2DNRA

Solution structure of rna binding domain in synaptojanin 1
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
91
structure length
91
Chain Sequence
b'GSSGSSGGTVLVSIKSSLPENNFFDDALIDELLQQFASFGEVILIRFVEDKMWVTFLEGSSALNVLSLNGKELLNRTITIALKSPSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Synaptojanin-1
publication title Solution structure of RNA binding domain in Synaptojanin 1
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 12
structure length 91
sequence length 91
ec nomenclature ec 3.1.3.36: Phosphoinositide 5-phosphatase.
pdb deposition date 2006-04-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2dnrA00
2DNLA 2KHCA 1H2UX 5JVHQ 2N3OA 2HZCA 2MZSA 2CQDA 4M5DB 2L41A 1WG5A 1K9MT 2VOOA 2DGOA 1FJCA 3UCGA 2G1DA 1JJHA 5LXYA 2ZJRQ 1U6FA 1KOHA 1QVGR 3CULA 2LMIA 2OJ3A 3BO3A 5LJ5Y 2YH1A 3PIPQ 1A9NB 2EK6A 2AYEA 2LECA 3G6ES 1VQ9S 4IOCQ 4UQTA 4PRFA 3CF5Q 4TU9A 2VODA 4A8XA 2G4BA 2ZJPQ 1X4GA 1NJIT 2CQ1A 5CYJA 2HVZA 3CCSS 3MUVP 3U1MA 3BEGB 4Y0FA 1K8AT 1HL6A 4TU7A 2G0CA 5DDRC 1QVFR 2X1FA 3MOJB 2XS5A 4OZ1A 2DNYA 5D77A 1UW4A 2MZQA 2RNEA 3G71S 2DNRA 4WFNQ 2F9JA 2RUGA 3CCUS 2MKKA 3CMAS 1R8PA 5DDPC 1WI6A 1X4EA 2CQGA 2LA4A 2RS8A 3EX7B 1OO0B 2CPXA 1VQPS 1X5TA 1M1KT 3ZZZA 1Q7YT 4WCEQ 2MKSA 2LQ5A 2M9KA 3UE2A 2FC9A 3G4SS 4P6QA 2MQMA 1OWXA 2LEAA 3SMZA 1AUDA 1WG4A 2DNPA 1UFWA 1NU4A 4RU2A 2DGUA 2NLWA 5FJ4A 3S7RA 2M88A 3U1LA 5BJRA 1WELA 3JB9k 2V94A 1M90T 4C7QA 5DM7Q 4ED5A 1N88A 3D2WA 2PE8A 5ITHA 3CC2S 1B7FA 3CCES 5EN1A 3CCLS 2LA6A 1WEYA 5GAEU 1R8HA 2KXHA 4EGLA 2UP1A 2DGWA 3LPYA 5LXRA 5LSLA 1X4DA 2MKIA 2DHAA 2AYGA 5LJ3Y 1M5VC 1M5KC 1U1QA 2WBRA 2MSSA 4V19X 2BOPA 1U1LA 2DGVA 1L3KA 2FC8A 1HA1A 2E5JA 1VQNS 3K0JA 4U67Q 2DH7A 3R1HA 2QEXS 1ZZNA 3S01A 4W92B 1FHTA 4QQBA 2EVZA 1JMTA 2GHPA 1FJEB 2B0GA 2D9OA 4C4WA 1X4CA 5LSOA 2D3OR 1Q81T 1SJFA 3THTA 5IM0A 2DH9A 4Z2XA 1YJ9S 2YWKA 2KXFA 3SXLA 2MZTA 2F3JA 3EGNA 1VQOS 1DZ5A 2FPHX 2XSFA 2OTJS 3R27A 1U1KA 3EGZA 2GO9A 2KG1A 3MURP 1VQ5S 2JX2A 2E5HA 1X4AA 5CXTA 1WTBA 2KFYA 2DIUA 1RKJA 3I55S 3I56S 2XS2A 2L08A 4IO9Q 1X0FA 1PO6A 3CD6S 3P49B 2HGLA 1YITS 4UY8T 3RW6A 1VBYA 2RS2A 2CQPA 3NS5A 1W2BR 1VQ7S 1F9FA 4IOAQ 3H2UB 2PEHA 2MY7A 1KC8T 1M5OC 3G9CA 2M70A 2DNHA 2OSRA 3CTRA 2MQQA 2DNMA 1VBZA 4ZKAA 2KM8B 2J8AA 1YJWS 4F02A 1FNXH 1PGZA 3MD1A 3NMRA 1VQ6S 3DXBA 3CPWR 3CC7S 3MD3A 2MY8A 1P1TA 1BY9A 4WFBQ 1RK8A 1SXLA 1VC6A 1KD1T 2MQLA 2RT3A 3BO2A 1ZH5A 1WHYA 3VF0B 3MXHP 1H6KX 1DBDA 2JRSA 2DK2A 2N7CA 3B4DA 3BO4A 1OIAA 2DNQA 2DNZA 4Y00A 3R1LA 2FY1A 4IUFA 1FO1A 3S8SA 3H2VE 2MGZB 3N9UC 3G8TA 2MKJA 3CCVS 3G96A 3CUNA 2KG0A 1SJ3P 1KQSR 2KN4A 1IQTA 3MDFA 2DISA 2HYIB 1X4HA 3CXCR 1SJ4P 2MYFA 3TO8A 2M7SA 3MI7X 4WKRA 1JJ2R 3HI9A 1X5PA 5GVQA 4F25A 2FHOB 1D9AA 2MHNA 3NNAA 2YH0A 5D78A 4C0OC 1S79A 5IQQA 2XNRA 1Q82T 2MQNA 4LMZA 4PR6A 1VC0A 3US5A 2CQHA 3SDEA 3B4MA 1N8RT 4J5OA 2MZRA 2LKZA 2KU7A 5GADU 1HD1A 4WF9Q 2I2YA 2JVRA 1FJ7A 1SJQA 3HHNB 1WEXA 1YI2S 2X1GA 4TU8A 4TLQA 1UAWA 4PKDB 2M8HA 3NNHA 2CQCA 2JWNA 3UD4P 1JJ4A 1ZZFA 2VONA 1X4FA 2DHGA 2HGMA 3VAKA 1YJNS 3MUMP 1WG1A 1N52B 1URNA 2KRBA 1X4BA 1QM9A 2CQ2A 4WFAQ 2K3KA 3VAHA 2RRBA 1XN9A 1VQKS 2KM8C 1SJRA 4BS2A 1FXLA 3J7ZT 3L3CA 4YOEA 2OIHA 1WHXA 3CCRS 3UWTA 4YB1P 2RRAA 5DDOC 1YWXA 3LQVA 2MQPA 2Q79A 2CPYA 3CCMS 4QU6A 2HGNA 2QA4S 5MLCV 4W90B 2M2BA 2MQOA 1WF0A 2O3DA 3DLLQ 1VBXA 2CPZA 2MXYA 2MZJA 2DGSA 3THPA 3G8SA 5JVGQ 2AYBA 2CJKA 2CQ4A 2E44A 1U1MA 3TYTA 2DO0A 2XB2D 3P6YC 2DB1A 2J0QD 1H2VZ 2DITA 2ERRA 3UD3P 2DIVA 5CA5A 2U2FA 1N54B 3CMES 1WF1A 2CPEA 2DNOA 2MPUA 3UCUP 4CH0S 5IM0B 3Q2TC 2X1BA 1WWHA 2CPIA 1S72S 3IWNC 4ERDA 2D9PA 2LEBA 2DHSA 2AD9A 2MSTA 2EK1A 2OSQA 5HO4A 1O0PA 2LXIA 3CCQS 1YIJS 2CPJA 1YHQS 2CQIA 3ULHA 2MB0B 3S6EA 5GAGU 2NZ4A 1WF2A 3Q2SC 2U1AA 1VQMS 2A3JA 3BS9A 2M0GB 1U1NA 5HL7Q 2CQ3A 2DGTA 3ZZYA 2ADCA 3OW2R 2MJUA 2I38A 4WIIA 2XS7A 2F9DA 2M52A 2MMYA 2M4MA 4FXWA 2YKAA 2DH8A 1P27B 1NO8A 4CQ1A 1U1RA 2CQBA 1OPIA 3P5TL 2CQ0A 2J0SD 2MZ1A 4LJMA 2RVJA 2KRRA 2SXLA 3P3DA 3CCJS 1WHWA 4YUDA 4F26A 1U1PA 2LXUA 3RW7A 4CIOA 2RQCA 1U2FA 3FEYB 2LYVA 3UCZP 1VQ4S 1A7GE 4OZ0A 2N3LA 1HD0A 2E5IA 2ADBA 2DNKA 5DETA 5H1SV 2KH9A 5IFMA 5GMKa 2RU3A 5GAHU 1KOOA 2CPFA 2OTLS 1CVJA 2X1AA 1VC5A 1K73T 2DGXA 3NS6A 3FEXB 3J7YU 2KVIA 1D8ZA 2E5GA 3CC4S 2MJNA 2N82B 2M8DB 1DRZA 4CH1A 2KXNB 1VQ8S 2MKCA 3IRWP 4QU7A 2KYXA 3VAMA 2DNNA 2BZ2A 3VAIA 1VQLS 2CPDA 2AYMA 2YTCA 3MUTP 2KI2A 2DNGA 1WEZA 2ZJQQ 2JVOA 3VAFA 1UP1A 2KT5A 1G2EA 1DHMA 1YTYA 2K8GA 2MKHA 4LIRA 5DDQC 1U1OA 1U6BA 3NNCA 4QPTA 3VAGA 3SDEB 4FXVA 3VAJA 3V4MA 1M5PC 1H2TZ 2DHXA 2LCWA 2QFJA 5DM6Q 2J76E 2XNQA 1WHVA 2RQ4A 1FT8A 2MGZA 2L9WA 3PIOQ 1X5SA 1WI8A 2DO4A 2DGQA 1Q86T 2CPHA 3VALA 2VOPA 1X5OA 3TP2A
chains in the Genus database with same CATH superfamily
1GXLA 1FD2A 1SH2A 3MAAA 4ETZA 8RUCA 3OFHA 2YH1A 4XAKA 4IOCQ 2HS0A 4AXJA 2YNGB 4P9SA 3KHRA 1TFYA 5F9NA 3CVKA 1JLEB 3AOCA 1BQMA 1QVFR 4Y2CA 4OYZA 2D3O1 4B3MJ 1UW4A 1S0VA 3G71S 1XERA 2QMWA 5KFKA 3GYNA 5K14A 4WXOA 3G4SS 1W25A 2BV3A 4M5HA 1C4AA 3CJ3A 1AUDA 2QA2A 1UFWA 1NU4A 1OSDA 4OJ1A 2BW2A 2FVCA 5L1LA 1DLOB 1YGYA 4K0KJ 2UP1A 3HMJG 2MKIA 4OV6A 1LWEA 3MPYA 5F3TA 5K8NA 5KG7A 1S59A 2G13A 2XHWA 5K5MA 2F1FA 2GIQA 4MK9A 5MAOA 1SKRA 1PSDA 3SV4A 1IKVA 1YJ9S 3GILA 1FKPA 2F3JA 1UEUA 2HMIA 3DCAA 1T03B 3M8PA 1S49A 1RU2A 2E5HA 1NJXA 3H40A 4ELVA 3KLIB 3RB0A 5HANA 2WB1D 2C42A 1EETA 3DLHA 2C1EB 3CD5A 2B51A 1HNIB 2CUYA 7FDRA 1DQ9A 3NS5A 2AKWB 4CT9A 2I8EA 3DRSA 3FZ2A 2ZFHA 2CRLA 2DEJA 3T5LA 4FP9A 4HACA 2W9BB 3Q8QB 1HI8A 5K8OA 3J7A1 1UVMA 4P10A 1HNZF 3CJTA 1RJJA 1C0UA 4JI5F 1Y9OA 5DGAA 1OIAA 2H65B 2WOMB 3GFZA 1NRKA 2OUGA 1DY3A 4LF7J 1PAUB 5EX0A 1EP4B 2HFNA 3EDQB 2BBEA 2HIYA 2YX4A 1JJ2R 1X5PA 2ZOGA 1HHQA 5KFCA 1Q79A 1S79A 4LMZA 1LFPA 2MZRA 3QWUA 4WF9Q 2JHEA 3AY0A 2ZBCA 1Q16B 5EWGA 4TU8A 4CLWA 4M5DA 3KWMA 1URNA 4UOFA 2W4CA 2CQ2A 4USUA 1SJRA 1QE1A 4G3IA 3HK2A 3DLJA 4K8RA 2HQIA 3KLFA 2LVWA 1Y5IB 2CNLB 1WD6A 1XBWA 1D3WA 2HHUA 3LP0A 4W90B 4OX6A 1YZ6A 3K58A 1CULA 1HI0P 3CCTA 5HMZA 2AYBA 2DB1A 4IRKA 1O6XA 5IS2A 3UD3P 3POTA 4C8NA 4CLZA 4AT1B 4DDFA 4CO1A 3FC9A 5HROB 1RAJA 1ZTTA 1S72S 5A8KB 1PJ5A 2PA3A 2CPJA 2QV6A 1UFLA 4ZVQB 5CH7B 1JLQA 3Q86A 5B0FA 3MECA 3V4IA 4H4OA 2PMHA 4B9NA 2M0GB 1F2GA 4EFAC 3O6QA 3V6KA 1X9MA 4FF2A 1GAOA 2M4MA 1FK9B 2GHWA 4CQ1A 2YNFB 2ROGA 3B8HA 3OTBA 3P3DA 4EUVA 2J0WA 3BSCA 3CCWA 3GV8B 4USKA 4H4MA 2ASDA 5D0HA 3JXOA 1VS3A 3G87A 4CO4A 1YSJA 2OPPB 3SCJE 4LF1A 1X8DA 2CXEA 4PUOA 3BDPA 1H98A 5BXIA 3NOCA 1BLUA 4DX6A 2MKCA 2W8KA 1LWCB 2VC0A 2DNNA 2BZ2A 4N8NA 1H74A 1S1XA 2CPDA 3AODA 4K59A 1WEZA 2JVOA 4DX5A 1DQ8A 1S6QB 3CNQP 1NK7A 5DDQC 4FS2A 2LQ8A 4DUTA 2W2OP 1KLMA 3OLAA 5B0CA 1CJVA 1RCOB 2B43A 4C3LA 2CJ9A 4O4GB 1F1BB 1CQMA 4K4ZA 2R2SA 3QGIA 3TX0A 1RGVA 2CQDA 3RB3A 3HO1A 3V81B 2MQ8A 1JJHA 3M8WA 4F3MA 4HDHA 4O44B 3G6ES 1N36F 3IAS9 1YZ7A 3CW2C 4RBVA 3BEGB 1PC5A 2HHWA 4PPZA 1AFIA 1WKJA 1UL3A 3U02A 5D77A 4KGKA 3PHEA 5A6WA 2NSBA 2RUGA 1WI6A 3ENWA 2GQQA 4QWAA 4P6QA 5A0YB 4RU2A 1ZPWX 4DN0A 3NGKA 1AB8A 1SKUB 3GCWP 4OI3A 1IQZA 2CJBA 4IDKB 1TL3A 2AGPA 4M8LA 2LA6A 1K47A 3BH7B 5FIIA 5HQ8A 5G0RB 2H51B 1H7XA 1VK3A 3QZ7A 4LR8A 3UD5A 4RW4A 1K1SA 5DS7A 4RPFA 2VV5A 4LFAF 3R27A 4X4VA 2NZCA 1MROB 2FJBB 3VHQA 5AE2A 5BYRA 3IFEA 2G2YA 1RHQB 2PI5A 2YPZA 1NAQA 2HQCA 4YFUA 1QSLA 1XNQF 1WC5A 2BE9B 4WBFA 2N4DA 4A8OA 3PYEA 2Z2MA 3VZIA 2RJZA 4IRCA 4B3OA 2UXDJ 3MD1A 4F3OA 4X65J 5LM7E 1IUJA 4ED0A 1IBKF 3PJWA 1IBMJ 4ZMMA 1AT1B 1ZAVA 1VC6A 3MM7A 3KYLA 1DBDA 2X3DA 2W4PA 2ZUGA 3B4DA 1PG5B 4IFYA 1TV6B 1SIZA 2IVMA 4URGA 3EDRB 4RO0A 4LBIA 2KG0A 2FIUA 1B99A 3OUYA 2DISA 2HYIB 4LBHA 1FTCA 4F4AA 5J2QA 3AFGA 2XMMA 1REVA 4OZNA 2YH0A 3JSMB 1QSSA 1L3TA 3IO1A 3KLEA 4KHPF 1JLGB 2WAQD 2UV8A 5J1PA 3NY0A 5T14A 4CCHA 4U7CA 2FD2A 5C24A 3BH6B 4DN9A 4M5KA 3A8JA 1IKWB 3MR6A 2NXNA 3UR0A 1QM9A 3H5SA 4OZLA 1XN9A 3QRRA 1KQFB 4QYZK 4YB5A 3ICLA 3LQVA 4HLBA 2LQJA 1TAQA 2N7YA 2CPZA 2MZJA 3GQCA 3OTCA 5KT7A 1HR0F 5G4DA 4A8WA 4ANCA 3PHTA 1UMJA 2DR8A 1WWHA 3FFIA 1PKUA 4B9TA 4LSLB 2BR0A 2VFUA 2MSTA 2Y0BB 3OXGA 4M94A 1YHQS 5I3PA 1RE1B 2BUNA 4DLGA 2V50A 1C1BB 4IYQA 3NBPB 3ZZYA 3PW4A 2Q66A 4NLGA 5D15A 1NO8A 2R7QA 2FGOA 2CJYB 4RW9A 1CS4A 3I96A 4JI3J 4DG1B 3L4BC 2ZC4A 1OMSA 4FYVB 4EYHB 4NYOA 4Y2MA 1F6TA 4DV2J 3FEYB 4G1PA 3IAM9 4DSEA 4LVNP 1SV5B 4QIVA 1RTJA 1TZ0A 4DR4F 3L09A 1HD0A 1QLNA 1HQUB 5L9XA 5GAHU 2CPFA 4BC7A 3AHPA 3FMWA 2UUBF 2V2QA 5J2PB 2D3ZA 4B3TJ 2DEIA 3O2IA 1U8SA 3VQTA 2RAQA 4QOTA 1KWMA 2HNYB 3ONQA 4WK1A 2HS3A 4F4WA 2AJ1A 1RZMA 3V6DB 2UUWA 1RABB 2FZGB 1NZAA 3D0HE 1CJUB 1FDNA 1U0SA 2EFOA 2QSFA 1FDBA 2YKNB 4U8YA 3MMCA 2FZKB 3ENVA 4WZQA 1FJCA 4QW9A 5ETVA 4G6VB 1KOHA 3DDNA 4O3RA 4JI6J 5ETSA 2VODA 2H4YB 5D0GA 4IRDA 4L3KA 1R6VA 3QAEA 2QRRA 1FF2A 3UDCA 2B5JB 4DR1J 5DDRC 4XPEA 2X1FA 4PWWA 4ZP9A 3PACA 1JKHA 2VPXB 2NXEA 3K2YA 2ZITA 1VQPS 1T95A 1W2IA 4WCEQ 2XBPA 2B9XA 4DS5A 1ZM9A 3PEJA 4R5PB 2DGUA 3HFVA 1S12A 5GADI 5BJRA 4KO0A 4DSIA 1LXNA 4NCGB 2BJ7A 4LRAA 4DV7F 2N4CA 4LF4F 5ETPA 4EGLA 1TKXB 4JP8A 4N47A 3MPUB 1U1QA 3H4DA 2E5JA 4MFBA 2VQEF 2GHPA 3MEGB 4RR5A 1B0VA 2H4WB 2V2VA 3VGSA 2D3OR 5A8RA 3NS7B 1XR7A 5A2QU 2OMOA 1RBOB 2BACA 3UPFA 2ZH6A 2QLFB 3FBCA 3MURP 5EHHA 3R5BA 4PQUB 1R0AA 4U7UK 1LWFB 2FJXA 3C15A 3NKYA 4ILLA 4IFVB 4QBUA 3QGPA 1S1VA 3W62A 2CQPA 1FEEA 3D0GE 3D3BJ 4Q2MA 2NSCA 2YNIA 2ZH7A 3ZZRA 5B08A 1BWVA 1EJ7L 1OYEA 2CZ9A 2RF2B 4MH8A 3D3CJ 4FKYA 1YJWS 1PCAA 4PWDA 3D28A 2HFVA 4JB8B 4MAKA 2CAJA 3PFOA 2VH7A 1KD1T 2MQLA 3NRBA 3LGNA 4DV3F 5B0BA 5AT1B 1FEHA 3HDSA 2DNZA 1R43A 2HWHA 4CNZA 2ZH9A 1LK5A 5I3UA 4NEYA 4GKJJ 4ZVSB 3FCVA 4I1TA 5AJ3J 2M7SA 2W7PA 1HI1A 3HI9A 2FHOB 4PYDA 4OZJA 2VFRA 2AWZA 3I87A 5D3GB 2QA4G 4P2MA 2PSZA 4DUYF 4G65A 4OHVA 1UW9A 3RGIA 2FVSA 3LP1B 1G1XA 3MPDA 1WEXA 4EWTA 5KFWA 2KL8A 1MLAA 1X4FA 1IJEB 4WK3A 2E66A 4WFAQ 1RWMB 2QG9B 3H5UA 1PJ7A 1H3DA 5H9EK 3MM9A 2HHHF 2ZNZA 5ETMA 4AFFA 4RNHA 4OHYA 4DSJA 2VZ9A 5K20B 3HFKA 3OTDA 1T11A 2GVZA 4ZN1A 3LAMA 2AHOB 2OFGX 4Z7YA 2MXYA 4NMXA 1J5OB 1BD6A 4NLSA 4F7VA 5EGYA 3WHIA 2DIVA 5CA5A 1SPBP 3CMES 5C2GA 4NXMJ 2AX0A 2IYIA 3ILOA 3LWLA 4ERDA 3MEEA 3RRGA 1RT1A 3IR5B 1G7CB 5J2NA 2DHSA 3BZQA 2EK1A 4P52A 4J9OA 1YG0A 1HFEL 4LREA 3IA0A 1VHFA 2LP4A 3RB4A 2BRKA 3DLBA 1VQMS 3PX6A 1QTMA 2XULA 4MK7A 1TMMA 2I38A 3SI8A 2BKOA 3HT3A 4OLOA 3N01A 4ZCKA 3UDLA 3I9ZA 5F8MA 4PXBA 2C2EA 3ISZA 1V5IB 4CLYA 4EYIB 1A7GE 4C8LA 4ZVUB 4YDXA 1VI7A 2FLOA 2RSQA 5DQHA 4WP3A 2OTLS 2WSEC 3HD2A 3KTQA 2EFNA 1M5HA 2E5GA 2HS4A 3MCNA 1FWLA 4NLDA 3D0IE 1VFJA 4Z37A 3HD1A 3J7Z5 5L39A 3CO9A 5CQGA 2Z0GA 1MWYA 1SL0A 4WP9A 3G82B 3GLJA 2MTLA 5KG5A 1S5ZA 5F9LA 1JB0C 1RA6A 3BDEA 4Q5VA 1GQEA 5CHCB 3VAJA 2ZUAA 3TI0A 3OFEA 1LEOA 3Q8VA 4UZCA 1NJYA 1X0PA 3BN7A 1KKHA 1NKBA 3MM8B 1Q4RA 2G1DA 4OHZA 2KO1A 1TVRB 1B3TA 4X2BA 1A9NB 2C2DA 2XI3A 4RBUA 2R2RA 3KUHA 4PRFA 4ZPWR 1FD8A 3N4WA 1NK4A 2K2PA 2EPIA 3QQCD 3MOJB 2IFXA 2MZQA 2L9NA 2ZE2B 4DCPB 3BPDA 5DDPC 2XSJA 1BUXA 3N5FA 2ALYB 3W3SA 4FYYB 4Q44A 3UNYA 3DLEB 3OPKA 3PJ9A 4CLFA 3I0RB 3F0NA 2LXFA 5KFIA 3TZYA 2VG5B 2M88A 5KFRA 1QDUB 1S1UB 3UI3A 4ED5A 2BM0A 1DARA 2OD4A 2HHXA 4GC7A 2OAUA 5LXRA 4GMKA 4LF8F 2DHAA 1VHIA 1G4CA 1LW0B 5A8WA 2J8SA 2XYHB 4NA3A 2GNKA 5LT5A 3I0SB 1RT4B 2LDYA 3LAKA 3FBEA 3TAMA 1SJFA 4Z2XA 4HVZA 3TW0A 2UV8G 3EGNA 3MMBA 3CJKB 4QYZJ 3J81Y 2L08A 4OYPA 2HRUA 1P1LA 2QX0A 3HCXA 1VIOA 3MWBA 4K2JA 3E8OA 4NPOA 3KXDA 5DLFA 3C6UB 3G9CA 1FCAA 1PGZA 3AD8C 3FUYA 2ROEA 3GV7B 3IS9B 1J5EJ 2VKZG 3MD3A 2HVIA 4ER8A 1R8BA 2NPIA 3EZUA 4NZ6A 1HBMA 3RTVA 2P9GA 3MTKA 4BDPA 2HLUA 1NK5A 1H6KX 2QTWA 3D9BA 3PO5A 2YQ0A 4KKOB 5F0WA 5CYQA 5DG8A 1NB7A 1VRTB 1KBRA 1W26A 1X9WA 3KK3B 1UZDA 2HG4A 1QSYA 4EZ6A 2NUUG 2RDDA 1HNVA 2V0NA 1LOUA 1NSKL 1RHKB 5KFMA 5DQIA 2V2KA 5C7PA 4TXSA 2FQQB 5BYSA 3IR6B 3DGPB 3DM2A 4P73A 4DSLA 1MMNA 3H20A 2OEJA 3SDEA 2J9DE 4ECVA 2HQFA 1FJ7A 1SCJB 3HHNB 2WONA 5I4MA 2D41A 3M7VA 5L1IA 5F8HA 1DTQA 4UF4A 3DYAA 4DPWA 2KRBA 3PDNA 4I7FB 2KM8C 1FXLA 4M5MA 2DD8S 2OIHA 3W2WA 1YWXA 1NLKL 2CPYA 4KHRA 4C8ZA 3LP2B 2M2BA 1WF0A 4CTAB 2ZBIA 1TKTB 4X62F 4FPRA 3G8SA 2GJ2A 3W65A 1D09B 2E7XA 5KFLA 1HWKA 2AW0A 2COLA 3CDWA 1NDKA 1RT7B 1T9TA 1NK0A 4AQYF 1FFWB 1O0PA 1NSPA 4CLKA 3NCPA 1RT6A 4OMFG 2OPRB 3D5MA 3PCOB 1XR6A 4Z7CA 3EGWB 4DR3F 3AA8A 3U7JA 4XO0A 1V5VA 3JAMU 3ADAC 2B8PA 4M5NA 1YX2A 4L72B 2CQ0A 4LJMA 4NRUA 1KQGB 2E7VA 4HT5A 2YNHB 1WHWA 1FRLA 1XTZA 4F26A 3T5HA 3R5JB 1AZSA 3NEKA 1HNXF 3FSIA 2UXBF 3QT5A 1UPPA 3AJ1A 1TK0A 2O1PA 2DNKA 5DETA 1Q78A 5IFMA 2GA7A 5LMUJ 2VBXA 3TWZA 3TZWA 3DRYA 2D3UA 2M8DB 1DRZA 1S57A 3W9HA 5DG7A 1EAYC 1N4LA 2KVQE 3VAIA 2V6AA 2PO4A 2YNGA 4JI5J 2DNGA 2DR6A 1JLEA 3KHHA 2K8GA 4I69A 4WP8A 3K8VA 2Q6CA 5D4OA 2BJ9A 3QFHA 2QFJA 3F41A 1FTRA 2Z2LA 4QIGA 2DGQA 1Q86T 3VALA 4DV6J 3KLGB 1YJVA 1T3NA 4MIAA 4JYAF 4CO3A 2VBYA 3BB5A 3CULA 4JI2F 3TVYA 2AYEA 3CF5Q 1H73A 1RYSA 3AA9A 4RNOA 4A8XA 3GIIA 4K7QA 5BR8F 3Q0AA 3GR0A 1RYRA 3SYZA 4ZP8A 2VG7B 2CNOB 4GKKJ 1ROFA 1TL7B 3FCHA 3GSDA 4WFNQ 2QFIA 1CJTB 2CPXA 2NYIA 3QGGA 2MKSA 2LQ5A 2YBVA 3FBFA 1U26A 4C6AA 1T03A 3OFFA 1N6QB 2Y1RI 2I9SA 4OJHA 4CLLA 3X1LB 1HNIA 4O3OA 5T7LB 3SQGB 5GAEU 2VUGA 1Q5VA 5IT4A 3PKMA 2B4OA 2WBRA 3GPAA 1L3KA 2IRUA 2EFQA 4LVOP 4IQXA 1FHTA 2RE1A 1GX5A 3D7SB 1BQNA 4DV0F 3LTOA 2F8HA 2LU1A 4F4KA 4V19J 2FVQA 5B0AA 3SXLA 5DJBA 2AU0A 3M2RB 2IVYA 4TKTA 2CZVC 1U09A 3DI6A 3D6FB 3D54A 2CKWA 2HGLA 5L46A 1GMWA 3W8PA 4KV8B 1FDAA 1EP4A 3DHXA 2XC9A 1WC4A 4WPAA 1EB0A 5D4LA 2OSRA 2LFVA 3GIRA 4F02A 4HTIA 3W8GA 2UUAF 2A10A 1EARA 5ETTA 3DXBA 3WIVA 2FVRA 5B09A 4DR6F 3GG0A 1RK8A 1X31C 4KB7A 3AH6A 1N34J 2V4JB 3BO2A 4L3NA 2YVSA 3KFWX 3QJLA 2CA9A 1ZS6A 1C0TA 4QWBA 4NMLA 5J1NA 2IRXA 3OVBA 4AE5A 2BRLA 3UVJB 2YKOA 3TO8A 1WJ9A 5I3QA 3R2CJ 4UOCA 3NNAA 2L9DA 2I5JB 4KGXB 4JI4F 2XNRA 1Q82T 2BANB 4RUBA 2P6TA 2HKEA 3IG1A 1MN7A 1H0HB 3EE3A 2CDQA 5GADU 1S97A 1HD1A 1NDLA 2YQ3A 4YB6A 3TARA 2LDIA 3UW1A 4BBYA 5HROA 3UD4P 4KH1B 1UTAA 4A8FA 2E9TA 3DOMB 1N36J 3DDIA 3TAPA 1FI4A 1SH3A 1T9VA 3ZZTA 4ALZA 4BS2A 2CADA 3OTOF 1BE4A 3CCRS 1UJ6A 3E2EA 1NSAA 4M1KA 3BN4A 2W2QP 1EKRA 3CJ4A 1VBXA 1FK9A 5JJBA 4O0NA 2YNFA 2PGCA 3D6MB 1J27A 1M0SA 2XB2D 3W1YC 4ZVHA 3UCUP 3IGVA 1T8EA 1N0UA 3NG8A 2DR7A 3RBEA 2E1MC 2LEBA 3OL8A 1S48A 2ZWOA 4KAIA 3GFYA 4KTQA 2OPPA 3EVOA 4USVA 1U2CA 4CYUB 2U1AA 4FVMA 4NL5A 4I2PB 1O51A 3PRBA 1OPZA 4ILRA 2CQ3A 3OW2R 1QY7A 4OZ3A 1LWCA 1KHVA 4LBPA 1RTZA 3QLHB 4FF4A 4J7CA 2K06A 4LFAJ 4HT7A 5AXLA 3T1YJ 1RDRA 2DXEA 2Y8YA 4YUDA 2HFOA 2C3PA 4HHUA 3C8YA 5KFHA 2LYVA 3Q23A 3HM9A 2F8MA 3QIDA 3OFGA 2HQGA 4O4GA 3JQJA 3NS6A 1S1WA 2QLWA 1QUPA 2FLLA 1N5VA 3G86A 4O44A 1IBKJ 4F2SA 3KLHB 2KT2A 1SL1A 2MKHA 4B9MA 1REGX 3DDKA 3DRRB 1WNEA 2DHXA 4PXDA 1WHVA 3VGTA 4ES1A 1F9EB 3K17A 2VL1A 1RAOA 1Q5YA 4ENOA 2JC1A 5AXNA 3IRXB 4E8UA 4IDKA 5LOQA 2EK6A 4DQQA 3QIPB 4S0MA 3TANA 3MM6B 3PKYA 3FNNA 4NLTA 1NJIT 2IJFA 4Y0FA 2IBOA 5AXKA 4RX6A 1S9EB 2Y3YA 3E51A 2RNEA 1F5AA 4A4JA 3CCUS 4AL6A 4K4VA 3EX7B 1OO0B 2J6TA 3OSPA 1JLAB 2WBMA 3VVUA 3UNGC 1MROA 1YJTA 3HHLA 3TOQA 2EFVA 4BC9A 1TMJA 4MMOA 6FD1A 1NKEA 1X7VA 3D67A 4CLUA 4N77A 2DRAA 2DGWA 4DS4A 1X4DA 1S76D 2ZWPA 4MJKA 2BOPA 4K4XA 1VQNS 3OR2A 4EU0A 4W92B 4X4SA 3KG0A 3IXQA 4JI7F 1UVJA 3BREA 1RWPB 4OHXA 1C1CB 1TFWA 4JV5F 1NEEA 1QAYA 5HBMB 1WC0A 3QO9B 2XM3A 1FE0A 4DF8A 1TV6A 2KKHA 3ZTSA 5L38A 4YMEA 2KFYA 2DIUA 2GW8A 3P96A 2CWXA 1HNWJ 2HVEA 3WDOA 1PYSB 1M1GA 3M1VB 2IAJA 1ZETA 1BWEA 2A18A 3H25A 1SUQA 2G0JA 2H9ZA 4QYRA 2KM8B 4ICLB 2J8AA 1RBAA 3JSMA 3LOUA 3NMRA 1JLGA 4Y2KA 4YS2A 1JK9B 1URRA 1HKAA 4DR4J 3FJ2A 2E1RA 3GYGA 4Q8FA 4QCLA 4GVLA 1V3ZA 4UTGA 2VASA 2UUBJ 4Y00A 3R1LA 4IR9A 2P5VA 1N56A 2DXFA 1HBUB 1KNZA 1NBEB 2NUHA 5B0DA 5M2PA 1CC8A 3PJXA 2H1YA 5KT3A 4ZCLA 4GVBB 1AROP 2E1AA 1WDTA 1GK8A 4F25A 2HZAA 1MG7A 2IM0A 1N32F 3IMQJ 3RAQA 5B7WA 1QAJA 5D6GA 2J6SA 3LPEA 4L73A 2BJ3A 3H90A 2K7KA 3BYPA 1N0VC 4LF2A 1ZBTA 2A2CA 3T3FA 1KP6A 5B0GA 1FFSB 1WOSA 2YQ1A 1SJQA 2VF3A 3QSIA 1TUWA 3PM9A 1JXLA 3MM5A 1RU1A 3M30A 4QR2A 2VONA 4LSLA 4KIAA 3GIMA 1Y5NB 2ROPA 1X4BA 5L9NA 3Q8YA 1IN0A 1RACB 4L74A 4NWBA 3RBZA 2AEFA 2WSCC 4MYUA 3PV8A 4LSNB 1C1BA 1S77D 4QU6A 1RT3B 3NBPA 4ZPDA 1VQSA 3H42A 3BV8A 1LWEB 2VKRA 3VVTA 3NGRA 5JVGQ 2DCUB 1WACA 3P6YC 4DG1A 4DPYA 1H2VZ 4KR0B 1Y11A 3OBIA 2U2FA 3QT6A 3DXSX 2MPUA 2OELA 4M5LA 4USIA 1QJHA 1UVNA 3TJAA 2ZM6F 5KFPA 1SV5A 3GYXB 4DV7J 4JI8J 2LXIA 4LF4J 1HQUA 1QD1A 4OJ3A 3BQ0A 2IA0A 3S6EA 3VGVA 3IWXA 2K3IA 3BS9A 1T02A 4UQGA 1DTTB 1RQ0A 5J2PA 3HFZB 1UVKA 4X66J 1KFSA 3DRSB 4KPCA 1HLWA 4J9VA 2JZ5A 3CSKA 2BKPA 2AZ3A 2KRRA 1QTNB 3CCJS 5KFNA 2HNYA 2R8IA 3LW5C 2ZKTA 3TZXA 3V6DA 4U8VA 4RBTA 4RNFA 2C28A 4RW8A 3J80Y 2ZZTA 4H4KA 4Y2IA 4MYTA 1O8BA 4B3MF 1KOOA 5SUHA 1GXUA 2YKNA 3BGFA 1RT2B 3WX4A 1VC5A 4FF3A 4A8YA 4OI1A 4LQ9A 3WQPA 2C2RA 1T9YA 2KXNB 1MMDA 2FY8A 4QWCA 3MUTP 3T6BA 2B5JA 2RKIB 2QZ8A 4DV3J 2R7UA 5J2MB 4JOUA 2JSXA 1U6BA 1XMQJ 1VLOA 1RWNB 4P2XA 2IA6A 3BGRB 2DKOB 4PG7A 1MSWD 4DPXA 2DO4A 4ECWA 2B3TB 1RI7A 4RW6B 2VBZA 3AJ2A 4M5DB 3FGVA 2HRTA 1K9MT 3KG1A 1D1UA 1FXRA 1L3VA 3PIPQ 3DC2A 4ZVOB 4UQTA 1QE1B 4KFBB 3F73A 2HNDB 4DUYJ 3KLFB 1ZAXA 3L9ZA 2HAFA 2B9YA 1GEHA 1HWIA 4W98A 3A1YG 4HR2A 2HW3A 1L5UA 2RU9A 3HVWA 3LP0B 1U24A 3MEGA 2DNRA 4DF4A 2MKKA 2CQGA 2YKPA 2CIMA 2GGPB 3UE2A 1R8CA 1K1QA 3POTB 2GS8A 3ITHB 4ID8A 3HVTB 2OI2A 3S7RA 1S6PB 1LWFA 4Y6IA 2V9KA 3DN9A 3PEHA 4IFVA 3ZTRA 3CJ0A 1I5OB 3KDNA 4UOHA 3O8WA 2L48A 3M6VA 3MTJA 2RF2A 1U1LA 2DGVA 3C6TB 4LF7F 4LF6J 5CABA 1SKWA 5AE1A 4N41A 2V8DA 2EG1A 2R7XA 1UETA 4ZVTB 4B9UA 2HK2A 2FPHX 4F0HA 2FDNA 5C42B 2ZH3A 1MU2B 2DYAA 1CG2A 1RKJA 2XS2A 1DURA 3Q89A 2CVIA 1X0FA 1PILA 1R0BG 3NCRA 5IV4A 1XNRF 2XHCA 3WIUA 1VQ7S 4PUOB 2FHMA 5E2QA 3M6WA 5KFOA 4FYWB 2DNHA 3MR3A 5IT9U 4DCJB 3QAUA 2Y8WA 1JLBB 2QSWA 3H5XA 4ED8A 2VA3A 1WOPA 1VQ6S 2EW9A 1S1XB 2EKYA 3SQOP 2E1CA 4CM2A 1KLMB 3LP1A 1RHMB 2KYZA 1CJVB 3S1TA 3TNVA 2V8VA 1YDLA 2MKJA 3KJNB 3CCVS 1ZOTA 1KQSR 4MTPA 3L7UA 4J9QA 3VGUA 1WC3A 1BQXA 4CO5A 1Y10A 2B7CB 3GE9A 4O3NA 3PX4A 3DHWC 1Y3KA 2QA1A 1WORA 1N8RT 4J5OA 1J5OA 5CAAA 1Q8IA 2XMJA 5EUHA 4ITSA 1NPPA 3D66A 2DRDA 1T0TV 3QMQA 2BVZA 3ET6B 2E9RX 3A3OB 1ZZFA 4P2FA 2UXCJ 4OX8A 1FNOA 3IC1A 3VAKA 1O5JA 3H2LA 3H4BA 3VAHA 4PG6A 2WSFC 2AIRB 1HBNB 3IGNA 3PYGA 3EWGA 1DQAA 3DFEA 4CO0A 1T94A 2EG2A 3TR5A 3TEHB 5L1JA 3V6HA 7AT1B 1GMWD 3WBZA 4XPCA 4F0KA 2BJDA 2DITA 2OO4A 3I32A 3G2XA 3MR2A 1YRXA 2D7SA 4MT1A 1XJWB 2B6AB 3ZO7A 3UR3C 4KBIA 4DL6A 2AD9A 3AB4B 1YIJS 5KFGA 2AV5A 5K8MA 4B3RJ 5D4NA 2A3JA 2BDPA 5HSPA 3MR7A 2E7WA 2B4UA 3R5DA 2NREA 1YKWA 3CJQA 2EFPA 2XS7A 3SCLE 4G1QB 2YKAA 1P27B 5E41A 2QGFB 2R7OA 4CLSA 4NLPA 1I3OB 5JMNA 4DR5F 2ZOMA 3TAQA 3G82A 3ZTPA 3C14B 2KT3A 5D0RA 3RRHA 2UUCF 4YHHF 4BCAA 2LXUA 4O4RA 4CIOA 1HWJA 1I94J 5KG1A 3MM7B 3NAHA 2E5IA 1SC4B 4C8KA 4ED7A 4DJBA 3K59A 4ED3A 1JLFB 3V5RA 2CYYA 4IFYB 4Y28C 4HI1A 4PZVA 1K73T 2MJNA 4KGMA 2FJVA 2GAGC 3K57A 1TVRA 4H4KC 4J9UE 3TJ9A 5J2QB 2MDAA 5IZHA 3KLVA 4IKAA 3VAFA 3KLEB 5KFQA 4FF1A 1LW2B 4HEA9 3W63A 2E5LF 4KT0C 2ZE2A 3TQEA 4JI0F 2Q43A 1CLFA 1FRIA 4WTOB 5C24B 3OV7A 1S1TA 2DNLA 3N5BA 4K2XA 3N0VA 3I5BA 3I0RA 4WFYA 4F4YA 1VRQC 2VG5A 2V4RA 1S1UA 2BQRA 3IN5A 3MEKA 2R2UA 2AEMA 3KJVB 4M63A 4ZLPA 2ZJPQ 2AZ1A 3MUVP 3K5OA 1K0TA 5FDLB 4ZHRA 4OJGA 1ZM2A 2YWHA 1LW0A 2BJ1A 2DNYA 4C0HA 3O44A 8AT1B 3I0SA 1Y00A 1RT4A 2IM2A 4I67A 2XZDB 3M9MB 3U1NA 2VJVA 3CJKA 3ILLA 4TVAB 4JI1F 2C2MB 3BSNA 1IBMF 1FX4A 4M95A 4CLPA 1N88A 1IKYB 5HJXA 4NCAA 2JLFA 4ILMA 3CC2S 3CCLS 1WEYA 5HATA 1RWVB 2H3EB 7FD1A 3PX0A 1M5VC 3C6UA 2FB0A 4Q43A 2R7VA 2B4PA 4ZA1A 5HMXA 1V9OA 2OEMA 3ELHA 3IS9A 2B0GA 4ECQA 1F3FA 3JYTB 1KQKA 5KG6A 1LQ9A 4AQYJ 1K0VA 2R9LA 1FKOB 5KFXA 2W7AA 4KKOA 2JJ4D 3M8QB 5CXTA 1XEZA 1G3OA 5K9FA 3IM9A 1VRTA 4WU2A 2M5YA 2HWIA 3KK3A 2EWHA 2J5AA 4HL9A 4CRJA 1VBZA 3ISND 3W5XA 1B7YB 4E0DA 4EK2A 3ZNJ1 2MY8A 4WFBQ 3KHLA 3HVAA 3AAWB 2VFVA 4OX7A 1RP5A 5C25A 2MLXA 2JRSA 4TY9A 1RWUA 1NHVA 5KFVA 3KJFB 4HI2A 3CUNA 2V9WA 2B8QA 3RR8A 4DV5F 1T05B 4I68A 2XCPA 4ED4A 1U0HA 3HJVA 3MMCB 4I7FA 4WKRA 4DV1F 2DR5A 2HHSA 4IH7A 4LRDA 4EMDA 3HHLD 3HPOA 3ZZUA 3LP2A 2GO8A 5E3AA 1TKTA 3KK1B 3MAQA 1RWKB 2XWYA 1H72C 5KG2A 2LEPA 2ATCB 4DCOB 1YI2S 2DPJA 4TLQA 2A1BA 1UAWA 1JKHB 2VA2A 5HMYA 4JYAJ 4RUHA 3CJ2A 1RT7A 4E98A 1HHTP 2AMCB 4JI2J 2W2MP 4JI3F 2ZZNA 3MFHA 1FFGB 5BR8J 3B54A 1CC7A 1TR0A 2OPRA 3Q22A 2XO6A 2Z2YB 3T1HJ 1RLDA 2R8GA 1DAXA 1CQNA 2O3DA 4DQRA 1NMEB 2PA8D 3UN5A 1F5BA 2ERRA 5E0OA 4AL5A 1SVDA 4TQSA 3OLBA 3RU0A 3BPSP 2QIFA 3H59A 1Z4UA 2HK3A 4DL3A 4AD6A 2XG8A 2ZHBA 3GSIA 1NK9A 2ZNYA 2HLTA 2XWXA 3H7HB 4DZ6A 5CCMA 4C8YA 1S7HA 3EVWA 1SIWB 1HWLA 4FXWA 1OJ4A 2HFUA 1VCTA 4EO6A 3GMGA 1FDDA 4DSKA 3WC2A 2HBQB 2VPZB 3PW2A 4G1IA 4M5JA 4PWDB 4JI6F 4IG3B 2GMHA 2POKA 5EDWA 1VQ4S 1F0XA 2DY9A 4OI6A 4A48A 3DNCA 3SSRA 2IYGA 3FEZA 3MEDB 3KLGA 2X1AA 2PFFB 3HZEA 2DGXA 3FCWA 3GV5B 2N82B 3LGMA 1T9XA 2CDRB 4FYXB 2UUAJ 4I6WA 3HVRA 1U7LA 2CNNB 2UZAA 4QU7A 4WU3A 5LMNF 3FDSA 1YBAA 2WHOA 3JSBA 4NLVA 1QAXA 3EJMA 5M2RA 2KT5A 4B3SJ 2VG7A 5KG3A 4FXVA 1TL7A 5EX3A 3CJ5A 2LCWA 4DSFA 2GFFA 1CJTA 4WJBA 4LQ3A 3TUIC 1LV5A 2IC3B 1E6VA 2GQCA 2RMLA 3ZTQA 3TP2A 2ZOFA 2XY6A 1N6QA 3FRZA 4FZVA 3IBCB 4JI4J 1VJWA 5LJ5Y 5F0UA 5ETKA 4QJVA 1VQ9S 2GJIA 3SQGA 2CQ1A 4QIEA 4QPXA 3EYZA 3TUPA 4CH7A 4OZ1A 2Q6BA 4KGZB 1SI9A 1TQLA 4DUZF 5IC4B 3K5PA 2BQ3A 2F9JA 5D4PA 4P74A 3CMAS 1R8PA 4DPOA 2I6WA 3AD9C 2RHQB 1FESA 2G2ZA 3AOAA 4MKAA 3M2RA 3PYDA 1YJUA 1N33J 1HQEA 1FWKA 4P7TA 3OTOJ 4CT8A 1WG4A 4N5SA 3ENQA 1IKXB 3JB9k 2YKMA 2NXCA 1IM6A 4NZ0A 4ZJLA 4KV8A 5ITHA 1B7FA 3DGVA 4LR9A 1SKSA 3LPYA 4DQPA 2CJXB 4YR0A 3V2UC 2UU9F 2MSSA 2O5DA 3HSGA 4JUZA 2FC8A 1HA1A 4K4UA 4U67Q 2VJUA 2LQBA 1UA0A 4IH6A 2F8EX 1X4CA 3OR1A 4AXIA 2MLZA 2V4JA 4IOBA 4RLEA 2X51A 1U1KA 3C16A 2KG1A 3SEOA 1JLCB 1SJ1A 1WTBA 4KJIA 2HPUA 2R7RA 4UY8T 3ETOA 1SC1B 4DL4A 3OJUA 5KFDA 4I2QB 4WIQA 1HMVB 1P6TA 2FJEB 4ZKAA 1FJGF 1ICEB 1YBUA 1MN9A 1NPKA 1PBAA 2I5JA 3CC7S 2NR0A 2HRYA 2C3YA 4C48A 1KDNA 4KYZA 1PBUA 2WB4A 5AXMA 2DK2A 3QATA 2KB2A 3W5YA 3BO4A 4DL0C 3KK2B 5KFBA 4LF9F 4K4YA 4IUFA 1R7IA 2LLZA 2ZBRA 5JXSA 3G8TA 3GFHA 5E3CA 2V68A 1HYSB 2KN4A 3BBBA 2XMVA 3T6JA 2VD3A 3R7BB 3UQSA 2MHNA 3AD7C 2C3OA 4Q7AA 2KDOA 3IR7B 4ZPTR 2BQUA 3QWPA 4FYDA 3B4MA 3DOKB 5A2QY 3PG9A 4EBCA 1S4EA 2YPYA 4J9KA 4ID5B 2VDIA 4YQWA 3UN2A 1WSVA 1I6JA 4X4TA 1WG1A 1UJ4A 2ZDOA 2Z57B 4EO8A 1IR0A 2RRBA 4YR3A 3TVKA 3BGOP 4CYUA 4I2PA 4QZVB 4DL2A 2PMWA 2WK4A 5GMDA 4TY8B 1UEKA 4HH0A 3QGHA 3QLHA 2C22A 2D1CA 4ETXA 3UN3A 1ITPA 1CJKA 3TVZA 2RD5C 3VV2B 4HYKA 3TAMB 5KG0A 4CH0S 2KZMA 2QYCA 3W9JA 3UDEA 2D9PA 3KDOA 1V6HA 1IWGA 3DMJA 3MMBB 2BE2A 2P9EA 3A3NB 2CQIA 4ZITA 2ZVIA 2VG6B 1WF2A 2DVIA 4NEZA 1U1NA 2QMXA 2XMUA 4GO7X 2VFSA 2CQBA 4DL5A 4Q0BB 2KJWA 5I42A 4OYAA 3KLHA 4JV5J 2PN6A 2Y1LB 5GAHI 1WOOA 1GMUA 5B0EA 3DRRA 2R8JA 1HBMB 2RRNA 4USTA 5FD1A 1KVJA 1PAEX 4YY3J 1AUSL 1Z1ZA 1C2PA 4OYWA 3EICA 3VWSA 1CVJA 3D6TB 2IPOB 2O66A 2ZBQA 4NXNF 2C2ZB 3IRXA 2R42A 4QWEA 3QIPA 3IP0A 3MM6A 1HPZB 2AYMA 2NCKL 2DPIA 2H5IB 2DR9A 3CE8A 3RB6A 3GP9A 3VCDA 1S9EA 3VAGA 1UWAA 3SDEB 2I1RA 4LRCA 4F36A 5H9FK 2JEGA 2UVVA 2D69A 3D1OA 2MGZA 1VIXA 1X5SA 1JLAA 1WI8A 2CPHA 2WONB 3R3TA 4TYBA 1NKCA 2RH3A 5JVHQ 3H98A 5IOLA 1V3SA 1N32J 3CT9A 1R3NA 2O67A 2F7VA 2V67A 1Z2ZA 2Y1JA 3BO3A 1JWWA 2LECA 5DG9A 3A12A 1EIYB 2GV1A 3BSOA 2NXUA 1MWZA 1KR4A 4YR2A 2BM1A 3Q24A 4OX9F 2ZEJA 1X4EA 5L8RC 2HQ3A 4DFJA 4P75A 5J1EB 1C1CA 1OY6A 1EZZB 3DRPA 4PPDA 1JXEA 3QO9A 1J5EF 2DNPA 2HURA 1JJCB 4L6V3 4N8OA 3T9NA 3DOLB 4C7QA 3QSYB 4J9LA 2ZHOA 1KFDA 5A6PA 1M5KC 2AGOA 4R8UB 4ICLA 4F4XA 4WFXA 2D9OA 4C4WA 3WC0A 4W4MA 2YWKA 4NI2B 2MZTA 3LO3A 1ZM3A 1VQOS 1NZ8A 4DMZA 1VRUB 3EGZA 1AZSB 4X64F 5HLFB 4M5IA 4NOHA 1XMOF 1RT5B 1YITS 4OIXA 1HBUA 3A8KA 3BBFA 3W2VB 2R4FA 2RS2A 1IBLJ 4GVBA 4R0JA 3P45B 4ZCMA 1MWQA 1S0NA 4N7TA 4D3HA 1FVSA 3T5JA 4OI4A 5KT5A 1P1TA 3B78A 3GWCA 1YK9A 1S0MA 4NX9A 1GX6A 3HT0A 2GHVC 1NK8A 1VGYA 2AJ4A 2W8LA 4B08A 3G6VA 4P71A 1RHUB 2DNQA 1RAFB 2W25A 3R5GA 5LL6d 3AXMA 1MMLA 3L95X 5KOXA 1IR2A 1TKZB 3TA1A 2XMKA 3ZC4A 2R2TA 2EKNA 2HWTA 2XMWA 4HH1A 4LSNA 1RT3A 1TAUA 2XEXA 1RUSA 3FVYA 1RTIB 4R25A 2I2YA 2XMAA 5HP1A 4DXLA 2JFKA 3EPGA 1QAIA 1ZPVA 3RAMA 1K44A 2PT0A 2M8HA 1Y5LB 1U25A 1UWBB 4PABA 4BLGA 4LF5F 2BOAA 2IY5B 2LU2A 4ZP6A 2E1PA 3KMQA 4I64A 1KHWA 3AQOA 3JS9A 5CYMB 2QC3A 2Q79A 3CCMS 2IMWP 1PIEA 3AQPA 1DTTA 1R8AA 5LMUF 4DFPA 2JFDA 2GMJA 3R9LA 3FK4A 2CJKA 4C11B 2VQFF 5T41A 3QZ8A 2J0QD 3BF4A 3LANA 1IR1A 3AOBA 4MKBA 1BQNB 5FLXU 3MFIA 3ZXWA 2OP5A 4ZP7A 2X1BA 1HW8A 1U02A 4B9SA 4LFCF 3D1HA 2ZD1A 4N56A 4USWA 2PC6A 4KPYA 3KJQB 3W66A 3DI6B 3P4UB 4ZVRB 1I1GA 1RT2A 5D0EA 4USJC 1VBKA 1GTEA 2OLWA 4DV6F 4WIIA 1GNKA 2KJVA 2A0FB 1ZAWA 1NHKL 4URQU 3P5TL 4ELUA 3AT1B 3KMSA 1VK8A 2RKIA 2RHSB 1NDPA 3T9ZA 2OPSB 5J2MA 2AQ4A 3LGHA 2RQCA 2NYHA 1EHWA 2XTJP 3NL0A 4O23A 3BGRA 3C66A 1AA1B 1XNRJ 4RW6A 4GKKF 3VR1A 4J9PA 3GJSB 2V63A 1TUGB 3A8IA 5DO2A 4WYLA 3DLKB 1D8ZA 1C0TB 3CC4S 3KHGA 1RXOB 1WC1A 3RG6A 3V6JA 1IXKA 3M8RA 1NH8A 4KFBA 2HNDA 3HSJA 2ZH4A 2YTCA 4HHJA 2W9AA 1G2EA 3PO4A 2CNKB 4QPTA 1S9GB 1D9FA 3QNWB 3U27A 2WRMA 3IG1B 2HAIA 1JQGA 3JQMA 2HHQA 3RR7A 2GGPA 4NE9C 1X5OA 3ITHA 3R5AA 3RJMB 1JNZB 3PR5B 1ELOA 1YRTA 2L41A 1RAIB 3HVTA 2DGOA 2YKQA 1S6PA 2R7TA 1M5SA 2ZJRQ 2AJ2A 2IDLA 2LMIA 2OJ3A 2W2NP 3FSXA 3N79A 1YJ7A 4IQMA 5KFEA 3EXYA 3AB2B 9RUBA 3JAMY 5RUBA 3CCSS 3BKFA 3EMTA 3C6TA 3CMQA 3QFWA 1Q8LA 1GH8A 2LA4A 3JTNA 2RS8A 1HBOA 1Q7YT 1RISA 3SMZA 2DCLA 3CJRA 4QIFA 5C42A 1E6YB 1RAAB 1MU2A 2KFZA 4FKXA 1M90T 4FN5A 1N34F 1BHNA 4LFBJ 5DQGA 3D2WA 1FRHA 2EFGA 1BGXT 4MIWA 2JDJA 2ZZMA 1JLBA 3HP6A 1HARA 3S01A 3HX9A 4DPTA 2EVZA 1Q7LB 2JLGA 1NPRA 5LSOA 3THTA 5IM0A 1Q8KA 1NH7A 4OYBA 4A8QA 3OVAA 2G0IA 2GO9A 3MMAB 2HIQA 2JX2A 2WTFA 1S9FA 2K1RB 4CNYA 3UDVA 4CLTA 3L7OA 4WE1A 4B9LA 2BX6A 4ZOSA 1VBYA 2XLJA 3E01B 4UT4A 4IOAQ 1S1WB 2M70A 4IG0B 3CTRA 2DNMA 4DR5J 3F56A 3OT9A 2EC0A 2UUCJ 1LFWA 4YHHJ 2Z58B 2YWFA 1U2RA 1RTDB 3FRYA 3PTWA 3CJSA 3Q8PB 2BA9A 2WVEA 1S7IA 4ZLLA 1FO1A 3ET6A 1XQIA 3N9UC 1AFJA 3SV3A 3K5MA 3A8EA 3R6GB 4D3GA 1JIHA 3NLCA 2CFXA 3O1LA 2IRYA 1HBNA 2Z8QA 2C2OB 1D9AA 1TL1B 2E5LJ 2QYGA 2MQNA 2IJNA 1SQGA 1P8GA 4JI0J 2OHDA 3SBMA 4DL7A 4GRSA 4OLPA 4NLRA 5KT4A 4L76A 4X4PA 2JWNA 2B6AA 2G2OA 5SZTA 4CI0B 4FVCA 3CDAA 2A6OA 1VDHA 3Q8UA 3T1YF 4B17A 1KSPA 3HHLB 1YRUA 5F8JA 4LSZB 3L3CA 4J9NA 3MZIA 1HNZJ 4RNNA 4NLWA 3RYLA 2HGNA 1DFDA 3M05A 5MLCV 1S99A 3EVMA 3PY8A 4G1QA 3DLLQ 1GTHA 5H9FJ 4ANEA 3NWRA 1U1MA 3OR2B 1UEVA 3C14A 3MHYA 4JI1J 1YJRA 4Y2AA 4DQSA 3IWNC 1T3OA 3P8BB 4EBDA 1SC6A 2DTJA 1JLFA 1DLOA 3WX8A 1SBRA 1VQYA 1UZHA 1LNQA 2AJ0A 3QT7A 2WVFA 2IAJB 2CZ4A 2OMLA 3BQ1A 2KTQA 1SUQB 4C0BA 1XMBA 2F9DA 2AF6A 4ED6A 4Y65A 3EZ5A 4FNIA 4OZ5A 1ZYQA 5D8HB 5F8GA 4U9RA 2W2PP 1LW2A 1YQHA 3RW7A 1Y0HA 1Q8BA 3KLIA 5H1SV 1T9WA 3W60A 2QL5B 3FEXB 2RIJA 5K8PA 3D6HB 2OEKA 3NCQA 1WKKA 1VQ8S 1HQ2A 3KJVA 3HHEA 1LKZA 3W5ZA 2W9BA 4RKUC 5FDLA 2ZJQQ 4J9MA 4X84A 4USHA 3I4PA 4NLOA 5H9EJ 3HHKA 3V4MA 2WOMA 2RQ4A 5HI7A 3PIOQ 4DV5J 2XQCA 1U47A 5AE3A 5HJYA 2AT1B 5C2CA 3PNIA 3CIZA 2KHCA 3MM5B 3NGUA 3M30B 1SB6A 3K89A 4RU9A 4DV1J 3BKTA 4TNOA 3UCGA 4I6AA 1QVGR 2QT7A 1IKYA 2IIHA 2W24A 1FRXA 4TU9A 3WZ0A 2W9CB 3CJ8A 1P9QC 4UUWA 4LRFA 2DRBA 2UVUA 1A0OB 1HNWF 3BGUA 3M8YA 2VICA 4I56A 2CWKA 4FBTA 3JYTA 3SSQA 2HZVA 3DLGB 1X5TA 1M1KT 1F60B 5GAEI 1FKOA 2EC2A 1N5TA 4U96A 3M8QA 3U1LA 2QO3A 2V94A 1NCLA 3M2UB 4CM0A 4MKYA 2K7JA 3CDEA 1TKDA 2DY1A 4TQRA 4KQZA 3GJQB 2AYGA 1SH0A 1UCNA 4PXEA 2J9CA 3PZPA 1XWLA 1ZZNA 2CJAA 2JC0A 4C8OA 1JMTA 1B64A 2NPFA 2DH9A 2R7WA 5IQ6A 4Q2LA 1Q1KA 4J90A 3OSNA 1HIYA 3BR9A 5A8KA 1DZ5A 3CWJA 2OTJS 3KKFA 1EKSA 3DKDA 4RW8B 3W9IA 2VFTA 3I55S 3CD6S 4C98A 4FBUA 3RZAA 4ATNA 4PEOA 4RL1A 1T05A 2FGCA 2PEBA 2ASLA 3FKBA 4C9DA 1KTVA 1KC8T 5KFZA 4QWDA 1KLNA 2YY3A 1NJWA 4I0WA 2QMUB 3C3LA 2PMZD 2YXLA 2AJQA 2OGUA 3EPIA 4ECRA 3KK1A 4YB7A 2A6MA 2RT3A 1ZH5A 3VF0B 3MXHP 4DX7A 2M3DA 1KEKA 5C5JA 1LXJA 2RQKA 2FY1A 4DZDA 1D0EA 2EXUA 4ZVGA 5DRKA 4DR2F 4RW7B 3G96A 1UVLA 2F4VF 3G8QA 5LMNJ 2R3VA 4H54A 2CJQA 1I51B 4ZJOA 4C0OC 5IQQA 1S6QA 4JI8F 4B9VA 2J0XA 1VC0A 1RA7A 3GB0A 2DT9A 3MGJA 4X4UA 5ETRA 4X66F 1XNQJ 3NNHA 2J9EA 3W61A 3NOGA 4DU7A 2UUTA 3V81A 2HGMA 2DJWA 1KVKA 1UJ5A 5E3QA 2WVBA 1VJQA 1WHXA 3KOAA 4YB1P 4QIWD 3L7PA 4DUZJ 3D1QA 1OQ3A 2MQOA 4KH0B 5HQLA 4RNMA 3THPA 2CQ4A 4J91A 2DXDA 4ZCIA 4IG3A 1XC9A 4U6PA 2Y9HA 5A0YA 1RTHB 3CD0A 2IBKA 3HSDA 4KHPJ 3FSYA 4KSEB 2JEIA 3MEDA 1XMQF 1JX4A 3SIPB 2JNJA 2P2CB 2UU9J 1J2VA 1N5YB 5HMWA 5IC6B 2WCXA 3KUEA 5HL7Q 2ADCA 3F44A 5G0RA 4CO2A 2GX8A 4OZ2A 2V2ZA 1N5SA 2IM1A 3GCXP 4U95A 4A8MP 5HN0A 5E3RA 3GZ7A 4E2FB 2UVWA 2SXLA 4ZPCA 3SCIE 2OPQB 3T5KA 3PW7A 1FA0A 3B82A 4OZ0A 2E9ZA 1S10A 1F3VA 2UVRA 1F2HA 2IC3A 2RU3A 4DV4F 1NSQA 1HW9A 4PAAA 3EM1A 2CG8A 1FJGJ 4C97A 4PQAA 1HR0J 4UW2A 2LQ9A 3MPVA 3VAMA 4RUCA 1FRJA 1UP1A 4K50A 4LIRA 2IJRA 4DU8A 4URSA 1RAEB 2HNZB 3RBXA 4LF9J 1FRMA 4LUBA 1M5PC 1CSJA 2W01A 1Q0NA 2XNQA 1QUVA 2H48B 3PFEA 4NCBA 4OYMA 4LF6F 2HZCA 3FBBA 4XTTA 4ZLNA 3M2VB 1IKXA 2OH2A 2GVDB 4NA2A 4P72A 3HLUA 2G4BA 1YVFA 5CYJA 3M32B 2BW7A 3U1MA 4WXWA 4TU7A 4DLEA 2XS5A 4JV2A 2VPWB 1KVIA 4DR7F 2R8HA 1HWUA 1IKWA 2FJDB 5E3PA 2NXJA 3LA0A 3NAIA 1U4BA 2FC9A 2PD1A 4O3PA 2WW8A 2BE7D 2MQMA 1OWXA 4F0MA 2BYCA 2VPYB 2F5GA 3MAAB 1JLCA 3HZGA 4C8MA 5E33A 5DM7Q 2GAHC 4IO1A 1FE4A 3SFGA 3R8YA 2PE8A 5KT6A 1R8HA 2KXHA 4I2QA 2V8HA 1HMVA 5LSLA 5LJ3Y 1EQMA 1BQMB 1P9YA 3JTOA 2DH7A 4QQBA 1NUEA 4YN3B 4WYWA 2JEJA 2XMTA 2GZOA 2MEWA 2KXFA 5K14B 5JUMA 1TK8A 4K5SA 3I4HX 1KN6A 5ETNA 1VQ5S 3I6PA 3KK2A 1WUUA 3MCSA 2XZTB 1VISA 4IR1A 3RW6A 4J37A 1HYSA 4HDGA 3ZTOA 3IWLA 3C46A 4NLYA 3H2UB 2PEHA 2MY7A 1M5OC 5EWEA 4FNHA 4RJVA 2UXCF 3JQKA 3I9V9 3GTYX 5GAGI 1RLCL 1TK5A 1VLYA 3DU6A 1IKVB 1FKPB 3DOKA 1SXLA 4WKYA 2PFDA 2HMIB 1WHYA 4RWWA 3ILJA 3M8PB 3PW0A 4ID5A 1WSRA 3DRXA 1EETB 4NXNJ 3OHAA 3M8ZA 3FQKA 3QRQA 1S1TB 1IQTA 2VQEJ 1AXQA 5IWAF 2ASJA 3HJFA 4X4QA 3T19A 3UO0A 2JLEA 4JBCA 1IBCB 4HACB 5KG4A 2FTRA 3G6YA 3SSSA 1FRKA 4TY8A 3J7YI 4AL7A 2EEYA 5IXUA 4ZHRB 4B3RF 1C0UB 4PG4A 2IHR1 4DQIA 1UKUA 2VIHA 2QJ3A 1CJUA 3R7NB 3ZZPA 2CQCA 3H8YA 1MW7A 1NXIA 2W4DA 2BKNA 3RUBL 3ZZ0A 2K3KA 3J7ZT 4FDFA 1I94F 4ZDNA 3UWTA 2VG6A 5IT9Y 1YLXA 5DDOC 2X7IA 4TLRA 2RB7A 3QJPA 2QA4S 4OX9J 3JSYA 4K0KF 5KFAA 4Q0BA 4DFKA 2E44A 2FZCB 3TYTA 2DO0A 3R2DJ 4USMA 1Y4ZB 1U49A 3Q2TC 3W64A 4R5PA 2CPIA 3IM8A 4MKVA 3AJDA 4ECYA 4NCGA 3CCQS 5CD4A 2BJEA 3B6BA 5ETOA 2MB0B 4UZBA 1TKXA 3Q2SC 4OQJA 3TA0A 4UOGA 2ZHAA 1TTHB 4I4BA 4NA1A 2BABA 4WZMA 1CULB 2DH8A 4DEZA 1BMQB 1U1RA 1EX8A 1HPZA 5IV3A 4BWMA 3BYRA 2C3MA 2B9EA 3MPWA 4X64J 1CBKA 3PVXA 2HHHJ 4MIBA 4ZVPB 4ED1A 4PQUA 1XMOJ 2V34A 1WC6A 5C25B 1HHSA 2ZVSA 4ECUA 2ILZA 2MKYA 1JLQB 1RCXB 5BYQA 3MECB 3V4IB 4H4OB 5KT2A 3Q83A 3PXGa 2Q1LA 3TUJC 4CH1A 1RB0A 1U0HB 4LR7A 2KYXA 1GXTA 5F3ZA 2NS1B 1RAGB 4HKQA 4LT6A 3PRVA 3THVA 1DHMA 2ZKUA 1U1OA 6AT1B 3NNCA 2HFZA 1AW0A 4H4MB 1R6YA 1RWOB 5HAOA 1BXNA 2ZC3A 1S4FA 2J76E 3HSZA 5J1EA 2FHKA 2V8GA 2E29A 3SFUA 2MZSA 2RUSA 4PCQA 3J81U 2AJFE 4TYAA 4XIUA 3DOLA 4KC5A 1WKLA 2X3GA 3SCKE 2KHDA 1FVQA 5D3GA 1K8AT 1HL6A 4ECTA 2V69A 4PWUA 4R8UA 4ZPAA 5HQMA 2HFSA 2KFNA 3EXCX 1NM2A 5KOWA 1OS5A 4RZRA 4LF5J 3K5NA 4NI2A 2HQDA 2VBWA 1VRUA 2MHEA 5HLFA 5CZVA 2F65A 3ILIA 1Y3JA 1RT5A 1RWXB 4ECXA 1TL5A 3W2VA 1CPZA 2VQFJ 4V19X 2XI2A 4J9RA 3BBCA 4EI2A 4LFCJ 2OKQA 2ATLA 2FHJA 3CD7A 1X4AA 4AUKA 3I56S 3VZHA 4IO9Q 1SC3B 4PXCA 4ZPVR 3P49B 1X9SA 3DU5A 1TL3B 1TKZA 3MOZA 1UVIA 1OY9A 1W2BR 3TQ1A 2MQQA 5ETQA 3EUNA 1FNXH 4O3SA 2WVCA 1IVZA 2H5EA 2V5HG 4RW4B 1RTIA 3T1HF 1ZA2B 5DZ7A 2GIFA 3OL6A 4LF8J 2Y0SD 1UWBA 2C2NA 1B4SA 3CEDA 1NB2A 4Y3CA 2ZDPA 1E6VB 1PJ6A 5IT0A 3OJSA 3GFXA 1B0TA 5HK4A 3N6MA 5GVQA 4DOZA 3C2PA 4B3OB 5CYMA 5D78A 1R89A 3O3LA 2C2KB 3ENAA 2LKZA 4C11A 3NMAA 1Q95G 2X1GA 4N76A 3CDBA 3MM8A 1A6LA 2ZH2A 4YP3A 1JJ4A 3VQSA 3M6XA 3ZZOA 1U8WA 3A13A 1YJNS 3MUMP 1R27B 3OUYB 1HQEB 2J6UA 2HBRB 4DHVA 1VQKS 4ED2A 3BQ2A 4YOEA 1REVB 2YKMB 3LWMA 2MQPA 1U48A 4I6YA 3M6UA 2YX7A 3IBWA 1CEZA 1N5QA 2GIRA 2GCFA 3RAXA 2OPSA 3DLEA 3QJJA 5KAKA 2EBEA 1U6ZA 2PIIA 3OR1B 1MNEA 2WW4A 4C2MA 5HO4A 4X4OA 4EZ9A 1NK6A 3C16B 3Q8SB 4B3SF 1G6BA 2XGQA 2RDJA 3ULHA 4Y34A 4X4RA 1LWXA 3FQLA 2B7BB 3DLKA 1XIQA 1GFWB 1U45A 4WFZA 4PYAA 5F8IA 2MJUA 2F63A 3P5BP 2J0SD 3E3XA 2UXDF 4X65F 1U1PA 1S9GA 1U2FA 3FFIB 2HVHA 4DX8H 4K4WA 3MR5A 4OYXA 2HBZB 5GMKa 1KS2A 3LF0A 4X62J 4RWXA 2H5JB 2KVIA 1RSCA 4OHWA 3G6XA 2VC1A 3GJRB 2PDAA 1N33F 2ILYA 4YDDB 1VQLS 3LH2S 3CGIA 4NYZA 4RW9B 1CS4B 1KRPA 1YTYA 5KFSA 2YWEA 1ULRA 5F8NA 1RTJB 1GMVA 2AX1A 1B0PA 3TJ8A 4DR3J 1FX2A 2VOPA 3PW5A 2JOQA 3QT8A 1H2UX 2N3OA 2HHVA 2D74B 3FZBA 1E6YA 2R8KA 9ATCB 3A3PB 5L1KA 2VOOA 3JSRA 2J7KA 5LXYA 1SL2A 2J7WA 2YWGA 2CG4A 4Q45A 1ZA1B 3DGPA 2XYPB 1X4GA 3X3UA 1R0CB 1HNXJ 2UXBJ 2HVZA 4ZVFA 1VOMA 3JTPA 3KG4A 4A46A 1M1HA 4PG8A 3OD2A 4DI6A 2IM3A 2XLKA 2FUG9 4XDCA 4K4TA 3AXKA 3ZZZA 4C3KA 1CJKB 2M9KA 3IBFB 2RILA 2J7UA 2CVEA 3MMAA 4ES2A 1R31A 1OYDA 2K1RA 4FXDA 2NLWA 5FJ4A 3OHBA 3DMJB 4DBQA 2BE2B 3R97A 4XK8C 2DBBA 3CCES 5EN1A 5E7OB 2VB6A 3E01A 3CO0P 2AP6A 4CTAA 4ZJQA 4XDDA 4IG0A 2KZZA 3K0JA 4ZIVA 1FNMA 3R1HA 2QEXS 4OYIA 1RTDA 2HSEB 2ABYA 1Q81T 4GC6A 1H38A 1RHJB 5I42B 4KY3A 3VTIA 4F4ZA 1UA1A 4B02A 2XSFA 3ZNUA 3J7AN 2H54B 3M4XA 3R5CA 1L3SA 4DV2F 1PO6A 3N6NA 4KO0B 1TU0B 4NRTA 5CD4H 3K7RA 5HVFA 1RWWB 3EGVA 3ZFVA 3Q8RB 4KE5A 2BJ8A 1F9FA 6FDRA 4MFBB 1TL1A 3NXZA 2QLXA 2YNHA 2F40A 4B3TF 3CPWR 3TZZA 4OYOA 3OTEA 1BY9A 5A8RB 3BM7A 2Z2ZA 4QR0A 2EBGA 1BC6A 3T1AA 4ZPBA 3KNAA 2ACMA 2FYXA 1R0AB 1RKIA 3GG1A 2O01C 3S8SA 4ANDA 2RQMA 2MGZB 3C15B 4R0EA 1LK7A 1S1VB 1SJ4P 4DV0J 1UPMB 2YNIB 3MI7X 1JXVA 2I0XA 1F5CA 1C4CA 2QE5A 3PYFA 4OFZA 2HHTA 3PR4A 3US5A 2CQHA 1JNRB 4EEYA 4AYBD 1V3RA 4ECSA 2KU7A 5ADZA 8ATCB 4DR1F 3H0PA 2Z56B 3BGLA 1Q53A 1XK8A 2W1BA 5EWFA 5I3UB 1N52B 3DRPB 3KNGA 3TX8A 4DR6J 4F67A 3GU0A 2B9WA 4UY85 1ZTWA 2VDHA 1Y7PA 5E5NA 5U47A 3BSAA 4YY3F 1FXDA 2IMOA 3HULA 5LSRA 4CDIA 4U7UD 1D9DA 2DGSA 3I31A 1VMBA 3GJTB 2FJWA 4NYPA 2HBYB 3BKUA 1WF1A 2DNOA 3HKWA 3MF5A 4NLXA 2IDEA 4NZ7A 3MM9B 3GONA 5T7LA 1N48A 5GAGU 2IVFB 2NZ4A 2WZ1A 4OI2A 2DGTA 2XYGB 2GVZB 2M52A 4C3MA 3I82A 1APSA 1GT8A 1OPIA 1S0OA 3H5YA 3D4JA 1VYAA 3KUGA 4FS1A 3OQ2A 2GMLA 3MEEB 3MMJA 1RT1B 2APOA 3OL9A 5J2NB 1SQEA 2XGPA 4J9SA 3CCZA 1F9HA 2KH9A 4FPIA 4X4NA 3QPIA 4WWSA 3PRDA 2F4FA 3OVSA 4HHHA 3J7YU 4PG5A 2BEFA 4ECZA 1H7WA 4GKJF 3FMBA 1KTQA 5KFYA 1YBTA 2W9CA 4CZCA 5AJ3F 2KI2A 2QL7B 1VR6A 1NDCA 2YX1A 1H2TZ 4ES3A 4DR2J 2C3UA 1TP7A 1FT8A 3DLGA 2L9WA 2F4VJ 1T9UA 5HP1B 2JH3A 2J9DA 1T7PA 1B70B 3UVJA 5DLGA 4KGVB 1WG5A 2OFHX 1OSCA 3CIMA 4CWBA 4M5GA 1U6FA 3M2UA 3LUYA 4OI0A 3HXMA 2BANA 1EQ0A 4JV0A 1FKAF 3K8WA 1OY8A 2JL9A 2AEJA 5F41A 2G0CA 2ZBPA 1ZM4A 4O3QA 3W7BA 4BHQA 4F50A 4BWJA 1IBLF 3QBCA 4ZK7M 2GJFA 2HVDA 5HVGA 1RHRB 1KONA 4DWIA 4K5RA 3DOMA 1TL4A 4ZS6A 2LEAA 1IM4A 3NGTA 3MAHA 3OXFA 4NXMF 2G9OA 2ZD1B 3NP5A 3M9NB 2QL9B 1WELA 3CDUA 5DGBA 3A4TA 1W7WA 3EZOA 3MCMA 1FERA 4GO5X 2BXJA 3M8SA 4CP5A 1IJFB 2V8PA 4OL8A 2B56A 1FJEB 2HHPA 2XSJB 4Q8EA 3QYYA 3UFCX 2PI4A 4MK8A 4IH5A 3R6LB 2XZWA 3BR8A 1UFKA 1PYTA 3HF5A 4K4SA 3TRGA 1TUVA 3I5AA 4QR1A 4RW7A 2ZH8A 2RDIA 4LIWA 5HVHA 3M9OB 3LALA 3HKZD 4RUAA 1S6UA 3NWGA 5CZXA 1RADB 5A8WB 2MLYA 4F8RA 3BJYA 2OD6A 3ISNC 4P2SA 2XY5A 1NHUA 3RBDA 4O0IA 3J81j 3N28A 5A76A 4ZLJA 1RAHB 2N7CA 4DV4J 2FLNA 4F3QA 3TA2A 1OQ6A 3O5TB 3H2VE 5KFTA 4ELTA 4NLUA 2BMBA 4ZN3A 1X60A 1SJ3P 1PC4A 2VHGA 3MDFA 3NGDA 5DZ6A 1X4HA 5KFUA 3CXCR 5KTQA 2MYFA 4JI7J 2A2DA 2FVPA 2P6SA 4UUXA 3TEGA 4PR6A 3GIKA 2R7SA 4A8KA 3R7SB 2JVRA 3HHLC 2QLJB 3T41A 4PKDB 5CYQB 1NNDA 1HBOB 1RTHA 4ZIWA 3RRKA 3J80U 2V4QA 4JV1A 2DHGA 4TN2A 2Z4PA 4OV1A 1HNVB 5ETLA 2EI5A 1IWAA 2RRAA 1N5YA 5GMEA 3D68A 3OL7A 2VU5A 4DR7J 2L3MA 2FHJD 5F8LA 1FWPA 2XCAA 2ZH1A 3DM2B 4F04B 1XR5A 1AYEA 3MCOA 2XY7A 1PYOB 2ALZA 2JEFA 1S6OA 4V1Ak 1N54B 3K5LA 3GR1A 2CPEA 2OPQA 5IM0B 1NJZA 1DTQB 3DYAB 2OSQA 5THWA 3ETMA 4ZVEA 1WDDA 2QLBB 1L3UA 2FJAB 2B4VA 2Y1IA 3QRPA 3W2WB 4WE1B 3TUZC 2GQ2A 2P8IA 1TELA 3N6LA 2MMYA 4KHMA 4KRWA 5KFFA 3CB4A 1ACMB 2MZ1A 2RVJA 4NLQA 1Z2LA 1D8YA 3HHDA 3C19A 2Q3PA 5HBMA 2AGQA 2HNZA 3UCZP 2WVDA 3SZ2A 2N3LA 2ADBA 2Z30B 3M1VA 3NGSA 5CCLA 4DFMA 1RT6B 2QN6B 4YEAA 2ASYA 3M2VA 2P9CA 2GVDA 4DPUA 3IRWP 5M2UA 2XLIA 2W7OA 1WTFA 4EBEA 2ACYA 4HTJA 4LRBA 2ZM6J 1SQFA 3M32A 2G1HA 4F2RA 1DJ0A 2YWWA 4P7VA 3OXLA 4NASA 3GIJA 4L75A 4A47A 4LFBF 5FLXY 2XO7A 2HEKA 3I5CA 4WTYA 5DM6Q 2ZH5A 5KFJA 2NQPA 2DHHA 2GC8A 2FLPA 1RBLA 4A8SA 5IWAJ 4QW8A
chains in the Genus database with same CATH topology
1T3NA 1GXLA 2HZCA 1FD2A 1SH2A 2ZOFA 4MIAA 2XY6A 4JYAF 1N6QA 4CO3A 2VBYA 3M2VB 3FRZA 1IKXA 4FZVA 2OH2A 3BB5A 4ETZA 3CULA 4NA2A 3OFHA 4JI2F 1VJWA 5LJ5Y 2YH1A 5F0UA 3TVYA 4QJVA 4XAKA 2AYEA 1VQ9S 4IOCQ 3CF5Q 2HS0A 1RYSA 2GJIA 3AA9A 4RNOA 3HLUA 4A8XA 3GIIA 2G4BA 3SQGA 4AXJA 1YVFA 5BR8F 2CQ1A 2YNGB 4QIEA 4QPXA 5CYJA 3M32B 3KHRA 3Q0AA 3U1MA 1TFYA 5F9NA 3CVKA 3EYZA 3GR0A 4WXWA 4CH7A 1JLEB 4TU7A 1RYRA 1BQMA 4DLEA 3SYZA 1QVFR 4ZP8A 4Y2CA 2XS5A 4JV2A 4OZ1A 2VPWB 1KVIA 2Q6BA 4DR7F 1SI9A 1TQLA 1UW4A 2VG7B 2R8HA 4DUZF 1HWUA 1ROFA 3FCHA 1S0VA 3K5PA 3GSDA 3G71S 2BQ3A 4WFNQ 2F9JA 1XERA 5D4PA 3CMAS 1R8PA 2QMWA 1IKWA 2FJDB 4DPOA 5E3PA 5KFKA 2CPXA 3GYNA 2NYIA 3NAIA 1U4BA 3QGGA 2MKSA 1FESA 5K14A 2LQ5A 4WXOA 2FC9A 2PD1A 4MKAA 4O3PA 2WW8A 3M2RA 3G4SS 1U26A 1YJUA 2MQMA 1OWXA 1W25A 1HQEA 2BYCA 1T03A 2BV3A 1C4AA 3CJ3A 4P7TA 2VPYB 3OFFA 4CT8A 1AUDA 1WG4A 2QA2A 1JLCA 1NU4A 1OSDA 1UFWA 3HZGA 4OJ1A 2Y1RI 4C8MA 4N5SA 1N6QB 3ENQA 5E33A 2I9SA 1IKXB 4OJHA 3JB9k 5DM7Q 2BW2A 2YKMA 3X1LB 4IO1A 4NZ0A 2FVCA 1FE4A 1HNIA 3SFGA 5L1LA 1DLOB 1YGYA 2PE8A 4KV8A 4O3OA 5T7LB 5ITHA 5KT6A 1B7FA 3SQGB 5GAEU 1R8HA 2KXHA 2UP1A 4I2QA 1SKSA 2V8HA 1HMVA 2VUGA 3LPYA 5LSLA 3HMJG 4DQPA 2MKIA 4YR0A 5IT4A 5LJ3Y 3PKMA 2B4OA 1LWEA 3V2UC 1BQMB 2WBRA 2MSSA 2UU9F 3MPYA 2O5DA 5F3TA 5K8NA 5KG7A 3JTOA 1L3KA 2FC8A 2G13A 1HA1A 2EFQA 2IRUA 2XHWA 5K5MA 4JUZA 4K4UA 4U67Q 2DH7A 2F1FA 2GIQA 4LVOP 4MK9A 4IQXA 2LQBA 1UA0A 1FHTA 4QQBA 4IH6A 2F8EX 2RE1A 1GX5A 5MAOA 1BQNA 1X4CA 1SKRA 1PSDA 4DV0F 4WYWA 3OR1A 3SV4A 2F8HA 2XMTA 4AXIA 2JEJA 2LU1A 1IKVA 1YJ9S 3GILA 4F4KA 4V19J 2FVQA 1FKPA 2KXFA 5B0AA 3SXLA 5DJBA 5K14B 5JUMA 2F3JA 2AU0A 3M2RB 2IVYA 4TKTA 2V4JA 4IOBA 4K5SA 1UEUA 3I4HX 4RLEA 2HMIA 2CZVC 3DCAA 2X51A 1U09A 1U1KA 1T03B 3DI6A 1KN6A 2KG1A 3D54A 3M8PA 1S49A 3SEOA 3I6PA 1VQ5S 1JLCB 2E5HA 1NJXA 1SJ1A 3H40A 4ELVA 3KK2A 1WTBA 4KJIA 3KLIB 3RB0A 2WB1D 3MCSA 2C42A 1EETA 2HPUA 2CKWA 2HGLA 2R7RA 3DLHA 4UY8T 3ETOA 3CD5A 2B51A 4IR1A 3RW6A 1HNIB 4DL4A 4J37A 4KV8B 1HYSA 1FDAA 1EP4A 3DHXA 4HDGA 2XC9A 5KFDA 3OJUA 3IWLA 7FDRA 1DQ9A 4I2QB 3C46A 3NS5A 4NLYA 1HMVB 1P6TA 2FJEB 4CT9A 2I8EA 3H2UB 5D4LA 3DRSA 2PEHA 2MY7A 1M5OC 3FZ2A 2OSRA 2ZFHA 5EWEA 4ZKAA 4FNHA 2UXCF 1FJGF 2CRLA 3T5LA 4FP9A 4F02A 4HTIA 2I5JA 3I9V9 2A10A 2UUAF 3DXBA 2W9BB 2FVRA 3CC7S 5B09A 3Q8QB 5GAGI 2NR0A 1HI8A 2HRYA 1TK5A 1VLYA 5K8OA 4DR6F 3DU6A 3J7A1 1IKVB 2C3YA 3GG0A 1UVMA 1RK8A 1FKPB 3DOKA 1SXLA 4KB7A 1HNZF 4WKYA 1RJJA 3AH6A 1C0UA 4JI5F 2WB4A 2V4JB 3BO2A 5AXMA 2HMIB 1WHYA 1Y9OA 4RWWA 4L3NA 2DK2A 2KB2A 2YVSA 5DGAA 3M8PB 3BO4A 1OIAA 3KFWX 4DL0C 3QJLA 3KK2B 5KFBA 2WOMB 4LF9F 3PW0A 4ID5A 4K4YA 4IUFA 3DRXA 3GFZA 1EETB 1R7IA 2LLZA 1NRKA 5JXSA 3GFHA 3G8TA 3OHAA 1C0TA 3FQKA 4QWBA 4NMLA 1S1TB 5E3CA 5EX0A 1HYSB 5J1NA 1EP4B 2KN4A 1IQTA 2HFNA 2IRXA 3OVBA 1AXQA 4AE5A 2BRLA 5IWAF 2XMVA 2YKOA 3T6JA 2ASJA 2BBEA 3TO8A 3HJFA 2VD3A 2YX4A 1JJ2R 1X5PA 4X4QA 5I3QA 2ZOGA 3T19A 5KFCA 3UQSA 1Q79A 4UOCA 2MHNA 3NNAA 2C3OA 1S79A 2JLEA 2L9DA 2I5JB 4JBCA 2KDOA 4Q7AA 4JI4F 3IR7B 2XNRA 1Q82T 2BANB 4LMZA 4ZPTR 5KG4A 2FTRA 3G6YA 2P6TA 2BQUA 3SSSA 1FRKA 1LFPA 4TY8A 3QWPA 4FYDA 3B4MA 3J7YI 4AL7A 2MZRA 5IXUA 3DOKB 3IG1A 4ZHRB 5A2QY 4B3RF 1C0UB 3QWUA 1H0HB 2CDQA 5GADU 4EBCA 1S97A 1HD1A 4WF9Q 2JHEA 4PG4A 3AY0A 2IHR1 2ZBCA 4DQIA 2YQ3A 1UKUA 4YB6A 1Q16B 3TARA 4J9KA 5EWGA 2LDIA 4TU8A 3ZZPA 2CQCA 4ID5B 3UW1A 3H8YA 4YQWA 1MW7A 4BBYA 5HROA 3UD4P 4M5DA 2W4DA 1I6JA 4X4TA 4A8FA 2E9TA 3KWMA 1WG1A 1UJ4A 1URNA 3ZZ0A 2ZDOA 2W4CA 2CQ2A 2K3KA 4EO8A 1IR0A 2RRBA 3TAPA 1SH3A 4YR3A 3ZZTA 1SJRA 4ALZA 1QE1A 4BS2A 3J7ZT 3OTOF 4G3IA 3TVKA 3HK2A 1I94F 3CCRS 3DLJA 4ZDNA 3UWTA 2VG6A 5IT9Y 1UJ6A 2HQIA 5DDOC 3KLFA 3E2EA 2XS2A 2LVWA 4I2PA 4TLRA 1Y5IB 4M1KA 3BN4A 1WD6A 1XBWA 2RB7A 4QZVB 3QJPA 4DL2A 2QA4S 1D3WA 2HHUA 3LP0A 4W90B 4OX6A 3CJ4A 3JSYA 3K58A 2WK4A 4K0KF 1HI0P 5KFAA 4TY8B 1VBXA 1FK9A 5JJBA 3CCTA 5HMZA 2YNFA 4HH0A 2PGCA 4Q0BA 3QGHA 3QLHA 4DFKA 2AYBA 2E44A 2C22A 1M0SA 2D1CA 3TYTA 2DO0A 2XB2D 4ETXA 2DB1A 4IRKA 5IS2A 3UD3P 3POTA 4C8NA 3TVZA 2RD5C 1Y4ZB 4ZVHA 1U49A 3UCUP 3IGVA 1T8EA 4DDFA 3TAMB 5KG0A 4CH0S 1N0UA 4CO1A 4HYKA 3Q2TC 5HROB 1RAJA 4R5PA 1ZTTA 2CPIA 3NG8A 1S72S 2KZMA 2QYCA 2DR7A 3RBEA 2E1MC 2D9PA 2LEBA 5A8KB 1V6HA 3OL8A 4ECYA 3DMJA 3MMBB 2BE2A 1S48A 2PA3A 2P9EA 4KAIA 4NCGA 3CCQS 3GFYA 2CPJA 2QV6A 2BJEA 4KTQA 1UFLA 2OPPA 1JLQA 5CH7B 2CQIA 2MB0B 5B0FA 3MECA 1TKXA 2VG6B 1WF2A 3V4IA 3Q2SC 4H4OA 2U1AA 4FVMA 4OQJA 4NL5A 4I2PB 3TA0A 1O51A 2DVIA 2ZHAA 2PMHA 3PRBA 4B9NA 2M0GB 1U1NA 1F2GA 1OPZA 4ILRA 2CQ3A 4I4BA 3O6QA 4NA1A 2QMXA 4EFAC 3OW2R 3V6KA 1QY7A 2XMUA 2BABA 4GO7X 1X9MA 2VFSA 1LWCA 1KHVA 4FF2A 1GAOA 4WZMA 2M4MA 1FK9B 2DH8A 2GHWA 4DEZA 4CQ1A 1U1RA 2CQBA 2YNFB 4DL5A 1HPZA 4Q0BB 3QLHB 2KJWA 2ROGA 5I42A 3B8HA 4BWMA 3OTBA 4FF4A 3KLHA 2C3MA 2PN6A 3P3DA 4EUVA 4HT7A 5AXLA 2J0WA