BO3A 2DNKA 2LEPA 4WZQA 3MR5A 1FEHA 5HVFA 5LSRA 5HP1A 3V6HA 4KR0B 1M1KT 1RDRA 3HM9A 2LVWA 4Z2XA 4TU9A 2OELA 4LFCF 4FYDA 1JLGB 2AZ1A 3HVAA 4JI0J 4DSFA 1LKZA 4AUKA 4YMEA 3P96A 1WDTA 2KTQA 2B4VA 1NPPA 1HMVA 3DMJB 2FHJD 2ADBA 3KK2A 2PO4A 4HT7A 4RW8A 3FQLA 2DH9A 4U8YA 2HG4A 2YKNA 3EXYA 3CF5Q 4B3SJ 3FEYB 2XEXA 3M9MB 3K5OA 3THTA 2I0XA 3MMBA 1RT4B 2R3VA 3TI0A 5GMEA 4PQAA 2B56A 2CQ0A 5E3QA 4DCOB 3UNGC 3PO5A 4WKYA 3BF4A 4JI4J 2V8GA 4CM0A 1JIHA 2W01A 4K2XA 4M5DA 1KNZA 4DU7A 2DCUB 1G7CB 4DV3J 4QJVA 1H38A 3EVOA 3LW5C 5A0YB 3MAQA 2H65B 2AGQA 3DRPB 4DV4J 2I8EA 4M8LA 3ICLA 3IWLA 3LALA 3AODA 2VODA 1VK3A 1F1BB 4MIAA 4ITSA 2KHCA 1FX2A 2G0JA 4Q0BB 4CH0S 4EUVA 4DV5J 1RTZA 2IHR1 1VBZA 3L9ZA 1HD0A 1FFGB 4C98A 2HVIA 1RBAA 1PJ6A 3UCZP 2JH3A 3N01A 1EARA 2WONA 2U2FA 1S1TA 2FPHX 1MWQA 1YK9A 4DLGA 3D54A 4RW7B 1F5BA 2YNIA 3VGVA 3LH2S 3EM1A 3HHLB 2EPIA 4AL7A 3TEHB 4JYAF 3T1AA 3AJDA 1NMEB 4LUBA 4RU2A 5KOXA 4JV5F 5DETA 4PAAA 1Y00A 1KRPA 1OYEA 2OSQA 1L3UA 3HX9A 1N32F 2F65A 1UEVA 4KTQA 1OPIA 2EC2A 4HR2A 4ZJLA 5L38A 3ONQA 4DV2F 1C0UB 3RAXA 1CJVB 2HHUA 1HBNB 4OI0A 2XLIA 1NU4A 5F0UA 4KPCA 2R7WA 4KGVB 1HBOA 2CQBA 2HHQA 4NXMF 5HBMA 4MT1A 3HKZD 2R7UA 4QCLA 1UVLA 1REGX 4ECZA 3SFUA 1YVFA 3MMCA 1RT3A 3OR1A 3PYFA 3OL9A 1RCXB 4F3OA 4JI2J 2ZH6A 3UFCX 3BSNA 3GTYX 3I0SB 3PM9A 4ZPTR 5L1JA 3K5LA 1RWXB 2KT3A 5J2PA 4ZHRA 2HBZB 2J8SA 2KKHA 3BGOP 2G1HA 4ALZA 1IBKF 4ZS6A 3D0HE 5D8HB 2YH0A 3MEEA 4RWXA 1S9GB 1XMOF 2XWXA 2YX7A 1B0VA 1LXJA 5J2NB 4BC7A 1MLAA 3NNHA 1PCAA 4FYWB 3CPWR 3C8YA 3VQTA 2Z30B 2FLPA 3AD7C 3P5BP 4HACB 2VG5A 3WC2A 4QIFA 3AAWB 2W9CA 2BE2A 4CO3A 5DJBA 3GV8B 2HWHA 1TAUA 1PBAA 4LSNA 3OV7A 3Q86A 2FLNA 3MM7B 4HHUA 1JB0C 2B9EA 4O3OA 4O44B 3UI3A 1WF2A 2L48A 4DR3J 5D0RA 4NLVA 1VR6A 2C2EA 3CTRA 4NI2B 2FD2A 4C9DA 2W1BA 4CO4A 1ZM3A 5D6GA 1VQLS 4OFZA 4Q5VA 2PA3A 3U27A 2J0XA 1LFWA 5DDRC 4G1QA 4OZNA 4CIOA 1R8BA 4NLYA 4J9SA 4B3TF 2R9LA 1R3NA 4WFXA 4F04B 3Q8PB 4A4JA 1LW0A 3DRSB 2VPYB 3C16A 2PEBA 2RQMA 3HLUA 2ZBRA 5DZ7A 3UVJA 3R1LA 1YJWS 2ZH4A 3DDIA 1JNRB 4LBPA 3IRXB 4M63A 2GVZB 3H8YA 5A8RB 4DPUA 1KDNA 1RWUA 1TL7B 2BJDA 1TK0A 1PYOB 2G2OA 2M7SA 3IR5B 4KFBB 5LSOA 4TY8B 4CP5A 3MAAB 2JC0A 2MEWA 2G9OA 2VC1A 1ZZNA 3D2WA 1VJQA 2KM8B 3CCTA 4OLOA 3MOZA 4JOUA 1KD1T 2OUGA 1S57A 4KH0B 3KLHB 2H4WB 3OL7A 4DV1J 4GKKF 2OHDA 2CJYB 3NEKA 3SFGA 4HH1A 2QLJB 3QJLA 3SSRA 3W8GA 3R5DA 1WKKA 1FA0A 3ENAA 2BUNA 4F2RA 2K7KA 1M90T 4F3QA 2DNPA 4HDGA 2VJVA 3G96A 2LQ9A 1UVIA 2Y1LB 2OLWA 1TELA 2IAJB 3KK2B 3LOUA 1BQMA 3KWMA 5HL7Q 4C3KA 4MFBB 4DG1A 1CPZA 2IRXA 4F4XA 4IO1A 2GQCA 4M95A 4DV0F 2PE8A 3MMBB 3O5TB 3MEDA 4DV6F 4YQWA 1KVIA 4QBUA 4ID5A 1RAGB 3KTQA 2RQCA 4ED6A 2QIFA 2EC0A 1T8EA 3SQGA 2XQCA 2HGLA 4NLQA 4AE5A 2GAHC 2D7SA 2MQLA 1NAQA 1FD8A 4QZVB 4C8YA 2R7OA 2L9DA 1FTCA 1N5TA 4OI2A 2AD9A 4FDFA 1K0TA 2LCWA 3BGRA 2DGVA 4NLWA 3C14A 2J0WA 1LV5A 3CCMS 3DLKB 1D9AA 1W7WA 5HVHA 1EJ7L 5I42A 5D0GA 2IVFB 2D3ZA 3AT1B 4MMOA 1S77D 1IKWA 2HHHJ 4M1KA 4NA2A 1W26A 1P8GA 5KG7A 4TKTA 4H4MA 1KN6A 2X1AA 3O6QA 5KAKA 5CCMA 1XR6A 1W25A 1FXDA 1YBAA 4GO5X 2YNGA 2V2VA 4USMA 3RB4A 4OMFG 2AJ2A 1V6HA 2XG8A 5D15A 1JK9B 3OXLA 2YTCA 4NLDA 4DI6A 3M2VA 2WONB 2FY8A 2UUCF 4OYIA 4RW6B 1KKHA 9RUBA 2P9CA 5EGYA 2F4VF 1S9FA 5E3AA 2YNIB 3SSSA 3VF0B 4HH0A 1KC8T 3FCWA 1VQSA 2DR5A 5L8RC 2DGWA 3RBXA 4WWSA 4MH8A 3BYPA 4ZN1A 1XBWA 2XZWA 2HQCA 3H5SA 1WOOA 4KGZB 3ZZ0A 4WE1B 1TL1A 2IFXA 4IG3B 3Q8VA 4MKBA 4J7CA 5HO4A 5CH7B 4HL9A 1JLBB 3R7SB 3MDFA 4NZ0A 1HBOB 2NLWA 3HD1A 4ECYA 1X9MA 4DL5A 4R5PA 3NY0A 3J7AN 5HBMB 3ITHA 3T5LA 2B9YA 2CNOB 1QE1A 2QMWA 5F8HA 5DM6Q 1RT7B 3IS9B 3MFIA 2BRKA 1RT3B 2HEKA 3OR1B 3CB4A 2YWEA 8AT1B 3R5CA 2YPYA 4DU8A 5GAEU 1VRUB 3AJ1A 1IJFB 2DYAA 2UVRA 2F9JA 6FDRA 3KK3A 5D0HA 5JVGQ 3C46A 1LWEB 3IM8A 3QT6A 1F6TA 5KFPA 5J2PB 4PG7A 2GHWA 4ZHRB 2FGCA 3Q22A 4J9OA 2Y8YA 2BV3A 2CFXA 2XSJA 1NZAA 2V8VA 2LDIA 3MCOA 4LMZA 3D6MB 3ET6A 5KFBA 1MNEA 1OY9A 5KT6A 1RU2A 3G6VA 1PJ7A 4LFAJ 4NEYA 5IOLA 2OMLA 5KFSA 2AIRB 1NH8A 2ZD1A 4C8OA 2HFZA 3FFIB 2N7CA 4OYPA 2K3IA 4ZDNA 3T6JA 4O3PA 4Y2MA 1VBXA 1DQ8A 5KFHA 3A8EA 2W9CB 1RGVA 4PUOB 1J5OB 2BE2B 2M88A 5I4MA 1S10A 3KHHA 1UZHA 3MCSA 1N34F 4Y2IA 4UY85 3W5YA 2HBYB 4LF2A 4ECTA 2R2SA 4B9MA 3DC2A 2A3JA 2MQMA 3KNGA 4OHWA 1X4HA 2M8DB 2BJEA 3MR7A 2XS7A 2LEBA 4DF8A 1R27B 2XO6A 3QZ7A 4A8YA 3AJ2A 1VQ6S 2HNZA 5C2CA 3WHIA 2GAGC 1VBKA 4K5RA 4LF6J 1UVKA 3OFFA 1U1MA 2UXBF 2R8JA 2FVRA 3KJNB 2ZWPA 3N6LA 4DF4A 3EGZA 3MPYA 3PO4A 1Q53A 2MZJA 1U2CA 1ZYQA 1JXLA 4CLZA 2YKOA 5ETQA 1X4GA 1N0UA 4EYHB 5G0RA 4WJBA 1UEUA 2W2MP 2C42A 2QLWA 4E8UA 1ZA2B 2HNYB 1Y3JA
chains in the Genus database with same CATH topology
2CQ2A 2D9OA 2HRUA 4R0JA 1U1NA 2DRBA 2ZHAA 2ZE2B 5F9LA 3DLBA 2HW3A 5BR8F 5GAGU 3W3SA 2FGOA 3BN7A 2PFFB 2RU3A 1H6KX 1AFJA 2HNDB 4MKYA 5IM0A 2J7KA 1VQ8S 4V19J 2RUGA 3QIDA 3D0IE 3BO4A 3RAQA 1VQPS 3PIOQ 1LK5A 2CPHA 3IBWA 4RX6A 3MECA 2XULA 3GIJA 2MPUA 4ZP7A 1QTMA 2GMJA 2KHDA 4P6QA 4F26A 4DR7F 1SL1A 4NLXA 4J9LA 2B9XA 2ROEA 5AXMA 3JSMB 3V6JA 2B4PA 2FIUA 2DNGA 3A1YG 3GFYA 2GV1A 3N6NA 4LF4F 3RR8A 4PG6A 5B0FA 4DS4A 2LECA 2MKCA 3V2UC 3KLEA 4QU6A 1OQ6A 3W2VB 3PV8A 5KG2A 4DUZF 3HO1A 3NLCA 2EW9A 4EBDA 3MM6B 3G6ES 2CPEA 2DCLA 2DR7A 3NKYA 2PMHA 3N4WA 3V5RA 3HHLC 4DN9A 1S7HA 3HHEA 3HJFA 2YNFA 4YEAA 1YJTA 2A1BA 3CWJA 3IG1B 4QYRA 3TNVA 1HNVA 1S79A 1DZ5A 3EPIA 1RT5A 4ECXA 2Q3PA 1G3OA 3FSYA 5C42B 4Y00A 1NJXA 1GQEA 3ENWA 2YWGA 5HI7A 2FJBB 1QVGR 4YP3A 1R0AA 1BQNB 5J1EA 4X4RA 1KOHA 4DV1F 4Z37A 5LMUF 4KO0B 2CKWA 3KK1A 4H4OA 1X5SA 4ZA1A 3RYLA 3MEGB 3MEKA 2PA8D 1NKEA 4OL8A 5KFFA 3CCJS 3DU6A 4IDKB 1N5VA 3D1QA 4BWJA 1JLFB 5GADU 4WFBQ 1Q7YT 3TA1A 4I67A 4Q7AA 3ZZRA 4EBEA 1NK9A 3V6DB 1FRKA 2HVZA 2XMUA 2J6SA 1Z1ZA 3FEZA 3H40A 2VASA 2KU7A 2JFDA 4IH7A 1Y3KA 1CG2A 1S1WA 2YH1A 3DRSA 4GC6A 3H4DA 2CPDA 1VIXA 1T3NA 1JLEB 1X4EA 3BB5A 1LFPA 5HP1B 2M2BA 1JMTA 3HI9A 3SZ2A 2FHOB 2MSSA 1T03B 1R8HA 4OZ0A 5EWEA 4PPDA 4DQRA 3G9CA 3MI7X 2WOMA 1ZTTA 4NWBA 4DX8H 3M8SA 4IOAQ 2IC3A 2JLEA 4C0OC 2B43A 4DR1F 4FXWA 2QMXA 1E6VA 4FVMA 3AA8A 1K0VA 1O0PA 1UWBA 1UVNA 1DBDA 5H9EJ 3IRXA 3E3XA 3M6WA 3PNIA 2E66A 2OPQB 3PRBA 1S6QA 5A8RA 2I2YA 1RKJA 2M5YA 3QAEA 5E3PA 4TU7A 2NREA 4A48A 2YWHA 2VBZA 5KFMA 1NNDA 2O1PA 2JSXA 1NJIT 3MEDB 1IBLF 5DDOC 2DGXA 1X9SA 2Q66A 3FRYA 4ED1A 5CYJA 2DTJA 5E2QA 4RU9A 1FNMA 1ZAVA 1N33F 4KFBA 3EPGA 3HHLD 2DH8A 3JTOA 4ID5B 4C7QA 2LXUA 5L39A 3UPFA 2CZVC 2RJZA 5AE3A 4KHMA 1XR5A 5SZTA 1SJ1A 1P1LA 1HMVB 2AWZA 2GX8A 3AQPA 3IC1A 2CQHA 3QWPA 4I2PA 1FE4A 2ZOFA 1SH0A 4OLPA 3SQGB 1G6BA 3KLIA 1WTFA 4FNHA 3DOKB 1JX4A 5IT9Y 4B9SA 2WRMA 4ILLA 4EGLA 2J9DA 4G1IA 4QR1A 4DUYF 3DCAA 4JI0F 4IRDA 1S6UA 3E01A 2JHEA 3ZZPA 3B4DA 4RW8B 1DFDA 5D77A 1E6YB 3M2RA 2XMVA 3MM9B 3T9NA 5KFXA 4XAKA 5B09A 5J1PA 3CCSS 5KFTA 1SH3A 1FKAF 4IUFA 4TXSA 1S97A 2YKNB 4KV8A 2D3OR 3IAS9 5HLFA 3PY8A 4ED5A 2XY5A 1IUJA 4ZPDA 4FZVA 3KLHA 2VG7A 3LQVA 2XMTA 4JI6F 1MMLA 5E41A 3AB4B 4A8OA 1IM4A 3O3LA 4URSA 2CRLA 1RAJA 3DXBA 2W7OA 3NCRA 3UCUP 2CJKA 2UU9F 3GYNA 4F3MA 3W2WA 3J80Y 2M9KA 4TQRA 4CNZA 3PIPQ 2QSFA 3LF0A 1D9FA 5DG7A 1JKHA 1WF1A 2FC9A 5CYMB 4A46A 3DDNA 3UDLA 4B3SF 3DDKA 3CJ2A 5JUMA 4Y2CA 3H2LA 1U09A 2EFGA 4B17A 2KFZA 1YGYA 3QGPA 2FJEB 1HI8A 4WTYA 2ZKUA 2L3MA 1KR4A 2YX4A 1C1BA 1MW7A 2DNQA 2XO7A 2W9BA 3H2VE 5E0OA 3PRDA 4NZ7A 5D4NA 2FLOA 2VPXB 5HMYA 5D4PA 5KFQA 2WTFA 5JVHQ 4DL0C 4A8FA 4UUWA 4KB7A 1HYSA 5CQGA 4PPZA 3HVTA 4CTAB 2V8DA 1X4CA 1Q81T 3MAHA 2MZRA 2CPFA 4FF1A 4B02A 4F4YA 5FD1A 3OBIA 1H2VZ 3CIMA 3I5BA 2BANA 1VC0A 4FXVA 3SDEB 2HHHF 3Q2TC 1VI7A 2IAJA 3GZ7A 2VC0A 4XK8C 4DSJA 4TY9A 3OW2R 4M5DB 2E9ZA 3US5A 1O5JA 2MKJA 3TANA 4JI3F 4JI4F 1NKCA 1QAXA 4MFBA 3I56S 1CC7A 3DYAB 3WBZA 1KHVA 3AA9A 4X4OA 1VQOS 2IYGA 2ROPA 5KFOA 2PT0A 2Q6BA 2PMZD 4DFKA 1WTBA 1EETB 5EUHA 2ZH8A 1U25A 5F8JA 2ZH7A 4QIVA 3C66A 1R6YA 3M2VB 1HD1A 2FHMA 3ZC4A 1SIWB 4F8RA 3GR0A 2ZH1A 4P2SA 3OUYB 2MGZA 2OPSB 4IQMA 4WKRA 1TVRB 2A18A 4HYKA 2MZTA 2EBEA 3JSBA 3RRKA 4PWDB 4EFAC 4OHZA 3MOJB 1DQ9A 1KLMB 2CPIA 1TKXA 3D1HA 1YRUA 2MKIA 4X65F 3ZZOA 3KJVB 3OR2B 3H4BA 1IQTA 1N5YB 2AP6A 4JV0A 2JVOA 2B7BB 3LPYA 4K4WA 2RKIA 4XIUA 4Y65A 3M9OB 1X5PA 4DV4F 2KVIA 2V9WA 1OSDA 3KG0A 2NSBA 2PDAA 1NHVA 5FIIA 5CZXA 2ZOMA 2JLGA 1UA1A 3BDPA 4NRUA 1GXTA 2DK2A 2EFNA 2KT2A 4MAKA 4ZPAA 2MDAA 5E3CA 3WC0A 4J9PA 3G71S 2YKAA 1HQUA 7FD1A 4OV1A 2HPUA 3PXGa 1FJCA 1S4FA 1VRTA 2FHKA 4PG8A 1ULRA 2OO4A 2OH2A 4TN2A 4BHQA 5FDLA 4WYWA 1DHMA 4ZP6A 2XHWA 4MK9A 4MYTA 5KTQA 1IKYB 1S1TB 4DR6F 3QGGA 1TL1B 1CC8A 2KJWA 2Q79A 3DLKA 2NPFA 3SI8A 1VQ7S 1DTQB 4NLTA 1MU2B 2IM0A 5KT5A 2Y1RI 4YB7A 2W7PA 4OIXA 2N4CA 2GHVC 3QGIA 2BQUA 4UY8T 3TX8A 5F8GA 4FF4A 3VQSA 1U7LA 2FC8A 4R8UA 1FTRA 3DLEA 3NGDA 3E8OA 1JLQA 5DGBA 4QR2A 1IBMF 4K4SA 3MR6A 2JOQA 2WSFC 2GQ2A 1YJNS 3IAM9 2K7JA 3OXGA 1A9NB 1J5EF 2BRLA 3I6PA 5C25A 2V4RA 3Q23A 1YJUA 4HI1A 2KO1A 3MMAA 1FDBA 1EP4B 2XMJA 3WDOA 2OIHA 5A8KA 1DLOA 2RF2B 2DNOA 3ITHB 5KFKA 3NMAA 3CMAS 1T3OA 2DGOA 2EK1A 4DJBA 3D5MA 4UW2A 5J2QB 5LT5A 1L3TA 1RT6A 4ATNA 4ECSA 2YQ3A 3GB0A 3N6MA 4OQJA 2ZUGA 4DMZA 1UL3A 5L9XA 5I3UB 2X1AA 2ASJA 4ED7A 4LF8F 1BWEA 5MAOA 3SEOA 3PW5A 3FNNA 4H4KC 2JEJA 4L3NA 2KM8C 2OKQA 4IFYA 4KE5A 4OZ1A 4B9NA 2JFKA 3Q24A 2GC8A 4BBYA 3I9ZA 3FEXB 1DAXA 2RVJA 5BYQA 2QT7A 3MTKA 5EWFA 3HP6A 4ZMMA 4ZPCA 4PXBA 5DDQC 4BWMA 1SKWA 3OJUA 3CCUS 5LXRA 2DHGA 5A0YA 4ECQA 1D8ZA 2NPIA 4I4BA 4OJ3A 3KK3B 4W92B 5AXNA 2A10A 2QV6A 3DRPA 3G4SS 1UW4A 3L95X 3OSNA 2MXYA 2WK4A 4O3RA 5B0EA 3N5FA 2POKA 3GFXA