3J7YU

Structure of the large ribosomal subunit from human mitochondria
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
111
structure length
111
Chain Sequence
b'ARNVVYPLYRLGGPQLRVFRTNFFIQLVRPGVAQPEDTVQFRIPMEMTRVDLRNYLEGIYNVPVAAVRTRVQHGSNKRRDHRNVRIKKPDYKVAYVQLAHGQTFTFPDLFP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Structure of the large ribosomal subunit from human mitochondria.
pubmed doi rcsb
molecule tags Ribosome
total genus 14
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2014-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3j7yU00
1G2EA 2EVZA 3G8SA 3MD3A 2DNMA 1M5VC 2MZ1A 3J7YU 3CMES 4YB1P 2OIHA 2DGQA 1VBZA 4QQBA 3THTA 2DH9A 1HA1A 4W90B 5DM7Q 2MKHA 1OO0B 2VODA 3RW7A 1VQ4S 1U1OA 3VAGA 5LXYA 3HHNB 3LQVA 3TP2A 2N82B 5MLCV 1WTBA 5CXTA 4C4WA 2ZJRQ 2M70A 4LMZA 3BO3A 3RW6A 3IRWP 2M4MA 1U1MA 1VQ6S 1D9AA 1X5PA 1U1QA 4EGLA 1K9MT 1X4BA 2LA4A 1H2UX 1U6FA 3SXLA 4C7QA 1M5KC 2RVJA 3Q2TC 3VAHA 2CQIA 1VQ5S 4IOAQ 2GHPA 2CQBA 3CCMS 4WFNQ 2CPZA 1X0FA 1YI2S 3FEXB 3G9CA 4QU7A 2CQ3A 3CCES 3BEGB 2DNNA 5FJ4A 2KXFA 3UCZP 2DNRA 2HGMA 1UP1A 1X4GA 3DXBA 1W2BR 1FHTA 1IQTA 4UQTA 1M5PC 2YH0A 2DGTA 3VAKA 3CUNA 2I38A 1X5SA 2DNYA 4WFAQ 4PRFA 2CPHA 3MURP 2CPEA 3P6YC 2U2FA 2OSRA 4Y00A 1P1TA 2DNGA 2PE8A 5HO4A 1KQSR 3CCJS 2EK1A 1JMTA 4BS2A 2ZJQQ 1WEXA 1KC8T 2G1DA 3ULHA 2M8DB 2VOPA 4IUFA 2DGUA 2DHAA 5IQQA 1VQ8S 2ZJPQ 2G4BA 2LEAA 1CVJA 2DB1A 4LIRA 4CQ1A 2HGNA 2MKIA 2ERRA 2M8HA 1UW4A 3CCLS 3UE2A 1JJHA 2MKSA 2E44A 3TO8A 3L3CA 3VAMA 4Z2XA 3MXHP 2JVRA 3V4MA 2XS7A 1FNXH 5LSOA 5HL7Q 1Q7YT 2O3DA 2CPFA 2M9KA 2D3OR 2D9OA 2DIVA 3JB9k 2UP1A 1SJ3P 3NNAA 1N52B 1U1PA 2NLWA 1VBXA 2KN4A 2CQPA 3NNCA 1WG1A 2CPXA 3P3DA 1OWXA 2BZ2A 2MQPA 4V19X 3S8SA 2MXYA 1DZ5A 3CC2S 3H2VE 3FEYB 2MB0B 2K8GA 3SDEA 5BJRA 2MYFA 3MD1A 2LQ5A 3CCRS 1SJ4P 3CULA 1WG5A 1FXLA 1FO1A 5DDOC 2SXLA 1VC5A 4C0OC 3N9UC 1WHYA 3UD4P 1Q82T 1X4CA 2MPUA 2DNZA 4WIIA 1X5OA 2OJ3A 5DDPC 2LYVA 1VQOS 3US5A 3CXCR 2MSTA 3ZZZA 4WFBQ 2MQNA 3I56S 3NMRA 4RU2A 3Q2SC 1HD1A 3CMAS 2DGVA 3G6ES 5ITHA 2DH7A 3BS9A 2FC9A 2XSFA 2RT3A 3OW2R 1RK8A 1ZH5A 1HL6A 5IM0B 2DGOA 4F25A 1WI8A 4OZ0A 4ERDA 3MDFA 2L9WA 2DNPA 2FHOB 3G8TA 2RQ4A 3VAIA 2CQ1A 4YUDA 1NJIT 2DITA 2DNKA 2DHGA 1VQNS 2M52A 3SMZA 2CPIA 2AYMA 2DHXA 1Q81T 1WF1A 3B4MA 2DK2A 1FJEB 2MY7A 1YITS 4FXVA 2E5HA 2N3LA 2XNQA 1P27B 1H2VZ 4QU6A 3VF0B 2RU3A 2DH8A 3K0JA 2K3KA 4A8XA 2HVZA 2LCWA 2LKZA 1SJRA 2KXNB 1N88A 3MI7X 1KOHA 3P5TL 3UCUP 2MZSA 1X4DA 1WHWA 3MUTP 2KG0A 3S6EA 2QEXS 1YHQS 1XN9A 2LA6A 2X1FA 1WF2A 1WWHA 3H2UB 1A9NB 2DGXA 2KG1A 3P49B 1WI6A 2CJKA 2F9DA 2J0SD 2KFYA 3D2WA 2CQ2A 2MQMA 2M2BA 2NZ4A 1N54B 1UFWA 2MQLA 3IWNC 4UY8T 3U1MA 2G0CA 2XB2D 1DBDA 2KU7A 1M90T 1R8PA 4IO9Q 4WKRA 2MHNA 4ZKAA 2LMIA 2DNLA 2HYIB 2KM8C 3CC4S 3R1HA 2M88A 1K8AT 1WF0A 2YKAA 1VBYA 2XS2A 3CCSS 2OTLS 1WHXA 1U2FA 2E5JA 1R8HA 2LECA 2KVIA 1KD1T 3NS6A 4WCEQ 2DNHA 4CH0S 3U1LA 1U1LA 2WBRA 2DO4A 2I2YA 4TU7A 5CYJA 1QVGR 3VALA 2FY1A 1YJ9S 1JJ2R 2A3JA 1S79A 2MQOA 3HI9A 3UWTA 2MZTA 5JVHQ 3ZZYA 1N8RT 4ED5A 2JVOA 2X1GA 2MY8A 5GMKa 1OIAA 4IOCQ 2DGWA 2RRBA 2J76E 1WEZA 2U1AA 4F26A 2DNQA 2KRBA 5LSLA 1Q86T 1VQMS 1FT8A 1X4AA 3UD3P 1VQ9S 2CQ0A 2CQHA 1U1RA 2MGZB 2JWNA 3I55S 3CD6S 1U1NA 1M1KT 3CCUS 4CIOA 3S01A 2MGZA 2DIUA 2D9PA 1H6KX 2MJNA 2FPHX 2M7SA 2MKCA 3TYTA 5CA5A 3BO2A 1SJFA 5DDRC 1PO6A 3CF5Q 4J5OA 3EGZA 2KHCA 1A7GE 1WG4A 3PIPQ 1YJWS 2F3JA 4W92B 2KXHA 5GVQA 5IFMA 5JVGQ 4OZ1A 4TLQA 5IM0A 2CPDA 3DLLQ 3G4SS 2CQDA 3PIOQ 2OTJS 4YOEA 2LEBA 1UAWA 1QVFR 2DGSA 1D8ZA 1VC6A 2BOPA 1AUDA 4QPTA 2M0GB 2MKKA 4F02A 4LJMA 2KI2A 5LJ5Y 1F9FA 2F9JA 2MKJA 1VQKS 2YTCA 4P6QA 1X4HA 2MZQA 1FJCA 3B4DA 3VAFA 1VQ7S 1VC0A 1O0PA 2VONA 2LXUA 2X1BA 2QFJA 1DRZA 1B7FA 1VQPS 2HGLA 2ADBA 3EGNA 1KOOA 2L08A 1YTYA 2XNRA 4U67Q 4PKDB 2J8AA 2X1AA 3EX7B 1ZZNA 1PGZA 3CCVS 1SXLA 3R27A 2GO9A 2LXIA 2VOOA 4WF9Q 2V94A 2CQ4A 5D78A 5DDQC 3THPA 1OPIA 1M5OC 2XS5A 4FXWA 4TU8A 5H1SV 2L41A 5DM6Q 3CC7S 1X4EA 3BO4A 2YWKA 4PR6A 1WEYA 2B0GA 2OSQA 2MZJA 2KT5A 2E5GA 1HD0A 2MQQA 1X4FA 2ADCA 1SJQA 3CTRA 3CPWR 1YIJS 3CCQS 2J0QD 1URNA 2RS8A 4CH1A 2RQCA 2FC8A 5GADU 3MOJB 2RS2A 1JJ4A 1X5TA 3MUMP 5DETA 2AYEA 5EN1A 3J7ZT 1DHMA 5LJ3Y 1WHVA 2AD9A 4Y0FA 1YJNS 1QM9A 2RUGA 5GAHU 2HZCA 3VAJA 2EK6A 2DISA 2CPYA 2DNOA 1VQLS 4TU9A 2RRAA 2CQCA 3G71S 2AYGA 1NU4A 2MJUA 2CPJA 4M5DB 5LXRA 1RKJA 1NO8A 1WELA 3G96A 3NS5A 1FJ7A 2JRSA 1ZZFA 2KYXA 3MUVP 3SDEB 1BY9A 1U1KA 1U6BA 3NNHA 5GAGU 2N3OA 1L3KA 2AYBA 5GAEU 3LPYA 2MZRA 2KM8B 1H2TZ 2DHSA 2PEHA 2CQGA 2E5IA 2MSSA 3UCGA 3R1LA 1K73T 5D77A 1S72S 2YH1A 2MMYA 2QA4S 2DO0A 1YWXA 3S7RA 2RNEA 2N7CA 2KRRA 2JX2A 2Q79A 2KH9A
chains in the Genus database with same CATH superfamily
2XMWA 2A6OA 2H51B 1KN6A 2DGQA 3HVRA 4N7TA 1PC4A 2NSBA 4NA3A 2F8MA 2I6WA 2YNFA 4ICLA 1EQ0A 3RB3A 4WKYA 1J5OA 5DG8A 3VGTA 3IN5A 1PIEA 1FI4A 4B08A 1X4BA 2R8KA 3SXLA 1ZBTA 2YQ0A 3E2EA 2CPZA 3KHLA 1ACMB 5EHHA 4DF8A 4LT6A 2DNRA 3QGIA 3AQOA 3DXBA 4Y2IA 1JKHB 2YH0A 1VK8A 1YX2A 4P2SA 4PG5A 4ZJOA 1T95A 3DHWC 4M5GA 2J0XA 3UI3A 4LF6F 1Q8IA 4DV5J 4DG1B 4ZDNA 3AOAA 4LF4F 3T6JA 2DGUA 1VQ8S 2ZJPQ 2G4BA 1WC3A 2ZH3A 5DZ7A 4DN0A 5JUMA 2ERRA 3OVSA 4RWWA 3ITHA 3TZZA 1OY9A 3HDSA 2IDLA 2ZBPA 2D9OA 2OPPB 1N52B 1T9UA 3S8SA 3KLEA 1ZAVA 3CCZA 3GSDA 3M8WA 4NLPA 2GVZA 4HTIA 1VIXA 4MH8A 3M1VA 1YJUA 3W60A 4Y65A 1WG5A 3KNAA 3MTKA 3KXDA 3EDQB 3KUHA 3JS9A 2MLZA 4Q44A 1T03A 2XSFA 4ZVPB 3OW2R 3OD2A 2V0NA 2B6AA 2L9WA 2Y3YA 4YUDA 1SB6A 4QBUA 1YJVA 2DPIA 2CDRB 2ATLA 2PDAA 2AZ1A 2HVZA 2LCWA 2XMTA 5C25B 1TAQA 1KOHA 2C2DA 1TFWA 3H0PA 1WF2A 1FWKA 2FHKA 4TQRA 4DL2A 1WUUA 2A6MA 5EUHA 1KRPA 1PYTA 1S0NA 1N54B 3CSKA 4NI2A 2G0CA 4NLUA 4MT1A 2Y1JA 1FNMA 3I9ZA 3MM7B 3R97A 2G2YA 3CC4S 3BH7B 3R1HA 5G4DA 5L9XA 2CJAA 2RDIA 1WHXA 2BRLA 1OS5A 3WZ0A 3HKWA 3U1LA 3DMJB 1TKXA 5CZXA 4X4QA 1I5OB 1HQEA 2HFNA 2ACMA 4ZVEA 1U48A 2EFQA 4USTA 2V4QA 4DFKA 3KK1B 4EBDA 4NL5A 4IOCQ 1BQXA 4B9TA 2W9BA 2J76E 5IZHA 4OYPA 3KK2A 2HIQA 2EKYA 3NOGA 3JAMY 4OI2A 3R8YA 1X8DA 1Y10A 5LMUJ 2F8EX 4RBUA 1SPBP 2B56A 2MKCA 1O8BA 2BE2A 1A7GE 1L3SA 3CJ5A 4N41A 4XO0A 1RUSA 1U0HA 4NLOA 3MMBB 1NK9A 2ZFHA 2B8QA 4A8FA 3RAQA 1V5VA 4LSLA 5H9FK 1VC6A 2M5YA 2B4PA 2LQJA 1XMBA 4W4MA 2VG5B 1DY3A 1S1VB 2BJ7A 3KLGA 4RW6A 3KHRA 3DRXA 1RAJA 2X1BA 1VQPS 1CJUA 4LFAJ 1T02A 4HDHA 2L08A 2W8LA 2WTFA 4Q2LA 2W9CA 1TL1B 2GO9A 3S1TA 2WK4A 3GYGA 2JLGA 4ZLJA 4RW7A 1JLCB 1RTJB 1NZ8A 2DPJA 1B99A 1E6VA 1U8WA 3FCVA 4O3NA 2XYGB 3TAMA 2ADCA 3TQEA 3SQOP 5F3TA 1N6QA 2FC8A 2JC0A 2GMHA 1S1XB 2AD9A 2VICA 3AOCA 5GAHU 5KT5A 1U2CA 4OX9J 2CPJA 2BDPA 1RBLA 2B9XA 1ZZFA 3IGNA 2D69A 4JI8J 3ETMA 2LU1A 5HMWA 3FRZA 4CTAB 2JL9A 4R5PB 4AUKA 2K06A 2EFGA 4KFBB 3W9JA 1U4BA 1JIHA 3R7SB 1WKLA 3TI0A 4BBYA 4NXNF 4X4NA 4IG3B 1KVKA 1M5VC 5J2NA 2OIHA 3QSIA 1OY6A 4ZVOB 2WVDA 1VQ4S 2VBZA 3NKYA 4C4WA 3RW6A 1KQKA 3HD2A 1U1QA 5IS2A 2ASDA 3TJAA 1IWGA 3HCXA 2ZOFA 3M8SA 3FEXB 4I4BA 3G9CA 2M3DA 4KPYA 3DGPB 2DR8A 2HGMA 3GV8B 3OPKA 1TP7A 2I38A 1ZTWA 4DLEA 2CPEA 1JKHA 2MLYA 1K47A 3M05A 1SV5B 3UFCX 1HBUB 2VIHA 2HGNA 1MSWD 1UA0A 3VZIA 4Z2XA 2R8IA 3T1YF 2Q6CA 1UEKA 1EHWA 1WORA 1SJ3P 3T5LA 2KN4A 3NGUA 1SH0A 5KFKA 2AKWB 2OPPA 1QAXA 3N0VA 1PILA 1RHQB 3DKDA 1OSDA 2XC9A 3P4UB 2XSJB 1AROP 4YDXA 3H4BA 3CULA 1N4LA 4OI0A 2YKOA 3BR8A 2V8DA 5DDOC 1F9EB 3UD4P 3K17A 1BQNB 3UQSA 4BWJA 3MCMA 3MHYA 3ZZZA 2QL9B 3NMRA 3PEHA 1YKWA 3KWMA 2OMLA 3D66A 4OI4A 4F25A 4ERDA 4ECZA 4IDKB 4URQU 1T8EA 4F0HA 3JQMA 4FNHA 2E5HA 2ACYA 1H2VZ 4FF4A 2IY5B 1NB7A 2BJEA 5B0DA 5AJ3J 4GO5X 1ZM2A 5K20B 1X4DA 4AQYF 5C25A 2DKOB 3GFYA 5KFBA 4OHYA 3UN3A 1GAOA 2KT3A 4TXSA 3GFZA 3T1HJ 1Q8KA 3KLIB 2C3UA 2W25A 2DXFA 2CJKA 2F9DA 2VD3A 1H0HB 1S6PA 3NAHA 2EKNA 4N77A 4O3RA 2AJFE 3U1MA 1S9GB 2GS8A 4LRDA 1NXIA 1Z2LA 3PX6A 1YDLA 3CCSS 3MM7A 3O8WA 1FD2A 3W62A 1CC8A 3QIDA 3LWMA 3I87A 2OEKA 2HRTA 3KLHB 3NGSA 4TYBA 2HHVA 4FBTA 3Q24A 3DMJA 1FERA 1P9QC 5F9LA 2GCFA 3MFHA 5HVHA 3KK1A 1HBOB 4Q2MA 4USWA 4AL6A 3KG1A 1H3DA 1G6BA 3ONQA 2MGZB 2JWNA 3GJQB 4CLPA 2GX8A 2ZWPA 5HQLA 4YY3F 4KH0B 3MR6A 1U45A 3MAHA 5CA5A 2GO8A 2FB0A 4ZVQB 1DFDA 1XBWA 2OKQA 5GVQA 2DCLA 4X64J 1ICEB 1TUWA 3D1HA 4DPUA 5HQMA 1QSSA 3IBWA 1SI9A 3MMBA 4ER8A 1CQNA 1FFWB 2OELA 2YTCA 1FJCA 5L38A 1NHKL 3DLBA 2VG5A 1KBRA 3QZ8A 7AT1B 5F41A 2VBYA 4OHWA 2IIHA 4KHPJ 3FCHA 4F2SA 2UV8G 4ZVRB 3NBPA 1WOOA 1MWQA 2PMHA 4DSEA 4X4UA 2V2ZA 2K3IA 3W7BA 2O5DA 1JLCA 4Z7YA 2G1HA 1RTJA 2E5GA 1OQ6A 2YWHA 1XNQJ 2ZITA 3IAM9 2HW3A 2VU5A 4MJKA 3CCQS 2RS8A 1RT2B 5BYSA 1UZDA 1NMEB 2IPOB 2J6SA 5SZTA 1Y3JA 2XMUA 3VAJA 4MKYA 3MWBA 5A76A 5A2QU 4WU3A 4LF9F 2RB7A 2Q6BA 3G96A 1FJ7A 4FYDA 1Q5YA 3NCRA 2HMIA 2WONA 5GAGU 1HBMB 3QJJA 1VK3A 3AB4B 5E2QA 2RSQA 1M5SA 1PSDA 2E5IA 3KMQA 4K0KJ 1K73T 1Q78A 4OMFG 4CTAA 1AFJA 4R5PA 1H73A 2HQ3A 3BPDA 4KFBA 5HQ8A 1U2FA 2Q79A 4GKJJ 4L3KA 4QQBA 1F5CA 2ASLA 1WTBA 1XERA 4KB7A 5HI7A 5FIIA 2CQIA 3KMSA 4WFNQ 3IAS9 4M8LA 3CIMA 4DV2F 4MKAA 2R2RA 1FJGF 3DGPA 4ZCMA 4I6AA 4WZQA 3MURP 2D7SA 2FJBB 4LRBA 4ZK7M 2EC2A 1Y9OA 2QO3A 2N4CA 4PQUB 2MLXA 3U27A 4MIBA 3LGMA 5D0RA 4AD6A 1EB0A 2IJRA 2DB1A 4DV0F 4RU9A 1SV5A 2YQ3A 1HBUA 1SC3B 2R7OA 1HHTP 2HBQB 3B78A 2JJ4D 2ZBCA 1D3WA 4B02A 4B3MF 3IBFB 3C14B 2CZ9A 2BZ2A 1TFYA 2GVDA 4DQIA 3H2VE 1WACA 2VPZB 1PJ5A 3CE8A 3MM6B 1L3VA 1SL2A 3HFVA 2BRKA 1IBLF 1RT6B 4IRKA 5RUBA 1X4CA 1WTFA 3PW4A 1GEHA 1TL4A 2HHHF 4DR3F 1BQNA 1WOPA 3HSGA 4DL6A 1F2GA 3THVA 3OR2A 2FC9A 3NGKA 4L3NA 2HVHA 4C3LA 4FYVB 2IVYA 4OZ0A 2QE5A 3V4IB 3OL7A 5KG0A 3VAIA 2UZAA 2ZHBA 3H8YA 3C6TB 4HI1A 4IDKA 1RYRA 1UWBB 4TYAA 1UJ4A 4ZJLA 2LKZA 4FKXA 3QRQA 1X9SA 5C2GA 3MI7X 1XWLA 4I69A 2I5JB 4F0MA 2XQCA 5ETSA 3H2UB 2JEFA 1RT7B 2G0IA 1RTIB 2V8PA 3KLIA 4JI2F 4FYYB 1S97A 1JLFB 1R8PA 3H42A 3OLAA 1S9GA 1WF0A 2B4OA 3VQSA 2KHDA 3HVWA 1S76D 2FIUA 3NS6A 2ZC3A 2YPYA 3HULA 4L73A 2VH7A 2AU0A 5CYJA 2HFUA 3DLJA 3LP0A 1S79A 3KLHA 1HR0J 2Y1RI 4OYXA 4F50A 4ELVA 4DSFA 3RR7A 4NA2A 5GMKa 2RRBA 2C2KB 1FFGB 1I94J 5K8PA 3UD3P 4LSNB 3DRRB 4FPIA 2HNYB 5E5NA 4EZ6A 2Y9HA 2XBPA 2MGZA 2F5GA 3A3PB 2J6TA 4O3PA 1MMNA 4LUBA 4NLRA 3I96A 2IM0A 4WK1A 5IFMA 1N36F 1FK9B 3PV8A 3DLLQ 3AQPA 5HMYA 1FKAF 2LEBA 4UTGA 3EVWA 4BDPA 4K4XA 3JYTB 4USJC 1N32J 2W4DA 5KFUA 2QA4G 2R8JA 2QFJA 3GIMA 1MW7A 2V5HG 6FDRA 3IR5B 4DV3F 1KOOA 2CNNB 4U67Q 1LWFB 5KG1A 4M5KA 2VOOA 1YJRA 4QWDA 3TX0A 2HVDA 1A6LA 3I5CA 2RF2B 4PR6A 3OV7A 3AA9A 4H4KA 4OHZA 4CLYA 4F4XA 4F0KA 1BWEA 3OFEA 4JI0F 3CTRA 3W2WB 1Q8LA 3GB0A 3B6BA 2AGPA 1URRA 4MKBA 1JJCB 1RT2A 2YWWA 3DXSX 4Y0FA 1QM9A 3BGRB 2MJUA 5L8RC 3GIJA 2KYXA 2HQGA 2CJ9A 1BY9A 2CZ4A 1TV6A 5E3CA 5AXMA 2PEHA 4P2XA 3KLVA 5ETVA 2HHTA 1HBMA 4PYDA 3BGOP 1F9HA 2ZM6F 5IXUA 2N7CA 3QQCD 3C3LA 2Z2YB 3E3XA 3M32B 4OJ1A 3QGGA 3ENQA 4Q0BB 1G7CB 5DM7Q 3PY8A 1MMLA 3TRGA 3QATA 5LXYA 1R27B 4NX9A 3OTBA 2V63A 4LMZA 1U1MA 3QZ7A 4DS5A 2AF6A 4KHRA 2AGQA 4C48A 2YKPA 5L9NA 2QSFA 3SCKE 3QT7A 3OBIA 1LW2B 1B0TA 2AW0A 3BEGB 4RL1A 2W2MP 1C0UB 2H4YB 3KJFB 4PWDB 2MDAA 4UQTA 1KDNA 2FJEB 4ECWA 4WFAQ 3Q8QB 3FEZA 3BSOA 4M1KA 1LXNA 4RW8B 4N5SA 1B0VA 5D3GB 4OZ5A 3WBZA 3D7SB 3MCOA 4HLBA 4FVCA 1GK8A 3M30B 2PI5A 2FVCA 1VOMA 3JSYA 5HMZA 3MECB 3EPGA 1U49A 2BR0A 3Q23A 2E1RA 3SZ2A 3K2YA 3C14A 5L1IA 4P71A 2MB0B 5DO2A 2R9LA 3OLBA 5D4LA 4G65A 4WYWA 1L3UA 1RAIB 1UVNA 3MM6A 2SXLA 2H1YA 5K5MA 2PMZD 1FVSA 2DNZA 4LQ3A 3MR7A 1RT6A 2MSTA 4WP9A 2YPZA 2ZOGA 3DN9A 4ZS6A 2CIMA 1U7LA 5DQIA 4NLGA 4A46A 1U2RA 3M8QB 1H98A 3AD9C 4O4GB 1NHUA 3DLGA 1WF1A 3V4IA 5EWGA 1Y5IB 2C2MB 4NXNJ 4FKYA 3C6TA 1WDTA 3JQJA 4K59A 4MYUA 2RU3A 3K0JA 1Q79A 1GMUA 1UWBA 1NB2A 1GQEA 2A2DA 4LVOP 2GHWA 3HFKA 4Q7AA 3Q86A 4YMEA 3IO1A 3J80Y 2QL7B 3CJ3A 4E2FB 2R7XA 1VRTB 3MR3A 1RT7A 5GMDA 3TA1A 3HP6A 2AHOB 3CNQP 1K1QA 4GVLA 1WOSA 1DBDA 1U26A 2XY6A 4NYOA 5ETNA 4KR0B 1RTIA 4ZKAA 5KT7A 5A8RA 1JLFA 2IRYA 2R4FA 2XS2A 4X84A 5LMNJ 4BC7A 3C2PA 4ANEA 3HX9A 4TU7A 1YJ9S 2RKIB 3VWSA 2MQOA 4OV1A 1FEHA 2W7PA 4DV4F 4XDDA 3CIZA 4NXMF 4OYOA 3BM7A 1TK8A 2B43A 1X4AA 2OUGA 4DV6J 3T1YJ 5KFIA 3KUGA 4LSNA 4JI7F 1NDKA 2P9GA 3DRRA 4YHHF 3PKMA 2DVIA 1HWUA 1PO6A 3EGZA 3HMJG 2KXHA 4ZVGA 2QLBB 5EWEA 1HNXF 4ZCIA 2WVCA 3PIOQ 5CD4H 1RWNB 2BA9A 1KNZA 1L5UA 4IO1A 4QPTA 2ZKUA 4IQMA 2GIFA 3D1QA 3JYTA 1RA7A 2UUWA 3ZZPA 2ZOMA 2VONA 2AWZA 4OYZA 1NSPA 1B7YB 1EZZB 5HAOA 3NAIA 1OY8A 2GNKA 4IOBA 5DDQC 4OI3A 2HQCA 4TU8A 4FXDA 3TAQA 4K4ZA 5KFGA 3FSIA 4N76A 2HSEB 1Z1ZA 4AQYJ 1NEEA 2IBOA 2AYEA 3W2WA 3DRYA 3O44A 5E3AA 2DISA 1NU4A 2PT0A 4I6YA 5KG7A 3BGRA 1WELA 2BW7A 2K7KA 3ZTQA 3WX8A 4A8QA 4ITSA 1IKXB 4X4SA 3NNHA 1FXDA 2H4WB 2WSCC 2DHSA 3TJ9A 2MSSA 3C46A 2E5LF 2VG6B 3MGJA 1Q4RA 3PW7A 2R7QA 4DX6A 2JDJA 3GTYX 1IXKA 2MZ1A 3CMES 3W5ZA 4BHQA 2D1CA 3HSJA 1GXTA 2R7TA 3DRSB 3M32A 3H25A 3NLCA 2C2EA 4LVNP 3W63A 4HHHA 2GAHC 5CXTA 4ED3A 2C2ZB 2CVIA 2GQ2A 1VQ6S 4U6PA 1X5PA 4DCJB 1QAYA 2BXJA 2ZZMA 4ZHRB 3GV7B 1XJWB 2DCUB 3TUZC 2QLJB 4J9VA 3KJNB 3GCXP 4WU2A 5LT5A 5DG9A 1M0SA 1IM4A 1LW2A 1X4GA 4LF7F 2BANB 3OR1B 2UVUA 1IBKF 4Y34A 4KKOB 1C0UA 3ET6B 2B3TB 4TY8B 3W66A 2OSRA 3GFHA 3RZAA 2DNGA 2ZBQA 4JI5J 2ZH5A 2R2SA 2M8DB 2VOPA 2DHAA 4LREA 3RBZA 4RW8A 3HO1A 3FBFA 5D3GA 2YX4A 2BJ8A 4BC9A 3L3CA 2JVRA 1SKUB 5HL7Q 1Q7YT 2YKNA 3M30A 1T94A 1YJ7A 2ZH9A 1QSYA 1WG1A 4ZP6A 2MQPA 3MECA 4P9SA 4QR2A 3AB2B 2C3OA 1ZETA 3PKYA 3BQ2A 1RWKB 1KFSA 2CJXB 4GC6A 4K4WA 4EUVA 1WDDA 4IFVB 1HHSA 1X5OA 3FCWA 2LYVA 3K57A 1YGYA 2WW4A 3I0RB 4JUZA 3Q2SC 2DGVA 2ZUAA 2DH7A 2V4JA 4HHUA 1ZH5A 2DY9A 5ETTA 2YBVA 3PFOA 4X4VA 5KFXA 3M8QA 4H4KC 2QG9B 5AE2A 4OL8A 2CJBA 4O4GA 4FXVA 3J7Z5 2NXCA 4DFJA 4QU6A 1GX6A 2K3KA 2AJ2A 4ECXA 4NZ0A 1R6YA 1X9WA 4DV5F 4HT7A 2V50A 3BH6B 4EO8A 2QEXS 1EAYC 5LL6d 2DGXA 2X7IA 2KG1A 4CLUA 3CDEA 3MEKA 1Y0HA 2MQMA 3D0HE 1WSRA 1YSJA 2LXFA 2VHGA 3JSMB 4IO9Q 4DV2J 3CEDA 1KTQA 5B0FA 4EMDA 2GIQA 4RWXA 2OEJA 2Z2LA 3AFGA 1KD1T 4WCEQ 4CH0S 5KT6A 5KFSA 2BM1A 2ZC4A 2ZZTA 1B4SA 3X3UA 3L4BC 3ZZYA 1CQMA 2RKIA 2CFXA 4MIWA 1Q86T 1V6HA 5J1NA 1RTDB 1JWWA 4ED7A 2CQHA 2HNZB 1D09B 4PPZA 2FY8A 4CIOA 2B7CB 5L46A 4MK9A 4J5OA 3Q83A 3PX0A 1XK8A 3PIPQ 4I7FB 4U8VA 2B5JB 1BHNA 5I4MA 3FDSA 1IBLJ 3IBCB 1UAWA 2CJQA 3QAUA 2X3GA 3T3FA 4F02A 1B64A 2KI2A 4DR3J 4USIA 3SV4A 1RAOA 2CG8A 5KTQA 3IM8A 2ADBA 4PWWA 4OFZA 3HF5A 3PVXA 3NWRA 2VPWB 1SXLA 1DARA 3QJLA 4Y2AA 2V94A 2VFRA 5D78A 3W8GA 1WC0A 2V8VA 2QFIA 1VLOA 1RHUB 4LBHA 2A2CA 2LQBA 4C8ZA 4G6VB 2IJNA 2LEPA 5DETA 3R2CJ 3R7BB 5IOLA 4CO3A 3MR5A 3SFGA 3UVJA 2RRAA 3O5TB 4M5NA 1QE1B 3TA0A 1TL3B 1GT8A 1VISA 5KT2A 3RJMB 1SQFA 4DFPA 2VPYB 3KDNA 1HHQA 1IKXA 3ENWA 3LH2S 1RT4B 4M94A 2NXJA 3OSPA 4MAKA 2KDOA 3S7RA 4A8WA 2VG6A 1HWIA 3MD3A 3TANA 2RDJA 4W90B 4J9KA 2DBBA 3OL8A 1UEVA 4FF2A 1S48A 4JV5F 3DRSA 2PN6A 4X4OA 4DS4A 1VQSA 1U6FA 3BN4A 2QJ3A 4U7UK 3GE9A 1U24A 1ZPWX 1N36J 2CQ3A 1NPKA 4ZHRA 1NKCA 2DNNA 1LWXA 2DEJA 1APSA 3W8PA 2Z57B 4YN3B 2BANA 3OR1A 1F60B 4X4RA 3M8ZA 3ET6A 5DLGA 4I6WA 3OFGA 1RT1A 4TY8A 3WC0A 4DV3J 3P96A 4OX9F 2MQ8A 1RQ0A 4PUOB 2M8HA 1EKRA 1NJZA 3TUIC 2XWYA 4EBCA 3I6PA 4JI8F 1HBNB 1HNVB 1PAUB 4WFXA 4LQ9A 1KS2A 3QBCA 5L1LA 2XMKA 2CPXA 3P3DA 2EFPA 3CC2S 3P8BB 3R6LB 2FLOA 4KGMA 3MMAB 3NY0A 2LQ5A 2GQCA 4QJVA 7FD1A 1HARA 1H7WA 2QYGA 3H98A 4FVMA 4PABA 1S4FA 2V2QA 2KJWA 2MPUA 3FBEA 3I4HX 1FRLA 2J7KA 3DLEB 2VL1A 4FPRA 1N5SA 3SFUA 4LRAA 3I0RA 1RK8A 2FHJA 3QT5A 5K8OA 2B9EA 3EGVA 4OHVA 1RAGB 4J9MA 2DGOA 3V6KA 2VFTA 2OFHX 3M6WA 5IC6B 2KL8A 4HACB 1Q81T 1M5HA 2G2OA 2ZM6J 4WBFA 3W2VB 2OEMA 3G2XA 4TKTA 1P6TA 4RUBA 1F0XA 1FNOA 2XLKA 3AJ2A 3P5TL 2KO1A 3N5FA 4W98A 1Y4ZB 1O6XA 3J7YI 4DV7J 1YHQS 3CJ0A 1A9NB 1ZYQA 4FZVA 1HW8A 2KFYA 1JXLA 2QGFB 3A8JA 2XZTB 1NDLA 4FNIA 2E1MC 2MHNA 1GMWA 2AZ3A 1X0PA 1SH3A 3JSMA 1NZAA 1UVJA 3U02A 1T7PA 3V81B 3G6XA 2RDDA 1U1LA 2UUBF 2DO4A 3DDNA 4R8UB 2NQPA 1S4EA 4K8RA 3HK2A 2FY1A 2ZDOA 1HQ2A 1REGX 2JC1A 2DRDA 2P9EA 3HI9A 2MZTA 3CO0P 1S77D 5BXIA 4J91A 2EBGA 1ZS6A 3UR3C 2EPIA 2ZD1B 2GMJA 2Y8WA 4AL7A 4DR2F 2FVQA 4P72A 1RTDA 3J7A1 3CCUS 4EYIB 4IQXA 2HNZA 4LRFA 5M2PA 2DIUA 1KEKA 3O2IA 2HFVA 2VV5A 4CO5A 4W92B 2GQQA 3SEOA 3D3BJ 4P10A 2BKPA 4O0NA 2B5JA 4ICLB 1PBAA 3CDAA 2FLNA 4F7VA 4QW8A 3BKFA 3EGWB 5DGBA 4E0DA 3JTOA 1FKOB 2IA6A 2MKJA 3IXQA 1VC0A 4G3IA 3CMQA 5KFZA 4ZPVR 4DU7A 3ISNC 4NCBA 3OL9A 2E1CA 3BBCA 5H1SV 3CC7S 4DR4F 2MQQA 4EBEA 4NZ6A 3LGNA 5D0EA 1IKYA 3NCPA 5SUHA 3D6TB 4TU9A 1KKHA 3ZO7A 4M5DB 2JRSA 5E33A 1R89A 5HANA 4YB7A 1QE1A 1VFJA 1ZPVA 1F5BA 4CNYA 1KVJA 4X64F 4E98A 2YH1A 1QUPA 2QA4S 1S59A 1S57A 1SUQB 1N0UA 2KRRA 3C19A 1RT4A 4DL7A 4MYTA 2EG2A 1T03B 3P5BP 2J9CA 1J5EJ 2FJVA 3EYZA 1RWMB 4NXMJ 1R43A 2YWEA 3CJ8A 4XDCA 1H74A 1EP4B 4EU0A 3I4PA 4K4YA 4KHPF 3QIPB 2M70A 3OVBA 4JI7J 1NAQA 3CT9A 2HRYA 4YHHJ 1CPZA 2JFDA 4WE1B 2Y8YA 4IOAQ 1NK6A 5E3QA 1KR4A 3UD5A 4RNMA 1HNXJ 2KXFA 2FVRA 5ETOA 2BUNA 4PEOA 3SCJE 1W2BR 5G0RB 2YQ1A 3CUNA 4ED1A 4PRFA 3N5BA 3T1AA 5E0OA 4WP3A 3I82A 2NR0A 1YZ7A 4DX8H 2HIYA 2HNDA 4QIVA 4BS2A 2V9KA 4IUFA 3W3SA 2PEBA 4CQ1A 2I0XA 2VBXA 2J9DE 5KT4A 2XM3A 3VTIA 3CCLS 1JJHA 2APOA 2XI3A 1NHVA 5T14A 5F0UA 4PUOA 3FFIB 1HPZB 4N8OA 4ZITA 1HBNA 1HNVA 1VBXA 3ISZA 3LOUA 5KFEA 1C0TA 1HWJA 1BC6A 3DU5A 5IT9U 2W7OA 3SDEA 5BJRA 4ED0A 2J7UA 1I3OB 1ZA1B 3KK2B 4O4RA 4U7UD 1N56A 3MMAA 2FJDB 1WHYA 3KLFB 1M1GA 2XWXA 1SKWA 3KHGA 2KFNA 2BE2B 3PJXA 1HD1A 1U6ZA 5LM7E 3DLEA 4LF1A 4KAIA 2E1PA 1XTZA 5ETQA 3M9NB 3MDFA 2FHOB 2CQ1A 4ETZA 5L1JA 1R31A 2CUYA 2AYMA 2QZ8A 3C16A 2LLZA 2HFSA 5GAEI 4DSLA 1FE4A 4HACA 4RW6B 2XNQA 3QO9B 4J90A 2DH8A 3QLHB 2J6UA 1CJUB 2UVVA 3T41A 1SL0A 3MAAA 4HH0A 5K8MA 1WHWA 4ES2A 1RISA 2CZVC 1IJFB 3M2RB 4J7CA 2PD1A 3MCSA 1F3VA 4TY9A 2G13A 5CHCB 3BKUA 3PR4A 3LAKA 2ZVIA 2XB2D 3TAMB 1N5YB 2JOQA 1M1HA 2IAJB 4KV8B 4WKRA 3AHPA 2LMIA 1S1UA 1DURA 1K8AT 1N6QB 4K5SA 2YKAA 4B3OB 5ETRA 3TWZA 4ZP7A 4C8KA 2IDEA 1BMQB 4QZVB 4C2MA 4NLWA 2JLEA 2RE1A 3QRRA 1YZ6A 3K5NA 5BR8F 1LWCB 4R0EA 3D4JA 4NRUA 1OPZA 3V81A 2YNHB 4LF5J 1RHRB 2JEIA 4Y2CA 3WC2A 4ED5A 3OL6A 2V68A 5HVFA 2KT2A 4PXCA 4ZVUB 4QCLA 3BZQA 3BYRA 2JNJA 1IJEB 2XZWA 1GX5A 3NGTA 3F73A 2ASYA 1UTAA 1U1NA 2ZD1A 1PC5A 3PHTA 4O23A 1BLUA 3EICA 1RWWB 4ZPWR 3GILA 3EWGA 3WX4A 1NH7A 4S0MA 2OTJS 2BMBA 2LQ9A 3GLJA 1QVFR 3NXZA 4F4ZA 3DDIA 2AP6A 4NWBA 3PTWA 1AUDA 2M0GB 3M8RA 5LJ5Y 1VQ7S 2ZBIA 5HROB 1FX2A 4FF3A 1FKOA 1IBMF 2IM1A 1ZM4A 4NLYA 2FJXA 3LW5C 3ILOA 3IP0A 1AA1B 4RW4B 5DQGA 1DAXA 5IV4A 1JNRB 3C6UB 1S6UA 1KLMB 3THPA 1M5OC 3M2VB 2V9WA 1P9YA 4C9DA 1FDDA 4DI6A 3RGIA 3W64A 4DQPA 3OTOJ 4FBUA 1FF2A 3QJPA 1HR0F 2HWHA 3QGHA 3QFHA 3DHXA 3J7ZT 4DEZA 1I94F 2C3MA 2ZH7A 4DUYJ 2CQCA 4K2XA 3DYAB 2OP5A 4M5DA 5HBMB 1U6BA 5JMNA 2EFVA 1IKVB 3AJ1A 2NXNA 2BJ1A 4B9LA 1Q7LB 5H9EJ 1S6QB 4KY3A 1JB0C 3GSIA 3W5XA 2DO0A 3BV8A 2ASJA 3OXLA 1IQZA 3N01A 1N32F 1RBOB 3AODA 1HWKA 1SUQA 2BACA 1HA1A 4NYZA 4G1IA 4LIWA 2RU9A 1NJYA 1LK7A 1EP4A 2M4MA 5KFJA 2LA4A 3QIPA 2A1BA 2GC8A 2YWGA 4JI4F 4MK7A 4WE1A 3U1NA 1X7VA 2DXEA 3DDKA 4RKUC 2XYHB 1JLEB 2AV5A 1VHFA 3ZTRA 4RW9B 1M5PC 3M9OB 3T5HA 1FFSB 2N4DA 5G0RA 5HO4A 1S6PB 2ZJQQ 2IA0A 3GG1A 3MAQA 4B3TJ 4FYXB 1RZMA 3GR1A 4C98A 4XPEA 5ETMA 3IS9A 2PI4A 2XS7A 4YFUA 1NKEA 2IYIA 2J0WA 5KG3A 2LDIA 3FFIA 1HPZA 1VR6A 1BD6A 2WOMA 1RTZA 2V69A 1V5IB 4PQAA 3LO3A 3CCRS 3P45B 3G6VA 4OJGA 3BR9A 1Q82T 2IM3A 4RBVA 5B0GA 3DLHA 1R3NA 2FGCA 1CULB 4OYBA 3US5A 3KLFA 2VFUA 2MQNA 2QLWA 1E6YB 4KGZB 1FDAA 2E1AA 4JB8B 3HKZD 4F4WA 2OD4A 3GONA 5J2QB 4YEAA 4TQSA 4DCPB 3JQKA 2ROEA 2QTWA 4KJIA 1SIWB 1NK7A 1DTTB 3RU0A 4AL5A 1NM2A 1HYSB 2DY1A 2FUG9 3ICLA 4QIFA 4I67A 2HHPA 3QO9A 2NPFA 3QLHA 3EZ5A 3NBPB 1AT1B 4JV5J 2C42A 4OI1A 1UZHA 5AE1A 1NPPA 2HLUA 1C1BB 3M2RA 1T9TA 1HFEL 3T5KA 2VG7A 2P6SA 1PAEX 2KU7A 3QRPA 4RNFA 5HSPA 2Z8QA 4KO0B 5A6WA 2DNLA 2HYIB 4WIQA 3OHAA 3ZTPA 1N5YA 1MLAA 4KV8A 2IAJA 2LECA 2DNHA 3PRVA 4B3OA 3IR7B 1REVB 1Y11A 4D3HA 4CLKA 2POKA 4PPDA 3HJVA 4ECYA 3HHLB 1LWCA 1UEUA 1TK5A 1R8BA 1SL1A 2HMIB 1TU0B 2YVSA 4AFFA 2YNHA 2WONB 5KOWA 3R5BA 4U8YA 1VQMS 2F1FA 1FWLA 5EWFA 3ZNJ1 5CZVA 3D6FB 2AIRB 4ILRA 3BBFA 5KG6A 2RHSB 4RPFA 2A10A 4C6AA 3MPYA 4HR2A 1WG4A 3R7NB 1YJWS 3OJSA 5IM0A 3HVAA 4TLRA 2CQDA 2E7VA 5IQ6A 4P75A 3OTDA 4DF4A 1ELOA 3M7VA 4PG6A 2XMVA 1NDPA 2HK3A 3DI6B 2LDYA 2HGLA 2J9DA 5HROA 2BV3A 3ADAC 3RB0A 4LR7A 3CCVS 3TQ1A 1NPRA 5E3PA 3FVYA 2LFVA 2VDHA 3MPUB 3VVTA 4RW4A 1Q5VA 1GFWB 5LMNF 3TVZA 3C6UA 1KLMA 3TJ8A 3CJ2A 1RXOB 3M2VA 1X4FA 1NK5A 3UDCA 2QC3A 5D4PA 4K7QA 2WRMA 4Q43A 1C1CA 2IC3A 3C15B 4ANCA 3SV3A 1ULRA 2HZCA 2EK6A 4DV6F 3FZBA 3PZPA 2NYHA 3G71S 1IR2A 2XHWA 2GVDB 2Z30B 4IH7A 1TL7A 4RR5A 2WVBA 1SKRA 2HG4A 1B70B 1T9VA 2I8EA 3GQCA 2AYBA 2MZRA 1ZAWA 2PA3A 3BN7A 3PO4A 3DYAA 3Q8YA 1KWMA 5HBMA 3UCGA 1IKVA 4WPAA 5D77A 3EM1A 2UUBJ 1EX8A 1KTVA 5H9EK 4NLXA 3BDEA 1C4CA 1XIQA 1S6QA 2XMJA 4CDIA 4DZ6A 3OR2B 5EGYA 1D8YA 1OO0B 5HJXA 4EK2A 2VODA 5KG5A 4UW2A 4M95A 4DL0C 1VQYA 3LQVA 5MLCV 4DR2J 1SQGA 4OJ3A 5AT1B 1F5AA 1M5KC 2CWXA 3H2LA 3CCMS 4ZCKA 4YS2A 1O51A 1EIYB 6FD1A 3TUJC 1TKDA 1FHTA 4AT1B 4RNHA 2HEKA 1JLEA 4RBTA 1B3TA 2MHEA 2HWTA 1H7XA 4B9NA 4RW9A 2BVZA 3SSRA 2YNIB 2U2FA 2FD2A 3CCJS 2F4VJ 3M9MB 1WEXA 1U09A 2UXCF 3R6GB 1LXJA 2MKIA 3OFFA 4A8SA 1YVFA 1FNXH 5LSOA 3OXFA 4X62J 2EI5A 2M9KA 2UP1A 1HNWJ 4KH1B 2CQPA 3LP0B 3NNCA 4DR4J 3D0GE 5C24A 4UOFA 2KYZA 5AE3A 2IYGA 3LPEA 1AFIA 4C0HA 3G8QA 1LWEA 3FGVA 5JJBA 1RB0A 4WP8A 3OTCA 3PRDA 1SJ4P 3CJ4A 2V34A 3NWGA 1G4CA 1AZSB 2ZE2A 3K58A 4HEA9 4AYBD 1N5TA 4UUXA 5FLXY 1WJ9A 4NLTA 4ZIVA 2H48B 1CULA 4LBPA 1MN9A 3BS9A 3FQLA 1E6YA 3CD5A 4LFCJ 2J5AA 1KHWA 2RQ4A 5J2QA 1QDUB 5KFAA 1R7IA 1NJIT 2DNKA 5DG7A 3RAXA 1VJQA 4GRSA 3T5JA 4XPCA 3WQPA 2DK2A 3ZZ0A 6AT1B 3L9ZA 4YQWA 3DCAA 1DTTA 1SJRA 2J7WA 1HYSA 4JI5F 4I2PA 2ALYB 3MMJA 2H5IB 1VRQC 4B9SA 2X1FA 2DEIA 5L1KA 3FSYA 2KKHA 1QJHA 4WFZA 3HHEA 2MQLA 2XGPA 3EUNA 1C1BA 2UUCF 1XEZA 3GP9A 3VZHA 4C97A 4NA1A 4KO0A 3DC2A 3DOMB 2L9NA 4OQJA 2C2NA 2I2YA 4KBIA 1XC9A 1AUSL 2V2VA 3MEGB 4DFMA 2ZVSA 2F65A 1REVA 4Y2KA 4USHA 4JV1A 3L7PA 2X1GA 1SIZA 1N33F 1IR0A 1TV6B 3HHLA 1RAAB 1WEZA 4E8UA 2QRRA 2IVMA 4OIXA 2HZVA 2XTJP 3PW2A 3CD0A 1VHIA 3MEDB 2E9ZA 1D0EA 4L74A 3A8KA 3BO2A 1FX4A 2HQDA 1ZOTA 2FZKB 4IR1A 2GW8A 2QLXA 1UVMA 1Z2ZA 2AGOA 2R42A 2ZZNA 3D0IE 3H5YA 4DV1J 3ZXWA 1RBAA 4DHVA 1S9EB 2EEYA 4FS1A 4ES1A 2HQIA 1CJTB 1ZA2B 2Z0GA 4ELTA 3GCWP 1DQAA 4JI6F 4CLZA 4IG0B 1DRZA 3IG1A 3KTQA 4HTJA 4X65J 3EMTA 3DRPB 4J9NA 3DI6A 1LOUA 1PGZA 2WB1D 1S10A 2CQ4A 3CJSA 4ATNA 2RILA 2W2NP 4X66J 3QMQA 3KDOA 4N8NA 2L41A 4HDGA 1LFWA 2MZJA 4I64A 4EYHB 1HD0A 1SJQA 2VFSA 1QD1A 2J0QD 2HLTA 3PNIA 1U02A 4V19J 3HFZB 4ZVSB 2DR5A 3DOKA 4RO0A 2LVWA 2R8HA 5ETKA 2YKQA 3C15A 3ELHA 3NCQA 4GMKA 4F36A 5HK4A 2VA2A 3SCIE 3ZZUA 2KM8B 1F6TA 1HIYA 2FTRA 1B0PA 1TMJA 3TVKA 3K7RA 2GMLA 5BR8J 5HLFB 1FA0A 2MTLA 2G9OA 2YXLA 1G2EA 2EVZA 3MF5A 4PAAA 4RNOA 3TAPA 4KTQA 1QUVA 2MKHA 1UKUA 2F40A 3HHNB 3TP2A 4IYQA 2VQEJ 1R6VA 2ZJRQ 3DLGB 3W9IA 2HFOA 1UJ6A 4AXIA 1F3FA 3V6DB 3CDWA 1XR7A 4HVZA 1RCOB 4J37A 3A1YG 1JLAB 1U0SA 2C1EB 3KJVB 2FGOA 1XNRF 4LR8A 4AXJA 5D4NA 5HJYA 1TQLA 1EKSA 1K0TA 2COLA 5KFOA 1CS4A 1P1TA 3R5JB 2PC6A 1TTHB 2YNIA 3ULHA 1IBMJ 5A6PA 3PRBA 5IQQA 8AT1B 2W7AA 2LEAA 4JI1F 4DWIA 3J80U 4F3QA 4PG7A 5A8RB 4RUAA 1FRMA 1FTRA 4EZ9A 2R7SA 1GH8A 4P2FA 4Q8EA 2ROGA 3AXKA 4B3SF 3SIPB 2ZDPA 2O3DA 2HURA 5F8LA 1HQUB 4V19X 2GJ2A 4NMLA 2IMWP 3TOQA 3BSCA 2WSFC 2VF3A 1TUGB 3W5YA 2NCKL 2MYFA 2VFVA 1FXLA 1WKJA 2OH2A 3FMBA 3C66A 2FJAB 2UUAJ 4O3QA 1RJJA 2B9WA 2E7XA 1AZSA 3J81Y 2G2ZA 2GA7A 2BJ9A 3FRYA 1SJ1A 2ZH2A 2RT3A 3OT9A 5KFFA 2ZH4A 1TR0A 4WXWA 2FLLA 2CWKA 3G8TA 3NP5A 4CRJA 4CYUB 2M52A 2CPIA 3MZIA 1S7HA 5GAGI 3B4MA 2GGPA 5E7OB 3A4TA 1QTNB 1I51B 3ZZOA 2RJZA 3N28A 4DR7J 5A8KA 3GMGA 1WC6A 2KG0A 3M6VA 5I42A 1W25A 3Q8PB 2D3ZA 4WFYA 2CQ2A 4JI4J 1MROB 2AEMA 3ENAA 1RWPB 1V3RA 1YBTA 5FDLB 1Y5LB 2LU2A 2IFXA 2BX6A 1HW9A 4WTYA 2C22A 5IT4A 2KVIA 3NRBA 1RHJB 2DT9A 2WHOA 4J9OA 2WBRA 3IA0A 3DOMA 3QWUA 1H38A 2XG8A 3EDRB 4OYWA 1VGYA 1JJ2R 2UUTA 2HWIA 1Q95G 4P73A 1MNEA 3BB5A 1R8CA 3MEGA 3R5DA 1OIAA 5K14B 2DGWA 1TKTA 2Z4PA 5IT0A 4F26A 1S5ZA 4KHMA 4NZ7A 1VQ9S 5IC4B 1I6JA 2BKOA 1QAIA 4A8MP 5HP1A 4B9UA 2H54B 2MJNA 1UVKA 4DR1J 2HS0A 1IM6A 3MEDA 5KT3A 2UVWA 5A0YB 5M2RA 2YY3A 3ENVA 2CPDA 2HZAA 3AH6A 2JEGA 1CJKB 4YOEA 1RCXB 5J1EA 3A3NB 2UU9J 4DV7F 1RI7A 1S9EA 2BW2A 5CCMA 3VAFA 2QSWA 2C2OB 1CJTA 4JV2A 4UQGA 3IC1A 4ZPDA 1S99A 1YTYA 4PKDB 4IG0A 4F67A 3DRPA 4C3MA 1NCLA 1SKSA 1W7WA 1DQ8A 3DM2B 2YWKA 3MOZA 3RUBL 2ZNYA 1HMVB 2XGQA 2UXBF 5MAOA 4H4OB 5IT9Y 2ABYA 2JEJA 1NDCA 3FMWA 3K59A 2RS2A 2YKNB 3IFEA 3UPFA 1SVDA 1DHMA 2D41A 4O3SA 2CAJA 2AX1A 1A0OB 4Y3CA 4QW9A 3MUVP 1RHMB 4ECUA 1FDBA 2QYCA 9ATCB 1BE4A 3H90A 1D9DA 1L3KA 4KQZA 1C2PA 1FEEA 2AQ4A 2VQFF 2B8PA 3CCTA 1S0VA 3HHDA 4DLGA 3HD1A 4DQRA 2VA3A 4NASA 1NRKA 1PJ6A 5KFQA 2KH9A 5HLFA 3FNNA 3ETOA 2BABA 2V4JB 3LALA 4UUWA 2LP4A 4L6V3 3TA2A 3WIVA 1CEZA 4IR9A 3H40A 1XQIA 4L72B 4GVBB 3IRWP 2F7VA 1PKUA 4EGLA 3O1LA 3PYFA 1VQ5S 3V6DA 1NK4A 3PACA 1X0FA 3CDUA 4ZOSA 4O3OA 4YB6A 3HXMA 2Y1IA 1JLAA 5FD1A 3FKBA 2XY5A 3KJVA 4OLPA 2BE7D 4IRDA 3B8HA 5K9FA 5EX3A 2PE8A 4D3GA 2B9YA 3HHLC 2XHCA 3TEGA 4LIRA 1P8GA 3BSAA 4F4YA 1N5VA 1YBUA 2HS3A 1TL5A 4ID5B 3L7OA 5U47A 2HBYB 1X9MA 3UDVA 7FDRA 3K5OA 4OX7A 2UV8A 3HJFA 1HQUA 3GJRB 2O01C 2AX0A 5I3QA 1CG2A 2ZNZA 1J5EF 3A8IA 4DR6J 1MG7A 4PXDA 2PO4A 4GKKJ 3M6UA 4QPXA 1WSVA 1RWVB 2QX0A 3VR1A 4USMA 3I31A 2OJ3A 5HMXA 2VZ9A 3PXGa 3VVUA 2ATCB 2P5VA 1UJ5A 2CXEA 3G6ES 3K8VA 3FSXA 2BJDA 2CADA 1WI8A 4KGVB 1RKIA 3E51A 4M5LA 2BBEA 1FJEB 1P27B 4CYUA 1UPMB 1IWAA 3PYEA 2L9DA 2RQMA 4C0BA 5AXNA 4LFBF 3CGIA 5D15A 2E66A 3NOCA 3TNVA 1QY7A 1T9WA 1WWHA 1RTHB 3P49B 4LF8F 1WI6A 3ZFVA 4DPWA 5T7LB 4DG1A 1NBEB 1K0VA 4I56A 3ILIA 3LP2B 3SBMA 1MROA 1RAFB 4YR2A 4HHJA 4ZIWA 4RJVA 5FDLA 1VBYA 3WHIA 2OTLS 2E29A 4JI3J 4UZCA 3UVJB 1UFKA 2Z2MA 4ZLNA 2UXCJ 4LSZB 3GIKA 2ROPA 3QT8A 4OYAA 3JSRA 4F3MA 1T05B 2RUSA 2U1AA 1FT8A 2OPRB 5K14A 1UCNA 2BE9B 3M2UB 3I55S 1RAEB 2DXDA 4ANDA 5LOQA 1HI8A 4BWMA 2M7SA 1SJFA 3DLKB 2R3VA 3WIUA 2E7WA 4DL3A 4DBQA 1N0VC 5JVGQ 4A4JA 2CG4A 5A0YA 1ZTTA 2W01A 4HL9A 1D8ZA 3Q89A 1CJKA 2MKKA 2N7YA 5KAKA 3B4DA 3LTOA 1O0PA 3RYLA 2LXUA 3GG0A 2HK2A 4FP9A 2YX1A 4YB5A 3FQKA 1OJ4A 2CNKB 1PJ7A 4WK3A 4NLDA 3UNYA 2H65B 4P2MA 2XS5A 4Y28C 1RT1B 1WEYA 4WZMA 2B0GA 1UMJA 4UT4A 5CCLA 1TVRB 5D0HA 3HM9A 3PFEA 3DM2A 4ZPTR 4ZN1A 4LF5F 1HI1A 1RA6A 1HNZF 1HMVA 2XYPB 5KG2A 2XEXA 4H4OA 3UW1A 2QN6B 1LFPA 2HKEA 3FUYA 2HAIA 2PGCA 4CLSA 1N34F 2BQRA 4CLLA 5KFLA 2CPYA 2VJUA 2IRXA 2F4FA 3EVMA 3BREA 2UUCJ 3BPSP 3PW5A 1NSAA 3LWLA 4J9SA 3LPYA 1KLNA 1CJVB 4CH7A 4USVA 1CBKA 3PM9A 2JH3A 1YRXA 1S72S 3OTEA 3BBBA 4ZP8A 2MMYA 1J27A 2XCAA 1ZAXA 2BQ3A 3JSBA 4J9QA 3MPVA 3G8SA 2DNMA 5GADI 1N33J 2Y0SD 4UOGA 3HPOA 4WYLA 3FK4A 1FESA 4DU8A 1U1OA 2JSXA 3VAGA 3FBCA 5F8IA 3B54A 2AEJA 4I2QB 5C7PA 4ZMMA 3BO3A 1VBKA 1D9AA 3LA0A 4ENOA 1H2UX 2RVJA 1S1VA 4GVBA 4QYRA 5F8MA 4LR9A 1VYAA 1TL1A 1JX4A 4DSJA 3OTOF 2V67A 5DLFA 3ZC4A 4Q8FA 1L3TA 1LEOA 2W2OP 4QIGA 5AXKA 5KFVA 4ALZA 2AJ4A 2NREA 2WSEC 1R0AB 2XLIA 2GZOA 4JI6J 3W1YC 1JMTA 3ISND 4DUYF 1DTQB 1CVJA 4DL4A 1RWUA 2MEWA 1KONA 2BOAA 3H5UA 1VLYA 1S1XA 5IWAJ 3OHBA 2ZHAA 2NLWA 3LUYA 4ID5A 4DSIA 3BDPA 3QYYA 3NG8A 2AJ1A 1LK5A 4CO1A 2V8HA 3FEYB 1OSCA 2K8GA 2GHVC 2JLFA 2NXUA 2IM2A 1FXRA 2VC0A 1FO1A 1X31C 2PMWA 4K4UA 1DLOB 3TVYA 2J9EA 4ID8A 3CXCR 3DU6A 2Q1LA 1WC4A 2O1PA 3BYPA 3I56S 2W9AA 4IG3A 1S7IA 1GTEA 1QTMA 4DPOA 3FC9A 3M4XA 2VB6A 5D8HB 3I32A 4M5HA 2PIIA 2DITA 1BWVA 1VQNS 2NUUG 4C3KA 2ALZA 4CT8A 1FTCA 4M5JA 3W65A 1RT5B 2VKRA 4ZLLA 3QSYB 1UETA 4K4SA 2QL5B 4QR0A 3VF0B 3OFHA 5D4OA 4K4VA 4O44B 1N88A 1SC1B 4BCAA 3CB4A 3H7HB 4B3TF 5KFTA 2HS4A 4H54A 4ILMA 1KQGB 2BJ3A 5D0GA 4L75A 4A8YA 4ZVTB 3VHQA 1RTHA 1F2HA 3IWNC 4B3RF 3RBDA 3KG0A 4U96A 5T7LA 1XMQF 2DHHA 2KM8C 4DQSA 3LP2A 1NLKL 1VDHA 3N79A 2UXDJ 1XNRJ 1IKYB 3KKFA 3MCNA 3IM9A 3RRKA 2FLPA 1TK0A 4OYMA 2JZ5A 3AY0A 1JLGB 1FCAA 3MEEB 1W26A 4JI1J 5JVHQ 1FRJA 4HYKA 2JVOA 4UF4A 4OZJA 2XSJA 3CDBA 4M5MA 4B3SJ 2QLFB 1T05A 4DCOB 2PFFB 3CW2C 1U1RA 3CD6S 1S49A 2OPRA 3Q22A 4DQQA 3M2UA 1VIOA 2HVEA 2C2RA 2F63A 1T3NA 3FBBA 3DLKA 5KFDA 4KPCA 4TLQA 2NZCA 4DN9A 2CRLA 3CJQA 3JTPA 2BM0A 2DTJA 5J2MB 1X4HA 2IMOA 4NOHA 3QWPA 5IV3A 4YP3A 1B7FA 2Y0BB 5KFWA 4NYPA 3RBXA 2LQ8A 4PYAA 4P74A 2I9SA 1OPIA 4KYZA 1FRKA 1NKBA 2HNDB 1EQMA 4OYIA 5M2UA 2FZCB 5E41A 3PW0A 1TVRA 3GJSB 2IHR1 3MOJB 3AJDA 4LF6J 1JJ4A 2XLJA 2CJYB 4PG8A 2DR7A 3T19A 4LF4J 1DQ9A 1QAJA 2DNOA 2X3DA 4QOTA 1C0TB 2AYGA 4DSKA 1NJXA 3NS5A 3PYDA 3DGVA 2DR9A 3SDEB 2BKNA 4OLOA 2N3OA 2FVSA 1HBOA 4XTTA 1ZM3A 5ETLA 5DZ6A 1RACB 4CP5A 1CJVA 4R0JA 4NRTA 3PJWA 1XR5A 5CQGA 2QMUB 4YB1P 2AJ0A 3NGRA 3THTA 1R0BG 2DH9A 2Q3PA 1S6OA 1SH2A 3UN2A 4UY85 3V5RA 2B51A 2RQKA 3OJUA 2CA9A 2AEFA 3BQ0A 2WBMA 2VJVA 3AXMA 3C16B 4ECRA 5JXSA 2IBKA 4I2QA 3Q2TC 4URSA 1IKWB 2B7BB 1JNZB 5KFMA 3BSNA 3MAAB 3Q8UA 5FJ4A 3UCZP 2FHMA 1IQTA 2DGTA 4KE5A 3KG4A 5F8GA 3P6YC 3E8OA 3N6LA 4YR0A 3D9BA 4DR5F 3D3CJ 1LKZA 4K2JA 4MIAA 2P9CA 2G1DA 4HH1A 3QGPA 1R0AA 5A2QY 4X4PA 1BQMB 4JOUA 1S1UB 2RIJA 4OV6A 2ZUGA 1QLNA 1DTQA 2MKSA 4RNNA 3MXHP 5ADZA 4WTOB 2D3OR 1XMOF 1U1PA 4KSEB 1T11A 4FS2A 1K44A 1RAHB 3Q8RB 2XO7A 4J9UE 3GFXA 2UXBJ 2J8SA 2NXEA 1SC4B 1P1LA 5B0AA 5KFRA 3MD1A 1D9FA 3GYXB 3LANA 1FE0A 5CH7B 4CCHA 2FHJD 4ETXA 3N9UC 2UVRA 1KHVA 3BKTA 5DDPC 2R2TA 2JHEA 4OX8A 1DLOA 3LAMA 2R7VA 4NEYA 2Z58B 3RRGA 4QWBA 2VQFJ 1HL6A 1N48A 3B82A 3W61A 1FRXA 2VUGA 8RUCA 2DHGA 3GIIA 3Q8VA 1YITS 1T9XA 1VI7A 4J9PA 1RT5A 1WC5A 3HLUA 3MM5B 3D6HB 2F4VF 4O44A 3IWLA 1PBUA 1ROFA 3S6EA 2K1RB 2LA6A 1GMWD 4I0WA 1WNEA 3F56A 1F1BB 1S0MA 4X62F 2M2BA 4PQUA 1JXEA 3LF0A 1IR1A 1HNWF 1BXNA 4LF2A 4DZDA 1IVZA 2W8KA 4URGA 1AB8A 4MKVA 2DJWA 1OQ3A 3VV2B 1YRUA 2QIFA 2Z2ZA 2QMWA 3ILJA 4P7TA 4F4KA 3K89A 3R3TA 4KIAA 3GU0A 2VDIA 1JLGA 2OO4A 3RR8A 3MEEA 2DNQA 2KRBA 2W4CA 3K5LA 1Q16B 2YX7A 1MWZA 4U7CA 2R7WA 2V8GA 4DPXA 4LFCF 2GJIA 4DJBA 2FPHX 1BGXT 4JYAF 3BGLA 1GNKA 4RX6A 3K5PA 1JQGA 1JLBB 2F3JA 5B7WA 3QAEA 3HT0A 4GC7A 4PWUA 2EFOA 1GXUA 1Q53A 3PYGA 2DRAA 2BOPA 4Z37A 1F9FA 1HLWA 1VQKS 2HPUA 2PFDA 1WKKA 4K50A 5F0WA 2HQFA 5J2MA 1IUJA 3MM9B 1RLCL 2XNRA 3GJTB 2X1AA 3R9LA 1ZZNA 4DX5A 3R27A 4V1Ak 2I5JA 2G0JA 2RAQA 2WW8A 4WJBA 2D74B 2KB2A 4U9RA 3R2DJ 4DUZF 3Q8SB 3O3LA 1NH8A 1X4EA 3NEKA 2KZZA 4CM2A 3FJ2A 2CYYA 1H72C 1T9YA 3CJRA 3LP1B 2FJWA 4LFBJ 2Q43A 3G82B 2EG1A 3HT3A 3IS9B 2V4RA 5GADU 3QT6A 4FN5A 3RB4A 1S12A 5EN1A 3SSQA 4LF8J 1YJNS 2RUGA 4HKQA 3H5SA 3CCWA 3TUPA 5CYQB 4CO2A 1N5QA 2WOMB 5DQHA 1NK8A 3JXOA 1U1KA 4R25A 2FZGB 1WC1A 4UOHA 2XY7A 1VJWA 1YJTA 1BUXA 2HNYA 4CLFA 4F3OA 2OI2A 4DV1F 1FWPA 3O6QA 1O5JA 1Q8BA 2C28A 2QV6A 3F41A 1Q1KA 3WDOA 1UVIA 1FK9A 2WB4A 4X65F 1DJ0A 1YRTA 3RW7A 2W24A 3JAMU 2N82B 4OI6A 3VQTA 1MWYA 4CZCA 5KFNA 4L76A 4U95A 1K9MT 3QNWB 4C7QA 5HN0A 3VAHA 1Y5NB 1KQFB 4X66F 5CYMB 3PJ9A 1YI2S 1Q0NA 3EZOA 4OZLA 1IKWA 2D3UA 4HT5A 2K7JA 4P52A 1LWFA 2P8IA 2O67A 3VAKA 3EE3A 4C8YA 5J1PA 2CPHA 5KFCA 5I3UB 4Q45A 3PEJA 5J2PB 4ZVHA 2RF2A 2HFZA 2H5EA 4OJHA 2VG7B 3AAWB 3BJYA 4NMXA 2OD6A 3HZEA 3QPIA 1UW4A 1TMMA 1BQMA 5C5JA 4ZVFA 3VAMA 3T6BA 3V4MA 4CNZA 3H5XA 5CAAA 2DIVA 2HHXA 4ELUA 3CD7A 4ZP9A 2EC0A 2MXYA 1DZ5A 2P6TA 3RAMA 1HNZJ 4NCGB 1V9OA 3E01B 3J81j 4USUA 2RMLA 3MM8B 5KFYA 2YNGB 1N34J 4RUCA 3CJTA 3VGSA 4KGKA 2OFGX 3X1LB 1TZ0A 3DFEA 4WIIA 3OSNA 1RE1B 2VQEF 2RHQB 4MFBB 1LQ9A 1WD6A 4NCAA 4C8NA 4H4MB 3A8EA 4Q0BA 2YKMB 5IM0B 2OGUA 4KC5A 4YY3J 3H59A 2DHXA 2NSCA 2EBEA 3ZTOA 2MY7A 2N3LA 2GAGC 1XR6A 2HBRB 4PG4A 3PX4A 2KXNB 4IH6A 5B0EA 3UCUP 1EJ7L 4PWDA 3MM5A 3D5MA 2VBWA 1Z4UA 4UOCA 4EFAC 1UFLA 4YDDB 2K1RA 2J0SD 4YR3A 1UL3A 2KTQA 1UFWA 4PCQA 2OPSB 3N6MA 4ED8A 4M5IA 2AT1B 1TELA 1NSQA 2KZMA 3IRXB 2HHWA 1C1CB 2IC3B 2CVEA 3POTB 2E5JA 3J7AN 1S9FA 3D28A 4TN2A 3MMCB 4QR1A 5L39A 3VALA 3EPIA 2RH3A 2UUAF 2H3EB 1R0CB 1TL7B 3EXYA 1PG5B 3GWCA 2FQQB 1N8RT 3NS7B 1VMBA 4X4TA 2IVFB 2O66A 3T9NA 1PYOB 3KJQB 2HHQA 3IWXA 4F8RA 2CQ0A 1FKPB 2VPXB 4LF9J 4C11B 1U47A 3S01A 1AYEA 4ED4A 1T0TV 2D9PA 1H6KX 2DRBA 1RWXB 4QIWD 3TARA 3PDNA 3CWJA 2KHCA 4EI2A 4LRCA 4XK8C 1UA1A 2B4UA 1JLBA 3G4SS 1S0OA 4N47A 4PZVA 2VASA 5E3RA 4DR7F 3KOAA 1AXQA 3TZXA 1KVIA 4QYZJ 4LJMA 5C2CA 4JBCA 2MZQA 5HVGA 4BLGA 4A47A 4FF1A 4CM0A 2X51A 3EGNA 4DPTA 3DNCA 3EX7B 3MM9A 1KSPA 2E9RX 3H4DA 1JXVA 1VRTA 3IR6B 4FXWA 1SBRA 4EO6A 1VRUB 4QWEA 1FRIA 3AA8A 1CSJA 3UDLA 1KFDA 1FJGJ 3GYNA 5KFPA 1TUVA 3BF4A 3LP1A 1URNA 2ZBRA 1I1GA 4CH1A 2RQCA 3G82A 4PXEA 4DUTA 5LJ3Y 1YQHA 3K5MA 5BYRA 1VQLS 5C24B 2B4VA 1NJWA 4A48A 1RKJA 4B3RJ 4DV0J 2QMXA 1PYSB 1XMQJ 1RABB 1LWEB 1X60A 5CYQA 4DR1F 3R5GA 2XI2A 1H2TZ 3CJKB 2IRUA 3KHHA 4ES3A 4B3MJ 2WCXA 2R7UA 4ECTA 4ECSA 2ZE2B 1GXLA 4F4AA 3VCDA 4EEYA 3J7YU 2UU9F 3LGHA 3IMQJ 1TKZB 4CI0B 2CKWA 2EW9A 2GFFA 1JK9B 4ZLPA 4MK8A 2HHHJ 4MMOA 5FLXU 4DOZA 3TW0A 2R7RA 2ILYA 4K5RA 2GHPA 2CQBA 3GPAA 1V3ZA 4I2PB 3CCES 2RD5C 5CYMA 1UP1A 4DMZA 2FYXA 1EETB 1S1WB 1FDNA 4QWAA 2ZH1A 4ZN3A 1RADB 5THWA 5I3UA 2W4PA 4RUHA 5J2PA 1G3OA 4QIEA 3RRHA 3M6XA 2NPIA 1U25A 2EFNA 5KFHA 1LW0B 3TO8A 5F9NA 3V6JA 3BGFA 2D3O1 4C8OA 2CPFA 2W2QP 3JB9k 4JI2J 3NNAA 3EJMA 4XIUA 5LMUF 1RT3B 2Z56B 1OWXA 1MU2B 2P2CB 5EDWA 1RU2A 5BYQA 3UR0A 1JLQB 2AMCB 5A8WB 3TR5A 5KG4A 4IFYB 3GZ7A 3I9V9 4NCGA 1ZM9A 1VC5A 4C0OC 3E01A 1SCJB 3I0SB 2C3YA 5HATA 3MM8A 1D1UA 5C42B 1VQOS 2WVEA 2YNGA 4FYWB 3RBEA 4WFBQ 4RU2A 3CMAS 4OZNA 1V3SA 2A18A 5ITHA 4LFAF 4MFBA 1QSLA 4NLSA 3KK3B 4H4MA 3HSZA 2YKMA 2CDQA 2MKYA 3SMZA 4K4TA 3KNGA 2OAUA 1LV5A 2QA2A 3IG1B 3W9HA 3HVTB 4AE5A 1MN7A 2MZSA 3M8PB 3MUTP 2NS1B 2Y1LB 1ITPA 4DL5A 4KKOA 2NYIA 3DOLB 2KVQE 3R5CA 3OXGA 4CLTA 3U7JA 1KP6A 3BGUA 4C8MA 3D2WA 3M8YA 1SC6A 2KFZA 4UY8T 3TX8A 3MPDA 1Y7PA 1M90T 2GJFA 5DGAA 1RU1A 1VCTA 3L95X 2OPSA 2RRNA 2M88A 2CNOB 4M63A 1RP5A 3FZ2A 2F8HA 1R8HA 3DOKB 3IRXA 4ZJQA 2NUHA 1RWOB 3R5AA 3NL0A 4DR5J 3POTA 4DR6F 3QFWA 5I3PA 3MR2A 2FVPA 1QVGR 4GKKF 3MMCA 3ZZRA 3PO5A 4JI0J 3UWTA 1YBAA 4ZPBA 3A12A 5EX0A 3KYLA 3I5AA 5DJBA 2C3PA 3C8YA 3SCLE 3UN5A 1XMOJ 4Y6IA 1M1KT 2FDNA 3F44A 4IFVA 4TNOA 2ZWOA 1FKPA 1HNIB 3SI8A 5DDRC 3UDEA 3CF5Q 4LBIA 3NGDA 4C11A 5DRKA 4NLVA 4JP8A 4IKAA 2GIRA 1HKAA 1J2VA 3SSSA 4ED2A 2QT7A 3D68A 2DGSA 3G87A 1EARA 3PHEA 3G86A 2HHUA 3SQGB 4QYZK 2QA1A 2OPQB 3D67A 3N4WA 2BQUA 1T3OA 4DDFA 4ECQA 2HAFA 1YK9A 3N6NA 2LXIA 5AXLA 4DXLA 5K8NA 1IN0A 5F8JA 2XMAA 1OMSA 1CS4B 2YWFA 5DM6Q 3BO4A 4JI3F 2V6AA 2OSQA 3OUYB 1SQEA 1VRUA 3NMAA 2OMOA 4PXBA 1NNDA 1X5TA 3MUMP 2W1BA 1Y00A 4X2BA 3AOBA 1S1TB 4QWCA 4O0IA 4ZPCA 3VGVA 1NO8A 3UNGC 2ZH6A 4G1QB 2VKZG 3L7UA 5GAEU 4ZPAA 3CJKA 4CO4A 1NSKL 1YWXA 2DR6A 2RNEA 2ZKTA 4MTPA 3TZWA 5LSRA 1LNQA 4ZA1A 3ZNUA 1VBZA 1FRHA 4I7FA 2YNFB 5AJ3F 3CVKA 2H9ZA 1RYSA 4KGXB 1J5OB 3A13A 5GAHI 1UW9A 1IBCB 1TKZA 2EXUA 3J81U 2GGPB 4CT9A 3T1HF 3EZUA 4JYAJ 4J9LA 1RGVA 3BQ1A 3CO9A 4EWTA 5B0CA 9RUBA 4QU7A 1U8SA 3V6HA 3MTJA 4G1PA 4I68A 3EVOA 5A8KB 4Q5VA 1X5SA 5I42B 2DNYA 3HZGA 2L3MA 1EETA 1S1WA 2WVFA 4Y00A 3AT1B 1KQSR 1RDRA 2EK1A 3G6YA 1KC8T 4B9VA 2WAQD 4NE9C 4XAKA 4OZ2A 4A8KA 3ITHB 1FD8A 1HWLA 3UE2A 2E44A 4ECVA 2JFKA 4DUZJ 1LW0A 2A0FB 3KLEB 4N56A 2GVZB 3HSDA 3F0NA 1K1SA 1MMDA 3M1VB 2KJVA 2BEFA 1RT3A 4ED6A 1TL3A 3ZTSA 1PCAA 1MU2A 1TKTB 1VS3A 1JLQA 3KUEA 4J9RA 3AD8C 5A8WA 4OHXA 4C8LA 2CNLB 4RLEA 1TAUA 2XZDB 4IFYA 1G1XA 5HP1B 2H5JB 1CLFA 5B08A 4DV4J 3I0SA 2HRUA 2PA8D 3TZYA 5C42A 3D54A 2L48A 2K2PA 2B6AB 3RB6A 1YG0A 8ATCB 4NLQA 5J1EB 3OVAA 2DNPA 2ZEJA 5DS7A 3KK3A 1C4AA 4F04B 4CWBA 1GTHA 3UO0A 2IJFA 5B0BA 4OX6A 1R8AA 4A8XA 1NUEA 3RTVA 3GV5B 5F3ZA 1XNQF 3V2UC 5F8HA 4ILLA 2WZ1A 3HVTA 4NEZA 1XN9A 3M8PA 1NK0A 4DPYA 4NI2B 5KOXA 4I1TA 4DX7A 1AW0A 3DOLA 3ZZTA 4Z7CA 2NZ4A 5IWAF 2OHDA 4Y2MA 3D6MB 2DYAA 5T41A 2Q66A 3MPWA 1TKXB 3HHLD 1HQEB 2ILZA 4K0KF 2HHSA 4NPOA 1UVLA 4B9MA 4FDFA 5ETPA 2A3JA 3PR5B 2W9BB 4IRCA 4GKJF 4HI2A 4B17A 4KT0C 3T9ZA 2MY8A 2AJQA 1UWAA 4OZ3A 3JTNA 5LSLA 1OYDA 3SYZA 4RZRA 3TEHB 2HVIA 1GMVA 3PCOB 4A8OA 2R8GA 3TYTA 4P7VA 3EXCX 1U0HB 2ZHOA 2DD8S 1HNIA 4WXOA 4OZ1A 5GMEA 4TVAB 2E5LJ 4LSLB 3MFIA 3RG6A 4CLWA 4CO0A 2XULA 3HHKA 3H20A 2XCPA 2HBZB 5H9FJ 3Q0AA 3I5BA 3L09A 1RHKB 3KLGB 3GIRA 4IH5A 3KFWX 2F9JA 3W2VA 1UPPA 2PSZA 4P6QA 2XO6A 2E9TA 2W9CB 2OLWA 3SQGA 5D6GA 3AD7C 2OPQA 2J8AA 2V2KA 2EWHA 4RW7B 4WF9Q 2UXDF 2W2PP 2XMMA 4USKA 1E6VB 1W2IA 2BYCA 4ZCLA 3PG9A 3VGUA 2KT5A 4LF7J 1IBKJ 1FVQA 3CPWR 1YIJS 4UZBA 1OYEA 3OUYA 2VC1A 2GV1A 3ILLA 1RLDA 1WHVA 1YLXA 5F8NA 4R8UA 1CC7A 5CABA 2ZH8A 3D1OA 3IGVA 4KRWA 4JV0A 5LXRA 1S1TA 1HI0P 5B09A 4F2RA 4GO7X 3A3OB 3OQ2A 3GR0A 5CD4A 3K8WA 1Y3KA 1RSCA 4G1QA 2CQGA 3R1LA 2R2UA 2I1RA 5J2NB 4WWSA 2JX2A
chains in the Genus database with same CATH topology
2XMWA 2XMJA 2JDJA 1IXKA 2MZ1A 3CMES 4YB1P 4BHQA 2AJ0A 2D1CA 1KN6A 3OR2B 2DGQA 3HVRA 1GXTA 1PC4A 3THTA 2DH9A 2Q3PA 1S6OA 5EGYA 1D8YA 2R7TA 2NSBA 4NA3A 1SH2A 3DRSB 1OO0B 3M32A 3H25A 3NLCA 4UY85 3V5RA 2B51A 2VODA 2F8MA 2RQKA 5KG5A 4UW2A 3OJUA 2C2EA 4M95A 4LVNP 4DL0C 1VQYA 3LQVA 5MLCV 2YNFA 2WBMA 3BQ0A 5CXTA 4ICLA 3RB3A 4WKYA 4ED3A 4ECRA 5DG8A 1J5OA 2CVIA 2GQ2A 1VQ6S 4U6PA 1X5PA 3IN5A 1QAYA 5JXSA 4B08A 2IBKA 1X4BA 2R8KA 4I2QA 4OJ3A 1F5AA 2BXJA 3SXLA 1M5KC 1ZBTA 4URSA 3Q2TC 2ZZMA 4ZHRB 3GV7B 1IKWB 3H2LA 3CCMS 2DCUB 3TUZC 2B7BB 3E2EA 2CPZA 1JNZB 3KHLA 4ZCKA 5EHHA 4DF8A 4WU2A 4LT6A 5LT5A 5DG9A 5KFMA 3BSNA 1M0SA 1O51A 5FJ4A 3UCZP 2DNRA 2FHMA 6FD1A 3QGIA 3AQOA 1IM4A 3TUJC 1TKDA 1LW2A 1X4GA 3DXBA 2BANB 4LF7F 3OR1B 4Y2IA 1JKHB 2UVUA 1IQTA 1FHTA 1IBKF 2YH0A 1VK8A 4P2SA 4PG5A 4RNHA 4Y34A 2DGTA 4KKOB 1JLEA 4RBTA 1T95A 3DHWC 1C0UA 2HWTA 2MHEA 1H7XA 4KE5A 4B9NA 2B3TB 4RW9A 2BVZA 3SSRA 2J0XA 3KG4A 4TY8B 5F8GA 3P6YC 2YNIB 3E8OA 3N6LA 3UI3A 4YR0A 4LF6F 2U2FA 2OSRA 4DR5F 2FD2A 3GFHA 3RZAA 1Q8IA 2DNGA 3CCJS 1LKZA 4MIAA 4DG1B 2P9CA 3M9MB 4ZDNA 2ZH5A 1WEXA 2G1DA 1U09A 2R2SA 4HH1A 2M8DB 4LF4F 2UXCF 2VOPA 3QGPA 3T6JA 1R0AA 2DGUA 2DHAA 1VQ8S 2ZJPQ 5A2QY 2G4BA 4RW8A 4X4PA 1BQMB 4JOUA 1LXJA 1S1UB 3HO1A 2ZH3A 2RIJA 2ZUGA 4DN0A 2MKIA 5JUMA 2ERRA 5D3GA 3OFFA 2YX4A 1QLNA 4A8SA 3OVSA 4RWWA 1DTQA 1YVFA 2MKSA 3ITHA 4BC9A 3L3CA 4RNNA 3MXHP 2JVRA 3HDSA 1FNXH 5LSOA 5ADZA 5HL7Q 3OXFA 1Q7YT 2EI5A 2YKNA 3M30A 1T94A 2M9KA 2D3OR 1XMOF 2D9OA 2OPPB 2UP1A 1N52B 1U1PA 2ZH9A 1QSYA 2CQPA 3LP0B 4KSEB 1WG1A 3NNCA 3D0GE 4ZP6A 4FS2A 5C24A 2MQPA 3MECA 2KYZA 3S8SA 3Q8RB 3KLEA 1ZAVA 5AE3A 2XO7A 3CCZA 3GFXA 3GSDA 2IYGA 4NLPA 1AFIA 4QR2A 4C0HA 3AB2B 4HTIA 3G8QA 1VIXA 2C3OA 4MH8A 1LWEA 3FGVA 3M1VA 5JJBA 3PKYA 1YJUA 1ZETA 3OTCA 1P1LA 3PRDA 5B0AA 5KFRA 4Y65A 3MD1A 1D9FA 3BQ2A 1SJ4P 3GYXB 3CJ4A 1WG5A 3LANA 1FE0A 3KNAA 3NWGA 1KFSA 3MTKA 4GC6A 5CH7B 4K4WA 4CCHA 2FHJD 4ETXA 3N9UC 4EUVA 2UVRA 1KHVA 4IFVB 1HHSA 2ZE2A 1X5OA 3K58A 4HEA9 5DDPC 4AYBD 2LYVA 1N5TA 2R2TA 3K57A 1YGYA 2JHEA 4OX8A 4UUXA 1DLOA 5FLXY 3I0RB 3LAMA 4JUZA 4NLTA 4Q44A 3Q2SC 1T03A 2DGVA 2R7VA 2XSFA 2DH7A 2V4JA 3BS9A 3RRGA 4QWBA 3OW2R 3FQLA 1ZH5A 1HL6A 1E6YA 3CD5A 2V0NA 1N48A 3B82A 2B6AA 1FRXA 3PFOA 2J5AA 2L9WA 4X4VA 1KHWA 2RQ4A 5J2QA 2VUGA 5KFXA 4YUDA 5KFAA 1R7IA 1NJIT 1SB6A 2DNKA 2DHGA 3M8QA 4QBUA 5DG7A 1YJVA 3GIIA 3RAXA 2DPIA 4H4KC 3T5JA 4XPCA 5AE2A 4OL8A 2DK2A 2CJBA 4O4GA 3ZZ0A 1YITS 4FXVA 3J7Z5 4DFJA 2ATLA 4YQWA 4QU6A 1GX6A 2K3KA 2PDAA 1VI7A 2HVZA 2LCWA 3DCAA 1DTTA 4ECXA 4J9PA 1RT5A 4NZ0A 1R6YA 2XMTA 3HLUA 3MM5B 1X9WA 1SJRA 5C25B 2J7WA 1TAQA 4DV5F 1HYSA 4JI5F 2F4VF 4I2PA 1KOHA 4HT7A 2C2DA 1TFWA 3MMJA 4O44A 3IWLA 1ROFA 4EO8A 3S6EA 2QEXS 4B9SA 2K1RB 5LL6d 2LA6A 2X1FA 1WF2A 4I0WA 2DGXA 1WNEA 2KG1A 2FHKA 3F56A 5L1KA 3FSYA 4TQRA 4DL2A 5EUHA 3CDEA 2KKHA 3MEKA 1QJHA 1S0MA 1KRPA 4WFZA 3HHEA 4X62F 1Y0HA 2M2BA 2MQMA 4PQUA 1S0NA 1N54B 3D0HE 2MQLA 1JXEA 3CSKA 3LF0A 2XGPA 1YSJA 1HNWF 2G0CA 4NLUA 2Y1JA 1FNMA 3EUNA 2LXFA 1C1BA 2W8KA 4URGA 3JSMB 3I9ZA 4IO9Q 2UUCF 3CEDA 3MM7B 1KTQA 5B0FA 3CC4S 2DJWA 3R1HA 5G4DA 2GIQA 1XEZA 1OQ3A 3VZHA 5L9XA 4RWXA 2CJAA 1YRUA 2Z2LA 4C97A 2RDIA 1WHXA 2BRLA 4NA1A 4KO0A 1OS5A 3DC2A 1KD1T 2L9NA 3WZ0A 4WCEQ 4OQJA 2QIFA 4CH0S 3HKWA 3U1LA 5KT6A 3DMJB 1TKXA 5CZXA 4X4QA 5KFSA 2BM1A 2I2YA 2QMWA 2ZC4A 4KBIA 1HQEA 2HFNA 4ZVEA 1XC9A 4P7TA 1U48A 2EFQA 3MEGB 4DFMA 2ZVSA 2V4QA 4F4KA 4DFKA 1REVA 4Y2KA 3KK1B 3X3UA 3R3TA 4KIAA 4USHA 4EBDA 4JV1A 3L7PA 3ZZYA 1CQMA 4NL5A 1JLGA 1SIZA 2OO4A 2X1GA 3RR8A 2RKIA 4IOCQ 2CFXA 1N33F 1BQXA 1IR0A 1TV6B 3HHLA 2W9BA 3MEEA 4B9TA 2J76E 4MIWA 1WEZA 2DNQA 2KRBA 2W4CA 4E8UA 2QRRA 5IZHA 1Q86T 1V6HA 3K5LA 3KK2A 1Q16B 2YX7A 5J1NA 1RTDB 2HIQA 1JWWA 1MWZA 4U7CA 2EKYA 2R7WA 3JAMY 4OI2A 4ED7A 2IVMA 2CQHA 2HNZB 4OIXA 2V8GA 4LFCF 4PPZA 1X8DA 2GJIA 2F8EX 4CIOA 4DJBA 3PW2A 2B7CB 3CD0A 4RBUA 3MEDB 2B56A 2FPHX 2MKCA 1D0EA 2E9ZA 3BO2A 4MK9A 1BGXT 1O8BA 4JYAF 2BE2A 3BGLA 4J5OA 1GNKA 3PX0A 1A7GE 4RX6A 3K5PA 1XK8A 3PIPQ 1JLBB 1L3SA 3CJ5A 4I7FB 1ZOTA 2F3JA 5B7WA 4N41A 3QAEA 4XO0A 4IR1A 2GW8A 2B5JB 4NLOA 2QLXA 1UVMA 3MMBB 4PWUA 4GC7A 1Z2ZA 1NK9A 5I4MA 2ZFHA 3FDSA 2AGOA 4A8FA 2EFOA 3RAQA 1GXUA 2ZZNA 3D0IE 1Q53A 3H5YA 1UAWA 4LSLA 2CJQA 3QAUA 2DRAA 4DHVA 1S9EB 1VC6A 2M5YA 4FS1A 4ES1A 2X3GA 2BOPA 2HQIA 2B4PA 2LQJA 1XMBA 3T3FA 4F02A 1B64A 2VG5B 2KI2A 2Z0GA 4Z37A 4ELTA 1F9FA 1VQKS 1S1VB 4USIA 2HPUA 3SV4A 3KLGA 4RW6A 3KHRA 3DRXA 4K50A 1DQAA 4JI6F 1RAJA 5KTQA 4IG0B 2X1BA 3IG1A 5F0WA 4HTJA 1DRZA 1VQPS 3KTQA 5J2MA 2ADBA 1IUJA 3MM9B 4OFZA 1T02A 3DRPB 2L08A 3HF5A 4HDHA 2W8LA 3PVXA 2XNRA 4J9NA 2WTFA 4Q2LA 2VPWB 2W9CA 2X1AA 1TL1B 3DI6A 1LOUA 1ZZNA 1PGZA 1SXLA 1DARA 3R27A 2GO9A 2I5JA 3QJLA