3J7YU

Structure of the large ribosomal subunit from human mitochondria
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
111
structure length
111
Chain Sequence
ARNVVYPLYRLGGPQLRVFRTNFFIQLVRPGVAQPEDTVQFRIPMEMTRVDLRNYLEGIYNVPVAAVRTRVQHGSNKRRDHRNVRIKKPDYKVAYVQLAHGQTFTFPDLFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the large ribosomal subunit from human mitochondria.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 14
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2014-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3j7yU00
4WCEQ 2XNRA 2DGWA 3EX7B 4A8XA 4Y00A 2L9WA 2RRAA 2DB1A 1AUDA 1WEXA 2J76E 2HGMA 1YTYA 3CC2S 4LIRA 3CC7S 1H2TZ 4C0OC 3UD3P 3CULA 2CPJA 3BO2A 2LXIA 3IRWP 1W2BR 2EK1A 2MQNA 3CD6S 5LJ5Y 2JRSA 4P6QA 2YTCA 2CQPA 1QVFR 3LQVA 1SJ3P 5DDQC 4LMZA 2DO0A 2JX2A 2N3OA 2M8DB 1ZH5A 1WG4A 3TP2A 3CUNA 2MKIA 1FT8A 2DISA 2FHOB 2LEBA 3P6YC 3BS9A 3ZZYA 5CXTA 2CQBA 3J7YU 1U1LA 5DDPC 1VQMS 2CPEA 4QU6A 2KN4A 3NS6A 2M70A 2KYXA 2E44A 1NJIT 1X4EA 3CCJS 1L3KA 3OW2R 2M9KA 1VQKS 2KHCA 2RRBA 3MUTP 1OO0B 2Q79A 1Q81T 2MXYA 1WF1A 1D8ZA 1X4DA 2MQPA 2GO9A 1ZZNA 4WF9Q 3G71S 2PEHA 4M5DB 5D78A 1K73T 4UQTA 3PIPQ 4ERDA 2N3LA 1SJFA 4WIIA 2U2FA 2GHPA 3U1LA 1X5TA 3I55S 2CQDA 2KT5A 2FC9A 2DHSA 2F3JA 3R27A 1OIAA 2XB2D 2JVRA 2MJNA 2L41A 3RW6A 2OSQA 1DHMA 2DNKA 5MLCV 1S79A 1M90T 2CQGA 3SDEA 2JVOA 3G4SS 2RQ4A 3BO4A 3BO3A 1X5SA 4Y0FA 3MOJB 2FC8A 1X4BA 2MSTA 1S72S 1UP1A 3G96A 2AYGA 1YJWS 2OSRA 2E5GA 1VC0A 2CQ1A 3U1MA 1WTBA 2HGLA 3THPA 3EGZA 2MQOA 3P3DA 2G1DA 2K3KA 4WKRA 1B7FA 1JJ4A 4F02A 1VQPS 1H6KX 1YJ9S 2DIVA 1X4FA 1VQ5S 1N88A 3MDFA 1VBYA 4PR6A 1KC8T 2DK2A 2MZQA 5D77A 3P5TL 3S7RA 2KG0A 2RVJA 4QQBA 1HD1A 4UY8T 2LCWA 3J7ZT 1R8HA 3JB9k 2DHXA 3R1HA 5JVHQ 3H2VE 2LA4A 2DO4A 3MUMP 2LECA 1U1QA 3SMZA 1RKJA 1D9AA 4IO9Q 2O3DA 3NNAA 2MHNA 2MGZA 3NMRA 1YITS 3S8SA 3CCQS 2DNOA 2X1BA 2QEXS 2KXFA 5CA5A 2RS8A 5H1SV 2DIUA 2ZJPQ 4ED5A 5GAEU 2I2YA 3CTRA 2CPIA 2G4BA 1FJCA 2M4MA 3B4MA 1SJ4P 2DH8A 4CH1A 1Q82T 1X4CA 1FJ7A 2KRBA 2MB0B 3Q2TC 5GVQA 2MZJA 3CCLS 1M5KC 4CQ1A 2RNEA 4F25A 2DGQA 2VODA 2MQQA 4PKDB 1P27B 2G0CA 2D9PA 2DH9A 1JJ2R 3P49B 3FEXB 3DXBA 2ERRA 1SJRA 4WFAQ 1A7GE 2MY8A 1O0PA 2DGSA 1N52B 2DGXA 3D2WA 1SXLA 3EGNA 2XS5A 4FXVA 2DNNA 5GMKa 3S6EA 4U67Q 2RU3A 5HL7Q 3L3CA 3VAHA 3TO8A 2UP1A 2YH1A 3MURP 3G6ES 2MKJA 2DNQA 4W90B 3MXHP 2KI2A 2AYMA 2MSSA 1NU4A 1UFWA 3CPWR 3CCRS 2RS2A 5LSOA 1WG5A 2M52A 3S01A 3CXCR 1M5OC 2X1AA 1X0FA 3IWNC 1N8RT 1FJEB 1H2VZ 2MKCA 5DETA 2XS7A 2MKKA 3VAJA 1WHWA 2DNMA 1VQNS 3NNCA 4TLQA 1VBZA 1KQSR 2I38A 3FEYB 2D3OR 4LJMA 2QFJA 2ADBA 5GAHU 1U1NA 1X4GA 3HHNB 2KVIA 1DZ5A 3CCVS 1VC6A 2DGVA 1YIJS 1VQOS 1OWXA 1BY9A 2YKAA 2CPHA 3THTA 3CC4S 2K8GA 4F26A 1UW4A 3UD4P 3ZZZA 5HO4A 3CMES 2CPFA 3LPYA 3CCMS 4FXWA 2DH7A 2KRRA 2VOOA 1FXLA 3SDEB 1CVJA 4C4WA 4ZKAA 4IOAQ 1P1TA 4BS2A 2KXNB 2VONA 2MKSA 2CQCA 5LJ3Y 5DDOC 2NLWA 2NZ4A 3VAKA 1VQ9S 5BJRA 3G9CA 1OPIA 1HD0A 2RUGA 1H2UX 4CIOA 2KH9A 2M2BA 1QVGR 2DNLA 2CJKA 1HA1A 2M7SA 2DGOA 2MPUA 5CYJA 5IM0B 2MQMA 2MKHA 2D9OA 2MGZB 1U1MA 2V94A 2CQHA 2DNZA 5IM0A 1DRZA 2DGTA 2RT3A 4C7QA 2M0GB 2CQIA 2AYBA 1U1OA 2DNYA 3CMAS 1VQLS 1ZZFA 1Q7YT 5GAGU 3NS5A 2MY7A 2J0QD 3RW7A 5IFMA 5LXYA 2LEAA 3CCUS 1X5OA 1KOHA 1U1RA 4QU7A 1WF2A 1NO8A 2MMYA 2CQ3A 1FO1A 1VQ6S 3V4MA 4W92B 2YH0A 3TYTA 1UAWA 3VAGA 1K8AT 1IQTA 2KU7A 2OTJS 2MQLA 2OJ3A 2ZJRQ 1VQ8S 2MJUA 3MD1A 1WF0A 5DM6Q 3UE2A 3CCES 2ZJQQ 1FHTA 3MUVP 3CCSS 2LYVA 2LA6A 1YI2S 2OIHA 4IUFA 1VQ7S 3SXLA 3Q2SC 5FJ4A 3G8TA 2DNPA 2VOPA 4QPTA 3CF5Q 3UCUP 1VC5A 1K9MT 5IQQA 2CQ2A 3MD3A 1WHYA 4YUDA 1DBDA 5JVGQ 1M5PC 5DM7Q 2LXUA 1WHXA 3VF0B 2MZSA 2BOPA 1XN9A 1WEYA 1U1PA 2KM8C 1YJNS 2RQCA 2EVZA 3R1LA 3MI7X 4RU2A 2B0GA 4Z2XA 4CH0S 3B4DA 2DNRA 1A9NB 1KOOA 1JJHA 2CPDA 2CQ4A 2DGUA 5EN1A 2HGNA 3PIOQ 2M8HA 1U6FA 3G8SA 2OTLS 3VAFA 1M1KT 2CPZA 2AD9A 5LXRA 1QM9A 1U1KA 1WHVA 2DITA 2QA4S 2DHGA 2MZRA 1WELA 2JWNA 2XSFA 1WWHA 2KXHA 2U1AA 1F9FA 2DHAA 2BZ2A 3HI9A 2N7CA 3NNHA 4V19X 1X4AA 1RK8A 1X4HA 2LMIA 4WFNQ 2X1FA 2A3JA 4OZ0A 4TU8A 2AYEA 2X1GA 2M88A 2CPYA 4OZ1A 1M5VC 2CPXA 2HYIB 3VAMA 1FNXH 2E5JA 2EK6A 4PRFA 2KG1A 3UCGA 2CQ0A 1YHQS 4YOEA 1HL6A 2SXLA 3VALA 1R8PA 2HZCA 1VQ4S 2F9DA 4WFBQ 5GADU 3UCZP 2ADCA 4TU9A 5LSLA 1PGZA 3ULHA 4YB1P 2LQ5A 2FY1A 3US5A 4J5OA 1YWXA 4EGLA 1Q86T 5DDRC 2DNGA 2WBRA 2PE8A 4TU7A 2N82B 2XNQA 3VAIA 1WEZA 1URNA 3K0JA 3DLLQ 2XS2A 3N9UC 1JMTA 2E5HA 1SJQA 1KD1T 2HVZA 2MYFA 2MZ1A 3I56S 1N54B 2KM8B 2L08A 1G2EA 2J8AA 1U2FA 3H2UB 2J0SD 1U6BA 2DNHA 1PO6A 2MZTA 2LKZA 2KFYA 2E5IA 2YWKA 1WI8A 1VBXA 1WG1A 1WI6A 3UWTA 2F9JA 3BEGB 1X5PA 2FPHX 5ITHA 4IOCQ
chains in the Genus database with same CATH superfamily
1H7XA 2CIMA 5K14A 4WCEQ 1K0VA 2KFZA 3MAQA 1S0NA 2F1FA 2L9WA 4OYMA 3ZTSA 2XLJA 1T9WA 1E6VA 5IZHA 1NZAA 4QYRA 4EK2A 3UN3A 3JSMA 3VV2B 3ZZRA 1NK4A 3FSYA 2Z30B 5KFPA 1R6VA 4ZIWA 2HQIA 1C0UB 2GJ2A 1Z2ZA 1TK8A 3T9NA 1S57A 3BO2A 5F3ZA 1KLNA 2CJAA 2EG2A 4NA1A 3IRWP 3U02A 4HKQA 2XS2A 2HMIB 1W2BR 4OHYA 2QYGA 1LXJA 1FFSB 5T41A 4NRUA 2VHGA 1VHFA 3GSIA 3SZ2A 3DRPB 2ZH4A 3M1VB 1RYSA 1SC6A 5KFDA 1PILA 2VPWB 4C2MA 4PQAA 2WHOA 1SJ3P 2DXEA 3E8OA 2DO0A 1U48A 2DY1A 4JI5F 4LF8F 5KFVA 2HPUA 2L9NA 4QR2A 4ZVRB 2N3OA 1T9XA 3AB4B 3CD5A 2AW0A 2RQMA 1Q95G 3DGPB 4UT4A 1PAUB 3FRZA 2MKIA 1WC4A 2I1RA 3SQOP 5HVGA 3R7NB 4F4XA 3GB0A 1L3SA 1HQUB 3U1NA 5EX3A 3K57A 3CJ3A 3L7OA 3T9ZA 3UR3C 3RB6A 4NZ0A 4ED8A 2NR0A 5CXTA 2C2MB 1MROA 2FHJA 5DLGA 2VD3A 4B17A 1U4BA 5A6WA 1ZM3A 1DQ8A 2WTFA 2KN4A 4O3SA 4USWA 2J7UA 1MMDA 1HHQA 3AXMA 4RZRA 5CH7B 4L76A 1JLGA 1L3KA 1VRTA 2W2OP 3NOCA 2M9KA 2DD8S 4KRWA 1VQKS 3CDWA 3JXOA 2KHCA 2ROGA 2RRBA 1RWUA 2E1PA 4LR7A 4Y2IA 4LREA 3MPYA 5CHCB 2HLTA 3W8PA 3W9IA 1WF1A 4OMFG 2J9EA 1CS4A 4ZP8A 1ZZNA 1FESA 1O5JA 1SC4B 2KDOA 4TN2A 5D78A 1NDKA 1AZSB 1NLKL 5KFUA 1EQ0A 4LR9A 4QIGA 1YX2A 1HWUA 1VIOA 2HEKA 4DR6J 1RU1A 3PM9A 1TL7B 4I7FA 3RTVA 4QIEA 4G3IA 2U2FA 1FKPB 3LGHA 4BHQA 4EUVA 4ES1A 2VFTA 3I55S 3PYEA 1BWVA 3SFGA 1S4EA 2IVYA 1FEHA 3F44A 2BEFA 3CIZA 4OHXA 4R0JA 2DHSA 4WXWA 4BC7A 5G0RA 3G8QA 3D0IE 3OV7A 2CNOB 3JSBA 3OSPA 1N6QB 1WJ9A 1S6QA 3BH7B 1EZZB 3NAHA 3IS9A 2RD5C 2V4QA 2ILYA 4JI3F 3MEGA 3OHAA 2CQGA 3AJDA 5HSPA 3G4SS 3MTJA 1LNQA 2RQ4A 3BO4A 3BO3A 3ZZOA 5KG2A 4DFMA 4LFAF 1S1WA 3QT5A 4OI4A 5A0YA 4Y0FA 3NGSA 5CQGA 1P6TA 4RUBA 4JI5J 3CDBA 3EUNA 5ETLA 3QPIA 4ZJLA 4CZCA 2AU0A 1VRUB 2AJ1A 4A4JA 3ONQA 2W2MP 1FCAA 1GX6A 5GMEA 2F65A 4CLLA 2BE2A 3DDKA 5DGBA 3TQ1A 2AYGA 2B4UA 4WYWA 1WC5A 2MLYA 1SV5A 2CQ1A 1YDLA 3QT7A 4Q45A 2H3EB 4ZPCA 2P2CB 3MEDA 5C24B 4X4QA 4GC6A 3AD7C 3TARA 1JLEA 2OKQA 3CIMA 5KFWA 4NEZA 1ZETA 2J0SD 1BQMA 2QA1A 1RADB 1RWMB 1PCAA 4EWTA 4ZLNA 1MMLA 2E5LJ 3EGZA 2XMKA 3BSOA 2R2RA 3N6MA 2C3UA 2GW8A 2K3KA 1YZ7A 1VDHA 2CG8A 1JJ4A 4F02A 1SQFA 1U26A 1TV6A 1XK8A 1H6KX 2YVSA 3JTOA 4R8UA 3M9MB 2J7KA 2LDYA 5E3CA 3IN5A 1YJ9S 4JI8J 1N88A 4RWXA 3N5FA 1VRQC 3DCAA 2OP5A 4CO2A 5F8MA 4JP8A 3V6HA 2M3DA 3EZ5A 1R31A 2A10A 4ED4A 1SL0A 2HHQA 2JEFA 5J2NB 2ZD1B 3M6UA 4DV3F 2Z8QA 1FDDA 4RW7A 5D4NA 3DOKB 1RT2A 2BANA 1Y5LB 4GMKA 3S7RA 4QQBA 1J5OB 4B9NA 2JNJA 2V8PA 3DRPA 3KJVB 2LCWA 8RUCA 4MIAA 3K5MA 3PYDA 2HFSA 2YQ1A 3J7ZT 4J90A 8ATCB 1C1CB 1F60B 1NK7A 3KYLA 4CLWA 2OH2A 3H2VE 1RLDA 2IY5B 5K20B 1QAXA 2BXJA 5H9EK 1E6YB 1TL3B 3UW1A 2EFOA 3U1LA 3GYGA 5DO2A 2YXLA 5T14A 4XO0A 4X4OA 1U1QA 2R7UA 3EZUA 4S0MA 3NWRA 4ECTA 4QR1A 3HT3A 5JUMA 4U6PA 1RT6B 1N5SA 3IR5B 4OZ3A 3CJ8A 2XO7A 3S8SA 3DYAA 1EX8A 1Q8KA 1ZA2B 3AH6A 3EZOA 3PRDA 4F4WA 2FJDB 1DLOB 1T03B 1KDNA 1MWYA 2OGUA 1F5CA 1M1GA 3DGPA 4NASA 2RS8A 4RW6B 3ADAC 4WK1A 5F0WA 3W65A 2BMBA 5CA5A 1DQ9A 5J2QB 4PQUB 2D3UA 4ZHRA 4MYUA 4NZ6A 3NY0A 3OSNA 2HHPA 4PCQA 5F8JA 1KNZA 3PRVA 3TVZA 1OYDA 2DTJA 2X3DA 2DR9A 4JI0J 1SQGA 2Y8YA 1HYSA 3R3TA 4LRFA 1OQ3A 4YB6A 5B0GA 2G4BA 3B4MA 1SJ4P 5E3AA 3DM2B 3VGVA 5DS7A 4FF3A 5LM7E 2DH8A 3R8YA 3KNAA 2KT3A 1CSJA 1HHTP 3FNNA 4RWWA 2NXEA 4LF9F 4ZLJA 3QO9A 3CCLS 2VF3A 4RW6A 1N4LA 1M5KC 1QAIA 2RNEA 3KHLA 2DGQA 4ZVSB 1RT5B 2VODA 1SC3B 4HHUA 3WIUA 2G0CA 2D9PA 5HANA 1AB8A 2VICA 3KK3B 1QSLA 3GWCA 4EO6A 5MAOA 3N01A 4NX9A 2Y1RI 1JJ2R 3TW0A 1N32F 1RHKB 2AX1A 3I87A 2Y1LB 4FKXA 4DX5A 5A2QU 5I3PA 1NHUA 4M95A 2UUCJ 1A7GE 2CKWA 3FFIA 2DEIA 1QSSA 2CA9A 3MMAB 1LWCB 4CLPA 2XM3A 3C19A 4JBCA 1ZBTA 1KQFB 1GH8A 4CLKA 3DGVA 1RTDA 1C1BA 2YKNA 3Q24A 1RQ0A 2XS5A 3I0RB 1QAJA 2DNNA 2Z56B 5KFMA 4WP9A 4WTYA 2RU3A 5DLFA 4OX9J 1X0PA 1BQMB 2RAQA 4I69A 3C6UB 1WDTA 2UP1A 2YH1A 3MURP 1RYRA 1TKZB 1JKHB 3QMQA 3N0VA 3TA2A 5J2PA 4W90B 3RBDA 1IBKJ 1VGYA 4DR2J 3TAPA 1LW0A 1R27B 4DQPA 2XULA 4RPFA 4FXDA 2XZDB 2W4PA 3D6MB 4WP8A 4F4ZA 4B3RJ 2MSSA 2WSEC 3PNIA 1UFWA 4OLPA 3OLAA 4J9NA 1TL3A 3RZAA 4FYXB 1KHWA 2IFXA 5AJ3J 2IMWP 1C2PA 3PFOA 4MIBA 5L9XA 3TX0A 4DI6A 3IP0A 1RTIA 4UOCA 4LFCJ 5DETA 1XIQA 4J7CA 5D3GB 4P73A 1EHWA 1ULRA 5K8NA 1IBMF 3R7SB 3NNCA 2ILZA 2ZNZA 3MM9B 4TLQA 1VBZA 1FKOB 2I38A 1ZAXA 2XCPA 3TX8A 2JDJA 3D4JA 2GHWA 1NHKL 4LSNA 4PYDA 5CYMA 4C3MA 3HMJG 3SV3A 4ED7A 1D9FA 2BE7D 1HI0P 1X4GA 3HHNB 1VYAA 2KVIA 4CO3A 1TL1A 3M32B 4KBIA 1XR6A 4CTAA 3I4HX 2FYXA 1R7IA 4OZLA 2MKYA 4DPYA 3KLEB 1BY9A 3EVMA 3JQKA 4N41A 2MDAA 3THTA 5M2PA 1G7CB 1UW4A 2CJYB 2OI2A 3FEZA 3UD4P 1UW9A 2RMLA 1YKWA 3HSDA 3D0GE 3MM9A 4X62J 3CMES 1FD8A 3V81A 2LEPA 3UVJA 3CCMS 4C0HA 3C46A 5MLCV 2VDIA 2RHQB 1IR0A 4NLWA 1RWWB 4DX7A 2R8GA 1REGX 3GCXP 3NLCA 2NUHA 4C4WA 1IM6A 3JTNA 1OQ6A 3HFZB 2LVWA 3G82B 3GFXA 1WD6A 2QL5B 5EWFA 2KXNB 3LWMA 1B0PA 1HIYA 1RSCA 5E5NA 2RJZA 4OI2A 3FZ2A 1VFJA 3ISND 5E41A 3KHRA 1F9HA 2IJNA 2HQ3A 2NLWA 3CJTA 3SCIE 4DXLA 5DG7A 2NREA 2KFNA 1IKVA 1WUUA 2YWWA 4KFBB 3FCHA 3TUJC 3T1HF 4C97A 2DNLA 1NKBA 2CJKA 4RNFA 1LWFA 3BSCA 1NMEB 2HK2A 3PACA 4QZVB 5E2QA 2DVIA 4N76A 2QRRA 3PKYA 4PUOA 1RTJA 3LAKA 2MPUA 5CZVA 2N4DA 1NDPA 2X3GA 5CYJA 3RUBL 2YNHB 1XBWA 4Q0BA 3ENQA 3NGKA 4FF1A 1C0TA 1XMBA 1WSVA 3C14B 4B9TA 4P2SA 2P5VA 4ECQA 4M94A 2GQCA 1FX4A 3IO1A 5IM0A 2B9XA 4A48A 2CQIA 5JJBA 3T1AA 2QYCA 4BLGA 4XPCA 3K5LA 4CM0A 2UUWA 4K0KJ 2DNYA 3CW2C 3M8WA 1ZZFA 3I0RA 1MLAA 2HWIA 3ET6B 3NS5A 3P8BB 5GAGU 1WORA 4G1QB 1S0VA 1JLGB 1VRTB 4C98A 2J0QD 2Y8WA 1FI4A 4C3KA 2G13A 4LFCF 5LXYA 2HHHF 2LEAA 1HKAA 4ZCLA 4X4PA 4DSJA 4KHMA 1X5OA 5L1LA 4WZMA 4NCGB 4GVLA 4A47A 1U1RA 2IRYA 1RABB 3M9OB 5HBMB 2F8HA 3R5JB 2QA2A 4QU7A 2QMXA 1N33F 3V2UC 4IG0B 2JEGA 2MMYA 1JLBA 1R8BA 1RT1A 4I2PA 1FO1A 5EHHA 2JLGA 3DLKA 1VQ6S 2F4FA 1UAWA 1DJ0A 5C42B 4DV1J 4RNHA 2VA3A 1IQTA 3ET6A 1ITPA 2ZKUA 4LF6J 1ZM4A 4JI6F 2MQLA 2OPPA 1KLMB 1HPZA 2MJUA 3MM8B 2ZJRQ 1VQ8S 4HTIA 4PPDA 3UE2A 4DR7J 3NCPA 2F40A 4F0HA 3W61A 3W2VB 4Z37A 4IR1A 2LA6A 4NCGA 2GMLA 3AY0A 1YZ6A 3G82A 3IM9A 1WC1A 3MECA 3MM7A 4MH8A 3JTPA 1ZTWA 4IUFA 3VCDA 1NAQA 5BR8F 4O0IA 1J2VA 3SXLA 3MPVA 1YG0A 3A3PB 4DPOA 4GKJF 1WOSA 3CDAA 3MAAB 5FJ4A 1R0CB 4CYUB 1ZPWX 4YY3F 3QQCD 4ZP7A 1F2HA 1VK8A 3MFHA 3UCUP 1JNRB 5BR8J 3H5XA 1IN0A 1FK9B 3GR1A 2G2OA 3O6QA 4OJGA 1HNXF 4IG3A 1CC8A 2RDIA 2CQ2A 4LRCA 1WHYA 5HLFB 3H8YA 1RGVA 2A1BA 1JIHA 1PKUA 2Y0SD 4DR7F 2L3MA 2B9WA 1D1UA 1OPZA 4MIWA 1MMNA 2BE2B 3A8JA 4TNOA 5KT2A 4LF6F 1LW2B 1XN9A 2F8EX 2XWYA 3ETMA 4DV1F 2QX0A 1UWBA 3D54A 4LF9J 3P96A 2E1MC 1PYTA 5EWEA 3GIKA 2DR5A 2Z2ZA 3QRQA 1IKXA 4C11B 2H51B 5HN0A 2GIRA 1NKEA 2JLFA 2ROPA 4K4SA 2BR0A 2EKYA 2HBQB 1SL1A 3WDOA 3AOBA 2AWZA 4H4KA 2PSZA 2UUBJ 4B9VA 1SKRA 1JJHA 5GMDA 3KLIB 2KHDA 2XYPB 5EN1A 1Y4ZB 3RRKA 3RU0A 4CLZA 5C24A 1NB2A 2QE5A 3BYPA 4B3TF 1U6FA 3IGVA 3G8SA 2OTLS 4FS1A 3VAFA 4LQ3A 2CPZA 4P75A 2AD9A 1AFIA 1FFWB 4M5GA 4M5DA 1VLYA 1QM9A 3DRSA 1VJQA 1RAOA 2ZM6F 2V4JB 1WSRA 2V8HA 2GMJA 3FMWA 5DQIA 2QC3A 5KFFA 2ZE2A 2AZ3A 2B6AA 1OYEA 4KKOA 1L5UA 3I5BA 1WWHA 5DG8A 5A8KB 1PYOB 2CWXA 1IKYB 3MR5A 2AJ2A 4L75A 1F9FA 4I6YA 2DHAA 2BZ2A 3KLIA 3UR0A 2EC0A 3NNHA 1T9TA 1X4AA 2DJWA 1RK8A 1Q16B 2NSBA 3C15B 3RRHA 4WKYA 3AAWB 1HLWA 3IA0A 5C25B 3NOGA 4PZVA 1ACMB 4USVA 5L9NA 3OFGA 4IR9A 4DL0C 2YWGA 4TU8A 4FN5A 2X1GA 2C2DA 1U24A 1RHRB 2M88A 3EE3A 3MEEB 1M5VC 3CVKA 1Y10A 4USMA 3ENAA 3R5BA 4DMZA 2HLUA 4Y2AA 3Q8SB 2VDHA 1S49A 3AOAA 1FD2A 4HDGA 2GIFA 3UCGA 3WIVA 2KYZA 2KG1A 3RBEA 4PRFA 4YOEA 3POTB 7FDRA 1HL6A 2G9OA 1R8PA 1BD6A 5IT4A 5D0HA 3UCZP 2H4WB 5K5MA 1HWLA 2H9ZA 4XK8C 1NUEA 3DU5A 3NG8A 2YX1A 4YB1P 2LQ5A 1NXIA 1VCTA 3PG9A 4MTPA 4PXBA 1EP4B 3MCSA 1EJ7L 4O3QA 4FVMA 2V0NA 4KH1B 3VQSA 4DZ6A 1L3VA 4Z7YA 1S76D 4G6VB 5DDRC 1PBUA 2RB7A 3R9LA 1J27A 4WK3A 4TU7A 4F3OA 1UL3A 3JB9k 1HNVB 2XNQA 3QRPA 1UTAA 5SZTA 3N6LA 2C3MA 2QLBB 2R7WA 5KFAA 1XMOF 4ZPBA 3DLLQ 3HVWA 1FX2A 3N9UC 4EYIB 1Q7LB 1S5ZA 2HVZA 3FRYA 4LQ9A 2J6TA 4J9OA 4JI7J 2F7VA 3IFEA 2ZOGA 5CD4A 4USTA 3UPFA 4DR6F 1RJJA 2VPXB 1D9DA 4LRDA 3NWGA 3OTDA 3W9JA 3MFIA 1UMJA 1G2EA 1LKZA 1SH0A 4LRBA 1UVNA 1UVJA 2B4VA 2B9YA 3MPWA 4TYBA 4ZVOB 3JS9A 3BR8A 4OX8A 3SFUA 5I3UA 2LKZA 2KFYA 4DFPA 1BGXT 2YWKA 3EM1A 5CYQB 4Q43A 3J7A1 1X9WA 2PI5A 1WI6A 2GQQA 3UWTA 5GADI 4DL2A 2QLJB 5F8GA 2FPHX 4F3MA 4C8OA 4JI7F 2KTQA 4DCPB 2AJ4A 2A0FB 1KLMA 3P5BP 3UQSA 2XNRA 2WONB 3H0PA 3JSMB 2DGWA 3DXSX 4LT6A 1MG7A 5B0FA 2V2VA 3QIPB 3BQ2A 2J7WA 2NXUA 2OPRB 4F3QA 3AJ1A 1NSPA 2DB1A 3H20A 1U7LA 3T6BA 2J76E 4CP5A 2QL7B 4ZHRB 4ECYA 3IBFB 2APOA 5LL6d 3DU6A 4OHVA 5IWAF 1RAEB 4CNYA 2NCKL 1H2TZ 5D8HB 5CZXA 1SBRA 3Q86A 2AEJA 3M6WA 2LXIA 5AE3A 4AQYF 5B0BA 1HYSB 4YR3A 2IVFB 2MQNA 2IRUA 2YX7A 2K1RB 4DG1A 1RT3A 4RBUA 4X4TA 1SKWA 3FGVA 4KKOB 4X65J 3GJSB 1NJYA 2YTCA 4WZQA 1JLAA 2BJ1A 4FYVB 5D15A 5CCMA 1JQGA 3SYZA 1P9QC 1KQKA 3W63A 3PDNA 2DKOB 5DDQC 1N56A 1NBEB 1G6BA 4FF4A 3OR2A 5A0YB 1ZH5A 2DXDA 3R5AA 1HI1A 1WG4A 3F41A 3BN7A 5EUHA 4HT7A 1FT8A 1SJ1A 2DISA 2FHOB 2UUTA 3HKZD 3UFCX 2E1CA 1O6XA 1F2GA 1CG2A 2WK4A 3BS9A 3OUYA 2J6SA 2HBYB 1BHNA 2CQBA 1P1LA 3T19A 4HYKA 1U1LA 4PUOB 1AA1B 4KR0B 1TKTA 2CPEA 2XZTB 3OXFA 3FUYA 3TJAA 1S1WB 4QU6A 2O1PA 2QLFB 2WVEA 3UD5A 1NK6A 1X4EA 1CJTB 1U2RA 3BDPA 4YHHF 5KG1A 1HR0J 1VQSA 3QT6A 4PABA 3C6TB 3HHLA 4LUBA 1OO0B 3Q0AA 1YBUA 4F67A 4K4TA 2J8SA 5JMNA 2MXYA 5KFGA 2DR7A 3PW7A 1D8ZA 1X4DA 4ZCIA 3CJSA 4WYLA 3H7HB 3U7JA 4WF9Q 2FDNA 2PEHA 4M5DB 1QY7A 1W26A 3JSYA 4GVBB 2Q3PA 4OZ2A 4ALZA 3DRYA 2ALYB 4A8QA 1UPPA 1M0SA 3TUZC 4ITSA 1JXLA 4Y2MA 2R9LA 1URRA 2VV5A 5F8IA 1ZS6A 2BABA 3HVAA 1X5TA 1S6QB 2M5YA 2CQDA 1EKRA 3HHKA 3KJQB 2F8MA 4OJ1A 2Y1JA 4JI2J 2HWTA 3CJ2A 1OIAA 2FVQA 3Q8VA 1TAUA 4ZPVR 1IUJA 2OSQA 3MMJA 1R0AA 1DHMA 3DNCA 2UUBF 2HK3A 4K5RA 2H54B 1S1XB 1QUVA 1UEUA 1M90T 3OL8A 4O44A 2QIFA 1BE4A 3TNVA 4PWDB 4K5SA 3KK1A 1KKHA 1X5SA 1BMQB 1Y5IB 2WBMA 5HQ8A 2VQFF 1I94F 2ZDPA 3HHLD 4JV2A 2BQ3A 4XTTA 3M8PA 2P6SA 2UVUA 1MW7A 3G96A 2F63A 4F2SA 2OUGA 4ZVTB 3GYNA 4J9KA 2OSRA 4C8LA 4J9PA 4ECSA 2WOMB 3UNYA 3U1MA 2OLWA 4ZN3A 4ZJQA 1OS5A 3D1HA 2HGLA 5LSRA 4UQGA 3THPA 2BJ7A 3K8VA 3U27A 5IWAJ 4L3NA 4IQXA 2P8IA 2ZH9A 3PX0A 3P3DA 2G1DA 4PWUA 4K4YA 3ZTOA 4WKRA 1N48A 3TOQA 3DM2A 4ETZA 3T3FA 4JI3J 2CRLA 3MM5A 1VQ5S 3CEDA 4NEYA 1RA6A 3SCJE 1VBYA 5C5JA 2B7CB 4PR6A 4KIAA 5AXMA 2VFSA 2YNGB 4DV2F 4GKJJ 2EXUA 1KC8T 1DTQA 2OEKA 3QGIA 3EXYA 2DK2A 1R89A 2MZQA 5IT0A 4FF2A 5D77A 3P5TL 4BCAA 4TY8A 4DQRA 4UY8T 4IRCA 2AQ4A 5IQ6A 3MM6A 4QCLA 1UJ4A 2CNNB 3KLVA 1RU2A 2AGOA 4K50A 2W7AA 3H40A 4FBUA 3D3BJ 1XERA 3MUMP 2VB6A 4FYDA 4OI1A 5CABA 4BWJA 4IRDA 1S0MA 1DTQB 2VFUA 5KTQA 4IO9Q 4DR3F 3SQGB 2OMLA 2MHNA 4WTOB 1B7YB 4KPCA 1YITS 4LSLA 2WB4A 1H3DA 3GIRA 5DG9A 2DNOA 1V5VA 3E2EA 2QEXS 3AJ2A 1S1XA 2YNFB 3TUIC 4QWEA 2BUNA 4X64F 1TV6B 1JLQB 3EXCX 5H1SV 2VFRA 3QATA 3JYTB 1XMOJ 3M6XA 4V1Ak 4QPXA 3SV4A 2E29A 2PDAA 2QLXA 1T95A 2WCXA 3TAMB 3RR8A 1JX4A 1CQMA 2AV5A 3MCOA 3DLBA 1B4SA 1I3OB 1YRUA 2I0XA 5F3TA 1KRPA 4ATNA 3WQPA 5M2UA 2M4MA 5H9FK 1ZAVA 5KFJA 2Z2YB 4GVBA 5ETPA 4CH1A 3D0HE 3DLEB 2FVPA 5E33A 2MB0B 1TELA 5GVQA 5KT3A 5D0EA 4J9LA 3V6KA 4PEOA 5E3RA 4G65A 1ZOTA 1IKWB 4LSZB 2PO4A 2C3OA 3TA0A 5J2NA 2MQQA 2FJEB 3C66A 4ICLB 3ISZA 2HWHA 5A8RB 3MEEA 2A6OA 5K8PA 3GIMA 2DRDA 2DH9A 1RAGB 2H1YA 5DZ7A 3SCLE 3ZZPA 3Q8QB 1GX5A 4B02A 4DR5F 1RCXB 1RUSA 1S6PB 2XYGB 3DXBA 4XPEA 1QAYA 3V4IA 3D6TB 1Y7PA 4J9RA 3WC2A 2XCAA 3M4XA 3CGIA 1VISA 1XWLA 3N6NA 4CLFA 1T9UA 2EWHA 2QSWA 3TWZA 2RQKA 3KHGA 4Y65A 1SB6A 4ZCKA 5A8KA 3FDSA 3FMBA 4K8RA 4LSNB 1GT8A 4WU2A 5CYMB 2F4VF 4P2FA 4PG7A 4O4GA 1IVZA 1VJWA 2V4JA 3L3CA 2KZZA 3VAHA 2ZKTA 4X62F 2HNZA 2QG9B 1RWOB 2YBVA 4WWSA 2EEYA 4QBUA 4MKAA 5M2RA 2BQUA 2P6TA 4DFJA 2VH7A 2MKJA 2DNQA 4ED0A 5HLFA 1KWMA 1PG5B 1OY6A 1HBUB 3LUYA 3OLBA 3MMBA 1OY8A 4ELVA 2AYMA 2OEJA 5GAEI 1RE1B 3B82A 3BGUA 4RU9A 1WG5A 2M52A 1YBTA 3R5CA 4KPYA 4QIWD 1BC6A 4KTQA 1M5OC 5L38A 2X1AA 3I6PA 2IBOA 1FJEB 1HNIA 1YGYA 4RUHA 1H2VZ 2LU2A 3PX6A 3ILLA 5KOXA 2MKKA 4D3HA 2AMCB 1WHWA 2G2ZA 2RF2A 3PXGa 1RT5A 1Q4RA 5K9FA 2OMOA 2ASLA 3QLHB 3HKWA 1WKJA 1S9EB 3M8ZA 4GKKF 2VBYA 3JYTA 2D3OR 1S7HA 3ITHA 4LJMA 4DCOB 4OX6A 1U0SA 1IBCB 5BYQA 5HMZA 1XNRJ 1WTFA 1DZ5A 1NK0A 2LDIA 4I6WA 2A18A 3C6UA 3IBCB 4DV5F 2CPHA 4M5NA 1VI7A 2CNLB 2POKA 2H4YB 2H65B 1V3SA 3DLEA 4X66F 2GJIA 4IDKB 2D41A 1EAYC 5HO4A 3DMJA 5ADZA 2FZKB 1NB7A 2HMIA 1YBAA 4JI4F 2VOOA 1FXLA 3SDEB 1IWAA 2JJ4D 2HNYB 4IG0A 4OFZA 4LF5J 2O01C 4LBPA 1X31C 4FPRA 4BS2A 2VONA 1PJ6A 2MKSA 1SPBP 3J80Y 4H4OB 1MROB 4NMLA 1JWWA 5LJ3Y 4C8NA 2QFIA 2NZ4A 3DHXA 1NPPA 1JLFB 1FA0A 2OPRA 3BREA 3GFZA 2VIHA 2ZHOA 2BV3A 5KFLA 3TVYA 3G9CA 3H42A 2KH9A 5B0CA 2M2BA 2AJQA 3DLKB 5KFRA 3FCWA 1HA1A 4IFYB 5KFCA 1WKKA 5KAKA 1TMJA 3H4DA 1IJEB 3OVSA 1KS2A 1JLQA 2HS0A 4X66J 2FB0A 2MQ8A 7FD1A 2VA2A 2QGFB 3KOAA 2XYHB 2BQRA 4JI6J 1HPZB 4ZIVA 2K06A 5IM0B 4DV5J 3VQTA 3RAXA 1S59A 2FGCA 4R5PB 2VJVA 1H7WA 3LP1B 5CYQA 3QJPA 1U1MA 2FVSA 2HHSA 2CQHA 2FJVA 4OHWA 4P2MA 4DCJB 3OXGA 1KFSA 4H4KC 4RNMA 1GNKA 2RT3A 1DRZA 1HMVA 4B9MA 2HNDB 1F5BA 2AYBA 2YKMB 2FHKA 1NSKL 3A8KA 4RL1A 4YS2A 2UV8G 3W5ZA 4KHRA 3KMQA 4F04B 5IV3A 2MY7A 3HSJA 4FNIA 4USIA 2W9BA 2RDJA 1FE4A 1ICEB 4OYOA 3RW7A 1FJGF 3LO3A 5IXUA 4OX7A 3CCUS 3M30B 4DPWA 3V81B 3FQLA 1NK9A 4IRKA 4XAKA 2C3YA 5KT5A 1XMQF 2CUYA 1KR4A 3DRRB 1S9GB 1WKLA 2HVEA 3HULA 2FLNA 1WF2A 2B43A 2HQDA 3OL7A 2ZZNA 5SUHA 4NRTA 4A8FA 1F6TA 1T8EA 2MEWA 4A8YA 4OV1A 2D3ZA 3DLJA 4DQQA 4R0EA 4KYZA 2FJWA 3HO1A 1XR5A 3C6TA 3VAGA 2XG8A 3T1YF 1K8AT 1NCLA 1C1CA 2HW3A 4JI1F 4Q2MA 1XC9A 2KU7A 4GC7A 3MD1A 4WBFA 4ZVGA 5DM6Q 3CCES 2ZJQQ 1S1TA 1PC4A 4RW8B 3KLHB 3CCSS 4QYZK 1VRUA 3T5LA 1TKTB 2LYVA 5KOWA 1RTHB 3G6VA 1YI2S 1UA1A 5AE2A 2R7OA 4C3LA 1CLFA 5E7OB 1UVKA 4DPXA 3OTCA 1FF2A 2J9DE 5JXSA 3CJKA 4A8OA 5KT6A 1VQ7S 2HIQA 2UU9J 3M8YA 3ILIA 5F9LA 3LTOA 3PY8A 2VOPA 4KGXB 3LH2S 4DPTA 4Y2CA 3BGOP 4QPTA 2ZD1A 5T7LB 4RR5A 1K9MT 3HLUA 1TAQA 4FVCA 3LALA 4CRJA 4MKYA 1NJXA 4K4VA 4RUAA 5IQQA 2ASDA 2E5LF 3QJLA 4QWCA 1DBDA 1HW8A 1RKIA 3JQMA 4IOBA 1M5PC 2V6AA 5FDLB 3HP6A 2B6AB 2LXUA 1GFWB 4IG3B 1BQNA 2BW7A 3BBCA 3CNQP 6FDRA 1RHJB 2MZSA 5KFOA 4DSKA 2R4FA 3L7UA 5I3QA 5B0DA 3SSQA 1T05B 4LFBF 3QAUA 2V5HG 2KO1A 2YKOA 3T1YJ 5KG3A 1YJNS 4QJVA 4U9RA 2ZH7A 2EVZA 5AXNA 2HHWA 4XIUA 3BPDA 1KBRA 3N4WA 2P9EA 2XLIA 2XBPA 2W9CA 3W3SA 4LIWA 1CBKA 3W2VA 3IRXB 2NZCA 1N5YB 1S77D 1CPZA 4CH0S 4P10A 2ATCB 1YJRA 1F5AA 1RDRA 4OV6A 2DNRA 1IBMJ 2BKPA 3KUGA 1KOOA 1P9YA 3EYZA 1RTZA 3MAAA 4GRSA 4LF4F 5CD4H 4DS4A 2JLEA 2CQ4A 4X64J 2IC3B 1Q8LA 1TUVA 2GV1A 2I5JB 4UW2A 3E3XA 4R5PA 3FQKA 1FDAA 3ZZ0A 1M1KT 2R2UA 3OL6A 1M5HA 4C0BA 1U1KA 2O67A 5DQGA 3ZZUA 1MNEA 4NLOA 2FQQB 4Y6IA 2DITA 4WJBA 3Q8PB 1JXVA 2XY5A 2MZRA 1LFPA 1GMWA 1RWXB 2BBEA 4HLBA 1M1HA 4M5LA 1WACA 2HAIA 1JKHA 4WXOA 5G4DA 4DJBA 1HWIA 2V63A 3HI9A 4TXSA 3GYXB 2N7CA 4YR2A 3EDQB 1FDBA 1VR6A 5L1IA 1X4HA 4DUTA 2ZBRA 2UZAA 2VBXA 3T6JA 1GXLA 2EW9A 2GVZA 3CJ4A 4P74A 4X4SA 2YKMA 1I5OB 2W24A 2D7SA 4K0KF 3GV5B 2JSXA 3AOCA 1TKZA 1E6VB 4M5HA 4DZDA 1TU0B 2AYEA 2IM0A 2ZVIA 3MR2A 2CPYA 3I32A 2W9BB 2CPXA 2YPZA 3T41A 3GTYX 3NBPA 2XGPA 4YR0A 4DV7F 3QJJA 2OFHX 5HATA 4LF5F 3UDLA 3KUHA 2CWKA 2HFNA 4JI4J 2SXLA 3KKFA 3M7VA 3M2UA 4IYQA 4ZOSA 3OVAA 1H0HB 5HJXA 3WHIA 4LF8J 3R97A 1XEZA 2IJRA 3CCZA 3MMAA 4MMOA 3UDEA 1C0TB 5D0GA 5GADU 3K5NA 4URQU 2ZH8A 2XMMA 2WB1D 2G0JA 3M05A 1MWZA 3EVWA 4OYAA 4J5OA 1YWXA 4IFYA 1UFKA 4O3RA 4M5KA 5EWGA 4RNNA 3QZ7A 3FK4A 4Y2KA 3GG1A 1XQIA 4MKVA 3JAMY 3B78A 4O23A 4FNHA 8AT1B 3GILA 2HBRB 2W4CA 4AUKA 5L1JA 2B5JA 3MZIA 3IG1A 2W25A 4KJIA 1F3FA 4HEA9 4HR2A 2NS1B 3OTOJ 2HHVA 1U8SA 3VGTA 2HURA 4TQSA 2IBKA 1KTVA 4F0MA 1JMTA 2E5HA 3JSRA 2MYFA 2MZ1A 2RSQA 2E66A 2VPYB 4N47A 1JNZB 2IHR1 4ILLA 5C25A 2UVWA 1BXNA 4KO0B 3HT0A 5HVFA 4DV0J 4RJVA 5H9FJ 5I3UB 4DF8A 2IA0A 2IA6A 1FKOA 2CYYA 3H2UB 4NYOA 3I5CA 4DBQA 2XSJB 1RLCL 3KG0A 4KC5A 1T03A 1PO6A 3LW5C 1D0EA 1QE1B 2GC8A 4Y3CA 3BDEA 4ZA1A 1G4CA 1WI8A 1HNWF 3UVJB 4MKBA 5AXLA 4CTAB 4ZMMA 2AGPA 1X8DA 5KFHA 1N36F 3TVKA 3BEGB 1TK0A 3KXDA 4DQIA 4O4RA 1RT2B 2BANB 1N6QA 4AFFA 2F4VJ 4MK7A 4EU0A 3DFEA 1YJVA 5AXKA 5IC4B 3PHEA 3D9BA 5A76A 2NPIA 4K4UA 3Q83A 3KK2B 4F7VA 3EX7B 5KT4A 3MR6A 3BF4A 2KB2A 4OYXA 3W5YA 4P72A 4RNOA 3OTOF 3BJYA 4J9MA 4ILMA 2RRAA 1RAFB 3T5JA 3VGSA 1Y9OA 2VBWA 1QE1A 2OPSB 1AXQA 2EPIA 3DOKA 3ZC4A 5RUBA 4ECUA 1S9EA 2D1CA 1J5OA 1YTYA 3E01B 2B4OA 5D0RA 3ZTRA 3CC2S 1Z4UA 1RT7B 4DV6F 2QT7A 4HL9A 3UD3P 3N28A 3N79A 2CPJA 1MSWD 1QDUB 1Q1KA 4MYTA 5IC6B 1Y0HA 4NZ7A 2OAUA 2BX6A 2W7OA 4C9DA 4X65F 1TP7A 1C4CA 3KHHA 3DRXA 2GIQA 3FKBA 2JRSA 2ZUGA 1QVFR 1OMSA 2V9WA 1R6YA 1VIXA 3FFIB 3LQVA 2P9CA 5IT9Y 1BLUA 1FRIA 1ZM9A 2DPIA 3FVYA 4XDDA 2JX2A 2HQCA 3OR1A 4EFAC 3MEDB 2C2ZB 3OUYB 2J6UA 1RTDB 1TL4A 2JHEA 1REVB 3TP2A 3CUNA 2HQGA 3DHWC 4HI2A 5LT5A 1TFWA 2HAFA 3HHEA 1EB0A 1U09A 3EVOA 3ZZYA 2GAHC 5EGYA 3QSYB 4KV8B 4RW4A 4FDFA 3WZ0A 5DDPC 3VGUA 4F4YA 1V3ZA 3V4IB 3W64A 2QO3A 1D8YA 3IG1B 5LOQA 2ZZMA 3NS6A 4DL6A 4ZVQB 5DJBA 2G1HA 3C2PA 4IFVA 1FWKA 4BC9A 3KG4A 1LW0B 4DR3J 3OXLA 4YFUA 4ZS6A 3PJWA 3CCJS 1NJIT 1RBAA 3OW2R 2W1BA 2XWXA 2ZHBA 3A8IA 5C42A 2MLXA 2WONA 5HVHA 3MUTP 3GMGA 4WE1A 2Q79A 2VUGA 1RXOB 4NLDA 1FNMA 3LA0A 1RBOB 4K2XA 4EI2A 3GQCA 5DGAA 2DRBA 5D4LA 3H98A 1IKXB 4C11A 2IPOB 3HZEA 5F9NA 5GAGI 3P4UB 3ZTQA 4CWBA 3V6JA 1VQ4S 4U96A 3FCVA 2RE1A 4JUZA 4DL5A 1S10A 3KK3A 1K73T 4UQTA 4QW8A 2I8EA 1N34F 5KT7A 4PXDA 1D09B 2N3LA 5KG4A 4ERDA 1X9MA 1SJFA 4WIIA 1DARA 5DQHA 4ZN1A 3MM5B 2ACMA 2LLZA 2KT5A 2ZBPA 4Y34A 2FC9A 4RBVA 4H4OA 4HH0A 2VG7A 3R27A 4LR8A 2B51A 1VK3A 4M5IA 2JVRA 2MJNA 4CYUA 1H74A 2B5JB 2P9GA 4Q5VA 1U47A 1RT4B 3G2XA 2AF6A 2GHVC 2DNKA 2GGPA 1SCJB 3BKTA 1WOOA 3M6VA 3PEJA 4QIVA 3SDEA 3W7BA 3OHBA 4C8ZA 1FRMA 3ENWA 2V9KA 4NWBA 3MOJB 1AUSL 2IM1A 5I4MA 2BJDA 5KG0A 1X4BA 4G1PA 4X4RA 5D4PA 3AXKA 1RHQB 2MSTA 1UA0A 1S72S 3BSAA 1UP1A 3M1VA 3HM9A 4PPZA 3QIDA 2AGQA 4B9LA 4MK8A 5BYSA 2RU9A 3W2WB 1YJWS 2E5GA 4K4ZA 1IXKA 3HJVA 2C2OB 4NLVA 1IR1A 2GFFA 3HCXA 4M5MA 2HRTA 1WTBA 2V67A 1UJ5A 2ROEA 4MT1A 1SIWB 3BV8A 5A6PA 3C16A 3Q22A 1I94J 3BGFA 5HJYA 3X1LB 4MFBB 1LWEB 4CT9A 1B7FA 3GJRB 3X3UA 3BBFA 2EC2A 3OQ2A 4RW4B 3PVXA 1VQPS 3FBCA 5LMNJ 1IKVB 1DAXA 1X4FA 2DIVA 4KFBA 3J7AN 4IQMA 2VC1A 2AEMA 3MDFA 5D4OA 2A2CA 5HAOA 1NJWA 2V68A 4OYPA 1REVA 1PSDA 2RUSA 2C2RA 1SV5B 1R0AB 2UU9F 1CJVB 3QT8A 1HNZF 2KJVA 2VKRA 4O3NA 1PJ5A 1R8AA 1YK9A 4QWDA 4KV8A 2W4DA 2D69A 1PIEA 2YNGA 2RVJA 4USUA 4NOHA 4WPAA 1HD1A 1RISA 4ZVUB 3GIIA 2E9ZA 1I6JA 1R8HA 3LAMA 4NLQA 2XMVA 2DHXA 5KFIA 3VHQA 5GAHI 4ETXA 2QL9B 3R1HA 2N7YA 3FBEA 3KLFA 4J37A 3OR1B 4MK9A 5JVHQ 3M9NB 3UO0A 2DO4A 2DY9A 2HZVA 4CT8A 4JI1J 4P7VA 1CC7A 3CCWA 2J0XA 1T05A 2HQFA 1F9EB 1KHVA 3C15A 3W60A 4CI0B 5T7LA 2ZM6J 1HR0F 1KEKA 2XLKA 1D9AA 2O3DA 3PR4A 2XMUA 4HHHA 5ETNA 4DLGA 4KGZB 4DSEA 3PO4A 4NL5A 2DBBA 2I5JA 2EI5A 1GQEA 1CJKB 3AA8A 2X1BA 3KJVA 3B54A 2H5EA 4ZITA 3RAMA 4NA2A 4LF7J 2XEXA 1AYEA 2AX0A 1FJGJ 1WOPA 3AD9C 3J81U 2DIUA 3A13A 1ZM2A 3TZWA 3HJFA 2KJWA 4DL4A 2FZGB 4DDFA 1L3UA 4ELUA 4JV5J 3NMAA 3O44A 3SIPB 3MEKA 4JOUA 3MCMA 3N5BA 1UZHA 2CPIA 1TR0A 2GA7A 4X84A 5FLXU 2FLLA 4DG1B 3CJ5A 1UZDA 4GO5X 3JQJA 4DL7A 2PGCA 1IKWA 3A3OB 3CO0P 5J2MB 2IYIA 1Q82T 1IR2A 2E7WA 2CZ4A 2ZEJA 2KRBA 4USJC 3Q2TC 3I5AA 1FJ7A 3LPEA 3MMBB 1FKAF 4CQ1A 3OTEA 4PAAA 4H4MB 1SIZA 4DHVA 2QA4G 1RA7A 4DL3A 4OZNA 1S1UB 1IJFB 3PZPA 4KHPF 1C4AA 3KDOA 2EBEA 1T9VA 3TZZA 2BKOA 3CWJA 4EBCA 3TAQA 1VLOA 2WRMA 4ZP6A 3NAIA 3SQGA 3Q8RB 3MMCB 3HXMA 2JOQA 1SJRA 3MHYA 5C2CA 4YN3B 2MY8A 5HQLA 5HROA 4ED3A 1O0PA 3PW0A 1SI9A 1MU2A 3CO9A 4ANCA 1N52B 2DGXA 1GTEA 1K1QA 2ZZTA 3KG1A 4NLUA 3CJKB 1SXLA 3IS9B 2BM1A 3EGNA 3FBBA 4Q8FA 4NMXA 1NDLA 3PYGA 4ECRA 4JV1A 3EGVA 1OSCA 3O5TB 1HARA 1LEOA 1JLBB 3GP9A 1DTTB 1RWNB 2D74B 1B99A 4I2PB 2OO4A 1FRJA 4KE5A 5F41A 2JC1A 3B6BA 3RGIA 1Y5NB 2QSFA 4WFXA 2YX4A 2J9DA 5F8LA 1T11A 4ECXA 3D1OA 3MXHP 1YJTA 4OJHA 3W2WA 3H59A 3KLGB 1LWCA 5KFZA 1AT1B 2ZVSA 3TANA 3BB5A 3QGGA 2KI2A 4HVZA 4JYAJ 2R7TA 1AW0A 1NU4A 4PG4A 2XHWA 3CPWR 3NL0A 2RS2A 2UXCJ 3RJMB 5LSOA 3BGRA 3K8WA 3OPKA 2HS3A 3Q89A 1O8BA 4B3MF 1CJVA 2ACYA 3M2VA 1X0FA 2JEJA 3BR9A 3PV8A 3D66A 1N8RT 2HHHJ 1HQ2A 2PA8D 2MKCA 2XS7A 2B9EA 3CMQA 4I1TA 4H54A 2NYIA 1VQNS 2IRXA 3B8HA 2I9SA 4HT5A 5HBMA 3GV7B 1KQSR 2R7VA 5CCLA 2PFDA 3HD2A 2AKWB 3C16B 3FEYB 3J7YI 4I2QB 3I0SA 2QFJA 2ADBA 1E6YA 1U1NA 2IMOA 4NXMJ 1V3RA 2LQJA 2XMAA 3CCVS 2GJFA 3PJXA 2O66A 1S4FA 3HD1A 4NI2A 1YIJS 4QWAA 2BKNA 3F56A 1SH2A 1OWXA 3KMSA 1VQOS 4LFBJ 2QLWA 1XNQF 1FRHA 1YSJA 4ZVEA 4F26A 1HQEA 4KB7A 2WW8A 3GV8B 4L72B 4OIXA 4AXIA 1B0VA 4UUXA 3ZZZA 4UOHA 4DU7A 2CPFA 5KFXA 5B7WA 5EDWA 3ZO7A 2DH7A 2ZBQA 3T1HJ 3NCQA 2KRRA 2QMUB 2YWFA 2R8JA 4TY9A 1CJUB 2CFXA 3PW2A 1RTJB 2B8QA 5K8OA 2GVZB 1TMMA 1UJ6A 2CQCA 2W01A 3PR5B 5ETVA 1HFEL 4ID8A 3QGHA 5DDOC 5HMWA 4DUZJ 3T5HA 4Q2LA 2BACA 2NXCA 1X7VA 3D6HB 3H5SA 3I82A 3EGWB 3SSSA 4IH7A 4M8LA 5U47A 3WC0A 5BJRA 1HD0A 2RUGA 3UDCA 5ETOA 1UVLA 4H4MA 2VC0A 4B3OA 5LMUF 2OD4A 4EZ9A 4AL5A 4KSEB 2DEJA 2F5GA 2OFGX 4J9SA 4TVAB 3Q8YA 1DTTA 3FJ2A 4E0DA 2COLA 3KJNB 2LP4A 3LGNA 2LU1A 3H25A 2VG6A 4I67A 2MKHA 3I4PA 3O1LA 1V5IB 2D9OA 4U7UK 2V94A 2MGZB 4NLGA 1R8CA 3AT1B 1AROP 1S48A 2DGTA 3UN2A 2M0GB 1JLCA 1SUQB 3GPAA 3HF5A 3SEOA 3V6DB 4NCAA 1XMQJ 2IIHA 3BYRA 4ID5A 3CMAS 1NSAA 1VQLS 1TK5A 1HWKA 2DPJA 2ZHAA 1U25A 3HSGA 2DCUB 3IR7B 1PBAA 3HFVA 5HMYA 4ZVPB 3SBMA 2OPQB 2Q43A 4IH5A 4KY3A 4QYZJ 4G1IA 2R2TA 1S9FA 2MLZA 3IGNA 4F4AA 4F50A 1KOHA 5DRKA 4URSA 2ERRA 5F8HA 3G87A 2R42A 4A46A 1NKCA 2Z58B 2PN6A 5THWA 5BXIA 1L3TA 5K8MA 4CLYA 2XZWA 3QYYA 1BQNB 4J91A 1S99A 2CZ9A 2A6MA 1RWVB 2EBGA 2YH0A 2W9CB 4B3RF 3RBZA 4DR2F 4FP9A 4M1KA 1RWPB 4N8OA 3GU0A 2OEMA 3J81Y 4OYIA 3AA9A 3G6YA 1RT7A 4NLXA 1BUXA 5I42A 3KTQA 2VASA 5IS2A 3MR3A 2OIHA 1U0HA 2WZ1A 2GCFA 1IKYA 2C3PA 3OT9A 4YMEA 2HRUA 3VR1A 1ZTTA 1HNXJ 2E9RX 4PWWA 2RKIB 2PA3A 3ILOA 1FKPA 3PW5A 1U8WA 4HHJA 3BKFA 2LQBA 4YY3J 3EDRB 3CD7A 3D28A 2PIIA 3G8TA 2DNPA 5G0RB 1UWBB 2XY6A 2JH3A 4NLTA 2PC6A 3DN9A 4EBDA 4NYPA 3CF5Q 2IM3A 3BH6B 3L95X 1HMVB 3NS7B 2GAGC 4L3KA 2JFKA 3HK2A 1N32J 4NLPA 1LWXA 1B0TA 1Q5YA 1LFWA 3MD3A 3RBXA 4PYAA 4YUDA 4NXNF 3MECB 2VG6B 4RKUC 4DR1J 4A8WA 4UZBA 1WHXA 3TJ9A 4NPOA 2W2NP 2EFGA 1CS4B 2V34A 3TAMA 1CJUA 3K5PA 3RB3A 1YVFA 3QWPA 4HH1A 2CDRB 3M8RA 4WFZA 2V2KA 4ICLA 2C42A 3MM6B 3MI7X 4XDCA 1DURA 1N33J 4AT1B 4HI1A 4RU2A 4UOFA 1XNRF 2VQFJ 4RBTA 1EIYB 3AODA 1QUPA 4OHZA 2VQEJ 2G0IA 4JI0F 4GKKJ 3B4DA 2CXEA 3L7PA 4CDIA 3ETOA 4GO7X 1LXNA 4I0WA 2AJ0A 1SKSA 1A9NB 2L48A 2Z2MA 4B08A 1TVRB 3PCOB 1FTRA 2CPDA 4JI2F 2DGUA 4OI6A 3W5XA 1MWQA 1KVJA 4LSLB 1GMWD 1RHUB 2OD6A 3DDNA 3HZGA 2M8HA 3M2UB 4G1QA 2CG4A 5HMXA 3I9ZA 4UF4A 1VHIA 2ALZA 2ZFHA 2LXFA 2C22A 4OI0A 5LXRA 4QOTA 1EKSA 1LK5A 1WHVA 1F1BB 3CT9A 3GJTB 3IAM9 4CCHA 1W2IA 3ZXWA 1M5SA 5J1EA 4EYHB 4F2RA 3KNGA 2KXHA 3K58A 3P45B 3RR7A 2J9CA 1B70B 4Q0BB 3FSXA 5L8RC 5AE1A 1Y3JA 2ZNYA 1RBLA 3TUPA 5B0AA 2C28A 2VKZG 2NYHA 4WFNQ 3O8WA 2X1FA 2XQCA 1HW9A 2Z2LA 1HBOB 1MN7A 2YNIB 5A8WA 4YP3A 2HHXA 3NBPB 4WFYA 3TRGA 3J81j 3PX4A 1DLOA 2RRNA 2HIYA 3PJ9A 4OZ0A 3RRGA 1HNIB 5J1EB 2RKIA 4OZ1A 3C14A 2IAJA 4A8SA 2V8DA 2RILA 4Q44A 3KFWX 4N8NA 4Y28C 1FNXH 4ED6A 1YQHA 1T02A 3ELHA 2VG7B 3MPUB 4NLRA 4RW7B 4WP3A 2EFPA 4A8KA 4DR5J 3IRXA 3THVA 4OLOA 1SL2A 3DLGB 3HPOA 2JZ5A 5ETTA 2CAJA 3W62A 2F9DA 4RUCA 5F8NA 2GX8A 3GE9A 4PG5A 3AQPA 2ADCA 1RAIB 5EX0A 4DX8H 3KDNA 4LVNP 1NH8A 1QTNB 5K14B 3ULHA 1TKXB 1K44A 1XNQJ 2KT2A 4MJKA 4TYAA 2EFVA 3OFHA 1WNEA 3VWSA 5L46A 2JEIA 2ABYA 3US5A 1N5QA 4EGLA 1Q86T 2VPZB 2MTLA 4X4NA 3HHLB 2GVDA 2DHHA 1V6HA 1Q0NA 2PE8A 2PT0A 4KGKA 4F0KA 3KK1B 3H5YA 4OYWA 2V69A 5ETRA 3VAIA 1WEZA 3ICLA 1N5TA 2B56A 5KFSA 3D5MA 3FSIA 2CNKB 2H48B 5HP1B 2C1EB 1URNA 4ZPAA 3K0JA 1NK8A 3QAEA 4ANDA 2OPSA 3AB2B 2QMWA 4CO4A 1RACB 4ECZA 1SJQA 2W7PA 1S6UA 2EG1A 2X7IA 4B3MJ 4ELTA 4RW9A 1I51B 2RH3A 3BM7A 1Y11A 2QJ3A 4C8MA 4W4MA 2ZWPA 3D68A 2ZC3A 1N34J 2WAQD 3GJQB 3K89A 5KFNA 4JYAF 3LP2A 3HSZA 1UVIA 1IBKF 2J8AA 5FLXY 3DRSB 1KVIA 2DNHA 3DOLA 2MZTA 1FE0A 2NXJA 5J2PB 2E5IA 3TQEA 2ZH2A 3HVTA 1FNOA 4OYBA 5D3GA 5KG7A 1WG1A 4OX9F 4C8KA 2XSJA 2V8GA 2PMWA 4DPUA 3DLHA 1WDDA 1X5PA 4X4VA 1KP6A 3H5UA 1GMVA 2V2ZA 3IMQJ 4ES3A 1ELOA 4R25A 3OL9A 3DRRA 3R2DJ 3DKDA 1NHVA 3BGLA 2Q66A 4DV2J 1FTCA 4A8XA 2FIUA 2H5IB 4Y00A 4L74A 1TL1B 3M32A 3NGRA 3QRRA 1CJKA 2HVDA 2R8KA 1UETA 2DT9A 3K59A 1KFDA 4UUWA 1WEXA 3MAHA 3KK2A 5H9EJ 1AUDA 1AFJA 2HHTA 1AZSA 2HGMA 3MPDA 4LIRA 4ZPTR 3HHDA 4ILRA 3CC7S 3SI8A 4KHPJ 4C0OC 3CULA 1JB0C 1WC6A 2NQPA 1GXUA 4KGVB 3Q8UA 4LF1A 2B7BB 2ZWOA 1B64A 3ZFVA 2EK1A 4J9UE 3LWLA 3CD6S 4BBYA 4RO0A 3LP1A 3HFKA 5A8WB 5LJ5Y 4P6QA 2HVHA 5KFEA 1IBLJ 3BPSP 2CQPA 3MF5A 3UNGC 1S12A 4U95A 2GGPB 3KLFB 4OZ5A 3R7BB 1S1TB 4DV6J 1NK5A 3BQ0A 4LMZA 1RCOB 2ZH6A 5HK4A 4KO0A 2HBZB 1LV5A 3VVTA 3TZXA 4U7CA 2M8DB 3NP5A 4IH6A 3AFGA 4JV5F 3MGJA 2FY8A 2K3IA 9ATCB 2LEBA 4ZPDA 2V2QA 4DF4A 4OJ3A 3VZHA 4N7TA 3P6YC 2R8HA 3J7YU 1NPKA 4DV4F 2ZUAA 4I64A 3BGRB 1VQMS 4E8UA 4LF7F 1HBMB 1RP5A 3ISNC 5F0UA 1WC0A 2M70A 2YNFA 1YRXA 2KYXA 4FYYB 2E44A 2ZH5A 2J5AA 4YQWA 1T3NA 4B9SA 1GEHA 3IC1A 1TVRA 3Q23A 4K2JA 2Q6BA 3ILJA 2FHJD 2AEFA 1Q81T 3NGTA 2Y0BB 4J9QA 1HQEB 1Y00A 1NH7A 3FC9A 5ETQA 5D6GA 2MQPA 2GO9A 4QW9A 3G71S 1TKDA 2DXFA 1VS3A 4NA3A 4WE1B 3WX4A 2ZOMA 4I6AA 5KFQA 2B4PA 3W1YC 2ZH1A 3LANA 4YHHJ 3W66A 3ZNUA 4NI2B 4MAKA 3VVUA 3PIPQ 2KZMA 1JJCB 1S1VA 2VL1A 3BKUA 4FYWB 4ZP9A 1QSYA 2WVDA 4O3PA 1QJHA 3PW4A 3T5KA 2VG5B 2GHPA 2AJFE 1HNVA 2IYGA 3M2RA 1HNZJ 1RT4A 1S7IA 2DYAA 4WU3A 3GONA 1Z2LA 2BA9A 3EJMA 4DV4J 2ZBCA 2F3JA 3H4BA 2ASYA 4L73A 2L41A 3AD8C 1EP4A 3RW6A 1S97A 1J5EJ 2YY3A 4AL6A 1H73A 1IM4A 1S79A 2BOAA 2IVMA 3DOMB 1CQNA 3MOZA 2JVOA 4RX6A 1IWGA 2IC3A 3ZTPA 2CVEA 4DR4F 4EBEA 3E51A 2NSCA 2J0WA 4W98A 5E0OA 4PXEA 2DRAA 3PYFA 3OTBA 2FC8A 3BBBA 2HNZB 2XTJP 2UXDJ 2AZ1A 1X9SA 2V50A 2YWHA 1TFYA 4AL7A 3QBCA 5CAAA 1IBLF 3LP2B 4EEYA 2W2PP 1HBUA 4ES2A 4ZDNA 1VC0A 3GCWP 4AQYJ 1G1XA 1RZMA 4RW9B 3A8EA 4M5JA 4N56A 3GR0A 3PEHA 2RHSB 4NXNJ 4C8YA 1ZPVA 3DI6A 2MQOA 2FTRA 1NNDA 4LFAJ 3MWBA 3IWXA 3OFFA 1UKUA 2WSCC 4K4XA 1NEEA 2VU5A 3S1TA 2WVBA 4DV7J 3MTKA 3DC2A 3KUEA 2HG4A 4R8UB 2PMHA 4OQJA 1GK8A 3OFEA 4ID5B 1Z1ZA 1HWJA 5HP1A 1RI7A 3DI6B 2KG0A 2HFZA 5J2MA 3M8SA 1TZ0A 2HZAA 1IQZA 2E9TA 3OJSA 2FZCB 2LFVA 3SCKE 4PG6A 1OSDA 2LA4A 1QTMA 4HACA 1K47A 1Q78A 5I42B 2CJBA 3PTWA 2LECA 3QFWA 3AQOA 4OI3A 4ZVHA 5AT1B 5J1PA 3SMZA 3TR5A 3J80U 1RKJA 4DWIA 1APSA 3NNAA 1TUGB 2BE9B 2MGZA 4CH7A 3NMRA 3R5GA 3CCQS 1SVDA 1TUWA 1S1VB 2Y9HA 2KXFA 2R3VA 1UEKA 4F8RA 1UWAA 3K2YA 1OY9A 4PG8A 4LF4J 3E01A 2ZJPQ 4ED5A 4IO1A 1Q8BA 1PYSB 2K7JA 2CJ9A 5GAEU 2I2YA 2IJFA 2KVQE 3HX9A 3CTRA 1N0UA 1NM2A 2V8VA 3MR7A 4ENOA 3D67A 2KKHA 1NDCA 1FJCA 4Z7CA 1RTHA 1V9OA 2BJ3A 1X4CA 5E3PA 1LW2A 3BZQA 4ZLLA 2MZJA 1W7WA 2HRYA 4TLRA 1TL5A 2KL8A 3M2RB 4OYZA 4F25A 4KQZA 2YKPA 1Q5VA 2W9AA 4PKDB 1P27B 3LGMA 1VOMA 3RAQA 2X51A 1QD1A 2BW2A 3IR6B 3DOMA 1H98A 3M8QA 1T94A 5B08A 3OJUA 3EWGA 4RLEA 1RT6A 3P49B 1FWPA 1TQLA 1XR7A 3FEXB 2B3TB 1HBOA 2YNIA 2EFNA 3D7SB 3NXZA 3TA1A 4WFAQ 1YRTA 1K1SA 4DSLA 3JAMU 2WW4A 3G86A 4DUZF 2R7SA 2XI3A 1C1BB 2YKNB 3PFEA 2HNYA 1KTQA 2DGSA 4N77A 3D2WA 2NXNA 4M63A 3I0SB 4KT0C 4B3SJ 3GG0A 3GFHA 2HFUA 4FXVA 4O3OA 5GMKa 3UI3A 1N36J 3QSIA 3S6EA 3IXQA 4U67Q 2HFOA 4CNZA 1T3OA 5HL7Q 2IM2A 3W8GA 1HNWJ 1RWKB 1Q79A 3TO8A 3M8PB 3NCRA 1H38A 3KLGA 3A1YG 4F4KA 4UY85 3G6ES 7AT1B 1B3TA 3GSDA 1DFDA 4O0NA 4UTGA 1G3OA 2WVFA 3R6GB 4ER8A 3ITHB 2FVCA 1ZAWA 2Z0GA 4P52A 4DSIA 3CCRS 3D6FB 4AYBD 1VQYA 3S01A 3CXCR 4B3TJ 4FS2A 1U6ZA 3IWNC 1YLXA 3H2LA 1O51A 4KAIA 1FXRA 3HVRA 3L9ZA 5HI7A 2N4CA 4E2FB 2GQ2A 2BYCA 4TY8B 2WVCA 3VAJA 2DNMA 3M2VB 1A6LA 1ROFA 4I2QA 5HROB 3J7Z5 2CJQA 3V5RA 1KN6A 4IDKA 2XC9A 3NEKA 2VQEF 4U8YA 2XB2D 4J9VA 4ZJOA 1XJWB 5AJ3F 4DX6A 4TQRA 4HACB 5GAHU 1LWFB 4ZCMA 1BQXA 3RYLA 1SQEA 4DUYF 2YQ3A 3HVTB 1VC6A 2PI4A 3OBIA 4U7UD 2DGVA 2AHOB 4AE5A 1XTZA 5KG6A 2LQ8A 2CADA 1DY3A 2YNHA 1RB0A 3CD0A 3GFYA 4O44B 5KFYA 5KG5A 2FLOA 2YKAA 2HHUA 1UEVA 3CC4S 2K8GA 1H72C 3POTA 4AXJA 2BVZA 3M8QB 2W8KA 4K59A 2I6WA 3KLEA 3OD2A 4DR1F 3C3LA 2ASJA 1HBNA 3IM8A 2EFQA 1PAEX 1D3WA 3LPYA 1EETA 2CZVC 4FXWA 1U02A 5IT9U 2XMTA 4DN9A 2FJAB 1K0TA 1GAOA 2Z57B 4CO0A 1CVJA 4ZKAA 3CJ0A 1GMUA 1Q53A 4IOAQ 3CE8A 3HHLC 1P1TA 1NSQA 1DQAA 3AHPA 3PHTA 1R43A 2Z4PA 2OHDA 4PXCA 4USHA 2UVVA 5ETMA 1JK9B 1LOUA 1SKUB 5E3QA 3VAKA 3LP0A 3QFHA 1VQ9S 3K7RA 3L4BC 4LBHA 1U49A 4I7FB 4IFVB 3L09A 1RT3B 4Q7AA 3ZZTA 1OPIA 5ETSA 1QVGR 1H2UX 4URGA 4CIOA 4DLEA 2CDQA 5HQMA 2YKQA 3TJ8A 4EZ6A 1HHSA 2K2PA 1N5VA 2M7SA 3K5OA 1KVKA 4LBIA 3NRBA 4E98A 2DGOA 1LQ9A 2BJEA 1RAHB 3H90A 4TKTA 3BSNA 1T9YA 3NKYA 1R0BG 2MQMA 3M30A 5FDLA 3FBFA 5BYRA 4UOGA 2R7XA 4C48A 2OJ3A 4HDHA 2CJXB 2DNZA 1U0HB 3I31A 4DUYJ 2YPYA 3LP0B 2VFVA 2VBZA 1FK9A 2K7KA 4C7QA 4CM2A 3TZYA 4FZVA 2ZOFA 4DEZA 2NUUG 1U1OA 2Q1LA 3OR2B 2UUAF 5KFTA 1I1GA 4MFBA 2BRLA 2BJ9A 2XGQA 1S6PA 1Q7YT 2HFVA 2BRKA 4DN0A 1CJTA 1R3NA 2FJBB 2XO6A 2VJUA 5ETKA 3KJFB 3MEGB 3W9HA 4P71A 3NGUA 2K1RA 5IFMA 4OL8A 3CDEA 1RHMB 3CDUA 2FGOA 2DR6A 1NO8A 2XHCA 1CEZA 3R6LB 1YJUA 2CQ3A 2G2YA 1T0TV 2BJ8A 3GZ7A 3V4MA 2R2SA 4QR0A 3TYTA 3RB0A 4W92B 5A2QY 4B3OB 2DCLA 1N0VC 4V19J 5IOLA 2UXBF 1HBNB 5IV4A 2OTJS 2AP6A 1GTHA 1RAAB 4ANEA 1WF0A 3C8YA 4I68A 1FHTA 2HS4A 3MUVP 2YWEA 2B8PA 2ZDOA 3CJQA 2C2NA 4WIQA 4CO5A 4ZK7M 5LMUJ 2OPPB 3MM8A 4X2BA 2R7QA 3D1QA 1FWLA 2GS8A 2ZC4A 4DV3J 4DQSA 2JC0A 2VG5A 1T7PA 3CJRA 2E7VA 1F0XA 4UZCA 3Q2SC 2GNKA 1FXDA 3MM7B 4FKYA 1VBKA 4D3GA 1YJ7A 1HBMA 1UCNA 5J2QA 4PQUA 4JI8F 5LMNF 3UDVA 2PMZD 4DFKA 3QO9B 1VC5A 1RAJA 2JFDA 4YB7A 4LVOP 2H5JB 2ZITA 3QIPA 5KFKA 2E1AA 2FHMA 2WOMA 1JLFA 1U2CA 4HTJA 2BDPA 1MN9A 9RUBA 4CO1A 5JVGQ 5DM7Q 3DMJB 3ZNJ1 1JXEA 2ATLA 2PD1A 4P7TA 3VF0B 4QIFA 3EPGA 2BOPA 3GIJA 1FRLA 2UXBJ 1WEYA 4DU8A 5C7PA 3QLHA 1U1PA 4P9SA 2KM8C 3LF0A 5L39A 3VTIA 1FVQA 1LK7A 2GZOA 2QV6A 2WSFC 2RQCA 4EO8A 3R1LA 2E7XA 3I96A 1F3VA 3HDSA 3PRBA 5DZ6A 3NGDA 3CSKA 4NXMF 3DYAB 1RT1B 4DSFA 2B0GA 4Z2XA 4JB8B 1SH3A 1WC3A 3GLJA 4C6AA 4K7QA 1A0OB 2O5DA 4DOZA 2HSEB 4X4UA 4Q8EA 2DR8A 1GXTA 5L1KA 2QTWA 4PWDA 2HGNA 6AT1B 2CVIA 1KQGB 3PIOQ 2UUAJ 1OJ4A 3PKMA 4LRAA 1EARA 2GO8A 5FIIA 2UXCF 1CULA 4IKAA 3RG6A 3WBZA 2IDLA 2RF2B 2RIJA 1N5YA 3IWLA 2JL9A 4YDXA 2QA4S 2DHGA 2L9DA 4JV0A 1WELA 5KFBA 2JWNA 2XSFA 3QZ8A 1QLNA 3OVBA 1ZA1B 2NPFA 3WX8A 1TTHB 3RB4A 2U1AA 4FBTA 1NRKA 2ZE2B 4V19X 2D3O1 2LMIA 2R7RA 2IDEA 4U8VA 2XMJA 4P2XA 2QZ8A 3PO5A 2Q6CA 4USKA 4ECVA 2A3JA 2FVRA 4F36A 3VZIA 1FFGB 4CLTA 4AD6A 4B9UA 4NLSA 4N5SA 1S1UA 4QWBA 2HYIB 1EETB 1FRXA 3A12A 3VAMA 4KGMA 2XY7A 1U45A 2E1RA 2UUCF 1BWEA 1VMBA 3IAS9 2E5JA 2EK6A 3F0NA 3MMCA 2YQ0A 1UPMB 2CQ0A 1YHQS 3LOUA 4ZLPA 1FVSA 1EQMA 1NPRA 2LQ9A 3VALA 2HZCA 1TKXA 4I4BA 1JLEB 4NYZA 1TL7A 3CB4A 1RTIB 4YEAA 1MU2B 2A2DA 4WFBQ 2PFFB 3TEHB 4LF2A 1FERA 2OELA 4TU9A 1PC5A 2C2KB 2XMWA 3R5DA 3EICA 3DOLB 4KH0B 5LSLA 1PGZA 3I9V9 5J1NA 2GMHA 3O2IA 3O3LA 4NLYA 4I56A 1JLCB 1SUQA 3V6DA 2FY1A 4ECWA 4BDPA 1NZ8A 4YB5A 1S9GA 3KWMA 4EMDA 2UXDF 2DNGA 2WBRA 2N82B 2HVIA 5B09A 4OZJA 2Y1IA 2OPQA 3F73A 2UVRA 4DR4J 2Y3YA 3A4TA 4NCBA 1KONA 2GVDB 1Y3KA 6FD1A 2AIRB 2VZ9A 4O4GB 2RDDA 3EPIA 1ZYQA 1J5EF 4K4WA 2FUG9 2V4RA 4CLUA 1X60A 3QGPA 2FD2A 4NE9C 3G6XA 4RW8A 3UN5A 2HNDA 1W25A 3SSRA 3KLHA 2IAJB 1UVMA 3MCNA 1HQUA 2FJXA 1KD1T 4ZVFA 1NJZA 4A8MP 4ED2A 2EKNA 1Q8IA 5A8RA 1S0OA 2AT1B 3TEGA 2ZBIA 2UV8A 4DS5A 1FEEA 4YDDB 3I56S 4ED1A 3EMTA 5FD1A 1N54B 2KM8B 3DLGA 1LWEA 3BN4A 2R8IA 2L08A 4FPIA 4L6V3 4CLSA 2ZH3A 3A3NB 3R2CJ 1U2FA 1CULB 1UFLA 2PEBA 4BWMA 1JLAB 2MHEA 3DDIA 2FLPA 1U6BA 2W2QP 3CCTA 3K17A 1PJ7A 3FZBA 1HI8A 1P8GA 2QN6B 5B0EA 1KSPA 3TI0A 4DV0F 2W8LA 2XI2A 1VBXA 1FDNA 4ZPWR 1S6OA 1FRKA 5C2GA 2C2EA 2F9JA 1C0UA 3D3CJ 3QNWB 5ITHA 3BQ1A 3ENVA 4IOCQ 3QWUA 2HKEA 4B3SF 1SC1B 2BM0A 3IBWA
chains in the Genus database with same CATH topology
1H7XA 2CIMA 5K14A 4WCEQ 1K0VA 2KFZA 3MAQA 1S0NA 2F1FA 2L9WA 2XLJA 5IZHA 1E6VA 1NZAA 4QYRA 3JSMA 3ZZRA 1NK4A 3FSYA 5KFPA 2HQIA 1C0UB 2GJ2A 1Z2ZA 1TK8A 3T9NA 3BO2A 5F3ZA 1KLNA 2CJAA 2EG2A 4NA1A 3IRWP 3U02A 4HKQA 4OHYA 2HMIB 1W2BR 1LXJA 5T41A 4NRUA 1VHFA 3SZ2A 3DRPB 2ZH4A 3M1VB 1RYSA 1SC6A 5KFDA 1PILA 2VPWB 4C2MA 4PQAA 2WHOA 1SJ3P 4JI5F 3E8OA 2DO0A 1U48A 4LF8F 5KFVA 2HPUA 2L9NA 4QR2A 2N3OA 3AB4B 3CD5A 2AW0A 2RQMA 3FRZA 2MKIA 2I1RA 1L3SA 4F4XA 3GB0A 1HQUB 3U1NA 5EX3A 3K57A 3CJ3A 3L7OA 3T9ZA 3UR3C 3RB6A 4NZ0A 4ED8A 2NR0A 5CXTA 1MROA 2FHJA 5DLGA 2VD3A 4B17A 1U4BA 5A6WA 1ZM3A 1DQ8A 2WTFA 2KN4A 4O3SA 2J7UA 1MMDA 4RZRA 5CH7B 4OI1A 1JLGA 1L3KA 1VRTA 4KRWA 2M9KA 2DD8S 1VQKS 3CDWA 4Y2IA 2KHCA 2ROGA 2RRBA 1RWUA 4F2SA 5CHCB 3MPYA 2HLTA 1WF1A 4OMFG 2J9EA 4ZP8A 1ZZNA 1FESA 1O5JA 2KDOA 4TN2A 5D78A 5KFUA 4QIGA 1HWUA 1VIOA 3PM9A 4I7FA 3RTVA 4QIEA 4G3IA 2U2FA 1FKPB 4BHQA 4EUVA 4ES1A 2VFTA 3I55S 3SFGA 2IVYA 1FEHA 3F44A 4OHXA 3CIZA 4R0JA 2DHSA 4WXWA 4BC7A 5G0RA 3G8QA 3D0IE 3OV7A 1N6QB 3JSBA 4B9LA 1S6QA 3NAHA 2V4QA 3IS9A 2RD5C 4JI3F 2ILYA 3MEGA 3OHAA 2CQGA 3G4SS 3MTJA 2RQ4A 3BO4A 3BO3A 3ZZOA 5KG2A 4DFMA 4LFAF 1S1WA 4OI4A 5A0YA 4Y0FA 5CQGA 1P6TA 3CDBA 3EUNA 4KJIA 3QPIA 4CZCA 2AU0A 1VRUB 2AJ1A 4A4JA 3ONQA 1LV5A 1FCAA 1GX6A 5DGBA 3TQ1A 4KTQA 2BE2A 3DDKA 2AYGA 2B4UA 4WYWA 1SV5A 2CQ1A 4Q45A 4ZPCA 5C24B 4X4QA 3MEDA 4GC6A 3TARA 1JLEA 2OKQA 3CIMA 5KFWA 1ZETA 1BQMA 2QA1A 4EWTA 3EGZA 1MMLA 2XMKA 3BSOA 2R2RA 3N6MA 2C3UA 2GW8A 2K3KA 1JJ4A 4F02A 1U26A 1TV6A 1XK8A 1H6KX 2YVSA 3JTOA 4R8UA 3M9MB 2J7KA 2LDYA 5E3CA 3IN5A 1YJ9S 1N88A 4RWXA 3N5FA 3DCAA 2OP5A 4CO2A 5F8MA 3V6HA 2M3DA 3EZ5A 1R31A 2A10A 2HHQA 1SL0A 2JEFA 5J2NB 2ZD1B 3M6UA 4DV3F 2Z8QA 1FDDA 4RW7A 5D4NA 3DOKB 1RT2A 2BANA 1Y5LB 4GMKA 3S7RA 4QQBA 1J5OB 4B9NA 3DRPA 3KJVB 2LCWA 3K5MA 4MIAA 3J7ZT 1C1CB 1F60B 1NK7A 3KYLA 2OH2A 3H2VE 1QAXA 2BXJA 1E6YB 1TL3B 3UW1A 2EFOA 1U1QA 5DO2A 5T14A 4XO0A 4X4OA 2R7UA 3EZUA 4ECTA 4QR1A 3HT3A 5JUMA 4U6PA 1RT6B 1N5SA 3IR5B 2XO7A 3S8SA 3DYAA 3AH6A 3PRDA 4F4WA 1T03B 2FJDB 1DLOB 1MWYA 3DGPA 1F5CA 4WK1A 4RW6B 5CA5A 2RS8A 5F0WA 5I4MA 2V9WA 1DQ9A 5J2QB 4PQUB 2D3UA 4ZHRA 4MYUA 4NZ6A 3OSNA 2HHPA 4PCQA 5F8JA 1KNZA 3TVZA 2DTJA 1HYSA 2DR9A 3R3TA 1OQ3A 4YB6A 5B0GA 2G4BA 3B4MA 1SJ4P 5E3AA 3DM2B 5DS7A 4FF3A 2DH8A 3KNAA 2KT3A 1CSJA 1HHTP 3FNNA 4RWWA 4LF9F 3QO9A 3CCLS 4RW6A 1N4LA 1M5KC 1QAIA 2RNEA 3KHLA 2DGQA 2VODA 1RT5B 2G0CA 2D9PA 2BDPA 3KK3B 1QSLA 3GWCA 4EO6A 5MAOA 3N01A 4NX9A 2Y1RI 1JJ2R 3TW0A 1N32F 2AX1A 3I87A 5I3PA 1NHUA 4M95A 1A7GE 2CKWA 3FFIA 1QSSA 3MMAB 1LWCB 4JBCA 1ZBTA 1KQFB 1GH8A 1RTDA 1C1BA 2YKNA 3Q24A 1RQ0A 2XS5A 3I0RB 1QAJA 2DNNA 5KFMA 4WTYA 5DLFA 2RU3A 1X0PA 1BQMB 4I69A 3C6UB 2UP1A 2YH1A 3MURP 1RYRA 1TKZB 1JKHB 3QMQA 3N0VA 3TA2A 5J2PA 4W90B 3RBDA 1VGYA 4DQPA 3TAPA 1R27B 1LW0A 2XULA 4FXDA 4F4ZA 2W4PA 2MSSA 2WSEC 3PNIA 1UFWA 4OLPA 3OLAA 4J9NA 1TL3A 3RZAA 1KHWA 2IFXA 2IMWP 1C2PA 3PFOA 4MIBA 5L9XA 1RTIA 4UOCA 5DETA 5D3GB 1ULRA 5K8NA 1IBMF 3NNCA 2ILZA 2ZNZA 3MM9B 4TLQA 1VBZA 1FKOB 2I38A 1ZAXA 2XCPA 3TX8A 2JDJA 2GHWA 4LSNA 5CYMA 4C3MA 3SV3A 4ED7A 3HMJG 1D9FA 4DSIA 1HI0P 1X4GA 3HHNB 2KVIA 4CO3A 1TL1A 3M32B 4KBIA 1XR6A 4CTAA 3I4HX 1R7IA 4OZLA 3KLEB 1BY9A 2MDAA 3THTA 5M2PA 1G7CB 1UW4A 3FEZA 3UD4P 2RMLA 3D0GE 3MM9A 3CMES 1FD8A 3V81A 2LEPA 3CCMS 3C46A 4C0HA 1IR0A 4NLWA 2R8GA 3NLCA 2NUHA 4C4WA 3JTNA 1OQ6A 2LVWA 3GFXA 1WD6A 3LWMA 5EWFA 2KXNB 1B0PA 5E5NA 2RJZA 4OI2A 3FZ2A 1VFJA 3ISND 5E41A 3KHRA 2IJNA 2HQ3A 2NLWA 3SCIE 5DG7A 2NREA 2KFNA 1IKVA 4KFBB 3T1HF 2CJKA 3FCHA 4C97A 2DNLA 1NKBA 4RNFA 1LWFA 3BSCA 4QZVB 5E2QA 3PACA 2DVIA 4N76A 4PUOA 2QRRA 3PKYA 1RTJA 3LAKA 2MPUA 5CZVA 2N4DA 2X3GA 5CYJA 2YNHB 1XBWA 4Q0BA 3ENQA 3NGKA 4FF1A 1C0TA 1XMBA 4M94A 4B9TA 4P2SA 2P5VA 4ECQA 2GQCA 3IO1A 5IM0A 2B9XA 4A48A 2CQIA 5JJBA 3T1AA 2QYCA 4XPCA 3K5LA 2UUWA 2DNYA 1ZZFA 3I0RA 2HWIA 5GAGU 3NS5A 4G1QB 1S0VA 1JLGB 1VRTB 4C98A 2J0QD 4C3KA 2G13A 4LFCF 5LXYA 2HHHF 2LEAA 4ZCLA 4X4PA 4DSJA 4KHMA 1X5OA 5L1LA 4WZMA 4NCGB 4A47A 1U1RA 2IRYA 3M9OB 4QU7A 5HBMB 2F8HA 2QA2A 1N33F 2QMXA 3V2UC 4IG0B 2JEGA 2MMYA 1JLBA 1R8BA 1RT1A 4I2PA 1FO1A 5EHHA 2JLGA 3DLKA 1VQ6S 1UAWA 1DJ0A 5C42B 4RNHA 1IQTA 2ZKUA 1ZM4A 4JI6F 2MQLA 2OPPA 1KLMB 1HPZA 2MJUA 3MM8B 2ZJRQ 1VQ8S 4HTIA 4PPDA 3UE2A 3NCPA 2F40A 3W2VB 4Z37A 4IR1A 2LA6A 4NCGA 2GMLA 3AY0A 1ZTWA 4IUFA 3MECA 3MM7A 4MH8A 3JTPA 3VCDA 1NAQA 5BR8F 4O0IA 1J2VA 3SXLA 3MPVA 1YG0A 4GKJF 4DPOA 3CDAA 5FJ4A 1ZPWX 4YY3F 4ZP7A 1VK8A 3MFHA 3UCUP 1JNRB 3H5XA 1IN0A 1FK9B 3GR1A 3O6QA 4OJGA 1HNXF 4IG3A 1CC8A 2RDIA 2CQ2A 1WHYA 5HLFB 3H8YA 1RGVA 2A1BA 1JIHA 2Y0SD 4DR7F 2L3MA 2B9WA 1D1UA 1OPZA 4MIWA 1MMNA 2BE2B 4TNOA 5KT2A 4LF6F 1LW2B 1XN9A 2F8EX 2XWYA 4DV1F 1UWBA 3D54A 3P96A 2E1MC