3J7YU

Structure of the large ribosomal subunit from human mitochondria
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
111
structure length
111
Chain Sequence
ARNVVYPLYRLGGPQLRVFRTNFFIQLVRPGVAQPEDTVQFRIPMEMTRVDLRNYLEGIYNVPVAAVRTRVQHGSNKRRDHRNVRIKKPDYKVAYVQLAHGQTFTFPDLFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title Structure of the large ribosomal subunit from human mitochondria.
pubmed doi rcsb
total genus 14
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2014-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3j7yU00
1YTYA 2CQHA 3P6YC 5LJ3Y 1X5OA 3THTA 3UD3P 3VAMA 2MQNA 1XN9A 3RW7A 5LXYA 5HO4A 1NJIT 2MJNA 2M4MA 1PO6A 3PIPQ 3TP2A 2RRBA 2HYIB 1WEYA 1PGZA 1JJ2R 3CXCR 2CQ2A 2EVZA 3CCMS 2ERRA 3IRWP 2HGMA 2MQMA 5GMKa 1VBYA 1U6BA 2LA6A 2E5HA 2CQ3A 1WHYA 1KOHA 2LA4A 2YKAA 3CCVS 3FEXB 3CCES 2J76E 2KU7A 3VF0B 4W90B 3R27A 3U1LA 2CPHA 3G6ES 2XS7A 3VAFA 2DB1A 4F02A 2MQPA 2CPZA 1M1KT 3NNAA 1NU4A 3BO4A 5IM0A 1A9NB 3I56S 2WBRA 2M2BA 2O3DA 1A7GE 1O0PA 2AYMA 1M5OC 4Y00A 1VQ7S 2K8GA 4Y0FA 2RQCA 1WEZA 2DNNA 1VQMS 3I55S 1RKJA 1ZH5A 2CPEA 3U1MA 3MXHP 5EN1A 2MQLA 2AYGA 3VAGA 3CD6S 1N8RT 1NO8A 5DM6Q 3UWTA 1DZ5A 3MUMP 3R1HA 2RU3A 4F25A 3CC2S 5DDQC 3Q2SC 3MD1A 4LMZA 1X5TA 3P49B 2QA4S 2MGZA 1KOOA 2DO0A 2JWNA 3J7ZT 1VQ5S 3MUTP 1SXLA 2MKCA 3UE2A 5DDRC 1VQOS 2UP1A 2DNKA 2JX2A 5H1SV 2LKZA 2MZTA 2XS5A 2I38A 3CCUS 3UD4P 2M8DB 2FC9A 2OIHA 2KI2A 2KVIA 1X4GA 1UFWA 2LCWA 2J0QD 4WKRA 2MSSA 1OWXA 3CF5Q 1U1QA 4U67Q 1S72S 2G0CA 2KG1A 2DGOA 1N54B 2MJUA 2OTLS 5LXRA 2MKIA 1M5VC 2CQCA 4PKDB 2ADBA 4PR6A 4FXVA 1YIJS 5JVHQ 4IO9Q 4A8XA 1H6KX 2X1BA 2E44A 2F9DA 2YH0A 2CQ4A 2CPIA 2DGQA 1WHWA 1D8ZA 5D78A 1U6FA 1W2BR 3MD3A 2OSRA 1YJNS 4C7QA 1WF0A 2CQIA 1U1OA 2X1GA 5DDPC 2AYEA 4WCEQ 2YTCA 1X0FA 3TYTA 3CC7S 2LYVA 1X4EA 1HL6A 1H2VZ 3UCZP 1VC6A 2FPHX 1HD1A 1K8AT 5HL7Q 2AYBA 3SMZA 2XNRA 4CH1A 2JVRA 2KYXA 3THPA 2DGUA 2LEBA 5BJRA 1UP1A 1WI8A 2OSQA 4CQ1A 1U1PA 2DH9A 3CTRA 2N3OA 4QPTA 4WFAQ 2M70A 1X4DA 4Z2XA 1FJ7A 2HGNA 1VQ6S 5D77A 1VQPS 2D3OR 3EGZA 4QU7A 4QU6A 2MKJA 2DGSA 2V94A 1FJCA 3EGNA 3S6EA 1QVGR 1VQKS 4IOCQ 2KN4A 2M8HA 2DGTA 2MSTA 2U2FA 2DNQA 2BOPA 1H2UX 3P3DA 4C0OC 3CCSS 4RU2A 1VQ4S 1N88A 3CMES 2DISA 2MQQA 2CQDA 3CPWR 1VQ9S 2KXNB 2K3KA 4IOAQ 1X4HA 2SXLA 4YUDA 1WHVA 2LXUA 4J5OA 1K9MT 1X4AA 5DETA 5MLCV 5GVQA 2MZJA 1FHTA 2RT3A 3S01A 2L9WA 2MZSA 1WF2A 1X4CA 4TU8A 3NNCA 5CA5A 3SDEA 2VONA 5GAGU 1ZZNA 2U1AA 1VBZA 1S79A 1VQNS 1JJHA 3JB9k 1YITS 3MOJB 3N9UC 2M0GB 2VOOA 1FJEB 4P6QA 2MQOA 3G8SA 2N3LA 1WWHA 2GHPA 2D9OA 2CQ0A 1UAWA 2CQ1A 1SJ3P 3ZZZA 4TU9A 2KXHA 2CPYA 3HHNB 3VAHA 3H2UB 5FJ4A 3FEYB 3ZZYA 4F26A 1U1NA 3DLLQ 2E5IA 1QVFR 3G96A 2KM8B 3NS6A 2KH9A 2DNRA 3MDFA 2MMYA 3L3CA 3VAIA 2X1FA 2XS2A 1FNXH 3J7YU 2DNPA 4UQTA 4C4WA 1R8PA 3MUVP 2MB0B 2DHGA 2LECA 2DGXA 1JMTA 3R1LA 1YWXA 5CXTA 2KHCA 1M5KC 1K73T 1HD0A 2CPJA 4TLQA 1Q82T 2G4BA 1KD1T 3B4MA 3US5A 4YB1P 3CUNA 4WFNQ 2HVZA 2MKSA 2XB2D 1L3KA 2FC8A 5IQQA 1U1MA 2MKHA 2HZCA 2CJKA 3DXBA 2MZQA 2F9JA 3Q2TC 1RK8A 2E5JA 1G2EA 3MURP 2CQPA 4W92B 1QM9A 2G1DA 4UY8T 4EGLA 5LSOA 2MKKA 1U2FA 1YJWS 5CYJA 1YJ9S 3BEGB 3ULHA 4YOEA 2QEXS 2RVJA 1X4BA 1D9AA 2DHSA 2GO9A 3CMAS 2M7SA 2MZ1A 1U1LA 1OPIA 3B4DA 2E5GA 2N82B 1VC0A 2MHNA 2DNZA 2XSFA 2NLWA 4ZKAA 3MI7X 2LQ5A 2DIVA 2RUGA 3G8TA 3NMRA 1FXLA 2PEHA 4PRFA 1UW4A 1SJRA 3CCLS 2KRBA 2VOPA 1YI2S 3CCJS 5JVGQ 1Q7YT 3NNHA 3CCRS 2F3JA 2DHXA 5LSLA 2DK2A 5IM0B 3G4SS 5IFMA 2Q79A 1ZZFA 4CIOA 2RQ4A 2DNYA 2NZ4A 2MY7A 3EX7B 4OZ1A 1P27B 3BS9A 1OO0B 2HGLA 1B7FA 1SJFA 2KXFA 5GAEU 2D9PA 1VQ8S 2OJ3A 2DNHA 3SXLA 1R8HA 3VAJA 3SDEB 3UCUP 2AD9A 1M5PC 2M9KA 2L08A 5ITHA 2ZJQQ 2JRSA 2OTJS 4WFBQ 1OIAA 3S7RA 1IQTA 2MY8A 3K0JA 2DNOA 3PIOQ 1WG1A 2N7CA 2BZ2A 1SJQA 2J0SD 1P1TA 2MGZB 1X5SA 4M5DB 2PE8A 2A3JA 3CC4S 1WEXA 2DIUA 2FY1A 1M90T 3V4MA 3D2WA 2M52A 5LJ5Y 3VALA 2L41A 2ZJRQ 2EK1A 2RS8A 1VQLS 1F9FA 4WIIA 2ADCA 2LXIA 1FO1A 5DDOC 3G71S 4BS2A 2RRAA 4LJMA 2XNQA 2DHAA 1Q86T 3RW6A 2KG0A 4IUFA 1SJ4P 2MYFA 3BO2A 3CULA 2EK6A 1WI6A 3VAKA 1WF1A 2M88A 4ERDA 1DRZA 1YHQS 2MZRA 3CCQS 3LQVA 2RS2A 1BY9A 1WG4A 2CPXA 2DH7A 1WG5A 2MPUA 2B0GA 2ZJPQ 3UCGA 3H2VE 2DH8A 2RNEA 5DM7Q 1CVJA 1X5PA 1U1KA 2MXYA 4QQBA 4LIRA 2JVOA 2KM8C 1X4FA 1HA1A 1AUDA 3S8SA 1WHXA 3LPYA 2I2YA 2KFYA 2J8AA 2CPFA 2LMIA 1VC5A 4CH0S 2CQBA 2DITA 3P5TL 1VBXA 2CQGA 4FXWA 2FHOB 1DBDA 1U1RA 3OW2R 2DNGA 4TU7A 4V19X 2CPDA 2DGVA 3BO3A 1KQSR 1N52B 2YWKA 2QFJA 1Q81T 1JJ4A 1WTBA 2DNLA 2DGWA 2VODA 4WF9Q 1DHMA 5GAHU 2X1AA 2YH1A 4OZ0A 1KC8T 1FT8A 4ED5A 1WELA 3G9CA 2DO4A 2DNMA 3IWNC 1URNA 3NS5A 2KT5A 2KRRA 2LEAA 3HI9A 3TO8A 5GADU 1H2TZ
chains in the Genus database with same CATH superfamily
1TKZA 4RUBA 3P6YC 2X7IA 1RYRA 5DGBA 1EJ7L 4DL2A 2IM1A 5A0YB 2VKZG 4DL3A 2W2PP 3M8RA 2DRAA 4LR7A 3FEXB 3VF0B 1P1LA 4Q45A 2HMIB 5CQGA 1FE4A 2VH7A 2IFXA 4ZHRB 3LP0A 3JQJA 3DMJB 1U2RA 1JLAB 4N76A 4Y65A 2OD4A 2IM0A 1BWVA 4RUAA 5EN1A 1VIOA 2HNDB 2FDNA 2HIYA 3C14A 5GMDA 1NJWA 4KGKA 1X5TA 2AT1B 2GNKA 3J7ZT 3T5KA 4J9QA 2L48A 3IXQA 2MKCA 2R3VA 1WOSA 3D3CJ 3OVBA 1M5SA 1X4GA 1UFWA 3M6XA 2UUCF 2C2MB 1XMOF 1VISA 2QLFB 3GTYX 3FSIA 3RB3A 4LSNB 3H5YA 5KFIA 3DRYA 3LF0A 3M8ZA 4B9VA 4JI2F 3ZZ0A 1YIJS 3UNYA 3GSDA 3WZ0A 2V4JB 1OSDA 2Y3YA 1W2BR 3AY0A 3MECA 2YKNB 5DQHA 2RDDA 2GC8A 3MOZA 4HH1A 2AHOB 1SQFA 1VQYA 1M5HA 1VLYA 4ANEA 1X4DA 3W63A 1SQEA 5AT1B 2UUCJ 4G1QA 5HVFA 4QU6A 2IYIA 1XMOJ 2FJXA 1QSLA 1IUJA 2VKRA 5ETTA 4ZN1A 4JI2J 1N88A 3W8GA 3PX6A 3CPWR 1N5TA 1X4HA 1K9MT 5A8WA 2UVUA 2ZM6F 2AGOA 3RRKA 2BJ1A 1YG0A 2ZH8A 4P6QA 2WHOA 2R2SA 1TVRB 1BLUA 5KFJA 2J7WA 3T5LA 3HFKA 3Q0AA 3BKUA 3R97A 5J1EA 4X4NA 2E9RX 3VAIA 3ILIA 4C4WA 3I32A 5LOQA 4H4OA 2DHGA 2VC1A 1YWXA 1U8SA 1VRTB 4FVMA 4I1TA 4PQUA 4JI6F 4PABA 1KD1T 4NLYA 1WKLA 1F9EB 1U1MA 1FWLA 5I3UB 3Q2TC 4OHWA 3GWCA 3NLCA 4HL9A 2ZM6J 3H5XA 1LK7A 2WONA 1GXLA 2YNGA 5HBMB 4QIWD 1D9AA 4OHVA 1OPIA 3RBDA 3RGIA 2BE2A 1L3TA 2HBZB 1RHMB 2F7VA 4DLGA 1G4CA 3PW7A 2BE7D 2G0JA 3RRHA 1U4BA 2WCXA 4MK9A 2AGQA 2OEKA 3TUZC 4EBCA 3OBIA 4JI6J 4KYZA 5K14B 1OO0B 4CLYA 2KXFA 4WFYA 1JNZB 1OY8A 3UCUP 2KJVA 3QRRA 2IDLA 2DRBA 1TUWA 1Y0HA 4WFZA 5CAAA 2QV6A 4RUHA 4GMKA 3RAMA 4ZVRB 2OPPB 2YKOA 2EBEA 3NG8A 2WTFA 2RU9A 2H5IB 1VQLS 3IWXA 3GIIA 1H7WA 1RTDB 1TL4A 4K59A 2EK6A 4F0MA 1OQ3A 4EBDA 1HI1A 1S77D 1NB7A 4CTAB 2ASJA 1NK6A 3C6UB 4ELTA 2J7KA 3W64A 1RBLA 4N8OA 4UT4A 5K9FA 3FBEA 3CT9A 4WPAA 5K8PA 3GIRA 2PA3A 2I2YA 1OS5A 3P8BB 3TANA 4NE9C 2XZTB 2QTWA 4OYAA 1H0HB 1DBDA 4QW9A 2HSEB 1V6HA 2OPQB 5J2PB 3ZC4A 2QFJA 2BXJA 2B7BB 5GAHU 2PMHA 3QT7A 4NEZA 4K7QA 3MGJA 2DNMA 2Z30B 2DXEA 1REVB 2PA8D 3PNIA 3OPKA 5CZVA 1P6TA 2X3GA 2MJNA 2Y0SD 1PO6A 1HNVA 2Z57B 5I4MA 4Q44A 3W7BA 4NI2A 2MQMA 4P74A 1I6JA 3KK2A 2OGUA 2DEJA 4C11B 4IFVA 4F02A 3H90A 2WBRA 2FHKA 5K5MA 2HS4A 5E33A 5L46A 3HJFA 4R5PA 1ZH5A 4KQZA 3KHRA 1N8RT 4OYWA 3GLJA 2D3ZA 5DDQC 3MAHA 3EDRB 3P49B 1DQ9A 2P9GA 1SXLA 1RP5A 1Y5NB 1UPMB 2LKZA 2BANB 4DSFA 2I38A 2KI2A 3QZ8A 3MMCA 4YP3A 1SKWA 4F2SA 3CF5Q 2IAJB 4P2XA 3UDCA 1NZ8A 3HLUA 3N28A 2BM1A 1N5SA 2LU1A 1QD1A 4IO9Q 3QJPA 4KV8A 1B70B 2YH0A 4NPOA 1WHWA 5D78A 2HQFA 1WF0A 3MZIA 3GJSB 4H4MB 3V5RA 4DSKA 3PO4A 2J6SA 4X4PA 4DS4A 2FGOA 4WJBA 2DR9A 2LEBA 1WOOA 4Y34A 4QPTA 3EM1A 1EAYC 2D3O1 5JJBA 3DM2A 3JTPA 2O1PA 4YB5A 2V94A 2RQMA 1S7HA 3TQ1A 3GIJA 3VQSA 4PQAA 1KHVA 5CH7B 1PC4A 1MU2B 4C0OC 2AX1A 3RB0A 3QSYB 4IQMA 5A76A 1T05A 3MAAB 2BV3A 3FCVA 5ETRA 4C0HA 2ILZA 4J37A 2HFNA 3NGTA 1YQHA 2V2VA 3SDEA 2PGCA 2HFUA 2HBRB 4XTTA 5CYQB 2J6UA 2L9DA 3G8SA 3TAPA 4P72A 4TY9A 3CO9A 4KHMA 4IRKA 7FD1A 2YPYA 5KG4A 2NR0A 3N01A 2Q6BA 3OVAA 1VRUA 1CPZA 3R9LA 1FKPA 5ETVA 1Q8KA 5SUHA 2F4FA 2DEIA 3QBCA 2XMWA 4MIWA 2W2OP 2XI2A 3QQCD 4RR5A 2HNYA 2W9BB 2W9CB 1EQ0A 3KJVA 2BDPA 5F0WA 1FKOB 5C42A 4EZ6A 1X4BA 2MZ1A 4OZJA 5KFYA 1VC0A 4DL5A 1RACB 1U7LA 2CDQA 1JIHA 4KB7A 4ED7A 4PRFA 2AJFE 4DL0C 1FWPA 1IR0A 2DCLA 3CJ5A 1JJCB 2VDIA 5L1IA 4DQRA 3IG1A 2E5LF 3MEDA 3FNNA 4FS2A 2DVIA 4LT6A 5D3GB 3H20A 3NWRA 1QLNA 4PPZA 2R2TA 5HI7A 4ILRA 1CLFA 3HP6A 3OTEA 3AOAA 4DL7A 4DXLA 1N4LA 3RTVA 2YWFA 4C3KA 1Z2ZA 4KT0C 2DY1A 2PI4A 4TLRA 3VV2B 3UDVA 1UEVA 1TQLA 2VC0A 2AZ3A 1F9FA 4O3QA 5HSPA 5J2NA 2UXDF 3DGVA 3L95X 5F9NA 3BO2A 2E5LJ 1HNIA 2EFPA 1W7WA 2GW8A 2HEKA 4M1KA 4PAAA 3TI0A 1XMBA 4NLTA 4BLGA 2RS2A 2UVRA 5I42A 2W8LA 2XYGB 3BSOA 3D9BA 2EFOA 2DH8A 1CSJA 5C25A 2CZVC 1WORA 3VHQA 3ADAC 2WONB 2YNGB 3EVOA 5DQIA 3N5BA 3GIMA 4QWEA 3LPYA 2UU9F 2J8AA 4FN5A 1KVJA 2VJUA 4DSIA 2UUAF 1ZM4A 2LDIA 1PG5B 3CD0A 2VU5A 2DNGA 3NWGA 3GG0A 3DLHA 2K3IA 4WF9Q 2UXDJ 2MQ8A 1OY6A 3C66A 3G9CA 2F8HA 4ED1A 4F0KA 2ZUAA 2QN6B 2A6OA 2CFXA 3LP1A 2MQNA 2L9NA 2ZITA 1YJUA 2ZOMA 1T7PA 4I69A 2HBQB 4KTQA 1VLOA 3CIZA 1T3NA 2EVZA 4RW6B 3NGKA 3UO0A 2HS0A 4HI1A 2IVFB 5GMKa 2UU9J 3M1VA 5HAOA 3D6FB 3DOMB 2UUAJ 1HQUA 3R27A 3D54A 1VHFA 3N6NA 3M9OB 4H54A 3G8QA 1M1GA 4WE1A 1FEHA 1QE1B 1R7IA 3C6TA 4FXDA 2J0WA 4MKBA 3KLEB 3SV4A 2QYCA 2CPEA 2IA6A 2AYGA 2B5JA 4J9RA 1FWKA 4NOHA 2AGPA 4Q0BB 3EXCX 4USWA 3J80U 2DO0A 4AL6A 2QZ8A 2B9XA 3CCTA 3ET6B 1IKVA 5AE3A 2VZ9A 2A1BA 4L73A 3UD4P 1IWAA 1QDUB 4RNMA 1KLMB 3DLGA 4M95A 5KFTA 2QX0A 2MSSA 3T3FA 2OPSB 3CW2C 4GO5X 2D41A 5C2GA 1S1UB 1IR2A 4ZPVR 1YKWA 2UVWA 1T3OA 2GQQA 3DHXA 2CQ4A 3MM5B 5KFEA 2XHCA 1IXKA 3FDSA 1T03B 2V8HA 1FRMA 3ZO7A 1CBKA 4MYTA 1UZHA 4ATNA 4NI2B 4DF8A 5IZHA 4FYXB 1KQGB 5C24B 4EMDA 1UEUA 3CEDA 1RISA 1JLQA 1VQPS 1S48A 1S0MA 4QU7A 5B0EA 1QTNB 2DCUB 3LO3A 1Q8IA 2KN4A 2G2ZA 3FGVA 4JI7F 4CCHA 4I7FA 4OZ3A 3OTOF 3C46A 2OEJA 3C15A 3QSIA 3MM9A 1CJUA 3TWZA 2E9TA 2VPXB 2MZSA 4HVZA 4CNYA 3NNCA 1JJHA 3MOJB 3QFWA 3CCZA 4U9RA 2MQOA 3C16B 1N48A 4YR2A 2D9OA 3MEKA 3TUIC 1TFWA 4NYOA 1PJ6A 3G96A 2B8QA 3FJ2A 5KFUA 2KH9A 2HQGA 3W9JA 3KLFB 4OYPA 1IBCB 3DNCA 4JI7J 2LECA 2AMCB 2BJDA 3R1LA 3OTOJ 4KO0B 2JEFA 2BQUA 4OZ2A 2WVFA 5LM7E 1QAJA 1PBUA 1UTAA 3SFGA 1S49A 5L1LA 5F8IA 1SKSA 3WIUA 3UW1A 2ZE2B 2YKMB 4K4UA 2EW9A 1V5VA 1IWGA 3J7AN 2H48B 1U1LA 3H4DA 3ZTSA 2XSFA 7AT1B 4NZ6A 2RF2B 2OEMA 3BN7A 1HNXF 4DV4F 3HF5A 3DU6A 3HHKA 1EETB 4E2FB 2MHEA 2H51B 1SH2A 4PWWA 4LF9F 4MIAA 2ZUGA 3LWMA 3G86A 1R8HA 2NCKL 3SDEB 3TJ9A 3BV8A 5IV4A 2VG6A 1NSKL 1Q53A 1SJQA 1X5SA 4HACB 1RWXB 2DIUA 3H98A 5CYMA 1HMVA 2L41A 1VRUB 1HNXJ 4DV4J 1FKPB 3WC0A 2XCAA 3RW6A 3CULA 4F3OA 5AE1A 3AOBA 3T1HF 1LWEA 4WZQA 1XWLA 2MLYA 3V4IB 2NXNA 4LF9J 2HRUA 2FLPA 2CPXA 2MPUA 1X60A 5KT5A 4F50A 2DR6A 3GYXB 3KJVB 4FF3A 2A18A 4FBUA 2CNNB 5KT7A 1AUDA 1J5OA 2J8SA 4X2BA 3N79A 4Q7AA 3T9ZA 3DKDA 2KT3A 5EGYA 3EWGA 3D4JA 4DCPB 2XWYA 3CE8A 4F3QA 3J7Z5 4DCJB 1JLGB 3MM6B 3PW0A 3GE9A 3PRDA 3T1HJ 3I96A 3ITHB 4ECSA 1RCOB 2LEAA 3IRXA 5GADU 4JB8B 1XTZA 1OYDA 3RW7A 5KT6A 3EMTA 3PYGA 2E29A 3R5BA 1Z4UA 1TTHB 1S0OA 2R7OA 3H59A 3R7SB 1MG7A 1URRA 1DTQB 2VPZB 5E41A 4G65A 3W2WA 2AJ4A 4K2XA 2DB1A 1QAIA 3HD2A 2CPZA 4LR8A 1QJHA 4PCQA 2HHQA 2NREA 3UDLA 2Y8YA 1WTFA 1TKDA 4QW8A 2AYMA 1VQ7S 4ZK7M 3R5CA 2GIQA 1VMBA 3QIPB 2LLZA 3GYGA 1UA0A 2OFHX 5LMNF 2RAQA 2RE1A 4MKAA 1U6ZA 3TNVA 2GGPB 3CDUA 4DPYA 3R6GB 3BSCA 5L1KA 1VQOS 4ID5A 1RDRA 2YWGA 2D69A 2BACA 1OWXA 2O66A 4CLUA 4DN0A 4NCAA 2KG1A 3DLKB 4YR3A 4PKDB 3A12A 4IRCA 3MFHA 4DFPA 1TELA 3PXGa 2F65A 4FPRA 4NRTA 1KDNA 3C2PA 1YLXA 5M2PA 3FKBA 5LMNJ 2E7XA 3FRZA 5DDPC 1JLEA 2LYVA 5HL7Q 5GADI 4K8RA 2W7PA 5T41A 3BSNA 2XMJA 5D77A 4LVOP 1B7YB 4IR9A 3S6EA 3TJAA 4LBIA 1VIXA 3Q8QB 4CM0A 2NS1B 3RUBL 2DISA 3BR9A 2B5JB 1FI4A 1PYSB 2P6TA 4LBHA 3M9MB 1ROFA 2ZVSA 3NGSA 4USTA 3PCOB 4TU8A 3L9ZA 2LXFA 2R9LA 4K4TA 2M0GB 3VGSA 1RT1B 2N3LA 4ZPTR 4DX5A 4OYXA 5F8GA 4L72B 3R2DJ 4LRAA 4UOFA 3HVAA 1YJRA 3JSMB 4KFBB 1U1NA 4L6V3 1V3SA 3IMQJ 3FBFA 3I31A 4X65F 2IPOB 1VK3A 2DGXA 3CJ0A 3TQEA 2Z4PA 4OJ3A 4CLPA 4FDFA 1Q82T 4ED2A 2HVZA 2YQ3A 2BJ7A 2IJRA 4ZLNA 2BYCA 5HK4A 1AA1B 1HBOA 5LSOA 4ZPWR 1D3WA 4BC7A 2VIHA 1TU0B 3CWJA 4USVA 2OAUA 4P75A 4DV7F 3IM9A 2BJ3A 2Z2YB 5DLFA 1RT3A 4X65J 1IBMF 4B9NA 3P45B 3M2UA 4PXBA 4KSEB 4CIOA 3DDNA 3EX7B 5JUMA 3G82B 4IG3A 4EO8A 3O2IA 3HHDA 4ZOSA 4NYPA 5B0CA 3PYDA 3OFGA 4J9VA 3IA0A 2COLA 4O3RA 1WG1A 4AYBD 3OR1A 1IBKF 4ZP8A 3AXMA 3HJVA 5KG6A 4PWUA 4DV7J 1MROA 2I9SA 2W01A 1KTVA 2D7SA 2BABA 1FO1A 2R4FA 3VTIA 2RRAA 1IBMJ 1RTHA 5HANA 5D4NA 2RDIA 3K7RA 4CO2A 5KT2A 2YXLA 3Q8VA 1SL0A 2ZEJA 4YDDB 1YJVA 2B0GA 3QPIA 5BYSA 5DM7Q 1NHUA 2QE5A 2AIRB 4DR5F 3W65A 3UVJB 4B3TF 1ZTTA 1IBKJ 3I4PA 5KFDA 3OVSA 3P5BP 1S1TB 4M5GA 4F3MA 2FHOB 1JX4A 4DR6F 4TU7A 2DGVA 3BKTA 4LR9A 1RT7B 4RJVA 3HSZA 2R42A 3N0VA 1JJ4A 3BGLA 4RW8B 2HHWA 1YSJA 3LW5C 1FT8A 1TKXB 2KT5A 1D9DA 2YWHA 1RTIA 5KG5A 1HHQA 4RW9B 1S9EB 4ZP7A 3LWLA 2HZVA 4USIA 1W26A 2RRBA 4PXCA 2KTQA 4DR5J 1N5VA 4B3TJ 1RU2A 3B82A 1KRPA 3EVMA 4WXOA 2WSCC 4QZVB 3OXLA 4DR6J 1S1VA 1WD6A 1RAIB 1N34F 4PG6A 1Q8BA 2O3DA 5F8HA 4ZPCA 3R7NB 2QGFB 2K8GA 3KLGA 3KG4A 2BM0A 3L7PA 5A8KB 5D4LA 5ETNA 3KKFA 2AX0A 2J6TA 1BMQB 3CJKB 4JV5F 4LMZA 2PD1A 3VVUA 2XMTA 5A2QU 5A2QY 4DQIA 4I64A 4FF4A 5KFRA 5H1SV 4CNZA 3CCUS 3BH7B 2J0QD 1QAYA 4KHRA 2YNFB 1U1QA 4U67Q 3MM7B 1S72S 5EWGA 1N34J 1CG2A 2JLFA 4X4RA 4A8XA 3SQOP 3GCXP 2GZOA 4WTOB 3IBFB 1VR6A 3LANA 4JV5J 3KLHB 1X0FA 1TV6A 2ZFHA 1K8AT 2XNRA 4ER8A 5CABA 2B9EA 3K17A 4DV5F 5CHCB 1RWWB 3DRPA 1F6TA 3D1HA 4TNOA 2D3UA 4WXWA 3DOLA 3KJQB 2C2EA 5HP1B 2P8IA 2NSCA 4V1Ak 4E0DA 3NBPB 3K5MA 2VG7A 3R5DA 5LL6d 1H73A 2MQQA 5F3ZA 1VQ9S 2A6MA 4USUA 4J5OA 2PSZA 3UFCX 5MLCV 2FZKB 3EVWA 2L9WA 3QIDA 2OLWA 3ZTQA 3W2VA 4ZCIA 1WC0A 4D3GA 1ZZNA 1VBZA 2FUG9 4ID5B 4UUXA 1SJ3P 2LU2A 4DV5J 4B3OA 4ZMMA 2KXHA 5IT9U 4F26A 2ZZNA 3ZNUA 6FDRA 2KM8B 1L3UA 4PEOA 2NUHA 3IBCB 2X1FA 5L1JA 3J7YU 3POTA 3KYLA 2KHCA 1FESA 2HURA 4YB6A 2DTJA 1FEEA 1NAQA 3BGRA 2R7TA 3OFEA 1ZAVA 3OL6A 4MFBA 5JXSA 4IFYA 1U2FA 1MN7A 1PYOB 1QUPA 3JAMY 3JAMU 3M8QA 5CCLA 1RABB 4C3LA 3NCPA 2QMWA 3MM8B 2RUGA 3MMJA 3TUPA 3CCLS 1A0OB 4KE5A 3NNHA 3NKYA 1QY7A 2GVZB 4DFMA 5GAEU 2IRUA 2D9PA 2DNHA 5IC6B 2YY3A 1NDKA 2IVYA 4A8OA 3BM7A 1NK5A 2K7JA 2AD9A 4A8QA 4C48A 4MTPA 1MMNA 4YDXA 3IN5A 3KK3B 2ZJQQ 3TEHB 2PDAA 2B43A 1C1BA 4BWMA 3RB4A 2MGZB 2FYXA 1RT2A 1U02A 2FY1A 2UUWA 4JBCA 2GX8A 2RJZA 1VJQA 2W25A 5FDLB 4LFBF 4ED4A 2CJ9A 1DLOA 3DC2A 4R8UA 1C0UB 4I2QA 4FKXA 1U0SA 2R7SA 3CCQS 3O3LA 4PUOB 5E3AA 3ZZOA 1WG4A 2P9EA 4FYWB 3DLEA 1TFYA 3BQ1A 5KOXA 3UR3C 3AHPA 3X3UA 4QR2A 1V3RA 5T7LA 2VG5A 1HFEL 1JKHA 1GX5A 1XR5A 4FKYA 3GMGA 4NLWA 4LFBJ 2CPDA 4RBVA 1BQNA 1KQSR 5A8RA 1TMJA 1VK8A 1KC8T 4I2PB 2YNHA 1H74A 3THVA 3FZBA 2WK4A 1APSA 3LP2B 1JWWA 1JLCB 1C4CA 1SPBP 1Y5IB 3HVRA 1PGZA 1UWBA 3KUHA 1S9FA 1RAJA 5DGAA 4RW7B 4L3KA 5GAEI 2CQ3A 3KOAA 3EYZA 3ENVA 2WSFC 2J76E 2V0NA 1VDHA 4F4ZA 4PG5A 3U1NA 4OFZA 2XS7A 1FERA 1S6PB 3PJXA 5HROA 1IR1A 2FLLA 2C22A 1PBAA 2IMOA 2VBWA 1NU4A 2ZHAA 3HVTA 2ZH6A 1YX2A 4ZPAA 4ES1A 3J7A1 2KZMA 1YDLA 5EUHA 1N32F 1TK0A 5DM6Q 2UZAA 3R1HA 1RT4A 4OV1A 1RT6B 3CC2S 2VA2A 3Q2SC 2NUUG 2XY6A 4WTYA 2XZWA 1R27B 1PJ5A 1TK5A 1RWVB 3IR5B 4Q2LA 4ZS6A 2X3DA 3DI6A 5T14A 1LXNA 3MEGA 4EBEA 4CLLA 1RBOB 2I5JA 2GVDA 2I1RA 3FFIA 3KFWX 2OTLS 2GO8A 5JVHQ 3V6HA 2ZZTA 1N32J 1NLKL 2HHXA 3FBBA 2CAJA 2HLUA 1CS4A 4K5SA 2E1AA 4UOCA 5F41A 1XK8A 2E1PA 1HD1A 3MCOA 3OXGA 1JLFA 2C3YA 3FK4A 4N7TA 1KP6A 4A8SA 3KG0A 2HWIA 3LH2S 1AUSL 2AJ1A 2JFKA 2GCFA 3DN9A 3RAXA 2ZBRA 4QYZK 3OQ2A 2CJXB 2Q1LA 2IM2A 4W98A 3PG9A 3CDAA 3W3SA 4QR1A 2H4WB 1BUXA 3TA0A 2GJFA 3H40A 5AXNA 1X4CA 5CA5A 2EBGA 5GAGU 4JI3F 3QGIA 3JTOA 2VOOA 1NKBA 2HMIA 1UAWA 4XDCA 1PILA 1YBUA 2JL9A 3OT9A 4RUCA 5HQMA 4ZHRA 3E8OA 3DMJA 2IHR1 2BQ3A 3TX8A 1MWZA 1AT1B 4JI8F 3H4BA 1JB0C 1KEKA 2Y1IA 4WK3A 4ZIWA 2B9YA 2O01C 2HNDA 1K73T 1QSSA 1Q95G 1S1WB 2G4BA 1NPPA 4X84A 3CUNA 2VHGA 2FB0A 2G2YA 2AEJA 1WOPA 3W5YA 5L9NA 2E5JA 5AXLA 1TV6B 3C8YA 4EGLA 4JI3J 3B8HA 3E51A 3BPSP 4LF1A 4GC7A 4MK7A 1SVDA 1DTTB 2GO9A 3TZZA 5ETSA 3BGUA 4U95A 2Z2MA 2OI2A 1N6QB 3GILA 4ECZA 4LSNA 4LRBA 2F40A 3GIKA 5K8MA 4N56A 2FZCB 4ILLA 3A3PB 4JI8J 3WBZA 3SV3A 4OI6A 1RXOB 1LXJA 2VG7B 2QRRA 2CVIA 2GA7A 1GXUA 3DRSA 4EO6A 2YKNA 2JOQA 2LP4A 1FTRA 2JEJA 3SXLA 1NPRA 2V68A 4AXJA 1KN6A 4O23A 1UL3A 2NPFA 1B4SA 3FVYA 4P10A 4XDDA 4B3OB 3SQGB 3QLHB 1NCLA 3HD1A 2GHVC 5LJ5Y 1FFGB 3VALA 2HVHA 2EK1A 2HHSA 1T95A 4PG4A 5KFXA 1KQFB 2FGCA 4LJMA 5E3PA 2PEBA 1NH8A 2DHAA 2IJFA 3KMQA 4F0HA 3SEOA 1F1BB 2AW0A 1WI6A 3KG1A 1N5YB 1DRZA 1REGX 3QGHA 3BGRB 4LRCA 1NDPA 1EZZB 2DYAA 5KFCA 2FHJD 1KS2A 4IH5A 1PJ7A 3BKFA 2PMWA 4FYDA 4UOHA 5E3QA 1TVRA 3B6BA 1UJ6A 1WHXA 1VC5A 3BPDA 2LVWA 2B4VA 1Y11A 3PYFA 3A4TA 3P5TL 3VZHA 2WVDA 4DL6A 3F56A 3BO3A 2V5HG 4C8OA 1VRTA 3KHGA 2ALZA 2FIUA 1SH0A 4LRFA 3PRBA 1OY9A 2B4OA 2ACMA 4QIEA 4NL5A 1X9WA 5I3UA 4Z7CA 2AEMA 1C1CB 4DBQA 5HO4A 2K2PA 1ELOA 2HVEA 2M4MA 2YQ0A 4QWCA 2QL5B 5HBMA 3G6XA 4FBTA 2ERRA 4ZPBA 2BRKA 1T11A 5FD1A 1FRIA 1T9XA 4I6AA 2CPHA 4WK1A 3NGUA 4X4TA 1NHKL 2G0IA 3NNAA 1UKUA 5K14A 4ECYA 4EWTA 1HW8A 3R8YA 1RKJA 4MKVA 3TX0A 4GVBB 1NO8A 1SC1B 1PSDA 1VCTA 1C4AA 2WVBA 1X9MA 2BKOA 4Y2CA 2I6WA 4TQRA 2EFVA 1NJZA 4OHZA 2E1MC 2PC6A 2OPPA 2E9ZA 4ZJLA 2ZBPA 1IBLF 2XS5A 5E3RA 2OIHA 2XEXA 2CADA 4A8WA 2LCWA 4JUZA 1RTDA 4ZP6A 3E01B 3TJ8A 2JJ4D 2KKHA 2V9WA 1E6YB 3N4WA 4CTAA 4NWBA 1T9TA 2YNHB 1HQ2A 2X1BA 1IM6A 1XR6A 3QFHA 3PY8A 1XJWB 3FZ2A 5EHHA 1WJ9A 2CQIA 2NXJA 4CLTA 1LQ9A 5K8OA 3BN4A 4K4VA 2C2DA 1N0VC 1TL7B 4B3SF 2ZC3A 1IBLJ 2GAHC 4LFCF 1VJWA 5J2PA 2XYPB 5CCMA 3EZ5A 4Q5VA 4LVNP 4OI4A 3K8WA 1RAFB 2XWXA 3GG1A 1QVGR 1P9YA 2QA1A 1FDNA 3O6QA 3V6KA 1SC6A 2DNQA 2HAFA 3CDBA 1REVA 5DJBA 3GZ7A 2J9DE 2Y1RI 1R43A 4N41A 5HATA 2CZ4A 1MN9A 2MZJA 1YJTA 2ZHBA 1FHTA 1WF2A 5CD4A 3FMBA 3K8VA 1I1GA 2DXFA 2WW8A 3MMBB 3T6BA 3SI8A 4OIXA 4B3SJ 4M5MA 4V19J 3LGHA 4C11A 4X4OA 1RA7A 4LFCJ 1UVJA 1MWQA 4MYUA 4TU9A 4ECVA 2B4UA 3T41A 3FEYB 4GKJF 2E5IA 4C0BA 4ZJQA 4B9SA 1SC4B 3IP0A 2VFSA 2VD3A 3GFHA 1JXLA 1UFKA 2BMBA 4F4AA 4CO4A 1M1HA 2FC8A 1YGYA 2ZC4A 2DHHA 2XSJB 3UR0A 4DUZF 1T8EA 4DX8H 3NL0A 2BANA 3OL7A 4J7CA 4KGMA 4N47A 5F0UA 3ULHA 4YOEA 2VFVA 4HI2A 3EZOA 2DHSA 3NAIA 2E5GA 2IAJA 1Y5LB 2MHNA 3ENWA 2CZ9A 5H9EK 4GKJJ 3G8TA 4NLQA 4YHHF 3LAKA 2QLBB 1HNZF 3F44A 5JVGQ 4ES3A 2ABYA 2LQJA 5CZXA 2DNYA 4RU9A 1P27B 4RNNA 5D6GA 4H4MA 4ZDNA 2OJ3A 4EZ9A 5E5NA 1RWOB 3Q8SB 1UVIA 2VICA 4DUZJ 1OIAA 3OHBA 1SUQB 5IT0A 2MLXA 3NGRA 2EG1A 2GIRA 1RTZA 3T6JA 2ATLA 4NEYA 4RWWA 1RJJA 4U7CA 1SKRA 4YHHJ 1MU2A 3AD8C 2BW2A 1HNZJ 3MAAA 3NGDA 2MLZA 3AH6A 1RWNB 3GFYA 1ZPWX 1YHQS 3IS9A 1EP4B 2MEWA 3BDEA 1CQNA 2FZGB 3QWPA 5FIIA 5CYQA 1RHQB 2JVOA 1T02A 3HULA 4EYHB 4B3MF 1NKEA 1VBXA 3EE3A 4F4YA 2CRLA 5DG9A 1R8BA 2GIFA 2FTRA 2WBMA 3R5GA 1Q81T 1FF2A 2DNLA 2JEIA 3OJUA 4X4SA 3DRSB 2X1AA 2YH1A 1KKHA 4RNHA 3DGPB 4DPXA 3NS5A 4FF2A 4OI3A 2W9BA 2W9CA 1NKCA 5KFMA 3QATA 4YR0A 1SV5B 1FKOA 2IY5B 4GRSA 1R31A 1UPPA 3BGOP 3BZQA 2V2KA 1ZAWA 3UNGC 2V2ZA 4B3MJ 1XBWA 4E8UA 2B6AB 3HSDA 3OJSA 1TKTA 1RWKB 2V2QA 1A7GE 3KHLA 5D3GA 4Y0FA 2IM3A 2RQCA 2DNNA 3I55S 4L76A 3VAGA 3CD6S 4CO0A 1FVSA 2IDEA 1AW0A 2EPIA 2QA4S 2UXBF 3UE2A 5DDRC 4OZLA 2YNIB 2R2UA 2EG2A 3N6MA 4I4BA 4NXMF 4LSLB 5L9XA 3W9HA 1AYEA 1MMLA 4P52A 4HTIA 2HWHA 4GO7X 3CJ8A 2DGOA 1OJ4A 2J7UA 3KLIB 2CQCA 2VDHA 2Q6CA 4BWJA 5AJ3F 2KL8A 3W5ZA 3JTNA 2N4CA 1U47A 1S0NA 3GONA 1VGYA 1U6FA 1U1OA 2GJ2A 2YTCA 2LQBA 4QYZJ 4ZVEA 1X4EA 4DPWA 2AYBA 1JK9B 5DQGA 3IWLA 2OFGX 2UXBJ 2ZH7A 4O4GB 3K58A 4OLPA 1QAXA 4DV2F 4NXMJ 1CULB 3EGZA 2DGSA 1UZDA 3EGNA 1BWEA 1ZA1B 1IKYB 3KJNB 1UETA 2M8HA 5AJ3J 4QWBA 2BRLA 2GAGC 1YRUA 2KXNB 1XQIA 4URSA 2DJWA 1WHVA 1Y3JA 4B02A 2ZH4A 2W24A 4DUTA 2BX6A 4DR1F 5DETA 1NSAA 2OD6A 2XMMA 2RT3A 1NK9A 4RW6A 1SL1A 4G6VB 4B9UA 2RHSB 3DDIA 4IOBA 3DOMA 2GHPA 3KJFB 5JMNA 5ETOA 3OL8A 2RD5C 4DV2J 4OZNA 1QE1A 4B9MA 5F9LA 4XO0A 1YRTA 3KLEA 2VF3A 3V6DA 5KFPA 2G9OA 4CYUA 4YB1P 3US5A 1NM2A 4Q0BA 4DR1J 3JQKA 3T5HA 3D0IE 5KAKA 2CJAA 1R0CB 3ET6A 4OX8A 2J9EA 3U27A 3WC2A 2XHWA 3RR7A 1KLMA 3S1TA 1UJ5A 4UZBA 2WW4A 2CIMA 1NK4A 2OPSA 1U25A 4ECRA 4ZKAA 4ID8A 2LQ5A 3A8IA 2AF6A 1S1UA 2R7WA 4URGA 3ZNJ1 2EWHA 5J2QB 5B0BA 3MM5A 2C3PA 1WACA 3PR5B 1XMQF 2ZKUA 1AXQA 1T03A 4ELUA 3BS9A 3AQPA 2A2CA 1B7FA 3GFXA 5G0RB 3ISND 3HZGA 3QO9B 4NA2A 1LFWA 1MW7A 4B3RF 2L08A 5IS2A 1FDBA 1NXIA 5C24A 1X9SA 1TR0A 3PJWA 4F4XA 2R7VA 3QT5A 4ZPDA 3SYZA 2LDYA 1Q86T 3HVWA 5HMYA 2KG0A 4J9NA 1RHRB 3OUYB 1LWCB 3MPUB 2MZRA 1MMDA 4HHUA 4KPYA 1Y10A 1PCAA 3HKWA 3HKZD 4B08A 2GJIA 1RAGB 1FA0A 4DDFA 4B3RJ 3Q8RB 3QMQA 3C16A 4I0WA 1SCJB 1WKKA 3NOCA 4IO1A 4Y2AA 1QUVA 1LOUA 5HQLA 3TRGA 2CQBA 3ZTOA 4CO3A 3LGNA 5FLXU 5FLXY 2RDJA 1N33F 5KFKA 3KLFA 1FRLA 4V19X 4EUVA 4RPFA 1FCAA 4X66F 4DSJA 4KO0A 1JLBB 4DR3F 2Z56B 1VFJA 3KNAA 2AJQA 4P9SA 1JNRB 4HTJA 5GAHI 3MPYA 3MEEB 3A3OB 3U02A 2ZE2A 3UD3P 2YKMA 1XN9A 5KFGA 3MMAB 4QIGA 4C8NA 3PIPQ 3TP2A 3FCWA 1UVKA 3KDNA 4CT8A 3GJRB 1FXDA 1VBYA 1NHVA 2LA4A 2RF2A 3V6JA 1N33J 4LSZB 4KR0B 2GFFA 1EETA 4X66J 1FRKA 4ZVFA 1A9NB 2Y1LB 4DR3J 1FFWB 1M5OC 3IS9B 2APOA 2WAQD 2XGPA 4CLWA 3CD7A 4FYYB 4PXDA 1U49A 5IOLA 3HT3A 3MUMP 1NNDA 1K0VA 3ZZPA 3LPEA 5HMWA 4DQQA 3K89A 4HACA 4CH7A 4HH0A 1M0SA 4NX9A 2CA9A 3PR4A 4A48A 4KGZB 4DF4A 3AT1B 1GXTA 2G0CA 1VBKA 3IFEA 3V4IA 2QT7A 1LNQA 2K06A 3LA0A 3D0HE 3LUYA 2ZKTA 2Z0GA 3SSRA 4CO5A 1HL6A 3M6WA 3CJ4A 1JXEA 2OSQA 2C3MA 2DH9A 4DWIA 4Y3CA 4NCGB 2HGNA 2H54B 1TKTB 2FVCA 3LOUA 5HVHA 3ZFVA 2RQKA 1JLGA 3MM6A 2FJVA 3TA1A 3GB0A 3ITHA 1P8GA 5F8MA 2K1RB 3KUGA 1FXRA 3MPVA 2XMKA 3MR5A 5IWAF 4WZMA 2B7CB 1ZETA 3M30A 2BE9B 2QMXA 5KFAA 1YZ6A 2OHDA 1DTQA 3A3NB 1U0HB 4A47A 1EX8A 2RRNA 4M5DA 3DRRB 3ZZYA 1HPZA 3EGVA 3LTOA 4JI0F 1HW9A 4UUWA 3BDPA 4O3OA 3NMAA 3O5TB 2IA0A 3QIPA 4DPOA 1SJ1A 5H9EJ 3ETMA 4KJIA 2XB2D 5IWAJ 1BQXA 3AXKA 2WSEC 2GGPA 1Q1KA 4CM2A 4LF8F 1DY3A 4ECXA 4OMFG 5D8HB 3VWSA 4TXSA 2CG8A 4JI1F 3ZXWA 3DLKA 2HFSA 4OYIA 4PPDA 3RYLA 4JI0J 4PG7A 2KRBA 3AJDA 5IM0B 2MY7A 1T9YA 3QJLA 2QLXA 1BD6A 1N0UA 1U24A 3F73A 2M9KA 1WC4A 3S7RA 3K0JA 2MTLA 4LF8J 4CT9A 4DOZA 3HHLD 3HHLA 3G87A 5EX3A 4CI0B 4LF5F 1ZS6A 2YBVA 3L09A 4JI1J 1Z1ZA 4NLSA 2ZOGA 4NCBA 1CEZA 1AFJA 3QAEA 5H9FK 4BS2A 1GTHA 4L3NA 3V6DB 2HZAA 1H3DA 2CYYA 3W60A 4AUKA 3VAKA 4JI5F 4CYUB 2XTJP 1R8CA 1ZA2B 2KVQE 3WIVA 1BY9A 3M8PB 1ZYQA 3J80Y 4JV1A 2V8GA 2GMHA 2C2ZB 1KSPA 1VQSA 1RT1A 1FK9B 1X4FA 5ETQA 3BYRA 1HWKA 4KY3A 1U45A 2A10A 3HMJG 2QL9B 5DLGA 2NXEA 3KNGA 4ZVSB 3JSMA 4KFBA 4LF5J 1CJVA 2VFUA 2DITA 3CVKA 3QWUA 3Q86A 3TZXA 2HQIA 1JQGA 2J9CA 5HQ8A 2VV5A 4JI5J 4IG0A 2DO4A 2IBKA 1HWUA 4USKA 1HQEB 2CQHA 1S6OA 4DV3F 3MR7A 2AU0A 2H4YB 1HBNA 1TL5A 1WEYA 4R0JA 3CCMS 1GMUA 3CCVS 2VB6A 2KU7A 1CJTA 4BCAA 1VS3A 3U1LA 3NCQA 5HLFB 4OYBA 4TVAB 2J9DA 3G82A 2ASYA 1KFSA 2KT2A 4Y2MA 2F8EX 1D0EA 4DV3J 3UWTA 1RAEB 3BF4A 4TYAA 4P2FA 2FLOA 3MD1A 4FPIA 1S5ZA 1D09B 4QBUA 4J9SA 2AEFA 2KFNA 1MNEA 4IR1A 2ROPA 3CJQA 3NAHA 2PI5A 2UP1A 2GS8A 1F0XA 1FDAA 5F8NA 2JHEA 3TEGA 1QSYA 1FX4A 4YMEA 3VVTA 2F5GA 3M32B 4M5NA 2QLWA 2ZDPA 1GFWB 2UVVA 5DG7A 1BC6A 1NK8A 1UWAA 3GFZA 1H6KX 1XEZA 4M8LA 2FY8A 3M2VB 2AV5A 2CPIA 4ZLLA 2QA2A 1YJNS 4ELVA 2AYEA 3UVJA 3H25A 4Y6IA 3J81j 4PXEA 1RAHB 2HNZB 3SSSA 4CH1A 2CDRB 3AJ1A 1S1TA 1UP1A 1TAQA 3MHYA 2RKIB 1N5QA 3M7VA 1RT7A 3IAS9 2VJVA 4DPTA 2MKJA 2ROEA 3O44A 4RW8A 1LW2A 4NA3A 3J81Y 3J81U 2ZVIA 2W9AA 2DGTA 1TKXA 1H7XA 1F9HA 2GV1A 4RW9A 3D67A 5IC4B 2HK2A 1P9QC 1S9EA 4DQSA 3DDKA 1RUSA 3S01A 1FX2A 4K2JA 2W2NP 3JB9k 4OYMA 4F67A 2VBZA 3NXZA 3GPAA 1BHNA 3BBFA 5J2MB 2M5YA 1D1UA 1S9GB 2RH3A 4OV6A 3NS6A 1UVLA 1ACMB 3PFEA 2BOAA 4OZ5A 2DNPA 4UQGA 1R8PA 3CJSA 3MPWA 3K59A 1YRXA 1JMTA 5A8KA 4DQPA 1WDTA 2CPJA 1WSRA 3CJKA 4O0IA 2FHMA 2A2DA 3R5AA 3DXBA 1EKRA 2F9JA 3O8WA 3G6YA 1RK8A 1IM4A 1LWFA 3PTWA 4ILMA 4KH0B 2ZNYA 3RBEA 4UY8T 5CYJA 3G2XA 2EFGA 3BEGB 3A8KA 1T9WA 2KDOA 1NBEB 2ZH3A 9ATCB 2YNFA 3JS9A 3MM7A 3MI7X 4EK2A 4OYZA 4F8RA 4OX6A 1R0AB 1CJKB 4C98A 4C8YA 1HNWF 4I6YA 3NY0A 1AB8A 1Q7YT 2V6AA 1S1XB 4U8VA 2F3JA 3KK1A 3OL9A 4NLOA 2DK2A 4NRUA 5KG7A 1L3VA 2RQ4A 3GCWP 2GHWA 3T19A 1SJFA 1SBRA 1K44A 3KLHA 1VQ8S 3M30B 4DV0F 3IAM9 3AA8A 2EKYA 2YKQA 1F3FA 2OTJS 4RLEA 4PZVA 3FC9A 1XC9A 1S4EA 1P1TA 4DU8A 4M5DB 4CDIA 1HBMA 4JV0A 4Q8EA 2M52A 4O0NA 1HPZB 2BJ8A 5HP1A 4HHHA 1RA6A 3ISZA 2BKNA 5BXIA 1RADB 3NBPA 3I6PA 3G71S 1EARA 2DD8S 1HNWJ 5D0GA 2XBPA 4DV0J 3UCGA 1OYEA 5D0EA 3RBXA 4HT7A 2MXYA 2KM8C 2ZBCA 5C7PA 2ZH1A 2AJ0A 4BDPA 4CH0S 4M5KA 4QIVA 1WKJA 4DX6A 1ZTWA 4DR4F 3NCRA 2V69A 4IKAA 1KVKA 3PYEA 3U7JA 1PC5A 3TAMA 1NK0A 3KHHA 4IH6A 4GC6A 1WELA 4ICLB 2MKYA 4F4WA 1LEOA 4RL1A 4Q43A 1OQ6A 3THTA 4FYVB 4CO1A 4TY8B 3MR3A 3VGUA 3CB4A 3D6HB 1RI7A 1UW9A 1F5CA 3AD9C 5KG0A 3HHLB 4DU7A 4DL4A 2NXUA 3MM8A 5HN0A 2YKAA 3CCES 1F3VA 4DR4J 1HBUB 2CXEA 5IT4A 3JYTB 1U2CA 3IM8A 3TVKA 1M1KT 3BO4A 3V81B 4QOTA 2GVZA 2OPRB 2GQ2A 3KK3A 2XC9A 4LRDA 4RKUC 1DURA 1ZPVA 1NMEB 2P5VA 2MGZA 3QJJA 3M8YA 3MUTP 3N5FA 3KMSA 1S4FA 4K5RA 1CJVB 5SZTA 5FDLA 1NSPA 2KVIA 2GMJA 3PZPA 4WKRA 1WNEA 3EPGA 4K4WA 4B9LA 4WIQA 3BSAA 1C0UA 1H72C 1B3TA 2MKIA 4IG0B 3GV7B 4DUYF 1SL2A 4PUOA 4FNIA 2RIJA 4RW4B 4AFFA 2R8JA 2DGQA 1TL3B 3BR8A 4ANDA 4DLEA 4KKOB 3W5XA 1HBNB 1KVIA 3I0SB 2H5EA 3A1YG 3HCXA 3LALA 3H5SA 4H4KC 3ZZUA 2HHTA 2JVRA 2IC3A 5LMUF 3IGNA 4ZCLA 3CTRA 2N3OA 1CJTB 1DJ0A 1RU1A 3AB4B 3IBWA 2LFVA 4NLRA 4UZCA 4DS5A 2IVMA 2W7AA 4H4KA 2D3OR 3WDOA 1FJCA 4ZVOB 4P7TA 4I2PA 1H2UX 3P3DA 1ULRA 4DUYJ 2C1EB 3VCDA 3CMES 1K47A 1K1QA 3DU5A 4Q8FA 4TQSA 3MTJA 1O5JA 1F5BA 3LP2A 1X4AA 1JLCA 1TL1B 2JNJA 2RILA 1N36F 1F60B 5C2CA 1RKIA 1F2HA 2VPWB 3D6MB 1ITPA 2VONA 4RW7A 3D66A 3E3XA 1YITS 2I8EA 5I3QA 5LMUJ 3KUEA 3SFUA 1S6PA 5KT4A 4DG1B 3DLLQ 4LREA 2BQRA 5RUBA 2WOMB 2V8VA 4DFKA 3MUVP 4QWAA 3IC1A 3LGMA 2DR7A 4N8NA 6FD1A 3L7OA 1IKWB 3CJ3A 1GT8A 1RT6A 2MKSA 2N7YA 1MSWD 1N36J 8AT1B 1G2EA 3HT0A 3VGVA 1TKZB 5EWEA 1WC3A 4RNFA 1Z2LA 4C8MA 1YJWS 1VYAA 1AFIA 1SIWB 2VQEF 4PYDA 3OLBA 8ATCB 3DCAA 2PN6A 1LW2B 2F4VF 2HWTA 2F1FA 3QT8A 1SJRA 3LP0B 1S76D 3JSBA 3DRXA 4USJC 2DHXA 5HVGA 1AROP 3D68A 3G4SS 3QRPA 1X31C 4IYQA 3ENQA 5H9FJ 1Q7LB 3TARA 3VAJA 4GKKF 5J1NA 3KWMA 3V2UC 3C14B 4PWDA 4KRWA 5B09A 3TVYA 2DBBA 2JLEA 2VQEJ 3M4XA 3QYYA 4X64F 4O44A 2ADCA 1XIQA 2F4VJ 4DR2F 2R8KA 4NA1A 2K7KA 2E7WA 3TW0A 2QG9B 1KR4A 4YN3B 3LQVA 3QRQA 3H8YA 1Q16B 1LWFB 3BYPA 4GKKJ 3MECB 1KLNA 4ZITA 2XY5A 3S8SA 2KFYA 3R2CJ 2LMIA 3M6VA 3GV8B 2LQ9A 1SI9A 1QTMA 5J1PA 4KPCA 5THWA 4X64J 2YWKA 4DR2J 4M5JA 3I0RA 4G1QB 3GR1A 3IR7B 1WTBA 2JFDA 2FVRA 2DRDA 1S1WA 3ICLA 3KK1B 5KG2A 3FEZA 3H7HB 1RHUB 2ALYB 2VFRA 2B56A 3R5JB 3TO8A 5KFSA 1H2TZ 3PEJA 1YTYA 5LJ3Y 3HDSA 3QAUA 2DPJA 3W66A 5A8WB 4HYKA 4YB7A 5AE2A 1DTTA 1HARA 5K8NA 3IRWP 2FQQB 2HGMA 1U6BA 1HBMB 1N6QA 2N4DA 1XNQF 2OMLA 2D1CA 3G6ES 2R2RA 3VAFA 2C2KB 2FD2A 3R6LB 2DXDA 2MQPA 2R7QA 1HR0F 1UA1A 3RR8A 4KGXB 5J1EB 2QMUB 5DO2A 5E0OA 2EI5A 1RGVA 3BJYA 4H4OB 2QO3A 4NZ7A 3CJ2A 4YQWA 3AJ2A 1FVQA 2VFTA 4PQUB 5KFHA 1Q5VA 4F4KA 4L75A 4J9OA 1GK8A 2HHHF 1LW0A 1VHIA 1MLAA 1KOOA 2JWNA 1IQZA 2UV8A 4USHA 3SQGA 3QLHA 5IT9Y 4ZN3A 2MZTA 2ASDA 4JI4F 4ECWA 1XNQJ 3PW2A 3MAQA 3TAMB 3DLJA 4O4RA 5B0AA 3BQ0A 3PRVA 1BQMA 3PKYA 2BE2B 1HR0J 2MJUA 1NH7A 1N5YA 2BEFA 2M3DA 5KFLA 4FNHA 4RX6A 3BGFA 5G4DA 2XLJA 3NOGA 2KZZA 3C19A 2PFFB 2HHHJ 3TYTA 2HFOA 4JOUA 2HQ3A 3SMZA 3MCSA 1HI8A 2RHQB 4X4UA 4LQ9A 3SCLE 4JI4J 1NPKA 1FJ7A 1VQ6S 4C8ZA 4L74A 1JXVA 1VOMA 1HWIA 3DHWC 1WDDA 3UN3A 1B0TA 3EXYA 3QT6A 5ETLA 2UV8G 2E1RA 2VBXA 3CCSS 1HHTP 4NXNF 1XERA 1C1CA 3QGGA 3WQPA 4J9LA 4NLDA 2K3KA 3ZZTA 2SXLA 4EI2A 2DKOB 2FJEB 2CJQA 4KH1B 2V63A 3BQ2A 4C3MA 4AD6A 5HMZA 5BYRA 2FJWA 2WRMA 1S79A 1TK8A 4NZ0A 2A0FB 2HLTA 3N9UC 2OUGA 4EYIB 3MF5A 3TVZA 4XIUA 2POKA 5DG8A 1R6YA 2C28A 1QVFR 3AD7C 2HFVA 1EHWA 4G1PA 2DNRA 3MDFA 2HKEA 2MMYA 3CIMA 4UQTA 3ILLA 2J5AA 1SB6A 1FNMA 5I3PA 4GVBA 3J7YI 4NXNJ 1HD0A 3L4BC 3SCIE 1NEEA 2MZQA 1LV5A 1S97A 1LKZA 2JLGA 4MIBA 1SKUB 3EPIA 2IC3B 5B08A 5LSRA 2BUNA 1HNVB 4F7VA 4HHJA 4MKYA 3CMAS 1HWJA 2M7SA 3E01A 3B4DA 2EXUA 4YS2A 3KK2B 2DNZA 2ZH2A 4ZLJA 1DQ8A 1FKAF 4QJVA 2ZH9A 3SBMA 1TUVA 1FXLA 4IFVB 1E6YA 2PEHA 2B9WA 2Q43A 2KFZA 2NQPA 3ZTRA 1PKUA 3OR2A 3OFHA 3WX8A 5LSLA 1NB2A 4AL7A 4OZ1A 2XMAA 3WHIA 3H2LA 4R5PB 5CD4H 2G13A 1I3OB 4C6AA 1TL7A 1RWUA 2MY8A 4C8KA 2Y1JA 4LFAF 3GU0A 1EIYB 4G1IA 4NMXA 4Y2KA 1M90T 1RZMA 2IIHA 2XM3A 3MMCB 2FJAB 1R8AA 5ETKA 2NPIA 3FQLA 4ES2A 3D1QA 3O1LA 2HIQA 4ZVTB 1NK7A 1WF1A 4XPCA 2W4DA 3K57A 3ZZRA 1WG5A 4KV8B 1YZ7A 2ZJPQ 5DZ6A 3H2VE 3MMBA 1FRXA 1X5PA 2W4CA 2C2NA 2AKWB 2PO4A 4N77A 4DMZA 1HHSA 4J91A 1UFLA 4LFAJ 1S10A 4A4JA 1UJ4A 1Q0NA 3IR6B 4K50A 4LQ3A 4HT5A 4B17A 2H5JB 1S6QA 5F8JA 4KGVB 3I5AA 3OHAA 3RU0A 3DM2B 1R0BG 3F41A 1EQMA 1RLCL 4M63A 4HDHA 2HPUA 3RAQA 3TZYA 3QGPA 4CLFA 5D0RA 2XSJA 5KOWA 2ASLA 5BYQA 1T05B 3D3BJ 2Q3PA 4PWDB 2Z58B 3MCMA 5EDWA 2CQ2A 1NZAA 2KJWA 1KOHA 3RZAA 4OYOA 4O44B 3CJTA 4KBIA 2Z2LA 4AE5A 4WU2A 3ENAA 1IJEB 2V4QA 3I56S 4OJ1A 1AZSA 2PFDA 4ECQA 1V3ZA 4X4VA 1Q4RA 5D4PA 1TAUA 3EJMA 2KHDA 1SUQA 5KG3A 2HNYB 1T94A 2QYGA 4DHVA 2DNKA 1TMMA 3KTQA 4E98A 5C42B 2B8PA 2W8KA 3I0RB 3GV5B 3HHEA 4NLXA 3EICA 4OQJA 2VA3A 4G3IA 5KFQA 5D4OA 1O6XA 4RO0A 3RBZA 3OTBA 5DS7A 1EP4A 4PR6A 2LQ8A 4J9PA 4YY3F 2VL1A 3FCHA 3IG1B 2F9DA 1T0TV 5E3CA 2ACYA 2CJYB 4CZCA 3MEDB 1XR7A 3NP5A 2AQ4A 4I67A 4WFXA 4JYAF 4ANCA 4CLKA 1FD8A 1FD2A 1NJYA 4F36A 3UCZP 3HFZB 1VC6A 4JP8A 4EEYA 5B0DA 4LF6F 3THPA 4ETXA 1WI8A 4LIWA 4XK8C 4WFAQ 3Q23A 2HS3A 2R7XA 1GEHA 3PX4A 1TZ0A 3GR0A 4UY85 3H5UA 1PAUB 2V9KA 4WKYA 1Q8LA 2U2FA 4ZIVA 3DGPA 5IQ6A 4ITSA 5J2NB 2ZH5A 4YY3J 4DPUA 4S0MA 1HNIB 4IOAQ 4YUDA 1SV5A 4MK8A 4EFAC 3M8SA 2CJBA 4JYAJ 1LW0B 3OTDA 4LF2A 5I42B 3PX0A 1NDLA 4DN9A 1FFSB 4LF6J 3K2YA 2B6AA 5C25B 5D15A 5GAGI 2R7RA 3PVXA 1MWYA 3H42A 3ZTPA 1RQ0A 3ZZZA 3HHNB 3H2UB 1HIYA 1BQMB 4O3SA 6AT1B 2IBOA 1NRKA 2JC0A 3UN2A 1NJXA 2XS2A 3VZIA 3MWBA 4WYWA 2MB0B 2EKNA 4AQYF 1VI7A 3CSKA 4FP9A 4GVLA 4TLQA 5ETPA 2FHJA 4WFNQ 2HHUA 3OSPA 1RTJA 4IQXA 4MH8A 1ZM2A 2MDAA 2ZBIA 3CGIA 3LP1B 4DJBA 2YNIA 2ZWOA 3AAWB 3WX4A 3T5JA 3FQKA 3PM9A 2XCPA 4LSLA 4MAKA 1E6VA 2QSFA 3M1VB 2WVCA 3KLIA 1HQUB 3QZ7A 4ZVQB 4WE1B 2KB2A 2VOPA 1YI2S 4MMOA 2BR0A 1KTQA 3C6TB 2Y0BB 4AQYJ 3I87A 5M2RA 3ONQA 3W9IA 2NZ4A 1V5IB 4R0EA 2XMVA 2XO7A 2FJBB 1GMWD 1GMWA 1I5OB 1RBAA 1IQTA 4NLGA 2DNOA 4O4GA 4IDKA 2H65B 3K5NA 2PE8A 1CULA 4YEAA 5IV3A 3X1LB 5KFBA 1IKVB 2OELA 1IKYA 4A8MP 2RS8A 4PG8A 3DLGB 3MCNA 2LXIA 1OSCA 5U47A 1HLWA 2BVZA 5KTQA 4I68A 2YX1A 3E2EA 2J0XA 1YBTA 2AJ2A 1RLDA 1CVJA 3RRGA 1N56A 4DZDA 2YWEA 1HA1A 8RUCA 1YJ7A 2IYGA 2R8HA 1ZOTA 3BBCA 1B0PA 1CC8A 3PW4A 1JLQB 2LEPA 4C2MA 3OR2B 1DHMA 3T1AA 2CWXA 1KFDA 1URNA 2B51A 4I7FB 4X62F 3C15B 3MM9B 1CJUB 3CMQA 5LXYA 3B54A 4UOGA 3CDWA 3OSNA 4HR2A 1ZAXA 2YPZA 1IKXA 1I51B 3M2RA 5KFVA 4ZVGA 3SCJE 4TYBA 5AXMA 5J2QA 5HJXA 2XQCA 1S57A 1O0PA 1KHWA 5G0RA 3I82A 3QO9A 4X62J 3MXHP 3HXMA 2HQCA 2E7VA 1U48A 2ZHOA 3TR5A 2QIFA 4A8FA 4DV1F 5E2QA 2PMZD 4RBTA 1K1SA 5EWFA 2QA4G 4K4XA 1HYSA 2C42A 1C0TA 2P9CA 2AWZA 1WC5A 5E7OB 1FDDA 1GAOA 4HDGA 3DLBA 1RE1B 5KFNA 4OI1A 4U8YA 1S6QB 2HVIA 3MFIA 2C2RA 4ED6A 4BBYA 2HRYA 3OUYA 2OMOA 4Z37A 1LWCA 5LXRA 4BC9A 2ADBA 2YQ1A 4FXVA 3DYAA 1ICEB 3DXSX 4QPXA 3DOKA 2H9ZA 3I9ZA 2XLKA 2PT0A 4DI6A 3MD3A 2EFQA 4DV1J 4WCEQ 1FTCA 3CC7S 2ROGA 2V8PA 2DGUA 3EZUA 1CQMA 1U1PA 3D6TB 4NLVA 2VG6B 2W2MP 4DZ6A 1Y9OA 5CYMB 4ZVHA 2QFIA 1JLBA 1DAXA 1HMVB 5L38A 4U7UK 1AZSB 2JC1A 2MSTA 4HEA9 4YFUA 3MEEA 1RYSA 3K5LA 4RU2A 3PEHA 3Q89A 2CNKB 1F5AA 2Z2ZA 4OJHA 3HSGA 3MMAA 1LWEB 2VPYB 5HJYA 2UXCF 3DFEA 5GVQA 3K5OA 5B0FA 1G7CB 2U1AA 3AA9A 3FMWA 3M9NB 2VQFF 3Q8PB 5K20B 2JZ5A 4ZJOA 2F63A 2XMUA 1J5OB 1GNKA 2CNLB 2R8IA 3VAHA 3HPOA 4HKQA 4TKTA 4A8YA 5ETMA 5LT5A 3L3CA 3AOCA 3RB6A 4M94A 5L8RC 5AXKA 4FZVA 1R6VA 3JSRA 1B0VA 5CXTA 3N6LA 4WU3A 1M5KC 2UUTA 1XNRF 3B4MA 1F2GA 2HRTA 5IQQA 2UXCJ 2CJKA 3CJRA 3IRXB 4MJKA 4KHPF 3MURP 3TAQA 1EB0A 3B78A 2CQPA 4W92B 4ZLPA 2XY7A 5C5JA 2C2OB 4ENOA 2VQFJ 4Y2IA 3HK2A 2HHVA 1SIZA 2NLWA 4J9UE 4P73A 4I56A 3PW5A 3NMRA 3PHEA 4URQU 4F2RA 3W2WB 2ZWPA 1X0PA 3JXOA 4OX9F 1TP7A 3PKMA 1Q5YA 1LFPA 2ILYA 3CCJS 1XNRJ 4OHYA 2NYIA 2H3EB 1KNZA 3TA2A 4KHPJ 1M5PC 3MR2A 2C3OA 1O51A 4NCGA 4M5LA 4ETZA 3TOQA 3A8JA 4LF7F 3MR6A 3AODA 3HX9A 4FS1A 3V4MA 2R8GA 4NMLA 4IH7A 4ZA1A 1L5UA 1UEKA 3SCKE 2K1RA 4OX9J 2XNQA 2YVSA 1SJ4P 3GJTB 3BREA 3M8WA 1RAAB 2AZ1A 1RTJB 1GTEA 1SC3B 2JSXA 2YX7A 1BE4A 1U0HA 4CP5A 4DSLA 4HLBA 3Q22A 1JLEB 1U26A 3TUJC 2XI3A 3OTCA 3DRRA 4LF7J 2VBYA 1SH3A 1E6VB 2PIIA 4DR7F 2BBEA 3T1YF 2B3TB 4FXWA 3OFFA 3FSXA 4KIAA 1S12A 2CG4A 1PYTA 4MT1A 4ZP9A 5F8LA 4WP3A 4OZ0A 4NLUA 4OJGA 3Q24A 3CCWA 1RWMB 5KFZA 1L3SA 2FVSA 1X5OA 2WVEA 3D7SB 3A13A 3PACA 4FF1A 4IDKB 4WWSA 2HYIB 2ZD1A 3Q83A 3VR1A 4DFJA 3VQTA 4P7VA 4DR7J 4W90B 3T1YJ 4DV6F 1KWMA 2Y8WA 2BW7A 2HVDA 2EEYA 5IM0A 9RUBA 2M2BA 4Y00A 3GYNA 2KYZA 2HW3A 4F04B 1FRJA 3Q8YA 1DZ5A 2RU3A 4F25A 1IVZA 1IJFB 1SQGA 3BBBA 1VQ5S 2CUYA 4UF4A 1HBOB 2V4RA 1W2IA 2JX2A 2FLNA 2FVPA 2FC9A 4ZVPB 2QSWA 3OV7A 1U8WA 4RNOA 4DV6J 1IN0A 4P71A 4C9DA 1RT5A 1N54B 1NDCA 4QIFA 2Y9HA 2X51A 1FNOA 3ELHA 2HG4A 1RT3B 1Y4ZB 3PHTA 4K4SA 3M8PA 2E44A 4ED8A 4N5SA 3M2UB 4CWBA 3ILOA 2RSQA 4C7QA 1FK9A 4IG3B 1PIEA 3Q8UA 2H1YA 4BHQA 2FPHX 3LAMA 1IKXB 5BJRA 4NYZA 4K0KF 3M2RB 3FSYA 5B0GA 4KAIA 2B4PA 3W1YC 3OR1B 2V67A 4AT1B 4B9TA 3ISNC 2R7UA 3JSYA 1MROB 3JQMA 1ZBTA 3MPDA 3D1OA 4IOCQ 2V34A 4A8KA 2BOPA 4DX7A 1YK9A 1HQEA 2CQDA 1RTHB 4UTGA 4JV2A 4ZCKA 3AB2B 3OXFA 2LXUA 5HMXA 4WP9A 2EFNA 3VGTA 1RCXB 3I5CA 3UI3A 2XG8A 4ZCMA 1YBAA 4J9KA 1HYSB 1NUEA 3EDQB 2XLIA 1C0TB 2NYHA 2WZ1A 2OKQA 3RJMB 1J5EF 1FJEB 2OP5A 1WWHA 3L7UA 2CQ1A 5M2UA 4K0KJ 2P2CB 4CLZA 5L39A 3P96A 2AP6A 2XO6A 2V8DA 1X8DA 3NEKA 2BA9A 3KLVA 5HLFA 4P2SA 1XMQJ 3K5PA 1K0TA 2EC0A 3DYAB 2HAIA 4CLSA 3MTKA 1C2PA 1Q78A 3DOKB 3HZEA 1OMSA 1VRQC 2Z8QA 5B7WA 1L3KA 2G1HA 1D8YA 2MKHA 1CC7A 2GMLA 1BXNA 1RTIB 1OPZA 2MKKA 1YJ9S 1J5EJ 3GQCA 1WSVA 4W4MA 3HFVA 2N82B 2DIVA 3M32A 1KBRA 4ECUA 4QWDA 1LWXA 1S1VB 1UW4A 5MAOA 2O5DA 2ZNZA 3FBCA 3M2VA 3CCRS 5IFMA 2Q79A 2QJ3A 2OH2A 3ILJA 3KLGB 2Q66A 1RHJB 3G6VA 3IO1A 4RWXA 2HNZA 1GQEA 2FJDB 2JRSA 4O3NA 4IRDA 5A6WA 1RHKB 4J9MA 3PIOQ 2N7CA 3SIPB 1J27A 3KXDA 5A0YA 2RKIA 1KONA 3AQOA 3H0PA 3PJ9A 3C3LA 3D5MA 2RUSA 3D2WA 2BJEA 3UD5A 2ZOFA 1G6BA 4RBUA 3ETOA 2DT9A 2W1BA 4WYLA 5DDOC 3EGWB 2CWKA 2E66A 4IUFA 1JLAA 1O8BA 1Q79A 4X4QA 2M88A 2YKPA 4ERDA 1T9VA 3GP9A 1V9OA 5KFOA 3AFGA 2L3MA 2DH7A 1S7IA 1KQKA 2RNEA 2RB7A 2IRXA 4U96A 1U1KA 3D0GE 5J2MA 4QYRA 2QL7B 3I9V9 2XGQA 4M5IA 2VUGA 5IXUA 1S9GA 2DY9A 1H98A 2CQGA 4M5HA 1FE0A 3IGVA 3DRPB 1Y00A 4ECTA 2C3UA 2NXCA 2F8MA 2VODA 2DGWA 1WC1A 3DOLB 2FVQA 4ED5A 1S0VA 2IJNA 3CO0P 3IWNC 4OL8A 2KRRA 5KFWA 5ADZA 3M6UA 2V4JA 1Y3KA 3VAMA 1NJIT 2CKWA 3R7BB 3W8PA 4ED3A 1UMJA 4C8LA 4OHXA 1JJ2R 3CXCR 1FJGF 1J2VA 3UN5A 1TUGB 3W2VB 1RWPB 1HWLA 2LA6A 2E5HA 3PO5A 3GJQB 1WHYA 3EUNA 4P2MA 1R0AA 1CJKA 4NASA 2XZDB 1HI0P 4RZRA 4K4ZA 1S1XA 3A8EA 4USMA 5D0HA 1WEZA 3POTB 3UDEA 4PYAA 5KG1A 1VQMS 3U1MA 1B99A 2MQLA 1A6LA 1BGXT 2O67A 3W61A 2CVEA 4EU0A 4D3HA 4O3PA 1FJGJ 4MFBB 4IFYB 2ZBQA 2BKPA 2GQCA 1PAEX 4AXIA 2M8DB 3M8QB 3QNWB 1UVNA 5BR8F 1M5VC 1UVMA 3CD5A 1FRHA 1S6UA 1B64A 3FUYA 1D8ZA 2KO1A 2OSRA 1GX6A 2NSBA 4XPEA 1R3NA 1GMVA 2X1GA 4CRJA 2D74B 2EC2A 2HK3A 2ZD1B 4C97A 1G3OA 1H2VZ 4WP8A 2HQDA 5GMEA 2KYXA 2WB4A 2IMWP 4CQ1A 2M70A 4J90A 1C1BB 4ZVUB 4Z2XA 3GSIA 2JEGA 1RT2B 2DPIA 4TN2A 4QCLA 4AL5A 1VQKS 3PDNA 4ICLA 5BR8J 2W7OA 2QLJB 3CNQP 4R8UB 1DLOB 3I5BA 1WC6A 1VQ4S 3HHLC 4DEZA 1DQAA 2I0XA 1RSCA 4I2QB 4TY8A 4UW2A 2XULA 2JDJA 4U6PA 2VASA 3DLEB 1VQNS 2YX4A 1RB0A 2ZZMA 1HBUA 1T9UA 2CQ0A 5T7LB 2VG5B 4Q2MA 4OI2A 1JKHB 1DARA 3JYTA 2V50A 2CPYA 4Z7YA 2BJ9A 5KT3A 5FJ4A 4ALZA 4K4YA 2DR8A 1WUUA 1ZM9A 4DSEA 1RT5B 3V81A 3HM9A 1GH8A 1FNXH 4DCOB 1BQNB 2OPRA 1ZM3A 1W25A 2CNOB 2W2QP 5A8RB 1G1XA 5KFFA 3F0NA 5A6PA 3SSQA 2HZCA 4U7UD 2JH3A 1LK5A 3KDOA 3C6UA 4OX7A 2HHPA 4R25A 1QM9A 2G1DA 1EKSA 2OO4A 4OI0A 3M05A 2QEXS 2RVJA 1UWBB 2HFZA 4WBFA 3W62A 1S59A 4QR0A 3PV8A 4ED0A 5EX0A 3UPFA 4OLOA 2G2OA 3UQSA 4NLPA 2OPQA 2ZDOA 5HROB 5F3TA 4A46A 3R3TA 1Y7PA 4RW4A 1TL3A 4FVCA 1ZZFA 3HVTB 4KKOA 1HKAA 1U09A 5DRKA 2HGLA 4LBPA 1DFDA 3I0SA 4LUBA 3NS7B 2YWWA 3HO1A 1I94F 3RG6A 5ITHA 4WFBQ 1RT4B 1RAOA 2IRYA 2BZ2A 3FRYA 2J0SD 2WB1D 2A3JA 1YVFA 1WEXA 3CC4S 3DI6B 3MEGB 4LF4F 2ZJRQ 4KC5A 1H38A 1D9FA 7FDRA 4WIIA 3PFOA 3P4UB 2HBYB 2I5JB 2GVDB 2W4PA 3D28A 3FFIB 4Y28C 2MYFA 1UCNA 2UUBF 1TL1A 3T9NA 2ATCB 3TZWA 3NRBA 1NSQA 2P6SA 3HSJA 1S99A 1I94J 1CS4B 4QQBA 4LIRA 2RMLA 1X7VA 4DG1A 5DZ7A 2CPFA 2QC3A 4I6WA 1JLFB 4LF4J 3BB5A 1U1RA 2WOMA 4XAKA 3OD2A 3OW2R 1N52B 2E1CA 3I4HX 3SZ2A 1IKWA 1R89A 3BH6B 2DR5A 3OLAA 2NZCA 2UUBJ 3CDEA 3HI9A 2XYHB
chains in the Genus database with same CATH topology
2XSJA 1RTIA 5KG5A 1TKZA 5KOWA 3P6YC 3U02A 4RW9B 2ZE2A 2ASLA 3UD3P 2YKMA 5BYQA 1T05B 1RYRA 1XN9A 5KFGA 3MMAB 5DGBA 1S9EB 4ZP7A 3LWLA 4QIGA 2Q3PA 4USIA 4C8NA 4DL2A 4PWDB 3PIPQ 3TP2A 2RRBA 4PXCA 1UVKA 2KTQA 4CT8A 5EDWA 2IM1A 1N5VA 5A0YB 2CQ2A 2VKZG 1NZAA 4DL3A 1FXDA 3M8RA 1VBYA 2DRAA 1NHVA 2KJWA 1KOHA 2LA4A 3RZAA 3B82A 3FEXB 1KRPA 2RF2A 3VF0B 1P1LA 4Q45A 2HMIB 5CQGA 4O44B 1FE4A 4WXOA 2WSCC 4QZVB 3V6JA 2VH7A 3OXLA 4KBIA 1S1VA 2Z2LA 1WD6A 4AE5A 2IFXA 4ZHRB 4WU2A 3LP0A 3DMJB 4KR0B 2GFFA 1IJEB 2V4QA 1EETA 1N34F 4PG6A 1FRKA 1U2RA 1JLAB 4ZVFA 1A9NB 3I56S 1Q8BA 2O3DA 4N76A 4OJ1A 5F8HA 4ZPCA 1M5OC 4Y65A 2OD4A 2K8GA 3IS9B 3KLGA 2APOA 4ECQA 2IM0A 1V3ZA 3KG4A 2WAQD 2XGPA 2BM0A 4RUAA 3L7PA 3CD7A 5A8KB 5EN1A 1VIOA 2HNDB 4PXDA 1U49A 4X4VA 5D4LA 3HT3A 2FDNA 1Q4RA 3KKFA 2AX0A 2J6TA 5D4PA 3MUMP 1TAUA 3CJKB 1NNDA 2KHDA 1NJWA 1K0VA 3ZZPA 4KGKA 5HMWA 4DQQA 4JV5F 1SUQA 5KG3A 2HNYB 4LMZA 1X5TA 1T94A 2GNKA 3J7ZT 3T5KA 2PD1A 2XMTA 4CH7A 4J9QA 5A2QY 4HH0A 2L48A 3IXQA 1M0SA 4DQIA 4NX9A 4I64A 4FF4A 2MKCA 4DHVA 2DNKA 5KFRA 5H1SV 4CNZA 3PR4A 3CCUS 3KTQA 3OVBA 1M5SA 1X4GA 4E98A 5C42B 4A48A 1UFWA 3M6XA 2UUCF 2W8KA 2J0QD 1QAYA 4KHRA 3I0RB 1XMOF 3GV5B 3HHEA 4NLXA 4DF4A 2YNFB 1U1QA 4U67Q 3FSIA 4OQJA 1GXTA 3MM7B 3RB3A 4LSNB 2G0CA 1S72S 3H5YA 5EWGA 2VA3A 5KFIA 4G3IA 5KFQA 3DRYA 5D4OA 1CG2A 3LF0A 2JLFA 3IFEA 3OTBA 5DS7A 1EP4A 4PR6A 3V4IA 4B9VA 4J9PA 4JI2F 2QT7A 4YY3F 2VL1A 3ZZ0A 1YIJS 4X4RA 3FCHA 3GSDA 4A8XA 3IG1B 2F9DA 3WZ0A 5E3CA 2V4JB 5CYMB 2ACYA 4CZCA 3D0HE 3MEDB 1OSDA 1XR7A 3NP5A 1W2BR 2AQ4A 3AY0A 3MECA 3LUYA 4I67A 4WFXA 2YKNB 3LANA 4JYAF 2ZKTA 1FD8A 1FD2A 5DQHA 3KLHB 1X0FA 1NJYA 2Z0GA 3SSRA 4CO5A 1HL6A 2GC8A 3UCZP 1VC6A 1TV6A 3MOZA 2ZFHA 1K8AT 4EEYA 3M6WA 2XNRA 5B0DA 4LF6F 4HH1A 3THPA 3CJ4A 4ETXA 1VQYA 1JXEA 1WI8A 2OSQA 4LIWA 2C3MA 2DH9A 1M5HA 1VLYA 4XK8C 4DWIA 4DV5F 4WFAQ 4Y3CA 1X4DA 5CHCB 4NCGB 3DRPA 2HGNA 3Q23A 2HS3A 2R7XA 1SQEA 1TKTB 2FVCA 3LOUA 4G1QA 3ZFVA 3PX4A 1TZ0A 2RQKA 1JLGA 3D1HA 2IYIA 3GR0A 4TNOA 3MM6A 2FJXA 2D3UA 4QU6A 4WXWA 3DOLA 2C2EA 2FJVA 1QSLA 1IUJA 2VKRA 3TA1A 4UY85 5HP1B 3H5UA 2V9KA 4WKYA 3GB0A 2NSCA 1Q8LA 2U2FA 3DGPA 3ITHA 5IQ6A 1P8GA 4ITSA 5F8MA 2K1RB 4E0DA 3NBPB 3K5MA 5J2NB 1FXRA 2ZH5A 1N88A 3MPVA 2VG7A 3R5DA 5LL6d 2MQQA 3PX6A 3CPWR 2XMKA 5F3ZA 1VQ9S 1HNIB 1N5TA 4IOAQ 1X4HA 4YUDA 3MR5A 5IWAF 1SV5A 4WZMA 4J5OA 1K9MT 2B7CB 1ZETA 4MK8A 5A8WA 2UVUA 4EFAC 2PSZA 3UFCX 5MLCV 3M8SA 2CJBA 2L9WA 1LW0B 3M30A 3OTDA 2OLWA 3QIDA 5I42B 2QMXA 2ZM6F 5KFAA 3W2VA 3RRKA 2AGOA 4ZCIA 1DTQA 4D3GA 3PX0A 1ZZNA 1VBZA 4DN9A 1YG0A 2FUG9 4ID5B 4A47A 3K2YA 2B6AA 5C25B 2ZH8A 5GAGI 4P6QA 2R7RA 2WHOA 4UUXA 1MWYA 2R2SA 3PVXA 2RRNA 1RQ0A 1SJ3P 2LU2A 1TVRB 1BLUA 4B3OA 4M5DA 5KFJA 4ZMMA 3ZZZA 2J7WA 2KXHA 3HHNB 3DRRB 3H2UB 3T5LA 1BQMB 3HFKA 3ZZYA 4F26A 4O3SA 1HPZA 2ZZNA 3Q0AA 2IBOA 6FDRA 2KM8B 1NRKA 2JC0A 1L3UA 5J1EA 4X4NA 1NJXA 2NUHA 2E9RX 3VAIA 4JI0F 1HW9A 4UUWA 5L1JA 2X1FA 2XS2A 3J7YU 3VZIA 3MWBA 3POTA 4O3OA 4WYWA 3I32A 3BDPA 3NMAA 3KYLA 4C4WA 4H4OA 2MB0B 2DHGA 2VC1A 1YWXA 3O5TB 1U8SA 2KHCA 2IA0A 1VRTB 3QIPA 1SJ1A 4DPOA 4AQYF 1VI7A 3CSKA 4FVMA 4I1TA 5H9EJ 4PQUA 4FP9A 4TLQA 4JI6F 1KD1T 1FESA 2FHJA 4NLYA 4WFNQ 2HHUA 4KJIA 2XB2D 3OSPA 1U1MA 4YB6A 2DTJA 1FEEA 1NAQA 1RTJA 3BGRA 1BQXA 2R7TA 5I3UB 3Q2TC 4OHWA 2WSEC 3OFEA 4IQXA 2GGPA 1ZAVA 4MH8A 3GWCA 3OL6A 1ZM2A 2MDAA 2ZBIA 1Q1KA 3NLCA 4HL9A 4MFBA 3H5XA 5JXSA 3CGIA 3LP1B 4IFYA 4DJBA 1U2FA 4LF8F 2YNIA 4ECXA 1LK7A 4OMFG 2WONA 1QUPA 1GXLA 2YNGA 3JAMY 5HBMB 3AAWB 5D8HB 3VWSA 4QIWD 3M8QA 3WX4A 3T5JA 1D9AA 4OHVA 4TXSA 5CCLA 1OPIA 3FQKA 3RBDA 3PM9A 2XCPA 4LSLA 4MAKA 1E6VA 2QSFA 3M1VB 4C3LA 2BE2A 3NCPA 2QMWA 1L3TA 3MM8B 4JI1F 2RUGA 3MMJA 2F7VA 3DLKA 4DLGA 3KLIA 3PW7A 1HQUB 4PPDA 3RYLA 3RRHA 2WCXA 1U4BA 4MK9A 2AGQA 3QZ7A 3TUZC 3CCLS 4WE1B 4PG7A 2KRBA 2KB2A 2VOPA 1YI2S 4MMOA 4KE5A 1KTQA 4EBCA 2BR0A 3NNHA 3C6TB 5IM0B 3NKYA 3I87A 5M2RA 3ONQA 3OBIA 2NZ4A 2MY7A 1QY7A 5K14B 1OO0B 4DFMA 3QJLA 2KXFA 4WFYA 5GAEU 2IRUA 1JNZB 4R0EA 2D9PA 2QLXA 2XMVA 2DNHA 1BD6A 1N0UA 2YY3A 1U24A 2IVYA 4A8OA 3BM7A 1NK5A 2K7JA 3UCUP 2AD9A 4A8QA 4MTPA 1MMNA 4YDXA 2XO7A 3F73A 3IN5A 2M9KA 2KJVA 2FJBB 3KK3B 2ZJQQ 1IQTA 3S7RA 2DRBA 4NLGA 3K0JA 2PDAA 2DNOA 1Y0HA 4O4GA 4CT9A 4WFZA 4IDKA 2B43A 2QV6A 4DOZA 4RUHA 1C1BA 4GMKA 3HHLD 4BWMA 3RB4A 3HHLA 2MGZB 3K5NA 3RAMA 2PE8A 1RT2A 4YEAA 5EX3A 2FY1A 4CI0B 2OPPB 4LF5F 2YKOA 2UUWA 5KFBA 1IKVB 2EBEA 4JBCA 3X1LB 2GX8A 2RJZA 3L09A 3NG8A 1IKYA 4ELUA 2WTFA 2W25A 5FDLB 4A8MP 1Z1ZA 2RU9A 2RS8A 2ZOGA 4NLSA 4PG8A 1VQLS 3IWXA 4LFBF 4NCBA 3DLGB 3GIIA 1CEZA 1H7WA 2CJ9A 1DLOA 3DC2A 4R8UA 2LXIA 1OSCA 1AFJA 3QAEA 1RTDB 5U47A 1TL4A 4BS2A 1GTHA 4L3NA 3V6DB 4K59A 1H3DA 2CYYA 4AUKA 2EK6A 1C0UB 3VAKA 4JI5F 2BVZA