4FXWA

Structure of phosphorylated sf1 complex with u2af65-uhm domain
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
105
structure length
105
Chain Sequence
PLGSTEVLCLMNMVLPEELLDDEEYEEIVEDVRDECSKYGLVKSIEIPRPVDGVEVPGCGKIFVEFTSVFDCQKAMQGLTGRKFANRVVVTKYCDPDSYHRRDFW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Splicing factor U2AF 65 kDa subunit
publication title Structure of Phosphorylated SF1 Bound to U2AF(65) in an Essential Splicing Factor Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 29
structure length 105
sequence length 105
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4fxwA00
2YTCA 1X4FA 2CQ1A 4WF9Q 1WG4A 1YWXA 2KG1A 1QVGR 2CQ4A 2MQMA 2RQ4A 1YHQS 3CMES 2AYBA 2DNYA 2RT3A 5LJ5Y 4CH1A 1Q82T 2DNMA 2LXIA 2DNHA 2G4BA 3UCUP 5HO4A 1X4AA 4OZ1A 2KRRA 4A8XA 1U2FA 4Y0FA 2DO4A 1JJ2R 2EK1A 4FXWA 3RW6A 2DNOA 5GVQA 2GHPA 1HD1A 5D78A 4TU8A 2FHOB 1QM9A 4QPTA 2XNRA 2JX2A 2LMIA 2FC8A 2KM8B 3H2VE 2M7SA 1DHMA 1M1KT 1HA1A 5IQQA 2KU7A 2RS8A 4YOEA 3BEGB 1YJ9S 3PIPQ 4W92B 2RVJA 2DGUA 5DDQC 1U1PA 4YB1P 2CQBA 1G2EA 3S01A 2KFYA 1YTYA 1S79A 2PE8A 2J76E 2J8AA 3CCLS 2MZRA 2M2BA 2JWNA 1RK8A 2MHNA 2MGZA 1VC6A 2FC9A 2K8GA 2HGNA 2K3KA 3ULHA 2QA4S 5DM6Q 3S6EA 1X4HA 4U67Q 3CCSS 2RQCA 2DHXA 1KOOA 1Q7YT 5GAGU 1VQPS 1M5OC 2EVZA 2SXLA 2KM8C 3EGNA 2CQ3A 2MKHA 2FPHX 3B4MA 4FXVA 2L9WA 1VBYA 2L08A 1VQ8S 2YH0A 3VAHA 4LIRA 3NS5A 2MY7A 1H2UX 2MKSA 2OIHA 3SDEA 1X5TA 2BOPA 2MB0B 2X1GA 1DBDA 3R27A 2MSTA 1WEXA 1BY9A 2CQIA 1U6FA 2MZTA 2MZ1A 3K0JA 2CPXA 1WF2A 2HVZA 2M88A 4WKRA 3NNHA 1XN9A 2DGXA 1JJHA 2RS2A 3DXBA 5GMKa 3MI7X 3U1LA 1K8AT 1HL6A 3S8SA 2LXUA 1ZH5A 1KD1T 2AYMA 3U1MA 2OSRA 4Z2XA 1SXLA 1VBZA 2OTJS 3CCUS 1VC0A 3MUTP 4F25A 3CUNA 2CPIA 5CYJA 1DRZA 2B0GA 3LPYA 2DH9A 3CULA 1KC8T 2F9DA 3THPA 2MKJA 2MYFA 3UD3P 4J5OA 3Q2TC 2DNZA 1WHWA 1QVFR 3CCRS 1WG1A 5GAHU 3CF5Q 1UP1A 1M5VC 1SJ4P 3CPWR 2LECA 4WFAQ 2X1BA 1M90T 3JB9k 4QU7A 3PIOQ 4PRFA 3P5TL 3OW2R 2D3OR 1U1QA 2M8DB 2MMYA 2U2FA 4CH0S 4RU2A 2AD9A 2DHAA 1FXLA 2PEHA 1N52B 1FJEB 2NZ4A 4UY8T 2MQOA 2CPYA 1O0PA 3UE2A 3MXHP 1ZZNA 5DDOC 2XS2A 1DZ5A 1UAWA 3NMRA 2LCWA 1H2VZ 1YI2S 2HGMA 3NS6A 1L3KA 1RKJA 2KI2A 4CIOA 2EK6A 2KXNB 1X5PA 3CD6S 2L41A 2XS7A 3FEYB 1F9FA 2RU3A 3ZZYA 2X1AA 5LSOA 2G1DA 1WG5A 3G8TA 1W2BR 1VQ6S 2E5IA 2HZCA 1Q86T 1FHTA 3SMZA 2LA4A 3J7YU 2E5GA 3CC7S 2E5HA 4TU9A 2DNGA 1OWXA 3HHNB 2KYXA 1PGZA 1AUDA 3Q2SC 1X4DA 2M70A 1U1OA 4PKDB 2MPUA 2DGVA 2NLWA 2KXFA 2KG0A 2MQNA 5BJRA 3G71S 1JJ4A 4ED5A 5HL7Q 2I38A 2DHSA 4LJMA 5LXRA 1WI8A 2XB2D 3MOJB 2MXYA 1YIJS 2OTLS 2M0GB 2ADCA 2AYEA 1OIAA 1WF1A 1X4BA 3LQVA 3H2UB 4WFBQ 2HYIB 2XNQA 2MKKA 1WELA 2MY8A 3P6YC 3J7ZT 5IFMA 1M5PC 2VOOA 3CCES 2DNQA 3G6ES 1K9MT 1VQLS 2MQPA 1WTBA 3V4MA 5DETA 3MURP 3N9UC 4IO9Q 2N3OA 1FJCA 2X1FA 3CXCR 5DDPC 3UCGA 3VAJA 3D2WA 2E5JA 2CQCA 2DGQA 4P6QA 1KQSR 5IM0B 3VAMA 2DK2A 4Y00A 3VAIA 3CMAS 2DH7A 3MUVP 1UFWA 3CTRA 2D9PA 1X5OA 1FT8A 2J0SD 2CJKA 5GAEU 2YKAA 3TYTA 3L3CA 2DNRA 1Q81T 3IRWP 2RNEA 1ZZFA 5LJ3Y 2DGOA 2KT5A 3R1HA 3CC4S 5DM7Q 4YUDA 5FJ4A 4W90B 2VOPA 1A7GE 2DITA 3DLLQ 1WI6A 2M4MA 3MD3A 4UQTA 3VAKA 1YJWS 1IQTA 4OZ0A 4C0OC 3VALA 2WBRA 3VAFA 2ERRA 1D9AA 1X4GA 2YWKA 2ZJRQ 1U1NA 3G9CA 2M52A 1U1LA 2DB1A 1VQ7S 4PR6A 1PO6A 2QEXS 3P49B 4IUFA 1FNXH 3VAGA 2CQ2A 2YH1A 1N88A 2DNLA 2FY1A 1URNA 1VQ5S 1SJFA 1VQOS 1OO0B 5JVGQ 4BS2A 5LSLA 2DHGA 2UP1A 3CCQS 1NU4A 3VF0B 1WEYA 1VQ4S 2Q79A 2E44A 3G96A 5JVHQ 3B4DA 1VQKS 1WWHA 2J0QD 4IOAQ 2DGWA 1VC5A 2DH8A 3US5A 1U1KA 1FO1A 3EGZA 1P27B 1WEZA 2HGLA 3TO8A 2O3DA 4CQ1A 2VODA 3MUMP 2DNNA 3BO4A 1X4CA 1NJIT 1X5SA 1VQ9S 2U1AA 4TLQA 2MGZB 2XSFA 2CQHA 1U6BA 3CCVS 4ERDA 3ZZZA 2RUGA 2VONA 3I55S 2KVIA 4WCEQ 1R8PA 2V94A 2ADBA 5LXYA 2KH9A 2A3JA 1M5KC 3UD4P 2KN4A 2MSSA 2MZQA 1A9NB 2JVOA 2RRAA 1OPIA 2ZJQQ 5H1SV 2MKCA 3IWNC 3FEXB 3CCMS 2LA6A 4WIIA 4LMZA 2CQGA 1SJQA 2LKZA 2DO0A 2D9OA 2BZ2A 2M9KA 2DGSA 1KOHA 4EGLA 3RW7A 3I56S 2DIUA 1N54B 1U1MA 2LQ5A 5DDRC 1SJRA 2CPHA 2MZJA 1WF0A 2LEBA 2F3JA 4QQBA 1U1RA 2CPFA 2LEAA 2CQPA 2MQLA 1S72S 1VQMS 1JMTA 2MJUA 3SDEB 5CXTA 3UWTA 1WHYA 4F02A 2CPDA 3G4SS 4IOCQ 2MJNA 1VQNS 2QFJA 2MQQA 3EX7B 4C7QA 1K73T 2XS5A 2AYGA 2DISA 5CA5A 2F9JA 1UW4A 4QU6A 4C4WA 2N7CA 3BO2A 1WHXA 3BO3A 2I2YA 3MD1A 2M8HA 3TP2A 1P1TA 1H2TZ 1YJNS 4M5DB 2DNPA 5D77A 4WFNQ 5ITHA 3G8SA 1WHVA 3THTA 2CPZA 2DIVA 1YITS 2RRBA 3MDFA 2G0CA 3UCZP 1D8ZA 4V19X 3NNCA 2JRSA 5IM0A 5GADU 3R1LA 3HI9A 3SXLA 2N3LA 4TU7A 1X0FA 3CCJS 1SJ3P 2MZSA 2LYVA 2MKIA 2OJ3A 3NNAA 2DGTA 1NO8A 2CQDA 5MLCV 3P3DA 2KRBA 2CQ0A 1X4EA 1N8RT 1VBXA 1CVJA 4F26A 2JVRA 2DNKA 2CPJA 2ZJPQ 2GO9A 1FJ7A 1HD0A 5EN1A 1R8HA 2KXHA 2OSQA 2KHCA 4ZKAA 2CPEA 2N82B 3CC2S 3BS9A 1H6KX 3S7RA 1B7FA
chains in the Genus database with same CATH superfamily
3OBIA 1WG4A 1YZ6A 2UXDF 1Y10A 4DPUA 1YHQS 2W9CB 4NYOA 4C2MA 2Z2MA 2X7IA 3OVBA 3PEJA 3TJ8A 4NCGB 3WIVA 1KWMA 4QYZJ 4WE1A 1LKZA 5D8HB 2YQ0A 2OPSA 2EK1A 3E01B 3ENQA 1QAYA 1NJXA 3HFZB 2J8SA 2FHOB 1QM9A 2WZ1A 1ZPWX 3GFHA 2XM3A 4X65F 3KUHA 3H2LA 4KO0A 1TAUA 1BE4A 3FBBA 3DDIA 3CO9A 3MPYA 4K2JA 2YKMB 1NPRA 1RT4A 5K5MA 3TVYA 3TQ1A 1HR0J 4U6PA 3MFHA 4KGKA 4FPIA 2YWEA 3Q8VA 1IKYA 3A3PB 2Q43A 1X4HA 1I94J 2RQCA 2HHVA 5GAGU 2ZBIA 4WXOA 4KT0C 2SXLA 4OX7A 1S6UA 2RH3A 4OL8A 2H9ZA 4Z7YA 3FEZA 4B3MF 4IRDA 5AJ3F 1I6JA 1S1XA 1DBDA 2B3TB 4DV0J 1FXDA 3GR1A 4KC5A 1E6YB 4MK8A 3AJ1A 3PRDA 4DG1A 4AQYJ 1X8DA 4NEZA 2AYMA 2Y0BB 1VBZA 3SBMA 4B9MA 1Y9OA 3IP0A 4LBPA 5DLGA 3GCXP 2O67A 1RT7B 2BJ8A 4R5PB 5GMEA 2QZ8A 1WG1A 2EC0A 2XGPA 3KHHA 3W2VA 2DEJA 1RQ0A 3HSJA 4ZPDA 3RR8A 4ICLB 2XY5A 1XK8A 2MQOA 2EFNA 4FF4A 4KFBB 1HNIB 3EICA 5T7LB 1TL3B 1TMJA 1N0UA 5F9NA 2MTLA 4UOFA 1U0SA 3PZPA 2XO7A 5KFFA 1IKWB 3GSIA 5D0RA 4ELVA 3BR8A 1RCOB 1V9OA 1HBOB 4PQUA 1AUDA 4UW2A 4DL2A 4ZJQA 4ECQA 1UJ4A 4NZ0A 2XI3A 3AFGA 3FFIA 5KFSA 3UDVA 2CZ9A 1WI8A 2AEMA 4TVAB 1V5VA 4U7CA 1NPKA 2ADCA 1SUQA 3PTWA 4PXEA 3AQPA 1M5PC 2BE2A 3QRPA 1S0NA 4P71A 2IRYA 3MR2A 2DGQA 1KQSR 2HWIA 1DQAA 3HZEA 4HHJA 4ZVQB 2FB0A 3C3LA 3I82A 1JLQA 2YKAA 1CQMA 1LFPA 3M2VB 4JI5J 1YDLA 3R1HA 2FTRA 4PPZA 1O8BA 1T7PA 4HHUA 3THVA 3QT5A 2KB2A 2E29A 4G1QB 4AXJA 5LOQA 1U1LA 1IWAA 2DB1A 4ZIVA 4EBCA 2UV8A 5KFUA 4AD6A 2YH1A 2B7CB 4Y2IA 3GMGA 1S6OA 2VV5A 2BYCA 1R27B 2X3DA 2K1RA 5DJBA 3D9BA 1F6TA 4ZN1A 1IBCB 3B4DA 1SVDA 2GW8A 1WWHA 3MAHA 5HMWA 1IM6A 4I67A 1KVJA 2ZH2A 1OY9A 5EGYA 4ECXA 1FA0A 2CG4A 3MUMP 2QYCA 1X4CA 1DJ0A 3MM5B 3CCVS 3T5KA 3RR7A 1VGYA 8AT1B 3HLUA 2PSZA 2CNLB 4UOCA 5LXYA 2J6SA 3JXOA 4HDHA 2H4WB 1OPIA 1EIYB 4WIIA 2FY8A 3I56S 5F0UA 1T11A 1U1MA 1N54B 1R31A 3FBFA 3LP2B 3LANA 1GFWB 1MLAA 5ETSA 2BDPA 3EM1A 2IMWP 4UY85 4P10A 3VTIA 1UWAA 2KO1A 3DC2A 3Q83A 2LDYA 2PA8D 4MIBA 3D68A 3G6YA 3G8SA 3THTA 3JSBA 1H38A 1SJ3P 1T03B 4RR5A 1T9XA 3L95X 4WTYA 1HD0A 2GS8A 4MAKA 2HQGA 2KHCA 4ZKAA 4HDGA 2IC3B 3OD2A 4QR0A 2UUTA 1B7FA 3MMBA 3KMQA 4DPOA 4YB7A 2AJ2A 4WZQA 1FERA 1HNZF 4UZCA 2HNZB 2DY9A 3K5OA 4OZ3A 1F3FA 4O0NA 2VFTA 3WX8A 2GIQA 1Y3KA 1C0UA 3C6UA 4IFVA 4QCLA 2RAQA 3IGVA 3SCIE 1LNQA 4FVCA 4DR1F 3OJSA 1ZM9A 4QWDA 5HK4A 4AXIA 3ZZPA 1LFWA 3R5JB 2FC9A 2K8GA 1B99A 2H1YA 4D3HA 3V4IB 3C6TB 4DR5J 1J2VA 3CSKA 3R6GB 5CABA 4X4QA 4RPFA 4ED2A 4NLYA 4DL0C 3F41A 2H54B 4KH0B 2VKRA 2V67A 1LV5A 4ER8A 3WHIA 2KFNA 3J7A1 2V4JB 3DDKA 2HQCA 4P2XA 2OPRB 4WKRA 1RT3B 3MM6B 4QIVA 3MMCB 1HLWA 1K1QA 4A46A 1MMNA 3NMAA 4NLPA 4CWBA 3A3OB 3CUNA 3R5CA 4ZVGA 3VZHA 1XMOJ 4B3SF 1TMMA 2VJUA 1QVFR 1M90T 3KLIB 4JYAJ 3A8KA 5HP1B 3HT0A 4EYHB 1O5JA 5KOWA 1UVIA 2AZ1A 3TUIC 3ZZ0A 4MIAA 1S1TA 3M6UA 4ZIWA 2VG5B 1YBUA 2WVCA 4ZVRB 5KT3A 4WIQA 1X60A 4F4ZA 1D3WA 1G4CA 1S49A 2BKNA 2C2KB 2MLZA 4EUVA 5LMUF 3H90A 4LRAA 4EBDA 4ZPWR 2KYXA 2XQCA 2R9LA 5HL7Q 3O2IA 1U0HB 1RT5A 2J0WA 3G6XA 1TKZA 5HAOA 4I2PB 3OVSA 4F0KA 1WF1A 1X4BA 3M2UB 5KFZA 4TN2A 5KT7A 2H3EB 3N4WA 4RW8B 2VQFJ 3W61A 4LSLA 2N3OA 4M5KA 3IS9A 4LF8F 3D54A 2JLGA 2E7XA 3PFOA 1AROP 5IT4A 2BX6A 5IC6B 3OV7A 3DLJA 2HHXA 1BQNA 4KR0B 1U6ZA 1ZZFA 5KG6A 4LUBA 5DM7Q 4KTQA 2V69A 2MKYA 3VAKA 3RU0A 2HVHA 4HEA9 2YY3A 3TJ9A 3DM2B 2EG1A 4TQRA 4X66F 2R2SA 1RTHB 4USKA 1HBMB 1FNXH 2Q6BA 3HVWA 1VQOS 9RUBA 3E3XA 5JVGQ 3C15A 1SV5A 3OHBA 2UP1A 1RWWB 4X65J 2HMIB 1F0XA 1J27A 2VG7A 1IQZA 4OI4A 5KFQA 3G87A 1P9YA 4USVA 4F2RA 3TO8A 2O3DA 5D4OA 2EWHA 4KKOB 3DRRB 1CJKB 2JJ4D 4CT9A 1KHVA 3QRRA 4H54A 3QWUA 3I0SB 2EPIA 2W8KA 2BE9B 2KN4A 2XI2A 4DR4F 1HQUB 4LSNB 3IWNC 2VICA 1N36J 3EZOA 2QLFB 1VRUB 4TYAA 2DO0A 2QA4G 4Y28C 2BZ2A 3C2PA 4EK2A 5AJ3J 4J9PA 5A8WA 4K4TA 1U1RA 2LEAA 1U2CA 1JMTA 2PD1A 5CXTA 2E7VA 2PFFB 2MJNA 2WSFC 1E6VB 3MD1A 3L7OA 4M5DB 4YDDB 3DGPB 4UQGA 1MN7A 3ITHA 2DPIA 1UW9A 2RRNA 3HI9A 1O51A 2LYVA 4ZITA 1SBRA 1ZM3A 1WC1A 4JI7F 4F26A 3GFYA 3TAMB 1RKIA 5B0AA 2BV3A 3KXDA 5FLXY 1T3NA 1LK7A 3OR1B 1TKDA 1YWXA 3TAPA 3MEKA 5T14A 3PYFA 2YNHB 1XJWB 2RUSA 1CJTA 2G4BA 5D4PA 2C3OA 4YN3B 3LOUA 2WVEA 3OTEA 3M8QA 6FDRA 3MMJA 3HF5A 4B02A 1FKPA 5J2NA 2DR9A 4K4UA 3NGKA 1YJ9S 4W92B 3FKBA 2DGUA 3DYAA 1S79A 1TAQA 2G2ZA 3BPSP 2B9WA 2FVSA 1P6TA 3C16A 2LU2A 3K2YA 2GCFA 4CLPA 2VASA 3S6EA 3BGLA 3D7SB 2VA2A 3P4UB 1RWOB 3CJRA 2Y1LB 1H73A 1RADB 3GG1A 2OFHX 2ZH5A 1S1UA 1RHRB 1X5TA 2I5JB 3R27A 4OZNA 3N0VA 3HCXA 3TZWA 2KL8A 1NHVA 4WFXA 1AZSB 4DV3F 3EGWB 4IDKB 4DR6F 1UA1A 1Q5YA 2ZITA 2LXUA 3TAQA 4EZ6A 1CC8A 4Z2XA 4EI2A 1RBOB 4ZPTR 3PW5A 2F9DA 2JFDA 3MR3A 1D9DA 4LBIA 4URSA 1UP1A 4RZRA 2FZKB 3QO9B 2M5YA 2B43A 1N52B 3C66A 1O0PA 3L7UA 4U7UD 3MXHP 5I42B 2YBVA 4Y65A 1B3TA 2ZUAA 2DCLA 1RYRA 3CDAA 2L41A 4X4RA 1T9VA 1MWQA 1RXOB 3P5BP 2DRAA 4DV5F 4I7FB 5CYMA 2W24A 3WBZA 1IKXB 5KG3A 3BYPA 3BH7B 1XNQF 3PR4A 1SC6A 3BZQA 5HJXA 2XNQA 4KBIA 1WELA 2DR6A 3P6YC 5KT2A 1LWFA 1S1XB 2QT7A 2HLUA 2MQPA 5DETA 3NL0A 5C5JA 1Z2LA 3DLBA 4I4BA 2HIYA 5EWGA 3W8PA 2VF3A 3JSMB 4IH6A 2Q3PA 5DQGA 3WQPA 2EFGA 2HWTA 3L09A 2DNRA 1Q81T 2OELA 1UETA 1VRTB 5C24B 1RU1A 3MM8B 4CLYA 1HNZJ 1NSAA 3B78A 1RWXB 5HLFA 4JI3J 2GHWA 4ZVSB 4KV8A 2JDJA 3VALA 3QGGA 3W2VB 5IS2A 4LR7A 1HFEL 2GGPB 4ZPBA 5E3QA 5J2PA 5ADZA 4AL6A 3FDSA 4QBUA 2V2ZA 2HNDA 1OO0B 3PW2A 4PCQA 5HMXA 4C6AA 5F8GA 5ETTA 4DR1J 1CS4A 1GH8A 4BC7A 1XC9A 4Q7AA 2WVDA 2PFDA 4C3KA 1YVFA 4ZCMA 4CQ1A 2IRUA 1R89A 2OGUA 2YX7A 3I6PA 3IO1A 1FDNA 4GC6A 2U1AA 2ABYA 4C11A 1U6BA 2OPQB 3ZZZA 3EXYA 3TZXA 4OJ1A 2KVIA 3CJ3A 3NWGA 3QT6A 1BGXT 2Z58B 5KFAA 5AXMA 5DRKA 1Q7LB 3T1YF 4WK3A 1SJQA 4KGMA 3MM7B 3PY8A 1PYTA 1IBKF 2WB1D 3HKWA 1F2HA 4A8WA 1NK9A 4IG0A 4G3IA 1TUGB 5I3PA 4PG4A 5DZ6A 2VFSA 1FVSA 5EWEA 4C4WA 1W26A 2P6TA 1S77D 1EETA 3BBBA 4F50A 1XR5A 5H9EJ 1T02A 5C2CA 3NRBA 2CKWA 2MZSA 4DFJA 2CQDA 3P3DA 3TARA 3FRYA 2W1BA 4K5SA 4DL6A 1FJ7A 1NDLA 2I8EA 3BB5A 4ZN3A 1DTQB 5IQ6A 3BS9A 2YXLA 4NLTA 3CD5A 3DLEB 3ZNJ1 1XNRJ 5B0CA 2G2OA 3KNAA 2LQBA 4KHMA 3M8PA 4A8XA 4Y2MA 4B3RF 3MF5A 4GKJF 2OLWA 3PRVA 3PYEA 2XYHB 4Y3CA 5LMUJ 3HKZD 3DLKA 2RDJA 4IQXA 1U1PA 3K5PA 4Q2MA 2HHSA 1YJVA 4P2SA 1MMDA 3ETMA 4HTJA 1OYDA 1QD1A 2QA4S 4USJC 2E9RX 4W98A 2OEJA 3ZC4A 4LF5F 1Z2ZA 1VQPS 3M6VA 3BGRB 2KM8C 1LW0B 3CJ4A 3JSYA 3DOKA 1VQ8S 4JB8B 1JLAB 4LF8J 1FRKA 2JEFA 2JNJA 4PXBA 1XR6A 2EFOA 2CQIA 2E1PA 4MFBB 3MTKA 2UUBJ 2B4VA 8ATCB 3BSOA 5J2MB 2DGXA 2QLXA 3GU0A 2DY1A 3OSNA 3KJVB 3AB4B 3IWLA 4F25A 1XWLA 2YX4A 5C2GA 2AJFE 3LPYA 3NBPB 1KC8T 4X66J 4A8KA 2YNGB 3MPVA 1NKEA 4WFAQ 3BJYA 1NJWA 4CH0S 1TK5A 4F0HA 1YJUA 4G1PA 1ZZNA 2BM1A 1KSPA 2HQ3A 2GFFA 2EK6A 3I5AA 2KXNB 4QW8A 1X5PA 2PT0A 4M5GA 2DJWA 1J5OA 4PG7A 1S6PB 3J7YU 2A0FB 3R8YA 5LM7E 1IVZA 2H48B 2AW0A 3TANA 1TL1A 2HHUA 2FJBB 1C0TA 2BJDA 2KXFA 3DRYA 3T1AA 3AD7C 3GV5B 1G6BA 3T1HF 1GQEA 3LQVA 2BOAA 3W60A 2FGOA 2MKKA 1ZAVA 3CW2C 5F0WA 1U09A 3R7NB 4IO9Q 3AAWB 4MMOA 3UCGA 2YNIA 1GXTA 3AODA 3TVZA 2R8KA 2DK2A 4X4TA 3RG6A 3CMAS 4M5MA 3E2EA 3R6LB 2HFUA 1VCTA 1JX4A 3ILJA 3O44A 2HNYA 1TKXA 3A8JA 1UVLA 2CXEA 4OV1A 4OLPA 3MPUB 3OXFA 1VRQC 4L75A 3B82A 1KKHA 1DLOB 1Q8IA 1NZ8A 1GAOA 2GVDB 1NJYA 2QV6A 1S5ZA 2ZZNA 1MROA 3VAGA 2ILYA 1CJUB 4EYIB 3OSPA 4IO1A 1MG7A 2XBPA 3KJQB 5D3GA 2O66A 1VQ4S 3HHLA 1VQYA 3AXMA 3EGZA 3SQGA 1GK8A 3VVUA 4OYXA 1W2IA 1H74A 3I55S 4ES3A 4M1KA 2ADBA 3SI8A 4ETXA 1WSRA 5A8KB 3HVRA 4F2SA 4K0KJ 3ZTPA 4OI0A 2DR5A 4NMLA 2RRAA 2V50A 1TVRA 1RI7A 4Y2CA 4PABA 1SKWA 2NPFA 4N77A 3TR5A 5C42B 1S72S 2POKA 1IM4A 2XZDB 2CPDA 2OHDA 2BACA 3POTB 2ZD1A 3PKYA 2QFJA 3FMWA 4NMXA 2DXFA 4FYYB 1N5YB 3KLFA 3TP2A 2G2YA 4DR6J 5DGBA 1HW9A 2DIVA 4WXWA 2PMHA 2RRBA 5A8RA 3AJ2A 3PACA 5IM0A 2KJWA 2X3GA 1RLDA 3TEHB 4BWMA 4F4KA 2I6WA 1RTJB 1VLOA 3N79A 2HURA 3KG0A 3MAAB 1VHFA 4YFUA 1X4FA 4WF9Q 2ZFHA 1MWZA 2ZC4A 3JAMY 4OYOA 2R7VA 3QIPB 3D6MB 3RYLA 5LT5A 5HO4A 2RB7A 2VPXB 3J7Z5 3CIZA 5DG8A 2WW4A 1NHKL 1TV6B 4P52A 2PEBA 4CI0B 5IQQA 4YOEA 1FDBA 2RVJA 2KTQA 2W4PA 3NCPA 4NCBA 2HHQA 1S9GB 3EWGA 3QSIA 1HWUA 4DQQA 3CWJA 3U02A 3J7YI 2RHSB 3N5FA 4CO3A 3ULHA 1XNQJ 4ECYA 4X4PA 4OZ5A 4LSZB 3K58A 3FBEA 3FVYA 2K7JA 4OI1A 1PJ6A 4FZVA 1TK0A 3BBCA 2JOQA 1NK6A 3VAHA 2C3UA 3QBCA 1N0VC 2CNNB 3SDEA 3GYNA 4NLVA 4LQ3A 2YQ3A 1C4AA 5I3UA 3QLHB 3HVAA 4O3QA 1JJHA 4OV6A 2M3DA 4K4VA 1EZZB 2VA3A 1ZH5A 2J6TA 5KOXA 2C2OB 2DH9A 3DXSX 2BW7A 5DQIA 3HFKA 2W4CA 3FZBA 2W7PA 4OYIA 4A8QA 3G86A 4CT8A 1WSVA 1SH2A 4P7TA 2GMJA 1RAFB 1BC6A 5BR8F 2W9CA 4JOUA 4ZDNA 3A12A 3BF4A 4J9OA 3NMRA 2LCWA 4NCGA 1F1BB 5F3TA 1RKJA 2GAHC 4EMDA 2K7KA 1VLYA 1FRLA 3E01A 3IAS9 5K14B 2IDLA 4ZP6A 5L46A 2ACMA 2E5IA 4O3NA 2JEGA 2V68A 3UO0A 4TU9A 2BBEA 2R2TA 3U27A 1A0OB 3T1YJ 1N33J 2YKMA 2ZH8A 1S10A 3OR2B 5BJRA 3CDEA 4ED5A 2I38A 3T9ZA 4FF3A 2VDHA 3C14B 2RKIB 2HBZB 4USTA 2AEFA 2JZ5A 2Z30B 3ZTQA 3M1VB 1K9MT 4F3OA 1FJCA 3CVKA 4K4ZA 2KZZA 3FSYA 4OI3A 1QJHA 4DR7F 4C8YA 2DPJA 2ZOGA 1E6YA 4N47A 4C8NA 1FT8A 1XMBA 4AL5A 1FEEA 3J81Y 3BQ2A 3H8YA 3HHKA 1B7YB 4N5SA 2B5JB 5K20B 2VOPA 2ZH3A 1GNKA 1RT7A 4C3MA 2XO6A 3VAFA 4R5PA 1LEOA 2ZJRQ 4DX7A 4B3RJ 2E1RA 1UL3A 4GKJJ 3UVJB 3MCOA 3OVAA 2HS0A 3ELHA 3PYGA 2D74B 2DR7A 3UFCX 3MEGB 1WJ9A 3R7SB 3GZ7A 2UXBF 2P9EA 4KFBA 4L76A 1HNIA 4MKBA 1VC5A 4JI0J 2W7AA 1P27B 1WEZA 4USWA 5T7LA 1FRHA 4NXMF 2HGLA 2IIHA 3GCWP 1Q8LA 3UN3A 3Q0AA 1VQSA 5B0EA 1IKWA 1TQLA 4PPDA 2AGOA 2V94A 4LF5J 2V63A 2CA9A 3UD4P 1HBOA 4PYDA 2ZJQQ 2AMCB 4A8OA 3FEXB 3CCMS 1QAJA 2G0IA 1ZTWA 4F4WA 3W9IA 3FC9A 2CZVC 4AFFA 4OIXA 2VB6A 1LQ9A 3EX7B 1F9EB 1UW4A 2RJZA 2J9DA 2M8HA 3EJMA 3BKFA 5K8PA 1RJJA 2ASDA 1N34F 3E51A 1LWEB 2E1MC 3OL9A 4TU7A 2OI2A 2HSEB 4DF4A 1V5IB 4YQWA 1WKKA 3TJAA 3IRXB 4ES1A 7AT1B 1RHJB 5EN1A 1GXLA 2ZVSA 2A2CA 1L3SA 4PWDB 2PDAA 3M2VA 1XERA 1JK9B 2KG1A 4ZPVR 1CULB 2CQ4A 3E8OA 4OJHA 3VCDA 4JUZA 4G1QA 2I9SA 3W8GA 2CIMA 1X4AA 4DSJA 2K3IA 3MECB 1U2FA 2V0NA 3RW6A 1U02A 2AX0A 1EARA 5CAAA 5DDQC 2L3MA 4F3MA 1AB8A 3EVMA 3HSDA 4CLZA 3MM5A 2JH3A 1XBWA 2IYGA 3EXCX 3D28A 1S7HA 2EVZA 4N56A 2HHTA 2ZZTA 2Q6CA 5DG7A 3G82B 2L08A 2JLEA 3LP2A 1H2UX 2D1CA 2FQQB 3O8WA 2BOPA 2XHWA 2MB0B 5BXIA 4DQIA 3KMSA 3ENWA 2Z56B 3ICLA 4X4VA 4KE5A 3D0HE 3OFFA 4UZBA 2RS2A 1FFSB 5F3ZA 2WW8A 4FYVB 2GQ2A 3B6BA 2V2QA 3TRGA 5J1EB 1GTHA 4Q8EA 4ZPCA 1T03A 2B0GA 3CCZA 3ZFVA 1S4EA 3EPGA 2DNZA 3PHTA 1TZ0A 1UZDA 1M5VC 2IC3A 3P8BB 4HKQA 1OY6A 2Z8QA 4RX6A 2UUAJ 3M8YA 2OMLA 2HNZA 1RWUA 1ZS6A 1UAWA 3MHYA 2CDRB 4YS2A 2Q1LA 2Q66A 4EEYA 4DPTA 1Z1ZA 1LW2B 4QWBA 4TKTA 5L9NA 4OYWA 1EB0A 3ZNUA 2CWXA 4JV2A 1VOMA 3KYLA 4ZCLA 5DGAA 3HHLC 1Q53A 3PW0A 3MR6A 4L73A 2FHKA 3V4IA 2XB2D 3C6TA 1T0TV 2ZH6A 1UVMA 5KFWA 3IGNA 4X62F 2LDIA 2G9OA 1EX8A 3FJ2A 1TL7B 2GJFA 3CCES 1OQ6A 1KDNA 2B9EA 3MURP 4NASA 3ENAA 1NSQA 3WIUA 2CRLA 4WYLA 2V4JA 3ZZOA 3KLEB 4JV1A 3MPWA 4LF9F 4GKKJ 3PM9A 1FDAA 2OPRA 1NK4A 4B08A 5ETLA 3QGHA 1TU0B 1RT3A 3CDUA 5L8RC 3MM6A 3MMCA 3TYTA 1CSJA 3QMQA 4TYBA 4OMFG 2QN6B 4ZVHA 3QSYB 4JV5F 1VK8A 2HQIA 1VK3A 1YKWA 3TUJC 2Y3YA 4X4SA 3U7JA 2VH7A 3BQ0A 2M52A 2LU1A 5KFBA 3KLIA 4NPOA 4LF6F 2P5VA 5HP1A 3LWLA 2VC0A 1YG0A 5A6PA 2RDDA 3P45B 2E44A 5KFHA 3UQSA 4OHZA 1LOUA 1S1VB 2VG5A 3KDNA 4HL9A 5DLFA 4A8FA 3O1LA 4LRFA 4TLQA 2MGZB 2RF2A 3LH2S 3MR5A 3D1QA 2E1AA 1SL0A 1UEKA 4DL7A 5H9FJ 2XMAA 1HBNB 3IN5A 1PYSB 4DS5A 2KT3A 3F73A 1H0HB 4XAKA 1HPZB 1QUPA 1T9TA 2D9OA 2DVIA 3S1TA 3K59A 4RNFA 2PGCA 4MKVA 4G65A 4RW6B 3QZ8A 4I2PA 1HWLA 3MEEB 5BYSA 2GVZB 3UNYA 4IOCQ 4LF2A 3M2UA 2XS5A 3X1LB 1D09B 2DISA 4LFCF 3EDRB 3BDPA 4RW8A 1TL5A 1YGYA 4R0EA 4ILLA 3SEOA 3M8ZA 4JI4F 1SC1B 3EPIA 3NNCA 4IH5A 4OX8A 2HHHF 4NLGA 2N3LA 4CTAB 3V6JA 1JXEA 5A76A 3IMQJ 2R2UA 3K8WA 1VBXA 1CVJA 5F8MA 1RAGB 2KXHA 1H72C 2DKOB 3A13A 2XWYA 2R7QA 4K2XA 3PVXA 2NXNA 5A2QU 5BR8J 4IYQA 2DNYA 3DM2A 2DNMA 1G1XA 1RTHA 2FVCA 2AKWB 1KS2A 1GXUA 2O1PA 4DZ6A 3D1HA 3TW0A 1JJ2R 1QAIA 1L5UA 4KYZA 2GHPA 2VHGA 2W2MP 2FC8A 2Y9HA 3NEKA 2HMIA 4BHQA 4KSEB 4DV1F 4DV4F 3PIPQ 2J9CA 2KFYA 2W9BB 4U9RA 4YP3A 3BGOP 1FEHA 1QTMA 1VC6A 1CPZA 4KKOA 3DRRA 1CJKA 3D6FB 5DM6Q 3I0SA 4N41A 5KFLA 2VD3A 2RMLA 1HQUA 4LSNA 2R8IA 3EGNA 1VRUA 5HI7A 1N5SA 3B4MA 3T6BA 2B51A 4ECUA 3TX8A 2Y8WA 1SQFA 5L1KA 5E3AA 4DI6A 2WHOA 3JAMU 2KKHA 5KG7A 2XSJB 4L3NA 1E6VA 4P2MA 4P2FA 3GG0A 3IG1B 4M5DA 3TA0A 3U1LA 3DGPA 1WACA 1K8AT 3CD0A 3FQLA 1UA0A 3MUTP 4DV6J 2ROEA 4L3KA 3TAMA 3THPA 3ADAC 3Q2TC 4HVZA 1WUUA 3M05A 1S9EB 1V3RA 2FZCB 1HNVB 1M1HA 2AT1B 3DU5A 1GX5A 1FF2A 3T9NA 4QU7A 2VFRA 2QTWA 2DHAA 3HJFA 2NCKL 3OR1A 3C19A 1M0SA 4IRCA 2YNHA 3O3LA 2WAQD 2J0XA 2UXBJ 5HANA 1LWXA 4URQU 4NXMJ 4HT7A 2V8PA 2DRDA 1JIHA 5ETNA 2W2QP 2YKPA 4LFBF 1B0VA 1RHMB 3IBFB 2HKEA 4I6WA 2E5GA 2IA0A 3DLGB 4Y34A 1S97A 1HI0P 3H4BA 3HZGA 4JI2F 3MEDB 2WK4A 3H0PA 3HHEA 4DUYF 1Y4ZB 5L9XA 1ZOTA 1TTHB 1VQLS 4ZVFA 1WTBA 1RDRA 3I0RB 1N34J 2IAJB 2V9WA 5KG5A 3I87A 2I5JA 3Q8QB 2OPPB 4UUWA 1RWKB 3CJ5A 3ZZUA 4RBUA 1AZSA 4ZJOA 2CJKA 1DURA 4IDKA 3WC0A 2XYPB 5ETPA 4EFAC 4UF4A 2BANB 4UQTA 5K8NA 3X3UA 4PQAA 3BH6B 4RWXA 3QWPA 1A6LA 2RIJA 4LVNP 1EAYC 3D0GE 1VQ7S 4Q2LA 2BJ3A 3QO9A 2BQUA 1VQ5S 1JQGA 2EW9A 3ZZRA 4UOHA 3ILLA 1NU4A 2F8EX 5I42A 1PG5B 5F9LA 2DH8A 1ZAXA 1CEZA 2J7UA 1TUVA 1RB0A 3R5BA 4M94A 2Z2LA 2Z57B 3G8QA 3B8HA 2K06A 2XSFA 4LIWA 4YR0A 2GO8A 1QSYA 1M5KC 4I7FA 2P9CA 4KHRA 4Q44A 3PO4A 1RBAA 3NGTA 2MKCA 2V4RA 5F41A 1IKXA 4ZLLA 3J81U 4RW9B 3HD1A 3I4PA 2AGQA 1L3VA 4ZHRB 1VI7A 1EQ0A 2GIFA 4ANEA 1FESA 4ZVTB 4CLLA 3G4SS 3LUYA 1VIOA 3DDNA 2AYGA 5CA5A 5B0GA 3D66A 1CG2A 1P1TA 1YJNS 2B4UA 3BDEA 4F4XA 1HKAA 5B09A 4WZMA 5D0GA 2HFZA 3MDFA 3OUYB 1D8ZA 4V19X 1NCLA 4N8OA 3NNAA 2DGTA 4NLUA 1PILA 3MFIA 1X4EA 2XC9A 3JSMA 1YBTA 3A3NB 2W2NP 3H42A 4KY3A 1QAXA 3V6DB 1FWKA 3JTOA 2VFUA 2FJWA 1VRTA 5C24A 3H5UA 3GPAA 1GX6A 3MM8A 1WC3A 3FQKA 4ATNA 2BXJA 2AYBA 4N76A 2J7KA 3HFVA 3UPFA 3UCUP 2BEFA 5EX3A 4OZ1A 3OTCA 2GGPA 3AH6A 1NKBA 1SC4B 4DXLA 5AE2A 5M2PA 3I5BA 3JQJA 1HA1A 4WFZA 1G7CB 2EEYA 1YRTA 1HIYA 4A48A 1YJRA 2CFXA 2PE8A 2MHNA 4HACB 5KT6A 2OPQA 2YKNB 3VWSA 2A2DA 2IPOB 1GMWA 1SIWB 2YNFB 3MM9B 4U67Q 1HQEB 2CZ4A 5BYQA 2Y8YA 2DHXA 4L6V3 1LWCB 2XG8A 1M5OC 3J80U 4RUAA 3ET6B 5ETMA 4MK7A 3IWXA 1VBYA 5KG2A 3MM7A 2VQEF 3CE8A 4DFPA 1UWBB 4YHHF 1EP4B 3CDBA 3BPDA 1UZHA 4ZLJA 1WEXA 2WB4A 1RZMA 3DRSB 1Y5NB 4IH7A 3QGPA 3CJTA 3NNHA 3I9V9 5GMKa 3NAHA 5C7PA 3CB4A 1NXIA 3DRPB 1WC5A 1KN6A 3D6HB 2UZAA 2XMUA 3LWMA 1X9WA 4DSEA 2XWXA 2AJ1A 4IFYB 4XK8C 3HXMA 5IWAJ 2HLTA 3I4HX 2VFVA 2ZNZA 2R8HA 2YWHA 4I2QB 1DTTB 1NK8A 1NB2A 3NGSA 4LF6J 4J90A 2AD9A 1DTQA 4C48A 3DLEA 2PEHA 4P74A 2BRLA 1R43A 2G0JA 5DDOC 1AT1B 4LR9A 1S0VA 3WX4A 2CVIA 3BREA 3PX4A 1B64A 5JJBA 1F5AA 2CWKA 2JEJA 1ELOA 1U7LA 1PAEX 2J7WA 5LSOA 3KNGA 1W2BR 3BN7A 2E1CA 1Q86T 3H59A 1OWXA 4ANDA 1PGZA 1VS3A 3Q2SC 4X2BA 3PX0A 1N5QA 3CJQA 6FD1A 4NCAA 4A8MP 3NS7B 1ICEB 1WOPA 2OO4A 1NEEA 3W9HA 4WFBQ 3BGRA 2AF6A 1LW0A 4ILMA 4C3LA 4LFCJ 2R2RA 1JLAA 4JI4J 2E5JA 2HHHJ 2C2MB 4R8UB 4MFBA 2ZH9A 1KLMB 3RB4A 1U8WA 5J2MA 2ZZMA 5F8LA 3HDSA 4AUKA 2ZH1A 4PYAA 5ETQA 2KZMA 1Q4RA 5HQLA 2XZTB 3KJVA 3V81B 2DITA 3KWMA 2KFZA 3CNQP 3KDOA 1T05B 3NBPA 1ZAWA 1D9AA 3UD5A 2YNGA 1U49A 2C2ZB 3TUZC 3TA1A 3P49B 3KHGA 2CQ2A 1WOSA 3PHEA 3D3CJ 5LSLA 4OI6A 2VJVA 4YMEA 2IJFA 3QT7A 4DV1J 4DV4J 2W7OA 1BQXA 3HHLD 1V3SA 3BQ1A 3GR0A 2Z2ZA 4NXNJ 3OTBA 2VG6B 4ZPAA 4NRTA 2PMWA 1DQ9A 3IXQA 1S6PA 3FMBA 5KFTA 1RT6A 2B8PA 4IQMA 5H1SV 2XYGB 2IRXA 3LP1B 2UUWA 4P75A 1I94F 3NCQA 4I6AA 2AIRB 1SJRA 1WF0A 4RW7B 5HVGA 2B8QA 1ROFA 2F9JA 2N7CA 1C1BB 3NLCA 5D77A 3GV7B 1S76D 3AD9C 1BWEA 2WSCC 5K8OA 5F8IA 2DXDA 3IBCB 2MKIA 1FRMA 1MMLA 3MCSA 4P9SA 2KRBA 2CQ0A 4C9DA 5C25B 3K5NA 4ZS6A 2WVFA 3TNVA 2FHJA 5KFIA 2F8MA 1QLNA 4UTGA 3IBWA 4FBTA 2YTCA 5D6GA 4K4WA 1X0PA 2ZBQA 4M5LA 1JXVA 2KT2A 1QVGR 4B3OB 3H40A 1C4CA 1DLOA 5B7WA 1RAHB 1YX2A 2PN6A 3L4BC 1Q82T 4LQ9A 2GVDA 4MT1A 1CJUA 4OYAA 1K1SA 2XMWA 1XMQF 5GMDA 2XEXA 4LFBJ 2R7UA 4FKYA 4QPTA 4NLRA 4HHHA 2ZHOA 4NI2B 1FTCA 1FKOB 3K8VA 1QUVA 1KLNA 2RF2B 1HMVB 2GIRA 1G2EA 1SH0A 2BA9A 2QA2A 4HR2A 5KFDA 2J8AA 1HARA 3CCLS 3W65A 3W64A 1Q95G 3M8SA 4LF4F 1UMJA 1APSA 1NAQA 5A8KA 4FNIA 3FNNA 4NLWA 1VBKA 4DUYJ 2NUHA 2QMUB 2F8HA 4BC9A 3OFGA 1HNWF 3AB2B 4J37A 2NREA 3IM9A 3OXLA 3PJWA 1UKUA 5C42A 3V6KA 2MKSA 2X1GA 3POTA 1QE1B 1BD6A 1YJ7A 3Q8YA 4G6VB 5CQGA 2CPXA 2HVZA 2M88A 1XN9A 3BYRA 1N5YA 4A8SA 3DXBA 3MI7X 4V19J 4A4JA 3BSNA 1N5VA 3A1YG 5HMYA 3IM8A 2IY5B 5ETKA 1DRZA 4CO4A 3CULA 1IJFB 2MYFA 2VU5A 4R25A 4DJBA 1RU2A 4WP8A 2UXDJ 2DEIA 3DFEA 5A6WA 1RTJA 1UFKA 4K4SA 4DWIA 3AD8C 1XTZA 3CCTA 2M8DB 2U2FA 3BV8A 1GTEA 3MAAA 4PXDA 4CCHA 3QFWA 4TLRA 4C8OA 2V2VA 3BSCA 3QIPA 3W5XA 3GONA 5DG9A 1R0AB 1H2VZ 3NGRA 1YI2S 1KQKA 1I3OB 3TUPA 3H4DA 2HQFA 1TV6A 4J9UE 2LA4A 3CC7S 4J9KA 2UU9F 3KK1B 1S9GA 3HPOA 1U1OA 3KK3B 2MQNA 3I9ZA 1JJ4A 4GMKA 5LXRA 1VMBA 3LGHA 3MOJB 2GZOA 4USIA 4MH8A 2C2NA 4ZK7M 4B3MJ 2W25A 5CCMA 3G6ES 4H4OB 4YB6A 3HVTB 1F9HA 4CO5A 2C2RA 5DDPC 3D2WA 2C28A 4AE5A 2ZBPA 1IBMF 4P6QA 1UCNA 2QO3A 4RO0A 4ZJLA 2JLFA 2DH7A 4O3PA 3QLHA 3KHRA 1NK0A 2VPWB 4U8VA 1NJZA 4WYWA 2Z4PA 4TY9A 3SQOP 1F3VA 1RUSA 1N6QB 2ATCB 3GIMA 1B70B 1EJ7L 1YJWS 1NLKL 1IQTA 3MZIA 4M95A 2IHR1 5EWFA 2BVZA 1U2RA 3QRQA 2QEXS 4WTOB 2AU0A 1D0EA 3IAM9 4NWBA 1FNOA 1HYSB 3QNWB 3VZIA 1RT1B 2E7WA 2DHGA 2KHDA 4NEYA 1OS5A 3RAMA 2GV1A 1U26A 3FCVA 1U1KA 4P72A 2CNOB 4NZ6A 1H7XA 1ULRA 2VODA 4DPWA 5CYQB 1RAOA 1X5SA 1VQ9S 3AOCA 2B6AB 5K14A 5CD4H 4CP5A 2NPIA 3W62A 1R0BG 2DRBA 4WCEQ 1JLCB 3GJQB 1HHQA 4QR1A 2A3JA 2AJ4A 3OL7A 3K89A 2MSSA 4E8UA 4JV0A 4FKXA 2COLA 3OFEA 3OR2A 2R8GA 1Y5LB 2VQEJ 2P6SA 1UEUA 4XTTA 3BBFA 4YHHJ 2F3JA 2CQPA 2MJUA 3C14A 2RKIA 1WHYA 4QJVA 3TZYA 2V8VA 2XZWA 1RWNB 5DS7A 4DSIA 4K7QA 4OHYA 3BO2A 1WHXA 3M1VA 4J9LA 4WFNQ 2CPZA 3DOMB 4M5JA 3UCZP 2JRSA 5GADU 2H5IB 2YKOA 5E2QA 4NE9C 5I3QA 1NBEB 1KP6A 2MQ8A 1S6QB 2DNKA 1SL2A 4I6YA 2JEIA 2OSQA 2NS1B 1Q16B 3GIKA 1JLEB 2HK2A 1XMOF 2B5JA 2P2CB 1D8YA 4ANCA 3OQ2A 1FFGB 3CMES 4ZMMA 3HX9A 3ENVA 3GILA 1RHQB 2J9EA 3LALA 3UVJA 2FIUA 1IBLF 4DV2F 2OAUA 1R8CA 2F63A 7FDRA 1XIQA 1FRXA 4HLBA 3MEGA 4EO6A 3BEGB 3M8WA 2C42A 2ATLA 2BRKA 4CLTA 2HFVA 4DR2F 2Z2YB 2HGNA 3M32B 1JLBB 4QIWD 3Q86A 5BYRA 3RRGA 2XLIA 2LQJA 3V2UC 1Q7YT 2IVYA 4DOZA 1RP5A 4KGXB 2GC8A 1LXNA 3RTVA 4ENOA 4FNHA 4WKYA 2OIHA 2NSBA 3C46A 1Y3JA 2JSXA 5JUMA 4NOHA 3LAMA 4DFKA 4USUA 4LF7F 3T19A 3H5SA 5HVHA 2IJRA 2G13A 1LWEA 2JL9A 3MCMA 3PJXA 4C0BA 2CPIA 2HVIA 2IM0A 4K50A 3D4JA 1RT2B 2D3ZA 4LREA 3UD3P 4DSKA 3IRXA 4M5NA 3EE3A 1SJ4P 5GAHI 5CHCB 3JB9k 3PIOQ 4PWDA 1U1QA 1Q1KA 4PUOB 3CCWA 4ID5B 4UY8T 1CULA 2E9ZA 2ZH4A 2CPYA 4CYUB 5IV4A 3NGUA 3JYTB 3GP9A 3MECA 1AW0A 4CLSA 3W9JA 4QWEA 3W2WB 2RU3A 3ZZYA 5A0YB 2AV5A 2QLWA 2BR0A 4K4XA 3HM9A 3LAKA 1FVQA 1TR0A 3GLJA 3PJ9A 3AQOA 4RWWA 4QYZK 3HMJG 2BM0A 5D4LA 4ZLNA 1N36F 5HATA 3KLVA 3GSDA 3GJSB 1TUWA 2HRYA 2OTLS 4DHVA 2MY8A 3G82A 2VOOA 1BQMB 3N9UC 5F8JA 5L1JA 2X1FA 1NDKA 4DV7F 2XCAA 1JLFB 4DUTA 2XMKA 2HFOA 2MDAA 4LF1A 2FHMA 1WNEA 3MMAB 2YPYA 3AT1B 1UFWA 3CTRA 3RAQA 1IR2A 4NA3A 5GADI 2FJVA 2QYGA 3JS9A 4X64F 4B3SJ 3MAQA 1TL4A 5J1EA 1V3ZA 2ILZA 4C0OC 3ISNC 4Y2AA 2L48A 4PR6A 4PAAA 4IUFA 1RTIB 1S57A 2BE7D 2DNLA 2DCUB 1XMQJ 4C8MA 1RAIB 3MPDA 3CCQS 3RAXA 2Q79A 3G96A 2VBZA 1BUXA 1U4BA 5K9FA 1S7IA 2V34A 2QRRA 2ACYA 1IN0A 4PEOA 3SSRA 4LF4J 1LXJA 4HTIA 1LW2A 4CO0A 4ERDA 2ZEJA 4IRKA 4WK1A 3N5BA 1U47A 1M5HA 4GVBB 3M6XA 2V9KA 4Y2KA 1N56A 1HNWJ 4IG3B 3IR6B 3NOGA 3M4XA 5EUHA 4FYWB 4H4KA 2DR8A 3ZTOA 5DO2A 3CJ0A 2MQQA 1U24A 2RE1A 2GNKA 1TL7A 4M5IA 3BO3A 4YB5A 3M9MB 2R8JA 1HNXF 1PKUA 2DNPA 4OJ3A 4DLGA 2WCXA 1JXLA 2ROPA 1RAEB 1BMQB 2C22A 3H7HB 1HBUB 4ALZA 3GB0A 1S4FA 3KLEA 5IT9Y 3GJRB 4OI2A 2CDQA 4MJKA 3PKMA 2K2PA 1AXQA 1OSCA 5THWA 1CC7A 1S9FA 3CJSA 3UN2A 2ZOMA 1ZBTA 5KFMA 4ILRA 2OMOA 1JLGB 1IKVB 5CYJA 4ECRA 3QIDA 1FE0A 3SCJE 2HEKA 2V6AA 3MWBA 5F8NA 5CZVA 5U47A 3QJJA 1HWKA 5D78A 4QZVB 4TU8A 3H2VE 2Y1JA 5HBMB 2KU7A 3CJKB 2UU9J 4GO7X 1S1VA 2UVVA 4ID8A 3PRBA 4B9SA 5HQMA 2YKQA 3K5MA 1RK8A 2MGZA 2B4PA 2RD5C 1RT6B 4DR4J 3HSZA 1FFWB 1HBNA 2HFNA 2YPZA 2J6UA 2QL7B 5KFVA 4OZJA 5GAGI 3NGDA 1ZETA 5IXUA 3R7BB 1HPZA 3RBZA 4CLFA 4QOTA 2FPHX 4X4OA 1JWWA 2MY7A 5G4DA 1IBMJ 3ZXWA 3KK2B 4RW6A 3VGSA 2XY7A 3MEEA 4RKUC 2GVZA 4BLGA 4DLEA 1URRA 1EQMA 2MZTA 4Y6IA 2NYIA 3NKYA 2BQRA 4N7TA 1NKCA 2G1HA 3VGUA 4JI7J 3PX6A 3U1MA 3AXKA 1K44A 1SXLA 4CTAA 3RUBL 4NL5A 2F40A 4UOGA 2DT9A 2WSEC 3CCRS 1FWPA 5AXNA 1S0MA 4JI3F 1KNZA 4PRFA 3CT9A 4DFMA 2MMYA 1NRKA 4DU7A 3FRZA 4CNZA 3M6WA 4PG5A 3UE2A 2V4QA 4IR9A 1NZAA 4L72B 4QR2A 3GYXB 1NMEB 1L3KA 2KI2A 1FX4A 4B9NA 2YX1A 3FEYB 1RYSA 4JI8F 2RILA 1VQ6S 3SIPB 2GJ2A 2CAJA 1J5EF 4OLOA 3TA2A 2W9BA 1AA1B 2NLWA 5A2QY 4UT4A 3DGVA 3GV8B 4LJMA 3JSRA 4CH7A 4USHA 1HWJA 2ZDPA 3KLGB 3DKDA 1RACB 3T41A 2HYIB 3T5LA 2LQ9A 3LP0B 4RUBA 1TELA 1O6XA 1WDDA 1I1GA 5JMNA 2QL5B 2HW3A 4PXCA 1L3UA 4MK9A 3CMQA 2CQCA 3RGIA 4ECVA 1IXKA 4DV3J 2XSJA 5KFJA 1I51B 2CJYB 2YQ1A 2EFVA 5G0RB 2QLJB 4O4GB 2PIIA 2ZBRA 3IG1A 2HBYB 2VBWA 3HT3A 1R6VA 2CVEA 4TNOA 1X9SA 4CO1A 1QSSA 2QL9B 4Z7CA 2DGOA 4QYRA 1Y11A 5KFOA 1A7GE 3DLLQ 2C2EA 3L9ZA 3IFEA 4OZ0A 1NHUA 2ERRA 5T41A 3CJ8A 1S9EA 3TWZA 3R5GA 4Q0BB 1HNVA 3T6JA 2FLNA 1XNRF 5KT4A 1IBLJ 2A1BA 4DV2J 4J91A 2XMMA 3F56A 2F4FA 1FK9B 3QAUA 4XDCA 1R3NA 4OFZA 2DGWA 2FUG9 2ASYA 4O3RA 4DR2J 4FF2A 2ZE2B 1REVB 3SSQA 4B17A 2CQHA 1B0PA 4P73A 4DV5J 3Q8SB 1R8PA 3JQKA 3JQMA 5KTQA 1ZTTA 2FGCA 3DLGA 1S59A 1P9QC 1YSJA 5E3PA 3M9NB 2LA6A 2CQGA 1OY8A 2LKZA 1KOHA 4NLOA 3PW4A 2DXEA 4WJBA 2BKOA 2PA3A 4TXSA 1B4SA 4OYBA 3MEDA 1VQNS 1RA7A 1SQGA 1RTDB 4C7QA 1R8BA 2WOMB 4ZVEA 5J2QB 4DR3F 2OFGX 4LF7J 4ECZA 3I0RA 2IAJA 1G3OA 3AY0A 5D0EA 2UUBF 3AA9A 1N5TA 2CNKB 2G0CA 1KRPA 4DL3A 2OPPA 3R1LA 3R2DJ 5B0DA 4RL1A 3ETOA 4ED7A 3V5RA 3NP5A 2ZJPQ 1R8HA 1ZPVA 4O44B 2VBYA 5E5NA 2R4FA 2CPEA 3CIMA 3KUGA 2HWHA 1WOOA 4U7UK 2BANA 5FD1A 4RNMA 2FJDB 3UR0A 2RQ4A 2OKQA 3G2XA 4C8ZA 4B9VA 3HD2A 2P9GA 1D1UA 3VGTA 5CZXA 2QX0A 1CQNA 4ES2A 3DMJB 4FXWA 5HQ8A 2KDOA 1YJTA 1NDCA 1S48A 4CZCA 3ZTRA 5AE3A 4YB1P 2CQBA 2W8LA 4C97A 1FI4A 1UVKA 1NSPA 2M2BA 3AHPA 4H4MB 2NUUG 1KTVA 4GRSA 1XR7A 3A8IA 2IA6A 1GMWD 4ZP7A 3NOCA 4YR3A 2V5HG 4XDDA 4PG6A 2XMTA 1IBKJ 4LRCA 5HROB 3O6QA 1IR0A 3TZZA 3LTOA 4BBYA 4RW9A 1Q79A 2V2KA 2VPYB 5CD4A 4ZHRA 3Q23A 3M2RB 4DPYA 1C1CB 4DV7J 3P96A 3H20A 1FE4A 4TY8B 1AYEA 3OL6A 9ATCB 2FD2A 3ILOA 2BJEA 4E0DA 1S1WB 1U6FA 3LPEA 1SKSA 2QMXA 3UNGC 1JJCB 4X64J 1KTQA 1CBKA 2R7OA 3OUYA 2OTJS 4CM2A 4DU8A 4F8RA 2F5GA 1KHWA 4ETZA 1RA6A 2MKJA 4J5OA 1GMUA 2IM3A 3FCHA 3OFHA 2WONB 3CF5Q 3SV3A 3V6DA 2GJIA 1YLXA 1UFLA 4RU2A 4CM0A 3DNCA 1FJEB 2B56A 1HHSA 2XS2A 4RW4B 1RWMB 3PW7A 3J7AN 4WWSA 1T3OA 3NS6A 5LL6d 1TKTB 2AEJA 1PYOB 3CD6S 4I1TA 3W66A 3UW1A 1WG5A 4JI1F 2FZGB 1FHTA 3RRHA 3PO5A 3UR3C 3HHNB 2IJNA 4K8RA 5L38A 2ZBCA 3GWCA 3DI6B 5KG0A 4HACA 4CO2A 4K0KF 4EBEA 1OYEA 1YK9A 2HAFA 2YKNA 4LBHA 5FDLB 2YWFA 2YNFA 3Q8UA 1XEZA 3PEHA 3MM9A 1HQEA 1QY7A 1FJGF 2AYEA 1LWCA 1OIAA 3GQCA 1VISA 3ET6A 2C2DA 3UDCA 4J9SA 3DOLB 4WPAA 1HNXJ 5AXLA 2AHOB 1R8AA 4XIUA 4LR8A 1UWBA 4U96A 1EP4A 4WU3A 3OL8A 2QG9B 3VAMA 3KLHB 1P1LA 2OEMA 1Q8BA 4KRWA 3DRSA 4H4KC 4FPRA 1X7VA 5EX0A 1MU2B 1NPPA 1H3DA 5GAEU 4IOBA 1HI8A 3DRPA 2CJBA 1QTNB 2I0XA 5ETVA 3EZ5A 1OSDA 3T5HA 5FJ4A 2RU9A 3J80Y 4FDFA 4M5HA 3MD3A 1BLUA 3I5CA 5KFPA 3N28A 5CH7B 2FVQA 4IFYA 4KIAA 2YWKA 3ONQA 4LRDA 1PO6A 4I2QA 1DTTA 4WE1B 2OPSB 4ZP9A 3CDWA 1R6YA 4G1IA 1REGX 2GHVC 5KG1A 2A6OA 3EDQB 2OEKA 3SSSA 5JVHQ 1NUEA 4QIGA 4KO0B 5KFNA 2XLKA 4Z37A 1SC3B 1CJVA 1RT4B 3GE9A 3JTPA 1NJIT 3QFHA 4RNNA 1IKYB 1NDPA 2AQ4A 3R5DA 1HW8A 4ELTA 4KQZA 2XMJA 1A9NB 4LMZA 3QAEA 2GA7A 2DGSA 5CCLA 2IM2A 6AT1B 2LQ5A 4ED6A 3T1HJ 3SYZA 4OX9F 1R0CB 2XMVA 1SCJB 4KGZB 1FD2A 2IMOA 3EYZA 2NSCA 1MNEA 4ZP8A 2VIHA 3HO1A 4O3SA 1F60B 5ITHA 4DG1B 1WHVA 1NM2A 5EDWA 3QQCD 2F7VA 3LF0A 2ZM6F 4XO0A 3D3BJ 4XPEA 3ISND 1KR4A 4GC7A 4R8UA 3DHXA 1UVJA 5MLCV 3QZ7A 1EHWA 1KLMA 4NLDA 2JVRA 4PWWA 2XLJA 2GO9A 5L1LA 2FJAB 3DU6A 5B0FA 4AT1B 1K0VA 3NAIA 3VQSA 2BMBA 2N82B 3FUYA 2Y0SD 2FHJD 3CC2S 3BR9A 1ZYQA 2YWWA 3V81A 4DCJB 4LVOP 5LJ5Y 4CH1A 2IDEA 1T05A 2AGPA 1OMSA 2LXIA 4F67A 1U48A 2KRRA 3EUNA 1V6HA 2GX8A 1NH7A 4Y0FA 4JI8J 3LA0A 5AE1A 2GQQA 4FF1A 1DHMA 2H5JB 2JC0A 2ZWOA 3H5YA 1WDTA 1KBRA 3TX0A 4IR1A 1J5EJ 3HULA 4PQUB 1FD8A 2F4VF 2HAIA 2J76E 1RCXB 2F65A 2VG6A 2K3KA 2PC6A 1RHKB 1N33F 3FFIB 4ZVPB 4OYPA 3GIIA 5IT9U 5IZHA 3Q8PB 4LFAF 1SI9A 3N6MA 2ZHAA 1SUQB 4CDIA 3LP1A 2ALZA 1N4LA 1U45A 2UUCF 1T94A 2BE2B 4KHPF 3IA0A 4DX8H 4NX9A 3D5MA 4RW7A 2EBGA 4QIEA 4DSLA 4CLWA 3VR1A 2MSTA 2KYZA 4NLXA 4MIWA 5L39A 3QJPA 5KT5A 1C1BA 4NYZA 2CG8A 4NLSA 1JLQB 2QA1A 4R0JA 1KD1T 4FBUA 3CJ2A 4YY3F 1JNRB 5GAEI 1FRJA 5C25A 1DFDA 2QIFA 2CUYA 4B9TA 1KFSA 2LECA 5M2UA 2B7BB 5M2RA 4ECTA 2D3OR 3NWRA 3M9OB 5H9EK 4B3OA 2K1RB 4RUHA 4I68A 1PBUA 3A8EA 1TP7A 4OZLA 2EC2A 2ZH7A 2HS3A 3A4TA 2DD8S 3PYDA 2HVEA 2G1DA 3G8TA 4JI0F 1VIXA 2W2OP 2HZCA 1VFJA 4NI2A 2UVUA 4ZLPA 1FKOA 1HMVA 5E41A 4DL4A 1NH8A 2D3UA 4PKDB 2DGVA 3SZ2A 5HVFA 2EG2A 1WC6A 1YIJS 3EZUA 3TOQA 4D3GA 3GYGA 3W5ZA 2R7SA 4DZDA 3H2UB 2AJ0A 5SUHA 3OTDA 2H5EA 5KG4A 3J7ZT 4F04B 1WD6A 4DR3J 5E7OB 2PO4A 5AT1B 3V6HA 4EZ9A 4NLQA 2DYAA 2MLXA 1QE1A 1UEVA 2I1RA 3WC2A 5KFKA 2ZHBA 2D9PA 3W63A 2J0SD 3RB0A 3OT9A 3RBEA 3WDOA 1S99A 2QSWA 1FX2A 3MMBB 4KB7A 4DEZA 3KTQA 3PFEA 2WBRA 2ZOFA 2O5DA 4JI6F 1U1NA 1MSWD 1W25A 3DCAA 2XGQA 4QPXA 1KQGB 1URNA 2R42A 3RZAA 1C0UB 3C6UB 2NQPA 3KUEA 4IFVB 1W7WA 5IC4B 5E3RA 2EBEA 1MW7A 4UUXA 4AL7A 3DRXA 1SL1A 4RNOA 2AX1A 2J0QD 4DQRA 4IOAQ 1DY3A 5KFCA 1R0AA 3K5LA 5DZ7A 1RGVA 1SPBP 2LQ8A 4WP9A 2KJVA 4X4NA 4PG8A 2QC3A 1KVKA 3ISZA 3IC1A 4KH1B 4LT6A 2OD4A 2PI5A 3KK1A 3KHLA 2J5AA 3KK3A 3O5TB 3RW7A 5LMNF 4DX6A 2ZKTA 4DL5A 2UXCF 3AA8A 4HT5A 2A18A 3GFXA 3BN4A 2RHQB 1RE1B 1IUJA 2EFPA 4KPCA 2B9XA 3EGVA 4H4OA 3HVTA 4F3QA 4DR7J 2HVDA 4C8KA 4DQPA 2E66A 3CCJS 1X9MA 5HJYA 2IBKA 1N8RT 3I32A 1S12A 2CPJA 4JP8A 4QWCA 2LLZA 1T8EA 3SFUA 4QWAA 1N6QA 2CJAA 1YRUA 3I96A 4OYZA 3FBCA 1T9YA 1H7WA 1S1TB 2KVQE 3ZO7A 1H98A 2UUAF 3IR5B 5I4MA 1T9WA 1HYSA 3MGJA 2BUNA 1RT1A 5GVQA 2W9AA 3PG9A 2N4CA 1PJ7A 4K5RA 4JI1J 3MOZA 3R5AA 2KM8B 3D1OA 1M1KT 2RS8A 3Q8RB 1JB0C 3S01A 2DHHA 2QSFA 2B9YA 5CYQA 2JWNA 3N6NA 5ETRA 2B6AA 3M30A 1RT5B 3LGNA 4B9UA 1JLCA 1TKZB 4P7VA 1FJGJ 2H4YB 3CCSS 2ZUGA 1Y5IB 2EI5A 4OHXA 4ZA1A 2CQ3A 3EVWA 2VPZB 1RHUB 1WTFA 3MR7A 4J9VA 4LSLB 3IS9B 1RWPB 2RQKA 1RBLA 1MWYA 2E9TA 3UN5A 2MZ1A 2NXJA 2FLPA 1WF2A 1PC4A 1BQNB 1RAAB 2V8HA 3N01A 4GKKF 3Q24A 1N48A 1HL6A 2N7YA 3S8SA 3DOMA 1FNMA 4DQSA 4XPCA 1QSLA 2LFVA 4RU9A 3HK2A 3CCUS 1VC0A 3FCWA 3W7BA 1S6QA 2CJXB 2FYXA 1WKLA 3CEDA 4U8YA 4C8LA 2BW2A 1JLEA 3C8YA 3MCNA 3OW2R 4E2FB 4EWTA 4ZOSA 1VR6A 3C15B 1SV5B 4ZCKA 1RSCA 4N8NA 2VG7B 2D69A 1FXRA 1YBAA 3TEGA 1QDUB 3KOAA 2Y1IA 3F0NA 2VUGA 2XS7A 1BXNA 1F9FA 1YQHA 2ZNYA 2HHWA 2NXCA 3SMZA 2DBBA 3AOBA 3RBDA 4HI2A 4KGVB 2DNGA 1SKUB 2QLBB 1OQ3A 1RISA 4RNHA 1X4DA 4QW9A 1WKJA 3BM7A 5HN0A 2FJXA 1YRXA 4J9RA 1UJ6A 3M32A 2HHPA 1JLBA 2DHSA 4OX9J 5A8WB 5FLXU 4NA2A 4QIFA 2WVBA 4ECWA 1SH3A 2QGFB 5L1IA 2FVPA 3KJNB 5B0BA 2HBRB 2BKPA 3J81j 2NYHA 3KFWX 4KAIA 2CJQA 5FIIA 1NK5A 2ZM6J 3VAJA 2RQMA 3AJDA 3ITHB 1JKHA 2AJQA 4RJVA 1SKRA 4AYBD 4Y00A 2XULA 4F4YA 1CLFA 4O23A 3MUVP 2YVSA 3UDEA 2XCPA 3TQEA 4Q5VA 5LJ3Y 4HH1A 4A47A 3HHDA 5KAKA 4CLUA 3LO3A 2ALYB 1RT2A 1TFWA 1SIZA 1CJTB 3G9CA 2APOA 4F0MA 2FY1A 1VDHA 3M8QB 4PUOA 2QMWA 4ID5A 3BKTA 4BS2A 2QFIA 1FKPB 5J2NB 1SJ1A 1F2GA 4CYUA 3BGUA 3QGIA 2F4VJ 3JYTA 3US5A 2AZ3A 1IWGA 3DYAB 2DNNA 3BO4A 3H25A 4X84A 3W2WA 3L7PA 3C16B 5A0YA 1X31C 4LFAJ 4S0MA 2KH9A 1AUSL 3PR5B 2E5LF 3LGMA 3PNIA 2UUCJ 1RAJA 4KHPJ 4ELUA 4X62J 1S1UB 2MZJA 2FLLA 2MQLA 1VQMS 3K57A 3UWTA 4B3TF 4MYUA 3H98A 1K73T 5J1NA 2ASJA 3WZ0A 1BQMA 4MYTA 4LF9J 5ETOA 1JLFA 4DCOB 3BGFA 4YY3J 3SXLA 2PMZD 2OJ3A 1EKRA 1NO8A 4E98A 3IR7B 3MMAA 4JV5J 3KG1A 1KQFB 2X51A 4DV6F 1UVNA 2CQ1A 1F5CA 3OLAA 1N32F 2RT3A 3FZ2A 3NCRA 3JTNA 4LRBA 4CRJA 3QJLA 2DNHA 4ICLA 3GJTB 4OX6A 4M63A 3M8RA 3TI0A 1RTIA 4FYXB 2F1FA 2DNOA 1FTRA 2JX2A 1TL3A 2AWZA 3R97A 1NB7A 1CJVB 4GVLA 5CYMB 3FSXA 5HSPA 4Q8FA 1GMVA 3OPKA 4DUZF 4F7VA 2R7XA 2R3VA 4GVBA 1KOOA 4ECSA 2HRTA 4DSFA 1RWVB 1VHIA 2MHEA 2MKHA 4IG3A 2L9WA 3FGVA 1PCAA 1LWFB 2IVMA 3NS5A 4WU2A 4FS2A 4ITSA 1GEHA 1KEKA 1K47A 1BY9A 4I64A 4MTPA 3K0JA 2D7SA 1RTZA 4DBQA 4J9MA 4ED3A 1PAUB 3QT8A 2VKZG 5EHHA 3OTOF 4TQSA 2OSRA 1ZM4A 1HBUA 2IBOA 4C98A 2FJEB 1PJ5A 1FCAA 2V8GA 3D0IE 3SCLE 4I69A 5HLFB 5AXKA 1P8GA 4DCPB 4KV8B 1ITPA 4JI6J 2H65B 5E3CA 1D9FA 1WHWA 1Y7PA 2R7WA 3CPWR 3T5JA 2HBQB 2X1BA 3B54A 1FDDA 4EU0A 3Q22A 5J2PB 4DF8A 5B08A 1JLGA 3K7RA 1IKVA 3GFZA 2HNDB 5JXSA 2NZ4A 1CS4B 3SV4A 2EXUA 4OZ2A 3F44A 2HGMA 3D67A 1PBAA 1SB6A 3UI3A 2UV8G 4C11B 4I0WA 2X1AA 3PDNA 2EKYA 5IOLA 3RBXA 4DX5A 5HBMA 3CJKA 2Z0GA 4HH0A 1ZA1B 3HSGA 1Y00A 2M70A 4ZVOB 1HI1A 3K17A 2KG0A 1HR0F 5LMNJ 2UVRA 3FSIA 1YZ7A 2UXCJ 4IG0B 4J7CA 5IT0A 3GIRA 2QJ3A 4C0HA 3H5XA 5IFMA 2DNQA 3D6TB 3V4MA 1EETB 2WRMA 1M5SA 3KK2A 3ZTSA 2H51B 4DV0F 4USMA 2HG4A 1WC4A 1AFJA 2HQDA 1X5OA 3KG4A 1Y0HA 1Q0NA 1UPMB 3IRWP 2BABA 1HQ2A 4AQYF 2KT5A 3CC4S 5IV3A 1C2PA 5LSRA 1F5BA 3QYYA 3M8PB 4FVMA 5D15A 1RLCL 3CO0P 4K4YA 3NY0A 3AOAA 2PI4A 1SJFA 2HZVA 3SCKE 2NZCA 2DTJA 3G6VA 1WEYA 2MEWA 4BDPA 1VQKS 2IYIA 3DLKB 1M1GA 4CLKA 1T95A 1FO1A 4U95A 2C3MA 4O4RA 1GT8A 2JFKA 8RUCA 4IKAA 4JBCA 2CYYA 2NXEA 4NA1A 4O0IA 5KFYA 4ED1A 2RUGA 1XQIA 3KJFB 3BSAA 4OYMA 3CGIA 2R7TA 2Y1RI 4DPXA 3RRKA 2WBMA 2JC1A 2MZQA 2JVOA 2UVWA 1T9UA 3EVOA 1S0OA 5KFXA 3OHAA 5KFRA 3MTJA 4DDFA 3PXGa 4JI2J 5E33A 4EGLA 3DOKB 2AP6A 5DDRC 2J9DE 2CPFA 1PIEA 1K0TA 4FYDA 3KLGA 2VL1A 4X4UA 3DHWC 1I5OB 4MKYA 1UTAA 3LP0A 3I31A 2I2YA 3W5YA 1AFIA 1YITS 2P8IA 1ZM2A 1BWVA 2GMLA 2IM1A 2W2PP 4EO8A 5G0RA 2LXFA 4O4GA 7FD1A 3TVKA 2MLYA 5IWAF 4WP3A 4BCAA 3S7RA 4JI5F 1PSDA 4ED0A 5KFGA 4V1Ak 5HMZA 2MQMA 4YDXA 1IJEB 4BWJA 2FLOA 1U25A 4Q0BA 2DO4A 1HD1A 2O01C 2XNRA 1FK9A 1J5OB 2LMIA 1EKSA 2M7SA 1TFYA 4O3OA 2VDIA 3FK4A 1Q8KA 3QPIA 1TL1B 3ZZTA 1YTYA 1C0TB 2MZRA 5MAOA 2ZE2A 1REVA 2C1EB 5D4NA 4FS1A 4L74A 2C3PA 1WORA 2RDIA 4CNYA 2QE5A 4RBVA 3CD7A 1U0HA 4FXDA 3N6LA 4YEAA 4FXVA 4J9NA 4WFYA 2FDNA 2YH0A 2ZWPA 4LIRA 2ZKUA 4RBTA 2YNIB 4KJIA 4W4MA 5E0OA 1Q78A 2NXUA 5H9FK 2BJ7A 1JNZB 1WC0A 2A10A 1NSKL 1U8SA 1RTDA 4MKAA 5SZTA 3VHQA 2WOMA 5J2QA 4DS4A 1HWIA 2HNYB 1VJQA 2GMHA 2ZC3A 1TKXB 1DARA 2LEPA 3HP6A 3LW5C 2OUGA 2VBXA 5J1PA 2FVRA 3QATA 2OP5A 2GQCA 5K8MA 1UJ5A 5GAHU 4O44A 2BQ3A 1MROB 2W4DA 1Z4UA 3P5TL 2OD6A 1FXLA 2NR0A 1HBMA 3DN9A 5D3GB 2L9NA 1VYAA 4A8YA 1NNDA 3HHLB 1OJ4A 1DZ5A 2OH2A 4CIOA 3GTYX 3SQGB 3RB3A 4ZCIA 3DMJA 4NZ7A 3NG8A 3OLBA 2CADA 1KVIA 1ACMB 3VVTA 4NXNF 4Q45A 1FKAF 3R9LA 2E5HA 2N4DA 2E5LJ 2LVWA 3KKFA 1UPPA 3PV8A 3M30B 2W01A 1TVRB 3T3FA 3ILIA 2MPUA 2HS4A 4OJGA 4H4MA 3G71S 2XTJP 4OHVA 4DN9A 4RLEA 4F36A 5D0HA 3VQTA 2MXYA 4B3TJ 2RSQA 4DR5F 5DQHA 2M0GB 1L3TA 4PZVA 2ZD1B 2EFQA 5HROA 2ZDOA 3KLFB 2VZ9A 3GIJA 4ZVUB 3OJUA 3R2CJ 2HIQA 2ROGA 3M2RA 1C1CA 4ED4A 2XY6A 3CXCR 1RABB 4TY8A 3PCOB 5A8RB 2C3YA 1HHTP 1R7IA 5IM0B 4KPYA 2BJ1A 2VC1A 3Q89A 1S1WA 3VAIA 2HFSA 3HJVA 1DQ8A 5RUBA 3BKUA 3L3CA 4ED8A 4HI1A 2V8DA 4Q43A 2RNEA 4OQJA 4YUDA 2LP4A 4W90B 2CJ9A 4URGA 1WI6A 2M4MA 1N32J 1KFDA 4DN0A 1SQEA 3DLHA 1X4GA 2HRUA 2WONA 4NRUA 1KONA 3RJMB 4DMZA 1N88A 3OXGA 2WTFA 4JYAF 3VGVA 2HPUA 3R3TA 3VF0B 1IR1A 3W1YC 3SFGA 2ASLA 2EKNA 3U1NA 4RW4A 2R7RA 4M8LA 1TKTA 2GAGC 4I56A 2HZAA 4DUZJ 3RB6A 2XHCA 2L9DA 2VONA 2BJ9A 5KFEA 1BHNA 1NK7A 1LK5A 1Q5VA 3UDLA 1FWLA 4PWUA 2YWGA 3DI6A 2M9KA 2HK3A 2DIUA 1FRIA 5FDLA 2CPHA 2LEBA 4QQBA 4OHWA 3SDEB 4F02A 2B4OA 1VJWA 4WBFA 3VV2B 4GO5X 2D3O1 1TK8A 3EMTA 1DAXA 4QU6A 3DOLA 5I3UB 4J9QA 1JKHB 1H2TZ 4F4AA 2IVFB 4B9LA 4FN5A 1B0TA 2VQFF 4HYKA 3OTOJ 2D41A 1OPZA 3W3SA 2ZVIA 4NYPA 4RUCA 5F8HA 4FP9A 3M7VA 1MN9A 3KLHA 2IFXA 1X0FA 4YR2A 3NXZA 1MU2A 2JHEA 1PC5A 2A6MA 1ZA2B 4K59A 1H6KX
chains in the Genus database with same CATH topology
3IBWA 1ZYQA 3OBIA 4FBTA 1VHFA 2YTCA 5D6GA 1X0PA 1X4FA 2ZFHA 4YFUA 4K4WA 3V81A 1WG4A 4WF9Q 1QVGR 2KT2A 4B3OB 1MWZA 2ZC4A 2UXDF 3H40A 1C4CA 1DLOA 1YHQS 5B7WA 4LVOP 2W9CB 3JAMY 2PN6A 5LJ5Y 3QIPB 4CH1A 1T05A 2R7VA 2AGPA 1Q82T 4LQ9A 4NYOA 4C2MA 2Z2MA 2LXIA 4F67A 3RYLA 3OVBA 3PEJA 5LT5A 1U48A 5HO4A 4NCGB 2KRRA 4QYZJ 2RB7A 4WE1A 1LKZA 3EUNA 1V6HA 2VPXB 5D8HB 2GX8A 1NH7A 4Y0FA 2OPSA 3J7Z5 3CIZA 5DG8A 2EK1A 1K1SA 5AE1A 3E01B 2XMWA 3ENQA 1QAYA 1XMQF 1NJXA 2XEXA 2R7UA 2FHOB 1QM9A 4NLRA 4QPTA 1TV6B 2GQQA 4FF1A 1ZPWX 3GFHA 1DHMA 2ZHOA 1FTCA 2JC0A 3H5YA 4X65F 1FKOB 5IQQA 4CI0B 4YOEA 3H2LA 4KO0A 3K8VA 4IR1A 1FDBA 1TAUA 1QUVA 2RVJA 1KLNA 2RF2B 3CO9A 3MPYA 1HMVB 2KTQA 2GIRA 2W4PA 1SH0A 2BA9A 1FD8A 1S9GB 2QA2A 3NCPA 4NCBA 2F4VF 2HAIA 4PQUB 5KFDA 2J76E 2YKMB 1HWUA 1HARA 1RT4A 2J8AA 5K5MA 3TVYA 3CCLS 4U6PA 4DQQA 3TQ1A 3CWJA 3MFHA 4KGKA 2VG6A 2YWEA 2K3KA 2PC6A 3U02A 3J7YI 4LF4F 1IKYA 3M8SA 3N5FA 4CO3A 3ULHA 1N33F 1UMJA 1APSA 3FFIB 4ECYA 2Q43A 4X4PA 3GIIA 5IZHA 1NAQA 1X4HA 3Q8PB 5A8KA 4LFAF 2RQCA 4FNIA 1SI9A 4OZ5A 2HHVA 3N6MA 5GAGU 3FNNA 4NLWA 2ZHAA 3K58A 3FVYA 2K7JA 2ZBIA 4WXOA 1SUQB 2NUHA 2SXLA 4KT0C 3LP1A 2ALZA 4OX7A 1S6UA 2F8HA 1N4LA 4OI1A 1U45A 4FZVA 4BC9A 1TK0A 2UUCF 2RH3A 3OFGA 1T94A 2BE2B 1HNWF 2JOQA 4KHPF 4OL8A 3AB2B 3IA0A 4J37A 1NK6A 2NREA 2H9ZA 3VAHA 2C3UA 4DX8H 3FEZA 3OXLA 3PJWA 4B3MF 1UKUA 5C42A 5AJ3F 4IRDA 3V6KA 4NX9A 1N0VC 3D5MA 4RW7A 2EBGA 2MKSA 4QIEA 4DSLA 3SDEA 3VR1A 1I6JA 1S1XA 1DBDA 2X1GA 2MSTA 2B3TB 2KYZA 3POTA 4NLXA 4MIWA 1FXDA 3GR1A 1QE1B 3GYNA 1BD6A 4NLVA 5L39A 4LQ3A 3QJPA 4KC5A 1E6YB 4MK8A 2YQ3A 4G6VB 3AJ1A 2CPXA 5CQGA 5KT5A 2HVZA 2M88A 1C4AA 5I3UA 1XN9A 3HVAA 3QLHB 1C1BA 4O3QA 1N5YA 1JJHA 4NYZA 3DXBA 4A8SA 2M3DA 4NLSA 4K4VA 1JLQB 3PRDA 3MI7X 4V19J 2QA1A 4DG1A 4A4JA 3BSNA 2VA3A 1X8DA 1N5VA 1ZH5A 4R0JA 1KD1T 2AYMA 3A1YG 5HMYA 2J6TA 1VBZA 4FBUA 1G2EA 4B9MA 3CJ2A 1Y9OA 5KOXA 5DLGA 4YY3F 2O67A 1JNRB 1DRZA 1RT7B 5GAEI 2DH9A 4CO4A 3DXSX 1FRJA 5C25A 3CULA 1IJFB 2MYFA 5DQIA 1DFDA 2QIFA 3HFKA 4R5PB 2QZ8A 2W4CA 4B9TA 3FZBA 4R25A 4DJBA 1WG1A 2W7PA 4A8QA 1KFSA 2EC0A 2LECA 3DFEA 3G86A 1RTJA 5A6WA 4CT8A 2XGPA 4K4SA 4DWIA 5M2UA 2B7BB 3KHHA 5M2RA 3W2VA 1XTZA 3CCTA 4ECTA 2D3OR 2M8DB 1SH2A 2U2FA 1GTEA 4P7TA 1RQ0A 4PXDA 4CCHA 2GMJA 1BC6A 4ZPDA 3M9OB 3RR8A 2K1RB 4B3OA 4TLRA 4ICLB 4C8OA 5BR8F 2XY5A 4RUHA 1XK8A 4I68A 2MQOA 2W9CA 3BSCA 3QIPA 4JOUA 4ZDNA 3BF4A 3A8EA 1TP7A 2EFNA 5DG9A 4FF4A 4KFBB 4OZLA 1R0AB 4J9OA 1HNIB 3NMRA 2LCWA 1H2VZ 4NCGA 5F3TA 1YI2S 1KQKA 2ZH7A 5T7LB 1RKJA 1TL3B 2HS3A 2K7KA 5F9NA 1N0UA 1VLYA 1FRLA 3E01A 3IAS9 2DD8S 5K14B 3H4DA 3PZPA 2G1DA 4ZP6A 2XO7A 3G8TA 4JI0F 5KFFA 1IKWB 1TV6A 1VIXA 2E5IA 4O3NA 2JEGA 2HZCA 1VFJA 2UVUA 4ZLPA 1FKOA 2LA4A 4ELVA 3CC7S 4TU9A 4J9KA 3BR8A 2UU9F 2BBEA 2R2TA 3U27A 1HMVA 3KK1B 1V9OA 1HBOB 5E41A 4DL4A 1AUDA 1S9GA 4PQUA 3HPOA 4UW2A 1U1OA 2YKMA 2ZH8A 1NH8A 2D3UA 4PKDB 4DL2A 2DGVA 3KK3B 1S10A 2MQNA 3OR2B 3SZ2A 5BJRA 3I9ZA 3CDEA 4ECQA 1UJ4A 4NZ0A 1JJ4A 4ED5A 2I38A 2EG2A 4GMKA 2XI3A 5LXRA 1VMBA 3FFIA 5KFSA 3T9ZA 1WI8A 3MOJB 4FF3A 1YIJS 4USIA 3EZUA 2RKIB 4U7CA 4MH8A 3TOQA 4D3GA 2R7SA 2JZ5A 2ADCA 4ZK7M 1SUQA 3H2UB 2AJ0A 2W25A 5CCMA 4PXEA 3AQPA 5SUHA 3OTDA 2H5EA 5KG4A 3J7ZT 1WD6A 5E7OB 2BE2A 2PO4A 1M5PC 3G6ES 3M1VB 1K9MT 1S0NA 4H4OB 4YB6A 3HVTB 4F3OA 3V6HA 1FJCA 4CO5A 2C2RA 2IRYA 3CVKA 5DDPC 3D2WA 2C28A 4EZ9A 4AE5A 4NLQA 3MR2A 2DGQA 1IBMF 4K4ZA 4P6QA 1S0OA 1KQSR 2KZZA 3FSYA 4OI3A 2HWIA 2QO3A 1QJHA 4DR7F 1DQAA 3HZEA 1QE1A 4HHJA 4C8YA 2DPJA 2ZOGA 2JLFA 2DH7A 1E6YA 4O3PA 4N47A 1UEVA 2I1RA 3WC2A 5KFKA 2FB0A 2ZHBA 3QLHA 3C3LA 3I82A 2D9PA 4C8NA 1FT8A 3KHRA 2J0SD 1NK0A 3RB0A 2VPWB 3RBEA 1JLQA 2YKAA 3WDOA 1NJZA 1S99A 1XMBA 4WYWA 4AL5A 2Z4PA 1CQMA 1FEEA 1LFPA 4TY9A 3J81Y 3M2VB 3BQ2A 3H8YA 2QSWA 3HHKA 1N6QB 3R1HA 4N5SA 2B5JB 2FTRA 4PPZA 1O8BA 3MMBB 1T7PA 4KB7A 4DEZA 3KTQA 3GIMA 2VOPA 3PFEA 2ZH3A 1GNKA 1YJWS 3THVA 1RT7A 1IQTA 4C3MA 2KB2A 2WBRA 3MZIA 3VAFA 4R5PA 2ZOFA 4M95A 2O5DA 4JI6F 2E29A 4G1QB 2ZJRQ 2IHR1 1U1NA 4AXJA 5EWFA 1U1LA 1MSWD 2BVZA 1W25A 1U2RA 2DB1A 3DCAA 4EBCA 2QEXS 2XGQA 2UV8A 2E1RA 5KFUA 2AU0A 1D0EA 4QPXA 1UL3A 3IAM9 2YH1A 1KQGB 4NWBA 1FNOA 1URNA 2B7CB 4Y2IA 3OVAA 1HYSB 3GMGA 2HS0A 3RZAA 3VZIA 1RT1B 1S6OA 2VV5A 1C0UB 1R27B 2BYCA 3C6UB 2NQPA 4IFVB 2E7WA 2K1RA 5DJBA 2DHGA 2D74B 2KHDA 2DR7A 5E3RA 1OS5A 2EBEA 3UFCX 1MW7A 4UUXA 3MEGB 3B4DA 4AL7A 2GW8A 3DRXA 1SL1A 1WWHA 4RNOA 3GZ7A 2AX1A 3MAHA 2J0QD 2UXBF 4DQRA 4IOAQ 2P9EA 4KFBA 3RAMA 5HMWA 5KFCA 1R0AA 4I67A 3K5LA 1HNIA 2GV1A 4MKBA 1VC5A 1KVJA 1U26A 2ZH2A 1U1KA 2W7AA 1P27B 1WEZA 5EGYA 5T7LA 1FRHA 4ECXA 4NXMF 2HGLA 1H7XA 1ULRA 1FA0A 4NZ6A 2CG4A 2VODA 1RGVA 3MUMP 2QYCA 5CYQB 1Q8LA 1X4CA 1X5SA 1VQ9S 3Q0AA 1DJ0A 1VQSA 2KJVA 5B0EA 3MM5B 4X4NA 2B6AB 5K14A 3CCVS 3T5KA 5CD4H