2DNRA

Solution structure of rna binding domain in synaptojanin 1
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
91
structure length
91
Chain Sequence
GSSGSSGGTVLVSIKSSLPENNFFDDALIDELLQQFASFGEVILIRFVEDKMWVTFLEGSSALNVLSLNGKELLNRTITIALKSPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein
molecule keywords Synaptojanin-1
publication title Solution structure of RNA binding domain in Synaptojanin 1
rcsb
source organism Homo sapiens
total genus 12
structure length 91
sequence length 91
ec nomenclature ec 3.1.3.36: Phosphoinositide 5-phosphatase.
pdb deposition date 2006-04-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2dnrA00
2MZQA 2G0CA 2DGSA 2UP1A 3VAGA 2M4MA 1N54B 5GMKa 2CPYA 4U67Q 1H2UX 2FC9A 5DDPC 1YITS 2M52A 2NZ4A 2HGNA 4WF9Q 5IM0A 2CQDA 1FJCA 2BZ2A 1Q81T 3IWNC 1M5VC 3LPYA 1UFWA 3DXBA 2X1GA 3G4SS 1VQMS 1W2BR 2OTLS 5GAGU 3B4DA 1QVFR 3MDFA 4ZKAA 4Z2XA 1K73T 2LA4A 2G4BA 1WHXA 4TU9A 2EK6A 2JVOA 2DNKA 1VQ6S 3B4MA 3G6ES 2KXNB 2MSSA 5IFMA 1WG5A 1CVJA 2AYEA 1WI8A 2MXYA 1VQLS 3TP2A 2OSRA 5D77A 2M8DB 1FHTA 1X5TA 3UCUP 1M5PC 3BEGB 1SJQA 1VQKS 2FC8A 3R1HA 2U2FA 3MUVP 1NO8A 2CQ2A 4FXVA 3ZZYA 3VAMA 2RVJA 3VAFA 3CC4S 2HGMA 1U1PA 1F9FA 3CC2S 3EGZA 2M7SA 1WG4A 2YH1A 3CD6S 2LECA 2M8HA 2ADCA 1VQ4S 2EK1A 3MD1A 3SDEB 3LQVA 2MKIA 2MQQA 4F26A 2JX2A 2JRSA 4ED5A 2J76E 3G71S 2ZJRQ 2CQ0A 2DNGA 5DDRC 3P5TL 2RU3A 2U1AA 3BO2A 2MZRA 2D9OA 2LA6A 2XS2A 3MXHP 2CPZA 2MZSA 5GAHU 3D2WA 2KH9A 5GVQA 5MLCV 3UCGA 1OWXA 2QA4S 1B7FA 2DGQA 1RK8A 1X5PA 2M88A 4PKDB 2ERRA 1Q86T 2KYXA 1YJ9S 1WG1A 2DH7A 4WIIA 1SJ4P 1X4BA 2RQCA 1DRZA 4QU7A 2MQMA 3THTA 4WFNQ 2JVRA 2KHCA 3NS5A 1KOHA 2CPFA 2KU7A 2MQLA 4C4WA 2CPDA 2FY1A 5LXYA 1M5OC 2DNNA 3UWTA 1YWXA 4UY8T 1X4HA 2DNLA 1WEXA 2MSTA 2DNPA 1X4EA 2J8AA 1K9MT 2XS7A 4ERDA 4UQTA 3J7YU 3I55S 3VAJA 2OSQA 3MUMP 2DNQA 5LSLA 2VODA 2O3DA 2V94A 1VC0A 4LJMA 4PRFA 2KT5A 3P3DA 2EVZA 2AD9A 1WI6A 1U1LA 2MB0B 5H1SV 1SXLA 2DGOA 1U2FA 3THPA 4WCEQ 3CCQS 1VQNS 2GO9A 2M70A 3RW7A 3VAKA 5GADU 3CCSS 1FJEB 2N3OA 2DNMA 3MI7X 3NMRA 1HD0A 2XB2D 2MZJA 2KVIA 3CCVS 5CA5A 1SJ3P 2PE8A 1P1TA 5BJRA 2KG0A 2MPUA 1VBXA 2DO0A 2ZJPQ 2DHSA 4RU2A 2HZCA 2MZTA 5D78A 1WF0A 2F9JA 3CCLS 2KI2A 2MYFA 2MGZA 3UE2A 3NNAA 1QM9A 5JVGQ 3MUTP 2YWKA 2XNQA 2DNHA 3EGNA 4C7QA 2N7CA 3S7RA 2CQ1A 3EX7B 1FNXH 2D9PA 2L08A 2DGXA 4QU6A 1U6BA 1WHVA 2ZJQQ 3NNCA 3UD3P 2CPEA 2DNYA 3R1LA 2MKCA 1X4FA 4M5DB 3G8SA 3SMZA 1VQ8S 2J0QD 1DZ5A 2K8GA 1PO6A 4IUFA 3MOJB 2DGTA 3Q2SC 1H2TZ 3CF5Q 1FT8A 3S01A 2WBRA 2RS2A 2LYVA 3V4MA 3G96A 2AYBA 1P27B 4OZ1A 2DGUA 2E44A 1FJ7A 1Q7YT 3UD4P 5CYJA 1U1MA 1U1NA 1VQ9S 1S72S 2NLWA 2MQOA 2MMYA 2RRBA 3CCJS 4FXWA 1KD1T 2OTJS 1VBYA 1A9NB 2YTCA 4A8XA 2CPJA 1M90T 2CQHA 4BS2A 3I56S 2KN4A 1X5OA 3TO8A 1JJHA 5FJ4A 2CQIA 1VQ5S 2DH9A 3H2UB 4W92B 3P6YC 2XNRA 4YUDA 2AYMA 3H2VE 1OPIA 2CQCA 2DISA 3CUNA 5IQQA 3DLLQ 2CJKA 5DDQC 3MD3A 2E5GA 4IOCQ 1YJWS 3CXCR 3CC7S 3ZZZA 1O0PA 5IM0B 4TLQA 2JWNA 4QPTA 2MY7A 2DNZA 1X4DA 3G8TA 2DH8A 1UW4A 3PIPQ 4IO9Q 1NJIT 1ZZNA 5LXRA 1ZH5A 2BOPA 2E5JA 3K0JA 2A3JA 2XSFA 5EN1A 2ADBA 2CQ4A 3TYTA 1U1KA 3CTRA 5LJ3Y 1UAWA 4Y0FA 3S8SA 2LEBA 4J5OA 1X4GA 5LSOA 4OZ0A 1X0FA 1VC6A 2HVZA 1WF1A 4WFBQ 5CXTA 1VC5A 3SDEA 3FEYB 5DM6Q 5GAEU 1WEZA 2VOOA 4F25A 1HD1A 3NNHA 1BY9A 1FO1A 2N82B 2KG1A 2J0SD 2DNOA 1KC8T 4CQ1A 1YTYA 2YH0A 1YI2S 1KOOA 2MKSA 1WWHA 4IOAQ 2DGWA 3CCMS 1M1KT 3J7ZT 1H6KX 1YHQS 4W90B 5JVHQ 1QVGR 5DDOC 1IQTA 3CMES 4Y00A 4EGLA 2MJNA 3Q2TC 2CPIA 4P6QA 2AYGA 2DO4A 2MJUA 1SJRA 1VQ7S 1R8PA 2HGLA 4CH1A 1WELA 3CCRS 4LMZA 2RQ4A 2M0GB 3N9UC 1U1QA 2FPHX 3UCZP 5DM7Q 2LEAA 3BO4A 1WF2A 2M2BA 4TU8A 4YB1P 3CMAS 2PEHA 3U1MA 4TU7A 2X1AA 1N8RT 3FEXB 1HA1A 3R27A 2KM8C 2KFYA 3CCUS 1JJ4A 1X4CA 2N3LA 2DHAA 2X1BA 1K8AT 2D3OR 1N52B 2K3KA 1DHMA 2RNEA 2SXLA 2QFJA 2DIUA 4QQBA 2MZ1A 2CQBA 1U1OA 1WHYA 2CPXA 3SXLA 1UP1A 1WEYA 5DETA 5ITHA 2E5IA 1YIJS 3G9CA 3RW6A 1R8HA 3VAIA 2OJ3A 2DB1A 2MQNA 1XN9A 1DBDA 2LQ5A 4CIOA 2VOPA 2DNRA 2XS5A 2MKKA 4C0OC 3HI9A 2QEXS 2OIHA 2I2YA 3US5A 2RUGA 2G1DA 2MKJA 4YOEA 1JJ2R 3BS9A 1AUDA 1A7GE 3VAHA 3HHNB 1D9AA 3CCES 2KRBA 2X1FA 1U6FA 1L3KA 3PIOQ 1FXLA 2KXHA 3L3CA 2LMIA 1HL6A 4WKRA 2GHPA 3JB9k 2F3JA 1VQOS 2MQPA 2DITA 1WHWA 2CQPA 3MURP 1VQPS 3BO3A 3CULA 2F9DA 2VONA 2B0GA 3VALA 1SJFA 1URNA 2MKHA 3CPWR 1N88A 3OW2R 1X5SA 1NU4A 2RRAA 4LIRA 3IRWP 1ZZFA 2MHNA 1KQSR 1H2VZ 2I38A 1M5KC 2DGVA 1VBZA 2KXFA 4V19X 1PGZA 4PR6A 5HL7Q 2KM8B 2KRRA 2RT3A 2FHOB 1OIAA 2DHGA 2Q79A 2MGZB 2MY8A 4F02A 1JMTA 2HYIB 1OO0B 2M9KA 4CH0S 2CQ3A 1U1RA 1D8ZA 5LJ5Y 5HO4A 2LXUA 3S6EA 3ULHA 2RS8A 1X4AA 3VF0B 1RKJA 3P49B 3NS6A 1Q82T 3U1LA 2CPHA 2L9WA 2YKAA 4WFAQ 1S79A 2L41A 1G2EA 2LCWA 2DIVA 2DHXA 2LXIA 1YJNS 2LKZA 2CQGA 2DK2A 2E5HA 1WTBA
chains in the Genus database with same CATH superfamily
2HQCA 3ILLA 2FVCA 2ROEA 3BGLA 2CQDA 3IWNC 1RU2A 4LFBF 1QUPA 2UV8A 5LMUJ 4CLSA 2AU0A 4Z2XA 3I6PA 1DTTA 3C6UA 1VQKS 1X9WA 2U2FA 2CQ2A 4FXVA 5LMNF 1FX2A 4DV3J 3NL0A 1RYSA 1UEUA 1U1PA 1GQEA 3BV8A 4DWIA 2AP6A 4H4KC 4L3KA 2VFUA 1JKHB 4LF9J 3EVWA 3PACA 1TL7A 3DLGA 5KG6A 2YKMA 2DNGA 3DOLB 4LF5J 5F0WA 4IG0B 2I5JA 3DHXA 4URGA 4RBTA 1KN6A 4WZQA 2AGQA 3K8WA 1SC6A 2E1AA 3MR7A 5HK4A 2RDJA 1S0NA 3C66A 3CJTA 2FY1A 2J9CA 1WEXA 1PJ5A 3KUEA 4O3PA 3VAJA 5HLFA 1S10A 1VC0A 2BJ1A 3V2UC 2W24A 2B9EA 4NCBA 1NB7A 4RUAA 3Q8PB 3KJVB 1HNXF 2OEJA 2JL9A 2N3OA 3ENAA 4ICLA 2KVIA 4ATNA 1TU0B 1RAIB 1QLNA 4F3OA 2HZCA 2WOMB 3W2VA 2VQEJ 2HRTA 2WHOA 2D9PA 4QU6A 2HRYA 1BQXA 3T6BA 4EO6A 4UT4A 4K4YA 2FLPA 2XC9A 1RT7B 3IG1B 2V2KA 3PTWA 2GNKA 3Q2SC 2XYPB 1YDLA 2JFKA 3M7VA 3SSRA 1HYSA 1FT8A 1HNZJ 3L7UA 2R7UA 2CPJA 2ZBPA 3I9V9 4ZPWR 4TY9A 4TXSA 1LWFA 1JJHA 2YWHA 1K0TA 5GAEI 2HHWA 4ED4A 1OPIA 1WC6A 2NXNA 4IOCQ 4RNMA 4ZIVA 1TK8A 3CO9A 3CXCR 4ZVEA 3ISNC 4H4OB 4J9PA 2BOPA 2E5JA 4DX8H 5A2QY 1GXUA 2OPQA 2HAFA 4PWUA 3KOAA 3KK1A 1ZAWA 3OTDA 1RBOB 4OI6A 2W01A 1OS5A 1G4CA 3HLUA 2FGOA 2IM2A 4XPCA 1CQMA 2BUNA 4NLUA 4A8KA 2ZH1A 3FDSA 1FO1A 1PAUB 1CJVB 1KC8T 1KP6A 2YKQA 1T7PA 3PJXA 4LRAA 3J7ZT 3QATA 2PN6A 2XMAA 3W8PA 2QGFB 3GWCA 4F4WA 5DDOC 3MPUB 1S0VA 4LF7J 3M8WA 2YX4A 1H72C 2EG2A 2AGPA 2L48A 2FJAB 3BGRB 4PG4A 5DM7Q 3D1QA 2F4VJ 1C1CB 1J2VA 1MMDA 4G1QB 3CJ8A 4FPRA 3CDAA 3DRRA 3R27A 3G2XA 2RNEA 1DHMA 4PABA 1TQLA 4FYYB 2DR7A 1DBDA 3D6HB 3FC9A 2BJ3A 2XS5A 1TUVA 1L5UA 2PI5A 3US5A 2GMJA 3NBPB 4PQAA 2QT7A 4K0KF 1D9AA 3HHNB 2UU9J 2XGQA 4J9SA 2XI2A 2YQ1A 3MF5A 2V2ZA 2DITA 1WHWA 4DQRA 3SCIE 1JLAA 4URQU 4FPIA 1CBKA 4MTPA 2XSJB 1SC3B 3QLHA 2UVWA 3ILIA 4FP9A 2Q79A 3NOGA 5DZ7A 5IC4B 1RWNB 2GAGC 2HYIB 2HW3A 5CZXA 1U1RA 1VFJA 2V8HA 1AROP 5ETLA 2YNFA 3MM8B 1HNIA 3TAQA 2LXUA 5HQ8A 3CCWA 5HAOA 3VF0B 2BMBA 2B9XA 3VQTA 3P49B 3KLHB 3D0GE 2CPHA 3KLIB 3J81U 4OX7A 3OL8A 1RT5A 2C22A 3KK3B 2MZQA 3VAGA 3SCKE 4WU3A 3DOMB 1YITS 1M5VC 1EJ7L 1ZOTA 4MAKA 5A6PA 1BGXT 5J2QA 1VLYA 2RJZA 4DUYJ 1Y00A 2E7XA 2YX7A 5F8MA 5AJ3F 2J9DE 1W2IA 2Y1JA 5ETMA 1T05B 2IBOA 3W5YA 3BH6B 1UWBA 1Z4UA 4F3MA 2HQIA 5A0YB 3PY8A 2YX1A 3QBCA 4J9UE 4QOTA 1LKZA 4M94A 4J9LA 4DU8A 4JI8J 2HZAA 3EGWB 2XYHB 2DD8S 3LW5C 4KR0B 1QE1B 3M8PA 2HBYB 2Z2ZA 3HSZA 3MPVA 2A6OA 1V3ZA 4IOBA 1V3SA 2HEKA 3B6BA 3M6WA 3H2LA 1RWUA 2GW8A 4ANDA 1IKYA 2VFRA 5DZ6A 4A8QA 4LF6F 1RP5A 3MFIA 1BWVA 1N33J 3OLAA 3I55S 2DNQA 1NLKL 4KPYA 4AQYF 2G2YA 1WI6A 1U2FA 3ONQA 1OQ6A 2NXUA 1TK0A 1U24A 1LWXA 3OJUA 1RT3B 3VAKA 1U48A 1MNEA 3IM8A 2RIJA 4DZDA 2XB2D 3NXZA 3CCVS 2R2SA 3TARA 1XC9A 3R5DA 4X62J 4URSA 2MZTA 1UFKA 1S4FA 1VI7A 1CJKA 5AXMA 1M1HA 4ZPCA 4KTQA 4LREA 2CQ1A 1HKAA 5F8JA 3KLGA 3V6KA 1C0TA 3OTOJ 2AV5A 1UKUA 1SVDA 1PC5A 1H74A 5SUHA 1VJQA 1GX6A 1Y3JA 5DS7A 1IBLF 5J2MA 1DZ5A 2DPIA 3UDVA 1NAQA 1WKKA 4GO7X 2E5LF 3PR4A 1K1QA 3NRBA 1FJ7A 1U1NA 1O8BA 4MH8A 4RW4B 2B7CB 3OUYB 4BS2A 3QIDA 1DQAA 3TO8A 5FJ4A 3MM9A 4ZPDA 2GV1A 2O67A 3KDNA 1Q8BA 4M63A 5I42A 4C11A 4Q7AA 2QN6B 2DY1A 1FEEA 1YRTA 5AXKA 4Y2IA 4GKJF 1DQ8A 3CTRA 2GQ2A 1D8YA 4RWWA 3ILOA 2XWYA 2AZ3A 1BUXA 2LEBA 1X4GA 3VGUA 5E41A 2B43A 4K5RA 1B0PA 2KZMA 3MEDA 1QAJA 2OFGX 1N48A 3LF0A 2N82B 4ID8A 2XTJP 2IC3B 3NAIA 1HBMB 2BKNA 4G6VB 1YHQS 2KFNA 1NHVA 4BC7A 1VQYA 2DYAA 2CPIA 3OVAA 4JV5F 2BANA 2W1BA 5IT9Y 5BYQA 5HQLA 1MWQA 5ETRA 1R0CB 1JB0C 3ITHA 3U1MA 5IV4A 4ZN1A 4I64A 3HDSA 4DV6J 2I0XA 1BQNB 4R8UB 1BLUA 4OYXA 5HP1A 2V8PA 2R2TA 4B9MA 3DFEA 4B3OA 4WIQA 2HQDA 2CUYA 3POTA 3M8YA 4HH1A 3LP2B 3HI9A 4Y3CA 2I2YA 3I0SB 3R5CA 1ROFA 3GCXP 2G2OA 2CZ9A 4DPUA 4ZJQA 3P45B 2HG4A 3L3CA 1SQGA 2GHPA 2I9SA 1SJFA 2IAJB 3QJJA 3UR0A 1L3VA 2IFXA 1RWOB 5KFNA 3ENQA 1N4LA 4V19X 3RRHA 1NDCA 1RTIA 4RL1A 4I56A 4DFJA 3GJSB 4EU0A 1HWJA 1VRTA 3QMQA 3QT6A 3ULHA 1X4AA 2X3GA 4A46A 1PYSB 1JLGB 4DV3F 2JZ5A 2V4JA 2DY9A 1AFJA 3LP0A 3GTYX 1FKOA 4LF9F 2ZKTA 3FNNA 3K17A 5KFAA 2FC9A 2BABA 1HI0P 4H4MB 1XEZA 1A0OB 3V6DA 1IQZA 1NK5A 2HHXA 2OTLS 2KJVA 2QLFB 1QVFR 2PA8D 2FZKB 3VTIA 4RW9B 1TFWA 5CYQB 2CXEA 3D28A 3R9LA 2OPRA 4DCJB 3H5XA 1WI8A 4OL8A 3UCUP 4Y34A 3MTJA 1C0UB 4I6WA 4P9SA 3QJPA 2IRXA 2RVJA 3CC2S 4N76A 3HVTA 4YB6A 3BPDA 4OZNA 4OI2A 2YWEA 1H98A 4J9QA 2CQ0A 3DYAA 2BDPA 1V5VA 5ETKA 3ISND 2E66A 1SPBP 1UJ5A 2WONA 5SZTA 2NXEA 3EVMA 2BM0A 3ZO7A 1N0UA 4N47A 2AJFE 1SC4B 2QLJB 2PDAA 2ZDOA 1TL3B 4Q2MA 3THTA 4GVBA 1E6YB 5DQIA 1JWWA 1NBEB 3R3TA 2MQLA 4JI7J 1MWZA 4B3TJ 4RPFA 3NLCA 1TUGB 3EXYA 3J7YU 2VL1A 4HHJA 3BBBA 3IRXA 1YQHA 4WCEQ 1HNZF 4MFBB 4DR2F 2GS8A 2HS4A 2M70A 4GC6A 4D3GA 4KIAA 1FJGJ 1VCTA 2R7VA 1KTQA 1FCAA 1RBLA 4ZDNA 5KFBA 2PD1A 4JI4J 1WJ9A 5A2QU 1U49A 3BQ1A 1LOUA 1TL1B 3SV3A 5EX0A 5E3QA 2IDLA 2W7PA 4A8WA 2MKCA 3R8YA 2WVDA 4J9RA 3T1HF 4DN9A 1I3OB 4B3SJ 2QIFA 5HVHA 4RNOA 5CYJA 3WBZA 2QTWA 2NLWA 3MM6B 4RKUC 4NCGB 3RTVA 1S6OA 2V9KA 1W7WA 2W7AA 4MMOA 3NWGA 1RTJA 4NYPA 5JUMA 1OSCA 1RWWB 2W8KA 2DISA 4LF7F 1PYOB 1TVRA 2NUHA 4NLTA 1O0PA 4ZIWA 3EJMA 5F8NA 1IN0A 2CG8A 2I8EA 4C3LA 3PX0A 5DG9A 3W5XA 4ZCKA 2CJXB 1JIHA 5LJ3Y 1UAWA 5LSOA 4A48A 1XK8A 2ROGA 1OY9A 2EKNA 3QIPA 1VC5A 1B0TA 5JJBA 4L73A 4QWCA 3BSOA 3D6TB 4F25A 1Z1ZA 2J0SD 4JBCA 3EZUA 4OJ3A 5HMZA 3BGOP 5EWFA 3JSMA 4B3RJ 2UU9F 4J9MA 3J7Z5 2JEFA 3MR2A 2FLNA 2DCUB 2P5VA 1AB8A 4DPTA 3C6TB 2LEAA 2J6TA 4P10A 3KHLA 1JLEB 3ISZA 4Q8EA 1XQIA 3AB2B 2ZHBA 2DIUA 4WU2A 2ASJA 4MT1A 4P2SA 4DUZJ 5HBMB 2CWXA 4CLYA 3SBMA 5KFOA 2VA2A 3E01A 4EWTA 2Z58B 2RUGA 2J7KA 1SL2A 4KY3A 1FVSA 2F3JA 4O44B 3CJKB 1VQPS 3BO3A 5A8KB 3WX4A 4WP3A 4RW7B 3OW2R 1RWXB 4LQ3A 4UUXA 1FDAA 2XZWA 1E6VA 3PNIA 4DUYF 2G13A 2GVDB 5K8OA 1SIZA 4IFYB 4DLGA 1R6YA 4RWXA 4W4MA 1MMNA 1Q95G 1IUJA 4X65J 5KFVA 2HQ3A 2RE1A 3N6LA 1YJNS 3OV7A 3MAHA 4DN0A 1HQEB 2E5HA 1JXEA 2WW8A 1RTHA 2G0CA 4DX7A 4WP9A 2LDIA 1YRUA 4KYZA 4I2PB 4JI6J 3F0NA 3DM2A 4TNOA 3A3NB 5LM7E 4EMDA 4DCPB 1VQMS 4CWBA 7FD1A 4HACA 4ZKAA 2Q66A 4EI2A 1X0PA 3C15A 3RRGA 2EK6A 5EWEA 4OLPA 1HQUA 3NCRA 2MXYA 1VQLS 3F44A 4DV7F 4MYUA 3BR8A 3F41A 3OTBA 1NKEA 4YR0A 4NA3A 1BC6A 4ES1A 3TW0A 3CD6S 3MTKA 3GFYA 3G8QA 3MMAA 3K59A 5JMNA 1K47A 4B9LA 3QGGA 2HFSA 1T9TA 5DDRC 4OHXA 5AXNA 3KK2A 1UTAA 3MXHP 1MLAA 1KHWA 2GMLA 5GVQA 4WFXA 5KFFA 2KYXA 2RQCA 4EZ9A 1ZM3A 4QU7A 4BLGA 4FF2A 2KHCA 2W4DA 3OTOF 2UXDJ 2KU7A 3KXDA 2AWZA 1SJ1A 3NCPA 3EVOA 2HVDA 1X4HA 3U27A 3IGNA 1Q7LB 4P71A 1GT8A 2JLEA 2VG5B 2RH3A 3M2RA 1F9HA 4DV1J 3IBWA 1YZ7A 1S7HA 2DGOA 1XWLA 3BN4A 2QFIA 1I51B 2MQ8A 3MECA 4TQRA 2KO1A 3I5CA 2MPUA 2VPXB 4IG3A 2DO0A 2DHSA 2W4CA 1I6JA 1UVMA 4IFVA 2FLOA 4L76A 1AFIA 3L9ZA 3FBEA 5K8NA 1VQ8S 2J0QD 1Q79A 4N5SA 2KZZA 4I69A 5DLFA 5C2GA 3D9BA 3FJ2A 3N6MA 3M9NB 2Q43A 1RLCL 3A8KA 4N56A 5I3UB 5BYSA 4OZ1A 1T8EA 5EDWA 3GQCA 3JYTA 1HHSA 3CJRA 4NI2B 2MQOA 1VOMA 3TOQA 5L1LA 1GMWA 2KN4A 2F1FA 2HVEA 2BEFA 1ZA1B 2DH9A 4JOUA 2AJ2A 1P9QC 1T9WA 3V4IB 4FNIA 1T95A 4JV2A 2EFVA 2IRUA 1XNQJ 1HWUA 2R2RA 3RGIA 2H3EB 3I0RA 2AMCB 4NA1A 3CIMA 1WOOA 4F50A 1PILA 4NOHA 3DN9A 3S8SA 4DV6F 4NRTA 1HPZA 2X3DA 1DTTB 3CCZA 3C6UB 5GAEU 4P72A 2ZZNA 3Q8VA 1BHNA 1F2GA 4U7UD 3H7HB 3KJQB 4IOAQ 1KLMA 2BE2A 2DGWA 3PW7A 2Q6CA 4B9NA 4W90B 3W9IA 3DDIA 5D8HB 3WHIA 1TL7B 3DLGB 4GRSA 4CLPA 3FEZA 2YKMB 3O44A 2E7WA 4MK8A 2M0GB 1CULA 2BRLA 2I5JB 2IJFA 2X1AA 3ZTQA 1HA1A 4KHPJ 4CNZA 2UUCJ 2C2DA 3C14A 4BHQA 2B9WA 5A8RA 1RAAB 5ITHA 4PWDA 2R8IA 4Q8FA 6FD1A 2IVFB 2HNYA 4ILRA 3MR5A 5ETQA 4F4ZA 1FRXA 1YZ6A 2QEXS 2OIHA 2MKJA 5HLFB 3M9MB 3RR7A 2DR6A 2MQPA 2UVUA 4C8NA 1Y7PA 1U8SA 3D5MA 3RB6A 4QIWD 2VC1A 2DHGA 4DR4J 2ZUGA 1N0VC 4DPYA 3I5AA 4N7TA 4IR1A 1NK9A 1TV6A 1Y3KA 2XQCA 4O3QA 2C3MA 3SEOA 4DG1A 3Q8YA 3NS6A 2WRMA 3DU5A 2L9WA 4K8RA 1UPPA 5BYRA 5IT4A 2LXIA 2FYXA 2WSEC 4V1Ak 3DRXA 2O5DA 1ZM2A 1HYSB 3FVYA 1UA0A 2OMOA 2AJ4A 2AEMA 4TYBA 4EO8A 2OH2A 1NMEB 4TKTA 1RGVA 3HVRA 1Q81T 3P4UB 4NASA 4R0JA 3W65A 1LWFB 4AL7A 1WHXA 5CZVA 5KFDA 2BM1A 3B4MA 4NLPA 3M6XA 3GIMA 2AYEA 2KL8A 4NCAA 4C48A 4JI7F 3K7RA 4B3TF 1YSJA 2OPQB 2WK4A 4KGVB 1P6TA 1XERA 2VJVA 3KK1B 3TNVA 2HGMA 4ELTA 1RT1A 2HHQA 3RBEA 4DQIA 1B0VA 3MR6A 3RAMA 3LA0A 1T9YA 2ZH4A 1AT1B 4RW8A 4F26A 1YJ7A 2AIRB 4QYZJ 1KVKA 2EKYA 2XZTB 1TMJA 3UDLA 5MLCV 2IYIA 4ECRA 1YJ9S 1NKCA 1EIYB 1YJTA 1ZM4A 2DNNA 4MIBA 3DRRB 2MSTA 4CLUA 1F0XA 3FGVA 5GMDA 4X64F 5D6GA 2GC8A 5KFHA 4NX9A 3OHAA 2HQFA 4B3SF 4PRFA 2YPZA 2YWWA 2E29A 3JAMY 2ZD1B 1MU2A 3THPA 3V6HA 4QW8A 3M6VA 1U7LA 4DSKA 2C2KB 4K4SA 1KS2A 2MZJA 5CA5A 2AQ4A 1IBMF 2W25A 1ZA2B 5ETPA 3NNAA 1QM9A 1RISA 3U02A 3CD7A 2MTLA 1S49A 4ZLJA 1JLAB 2K3IA 2K7KA 1CSJA 4ZA1A 3QWPA 4X4PA 3QLHB 1RCOB 7AT1B 3PFOA 3GLJA 2R7WA 4ECYA 2QLBB 4KSEB 1ZTWA 1F9EB 2RRNA 4YHHF 2YNFB 1HNIB 4KH0B 3IFEA 3OVSA 2QO3A 2UXCJ 4FS2A 4QR2A 3W2WA 1PCAA 2MMYA 2Z57B 4B9SA 1VBYA 2YTCA 3K5PA 1SL1A 2DR9A 4NPOA 4B3RF 1RT5B 3QT5A 2PT0A 4J9VA 1N36J 2HSEB 3OFEA 2CJKA 3ETOA 3KTQA 2BKPA 4KQZA 1DLOA 3MMBA 5C5JA 2FDNA 1YGYA 3R7NB 5J2QB 2CQ4A 2DHHA 1NPRA 1P9YA 2UUBJ 2KVQE 2BQUA 4LR9A 4LVNP 5IQ6A 5ETOA 1S6PA 4AFFA 4B02A 4GKKJ 2EC2A 3I9ZA 4DUZF 1S0MA 1EZZB 3MCSA 2KG1A 1UWBB 3DCAA 2ATCB 3BDEA 1SL0A 4CQ1A 1M1GA 4DU7A 2ASLA 1S77D 1EAYC 1M1KT 2ZH8A 5T7LA 3W5ZA 5KG1A 2PA3A 1Q53A 2GVZA 1HNVA 2E1PA 1WELA 2HGLA 2VBZA 3PYFA 4DL7A 3FKBA 4KBIA 1LNQA 5K8PA 3ET6A 5B0GA 1LFWA 3TWZA 3M8PB 1JJ4A 1RHRB 3KNGA 2XO7A 3ZZOA 2QFJA 2MZ1A 4TY8A 1SKUB 1S97A 1Q8IA 1V5IB 5AXLA 5CD4A 3T9ZA 4JB8B 3L4BC 5F41A 3T1AA 3EXCX 1IKYB 4X65F 2VOPA 4FYDA 2G2ZA 1Q5VA 3G86A 1I5OB 1ICEB 3PJWA 4XDCA 4UOGA 4AXJA 3D6FB 3R6LB 3UN3A 2VBWA 4QYZK 2QV6A 1S1VA 4HTJA 2ZVSA 5KFWA 4JI6F 4BCAA 4ZITA 3J80Y 1OJ4A 3UN2A 3OPKA 4UOCA 4ZLNA 3CSKA 5AT1B 2KXFA 4KT0C 2RT3A 1CJKB 2HVIA 1UW9A 4OZJA 2Q3PA 1KR4A 1SB6A 1D8ZA 1FI4A 4XIUA 1B99A 3EUNA 2GMHA 3KLGB 4K4WA 3ELHA 1C0TB 4NRUA 2ILYA 2PEBA 2RS8A 2YQ3A 5LMNJ 2R8KA 4QYRA 1GMVA 5ETNA 1ZS6A 1WKJA 3AQOA 5J2MB 1RCXB 1G7CB 3LWMA 2DK2A 2QLXA 5H9EJ 5KFJA 1FDDA 2CPYA 5B0EA 1T11A 2VF3A 1HW8A 3X3UA 4LSZB 1RTZA 2X1GA 1U2RA 1W2BR 4RZRA 1BWEA 4C2MA 3MM9B 5L38A 1FFWB 3GB0A 4ZCMA 3IR5B 5IFMA 3OFHA 4H4KA 5I42B 4C11B 4IRCA 3E2EA 2FJXA 1M5PC 2UXDF 1SJQA 2Z2LA 2XY7A 2QRRA 4L75A 1H7WA 4HHHA 2R7OA 3FBCA 1NK0A 1R27B 4DV1F 2LU2A 1VQSA 1RT4A 3NGKA 1OY6A 4NYOA 1HNXJ 2XLJA 3P5TL 3W3SA 2LA6A 2XI3A 3O1LA 3CT9A 1RK8A 1XNRF 1J5OA 4ZLLA 2BANB 3G6XA 3QQCD 2JEJA 4G1IA 2V8DA 3NS5A 2B3TB 3I4PA 3ITHB 3FBFA 3MM5A 3DMJA 3DNCA 1OY8A 2VODA 1IR0A 2ACYA 5HP1B 1R3NA 3MEKA 4I6YA 4RNHA 5C24A 4DPOA 4B3OB 2ATLA 2RF2A 3FFIA 4K7QA 4UW2A 2VH7A 3POTB 5HATA 1FNOA 3CWJA 4B9UA 3AA8A 1RDRA 5KFKA 4ZVPB 1XNQF 3GJQB 5AE2A 3MAQA 4C7QA 3S7RA 1FXDA 3OL9A 3QGHA 2H5JB 1YK9A 4YDXA 2JSXA 1G6BA 2CWKA 3RBDA 1F5AA 1DJ0A 4MKAA 4U6PA 1RTIB 4RLEA 2W9CA 1FESA 2PMHA 5HMXA 4CT9A 1GXTA 1VRTB 4ZP9A 4OX6A 1Q7YT 3IC1A 1S72S 4UUWA 3VCDA 1D9DA 1FWLA 4I4BA 2CQHA 2V4JB 4LBPA 4KGMA 4N8OA 2CQIA 4W92B 2GX8A 1U09A 1F5CA 2JHEA 1XR6A 2D7SA 1FKOB 2QG9B 3SQOP 1YJWS 4Z37A 3ZZZA 3CJ0A 3MMJA 2DNZA 1TMMA 1NJIT 4Q45A 4ZVUB 1DY3A 5LXRA 1FFSB 3V6DB 2NS1B 2A3JA 1JNRB 2UUCF 1S9EA 1TL5A 2ZWPA 5D0GA 1X0FA 1VC6A 2OPRB 2HVZA 5CXTA 3AD9C 2LQBA 3SDEA 4USVA 2VOOA 4ZPVR 1VYAA 3RJMB 4Q0BA 5H9EK 4QIVA 2BKOA 3HVTB 3ZZ0A 4K0KJ 5KT5A 4A8SA 2K2PA 3LWLA 2ZC4A 1AA1B 3TUZC 4J9KA 3DYAB 3PW5A 1MN7A 3G82A 4LRCA 5F3TA 2FJBB 2OMLA 3B8HA 1RKIA 2GJFA 2WONB 2KYZA 1PJ7A 4C8KA 4DR4F 5ETSA 3NEKA 5DETA 4YDDB 4GVBB 3AY0A 3BGUA 4FYWB 3VAIA 2EC0A 4G1PA 4CIOA 3Q8QB 4JUZA 4C0OC 1NNDA 2IMWP 3BB5A 3UDEA 1JJ2R 1AUDA 4O4RA 2ZE2A 4FYVB 2E7VA 1DQ9A 2KRBA 3PRVA 4F2SA 1FRIA 3IRXB 3LGHA 3KMQA 3FMWA 1NSQA 4BWMA 2LVWA 4WYLA 3TAMA 2V63A 2RRAA 4X66J 4IO1A 2OPSA 5MAOA 1AZSA 4EK2A 3PVXA 5HL7Q 3GSIA 2DKOB 2VDIA 2DJWA 4WXOA 5AJ3J 3HJFA 3QFHA 2VBXA 2BW7A 5DRKA 5LL6d 2D69A 5L9XA 4ID5A 3T19A 1RKJA 1Q82T 4MKVA 4U7CA 3GFZA 1S79A 2DHXA 1KBRA 2BJDA 4DMZA 1T94A 2XMMA 5HQMA 2A1BA 2EFGA 2VG6A 3SZ2A 5CCLA 1U47A 3W9JA 5GMKa 1IJFB 3T6JA 4KO0A 5THWA 2XY6A 2OEMA 3QGPA 2XMUA 1NSAA 3VV2B 4EYHB 1RTJB 1RQ0A 3V5RA 4FBTA 4TU9A 1TVRB 2C3OA 1XMQJ 3G6ES 2GIFA 4USMA 3EZ5A 2R7QA 1FHTA 3V6JA 5E3CA 3JQMA 4LF6J 5BR8F 4CLFA 2R8JA 1HHQA 1FRJA 3JAMU 1CPZA 1LWEA 2WSCC 4LQ9A 4K4ZA 4ZJOA 4KHRA 3QIPB 2BR0A 1F5BA 3C46A 2JX2A 4ED5A 1JLFA 2Z4PA 3I82A 2RU3A 3LTOA 2MZRA 2KT2A 2UXBF 1LXJA 5H9FK 3I96A 2CPZA 2C3UA 2ZH5A 3JSMB 4YB5A 1IKVA 1XMOF 3FQLA 3IBCB 4PKDB 1Q86T 5E7OB 5GADI 4YY3J 3G87A 1SJ4P 1TKTA 3BKTA 4LFCJ 3DDKA 1JNZB 4M5LA 1C2PA 2JVRA 1VIOA 2POKA 4IQMA 5E3AA 1B7YB 4FKXA 4C4WA 3UWTA 2DR5A 4ERDA 4HL9A 1IBLJ 4CO1A 1HNWF 1B70B 1U1LA 2GQQA 2E5LJ 1U0HA 3BQ2A 2HK2A 3HHKA 3A3OB 4OMFG 4ECXA 3IN5A 3VR1A 3E01B 4G3IA 3FZBA 3R2CJ 2ZWOA 3TVYA 4DV4F 3CJ3A 1RAOA 2V8GA 3W60A 2ZJPQ 3T1YF 1URRA 2HIQA 5D78A 3FSXA 1U4BA 4IRDA 1N36F 2MYFA 2NUUG 2DT9A 1B3TA 1R6VA 3HVWA 5C42A 3MUTP 1RHMB 5ETVA 2Z30B 5KFIA 5B7WA 2Z8QA 1FK9A 2GGPA 3W64A 1EQMA 3CDWA 3R5GA 3FSYA 3OSNA 2UUBF 1E6VB 2FQQB 5KFXA 3G6YA 3UW1A 1S1TA 1WDTA 3HJVA 3CO0P 3D0HE 1SKWA 2DGUA 4DOZA 2RDIA 4ITSA 4AE5A 1VQ9S 5EUHA 2QYGA 2OI2A 4WWSA 2BACA 1N56A 2PMWA 3Q24A 4FYXB 3SV4A 1RTHB 4YEAA 5DDQC 2E5GA 4NYZA 4JV5J 2EI5A 4O3RA 3IAM9 3CC7S 4RBVA 1UW4A 2CJ9A 3K89A 1ZZNA 4OYWA 1WKLA 5GMEA 4HACB 4FVMA 4M1KA 3C15B 1WC0A 3IMQJ 1S59A 3M8RA 1WF1A 1PYTA 3H5UA 1IR2A 2QSWA 1HQUB 2E1MC 3FEYB 4X4OA 1QAIA 1CQNA 5DM6Q 2L3MA 2B5JA 4QCLA 3M2VA 2XMWA 3DLJA 4DV0F 1GNKA 1HI1A 1I94J 1S9GA 1NDLA 2FGCA 1G1XA 1FFGB 5LSRA 2QL7B 1H6KX 3MMAB 4EGLA 2C2NA 4LBIA 3MFHA 2PFFB 1WC5A 4PG5A 2LQ8A 1BQMA 1NZ8A 3KK2B 1WF2A 3ZC4A 2EBEA 2HRUA 4CO0A 4TU7A 3CDUA 3DLHA 5B08A 3GV8B 1TAQA 2C3YA 3THVA 4LF1A 1R43A 3AODA 3LP1A 2AEJA 1NSKL 3HHLA 3QT8A 4C8OA 1OYEA 2EXUA 3Q0AA 1IBCB 2ZZTA 3NAHA 1KEKA 4NA2A 3OXFA 9RUBA 2UZAA 4DUTA 3TJ9A 1JXVA 5DG8A 1XR5A 3CCES 1OSDA 2X1FA 3M2RB 3K2YA 2KXHA 3P8BB 1NDKA 3MECB 3L95X 3Q86A 1X5SA 3CJ5A 2IM0A 3T5KA 1QSYA 3VZIA 4IG3B 2JJ4D 1M5KC 4HDHA 4IFVB 4M5DA 2G0IA 3W1YC 2QA4G 1C1BA 3SSSA 5KFQA 1UETA 3OR2A 3PYDA 1JLCA 4PCQA 4UF4A 4DR5J 5D0EA 1N34J 2DIVA 2DCLA 3OFGA 2DEIA 4DR6F 1MWYA 3VGTA 3JYTB 2HFNA 1B4SA 2Y0BB 1R0BG 4JP8A 3DGPA 3ZNUA 3E51A 5HJXA 5CCMA 4J9NA 4DEZA 4X4QA 3MDFA 4K2XA 2O1PA 2C28A 3EZOA 2ZH7A 5KG7A 1VQ6S 1WG5A 1VR6A 2GJIA 2H48B 4DSJA 3I0RB 3TP2A 3FCWA 3DRSA 4M5GA 1NO8A 4A8YA 4DPXA 2BJ7A 2Z2MA 2RILA 2DR8A 2NXJA 3N01A 3HSJA 1WG4A 3N6NA 3HMJG 3D0IE 2CZ4A 4EBCA 1D3WA 1HPZB 2CJQA 1EARA 3MD1A 4F0MA 3PEJA 2ZKUA 3J7AN 4DR2J 2UUAF 5EGYA 2OPPA 4IH6A 3IWXA 1VRQC 1RUSA 2W2PP 1U25A 1PBAA 2P2CB 3HFVA 1KLMB 2BE2B 3TEGA 5A76A 2QA4S 1CLFA 2F7VA 2ERRA 2DH7A 2NSCA 3K57A 2ZM6F 2QC3A 3QFWA 1NK8A 1CULB 1IR1A 2CRLA 1S6UA 4C0BA 2FJVA 3H5SA 2XCPA 1KNZA 1X4EA 2BQ3A 4KFBA 3T1HJ 3GFXA 4F4KA 3C14B 4XK8C 4X4VA 4LJMA 5A8RB 4DLEA 2A2CA 4PWDB 1SXLA 3CD0A 3KLEA 2HNYB 3TA0A 3RW7A 4RW6A 3CCSS 3T5HA 2XHWA 3IAS9 1N32J 3NMRA 2COLA 3NOCA 1SJ3P 5BJRA 2K1RA 4YFUA 5L1JA 3NG8A 3M8QA 4DV5J 4RJVA 2HVHA 5JVGQ 4YMEA 4XDDA 2XNQA 1T03A 4O0IA 1S12A 1MSWD 3QO9A 2HS0A 1FNXH 3H8YA 2GFFA 4DZ6A 3WC0A 2YQ0A 4KKOA 1TKXA 3A8EA 4DHVA 2CPEA 2Q6BA 4ZCLA 1R7IA 2NXCA 3RU0A 2YNHA 5K9FA 1S1XA 2HS3A 3BYPA 4P75A 2CNKB 2H5IB 1T9VA 1WTFA 1TV6B 2AT1B 3D67A 4DL0C 1HWKA 3DLKA 2EFQA 4NLGA 5A6WA 1KRPA 3J7A1 2IA6A 2VICA 2NCKL 3BJYA 3HF5A 1HR0F 4HVZA 3RRKA 4USKA 2IY5B 4J90A 3NMAA 3IBFB 4F4YA 3K5MA 4B9VA 1S7IA 2W2NP 2JC1A 4KH1B 1Y5IB 3OR1A 2OHDA 2ZOMA 5EWGA 5FDLA 3HKWA 1JLQA 3HD2A 3TVZA 2OD6A 4OHZA 4ECVA 1QAXA 8RUCA 2CA9A 2W8LA 4K4XA 3OXGA 4OJGA 4NLXA 4PG6A 2B4OA 3ICLA 1KOOA 1NK7A 2PC6A 3CCMS 1RT1B 4LBHA 4ALZA 1M0SA 5JVHQ 4CLZA 1BMQB 3WDOA 4RW8B 4LVOP 4P6QA 1SJRA 1DTQA 4JI3F 1VK8A 2BOAA 4L72B 3MCNA 4ZHRA 2FPHX 1CC8A 1HHTP 3D54A 4X66F 4X4TA 3BO4A 4U8YA 1VMBA 3GCWP 4BC9A 2DEJA 1JQGA 3RW6A 5KOXA 2OJ3A 4DL3A 4AUKA 1NH8A 1ZYQA 3D66A 4PYAA 3PCOB 2XMVA 2MKYA 1RADB 1Q78A 1MU2B 2WVCA 2V2VA 1GMUA 1NHUA 3TX8A 4OX9J 3W63A 5D3GA 6FDRA 1PGZA 1QUVA 2HHVA 5I3PA 2KM8B 2HMIA 3AH6A 1XMQF 1OO0B 2M9KA 4CH0S 4DV7J 3TA1A 1X9SA 1NRKA 1J27A 2P9GA 2P6SA 2YKAA 1IM4A 3GIKA 4ANCA 2G1HA 4FXDA 3GFHA 3AT1B 3NGTA 3H90A 3Q83A 2LU1A 2XHCA 2ALYB 4Y2MA 3AHPA 1H2UX 4H54A 3W2WB 4M5HA 3ENWA 1RHJB 2BZ2A 2BE7D 1Y5LB 3TI0A 4ZLPA 4MKYA 1N5TA 1FDNA 2C2MB 1L3SA 3ADAC 4NLVA 1FRMA 2R7SA 1K73T 1QTNB 2QSFA 3ZZRA 2IJNA 3DLBA 4YY3F 3BQ0A 1FRLA 4LFCF 1NSPA 4HI2A 5KFZA 2CADA 4L6V3 1DLOB 3MMBB 5D77A 3CW2C 1WDDA 1S4EA 3OXLA 4WTYA 3OSPA 1KVJA 3TEHB 1NJZA 4MIAA 1S6PB 1Q5YA 2UV8G 3L7PA 3HSGA 2VDHA 5CYMA 3PYGA 2VPWB 3HHDA 3BO2A 1LXNA 1N5YA 1RT6A 2H65B 2R7TA 4F4AA 4PXBA 1B7FA 3VWSA 1X5PA 2M88A 3V81B 1Q0NA 1X4BA 2HPUA 2UUTA 2JH3A 5DQHA 3HZGA 2DBBA 2GVZB 1HNVB 3LAMA 5KT2A 1RACB 2H54B 2QLWA 3ET6B 4K2JA 2UVRA 5LXYA 2J7UA 3O2IA 3OJSA 5LT5A 1TAUA 4C8YA 3M1VA 4TY8B 3VZHA 1MW7A 4MK7A 3HFKA 3GIJA 3PX6A 3JQKA 3KLFA 2APOA 4A47A 2D74B 2VKRA 4PUOA 2PE8A 1QSSA 3RYLA 4OI4A 3H40A 1WF0A 1S1VB 3AOBA 2K7JA 5L39A 2KKHA 2GIQA 3LGMA 4C98A 4PQUA 1FKPA 2A6MA 3D68A 4CI0B 4USWA 3PW2A 1PAEX 2F40A 3TQEA 1RWPB 2WBRA 2HIYA 2ZHAA 2E9TA 2CJYB 1I94F 2F63A 1JXLA 4USHA 1ZPVA 1YBUA 5E2QA 1S76D 3H2UB 3FMBA 4ANEA 5K8MA 5U47A 3UI3A 1VDHA 2LFVA 4P2FA 1NZAA 3GE9A 3PEHA 2MY7A 1H7XA 1ZH5A 1UL3A 5HBMA 2VG7A 1UJ4A 4OZ0A 3SCJE 3NWRA 2HURA 2VQFF 3H5YA 1AXQA 3LH2S 2RB7A 4CCHA 4OQJA 2Y3YA 4PAAA 2YH0A 2VFSA 3NKYA 2C42A 1IXKA 5D4PA 5B0AA 1PKUA 3SQGA 1RT4B 5KT6A 4EYIB 5FLXY 3CJ4A 3JXOA 4U9RA 5E33A 4R0EA 3QRQA 3MEGA 1HWIA 3U1NA 2M2BA 3MGJA 2PFDA 2ZH2A 2KM8C 4PPZA 1RWVB 4J7CA 1J5OB 2GZOA 2IHR1 3LOUA 5J1EA 1ZBTA 4QQBA 1I1GA 3MPWA 4HH0A 3M9OB 3UNYA 2L9DA 3CJQA 3N28A 1WC3A 3WIUA 3R7SB 1RAHB 1VK3A 4UZBA 4DR5F 1N34F 3ZFVA 4CM0A 5F0UA 2VZ9A 5C24B 4DSFA 4WKRA 1G3OA 4ZPAA 2RF2B 3FFIB 3NGDA 4ECUA 2JEIA 5J2NA 1D09B 1ZZFA 1KQSR 1H2VZ 1SIWB 4DL4A 2B4PA 1CJUA 3HHEA 4LT6A 5K20B 4P2XA 5AE3A 1JMTA 1MROA 1VHIA 4D3HA 1IWGA 2AJQA 1CS4A 2PSZA 2HNDA 3DLEA 4FKYA 1H73A 2RU9A 1D1UA 3KYLA 1WTBA 1VRUA 4ZCIA 4ILMA 4JI0F 4WF9Q 4UQGA 3A1YG 3EICA 4F4XA 2IYGA 3MPYA 3UNGC 1FXRA 5KG5A 3B4DA 1PC4A 3H0PA 4DQQA 4U95A 4A4JA 4HEA9 2HWHA 1HBOA 4F8RA 4PG7A 5FD1A 2YKOA 4OI0A 2YNGB 2VIHA 2F65A 4F0KA 3ZZYA 1RI7A 1S9EB 4X64J 1IBKJ 1REVA 3EGZA 4DR7F 3QNWB 2PMZD 3M05A 2NYIA 3M32A 2M8HA 2PO4A 4ZVQB 3SDEB 4RUHA 5D0RA 2MLXA 1RXOB 1FEHA 2J76E 1KQFB 3KUGA 3BKFA 2C2OB 1N32F 3RR8A 4Q0BB 4QW9A 2NZCA 1HARA 2MZSA 3D2WA 4DV5F 5F9LA 1IBMJ 1SKSA 3PJ9A 1LWCA 4CTAA 1FX4A 3A8JA 1TKZA 1K0VA 4DSEA 1FTRA 2H1YA 2OD4A 4PWWA 5CHCB 4ZVGA 1KOHA 3R5JB 3G82B 3KHHA 2V0NA 2R2UA 2B56A 3R97A 4AD6A 3TX0A 1YWXA 2XBPA 2J8AA 2DRAA 3CEDA 3N0VA 2VASA 5LSLA 2N7YA 4CO2A 4USTA 4YHHJ 8ATCB 1VQNS 3CJ2A 3GIIA 5GADU 1R89A 4OYZA 1S6QA 5B0DA 4DS5A 5L8RC 4OYOA 2A18A 1RAEB 1ZAVA 2ZE2B 3NY0A 3GSDA 3PRDA 2N4DA 1NUEA 2MGZA 1RAGB 3HKZD 4F7VA 5KFUA 3AJ1A 4DX6A 3OTCA 3UFCX 3VGVA 3TAMB 4NXMF 2OPSB 2VUGA 2XZDB 4OLOA 4RUCA 1AZSB 5F8IA 2FVRA 2K8GA 2DGTA 5D4NA 1F1BB 3Q8UA 4K5SA 1TUWA 2CVIA 2QL9B 3PZPA 3V4MA 3G96A 5CQGA 1YBAA 2AYBA 4WJBA 2B6AA 3C2PA 4ID5B 4C8MA 4QBUA 2DXFA 1Q1KA 3PRBA 1GMWD 3GR1A 1MMLA 4E8UA 4HT7A 1IKXA 3GV7B 3LANA 3W62A 5KAKA 3P6YC 1ZPWX 1YRXA 3ZZUA 2ABYA 2GQCA 2VG6B 5FIIA 5HI7A 3IXQA 1UVKA 1BE4A 3QZ7A 2J5AA 3CVKA 1HBUA 4LSNA 4KO0B 3RG6A 1Q4RA 3PIPQ 3GMGA 4M5KA 3MCOA 5EN1A 4P2MA 2H4YB 3RB4A 2EW9A 1KFSA 1KTVA 4KJIA 1TR0A 4Y2CA 2H51B 4QIFA 4OI3A 4MYTA 3T9NA 2VD3A 4ZVRB 3NS7B 1BD6A 3HVAA 3FUYA 1LWEB 4Y2AA 3CDBA 4X4NA 1WORA 5A8WA 2FJDB 2VBYA 4ZJLA 4ECSA 1NJWA 4E0DA 4LF8F 4LRDA 2MHEA 4Y00A 2AX1A 2MJNA 2C2EA 2BJEA 2VFVA 2XY5A 1JLFB 2V67A 4DL5A 3NP5A 2ASDA 1U1QA 1UZDA 4OX9F 2P8IA 3FEXB 2C3PA 1X4CA 1IKVB 2RHSB 3CE8A 2HHTA 2H4WB 1XMBA 4A8FA 1AUSL 1TKTB 4ZP8A 4HR2A 4MIWA 3BN7A 2E5IA 2G0JA 3MAAA 5E3PA 4JYAJ 1FTCA 4QR0A 1YJUA 4NLOA 4C97A 4DF4A 5KFPA 2G1DA 4YOEA 5DG7A 2FHKA 1R31A 2HFUA 1U6FA 2YKNA 2N4CA 2RUSA 1U0HB 2XCAA 3CULA 2HQGA 3HZEA 4HI1A 3VALA 3CPWR 1N88A 4IRKA 5G0RA 2FHJA 3IM9A 4TLRA 1IM6A 4OZ5A 2I38A 2DGVA 1SUQA 3AA9A 2BJ9A 1SC1B 1UVLA 4HTIA 1JLBA 2KRRA 1OIAA 4AXIA 4B9TA 5C42B 2CQ3A 5GAGI 1VGYA 3ILJA 2AJ1A 1FK9B 3AOAA 2GGPB 4LSLA 2O01C 3U1LA 3AXKA 1KDNA 1IKWA 1TFYA 1T3NA 1S1TB 1LW0A 3DC2A 4NZ6A 2KTQA 2HHSA 2V34A 3MHYA 2CNOB 2CAJA 3AB4B 4CYUA 5DLGA 2BJ8A 4R5PA 2M52A 4DV2F 4WXWA 1S1WA 5K5MA 2OGUA 4RNFA 1SV5A 1XNRJ 1HBNA 4RX6A 3RBXA 3A3PB 1YBTA 3MWBA 1EKRA 2KHDA 4KPCA 3VVUA 5GAHI 2YVSA 4O4GA 3BSNA 2ZD1A 1RAFB 1KQGB 3BM7A 4PXEA 1R0AA 3ZTOA 4WE1A 3O5TB 4Y65A 3VAFA 3MR3A 4LR7A 2QMXA 3KG0A 2AX0A 1UCNA 4N41A 2EK1A 2B9YA 2MKIA 2MQQA 2B5JB 3SFUA 3M2VB 2JRSA 3BBFA 3BSAA 1S9GB 4C6AA 3TZWA 2IJRA 2BE9B 1EKSA 1EETA 1NJYA 3GR0A 4DR3J 3MCMA 1X60A 3RAQA 3QSIA 2OEKA 5ETTA 1WG1A 5C7PA 2H9ZA 4F2RA 1NEEA 2X51A 1QD1A 4EEYA 2ZBIA 2GJ2A 1BQMB 2CPFA 2JFDA 2DNLA 4PXCA 1WACA 2QE5A 2C2RA 2Q1LA 2V94A 2ZBRA 3DI6A 1RSCA 3OTEA 3LP1B 3HHLB 2QX0A 2UVVA 2B8PA 2FIUA 2RQMA 3MI7X 1PJ6A 3Q22A 9ATCB 2KG0A 3AD7C 3BDPA 2MLYA 4DF8A 4ZP7A 1X8DA 4Y2KA 3PO4A 3Q23A 2YWKA 3BH7B 1UVJA 3R5BA 3KG4A 1L3TA 3NNCA 2NREA 3R1LA 1H3DA 2OAUA 4M5DB 3O8WA 3MOJB 1C1BB 2CNNB 4X2BA 3TZYA 3UPFA 2RDDA 2LYVA 3OR2B 3MEEA 2VKZG 2VFTA 2EFNA 1R8AA 2FHMA 2CVEA 3UD4P 1U1MA 1Y9OA 2CDQA 1TP7A 3PO5A 1JLCB 5FLXU 1A9NB 2AJ0A 1M90T 4TQSA 2IMOA 3DGVA 1HLWA 4YUDA 2AYMA 3H2VE 1SH3A 3GJTB 5C2CA 3DLLQ 5HANA 4DSLA 2DXDA 3OFFA 4TLQA 2JWNA 2W9BA 5DGAA 4LIWA 4IO9Q 3JTNA 4ICLB 3DGPB 1KSPA 4IR9A 2ROPA 2DVIA 4J5OA 3K5OA 4LFAF 4I1TA 1QAYA 1F3FA 5E5NA 4DR1F 3W2VB 3EPGA 2CIMA 3DRSB 3HX9A 3NNHA 4OI1A 1BY9A 4NLWA 4FDFA 1EQ0A 1N6QA 5AE1A 4U8VA 1XIQA 2CJAA 1UWAA 3CMES 4G65A 3OL7A 3M2UA 4DL2A 1VQ7S 2OPPB 3CCRS 2HAIA 3NGRA 4WTOB 1Z2ZA 4NZ7A 3SFGA 1U02A 3CCUS 4FF1A 3BR9A 2N3LA 5D15A 2F4FA 1UA1A 2CDRB 2YWFA 2XO6A 3FK4A 4ED8A 1N5QA 3M30A 1NKBA 1YIJS 5J2PA 5I4MA 3HT0A 3DRPA 1CEZA 3QAUA 3D3CJ 3OL6A 4KFBB 1RJJA 4AL5A 4PEOA 3IR7B 3C3LA 2V4QA 1FXLA 5KG2A 3KLEB 3N4WA 1GXLA 2RAQA 3JB9k 2E9ZA 2F9DA 4RW6B 2MKHA 3C19A 3C8YA 5KFLA 5K14A 4QWAA 2MHNA 3A8IA 2K1RB 1EP4A 3M8QB 1VBZA 3CB4A 1XTZA 3LALA 2O66A 3TR5A 5D0HA 1SBRA 1T03B 3GJRB 4B08A 5LJ5Y 3QO9B 5HO4A 3MZIA 5BR8J 3EM1A 3QPIA 5L9NA 2IVMA 1U0SA 2WVBA 4KKOB 1Q8LA 1TKXB 1YLXA 1F3VA 1IBKF 4DS4A 1G2EA 3ZTPA 1ULRA 2YNHB 1FRKA 1S1XB 2W9AA 3N79A 1N54B 3D6MB 3H4DA 4CLLA 3DLKB 3FCVA 2UXBJ 4FF4A 1UFWA 2NQPA 2BXJA 3GG1A 1XMOJ 1Y5NB 4B3MF 1TK5A 3E8OA 2B7BB 3AD8C 4CP5A 3GIRA 5M2UA 2MSSA 1JK9B 2M8DB 1X5TA 4IH7A 3M6UA 4WFZA 5F8LA 2FC8A 5DQGA 3R1HA 2FTRA 3HP6A 1S5ZA 1KHVA 1QJHA 3OR1B 5FDLB 1HNWJ 2KJWA 1JLQB 3HHLC 2ADCA 5IC6B 2Y1LB 3ZTSA 1WOPA 4M5MA 2OFHX 5F8GA 4DV4J 2HNZA 1OYDA 4MKBA 3EDQB 1PBUA 3T41A 4S0MA 3T1YJ 5LMUF 3UCGA 5CABA 4KGXB 1FWKA 3L7OA 4O3SA 5C25A 3RB0A 5J1NA 4K4VA 4WFNQ 2P9CA 1LQ9A 1DTQB 2GO8A 4ZHRB 1FRHA 3HXMA 1QY7A 1M5OC 4UY8T 2HLTA 4EZ6A 4QIEA 2ILZA 4ECTA 3HK2A 2KT5A 2GCFA 1VJWA 5M2RA 3GONA 4OHWA 3FQKA 3OQ2A 3E3XA 4LF5F 3GYXB 4YB7A 4OZLA 4F67A 2BQRA 2I1RA 4C0HA 1HW9A 2F9JA 4OZ3A 3I4HX 3TA2A 3ZNJ1 1YKWA 2WW4A 5KFSA 2N7CA 3EX7B 3IR6B 2L08A 4CLTA 2QA1A 3CIZA 5D3GB 1V9OA 2XULA 2HMIB 5KFYA 2JLGA 1TL4A 1RTDA 3H42A 1KWMA 3CF5Q 2RS2A 4DV0J 3QSYB 4QJVA 2PGCA 4FN5A 2OTJS 3CCJS 2HHHJ 4W98A 3KFWX 2C1EB 2UUWA 2WB1D 4JV0A 4U96A 5HSPA 2FVPA 4LUBA 2CG4A 3TUJC 3T5LA 4NLDA 4OJ1A 3UVJA 2VQEF 1SQFA 5HMWA 2ZITA 5KT3A 2WSFC 4QWDA 1NM2A 4M5IA 3ETMA 1GH8A 1WNEA 1YJVA 3BYRA 2RKIA 3PM9A 5KFTA 3NCQA 3GPAA 1P8GA 3KLVA 4JYAF 3GG0A 1K1SA 2DNOA 4P7TA 5IXUA 2FVQA 1T9UA 4L74A 1Y4ZB 4CO5A 3PW4A 4I2QA 1HI8A 1F60B 4ZPTR 2X7IA 1N5SA 5CYMB 4JI5J 3MM7A 3SCLE 2RQ4A 2IRYA 3H25A 1N5YB 3W8GA 4ZVSB 1RT6B 1W26A 2D1CA 2DHAA 2R8HA 5L1IA 2X1BA 2D3OR 3WIVA 4WZMA 2YNIA 2K3KA 2SXLA 3PR5B 3KJNB 1U1OA 1WHYA 2CPXA 2QL5B 1X31C 3G9CA 2Y9HA 2BA9A 2DB1A 1CJTA 1MN9A 3BF4A 1XN9A 2DNRA 1U45A 2OLWA 2MKKA 4DX5A 2E1CA 4CM2A 4RBUA 1NPKA 5EHHA 3CMQA 2ZNYA 3M1VB 1O6XA 4DR6J 2ZH6A 1LV5A 3MEDB 5B0CA 2ZEJA 4I68A 1YVFA 2OP5A 1SH2A 2ZC3A 2HFOA 4KV8A 4BWJA 1J5EJ 2WAQD 2VONA 5L46A 3KLFB 4PYDA 1HMVA 5D4OA 2WB4A 3WC2A 4K59A 4PUOB 2F4VF 1V3RA 2ZHOA 3TANA 2IA0A 4CLWA 4ER8A 1WOSA 2HKEA 4CDIA 1O5JA 2ZUAA 4ETXA 4PQUB 1OPZA 1FKPB 4DDFA 5HVGA 2ALZA 2ZNZA 1C4CA 2FY8A 4F3QA 4DFKA 4JI2J 4J91A 3D7SB 2JEGA 3C16A 4E98A 4OIXA 2DGSA 4ZP6A 2LXFA 7FDRA 2UUAJ 5DDPC 4BBYA 2G9OA 5IM0A 4UZCA 4OHVA 1ZTTA 3K58A 1U8WA 4OHYA 4DR3F 4OYMA 1HQ2A 4OYBA 2ZM6J 2V69A 1S57A 5IOLA 4WKYA 2KXNB 1ZETA 4I7FA 3HFZB 3VVTA 5HMYA 1T3OA 3ZXWA 2IPOB 2KDOA 3OT9A 2VG7B 3IS9A 2WZ1A 2A0FB 3MUVP 1H38A 2XG8A 3CC4S 1AYEA 4PXDA 3VQSA 1U6ZA 1TZ0A 4DFPA 2LECA 4ED6A 2FZCB 2CFXA 1FD2A 5ADZA 3DKDA 1RWMB 1PIEA 2C2ZB 2B51A 2U1AA 2JC0A 2WBMA 2D3UA 2XWXA 3LP0B 4Q44A 1Q16B 1CC7A 1JX4A 3SQGB 4I67A 4O0NA 3RUBL 1T9XA 1W25A 3GYNA 4FNHA 3CDEA 4OV6A 5HROA 4I0WA 3MMCA 3MEGB 1ACMB 5RUBA 1S1UA 3Q8SB 2VPZB 1ZAXA 4EUVA 5KT4A 2OSQA 5J1EB 1LFPA 2AD9A 3BSCA 4IDKA 1YG0A 5B09A 3LGNA 3CCQS 1LW2A 1L3UA 4JI8F 4ZOSA 4NEYA 2EPIA 1REGX 4ZVTB 1P1TA 1VBXA 2RQKA 2FJWA 1RT2A 4RU2A 2IM3A 4KE5A 1FDBA 5KT7A 3IP0A 2IDEA 2MDAA 1HR0J 2KI2A 2J0XA 3UE2A 2LLZA 2ZZMA 2QMUB 4ELUA 2DNHA 2HK3A 3GZ7A 1EX8A 5J2NB 5G4DA 2MLZA 1U6BA 1WHVA 2ZJQQ 2HBQB 3UD3P 1N33F 1CJUB 1YX2A 3SMZA 1PO6A 3PKYA 4IUFA 3M4XA 3DOKA 1MROB 4OJHA 1P27B 1CS4B 2E44A 3GU0A 2HNDB 3DLEB 1XBWA 1X5OA 1RLDA 4ZN3A 1VQ5S 1OMSA 4X62F 4DQSA 2GHVC 2Y1RI 2CQCA 3NGSA 3ENVA 1VRUB 4DI6A 2V50A 4CH7A 3PDNA 2B8QA 4JI3J 5L1KA 5IWAJ 3HULA 4P7VA 4NE9C 3K0JA 4ENOA 1VISA 3T3FA 1U1KA 4NWBA 1U2CA 4ZMMA 5KFEA 2Y1IA 4WFBQ 1RA7A 1JKHA 4HDGA 1HBOB 1WEZA 2J9DA 1KONA 3DOLA 4Y28C 4QWBA 3KMSA 4QIGA 4IG0A 2MKSA 1REVB 2W7OA 2ZOFA 1NXIA 1QVGR 3M32B 2MJUA 4USIA 1R8PA 1ZM9A 3N9UC 2IVYA 1N8RT 4LRBA 2CZVC 3B54A 2V2QA 3SIPB 3ZZPA 4AL6A 1LWCB 4CTAB 2J8SA 5F9NA 1TKZB 2LQJA 2CQBA 1M5HA 2E9RX 1UP1A 3AJDA 3HHLD 3KJVA 4OX8A 2LQ5A 4WYWA 8AT1B 2KT3A 4DBQA 3SSQA 3SYZA 1A7GE 2LP4A 5IT9U 4LF4J 1KVIA 4IYQA 4ZVFA 4WBFA 4ECZA 3LPEA 3DDNA 4RNNA 4PZVA 3KG1A 2WOMA 4L3NA 2WTFA 1R8CA 3QYYA 1S6QB 2V6AA 4LIRA 3QRPA 2AEFA 4Q43A 1Z2LA 2ZDPA 1RT7A 3IG1A 1GEHA 3I87A 4NLSA 2MGZB 3PV8A 2EBGA 4F02A 2AF6A 5EX3A 3KWMA 2IM1A 2XMTA 1FNMA 3PHEA 3FBBA 4PG8A 4CRJA 4UTGA 2LKZA 3JSBA 3N5BA 4DPWA 1FVQA 3WZ0A 2M4MA 2V9WA 4ILLA 4HKQA 2B6AB 4U67Q 4WK3A 4A8OA 2HGNA 1FJCA 5IV3A 2J7WA 4H4OA 1KKHA 2ACMA 3LPYA 4KRWA 2RD5C 1IKXB 3JS9A 5GAGU 4C9DA 1WUUA 1FWPA 2LA4A 2ZBQA 4X4RA 3GV5B 2J6SA 3PFEA 1HBUB 4LSNB 1KLNA 1RB0A 1YJRA 2EEYA 1CJVA 2R7XA 1FD8A 3GILA 1IWAA 1F9FA 1IJEB 2M7SA 4OYIA 1UZHA 1LEOA 1WSRA 1XJWB 1SKRA 4JI1J 4Z7CA 2YXLA 3BGRA 3QT7A 3BKUA 3M8SA 1C1CA 2D9OA 3DU6A 1UJ6A 5DJBA 5A8WB 5GAHU 1DARA 4G1QA 2KH9A 4USJC 1RBAA 3M8ZA 4UOHA 5IT0A 1LK7A 5D4LA 3OBIA 1DRZA 2WVEA 1ITPA 5HN0A 4ZPBA 1VS3A 4J9OA 3DM2B 4FBUA 2AKWB 4R25A 2DTJA 2D3ZA 2CNLB 1QDUB 5KOWA 1K9MT 3HSDA 4NEZA 3K8VA 1A6LA 1FE0A 3NBPA 3OD2A 3MUMP 2O3DA 4UY85 3F73A 4I6AA 4RU9A 3TJAA 3WX8A 3OVBA 3MAAB 3U7JA 4QPXA 2HHHF 2DNMA 1HD0A 2XSJA 3PXGa 1GK8A 2YKNB 3DHWC 4NLRA 4ES2A 1WSVA 5HVFA 1FE4A 4RR5A 2HHPA 5T14A 3AFGA 3EGNA 5F8HA 1C4AA 3FCHA 3MM8A 5G0RB 1EB0A 3BREA 3JSRA 4CLKA 2AZ1A 2DGXA 4NZ0A 1F2HA 1DURA 3KLHA 1SUQB 3IGVA 3KLIA 2ZH3A 2EWHA 1JLBB 1H2TZ 2VQFJ 3KK3A 1NPPA 3S01A 3W61A 2QA2A 4C8ZA 4XO0A 2XEXA 3O3LA 1RHQB 3DOMA 4WPAA 2RRBA 4LSLB 1FJGF 3Q89A 3H98A 2AGOA 5BXIA 3I56S 1IKWB 1LW0B 1HFEL 1T0TV 1DFDA 2VC0A 4KB7A 3CGIA 4DFMA 4C3KA 3H4BA 5IQQA 3CUNA 1LK5A 4JI4F 4CYUB 4JI5F 4J37A 4R5PB 5F3ZA 3G8TA 1T05A 1S1WB 1WC1A 2ZOGA 5IZHA 3TUPA 2LDYA 1SV5B 1UEVA 1HBNB 1FF2A 4K4TA 5A0YA 2D3O1 3TQ1A 1NDPA 2VU5A 3JTPA 4O4GB 5E0OA 2LQ9A 1K44A 1HD1A 3L09A 4KC5A 1R0AB 4WE1B 1SQEA 1YTYA 1QE1A 4M5JA 3HPOA 1QTMA 4NLYA 2NSBA 3X1LB 2DO4A 2Y8YA 3AXMA 1J5EF 2HBZB 4JV1A 2BV3A 2F8EX 4C3MA 4TU8A 4YB1P 1SH0A 1EETB 1RABB 2WCXA 1GAOA 4HLBA 1N52B 4X4UA 1NB2A 1RHKB 3SXLA 2B4UA 4ED2A 3GYGA 1FERA 1EHWA 3EWGA 1RT3A 4F0HA 3BPSP 3F56A 3HD1A 2BRKA 4JI2F 3DI6B 3LUYA 3PIOQ 5CAAA 1P1LA 1H0HB 3RZAA 1VQOS 4JI0J 2CQPA 3MURP 1KQKA 4AT1B 1NU4A 1UMJA 1NHKL 3IRWP 2D41A 3RB3A 3QAEA 3R2DJ 4PR6A 2M3DA 2H5EA 3IO1A 1Y11A 4DL6A 2YKPA 4K4UA 2W2MP 2EFPA 1QSLA 2GA7A 3I32A 3P96A 4NXNJ 2A10A 4RW4A 4F04B 3OUYA 4DR7J 3N5FA 1IVZA 1AW0A 1WC4A 3V81A 2HWIA 3MEEB 2OKQA 3MOZA 5KFGA 4TN2A 3DXBA 3G4SS 4X84A 3PHTA 4BDPA 3I31A 3NGUA 2HZVA 2FLLA 3VGSA 2DNKA 3G6VA 3KHRA 3IA0A 1CVJA 4CNYA 2OSRA 2W9BB 3DRYA 2VB6A 4OYAA 4DXLA 2IC3A 3W7BA 3UN5A 1HBMA 1TKDA 2OELA 2YH1A 1VLOA 2R7RA 1VQ4S 1APSA 3RAXA 1MG7A 4HT5A 1O51A 1FKAF 3G71S 4DG1B 5KFCA 3GP9A 1TELA 2RSQA 1N6QB 4LFBJ 4IKAA 1HIYA 4V19J 1OWXA 1GFWB 3RBZA 1BQNA 4O3NA 4R8UA 4B17A 3M2UB 4NXMJ 2F5GA 3A12A 2JDJA 4RUBA 2Y0SD 2DRDA 2NYHA 2XS7A 3LP2A 2DNPA 4TVAB 4A8MP 3I0SA 3PYEA 4DJBA 3R6GB 3FZ2A 3P3DA 3M30B 4CO3A 2EFOA 2MB0B 3TZZA 5J2PB 1B64A 3FRZA 5I3QA 2YBVA 2GO9A 3DRPB 2IAJA 1FJEB 3HT3A 3JSYA 2RMLA 2CKWA 1GTEA 3TJ8A 2DXEA 1S0OA 3BGFA 3S1TA 5T41A 2V4RA 4ED7A 2W2OP 4OV1A 3OHBA 2KB2A 2VJUA 3KUHA 4ZVHA 5IWAF 5K14B 4WK1A 4USUA 1EP4B 1Y10A 2V8VA 1JLGA 4FVCA 1X4FA 5CD4H 3IWLA 4DCOB 3ZZTA 2Z2YB 3O6QA 2VV5A 2YPYA 2FJEB 4H4MA 4QZVB 1KD1T 2NPFA 1RE1B 3J81j 2P6TA 1UPMB 4LF8J 5CH7B 4RW9A 2E1RA 3P5BP 5CYQA 1PG5B 3D4JA 3BBCA 3D1OA 5KFRA 5KG0A 2FZGB 3PX4A 2MEWA 1X4DA 5KTQA 2XSFA 1C0UA 2ADBA 3TYTA 3FRYA 2BW2A 1GTHA 4M95A 4K50A 3CCTA 2GAHC 1ELOA 3JTOA 1BXNA 2JOQA 4XPEA 2LEPA 1VHFA 2XGPA 4HYKA 3A4TA 3UO0A 5IS2A 2BX6A 1YI2S 1WWHA 4LF4F 3QGIA 4MK9A 1IQTA 3QJLA 2QMWA 2ZH9A 1NCLA 3EMTA 3Q2TC 2AYGA 1TL3A 4CO4A 1E6YA 3H59A 4QR1A 1V6HA 3UCZP 3K5LA 1KFDA 2HNZB 2VPYB 3CMAS 2PEHA 1HWLA 2R9LA 4M5NA 2KFYA 3BZQA 2J0WA 5C25B 4GC7A 4X4SA 4HHUA 4O3OA 4ED1A 1JJCB 2AW0A 1R8HA 4NMLA 4MFBA 4FZVA 2MQNA 3LO3A 2HFVA 3CJSA 3PW0A 4Q5VA 1L3KA 2XLKA 3ZTRA 2LMIA 3UD5A 1HL6A 4P74A 1OQ3A 2IBKA 5H9FJ 2FVSA 1CG2A 1TL1A 1UEKA 1FA0A 1URNA 1N5VA 4DV2J 4YR2A 1RU1A 4MJKA 2L9NA 4QWEA 1NK6A 3B82A 2YNGA 2CYYA 3CD5A 4KHPF 5T7LB 2I6WA 1RHUB 3JQJA 3R7BB 3FSIA 3A13A 1SI9A 2R3VA 2MY8A 2W2QP 4ZK7M 4KHMA 4OZ2A 3S6EA 2ZVIA 4WFYA 2QZ8A 3MM6A 4NCGA 5JXSA 4EBDA 2HFZA 2GIRA 2L41A 2LCWA 3SI8A 1RTDB 2ZBCA 4ZS6A 2UP1A 4GVLA 3EYZA 1D0EA 3PG9A 4JI1F 2KFZA 5B0FA 2NZ4A 1T02A 4P73A 4Q2LA 3TVKA 3KKFA 3CNQP 3R5AA 3HO1A 3VHQA 3W9HA 2G4BA 1D9FA 4F36A 2F8HA 2JVOA 4ES3A 6AT1B 1VBKA 2FD2A 3UVJB 1SCJB 2J9EA 3BEGB 3HCXA 5KG3A 4OFZA 2DRBA 3AAWB 3VAMA 2J6UA 3AQPA 4KGKA 2RKIB 2BBEA 2HBRB 2FUG9 1GX5A 1Y0HA 2R42A 2XLIA 2W4PA 3HM9A 3LQVA 3J7YI 3J81Y 2ZJRQ 2P9EA 1UFLA 1NK4A 3TZXA 2QYCA 3C6TA 2HWTA 2XS2A 4TYAA 2R4FA 1JLEA 1WD6A 4I2QB 4YN3B 2DGQA 3LAKA 1S99A 3TRGA 4FF3A 4WIIA 1Q8KA 4O23A 2MQMA 3MM7B 4LRFA 4U7UK 3TAPA 2F8MA 2CPDA 4DSIA 5J1PA 4UQTA 2YNIB 2K06A 3QWUA 1XR7A 2IIHA 2Z0GA 2EVZA 3DXSX 5H1SV 5LOQA 2VA3A 5DO2A 3H20A 4O44A 3CJKA 2EG1A 1CJTB 4EFAC 5A8KA 2YWGA 1RYRA 4RW7A 2DPJA 2M5YA 4ELVA 2HHUA 4N77A 4GO5X 2NPIA 2PIIA 3KDOA 3KNAA 4PPDA 1M5SA 4GMKA 4LF2A 2NR0A 4Z7YA 4Y6IA 3EPIA 3CCLS 4DQPA 3T5JA 2GVDA 2HLUA 4IFYA 4KV8B 2CJBA 5M2PA 1HMVB 4CZCA 2OUGA 1RAJA 2JLFA 4RO0A 1TTHB 2DNYA 4ECWA 3G8SA 4LFAJ 4DR1J 1HQEA 2V5HG 4AQYJ 3D3BJ 5DGBA 4P52A 2Z56B 2XMJA 4I2PA 3PKMA 3MM5B 3DMJB 5KFMA 4FXWA 2VHGA 4A8XA 2YY3A 4NL5A 1R8BA 4KGZB 3C16B 3I5BA 4C8LA 2XNRA 4ZVOB 1X7VA 3MD3A 2AHOB 3TUIC 3B78A 5IM0B 4QPTA 5HJYA 2DH8A 4NLQA 2V68A 1NJXA 3K5NA 1F6TA 4Y0FA 3KJFB 4KAIA 5B0BA 1U26A 3Q8RB 4I7FB 4FS1A 2UXCF 4NMXA 3IS9B 2ZFHA 1X9MA 5E3RA 4IQXA 2XMKA 4ED0A 4N8NA 4AYBD 2BYCA 4XTTA 4XAKA 2RHQB 2W9CB 1PSDA 4M8LA 2WVFA 3D1HA 3EGVA 3MPDA 2JNJA 4CH1A 4LMZA 2FB0A 1RWKB 2A2DA 4CT8A 2ASYA 2GHWA 4GKJJ 1S9FA 3QZ8A 3AOCA 1K8AT 4YR3A 2VG5A 1DAXA 3QRRA 1WEYA 2BVZA 5HROB 3W66A 4ETZA 4GKKF 3MMCB 2QJ3A 4NXNF 1UVNA 1S1UB 1VIXA 4LR8A 2B4VA 3EE3A 1RA6A 3BS9A 3VAHA 3EDRB 4IDKB 4ED3A 3UQSA 3WQPA 1S48A 1LW2B 2B0GA 4YQWA 3AJ2A 5KG4A 2FHJD 2XYGB 4OYPA 3OLBA 1UVIA 1RT2B 3KHGA 4B3MJ 2FHOB 2Y8WA 3UDCA 5I3UA 4ECQA 4YS2A 4E2FB 4YP3A 4IH5A 4EBEA 4WP8A 4NI2A 3UR3C 2PI4A 4UOFA 2OO4A 2R8GA 4WFAQ 2CQGA 1RZMA 3DOKB 3J80U 1NH7A 2XM3A 3V4IA
chains in the Genus database with same CATH topology
2OMOA 2DGSA 2AJ4A 4ZP6A 2LXFA 4Y2MA 7FDRA 4TYBA 3AHPA 1H2UX 4EO8A 2OH2A 2FVCA 2ROEA 3BGLA 5DDPC 4BBYA 2G9OA 4H54A 3W2WB 3ENWA 5IM0A 2CQDA 4TKTA 2BZ2A 4OHVA 1Y5LB 3TI0A 1RGVA 3HVRA 1Q81T 4ZLPA 4MKYA 3IWNC 4LFBF 1ZTTA 1N5TA 1QUPA 1FDNA 4R0JA 3K58A 2UV8A 1L3SA 1LWFB 4OHYA 4NLVA 4DR3F 1FRMA 2R7SA 2AU0A 4Z2XA 2QSFA 4AL7A 1K73T 3ZZRA 1WHXA 2IJNA 3DLBA 5CZVA 4YY3F 5KFDA 3I6PA 3BQ0A 1FRLA 4LFCF 4HI2A 5KFZA 2BM1A 3B4MA 4WKYA 2KXNB 1DTTA 4NLPA 3M6XA 3GIMA 4L6V3 1DLOB 1ZETA 4I7FA 2AYEA 3C6UA 3MMBB 5D77A 5HMYA 1T3OA 4NCAA 2KDOA 1VQKS 4JI7F 3K7RA 2VG7B 3IS9A 1X9WA 4B3TF 2U2FA 3OXLA 3MUVP 2CQ2A 1YSJA 2OPQB 2WK4A 4FXVA 5LMNF 1P6TA 1XERA 4WTYA 1H38A 3NL0A 2XG8A 3KK1B 3TNVA 3CC4S 1RYSA 1UEUA 2HGMA 1U1PA 4ELTA 4PXDA 3VQSA 1RT1A 1TZ0A 1U6ZA 1GQEA 3OSPA 4DWIA 4DFPA 2HHQA 2AP6A 4H4KC 3RBEA 1KVJA 4DQIA 1B0VA 3MR6A 4MIAA 1S6PB 1NJZA 2LECA 2UV8G 4ED6A 3RAMA 2VFUA 1JKHB 2CFXA 3L7PA 2ZH4A 1FD2A 5ADZA 5CYMA 4RW8A 3PACA 3DLGA 4F26A 5KG6A 2VPWB 2YKMA 3HHDA 2DNGA 2B51A 3DOLB 3BO2A 2U1AA 4QYZJ 1LXNA 5F0WA 1N5YA 2JC0A 2WBMA 2EKYA 4IG0B 2D3UA 2I5JA 1RT6A 2XWXA 2R7TA 3LP0B 3DHXA 4Q44A 4PXBA 1Q16B 3UDLA 5MLCV 1CC7A 4URGA 4RBTA 3VWSA 1B7FA 1X5PA 2M88A 2IYIA 4ECRA 1KN6A 1JX4A 4WZQA 3SQGB 3V81B 1YJ9S 4I67A 2AGQA 1W25A 3GYNA 4FNHA 3K8WA 1SC6A 1X4BA 2HPUA 2UUTA 2JH3A 5DQHA 2E1AA 3CDEA 3HZGA 2DBBA 1NKCA 5HROA 1HNVB 4I0WA 3LAMA 1YJTA 2RDJA 5KT2A 3MMCA 3MEGB 1S0NA 3C66A 2QLWA 2UVRA 2FY1A 1ZM4A 5LXYA 2DNNA 2J9CA 1S1UA 4MIBA 3Q8SB 1WEXA 2MSTA 2VPZB 3DRRB 1ZAXA 2J7UA 1F0XA 4O3PA 3O2IA 4EUVA 5KT4A 3OJSA 3FGVA 2OSQA 5LT5A 3VAJA 5HLFA 1S10A 4X64F 5D6GA 2GC8A 1TAUA 5KFHA 4NX9A 1VC0A 5J1EB 3OHAA 4B3SF 4C8YA 4PRFA 3M1VA 4TY8B 3VZHA 1LFPA 2AD9A 3BSCA 3V2UC 2W24A 1MW7A 4IDKA 2E29A 1YG0A 4MK7A 4NCBA 3JAMY 5B09A 2ZD1B 1NB7A 1MU2A 3THPA 3V6HA 4RUAA 3Q8PB 3LGNA 3HFKA 3KJVB 4QW8A 3GIJA 3CCQS 3PX6A 1HNXF 3M6VA 1LW2A 2JL9A 3KLFA 2N3OA 1U7LA 2APOA 1L3UA 4DSKA 4JI8F 4A47A 4K4SA 2D74B 2VKRA 4PUOA 1KS2A 4ZOSA 2MZJA 4ICLA 2EPIA 2KVIA 5CA5A 4ATNA 2PE8A 1P1TA 1QSSA 1VBXA 2RQKA 2AQ4A 2FJWA 1RT2A 4RU2A 2IM3A 3RYLA 4OI4A 4KE5A 1QLNA 1FDBA 2HZCA 4F3OA 5KT7A 1IBMF 3H40A 1WF0A 2W25A 2MDAA 2KI2A 2J0XA 1S1VB 3UE2A 3NNAA 1QM9A 2LLZA 1RISA 2WOMB 2K7JA 2ZZMA 3U02A 4ELUA 3CD7A 5L39A 2DNHA 3GZ7A 1S49A 3W2VA 2KKHA 2GIQA 1JLAB 2K3IA 3LGMA 4C98A 2K7KA 2WHOA 1CSJA 5G4DA 2D9PA 5J2NB 4PQUA 4ZA1A 1FKPA 4QU6A 2HRYA 3QWPA 1BQXA 3T6BA 4EO6A 1WHVA 2ZJQQ 4K4YA 2FLPA 1U6BA 3UD3P 2XC9A 1N33F 4X4PA 1RT7B 3QLHB 4CI0B 3IG1B 3PFOA 3SMZA 3PW2A 1PO6A 3PKYA 4IUFA 2R7WA 2V2KA 4ECYA 3M4XA 2GNKA 3DOKA 3Q2SC 2F40A 2JFKA 1MROB 3SSRA 4KSEB 1ZTWA 1HYSA 1FT8A 2WBRA 2RRNA 4OJHA 2ZHAA 4YHHF 2E9TA 2YNFB 1HNIB 1P27B 3IFEA 3OVSA 2QO3A 2E44A 1I94F 2AJQA 4FS2A 4QR2A 3W2WA 1JXLA 2HNDB 2MMYA 2R7UA 4B9SA 1VBYA 3DLEB 2YTCA 1XBWA 2CPJA 3I9V9 3K5PA 4USHA 1SL1A 4ZPWR 2DR9A 4NPOA 4TY9A 1ZPVA 1X5OA 4TXSA 1LWFA 1JJHA 2YWHA 1K0TA 5E2QA 5GAEI 1VQ5S 3H2UB 1S76D 4B3RF 3FMBA 2HHWA 1RT5B 4X62F 4DQSA 2GHVC 1OPIA 2PT0A 2CQCA 2Y1RI 5K8MA 3ENVA 1VRUB 5U47A 3OFEA 3UI3A 2CJKA 4IOCQ 4RNMA 1TK8A 3ETOA 4CH7A 3KTQA 3PDNA 3CO9A 3CXCR 1NZAA 3GE9A 4KQZA 1DLOA 4ZVEA 3PEHA 2MY7A 5L1KA 3ISNC 3MMBA 4H4OB 4P7VA 5C5JA 4J9PA 2FDNA 1H7XA 1YGYA 1ZH5A 1UL3A 5HBMA 2BOPA 2E5JA 3K0JA 4DX8H 2VG7A 5A2QY 1GXUA 5J2QB 2CQ4A 1UJ4A 3T3FA 2OPQA 4PWUA 3KOAA 1U1KA 3KK1A 1ZAWA 3OTDA 4NWBA 2BQUA 4ZMMA 5KFEA 4LVNP 4OI6A 4OZ0A 5IQ6A 3SCJE 1OS5A 3HLUA 1S6PA 2FGOA 2Y1IA 4AFFA 4WFBQ 1RA7A 2VQFF 2IM2A 4B02A 1JKHA 3H5YA 4XPCA 1AXQA 4HDGA 1HBOB 1WEZA 3I9ZA 3LH2S 1CQMA 4DUZF 2BUNA 4NLUA 1S0MA 2J9DA 1KONA 2RB7A 4A8KA 2ZH1A 3MCSA 4CCHA 3FDSA 4OQJA 1FO1A 2KG1A 3DOLA 4Y28C 1UWBB 4QWBA 3KMSA 3DCAA 1KC8T 3BDEA 1SL0A 2YKQA 4QIGA 4CQ1A 4IG0A 2YH0A 2MKSA 1T7PA 3PJXA 2ASLA 1REVB 2VFSA 1S77D 2W7OA 1M1KT 3NKYA 2C42A 3J7ZT 1IXKA 2ZOFA 2ZH8A 2PN6A 5D4PA 5B0AA 4F4WA 3GWCA 3M32B 1QVGR 5DDOC 5T7LA 3SQGA 1RT4B 1S0VA 2YX4A 5KT6A 4EYIB 5FLXY 2EG2A 2AGPA 3CJ4A 5KG1A 2PA3A 2MJUA 4USIA 1Q53A 2L48A 1R8PA 1HNVA 2HGLA 1WELA 2VBZA 4U9RA 2FJAB 5E33A 1ZM9A 3BGRB 4R0EA 3MEGA 3N9UC 4PG4A 4DL7A 5DM7Q 4KBIA 2IVYA 3D1QA 1C1CB 1HWIA 1J2VA 5K8PA 3U1NA 2M2BA 3MGJA 5B0GA 1MMDA 1LFWA 4G1QB 1N8RT 2CZVC 2ZH2A 4FPRA 3M8PB 3CDAA 3DRRA 3R27A 4PPZA 2KM8C 1JJ4A 3KNGA 2XO7A 3ZZPA 4AL6A 1LWCB 3ZZOA 4CTAB 2RNEA 1DHMA 1J5OB 2IHR1 5F9NA 3LOUA 5J1EA 2QFJA 1ZBTA 1TKZB 4QQBA 2LQJA 2CQBA 1I1GA 1M5HA 3MPWA 4TY8A 2MZ1A 1S97A 1UP1A 1Q8IA 2E9RX 1TQLA 3HHLD 5AXLA 4HH0A 3M9OB 3T9ZA 2L9DA 2DR7A 5F41A 3N28A 3T1AA 3KJVA 3EXCX 1IKYB 4X65F 1DBDA 4OX8A 2LQ5A 2VOPA 3PO5A 2XS5A 4FYDA 4WYWA 2KT3A 3G86A 1TUVA 1L5UA 2PI5A 4DBQA 1VK3A 3US5A 2GMJA 3NBPB 3PJWA 4PQAA 4XDCA 4DR5F 1N34F 3SSQA 3SYZA 3ZFVA 4AXJA 1A7GE 1KVIA 2QT7A 4IYQA 1D9AA 2VZ9A 5F0UA 4ZVFA 3HHNB 4K0KF 2VBWA 2XGQA 2XI2A 4J9SA 4ECZA 3MF5A 2QV6A 5C24B 1S1VA 3DDNA 4DSFA 4RNNA