4FXWA

Structure of phosphorylated sf1 complex with u2af65-uhm domain
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
105
structure length
105
Chain Sequence
PLGSTEVLCLMNMVLPEELLDDEEYEEIVEDVRDECSKYGLVKSIEIPRPVDGVEVPGCGKIFVEFTSVFDCQKAMQGLTGRKFANRVVVTKYCDPDSYHRRDFW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of Phosphorylated SF1 Bound to U2AF(65) in an Essential Splicing Factor Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Splicing factor U2AF 65 kDa subunit
total genus 29
structure length 105
sequence length 105
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4fxwA00
4ZKAA 2DNHA 1M5VC 2XSFA 3CUNA 2KU7A 2MQPA 2M9KA 2MQQA 2MQOA 2GO9A 2FY1A 1PGZA 3NS5A 2XNQA 3CMES 2DIUA 1U1LA 1YWXA 1X4BA 3MUMP 4WCEQ 2PE8A 2RVJA 1X5OA 2DGWA 1WELA 5IM0A 2DGXA 3JB9k 2XNRA 2CPZA 1RKJA 2KRRA 3D2WA 4YUDA 2KXHA 1QVFR 1FXLA 3N9UC 2NLWA 3ULHA 2DNMA 3ZZZA 1FO1A 2XS5A 3S01A 1VQ6S 3VALA 1WEYA 2LEBA 4BS2A 2D9OA 4LIRA 3VAMA 5CA5A 4U67Q 5GADU 2MKKA 4PRFA 1VBXA 2GHPA 4LJMA 3MURP 4ED5A 1VQ8S 1VQ5S 5H1SV 1N8RT 2M88A 1U6FA 1FJCA 2N3OA 3L3CA 1DHMA 1YHQS 3NNCA 2DNKA 2PEHA 2QFJA 5GVQA 3ZZYA 2KHCA 2KYXA 1QM9A 1VQ9S 1A9NB 2DHGA 2YWKA 4IO9Q 1X4EA 4WF9Q 2L41A 3NMRA 2YKAA 4CQ1A 3CCSS 5HL7Q 2CQ1A 4TU9A 2N3LA 1M5OC 3SDEB 2N7CA 1K9MT 3G8SA 3UD4P 2CPIA 1WF1A 2DGVA 2N82B 4W92B 1VQLS 2XS7A 2KG1A 1M5KC 1PO6A 2K8GA 2AYGA 2DNNA 3Q2SC 3SXLA 3UCGA 1VQOS 2OSQA 4LMZA 3UE2A 5LSLA 1N54B 2RRBA 2MXYA 1X4AA 1OPIA 2KT5A 5IFMA 3G96A 3SDEA 3R1HA 1KD1T 2DGSA 2CQDA 2J8AA 1JJHA 1ZH5A 5DM7Q 3S7RA 1YTYA 2E5HA 2M70A 2O3DA 2RS2A 2M7SA 1X4GA 3J7YU 2LECA 1AUDA 2MQNA 1X5TA 1HA1A 2E5IA 3CCLS 3NNAA 2MZQA 2E44A 2J0SD 3CCUS 2MKSA 2YH0A 4P6QA 1YJ9S 3BEGB 2OSRA 5HO4A 1VQKS 5MLCV 2MZTA 2OTJS 1KQSR 3EGNA 3CMAS 1WHWA 3VAIA 1R8HA 4C7QA 2MGZA 5EN1A 2E5JA 4PR6A 3G4SS 3CF5Q 1UFWA 2LMIA 1SXLA 3LPYA 2MKIA 2FPHX 2MKJA 2G4BA 1U1OA 1NO8A 3PIPQ 5JVGQ 2AD9A 1KOOA 3BS9A 3TP2A 2D9PA 3MUTP 2CQHA 1O0PA 2LXUA 4F26A 5GAHU 4WFBQ 2DGOA 2DNYA 3S8SA 1ZZNA 5BJRA 3US5A 2MGZB 2CQBA 2DGTA 1NJIT 3HI9A 1WI6A 3G71S 3H2UB 1R8PA 1S72S 1H2VZ 3K0JA 2MJUA 4C4WA 1ZZFA 3CC7S 2LYVA 1VQNS 1X5PA 4CH0S 4EGLA 2OJ3A 1WHYA 3NS6A 1FT8A 2MZ1A 1JJ4A 2DNGA 1X0FA 1N52B 4Y00A 5DDPC 1NU4A 1SJQA 2CPDA 1XN9A 2ADCA 1DBDA 3VAJA 1VQ4S 1VQPS 1YIJS 2DHXA 1HL6A 2LCWA 4TU7A 3UWTA 5LJ5Y 2XS2A 3TYTA 3TO8A 2L08A 2HVZA 5LSOA 3UD3P 5DM6Q 2AYBA 2ZJQQ 2SXLA 3PIOQ 3HHNB 5FJ4A 1U1NA 5DDOC 2DH7A 2RS8A 1M5PC 1P27B 2DNZA 3VAKA 2DNQA 2KH9A 2U2FA 5D77A 1SJFA 3MXHP 1WEXA 3S6EA 2LA4A 1U1MA 2LKZA 3CCRS 2LEAA 2KFYA 1X4HA 1OIAA 3V4MA 1BY9A 2DHSA 2MQMA 5LXRA 3MD3A 2DGUA 2MMYA 2BOPA 3MDFA 4UQTA 1VBZA 2CQ2A 1VQ7S 5GAGU 1U1QA 2EK1A 2CPJA 2MSTA 1DZ5A 5CYJA 2RUGA 2VOPA 2JWNA 1W2BR 1WHVA 1FJ7A 4V19X 4CH1A 2G0CA 1WTBA 2MY7A 2HYIB 2MKHA 2MYFA 3UCZP 3EGZA 3G6ES 1KOHA 1H6KX 2X1BA 2RT3A 2MQLA 1WG4A 3MUVP 1YJWS 5D78A 2CQIA 2DNOA 2CQ4A 2RNEA 2DIVA 2DHAA 1JMTA 2KXFA 3J7ZT 1K73T 1F9FA 3CULA 2CQ3A 4IOAQ 2X1GA 1Q86T 4TU8A 2FC8A 1X4DA 2X1FA 4QU6A 2RQ4A 2DISA 1UW4A 1U2FA 2K3KA 1VC6A 2AYEA 3DXBA 2WBRA 2MZJA 1UP1A 3MD1A 1D8ZA 3U1MA 4PKDB 2KXNB 2BZ2A 3DLLQ 4WFNQ 1VQMS 1FJEB 3RW7A 4CIOA 1OWXA 1X5SA 3RW6A 2FHOB 1WF2A 2I2YA 2QEXS 2U1AA 1DRZA 2UP1A 5DDRC 3NNHA 2DITA 1JJ2R 2QA4S 2KG0A 4F02A 1WEZA 2L9WA 2F3JA 3CPWR 4IOCQ 2LA6A 3B4DA 1VBYA 2DO0A 2JVRA 1WG1A 2MKCA 1VC0A 2M8HA 5GMKa 2I38A 2KRBA 2KM8B 1KC8T 3BO2A 1OO0B 1YJNS 2B0GA 2HGNA 3THPA 1S79A 1U1KA 2CQ0A 1X4CA 3H2VE 2MB0B 3CC4S 4QU7A 2EK6A 3SMZA 1M1KT 3G9CA 1U6BA 2G1DA 2CPYA 3CCJS 3OW2R 4OZ1A 3CCQS 2DK2A 4FXVA 2KN4A 3I56S 1K8AT 5JVHQ 2DNRA 2M8DB 1CVJA 3P3DA 2DO4A 1WF0A 1A7GE 1U1RA 2LQ5A 4F25A 3G8TA 5IM0B 2M52A 4QQBA 4UY8T 4RU2A 2D3OR 3CCES 1UAWA 2M2BA 1M90T 2CJKA 1WG5A 3R27A 4FXWA 4WKRA 3VF0B 1VC5A 1Q7YT 2RQCA 3MOJB 2FC9A 2MJNA 5ITHA 1G2EA 3P5TL 2MZRA 3EX7B 1SJ3P 1HD1A 2V94A 3P49B 2DH9A 4TLQA 2CPEA 3CCMS 4J5OA 1YI2S 2ZJPQ 1Q82T 1HD0A 2MY8A 2NZ4A 2CQGA 1YITS 3IRWP 2M0GB 2F9JA 2HGLA 2XB2D 2M4MA 2Q79A 2KI2A 1SJRA 5LJ3Y 1FNXH 2HGMA 2DH8A 3CXCR 4M5DB 1SJ4P 4WIIA 4IUFA 3I55S 2MHNA 3IWNC 2YTCA 3BO4A 3UCUP 3R1LA 2ZJRQ 4A8XA 3VAFA 2J76E 4ERDA 5IQQA 2A3JA 1WWHA 2X1AA 1H2UX 2J0QD 2CPHA 2ADBA 1U1PA 4YOEA 1IQTA 2CPXA 4C0OC 2EVZA 2KM8C 2CPFA 3CD6S 1WI8A 2DGQA 2JRSA 2ERRA 2CQCA 4OZ0A 2DNLA 2E5GA 5DETA 3U1LA 2VODA 1D9AA 2YH1A 3LQVA 1N88A 1RK8A 5GAEU 3B4MA 3P6YC 2RRAA 5CXTA 4QPTA 1URNA 4W90B 3MI7X 3CCVS 2MZSA 2AYMA 3BO3A 1X4FA 2JVOA 2RU3A 3CC2S 2MSSA 3FEXB 1QVGR 2LXIA 1Q81T 2DB1A 1P1TA 3FEYB 1H2TZ 2OTLS 3VAHA 3Q2TC 2VOOA 2F9DA 5LXYA 3THTA 2KVIA 2HZCA 2MPUA 3CTRA 1B7FA 1FHTA 4YB1P 4Z2XA 3VAGA 2JX2A 4WFAQ 2CQPA 5DDQC 2DNPA 1L3KA 1WHXA 2OIHA 2VONA 4Y0FA
chains in the Genus database with same CATH superfamily
2HFOA 4C8NA 2H9ZA 2BABA 3CUNA 4F04B 4ZIWA 1VBYA 2FVPA 2YX4A 2MQPA 3RRGA 1RT1A 1Q8KA 2CG4A 3G82A 1PGZA 4LSLB 2XNQA 1IVZA 3D1QA 3CMES 2DIUA 1V9OA 5KFDA 1U1LA 1XNRJ 1X4BA 4R0EA 2D3ZA 5KT4A 2HK2A 3KHRA 2HWTA 2BEFA 4C8MA 4DBQA 2HNZA 4WCEQ 2ZD1A 3QBCA 4H4KC 3KJNB 3AB2B 2VC0A 4OV1A 3D3CJ 3W5YA 3PV8A 1T3OA 3V5RA 5KFEA 2CPZA 3GPAA 2XWXA 4NLTA 1LWEB 3GMGA 3KK1A 2CIMA 2MEWA 3POTB 4I2PB 3N9UC 2NLWA 3W66A 6FDRA 1VISA 4HT5A 3HM9A 4IR9A 2UVWA 5IWAF 2DNMA 4WU3A 3CJ8A 5CAAA 4MIAA 4X64F 1T05A 1BQMA 2XS5A 5GMDA 2ZDOA 3S01A 4J9LA 2W4CA 4ZPBA 2C3UA 4FXDA 3ZZPA 2E1RA 1FRIA 1OSCA 4K2JA 4DSJA 4CM0A 2D9OA 4YHHJ 2ASYA 2HFUA 2XGPA 3M30B 2IY5B 5CA5A 1HW9A 4Q7AA 4U67Q 4RNHA 4AL6A 3IMQJ 5GADI 1RUSA 4PRFA 4R25A 1VBXA 2C2RA 2GHPA 4IH5A 1N8RT 1H0HB 4BDPA 2FGCA 1R8CA 3K5NA 2VDHA 3DDNA 2VFTA 2FVCA 3LW5C 3BB5A 5E3AA 5A8KA 3QGGA 3L3CA 4PEOA 1K1QA 1DHMA 3OL6A 3D0GE 2YWFA 5H9FJ 4ZVOB 1UPMB 4X4QA 4K4VA 1FNMA 3DN9A 4CNYA 3SSQA 5LM7E 2BXJA 1U7LA 3PVXA 5J1EA 2KHCA 3VVTA 1QM9A 1J5EJ 2OH2A 4ZPTR 5F8GA 4PXBA 2YQ0A 1CBKA 2KYZA 2PO4A 4NLRA 2VBXA 3FBEA 1T05B 4USTA 1JKHB 5HL7Q 1FDNA 5KTQA 1T94A 1QJHA 2CQ1A 3OTCA 2WSCC 5FD1A 4ZJLA 3W7BA 4F7VA 1NSPA 4X65F 1M5OC 3M2RA 3BSCA 4ZJOA 3ZO7A 1KFSA 4ANDA 3QRRA 2H51B 3KDNA 3W5XA 4P2MA 4ZMMA 2CPIA 4HI2A 4DL0C 4JI4F 2M3DA 3CSKA 1CC8A 1BQNB 1O51A 2RQMA 4NA3A 4X65J 3C66A 1LFWA 3LA0A 2KG1A 3RYLA 3NY0A 4MMOA 1JNRB 2CJXB 1GTEA 3Q2SC 2UZAA 1IBKJ 4OX8A 3KYLA 4DSKA 2JEFA 5FIIA 3HPOA 3UQSA 4DQRA 3LP0A 3QLHA 2FJXA 4EUVA 4A8SA 1RT6B 3BH7B 2QSFA 1VHFA 4NI2A 4MIWA 5IT9U 3G6YA 3RR8A 3SDEA 1KD1T 2DGSA 3NP5A 4HDGA 2J8AA 4C2MA 2R8HA 2DY9A 1WC0A 3S7RA 4UZCA 2PEBA 3FVYA 1KLMB 3WX8A 4DV3J 4DR7F 2RUSA 2M70A 4GMKA 3R2CJ 4NLVA 4IQXA 1PBAA 1FVSA 3GJQB 1C1BA 1HQUB 3LP1B 4XAKA 2XHCA 2R4FA 3NOCA 1FKAF 4H4OA 4WJBA 3QRQA 2AKWB 4X4NA 1HA1A 3GZ7A 3CCLS 2RAQA 2MZQA 4OI3A 3FSIA 3H98A 1FRLA 4PXCA 2PN6A 3I6PA 3W3SA 3NEKA 3GILA 5IC4B 4ZOSA 2UU9F 2VBYA 1LOUA 3DOMB 4KE5A 5IWAJ 2R7UA 4P6QA 1QAIA 5HO4A 2QA4G 2HQIA 4TY8A 4FS2A 3IM9A 4QYRA 3A8EA 2QC3A 3VAIA 2VDIA 5E33A 1S76D 2XY7A 2IVMA 2UUBJ 4O44A 1R43A 2Q6CA 1D3WA 1FFGB 3LAMA 1TV6B 5K14A 5K20B 1R31A 4KR0B 1NKEA 4DX8H 5F8NA 3EJMA 2ZH1A 1NXIA 2BQUA 3OR2A 4MK8A 3SYZA 4F0MA 2YKQA 1EKSA 2KVQE 3FEZA 4G1QA 1SXLA 2RRNA 2JHEA 3WDOA 3CF5Q 3OL8A 2EW9A 1SPBP 2EPIA 1TR0A 2Z4PA 2W2PP 3THVA 3U1NA 2UXBF 3LPYA 4OHVA 3DDIA 4OV6A 4QIEA 2MKIA 3D4JA 2MKJA 4N56A 1RHJB 5BYQA 2B6AA 1T3NA 2HHSA 4ZCMA 4WF9Q 1LKZA 4RW7A 3PIPQ 4FF3A 4XPCA 2AD9A 1KOOA 1ULRA 3E2EA 1RWNB 1EAYC 3P45B 3T5HA 1REVB 2CQHA 3AA8A 4DCOB 2A6MA 2ZFHA 1WDDA 3CB4A 4DOZA 4ELUA 1NLKL 4WFBQ 2ATCB 1RU2A 4DSLA 1RCXB 4I0WA 2WHOA 2R8JA 3US5A 1RHRB 2I5JA 4I6AA 2ZH6A 4P9SA 2Z2MA 2MGZB 4X4TA 5K8NA 3LANA 2FZGB 3OTOJ 2K1RA 1X9SA 1DTTB 1RACB 1WI6A 3G71S 1JLAB 3P8BB 1R8PA 4DL6A 3OTBA 4C8LA 5KT5A 2FHKA 3P5BP 4C4WA 1XWLA 3DM2A 1JJCB 2A18A 2LYVA 4O3NA 4ZITA 4K4WA 1WJ9A 2B8QA 2QZ8A 2YWHA 4IO1A 3DU5A 4AQYF 2KZMA 4CH0S 2RF2B 2IM0A 1VK8A 1S48A 4ZPVR 3DGVA 2Y1JA 1N4LA 4NXMF 2OJ3A 2UUAJ 4ZP6A 1S9EA 1FT8A 2V2QA 1LK5A 1MW7A 5HATA 1TKZB 3UVJA 1N52B 5D0HA 4Y00A 2XLJA 3H40A 1X0FA 2FY8A 2J9CA 4DS4A 1RYSA 2QSWA 4YR0A 1SJQA 2CPDA 1XN9A 2R7OA 1N5YA 2ADCA 1BQNA 3TQEA 3FCVA 4IG3B 4PYDA 4B9VA 3A13A 3D1OA 3RAXA 1Y3KA 1FWPA 3CJKB 1OY9A 2OFGX 1FXDA 2CA9A 2ZKTA 2FUG9 3ILIA 1TAQA 2YQ1A 4P73A 5JXSA 5KFFA 3EMTA 2EI5A 2J9DE 1KFDA 1FERA 2QGFB 2FHJA 3UWTA 2LP4A 3M8PB 4LUBA 1V5IB 2XS2A 3UVJB 1S6UA 2IIHA 1E6VA 4YFUA 2LFVA 3O44A 4DV5F 1FWKA 1RT5B 2IC3A 4JI3F 3W9JA 3UI3A 2BOAA 5CYQA 1C2PA 4DCPB 1VQ8S 1UWBA 2B56A 2C2ZB 2KL8A 1NEEA 3PFOA 5HN0A 3AAWB 4NLSA 5AT1B 2IJFA 3TANA 4LF8F 4HKQA 3EICA 1T9YA 3EVMA 3M8QB 5KFQA 5FLXU 1RBOB 3EGWB 3A3NB 3TAMB 3J7Z5 4C3LA 2G13A 5DDOC 4WYLA 1U1NA 2RS8A 1WOSA 1TFWA 3IGNA 2CUYA 2DNZA 1FCAA 3W62A 3VAKA 1L3VA 4F4KA 2DNQA 3ZNUA 2Q66A 5J2MB 3MEGB 4L3KA 1ZETA 4CTAA 1I1GA 2LA4A 2ZBRA 2W7PA 1U1MA 2YNFA 4FBUA 3CCRS 3MCNA 4RNMA 2GGPA 1TVRA 1BY9A 4J9UE 5M2PA 2DEJA 2GVZB 3VGTA 1UKUA 1Y3JA 4TLRA 3MD3A 3NXZA 3AHPA 3SCKE 2BOPA 3MDFA 3I0RA 3PHEA 4HH1A 3DLJA 1VFJA 3Q22A 2EK1A 3O8WA 2BJEA 1Q95G 2C3OA 2MSTA 3W9IA 1ELOA 2IBOA 5KFCA 3K58A 4Q0BB 2J6TA 1Q5YA 3OVAA 5L1IA 1VOMA 2VOPA 1LNQA 2XM3A 2HNDB 1NK9A 1WHVA 3AODA 4BC7A 2XCAA 3H4BA 5IT0A 1VCTA 5BR8J 3ETMA 4JI5J 1WTFA 2MY7A 3C6UA 4EFAC 4GC7A 2HYIB 4F2RA 3OR2B 5KAKA 4GO7X 2FHMA 3EGZA 2CVIA 5CQGA 2MHEA 5EWGA 4P71A 2YXLA 3TUIC 1XNQF 2CJBA 2RT3A 1CS4B 1FK9B 1RAJA 3FNNA 3NLCA 5C42A 4P72A 2RNEA 4CH1A 2DIVA 1T0TV 1JMTA 2DHAA 2KXFA 1FESA 2JEGA 1JIHA 2CG8A 3D66A 1C0UB 2NPFA 3PKMA 2ZDPA 1NNDA 4HHUA 2X1GA 4D3GA 3CEDA 1MMDA 1AZSB 1S57A 2DISA 1L3TA 4K4ZA 4LR8A 2BJDA 3UNYA 2XMVA 2HBZB 3KJVB 2XO7A 2C22A 4A8MP 2H48B 2PMZD 4ECWA 3EXCX 2RDDA 4ANCA 1QSYA 4Q43A 5HROB 4LF8J 4NXNJ 1CJUB 4L72B 3ENQA 1HHQA 5J2NB 4DV1F 2YPZA 5C5JA 3LGMA 1VC6A 1RTDA 3J7A1 1X8DA 2WBRA 4KHRA 1UP1A 5ETOA 4OX9F 2ILZA 2Y8WA 2XMWA 1VYAA 1L3SA 2ILYA 4PKDB 1NKBA 5HLFB 4DV5J 1DTTA 2AW0A 4MKYA 1KQFB 2BZ2A 4Q8FA 4DQSA 4CO3A 4WFNQ 1VQSA 1ZAVA 1FX2A 2R42A 3TR5A 4QWCA 5D3GB 1SQEA 2IBKA 4ED6A 2RSQA 1OWXA 3E01B 1WF2A 4FYYB 3KJVA 4N76A 4WYWA 4RL1A 4C98A 1RQ0A 1XQIA 1FDDA 2VH7A 2UP1A 3HFZB 1U02A 3HX9A 1TUVA 3L7OA 2HZVA 3FSXA 1MG7A 3HCXA 3QAEA 3PYFA 2BJ9A 3OPKA 4KGMA 4M5LA 4NLOA 1RAEB 1H72C 1F1BB 2HAFA 4FZVA 5AXMA 3N6MA 3ZZOA 1S4EA 3LH2S 4MKBA 3QWUA 4NZ7A 4ZN3A 4LIWA 2LA6A 1R0AA 5KG7A 4IG3A 3UN3A 2B9EA 2UXDJ 2KFZA 3KK2A 3ETOA 1BQXA 1RAAB 3I32A 1C1CA 3L4BC 3CJKA 3GIMA 5LT5A 2VQFJ 1RT5A 3M8RA 2XY5A 1RCOB 2B4VA 3DYAA 1X60A 2B0GA 4U9RA 1SC3B 1NK8A 3HK2A 2KB2A 5L1LA 3CC4S 4LF5F 1PYSB 2W7OA 3V6HA 3M8ZA 1S0VA 3TWZA 3BPSP 2EXUA 1K0TA 2DHHA 3R5DA 1SCJB 2YWEA 5CYQB 1SBRA 1RBLA 4OZ1A 2QX0A 4UT4A 4K5RA 4DR1F 1NMEB 2E1CA 1FRXA 5E0OA 3G2XA 5F8IA 1NSKL 1HFEL 3GE9A 1HNWJ 2ALZA 4TXSA 2YNFB 2JLFA 3PDNA 3JSMA 2A2DA 1WC1A 2DNRA 4F50A 3SSSA 3BF4A 1EP4B 2G0IA 4F67A 2L9DA 2FTRA 2HS0A 3SCJE 2W9BA 1WNEA 3ET6B 1HQUA 2ROGA 2V2VA 3G8TA 1U09A 1FJGF 4QQBA 1JLGA 2HFNA 4RU2A 2UXBJ 1HARA 2D3OR 2GFFA 2M2BA 1NUEA 2OELA 1K1SA 2WAQD 4KGKA 3MZIA 4KGZB 4WU2A 1OYDA 3WIUA 2XLIA 2XMTA 3C46A 3DLGB 4ZS6A 5SZTA 1UEVA 1HLWA 3DU6A 5L1JA 2IM3A 2PMHA 3MOJB 2FC9A 3KLIB 5HP1B 3C6UB 4B9UA 3EZUA 4OI6A 5KFAA 2R7RA 4B3RF 4ZA1A 4RUCA 3R9LA 5KFIA 4ATNA 3OFGA 4DR5J 2UUBF 1MSWD 3TVZA 3AJ2A 1JLQA 1XMOJ 2P5VA 2YVSA 3DOLA 2F63A 2ZBCA 2VG5B 1SUQA 1LW2B 3MMCB 2CPEA 4TLQA 4J5OA 5HVGA 5ETMA 1I51B 2ZJPQ 1Q82T 1OSDA 1TL1A 3AOCA 1EP4A 1YITS 2POKA 2F65A 4RW9A 1YJ7A 3NG8A 2XB2D 2BJ1A 1ICEB 1YZ7A 2W2QP 3IAM9 5BYRA 1KVJA 1GMWD 1B70B 1OJ4A 4B3MF 4AT1B 1SJRA 2QLJB 3BGLA 2GHWA 4WP3A 3D6FB 2BJ3A 4ZPDA 3EYZA 5L1KA 1CJKA 1FNXH 1H38A 4WPAA 1RE1B 2H65B 4ZVTB 3GFZA 1KWMA 2DH8A 2RKIB 2ZNYA 1NJWA 1N34F 3HZEA 3C3LA 3MF5A 5ETLA 2G2YA 5KFKA 5A8WB 4DV3F 4J90A 4BWMA 3BBCA 4ED8A 3R1LA 1NKCA 1ZM4A 2W1BA 4OX7A 1RP5A 3DDKA 4A8XA 2ZHBA 3VAFA 4DV0J 2AGPA 1N32F 3EGVA 2MQ8A 5A76A 3MAQA 3UR0A 5J2NA 3NCPA 1TK0A 2J0QD 4YOEA 4KFBA 1N0UA 2K7KA 1RAHB 3UFCX 2VPYB 4ES1A 2CPXA 5T41A 3T1AA 5C25A 3TJAA 2GX8A 5DG9A 4F4ZA 2UUCF 1LEOA 2VASA 4NLYA 3HVAA 2HNYA 2FJAB 4RW8B 3TUPA 2RKIA 2LU1A 2OMLA 3MM9A 1WI8A 3GIIA 2ZC4A 4ITSA 1LFPA 2ZH8A 4I68A 5F8HA 2AWZA 2IDEA 5KFJA 3CDUA 3GIJA 1PCAA 4USWA 3ADAC 1S6QB 2E5GA 3CJRA 4YY3F 3JSBA 1R0AB 3CGIA 4OZ2A 4B3OB 1HBOB 3MCOA 3HDSA 3OHBA 1CPZA 4LR9A 4TNOA 5KFVA 5HQLA 3LQVA 4C11B 1N88A 3O6QA 4NLWA 4RBUA 5GAEU 3ZC4A 1AFJA 3MWBA 1I6JA 2RJZA 3K57A 5CXTA 3M8YA 1KLNA 2E9RX 3MI7X 1HI0P 3PJXA 3HFKA 2MZSA 3GG1A 3MPWA 1MU2A 1VI7A 4YB6A 2GV1A 1X0PA 2A2CA 2JVOA 4K8RA 4PUOB 3Q0AA 4P2SA 4P10A 3GR1A 3LPEA 5EHHA 5K9FA 5C2GA 4A8WA 1OS5A 2DB1A 3GR0A 1AXQA 2CZVC 3MM7A 1EHWA 4L3NA 4O0NA 4QIWD 5G0RB 1UEUA 4GO5X 2XMKA 5DO2A 1ZM2A 3T1HJ 1HWJA 1RBAA 1DQ9A 1OMSA 4F0HA 3JSMB 2W9CA 3Q2TC 5D4OA 2JLGA 3RBDA 2W9BB 2X7IA 3N6LA 2NQPA 4C8KA 3PKYA 2ZZNA 1IJFB 4OL8A 2HMIA 4H4KA 4RUHA 1BWEA 4TYAA 2HZCA 1TP7A 2BM1A 4C3KA 4J9QA 1B7FA 2C28A 2VBWA 2DTJA 2KFNA 4IH7A 1CSJA 3T9NA 4JYAF 2JX2A 4WFAQ 2MTLA 1RJJA 4OI2A 4FS1A 2RHSB 3VTIA 4OYMA 2VONA 2W24A 4WTYA 5H9EJ 4O3SA 2C2OB 2OLWA 3SCIE 4A47A 3FJ2A 3KLIA 2EG2A 2F4FA 4FYDA 3H5SA 2DNHA 1HBMB 2OPRA 2XSFA 4U8VA 1M5VC 1APSA 1TUWA 5IV3A 4DI6A 2MQOA 3ICLA 4M5HA 5K8MA 2IJNA 3NS5A 2IYGA 2BW2A 4KV8B 4OYXA 3MUMP 2B4OA 3J80Y 1RWKB 2HEKA 2LQBA 3W64A 4M5MA 3ONQA 4O4RA 3QMQA 1U25A 1QDUB 5F8JA 3V81B 1S97A 2BE9B 1RWPB 3JTNA 2DGWA 3JB9k 2XNRA 4U95A 4OJHA 3TZWA 2VFVA 4RPFA 1FWLA 3T19A 3RAMA 3RR7A 3KNAA 1T9WA 2QYCA 1QVFR 2HS4A 1FXLA 4FF1A 1HBMA 2OPRB 5HMYA 1REGX 1U45A 1C0TB 3HHLB 3QT6A 3NAHA 5J1PA 3KJFB 1FDAA 4JB8B 3MMBB 1HI8A 4ECQA 1N48A 3KFWX 1W7WA 3GIKA 2V4RA 4HDHA 3M30A 1IBMJ 5LMNJ 3A3PB 1SL2A 2VG7A 3EE3A 3VAMA 1CG2A 3BDEA 3R7NB 1KBRA 4JI2F 3GWCA 5GADU 1UWAA 2XMJA 1IKVB 2Y8YA 3H7HB 1CC7A 3HZGA 1ZYQA 4ED5A 2EFQA 3GIRA 4M5JA 1VQ5S 1RTJB 3W1YC 5HROA 1J27A 2R2UA 2YWGA 1C0TA 1U26A 1PAUB 3HHLA 4ZDNA 5I3QA 3EPIA 3DHXA 1WORA 4ZVSB 3DLEA 4JI8F 1K44A 1Q78A 2GJIA 3OFFA 3OSNA 1YHQS 4C8OA 4KPCA 5D8HB 3W8GA 4RNNA 1NJYA 2E66A 1PC5A 4K4UA 3KJQB 3ZZYA 1VQ9S 1A9NB 5JJBA 4NWBA 2YWKA 4BLGA 3G6XA 3SQGA 5KG0A 3M9NB 1X4EA 1E6VB 2GW8A 2PC6A 3I31A 1CJVA 1CQNA 2YKAA 1IKWB 4CQ1A 3NMRA 1V5VA 4R8UA 3BGRA 4OZ5A 2LLZA 3RBZA 2FVRA 1UW9A 5A2QU 1VRUA 3KLGB 1GFWB 2N7CA 1K9MT 3ISNC 3G8SA 1NDLA 4HHJA 2QLXA 1WF1A 3R5CA 4KGXB 2DGVA 4O3RA 4MYTA 1J2VA 4W92B 1VQLS 2XS7A 1M5KC 3PW7A 3CNQP 1XIQA 3OVSA 2K8GA 2HW3A 2DNNA 2BE2A 1TZ0A 3CDBA 4ID8A 3UCGA 1S1UB 4ED0A 2ZBQA 2J6UA 1I5OB 5G0RA 4LMZA 3VZHA 1LWCA 1MU2B 4JP8A 4ILRA 4MJKA 3UE2A 4PUOA 1N54B 3PO5A 1EZZB 3LTOA 4AUKA 5L39A 4OI0A 2UVRA 3G96A 5HQ8A 3KLGA 3R1HA 1RWWB 3H42A 4BC9A 4NI2B 1ZH5A 5DM7Q 4DV2F 5J2QB 2F4VJ 2IRXA 4J9RA 3TZYA 1TMMA 2W2NP 1NSAA 2OPSB 2RS2A 1IR2A 1QUPA 1X4GA 1TELA 2YKNA 3VGVA 2BM0A 2XZTB 1RT4A 3CDAA 3O1LA 4WE1A 4CLFA 2DYAA 3DRPB 2P9GA 2FVSA 3Q83A 1BHNA 1U2CA 4JI7F 1YBAA 3NNAA 3JYTA 2KJWA 2ASDA 1GH8A 3GLJA 4YB7A 1KTQA 2E44A 5CYMA 2QLBB 1D8YA 2AEMA 1JLFA 1UL3A 2JZ5A 1S49A 2MKSA 2VFSA 1RADB 3BGOP 5LOQA 3BEGB 3CCUS 2QG9B 5MLCV 2MZTA 3MCSA 3EGNA 1WHWA 2EWHA 2KHDA 2V2ZA 3MM6A 2F7VA 2WVCA 2DRBA 1KVIA 4E98A 1EIYB 5M2RA 4C7QA 3R5GA 1UVKA 4O3QA 4F4AA 1Y11A 1Z2LA 4L74A 2DR7A 2C2EA 3TUJC 3UDEA 4PPDA 4B08A 3ZZ0A 4CO2A 1DURA 3M6XA 4RW4B 2F5GA 5B0GA 3M8WA 2EBEA 4NA1A 1NDPA 2OP5A 3TAMA 4F2SA 1RT3B 3EVOA 2YBVA 3R8YA 2CZ9A 1T02A 5D4PA 3KUEA 5CH7B 3R7SB 1N56A 4S0MA 1MROA 1X31C 3MMAB 2G4BA 4DU8A 1RXOB 1U1OA 2AJFE 2RE1A 1RSCA 4NA2A 3TA0A 4X62J 4LRCA 1KP6A 3UN5A 2D9PA 3MUTP 4RW9B 1UFLA 2DR5A 1FVQA 1QAJA 1VGYA 1N5TA 1NB2A 1FRJA 3MR7A 4OZLA 4ED4A 3CD7A 3UDLA 3EVWA 2DGOA 4I56A 4RW4A 5CCMA 1TL4A 1JK9B 1S12A 1ZZNA 3O5TB 4WXWA 3H4DA 1S9FA 4DV2J 3IG1A 1MMNA 3LGHA 5G4DA 2R7QA 1M1GA 2QO3A 3QQCD 3A8JA 2NXEA 3HKWA 4DV6J 5GAGI 3TEHB 4RKUC 3H2UB 3FZ2A 2GQQA 2N4CA 3N28A 4ZP7A 2K1RB 2MJUA 3X3UA 1GEHA 1S4FA 2Y1RI 5C2CA 5EDWA 2Z2LA 3DLHA 4Y2KA 1VQNS 4K4SA 1SKRA 3E3XA 3FZBA 1HNXJ 1GTHA 2FD2A 2B5JA 2YX1A 2V8PA 4JOUA 2JC0A 3DC2A 3PHTA 2NXNA 4KB7A 1S59A 4MK7A 2CAJA 3R5AA 5KT7A 2MZ1A 5KG2A 4PG4A 3KLEB 2C42A 4OJ1A 2OEKA 4DUYF 1UVIA 3HHEA 3MAAA 3PW5A 2HG4A 1F2GA 1CQMA 2O01C 4ID5A 3OQ2A 1RHQB 3A4TA 4DS5A 1SL0A 4DV4J 2R3VA 1VQPS 4KTQA 3CO9A 1S1VB 4J9SA 4Z7CA 3W8PA 3K5MA 2JSXA 3JAMU 1PJ5A 4IFVA 1CJTA 3DI6B 4URGA 4TU7A 3KLFA 2AX1A 1U6ZA 2HVDA 4DUYJ 1D0EA 5LJ5Y 4JI8J 5KFBA 3TO8A 2BE2B 5LSOA 4LQ9A 5CZVA 1WKJA 3UD3P 1T7PA 2UVVA 5A6PA 5DM6Q 2AYBA 1MN7A 2HPUA 1RTIB 4LF7J 2J0WA 4DR3F 2B7BB 2W4DA 4FDFA 5DGAA 1TV6A 2RMLA 1FJGJ 2SXLA 4WE1B 3PIOQ 5FJ4A 1YG0A 1HNVB 3FRYA 2R7WA 1P27B 1SIZA 4ICLB 3D7SB 3D28A 4A8FA 5FLXY 3GU0A 3A1YG 2HRUA 2KH9A 3IRXB 1RWOB 2U2FA 4I6YA 2YKNB 1P8GA 3JTOA 4ECXA 1W25A 3AXKA 1FXRA 2ROEA 3QIPA 1C4CA 4ZVPB 4EMDA 2YKMA 4CLLA 1T9XA 2JJ4D 4AXJA 1YZ6A 4EO8A 2AQ4A 1N6QB 1VLOA 2VB6A 4KC5A 2DPJA 1KN6A 4J37A 2MQMA 5CYMB 5LXRA 2DGUA 4ZVQB 5KT6A 4YB5A 3N6NA 2B7CB 3JQMA 3VCDA 2CQ2A 2IJRA 3L7UA 2DRDA 4DPUA 2GS8A 1Y5LB 1U1QA 2HRYA 1FFSB 2E7XA 2D1CA 2CPJA 1FA0A 2YNHA 4HTJA 3T5JA 1DZ5A 4J9OA 4C0BA 4QW9A 3U27A 1TQLA 3PZPA 1S10A 1S0MA 2PI5A 4LFAF 4QYZJ 4CNZA 1FKPA 2FZKB 3FBBA 3N0VA 4NLQA 3TOQA 2ZUAA 5FDLB 2A10A 2HFSA 1B0VA 1AROP 1OY6A 4UF4A 2CFXA 3RJMB 3UDCA 2UXDF 1AA1B 2YKMB 4ZVEA 4IYQA 4ICLA 4DQIA 2ASLA 2WOMB 4EU0A 5F3TA 1H6KX 2LDYA 3NWGA 5D4NA 1WG4A 2HLUA 4WK1A 2X51A 1LQ9A 1SB6A 2QLFB 1DTQB 1M1HA 1QE1A 2CQIA 2PT0A 3ZTRA 4F4XA 3AOAA 1K73T 4ELTA 1JNZB 5IV4A 1CLFA 2H54B 4M5GA 1F9FA 2I1RA 1MWZA 1SI9A 2P2CB 1NH8A 1Q86T 3OD2A 3KG4A 1F3VA 4M63A 4MYUA 5LL6d 2VJUA 5F8MA 2LEPA 4ES2A 1UW4A 4B9TA 3TAPA 1S9GA 2OFHX 3EM1A 2EC0A 4ECZA 1Q1KA 2NUUG 1U2FA 1HHSA 2ZWPA 1S0OA 4U7UD 2Z58B 1F2HA 3PRBA 2QRRA 4Y28C 1XBWA 2D3UA 5I3PA 4F3OA 3BDPA 1Q0NA 2BV3A 4IRDA 2VG7B 4ETXA 4GC6A 1B0PA 2AP6A 1GMWA 4MTPA 3T1YJ 5EN1A 1X7VA 2ZBPA 5DRKA 1GQEA 2LU2A 5L9NA 3U1MA 4C11A 3MEDA 4L76A 1IKVA 2RB7A 2ASJA 2F4VF 3DOKB 3H8YA 2WW8A 1JXVA 5AJ3J 2N7YA 2ZWOA 3C19A 5AXLA 3W2WB 2QMUB 5K8PA 1XR5A 4X4OA 2A0FB 4FN5A 3T5LA 4C9DA 4GKJJ 1NPPA 2FHOB 1LWFA 2I2YA 4JI0J 2Q6BA 2QEXS 5DJBA 2B5JB 2DITA 4O3OA 3NGSA 1TL3B 3GONA 1JJ2R 1AT1B 1UVLA 5E3PA 1P9YA 5ETTA 4CT9A 4PQUA 1HWLA 3I5AA 4C0HA 2HHUA 3BGFA 4P74A 4KAIA 1RU1A 1RHKB 1S9GB 2AEFA 4FYWB 3AD9C 3NGUA 3GYXB 4Q2LA 3B4DA 2NUHA 1SH2A 3CCWA 4B9MA 5HJYA 4H4MA 2I38A 2W7AA 4HHHA 2MLXA 5BR8F 2KRBA 3PEJA 2AZ1A 3HVTB 2Q1LA 1FJCA 2ZKUA 5KG5A 4V1Ak 1O6XA 1C1CB 1EX8A 2HZAA 4FVMA 4ZHRB 4USHA 3CJ4A 2CQ0A 4FPIA 1U8SA 1S1TB 3M1VA 2GC8A 5KG3A 2EK6A 3SMZA 1M1KT 3Q86A 3JQKA 1TL7B 4DV0F 3UR3C 1WUUA 3ZTPA 5H9EK 1U6BA 1MNEA 4DSEA 1TK5A 3OW2R 3B54A 2CJ9A 4KH1B 1FEHA 4U96A 3CCQS 3HSGA 2Z0GA 2DK2A 3IAS9 5E3QA 4LF7F 2E1AA 3K89A 3UO0A 3I56S 1K8AT 4W4MA 5DQGA 1NK4A 4KV8A 3GJSB 4ED2A 2I9SA 1DY3A 3P3DA 4ZHRA 2DO4A 3MPVA 1DJ0A 1Z2ZA 4MFBB 1HPZA 4BWJA 3QIPB 4PCQA 3MPDA 2HVEA 5IM0B 4J9NA 2M52A 4KQZA 2V67A 4PPZA 5DZ6A 5RUBA 2IM1A 4UOFA 4UY8T 1KR4A 3AQOA 1N6QA 2AJQA 3M2VB 4I69A 4OZ3A 5C7PA 2J5AA 2DR9A 4N5SA 1HYSB 3QGHA 1TKXB 1FKPB 3L09A 4C6AA 4AXIA 4QPXA 1VC5A 1Q7YT 4CCHA 1FX4A 1ZOTA 1G2EA 1U4BA 4P2FA 3KLHB 1ZAWA 1NK5A 3P5TL 3KTQA 2WVDA 2WOMA 1RT1B 1F0XA 1BD6A 2XSJB 5F3ZA 5KFOA 2VQEF 3D9BA 2DH9A 1HBUA 1HNIA 2OAUA 3NWRA 3CCMS 2AT1B 3FBCA 1R27B 2L3MA 5EX3A 2PA3A 3IM8A 1UA0A 3MMJA 2CQGA 3KUHA 1V3ZA 3W61A 2HQGA 5HSPA 2G1HA 2H5JB 2M0GB 3ZTOA 5L38A 4RUBA 4QW8A 1R0CB 4FP9A 2IAJB 2YX7A 2QA1A 4USUA 4MIBA 4QZVB 3BBFA 2EKYA 2HGMA 1Y4ZB 2PDAA 3GCWP 5HAOA 3TW0A 3VQTA 4M5DB 5A8WA 3LWMA 4AQYJ 1SJ4P 3I55S 2VICA 3IWNC 3OTEA 2YTCA 2YWWA 3H5UA 3UCUP 2VKRA 3R5JB 1DAXA 1GMVA 3ISND 4KHPF 4ERDA 4J7CA 2XLKA 5KFGA 3DHWC 3TNVA 2XHWA 1ZBTA 2Y0SD 4OHWA 1U1PA 4M95A 3K17A 1GK8A 3M6WA 1IQTA 2RF2A 3WC0A 3EXYA 5HVFA 1HQEB 2D69A 2W25A 1GXLA 2IVYA 5ETPA 3DRSA 3M32A 4ELVA 2UV8A 3CD6S 3RTVA 4N8OA 3PJ9A 4ER8A 2WB4A 5D15A 4LREA 3SI8A 3BYPA 2ERRA 3MM8B 5HK4A 1N5YB 2J7WA 1XEZA 1LWCB 1A6LA 3MECB 1KEKA 4ED7A 1HHTP 3SZ2A 2BDPA 2V9WA 3U1LA 1EETB 3M2UA 4G65A 1D9AA 4YS2A 4OHXA 1RT7B 1U8WA 5ETKA 3BR8A 8ATCB 1JLBA 1RISA 2YPYA 3C14A 3K5LA 3MTJA 2RRAA 2DD8S 2FB0A 2HS3A 1URNA 2VQEJ 1RA7A 3GV8B 4Y2CA 4ID5B 4NPOA 4RNFA 2ATLA 3UN2A 4H4MB 4HH0A 4PYAA 3M1VB 2OPPA 1IXKA 3LP0B 3B6BA 3QLHB 1X9MA 3GSIA 1AFIA 2ACMA 3AJ1A 2RU3A 3J7AN 3CC2S 3TZXA 1F60B 3MCMA 1DQ8A 3BGUA 1Q81T 4ZCIA 2UUCJ 1H2TZ 2L48A 3PXGa 5IXUA 1N33F 1RT7A 3ELHA 4EBEA 2VZ9A 1TL7A 4NZ0A 5T7LB 2QYGA 4I7FB 6FD1A 2J9EA 4NXNF 2Z56B 2GIFA 1IQZA 1RABB 3R97A 3IBCB 3THTA 3VHQA 3KHLA 2OPPB 3AA9A 3LALA 4TQRA 1ZTTA 5KFHA 1FHTA 2JEIA 1VRTA 3VAGA 3HHDA 3POTA 2DY1A 2LQJA 4A8KA 4URSA 4XIUA 3FMWA 2YNGB 3PYDA 1GXTA 3L7PA 2FJEB 1WHXA 1BQMB 2IYIA 2V6AA 3HLUA 5DQIA 1CULA 3C16B 3PR5B 4B3MJ 2YQ3A 3M7VA 4O4GB 4B3TJ 1XNQJ 3FFIB 4ZKAA 1LWXA 2BRKA 2ALYB 4NYPA 1JXLA 2HBYB 4OX6A 3HKZD 4FYVB 4JI5F 3OFHA 2LQ9A 3RRHA 2M9KA 2GO9A 3GFXA 4PXEA 5KT2A 5ETSA 2ZVIA 5D0EA 1TKXA 2Q43A 1IBLJ 1YWXA 3NGDA 4Q45A 3M8SA 3VR1A 1NCLA 4YDDB 1EQMA 1B99A 4DG1B 5HJXA 2CJAA 8AT1B 4AFFA 3TX8A 4JV2A 4B3RJ 4PQAA 3FQLA 3J80U 1LV5A 2DGXA 3BV8A 4OYOA 3CCZA 3ZZTA 1RKJA 2KRRA 4I1TA 2YKOA 3VGSA 1SJ1A 3C6TB 2R2SA 4RNOA 4C8YA 4CLZA 4NRTA 4YUDA 4I2QB 3CVKA 3V6KA 1DARA 1JX4A 4DF4A 3WX4A 3ULHA 1Y5IB 2R2TA 2DJWA 2UXCJ 1B4SA 1OYEA 3DMJA 2QV6A 1IJEB 4IRKA 3LAKA 2B8PA 1FO1A 3PX0A 4JI2J 4E8UA 3M9MB 1VQ6S 1PAEX 4OI4A 4R5PB 3VALA 4PG6A 1WEYA 2COLA 2BR0A 4M8LA 4B9LA 2NPIA 5F0WA 1F9EB 2GJ2A 4M5DA 4IRCA 3C2PA 5AJ3F 4LRDA 1S0NA 2V8HA 2W2MP 3PJWA 4DSFA 2MKKA 2V8DA 4LSNB 4NYOA 4EBCA 4O0IA 2XBPA 1NJZA 4PZVA 2YY3A 1VJWA 2QIFA 4OHYA 4NL5A 2FJDB 5H1SV 4FF4A 4ES3A 2GZOA 2M88A 2HHVA 4JI3J 2ZEJA 1WC6A 1U6FA 3EDQB 1LXNA 2N3OA 3MHYA 5KFLA 5B09A 1WOPA 3DMJB 3BSOA 3M6UA 3NNCA 4ZCLA 5D6GA 2QA2A 5L9XA 4RJVA 4ZVUB 3P4UB 2PEHA 2QFJA 5GVQA 5LMUJ 4RR5A 2XYHB 3MM7B 3QT5A 4I2QA 4PWWA 4RBTA 2DHGA 1PYOB 1RWMB 2IRYA 2PSZA 1IKWA 2Y3YA 3EDRB 1OQ6A 4OYAA 5B0CA 2GHVC 2HWIA 4I64A 4CDIA 4EYHB 1ZAXA 4HACB 2L41A 1VHIA 2VQFF 2HQ3A 3FC9A 4UOCA 3MM8A 1T03B 3CJQA 3JS9A 2GMLA 2K7JA 1TL3A 2N3LA 1SV5A 2QMWA 1NM2A 4MAKA 1Q79A 1UJ5A 4Y65A 3SDEB 1KTVA 4DX5A 1EETA 2B3TB 3M2UB 2QTWA 3T6JA 4JYAJ 1YSJA 1BWVA 4DPTA 5A2QY 4RWXA 4QR1A 2P8IA 3OLAA 2ZC3A 4K2XA 4RW8A 3UPFA 1S6PA 2ZHOA 3BKTA 5C24B 2QFIA 1NK7A 2FLNA 2AYGA 3H25A 1XNRF 2HBQB 3C8YA 3SXLA 1TKTA 5A8KB 4QWAA 1VQOS 2AZ3A 3N01A 5HVHA 2BKOA 5LMUF 5LSLA 5KFRA 2QMXA 2ZE2B 2RRBA 4ZK7M 4L75A 1HIYA 3H2LA 1Q16B 4I7FA 1EB0A 1X4AA 3W9HA 1SKSA 5IFMA 2O5DA 1UVNA 1H7XA 3TA2A 3MFHA 1VQYA 2V4QA 2CQDA 2AF6A 3T1HF 2WCXA 3CJ5A 2XYPB 5DZ7A 1NSQA 2A1BA 2IMOA 2IVFB 2W4PA 1D9DA 4OMFG 2E5HA 2O3DA 4OX9J 2AJ1A 4YQWA 3GFHA 4DV1J 1RAIB 1Y9OA 3QYYA 1S99A 4U8YA 3IR5B 1MWYA 4YR2A 3F0NA 4N77A 3QGPA 4CTAB 1R6VA 2BE7D 1X5TA 2MQNA 2J7UA 1AUDA 3KOAA 2BW7A 2E5IA 5KG4A 1XERA 2BJ8A 2GGPB 1NZAA 1T9TA 5HBMA 7FDRA 3HSJA 5D4LA 3A3OB 4LBHA 2VHGA 3DI6A 3DLGA 3FBFA 3I0SB 4QWDA 3OXFA 2WK4A 2OSRA 2F8HA 3PYEA 8RUCA 1DFDA 1VMBA 5AE3A 4WKYA 4USIA 3OUYA 2LDIA 1KQSR 1B0TA 3HD1A 3NBPA 5MAOA 2CVEA 3HVRA 4PWDA 1AUSL 4YY3J 3AD8C 2HNZB 2MGZA 4ZVGA 3NS7B 4QOTA 1RHMB 2GCFA 2HQCA 1BXNA 1RT3A 4WTOB 1M0SA 3BJYA 4PR6A 3G4SS 3S1TA 2OEJA 4CYUA 4YR3A 5DS7A 1UFWA 4O3PA 4D3HA 1OY8A 1Y5NB 2I5JB 4J9PA 1G6BA 2ZD1B 4CWBA 3R3TA 4B02A 1LW0B 3QJJA 3M9OB 4WBFA 1IM6A 2JFDA 4X84A 3TI0A 1NK0A 4LFCJ 2F1FA 3MEDB 4B3TF 2IDLA 5JVGQ 4EEYA 5KFNA 3GV7B 3BS9A 5IC6B 3Q8PB 1U48A 1NH7A 2PD1A 3DM2B 3NCQA 4LFBJ 3PR4A 2HFZA 4DQPA 3KXDA 2DXFA 4ZPAA 1S1WA 4ZCKA 1BMQB 4WK3A 2OEMA 1S1XA 4F26A 2OPQA 5I3UB 3QSYB 3BQ2A 2EFVA 1HNXF 3MR5A 3AD7C 1RAGB 2O1PA 3BBBA 4CYUB 1ZTWA 5BJRA 4CT8A 2PI4A 2KZZA 4LRFA 2ZVSA 1FI4A 5HMWA 3D6TB 4Q44A 2DGTA 2ZITA 1NJIT 3Q8YA 3V4IA 3HI9A 3NGRA 2R2RA 4OYIA 4OYPA 4DV6F 2IA6A 4LSNA 5JMNA 3VWSA 3I87A 2HNYB 4Y2AA 5ETVA 3M6VA 1PKUA 2FHJD 4AE5A 4MK9A 4A8OA 4ETZA 4ED3A 2KKHA 3OR1A 2I6WA 5CHCB 4I4BA 1NZ8A 3HF5A 5ETQA 3IS9A 5KOXA 1NHUA 3HP6A 5LSRA 2XCPA 1X5PA 3Q8QB 2B6AB 2V4JA 4AD6A 2J9DA 2NSCA 1XMOF 1AW0A 4LRAA 1TAUA 1WHYA 4NEYA 2HLTA 2DXEA 1Q4RA 1JJ4A 4NASA 1ITPA 5KG1A 1REVA 4X62F 2NR0A 3N5BA 5DDPC 3QFHA 3V4IB 2IA0A 3LWLA 1WACA 4BBYA 1DBDA 4F4YA 3QATA 4ILMA 4ECTA 2FLOA 2ZH5A 3OR1B 1V3RA 2VV5A 4W98A 1EQ0A 4P7VA 1MLAA 4TKTA 2XO6A 2DHXA 1HL6A 1R7IA 1VS3A 2LCWA 2Z30B 1BLUA 3QSIA 1KQGB 2B51A 2GIQA 1J5EF 2NREA 2OKQA 1RWXB 1VIXA 1WKLA 1ZS6A 5F41A 3SFGA 9ATCB 4NCBA 4IFVB 2V8GA 2HHWA 3CT9A 4NXMJ 2L08A 5A8RB 4P7TA 2KDOA 3N5FA 1HNWF 4R8UB 3NKYA 4DQQA 2JFKA 3T41A 4KYZA 3FCWA 3LGNA 2NYIA 1C1BB 2OMOA 3LP1A 5J2PB 1H3DA 3NMAA 4ZLLA 2XI2A 1TMJA 4DL3A 2DH7A 4YHHF 3RGIA 5KG6A 3J81U 2XC9A 1M5PC 2BYCA 3AOBA 1TK8A 3TUZC 2V2KA 1R8AA 2VFRA 5D77A 3NCRA 5HI7A 3MXHP 4LBPA 1VIOA 3MMAA 2PGCA 3OXLA 4B9SA 3IRXA 2RILA 4ZN1A 2LKZA 2R9LA 2KFYA 4TY8B 1C0UA 1Q7LB 1Y0HA 3B78A 3OJUA 3T5KA 4EZ9A 4PG7A 4LF9F 2VUGA 4F8RA 1GX5A 2V69A 1UPPA 1CS4A 3ENAA 4LVOP 4DCJB 5C42B 2MMYA 1QTNB 4JBCA 4UQTA 1VBZA 1ZA2B 2YNHB 1EARA 4JUZA 4E0DA 1JB0C 1K47A 5GAGU 3PO4A 2XYGB 5CD4H 4URQU 4OHZA 3GP9A 1Q8IA 3QPIA 2RUGA 3FFIA 2HVHA 2JLEA 1PBUA 2JWNA 2UUWA 5FDLA 2XQCA 3QAUA 1KVKA 1SH0A 4HTIA 4DMZA 1FJ7A 4CO5A 2EKNA 1UFKA 2G0CA 2CJQA 3KHGA 1WTBA 1LW0A 1F5BA 2DXDA 2HIYA 2XULA 4YEAA 1D1UA 2MYFA 5GAHI 3W60A 2Z8QA 3G6ES 1KOHA 2X1BA 5B0BA 2ZZTA 4RW6B 2MQLA 4DG1A 3MUVP 4LF9J 1ZPWX 4AYBD 4XTTA 2DNOA 2CQ4A 2V50A 1S7HA 2V9KA 3NRBA 3BREA 3OLBA 3CULA 1O8BA 4DR6J 3CW2C 4V19J 2CQ3A 2E5LF 5D0RA 3TQ1A 4N41A 4WFYA 2FC8A 1X4DA 1WD6A 2GVDB 3IXQA 1QD1A 4LQ3A 4QU6A 2RQ4A 2W01A 3CJ3A 3DRSB 2YNIA 5D0GA 4EO6A 4DWIA 4X66F 1HNZJ 1LK7A 2DBBA 5H9FK 2OPQB 1UJ6A 2K3IA 3HSZA 3HULA 4A4JA 1SKWA 5GAEI 1I94F 2OO4A 4CLPA 1CEZA 1FE4A 3MR6A 2AYEA 4GRSA 1MROB 4ZVHA 4DLGA 3EPGA 5SUHA 1D8ZA 3VVUA 4YMEA 2ACYA 2CDRB 3DYAB 3ZFVA 3ZNJ1 1HW8A 1HNIB 3D5MA 1TL5A 3T9ZA 3DLLQ 3FK4A 2H5EA 1VQMS 2ZOGA 3DOKA 4M5NA 4TVAB 2E29A 4XK8C 2WVEA 1X5SA 2YNIB 3BKUA 1IBMF 3CDEA 4IR1A 4PWUA 3L9ZA 1YRUA 3NNHA 3IWLA 1NAQA 4IQMA 5DDRC 4EYIB 4KH0B 4DL4A 4KHMA 1F5CA 1DQAA 2RU9A 3DRRA 1IBKF 3TVKA 1XMBA 3TJ9A 3JSYA 4EI2A 2G0JA 1KHVA 4YDXA 4CLKA 5CD4A 1RTDB 2FVQA 4A46A 2QA4S 3TEGA 2KG0A 4F02A 4NRUA 4PQUB 4RUAA 2AGQA 2CKWA 4PAAA 4HACA 2L9WA 4CO4A 3CPWR 4IOCQ 4JI1F 2VU5A 2JVRA 2MKCA 3DLKB 1IR1A 1XR6A 3W65A 5GMKa 1GMUA 5KFMA 4P75A 3I9ZA 4F3QA 1PIEA 5EUHA 4ZLJA 3HD2A 2E9TA 3HHLC 4LF4J 1KS2A 1KC8T 3CJ2A 4L6V3 3IA0A 4ZLNA 3BO2A 3X1LB 2H3EB 2HGNA 2NZCA 4JI0F 1S79A 2W2OP 4LBIA 2BQRA 1X4CA 3GQCA 2Q3PA 4GKJF 4QU7A 5J2QA 5J2PA 3G9CA 3DKDA 5E3CA 3E01A 3OL9A 3MPYA 1H74A 2P9CA 3IR7B 2BVZA 3QZ8A 3CD0A 2G1DA 2J7KA 3CCJS 2AU0A 1ZA1B 4KT0C 4UZBA 1RT6A 2NCKL 4OJGA 3QT8A 5B7WA 2GJFA 3JTPA 5E5NA 3D1HA 5KFZA 4FXVA 4LVNP 5J2MA 3T1YF 1URRA 1TKDA 3KMQA 1YDLA 3V6DA 4YP3A 5JVHQ 2EG1A 5ADZA 2M8DB 1CVJA 3HMJG 5U47A 4LFBF 2AJ4A 2HAIA 3ENVA 1WF0A 3CIZA 3KDOA 4ED1A 1G1XA 2JH3A 3FDSA 3K8VA 4FVCA 4Y6IA 3IN5A 5KFPA 1RTIA 3H90A 1SVDA 2RHQB 3AFGA 4QIGA 4X64J 1P6TA 3CCES 1TVRB 4B3SF 1SQGA 4DDFA 1SL1A 2VPZB 1WG5A 1E6YB 3LF0A 4QIFA 1FF2A 3ILOA 4WKRA 3PM9A 4DSIA 1YLXA 3I0RB 1HYSA 2FQQB 2MJNA 2QJ3A 2UV8G 5EWFA 3ISZA 2FJWA 4OLPA 3UW1A 4F0KA 3RRKA 1PJ7A 1N5SA 3ZZRA 3KLHA 1HD1A 2V94A 1ROFA 4O23A 4ZVFA 4NLGA 1R6YA 1RKIA 1VR6A 2XSJA 2JOQA 4M94A 4K7QA 1NHVA 2NZ4A 4PG8A 1HBUB 4M5IA 3Q24A 1VRTB 2F9JA 2J0XA 3ET6A 3HT3A 4OLOA 2RIJA 2NS1B 1NB7A 2Y9HA 2OGUA 5E2QA 1EKRA 5KT3A 4I6WA 3BKFA 3OTOF 2GMJA 1IWAA 3CDWA 5KFWA 2VA3A 3WHIA 3I9V9 1QLNA 2C2NA 3H5YA 1HMVA 3C15B 3LP2A 2E7VA 4DZDA 1BE4A 1NJXA 1PC4A 4H54A 3O2IA 3PG9A 3CXCR 3DRXA 4EWTA 3R2DJ 4J9KA 2RDIA 3KMSA 3SBMA 1S1XB 3AT1B 3BO4A 3G8QA 2JNJA 4IG0B 4YN3B 5ETNA 1FKOA 1H73A 3CCTA 2ZJRQ 1N32J 4EK2A 3ILLA 4MKVA 1JLQB 5IQQA 3WIVA 2X1AA 1YRTA 1H2UX 3M2RB 2CPHA 2H4YB 3OXGA 5J1NA 2J8SA 4DR3J 1KKHA 4DPOA 4IH6A 4C0OC 4JV5J 3C15A 1WC4A 2EVZA 3LP2B 3F73A 3AB4B 1HQEA 1TTHB 2DVIA 2DGQA 3GTYX 1YK9A 2HBRB 3H59A 3RZAA 1KHWA 1MN9A 2CQCA 3MR3A 3HXMA 1RT2B 2WW4A 3PRDA 4OZ0A 1QVGR 4K0KF 2DNLA 3BSAA 3D54A 3DRRB 1FKOB 2ZE2A 3ILJA 4USMA 5DETA 3MECA 3UD5A 2VODA 1S9EB 2IFXA 2GAGC 1RK8A 3CWJA 3MPUB 1KQKA 7FD1A 3I5BA 3R6LB 2HHXA 1QSSA 3K5OA 4NEZA 2HHPA 5K8OA 2H5IB 4Y2MA 1FDBA 1B64A 4KFBB 2DT9A 3QIDA 1VK3A 4CZCA 1G3OA 3BO3A 2HHTA 1YJTA 1V6HA 1RT2A 4OJ3A 4DX6A 3KG0A 3BSNA 3FEXB 4DZ6A 1DLOB 4K4XA 1S6QA 3R5BA 4HLBA 5HBMB 4DFJA 3SV3A 1P1TA 4Q8EA 3FEYB 4KGVB 4DXLA 1L5UA 1T9VA 2OTLS 4CLWA 2W9AA 3H5XA 3I0SA 3D68A 3DXSX 2CWKA 3VAHA 3ZTQA 3FKBA 3ITHA 3NOGA 4CH7A 2XTJP 4DUTA 4ZPWR 2VOOA 4K59A 4RU9A 4DV7F 1U24A 2L9NA 1UWBB 2HQDA 1RTHB 2HFVA 3DRPA 5KFTA 3W5ZA 1Q8LA 5F9NA 1SC4B 2VFUA 2QL5B 1RZMA 3V81A 2ZZMA 5K14B 3TZZA 3K7RA 4TYBA 2H4WB 1QAYA 3V6DB 5DG7A 5E7OB 3OL7A 3M4XA 4Z2XA 4LF4F 2UXCF 2VKZG 3F41A 5DLGA 1KSPA 1YGYA 4FBTA 1MMLA 2CQPA 1S6PB 5DDQC 1MWQA 1AB8A 1ACMB 1YBTA 2DNPA 5BYSA 4Y34A 3KHHA 2OIHA 1XTZA 1TKTB 4Y0FA 2B4UA 1GNKA 1RLCL 2WZ1A 3BM7A 2IRUA 3FSYA 4QJVA 5KFYA 4LF2A 5IZHA 5DQHA 4C3MA 3G82B 4AL7A 2JC1A 1X9WA 4LF5J 2KU7A 1OPZA 4RW7B 4NOHA 2MQQA 2FY1A 3FQKA 4F36A 2VG5A 3E8OA 2VPXB 5EGYA 1IBLF 1IN0A 1RAOA 5F0UA 4FKXA 5AXNA 4DJBA 4K5SA 5I3UA 2BBEA 3HJVA 3MM6B 4OFZA 3OHAA 3HJFA 5BXIA 2MDAA 1F3FA 3JQJA 5B0DA 2AGOA 4GVBA 1QY7A 2PE8A 1PG5B 4DPXA 2HNDA 2RVJA 1VLYA 1X5OA 1WELA 2FYXA 2WBMA 5IM0A 2DRAA 3BQ0A 4G1PA 4H4OB 3D6HB 1WSVA 3VGUA 2XMAA 3D2WA 1SC1B 1HR0F 3DNCA 2KXHA 4DPYA 1TL1B 2W8LA 1T8EA 2OUGA 3SQGB 1SH3A 3DLEB 3ZZZA 4ECVA 1GX6A 1U0HA 3RU0A 2R8GA 2C2KB 2FLLA 2EC2A 2G2ZA 4OYBA 2LEBA 2R7VA 4BS2A 4DR2J 1RTZA 2CDQA 3EZOA 4LIRA 2ZH4A 1N36J 1D09B 4USKA 4JI7J 4R5PA 3PX6A 2ZHAA 4PWDB 2YKPA 1AZSA 1ZM3A 2VJVA 1H7WA 4FYXB 4DR6F 3H20A 3MGJA 4HL9A 4LJMA 4NLUA 5C25B 2NXUA 2GAHC 5KFUA 3MURP 4IG0A 2HIQA 1G7CB 2NSBA 4QR0A 3RB3A 2C3MA 2IAJA 3IG1B 4KHPJ 4Z37A 3N4WA 3V2UC 1HQ2A 3BN7A 4E2FB 3R7BB 4UTGA 2XI3A 5J1EB 3MEKA 5B0FA 4DR2F 4FF2A 2DNKA 4WP9A 5KFSA 1XMQF 4WXOA 2KYXA 4MKAA 3O3LA 4DL2A 4WFZA 1J5OA 4UQGA 1RWVB 1Y00A 2E1PA 3MAAB 3MM9B 4FNHA 4OYWA 5THWA 5JUMA 1GAOA 1HKAA 2FIUA 2NXCA 3MMBA 4TY9A 3GYGA 2JL9A 3NGKA 3CCSS 2ZH2A 3J7YI 3RB6A 1YVFA 2J6SA 2BJ7A 1G4CA 4TU9A 3QNWB 1RGVA 4OZNA 5HANA 2MLZA 4MH8A 2PMWA 2WTFA 1S1VA 4CI0B 2D7SA 2V0NA 2NXJA 5KFXA 3M8QA 3VQSA 3UD4P 3PYGA 3TAQA 1BGXT 3JYTB 1YJUA 2ZM6J 3TRGA 4ALZA 4KSEB 5KOWA 2N82B 2HHHF 1RTJA 1DLOA 1PO6A 4L73A 1UVJA 2FZCB 1CULB 2LQ8A 2B9YA 3C16A 2DR6A 3MEGA 3KK2B 2OSQA 5IT9Y 5A0YA 4IFYA 4WWSA 3HT0A 3BN4A 4OIXA 5IQ6A 5L46A 1IWGA 1TUGB 5B08A 3FMBA 3GB0A 2MXYA 3EZ5A 1WSRA 2VC1A 1OPIA 2KT5A 1IBCB 3EWGA 1K0VA 3GYNA 1J5OB 1AYEA 1JJHA 1JLBB 3ZXWA 3BH6B 2APOA 4F4WA 1YTYA 2GA7A 4M5KA 3IWXA 4ECUA 3Q8SB 3HFVA 1JWWA 2M7SA 2LECA 3SQOP 2F8EX 2R7SA 4CO1A 5B0AA 2HMIB 4XPEA 4G3IA 3KK1B 2V8VA 1PYTA 5LMNF 2HWHA 1QSLA 1F6TA 3IP0A 2ZUGA 3IGVA 1S77D 4DL7A 3GV5B 2J0SD 2AV5A 3J7YU 1O5JA 4C97A 4XO0A 2P6TA 2XEXA 2YH0A 1YJ9S 1FK9A 4UOGA 5F8LA 1VQKS 5A8RA 2OTJS 1N5VA 4GKKJ 2PIIA 1EJ7L 4J9VA 3CMAS 4N7TA 5DG8A 4PABA 3QFWA 4RLEA 1R8HA 4DR4F 4WIQA 3OUYB 1PSDA 3H0PA 1FD8A 1R3NA 2QE5A 5A6WA 1TFYA 3Q8UA 2CNOB 2E5JA 1A0OB 1IKXB 3OBIA 4G1QB 4HEA9 5HP1A 4LT6A 4Z7YA 1WC3A 2LMIA 1FRHA 3GSDA 1KDNA 1Q53A 1JQGA 3DRYA 3D0IE 4GVBB 4P2XA 4BCAA 5EWEA 4DL5A 2VPWB 4CLYA 1UETA 2FPHX 3D0HE 3T3FA 2VA2A 4K4TA 7AT1B 3RAQA 2VF3A 1U49A 1FRKA 1NO8A 2OHDA 1YX2A 2ZNZA 4J91A 1XC9A 4MT1A 1WC5A 4K0KJ 3TP2A 2A6OA 1PJ6A 2M5YA 3A12A 4ZJQA 5AE2A 4EZ6A 4DFMA 1O0PA 2EFNA 3EUNA 2LXUA 5GAHU 1T9UA 3RB0A 1IKYB 2DCUB 4UUWA 2DNYA 2C2MB 3KNGA 4R0JA 3PFEA 3S8SA 4C8ZA 3MFIA 3OTDA 1RA6A 4LRBA 3UNGC 2BANB 3VZIA 1HI1A 3KKFA 1F5AA 1RAFB 2CQBA 2HURA 2V5HG 3PNIA 4LF1A 4P52A 4RX6A 2KTQA 3I4HX 3MAHA 3C6TA 1S6OA 3K59A 2EEYA 1CJTB 3KLFB 2CYYA 4K4YA 1FRMA 1XJWB 2BUNA 2HSEB 2HQFA 3Q8VA 3DGPB 1H2VZ 3KK3A 4J9MA 4EBDA 1S72S 3IS9B 1NK6A 3K0JA 3GCXP 4ZPCA 1ZZFA 4HR2A 3ZZUA 3CC7S 1Z4UA 5DGBA 4U7CA 2V4JB 2KO1A 2RH3A 3L95X 4EGLA 3G6VA 4K50A 1D9FA 1IKYA 1GXUA 1I3OB 3TJ8A 2HHHJ 1SKUB 4LR7A 1L3UA 2AHOB 3NS6A 1VRUB 2BANA 2DNGA 5B0EA 1ZPVA 2HK3A 4KKOA 3JXOA 2ZOFA 2QL9B 4XDCA 3A8KA 1NU4A 1TKZA 1CJVB 1QTMA 3OJSA 2WONB 3PACA 2C3PA 3QJLA 2B4PA 3UDVA 3VAJA 1VQ4S 1RI7A 2JDJA 2ZOMA 3AQPA 3HVTA 2QN6B 4N8NA 2Z2YB 4Y3CA 2CJYB 3PTWA 3M8PA 4UY85 4ZIVA 1QUVA 2P6SA 4QBUA 2IMWP 2OI2A 4WP8A 3DOMA 3IC1A 2GO8A 4DUZJ 3IFEA 3TYTA 1T11A 4HT7A 5HQMA 2I8EA 2HVZA 3HVWA 3KLEA 5IS2A 2UVUA 1YKWA 3RUBL 4OZJA 1S1UA 1B7YB 3RG6A 1JKHA 5T7LA 4KY3A 3W2VA 4Q5VA 5IOLA 3F56A 4IFYB 3G87A 4B3SJ 1JLCB 3W63A 1JLGB 1NPRA 3E51A 2UU9J 3SV4A 4A8QA 3NL0A 4DEZA 1N0VC 2ZJQQ 4NCAA 1XR7A 4DLEA 4UW2A 3HHNB 1HWIA 2EBGA 1N36F 2WSFC 5CZXA 2RDJA 4RWWA 5EX0A 1FD2A 3IBWA 5GMEA 4WZQA 4OYZA 2OPSA 3T6BA 4I67A 1FNOA 3I5CA 3PW4A 1HBNB 2AJ2A 3J81Y 1SJFA 2QL7B 4DN0A 1WEXA 3S6EA 1N34J 3R6GB 1YJVA 1SUQB 2BA9A 2LEAA 2DR8A 4DR7J 1X4HA 1OIAA 3V4MA 2QT7A 4ECYA 2DHSA 4X4RA 4DF8A 3SEOA 2OD6A 4UOHA 2ROPA 3AY0A 2GVZA 2GNKA 4DU7A 3IBFB 1UTAA 1VQ7S 5DLFA 2R7XA 2V34A 4LSZB 3OVBA 3MEEB 5CYJA 1W2BR 2CNKB 4LFAJ 2DPIA 2E9ZA 1YBUA 1UZHA 3QRPA 2ZH7A 2HKEA 4V19X 2B43A 3GFYA 4C48A 4DR5F 1XK8A 4NMXA 2MKHA 4TQSA 4JI4J 4RW6A 3AH6A 3UCZP 4UUXA 4JI1J 2ABYA 3PX4A 3CJTA 4QWEA 4G1IA 2XZDB 3A8IA 2XMUA 1YJWS 3QJPA 1LWFB 5D78A 4GKKF 3GJRB 3J7ZT 3NBPB 2C1EB 3KWMA 3VV2B 2GVDA 1ZM9A 4CO0A 3W2WA 4ECSA 2ZBIA 1TU0B 4PG5A 1UEKA 3IR6B 4TU8A 4IOAQ 2X1FA 1JXEA 1PILA 3QZ7A 3M05A 3I82A 2AJ0A 3OFEA 4CM2A 2W8KA 4A8YA 3ZTSA 4NE9C 4Q2MA 4X4UA 5I4MA 3DFEA 1SQFA 1T95A 1NDCA 1QAXA 2K3KA 4HVZA 3U02A 4ZLPA 4DV7J 1U0HB 1FFWB 1UVMA 4IDKB 4NCGB 1KRPA 3WC2A 4QR2A 1S5ZA 4FPRA 4QYZK 2XG8A 3DXBA 2MZJA 2XY6A 1CJUA 3MD1A 3KG1A 5HLFA 4DR1J 1Q8BA 1Z1ZA 1WDTA 1YQHA 2AMCB 3DCAA 2G9OA 1KONA 2VL1A 1HWUA 2KXNB 4KPYA 3CJ0A 3I96A 1I94J 3HO1A 1S1TA 1FJEB 3RW7A 1UCNA 4PXDA 1HNZF 3BZQA 4Q0BA 1S1WB 4CIOA 3RW6A 2BMBA 1DTQA 1QE1B 2V68A 3IO1A 4RO0A 2XGQA 5D3GA 2HVIA 4FNIA 1T03A 1HWKA 2U1AA 1DRZA 4KJIA 2O67A 2N4DA 3CIMA 4CRJA 2FLPA 5T14A 2BX6A 2AIRB 2WONA 3K5PA 2Y0BB 3JSRA 4IDKA 4NCGA 4DV4F 4CLTA 1IM4A 3V6JA 3CD5A 2EFPA 1U0SA 2RD5C 5HMXA 3SIPB 2FJVA 4OI1A 1WEZA 4KO0B 2B9XA 2CWXA 2F3JA 1VBKA 2GQ2A 2K06A 3HHKA 3ITHB 3U7JA 3JAMY 2DO0A 3BGRB 2Y1LB 1P9QC 1WG1A 2W9CB 2XMMA 2M8HA 3TVYA 1VC0A 2KJVA 1RTHA 4TN2A 2KT3A 3DLKA 4USVA 2KM8B 4DPWA 5I42A 2X3GA 3P96A 4NYZA 3W2VB 3MTKA 1OO0B 1UZDA 3HHLD 2VG6A 3ENWA 4CP5A 1YJNS 1VDHA 4IOBA 2OD4A 3THPA 1U1KA 1XMQJ 2FJBB 3H2VE 2MB0B 3TA1A 2R8IA 3FUYA 2CNNB 2CZ4A 2WVFA 4A48A 2MKYA 3FGVA 3OT9A 3FCHA 2AX0A 4KIAA 4ANEA 2DKOB 4U7UK 2CPYA 4JI6F 4DX7A 3OV7A 3M2VA 5CCLA 2GIRA 4HYKA 2CNLB 2B9WA 2DEIA 2CADA 9RUBA 1JLEB 5E41A 1HBNA 2Y1IA 5IT4A 3OSPA 2EFGA 2KN4A 3B82A 3QO9A 4LF6J 2O66A 1HNVA 4USJC 2UUTA 4RZRA 4QWBA 1VJQA 2FDNA 4IO9Q 3K2YA 1SIWB 3PW0A 2HHQA 4DUZF 4ZP9A 4NZ6A 2IPOB 3QWPA 1RT4B 1A7GE 2IC3B 2MLYA 3BPDA 2LQ5A 3AJDA 3CMQA 1U1RA 1RYRA 4F25A 3PY8A 4O4GA 3AXMA 4NLXA 5ETRA 1RHUB 1NRKA 3RBEA 1E6YA 1YJRA 2Z57B 1UAWA 2P9EA 3MEEA 2YNGA 1M90T 4O44B 2CJKA 2D41A 3R27A 4FXWA 1WKKA 3CE8A 1HR0J 4NLPA 3VF0B 4B9NA 2CXEA 2D74B 3G86A 3WZ0A 2BACA 2RQCA 5E3RA 5ITHA 2DCLA 4B3OA 1W2IA 2VBZA 2F8MA 4Y2IA 1UA1A 2EFOA 4ENOA 1LW2A 2MZRA 3MMCA 4X2BA 3EX7B 3WBZA 1SJ3P 3P49B 4WFXA 4LSLA 4AL5A 2V63A 1UMJA 4DHVA 1LXJA 2R8KA 3D6MB 3RBXA 1YI2S 3DOLB 4G6VB 1R89A 1Y7PA 4KBIA 4ECRA 1IKXA 1HD0A 2MY8A 4I2PA 1NDKA 4WZMA 3KUGA 4M1KA 2R7TA 3IRWP 1V3SA 2HGLA 1Y10A 3MM5A 4HI1A 3MR2A 2M4MA 2PFDA 4CLSA 5M2UA 1U2RA 5AE1A 2E5LJ 1HPZB 2Q79A 5L8RC 1N33J 2KI2A 2ZH9A 1YRXA 2E1MC 4DN9A 5LJ3Y 3GJTB 1B3TA 1NPKA 2LXFA 3BR9A 3CO0P 4WIIA 1HMVB 2ZH3A 3NAIA 4IUFA 4NMLA 2MHNA 4X4VA 3C14B 4GVLA 3TARA 1JLAA 5F9LA 2E7WA 3Q8RB 6AT1B 2WSEC 2RQKA 2GMHA 1RB0A 2GQCA 4JV1A 1H98A 2J76E 3Q23A 3WQPA 1IUJA 4F3MA 2A3JA 1WWHA 2FGOA 2Z2ZA 4B17A 2ADBA 2K2PA 1F9HA 2WVBA 2PFFB 2CRLA 3D67A 3PW2A 1GT8A 1SC6A 3MOZA 1M5SA 2X3DA 3LO3A 1RWUA 2H1YA 2KT2A 3DGPA 2KM8C 3KK3B 2CPFA 3BQ1A 2BKNA 3I4PA 3MM5B 2BQ3A 2JRSA 4U6PA 2C2DA 3F44A 2XZWA 2BRLA 3NGTA 3FRZA 5AXKA 5A0YB 3PCOB 1NHKL 4LFCF 4DR4J 4QIVA 3GG0A 4DFPA 1C4AA 2LVWA 2YH1A 2IHR1 1M5HA 1UJ4A 4KKOB 3TX0A 1HBOA 3B4MA 3P6YC 5I42B 4IKAA 4NX9A 1BUXA 1P1LA 2F40A 4KO0A 3SSRA 4QPTA 3DLBA 4ILLA 1OQ3A 1SV5B 1W26A 2G2OA 3N79A 4W90B 4ZP8A 2XWYA 2BKPA 3B8HA 3M32B 1FEEA 4X4SA 3CCVS 2JEJA 4N47A 1BC6A 1N5QA 1NBEB 2AYMA 3SCLE 2UUAF 2WB1D 1X4FA 4KRWA 1Q5VA 3QT7A 1YIJS 1KNZA 4QCLA 3PEHA 1FTRA 2MSSA 2QLWA 5C24A 1WOOA 1R0BG 2LXIA 2VG6B 3Q89A 4RBVA 5CABA 3LOUA 3K8WA 3LUYA 4JV5F 1JLEA 1JLFB 1KLMA 3QO9B 4DFKA 4NLDA 4BHQA 2VIHA 3RB4A 2C3YA 3CJSA 4JV0A 2HRTA 1IR0A 2F9DA 5LXYA 1JLCA 1RDRA 3KLVA 2PA8D 4X66J 4X4PA 3QGIA 2KVIA 2AEJA 1R8BA 2MPUA 2NYHA 3CTRA 1S7IA 2VD3A 4YB1P 1FTCA 3BYRA 4LF6F 1VRQC 3HSDA 2WRMA 4OQJA 4ZVRB 5HMZA 3PRVA 4CLUA 3J81j 2ZM6F 1L3KA 1FE0A 3D3BJ 2I0XA 3SFUA 4JI6J 4MFBA 1CJKB 4XDDA 2D3O1 4FKYA 2IM2A 5K5MA 1LWEA 1U47A 1RLDA
chains in the Genus database with same CATH topology
2HFOA 4C8NA 2H9ZA 2BABA 3CUNA 4QYZJ 1VBYA 2FVPA 2YX4A 2MQPA 3RRGA 1RT1A 2CG4A 1PGZA 4LSLB 2XNQA 3D1QA 3CMES 2DIUA 1V9OA 5KFDA 1U1LA 1X4BA 4R0EA 2D3ZA 5KT4A 3KHRA 2HWTA 4C8MA 4DBQA 2HNZA 4WCEQ 2ZD1A 4H4KC 3AB2B 2VC0A 4OV1A 3PV8A 1T3OA 3V5RA 5KFEA 2CPZA 2XWXA 4NLTA 1LWEB 3GMGA 3KK1A 2CIMA 3POTB 4I2PB 3N9UC 2NLWA 6FDRA 3HM9A 4HT5A 2UVWA 5IWAF 2DNMA 4WU3A 4X64F 4MIAA 1T05A 1BQMA 2XS5A 2ZDOA 3S01A 4J9LA 2W4CA 4ZPBA 2C3UA 4FXDA 3ZZPA 2E1RA 1FRIA 1OSCA 4DSJA 2D9OA 2ASYA 2XGPA 3M30B 5CA5A 1HW9A 4Q7AA 4U67Q 4RNHA 4AL6A 5GADI 4PRFA 4R25A 1VBXA 2C2RA 2GHPA 4IH5A 1N8RT 1H0HB 4BDPA 2FGCA 1R8CA 3K5NA 3DDNA 2VFTA 2FVCA 3LW5C 3BB5A 5E3AA 5A8KA 3QGGA 3L3CA 3GIJA 1K1QA 1DHMA 3OL6A 3D0GE 2YWFA 5H9FJ 4X4QA 4K4VA 1FNMA 3DN9A 4CNYA 3SSQA 2BXJA 1U7LA 2OH2A 5J1EA 2KHCA 1QM9A 4ZPTR 5F8GA 4PXBA 2KYZA 2PO4A 4NLRA 2VBXA 1T05B 1JKHB 5HL7Q 1FDNA 5KTQA 1T94A 1QJHA 2CQ1A 3OTCA 2WSCC 5FD1A 3W7BA 4X65F 1M5OC 3M2RA 3BSCA 1KFSA 4ZMMA 2CPIA 4HI2A 4DL0C 4JI4F 2M3DA 3CSKA 1CC8A 1BQNB 1O51A 2RQMA 4NA3A 3C66A 1LFWA 2KG1A 3RYLA 4MMOA 1JNRB 1GTEA 3Q2SC 2UZAA 4OX8A 3KYLA 4DSKA 2JEFA 5FIIA 3HPOA 3UQSA 4DQRA 3LP0A 3QLHA 2FJXA 4EUVA 4A8SA 1RT6B 2QSFA 1VHFA 4MIWA 3G6YA 3SDEA 1KD1T 2DGSA 3NP5A 4HDGA 2J8AA 4C2MA 2R8HA 3S7RA 3FVYA 1KLMB 4DR7F 2M70A 4GMKA 4NLVA 4IQXA 1FVSA 1C1BA 1HQUB 3LP1B 4XAKA 2R4FA 1FKAF 4X4NA 4H4OA 4WJBA 1HA1A 3GZ7A 3CCLS 2MZQA 4OI3A 3FSIA 3H98A 1FRLA 4PXCA 2PN6A 3I6PA 3W3SA 3GILA 4ZOSA 2UU9F 2VBYA 1LOUA 2R7UA 4KE5A 4P6QA 1QAIA 5HO4A 2QA4G 2HQIA 4TY8A 4FS2A 4QYRA 3A8EA 3VAIA 5E33A 1S76D 2IVMA 4O44A 1R43A 2Q6CA 1D3WA 3LAMA 5K14A 1TV6B 1NKEA 5EN1A 1R31A 4KR0B 5F8NA 4DX8H 2ZH1A 2BQUA 3OR2A 4MK8A 3SYZA 2YKQA 3CF5Q 4G1QA 3FEZA 3WDOA 1SXLA 2RRNA 2JHEA 4IR9A 3OL8A 2EW9A 2Z4PA 2EPIA 1TR0A 3THVA 3U1NA 2UXBF 3LPYA 4OHVA 2MKIA 4QIEA 2MKJA 4N56A 5BYQA 2B6AA 1T3NA 2HHSA 4ZCMA 1LKZA 4RW7A 3PIPQ 4FF3A 4XPCA 2AD9A 1KOOA 1ULRA 3E2EA 1REVB 2CQHA 3AA8A 2ZFHA 3CB4A 4DOZA 4ELUA 4WFBQ 4DSLA 4I0WA 2WHOA 2R8JA 3US5A 2I5JA 4I6AA 2ZH6A 2Z2MA 2MGZB 4X4TA 5K8NA 3LANA 2K1RA 1X9SA 1DTTB 1WI6A 3G71S 1JLAB 4DL6A 1R8PA 3OTBA 4C8LA 5KT5A 2FHKA 4C4WA 1XWLA 3DM2A 2A18A 4O3NA 2LYVA 4K4WA 2YWHA 2KZMA 2QZ8A 4IO1A 4AQYF 3DU5A 4CH0S 2RF2B 2IM0A 1VK8A 1S48A 4ZPVR 2Y1JA 1N4LA 4NXMF 2OJ3A 4ZP6A 1S9EA 1FT8A 3BQ0A 1LK5A 1MW7A 1X0FA 1TKZB 1N52B 4Y00A 2XLJA 3H40A 2J9CA 4DS4A 1RYSA 2QSWA 4YR0A 1SJQA 2CPDA 1XN9A 2R7OA 1N5YA 2ADCA 1BQNA 4IG3B 4B9VA 3D1OA 3RAXA 1Y3KA 3CJKB 2OFGX 1YIJS 1FXDA 5KFFA 2ZKTA 2FUG9 1TAQA 5JXSA 2EI5A 2J9DE 1KFDA 1FERA 2FHJA 3UWTA 3M8PB 4LUBA 2XS2A 1S6UA 4YFUA 1E6VA 3O44A 4DV5F 1RT5B 2IC3A 4JI3F 3UI3A 5CYQA 1C2PA 1UWBA 2B56A 3PFOA 1NEEA 5HN0A 3AAWB 4NLSA 2IJFA 3TANA 4LF8F 3M8QB 5KFQA 3TAQA 3EGWB 3J7Z5 3TAMB 1U1NA 4C3LA 2G13A 5DDOC 4WYLA 1TFWA 2RS8A 3IGNA 2DNZA 1FCAA 3VAKA 1L3VA 4F4KA 2DNQA 2Q66A 5J2MB 3MEGB 4CTAA 1I1GA 2LA4A 1U1MA 2W7PA 2YNFA 4FBUA 3CCRS 4RNMA 2GGPA 1TVRA 1BY9A 5M2PA 1UKUA 1Y3JA 4TLRA 3MD3A 3AHPA 3SCKE 2BOPA 3MDFA 3I0RA 3PHEA 4HH1A 3DLJA 1VFJA 3Q22A 2EK1A 3O8WA 2BJEA 2MSTA 2C3OA 3NL0A 3K58A 1ELOA 2IBOA 5KFCA 4Q0BB 2VOPA 2J6TA 2HHVA 3OVAA 5L1IA 1VOMA 1NK9A 2HNDB 1WHVA 4BC7A 3H4BA 2XCAA 5IT0A 3C6UA 1WTFA 2MY7A 4EFAC 4GC7A 2HYIB 4F2RA 3OR2B 5KAKA 4GO7X 2FHMA 3EGZA 2CVIA 5CQGA 2MHEA 5EWGA 3TUIC 1XNQF 2CJBA 2RT3A 3FNNA 1FK9B 1RAJA 3NLCA 5C42A 2RNEA 2DIVA 2DHAA 1JMTA 2KXFA 1FESA 2JEGA 1JIHA 1C0UB 2NPFA 3PKMA 2ZDPA 1NNDA 2X1GA 4D3GA 3CEDA 1MMDA 1L3TA 4K4ZA 2DISA 2BJDA 2XMVA 3KJVB 2XO7A 2C22A 4A8MP 2PMZD 4ECWA 3EXCX 1QSYA 4Q43A 5HROB 4L72B 3ENQA 5J2NB 4DV1F 5C5JA 1VC6A 3LGMA 1RTDA 3J7A1 4KHPF 1X8DA 2WBRA 4KHRA 1UP1A 4OX9F 2ILZA 2XMWA 1L3SA 2ILYA 4PKDB 1NKBA 5HLFB 1DTTA 2AW0A 4MKYA 1KQFB 2BZ2A 4Q8FA 4DQSA 4CO3A 4WFNQ 1VQSA 1ZAVA 3TR5A 4QWCA 5D3GB 1SQEA 2IBKA 4ED6A 2RSQA 1OWXA 3E01B 1WF2A 3KJVA 4N76A 4WYWA 4C98A 2UP1A 1RQ0A 2VH7A 1FDDA 3HX9A 3L7OA 1TUVA 3FSXA 3QAEA 3OPKA 4KGMA 4NLOA 5AXMA 4FZVA 3N6MA 3ZZOA 3LH2S 4MKBA 3QWUA 4NZ7A 4LIWA 2LA6A 1R0AA 5KG7A 4IG3A 2KFZA 3KK2A 3ETOA 1BQXA 3I32A 1C1CA 3CJKA 3GIMA 2XY5A 5LT5A 1RT5A 3M8RA 2B4VA 3DYAA 2B0GA 4U9RA 1NK8A 3HK2A 2KB2A 5L1LA 3CC4S 4LF5F 2W7OA 3V6HA 1K0TA 3R5DA 2YWEA 5CYQB 1SBRA 4OZ1A 4DR1F 4K5RA 2E1CA 1FRXA 5E0OA 5F8IA 1HFEL 3GE9A 2ALZA 4TXSA 2YNFB 2JLFA 3PDNA 3JSMA 2A2DA 2DNRA 4F50A 3SSSA 3BF4A 1EP4B 4F67A 2W9BA 2L9DA 2FTRA 2HS0A 3SCJE 1WNEA 1HQUA 2ROGA 3G8TA 1U09A 1FJGF 4QQBA 1JLGA 2HFNA 4RU2A 1HARA 2D3OR 2GFFA 2M2BA 2WAQD 1K1SA 4KGKA 3MZIA 4WU2A 3C46A 2XLIA 2XMTA 3DLGB 4ZS6A 5SZTA 1UEVA 3DU6A 5L1JA 2IM3A 2PMHA 3MOJB 2FC9A 3KLIB 5HP1B 3C6UB 4B9UA 3EZUA 4OI6A 5KFAA 2R7RA 4B3RF 4ZA1A 4RUCA 1MSWD 5KFIA 4ATNA 3OFGA 2UUBF 3TVZA 3AJ2A 1JLQA 2P5VA 2YVSA 3DOLA 2ZBCA 2VG5B 1SUQA 1LW2B 3MMCB 2CPEA 4TLQA 4J5OA 2ZJPQ 1Q82T 1OSDA 1TL1A 1EP4A