4FXWA

Structure of phosphorylated sf1 complex with u2af65-uhm domain
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
105
structure length
105
Chain Sequence
PLGSTEVLCLMNMVLPEELLDDEEYEEIVEDVRDECSKYGLVKSIEIPRPVDGVEVPGCGKIFVEFTSVFDCQKAMQGLTGRKFANRVVVTKYCDPDSYHRRDFW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords Splicing factor U2AF 65 kDa subunit
publication title Structure of Phosphorylated SF1 Bound to U2AF(65) in an Essential Splicing Factor Complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 29
structure length 105
sequence length 105
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4fxwA00
2DNNA 1VC0A 3CC4S 3Q2SC 1Q81T 2DHSA 2LCWA 5ITHA 2DGWA 2E5HA 2HYIB 3CCQS 4ED5A 1O0PA 2CPXA 4Y00A 1M5KC 2NZ4A 2CPEA 2PE8A 4BS2A 2DB1A 4OZ0A 2KRBA 2LQ5A 3MUMP 3U1LA 5DDPC 2WBRA 2X1GA 1U1KA 2AYMA 1N54B 2RRBA 3IRWP 4WIIA 3IWNC 4WCEQ 2VOOA 5EN1A 4QQBA 1X4GA 3SXLA 3UCGA 2MQQA 4UY8T 1Q82T 1H2UX 1S72S 1YTYA 4CQ1A 2N7CA 3S8SA 2CQ3A 3VF0B 2CJKA 5D78A 1WELA 1WHXA 3US5A 2KRRA 5LXYA 3G8SA 3B4DA 2F9DA 1N52B 2YH1A 1FJ7A 1YJ9S 1JJHA 2E5IA 1JMTA 2CQGA 2M7SA 2SXLA 3K0JA 2DNKA 2ZJRQ 1IQTA 1M5OC 4WKRA 2VOPA 2RT3A 3MD1A 3G8TA 5GAGU 4P6QA 3CPWR 2U1AA 1NJIT 2EVZA 2M8HA 3VAMA 2OSQA 3P5TL 1ZH5A 2MHNA 2MQNA 1YJWS 2MMYA 4QU6A 2A3JA 4CH1A 2CQ0A 3CCES 1YIJS 1VBYA 4EGLA 3J7YU 3MUVP 2KVIA 1YWXA 1X4EA 4C0OC 1N88A 5LSLA 4F02A 1DBDA 1CVJA 1U1NA 2N82B 1VQ8S 2LA6A 1WG5A 3RW7A 3ZZYA 1SJ4P 1WG4A 1X5PA 3G9CA 2MXYA 1A7GE 2LEBA 2DO4A 1WEYA 5HO4A 2MQPA 2RU3A 2XS2A 5JVGQ 1SJFA 2CQ4A 2DNYA 1OPIA 2M70A 2CQIA 2MPUA 2CQHA 4C4WA 2F3JA 2DGVA 2I38A 3VAGA 1QM9A 1VBZA 2U2FA 1FHTA 2DGQA 1X5TA 2M0GB 3RW6A 2LXIA 2CPDA 3UD4P 1YJNS 1VQKS 3CXCR 2OTJS 5DM6Q 2BZ2A 4Y0FA 2D3OR 2RQCA 2ZJPQ 5DETA 1H2VZ 2MJUA 1WF2A 3I55S 5DDRC 2XS7A 1Q7YT 2XNQA 1VBXA 2XNRA 2KM8B 1WG1A 2ZJQQ 2M2BA 2DO0A 1URNA 2G4BA 2M4MA 3CUNA 3P3DA 3BO2A 1FO1A 2AYGA 2OTLS 2VODA 2HGLA 3HI9A 4A8XA 5GAHU 3OW2R 3MDFA 1XN9A 2JVRA 1RKJA 1VQ9S 3CCLS 1HD0A 1N8RT 1X4DA 4W92B 2DISA 2DNQA 3VAJA 3CCUS 1DZ5A 3J7ZT 1L3KA 3MURP 3DXBA 4F25A 1VQOS 3B4MA 2DHAA 3BS9A 1VQ7S 2J0SD 1QVFR 4PRFA 2HZCA 1FJEB 2G0CA 3CCJS 3BEGB 1G2EA 1K8AT 1RK8A 4LIRA 2E5GA 4CIOA 3CULA 2DHXA 3HHNB 5D77A 1K9MT 3CTRA 1KD1T 2KG1A 3VALA 4WFNQ 2KI2A 2MQOA 1KOOA 1X4CA 5IQQA 2RRAA 2HVZA 2EK1A 5GMKa 3FEYB 3CCVS 1SJ3P 4IOAQ 1OO0B 4QU7A 2CPIA 1U1PA 4TU7A 1M1KT 1JJ4A 2YWKA 1M5PC 1SXLA 2RS8A 1F9FA 4TLQA 1WF1A 5CXTA 3UWTA 2L9WA 1VC5A 3S01A 3CMAS 1U1LA 3U1MA 2MZRA 4TU8A 3MUTP 2NLWA 5LJ5Y 1SJQA 2B0GA 3VAKA 2X1AA 3N9UC 2CPJA 2K8GA 2AYBA 2D9OA 2KU7A 3CMES 1M90T 3ZZZA 3MI7X 1VQLS 1VC6A 1NU4A 3R1LA 3PIPQ 1VQPS 1DRZA 2DNRA 4ERDA 4U67Q 2L08A 5H1SV 2DK2A 5LJ3Y 2CPFA 3TYTA 2CQPA 2OSRA 2FC8A 1YITS 3NNCA 4TU9A 2DH9A 2MZTA 1X4HA 2FHOB 3CCSS 3CCRS 3S6EA 3R27A 1U1RA 3P49B 3I56S 1WI6A 2KH9A 2MJNA 1U1QA 5JVHQ 2X1BA 5IM0A 3UCUP 2GHPA 2KXNB 2GO9A 4UQTA 3G96A 1ZZFA 3H2VE 4WF9Q 2RUGA 2DGTA 4QPTA 5CA5A 5DDOC 3G6ES 1X4BA 1UFWA 2CQ1A 1JJ2R 2FY1A 2E5JA 4CH0S 2RNEA 2DNPA 2KXFA 2DNZA 2DNLA 3MD3A 4F26A 1X0FA 2MZSA 1WF0A 2DITA 2MGZA 1UP1A 3THPA 5IM0B 3FEXB 2E44A 2YTCA 1KOHA 1ZZNA 1R8HA 3NS6A 1UW4A 5GVQA 2EK6A 2M52A 1KC8T 3EX7B 2MSSA 5MLCV 2MQLA 3H2UB 2X1FA 3CC2S 1A9NB 2DNMA 4WFBQ 1UAWA 2MB0B 5HL7Q 2MYFA 2J76E 1OWXA 4YOEA 1Q86T 2KN4A 2DH7A 2KHCA 3THTA 5DM7Q 2ADBA 2MGZB 1WEXA 3MOJB 2CPHA 3L3CA 2KFYA 2XS5A 3DLLQ 2DNOA 2RS2A 1HD1A 2MKHA 1VQMS 4LJMA 2MKSA 2PEHA 2MY7A 1P1TA 1VQNS 2DGOA 1NO8A 2J0QD 1WHWA 3UE2A 2RQ4A 1WWHA 2FC9A 1X4FA 3TO8A 1SJRA 1H2TZ 1PO6A 2DGUA 4PKDB 3JB9k 1HL6A 1U1MA 2V94A 4C7QA 1U6FA 2HGNA 5BJRA 2LYVA 2KM8C 2ADCA 2LMIA 2QFJA 1OIAA 2AYEA 2CQCA 3BO3A 3LPYA 1U1OA 1KQSR 1VQ6S 3CD6S 5DDQC 4ZKAA 1B7FA 4Z2XA 2OIHA 2K3KA 4YB1P 4W90B 2M9KA 3VAFA 2HGMA 2YH0A 3VAIA 1FXLA 2LA4A 4YUDA 3ULHA 2JRSA 2LEAA 4IUFA 5LSOA 1X4AA 2XB2D 2LXUA 3NNHA 2F9JA 2G1DA 2CPZA 2DIVA 1VQ5S 1D8ZA 3NS5A 3TP2A 2KG0A 2JX2A 4FXWA 2RVJA 1D9AA 3Q2TC 2DNGA 1QVGR 1W2BR 2CQBA 3EGNA 4V19X 4PR6A 2JWNA 1PGZA 1FJCA 2AD9A 1X5OA 2MQMA 3P6YC 1YI2S 3UD3P 3CC7S 3S7RA 2O3DA 2BOPA 1WHVA 3BO4A 1WI8A 2N3OA 3NMRA 2MZ1A 5FJ4A 1HA1A 1X5SA 4FXVA 3SMZA 1U6BA 2MKIA 2MKCA 1R8PA 2XSFA 4J5OA 5GADU 3D2WA 1FNXH 1VQ4S 1H6KX 1K73T 1YHQS 3SDEA 2DH8A 2LKZA 1P27B 2J8AA 2KYXA 1AUDA 1U2FA 1S79A 2MY8A 2DGSA 3LQVA 4LMZA 3UCZP 2N3LA 2M8DB 1M5VC 2MZJA 3CCMS 2M88A 4WFAQ 2VONA 2CPYA 1WEZA 4RU2A 3G4SS 2DGXA 2QEXS 2ERRA 2D9PA 2MKKA 2DNHA 1WTBA 3MXHP 3VAHA 1FT8A 3EGZA 2DHGA 4IOCQ 2OJ3A 3G71S 2Q79A 3R1HA 5CYJA 4M5DB 2LECA 3CF5Q 3NNAA 5GAEU 3PIOQ 2KT5A 2CQ2A 1DHMA 2YKAA 4OZ1A 2QA4S 2KXHA 5LXRA 2I2YA 3SDEB 2MZQA 2UP1A 1BY9A 2MSTA 2MKJA 4IO9Q 5IFMA 2DIUA 2JVOA 1WHYA 3V4MA 2L41A 2CQDA 2FPHX
chains in the Genus database with same CATH superfamily
1VC0A 4USWA 1L3TA 3C8YA 5GAGI 4KRWA 3MEEB 2RF2A 1N54B 3G82B 3D1QA 1SC4B 5AJ3F 3LA0A 3GV8B 2I0XA 3NGDA 5M2PA 3PCOB 3EGWB 5A8WA 4EMDA 4DMZA 1I6JA 4L76A 1XR6A 4FPRA 1QAJA 3G8TA 1NJIT 3DLBA 3CO0P 4X65F 2MMYA 2ZC3A 3J7YU 2HRYA 1DARA 3K8VA 3DHXA 5A6WA 2W2NP 3FKBA 5ETKA 2V9WA 3PZPA 3AH6A 1GX5A 3DRRB 3CCZA 3KJVB 5KFKA 3IR5B 2AV5A 1S0VA 2P9GA 4C4WA 1AW0A 1HQEA 3SQGB 2B4OA 2HBQB 2KT2A 3RW6A 2M0GB 1H7XA 1TL7A 2HNDA 4NI2A 2ZZMA 4X62J 5CD4A 3IG1B 2H4YB 2XNQA 3HVTB 1S59A 3GPAA 3HFKA 1TZ0A 4NCBA 3P3DA 3RZAA 3ZTQA 1M5SA 4A8XA 5AE3A 3OW2R 1S9EA 4ECYA 3CCLS 2F4VF 2XMKA 1QVFR 1V3ZA 1K8AT 1VFJA 5BYQA 4ZVFA 5HN0A 4K4YA 3OVSA 4ANDA 5GMEA 2DD8S 3TX0A 1TL5A 7FDRA 3FEYB 3CCVS 1M1KT 2C2RA 2APOA 3NCRA 4DLGA 1M5PC 3MCSA 4JV0A 4CT9A 2QGFB 3S01A 3ELHA 5LJ5Y 3UDEA 1JLEB 3OUYA 3P5BP 3M8YA 3HVWA 1QE1A 1DLOA 2ZOMA 3MI7X 4ZP6A 2DRAA 3MMCA 4P10A 3BB5A 1N5QA 1OY9A 1FEEA 4HYKA 5D0EA 1QAIA 2OSRA 3NNCA 3DLHA 3PR5B 1WTFA 1CSJA 1KTQA 3G96A 3H2VE 3LGNA 3KK3B 2HG4A 2GJ2A 4L73A 2CZ9A 1F5BA 4YB7A 4M5DA 4ID5A 3V81B 2GQCA 1WKLA 5L1JA 1RWKB 2EPIA 3MHYA 3BSAA 2B9XA 4JI0J 3THPA 3C16B 1UVLA 1KOHA 4WU3A 1C1CA 1CJVB 4JV2A 4PUOB 1A9NB 1RAFB 4YOEA 3DI6A 3EVMA 4G1PA 3TA2A 2HS0A 5DLGA 3DM2A 4WZQA 1WWHA 4KBIA 1X4FA 2DGUA 1NUEA 3IN5A 2CFXA 4XDDA 4ZVEA 1GK8A 1PG5B 2LMIA 3BQ1A 1TELA 4MKYA 2ZH6A 2QFJA 2NXJA 4NCGB 2W4CA 1SL1A 3L7PA 4CRJA 4H4OB 4YUDA 4Q8FA 5KG1A 3OPKA 3FDSA 2CPZA 3IWLA 1D8ZA 2VG7B 3N4WA 3MR5A 4QBUA 2B6AA 2HQDA 2WW4A 3EJMA 3KLGA 3CC7S 1JJCB 3BJYA 1NJYA 3I4HX 2HHSA 5KFQA 3TARA 5KFNA 1VQ4S 1L3VA 3MEGA 1APSA 2P6TA 1TUGB 2JNJA 2R2UA 3WX4A 1RAHB 4NZ0A 1P27B 3K17A 1YZ7A 3CDEA 5LMNJ 2JC1A 3MMJA 3MECA 5ETRA 2B4UA 2DGXA 1NJXA 3VAHA 1TP7A 5DRKA 3NOGA 3VR1A 4IOCQ 1KLMB 1FKAF 4MK7A 1AFJA 2UZAA 1SC6A 1U6ZA 4WTYA 2JVOA 2RSQA 4FF4A 5J2QB 4RL1A 2OGUA 2Y1JA 3MAAB 3QWPA 2CPXA 5KT7A 5E3PA 2CKWA 2R7RA 2QYCA 3WHIA 2GFFA 4MIAA 5D4NA 3OL7A 4CZCA 2CADA 2H4WB 4CQ1A 1PBAA 2V63A 1GNKA 2PMHA 4FDFA 3E3XA 4X2BA 1N52B 1CULB 2UXBF 3OD2A 2AHOB 1WNEA 4WKRA 4A8SA 4LF4F 4EFAC 3H5YA 5FLXY 1G3OA 1U24A 3P5TL 3M9MB 2K1RA 4RBTA 2A3JA 4CH1A 4FYDA 3CD0A 3DDIA 1UKUA 1BQNB 4F4YA 2FLPA 4DLEA 4NLVA 4I2QA 1GMWA 1F6TA 1FVSA 1RAOA 1RTZA 4G1IA 2WVBA 5H9EJ 2RU3A 2CJBA 1YBTA 1ACMB 4ZPBA 1WC5A 3AQOA 1VGYA 3TUZC 4DCJB 4KSEB 4C98A 3UD4P 2OTJS 5CD4H 4RNFA 1ZA1B 3CGIA 2MJUA 1ZYQA 4KHRA 2ZJQQ 5HVHA 3H98A 1YLXA 5E2QA 3BBBA 5A8RB 3BH6B 4KH0B 4QWCA 5IT9Y 2G2YA 2UUWA 2GZOA 1JLGB 1UVJA 4K50A 3PEJA 4N8OA 3EYZA 3J80U 1DQ8A 2UUAF 2OKQA 1DZ5A 3DXBA 5E3QA 4ZCIA 2VASA 1VQ7S 2R8HA 2W2OP 3ZNJ1 3CCJS 2BJ8A 1N4LA 2H5EA 1NMEB 1XEZA 4BWJA 3T9ZA 1LOUA 4K5RA 4ZVUB 3HSDA 1C2PA 3CMQA 3MOZA 4NLYA 2MKYA 3PJWA 3VZHA 3V6DA 1QAXA 3MUTP 2D3O1 1TK5A 3VAKA 1S9GB 2F8MA 4YN3B 1S0OA 1WKJA 2KU7A 3T19A 3UI3A 4NZ7A 4O4GA 2IC3B 3X1LB 3UO0A 5CQGA 2YKPA 2V2VA 1RYSA 3G87A 1HI8A 3RAMA 5C25A 2JJ4D 3IC1A 2IRUA 3J7Z5 1VLYA 2W2PP 3OR1A 2GHWA 5DZ7A 2GHPA 4KGZB 4EZ9A 2JHEA 1S49A 5K20B 5BR8J 4YR0A 2IMWP 1MMLA 3MM7A 1NM2A 4NYZA 1PAEX 3CJ2A 1XR7A 4NLGA 5HP1B 1WF0A 2DITA 5E41A 5IS2A 3BPDA 4DR7F 1FE4A 1BQMB 3QIPA 3CEDA 5KFOA 2ZM6J 4OYIA 2IY5B 4GC6A 2Z2YB 5HL7Q 4RZRA 2BUNA 3BSNA 4ALZA 3SV3A 1RAAB 2DH7A 1MWYA 5DM7Q 4LFCF 1RWMB 3L3CA 1V5IB 2HHPA 1FI4A 3WIUA 4ILLA 4C8KA 4LF6F 4YFUA 1R3NA 2D74B 5I3UA 4IRKA 4Y6IA 1T9XA 2FUG9 2ZITA 3JB9k 1CJTA 3A12A 2J0WA 4UOHA 4DQPA 2C2KB 2R7UA 4KR0B 1E6YB 2R2RA 5DQIA 3E01B 4QJVA 2CQCA 1KQSR 3FBCA 2FVCA 3QAUA 4DV5J 3MGJA 3VAIA 3I9V9 1FXLA 4MTPA 5ETPA 1HIYA 1RWPB 4Y65A 1S1XA 3M2UB 1YDLA 1AZSB 4DU8A 1UJ4A 1HBUA 2MHEA 2IA6A 1T94A 2W7AA 4ECVA 2OPRA 4PABA 3P6YC 1TL3A 2ZOGA 4F50A 4BC7A 4K0KF 5L38A 2IMOA 3CDUA 4AL6A 1WC4A 3Q8QB 3QZ7A 3L9ZA 1U2FA 3NS7B 2V50A 4B3MJ 4BLGA 4CH7A 1WEZA 2Q66A 3G4SS 3PJ9A 2QEXS 2XEXA 2Z30B 4U7CA 1ZM2A 3HULA 3O6QA 3QNWB 4RW8B 2C28A 3NNAA 4RW9A 5GAEU 3CCWA 3NRBA 4OX9J 1UETA 3EVOA 2HHWA 2LQ8A 3M6WA 2GW8A 4M5NA 2NCKL 2ZUGA 5CZXA 1Z2LA 2YVSA 4ED5A 1V6HA 3QRRA 3GFXA 4NLOA 3TQ1A 4CT8A 1HNIB 1V5VA 3P45B 1FD8A 2NYHA 1YK9A 3WIVA 3AB2B 1ZOTA 4HDGA 2B4PA 1WHXA 2GA7A 2FDNA 4G1QB 1TVRA 4JI8J 4MT1A 1YJ7A 3AA8A 2YXLA 1F0XA 3PW7A 1UVMA 4AQYJ 2HAIA 4Z37A 1VRUA 4DR4J 2V9KA 3KK2A 2E1AA 2YX7A 5E5NA 3MM5B 1FNOA 3V5RA 2GVDB 3C15A 4EGLA 5L1KA 1IVZA 1RT5B 1T05B 4HI2A 4WP3A 1I1GA 3IXQA 1FRMA 4Q7AA 1R6VA 4LVOP 1S0NA 2IDEA 1HMVA 1F9EB 2HHUA 4ED6A 3BSCA 4H4MA 2HFVA 4CO4A 3HT3A 2AEFA 4OX6A 2UV8A 1DFDA 4AD6A 4F4KA 4DV3J 5ETOA 3IBCB 1XNQJ 3GJSB 3GE9A 3DOKA 3I5CA 1TFYA 3BO2A 4K4TA 1RHKB 4N41A 1XN9A 4ZN3A 4PYAA 1VQ9S 3W9JA 4EO6A 1MLAA 1S1UA 5FD1A 3CCUS 2PI4A 4QWBA 1PIEA 1VJWA 2HW3A 4L3KA 2HHHJ 3HSJA 2FB0A 1IJEB 2DHXA 4MFBB 5KAKA 5E3RA 4O3NA 3CDBA 2BJ9A 2HNYB 2CVIA 2RRAA 5GMKa 4IOAQ 1UEKA 2HLUA 4X64F 2CPIA 4ELTA 1U1PA 2E1CA 1ZTTA 4NOHA 2JZ5A 3RB0A 3DGPB 5KT4A 3R7SB 4GVBA 3MM6B 2QG9B 3D68A 4R0EA 2B0GA 1FTCA 3JSBA 4H4KC 1LWCB 3V4IA 3JSMA 3PIPQ 5KFBA 2BQ3A 2BR0A 1YBUA 2Q3PA 4X66F 3O8WA 2AF6A 3FUYA 4TU9A 3OFEA 2MZTA 1VRTB 2VPXB 4LREA 3OR2A 1FKOA 5IXUA 1DQ9A 1MNEA 3W9IA 3CCTA 1N33J 1X4BA 2QLWA 3FZBA 3PO4A 2FY1A 2AP6A 3D0HE 3IA0A 1KP6A 2UUCJ 2DHHA 2PIIA 1C4CA 3V6KA 2DEJA 4DUYF 3TZZA 5D4LA 4B9SA 1XMQF 4DSLA 4ZP9A 3H2UB 4NLWA 2W9AA 1T03B 1BC6A 2W01A 2KN4A 4J9OA 4OX8A 2KHCA 3CT9A 2CPHA 2XMVA 2CZVC 1FRXA 1RWWB 3R5BA 4M5HA 1U09A 4LJMA 3G8QA 2F8EX 1C1BA 1NO8A 2Q6CA 3AAWB 3OL9A 3DRXA 1EETA 4G65A 4USMA 2B5JA 3QO9B 5BYRA 3BF4A 2LFVA 2YBVA 3FRZA 2DRDA 1F2GA 2JEIA 5DDQC 3QPIA 2K3KA 2IM3A 4D3GA 2VG6A 4RBVA 3K5PA 1IKXA 3I0RA 1S1WB 2VD3A 4JI6J 4I67A 3G6YA 2FJBB 3QJPA 3GFYA 4O0NA 4I64A 1FX2A 2CQBA 4LF9J 3UDVA 4OMFG 3G2XA 1HW8A 1N5TA 3DGVA 1RT4A 4TKTA 5KFFA 2CIMA 4XO0A 3KLFB 3AT1B 4PG5A 3JYTB 2N4CA 1RGVA 3ILIA 1AYEA 4B3OA 4F3OA 1IKVB 3EZUA 1S79A 5ETLA 4M5MA 1LFWA 3U1NA 3OQ2A 4K4WA 4I6WA 4GC7A 1DTTB 1CQMA 2KFZA 2OEJA 5C2GA 3GWCA 3D3BJ 2RIJA 3F44A 4DSFA 3V6JA 3QIDA 5J1EB 2CQ2A 2XSJA 1O6XA 3D1HA 2KL8A 3GYGA 1UZHA 2DHSA 1C0UA 4USHA 2AX1A 3SZ2A 4LT6A 1DTQA 5HROA 1TL1A 2HZVA 3SXLA 3CJ8A 1XWLA 4ETZA 3P4UB 2F7VA 2ZH1A 4DQIA 3PTWA 3HKWA 2DPIA 1IKYB 5HANA 1JMTA 3K5LA 1HWJA 2ZJRQ 2QLBB 4ELVA 4HI1A 1LXJA 3HDSA 1MW7A 3POTB 4WP8A 1FEHA 3DNCA 2QA2A 4F36A 2COLA 2HHVA 1TKXA 2O67A 2ILZA 1NDKA 4AXJA 2G9OA 3CJQA 1CVJA 1U1NA 4CLKA 1Q95G 4DR6F 1T9VA 3GCXP 3W2VA 2MXYA 4F0HA 1CS4A 4NLUA 3MMAB 1RHQB 4DV4F 2LDIA 2OP5A 5GAHI 1ZAWA 2GO8A 4N47A 1JX4A 3D5MA 4DSJA 2CQHA 3OSPA 1YKWA 3UW1A 2VA3A 1ZTWA 4URSA 2KZZA 3DXSX 3RRKA 5C2CA 4NXNF 2RU9A 4FF1A 4Q8EA 4KFBA 4I1TA 3QT7A 3UNYA 3I0SB 3M6XA 2Q43A 2E7WA 4OZJA 1RKJA 1RLCL 4MKVA 5DO2A 4DL6A 4W92B 2HURA 3LAKA 2W8KA 2VQEJ 1REGX 2QO3A 4KPCA 2W9BB 4CIOA 2YQ3A 2VHGA 4HVZA 4OJHA 2RD5C 4TY8B 3OV7A 5K8NA 1KD1T 3ZZOA 2LDYA 3ZTRA 3VALA 1J5EJ 2KI2A 1SH2A 1X4CA 3F56A 2HVZA 2EK1A 3MZIA 1SJ3P 5A8KA 5M2UA 1SC1B 2YWKA 4PPZA 2Y8WA 3CNQP 3W3SA 4DZ6A 4J37A 3T9NA 3M8PB 2FJWA 4IG3A 1B70B 3EICA 4CI0B 3EXYA 3N6NA 2LQ9A 1M90T 3R1LA 4F4WA 2XMAA 1T8EA 1IWAA 2AKWB 3LP1A 4IDKB 3DYAA 4ZA1A 5F41A 3QGGA 5JVHQ 2WHOA 5AXMA 2POKA 3KJFB 1HLWA 1A6LA 3EPIA 1LW2A 5IV3A 2JEJA 1RTDB 4CO3A 1KWMA 4CLLA 4B3TJ 1X31C 3FVYA 3AD7C 3P8BB 2MGZA 3MPYA 3Q86A 4CP5A 2FZCB 4C8LA 1HQEB 3ILLA 1JIHA 1J5OB 4NI2B 4ZCMA 4FZVA 3M9NB 4WFBQ 1Y3JA 4FNIA 2XYPB 5KFCA 3ITHA 2BQUA 2CG8A 3HFVA 1HBNB 3WZ0A 2RHQB 1T02A 3BKFA 1VIOA 3BREA 1S9EB 2ZBIA 2PEHA 3JQMA 1NHKL 4ZPVR 2E1RA 3TO8A 1SJRA 3H25A 2HQGA 2WOMA 4A46A 2C2OB 4OV1A 1FRLA 4DV0J 1MWQA 3EDQB 3Q83A 1SV5A 4UT4A 3R97A 2PSZA 2CJAA 3MPDA 5THWA 4DPXA 5HK4A 2M5YA 4R5PA 4BDPA 1E6VA 2KG0A 4FXWA 3THVA 4XAKA 1ZBTA 4CLWA 1KSPA 4G6VB 3F73A 4B9UA 2FHJD 4A8YA 4X84A 3OUYB 5J2NB 3H90A 1S6PA 2AIRB 1SIZA 2MKIA 2MDAA 1RHMB 2ZD1A 4C3KA 4LFBJ 1KEKA 5SUHA 2QX0A 2OUGA 4ELUA 2EFNA 2EBGA 2HHXA 2KYXA 2DGSA 1AUSL 2UUBJ 3LGMA 4H4KA 4AXIA 5C42A 4IOBA 2OAUA 4AQYF 1TKZA 4KT0C 3GIJA 4JI4J 4UY85 4M5DB 4DV7J 3KXDA 1FWLA 1HPZB 2HQIA 2F63A 2MKJA 3IS9A 3IAS9 3QT6A 2IBKA 3Q2SC 2RMLA 3GZ7A 2CXEA 2JH3A 1HBOA 2DGWA 4E8UA 2V4JA 2Z58B 2JFKA 2FVQA 1FRHA 1R43A 1NJWA 3Q8YA 5I42B 3I87A 1N5YB 4F2RA 3OHBA 1XMBA 3UCGA 1SIWB 3H40A 2HWTA 5H9EK 3HHDA 3C14B 1R6YA 3FSYA 2YH1A 4JYAJ 1XNQF 5L46A 4UW2A 3UR0A 4JI2J 3C6UA 5GAGU 4EU0A 2MQNA 2PI5A 4F02A 1UJ5A 3RW7A 1WG4A 1UVKA 1ZM3A 1A7GE 2CDRB 3Q22A 2B6AB 3IO1A 4KJIA 1U2CA 3KLGB 4ZHRB 1N48A 2LXIA 4U8VA 4DPOA 1YJNS 2E1MC 1EQMA 3JTPA 1VR6A 3DLGB 1VK8A 3CUNA 2Z8QA 2E66A 2HNZB 3NWRA 2BW2A 2OTLS 2FGOA 1HR0J 3RB6A 2HMIA 3O44A 3D6MB 3SI8A 3W61A 2CA9A 2HRTA 3OXGA 3TUIC 4X4PA 3PFOA 5E3CA 1U8WA 4ZVRB 4HDHA 3B4MA 2W2QP 4F4ZA 3KHRA 2UU9F 3KYLA 2J0SD 3MWBA 2G0CA 3R5JB 3TUJC 3CULA 2MLXA 3K57A 5D77A 2KG1A 1WOPA 1MN7A 2QMUB 1TAUA 4LBIA 3OLBA 3CE8A 2Z0GA 3ZNUA 5CYQB 5FDLA 3K5NA 3ZZTA 2P5VA 1RB0A 1JKHA 3EVWA 2CPJA 3Q8UA 4DG1A 3H2LA 2AYBA 4Q0BB 1XR5A 4MKAA 1SQFA 3SEOA 1YITS 3M8RA 2HBRB 1R31A 4RKUC 3P49B 1WI6A 3GV5B 2UXDJ 4DUZF 3HM9A 3UCUP 3M2VA 3J7AN 4NRTA 4ILRA 4QPTA 2B56A 2IYGA 4ECTA 3G6ES 1YSJA 2C1EB 1JJ2R 4UOCA 1G1XA 2RE1A 2ZBPA 2WSEC 1Q78A 4DSKA 4O3PA 4FPIA 1T9TA 5F8MA 1HYSB 3FEXB 1FESA 1NZ8A 3NS6A 4URQU 3K8WA 2BM0A 2NREA 3NAIA 5KFYA 3WBZA 3LP0A 2MSSA 1NRKA 1VQYA 2IFXA 5LOQA 4U9RA 1NSPA 1BQXA 5B09A 1EZZB 1T11A 1WKKA 2E9TA 4P52A 4JI1F 2GIFA 1IR0A 2XZWA 2Z56B 3D6FB 1OS5A 2MY7A 2AZ1A 1VQNS 3H4DA 4PQUB 3EXCX 2OEKA 4LF1A 1MROA 4K7QA 3OL6A 1U1MA 3PW2A 4JV1A 2WB1D 3RBZA 3D0IE 5AXKA 5CZVA 4U96A 2ADCA 3TJ9A 2YNIB 3DMJA 4L6V3 3VGUA 2HFZA 5GADI 1B64A 1Q53A 3GYXB 2YX4A 2HVHA 3T5JA 1QJHA 3O5TB 3QT8A 1WSRA 2G1DA 2DIVA 3M05A 2HLTA 3DFEA 1NBEB 2R7XA 2DT9A 3NGTA 1TKTA 3HHEA 3MEDB 2N3OA 1XQIA 1TQLA 3J81Y 5J2MA 4O4GB 1HNWF 2BJEA 3JSYA 2BE2A 1CC7A 1VS3A 5KFUA 2AEMA 2YWGA 1I94F 4JBCA 3OTOF 2HFSA 4ITSA 5J1PA 4WFYA 1UPMB 5C25B 2GIRA 4N77A 2VL1A 4PCQA 3OR1B 4WFAQ 2A2CA 1NHVA 4LUBA 3G71S 2I5JB 2LECA 3TAMB 4OZ1A 4PZVA 3MM7B 1CJKA 2J0XA 4WJBA 1Y3KA 1BMQB 2FQQB 1H7WA 5B0FA 5HVGA 2E7XA 3UVJB 4DHVA 1ZAVA 4ZVPB 4F04B 3J80Y 3ZZPA 2E5HA 4ZIVA 2XY7A 2C3UA 1GXLA 2CWKA 4OZ0A 1XMOF 4N8NA 4N56A 4MMOA 3CIMA 5KTQA 4OIXA 4ED3A 1LWFB 2MTLA 3S8SA 4Y2KA 2KRRA 3VWSA 1BLUA 1Q8LA 1QAYA 1FDBA 4P2FA 3QATA 2VBXA 4DPWA 3QRQA 1UPPA 2OLWA 2HHQA 2LLZA 3A8JA 3ZFVA 1WC0A 4XK8C 5H9FK 5JUMA 3ZTSA 2V4RA 4PWDA 2LQJA 1YJWS 2ZHAA 1YIJS 3CJ3A 3QFHA 1U4BA 1WC6A 2KVIA 4X4QA 2AJ2A 2KO1A 3GB0A 1WG5A 2DVIA 3UFCX 3G9CA 1S1XB 1YQHA 3JAMY 2XMMA 3GCWP 1B0TA 4TXSA 5J2PB 3CJKB 4DX8H 1J5EF 2DNYA 5EX0A 1EX8A 3T1AA 3BPSP 1DY3A 3PYDA 2CPDA 1VQKS 2O1PA 1RWUA 2IRXA 1VRQC 1B0VA 1RWOB 4Q2LA 3MTKA 5DGBA 4P71A 1RTHA 2XO7A 4KKOA 1S0MA 1XIQA 2HVDA 4Y2CA 1WC3A 4BWMA 3KKFA 4WIQA 2B9YA 1NHUA 4EBDA 1X4DA 4OI4A 2DNQA 5IWAJ 4M5GA 3AFGA 2I6WA 3JQJA 4DPTA 5DQHA 3M32B 5EX3A 2QT7A 1LWEB 1K9MT 3TVYA 3OJSA 4DR2F 1O8BA 5G4DA 4TU7A 4B3TF 4U95A 3DDNA 4OYOA 5F9NA 4P9SA 2F65A 5CXTA 2KFNA 4M5KA 4FS1A 2C3PA 3SCIE 2WCXA 5KFXA 3GILA 5F8LA 1JNRB 2BEFA 4OYMA 1TVRB 1RACB 1VQLS 1KLNA 4ERDA 4U67Q 2HRUA 2L08A 4OL8A 5H1SV 5LJ3Y 2FC8A 2GQQA 3AJDA 1PCAA 2YKNB 2IJRA 3KK2B 1V9OA 3HKZD 3D6HB 4KV8A 1AXQA 4A8WA 3T1YJ 4FBTA 1JLBA 4DV6F 1ZPWX 2OFHX 3FMWA 4OYAA 2BRLA 2XO6A 5DDOC 1UFWA 3K7RA 4QIEA 2XC9A 4FXDA 2R2TA 5ETQA 2KJVA 4KO0B 2HQFA 1HMVB 4F26A 3CB4A 3MM9A 2RUSA 3OXLA 5D8HB 1F5CA 3U02A 1NDPA 4DN9A 1RBOB 1N36J 1NK8A 4JI7J 1FK9A 2DNMA 4DV1F 3SBMA 4OHZA 4R8UA 1Y7PA 1FRIA 3OFGA 3W60A 1RHJB 5I4MA 2E9RX 1VQMS 1F3VA 4YEAA 1P1TA 5KFDA 1LFPA 2J0QD 4DCOB 1S1UB 3U27A 3IR6B 1VCTA 3T41A 1TV6A 5HBMB 4DR3J 1C0TA 4EYIB 5KFRA 2VUGA 4JI4F 2XQCA 3X3UA 4DR5J 1S77D 2QV6A 5AE1A 3ENWA 5LSOA 2LXUA 5KT3A 1VQ5S 2EG1A 4FF3A 2H51B 2MQMA 4IFYA 1F9HA 2BOPA 4Y28C 4LRDA 1F60B 4JI3F 2ZE2A 1IBLJ 1RADB 1FCAA 1IQZA 2DR8A 2DPJA 4OYXA 3CJ0A 1AUDA 4CO0A 2EFVA 1REVA 4LRCA 1K47A 2ROPA 3HXMA 3SSSA 3W8GA 4ZLNA 1RBAA 3EGZA 1UZDA 4X4SA 2Q79A 3NBPB 5F9LA 3D4JA 1XNRF 2HHTA 4YHHJ 1QD1A 2PO4A 4IG0B 3GTYX 1WHYA 2PA3A 5LT5A 4KGVB 3V4MA 4EBEA 3CD7A 3PV8A 2JFDA 3CC4S 2HBYB 2LCWA 2ASJA 5A0YB 3GQCA 5KFVA 1BGXT 4DFPA 1NPRA 4FN5A 2HS3A 4LF5J 5KFJA 4DWIA 1IWGA 1FE0A 3OVAA 4RW7A 1HQUA 5L9NA 3OSNA 2CQ3A 1CG2A 1M1HA 3LO3A 2DNKA 2G0IA 3MD1A 4ZVTB 4P6QA 5F0UA 1U2RA 3R3TA 2G2ZA 1MN9A 2B5JB 2NXNA 4PXBA 4K5SA 1HR0F 2CJYB 1B4SA 2YWFA 3KJVA 1JLQA 4W98A 1SKRA 2L3MA 3GSDA 1VBYA 3PM9A 3SQGA 1YWXA 2VG6B 1DBDA 1VQ8S 4FVCA 3ZZYA 1I3OB 1KFDA 3AQPA 2JC0A 4KYZA 2KJWA 3HVTA 2K06A 3IP0A 2Z57B 1RI7A 3I9ZA 3WC0A 1SJFA 2EKYA 4DUTA 5IC4B 2G2OA 3T5KA 1N0UA 4LQ9A 1TK0A 3NMAA 1VBXA 2F5GA 4GMKA 2M2BA 1VDHA 4FKYA 4ATNA 1OMSA 2WTFA 1N32J 2XHCA 3R7NB 3QBCA 4XPCA 2VKZG 2JDJA 4UZBA 3MAHA 3FQLA 3W2WA 1UMJA 3BS9A 1KKHA 1NPKA 2ZWOA 3ISND 4C0BA 3FGVA 1KTVA 2YNHA 1JLEA 2OEMA 2AGPA 1HQ2A 2H5JB 1FX4A 1C0UB 2A6OA 4ZS6A 4TQRA 4EK2A 2WSFC 2VV5A 4X4TA 1WF1A 2RRNA 4DI6A 1VC5A 4OYWA 2IJFA 4DX5A 3U1MA 4NRUA 4B3SJ 2KB2A 3PX0A 2XLKA 1A0OB 1Q0NA 2OD6A 4QIWD 4NL5A 2D3UA 1TAQA 3KK3A 4R25A 4RUBA 2CWXA 1H0HB 1S7HA 2BM1A 4DQQA 4S0MA 4LF7J 1NKEA 3PX4A 3V81A 3B78A 4ES2A 3WDOA 4K4ZA 2J9DE 1JB0C 3I56S 2NS1B 4RNNA 1GAOA 3C16A 1TKXB 1VBKA 4U7UD 4DF8A 4WF9Q 1CJVA 4HL9A 3BBCA 4PUOA 2BQRA 3W2VB 3W5YA 2E5JA 4CH0S 2NQPA 1YRXA 2V4QA 1R0CB 2MZSA 4DOZA 2E44A 2YTCA 4BCAA 1ZZNA 4ES3A 1EAYC 3AD9C 3FCVA 1U47A 2BYCA 4EYHB 2NPIA 3RB4A 1WUUA 3AOAA 4JV5J 4ZPWR 2F8HA 2ZC4A 2KT3A 3QGHA 4B9MA 1S4FA 3NGUA 1B99A 1S1VB 4ECUA 3GIRA 3THTA 5F8NA 2LEPA 3EM1A 2XY6A 1GTEA 3CDWA 1VJQA 4CCHA 5CYMA 4UF4A 1Q16B 4ECWA 3M4XA 4C8ZA 4ZVQB 5C7PA 4OX7A 5RUBA 4KQZA 4M63A 2WBMA 2WB4A 4ZVHA 1HL6A 1TU0B 2VG7A 4X4RA 2LYVA 3SFGA 4QR1A 1IBKJ 3Q23A 2J6UA 2M9KA 5EWFA 4LBPA 2OELA 2V8VA 5A8KB 3O3LA 2XB2D 1QUVA 3BYPA 1NK6A 2K7KA 4LVNP 1SKUB 4OQJA 3RBEA 1WHVA 3HSZA 4Y34A 3PKYA 1Y5LB 2V68A 3SMZA 5K8MA 1OSDA 1K73T 1YHQS 3T1HJ 3DYAB 5ADZA 5IT9U 5B0AA 4A8FA 2XWXA 5J2QA 2OFGX 3NP5A 2DHGA 4DJBA 1LW2B 2YNGB 3SDEB 2MSTA 2DJWA 4OHWA 4MYUA 3MFHA 3KMSA 1PBUA 2LXFA 4K4VA 2HYIB 5BYSA 2IM2A 1CULA 3DLJA 1ROFA 4M1KA 2VA2A 4ED1A 2R4FA 1Q79A 2Y1LB 1RTJA 1S72S 4TN2A 1NDCA 4DF4A 1HI1A 1HHSA 4YDXA 1BQNA 3CJSA 2NXEA 4YY3J 3IRXB 3TEGA 4NLRA 5LMUF 4DPYA 2E5LJ 2OO4A 3MM8A 2XMWA 1SV5B 3FFIB 2LA6A 1PYSB 1ZAXA 3DU5A 1HNXJ 2MEWA 3RYLA 2LEBA 1BXNA 2DO4A 2OPQB 1FJGF 4YP3A 3Q8VA 1RWVB 5A8RA 2AW0A 1JNZB 4ICLB 2R7SA 3PEHA 1N6QB 4DEZA 2U2FA 4DL0C 1X5TA 4WE1B 1WACA 2B7BB 1GXTA 4HHUA 3GP9A 1XBWA 4WZMA 2ZD1B 1RYRA 1EIYB 2RQKA 4DS5A 2VC0A 1RISA 1R27B 5C24B 4ED7A 4GKKJ 1RT6B 1FO1A 4NZ6A 3HHKA 5GAHU 1QUPA 3W62A 2HAFA 2HFUA 3F41A 5D15A 2BDPA 4JI5F 1HNZF 2EI5A 2YY3A 3GFHA 4OYPA 1VIXA 3FBEA 2J8SA 2VG5B 3WC2A 5T14A 2J9CA 3IS9B 4BC9A 5E33A 3RUBL 3ILOA 4WFNQ 1KOOA 1S9GA 2HQCA 4XIUA 4QU7A 2I1RA 4IFVA 3NL0A 3DHWC 2V4JB 3BN4A 2DYAA 2IC3A 1JJ4A 3GIKA 3GU0A 1H74A 4CTAB 5HMXA 1N34F 3A13A 2MZRA 1N36F 3TA0A 3W7BA 1RT7B 1D9FA 4CWBA 2FLNA 2KDOA 4DL3A 5KT6A 2ZKUA 1FDNA 4N7TA 5MAOA 3CJ4A 4DV2J 3F0NA 3AA9A 4LIWA 3AODA 3T3FA 2AGQA 4U6PA 3A3NB 2A6MA 3MF5A 5ETTA 1N5SA 4J9VA 2GNKA 3KLHA 3E51A 4LF8F 1U1QA 1LW0B 2X1BA 5G0RA 4I69A 5AJ3J 4I56A 2PFFB 4NE9C 2VPWB 3M9OB 1VISA 2R8IA 1X7VA 4DR1F 1X9WA 2E9ZA 2Q6BA 3VVUA 5KFMA 5L8RC 3CD5A 4RWXA 1KC8T 2K2PA 3BM7A 3EX7B 4QWAA 4HHHA 5MLCV 2MQLA 5HATA 4X65J 3SCJE 1R0AA 2X3GA 3CC2S 3DU6A 2MYFA 3NCQA 1D09B 2QZ8A 4NLPA 1E6YA 3MFIA 2HMIB 3E01A 1HD1A 4KHPF 2VFVA 1LK5A 2H3EB 3A8KA 2FC9A 2BACA 3W1YC 5CCMA 3LGHA 1NK9A 2IVYA 3IM8A 1M0SA 3M2UA 4USKA 3HZGA 4DFKA 4CLFA 7AT1B 5L1LA 4RWWA 4ANCA 1OQ3A 1XTZA 2E7VA 4ED8A 4ZKAA 3VAFA 3IBWA 5B0DA 1LV5A 2LA4A 2QMWA 1K0TA 1MG7A 1PJ6A 1AB8A 5FDLB 4RW6B 3NS5A 1QDUB 4OYBA 2AD9A 2F4VJ 4DL4A 3RR8A 3GJRB 3W66A 4I68A 1NCLA 4X4OA 3MCMA 5CH7B 4DG1B 5FJ4A 1FFSB 2GX8A 2ZUAA 5DGAA 2CNLB 1R8PA 1RT1B 4RW8A 7FD1A 1FNXH 1QSYA 2FJXA 3HD1A 2V2QA 2MY8A 5D0HA 3TAQA 2N3LA 3KJNB 5DS7A 3CCMS 2VONA 5D6GA 5K14A 3IM9A 5I3QA 4C8OA 1WTBA 2DNHA 4MAKA 1LKZA 1S1TA 3KNGA 2CVEA 3BR8A 3NAHA 3DRSA 2ZZTA 2XHWA 2QA4S 1HNIA 4ZITA 3BDPA 1B0PA 3HMJG 3Q8RB 4Y3CA 2GMJA 3TOQA 4NEYA 2VICA 2HSEB 1WDTA 3TRGA 4G1QA 2ZDPA 4A47A 3LP0B 2WSCC 1YJVA 2JLFA 4ZPCA 5HQLA 2WBRA 4LSNA 2X1GA 3R5AA 1RKIA 3IWNC 3BH7B 2V67A 3M1VA 3TNVA 1WD6A 3MM5A 5K8OA 2GVDA 1SH0A 2HFOA 1FJ7A 3A8EA 1IN0A 2E5IA 1MROB 3W5XA 4ZK7M 2BABA 3KJQB 3QSIA 1VHFA 1S6OA 1V3RA 3KK1B 1ZH5A 4WK3A 2FD2A 3DMJB 3MUVP 3G86A 3LP2B 2NSBA 4O0IA 2JEGA 4FYVB 4OZLA 4M8LA 2ZVSA 4QIGA 5ETMA 3DLKA 5HO4A 2PT0A 1IBMF 5JVGQ 4DDFA 4B9VA 2CQIA 1KRPA 1TKTB 3VAGA 1QM9A 3R2DJ 2W7OA 4XTTA 1YJTA 1RT3A 3BYRA 2RQCA 3LWMA 5J2MB 2J7KA 2GMHA 1U0HB 4WPAA 3OHAA 3B8HA 1KONA 4B3RF 4OFZA 1W2IA 4MFBA 4OZ5A 2HGLA 2GQ2A 1FRKA 4LF7F 3CJTA 3W65A 3B82A 3RR7A 5HLFB 2LQBA 1CJKB 2IM0A 3KOAA 2HZCA 3DGPA 3BEGB 2YNFA 4PEOA 4USJC 1YG0A 3N28A 5KFHA 4EZ6A 5KG2A 2V34A 1BWEA 3KLEA 1FKPA 4Q43A 3BGOP 1LWCA 4G3IA 1FFWB 1JXVA 4DFJA 1ZPVA 2E1PA 4AFFA 3DLEA 3ENVA 3UWTA 3QLHB 1HWLA 2FVRA 4C6AA 1VRTA 3N9UC 3FBBA 2D9OA 4XDCA 3CMES 3EE3A 3PHTA 4HT7A 2DXDA 1NU4A 2IHR1 4QOTA 2DNRA 2GV1A 1NNDA 4QW9A 4BBYA 2CPFA 4P7TA 2W8LA 4RUAA 3S6EA 3R27A 4GRSA 2LP4A 3M2RA 2XZTB 2IJNA 1C4AA 3EUNA 1RUSA 3VV2B 2DGTA 5BXIA 4QWDA 1RWNB 1T95A 3H7HB 5KFAA 4YR3A 1T03A 3C6TB 3DRPB 3MD3A 5KOWA 2BXJA 2ASLA 1W7WA 5IM0B 2B7CB 4LF4J 4N5SA 1RAEB 4HTJA 1FXDA 1UW4A 2EK6A 3KHGA 2N4DA 1AT1B 4WXOA 3NOCA 4Y2IA 2D41A 2F1FA 1J2VA 2J76E 3TEHB 1RTHB 1Q86T 4ES1A 2QA1A 1WEXA 3MOJB 3QO9A 3A8IA 2AJ4A 1PKUA 5U47A 3H42A 2ZH3A 3RRGA 1P9YA 3BGLA 3ETOA 1DQAA 2DBBA 1NH7A 3T1HF 2GVZB 4J9QA 3JXOA 4DU7A 1M5HA 1Q4RA 5IV4A 1RJJA 2JLEA 4X62F 3LPYA 3RU0A 2ASYA 3G6XA 4DL5A 3BV8A 1S12A 2LEAA 3SIPB 4YR2A 3HFZB 4IUFA 3JYTA 3NNHA 2CJ9A 3LOUA 4QW8A 2UUAJ 3UPFA 2JWNA 3TWZA 4O3QA 3PRVA 4C8MA 3HHLD 1IKVA 4DQRA 1VI7A 2UXCJ 1DTTA 4WBFA 1DURA 1U26A 5GADU 2B51A 2EEYA 4QCLA 2GMLA 5B0GA 4C2MA 3AXKA 1ZS6A 1D1UA 2WRMA 1XERA 1YX2A 2DH8A 3UQSA 2IA0A 4OZ3A 2YWEA 2NSCA 3UCZP 2M8DB 3H5UA 1RAJA 1FNMA 1JLFB 2ERRA 1NK7A 2BANA 1W25A 1LWXA 2OJ3A 5H9FJ 5CYJA 3CF5Q 4QR2A 3PIOQ 3L7OA 5D0GA 1S6UA 2F40A 2E5LF 3AOBA 3HPOA 1U02A 4DBQA 3NEKA 3MM9B 5KFGA 1Y11A 1QSSA 3FSXA 2Y0SD 2QL7B 3M8QB 4JB8B 1UTAA 3CCQS 1IKYA 2V2KA 3K59A 5IQ6A 4WP9A 2EFOA 3IRWP 4F67A 2AT1B 3N79A 4P2SA 1CBKA 3POTA 1NKCA 3D1OA 4K8RA 4RUHA 4NLQA 1WELA 2M3DA 4NASA 3R8YA 1NJZA 4PAAA 3M6VA 1VK3A 4GKKF 2CQGA 4JI0F 4ZCKA 2NPFA 2A10A 3JS9A 3VHQA 4DR7J 5DG9A 3MMAA 4I7FB 1OJ4A 2A18A 4USIA 2RHSB 4A8QA 4C0OC 4LFCJ 2XM3A 1EB0A 3HCXA 4RU9A 1S6QA 3KDNA 4YB6A 4AYBD 2RJZA 2MQPA 3OTBA 2XULA 4OJ1A 4IQXA 4IH6A 3I0SA 2MPUA 2WVEA 2VKRA 1NLKL 2YKMB 3CXCR 1QLNA 4RJVA 2D3OR 4I2PB 2ZE2B 5DETA 2ZNZA 1WC1A 5CCLA 2NUHA 4ER8A 3H4BA 2WONA 3VQSA 4TVAB 2W24A 4C48A 3N01A 5B7WA 4CO1A 4ZJQA 4RNMA 2WK4A 4MK9A 4TY8A 5F0WA 1HD0A 3LPEA 1WOOA 4DFMA 4K0KJ 3TAPA 3K89A 1DJ0A 1KVJA 1RK8A 4I6YA 4JUZA 4F4XA 3M8PA 4J90A 2RH3A 4J9PA 2QTWA 4O44B 5KT2A 1HFEL 1SUQB 2UVRA 4P74A 3CW2C 2K3IA 3L7UA 5LMNF 3R5CA 2RS8A 4OLOA 4OI6A 2Y1IA 4IDKA 4RW7B 1HQUB 1YBAA 2X1AA 2H48B 5F3ZA 3HLUA 2EXUA 4UUWA 5HMYA 1VQSA 4NA2A 4P2MA 1Q7LB 1UA1A 3Q8PB 2ROEA 1RDRA 1ZA2B 2C2EA 2QN6B 3CIZA 1RTDA 2AGOA 4PQAA 3VVTA 3GMGA 1EP4B 1SPBP 1UVNA 3CCRS 1JLQB 1JLAB 2ZBCA 4FKXA 2J7UA 2GO9A 4UQTA 3A1YG 1NK4A 3IWXA 3HHLB 1J5OA 1EKRA 1HBMB 2KVQE 2RNEA 3Q8SB 2UVVA 1X0FA 3MCNA 4B02A 4LSLB 2RB7A 3ISZA 2MLYA 5IT0A 1HBNA 3HJFA 5HMZA 4PXEA 2O01C 1IKWB 1S9FA 2DCUB 2ADBA 2PC6A 1L3UA 3QGPA 2KFYA 3DLLQ 4CLYA 9ATCB 1UWBA 4C0HA 3WX8A 3W2WB 4IH5A 4C7QA 4M95A 3Q24A 1U48A 5HMWA 2XY5A 4JOUA 1FVQA 1CPZA 3J81j 2V69A 2YNHB 5J2NA 1D8YA 4Z2XA 1HWUA 2EKNA 3M30A 2RVJA 2IVMA 2VH7A 3I5BA 1Y0HA 2D7SA 3CO9A 2O3DA 3DOLA 1Y5NB 2DKOB 3CSKA 2GGPB 4RNHA 4CDIA 5HJXA 4NLSA 1HPZA 4X64J 4F7VA 3D3CJ 2OPPB 3NKYA 1UEUA 1NSKL 2CPYA 3EMTA 3QRPA 1RHUB 2BVZA 3EDRB 5LXRA 5I42A 2I2YA 5EDWA 2UP1A 1N5YA 3NWGA 4IO9Q 2B43A 4X66J 1EKSA 2CQDA 3G6VA 4C8YA 4JP8A 3GJQB 4FP9A 3ONQA 3C14A 3QSYB 3D0GE 2IYIA 2RRBA 4IQMA 5L9XA 5EN1A 2DR7A 2BKOA 5BR8F 3TUPA 4UY8T 2N7CA 2ZZNA 5CYMB 1FA0A 3M8SA 5LXYA 5B0EA 2RF2B 2ZH7A 4DUYJ 3ADAC 1XMQJ 2RT3A 4NA3A 2JOQA 5KFTA 8ATCB 2HK2A 3VAMA 3FNNA 2QLFB 3OL8A 3ZZRA 1MMNA 2ZM6F 1FXRA 5A8WB 1LXNA 4ZHRA 3UR3C 1X4EA 2BE7D 4HT5A 2N82B 3D66A 5JMNA 1D3WA 1NK0A 2KZMA 3QZ8A 1IM6A 3M7VA 4ZVGA 3DLGA 3HSGA 4M5IA 1OY6A 3TI0A 1OPZA 3IBFB 1U0SA 3JTNA 2HNZA 2F3JA 5D3GA 1Y5IB 2DGQA 1UL3A 3GR1A 5DM6Q 1KDNA 2HWIA 2FHMA 5KFWA 3PR4A 4RW4A 2YPYA 2KM8B 1UFKA 5DQGA 2V6AA 1URNA 2QLJB 3HP6A 4DV5F 2G4BA 2M4MA 4K4XA 2ACYA 2ZFHA 2AYGA 1I5OB 3TW0A 2CJXB 1TL7B 1U25A 4ZOSA 2HNDB 3ENAA 5B0BA 1FFGB 3RBDA 3PYEA 5CYQA 4EBCA 4N76A 1J27A 1ZETA 2XCPA 2LU1A 3HHNB 2FJAB 2R8GA 3PFEA 4A4JA 3UD5A 2P2CB 1RZMA 2RKIA 2V5HG 2RAQA 4ZPTR 2C42A 1K0VA 4Q0BA 3MAQA 1TMMA 4B3MF 5AXLA 4WFXA 2BV3A 1FWKA 2L9DA 2JSXA 4ED4A 5HJYA 4I6AA 1RTJB 4NEZA 4IR1A 5KFZA 4OX9F 4CO2A 5EWEA 1Y4ZB 5KOXA 3OFFA 2FHJA 3JTOA 5KFSA 3ENQA 1NAQA 2DK2A 3J81U 5EUHA 2W9CA 1JQGA 3P96A 1GMWD 2FGCA 1HYSA 1QE1B 3KG4A 1DLOB 4ZPDA 2ZHBA 2KXNB 2ZEJA 2DR6A 3MM8B 3MMCB 2HBZB 3R5DA 5A2QU 1FDDA 3VGTA 2R7TA 3R5GA 1RAGB 3OVBA 3T6JA 2H5IB 2KXFA 4HR2A 3CDAA 2R2SA 4JI8F 2FY8A 2CNOB 2PGCA 3SSRA 5L39A 4NLDA 2J9EA 4DR4F 4ID5B 4PQUA 2B9EA 4USTA 2BE9B 2Z2ZA 1WJ9A 2VBYA 2L48A 2UXCF 1CJUA 4DR6J 2XS5A 2VJUA 2YNIA 1C1CB 4DV4J 2YX1A 2R9LA 1AA1B 2EFPA 2MLZA 1TFWA 2XYGB 4YB5A 4PKDB 1GX6A 2OH2A 3FJ2A 4F0KA 3DI6B 1SQEA 4NXNJ 1RTIA 4OI2A 1KS2A 4DV3F 3JQKA 3DOMA 4W90B 3GR0A 3LF0A 4HH0A 1JLCA 1R8AA 3DM2B 3MEDA 2HFNA 1RU2A 4IFVB 1KFSA 2H65B 4WK1A 2F9JA 1S76D 1Q5YA 1FWPA 4NWBA 1PJ7A 3EGNA 3JAMU 4V19X 1TUWA 1PGZA 2VQFJ 4CNYA 1GT8A 3UD3P 2VZ9A 2OMLA 2HVIA 2BJDA 2XWYA 4Q45A 3A3OB 4FXVA 2HHHF 3LWLA 2AX0A 1YJUA 4J5OA 4OJGA 2I5JA 5T7LA 4TLRA 3TAMA 4ZIWA 1GFWB 4J91A 4QYZJ 3D28A 5DZ6A 3KLHB 2D3ZA 3UVJA 5L1IA 1M5VC 2R7VA 2M88A 3ILJA 1MMDA 1TMJA 5G0RB 3Q0AA 3QYYA 2PEBA 1YRTA 2FVPA 2MKKA 2HQ3A 1B3TA 2RDJA 3SCLE 5KG3A 3IGNA 2ZH5A 3R1HA 3MEGB 3PHEA 3BDEA 1HWIA 1T3NA 3QAEA 5IFMA 3BGRA 2FHKA 3MECB 2FPHX 2BA9A 1KR4A 2XI2A 1LWFA 2OPSA 1Q81T 4PYDA 5F8JA 2DR9A 3H59A 1BUXA 4Y00A 1RAIB 4ZVOB 3RG6A 4A8OA 2HZAA 3LUYA 1R0AB 1KVIA 2KRBA 2LQ5A 3D54A 3QMQA 5DDPC 3NGSA 4WIIA 4WYWA 3TX8A 1X8DA 1IXKA 4EEYA 4WYLA 2MQQA 1N33F 3FSIA 1PAUB 3LW5C 1GH8A 4QPXA 1GQEA 2FJDB 2UUCF 2F9DA 2IM1A 1CC8A 4H54A 2ZVIA 1M5OC 1ICEB 2VOPA 3CPWR 3CVKA 4L75A 2QSFA 5LSRA 2QLXA 5J2PA 2M8HA 4HACA 4C97A 3CJKA 1RA6A 2ROGA 2MHNA 1SL2A 3AB4B 1UFLA 2WAQD 2EC0A 1OQ6A 1R7IA 2ZHOA 4U7UK 3PYGA 4MIBA 1WEYA 3KUGA 2YWWA 3OT9A 2G13A 2K7JA 2K1RB 1OPIA 2M70A 1RT2A 4I2QB 2B3TB 2VC1A 1H2VZ 1WF2A 5DDRC 3AD8C 2XNRA 4K2JA 3W9HA 3K2YA 1H72C 3M32A 4JI6F 4LR7A 2VODA 1LWEA 2B4VA 4NYOA 2XYHB 5K14B 4DPUA 5KG0A 1N8RT 2KHDA 2EBEA 5LL6d 4LF9F 1S1TB 3DRSB 4ZJOA 4ZN1A 2DHAA 3TVZA 2E5GA 3NLCA 1U8SA 3CTRA 1RSCA 1TUVA 1KHWA 5IQQA 1HWKA 3U7JA 1QSLA 4P73A 5AE2A 4IKAA 2FZKB 4LSNB 4IR9A 2OHDA 3C2PA 3TVKA 3M1VB 3CMAS 2YKNA 4TU8A 3TQEA 2DEIA 2ILYA 2BJ1A 2G0JA 2J5AA 3W64A 2R8JA 5K9FA 5T41A 3BKTA 3SSQA 3MMBA 3V6DB 1X0PA 4KO0A 2DH9A 2PFDA 2VFUA 1U1RA 1NZAA 2MJNA 5CAAA 3EZ5A 4RR5A 3B54A 3ISNC 5HQMA 3OJUA 3H5XA 2YWHA 3DLKB 1EJ7L 1OSCA 3KLIA 2DNZA 2E29A 2JLGA 1H73A 1RT3B 2X1FA 2N7YA 1PYOB 2WVCA 2MB0B 4CLPA 1KQFB 4QYRA 3HK2A 5HBMA 3KUEA 3BZQA 3ZC4A 1D0EA 3QIPB 2QYGA 4FYYB 2DGOA 5B0CA 2X51A 4WXWA 3C66A 2V94A 2KTQA 4OV6A 2NYIA 2YNFB 3L09A 3M8ZA 1UJ6A 1OIAA 2AYEA 2EC2A 1VQ6S 2QL5B 5AXNA 3KLEB 1FKPB 3MCOA 1R8CA 5I3UB 4KGKA 2VPYB 1CJTB 4TY9A 3DLEB 2FJVA 4E2FB 2ZBRA 2IAJA 5E0OA 4PR6A 1FJCA 2XI3A 3FQKA 5M2RA 3EWGA 2PD1A 2UU9J 1NK5A 2VQEF 2AJQA 4Y2MA 3K5MA 2V2ZA 3NBPA 1HBUB 1RABB 4KHMA 2OPRB 2VFRA 2J8AA 1TL3B 2FIUA 4IG0A 3GIMA 1HNVA 3C3LA 3M2RB 2VFTA 4NA1A 3MR7A 3PRDA 3D7SB 3MXHP 4RO0A 3FK4A 5HSPA 4AUKA 1MU2A 5F8GA 5A0YA 4IH7A 2FVSA 1F3FA 2PDAA 2YKOA 3KG0A 1KN6A 2MZQA 3BQ0A 3SV4A 3NGKA 2XLIA 5IT4A 3PJXA 4ZMMA 3QGIA 4L3NA 1NKBA 2X7IA 2CAJA 2RQMA 3Q89A 5ITHA 5D4OA 4YMEA 1M5KC 2DB1A 4RW9B 3LALA 4DUZJ 4O23A 1O51A 4B9TA 4WCEQ 2VOOA 4DQSA 1WORA 4USUA 3J7YI 2VB6A 4J9RA 3MTJA 2VU5A 3FC9A 2ZWPA 2I8EA 2J9DA 3UN2A 3K5OA 2FTRA 1YJ9S 3RGIA 2M7SA 2IPOB 4J9LA 3ZXWA 2WW8A 5EWGA 4ZP8A 3CWJA 1P9QC 4ILMA 1KQKA 4CLTA 1T0TV 3S1TA 4JI1J 3DC2A 3PO5A 1N88A 2WVFA 5LM7E 4AE5A 1VRUB 4HHJA 1VOMA 4CYUA 4OJ3A 4XPEA 4Q2MA 3TZWA 2WVDA 2ALZA 3L95X 4B08A 2XMUA 2P6SA 3C15B 3VGSA 4F0MA 2DGVA 1VBZA 1FHTA 4A8KA 1FD2A 2FZGB 5HAOA 4QWEA 2HK3A 2G1HA 3KG1A 3NCPA 4DV0F 3PACA 2BX6A 1YVFA 3TJAA 4H4MB 4RX6A 3NY0A 1NDLA 3ZZ0A 1KBRA 5J1NA 2BANB 2ZNYA 1I51B 4PXDA 2DISA 1L3KA 1JXLA 5KFIA 3TZYA 1EHWA 2ZH8A 3DOKB 3GJTB 4URGA 1G2EA 2C3MA 3UN3A 3IGVA 3AHPA 1HNWJ 4K4SA 2BJ7A 4UOGA 4LFBF 4ANEA 1I94J 2UUTA 3OTOJ 1GXUA 4DSEA 1U49A 3ET6A 1RHRB 2Q1LA 2W7PA 2O66A 2UUBF 1F9FA 1F5AA 1H98A 1SBRA 4P2XA 2NLWA 2P9CA 3I31A 3A4TA 2AMCB 3MR3A 4DV7F 2DY9A 2C2NA 3OTEA 3ZTPA 2R7QA 4DS4A 2D1CA 2AJFE 1VC6A 2RDDA 1VQPS 4ECXA 4GVBB 4OZNA 4KAIA 1X4HA 2FHOB 4KC5A 2ALYB 2VBWA 1XMOJ 2KH9A 1U7LA 2VIHA 3BGUA 3V4IB 1ZZFA 3JSMB 4R0JA 3LTOA 4BHQA 2AQ4A 1BWVA 3LAMA 2NXCA 4HEA9 2O5DA 2ZDOA 1S6QB 2DNLA 1TKDA 2OD4A 1S1VA 3OBIA 3I6PA 4JYAF 2IIHA 3OR2B 4C11A 4C8NA 1S48A 4JI2F 1FKOB 4ZLLA 2M52A 3ICLA 4ZCLA 2PMWA 3DN9A 3MEEA 5HVFA 1N5VA 2VQFF 1T9WA 3G82A 4KY3A 8AT1B 2IDLA 4NYPA 2WONB 4ECRA 2QIFA 2R7WA 2XMJA 4CLZA 4ENOA 2YKQA 5IOLA 1RP5A 3LH2S 3FCHA 2UVWA 4KE5A 2BKNA 5KG7A 1PO6A 1H2TZ 4DSIA 1L3SA 4I0WA 1K1SA 2HPUA 2Y8YA 3GYNA 4DCPB 4TYAA 4LSZB 1C1BB 2YPZA 4UUXA 1XJWB 1JWWA 5EHHA 1RCXB 1X4AA 3NGRA 3H0PA 3DRRA 1EETB 2VDHA 1UA0A 1LEOA 1CEZA 2AEJA 1W2BR 4FF2A 3OTCA 4M5LA 1S4EA 3CJRA 6FD1A 3RTVA 1S7IA 3IR7B 1IKXB 3I0RB 1X5SA 2HIQA 2MKCA 1H3DA 3IG1A 2LU2A 5JXSA 3KTQA 2C3OA 6AT1B 1UEVA 2GAGC 1DAXA 2QSWA 3ETMA 2YNGA 2NUUG 3SDEA 4DR2J 2LKZA 1Q8BA 3R7BB 4LMZA 1KNZA 3HVRA 3D6TB 1RT4B 4CM0A 4RU2A 4KIAA 1Z2ZA 2D9PA 2J7WA 5CHCB 5DG8A 1RLDA 8RUCA 4AL7A 3GG1A 4NXMJ 3OFHA 4B3OB 2BW7A 1QTMA 2EWHA 2GCFA 4J9SA 2B8QA 2EW9A 3AY0A 1XK8A 2DNNA 1X9SA 1IBCB 2XG8A 1O0PA 1BE4A 4TYBA 2PE8A 1SB6A 3MUMP 3U1LA 2I9SA 2AYMA 4OHVA 2UXDF 4DV6J 2C3YA 1RWXB 2XSJB 3IRXA 1Q82T 1Q8KA 2GAHC 2KKHA 1UWAA 5D78A 3RBXA 1UWBB 9RUBA 3FFIA 1JJHA 4DZDA 2PMZD 2SXLA 3I32A 1DTQB 2HIYA 5HROB 2VDIA 1TL1B 5EGYA 1FDAA 2OPQA 2ATLA 2OSQA 2HEKA 4QU6A 3GLJA 3CCES 2CQ0A 4DV1J 3MPUB 2EG2A 4UZCA 4ICLA 2J6TA 1N6QA 2CUYA 2XLJA 4WKYA 4WE1A 1YGYA 4YS2A 2C2ZB 1X5PA 2W4DA 3M30B 3KNAA 5C24A 3PY8A 3NXZA 2CZ4A 1RT6A 2CQ4A 1S57A 4DL7A 2DCLA 1TK8A 2QJ3A 3DOLB 2ZKTA 5HI7A 2JL9A 2ZJPQ 4O3RA 4P7VA 1CS4B 1Q7YT 1WG1A 1HHTP 3NG8A 2VG5A 2XCAA 5JJBA 2XBPA 2PA8D 2P8IA 3MDFA 2UV8G 3SCKE 5F8IA 1Z4UA 2V8HA 2YQ1A 4KFBB 4JI3J 3PW5A 4CTAA 2Z2LA 2BJ3A 4LRAA 1RT7A 2W25A 4NCGA 1T7PA 2AU0A 1OYDA 4H4OA 5CABA 1OO0B 2FYXA 1B7YB 3D9BA 2V8PA 4F8RA 1Y9OA 4FVMA 1SXLA 3DDKA 1LK7A 5HQ8A 1VHIA 4WU2A 2L9WA 4EO8A 1NSQA 5FLXU 4LR8A 2QRRA 1SJQA 4ZPAA 3GSIA 4M94A 4W4MA 3AJ2A 3AJ1A 3FBFA 4QR0A 1XNRJ 1LW0A 3HO1A 4E98A 5KFPA 3ZZZA 1SKSA 5DJBA 3TYTA 2H54B 1G4CA 1RCOB 3KWMA 1BHNA 4IG3B 1Y00A 2IRYA 3TA1A 2QE5A 4QZVB 3M6UA 1HHQA 3CJ5A 1RQ0A 2RUGA 4KH1B 3N6MA 4DN0A 1KLMA 2V0NA 3MPVA 4LRBA 1PYTA 3LP1B 1NB2A 4RPFA 1K1QA 4B17A 4DXLA 1R8HA 3BR9A 5D3GB 3PNIA 4NX9A 4FS2A 4PXCA 5I3PA 3MAAA 2BKPA 1UW9A 3R2CJ 1HARA 4AL5A 2EFQA 4RW4B 4DL2A 1TL4A 3KMQA 1NEEA 4V19J 2FLLA 2VF3A 2MGZB 4OI1A 2VPZB 4J9KA 2QC3A 1N0VC 4CO5A 2RQ4A 3VTIA 5C5JA 3H5SA 4ED2A 4NCAA 3TR5A 3RJMB 2V8DA 4NMXA 4LFAJ 4RW6A 5BJRA 5DG7A 3ITHB 1L5UA 2FLOA 4NPOA 3BO3A 3CD6S 2F4FA 4QYZK 3K58A 4OZ2A 4YQWA 2RKIB 5F8HA 2P9EA 1IUJA 1RT1A 4NMLA 3DKDA 5IZHA 3ZO7A 2ASDA 1D9AA 3Q2TC 2DNGA 1QVGR 2WOMB 2XTJP 2R8KA 2C22A 3QJJA 5IWAF 3S7RA 3W8PA 1WI8A 3FEZA 2MZ1A 5GAEI 4X4VA 4OHYA 1U6BA 3QQCD 4GO5X 4R5PB 3D2WA 1E6VB 1H6KX 4CM2A 2W9CB 1JLGA 2MZJA 3I5AA 1S6PB 1URRA 1D9DA 1FERA 1SCJB 4IO1A 4J9UE 1YJRA 3PKMA 2HWHA 1LQ9A 3KDOA 1P8GA 2ABYA 4QIVA 1JXEA 3EPGA 2H9ZA 2DIUA 2L41A 5C42B 4GKJJ 1HKAA 3OLAA 1TKZB 1S5ZA 1S97A 2NZ4A 4Q5VA 3HHLC 4OLPA 3PX6A 3T1YF 4F2SA 4X4NA 1ZM4A 4MYTA 5DLFA 1CJUB 4QQBA 1X4GA 3QFWA 3KK1A 1H2UX 2BMBA 3BSOA 1HW9A 3I96A 2BRKA 2IBOA 3VF0B 2CJKA 1HBOB 4PWWA 3RAQA 2B9WA 5ETVA 4F4AA 3LP2A 4B9LA 3K0JA 1IQTA 3KHLA 2U1AA 1ZM9A 2C2MB 3BBFA 4J7CA 2X3DA 1RTIB 2A0FB 3PDNA 4JI7F 4O3SA 3DOMB 1JLCB 3PYFA 5KFLA 5LSLA 4CNZA 1SJ4P 4I4BA 3KHHA 2JEFA 3C6UB 1U45A 4RBUA 4RUCA 4ECSA 2HS4A 4OI3A 3RRHA 1PJ5A 1KHVA 3PVXA 1U0HA 5HP1A 1OY8A 4V1Ak 2XS2A 3AXMA 1VYAA 2ZH9A 2D69A 2I38A 4FBUA 2UVUA 4UOFA 2DY1A 5A2QY 1BQMA 3GV7B 3OTDA 4KPYA 4Y0FA 4DR3F 3HF5A 3V2UC 2XS7A 5T7LB 5HLFA 4KTQA 4Y2AA 4ECQA 3W5ZA 4CLSA 5ETSA 2DO0A 2CJQA 4DR5F 1JK9B 4HTIA 1NPPA 3HI9A 4A48A 4ZDNA 4LRFA 2ZH2A 3FZ2A 3J7ZT 3MURP 2ZBQA 4F25A 1VQOS 3A3PB 1SI9A 3I4PA 5E3AA 2Z2MA 3M8WA 2GJFA 1SL0A 4PRFA 4NLXA 3D67A 4LIRA 3QLHA 4HH1A 3IMQJ 1TTHB 3BGRB 4USVA 1IBLF 4L72B 2OPSB 1UCNA 1Y10A 3SYZA 2XMTA 2Y1RI 1AZSA 3VGVA 2AJ0A 4D3HA 4X4UA 4PG8A 4TLQA 3HZEA 5K5MA 4QIFA 1U1LA 3JSRA 2Z4PA 2GHVC 1IM4A 1RE1B 1ULRA 3PRBA 1N56A 1MSWD 2ZH4A 3DRYA 4WFZA 4FNHA 3DCAA 4YHHF 3KUHA 4ID8A 1PC4A 3QWUA 3C6TA 3FMBA 2HKEA 3DRPA 4HACB 3CCSS 1JKHB 4PG6A 1GMUA 3B6BA 1S10A 5IM0A 4AT1B 4LF5F 4ZJLA 5SZTA 1YRUA 4P72A 2OMOA 4Z7YA 2A2DA 3C46A 5F3TA 1SJ1A 3WQPA 1UP1A 3IAM9 2R3VA 2NZCA 5D0RA 3M2VB 1RT2B 1O5JA 1OYEA 3R6LB 2FJEB 4O4RA 3BQ2A 2ACMA 2MQ8A 1FF2A 4GVLA 5LMUJ 4NLTA 4C3MA 2GVZA 3TJ8A 1OWXA 4MH8A 2V8GA 2VJVA 4FYXB 4E0DA 2DNOA 2RS2A 1FJGJ 1R89A 4ZP7A 1WHWA 1GTHA 3TANA 1KVKA 3LANA 1RA7A 2HGNA 2KM8C 2WZ1A 3SQOP 3QT5A 4K59A 2OIHA 1RT5A 2HGMA 1T05A 2GC8A 1T3OA 2CDQA 4NXMF 2EFGA 2JRSA 2LVWA 1N32F 4WWSA 1KQGB 3T6BA 2QMXA 4ED0A 2W4PA 2NXUA 3TP2A 2DXFA 2JX2A 3J7A1 3FRYA 4JI5J 1HNZJ 1W26A 4LF2A 2R7OA 4ZVSB 3BO4A 3NMRA 1JLFA 3GG0A 5KT5A 5AT1B 3BGFA 2BOAA 2RILA 1SQGA 5FIIA 2XSFA 1MWZA 5KG4A 3T5LA 3MMBB 3C19A 1XC9A 3MR2A 2HVEA 3LQVA 4HLBA 1SC3B 1SVDA 5K8PA 3GFZA 1N34J 4J9NA 4GO7X 1FT8A 4ZLPA 3M8QA 4LR9A 1X60A 2BE2B 1WDDA 4B3SF 2KT5A 1SH3A 2KXHA 3T5HA 1PC5A 3KLIB 4EWTA 4KB7A 1BY9A 4MKBA 4IYQA 4RNOA 3ZZUA 2DR5A 2CNKB 2VBZA 2HNYA 5A76A 4PPDA 2RDIA 2CPEA 3HVAA 4BS2A 4LF8J 1U1KA 4F3QA 4K2XA 1WOSA 3MM6A 4I7FA 1G6BA 1Q5VA 3GONA 3UNGC 3VZIA 1T9UA 1YTYA 1EQ0A 4DR1J 2CYYA 3MPWA 4C3LA 3US5A 3G8SA 3B4DA 4LQ3A 3PG9A 4ETXA 4EUVA 4IRCA 2EVZA 5D4PA 1PILA 2Y0BB 4JV5F 2W2MP 1IJFB 3HT0A 4YDDB 4P75A 3KLVA 4HKQA 2YKMA 4I2PA 5KFEA 2C2DA 4KHPJ 5ETNA 4M5JA 3PXGa 4OYZA 4CLUA 2IAJB 4PWDB 1CQNA 4TQSA 1V3SA 1H38A 5KG6A 3N5FA 1VMBA 3FCWA 2BZ2A 5IC6B 2AZ3A 3I55S 1CLFA 1IBKF 4C9DA 2UXBJ 3R9LA 4O3OA 4UTGA 4Q44A 2CG4A 3ZTOA 2J6SA 1Q1KA 1HNVB 1WSVA 1ITPA 2L9NA 2JVRA 4O44A 3N5BA 4MK8A 1LNQA 1SUQA 3VAJA 1IR1A 1MU2B 3E8OA 1ELOA 3N6LA 2Y9HA 3O2IA 3N0VA 1VLOA 3R6GB 1FJEB 4KKOB 3UDCA 1X9MA 2A1BA 4KGMA 2MQOA 3UN5A 1UVIA 5GMDA 4RLEA 4ZLJA 1IR2A 1S1WA 2GS8A 4TNOA 5A6PA 5B08A 1NSAA 3HJVA 1Z1ZA 4LBHA 5KG5A 2DTJA 4MJKA 1R8BA 2DRBA 4ECZA 2CNNB 1EP4A 1T9YA 2GJIA 1JLAA 3UDLA 1NXIA 4MIWA 2W1BA 2K8GA 3KLFA 3TZXA 3PW4A 4J9MA 3SFUA 2XGQA 1DRZA 3HHLA 4FYWB 2B8PA 1SKWA 1HBMA 3EGVA 3HD2A 2CQPA 3BN7A 3RB3A 1NB7A 2DXEA 1FRJA 2GIQA 4LSLA 2CRLA 1GEHA 2PN6A 4EI2A 2AWZA 4LFAF 2YQ0A 5CA5A 5J1EA 3VCDA 2XZDB 2CQ1A 1IKWA 6FDRA 2DNPA 1G7CB 4CYUB 3H8YA 3OXFA 2OI2A 4KV8B 2NR0A 1AFIA 4L74A 4OI0A 1JLBB 1FTRA 3QJLA 4YY3F 5GVQA 4UQGA 2R42A 2Y3YA 1UAWA 3VQTA 4PG4A 1P1LA 1NH8A 3IFEA 3GIIA 3KFWX 1HNXF 3RAXA 2MKHA 3AOCA 1RBLA 2MKSA 1IBMJ 1PSDA 2ATCB 1F2HA 3UE2A 1FK9B 4F3MA 2ZOFA 4B9NA 1P6TA 1U6FA 2QL9B 1RXOB 4R8UB 1BD6A 4Z7CA 3O1LA 3PW0A 1YZ6A 1Q8IA 1U1OA 3E2EA 3HX9A 2KYZA 1B7FA 2AJ1A 4YB1P 1HI0P 4OHXA 2QFIA 2YH0A 3ULHA 3W63A 4B3RJ 1F1BB 3ET6B 1AROP 4PWUA 2GGPA 4WTOB 2IVFB 1QTNB 1TV6B 4GKJF 1C0TB 1X5OA 4K4UA 1YI2S 3BKUA 2OPPA 2XGPA 1TR0A 3V6HA 1S99A 1HA1A 4LF6J 1R0BG 3H20A 4KGXB 1RU1A 4IFYB 1QY7A 4A8MP 3L4BC 4DX7A 2H1YA 3EZOA 3MR6A 4PG7A 1EARA 1M1GA 2BBEA 2YKAA 1DHMA 1K44A 4IRDA 1GMVA 4U8YA 5E7OB 2W9BA 1REVB 3I82A 4DX6A 2VFSA 3MEKA 2QA4G 4DV2F 4C11B
chains in the Genus database with same CATH topology
2IBKA 2RQMA 1VC0A 3Q2SC 1L3TA 2RMLA 3GZ7A 5ITHA 5D4OA 4G1QA 2JH3A 2ZDPA 1HBOA 2DGWA 3TRGA 3C8YA 4A47A 3LP0B 4YMEA 2WSCC 1YJVA 5GAGI 1M5KC 4KRWA 3MEEB 4E8UA 2RF2A 2V4JA 2DB1A 2JFKA 2JLFA 4RW9B 1FRHA 1R43A 4ZPCA 3LALA 1NJWA 2FVQA 4O23A 2WBRA 4LSNA 5I42B 2X1GA 1O51A 3I87A 1N54B 1N5YB 4F2RA 4B9TA 3D1QA 3R5AA 1RKIA 3IWNC 3OHBA 4WCEQ 2VOOA 5AJ3F 4DQSA 3M1VA 1XMBA 3TNVA 3J7YI 3UCGA 1WD6A 2VB6A 3MM5A 3GV8B 2I0XA 3NGDA 5M2PA 1SIWB 5K8OA 4J9RA 3MTJA 2HWTA 3H40A 3HHDA 3EGWB 5A8WA 1SH0A 2HFOA 2I8EA 2J9DA 4DMZA 1R6YA 1I6JA 1FJ7A 3A8EA 3FSYA 2YH1A 3K5OA 2FTRA 1XNQF 1YJ9S 1IN0A 2E5IA 1MROB 4UW2A 3UR0A 2M7SA 1XR6A 4FPRA 4J9LA 3C6UA 1QAJA 3G8TA 5GAGU 2WW8A 5EWGA 4ZP8A 4EU0A 4ZK7M 1NJIT 2BABA 3DLBA 1VHFA 3CWJA 1S6OA 1V3RA 1P9QC 4ILMA 3KK1B 1KQKA 1ZH5A 2MQNA 4WK3A 2FD2A 4X65F 2MMYA 3S1TA 3DMJB 2ZC3A 3DC2A 3J7YU 3MUVP 3PO5A 2HRYA 1DARA 3K8VA 1N88A 2PI5A 4F02A 3DHXA 5A6WA 1UJ5A 3G86A 3LP2B 3RW7A 2NSBA 4O0IA 2JEGA 2V9WA 3PZPA 1WG4A 4OZLA 1UVKA 3AH6A 4M8LA 4AE5A 2ZVSA 1GX5A 1ZM3A 4QIGA 3DRRB 1A7GE 3DLKA 3CCZA 1VRUB 4HHJA 3Q22A 1VOMA 5HO4A 4OJ3A 2PT0A 2B6AB 4XPEA 3KJVB 5KFKA 4Q2MA 1IBMF 3IO1A 4KJIA 5JVGQ 3L95X 3IR5B 4B08A 2XMUA 2ALZA 2P6SA 4DDFA 4B9VA 2CQIA 2AV5A 3KLGB 1S0VA 4ZHRB 2P9GA 1KRPA 4C4WA 1AW0A 1HQEA 3SQGB 1N48A 2DGVA 1TKTB 3VAGA 1QM9A 2B4OA 1VBZA 2KT2A 1FHTA 4A8KA 2W7OA 3RW6A 2M0GB 1H7XA 2LXIA 4DPOA 1YJNS 2E1MC 1YJTA 1FD2A 1RT3A 2HNDA 3JTPA 2RQCA 2ZZMA 4QWEA 3IG1B 3LWMA 5J2MB 2J7KA 2XNQA 3HVTB 3DLGB 3KG1A 3NCPA 3HFKA 4DV0F 2GMHA 1VK8A 3PACA 1TZ0A 3OHAA 3CUNA 4NCBA 2Z8QA 3B8HA 1YVFA 3P3DA 1KONA 2E66A 4B3RF 4H4MB 4OFZA 2HNZB 2BW2A 1W2IA 4RX6A 3RZAA 1M5SA 4MFBA 2FGOA 4OZ5A 3RB6A 2HGLA 2HMIA 2OTLS 4A8XA 5AE3A 3OW2R 2GQ2A 1FRKA 3O44A 1S9EA 3SI8A 3ZZ0A 4ECYA 5J1NA 4LF7F 2BANB 2ZNYA 3OXGA 3TUIC 3CCLS 4PXDA 2DISA 3B82A 4X4PA 3PFOA 3RR7A 1L3KA 5E3CA 1JXLA 2F4VF 5KFIA 5HLFB 4HDHA 3B4MA 4F4ZA 3KHRA 2UU9F 2ZH8A 2XMKA 2LQBA 3KYLA 2J0SD 2IM0A 3DOKB 3MWBA 1QVFR 3KOAA 2HZCA 4URGA 2G0CA 1V3ZA 3DGPA 3BEGB 1G2EA 2C3MA 1K8AT 1VFJA 2YNFA 5BYQA 3TUJC 3CULA 3IGVA 4ZVFA 3AHPA 4K4SA 4USJC 5HN0A 4K4YA 3OVSA 3K57A 1YG0A 4LFBF 5D77A 3N28A 5KFHA 4EZ6A 2KG1A 5KG2A 1TAUA 3KLEA 1FKPA 1BWEA 2UUTA 2DD8S 4Q43A 1TL5A 7FDRA 1GXUA 1LWCA 4G3IA 3FEYB 3CCVS 4DSEA 4DFJA 3OLBA 1U49A 1ZPVA 1M1KT 2Q1LA 3CE8A 2W7PA 2C2RA 2Z0GA 2APOA 3NCRA 4AFFA 3DLEA 5CYQB 5FDLA 4DLGA 1M5PC 2O66A 2UUBF 1F9FA 1F5AA 3ENVA 3MCSA 3K5NA 1H98A 3ZZTA 4JV0A 3UWTA 1SBRA 3QLHB 4CT9A 2P5VA 3S01A 1HWLA 2FVRA 2NLWA 1VRTA 5LJ5Y 1JLEB 2P9CA 3I31A 1JKHA 3OUYA 3MR3A 3N9UC 2CPJA 4DV7F 3HVWA 1QE1A 3OTEA 1DLOA 4DG1A 3H2LA 2R7QA 2AYBA 2D9OA 4XDCA 2ZOMA 3CMES 4Q0BB 1XR5A 3MI7X 4HT7A 2D1CA 4DS4A 4ZP6A 2DRAA 2AJFE 3MMCA 1NU4A 1VC6A 4MKAA 2IHR1 4QOTA 1VQPS 2DNRA 2GV1A 4ECXA 1NNDA 3BB5A 4QW9A 1N5QA 1FEEA 4BBYA 4HYKA 1QAIA 4OZNA 2CPFA 2OSRA 3SEOA 1YITS 4P7TA 3NNCA 3M8RA 2W8LA 3DLHA 4RUAA 4KAIA 3PR5B 1X4HA 2FHOB 1WTFA 4KC5A 1CSJA 1R31A 3S6EA 2VBWA 3R27A 4RKUC 3P49B 1WI6A 2KH9A 3M2RA 3GV5B 1U7LA 3BGUA 4DUZF 2IJNA 1KTQA 3HM9A 3UCUP 1C4AA 3V4IB 3M2VA 3G96A 1ZZFA 3H2VE 3JSMB 3LGNA 4NRTA 3EUNA 3KK3B 2HG4A 4ILRA 2GJ2A 4R0JA 2DGTA 4BHQA 4QPTA 2AQ4A 1F5BA 2B56A 4YB7A 2IYGA 4M5DA 4ID5A 3G6ES 1YSJA 4ECTA 3V81B 4QWDA 2GQCA 1T95A 3LAMA 1JJ2R 4HEA9 4UOCA 5KFAA 4YR3A 5L1JA 2O5DA 1G1XA 2RE1A 2ZDOA 1T03A 2EPIA 1S6QB 2WSEC 3C6TB 1Q78A 3MHYA 4DSKA 4O3PA 2DNLA 3DRPB 3BSAA 3MD3A 5KOWA 1TKDA 2B9XA 2OD4A 1S1VA 3OBIA 2BXJA 3I6PA 4JYAF 5F8MA 1HYSB 3THPA 2ASLA 1UVLA 3OR2B 2B7CB 3FEXB 5IM0B 4N5SA 1KOHA 4HTJA 4C11A 4WU3A 1S48A 1FESA 4C8NA 4JI2F 1FXDA 3NS6A 4URQU 1UW4A 1FKOB 3K8WA 1C1CA 2BM0A 2EK6A 3KHGA 2M52A 3ICLA 2NREA 3NAIA 5KFYA 2N4DA 3WBZA 3LP0A 2MSSA 4ZCLA 1NRKA 1VQYA 2IFXA 3DN9A 4JV2A 3MEEA 4U9RA 4WXOA 4PUOB 4Y2IA 1BQXA 2D41A 5B09A 1N5VA 2F1FA 2VQFF 1A9NB 2E9TA 4JI1F 1J2VA 2J76E 4YOEA 3DI6A 1RTHB 1Q86T 1IR0A 4NYPA 4ES1A 2WONB 4ECRA 2QA1A 2QIFA 2R7WA 1WEXA 3MOJB 2XZWA 2XMJA 3QO9A 4G1PA 2AJ4A 2YKQA 1OS5A 5U47A 2ZH3A 3RRGA 3TA2A 2HS0A 2MY7A 1RP5A 1VQNS 3LH2S 3FCHA 5DLGA 3H4DA 2UVWA 4PQUB 3EXCX 3DM2A 3BGLA 3ETOA 4WZQA 4KE5A 1DQAA 1WWHA 1MROA 4KBIA 2DBBA 5KG7A 1NH7A 1X4FA 1PO6A 1H2TZ 3T1HF 3OL6A 2DGUA 1U1MA 3IN5A 2CFXA 3PW2A 4DSIA 4JV1A 2WB1D 4J9QA 4XDDA 3D0IE 5AXKA 1M5HA 1L3SA 4I0WA 4ZVEA 1K1SA 5CZVA 1Q4RA 2ADCA 2LMIA 3BQ1A 1RJJA 2JLEA 4MKYA 2YNIB 3DMJA 4X62F 2HPUA 2ZH6A 2QFJA 3GYNA 3LPYA 4L6V3 3RU0A 4TYAA 2ASYA 3G6XA 4DL5A 2HFZA 5GADI 4NCGB 1C1BB 1B64A 2W4CA 4UUXA 1Q53A 3L7PA 1SL1A 1JWWA 4H4OB 5EHHA 4YUDA 3GYXB 2YX4A 4Q8FA 2HVHA 3T5JA 1QJHA 2LEAA 3O5TB 4YR2A 5KG1A 4IUFA 3OPKA 3JYTA 1X4AA 3FDSA 3NNHA 2G1DA 2CPZA 1EETB 3DRRA 2CJ9A 2DIVA 3IWLA 1D8ZA 3LOUA 3M05A 1UA0A 2VG7B 4QW8A 1CEZA 2HLTA 3N4WA 3UPFA 3DFEA 4QBUA 2B6AA 3MR5A 1W2BR 2R7XA 4FF2A 2JWNA 2DT9A 4O3QA