3J7YU

Structure of the large ribosomal subunit from human mitochondria
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
111
structure length
111
Chain Sequence
b'ARNVVYPLYRLGGPQLRVFRTNFFIQLVRPGVAQPEDTVQFRIPMEMTRVDLRNYLEGIYNVPVAAVRTRVQHGSNKRRDHRNVRIKKPDYKVAYVQLAHGQTFTFPDLFP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
molecule tags Ribosome
publication title Structure of the large ribosomal subunit from human mitochondria.
pubmed doi rcsb
total genus 14
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2014-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3j7yU00
1X4FA 5GVQA 3TO8A 3NNCA 5HO4A 2M8DB 2CPHA 5IQQA 2DH7A 2KXFA 2M0GB 2XS2A 3CF5Q 3U1LA 2L08A 3LQVA 2L9WA 1OO0B 3ULHA 2MXYA 2DNQA 2HGLA 2AYBA 2CQ3A 4ED5A 5LJ3Y 4W90B 2OJ3A 1WTBA 1QVGR 2E5IA 3G6ES 1WWHA 1M5VC 1XN9A 4IUFA 1VQLS 2MKCA 2RRBA 3P3DA 1W2BR 3NNAA 2N7CA 2CQ2A 2X1GA 5JVHQ 3P6YC 2M7SA 4LJMA 4WFAQ 1YIJS 2DGVA 4UQTA 2LYVA 3J7YU 3U1MA 3DLLQ 1U1MA 5IM0B 2X1FA 4LMZA 1A7GE 4QU7A 1IQTA 5DDRC 2MQPA 2RU3A 1U1PA 4C4WA 1WF0A 1VC5A 2LEBA 5H1SV 3Q2SC 1PGZA 2I38A 1WG4A 1VQ5S 2RS2A 1VQKS 2ZJPQ 1VQOS 3UWTA 1SJQA 1D9AA 3VAJA 3JB9k 3NMRA 1SXLA 1SJ4P 3NNHA 2DB1A 2MKHA 2MSSA 1M5KC 3D2WA 3G8SA 2E5GA 2DNLA 4PRFA 5BJRA 3VAIA 2MJNA 2JVOA 2KM8B 4F02A 2MB0B 1WEXA 2KU7A 1N8RT 3CCLS 1JJ4A 2F9DA 1SJFA 5DDQC 1M90T 3CMAS 2J8AA 1R8PA 2XNQA 1FXLA 2KG0A 1U1RA 2AD9A 4QU6A 2RVJA 2FC9A 3EX7B 3P49B 2U2FA 2N3LA 3UCUP 2EK6A 1O0PA 2CPYA 2F3JA 2MKKA 3I56S 2XS7A 3VAFA 3MUVP 1U6BA 4EGLA 4Z2XA 3B4DA 1DZ5A 2GO9A 4FXVA 2CJKA 2MKIA 3CUNA 2DGWA 4QPTA 2CQ0A 1WI8A 1WI6A 3SMZA 1N88A 2MQQA 3R1HA 2CQCA 5CYJA 1UFWA 2Q79A 1KOHA 1YJ9S 1U2FA 1X0FA 2CPXA 3DXBA 3ZZYA 1VBXA 3S8SA 1OIAA 5LXRA 5DDOC 1Q82T 3CMES 2DNPA 1VBZA 4WKRA 1Q7YT 3EGNA 1L3KA 2QA4S 2AYMA 2LXIA 1QM9A 2DIUA 2KVIA 4IOAQ 2CPFA 1KD1T 2MMYA 2LXUA 1DRZA 2J0QD 3B4MA 3HI9A 2HZCA 2X1BA 2E5JA 3NS6A 2L41A 1S79A 2U1AA 2NZ4A 1WHWA 2DNGA 3OW2R 1DHMA 1U1KA 1UAWA 2ZJQQ 2CQPA 2MQOA 2I2YA 5LJ5Y 2MPUA 3CC4S 2EVZA 3MD1A 4C7QA 2DGTA 1JJHA 1X4HA 2M88A 3BEGB 1H2UX 1WEYA 1U1OA 2DGOA 4QQBA 1BY9A 2SXLA 2DNKA 2YH1A 3S6EA 2PEHA 2CPIA 2DHGA 1NO8A 5IM0A 2J76E 4CIOA 3BS9A 3G4SS 2ZJRQ 3US5A 4TLQA 5EN1A 3UCGA 2FY1A 3CC2S 3G71S 5GAEU 1K73T 2MGZB 1A9NB 4RU2A 1U1QA 3R27A 1SJRA 1X4CA 3MDFA 2M4MA 2DNZA 3BO3A 1WG5A 2YKAA 5CA5A 1WHVA 2RS8A 2HYIB 2CQBA 2KN4A 3UCZP 1VQ7S 2MQMA 2KXHA 2DNNA 3MD3A 3IRWP 2VONA 3RW6A 1X4GA 2DIVA 1K9MT 1X4AA 2CQHA 3MOJB 4CH0S 4ERDA 3CCES 1N54B 2M9KA 2MY7A 3CCUS 3CCJS 2FHOB 1R8HA 2E44A 5GAHU 5MLCV 2XB2D 2MZRA 1WG1A 1OWXA 3CCQS 2XSFA 2RQCA 3CCRS 4W92B 3TYTA 3MXHP 1M5PC 3CCSS 2DHAA 1WF2A 2K8GA 4OZ1A 2RT3A 2RRAA 2JVRA 2GHPA 3UD4P 1KOOA 3IWNC 2D9PA 1KQSR 4P6QA 2NLWA 3H2UB 3S01A 1FNXH 5DM7Q 1PO6A 5CXTA 2CPJA 4YB1P 1RKJA 2OSRA 1YWXA 2MYFA 1HD1A 2KHCA 2YWKA 1K8AT 1X5PA 1VC0A 4CH1A 5D78A 5GAGU 1AUDA 3EGZA 1G2EA 4PR6A 2HGNA 3ZZZA 2MY8A 4YOEA 2QFJA 2MJUA 4WFNQ 5DDPC 3R1LA 2DGXA 2WBRA 2OIHA 2LKZA 1QVFR 1M5OC 2OTJS 2MZ1A 2RQ4A 3MUMP 3MUTP 4PKDB 1NJIT 4U67Q 4TU8A 3VF0B 2CPEA 2M2BA 1D8ZA 1WEZA 2DITA 1CVJA 1WELA 2HVZA 4F25A 1JMTA 2OTLS 3HHNB 2DISA 3V4MA 5JVGQ 2D3OR 2FC8A 1P27B 1KC8T 3SDEB 3VAGA 3L3CA 2RNEA 1H2VZ 3P5TL 2CPDA 2LA6A 5HL7Q 2DNRA 3SDEA 3CULA 2G0CA 3PIPQ 3THTA 2AYGA 4M5DB 3CD6S 2CQDA 2DH8A 2N3OA 4OZ0A 1NU4A 2O3DA 3FEYB 2DNMA 3VAKA 2FPHX 2KRRA 1WHYA 1X5OA 2OSQA 1URNA 2M52A 2MGZA 2MQLA 2CQ1A 1HL6A 1RK8A 3UD3P 3VAHA 5D77A 2M8HA 5ITHA 4LIRA 3CCVS 2G1DA 2J0SD 1HD0A 2BOPA 1YTYA 5IFMA 1HA1A 2DO4A 4ZKAA 1FJ7A 2QEXS 3H2VE 3S7RA 2YH0A 2DNOA 2LQ5A 1OPIA 2VOPA 5DETA 3CCMS 1YI2S 2VOOA 2YTCA 1YJNS 1FJEB 2D9OA 2MKSA 3J7ZT 2N82B 2KFYA 1UP1A 1Q81T 1H6KX 2KT5A 3VALA 2LMIA 1N52B 5LXYA 3RW7A 4WF9Q 2KH9A 1U1LA 2LCWA 1X4BA 4CQ1A 1VQ8S 4FXWA 1UW4A 2KI2A 2KM8C 3BO4A 3SXLA 3K0JA 4A8XA 5FJ4A 2MZSA 3CTRA 2DGQA 2F9JA 1YITS 4TU9A 1VQNS 2DH9A 2XNRA 1FJCA 3I55S 2ADCA 2A3JA 1FHTA 1VQMS 2E5HA 2VODA 2KRBA 2KG1A 4WCEQ 4J5OA 3THPA 2MHNA 3MI7X 5DM6Q 2CQIA 2DNHA 4C0OC 2MSTA 2DO0A 3CXCR 1M1KT 1VQ4S 2DNYA 5LSLA 1F9FA 2MZTA 2AYEA 2PE8A 4BS2A 4UY8T 2CQGA 1VQ6S 2B0GA 2JWNA 3MURP 1P1TA 3TP2A 2KYXA 1YJWS 2JX2A 2ADBA 1VC6A 1DBDA 2UP1A 1ZH5A 2X1AA 3UE2A 2MKJA 2LA4A 1H2TZ 1S72S 2G4BA 4WFBQ 4IO9Q 3CC7S 1X5TA 4WIIA 5LSOA 5GMKa 1WHXA 2CPZA 3G96A 1FT8A 2M70A 1U1NA 1VQ9S 3PIOQ 1X4EA 2ERRA 4IOCQ 1Q86T 1FO1A 3CPWR 2MZJA 5GADU 1YHQS 3FEXB 2JRSA 3BO2A 2BZ2A 1SJ3P 3LPYA 1X4DA 4Y0FA 1VBYA 2MQNA 3Q2TC 2DGSA 2V94A 1WF1A 2LECA 3G9CA 2DHSA 2DHXA 4V19X 2RUGA 1U6FA 2KXNB 1JJ2R 4Y00A 3VAMA 2DK2A 2K3KA 1VQPS 1ZZFA 2HGMA 1X5SA 3NS5A 1ZZNA 1B7FA 4F26A 2LEAA 2CQ4A 4TU7A 3N9UC 4YUDA 2MZQA 3G8TA 2DGUA 2EK1A 2XS5A
chains in the Genus database with same CATH superfamily
4PQUB 2NPFA 3TO8A 4B3TJ 4DL2A 3AJ1A 3V6DB 4DL0C 5IQQA 2KFNA 1T9TA 1HNWF 3PEJA 4IQMA 3B78A 3FCWA 1FD2A 4EI2A 2ROGA 5A0YA 2J7UA 5B08A 3M8SA 4KH0B 3TA1A 2HMIB 4RBTA 3THVA 2QMXA 1Y10A 3BQ2A 1T05A 1C0TB 2L08A 1UCNA 1OO0B 1CJUB 4CRJA 1YX2A 3QATA 1N34F 4RWWA 1HBOA 4B3RF 2GGPA 2VG5B 2HNZA 5LJ3Y 2NREA 3A8KA 2QN6B 2W2PP 2WCXA 2C2RA 2DRBA 2BM0A 4LF5F 4W90B 2JZ5A 4O3QA 3M8PA 4OYPA 2E5IA 5KFOA 3MM6A 1DTTA 4QW9A 2BVZA 3Q22A 3A13A 2W9BB 1X7VA 4JI2J 4F3OA 3MTKA 1M5VC 2UXBJ 3HZEA 2MKCA 4PWWA 4RUHA 1H0HB 3RB6A 3I4PA 2JLEA 3K2YA 4K59A 1B70B 1OYEA 2CQ2A 3O8WA 2RD5C 4K0KJ 2BE2A 2DEJA 5JVHQ 3HO1A 4F04B 1FFSB 2M7SA 1PIEA 4GVBA 2ZKTA 4I7FA 5D4LA 2AJQA 2BACA 2GA7A 1PJ6A 1QSLA 2UZAA 3CD7A 4IO1A 3O5TB 2CZ9A 4PWUA 3OFGA 4EU0A 3NWRA 2EG1A 2VUGA 3MM7A 4X4PA 2GQCA 5B0AA 1RAHB 1SC1B 3D1HA 3VR1A 4NRUA 2HKEA 4DSLA 3QRQA 5F0WA 3BREA 4HLBA 4M5JA 5D0HA 2MQPA 3PACA 1Q78A 1SH2A 2B4UA 4EEYA 3MECA 3GYNA 1FVSA 1VC5A 3AXKA 4M95A 1GH8A 3DYAB 4O3NA 1ZM3A 1PGZA 3K89A 1WG4A 3IXQA 1NLKL 2GIQA 2B9YA 4DL7A 2BQ3A 1WOSA 3GZ7A 5M2RA 2ZJPQ 1VQOS 1HLWA 2VBYA 1D9AA 3FSIA 4F4XA 3OJSA 1TK5A 4FYVB 3ILJA 4N8NA 3SFGA 2VHGA 5T7LA 4JV0A 3GYGA 3HHDA 2CWXA 2XLIA 2JLGA 3PX6A 2MSSA 3P4UB 5HBMA 3TA0A 2KL8A 2FJWA 3G8SA 1M5KC 1UVMA 1B0PA 2E5GA 2YNIB 2GJIA 4PRFA 2GHVC 1AROP 3VAIA 2QLFB 3AODA 3M1VB 2ZBRA 2UV8A 4WU2A 1EETA 1HNIA 4HH0A 4HVZA 1T02A 3C6TB 2CJAA 3MMAB 5KFAA 2E7WA 2AP6A 3LP0A 4PQUA 4ZVHA 4MYUA 2IVFB 5A8RA 2IBKA 1M90T 3LH2S 4CLKA 2XNQA 4NXNJ 4C0BA 4NLTA 2R7UA 1F2GA 3SFUA 1WC4A 1RWXB 2PMZD 1SC4B 3KLEB 1EZZB 1Q16B 1VI7A 3A4TA 4NA1A 4HDHA 4DUZF 4DCPB 4LF1A 4MKBA 5E3CA 3ENAA 2RVJA 3QSYB 3RBEA 2VICA 4DSKA 2C3MA 2QL5B 2XMJA 1GTEA 2H48B 3IAM9 5K14B 4MT1A 5KFLA 1HQEB 3DDNA 2MKKA 3G6VA 2XS7A 2HIYA 2F8MA 1I94F 2BKPA 4NLYA 4ECQA 2EWHA 4LSZB 2IRUA 2XMTA 3OLBA 4M5MA 4EGLA 1WC0A 1FX2A 3NWGA 4A8WA 3FRZA 5L1LA 1UFKA 1CJKB 1WI8A 5GADI 1HQUB 3F41A 3I0SB 2RKIB 3W9HA 2V0NA 3HMJG 3OFEA 5HANA 3NCRA 5KFWA 1N88A 4FYYB 4WTOB 1S1UB 5E3AA 1D8YA 3MMCB 1KRPA 1LOUA 3GIJA 1S99A 3ETMA 1TK0A 4WWSA 1GMWA 2BE7D 2CPXA 4F3QA 3T1HF 3G8QA 3LW5C 2CZVC 1JLAA 2Z56B 3C16A 1HBMB 3S8SA 4OHYA 2OKQA 1HW9A 4NLVA 3ZZPA 1Q82T 3CMES 2DNPA 4DZDA 4K5SA 2XI2A 3AY0A 5KFHA 3LUYA 4O4GA 1VRTA 4IRKA 2BXJA 4WPAA 4DQRA 1UJ4A 1L3KA 2NUHA 3HZGA 5D6GA 2ZM6J 4QCLA 5CHCB 1E6YA 2AYMA 2LXIA 3M7VA 4B3SF 4J9LA 1DQ8A 3W2WB 2AIRB 2VBZA 4HI2A 2A0FB 4LRBA 4FXDA 1T9YA 4C0HA 3IR7B 2R3VA 1VQYA 3HHLB 2E5LF 1SC3B 1UFLA 4QIWD 4WFXA 1KLMB 1TUVA 3B4MA 4MK8A 5KT6A 5IV4A 2X1BA 1LW2A 4TY8B 4LIWA 2XCPA 3DLBA 4IR9A 3M6VA 2EG2A 4QW8A 1ACMB 1D0EA 4BCAA 2ASDA 3TZYA 2NZ4A 2DNGA 1ZPVA 2BJ9A 3CD0A 4DL5A 2WB1D 1W26A 3I0RB 1UAWA 3BKTA 2DHHA 1HIYA 2ZBPA 3CDUA 1Y9OA 3GMGA 3EDRB 3M6XA 4KKOB 4MMOA 4P73A 4USTA 1X9WA 2I2YA 4NCBA 3DU6A 2MPUA 4OLOA 3CC4S 3MD1A 1B0TA 4C7QA 1L3TA 4DR4J 4WP3A 1RTDA 2UUAJ 1HBUB 2JNJA 2I0XA 1RA6A 4L73A 3MR6A 3GSIA 4OLPA 3T19A 2QRRA 5DG8A 5KT2A 2OP5A 2FTRA 2H1YA 2P6TA 2DNKA 3CCTA 1C1BA 2DHGA 2KJVA 2VQFJ 1Y3KA 2BYCA 4IG0A 1HYSA 3MM6B 1R6VA 1BQNB 2V2ZA 2W4CA 4ILRA 1AZSA 5HVFA 2WRMA 1BE4A 2ZC3A 2RF2B 5KG7A 2F5GA 3FCHA 1NRKA 3B6BA 5FDLB 3D0HE 4RUCA 5GAEU 4OZ3A 2DCLA 2O66A 1Q8IA 2BANB 3UVJB 3O44A 4C8NA 4ZN3A 4RNNA 5I42A 1Q4RA 2ZUAA 3PCOB 1XC9A 1X4CA 3W7BA 3ZNJ1 4CLTA 3HCXA 1IWGA 1RXOB 3FNNA 5A8WB 3H4BA 3TX8A 2QG9B 5KT7A 2MLYA 2I8EA 3MDFA 1C1CA 4OYMA 5EGYA 1ZAXA 3ENQA 3M2RB 4CTAA 3OR1B 5IXUA 2UVVA 4MJKA 3FBFA 2CVIA 2DNZA 2FJBB 2VD3A 3JQMA 3BO3A 2BJ8A 5AJ3F 4WXWA 1EQ0A 4DPTA 1WHVA 1I5OB 2FGOA 2CQBA 2XYPB 2IC3A 1JLQA 3QFHA 4ZN1A 3F56A 1BQXA 5DG9A 1D9DA 2VONA 2LDIA 2DIVA 1K9MT 3MCNA 5ETSA 1X4AA 1Y3JA 1DQ9A 3BSAA 5IC6B 4ZVPB 4QBUA 3MOJB 2GMJA 1SKUB 1F3VA 4Q43A 1JLGA 1N54B 1RT6A 3DGPB 5C2GA 4EYHB 4EZ9A 3QGIA 3DLKB 4R5PB 1AFJA 4QYRA 3E01A 5ETNA 1HKAA 4F4WA 1X8DA 2W2OP 4G1IA 3EWGA 3ILLA 1K47A 1N0UA 4I69A 4A8YA 3OSPA 2XB2D 4ZLNA 2GAHC 3R97A 1S59A 5DLGA 2FLOA 1OWXA 2Q6BA 2W9BA 2O5DA 4NMLA 3UN2A 2XGQA 3CCQS 2XSFA 3CCRS 2V5HG 4ECYA 1JQGA 3VVUA 5KFKA 3MXHP 4LT6A 4DV7J 3GR0A 1UZHA 3K5NA 1M5PC 1IKWA 1RSCA 5DS7A 2HNZB 3CCSS 3BGOP 3C46A 1VDHA 2RH3A 1C4AA 2VPZB 3N6MA 5E2QA 1UVLA 3UR3C 4GVBB 3GCXP 5I4MA 2OGUA 4I4BA 2D9PA 3AQOA 2WONB 2F8HA 4Y65A 5HLFA 4WE1A 5T14A 3AOCA 4DLGA 4WP9A 4YB1P 1NNDA 2BOAA 4KGZB 5CYQA 1N5VA 2ZWPA 2EPIA 3P5BP 4WTYA 4TY9A 2MTLA 2YWKA 4ITSA 4ZVRB 1Q95G 1ZAWA 1Z2ZA 4IYQA 5D78A 5AXMA 3GV7B 1AUDA 3EGZA 1G2EA 3ZZZA 2BW2A 1UWBA 3G6XA 4I68A 4KKOA 2FJDB 2GCFA 1IKXB 1KVKA 4LBIA 4M5IA 4OI4A 1YDLA 2R7WA 3PO4A 1CULB 4IR1A 4XO0A 1AT1B 2VBWA 2DGXA 3NAHA 1LXJA 2OIHA 2GVDA 2LKZA 3M9NB 1UA0A 4XK8C 2BM1A 3OTCA 5EX3A 5EWFA 3QGGA 3CNQP 1IKWB 2RQ4A 3MUMP 3PW2A 4PUOA 5IT0A 1F9EB 3R5BA 4U67Q 2KZZA 4I2QA 4RNMA 1U49A 4B17A 1G6BA 5KFRA 1T03B 3RB0A 2PO4A 4I0WA 4O4RA 1P6TA 2CPEA 4QIVA 3PM9A 4B9NA 3QJLA 4Q0BB 1RT5B 1HBNA 1WELA 2HVZA 2Z2ZA 4IFYB 4NXNF 1VGYA 2Y1IA 5KT5A 3HHNB 1TELA 1FDDA 3KLHB 2Z8QA 1SV5A 5E0OA 3V4MA 3LPEA 3OVBA 3KHLA 2D3OR 3ZC4A 3SCJE 1FKPA 1S1VB 4DV3F 7FD1A 3ADAC 3EICA 4C8KA 2C2ZB 3HHEA 1HNVA 1GMVA 2LA6A 4TYAA 1OS5A 2DNRA 2AU0A 3Q8PB 1HNXJ 3CJ4A 5D0RA 2AZ1A 2YPZA 4A8OA 1Q79A 4DFJA 4A8FA 1S6PA 3PIPQ 1BLUA 1NK5A 5IT4A 1C0UB 1FCAA 3G6YA 4X4QA 2QMWA 2P9EA 3KHRA 2ZHBA 3RR8A 3CD6S 2ZWOA 2OPPA 2FVPA 1QAYA 5DO2A 3JYTB 2LQ9A 2ILZA 3AHPA 3FEYB 3DOMB 3OPKA 1O51A 2WTFA 1GFWB 2OSQA 3LALA 1YRXA 3AB4B 1URNA 1FTRA 2N7YA 3L7OA 5I42B 2HHHJ 2BUNA 2CIMA 2V8HA 2ZD1B 3H42A 3MEDB 4WYWA 2C42A 1MNEA 2WOMB 4EYIB 3I96A 2R7QA 4I7FB 3GFYA 4PG7A 1FE4A 2IAJA 3IGVA 3IA0A 3GPAA 4XDCA 5ITHA 1NDCA 4I2PA 2QLBB 2G1DA 3PYDA 4LIRA 4O0IA 3MCOA 3CCVS 5F3TA 4P7TA 1UKUA 1ICEB 4PPZA 2DO4A 4KC5A 2JFKA 2UXCJ 1VK3A 4EUVA 1ZETA 1YGYA 2BBEA 4CCHA 3NGUA 4ANDA 4UF4A 2X3DA 1DFDA 3FCVA 1N6QA 3N01A 2VOPA 2YQ0A 1RADB 2C1EB 3FZBA 2GS8A 2C2KB 2VOOA 2YTCA 4I6AA 3O3LA 3ZFVA 1QAJA 2JEGA 1CJUA 1K1QA 2M3DA 2F4VF 2Y8YA 1U02A 4P7VA 4FKYA 4IG3B 1NHVA 2D9OA 3T3FA 2C2EA 3QIPB 1LV5A 4FF1A 1LK7A 3J81j 4AQYF 2KFYA 1F0XA 4GO5X 1FRLA 1VMBA 3HXMA 1Q81T 1T03A 2HRUA 4J90A 1EIYB 2R2RA 2ZHOA 1FFWB 1VRQC 2XSJB 3V2UC 2XC9A 3IN5A 3HFVA 2MEWA 2QSWA 3T1YF 2W4PA 1E6VB 2GJ2A 3M8QA 3V81B 2I6WA 3T1AA 2WW8A 4HACB 4NLXA 3VTIA 1S7IA 3D6FB 4CQ1A 2ZHAA 4DR2J 2VQFF 2EFPA 1UVNA 3GSDA 3A8JA 2XZDB 5AE2A 1YRUA 3SXLA 5AXKA 3BO4A 3CDEA 3TW0A 4ECUA 4I2QB 3UD5A 4DS5A 1V6HA 3TQ1A 2MZSA 4WU3A 1RGVA 1KQKA 3TA2A 2AGQA 2UXDJ 4NCGB 1S6QB 2F8EX 4TU9A 1VQNS 4GKKJ 4AUKA 3OFFA 1FJCA 3T6BA 1X31C 4YR3A 2V9WA 1LWCA 2ADCA 4DWIA 3Q83A 2AQ4A 1VQMS 1IKVB 3M8WA 4TNOA 1HNXF 2Y1LB 3IP0A 2KRBA 5KAKA 4WE1B 7FDRA 2ZM6F 1K1SA 1TU0B 1DJ0A 4X66J 3MI7X 1IBMF 4DF4A 4NWBA 1FWKA 4A4JA 1N5QA 4A46A 4FYDA 2C2OB 2BRKA 3EJMA 4OJ1A 5K5MA 1V5VA 1HBOB 2VIHA 3C15A 2MZTA 2AYEA 4CLYA 3AB2B 2LU2A 2BANA 1XR6A 1CJTA 2X3GA 2P6SA 2KYXA 3TP2A 2ADBA 1ZH5A 4P2FA 1TKTA 2UP1A 2VDHA 2HQ3A 1NSQA 1MN7A 1S4EA 2FHMA 3JSBA 3F73A 4Y2IA 1R3NA 4WFBQ 1CLFA 2C2NA 2YNGA 4P74A 1PBUA 4ZPBA 1TFWA 1RYSA 4PXCA 2HWTA 2RAQA 1FT8A 2G13A 5CAAA 2W4DA 3TUIC 1HNZF 1OSDA 5KFSA 1FESA 5LMNJ 2YBVA 3NCPA 4PQAA 4QIGA 1VFJA 4NLSA 2M70A 5J2QB 4MFBA 2NXNA 2GHWA 2QTWA 3CDBA 5LSRA 3PW4A 1U1NA 1CJKA 3PO5A 1FO1A 1YBAA 1UTAA 2W2MP 4DR5J 2MZJA 2ZJRQ 1YHQS 3KUEA 2DT9A 2YKOA 5F8MA 4FS2A 5J1EB 2DR5A 4DV4J 3I5BA 2HG4A 4J37A 4RNOA 3BO2A 1V9OA 3T5HA 4LF5J 3LPYA 4Y0FA 3IMQJ 4N8OA 4OX6A 2QLWA 1VBYA 3EXCX 3AAWB 2DGSA 2J6UA 4JI0J 3M8ZA 2V94A 1WF1A 2WVEA 4PXBA 2E9RX 4DCOB 9ATCB 4F2SA 4G3IA 3G9CA 2LEPA 3VGUA 1NK4A 2AEJA 2DHXA 2OHDA 4V19X 2RUGA 3QJPA 2QA4G 1JJ2R 1VK8A 4TN2A 4FBUA 4JYAJ 1RWUA 2XMVA 1U8SA 2K3KA 1KR4A 4RBUA 4BWJA 4ZMMA 1FRKA 1ZZFA 2V8GA 4ZPWR 2DPIA 2HZVA 3NRBA 4CO2A 4K4UA 1RB0A 2JSXA 4F26A 5KFYA 5E3PA 2LEAA 3BH7B 1IBCB 3W9JA 1HNWJ 1I3OB 2EC2A 4TU7A 2UUCJ 4HKQA 5IWAJ 5ETPA 3UW1A 4JI3F 3L4BC 2MZQA 3VZIA 2ZE2B 5KFPA 2B9XA 4XTTA 4OZ2A 4U96A 1VRTB 4JI0F 2XSJA 5GVQA 1HWJA 1C4CA 2OEMA 1KTQA 4HHJA 3QAEA 3RZAA 1SUQA 3M8RA 1NEEA 3R6GB 5HO4A 3QT8A 2CPHA 4KGXB 2R9LA 4ECTA 3CUNA 4KHRA 3OUYB 2FVRA 2V4QA 2G1HA 3KFWX 3R5CA 4RO0A 2XEXA 4N76A 2IVMA 1SH0A 1DARA 1SB6A 3PRVA 2XS2A 2VPXB 3BGFA 1RT2A 1TMMA 1YJVA 1BHNA 2GVZA 5KFZA 3CMQA 2WSCC 4C98A 3CF5Q 3U1LA 3J7A1 3DHXA 3FMWA 5F8GA 1IM4A 3AH6A 3W65A 3GONA 1H38A 2BE9B 2DNQA 2G2ZA 3CJSA 2HGLA 3R6LB 4OI3A 4ED5A 3ET6B 1LWXA 4KHMA 3BSOA 1C1CB 3GG0A 5HN0A 2AJFE 2WAQD 4RW8A 4DHVA 2XO6A 3Q8QB 2OJ3A 1KN6A 2HQFA 3G82A 5L39A 1JLEB 1W2IA 4NOHA 3G6ES 2CADA 2GGPB 2VG5A 5T41A 5KOWA 3TAPA 2XY5A 1WACA 1TKXA 2E7VA 2FYXA 1XN9A 1TV6B 4QOTA 4JI4J 4LF2A 1N5YA 2VH7A 4J9RA 3NNAA 1KLNA 2ZE2A 3Q8SB 1W2BR 3O2IA 3DOKA 2N7CA 3ZZ0A 3VV2B 4LFBF 2ZZMA 2CRLA 2X1GA 3TRGA 3V81A 2J9DE 4Y34A 1CSJA 2RF2A 2JFDA 4DX5A 3P6YC 2BA9A 3BDEA 4ILMA 4CWBA 1FEHA 4LJMA 4OV6A 2RJZA 4WFAQ 1T3NA 4D3HA 2C3UA 1REGX 5L1JA 4AXIA 4IH6A 4NZ6A 4A8SA 2VFTA 2YNFA 4JI8F 3OL6A 4B3RJ 1Q8KA 1WDDA 2KFZA 1RACB 2Q3PA 1NJWA 1A7GE 4R0EA 3W61A 5E7OB 3SSQA 4CZCA 3KK1A 3HFKA 5DDRC 3RRHA 3OL9A 2IYGA 3D3BJ 1U1PA 5KFIA 1NKCA 1WF0A 3ETOA 3IGNA 3LF0A 1AFIA 1FJ7A 2LEBA 3IR5B 5ETOA 4QU6A 4ECZA 5H1SV 1S4FA 3Q2SC 2D1CA 3DN9A 1HWIA 2VKZG 1R0CB 3TVKA 5D3GA 3UWTA 3JTPA 2ZEJA 4ED7A 1FRHA 4DXLA 4ELVA 4PWDA 5KFJA 4GO7X 2K7KA 4ZJQA 3NMRA 2NCKL 4MFBB 4NI2A 4BLGA 5GMEA 3DGVA 4E2FB 1SC6A 1YSJA 4IKAA 4EO6A 1IBLF 3FDSA 4AL5A 1UETA 3I87A 2BX6A 5HLFB 2IM0A 4USJC 2DNLA 4TY8A 2C3PA 2E9TA 4LUBA 2WBMA 4XPEA 1U48A 1R8BA 2LVWA 4N7TA 1FKAF 1S9GA 1N32J 3I0SA 4LVNP 4X4OA 3RB3A 1IN0A 3NGDA 1WEXA 4I64A 4RWXA 1N8RT 3L95X 4DN0A 2WW4A 3HT3A 1GQEA 2IM3A 1JLCA 3QQCD 3QRPA 2ZH7A 4FBTA 2H9ZA 1NJXA 4IQXA 1R8PA 1IKYA 1PC4A 2OI2A 3GP9A 5H9FJ 3DGPA 4O3RA 2E66A 8AT1B 2UVWA 1L5UA 2V34A 4WYLA 2A2CA 2KG0A 2ZH1A 2O67A 1U1RA 2AD9A 3WC2A 2P9GA 3MR5A 4DUYJ 3EX7B 4ALZA 2HRYA 3P49B 2K1RB 2U2FA 5HI7A 2IJRA 3J81Y 3KJVA 1FRXA 2CJYB 1QE1A 3BF4A 2UUWA 1YBUA 3KLIB 4CP5A 4IG0B 1O0PA 2CPYA 3FZ2A 4BBYA 3FGVA 5EUHA 2J9EA 2RMLA 1OY8A 3RB4A 1MLAA 4CLWA 5HVHA 1TL4A 2O1PA 3B4DA 3R9LA 2GO9A 4FXVA 2CJKA 3RAXA 3X1LB 2DGWA 5M2UA 4DLEA 2ZKUA 4QR0A 2JEIA 4JI2F 2DY1A 1YJ7A 1RWPB 4USUA 3BBCA 4OYOA 2B56A 3HLUA 1RJJA 2JC1A 2CQCA 2XHWA 1KFSA 3OR1A 2GNKA 3HKZD 1B7YB 2WSFC 3T5JA 1X0FA 2HMIA 4ZVTB 3DXBA 1VBXA 3WZ0A 5KG6A 2WVDA 4HACA 4A47A 1ZA1B 2ZDOA 3T9ZA 5LXRA 2ZOFA 3TQEA 5ETLA 5DDOC 4F4KA 3KNGA 3EPGA 3KLEA 3D68A 1LK5A 4PUOB 1C0UA 5DGBA 4I1TA 1RT1A 2W01A 5E41A 2JOQA 1HHQA 2Y0BB 2EKYA 3H90A 3LP2B 2R8JA 4R0JA 1RE1B 2NSBA 4CLZA 4X62J 3QIPA 3PVXA 4PAAA 4LFAJ 4K7QA 1QM9A 4G1PA 5KFBA 2IHR1 1RWWB 2AEMA 1NUEA 2D41A 4ZLJA 4IOAQ 3KOAA 1FK9B 3RR7A 4DFPA 1RCXB 5F8LA 3TJ9A 1NPRA 3DRPA 4KRWA 4H4OB 2HNDA 1JLFA 1GMWD 2JC0A 3I82A 1V3ZA 4UTGA 2OPQB 2DTJA 2HS3A 2RKIA 1HQUA 2CDQA 3T41A 2F4FA 2L41A 1HWLA 4ZHRB 2U1AA 4B9MA 1RTJA 3KUGA 1GNKA 4ETZA 1DHMA 2DJWA 3C14B 5B0FA 1V5IB 1Y0HA 2GVZB 1UPMB 2DR7A 3C2PA 1QLNA 4DU8A 1NHUA 2WONA 1U09A 2E1AA 2VC1A 3A3PB 2ZH6A 1IWAA 2JLFA 2EVZA 1K44A 2VJUA 2DGTA 1RHUB 1LKZA 2CFXA 1EP4B 4NLQA 2FVCA 2M88A 4PG6A 2ZZNA 4FPIA 5THWA 3D0IE 2DVIA 1APSA 4R8UA 4QQBA 3TX0A 1SL0A 3UDLA 2HFNA 1QAXA 3QMQA 1HR0F 1Q0NA 4QWCA 3UDVA 1MSWD 1JB0C 1F2HA 2P5VA 1IR1A 2CPIA 3S6EA 4U95A 1NO8A 4J91A 1PBAA 3W2WA 1MROB 5SUHA 2J76E 3HT0A 3C19A 2OPSB 2I5JA 3BS9A 3BQ1A 2KZMA 3KHGA 4P2MA 2HVDA 3TWZA 5C7PA 3G4SS 4DUZJ 4YDXA 3ZZRA 4J9MA 4OZLA 5EN1A 1JLGB 1QD1A 3UCGA 1NAQA 4DR4F 1NK0A 2PI4A 2HK3A 3H2LA 1KBRA 2GO8A 1RTIA 5HROB 1LWFB 3TARA 1K73T 4DCJB 2QLXA 4ID5B 3R27A 1SJRA 1TUGB 1QSYA 4K50A 4PG5A 1S0OA 3ITHB 5D0EA 1FDNA 3N28A 4FNIA 4YB6A 5LM7E 2FQQB 1RAAB 2BJ1A 2YWWA 3M8PB 4ILLA 4Q7AA 1KFDA 2XG8A 2M4MA 4K4VA 2QJ3A 3W2VB 2DCUB 4LBPA 3CJ8A 1F60B 2DXDA 3TR5A 1XMQJ 2YKAA 2LLZA 3BSCA 3W64A 5L38A 1U1MA 3CE8A 2BW7A 2RS8A 3M2RA 4M5DA 4USVA 1N48A 2HYIB 1IBKJ 5MAOA 3MECB 4IFYA 4KTQA 2HHTA 2R2SA 3HD1A 2MQMA 5GAHI 4B3MJ 4ZS6A 1ZYQA 1XJWB 2WZ1A 5HJYA 4ZIVA 3TJ8A 3PJXA 1N5SA 4CH0S 1PYOB 3DFEA 2B51A 5C24B 4ZCKA 3CCES 1JXLA 2M9KA 5FDLA 4M94A 4DX7A 1PAUB 4ED4A 4QR1A 5FIIA 3CCUS 1HNZJ 3KK3A 1WD6A 3CCJS 3KMQA 4NRTA 2BJEA 2FHOB 2VFRA 1R8HA 6AT1B 2E44A 3MPDA 4S0MA 1RAEB 5HMZA 2COLA 2MZRA 1RISA 3DLKA 1CULA 1ROFA 1JNRB 2R4FA 1ZM2A 4X4UA 2RQCA 3TYTA 1RHQB 3B82A 1ZA2B 4U8YA 2CG4A 2JDJA 1RCOB 4CTAB 2AT1B 2DHAA 2ZDPA 1XTZA 3ET6A 3N0VA 2HQDA 4CM0A 4RBVA 2XY7A 2RRAA 2JVRA 3C3LA 2OFGX 3DRYA 3LAMA 3SZ2A 5I3PA 2EBGA 1EHWA 3UO0A 2R7OA 2PA8D 3D28A 1KQSR 1KHVA 1FXRA 1PJ7A 3S01A 1NM2A 2R8KA 3NGKA 1HI1A 4ZK7M 1AXQA 2A2DA 3PW5A 4OHWA 4ATNA 5CD4H 5DG7A 2W7AA 2CNLB 4KYZA 1G4CA 1S6OA 1IR2A 1XMBA 4YR0A 2M5YA 3P45B 3J80Y 1RWVB 2UU9J 2HGNA 4K4ZA 1CG2A 2MY8A 2JJ4D 1P8GA 2GMHA 2MKYA 3C6UB 3DYAA 2MJUA 1RLCL 2HWIA 5DDPC 2UVRA 1WDTA 2X7IA 2V50A 3K5OA 1M0SA 3MR2A 1UW9A 4UZCA 2WBRA 4LR8A 5A8KB 2E1PA 5L46A 1QVFR 1HBUA 2B9EA 2H4YB 3IAS9 4OL8A 3IRXB 1R43A 4WXOA 5ETVA 4AQYJ 1IQZA 3NCQA 3OTEA 4URSA 3VZHA 4U7CA 2HW3A 4OX8A 3MUTP 2V2VA 2E5LJ 3CDAA 3PFOA 2QX0A 3Q23A 4CLSA 3ICLA 2J6TA 3AD8C 3OR2B 2HNDB 4RW6A 3CJ2A 3EM1A 2EFNA 3VF0B 2EC0A 3IS9A 1MMLA 1TZ0A 1XK8A 2L3MA 4DQSA 5CQGA 4ZP9A 2ZFHA 4YR2A 2FJAB 1NH7A 2DITA 3DC2A 4ZVUB 4Z7CA 3D3CJ 4HYKA 1HQ2A 3MMCA 4O3SA 5F9NA 2DISA 2E1MC 1F9HA 1ZPWX 2I9SA 4G6VB 2YKQA 3CJRA 4G1QB 5B0EA 5JVGQ 1HBNB 2ZH2A 1H7WA 1YLXA 1P27B 2HFOA 3PW0A 4PCQA 4CH7A 1I94J 2GIRA 3MFIA 5HAOA 3HHLC 3GTYX 1R6YA 2CPDA 2E7XA 5DJBA 2A1BA 4I6YA 3SDEA 2YX7A 5CCMA 5LMUJ 4ED6A 3CULA 1VCTA 4O4GB 1HI8A 2HLTA 3E8OA 3GE9A 1S77D 3DRRA 1GXLA 1WKJA 4M5DB 3DLGA 5F8HA 2LXFA 1T9VA 4TQSA 2CQDA 2IM1A 1B4SA 2BRLA 2VFSA 5FLXU 1R31A 2N3OA 2AWZA 4OZ0A 4QPXA 2R7XA 2QL9B 1R8CA 1NU4A 3UNYA 3TNVA 3WX4A 3EDQB 4Y2KA 3M4XA 2KHDA 2KRRA 5CCLA 1PG5B 2LFVA 3M9MB 3TUZC 2V69A 3R5GA 1LWFA 2M52A 3ZTRA 4JI6J 1RK8A 3FSXA 2FLLA 1U26A 1NBEB 5BYQA 2B5JB 1XMOF 5I3UA 2V63A 4USKA 4BC9A 3AD7C 2OD6A 2WVBA 3NG8A 2K3IA 4OHVA 5HQ8A 3K57A 1RT6B 4LF7J 1FA0A 1GXUA 3Q8YA 4CDIA 4J9KA 4CT9A 2Z57B 3TI0A 1HA1A 5GMDA 1TAQA 3HF5A 1RBAA 4C11B 2ROPA 3BSNA 2HQCA 1BMQB 3U27A 4QYZK 3QNWB 4X2BA 3OUYA 3GIIA 2UVUA 1FDBA 1SKRA 2HPUA 4NX9A 4ELTA 5F8NA 3S7RA 1Y7PA 2BJ7A 4ZVOB 2LQ5A 2MLZA 1OPIA 4D3GA 4C8YA 3DLGB 3ITHA 1MMNA 1YQHA 2HAFA 4ZPVR 4OI0A 1AA1B 1XMOJ 2YX4A 4N41A 3T1YJ 3KDOA 3DOMA 2IA6A 1LFWA 1IKVA 2G9OA 2ZBQA 2AJ0A 5AE3A 4HTJA 1U8WA 4HHUA 2R7RA 2HURA 1NK9A 1LNQA 2UXCF 1RTJB 4XDDA 5J2PB 3NOCA 3RAQA 1R89A 2VG6A 3V6DA 1RWOB 2QC3A 3KWMA 3VALA 5DQHA 2LMIA 2QO3A 1N52B 1YVFA 4JB8B 2YNIA 3RW7A 2CJBA 3W60A 5J2MA 5F8JA 2XLJA 4KJIA 2IDLA 3I32A 2LCWA 4OJ3A 1RAGB 4Z7YA 1UW4A 1U25A 3DI6A 3PX4A 4JBCA 3K0JA 4RKUC 5FJ4A 3RTVA 3FK4A 1N36J 4KE5A 1ZOTA 1UJ6A 5AT1B 3PRBA 1DTTB 3EGVA 3IR6B 4UOFA 4J9QA 1CPZA 3GJQB 1RT7A 1PSDA 1R0BG 3FBCA 4N56A 2DR8A 1SQEA 1ZBTA 3I55S 3MR3A 4GKJF 3VQTA 3M6WA 1Q7LB 5IC4B 2ALYB 2KVQE 2E5HA 2VODA 3HHLD 1QUVA 4ELUA 4F2RA 4CO1A 2Y9HA 2HHXA 1HARA 3THPA 2W2QP 4ED2A 2MHNA 3GIRA 2CQIA 3JSMB 3OTBA 2B8PA 4TKTA 1KONA 2DNHA 5A0YB 1N36F 3MPVA 1U0SA 1CQNA 4IDKA 2KYZA 5DZ7A 1VS3A 3C66A 4LRFA 4URGA 1VQ4S 1XBWA 2V4JB 5IS2A 5LSLA 4UY8T 4RNHA 1FNMA 2A10A 3HVTB 1JJCB 4F3MA 4RU9A 3PNIA 3SEOA 2B0GA 4A48A 1S10A 1IR0A 3OR2A 4RW6B 1Q1KA 5ETMA 4USMA 3QZ8A 3MURP 2JX2A 4H54A 1YJWS 1DBDA 5LMNF 4N47A 2H5JB 2VFUA 3IFEA 2PD1A 3ILIA 1T11A 3UE2A 3WIUA 1JXVA 3S1TA 1H7XA 4M5HA 1DLOB 3RG6A 5F3ZA 3HPOA 4OFZA 4RUBA 3BJYA 3BKUA 5J2NA 1IVZA 1KVIA 3E3XA 5JUMA 5H9EJ 1BD6A 2V68A 2CPZA 1JIHA 5C25A 2ZH4A 5HBMB 2RDDA 3FBBA 2R2TA 2ZH3A 3PKMA 2KTQA 1YK9A 4DX6A 5KFVA 4I6WA 3K8WA 3DRSB 2F1FA 3H7HB 4ZITA 4IOCQ 4HI1A 3MFHA 5GADU 1M5HA 1S1XB 1KTVA 4TLRA 2JRSA 4RZRA 2JEFA 5C24A 2PMHA 1NHKL 4ECRA 2BZ2A 3MEGB 4C11A 1SJ3P 4I67A 1RT5A 5IT9Y 5IV3A 3T9NA 2MQNA 2X51A 1GXTA 3MPUB 3OV7A 2LECA 2QZ8A 3OLAA 4G65A 1BGXT 3SCLE 3WC0A 1RTHA 3JSRA 3K17A 1HHSA 4NEZA 3TVYA 2KXNB 4DV2F 1KDNA 5J2MB 5D3GB 4C8ZA 4PWDB 1JLBA 3MF5A 5E33A 3BYPA 1H98A 4YHHF 3NS5A 1ZZNA 1B7FA 3FBEA 1VYAA 3MCMA 4L3NA 4OV1A 3UN5A 3KG0A 2A6MA 5I3UB 4JV2A 2YVSA 4Q45A 1RT3B 4DEZA 4XIUA 3KLGA 4ECSA 3PZPA 1EARA 4YUDA 2ZBIA 3DDKA 3R5AA 1NB2A 1SQGA 3W5ZA 2DGUA 3NY0A 2EK1A 2XS5A 2V8VA 3MM9A 1X4FA 1SQFA 4C3MA 3AOAA 1UVJA 5D15A 2V9KA 1YKWA 2M8DB 3PR4A 4DR1J 4KFBA 2RSQA 4NXMF 4PZVA 1U2CA 4HDGA 4LVOP 1M1HA 1OMSA 4OI1A 2KXFA 2HQGA 2M0GB 3FFIB 1HW8A 4L3KA 2C3OA 1VRUB 1TL1A 4USWA 4EWTA 1ZM9A 1NK8A 3MZIA 4DV1J 3FRYA 3N6NA 2L9WA 2V8PA 4NYOA 1J5OB 1HR0J 4URQU 2VPWB 3TAMB 4DV5F 1UJ5A 3LGHA 1RT7B 2AYBA 2XO7A 2EEYA 1QAIA 3KJFB 4AYBD 4ZLLA 2DRDA 2VDIA 3D67A 2VKRA 4UQGA 1FX4A 5BR8F 3PEHA 1WTBA 1QVGR 4FYWB 3TOQA 3F0NA 4U9RA 2GMLA 2YKNB 1TKZA 1WTFA 1RBLA 2KT2A 1U6ZA 4AT1B 4F4YA 3DLHA 4GRSA 3KXDA 2VQEF 2VBXA 1LEOA 5EDWA 2IAJB 4ZCMA 1XQIA 5D4PA 1OPZA 5BXIA 4FVCA 1YIJS 3BPDA 2BMBA 3H20A 3J7YU 3DLLQ 2ZNZA 4NLPA 3PG9A 1N56A 2X1FA 3QWPA 3GV8B 3IBCB 1U0HA 3H0PA 4F50A 2YWGA 4ZP8A 4DPWA 3R2DJ 3ZTOA 2P8IA 4DR3J 4ZIWA 3FC9A 1IQTA 1CEZA 1URRA 3I9ZA 3ISND 3OXGA 4OI2A 3A1YG 5I3QA 1IBLJ 2HHHF 3MEGA 4QR2A 3SQOP 2XQCA 1HHTP 4KV8A 2I38A 4NYZA 2H54B 4NYPA 1VQ5S 4DR6J 4K2JA 1VQKS 3BV8A 2B6AB 2K7JA 1OQ3A 3WQPA 4EBCA 3JB9k 3CT9A 4PABA 3VAJA 1SXLA 1SJ4P 4O23A 1KNZA 3OL8A 3W63A 1B99A 4LSLA 2K06A 2V2KA 3PW7A 4UOHA 4DBQA 4X4SA 4LF7F 1FEEA 1OYDA 1GEHA 2XMUA 4HHHA 4UOCA 2UU9F 2IRYA 3KK2A 2ZOMA 2PMWA 2QE5A 3CJ5A 2Y1RI 3PJWA 3SBMA 1F3FA 4P75A 4HEA9 3HHKA 4F02A 4V1Ak 2MB0B 4NLUA 1FERA 5IOLA 1CS4B 1XR7A 2PEBA 1JJ4A 2F9DA 1D09B 1VISA 2ATCB 2HQIA 3MTJA 5LT5A 1WSVA 5C5JA 5DDQC 4C3KA 1SJFA 4LFCF 2CXEA 2J8AA 2WHOA 3NOGA 5FD1A 4QWAA 3LAKA 3N4WA 2D74B 1WC6A 4E8UA 3LP0B 1NZ8A 4C9DA 2J9DA 4FNHA 2UUCF 2QA1A 2NQPA 2NXEA 3T6JA 3AT1B 2N3LA 3UCUP 2I5JB 3IWLA 4NLRA 5K9FA 3GG1A 2FGCA 1XERA 1MROA 2EK6A 3CO0P 1TKTB 2F3JA 1P9QC 2FZKB 3OBIA 3POTB 4NE9C 4KGKA 2CNKB 2R8GA 2VG7A 5M2PA 3MUVP 3CJKA 1U6BA 4U7UD 1VLYA 4Z2XA 4YOEA 2FB0A 1S48A 3I9V9 3MAAA 4KFBB 5F41A 3KLVA 2GW8A 1DZ5A 2KT3A 4OI6A 3QRRA 2WB4A 4QPTA 3SQGA 2CQ0A 3ZZOA 3KLFB 4JI4F 3VGSA 1AUSL 3VVTA 4FS1A 2PN6A 3DI6B 4LF8F 5CYJA 3M2UB 1UFWA 4TVAB 1Y00A 4JI6F 1FRIA 4QYZJ 5ADZA 4WP8A 1NK6A 2BKOA 2A6OA 3CW2C 2QA2A 3HSZA 4NEYA 1YJ9S 4LF6F 3C14A 2EW9A 2B4VA 4NMXA 4DFMA 2YNHA 1OIAA 2Q1LA 1WORA 3MPYA 1DTQA 1YRTA 2FHKA 2MQ8A 3IM9A 3JS9A 2V67A 3TZXA 3DRRB 1VBZA 2HHUA 1ZAVA 4WKRA 1IBMJ 3EGNA 3Q24A 3ILOA 4HT5A 4CT8A 1DQAA 1PILA 3E51A 4C3LA 4DQQA 2QMUB 2XYGB 4DSJA 1RLDA 4LF4F 4CO3A 1BXNA 1RWMB 3FEZA 1VBKA 3M30B 4NZ7A 4PPDA 4YY3F 4ER8A 5D0GA 1RAOA 2K2PA 2DIUA 1UEKA 3JYTA 3AQPA 2CPFA 3P8BB 1KD1T 3MM8A 1TL3B 2J0QD 1LXNA 1YBTA 2YNFB 5HJXA 3UDCA 5BYRA 3HI9A 4AXJA 1SKWA 2J7WA 3CJ3A 2W9AA 2CAJA 2R2UA 2CUYA 2PFFB 4K4SA 4IDKB 1CC8A 1S79A 1TQLA 2AKWB 2B43A 5KFDA 1RKIA 3BPSP 2GJFA 5G0RB 1U1KA 4MYTA 6FD1A 1B3TA 4ID5A 2OEKA 3AJDA 2HHWA 4ZHRA 3UR0A 2KB2A 2XI3A 4IH7A 3DXSX 1XNRJ 4A8MP 2VB6A 2Z58B 4B3TF 1T9WA 5LJ5Y 1QTMA 3HFZB 3MAHA 1U24A 1JJHA 1RBOB 3ZO7A 3BEGB 1H2UX 3PYFA 1N6QB 1U1OA 2AGOA 2AMCB 4OQJA 4BC7A 4DV4F 3HULA 1BY9A 2SXLA 3PKYA 3N5BA 2ZC4A 4M63A 1TKZB 3RRGA 4YEAA 1KEKA 3DKDA 4NL5A 4X65J 1FVQA 5IM0A 4DV6F 3L9ZA 5DGAA 4X64J 3FUYA 4PXEA 3VWSA 5L8RC 3HDSA 2VC0A 2YY3A 1XNQJ 1ITPA 1PYSB 3M1VA 4OYXA 2POKA 2PFDA 3US5A 5AXNA 2FY1A 3G71S 4JI1J 2IJNA 2OO4A 2BEFA 2KKHA 3R5JB 3SSSA 2DEIA 2XCAA 1A9NB 1QDUB 2HNYA 2JL9A 3ZXWA 3KHHA 1U1QA 3BBFA 1OJ4A 2HHPA 3QSIA 3QO9B 1X9MA 9RUBA 2QLJB 3G82B 4LSNA 5D4OA 3J7Z5 4EFAC 1RWNB 1O8BA 2XBPA 1F5BA 4B9VA 5RUBA 1S57A 3RUBL 2LP4A 1NSPA 1VHIA 3FKBA 1WG5A 3PYGA 4WFZA 5A6PA 4C8LA 5G4DA 3CB4A 2J5AA 3DLJA 3UFCX 4KAIA 3QLHA 1S76D 1PC5A 3EVMA 3W2VA 2DRAA 4ZPTR 5E3QA 3KLGB 3WBZA 1UVIA 3HJFA 2DNNA 1LWCB 3SSRA 3IRWP 3RW6A 4X4TA 1GAOA 1X4GA 3HKWA 3RBXA 1VQSA 4FN5A 4ZP7A 3AA9A 3GJSB 2JEJA 3M9OB 1W7WA 4USIA 3AA8A 1DURA 3H40A 2W25A 4MTPA 3CJ0A 1NB7A 2DKOB 2MY7A 3HHLA 4GKKF 3Q8VA 1ZS6A 5CZXA 3MM8B 3NXZA 4CLUA 1DY3A 1NK7A 4ZJLA 4V19J 3HK2A 4JV5J 2AJ2A 1FI4A 1CQMA 2HHSA 2W9CA 2HHVA 1IM6A 3QAUA 5DRKA 3HVTA 3QGHA 1S0NA 1IBKF 3EUNA 1TKXB 4W92B 3Q89A 3O1LA 4NA3A 4ES3A 4CO4A 3GIKA 4DOZA 3EPIA 3CEDA 4FVMA 3GV5B 4RW8B 3HSDA 3MAAB 4YDDB 2OELA 2L9DA 2QV6A 1NH8A 3D54A 3OSNA 4O3PA 4KBIA 1S1TB 1KOOA 4H4KC 4KO0A 2QFIA 3TUJC 3JQJA 3POTA 4P6QA 1WC1A 2FHJA 3H2UB 3JAMU 1NJYA 4J9SA 1PO6A 5CXTA 3EMTA 4NCAA 3KG4A 3L7UA 2MYFA 3IG1B 1BC6A 3D4JA 4KR0B 4JI5F 2APOA 3GLJA 5A2QY 1HD1A 3BM7A 4C6AA 5J2QA 4PXDA 2W24A 4X4NA 2GQ2A 1NPPA 3IBWA 2OPQA 4G1QA 1ZTTA 4Z37A 4PR6A 5CYQB 2H5IB 2Z2MA 4OYIA 1JNZB 1JXEA 1JWWA 3NLCA 3W5XA 2CNNB 1H74A 2P9CA 3OXFA 4IFVB 4P71A 3R1LA 3RBDA 4X65F 2YKPA 3W1YC 3RU0A 5EWEA 2HFZA 4PG8A 1S9FA 4ED1A 3DOLA 2DXFA 2NSCA 5F0UA 1RHRB 4DSIA 4E0DA 4B9SA 2OTJS 5SZTA 4KGVB 2RDIA 4WJBA 3IWXA 4RNFA 4PKDB 1NJIT 4CLPA 2HZAA 2WK4A 4TU8A 4RW7A 4DL4A 5B09A 4M5NA 3EE3A 2M2BA 3PJ9A 3V6KA 1WEZA 3QT5A 1CVJA 4ZP6A 3IM8A 4ZPDA 2ZZTA 5KFCA 3OTDA 2OTLS 2C28A 3CCZA 3IG1A 1N34J 2PT0A 5EX0A 2V8DA 4DQIA 2UXDF 2W1BA 2HBYB 4KQZA 4W4MA 5KG3A 4DV1F 1Y11A 3UDEA 1FK9A 3QJJA 4B3MF 1EB0A 5KOXA 3L3CA 1EAYC 1HBMA 2WVCA 3D6TB 2RNEA 1BQMA 1H2VZ 1WKLA 3OQ2A 2DYAA 5LL6d 3ZZUA 5B0DA 4X66F 2EFGA 4JI3J 2FLNA 3CIZA 5A76A 1MU2B 1VJQA 1RABB 1PKUA 1RT1B 1RT2B 1N33F 4B3OB 2YWEA 1LW0A 1S49A 2YNGB 3PR5B 3SYZA 2DH8A 1S1WA 3A12A 3UPFA 4LF9F 4DS4A 3AXMA 4JI7J 2OPRA 1VIOA 3K8VA 2DR9A 2O3DA 2W9CB 1ZM4A 2DNMA 3VAKA 4RW7B 4DG1B 1TV6A 5C2CA 3BB5A 3P96A 1TTHB 2MQLA 5CZVA 4R8UB 4L72B 2V4JA 3QPIA 1YJRA 5H9FK 3M2VB 5KFEA 4KGMA 3CVKA 3KK3B 4WZMA 3HVAA 3LANA 4PYAA 3UD3P 4JOUA 5D77A 5LMUF 1J5EF 2OMLA 2RB7A 5ETTA 3H5YA 2M8HA 2EFVA 1MWZA 3OTOJ 4F0HA 4YN3B 2V4RA 1YTYA 5IFMA 5JJBA 4RW4B 4DR6F 3CWJA 4NPOA 2HVEA 1MU2A 4UOGA 2J6SA 2ZOGA 1L3UA 1O5JA 2VA3A 5CD4A 3C6TA 1RTDB 1TUWA 3EXYA 3TEHB 2DNOA 1TVRB 3DM2A 4QWEA 3NBPB 2J0WA 1EJ7L 3OT9A 1JLFB 3R8YA 4DSFA 1YJNS 1J5OA 1FJEB 1OY9A 4K4XA 4J9OA 3NEKA 1R8AA 2WVFA 2IFXA 3WX8A 2HVIA 3W5YA 4LR9A 4Q5VA 3J7ZT 1RTZA 3M32B 2Y8WA 4LSLB 1REVB 4IRDA 3H8YA 1H6KX 4CLLA 2KT5A 3MGJA 2AJ1A 1T3OA 3M2VA 3MHYA 4OMFG 1RQ0A 3JAMY 3BGRB 5DQGA 3M6UA 1I51B 2OD4A 2KH9A 2VJVA 2AHOB 1FWLA 1N4LA 4ZJOA 1Y5LB 3NKYA 1MWYA 2Y3YA 3W8PA 5A8KA 1YZ6A 2RILA 1S97A 1Z2LA 1X4BA 4A8KA 1KVJA 3CGIA 2FIUA 4FXWA 3TEGA 2KI2A 2KM8C 2HBZB 1PCAA 3SCKE 1VLOA 4DV3J 4A8XA 1WOOA 3K5MA 3BR9A 2L9NA 3CTRA 1WJ9A 1JLEA 1SCJB 3NBPA 3PHTA 1TVRA 3DM2B 3H5SA 5KG5A 2C22A 1YITS 2HBRB 1T7PA 3W62A 2IDEA 1JLAB 2DH9A 3C16B 2IC3B 4HR2A 4NLOA 2A3JA 4PEOA 3DU5A 3GB0A 2Y1JA 5GAEI 2AJ4A 1TK8A 2EXUA 2R42A 3Q86A 1KLMA 4DPOA 4QZVB 4O44A 4C0OC 5HMWA 2MSTA 3I6PA 3SQGB 4K5RA 3U7JA 3CXCR 1M1KT 2Z2LA 4LSNB 3MEDA 1F9FA 3TAMA 1S0VA 5E5NA 3I5CA 4ZDNA 4ES2A 2XY6A 3D9BA 5ETQA 4WZQA 2CQGA 3DLEB 3DCAA 2VQEJ 1FWPA 2JWNA 4B9LA 1LFPA 3JTNA 1T0TV 2CVEA 1SPBP 3C15B 4I2PB 1NXIA 3A8IA 5K14A 1HQEA 3CJQA 2FLPA 1BWEA 3BGLA 3BN4A 2X1AA 4XAKA 4DZ6A 2MKJA 2IJFA 1H2TZ 2NYHA 2CDRB 4CI0B 2CJXB 2DD8S 2IYIA 1JK9B 3T5LA 1X5TA 3OD2A 2H3EB 5LSOA 1UEVA 1WHXA 1H73A 3SV4A 1RAIB 4GMKA 1FJGJ 2V2QA 2HLUA 4C8OA 2YPYA 1JKHA 3PIOQ 1VQ9S 1X4EA 2Z30B 3KLFA 1Q86T 3GYXB 3CPWR 2XGPA 4ECVA 2DBBA 1FTCA 2HEKA 1F5AA 1SUQB 1YZ7A 3H98A 4LRAA 4JYAF 1UVKA 1S0MA 1VJWA 3ONQA 3LOUA 2RU9A 3CJKB 2CG8A 4DV0J 4RX6A 4DV7F 4I56A 4L76A 4PG4A 2XM3A 2G0IA 3Q2TC 4DPYA 2E29A 2RE1A 4JP8A 4TYBA 1VRUA 2FD2A 4FDFA 4F67A 1BQMB 2DY9A 2ALZA 3DMJB 2HFSA 4Y28C 1U6FA 3M8QB 4OYZA 3O6QA 5AXLA 2ZUGA 1Z4UA 2B6AA 3JSYA 3VAMA 2KJWA 1S9EB 2DK2A 4OYBA 3E2EA 4ZA1A 1SI9A 2RHQB 4TXSA 3GIMA 1QUPA 2KDOA 3H5UA 1KP6A 4HL9A 5E3RA 1RP5A 2RHSB 1T95A 1QTNB 1GX5A 3KYLA 4DI6A 3DDIA 2OH2A 3QYYA 3LTOA 1F6TA 2CQ4A 3D66A 3VGVA 3N9UC 3PHEA 5B0BA 2MDAA 4DG1A 2QT7A 1NSAA 5JMNA 1RHJB 3ISNC 4JI1F 1FNOA 5CH7B 1T9UA 3FVYA 1S12A 4DUYF 1PAEX 2A18A 3NNCA 4K8RA 4USHA 2G0JA 2DH7A 5HQLA 4WKYA 4MIAA 4F4AA 5IZHA 3T5KA 3KNAA 3LO3A 5KFFA 1S6PB 1K0TA 2BJ3A 4Y2MA 2QYCA 1IUJA 2IPOB 1RTIB 2Q43A 3LQVA 3ULHA 3B54A 1TP7A 2MXYA 1KKHA 1QE1B 1UPPA 2CQ3A 5J1NA 3C8YA 4DPUA 1KQGB 2RUSA 3I5AA 1U7LA 3BR8A 3UN3A 4AFFA 4X4RA 4K4YA 2JH3A 2PA3A 3OXLA 2R8IA 2N4CA 3CD5A 3N6LA 4MH8A 4NCGA 2GIFA 4QIFA 3W3SA 1WWHA 5KG1A 4F7VA 4C8MA 4ANEA 3GFZA 1MMDA 4IUFA 4LRCA 1KSPA 2EKNA 3R7NB 3HM9A 1WC3A 2BQUA 1VQLS 2RRBA 2XYHB 3P3DA 4F36A 2HSEB 1AYEA 3FQLA 4NA2A 2YWFA 1KQFB 3G86A 4DR3F 3TZWA 3BKFA 4MIBA 5KFQA 1KWMA 5KFNA 4AE5A 1LW2B 2UUTA 2H5EA 3QFWA 4ES1A 2DGVA 4UQTA 2LYVA 3BGRA 3U1MA 3DLEA 4CO5A 2O01C 2ZVSA 5IM0B 3MAQA 1S6UA 2HIQA 4DV5J 3HSGA 1IKXA 4HH1A 3V6JA 5A8RB 4LFAF 5ETRA 1C2PA 4LMZA 2H4WB 4YY3J 3KMSA 8RUCA 3TAQA 3V6HA 2HK2A 3FMBA 4QU7A 2IM2A 1SH3A 1Y4ZB 2BJDA 3AOBA 2RU3A 2HS4A 4M5GA 4OYWA 2C2DA 1EKSA 4C4WA 4CNYA 2MLXA 5L9XA 1NZAA 1UWBB 1NMEB 2AEFA 2RS2A 2XHCA 4J9VA 3FJ2A 2BR0A 4ECXA 2DXEA 3CDWA 1SJQA 3JXOA 3ISZA 2AW0A 4EO8A 1JKHB 5HMYA 3NNHA 2DB1A 1S1TA 3OTOF 4P10A 2MKHA 1XNRF 1FXDA 2OMOA 3D2WA 2YX1A 4DR7J 4GVLA 3QLHB 2Z2YB 5BJRA 1TL7B 1SV5B 2MJNA 3QT7A 2EI5A 2PGCA 4B9UA 2QYGA 1RA7A 2W8LA 2JVOA 3KG1A 1P9YA 1S1XA 2D3ZA 1Q8LA 2KM8B 2KU7A 3TVZA 4Q0BA 3CCLS 4H4MB 1OY6A 3EZUA 3GFHA 3H59A 3GJRB 4WIQA 1U0HB 2UUBJ 4DU7A 4J9PA 2QSFA 3CMAS 5B0CA 3NL0A 1R27B 2F65A 3UVJA 5AE1A 4FYXB 8ATCB 4P2XA 4LBHA 5C42A 1FXLA 2NS1B 4FF2A 2IIHA 1DTQB 3HX9A 1UZDA 5L1KA 3D7SB 3D5MA 3K5LA 4ZPAA 4MIWA 1S1WB 2FC9A 4LREA 4UT4A 4DR7F 4HT7A 3CJTA 3IRXA 4P2SA 4X84A 4JI5J 4H4KA 1TKDA 1Q5YA 1HWUA 3B8HA 3I56S 2OPSA 3ZNUA 3VAFA 1QSSA 3L09A 1LWEA 5CYMA 3ZTSA 5D8HB 2GZOA 3KJNB 4QJVA 1XMQF 1VOMA 2IA0A 1D9FA 2FJXA 2J9CA 1RDRA 2FZCB 3AJ2A 3RRKA 4DPXA 3KDNA 1WKKA 3MM5B 2MKIA 2WOMA 5KT3A 3QT6A 3H4DA 3EZ5A 1RHMB 4QWBA 3BQ0A 5HVGA 4DR2F 1VHFA 1GK8A 3PTWA 1I1GA 1WI6A 3QO9A 1DAXA 4L6V3 4OZJA 3SMZA 2MQQA 2J0XA 3R1HA 1AB8A 4X62F 2YQ1A 1PJ5A 1YG0A 2HRTA 1KOHA 2Q79A 4P52A 5HK4A 3SCIE 1VIXA 4K4TA 1JLCB 1FRMA 1U2FA 1IJEB 2H65B 5HP1B 4Y2CA 1TL1B 3GFXA 3ZZYA 3QBCA 5J1PA 1FF2A 5K8NA 4OYAA 3IBFB 4JI7F 4GC6A 4CYUB 3J80U 3SIPB 4TQRA 5KG4A 2HBQB 2F7VA 4B3OA 4ZVFA 3R7SB 2D3O1 1Q7YT 2B7BB 2F40A 1XEZA 1TFYA 5ETKA 2AF6A 4KPCA 5HMXA 4DR1F 2QA4S 4RJVA 3M32A 4NLGA 4ED8A 1REVA 5FLXY 4EBDA 1QJHA 2OPPB 1FKOA 3WHIA 2KVIA 4JI8J 1TL5A 3ZZTA 4YP3A 2MMYA 3GCWP 2ACMA 4B08A 4UW2A 5DLFA 3J7AN 1Z1ZA 2LXUA 3AD9C 4ZOSA 1DRZA 3H5XA 4OIXA 5J1EA 2YKMA 1SIZA 3PX0A 2H51B 2HZCA 3NS6A 2E5JA 5LOQA 1RAFB 4LQ3A 4ETXA 4YQWA 4Q8EA 4O44B 1WHWA 3M8YA 2B3TB 3KUHA 1HPZB 2VV5A 3LGNA 4ZCIA 3OW2R 5A8WA 3HP6A 1RU2A 3GILA 2CKWA 2F4VJ 1NKEA 4J7CA 2LQJA 3NGTA 4KIAA 4LR7A 3VQSA 2ZJQQ 3JTOA 2CQPA 3PDNA 4RW4A 5EWGA 5HP1A 1T05B 5IT9U 5KFTA 4LQ9A 5K8OA 2MQOA 3TUPA 1G7CB 1FD8A 1O6XA 3KTQA 1SJ1A 4NZ0A 1L3VA 4KO0B 4KHPF 4ZVGA 3U1NA 4KV8B 4IH5A 4ZCLA 1S6QA 3F44A 4CLFA 1RAJA 1X4HA 5K20B 5EHHA 2R8HA 2AGPA 1WEYA 1S5ZA 2DGOA 4F0MA 2FJVA 2ZD1A 2J8SA 3VGTA 4YMEA 1HYSB 4LF9J 1NKBA 1N5YB 3R2CJ 3MM9B 2YH1A 2PEHA 7AT1B 1HMVA 3UQSA 5C25B 3FSYA 2GX8A 2Z0GA 3BDPA 4EZ6A 1RZMA 1NDKA 2NPIA 5A6WA 1B64A 4F8RA 4CIOA 4KT0C 2ZBCA 1WUUA 2N4DA 2UV8G 2AV5A 3VCDA 4XPCA 1KS2A 3MMBA 3K58A 4TLQA 2XZTB 5KFUA 3ENWA 2IY5B 3LWMA 3CC2S 5IQ6A 5BYSA 1S9EA 2MGZB 4YS2A 3RAMA 5IWAF 3K59A 1W25A 4PYDA 4CNZA 3CO9A 1UWAA 2ASYA 4RU2A 5G0RA 1GTHA 1Y5NB 1R0AB 1RT3A 2XMWA 4UZBA 2R7TA 3G87A 4C48A 1HWKA 1I6JA 2PIIA 1X9SA 2IBOA 4NXMJ 2XLKA 3NP5A 4DJBA 1UMJA 5CA5A 1FE0A 3R5DA 2IMWP 2VG7B 1OSCA 2ILYA 4BHQA 1TL7A 3G2XA 2PI5A 4UY85 2OFHX 2KN4A 4EMDA 3UCZP 3WIVA 2W7OA 3V4IB 4C2MA 1VQ7S 2KXHA 4ID8A 2IVYA 3MD3A 5T7LB 3LP2A 2HFUA 3W9IA 5GAGI 3PV8A 3HVRA 1PYTA 1YJTA 2VF3A 4DFKA 3I31A 2CJQA 2CQHA 3IO1A 4P9SA 3SV3A 4ERDA 3OHAA 1RI7A 4ECWA 2VZ9A 4M1KA 4L74A 2FY8A 4H4OA 2BQRA 4NLDA 1FJGF 2F63A 4DL3A 1RWKB 2YNHB 4F4ZA 2C2MB 1RU1A 2XTJP 5GAHU 2BABA 3HJVA 1NPKA 2HFVA 3A8EA 5MLCV 4MKAA 1P1LA 3N5FA 1WG1A 2PC6A 4J9UE 2ZH5A 4UUXA 1N32F 2YKNA 1NDPA 1XIQA 1TR0A 2XZWA 2YXLA 2ZNYA 4M5LA 4Q2LA 1UEUA 4AD6A 1M5SA 2L48A 2OPRB 2GV1A 2NXJA 2VASA 3HVWA 3KKFA 3MMJA 3QGPA 4ICLB 1J5EJ 4B9TA 4BDPA 1WF2A 2CNOB 2LDYA 1K0VA 2K8GA 3BZQA 2RT3A 4OZ1A 5KT4A 3NMAA 4K0KF 2GHPA 3UD4P 3IWNC 5K8PA 1WSRA 4LFCJ 2NLWA 4IOBA 2B7CB 4OZ5A 1Y5IB 3W8GA 5HQMA 1FNXH 5DM7Q 4U6PA 2XULA 2AX0A 2CPJA 3QZ7A 1RKJA 2OSRA 3RGIA 1YWXA 1CC7A 2FHJD 3FQKA 5L1IA 4DL6A 2UUAF 2D7SA 2AX1A 5KFXA 2HAIA 2KHCA 5CABA 2B8QA 1S1VA 2I1RA 1X5PA 4M8LA 1VC0A 1K8AT 1BQNA 3CSKA 5GAGU 4CH1A 5H9EK 2BV3A 2EBEA 4EK2A 1IKYB 1V3RA 5D4NA 4IRCA 1X60A 4DV6J 3VHQA 2QFJA 4WFNQ 1T9XA 2R7VA 3MM7B 1BWVA 2OAUA 2EFOA 3OJUA 4B02A 2DR6A 5HROA 4X4VA 1SBRA 2RQKA 2DPJA 1TMJA 4KPYA 1UL3A 3UI3A 3JQKA 1G3OA 1M5OC 1FFGB 2K1RA 1D3WA 4ICLA 2MZ1A 2E1RA 3EVWA 3QWUA 2R7SA 2XMAA 4UUWA 3KK2B 4K2XA 1JLBB 2GC8A 3T1HJ 2HS0A 4A8QA 1Q53A 1MW7A 1R7IA 3LP1A 5J2PA 4C97A 4MKYA 1SKSA 1D8ZA 2PDAA 4H4MA 4O3OA 1FDAA 1HI0P 2XMMA 4F25A 1JMTA 2NXCA 3MPWA 3JSMA 3X3UA 3M2UA 5DQIA 2UUBF 2XWXA 3D0GE 4Q8FA 4RLEA 3J7YI 2JHEA 2FC8A 1KC8T 3Q8UA 3SDEB 1XR5A 3VAGA 3D6MB 2HWHA 1D1UA 3GU0A 3P5TL 4P72A 3FFIA 1UA1A 4OHZA 3A3OB 5A2QU 2HNYB 5HSPA 5HL7Q 2D3UA 1HFEL 2G0CA 4RPFA 4RL1A 4J9NA 2LU1A 4KY3A 3DRXA 2RIJA 4GKJJ 3THTA 5L9NA 2AYGA 4FPRA 1IJFB 4KSEB 4WBFA 4CM2A 5J2NB 2G2OA 3NS7B 2W2NP 4DN9A 2LQBA 1G1XA 1F1BB 1U2RA 1U4BA 2NUUG 3MM5A 1EX8A 2ACYA 1MN9A 2B4OA 4E98A 4AL6A 1Q5VA 4JV5F 4DV2J 3PYEA 4IG3A 3IS9B 2FPHX 2QL7B 1WHYA 1X5OA 3LP1B 2PSZA 4QIEA 3K5PA 4RUAA 4LF6J 1C1BB 4WK1A 1LWEB 5CYMB 4O0NA 2J7KA 2CWKA 1F5CA 1HL6A 2CQ1A 2MGZA 4KH1B 2ZH9A 2Q66A 2VG6B 1N33J 2W8KA 4ZVSB 2RDJA 1EETB 1WOPA 3VAHA 5U47A 1HNIB 3MMBB 3OVAA 1NDLA 1ZTWA 2OEJA 2J0SD 1HD0A 3MWBA 4OX7A 2BOPA 3I0RA 5KFGA 3LA0A 2E9ZA 2EFQA 1RTHB 4ZKAA 4ED0A 1ULRA 2VFVA 3ELHA 4M5KA 3C6UA 2E1CA 4BWMA 2QEXS 4LFBJ 1RUSA 3H2VE 6FDRA 3NAIA 3V4IA 4FF4A 1B0VA 1EP4A 3PY8A 1U47A 2YH0A 5F9LA 3PFEA 5DETA 4OJHA 1VR6A 1H72C 4DV0F 3CCMS 1YI2S 2NR0A 3D6HB 4FP9A 1C0TA 4OZNA 2FZGB 3HD2A 3WDOA 5B7WA 4Y6IA 1T8EA 2MHEA 4DUTA 3A3NB 3DRSA 3BH6B 3ENVA 1R0AA 2CJ9A 1EKRA 2MKSA 2QGFB 1E6YB 4MAKA 3J81U 3M30A 4R5PA 3E01B 2N82B 4NI2B 1RYRA 3KJVB 1HPZA 3DNCA 5AJ3J 1UP1A 2GFFA 3SI8A 2ROEA 1YJUA 3RYLA 3TZZA 3EGWB 4NLWA 4U7UK 2W7PA 2IRXA 2YKMB 3PRDA 5LXYA 2QIFA 4KB7A 4KHPJ 1AW0A 4FF3A 4WF9Q 1U1LA 4Q44A 3Q8RB 3DMJA 4WK3A 4AL7A 3MEKA 3UNGC 3LGMA 3MCSA 2BE2B 3DOLB 3MEEB 1CS4A 1N5TA 4U8VA 4RR5A 1WC5A 3KJQB 2WSEC 1N0VC 4WFYA 3BGUA 1SIWB 3HSJA 4IFVA 4Y2AA 1RT4A 4RW9A 5B0GA 3RJMB 3EYZA 2BKNA 1FKPB 1SVDA 1VQ8S 4YB5A 1S1UA 4YFUA 2XWYA 2NXUA 2VPYB 3ZTPA 3GQCA 3TANA 1GT8A 2NYIA 2VL1A 3RBZA 1SL1A 2HVHA 1NSKL 4DMZA 5HATA 2YWHA 1JX4A 2DGQA 2F9JA 4GC7A 2ASJA 2CYYA 1FRJA 3NGSA 3OHBA 2FJEB 2GQQA 2ATLA 2XNRA 4LRDA 3M05A 2Y0SD 4K4WA 3DOKB 4ZVEA 1FHTA 4DF8A 2ABYA 1CBKA 4R25A 4ENOA 4N5SA 3Q0AA 2KG1A 5BR8J 4J5OA 4WCEQ 2RRNA 2ZITA 5JXSA 3EZOA 1S7HA 3R7BB 1CJVB 5DM6Q 2FUG9 3H25A 1AZSB 3AFGA 1ELOA 3PXGa 1H3DA 1Q8BA 2DO0A 2KO1A 5K8MA 2GVDB 2DNYA 1CJTB 1J27A 2B5JA 3D1QA 4B3SJ 3N79A 3MEEA 4Q2MA 2PE8A 3KK1B 4EBEA 1L3SA 4BS2A 4LF4J 1LQ9A 4DR5F 2OUGA 2Q6CA 4ZLPA 1T94A 1M1GA 1RT4B 2P2CB 4L75A 5KG0A 3W66A 4W98A 3ZTQA 1VQ6S 1P1TA 2UXBF 3KLIA 2VU5A 1TAUA 1VC6A 4DX8H 3MMAA 1A6LA 1NCLA 2B4PA 2RQMA 3GJTB 3CCWA 4CYUA 2FVQA 2LA4A 1LW0B 4F0KA 1S72S 4ZPCA 2G4BA 1GMUA 3BBBA 4OHXA 1KHWA 4ZVQB 4IO9Q 3QIDA 3OVSA 3CC7S 3OFHA 4WIIA 1XWLA 5GMKa 2G2YA 4NASA 5C42B 2IMOA 2VA2A 1RHKB 3G96A 2D69A 1J2VA 3LWLA 4LF8J 1MG7A 2ZH8A 3GR1A 3BYRA 2FDNA 1NJZA 2AZ3A 4MK9A 2V6AA 3I4HX 4OX9F 2ERRA 4JV1A 2OLWA 1A0OB 1S9GB 3NGRA 4YHHJ 1U45A 1CJVA 3FEXB 4YB7A 4DQPA 4MKVA 4OJGA 3TJAA 3KLHA 1TL3A 2FVSA 1QY7A 1X4DA 1IXKA 5F8IA 5KG2A 1X0PA 5DZ6A 4ANCA 1WNEA 2ZVIA 4FZVA 1EQMA 2DHSA 2GAGC 3BN7A 2B9WA 4CO0A 2CA9A 1E6VA 1HNVB 1BUXA 5KTQA 1XNQF 2ASLA 3MOZA 3K7RA 4Y00A 3V5RA 3OL7A 4X64F 1VQPS 2BDPA 3U02A 3CIMA 4Y3CA 2HGMA 1X5SA 1DLOA 3GWCA 4ED3A 3DHWC 4MK7A 1GX6A 3MR7A 4RW9B 2XMKA 3DRPB 4FKXA 4OX9J 2CZ4A 4JUZA 2HHQA 1JLQB 3D1OA 5KFMA 2C3YA 1FKOB 2YQ3A 1MWQA 2LQ8A 1SL2A 1OQ6A 1V3SA 4DDFA 2NZCA 2Z4PA 3R3TA 3G8TA 3EVOA 3L7PA 4DSEA 1HMVB 4N77A 4QWDA 4HTIA 3IC1A
chains in the Genus database with same CATH topology
4PQUB 2NPFA 3TO8A 4DL2A 3AJ1A 3V6DB 4DL0C 5IQQA 2KFNA 1HNWF 3PEJA 4IQMA 3B78A 1FD2A 2ROGA 5A0YA 2J7UA 5B08A 3M8SA 3TA1A 2HMIB 4RBTA 3THVA 2QMXA 3BQ2A 1T05A 1C0TB 2L08A 1OO0B 1N34F 4RWWA 1HBOA 4B3RF 2GGPA 2VG5B 2HNZA 5LJ3Y 2NREA 2WCXA 4W90B 2C2RA 2DRBA 2BM0A 4LF5F 2JZ5A 4O3QA 3M8PA 5KFOA 2E5IA 3MM6A 1DTTA 4QW9A 2BVZA 3Q22A 2W9BB 1X7VA 4F3OA 3MTKA 1M5VC 3HZEA 2MKCA 3RB6A 4RUHA 1H0HB 1U49A 3I4PA 2JLEA 3K2YA 4K59A 2CQ2A 3O8WA 2RD5C 2BE2A 5JVHQ 3HO1A 2M7SA 2ZKTA 4I7FA 5D4LA 2AJQA 2BACA 2GA7A 1QSLA 2UZAA 3CD7A 4IO1A 3O5TB 4PWUA 3OFGA 4EU0A 2EG1A 2VUGA 3MM7A 4X4PA 2GQCA 5B0AA 3D1HA 3VR1A 4NRUA 4DSLA 5F0WA 3BREA 4HLBA 2MQPA 3PACA 1Q78A 1SH2A 2B4UA 4EEYA 3MECA 3GYNA 1FVSA 1VC5A 4M95A 1GH8A 3DYAB 4O3NA 1ZM3A 1PGZA 1WG4A 3IXQA 2GIQA 2B9YA 4DL7A 2BQ3A 3GZ7A 5M2RA 2ZJPQ 1VQOS 3FSIA 2VBYA 1D9AA 4F4XA 1TK5A 3OJSA 4N8NA 3SFGA 5T7LA 4JV0A 3HHDA 2XLIA 2JLGA 3PX6A 2MSSA 5HBMA 3TA0A 2FJWA 1M5KC 1UVMA 3G8SA 1B0PA 2E5GA 2YNIB 2GJIA 4PRFA 2GHVC 1AROP 3VAIA 3M1VB 2UV8A 4WU2A 1EETA 1HNIA 4HH0A 4HVZA 1T02A 3C6TB 2CJAA 3MMAB 5KFAA 2E7WA 2AP6A 3LP0A 4PQUA 4ZVHA 4MYUA 2IVFB 5A8RA 2IBKA 1M90T 3LH2S 2XNQA 4C0BA 4NLTA 1F2GA 3SFUA 3KLEB 2PMZD 1VI7A 1Q16B 4NA1A 3QJLA 4HDHA 4DUZF 4QU6A 5E3CA 4MKBA 3RBEA 2RVJA 2C3MA 2XMJA 1GTEA 3IAM9 5K14B 5KFLA 1HQEB 3DDNA 2MKKA 3G6VA 2XS7A 2F8MA 1I94F 4NLYA 4ECQA 2EWHA 2IRUA 2XMTA 3OLBA 4EGLA 3NWGA 4A8WA 3FRZA 5L1LA 1WI8A 5GADI 1HQUB 3F41A 3I0SB 2RKIB 3HMJG 2V0NA 5KFWA 3OFEA 4WZMA 3NCRA 1N88A 1D8YA 1S1UB 5E3AA 1KRPA 3MMCB 1LOUA 3GIJA 1S99A 1TK0A 2CPXA 4F3QA 3T1HF 3G8QA 3LW5C 2CZVC 1JLAA 3S8SA 1HBMB 4OHYA 2OKQA 1HW9A 4NLVA 3ZZPA 1Q82T 3CMES 2DNPA 5KFHA 4K5SA 2XI2A 3AY0A 3LUYA 4O4GA 1VRTA 4IRKA 2BXJA 4DQRA 1UJ4A 1L3KA 2NUHA 3HZGA 5D6GA 4QCLA 5CHCB 1E6YA 2AYMA 2LXIA 4B3SF 4J9LA 1DQ8A 3W2WB 2VBZA 4HI2A 4FXDA 4C0HA 3IR7B 1VQYA 3HHLB 2E5LF 4QIWD 1UFLA 4WFXA 1KLMB 1TUVA 3B4MA 4MK8A 5KT6A 2X1BA 1LW2A 4TY8B 4LIWA 2XCPA 3DLBA 4IR9A 3M6VA 2EG2A 4QW8A 1D0EA 2NZ4A 4BCAA 2ASDA 2DNGA 1ZPVA 3CD0A 4DL5A 2WB1D 3I0RB 1UAWA 3M6XA 3CDUA 4MMOA 1Y9OA 3GMGA 4KKOB 4NCBA 1X9WA 2I2YA 3DU6A 2MPUA 4OLOA 3CC4S 3MD1A 1B0TA 4C7QA 1L3TA 1RTDA 1HBUB 2I0XA 1RA6A 3MR6A 4OLPA 3T19A 2QRRA 5DG8A 5KT2A 2OP5A 2FTRA 2P6TA 2DNKA 3CCTA 1C1BA 2DHGA 2KJVA 1Y3KA 2BYCA 4IG0A 1HYSA 3MM6B 1BQNB 2W4CA 4ILRA 2WRMA 2ZC3A 2RF2B 5KG7A 3FCHA 1NRKA 5FDLB 3D0HE 4RUCA 5GAEU 2DCLA 2O66A 1Q8IA 2BANB 3O44A 4C8NA 5I42A 4RNNA 1Q4RA 1XC9A 1X4CA 3W7BA 5A8WB 3H4BA 3FNNA 3TX8A 5KT7A 2I8EA 3MDFA 1C1CA 5EGYA 1ZAXA 3ENQA 3M2RB 4CTAA 3OR1B 5IXUA 4MJKA 2CVIA 2DNZA 2FJBB 2VD3A 3BO3A 5AJ3F 4WXWA 1WHVA 2FGOA 2CQBA 2IC3A 1JLQA 1D9DA 5DG9A 3F56A 1BQXA 2VONA 2LDIA 2DIVA 1K9MT 1X4AA 1Y3JA 1DQ9A 3BSAA 4QBUA 3MOJB 2GMJA 4Q43A 1JLGA 1N54B 1RT6A 4EYHB 4EZ9A 3QGIA 3DLKB 4R5PB 1AFJA 4QYRA 3E01A 4F4WA 1X8DA 4G1IA 1N0UA 4I69A 4A8YA 3OSPA 2XB2D 5DLGA 2FLOA 1OWXA 2Q6BA 2W9BA 2O5DA 4NMLA 2XGQA 3CCQS 2XSFA 3CCRS 2V5HG 4ECYA 5KFKA 3MXHP 4LT6A 3GR0A 3K5NA 1M5PC 1IKWA 5DS7A 3CCSS 2HNZB 3C46A 5E2QA 2RH3A 1C4AA 2VPZB 3N6MA 1UVLA 3UR3C 5I4MA 4I4BA 2D9PA 3AQOA 2WONB 2F8HA 4Y65A 5HLFA 4WE1A 5T14A 4DLGA 4YB1P 1NNDA 5CYQA 1N5VA 2EPIA 4WTYA 4TY9A 4ITSA 2YWKA 1ZAWA 4IYQA 1Z2ZA 5AXMA 5D78A 3GV7B 1AUDA 3EGZA 1G2EA 3ZZZA 2BW2A 1UWBA 3G6XA 4I68A 4KKOA 2FJDB 2GCFA 1IKXB 4OI4A 2R7WA 4IR1A 4XO0A 3NAHA 2VBWA 2DGXA 1LXJA 2OIHA 2LKZA 3M9NB 1UA0A 4XK8C 2BM1A 3OTCA 5EX3A 5EWFA 3QGGA 1IKWB 2RQ4A 3MUMP 3PW2A 4PUOA 5IT0A 3R5BA 4U67Q 2KZZA 4I2QA 4RNMA 4B17A 1G6BA 5KFRA 1T03B 3RB0A 2PO4A 4I0WA 4O4RA 1P6TA 2CPEA 4QIVA 3PM9A 4B9NA 4Q0BB 1RT5B 1HBNA 1WELA 2HVZA 4IFYB 4NXNF 1VGYA 2Y1IA 5KT5A 3HHNB 3KLHB 1FDDA 2Z8QA 1SV5A 5E0OA 3V4MA 3OVBA 3KHLA 2D3OR 3ZC4A 3SCJE 1FKPA 1S1VB 4DV3F 7FD1A 4C8KA 3HHEA 1HNVA 2LA6A 4TYAA 1OS5A 2DNRA 2AU0A 3Q8PB 3CJ4A 4A8FA 4A8OA 1Q79A 4DFJA 1S6PA 3PIPQ 1BLUA 1NK5A 5IT4A 1C0UB 1FCAA 3G6YA 4X4QA 2QMWA 2P9EA 3KHRA 2ZHBA 3RR8A 3CD6S 2OPPA 2FVPA 1QAYA 5DO2A 3JYTB 2LQ9A 2ILZA 3AHPA 3FEYB 3OPKA 2WTFA 1O51A 2OSQA 3LALA 1YRXA 3AB4B 1URNA 1FTRA 2N7YA 3L7OA 5I42B 2BUNA 2CIMA 2V8HA 2ZD1B 3MEDB 4WYWA 2C42A 1MNEA 2WOMB 4EYIB 3I96A 2R7QA 4I7FB 3GFYA 4PG7A 1FE4A 2IAJA 3IGVA 3IA0A 4XDCA 5ITHA 4LIRA 4I2PA 3CCVS 2G1DA 4O0IA 4DSKA 5F3TA 4P7TA 1UKUA 4PPZA 2DO4A 4KC5A 2JFKA 1VK3A 4EUVA 1ZETA 1YGYA 2BBEA 4CCHA 1DFDA 1N6QA 3N01A 2VOPA 3FZBA 2VOOA 2YTCA 4I6AA 3O3LA 3ZFVA 1QAJA 2JEGA 1K1QA 2M3DA 2F4VF 4P7VA 4IG3B 1NHVA 2D9OA 3T3FA 2C2EA 3QIPB 1LV5A 4FF1A 1LK7A 4AQYF 2KFYA 1F0XA 4GO5X 1FRLA 1VMBA 3HXMA 1Q81T 1T03A 2HRUA 2R2RA 2ZHOA 2XSJB 3V2UC 2XC9A 3IN5A 2QSWA 3T1YF 2W4PA 1E6VB 2GJ2A 3M8QA 3V81B 3T1AA 2WW8A 4NLXA 3VTIA 4CQ1A 2ZHAA 2VQFF 2EFPA 1KN6A 3GSDA 2UVVA 4ECUA 5AE2A 1YRUA 3SXLA 5AXKA 3BO4A 3CDEA 3TW0A