4FXWA

Structure of phosphorylated sf1 complex with u2af65-uhm domain
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
105
structure length
105
Chain Sequence
PLGSTEVLCLMNMVLPEELLDDEEYEEIVEDVRDECSKYGLVKSIEIPRPVDGVEVPGCGKIFVEFTSVFDCQKAMQGLTGRKFANRVVVTKYCDPDSYHRRDFW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of Phosphorylated SF1 Bound to U2AF(65) in an Essential Splicing Factor Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Splicing factor U2AF 65 kDa subunit
total genus 29
structure length 105
sequence length 105
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4fxwA00
2HVZA 1WHYA 1M90T 2ADBA 5DETA 1NU4A 3PIPQ 2CQPA 2E44A 2JWNA 2CPJA 2CPXA 2G4BA 2CQ0A 4W92B 3U1LA 1YIJS 2DGTA 3UCZP 1Q81T 1G2EA 3CTRA 1U1MA 1B7FA 3CCQS 1X5TA 2N82B 3NNHA 3HI9A 1N88A 2KXHA 3SXLA 1WI6A 3VF0B 3LQVA 1YI2S 4QQBA 2XS5A 3S8SA 3NMRA 5IQQA 4A8XA 2FC8A 2YH0A 2N7CA 2DGXA 2SXLA 2DGSA 1VQ7S 3VAHA 1DRZA 1FHTA 2CQ1A 1HD0A 2GHPA 1M5VC 2KT5A 3SDEA 2CPHA 2M4MA 1VC5A 2M88A 3IRWP 2CQIA 4BS2A 3H2UB 5JVHQ 1U1NA 1OPIA 2J0QD 1VQ6S 2KHCA 1X4GA 1H2TZ 1SJFA 2MQQA 1U6FA 4UY8T 3UE2A 2HYIB 2DH8A 4CIOA 2DH9A 1KQSR 1N52B 2DNPA 2DNZA 3UD4P 1WI8A 4IUFA 1D8ZA 3CCJS 1WHXA 5BJRA 2CQ4A 1M5KC 2Q79A 3G71S 5DDOC 4IOAQ 5FJ4A 2DNOA 2FC9A 2X1GA 3CMAS 4WIIA 5DM6Q 4EGLA 1YITS 2GO9A 1X0FA 2MY8A 2XB2D 2AYBA 2M8HA 2MMYA 3MXHP 4C7QA 2KG1A 2MKJA 3SDEB 3Q2TC 3THTA 2JRSA 2ZJPQ 2G1DA 2DHAA 2L41A 1WF2A 2LMIA 2DB1A 1UAWA 2CPYA 2M52A 2DNKA 1CVJA 3THPA 2D3OR 2E5HA 3LPYA 1SJ3P 2OIHA 4WFBQ 3IWNC 3VAMA 3JB9k 1JJHA 2UP1A 1YHQS 2DNYA 2MGZB 2CQGA 2XSFA 1FO1A 2HGNA 3CCSS 3BS9A 2DGQA 1UP1A 2RUGA 1FJ7A 3CCLS 4PRFA 1KC8T 5GMKa 2MZSA 2DNRA 2O3DA 2DNNA 3DLLQ 2FPHX 2CPEA 1U1OA 1Q86T 2X1FA 3ULHA 2VODA 4LMZA 4C4WA 3VAJA 3CD6S 2OTLS 2EK1A 2RVJA 3OW2R 3SMZA 2QEXS 4IO9Q 3CPWR 4OZ0A 1VBXA 1QVGR 2X1BA 2VOPA 2AYGA 1WEZA 2RS2A 2D9PA 2KYXA 4UQTA 2DH7A 2I2YA 4WCEQ 1U2FA 3MD3A 3TP2A 2MQMA 3MUVP 3CCRS 1HD1A 3EX7B 1VQ5S 1F9FA 2KVIA 1H2UX 2MQLA 1K8AT 2HGLA 2K8GA 2J8AA 2CPIA 1WHVA 3L3CA 2QA4S 3VAIA 2DGUA 4CH1A 4ERDA 3R27A 3NNAA 2DO0A 1A7GE 2XNRA 3BO3A 1U1QA 2VOOA 1SJRA 3G8TA 1Q82T 3MI7X 2LA6A 2DIVA 2LCWA 1M1KT 3VAGA 2MHNA 4TU7A 2DNGA 1ZZNA 1YJ9S 1VBYA 4RU2A 2CQ2A 2DGOA 1X5SA 4WFNQ 1VC0A 2MKKA 2MQNA 4V19X 3K0JA 2OTJS 1VQOS 2KU7A 2JVRA 4TU8A 3Q2SC 5LJ5Y 1JMTA 2YKAA 4QU6A 2ZJRQ 1U1KA 1RK8A 4J5OA 2M8DB 4Z2XA 1N8RT 1W2BR 4OZ1A 5ITHA 3R1LA 5D78A 1X4AA 2MJNA 2RT3A 2YTCA 3P49B 1HA1A 2KFYA 2KXFA 4WF9Q 2AYMA 3MDFA 3VAFA 2RQ4A 3DXBA 2ADCA 1K9MT 1KD1T 4PKDB 2ZJQQ 3V4MA 2EVZA 1RKJA 1P1TA 1X4FA 3CC4S 3UCGA 2J0SD 1WELA 2DNMA 3BO4A 3G9CA 5IM0B 1JJ4A 2MGZA 2MZQA 2M9KA 5IFMA 4YOEA 3P3DA 2LECA 4Y00A 2N3LA 2U1AA 1IQTA 2B0GA 1U1PA 1FJCA 1VQ8S 1X5PA 2F3JA 2L08A 1SJQA 2FHOB 2JVOA 4LJMA 4Y0FA 3ZZYA 5GAEU 3NS6A 3UD3P 2DNQA 2HGMA 2MKHA 1WTBA 3ZZZA 1X4HA 5LSOA 5DDRC 2HZCA 3MUMP 1XN9A 2KI2A 3J7ZT 3D2WA 2CQBA 3P5TL 2CQDA 2E5IA 1WF0A 1DZ5A 1L3KA 2YWKA 1WEYA 3B4MA 5CA5A 2DHGA 1AUDA 3R1HA 3FEXB 2DGVA 1HL6A 1KOHA 2DK2A 2DHXA 1U1LA 5GAHU 3H2VE 2NLWA 3RW7A 1VQKS 2V94A 4C0OC 3P6YC 1PGZA 3BO2A 2ERRA 4F25A 2A3JA 2X1AA 1VQPS 2MZ1A 2LYVA 3CMES 2KN4A 2DNLA 2KRRA 2MSSA 2CPFA 2JX2A 4U67Q 1JJ2R 4W90B 3NNCA 3CCUS 2MXYA 3S6EA 2MKSA 2CQ3A 2WBRA 3US5A 3B4DA 3I55S 1R8HA 3CCMS 2PE8A 2KM8B 2DO4A 2MZJA 5GVQA 2M0GB 1VQNS 3FEYB 2RRBA 1WG4A 5MLCV 2RU3A 1SXLA 4ED5A 4YB1P 3TO8A 3CCES 5GAGU 3NS5A 2KG0A 2MZTA 2PEHA 1SJ4P 4FXVA 5JVGQ 2I38A 2OSQA 2MQOA 3MURP 5DM7Q 3S7RA 1VBZA 1WHWA 2N3OA 1H2VZ 2LXUA 2CQCA 2QFJA 1X4CA 2LA4A 2LQ5A 3MD1A 1VQMS 2KXNB 1H6KX 5D77A 1ZZFA 2DGWA 4F02A 1DHMA 4P6QA 1BY9A 3UCUP 2CJKA 4QPTA 2MSTA 2XS7A 3CULA 4F26A 2MB0B 2MZRA 3CF5Q 3G4SS 2RS8A 3G96A 3VALA 4TLQA 3U1MA 1VC6A 1WEXA 3HHNB 2XS2A 3RW6A 1FXLA 2E5JA 3MUTP 4IOCQ 2OJ3A 3CCVS 3PIOQ 2DNHA 4FXWA 1FJEB 1KOOA 2MYFA 4WFAQ 1M5PC 2VONA 1QVFR 1WG1A 2DHSA 1VQLS 2F9JA 5H1SV 4LIRA 3CXCR 2YH1A 2MJUA 1FT8A 3CC7S 1K73T 1S79A 3G8SA 2LEBA 3CC2S 1ZH5A 2J76E 2MKIA 5LJ3Y 2KH9A 1X4DA 2D9OA 1WF1A 1QM9A 1UW4A 5DDPC 1R8PA 3VAKA 1URNA 3TYTA 2MQPA 1Q7YT 2AD9A 2F9DA 4ZKAA 5GADU 2LXIA 1YTYA 2E5GA 2LKZA 3BEGB 3N9UC 2DITA 1FNXH 1VQ4S 4WKRA 1NJIT 1NO8A 1P27B 2MPUA 1OWXA 2RQCA 2BOPA 1S72S 2XNQA 2RRAA 1U1RA 2MKCA 2LEAA 2RNEA 3J7YU 1M5OC 1YJNS 1YJWS 4M5DB 5HL7Q 2L9WA 3UWTA 4YUDA 1X5OA 5HO4A 2CPZA 2MY7A 1A9NB 4CQ1A 3EGNA 2BZ2A 1OO0B 2FY1A 3G6ES 5LXRA 4CH0S 2OSRA 2G0CA 1WG5A 3S01A 1DBDA 1U6BA 3I56S 2EK6A 3CUNA 4TU9A 2M70A 1UFWA 5EN1A 2DISA 1YWXA 1VQ9S 1D9AA 2DIUA 2CPDA 2M7SA 2K3KA 2KRBA 1O0PA 5CYJA 2KM8C 1WWHA 2M2BA 5DDQC 5LXYA 1OIAA 2U2FA 2CQHA 4QU7A 3MOJB 1X4BA 1N54B 2AYEA 5CXTA 4PR6A 5LSLA 5IM0A 1PO6A 2NZ4A 1X4EA 3EGZA
chains in the Genus database with same CATH superfamily
2BVZA 1FRJA 1Y7PA 1LW2A 2XI3A 4JP8A 3RBXA 3IG1A 1F6TA 1Q82T 3AD7C 4NLVA 3TZWA 1N0UA 3DRXA 2CJ9A 4PXCA 4ZN3A 5A0YB 1BHNA 2IDLA 3T9NA 1EQ0A 3AODA 2CQPA 5D0HA 2OLWA 3PG9A 2CPJA 3GILA 5KFWA 1RLDA 1XNQF 2A6MA 2HHUA 4XDCA 1C1BB 1G2EA 3FRZA 2DCUB 3D7SB 3OJUA 3M8SA 2HHXA 4QBUA 3CJRA 3J7AN 5C42A 3CJTA 1X5TA 2DHHA 2YKOA 1NK9A 4DL2A 3CJ0A 5HANA 1FFWB 2WSEC 1N88A 3RRHA 2DR6A 4DSLA 3FC9A 1IBKF 3NGUA 4ZJQA 5I3QA 4C8LA 1U7LA 2KJVA 1F5BA 2PIIA 4ZPAA 1YZ6A 1KHWA 2QSWA 3IGNA 1WI6A 1YZ7A 3RZAA 3VF0B 3J7YI 1HI0P 1HNXJ 4QQBA 1NEEA 3NAIA 1VK3A 2XS5A 1ZA1B 4ZPWR 1S48A 5IQQA 4QPXA 1XMQJ 3W2VB 2OPRA 1TP7A 2PEBA 1XMBA 2BMBA 3V81A 2PI4A 2ROEA 3VAHA 3CMQA 4ZP6A 3IRXA 1HD0A 4USTA 1OYEA 2GHPA 1TKDA 2QSFA 5KG2A 5ETVA 2VJVA 1F5CA 1D9DA 3SDEA 4LFCJ 2IY5B 1HBUA 3FQLA 2M4MA 2M88A 2D69A 4O4GB 1JXEA 4A8WA 2ZE2A 1RT5A 3H2UB 1U1NA 4LRAA 2IJFA 2HSEB 3SV4A 2VA3A 1YJUA 2V8GA 3ENVA 3AOAA 3CCWA 3G87A 3CJ5A 3UNGC 5MAOA 3KK1B 1RT3B 1L3VA 2FJWA 3AD8C 2W9CB 2H3EB 2ZVSA 4NE9C 4WYLA 3MMBB 4LFAJ 4IH5A 3UW1A 2FHJD 4AE5A 4EK2A 4PABA 3UE2A 1XQIA 5A8RB 3NBPA 4FF3A 3MAHA 1JXVA 4ECRA 3RG6A 2HYIB 4JB8B 2IA6A 4RWXA 1PBAA 4DR2J 2K1RB 2VKRA 1B7YB 4CYUA 5D0RA 4A8FA 2B9EA 4UOFA 3TNVA 1D8ZA 3BKTA 4HL9A 2K7JA 1U25A 2CA9A 2R3VA 2WZ1A 2ZFHA 4C11A 1UL3A 3CCJS 1EX8A 4P75A 2W2NP 4UT4A 5RUBA 1UZDA 4UUWA 2DRBA 1U24A 4BDPA 1RT4A 2DNOA 5G4DA 2MLYA 4XAKA 3V6DA 1T3OA 3VZIA 3DOLA 3CMAS 1FRXA 4LF6J 1VQYA 2PC6A 3HM9A 1EJ7L 5DM6Q 3HSGA 3PW5A 2AIRB 2GO9A 1S9GB 2Z4PA 2VFUA 3CW2C 2KTQA 3BKUA 2VFTA 4KO0B 2OPSA 3WX4A 2ZZMA 3KOAA 4NX9A 1SKUB 3SBMA 2UXCJ 3OXFA 1P8GA 3C14A 4Y3CA 4NLPA 2P9CA 2VV5A 3RGIA 3MR5A 4LF5F 2QJ3A 3CDEA 3DLHA 1B64A 3THTA 1OPZA 3P5BP 5F8GA 2D3ZA 5D3GA 2DHAA 4RR5A 2QIFA 3TEHB 1DJ0A 1LXNA 4N8NA 3MM9A 2LLZA 1F0XA 4ELTA 3CJ3A 3Q83A 4LUBA 1RAIB 2EKYA 4QIFA 5IT4A 3MOZA 4RNHA 1JNRB 2OIHA 4WFBQ 2RQKA 2ZC3A 2AEMA 4I2PA 4I67A 4B3RJ 2UP1A 5HBMB 3BQ1A 3JAMU 2RSQA 4X2BA 4CT9A 4C9DA 1CJUA 1TL1B 4H4OB 1M5HA 2FJVA 2MGZB 2RQMA 1FO1A 2GO8A 2GW8A 2D41A 3CO9A 3QLHA 1UP1A 2UU9F 1FJ7A 3DOKB 1HNVA 4DPYA 1KBRA 2CYYA 5I42A 4ZVRB 2DNRA 2YPYA 1VRQC 2W9AA 5ETNA 3D3BJ 2I8EA 3GQCA 1FJGF 1U1OA 1TVRA 1Z2ZA 2CPEA 3R7BB 1VQSA 2WONA 1TKZB 3ULHA 4DUTA 1WC4A 3GV8B 1Q86T 1Q16B 1RTJA 3CT9A 3OTOF 4Y2MA 4RNMA 2V4JB 1X0PA 4YFUA 2E5LF 2VODA 2AJQA 1MU2A 4EBCA 4U9RA 2GQ2A 3BYRA 3VAJA 1FK9B 3LGNA 2CDQA 1GX5A 2GHVC 3SQGA 2OD4A 3VQSA 2DKOB 5AJ3J 2XLIA 3CPWR 4N76A 3UN2A 2P6SA 3C6UB 4I6AA 2G0IA 4X4SA 5H9EJ 3OSNA 2AYGA 2HMIB 4RW7B 4DLGA 2C2OB 2KYXA 2BJ1A 4UQTA 2DH7A 1HBOB 4R5PA 4F50A 4IO9Q 4WCEQ 3MD3A 4KGXB 1LW0A 3QZ8A 3MFHA 2BW7A 3HVWA 2WOMA 2BDPA 2C1EB 1VLYA 3IS9B 5KG7A 1HQUB 1QAXA 4OZ5A 1HR0J 4MKBA 4A8OA 2V8HA 3SCJE 4RNNA 4IRDA 1FDNA 3CO0P 3EX7B 5H9FK 1K8AT 2FJAB 3CWJA 3KG1A 4RUBA 4USWA 2KT3A 5CZVA 5F8LA 2JNJA 4X66J 2DGUA 1NDPA 3ILLA 3PDNA 2QA4S 3VAIA 1TK5A 2DO0A 4PG6A 5HQ8A 5HVHA 2XNRA 3WDOA 4WXOA 1U1QA 4ECWA 3TJ9A 4V1Ak 2H51B 3V2UC 2ZH3A 1VDHA 5KFMA 3BPDA 4NYOA 1S99A 3ZTSA 2HVEA 3VAGA 3I4PA 1MWZA 3I9V9 4DSJA 1NSAA 3PEHA 4K5SA 1XMOJ 1YJ9S 1MG7A 1ZZNA 5KFUA 3I0RB 2DGOA 2EFQA 3BN4A 4HACA 1VBYA 4RU2A 4ZJOA 5CZXA 4USVA 1UKUA 4CCHA 4RL1A 1RT7B 3T41A 1O51A 4C48A 1RT6A 3AXKA 1RWNB 5LMUF 2I5JB 4DL4A 1VQOS 1T7PA 5HQLA 1Y5NB 1ELOA 2QLXA 5E7OB 3BDPA 4M1KA 2JVRA 2NQPA 3FKBA 1NH8A 3OXGA 3EZUA 4ES2A 3HDSA 4DG1A 3D1HA 3BSOA 2OFGX 5G0RB 2FIUA 3MM5B 1SL2A 4CO4A 1N8RT 4DX7A 2J7KA 1LFPA 4FYXB 4Y2KA 4DV7J 3WIUA 4ENOA 5D8HB 1XJWB 2XWXA 3PO4A 2HURA 2L3MA 3LP0A 1J2VA 1NSKL 3AB4B 3KLEB 2RKIB 3ZZPA 1JLFA 2H1YA 1LFWA 3TQEA 3H98A 3EPIA 1SL0A 1ZOTA 2R8GA 1O6XA 4O3NA 3PM9A 5FDLB 5EHHA 1BQNA 3N01A 2GMHA 3BGRB 3QQCD 4RW8A 4OX9J 4X4VA 2CWKA 3DRYA 4EI2A 4I64A 2AYMA 5AE2A 4D3GA 4RUCA 3GP9A 1ZTWA 4OMFG 4URSA 2V69A 3DXBA 4NLUA 4B3MF 2RRNA 1PBUA 5HN0A 1SCJB 3Q8SB 4EZ6A 4USKA 3DYAB 1TU0B 3T6JA 1Z2LA 3EWGA 2QE5A 2EVZA 2E1RA 2XY6A 4P71A 2IRUA 3QFHA 5F8NA 4OI3A 2OEKA 1S1VA 5E3QA 2J9CA 3BO4A 4IO1A 4IG0B 4F7VA 4PG8A 3HP6A 3TUZC 1X9MA 3AA8A 3PR4A 2VG5B 3LAKA 4CLSA 2CADA 2G2YA 3HO1A 1TAQA 4CH7A 1RT2B 2A10A 5IFMA 2Q43A 1RBOB 2ASLA 3M2UB 1IBLF 1IBMJ 4YOEA 3MAAA 2B0GA 2OPQA 3AB2B 3CSKA 3D68A 3ZTRA 1IUJA 4DLEA 4DQSA 1U1PA 4LF7J 3BV8A 2RUSA 2EFPA 3GZ7A 1X5PA 3HD2A 2F3JA 5LMNF 1EIYB 1SJQA 4OYOA 2FHOB 2W4DA 4G1IA 3MR2A 4NPOA 2QYGA 3KDOA 3MPVA 2JVOA 4ES1A 2OHDA 1GXUA 3B6BA 4FYWB 4QIVA 2HNYB 2XYGB 4DL7A 1QDUB 2XSJA 1VJWA 3ZZYA 4MK7A 1T0TV 1XTZA 4PQUB 3QO9B 2V63A 3O3LA 2GNKA 3H5YA 2HGMA 3T1HF 4DR7J 3BR8A 5J2NA 1WTBA 1R31A 3ZZZA 2QLBB 3W5YA 5LSOA 4B3SF 2V4QA 2I0XA 4USHA 4DU7A 3KLFA 2VUGA 4ZVEA 2QA4G 3NGTA 1XN9A 3DI6B 3R8YA 2KI2A 1Q1KA 2I9SA 2GVDA 3V6HA 5KT5A 1JLQA 1EETA 5IV4A 2E5IA 1DZ5A 4H4KA 3PJ9A 5CA5A 3B4MA 4YR3A 1T03B 2ZBQA 4RW9B 1Y10A 2DVIA 1UWBB 5C7PA 2ZBPA 1FFGB 2C2ZB 5A6PA 3WZ0A 1U1LA 4ZOSA 3C6TA 2B8PA 3D4JA 4DR3F 3H2VE 3RW7A 5KFPA 2OO4A 4CLUA 1VQKS 2BKNA 1HBMA 1MWQA 2YWGA 3ISNC 4C0OC 4B9MA 1HYSA 1BQXA 2GVZA 3A8KA 3P6YC 3NGDA 3M1VA 3I5BA 2ERRA 2X1AA 2A3JA 1VHIA 4QIEA 5KFHA 3HHLC 3HVTA 4NZ7A 2A0FB 2RDIA 3DLJA 4B9UA 4ED0A 3N5FA 5D0EA 3CMES 3ZTPA 4WFXA 3D6HB 4RPFA 2DNLA 3ITHB 4CTAB 1TKTB 3SSSA 2ACYA 3D0GE 4XDDA 2CPFA 4DEZA 4A8MP 4U67Q 1JJ2R 2UXDF 2YY3A 3T1AA 1T3NA 4W90B 3BKFA 3QRRA 4JI5F 2DXDA 1VJQA 4UOCA 5T41A 3S6EA 4DS4A 1S7IA 3A8JA 1EQMA 2LP4A 2FLOA 1CJVB 5E3AA 1XC9A 1NJXA 3QAUA 4E98A 2UUAF 4DXLA 5DQGA 1S1TA 4Q0BA 3LGHA 1VI7A 3QFWA 2G1HA 4P74A 2HZVA 4B17A 2ZZNA 2ABYA 2W4PA 4JI0F 1DY3A 2RRBA 1VQNS 3VV2B 5THWA 4ED5A 1HARA 3TO8A 2OGUA 3CCES 1FD2A 3NS5A 2H5IB 2KG0A 5K8PA 1H38A 3RRKA 2O1PA 1JJCB 3D6TB 3DMJA 4KIAA 1NH7A 3S7RA 3MURP 2XO7A 3K2YA 1FDAA 1VBZA 4PAAA 1TMJA 3NS7B 1FKPA 3HJVA 1FD8A 3QZ7A 2V0NA 2Z2YB 4HVZA 3MCNA 3IR7B 4AL5A 1H6KX 4LR8A 4ZVQB 1NK8A 3TA0A 1KQFB 5CD4H 1DHMA 4JI3F 4HHHA 4WE1B 3W66A 2CJKA 3IMQJ 2JJ4D 1RHJB 2LEPA 1GTHA 2YNIA 1VIOA 3HKZD 4L3NA 4K4XA 2UV8G 2XS7A 2PMHA 5ETLA 1JLCA 1R0AA 1OMSA 3TUPA 1NRKA 2K7KA 3H40A 1BQMA 1ZAXA 4IH7A 4MKYA 2MZRA 3CF5Q 2VH7A 3G4SS 3W1YC 3HT0A 5IT0A 3BGLA 3JXOA 3SFUA 1EHWA 3MUTP 4PQAA 1K1QA 1UPPA 3A3OB 3SCLE 3RRGA 4NCGB 3V6KA 1QAYA 3MEEB 4PUOB 5HK4A 2C3OA 2NXJA 1D3WA 4A4JA 1FJEB 4ZHRA 4PWDA 5KFZA 2ZEJA 1M5PC 3NWGA 5CYMB 3GV7B 1WG1A 1MROA 2J0WA 2YNFA 4DV2J 3N6MA 1PC4A 4CO0A 2F9JA 2QT7A 2CG8A 2AJFE 3DU6A 4LIRA 2WBMA 5H1SV 1HWKA 4O3PA 5L1LA 2W7OA 2YH1A 4LF5J 1U8WA 5KFVA 4DV6F 3QGHA 2XMWA 4NMXA 4RKUC 4DL0C 1WJ9A 9ATCB 4L74A 1FCAA 3SCKE 4DV3F 1K73T 2QL9B 2WAQD 3M9NB 3ISZA 1Q0NA 2HS4A 3LP1A 1VOMA 2MKIA 4K0KF 2VIHA 1X4DA 1IVZA 4W4MA 2YNHA 4DL5A 3GSDA 3HHEA 3LANA 2FJEB 2RILA 3UFCX 1YRUA 4ZVOB 2R42A 1WSVA 5DDPC 1URNA 3TYTA 4U8YA 1ACMB 1O8BA 2J7UA 2E1AA 3OBIA 1QSSA 2IBOA 4DI6A 3MFIA 2K2PA 2LKZA 3BEGB 3VWSA 1CJKB 2NXCA 2Q6CA 3DRRA 4HH0A 2HFZA 5KG1A 1VRTB 2G2ZA 2OEMA 1TQLA 3N28A 2PA3A 4WKRA 1T9YA 4OYMA 3KUEA 4NRUA 1P27B 3DGPA 5M2UA 2AGQA 4K2XA 1OWXA 2WSFC 1TL3A 2VBXA 3AXMA 5F8MA 2F4VF 1WC1A 4ZLNA 1HNIB 2XNQA 5B0BA 2LEAA 5HJYA 3POTB 1K0TA 4D3HA 1HHQA 3N6LA 4WIQA 3TRGA 2L9WA 3VCDA 5F8HA 3UWTA 4NMLA 3MMCB 1X5OA 2BV3A 3BBCA 2FJDB 3N6NA 1LEOA 2B4OA 1M1GA 2HS0A 1DAXA 1HW9A 1D9FA 1RT1A 2QYCA 5BYRA 3F73A 3OXLA 4ED7A 1O5JA 2HK2A 3ICLA 4WFZA 2J8SA 2DY1A 4C0BA 4MIWA 5KTQA 2KT2A 4X62F 4IR1A 2B43A 2G0CA 1WG5A 1JK9B 1NDKA 3S01A 5KG4A 3FSYA 4K4VA 1PJ5A 3M30B 2R8HA 2MEWA 3I56S 3A12A 4NI2B 4FS2A 2HHVA 2EK6A 2WSCC 4NOHA 2HIQA 3NMAA 5ETSA 3CB4A 4KHRA 5E3CA 3D67A 1HFEL 3OTDA 1FKAF 1Z1ZA 2L48A 4C8KA 5JXSA 1ZBTA 4QWDA 1QE1A 2ZH8A 2KRBA 2VG7B 3UNYA 4ANEA 1FFSB 4Q2LA 4WU3A 5CABA 2KM8C 2B4UA 2N4DA 4NA2A 1HWUA 5DDQC 1TFWA 3C46A 2Q3PA 1JXLA 5DS7A 2YWEA 5F0UA 3OLAA 1F5AA 2ZH5A 1SV5B 3V4IB 2ZH9A 3PVXA 4L72B 2ZDPA 4A47A 1L5UA 1S6PA 1WKKA 2CNLB 2ZHOA 4LRDA 4PR6A 2NCKL 5LSLA 4QWEA 5IM0A 4C8MA 1R8CA 3DNCA 4N5SA 5J2MB 4KJIA 1YSJA 5AXNA 3MM8A 4B3OA 2UUWA 2W7PA 1M90T 4TY9A 4ECTA 4KB7A 3DRPA 4IRKA 3HCXA 2DR5A 5IT9U 1R8BA 1UW9A 5CQGA 3PFOA 2DRDA 3PIPQ 3G2XA 2E44A 2FQQB 3M2VB 4LIWA 3K57A 4O3SA 2V34A 2ZD1B 1R6VA 1ZM4A 1WNEA 4I2QB 3I0SA 1QSLA 3UCZP 1DLOB 3RBDA 4K4TA 3CTRA 4KFBB 3R1LA 1F9EB 3PYEA 2BJDA 4BBYA 5A8KA 3RB6A 2HVHA 1GH8A 2V2ZA 4HKQA 4J9LA 4EWTA 3C16A 3MHYA 1NHKL 2E29A 4XTTA 4FF2A 2EPIA 2KXHA 3SXLA 3MECB 4ZCMA 4BCAA 3PR5B 2EBEA 2ASDA 3TJ8A 4L75A 3RR8A 2FJBB 2PD1A 5KT3A 2YH0A 3C15A 1N5QA 4C8YA 3KK3B 4KGMA 3QBCA 2BUNA 4DUZJ 1XBWA 4YHHF 2DGXA 2SXLA 1DTQB 2DGSA 3ENWA 1IKXB 3GB0A 3MEDB 1VQ7S 3KMQA 4PG5A 3FBFA 3NOCA 1NK0A 2CJQA 2IMOA 3RAMA 3CNQP 1BLUA 2BQ3A 1NCLA 3IP0A 3IRWP 4J90A 4QW8A 2B4PA 2QLJB 2VC0A 4CO3A 2JEGA 1C0TA 2VJUA 5JVHQ 4JI7F 1OPIA 4C3LA 2WVCA 1F1BB 8AT1B 2IYGA 4FZVA 1V5VA 2KHCA 1H2TZ 1SJFA 4OZNA 2GQCA 1KP6A 4URGA 4BC7A 1JLBB 2QL7B 3S1TA 2DH8A 2FGCA 4CIOA 1NB2A 1JLEA 2XHWA 3ZNUA 1ZPWX 1QUVA 2GC8A 2MTLA 1TKXB 1N52B 3EXYA 4N77A 2DNPA 3UD4P 3QPIA 1S1XA 3CCTA 1HNVB 1DARA 4O0NA 3I82A 1WHXA 2Y0SD 1UPMB 3D3CJ 4WWSA 5C24B 3M32A 3NY0A 5I42B 5BXIA 4LT6A 5D0GA 3BH6B 4X4RA 2C28A 1M5KC 3G71S 3DDKA 1SH0A 3OFHA 1NJYA 5FJ4A 3M8PB 1SQGA 3DLKA 4DR3J 4YY3F 1N5YA 4WIIA 2V4JA 3OHAA 3K7RA 2BEFA 2LQBA 4EGLA 1JLAB 4U7UK 3AAWB 3FCHA 2HLUA 5A2QY 1V5IB 3J80Y 5HP1B 2RHSB 1N34F 2AYBA 2UXCF 3MXHP 3Q8PB 4C7QA 4M5LA 2GZOA 4WFYA 4FYVB 3KHRA 2H4YB 2CFXA 3NOGA 4YQWA 4LF8F 2L41A 1FI4A 5A2QU 2DB1A 3N4WA 4XK8C 2CPYA 1V9OA 2M52A 2HHPA 4NASA 5K14A 2OMLA 2AJ0A 2D3OR 2BE2A 3PKMA 2ZKUA 3HFZB 3IO1A 3RTVA 3EDQB 1S0NA 4DR7F 1A6LA 2ZWOA 3I31A 3G6YA 5LMNJ 3LO3A 5KT4A 4ILLA 4NLGA 3QT5A 1RTHA 2NS1B 3VGTA 2ASYA 4ED6A 1VRUB 1S77D 2HNZA 1HWIA 2CQGA 2HGNA 2XMTA 2NXEA 1F2HA 1T02A 2HFOA 3O8WA 7AT1B 1TK0A 1N32F 3X1LB 1K1SA 4Q2MA 2LXFA 1RLCL 4PXDA 5C2CA 3FJ2A 2ZZTA 1QTMA 3WBZA 3J7A1 4I1TA 3FBCA 3VVTA 2DNNA 1OY9A 3OFFA 2FPHX 3DLLQ 3HKWA 2NYIA 1TV6B 2MLZA 2EWHA 4O4RA 4DJBA 4GKJF 4TLRA 1XR7A 3W8GA 3ZO7A 1NM2A 4AL7A 3B78A 4TN2A 2RB7A 4LMZA 2CKWA 4UF4A 4XO0A 4C3MA 4M8LA 2OTLS 3PYDA 1CS4B 1IN0A 4A48A 4B08A 2QEXS 4OZ0A 3DGVA 4LSNA 1Q79A 1RWUA 2JH3A 3UDEA 2X1BA 4Q8EA 2DR9A 2VOPA 3KFWX 2RS2A 4RUAA 4P52A 2VBZA 4B3MJ 1WTFA 1C2PA 1EZZB 2H5JB 3QWPA 4LSLA 5LT5A 1U2FA 1HQ2A 3PW4A 1SC1B 3Q22A 2I6WA 3ADAC 1U8SA 1GX6A 2EEYA 5JMNA 4DL3A 1N5VA 2HFSA 3EJMA 3K5LA 5T7LB 3QRQA 2CJBA 1R0BG 4QWCA 2VDHA 4OZJA 5B0CA 5DG7A 2MQLA 4K0KJ 1H2UX 5B09A 1Y5LB 4G1QB 2DR8A 3TUJC 4B9VA 2CPIA 4NCAA 3L3CA 1AFJA 1FE4A 4NLTA 5D4OA 4CH1A 3K5NA 4TNOA 3NNAA 2ZBRA 3MMAB 4N41A 1D8YA 2CVEA 4WZQA 3QWUA 5FDLA 3BO3A 4CLKA 2W4CA 4RW6A 3TVYA 1I1GA 4DZ6A 2LA6A 2OFHX 4KH1B 3KHGA 1HNWJ 2HRUA 5HI7A 4DUZF 1M1KT 2A1BA 4FNHA 2G2OA 2MHNA 4ILMA 1X31C 1RKIA 1N48A 1WD6A 3CCZA 4TU7A 2VICA 2DNGA 1RU1A 2CQ2A 4OYWA 1X5SA 5IQ6A 1IM4A 1RT3A 2HQFA 2XGPA 3JYTA 3OTBA 1VC0A 1T05A 1BXNA 1S1VB 1REVB 2C2MB 2JLFA 2MQNA 4ILRA 5KAKA 1RABB 1R7IA 4NLRA 4ZPBA 3K0JA 2OTJS 1ROFA 2CUYA 4PYAA 1YK9A 4CYUB 4USMA 2CDRB 4TU8A 3Q2SC 1ZA2B 2RDDA 3F41A 4CO5A 2FD2A 4K7QA 1IR0A 1N56A 1FWLA 3W7BA 2ZJRQ 1U1KA 2HHTA 1E6VB 2V8VA 2M8DB 1YJRA 4JI7J 4DPTA 4NYZA 1UEVA 2VG6B 1W2BR 2C2RA 4ID5B 5KFGA 3DOLB 2HLTA 2IM3A 3H4DA 3P4UB 3R2CJ 2XSJB 2COLA 4KYZA 4KSEB 2BQUA 2HRTA 3P49B 2BRLA 1WC5A 2OPSB 4DPUA 1Y0HA 3PJWA 4JI6F 2AZ1A 3C14B 3FGVA 3W2WA 1CLFA 1FNOA 2VZ9A 1F3FA 1NK4A 3Q8UA 2E9TA 3OR2A 3PACA 3KLIA 3VAFA 3IAS9 4ALZA 2C3UA 3R6LB 1SIWB 4HTIA 2ZJQQ 3V4MA 3IM9A 1RKJA 1N6QB 4ED4A 1P1TA 2E9RX 3OVAA 3CC4S 3UCGA 3BN7A 2D3UA 1ZTTA 2BM1A 1RACB 2DNMA 5HBMA 1U26A 3KWMA 2R7TA 2E5LJ 3C6TB 1CJUB 1TL1A 4M5JA 2UU9J 2HPUA 2MGZA 2DRAA 3B8HA 3DXSX 2MZQA 3KG0A 4QOTA 2UUCF 5CAAA 2Y1LB 1RA7A 2C42A 3GU0A 5KFJA 1OY8A 1Y4ZB 4LRFA 4Y28C 3RB0A 1GMVA 2U1AA 2R9LA 2BW2A 2EXUA 4AD6A 1FJCA 2OUGA 4C98A 4BHQA 2OEJA 1X60A 1QJHA 1I3OB 3LUYA 3AOBA 2L08A 4YDXA 5KOWA 2HWHA 4LREA 1PYOB 1RAEB 2KYZA 1S1UA 4QYZJ 1M1HA 4LJMA 4W98A 3IFEA 1EB0A 4CLWA 4Q45A 1Q4RA 2FDNA 3BPSP 5GAEU 4G65A 4RNFA 1KVIA 2E1MC 2B7BB 5C25B 3OSPA 4EEYA 2CNOB 2GAGC 1FKOB 5JJBA 1PSDA 2JEIA 4OLPA 1KS2A 2HQ3A 3GJRB 3HFVA 1FXDA 4DOZA 4E2FB 2ZDOA 3FK4A 4UUXA 3EPGA 3MUMP 1S9FA 4O3OA 1M5SA 4L76A 4CNZA 4ZMMA 5DZ6A 1LKZA 3W2VA 3MR3A 2OPRB 3J7ZT 4CP5A 3JSMB 4DV4J 5HMWA 2CQBA 3CE8A 3P5TL 4NRTA 4ZIVA 3J80U 3V81B 4FP9A 4LF6F 3PV8A 1U09A 1VMBA 2YWKA 1WEYA 5AXKA 5HQMA 1AUDA 3NCQA 2AMCB 2R7UA 4O4GA 1FRIA 1HL6A 1SH3A 1UEKA 4I7FA 1FWPA 2P6TA 4WTOB 2IJRA 5K8MA 1FXRA 4J9NA 4F4WA 3GIRA 4DV4F 4B9NA 2YXLA 2GGPA 3HMJG 2XLJA 1NJWA 4X4PA 2GQQA 3TW0A 1RA6A 4DV3J 5IC4B 2W9CA 1C0UA 2CZ4A 2EFGA 3FSXA 1HBNB 1PGZA 1S1WB 1FA0A 3QATA 4QW9A 4J9UE 3VVUA 4F25A 1RWOB 3I5CA 1OSCA 3NBPB 2HFUA 3EMTA 2XMVA 4GKJJ 2RIJA 4JI8J 1CQMA 3BGFA 3Q8YA 2IC3B 3DLGB 1QAIA 1LWCA 2AEFA 1BWVA 2LYVA 4RWWA 4WU2A 1FRLA 4YY3J 2FUG9 2GIFA 2R7VA 3W62A 3QGIA 5J2NB 2YQ1A 2RU9A 4MFBA 2FLLA 4ZS6A 1FERA 1RT7A 4KE5A 3PEJA 2RD5C 2XG8A 3TUIC 1RCOB 3R7SB 1U0HA 2RAQA 4X4TA 4X4OA 4ZLJA 2B5JA 3DOMA 4YR2A 2DPIA 1FTRA 2QMWA 2KJWA 1AZSA 2V50A 3I55S 3LWMA 1RHRB 3CIMA 4J9OA 1QSYA 4K50A 4M5KA 3UR0A 5DLGA 2KM8B 2DO4A 3IC1A 2OKQA 2R8JA 4U7CA 2DTJA 5GVQA 1NUEA 4DPXA 4R8UB 4X65F 1SXLA 4YB1P 5DG8A 1G7CB 5GAGU 3GIIA 3DRSB 5KT6A 5K8NA 1IKVB 5HLFA 4LF8J 1ZM3A 3MR7A 4FXVA 2BJ7A 2MQOA 2XO6A 1NMEB 2B6AB 2OD6A 5L1KA 1IKWA 2IA0A 3HD1A 4ZK7M 2C2DA 1X4CA 3OVBA 1CPZA 4UW2A 1DFDA 2G9OA 1Y00A 2LQ5A 3CJ4A 2XC9A 2ZKTA 1NK6A 2YBVA 2FVQA 3RBZA 3WX8A 1ZZFA 3FZBA 2NSBA 4KAIA 4OYIA 3N0VA 4OL8A 3KYLA 2W2QP 3ZNJ1 1TK8A 2B9WA 2Q6BA 4H4OA 5BYSA 3BQ2A 4WPAA 1J5OB 2QLFB 2V9KA 4J9PA 3QLHB 4ELVA 3HULA 2F40A 3QMQA 3PHEA 4N8OA 5H9EK 2B9XA 3KJQB 2D1CA 1AROP 2CG4A 1IM6A 3TWZA 4O3QA 2DJWA 4PCQA 1MNEA 3I96A 4TLQA 3VALA 2E66A 1WEXA 4FS1A 1VC6A 2XS2A 1TVRB 3RW6A 1RAJA 4Y6IA 3MAQA 1TKZA 4ECVA 3R2DJ 3CVKA 1CQNA 3GLJA 1RTJB 4J9MA 4ED2A 2OJ3A 5E0OA 5ETRA 1XNRF 1LK7A 3M2UA 4CLLA 2QLWA 1PILA 1U45A 1YJ7A 1S9EA 1KKHA 2VF3A 3KUHA 3MMCA 1NSQA 4O44B 4WFAQ 5CH7B 3Q86A 3C6UA 4HR2A 3SV3A 4FBTA 1RT1B 2DHSA 1VQLS 2HMIA 1JQGA 4CLPA 4GC7A 1HBOA 2V2VA 1NHUA 3KJVA 1MSWD 2AKWB 2HNYA 3G8SA 2AT1B 2H5EA 3GONA 3HFKA 4LRCA 4Z7YA 1DQAA 1TZ0A 4CO1A 3CC2S 3TQ1A 3M30A 5BR8J 2J76E 1T8EA 3P45B 5LJ3Y 3GWCA 2KH9A 2DPJA 3NL0A 4DFMA 4IH6A 5ETKA 1UJ4A 4TKTA 4YB6A 1P9QC 3KLFB 1HR0F 1CBKA 3GMGA 2H9ZA 3HHLD 3MM6B 3KLHB 1U49A 4JI0J 4FDFA 4L6V3 1R8PA 5L46A 4NXMJ 1KFDA 3E01B 2MQPA 3VQTA 5IWAJ 2VFVA 3BDEA 3J81Y 2B51A 1QE1B 3HZGA 2FVSA 5CYQA 2AD9A 4DF4A 2F9DA 4ZKAA 2PGCA 5KFDA 1JX4A 4ZIWA 2LXIA 1YTYA 2L9NA 4P9SA 1RXOB 4L3KA 3OTCA 3D6FB 3Q8QB 3K59A 3F0NA 4DV5F 3HPOA 5FD1A 3N9UC 3MEGA 4NLXA 2VBYA 1VQ4S 1KQKA 1KTVA 1NZAA 4PWWA 1RTDA 4X65J 1SV5A 3FCWA 3HSDA 1LOUA 1B3TA 4F04B 3AA9A 4IFVB 4DCJB 4NYPA 3UDLA 1JKHB 4G1PA 4KC5A 1U1RA 2LVWA 2MKCA 2RNEA 4ITSA 3QIPB 3RB3A 5HL7Q 1LWEA 3MM8B 4HTJA 5HROA 2NXNA 3TAQA 2W01A 1V3ZA 3DRPB 2NUHA 4LRBA 3CDWA 2N4CA 3UDVA 2APOA 2I5JA 2V68A 5HO4A 3OLBA 4CQ1A 3PYGA 1CULB 2P5VA 3EGVA 3OUYA 1QTNB 1C1BA 2JC0A 2BZ2A 3FMBA 4LF7F 4U7UD 4WBFA 1IKYB 2MDAA 1E6YA 2YKNA 4AXIA 1Q8LA 3AOCA 4QIGA 5C42B 2AX1A 2HNDA 2PMZD 3TEGA 4CH0S 1SC4B 2OSRA 1OSDA 4DG1B 4KFBA 2W8KA 2Y8WA 1D09B 1NDLA 3H2LA 1HPZA 3V5RA 3AJ2A 1W7WA 1Q81T 3KNAA 2UZAA 4TXSA 2VASA 4OX6A 1G4CA 2DXFA 2GX8A 2YX4A 5ETTA 8RUCA 2M70A 1UFWA 3B54A 1N32J 1YWXA 5IT9Y 1VGYA 3H5UA 1R3NA 2CPDA 3H42A 3D54A 4ZPVR 3UVJB 1JLFB 1KLMA 3ILJA 4CRJA 2JLGA 3TI0A 4USUA 1UVLA 1RHKB 2R8IA 2JEFA 2V8DA 3CD0A 4X4QA 3GFHA 1T11A 1WWHA 2CNKB 2M2BA 3I6PA 5KFFA 5LXYA 2P8IA 2D7SA 3T3FA 1X9SA 1PYTA 4IQMA 4OHYA 5KFYA 3ZZUA 3PTWA 4AXJA 2VU5A 1IJFB 1YJWS 3T9ZA 3MOJB 3BSNA 2AYEA 4OHVA 4E8UA 2NPFA 4F4ZA 3M8ZA 2BJ9A 2XQCA 3OFGA 2PSZA 5ETMA 1PO6A 3D0IE 1CC8A 4PPDA 4P7VA 1T9XA 7FD1A 2JOQA 2HVZA 5L9XA 4RUHA 5I3UA 2OAUA 4GMKA 2ADBA 3GSIA 3QNWB 5DETA 2F65A 1HWLA 1NU4A 1PAUB 4BLGA 4RJVA 1NSPA 2AGPA 1CEZA 4CLYA 3QIDA 1JLBA 4C0HA 1C1CA 4UY85 2EI5A 3EICA 2BANA 2G4BA 3H0PA 3U1LA 3V6JA 3HHLA 2W1BA 2FLPA 3UO0A 1F2GA 1NNDA 4P10A 1VS3A 1YRTA 4KV8B 5LMUJ 3NNHA 3HI9A 3B82A 3KLGB 4TQRA 2XMKA 4DCPB 2BR0A 1GQEA 1HQEB 2CZ9A 2O66A 3K8WA 3K5OA 1I94J 2M3DA 4FVMA 1S0VA 2A2DA 1U02A 4PYDA 4ZCLA 5AE1A 3ENAA 5E2QA 1RTIA 2IRXA 4H4MB 5K5MA 2PO4A 2FVCA 4GVLA 3S8SA 1JLAA 3NMRA 3H5XA 4OI1A 4A8XA 3CD6S 2N7CA 4JI3J 3AQOA 4UQGA 4IQXA 3DI6A 1MMNA 4Y2AA 4ZP9A 3DM2B 2ZHAA 4FF4A 3G86A 2CQ1A 1RGVA 1QD1A 1XMQF 5E3RA 1M5VC 1HLWA 2VHGA 1EKSA 1VC5A 3MM9B 1S6QB 2YKPA 1BC6A 2UUBF 2OPPA 4X66F 4P2MA 1HNZJ 3MCMA 4RW9A 4BS2A 4CLFA 2IVYA 3GJQB 2J0QD 4HLBA 1VQ6S 2NUUG 4HHJA 1HMVB 2LFVA 1X4GA 3MCOA 4I0WA 3WC2A 2BM0A 4ICLA 4O0IA 4JV2A 1LWFA 2IM1A 2B3TB 5IWAF 1RTHB 4NEZA 2P9GA 4JI4J 1HBMB 2ZH7A 4UY8T 1GK8A 4DV0F 2GVZB 3JTNA 2DH9A 1Y9OA 1KQSR 1VFJA 1NPRA 3JS9A 3VGVA 1WI8A 2YQ3A 5SZTA 1U2CA 4GO7X 1WDTA 3K58A 4NXNF 2MQ8A 1KWMA 4AT1B 4JI5J 2CQ4A 1RI7A 2FHKA 1HNIA 3ITHA 4CTAA 1H72C 5E5NA 5F8IA 5DDOC 1MU2B 4KPYA 2VPWB 4KRWA 3M8RA 5GADI 1FK9A 4KTQA 3A13A 1M0SA 2AW0A 3MCSA 4U6PA 3HXMA 1YITS 2HWIA 3QSIA 2NPIA 2XB2D 1ZPVA 2HW3A 3GCXP 2V67A 2M8HA 2MMYA 3FZ2A 4GVBA 2JHEA 3C19A 2KG1A 2KFNA 3FFIB 3KG4A 5J2QB 3Q0AA 1S4FA 2ZJPQ 1GXTA 2A18A 2G1DA 3IRXB 1RYSA 1WF2A 4HT7A 1UAWA 2WRMA 4M5MA 4Q7AA 2XZDB 2DNKA 2JFDA 1G3OA 1NB7A 1G6BA 3THPA 4NCBA 4B3RF 1I5OB 2MQQA 2RH3A 2ALYB 3LPYA 1XR5A 5DZ7A 2VPXB 3VAMA 4IDKB 1FKPB 2W2MP 3JB9k 2R2SA 3D5MA 4ZN1A 2Z57B 4O3RA 1CJTB 1SQFA 1WC3A 2DNYA 5KFQA 5ADZA 3D9BA 4Q43A 4OI0A 1HNZF 2AZ3A 4KHPJ 3GFZA 2RUGA 2XTJP 4WE1A 4PRFA 3R3TA 2F5GA 2V8PA 1UVIA 4KR0B 1KC8T 1SBRA 4TYBA 2MZSA 4CDIA 5GMKa 2ZH4A 3T1HJ 4WZMA 4ED1A 3WIVA 1YX2A 2O3DA 2J9EA 2WVEA 3CD5A 3UQSA 4WK3A 3W61A 3DLEA 3CJKA 2X1FA 3TX0A 1S12A 1YBTA 4NLSA 4EFAC 4OYXA 3GR0A 4Z37A 2ATCB 2P2CB 4P72A 1RBLA 1NK7A 2V9WA 4C4WA 1OQ6A 1RT4B 1ULRA 2YKMA 2XMJA 3HZEA 4MH8A 4Q5VA 3OVSA 3BM7A 2GJFA 3M2VA 1Y3JA 4EUVA 3OW2R 2PI5A 1VBXA 2ZVIA 1KDNA 4ZVGA 2AGOA 1WEZA 2B56A 3AH6A 1D0EA 4DPWA 2D9PA 1SIZA 5F3ZA 2ZM6F 4DR5F 1MROB 5LOQA 2O67A 3AFGA 2J6SA 4JI2F 2AJ4A 1R8AA 5A6WA 4X4UA 3NWRA 1HI8A 3I5AA 3BJYA 3T5LA 2LQ8A 2ASJA 4YDDB 4YB5A 1ZAVA 5C5JA 4IYQA 2QMUB 1B99A 4ID5A 5KFIA 3CCRS 2V4RA 2JC1A 4NLDA 2KVIA 4CO2A 2HGLA 2K8GA 3L4BC 3M7VA 4UZCA 1WHVA 3C15B 2F63A 5A8WB 4ERDA 4KHMA 5KFBA 3RAQA 3JAMY 3IBWA 1ZYQA 3NEKA 1A7GE 3TZZA 3LH2S 4QCLA 4GO5X 1Y11A 5EDWA 3DFEA 2BBEA 3MWBA 3AT1B 3LALA 4LVNP 3DYAA 2DIVA 1HKAA 2LCWA 3OR2B 4P2XA 3A3PB 1BE4A 4PG7A 3UD5A 5ETPA 3FNNA 3GJSB 2RHQB 3K8VA 1YRXA 2IVFB 3PZPA 2X51A 4MIBA 5AXMA 5IV3A 5L39A 1N34J 4GKKJ 4ECXA 5F0WA 1IBMF 4J7CA 3GR1A 2OI2A 1EP4A 3IBFB 2E1PA 4KGZB 4MIAA 4USJC 2LDIA 2BKOA 1IWGA 2KU7A 2NYHA 1TKXA 2UVUA 2VA2A 4ZVPB 1IBCB 1S1XB 2QFIA 5LJ5Y 2FJXA 2UUBJ 4LFAF 3MF5A 4GC6A 1JMTA 1QY7A 2ZM6J 2ZITA 4CNYA 3J81j 4FXDA 5KT7A 5CCMA 5AXLA 2EC0A 4OZ3A 3HHKA 3KK2A 5J2PB 4DR4F 4CI0B 2ZOMA 1S4EA 3IS9A 4WP8A 3R5GA 1HQUA 2RE1A 1RUSA 4OZ1A 5ITHA 4DF8A 1XMOF 2J9DA 3CDUA 1U2RA 4MKVA 5D78A 2F8MA 1TL4A 1H0HB 1X4AA 2MJNA 3MM7B 5J1EA 1KVJA 4JYAF 2RT3A 2YTCA 3L7PA 2JLEA 1PCAA 3L7OA 1V6HA 2WW4A 3M4XA 3U27A 2CNNB 4C97A 4MTPA 1HA1A 5D6GA 2FZCB 2C3MA 3CC7S 4ID8A 1JLGA 2R2TA 5KG0A 3IR5B 4AQYF 3M9MB 1TL7A 4OJ1A 5LSRA 3LA0A 4OZLA 1U6ZA 1BD6A 2GAHC 3PNIA 2MHEA 4KKOB 3ZZ0A 2LU1A 4DV7F 2ADCA 1S97A 1RAOA 1UMJA 1K9MT 1KD1T 2BE2B 2HG4A 1N0VC 3U1NA 3G82B 3OPKA 1DQ8A 4PXEA 4MAKA 3DHXA 3ENQA 4DQIA 1S0OA 3VHQA 2J0SD 4OI4A 4I7FB 1RYRA 3IG1B 4H54A 5IM0B 4J9KA 4F3OA 4F2RA 1JJ4A 3G9CA 1FVSA 3NLCA 3R5AA 4WP3A 5KOXA 3FBEA 1XNQJ 2C2KB 2UVVA 2OELA 4DS5A 2FVPA 1U47A 5B0FA 3MMJA 5AE3A 3P3DA 1HBNA 5BR8F 1S1WA 2V6AA 4ANDA 1NHVA 1KEKA 2H65B 2WW8A 3NG8A 3FDSA 3K5PA 4NLYA 1L3TA 4DZDA 2VFSA 4LBPA 5AJ3F 4DR1J 3W9IA 2UXDJ 5HJXA 2DR7A 3M6XA 5KT2A 4YS2A 4ZITA 2DEJA 4IFYB 4RO0A 2ROGA 1AXQA 1FEHA 2FYXA 2WTFA 1AFIA 4NEYA 2HHQA 3LF0A 2RF2B 1CS4A 2PA8D 5DQIA 1KLNA 3QJPA 4LSNB 1FRHA 2WK4A 2XLKA 2MKYA 2X3GA 2AU0A 1X4HA 2B7CB 2RKIA 3SIPB 1IWAA 3F56A 2OH2A 3LW5C 5DDRC 1AZSB 2HZCA 1RSCA 2LDYA 4R25A 1PJ6A 2Z0GA 3JQJA 1HWJA 3QGPA 4CT8A 4ECZA 3TAMA 3KK3A 2XWYA 3LP2B 4EU0A 3BGRA 3FEZA 3FQKA 2CQDA 5KFRA 3GE9A 1WF0A 1L3KA 2W24A 1UVKA 2DHGA 2MLXA 3FMWA 4ZA1A 3RAXA 1L3SA 2GIRA 2IM0A 2Y3YA 4WK1A 4FPIA 1T9TA 4IRCA 1RHMB 2DGVA 4Y65A 2XCPA 1KOHA 3PX0A 2R7SA 3L9ZA 2IPOB 1HNWF 4OYPA 3CGIA 1F60B 1AT1B 2DHXA 1OJ4A 2HRYA 9RUBA 4A46A 2FVRA 5E3PA 2ZOGA 5EWGA 3TA2A 3MMAA 1S7HA 3PW7A 5GAHU 3KJNB 2NLWA 4B9TA 4JV5J 4LF9F 2ZNZA 2C3PA 4HDGA 1RWPB 3I9ZA 4MKAA 2V5HG 1WACA 2YX7A 3RU0A 2EBGA 4FYDA 4RW4A 2WHOA 2BE7D 1H7XA 2BKPA 1VQPS 2VPYB 5KFLA 2ROPA 2QV6A 2HFVA 1KTQA 3MAAB 2MZ1A 2J0XA 3RBEA 4AFFA 5AT1B 2KN4A 3F44A 1SJ1A 4DN9A 1A0OB 2KRRA 2X3DA 1ZM2A 3A3NB 1WOPA 3DN9A 3G8QA 5C24A 2JX2A 2FHMA 3AY0A 5DG9A 2XZWA 2NZCA 3AD9C 4YMEA 2WB4A 5HMYA 4QYZK 2C3YA 4ATNA 3HJFA 2KFZA 4Y2CA 3ZTOA 2MXYA 4ECUA 2F8EX 2CQ3A 2MKSA 2ZNYA 2WBRA 3AHPA 4OZ2A 3EZ5A 4EZ9A 3VTIA 4PUOA 3C66A 3QO9A 1YKWA 3B4DA 2Q1LA 1V3SA 2PE8A 4O44A 4DCOB 3H7HB 1E6VA 1UFLA 4IG3B 4A8KA 2QA2A 3D6MB 3LWLA 3TANA 2XYHB 5MLCV 4OYZA 2RU3A 2BOAA 5D3GB 1SUQA 4DSFA 4K59A 3K89A 1PIEA 2BX6A 1EETB 1FX2A 2MZTA 2PEHA 3EE3A 3U02A 3DU5A 3FSIA 2ILYA 1SJ4P 4DX6A 2GJIA 3O2IA 2OSQA 5DM7Q 3CJQA 3TA1A 2VDIA 4LQ9A 3PJXA 1UA1A 1X9WA 2IFXA 1VCTA 4LR9A 2HEKA 3OR1B 5HATA 4I2PB 1H2VZ 1T9VA 2I1RA 2LXUA 2CQCA 3CD7A 3JSBA 3KHHA 2QFJA 3MD1A 1X7VA 2UXBJ 2KXNB 4F67A 2F4VJ 3PYFA 1BGXT 2Z58B 2WVBA 1K47A 1LW2B 3VZHA 4FKXA 1OY6A 2HQGA 4P6QA 1BY9A 2QN6B 1SKSA 1CJKA 3DOKA 2VD3A 2HNZB 3PFEA 5A0YA 4DQPA 4I68A 3NGRA 3H25A 1SKRA 2MSTA 3PXGa 3I4HX 4I4BA 2W2PP 3HVTB 4UZBA 3UDCA 1HNXF 4PZVA 1VISA 1N6QA 1BUXA 4JV1A 4R0EA 3CULA 2A6OA 2AWZA 2D3O1 4A8YA 2MB0B 1Q5YA 1J5EJ 1WKJA 1LWXA 2CXEA 3U1MA 5IXUA 2KKHA 1Q8IA 2E5JA 1TV6A 4IFVA 5LM7E 5D15A 3QRPA 3L09A 2DBBA 1ICEB 1R27B 4NZ6A 3CCVS 3SEOA 3PIOQ 4DV6J 1N36F 2F1FA 1W2IA 1LWEB 3BR9A 3W64A 2HQIA 4RW7A 3ET6A 1H7WA 1KOOA 4QR0A 2VONA 2HBQB 1L3UA 2BJ8A 3TZXA 2IHR1 4F0MA 5GAHI 4Q0BB 1IR2A 3CEDA 4LVOP 1S1UB 2CRLA 1FT8A 1GFWB 3MPDA 2PT0A 4LFCF 1S79A 4Q44A 2LEBA 1ZH5A 1GXLA 1C4CA 2BACA 1HPZB 2BJ3A 2GMLA 3NKYA 4ZVTB 3EZOA 1FKOA 1MLAA 5L38A 2VKZG 3DMJB 3BYPA 1RU2A 1RT5B 1WF1A 1WKLA 3NP5A 1RDRA 2H54B 3VAKA 4ZJLA 3UVJA 1T95A 3NCRA 2IVMA 3M6VA 3ONQA 1YLXA 2LQ9A 4CLZA 1ZM9A 3KK1A 3GIKA 4OI2A 4EYHB 1Q7YT 5EUHA 4DU8A 1TMMA 5GADU 3Q8VA 1IBKJ 3X3UA 2E5GA 4X4NA 4DR6F 1N5SA 5KFEA 4CM0A 4H4KC 3GV5B 1CSJA 3TX8A 3CIZA 4JI1J 1Q78A 2K1RA 4ZLLA 4QWAA 5H9FJ 2O01C 4C3KA 2R4FA 1NJIT 1AB8A 5CCLA 2MPUA 1CG2A 1JLCB 2GGPB 2LQJA 3ZC4A 2RQCA 4ECYA 1BQMB 4ZP8A 1R0AB 4BWMA 4F4XA 3KLVA 4DQRA 2UUAJ 5FIIA 3J7YU 1RT6B 4F3QA 2C22A 2HHHF 1TR0A 3R6GB 1YDLA 3NGKA 2QC3A 1REVA 4ZVFA 5KG6A 3M6UA 3DHWC 4NWBA 1AYEA 1QAJA 2YVSA 4YUDA 4K4SA 4I69A 3M05A 4U96A 4Y2IA 2MY7A 3MEEA 3OQ2A 4KQZA 2IC3A 3EGNA 1S9GA 1LWCB 3I0SB 4L73A 5KG5A 1DLOA 4ED3A 1C1CB 4RBUA 1NK5A 2FY1A 5A8KB 5G0RA 4KO0A 5SUHA 1RE1B 3K17A 3MM5A 5L9NA 3G6ES 4DFKA 3J81U 4X64J 4LF4J 3L7UA 4EYIB 3OT9A 4DN0A 2N7YA 5KFXA 1FDBA 4I6WA 3E51A 1U6BA 1AW0A 1YG0A 5U47A 4OV6A 2EFNA 3TOQA 1H98A 3QT7A 3L95X 2FZKB 3CUNA 2B5JB 3DOMB 4G3IA 3KLGA 5EN1A 1MMLA 1APSA 2DISA 1HQEA 1I94F 1VQ9S 3RR7A 2XI2A 4DSIA 4DMZA 4EBDA 1BQNB 5GMEA 3EVMA 2VBWA 3M8YA 4OIXA 2K3KA 4N56A 2W9BA 2C2EA 1DTQA 1IKXA 3JQMA 4DQQA 2F4FA 4NLWA 3MPWA 2GMJA 3O6QA 4OLOA 1VBKA 2DT9A 3GFXA 1I6JA 4J9RA 4PXBA 5C2GA 2AP6A 1UCNA 1H73A 3M2RA 2U2FA 3KUGA 3GIMA 5E33A 2JEJA 1F3VA 4DHVA 4TY8B 2HBRB 1MWYA 2ZH2A 2VFRA 4F36A 1KN6A 5HVGA 4QU7A 4DSEA 1I51B 2O5DA 4F0HA 1IKWB 5CXTA 2OPPB 3IM8A 1S57A 4IG0A 4PEOA 1N36J 3W60A 2NZ4A 2IM2A 4A8SA 2VG5A 4M5DA 4B3SJ 3EGZA 4ZCKA 4RBTA 4AL6A 1WHYA 2IAJA 1Y5IB 1RHQB 5E41A 3GYNA 3POTA 1JLEB 1VHFA 1WDDA 3H20A 1PYSB 3FVYA 4ZPCA 2JWNA 3SQGB 3GTYX 2WB1D 2NXUA 3T19A 2CPXA 2CQ0A 4K4UA 1LNQA 4W92B 1BWEA 1DTTB 4USIA 1YIJS 4C8ZA 2DGTA 2Z56B 3HSZA 1U1MA 2KZMA 3ZZOA 1RAGB 2DD8S 3GG0A 4IKAA 1T94A 4R5PB 3H4BA 3OJSA 1B7FA 3CCQS 4LBHA 4LBIA 2N82B 3M8PA 3N5BA 4HH1A 4A8QA 2WOMB 3MR6A 3D66A 3M8QB 3IGVA 4U95A 5F41A 2HZAA 3W63A 2JZ5A 2Y0BB 3NAHA 4DR2F 4NLOA 1S9EB 2UV8A 1FF2A 3LQVA 4ZPDA 7FDRA 1YI2S 3CDBA 1WOSA 4EMDA 5CD4A 2R2UA 4YR0A 4F8RA 2FC8A 3E3XA 4C6AA 1SC6A 2YNGA 2EG1A 1V3RA 3ZZRA 1URRA 2XMMA 2VG7A 3RB4A 1DRZA 3ELHA 3JSMA 1FHTA 5D4NA 2KT5A 4LQ3A 3QAEA 4K8RA 2D74B 2CPHA 3W8PA 2CZVC 5K14B 4DSKA 3PX4A 4YP3A 2CQIA 2VC1A 3JSRA 4ANCA 3NGSA 4DV1J 5FLXU 4X84A 2B8QA 3I0RA 1JB0C 4HACB 5F9LA 5F9NA 1YVFA 5B08A 4WJBA 3R5DA 1VRUA 4U8VA 3VGUA 2XHCA 2A2CA 1EAYC 1T9UA 1U6FA 2GFFA 2J5AA 3M1VB 1FE0A 4OX8A 4WXWA 2GS8A 4Y34A 1H3DA 2OMOA 1CJTA 2KB2A 2HAFA 4OYAA 1C0UB 1FESA 5EX3A 4ZVUB 4OX9F 5I3PA 3WC0A 2R7WA 3T5JA 1NBEB 4LF9J 4DX5A 3IBCB 4TVAB 2DNZA 4IUFA 4KH0B 1YJTA 3SSQA 2NR0A 1TKTA 2NREA 2VL1A 2HBYB 1ZS6A 3QT6A 5BJRA 3UR3C 4C8NA 3BBBA 2VB6A 3O44A 4J91A 1W25A 2Q79A 2XCAA 3E2EA 2DY9A 4J37A 5A76A 1N4LA 4IOAQ 4RNOA 2CVIA 1SC3B 3C16B 2FC9A 2X1GA 4QR1A 4J9QA 1Q8BA 4NXMF 1RB0A 2Z30B 3LP0B 2QA1A 3RYLA 2R7RA 4PWUA 4JI6J 4JOUA 3QSYB 1FNMA 3LAMA 3O5TB 2YKMB 1J27A 1X0FA 2MY8A 3AJDA 1CULA 3EGWB 4R0JA 1R43A 3OUYB 3PW2A 1B4SA 5B0GA 1Q95G 1E6YB 1VLOA 4WYWA 5D4LA 5HVFA 2F8HA 1OS5A 3H8YA 3G6XA 1T9WA 2E7VA 2ZUGA 2RDJA 2CJYB 2MKJA 4KBIA 4RW8B 3SDEB 3Q2TC 1HBUB 2JRSA 1KSPA 1MW7A 1NDCA 2ZE2B 2LMIA 3KMSA 2PN6A 2GIQA 1CVJA 3ETOA 2PDAA 5DLFA 2FLNA 2E5HA 4CM2A 4FVCA 4LFBF 1RCXB 1XNRJ 2B6AA 4F2SA 1UVNA 4LFBJ 1SJ3P 4K4ZA 1IXKA 3IWNC 3MMBA 4Z7CA 1JJHA 5A8RA 5BYQA 2QX0A 3GYGA 1RHUB 1YHQS 2R7OA 4BC9A 1IR1A 1P6TA 3N79A 2G13A 4IR9A 2XSFA 1AUSL 1TTHB 3CCSS 3BS9A 2DGQA 1RQ0A 3Q24A 3CCLS 1J5OA 1IJEB 4RZRA 4C11B 5KFSA 3T1YJ 4OJGA 5D4PA 5T14A 4MT1A 3UPFA 3JYTB 3CJ8A 1RJJA 3THVA 4PG4A 3UI3A 3PCOB 5HSPA 3V6DB 5KFCA 3T1YF 4NCGA 4B9SA 1RWWB 3EXCX 3UN5A 3SCIE 2Y1JA 4LSZB 2EKNA 2EK1A 2RVJA 3DLKB 4QYRA 3SMZA 5FLXY 1N5YB 4JI1F 4PQUA 5DO2A 3OTOJ 5CYMA 1QVGR 1NKEA 2YNFB 4JV0A 1B0TA 4DR6J 1Q5VA 2DXEA 4F4AA 2UUTA 3TVKA 2W25A 2JDJA 2AEJA 2IMWP 2I2YA 3G6VA 3SSRA 4ELUA 3R7NB 1NPPA 2GVDB 4LF2A 3TP2A 3T5HA 3W5ZA 1JLQB 1PC5A 2MQMA 5GAEI 2AV5A 3TAPA 4OYBA 3OFEA 3MUVP 3AJ1A 2BE9B 3I87A 1HD1A 4DR4J 1FJGJ 1UJ6A 1VQ5S 1F9FA 3LTOA 4HI2A 3SYZA 2GCFA 2AJ1A 3QGGA 4H4MA 2HWTA 5HAOA 3OD2A 3SFGA 2YWWA 4XPEA 2J8AA 2HVDA 4M5GA 2EG2A 4DUYF 3KKFA 3P8BB 4J9VA 1FVQA 3H5SA 1GT8A 3R27A 4QR2A 3W5XA 4FYYB 6AT1B 3AQPA 4EO8A 1N33J 2VOOA 1SJRA 1N5TA 2IYIA 3DC2A 1RISA 2R7QA 1RAAB 1XK8A 3ILIA 3MI7X 5CYQB 3G8TA 1FRKA 4EO6A 1LK5A 2E9ZA 4JI8F 4DBQA 1TL7B 1XR6A 3Q8RB 1HI1A 4NLQA 3MEGB 4KKOA 5HMZA 5KFKA 4ECQA 3GFYA 1NKBA 1RTDB 2WONB 1FEEA 1LV5A 4CZCA 1NJZA 2XMUA 1HIYA 2YKQA 4B02A 8ATCB 1TUWA 2KHDA 2VPZB 1KQGB 4ZDNA 4WFNQ 2VQEJ 3SZ2A 1LWFB 4C8OA 1SL1A 3IA0A 2MKKA 1OYDA 2HQCA 3QIPA 1GNKA 2Z2LA 5GMDA 4FPRA 2E1CA 4GKKF 5L1IA 1YGYA 2XULA 4KPCA 4ZVHA 5HROB 1P1LA 2HBZB 1Q53A 3OL8A 1QUPA 3CJ2A 4URQU 5B0AA 2KL8A 2YKAA 3FBBA 1HW8A 1S1TB 3MZIA 1LW0B 5KFTA 2W7AA 4QU6A 1IKYA 1RK8A 4J5OA 2YKNB 3VR1A 4X62J 1FX4A 3BQ0A 2J6TA 2FZGB 4ES3A 4Z2XA 4DV1F 2HNDB 2UXBF 2AQ4A 5DGBA 4M5NA 4YB7A 3UN3A 3HX9A 3EVOA 5C25A 1X8DA 2ACMA 2IBKA 3T6BA 3FUYA 1WSRA 1KFSA 2RF2A 4TYAA 1S10A 3A8IA 5ETOA 4DR5J 3D1OA 4BWJA 4FKYA 1SPBP 5B0DA 4GVBB 2JFKA 3C2PA 2GA7A 3I32A 2CJAA 1D1UA 4F4KA 3FFIA 3ILOA 6FDRA 5J2QA 1N33F 2KFYA 1QLNA 1RWMB 3BB5A 2EFOA 2KXFA 3BGUA 2R8KA 4WF9Q 1RWVB 4OI6A 4MYTA 3TAMB 4DUYJ 4JI2J 3LP2A 1EARA 3MDFA 4UTGA 4DX8H 2RQ4A 1AA1B 2ILZA 3HSJA 1OQ3A 3DDNA 4LR7A 4PKDB 1UVJA 2YNIB 3FRYA 1B70B 1PG5B 3M6WA 3EYZA 1TAUA 3BF4A 2UUCJ 4TQSA 1X4FA 1WOOA 3MPYA 4OHZA 3K5MA 1TUGB 1WELA 4YEAA 1EKRA 2B4VA 3GIJA 3GJTB 1T05B 5J1PA 2M5YA 4C2MA 5M2PA 1G1XA 4M95A 2QRRA 1GMWD 4RU9A 1KVKA 2V2QA 3HHDA 5LL6d 3R5BA 2YPZA 2M9KA 3PRVA 1GAOA 1DURA 2ZD1A 4X64F 4Y00A 2N3LA 2GHWA 2ZWPA 4RW4B 2LECA 1IQTA 1XEZA 2WVDA 1MN7A 1VK8A 2C2NA 2POKA 3IR6B 3IWLA 4ZVSB 3GYXB 4CLTA 1VQ8S 5L1JA 1FWKA 2BANB 2WVFA 1FTCA 3DLEB 3CJKB 2QMXA 4KHPF 1IBLJ 3O1LA 4RX6A 2ALZA 3ZZTA 1R89A 4DV2F 2UVRA 1JWWA 2PFFB 1UJ5A 2Y1RI 3BBFA 4KV8A 3E8OA 4XPCA 5I4MA 4Y0FA 3KLEA 2BXJA 4B3TF 3KNGA 3EM1A 4AYBD 1S5ZA 3NS6A 3UD3P 1GEHA 2DNQA 2MKHA 3DLBA 3A1YG 1UVMA 2YNHB 2XMAA 3EVWA 3R97A 1B0PA 1RTIB 3TJAA 3M9OB 2AJ2A 6FD1A 4ETXA 3C3LA 3R5JB 3D2WA 3SI8A 2G0JA 1SB6A 2Q66A 4OV1A 2XEXA 2BA9A 3DRSA 3H90A 1IKVA 4IOBA 2FB0A 3W2WB 2VQFF 5HLFB 3PY8A 2FGOA 2H48B 1SUQB 3DDIA 4QJVA 1K44A 3NCPA 5IOLA 1KNZA 3R1HA 3DRRB 3FEXB 1C0TB 3HF5A 4OX7A 4NA3A 1S6QA 3LPEA 5KFOA 2HS3A 4JUZA 2XY7A 2KDOA 4DWIA 2DK2A 4P2SA 1IQZA 3JTPA 3GPAA 1TL3B 2IJNA 4MYUA 2Z2MA 4DPOA 1FRMA 1RTZA 1NAQA 4FNIA 3GCWP 1HMVA 1CC7A 2V94A 3PHTA 1RT2A 4ICLB 4DV0J 3WHIA 1KR4A 2YWHA 4P7TA 4DR1F 3BO2A 4JI4F 2OPQB 5IZHA 1K0VA 3W9HA 4NXNJ 1UEUA 2JL9A 1SKWA 4B3TJ 5IS2A 3EDRB 2WCXA 4YHHJ 5DJBA 3HK2A 2DCLA 4DFJA 1UZHA 3M32B 1P9YA 2L9DA 5M2RA 2DEIA 2QZ8A 2RJZA 2AHOB 2XYPB 1R0CB 2ZHBA 2MSSA 2HIYA 3PKYA 2J6UA 4V19J 4LF1A 4QIWD 5B7WA 4HYKA 1GMWA 3W3SA 2FTRA 2FHJA 3LGMA 3CCUS 3NNCA 4NI2A 3OL9A 2ZC4A 5DQHA 2HFNA 2PFDA 3R9LA 3IXQA 3US5A 3A8EA 5F3TA 3KJFB 1S0MA 4FN5A 4FBUA 2IIHA 1UA0A 2H4WB 3PRBA 4UOHA 2NSCA 1R8HA 1RZMA 3Q23A 3BSCA 3CCMS 3CDAA 1REGX 3R5CA 3ZFVA 2JSXA 3QT8A 3ET6B 2MZJA 3OL7A 3D28A 4OFZA 2E7WA 2M0GB 3KK2B 2E7XA 3FEYB 2ZBIA 1WG4A 1ZETA 4OHWA 3TR5A 4AUKA 4XIUA 5L8RC 3C8YA 1T03A 2K06A 2KO1A 2ZH1A 4J9SA 2AX0A 2OP5A 5KFAA 3PX6A 1UWBA 2BYCA 2IRYA 4JYAJ 1XIQA 3LOUA 1U0SA 2I38A 5B0EA 1SVDA 5JVGQ 4ER8A 2X7IA 2W8LA 3MM7A 4OJ3A 3V4IA 1RAFB 1S6PB 1MN9A 1WHWA 3MM6A 5CHCB 2N3OA 1GTEA 3BH7B 3KLHA 3BSAA 1U48A 4K4WA 1WC6A 2LA4A 1VQMS 1HYSB 1WC0A 2R7XA 1YBUA 3FCVA 4M63A 5J2MA 4IDKA 4NA1A 4S0MA 2ZOFA 5D77A 3ZTQA 4QWBA 2DGWA 1UWAA 4N47A 4UOGA 4F02A 4B3OB 1ITPA 3VGSA 3IAM9 2ZH6A 2EC2A 3UCUP 3OV7A 3ETMA 4KGVB 4QPTA 4F4YA 3ZXWA 4I6YA 3BREA 3MEKA 4K4YA 1S59A 4ECSA 3PRDA 1TUVA 3G82A 4ZP7A 3TARA 2QTWA 1RBAA 3DLGA 4I2QA 4F26A 1J5EF 2XZTB 2HVIA 4K2JA 4P73A 2RS8A 1JKHA 3RJMB 5K20B 2Z8QA 3OHBA 1VYAA 3KXDA 3QYYA 5HMXA 3G96A 3HHNB 1FXLA 3J7Z5 1S49A 4IOCQ 4MFBB 4MK9A 1RAHB 2F7VA 2PMWA 3D0HE 1KONA 2HK3A 3DKDA 2RMLA 1U4BA 1CJVA 5F8JA 2DNHA 3MECA 1U0HB 1RWXB 4FXWA 1UFKA 1SQEA 4NL5A 4WKYA 1S76D 2YX1A 4NZ0A 3JQKA 5EGYA 2MYFA 2P9EA 4LSLB 2UVWA 4E0DA 1QVFR 5K9FA 1LQ9A 4G6VB 2VQEF 1S6UA 1Y3KA 3WQPA 3CXCR 3QJJA 2MJUA 2Y1IA 4IFYA 3MPUB 2CJXB 4R8UA 3MEDA 1NKCA 2J9DE 2BRKA 2QG9B 5T7LA 1R6YA 1HHSA 3BGOP 4GRSA 3A4TA 5K8OA 5EWEA 4PPZA 2XBPA 2QO3A 4G1QA 4RBVA 2XY5A 2Y8YA 3MTJA 4HT5A 4ZPTR 2D9OA 3TZYA 4EBEA 1PAEX 1KLMB 1QM9A 1PJ7A 1TL5A 2BQRA 5J1NA 1UW4A 3P96A 4ZLPA 1WUUA 2KZZA 4HEA9 2YWFA 4I56A 4WTYA 3OTEA 1NPKA 4RW6B 5A8WA 4RLEA 2W9BB 3JSYA 4HDHA 2HHWA 1VIXA 1UTAA 4ED8A 1DQ9A 3NXZA 4M5IA 1KRPA 3RUBL 3T5KA 4HHUA 2DITA 3MTKA 3HVRA 1XERA 2BJEA 2BABA 3H59A 3M2RB 4KT0C 1FNXH 5KG3A 2HAIA 3D1QA 3KTQA 1H74A 2QL5B 3CJSA 4Q8FA 1NLKL 3ISND 4KGKA 2ZUAA 4TY8A 1PKUA 4F3MA 1XWLA 2J7WA 1NO8A 3HT3A 1RWKB 1F9HA 1Z4UA 3W9JA 1JIHA 2BOPA 3PO5A 1KHVA 1NXIA 1ZAWA 5I3UB 1S72S 2ATLA 2RRAA 1GMUA 1WORA 1M5OC 2HKEA 1B0VA 4DV5J 5DGAA 1YJNS 5EWFA 4M5DB 3IN5A 4LF4F 2DYAA 3QJLA 1EP4B 1VR6A 2IAJB 1TFYA 4ZHRB 4PWDB 4M94A 2CIMA 3W65A 2CPZA 4OJHA 1A9NB 2ZBCA 4B9LA 4FF1A 2Y9HA 2YQ0A 1OO0B 1SH2A 3HHLB 5HP1A 2GV1A 5GAGI 4JV5F 5LXRA 2IDEA 4MK8A 1DTTA 3TVZA 2HHHJ 1TELA 2VG6A 3OL6A 1DBDA 5J2PA 3KJVB 3HVAA 2CAJA 1W26A 3LP1B 2EFVA 1JNZB 3NRBA 3DCAA 1YJVA 4MJKA 3KHLA 4M5HA 2XM3A 2CWXA 1RADB 3GG1A 4TU9A 5JUMA 4O23A 4QZVB 3U7JA 4DFPA 3M8QA 2KVQE 3JTOA 1D9AA 1LXJA 2DIUA 2FY8A 2HHSA 1SI9A 2HQDA 2M7SA 1UETA 2Z2ZA 4DDFA 1MMDA 1Q7LB 5J1EB 2R2RA 3PW0A 4IG3A 1O0PA 5DRKA 3SQOP 4ETZA 3EUNA 5CYJA 3DM2A 1NZ8A 3E01A 3HLUA 3IWXA 4N7TA 1Q8KA 4OHXA 4KY3A 4F0KA 1BMQB 2YNGB 4AQYJ 3KLIB 4WP9A 3M8WA 2GJ2A 1RP5A 1OIAA 1HHTP 4CWBA 1JLGB 1VRTA 1YQHA 1FDDA 4K5RA 2B9YA 2EW9A 2W2OP 4P2FA 5IC6B 2VQFJ 2K3IA 1C4AA 3BZQA 2XGQA 2AF6A 1YBAA 2CQHA 4DL6A 4HI1A 4YN3B 3DGPB 1X4BA 5ETQA 3OR1A 1N54B 5EX0A 4JBCA 2LU2A 4V19X 3KDNA 3Q89A 3MGJA 2V2KA 2QGFB 4ZCIA 5KFNA 1X4EA 4MMOA 4OQJA 1S6OA
chains in the Genus database with same CATH topology
2BVZA 1FRJA 1Y7PA 1LW2A 2XI3A 3IG1A 4NLVA 1N0UA 3DRXA 2CJ9A 4PXCA 5A0YB 3T9NA 2CQPA 2OLWA 2CPJA 3GILA 5KFWA 1XNQF 2HHUA 4XDCA 1C1BB 1G2EA 3FRZA 2DCUB 3OJUA 3M8SA 2HHXA 4QBUA 5C42A 1X5TA 2YKOA 1NK9A 4DL2A 3CJ0A 2WSEC 1N88A 3RRHA 4DSLA 1IBKF 5I3QA 4C8LA 1U7LA 2KJVA 1F5BA 2PIIA 4ZPAA 3RZAA 1KHWA 2QSWA 3IGNA 1WI6A 3VF0B 3J7YI 1HI0P 4QQBA 1NEEA 3NAIA 1VK3A 2XS5A 4ZPWR 1S48A 5IQQA 4QPXA 3W2VB 2OPRA 1TP7A 1XMBA 3V81A 2PI4A 2ROEA 3VAHA 4ZP6A 3IRXA 1HD0A 2GHPA 1TKDA 2QSFA 5KG2A 1D9DA 1F5CA 3SDEA 1HBUA 3FQLA 2M4MA 2M88A 4O4GB 1JXEA 4A8WA 2ZE2A 1RT5A 3H2UB 1U1NA 2IJFA 2VA3A 3SV4A 1YJUA 2V8GA 3ENVA 3CCWA 3CJ5A 3UNGC 5MAOA 3KK1B 1RT3B 1L3VA 2FJWA 2W9CB 2ZVSA 4WYLA 3UW1A 3MMBB 4AE5A 4IH5A 5A8RB 2FHJD 2MQQA 1X9SA 3UE2A 2UUBF 4FF3A 3NBPA 3MAHA 4ECRA 2HYIB 2IA6A 4RWXA 2K1RB 2VKRA 4A8FA 3TNVA 1D8ZA 4HL9A 2K7JA 1U25A 2ZFHA 4C11A 3CCJS 1UL3A 2DRBA 4UUWA 1U24A 4BDPA 1RT4A 2DNOA 5G4DA 3V6DA 4XAKA 1T3OA 3VZIA 3DOLA 3CMAS 1FRXA 1VQYA 2PC6A 3HM9A 5DM6Q 3PW5A 2GO9A 1S9GB 2Z4PA 2VFUA 2KTQA 2VFTA 4KO0B 2OPSA 3WX4A 2ZZMA 3KOAA 4NX9A 3OXFA 1P8GA 4Y3CA 3MR5A 4NLPA 2P9CA 2VV5A 1B64A 4LF5F 3CDEA 3DLHA 3THTA 1OPZA 5F8GA 2D3ZA 5D3GA 2DHAA 2QIFA 1DJ0A 1LXNA 4N8NA 3MM9A 2LLZA 1F0XA 4ELTA 3CJ3A 4LUBA 2EKYA 4QIFA 5IT4A 3MOZA 4RNHA 1JNRB 2OIHA 4WFBQ 2RQKA 2ZC3A 4I2PA 4I67A 2UP1A 5HBMB 3BQ1A 2RSQA 4X2BA 4CT9A 4C9DA 1TL1B 4H4OB 1M5HA 2FJVA 2MGZB 2RQMA 1FO1A 2GO8A 2GW8A 2D41A 3CO9A 3QLHA 1UP1A 2UU9F 1FJ7A 3DOKB 1HNVA 2CYYA 5I42A 2DNRA 2W9AA 2I8EA 3GQCA 1FJGF 1U1OA 1TVRA 1Z2ZA 2CPEA 1Q86T 1VQSA 2WONA 1TKZB 3ULHA 3GV8B 1Q16B 1RTJA 3CT9A 3OTOF 4Y2MA 4RNMA 2V4JB 1X0PA 4YFUA 2E5LF 2VODA 2AJQA 1MU2A 4EBCA 4U9RA 2GQ2A 3VAJA 1FK9B 3LGNA 2CDQA 1GX5A 2GHVC 3SQGA 2OD4A 3VQSA 2XLIA 3CPWR 4IO9Q 3PO4A 4N76A 2P6SA 3C6UB 4I6AA 4X4SA 5H9EJ 3OSNA 2AYGA 2HMIB 4RW7B 4DLGA 2KYXA 4UQTA 2DH7A 1HBOB 4R5PA 4F50A 4WCEQ 3MD3A 1LW0A 3QZ8A 3MFHA 3HVWA 2WOMA 2BDPA 5KG7A 1VLYA 3IS9B 1HQUB 1QAXA 4OZ5A 4MKBA 4A8OA 2V8HA 3SCJE 4RNNA 4IRDA 1FDNA 3EX7B 1K8AT 2FJAB 3CWJA 3KG1A 5CZVA 2KT3A 5F8LA 2QA4S 3VAIA 2DGUA 1TK5A 3PDNA 2DO0A 4PG6A 5HQ8A 2XNRA 3WDOA 4WXOA 1U1QA 4ECWA 3V2UC 2ZH3A 5KFMA 4NYOA 1S99A 3VAGA 3I4PA 1MWZA 3I9V9 4DSJA 3PEHA 4K5SA 1YJ9S 1ZZNA 1VBYA 5KFUA 3I0RB 2DGOA 2EFQA 3BN4A 4RU2A 5CZXA 1UKUA 1RT7B 1O51A 1RT6A 5LMUF 4DL4A 2I5JB 1VQOS 1T7PA 1Y5NB 1ELOA 2QLXA 5E7OB 3BDPA 4M1KA 2JVRA 2NQPA 1NH8A 3OXGA 3EZUA 4ES2A 3HDSA 4DG1A 3D1HA 3BSOA 2OFGX 5G0RB 2FIUA 3MM5B 1SL2A 4CO4A 1N8RT 2J7KA 1LFPA 4Y2KA 5D8HB 2XWXA 2L3MA 3LP0A 1J2VA 3AB4B 3KLEB 2RKIB 3ZZPA 1JLFA 1LFWA 3EPIA 3H98A 1SL0A 1ZOTA 2R8GA 4O3NA 3PM9A 5FDLB 5EHHA 1BQNA 3N01A 2GMHA 3BGRB 4RW8A 4X4VA 3DRYA 4I64A 2AYMA 5AE2A 4D3GA 4RUCA 1ZTWA 4OMFG 4URSA 3DXBA 4NLUA 4B3MF 2RRNA 5HN0A 3Q8SB 4EZ6A 3DYAB 3T6JA 1Z2LA 2QE5A 2EVZA 2E1RA 2XY6A 2IRUA 5F8NA 4OI3A 1S1VA 5E3QA 2J9CA 3BO4A 4IO1A 4IG0B 4PG8A 3HP6A 1X9MA 3TUZC 3AA8A 3PR4A 2VG5B 3LAKA 3HO1A 1TAQA 4CH7A 1RT2B 2A10A 5IFMA 2Q43A 2ASLA 1IBLF 3M2UB 4YOEA 4DLEA 2B0GA 2OPQA 3AB2B 3CSKA 1U1PA 1IUJA 4DQSA 5LMNF 2EFPA 3GZ7A 1X5PA 2F3JA 1SJQA 2FHOB 2W4DA 4G1IA 3MR2A 4NPOA 3MPVA 2JVOA 4ES1A 1GXUA 4QIVA 4DL7A 2HNYB 2XSJA 1VJWA 3ZZYA 4MK7A 4PQUB 1XTZA 3QO9B 3O3LA 2GNKA 3H5YA 2HGMA 3T1HF 3BR8A 5J2NA 1WTBA 1R31A 3ZZZA 5LSOA 4B3SF 2V4QA 2I0XA 4USHA 3KLFA 2QA4G 2VUGA 4ZVEA 1XN9A 3DI6B 2KI2A 1Q1KA 2I9SA 3V6HA 5KT5A 1JLQA 1EETA 2E5IA 1DZ5A 4H4KA 4YR3A 5CA5A 3B4MA 1T03B 4RW9B 2DVIA 1UWBB 5A6PA 3WZ0A 1U1LA 4ZOSA 3C6TA 4DR3F 3H2VE 3RW7A 5KFPA 2OO4A 1VQKS 1HBMA 2YWGA 3ISNC 4C0OC 4B9MA 1HYSA 1BQXA 3P6YC 3NGDA 3M1VA 3I5BA 2ERRA 2X1AA 2A3JA 4QIEA 5KFHA 3HHLC 3HVTA 4NZ7A 2RDIA 3DLJA 4B9UA 4ED0A 3N5FA 3CMES 4WFXA 2DNLA 3ITHB 4CTAB 1TKTB 3SSSA 2ACYA 3D0GE 4XDDA 2CPFA 4DEZA 4A8MP 4U67Q 1JJ2R 2UXDF 2YY3A 3T1AA 1T3NA 4W90B 4JI5F 4UOCA 5T41A 3S6EA 4DS4A 2FLOA 1XC9A 5E3AA 1NJXA 2UUAF 3QAUA 4E98A 5DQGA 1S1TA 4Q0BA 1VI7A 4B17A 2ZZNA 2ABYA 2W4PA 4JI0F 2RRBA 1VQNS 5THWA 4ED5A 1HARA 3TO8A 3CCES 1FD2A 3NS5A 2KG0A 5K8PA 1H38A 3RRKA 2O1PA 3MURP 3DMJA 4KIAA 3S7RA 1NH7A 2XO7A 1VBZA 3K2YA 1FDAA 1FKPA 1FD8A 3QZ7A 2V0NA 4HVZA 3IR7B 4AL5A 1H6KX 1NK8A 3TA0A 1KQFB 5CD4H 1DHMA 4JI3F 4WE1B 2CJKA 2JJ4D 2LEPA 1GTHA 2YNIA 1VIOA 3HKZD 4L3NA 4K4XA 2UV8G 2XS7A 2PMHA 1JLCA 1R0AA 1NRKA 2K7KA 3H40A 1BQMA 1ZAXA 4IH7A 4MKYA 2MZRA 3CF5Q 2VH7A 3G4SS 5IT0A 3BGLA 3SFUA 3MUTP 4PQAA 1K1QA 3RRGA 3SCLE 4NCGB 3V6KA 1QAYA 3MEEB 4PUOB 4A4JA 2C3OA 1D3WA 1FJEB 4ZHRA 4PWDA 5KFZA 1M5PC 3NWGA 5CYMB 3GV7B 1WG1A 1MROA 2J0WA 2YNFA 3N6MA 1PC4A 4CO0A 2F9JA 2QT7A 2AJFE 3DU6A 4LIRA 2WBMA 5H1SV 1HWKA 4O3PA 5L1LA 2W7OA 2YH1A 5KFVA 4DV6F 3QGHA 2XMWA 4RKUC 4DL0C 3CC7S 1K73T 3SCKE 1FCAA 4DV3F 2WAQD 3M9NB 3ISZA 2HS4A 3LP1A 2MKIA 1VOMA 4K0KF 1X4DA 2YNHA 4DL5A 3GSDA 3HHEA 3LANA 2FJEB 2RILA 3UFCX