2BUNA

Solution structure of the bluf domain of appa 5-125
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
121
structure length
121
Chain Sequence
LEADVTMTGSDLVSCCYRSLAAPDLTLRDLLDIVETSQAHNARAQLTGALFYSQGVFFQWLEGHPAAVAEVMSHIQRDRRHSNVEILAEESIAKRRFAGWHMQLSCSEADMRSLGLAESRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords APPA
publication title The solution structure of the AppA BLUF domain: insight into the mechanism of light-induced signaling.
pubmed doi rcsb
source organism Rhodobacter sphaeroides 2.4.1
molecule tags Appa
total genus 28
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2005-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04940 BLUF Sensors of blue-light using FAD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2bunA00
1FD8A 2ASYA 2QLWA 4A47A 1S6OA 5B08A 3KNGA 3GZ7A 4FNHA 2K2PA 4HL9A 3CJKB 1AW0A 1Q8BA 2G9OA 3TNVA 2GCFA 4A48A 2GGPB 5KAKA 2K1RB 1N5VA 1Q8LA 2XMWA 1YJTA 2ROGA 1R6YA 2XMVA 3I9ZA 4NPOA 2N4CA 1N5QA 1OQ3A 1URRA 2Q3PA 5K9FA 2IYGA 1V3ZA 5F0UA 1YJRA 2AW0A 5F0WA 1U7LA 4HI1A 3HDSA 2HFNA 1MWZA 1OQ6A 2ZDOA 1TZ0A 3KG0A 3QGPA 3MCSA 1LQ9A 2EW9A 1JK9B 2XMTA 3BR8A 3KG1A 2XMUA 2JDJA 2IFXA 1SI9A 1ULRA 2LQ9A 2XMJA 4U9RA 5B0FA 1KQKA 1JWWA 1SB6A 4YDXA 5B0DA 4OIXA 3E8OA 2ACYA 5T7LA 1OPZA 1P8GA 4F67A 3F44A 3BGUA 2AJ0A 3DCAA 1P6TA 1GXUA 2GFFA 2KYZA 2RU9A 2XMMA 4OJ1A 5A6PA 5B0GA 1Y3JA 1MWYA 3IWXA 1Y3KA 1XBWA 1VQYA 1AFJA 1FEEA 2W4PA 2N7YA 2K7KA 3T9NA 2KT2A 3FRYA 3CJKA 2FTRA 1FVSA 2ZDPA 2AP6A 1RJJA 2ROEA 1TR0A 4OJGA 2K1RA 2RMLA 2OAUA 2IYIA 4Y2MA 3HHLA 4Q2MA 1SQEA 2RILA 1APSA 2OFHX 4A46A 1YJVA 1CC8A 2QLXA 1WD6A 2VH7A 1GXTA 1Q4RA 3BF4A 1X8DA 1YG0A 3DXSX 5A6WA 2OP5A 3LGMA 1FE4A 4HI2A 3FMBA 4NL5A 3BM7A 5B0AA 3LO3A 1TL5A 2HQIA 1YJUA 4DN9A 5B0CA 1X0PA 1X7VA 2KKHA 3IWLA 2LXFA 3KKFA 4ZA1A 3HHLD 4DPOA 1VQSA 1IUJA 2HLUA 1AFIA 1YRXA 2HIQA 3HX9A 2BBEA 4Y2IA 2OMOA 4Y2KA 2KT3A 2N4DA 3HF5A 1CC7A 1FESA 2VV5A 2GGPA 2L3MA 4FNIA 5T7LB 2QIFA 3UDCA 4HH0A 1N5SA 4OJ3A 1FE0A 2HLTA 2RSQA 5IXUA 3HFKA 1K0VA 4QOTA 1OSDA 4ZOSA 2W4DA 1Y9OA 1QUPA 2K7JA 2ROPA 2LQBA 2OD4A 2FB0A 3K7RA 3BN7A 4DL0C 3MZIA 4OJHA 1Q53A 5B0EA 3QMQA 2GO8A 3HHLB 2BUNA 5B09A 4EFAC 2BJEA 1TL4A 3VTIA 3FGVA 1KVIA 1KVJA 2OFGX 2BJDA 1W2IA 3BDEA 2CRLA 2FIUA 3TOQA 3HHLC 1Y0HA 4Q2LA 2W4CA 4HH1A 2GA7A 2QYCA 1TUVA 2PD1A 3LGNA 2HFOA 2GV1A 2OKQA 4A4JA 2OD6A 3TRGA 2LDIA 2XMKA 1S6UA 3WDOA 2PGCA 1CPZA 5B0BA 4YEAA 3BB5A 1FVQA 2BYCA 1N5TA 2FHMA 2AJ1A
chains in the Genus database with same CATH superfamily
3DM2A 2KZMA 3RB0A 2XMWA 4ZHRA 1H98A 2IJNA 5CAAA 3TAPA 1TK0A 2JDJA 2V9KA 2Z8QA 3DGPA 2BMBA 3TX0A 5HVGA 5FJ4A 1RYSA 4PXBA 1T95A 2V69A 2WSEC 1B7YB 2J6SA 1TELA 2M52A 2VONA 1JIHA 3IWLA 2HVEA 4CLUA 4K2XA 4I7FB 3R7SB 3QAEA 1YZ7A 1O8BA 3ULHA 4BC9A 1C1CB 1RCXB 5KFUA 4NXMF 1SKSA 4YHHF 3LGHA 2VKZG 2GVZA 1WI8A 1XMQJ 1JXEA 3FGVA 2DCUB 3R8YA 4R8UB 4PEOA 2GA7A 3IRWP 3LPEA 5GAEU 2ZBCA 3I5AA 2AGPA 1VQOS 2X3GA 3UD4P 1FNOA 2UUCJ 2P5VA 2HVDA 2MKSA 3TA2A 5HVHA 2MQLA 2GGPB 4NPOA 3C19A 2JJ4D 1UFLA 2P9EA 3O6QA 4UQTA 3AOAA 2EW9A 1FRXA 5D4PA 3PACA 1OPZA 1L3TA 1J5OA 1JJ4A 2UXDJ 2GC8A 3A3NB 5H9EK 4WTYA 3QZ7A 3AJ2A 3PO5A 5KOXA 3M32A 4J9NA 3ZZTA 5E7OB 4MJKA 4LIWA 3HSGA 3J81j 1S5ZA 3NWGA 1X31C 1IM4A 4NE9C 1KFDA 3ITHA 1MROB 4FYYB 3EMTA 3CULA 5CYMA 2XI3A 2JC1A 2W4DA 1FKOA 2V50A 4YUDA 4DUYF 2C3PA 1U1RA 4EFAC 4UW2A 3KUGA 2F9JA 3MMBB 4FF2A 1NCLA 3VQTA 1MWQA 4TY8A 2VIHA 2HFVA 4ZN1A 4MTPA 3ZC4A 1N48A 1EB0A 2C3OA 4G3IA 5E3RA 3BQ0A 4PKDB 4NRUA 4E98A 2LDYA 4J9SA 3QYYA 2EFOA 4C8MA 2ZH4A 2CQ2A 2KVIA 4QWBA 4LFBF 3KMQA 2A18A 3T9NA 4DV4J 4B3TF 1JXVA 4B3MF 4OJGA 2Y1LB 4LF1A 4DR7J 1HARA 3UNYA 1XNQJ 4K5SA 4ZVFA 2W1BA 3GU0A 2BZ2A 1A6LA 3MEKA 3UVJB 2ZUAA 1PJ6A 3QT5A 3NCPA 5IXUA 1HKAA 4LVOP 4NZ6A 2V2QA 3RRKA 1K1QA 5C7PA 4RW9A 4NLSA 4WFZA 4KAIA 2MZJA 3OL7A 4DSEA 2YWHA 4PPDA 1YJ9S 5EWFA 2DD8S 2ZE2B 2ZJQQ 3SQOP 4DUZJ 2RNEA 2OHDA 3A3OB 4CLFA 2QGFB 4LFAF 2WVDA 4U8VA 2OUGA 3FQKA 3EGWB 3KK2B 1QAXA 2X1FA 2RB7A 4IH7A 2FJDB 4NZ0A 2LEBA 4Q2MA 2VKRA 1SKRA 3CD5A 5H1SV 1UVIA 4K59A 2AX1A 1YG0A 4WP8A 1FE4A 1MMNA 2C2RA 1NPPA 3ZTRA 3OSPA 4I2QB 3T5LA 1FFSB 4R5PA 1YRXA 4CH1A 3QAUA 1JJHA 3HF5A 2DNRA 1H2VZ 4HEA9 4WP3A 4L3NA 4R0EA 1D8YA 4ZP8A 3MUVP 3Q22A 1T9XA 2JEIA 3BYRA 2Q66A 2KO1A 5RUBA 1URNA 2CJXB 1S48A 4ILMA 4V1Ak 4KGXB 2MYFA 2AGOA 2ZITA 1FXRA 2ZHAA 1S72S 1LWFB 1N5QA 4YB5A 2W8KA 4ED0A 3HHKA 3CJKB 5KAKA 2XMVA 4N41A 2COLA 4OQJA 1VRUA 1SCJB 5D4NA 2ZZTA 3QT7A 2HURA 2J9DE 4DR3J 1RI7A 2JEGA 1RA6A 4URQU 2OPRB 5AE1A 2IM1A 3PRDA 4MK8A 1CJKB 2HW3A 5J2NA 4OJ1A 1GX6A 1NLKL 2CWXA 4DQPA 1HBUA 3PXGa 1HFEL 5IC4B 4DR4F 1UZDA 2WONA 8AT1B 1S6QA 5J1NA 1S9EB 1YZ6A 1FD2A 4ED8A 3KK3B 2MY8A 4ZN3A 3Q2SC 4H54A 4KH1B 3AHPA 3PYDA 1EHWA 1S1VA 2UXCJ 1QVFR 4QYZK 2H9ZA 2VFSA 2OD4A 3OTDA 2JEFA 1WHYA 1S1TA 2E5IA 2C3YA 3T41A 1RT5A 1Y0HA 4Q7AA 2W4CA 2BJ7A 4LR9A 4PG4A 5HBMB 2HFZA 2R7VA 3J7ZT 1VQ9S 3GZ7A 4I0WA 2YWWA 4OZ1A 3D0IE 2J5AA 1M5VC 4FVCA 2ZDOA 1TZ0A 1WJ9A 4B17A 3UO0A 3W61A 3KHRA 1ULRA 2DEIA 1FKPB 1YDLA 2IHR1 3H4DA 1TKDA 2E5JA 1T9VA 2B6AB 1RT6B 4USVA 2CG8A 4OZJA 3BV8A 3KK1A 3MGJA 3LH2S 4KHMA 3D6FB 4RW6B 3D3BJ 3J80U 4Q8EA 1KOOA 1X8DA 1VISA 4GKJF 3J80Y 4WZQA 1YJUA 3I31A 2ACMA 4LF5J 2WHOA 2R42A 1RWUA 1FRJA 1ZZNA 4KY3A 4J5OA 4ZLPA 2EEYA 4N76A 4JI5J 3BREA 2RRNA 3HP6A 4X4NA 4JUZA 4Z37A 2KFYA 1I6JA 4IUFA 3HFVA 1XMBA 5KFNA 4ELTA 1X9MA 2VDIA 4L6V3 3SZ2A 2XGQA 3P49B 2B9YA 3H25A 3BSOA 3N9UC 3KNGA 3TYTA 5KT7A 4ZLLA 3C6TB 4OYZA 4WYWA 4LR8A 4YN3B 1NH7A 2KTQA 2AU0A 1YTYA 5D78A 2UVWA 5K5MA 5EDWA 5DM6Q 2A2CA 2LCWA 2MKJA 2PMHA 3AY0A 1NK4A 2MTLA 5GAGU 5AT1B 4F67A 1EARA 1P6TA 3E01A 5CYJA 3RR8A 2RDDA 3OLBA 2H5IB 3BO4A 2UV8A 1R8PA 2HNZB 3V6DB 4OX7A 1X4BA 4NL5A 4QPXA 3KLFB 2W8LA 3CJ2A 1NDPA 2K3KA 1Z1ZA 5K8PA 1C1BA 1S6PA 2I5JB 3OFHA 3CT9A 3DRPA 2V4JB 2R7UA 1FT8A 3G8TA 2UXBJ 4ZIVA 3VAIA 3M8PA 3P96A 4OMFG 3TANA 2J7WA 5J2QB 2HNDA 3BO2A 4OYBA 5AE2A 1BY9A 3MR5A 1T8EA 2V6AA 2FHMA 2Y3YA 2E66A 2K2PA 1AW0A 3AB2B 1LWEB 1REGX 2ZHBA 4KR0B 3R97A 3UI3A 1OQ6A 5T41A 4RNNA 2F9DA 3KJVA 2XMAA 3AD7C 2F5GA 1KLMA 4LSZB 2ZD1A 2E1AA 1YJ7A 5B0GA 3ZZRA 5DZ7A 2A0FB 3PIPQ 1N4LA 2DXEA 4N56A 5IQQA 5FDLB 3W5XA 5KT3A 1G4CA 5KFOA 2CPXA 3FQLA 2RQMA 1ROFA 3P4UB 4Y2CA 1EP4B 1F6TA 1K47A 1IKYB 3LQVA 4FYXB 2RD5C 4ECSA 4QIFA 1WKJA 1Q7YT 1JMTA 2JLGA 2E9ZA 1X5SA 2HG4A 3CD6S 3D68A 2YKPA 1JLEA 3THPA 1HQEB 2LVWA 2FVSA 4C0HA 2HVHA 3QSIA 3NAIA 3SSQA 3RB3A 3IA0A 1TUGB 1DARA 1DY3A 1EX8A 1Y5IB 1HMVB 3ILLA 2CADA 1X5OA 4YEAA 2IY5B 4OHVA 2CQDA 2JL9A 3CC2S 4DCOB 4NXNF 2ADBA 4ZP9A 1V5VA 4PUOA 3MUTP 3QRPA 4H4MA 2CA9A 3RBZA 3TEGA 1F9FA 4HHUA 4F0HA 2YPYA 2XNQA 1WC1A 3BBFA 3TX8A 2AP6A 1ZS6A 4CTAB 3LP1A 2WVBA 1ZM4A 2UUBJ 1GXTA 2XGPA 1Q81T 3CJ4A 4N7TA 4DWIA 1RLDA 4ETZA 1SJRA 2IVMA 4C3LA 2PFFB 1FJGF 2BOPA 3DNCA 1RHMB 4CLLA 3V6HA 4PABA 4IOAQ 2XY7A 5A0YA 1H74A 2BDPA 1KFSA 3H2LA 2DH7A 3N0VA 3OVSA 3GCXP 3FMWA 5C5JA 1SH2A 4OHWA 4IG3B 3HJFA 4DV2F 3VAJA 2QMXA 3EPIA 2XMKA 3QWUA 4DQRA 2QSWA 3HT3A 4DV1F 5F8MA 4QZVB 4KV8A 2BV3A 3MMCA 3HPOA 4Y6IA 1RA7A 1MU2A 1HR0F 4RBTA 4NCBA 2DNZA 3F0NA 2FJBB 1QLNA 4CH7A 2DNLA 1N88A 3OR1A 1T03A 4F4AA 1XNRF 2X1GA 2WVEA 4B9NA 5D3GA 1JX4A 3CIZA 4HTJA 3MPDA 4LBIA 3OJUA 5E3AA 2CPIA 2VF3A 4PQAA 1HNIB 3JAMU 3KLGB 3DRRA 2CPDA 2KFNA 3GFYA 1RTHB 2ABYA 4H4KC 4B3OA 4K50A 3JAMY 3KLEB 3ENWA 1LOUA 5D6GA 4ZHRB 1L3VA 3DLEA 3T3FA 4OL8A 4NOHA 1VQSA 1H3DA 2BBEA 7AT1B 3DGPB 4ZMMA 2RIJA 5IOLA 2C2EA 3C2PA 5G0RB 2BUNA 1RU2A 2LP4A 3LAKA 1RWOB 3RGIA 5LXRA 2YX4A 3I96A 2DT9A 4W90B 4NYZA 1Q86T 3IS9A 2P6TA 3ENVA 1TL3B 1LFPA 4M5JA 4ZVOB 3QBCA 2DXFA 3KYLA 2HFNA 2GJFA 2GHVC 2IRYA 2ILYA 3TARA 1V9OA 2GW8A 1DTQA 2GVZB 3HO1A 2C42A 3AJ1A 3E8OA 1TVRB 1SH3A 3B6BA 2DGOA 2GO9A 4USJC 1HNWF 3WZ0A 4XIUA 4PWUA 1X4AA 2M70A 1XIQA 2VBYA 2L9DA 2R2TA 3FSIA 1TFYA 2IJFA 1OYDA 3UFCX 4U6PA 2MJUA 1J5EF 1F0XA 4LSNA 2FJAB 5A8WA 5DETA 4IO1A 2CYYA 3NLCA 2AYEA 1J5OB 2DNPA 4KO0A 4OI3A 1QD1A 2BANA 3SBMA 5HL7Q 3KLHA 4UY8T 1SC6A 3MECB 1YBAA 3M1VA 2ZVSA 3WIUA 3M32B 2LA4A 3C15A 1R6VA 3OTBA 2K06A 1BXNA 1LXNA 3KDOA 3O2IA 1CPZA 1RHUB 1S49A 3HVTA 4L76A 4YB6A 2WTFA 1CJVB 4F8RA 3VV2B 1OQ3A 3BGLA 5CYMB 2BVZA 4LMZA 2J9EA 4A8QA 2RT3A 1M0SA 2FZCB 2G13A 3BQ1A 3HHNB 4YDXA 5JVGQ 3BKUA 2XLJA 3EX7B 4GC6A 2X1BA 4M1KA 2V68A 1M90T 5U47A 1Y3JA 4F26A 1XBWA 4TY8B 2AJ2A 4PR6A 3GJRB 2DHXA 1NSQA 1FDDA 4DPXA 2OGUA 2B56A 1ZBTA 3FNNA 5C42A 5KFPA 3C14B 5EWGA 3CDAA 3UWTA 4J9RA 3HZEA 1KTQA 1U6FA 4MIWA 4WXOA 1LV5A 4DMZA 3T5HA 4DL0C 4TQSA 1BQMA 3UW1A 1FNMA 2W9AA 3H20A 4RR5A 3PX4A 3UN3A 3G2XA 2GVDA 4U8YA 4QU7A 2PN6A 2U1AA 3MM5A 3FZ2A 2IBKA 3DU5A 2CPHA 1HYSB 2CDQA 3BB5A 3BGRA 2JLEA 2VG5A 1H0HB 3K8WA 3VZIA 3NGUA 4F04B 3FZBA 3U27A 2HFUA 2KHCA 2M4MA 1TK5A 3CJ5A 1XTZA 2RHSB 4IG0A 5HO4A 4RW9B 2RU9A 3B54A 1QJHA 4C2MA 4TU7A 2AJQA 1U25A 2OO4A 2CJQA 2RMLA 2DCLA 2MQNA 5K8NA 1S9FA 5ETOA 3AOCA 5D0RA 4B9MA 1PIEA 4O4GB 3CJ3A 4DUYJ 3GV7B 5GAHU 3PZPA 2F8HA 3DHXA 2QN6B 4KGKA 2C2NA 4QR1A 2IRXA 2RRAA 1NPRA 2JZ5A 4ZK7M 4V19X 4TN2A 3QJLA 4ID8A 1UWAA 3M2RA 2DY9A 3TO8A 5H9FJ 4X66F 2ZC3A 5KFSA 4OYMA 5CZVA 1TKTA 2HFOA 4PYDA 1R31A 3A3PB 3GR0A 1GMVA 4B9LA 3WX4A 3KNAA 1C0TB 3QRQA 5IC6B 1SV5A 1SC1B 2KXFA 1B0TA 3U7JA 4Q0BA 3AOBA 1HQUA 3IM8A 5LMNJ 2XMUA 3IAM9 3FJ2A 5IZHA 1KR4A 2VODA 2JWNA 3RRHA 1F5CA 3DCAA 2RQCA 4LRDA 3FFIA 5B7WA 5DQGA 3R5JB 3CJSA 3DLKA 2XSJB 3UDEA 1S97A 2B9EA 2MDAA 2OFHX 2ZKUA 1U0HB 4ICLA 2RDJA 2RKIA 1S99A 2AKWB 2VQFJ 2R2SA 2ZH6A 2B0GA 2W9BA 2EFGA 4Y2KA 2H48B 1RP5A 1GQEA 1VQ5S 1NZAA 3OVAA 2BE7D 4NEYA 3W5ZA 1S1XA 2PDAA 3DOLA 5JMNA 3AQPA 3MEEB 2D3OR 4I4BA 2C3UA 5LSLA 3PFEA 2NYIA 1ZA1B 2KL8A 3NGKA 2ZFHA 2W2MP 1VC6A 1RT3B 1BQNA 4AQYF 4LFAJ 1S6QB 1S12A 3DRSA 2E9TA 2VL1A 3T1HJ 1WC0A 3HI9A 1S1VB 2WVCA 1BWVA 2GQCA 2CWKA 1S9GA 4KSEB 4J9UE 1X4GA 1KQKA 1S1TB 3PW5A 1RT5B 1I3OB 4O3NA 3DKDA 3GG1A 5LOQA 1JB0C 2ZKTA 3IBFB 5KT5A 4TU9A 4V19J 5L38A 3BGFA 1CS4A 4DJBA 3W9IA 2Q6BA 4CLTA 3EGVA 4GRSA 3ZTPA 1TQLA 1RAIB 4NLRA 4FKYA 2KT3A 1IR0A 4ZCIA 4JYAJ 2CQ4A 1L5UA 3IRXA 3KK1B 2YKNB 3PTWA 3I0RA 4C3KA 4NLXA 2N7CA 2ERRA 2BR0A 1MN7A 4UOFA 3LOUA 5AXKA 3M8ZA 2YX1A 3MM7A 2OIHA 5IQ6A 4FBUA 3Q8QB 4C8KA 3C3LA 2LLZA 4LRCA 5B0BA 4H4OA 1NMEB 4TYBA 1YJTA 2ZOGA 2N4CA 3GTYX 2IYGA 1T94A 5DDPC 5HP1A 2XYHB 4ZCKA 4B9SA 2BJ8A 4QIGA 2VHGA 4IR9A 2ZH1A 2CPFA 5HQMA 4ZCLA 3SFUA 2DHGA 3NG8A 1QSYA 5KFTA 3QT8A 1W7WA 3HHLA 4FS1A 3CCQS 3DHWC 3MAAA 3ENQA 3MFIA 2HBRB 3RB4A 4PXEA 5E3CA 1GX5A 1CULA 2IVFB 2ZH2A 5DS7A 5EX0A 2C3MA 1UEKA 1WHVA 4FF1A 3RJMB 2KG0A 4WKRA 3VQSA 1N36F 2IVYA 3HKZD 2CPEA 3E01B 2WOMA 3A13A 2D41A 4USUA 3H90A 3PNIA 3SDEA 2O01C 1H2UX 2R8KA 5AJ3J 5IM0A 4MIAA 2HMIB 3ONQA 2HWTA 4LSLB 2PIIA 3GONA 1HLWA 4MK9A 2GHPA 2CQPA 3I4HX 3DRPB 1K1SA 2Y0BB 4WK1A 4LRFA 3CC7S 4EBDA 2JX2A 5H9FK 4CM2A 2CAJA 2CZ4A 2RRBA 2FJVA 4M8LA 4FZVA 3M8PB 4N5SA 2I38A 3DOKB 3TJAA 5KFXA 3W65A 2FHJD 4MT1A 3A1YG 2M2BA 1T02A 5J1EA 4K4VA 3V5RA 4K4XA 2XS5A 1X4EA 4USHA 3M8SA 3LWMA 1I51B 4LJMA 2HWIA 1FXLA 5BR8J 3KKFA 1IJFB 3ENAA 2WRMA 3KJVB 3BH6B 2YNHA 4JB8B 2YWFA 1YHQS 1M1KT 4ALZA 4DL6A 2YX7A 1EKRA 1T0TV 3VVUA 1OWXA 2LA6A 2HHWA 2BJ1A 1VIOA 3RTVA 2ASDA 1XMQF 4BCAA 1NHVA 3M8WA 1F5BA 2DEJA 1C0UA 1GEHA 2DGXA 4ANCA 1JLQA 2UUCF 4HLBA 5F8NA 2W7OA 4KB7A 1NJIT 1H7XA 2CJKA 1CSJA 1M5PC 8RUCA 4O0IA 1WKLA 1WUUA 4DLEA 1MWZA 1W2BR 3OV7A 2B8QA 1JLEB 1CBKA 4O44A 4ECWA 2XMJA 5KG2A 4D3HA 3D6MB 3CD0A 3MHYA 4CCHA 2UXDF 4P72A 5ETVA 3IWXA 1RKJA 2VICA 3I9V9 3UDLA 1GNKA 2O5DA 1JLGA 1X4CA 3TVZA 3PX0A 2RDIA 2H54B 4PYAA 3PRBA 2J8AA 1IR1A 4TYAA 4OI0A 3PG9A 3MF5A 5IV3A 4PUOB 3KTQA 1B4SA 2GMJA 2O3DA 2NXNA 4H4MB 5KG5A 3VAGA 2JLFA 1JJCB 3US5A 3R2DJ 3L9ZA 2MQMA 2IA0A 4JI6J 1KQSR 2VPXB 5BJRA 3LP1B 2UU9J 3MXHP 2R9LA 1PILA 1R7IA 5DG7A 3I5BA 1FKAF 3ZZYA 5L1KA 2DNGA 3AXMA 3NRBA 2KRBA 3D2WA 1KBRA 1V3SA 1RWPB 2IC3B 3JTNA 1WDTA 1LQ9A 3K89A 1MMDA 2AIRB 4DV4F 2R3VA 4P10A 2MZSA 4DBQA 1VQMS 5KG3A 2VDHA 1AFJA 1G3OA 3BSAA 3CDEA 2CIMA 2HVIA 4DFKA 2IYIA 2IM3A 3I0SB 4DR7F 4KV8B 3MMCB 3FC9A 1QE1B 1MU2B 1YRTA 2HS4A 1XNQF 1VMBA 1VFJA 3GB0A 2DRDA 1VQPS 3NKYA 3CB4A 2BX6A 3OR1B 4DPOA 4K4WA 3TA1A 2CNLB 5IFMA 3AJDA 2MKHA 5D3GB 4DR6J 4M5NA 2FVCA 2H4WB 4DSJA 4OI4A 2ROPA 4JV0A 1HNVA 3DRRB 4OFZA 3ZZUA 4B3OB 3HHLC 4NA3A 2IM0A 1TP7A 3FKBA 3DLEB 4RBUA 1NM2A 2DNMA 3GV8B 4I68A 1YKWA 2B8PA 4HL9A 4DUZF 1UVMA 1SH0A 3RR7A 3PJWA 4FYWB 1XN9A 2VFRA 2DHSA 1WC5A 1NK9A 3E51A 2OMLA 2OPPA 4U96A 3JQJA 2EVZA 2XB2D 2R8HA 2FTRA 1F5AA 4KBIA 5DLFA 3IS9B 4J9QA 1U09A 1UJ5A 1I94J 1GFWB 2ZC4A 3BDPA 2CJYB 3ET6A 4MKBA 4BLGA 1RT4A 1DTQB 1S7HA 2OMOA 3A8IA 5LSRA 3UDCA 4HVZA 2E7XA 4IO9Q 4AE5A 2GS8A 1HBMA 4USWA 4EZ6A 4U95A 2YKQA 2BJ3A 4HTIA 4C8LA 1GK8A 2F8EX 3W64A 4OI2A 3LANA 2KZZA 2Z57B 1LK7A 4LSNB 2VC0A 1XEZA 4BC7A 3H40A 2VC1A 4ZIWA 4CI0B 2Q3PA 4KO0B 4DR3F 2BANB 5IT9U 1KS2A 3KLHB 4NMXA 4X4OA 4U9RA 2R2UA 1EQ0A 2QT7A 5IT9Y 4J9KA 3BGUA 5J2MB 3C15B 2FJWA 4TLQA 2ZE2A 3H0PA 5KFHA 1K8AT 5KG1A 5JJBA 4WE1B 5JVHQ 2M0GB 1F1BB 4O0NA 2LXFA 3TR5A 2QYGA 5CH7B 1IUJA 3G8SA 2WBMA 4CO5A 3KK2A 2UXCF 1HI1A 4B08A 3MEGA 4OX8A 4JI0J 3UQSA 3IBWA 4QPTA 1TL4A 2QJ3A 4RU9A 4LF7J 1IBCB 1RISA 3PM9A 4J9PA 5L9XA 1AUSL 1N56A 3D9BA 1U49A 4DXLA 1W25A 3Q8SB 4O3QA 5B08A 4JI8J 2F40A 2A3JA 4X4SA 2BM1A 3BKTA 4CT8A 1SIWB 2L9NA 1D9DA 1PYTA 2L08A 3MCMA 1U4BA 4ZJLA 1S77D 2IDLA 5C25B 4M94A 2DYAA 3VAHA 4I1TA 2GVDB 3VWSA 2N7YA 2HQ3A 3MM5B 3CJKA 3U1LA 1DAXA 2QX0A 2XZWA 2VG5B 5DDQC 3V4IA 4QYRA 1LWXA 4UF4A 2VH7A 1Q95G 5D4LA 5C24A 3TAMB 1L3SA 4LF5F 2N3OA 2E9RX 2RVJA 4Z7YA 1CJKA 2W9CA 2F7VA 4JBCA 1VLOA 3NCQA 4IG0B 1FESA 4JI5F 3MR2A 3SV4A 4PXCA 4LR7A 1XQIA 1EQMA 1ZTTA 2C2DA 2B51A 3D0HE 3GR1A 3KXDA 3H5SA 5FD1A 4MKAA 3MCNA 4J9MA 3OBIA 4NCGB 2BJDA 3BDEA 3J7AN 2PD1A 3AB4B 3IXQA 3GLJA 3KK3A 2ASLA 1R0AA 4OZ3A 1T9WA 1M1HA 1KRPA 2FVQA 1Q8BA 3TNVA 3RW6A 4OYXA 4ZVQB 2DNNA 2OPQB 3G4SS 2B7CB 1YJRA 4M95A 3KG0A 3JXOA 3MMJA 1VRTA 3M2RB 1AYEA 2W2PP 2ZHOA 1WC3A 3Q2TC 4ZPDA 2QC3A 4WU3A 2KYZA 5KFVA 5HBMA 1TKTB 3BKFA 2W4PA 1WG4A 2OJ3A 5KFMA 3K58A 4USTA 2HEKA 3CSKA 3ELHA 4P2MA 2Q43A 2ILZA 1SKUB 4E0DA 1SV5B 2DK2A 2DRBA 4ZLJA 3K5MA 2KU7A 3CJRA 2MSTA 2JSXA 4Q0BB 1R8AA 3M8QB 4X65J 1HQUB 2UP1A 1RAJA 1KN6A 2AJFE 2B6AA 2N4DA 4BS2A 3IFEA 1QSLA 4ES1A 1C2PA 3EGZA 2VA2A 1TUWA 2UXBF 4O4RA 2ASJA 3MM8B 2ZZMA 4ZP6A 3LUYA 4FXWA 2VA3A 3NNCA 1PAEX 3MD3A 3TRGA 3VHQA 3TI0A 4Z2XA 2ASYA 3FBCA 3IG1A 5KFRA 2HHPA 1OJ4A 5F0UA 1UJ4A 4GVLA 1S0NA 3GV5B 3DOLB 4C6AA 2W7PA 2NYHA 3FCWA 3JQMA 2XMMA 2OEMA 2A6OA 2LQJA 8ATCB 4IH5A 2VB6A 2YNIB 4RUAA 2V8PA 1BQNB 2DKOB 9RUBA 2EK1A 2AEJA 2MQQA 3C6TA 3K17A 4O3RA 3K8VA 1M5HA 3DRSB 1GMUA 2VOOA 2B9XA 2LQ5A 2HZAA 4CO2A 2BXJA 1D0EA 1ZETA 3MD1A 1YIJS 2QFIA 3HHLD 2D9PA 1IBMJ 3HVAA 1IXKA 2J6TA 1DTTA 5AXNA 4ZVEA 3CCTA 2D1CA 1BGXT 1JLCA 4O3PA 1WEZA 3BN7A 5B0EA 3T5JA 2FVPA 1FWPA 4BWMA 3KLFA 2PFDA 1CS4B 1R8CA 3GSIA 1H7WA 2XS7A 3OW2R 3KMSA 4KYZA 2PEBA 1UP1A 2M88A 2KJVA 2Z2LA 3R5CA 1WACA 2V4QA 1NJWA 2ROGA 3VCDA 1KVKA 4A8FA 1SL1A 1XWLA 3IRXB 2VG7B 5KG6A 1HPZA 2GZOA 3DFEA 2HRYA 2X1AA 4P52A 4CIOA 1Y4ZB 2DJWA 4QR0A 5J2PA 3MM7B 4ERDA 1TAUA 3TVYA 1RDRA 1MLAA 4JV5J 4H4OB 2UUBF 4LT6A 3CCUS 3G82A 3JSBA 2ZH9A 3UCGA 1NAQA 2POKA 3PJ9A 4RW8B 1WOSA 2HIYA 3MFHA 1N8RT 2VV5A 4FNIA 2HLTA 5FDLA 4WFNQ 3FSYA 1YK9A 4DQSA 2V94A 4CO3A 1ZA2B 3QJJA 5SUHA 1U26A 3G87A 3HHLB 2XWYA 3MAAB 3SIPB 3VGUA 3D67A 2J6UA 2DTJA 1EP4A 3K2YA 4NLVA 5HJXA 1CULB 4USIA 2A6MA 4ED5A 2YWKA 1FRKA 4DPTA 1CJTB 2K1RB 3I9ZA 1TL1B 1H72C 3W2WA 2B4OA 1PO6A 2ZJPQ 1N32J 1HQEA 1U7LA 1N34J 1YGYA 1LWCB 5BYQA 4F36A 4M5MA 3Q24A 5IT4A 3SDEB 3WBZA 4LBHA 2KRRA 1ACMB 2B5JA 5IM0B 2WW4A 4CLKA 2R7TA 2DGWA 3H2UB 3EWGA 1IKVA 3AT1B 4DSKA 2DNYA 2W01A 1AZSA 1HQ2A 1KKHA 4QQBA 2GIQA 2BM0A 1N33J 4HI2A 4WTOB 2RH3A 1FRMA 2P2CB 2HRTA 2MZQA 2EFPA 2MMYA 1KDNA 3BQ2A 4DX5A 2VJUA 2UV8G 4CTAA 2G2YA 3AH6A 3KLIA 4YB7A 3GG0A 4XDCA 2EKYA 4FXVA 5J1EB 1MN9A 3BSCA 3MDFA 5HLFA 2CUYA 5CQGA 1U1KA 4QBUA 3CCES 2ZVIA 2PGCA 4DV6J 1VDHA 3RBDA 4LF9J 3O3LA 4Y0FA 4GKKJ 1BD6A 3S6EA 2GAGC 4LF6J 2RUSA 4TXSA 3DMJB 4I6YA 2LMIA 4OI1A 2DGVA 4IG3A 1JLBA 5B0DA 1VQ4S 4PQUA 3OXGA 1RT7A 3CDBA 1JLQB 2AV5A 1VQYA 2DIVA 2NZCA 3KUEA 2KXNB 2E5HA 3EZOA 4LF4J 4A8MP 5CCMA 4DCPB 5E5NA 1X7VA 3H5XA 1OSCA 1KOHA 3M2VB 1VQNS 1CC7A 2IRUA 3KLGA 2LECA 3BYPA 4DL2A 4OX6A 4RJVA 1PBAA 1JLGB 5K8MA 3KLEA 3W63A 4ZPTR 3P8BB 3VTIA 3E3XA 2QO3A 2Z30B 1VC5A 1IQZA 4ANDA 1SJ3P 3M6VA 4QJVA 2MEWA 1P9QC 3RBEA 5CXTA 2YWGA 2R7OA 3PR5B 2WVFA 2V63A 4JI4J 3DLBA 3PEHA 4ES3A 2G0CA 2BQRA 5AE3A 5G0RA 2NXCA 5HI7A 3J81U 1NKCA 2KJWA 1U24A 3J81Y 2GHWA 1IBLJ 3T6BA 4JI7J 5KTQA 2PA8D 1UL3A 3B78A 4O3OA 1TL3A 3CEDA 9ATCB 2Z58B 3NMRA 5D4OA 3SEOA 1F2GA 4WP9A 1TVRA 4P2XA 3EXCX 2J7UA 4NLDA 2KM8C 3OL8A 3S8SA 2M5YA 2HQGA 2ZWOA 2CKWA 3PW7A 4DSIA 3AQOA 5KFGA 4M5GA 1S4EA 4XTTA 4J37A 1NEEA 2C22A 1YX2A 1Z4UA 1Q5YA 2JH3A 2Y9HA 3C16A 2DH9A 2FHKA 3SCKE 1NK5A 1N5TA 3CWJA 3ZZOA 2V8GA 4NEZA 4P6QA 1RLCL 4FDFA 2E1RA 2Q1LA 4DV7J 2J9CA 2YXLA 3MCOA 4TLRA 1UFWA 3MEDB 3MECA 3OSNA 3MCSA 1HNVB 4OZ5A 3CO0P 5GADI 5EGYA 2VPYB 1JJ2R 3JTPA 1TV6B 2HK3A 3OL6A 1S1UA 2P9CA 4FVMA 1IWAA 3BR9A 3MMAA 2HS3A 4F3QA 1CJVA 3SI8A 2CG4A 1RE1B 4FN5A 3VGTA 2G2ZA 4ER8A 1PC4A 2HS0A 2M3DA 3Q0AA 4IOCQ 2OPPB 3GFZA 2L48A 1WWHA 1DURA 4ECTA 4WK3A 4QCLA 2E44A 1ZPWX 4MFBB 1CQNA 4OV6A 1OYEA 2PT0A 2DNOA 1CVJA 4OLOA 2AQ4A 1KVIA 3IR5B 3THTA 2AT1B 5HANA 2V2VA 3ET6B 3C14A 2H3EB 2HK2A 2LEPA 1LK5A 1RT4B 1FD8A 2YQ3A 2DITA 3PYFA 1R6YA 1VK3A 4YFUA 1Y10A 5LMNF 2DHAA 1NKBA 1HBMB 1LW0A 1N6QA 4DG1A 4MYUA 3UE2A 5A6PA 4C9DA 4FF4A 1G7CB 2E1CA 4HT5A 1HYSA 2V8DA 3FRYA 3BS9A 1RAAB 1VQKS 4ECXA 2QA4S 2VQFF 1U8SA 1B7FA 1ZYQA 1UETA 2HQIA 3IR7B 2XCPA 4ECRA 3DLGA 3FEXB 4DFMA 2BKPA 3G6VA 3GPAA 1O6XA 2FZKB 1NJYA 1KP6A 4NA2A 5HROB 3OLAA 2AYBA 1RTIA 2K7JA 1FERA 1FF2A 4OJHA 4O4GA 3R7NB 3Q8RB 2EKNA 2MHNA 3K5LA 5ETNA 1IKXB 4F3MA 4XPCA 1QY7A 4HACA 1ELOA 1PKUA 2J76E 4K4TA 4ID5B 3T1HF 2DGTA 5BYSA 1SC3B 3MUMP 3MEGB 1BMQB 3UNGC 1Q8KA 1VK8A 1VHIA 2MQPA 3R1HA 3EVMA 3AFGA 1FK9A 2AF6A 4EK2A 2D3ZA 5I3UA 2VBWA 2XS2A 3N5BA 3PJXA 1T9UA 4HKQA 3ZTQA 1C0TA 4A8SA 5L1JA 4P2FA 4P2SA 4L75A 3HHEA 4A46A 2QLXA 2FVRA 2PI4A 3T5KA 4ZVUB 1HWJA 5C2CA 1MG7A 4DN9A 2AZ1A 1FFGB 2VD3A 3KLVA 2HSEB 3H2VE 4JYAF 4HHJA 2J0XA 4N8OA 2XSJA 5HN0A 2KVQE 2B3TB 3HFKA 4ZOSA 4LRBA 4IQXA 1R0BG 2RJZA 3CPWR 2HHTA 2QA4G 1U0HA 5LM7E 4IFYA 5F8IA 3FBFA 4C8OA 1KEKA 1RADB 3V4IB 1QAIA 4KKOA 5HK4A 4QIWD 2FQQB 5C24B 3LTOA 2W9CB 4Y34A 1M5OC 1FVQA 5JXSA 3HLUA 2YH1A 5DG9A 2HQCA 1S59A 3EZUA 2W24A 1HHTP 3C8YA 3ZZ0A 4HYKA 4NYPA 3MEEA 4JI1J 2G0JA 5ETKA 5THWA 4GO5X 1SJ1A 3IP0A 1RT3A 2WB1D 2D74B 4RX6A 4A8OA 1R0AB 2QV6A 1FFWB 1N0UA 2RF2B 3W60A 2WW8A 1WELA 1PSDA 4A8YA 2QLBB 1G2EA 1A7GE 1U02A 4CM0A 4JOUA 2WZ1A 1VRTB 4USKA 4OYPA 4ITSA 4DV0J 3EDRB 4A8XA 1PBUA 3MPWA 4XDDA 1RWKB 4GC7A 5CCLA 2BE2B 5AJ3F 4C4WA 1NPKA 2AJ4A 3NMAA 3FUYA 3SFGA 1NSKL 5KFQA 3CMAS 3N5FA 1PYSB 3R5DA 1L3UA 3PKYA 2FGCA 2YKNA 3NNHA 1UCNA 2G4BA 2VPZB 5LT5A 1DLOB 3NEKA 1GMWD 4F50A 4DV5J 1T3OA 2NSCA 5F3TA 4UOHA 1TU0B 4EGLA 4MIBA 3JSYA 4PXDA 2QG9B 4F0KA 3N6MA 1VLYA 2CJAA 4ILLA 1RCOB 2UUAJ 1SQEA 5LSOA 1BWEA 3X1LB 3IG1B 5A6WA 5BR8F 2A10A 5I3PA 3V4MA 2CQ1A 3K5PA 4IR1A 5HSPA 4IFVB 1HI0P 2H51B 6FD1A 4HH0A 4CP5A 5GVQA 4H4KA 4OX9J 3LP2B 1V3RA 2I9SA 1VI7A 1ZM2A 3AA8A 1IWGA 1HW9A 1U6BA 3VVTA 4DS4A 3D54A 2MKKA 5M2PA 4J91A 3HULA 5DM7Q 2Z2YB 3F41A 1H2TZ 4A48A 2QL5B 5BYRA 1DTTB 5K9FA 5KT4A 5FIIA 1XERA 1JLCB 2OPSA 3NXZA 3W1YC 2CXEA 1RUSA 2HMIA 4U7UD 4LSLA 1ZZFA 1U2FA 1O5JA 1O0PA 3TWZA 4FF3A 1R8BA 3KFWX 4OHXA 2AX0A 5HQ8A 1NKEA 3CJ8A 7FD1A 4NLPA 2E1MC 2M9KA 2RUGA 4K4ZA 1LFWA 1HPZB 3H5UA 3TUJC 3DOKA 1ZAXA 5J2PB 5E2QA 4LF8J 1AXQA 2FB0A 4JI6F 2UU9F 4CLWA 3RRGA 5DQHA 2B4VA 2F3JA 3G86A 3G82B 4LUBA 2PEHA 5HJYA 2EC0A 3K5NA 3SQGB 4RLEA 2K3IA 3RAMA 4P9SA 1PAUB 2XZDB 3QLHA 1KHVA 3OFGA 1VGYA 2BACA 4HI1A 5CABA 1ITPA 3D6TB 2AYMA 4X84A 2XC9A 2V0NA 3HD1A 4HHHA 5L46A 4J7CA 2XLIA 2RS2A 1E6VA 4CLSA 5F8GA 1QAYA 1Q5VA 3NAHA 4RU2A 3BF4A 3DXSX 4C8ZA 4F4ZA 3W2WB 1UTAA 2RHQB 2OH2A 1P1TA 5DQIA 1U47A 3VGSA 1EIYB 3N4WA 2XY5A 3GWCA 2DR7A 4DR6F 2JHEA 3U1NA 5GMKa 2VZ9A 1RT1A 4DU8A 3G71S 2B5JB 2Y1JA 1SJ4P 1RAOA 1RWNB 1FA0A 3M7VA 1IKVB 3SXLA 1XMOJ 1AZSB 6FDRA 1I5OB 3H59A 1KNZA 3CJTA 4DV3J 2BQUA 1UJ6A 2QYCA 3DN9A 1R0CB 2FHJA 5F8LA 1RTJB 4UQGA 2NQPA 2LDIA 1M1GA 3MI7X 4CNZA 2BQ3A 3VF0B 1RB0A 2HGNA 4GVBB 3CCVS 3A12A 2Z2ZA 2HQDA 1CJUB 3Q23A 3HDSA 3D7SB 3KLIB 2F65A 3NS7B 3R5GA 5GMDA 1HIYA 2R7WA 2I2YA 5HLFB 3TP2A 3QFWA 5DO2A 5KFWA 2IBOA 4IH6A 5GMEA 1I94F 1ZTWA 3FEZA 1SQFA 2V4RA 3PKMA 4CO1A 2IC3A 1NDLA 4UZBA 3H8YA 4FP9A 3TA0A 1JLBB 2UVVA 4PQUB 1PG5B 1RT7B 2D9OA 3I0SA 1QE1A 3L7OA 4J90A 1VRQC 4Y2AA 3VAFA 4PWDA 5EHHA 1OY8A 3BEGB 2WBRA 3CIMA 2YBVA 4DF8A 4JP8A 1FDAA 1UA0A 4PCQA 3DOMB 2QL7B 2PMZD 1RHQB 1RWVB 2GNKA 2GFFA 1DHMA 3B82A 3IBCB 1AB8A 2CQIA 1OY6A 4K4UA 3UR3C 3FDSA 1GT8A 4CO0A 4N8NA 2MY7A 3TZYA 3LO3A 2VQEJ 3ZZZA 2P9GA 4C3MA 1CG2A 4J9VA 3FVYA 3SMZA 4C8YA 4Y00A 4X64J 4OZ2A 4JI0F 1YVFA 4RO0A 2FY1A 3MURP 2PA3A 4I6AA 1REVA 3MTJA 4UUWA 1S76D 4LF7F 5I42B 1MNEA 2Q6CA 1X5PA 2QEXS 1SIZA 3LPYA 3N6NA 3CE8A 1YJNS 4TNOA 4JI8F 4ZPCA 2G1HA 3L3CA 1SJQA 1LNQA 2MJNA 1HBOA 1V3ZA 5HMWA 3ISZA 1FJEB 2IMWP 4F25A 3M9NB 2BRLA 1TAQA 2X7IA 3G6ES 3CVKA 3BPDA 2DR9A 4U67Q 3D1QA 4QW8A 3PR4A 2JEJA 1IVZA 4DUTA 3HVRA 1S0OA 2V8HA 1KD1T 1FVSA 3C16B 2OAUA 2ZM6J 5HMYA 1GTEA 3PV8A 3IM9A 1JQGA 4NWBA 4ZVRB 3POTB 1NBEB 4DR1J 1NB2A 2PMWA 5E41A 3CCRS 5J2MA 4G1QB 1X4DA 2HBYB 5DGBA 3I55S 4OJ3A 4QOTA 1S1UB 2WSCC 4WE1A 1QUPA 1FTCA 3MPVA 1KQGB 3MMAB 3EDQB 2CQ3A 5EN1A 4DQQA 2B9WA 4Q2LA 5KFJA 4K2JA 2OKQA 3JSMA 2KYXA 1FJCA 5D15A 1LEOA 5T14A 4ECZA 1KLNA 4ECUA 3M05A 1K0TA 3LP0B 2R7SA 4NCAA 4OZNA 5D0EA 1SXLA 2XMTA 3P5BP 3BR8A 4IKAA 4Q44A 1Q8IA 3EM1A 3F44A 1OO0B 1RT2A 2ZOMA 3BN4A 4PAAA 2KT2A 2HYIB 1VHFA 4DX8H 5IWAJ 2Z4PA 2OEKA 5C25A 1TFWA 4X65F 3MM9B 2IPOB 3GJQB 4WBFA 3P6YC 3CMQA 1T7PA 2B4UA 2R8IA 1ZH5A 1LW0B 2DBBA 1FO1A 2CQCA 4QYZJ 1N6QB 3SCIE 4DG1B 4NLWA 1KQFB 3Q89A 1S57A 3LAMA 1K0VA 3OTOJ 1FWLA 2GIFA 1F60B 1JKHB 3ZNJ1 3TAMA 3OL9A 2DVIA 2OFGX 4YR0A 1CQMA 4OYWA 1DFDA 4KRWA 5KT6A 3NOGA 1WI6A 4DL7A 3LGNA 2H4YB 2Y0SD 1FCAA 1TKZA 3DLGB 3PYGA 3EICA 1DQAA 4UUXA 1IBKJ 1UMJA 1GH8A 1WSRA 1S1WA 4WIQA 3VZHA 1M5KC 5KFAA 1D9AA 1RTIB 4NCGA 2DISA 3W9JA 4FYDA 1XR7A 1FEHA 1ZPVA 2B4PA 1EZZB 4AD6A 1DRZA 1FEEA 3NWRA 4HACB 2BRKA 2HBQB 1HNXJ 2OPQA 1N5YA 2AD9A 1I1GA 4WJBA 1CLFA 4CYUB 2H65B 5KFLA 3CGIA 3FBEA 1IBMF 1X5TA 1FK9B 4YS2A 2KB2A 1PGZA 2FPHX 4JI2J 2C2ZB 5I3UB 2SXLA 4OZ0A 4DR5J 2ZEJA 2BE9B 3K57A 3EVOA 1IM6A 4MK7A 4JI3J 1F3VA 2I1RA 5KFZA 4HDGA 1S4FA 3DLHA 4A8KA 3PW4A 2WB4A 5LL6d 4GO7X 3NGDA 4QWDA 3M8QA 1NK8A 3T19A 4Y28C 2VU5A 4A4JA 1X4FA 1WORA 1FTRA 2LXUA 4YMEA 1WSVA 4YP3A 4EWTA 4FNHA 2BKNA 4NLGA 2XY6A 2PSZA 1Y7PA 3GFXA 2GJ2A 4BWJA 2D3UA 3MM8A 2G1DA 4DR2J 3QSYB 5EX3A 2BW7A 4IFYB 2B43A 1SUQA 4EMDA 1OIAA 4YY3J 3D4JA 3IGVA 1G6BA 4KKOB 3V81A 4JV5F 5CHCB 4F3OA 3R5BA 4OI6A 5G4DA 4MH8A 1J2VA 2NXEA 4AXJA 2HIQA 3MM6B 1FDBA 2MGZB 1Q7LB 3KHLA 2VBZA 4F2RA 1U1MA 2I0XA 2ZBQA 2YNIA 4B9TA 4LIRA 5EWEA 3D1HA 2NZ4A 1BC6A 1Q0NA 3A8KA 4CZCA 1AT1B 2MKCA 3OFEA 4ZP7A 4OYIA 1RQ0A 5B09A 3RBXA 4OZLA 3DDIA 4DX6A 1D09B 1WG5A 1UEUA 4LREA 2ZOFA 3DXBA 3QT6A 2HNYA 3ICLA 5DJBA 4KHPJ 3KWMA 2CQGA 3I87A 2BYCA 2N82B 2QFJA 1N32F 3HK2A 2V2KA 1N34F 2HFSA 3ZXWA 1IKWA 3T1YF 4RWXA 4ZJQA 2CPYA 4Q5VA 4MKVA 4YR2A 4B3RJ 2LU2A 2W25A 3CMES 3JSRA 1RU1A 4YDDB 2ZBPA 3EJMA 4L3KA 3NL0A 4U7UK 1N33F 4F4XA 3QO9A 2EK6A 4AYBD 2IMOA 2VG7A 1HHSA 3MOZA 3SV3A 4NMLA 4RL1A 4ZA1A 3U1MA 2R7QA 5GADU 2DXDA 3T9ZA 2F4VJ 2FLOA 1R3NA 3IMQJ 4KJIA 1X60A 2YNFA 2CQBA 2RE1A 1VS3A 4WKYA 2ZWPA 4ILRA 5E33A 1Z2LA 4RW8A 1VOMA 3U02A 4DV6F 3UD3P 4LF9F 3WC2A 4GKKF 3W9HA 2LKZA 2O66A 4LF6F 2EWHA 4XK8C 4LF2A 4DCJB 1H6KX 3OT9A 1FX4A 2MSSA 4WIIA 1WTFA 4WFBQ 1HWIA 3OUYA 1HNZJ 2QSFA 3C6UB 1K9MT 4LF4F 1CJTA 2K1RA 1TL1A 5M2UA 1VBYA 5IV4A 2FLLA 2VFTA 4WFYA 3NS6A 3WC0A 1LWCA 3Q8UA 5F41A 5CYQB 2OPSB 1AFIA 2JVOA 3PHTA 5M2RA 3UDVA 2A1BA 4Q45A 4B3SJ 3OTEA 3CCWA 5CD4H 4USMA 4ZVSB 2RQKA 4LFCJ 5ADZA 2EFQA 4P75A 5ETQA 3RAQA 3PEJA 4X2BA 4IDKB 2J0SD 5DDOC 2EG1A 4G65A 4JI4F 4WPAA 3DYAA 2HAIA 3KJQB 2G9OA 1VBKA 2DRAA 1NO8A 4KQZA 4KT0C 3VAMA 3DDNA 2XO7A 4EEYA 4XO0A 2XYGB 4UOGA 2HHHJ 1IBLF 3MTKA 2NR0A 2NCKL 1YITS 4JI7F 5IS2A 1Y3KA 2XWXA 5ETPA 2L9WA 1OPIA 1KONA 2GJIA 5KT2A 3D6HB 2VG6A 3DMJA 3QLHB 4DSFA 4WYLA 2OP5A 4QIEA 3UN5A 2BKOA 1RHJB 2E5LJ 3TZXA 3O1LA 1RACB 2LXIA 1UVJA 1YSJA 2FD2A 1GAOA 3W8GA 2LYVA 1K44A 4AFFA 1VIXA 4OYAA 4PZVA 1E6VB 1JLFA 1MMLA 3CF5Q 1R43A 1ZAWA 1RWMB 3JQKA 4TY9A 2XHCA 4PWWA 3M2VA 2CFXA 3RAXA 3TZWA 2H5EA 3GYGA 4P7TA 3M2UA 1GTHA 4URGA 1WDDA 4TQRA 2GCFA 4DV7F 2W7AA 1RT1B 1TTHB 3OFFA 1R27B 4C11A 1TL7A 2CDRB 2GIRA 2XZTB 1RTDA 1A0OB 2E7WA 4J9OA 3EVWA 3IC1A 4ELVA 2YY3A 3GJTB 4ZVTB 2B7BB 3ETOA 3KJFB 2RILA 4WXWA 3P45B 3DI6A 1Q4RA 3HM9A 1E6YB 3NCRA 3BM7A 3IO1A 3K0JA 2KI2A 4EBCA 2YKMA 1HBNA 2C2OB 3HX9A 4RZRA 5ITHA 4MAKA 3S1TA 5KFCA 2RAQA 3TUZC 4QWCA 4AXIA 3V2UC 4M5DA 5DG8A 3LF0A 3BZQA 2IJRA 4YOEA 2ZNZA 2H5JB 2JRSA 4ZCMA 1EETB 3C66A 1C4AA 1TUVA 2BOAA 3G96A 2FJEB 4CLYA 3EXYA 4CDIA 3Q8PB 3SSRA 2GAHC 3X3UA 2ATLA 2YNGA 3LA0A 3QZ8A 1PJ7A 4NI2B 2WSFC 1IR2A 2IIHA 2GMHA 4EYIB 3SSSA 2QLJB 3NBPA 3M30A 3R3TA 3HD2A 2VFVA 1EKSA 2Z2MA 2UUWA 4FS2A 4KIAA 4KHRA 2MHEA 4ECQA 5KFKA 2J8SA 4PWDB 5K8OA 4BBYA 1WHWA 1YJWS 1T9TA 3MEDA 5D0HA 2Y8WA 4ZVGA 1RBAA 2F4FA 5DGAA 4X62J 2DGQA 3M4XA 4AL7A 1TV6A 4NA1A 3OXLA 3ETMA 4OLPA 1RK8A 5F3ZA 4DL3A 4NX9A 2XNRA 4F4KA 4ZJOA 1UVNA 3UCUP 3I32A 1NNDA 2OSRA 3D28A 1W2IA 3GILA 2J0WA 2P8IA 2XG8A 5A8KA 1UVKA 4EZ9A 4E8UA 4ZPVR 2AGQA 1PJ5A 2QMWA 3W62A 1XR6A 5DRKA 3MPUB 4MFBA 3DGVA 2OLWA 1HA1A 4K8RA 4CLPA 3OVBA 2F63A 3QGPA 4ED4A 1RWWB 1RTZA 1EJ7L 2CZVC 4URSA 1REVB 4RW7A 1TKXB 1YWXA 1F3FA 1F9EB 1YRUA 2Y8YA 1WTBA 3D0GE 2DO4A 2DGSA 2DY1A 5C2GA 1RJJA 4DOZA 2DPJA 3ZZPA 3QIPA 3M9MB 2YVSA 3GJSB 1MW7A 2KDOA 1T9YA 1U8WA 5F9LA 1HBOB 4F2SA 4I6WA 1FHTA 2Z0GA 3F73A 3CCLS 1XC9A 3DM2B 5LMUJ 2EXUA 3JYTA 4DDFA 3NGSA 2DPIA 4WFXA 1S7IA 2HKEA 1NDCA 1B0VA 2CRLA 2CVEA 4P71A 2VBXA 4ECYA 5MAOA 3OR2A 2DR6A 2EFVA 2AJ1A 5HROA 4B9VA 2HHUA 4DF4A 1N5VA 3F56A 4LVNP 1VQ7S 4ZS6A 4W92B 4JI1F 3R6GB 4OHYA 5AXMA 1Q16B 3T6JA 4EO6A 1Q78A 2W2OP 2QMUB 4K0KJ 5B0FA 4NASA 3M6WA 1Q1KA 2JVRA 1RYRA 1FRIA 1IKXA 1GXUA 4M5IA 1N52B 4W98A 3I82A 4ID5A 3KJNB 3JSMB 1RHRB 4CWBA 5D8HB 5F8JA 2I6WA 4Y65A 1CC8A 3ZTSA 2BEFA 3L95X 2R7RA 3H7HB 3ILIA 5I4MA 1U1LA 3CNQP 3G8QA 1UKUA 2VJVA 4MYTA 1B3TA 4DI6A 2KXHA 5L39A 3GP9A 3TZZA 2EBGA 4DV0F 1UZHA 1RXOB 1RT2B 2BJ9A 3FCHA 2NSBA 3L09A 2ZUGA 3O8WA 3PY8A 1UVLA 1N54B 2EC2A 3ILOA 2Y1IA 2CNNB 4IQMA 1T3NA 1Z2ZA 2MPUA 3FRZA 1WEYA 3A8JA 2O67A 2MLXA 1S6OA 5FLXU 4X4TA 1VYAA 5KFFA 2XO6A 4LRAA 2R4FA 2MZ1A 3N28A 1QVGR 1O51A 2AW0A 4HT7A 5FLXY 4DV5F 3CCJS 2EG2A 5KG0A 1U1PA 1SI9A 4G1IA 1SB6A 5T7LA 3JS9A 2XSFA 2AYGA 3ITHB 4C48A 5E3PA 1AA1B 3L7PA 1TKZB 2UUAF 3HSJA 1FKOB 2ZZNA 5K14A 1WD6A 1UPMB 1U2CA 4LBPA 4CT9A 1S1WB 2V2ZA 1LKZA 2HLUA 4ANEA 3AXKA 3N01A 2PE8A 4OX9F 4ETXA 2CPJA 4RNFA 1KTVA 2QA1A 1KHWA 2DIUA 3HSZA 4DLGA 2ALYB 3MZIA 3C46A 4NXMJ 2RF2A 3DRXA 3QMQA 2MB0B 1N5YB 4YHHJ 1R8HA 1D9FA 1DJ0A 1VR6A 1NK0A 1SJFA 2CJ9A 4ZPWR 4KTQA 1SC4B 3G6XA 2HRUA 3QNWB 2KN4A 4RPFA 1S0VA 2BE2A 1NK7A 1NK6A 3GYNA 3VGVA 4DEZA 4QU6A 3TQ1A 3BSNA 4CO4A 1X9WA 2EFNA 2ADCA 3T1AA 4ZITA 3CTRA 3VALA 1PYOB 2HHSA 2YQ0A 1QTMA 1OY9A 2GMLA 5L8RC 4PRFA 4U7CA 3PVXA 2NLWA 1DLOA 3OPKA 2G0IA 2ZBRA 4AUKA 4RW4A 4DS5A 2D3O1 1SUQB 2HGMA 2HGLA 4NZ7A 2VPWB 3O5TB 2QRRA 2BABA 1UWBA 4LF8F 3V81B 1T11A 3HXMA 4I67A 3K7RA 2HBZB 1RSCA 3TEHB 1BQXA 4EU0A 2C1EB 4N47A 3R5AA 4IFVA 2MKIA 4ED1A 4TU8A 4PG5A 3PFOA 2VFUA 3LP2A 1IN0A 3GQCA 1URRA 3HFZB 2FDNA 4M5KA 3THVA 1JK9B 5AXLA 3SYZA 2NPIA 4R5PB 4LFBJ 2AEFA 2I8EA 4B3TJ 2J0QD 3ZFVA 1DBDA 2HNYB 3FK4A 4B3MJ 2OTJS 5A2QU 3J7YI 4RUHA 4KH0B 2YKOA 4QIVA 5A2QY 5B0AA 1IKWB 3A8EA 1HL6A 1Y00A 2FLPA 3HZGA 4DHVA 4UTGA 1RBOB 4I56A 2AZ3A 2ATCB 3JTOA 3PX6A 3E2EA 1GMWA 4RNHA 1SL0A 4ZLNA 1XMOF 3MR7A 1VRUB 2NXJA 4DV3F 1Y5NB 3QO9B 2MQOA 3R7BB 4MMOA 4CQ1A 2U2FA 5J2NB 1YI2S 5K20B 5B0CA 5J1PA 2QLWA 3GCWP 1HBUB 1H73A 2ZH5A 3ADAC 4EBEA 4P7VA 4DZ6A 2C2KB 2WONB 2YNFB 1UFKA 4HR2A 3FBBA 1SBRA 1CEZA 4KPCA 1VC0A 5KFYA 4F7VA 2C2MB 3KG4A 4KFBA 4UZCA 3SQGA 1U1NA 2IAJA 1NSAA 1FRHA 2JFDA 4DPWA 2K7KA 2KHDA 5ETMA 2E29A 1RKIA 3ZO7A 1JXLA 5DZ6A 4RKUC 4RBVA 5GAEI 1TK8A 4X4PA 1X0PA 2XULA 2OELA 2KFZA 3CCZA 2X51A 3KHGA 4PG7A 4D3GA 1C4CA 4NLOA 1QSSA 3WIVA 1FE0A 2D69A 1XJWB 4FKXA 4RUBA 3OUYB 4CRJA 2DO0A 1BUXA 2GQ2A 1U1OA 5I3QA 1L3KA 1SVDA 5D77A 4HH1A 4DQIA 2RQ4A 3T1YJ 3W2VA 5A76A 3NNAA 2CPZA 5LJ5Y 4IOBA 1YBUA 5D0GA 3P3DA 4UT4A 3TQEA 3B4DA 4RNMA 1VJQA 2LU1A 4F4WA 1F9HA 3PDNA 1RZMA 4CH0S 1VQLS 4JV2A 2CNKB 1P8GA 1RTJA 3R2CJ 3W8PA 4I2PA 3P5TL 3PHEA 4GVBA 1LW2A 1CJUA 3DYAB 3I4PA 3RZAA 4ZVPB 4C8NA 2VQEF 1P1LA 4DR4J 3W5YA 4BDPA 1UAWA 3QIDA 3ISNC 4X64F 5L9NA 2YWEA 4NLUA 1QUVA 1N5SA 3Q8YA 3KOAA 4CNYA 4PG8A 3PW0A 1AUDA 2LQBA 3QGGA 4N77A 4DPUA 2MLZA 4YQWA 3PW2A 2VG6B 1JLAA 1QAJA 1FNXH 3UCZP 2UVRA 3FEYB 4EYHB 3MOJB 2YPZA 1ZM9A 4M63A 4DL5A 2QE5A 3H98A 1Q8LA 1XR5A 4WFAQ 2M8DB 1JLFB 1M5SA 4ZVHA 1UEVA 4UOCA 1WF0A 4WF9Q 2M7SA 2V8VA 3K5OA 4ES2A 3ILJA 2YH0A 1C1BB 1S6PB 1IJEB 1YLXA 2ALZA 1UA1A 1VQ8S 3OTCA 4WCEQ 3QGIA 2ZM6F 3S01A 3RB6A 2DR5A 3M2UB 4LQ3A 4K5RA 1UPPA 3DOMA 4GKJJ 3H4BA 4DR1F 4C11B 1TL7B 2HNDB 3EGNA 1RTDB 2QA2A 5KFBA 3CCMS 1Q82T 5EUHA 4C7QA 2R2RA 4G1PA 4R0JA 4M5LA 3L4BC 3DI6B 5ETRA 2IA6A 4IRDA 1KLMB 2LEAA 2ZD1B 3CCSS 3WDOA 3AODA 2YKMB 2PI5A 1HBNB 2VUGA 4BHQA 1HWLA 3D66A 3M8RA 1NJZA 3GMGA 1F2HA 4M5DB 5A8RA 2JC0A 2Q79A 5I42A 2GQQA 1PC5A 4TKTA 2EBEA 1NHUA 1JWWA 2UVUA 4QW9A 1TMMA 4HDHA 1D3WA 5HVFA 4C98A 2PC6A 1BE4A 5HAOA 3OXFA 5IWAF 2YNGB 4ZKAA 2DGUA 3HT0A 1SPBP 2CQ0A 3NP5A 1T05A 2HVZA 4WU2A 1DZ5A 1FDNA 4WZMA 3NBPB 1WEXA 2FC9A 4O3SA 3M30B 3R27A 3OTOF 1AROP 3UPFA 2RU3A 4ED6A 3NS5A 1Q79A 1D1UA 1GXLA 4NLQA 1DQ9A 3POTA 4AT1B 4DU7A 1WG1A 4G1QA 5L1LA 2KT5A 3TJ9A 2QZ8A 5ETTA 1IBKF 4E2FB 1YQHA 1U2RA 5DDRC 4B9UA 3PIOQ 2YKAA 3L7UA 4YR3A 4P73A 4I7FA 1S79A 2AWZA 1C1CA 3H42A 5A8KB 3N79A 1TMJA 1HNXF 4IRCA 2NUHA 2ZDPA 4NLYA 6AT1B 3M6UA 3LP0A 2OI2A 5A0YB 1YJVA 1V5IB 5CZXA 4R8UA 2HZCA 3J7A1 1RABB 3LGMA 1TL5A 3OHAA 2HHVA 4JI2F 4F02A 4Y2IA 3IN5A 4RW7B 1RAFB 4DR5F 2GGPA 3BH7B 4ZPAA 5E3QA 2RSQA 4F0MA 3PCOB 2XBPA 4KGVB 4EO8A 4JI3F 1U1QA 1B70B 4F4YA 4LQ9A 5JUMA 4KPYA 1RAHB 3OD2A 3TAQA 2BJEA 1T03B 4B02A 2P6SA 3QIPB 3MM9A 2HHQA 3KHHA 4X4QA 3PRVA 2EPIA 2XM3A 2DNQA 2O1PA 3WHIA 4S0MA 1Y11A 2J9DA 4W4MA 4PPZA 2W2NP 3B4MA 5F0WA 1JKHA 4NXNJ 3JYTB 4DR2F 3HKWA 2VASA 2H1YA 1SQGA 3QATA 4YY3F 2W2QP 3QRRA 4X4UA 3BPSP 2QLFB 2ACYA 1U0SA 4ED7A 2AJ0A 1MROA 4I69A 1RHKB 5LJ3Y 1BLUA 3HSDA 2F1FA 3CJ0A 2FGOA 3OR2B 1NRKA 3UD5A 4ED2A 3S7RA 3GIJA 1WC4A 1RWXB 2MLYA 3D3CJ 3VAKA 3MMBA 1K73T 5KFEA 2QTWA 3RU0A 3FMBA 1WC6A 4C97A 2NS1B 4R25A 7FDRA 3DU6A 1FJGJ 3CW2C 2L3MA 5HQLA 4Q43A 1V6HA 1FXDA 3RW7A 3KDNA 2KH9A 3QJPA 4IRKA 2ZH7A 4CYUA 5GAGI 1KVJA 3Q8VA 4DL4A 3PYEA 3A4TA 4DV2J 1S6UA 3MR3A 4KHPF 3WQPA 3EE3A 4DV1J 4DSLA 1MSWD 3IR6B 1X4HA 3DC2A 3J7Z5 1HR0J 1WF2A 2PO4A 1P27B 3I5CA 4A8WA 1SL2A 3G9CA 3V6KA 1NJXA 1KC8T 2ZJRQ 2DR8A 4B3RF 4OIXA 3ISND 1XNRJ 3UVJA 3ZTOA 1JNZB 3CUNA 3TVKA 5A8WB 4X4VA 2DNKA 3OQ2A 2UUTA 2XLKA 1WHXA 1HWUA 3HCXA 1RBLA 3TJ8A 3NY0A 3M1VB 2HWHA 4JV1A 1ZOTA 3O44A 2FC8A 2XCAA 3QQCD 3DLJA 2F4VF 1DQ8A 2JOQA 5T7LB 4EUVA 3HVTB 1OSDA 3M6XA 1S10A 4ECVA 1R89A 1Q53A 2XQCA 1QTNB 5K14B 2E5GA 3R6LB 4AL6A 1VCTA 3MM6A 2MGZA 2HZVA 2ZNYA 5KFIA 5MLCV 4ZPBA 1HW8A 3TUIC 3RG6A 4I2QA 1QM9A 1SKWA 5C42B 2IFXA 2VOPA 2XHWA 1U45A 1HNZF 4NYOA 3IGNA 1NU4A 3AA9A 1HNWJ 5KG7A 3D5MA 2R7XA 3MR6A 3PO4A 1N0VC 1XK8A 5KOWA 4OYOA 1BQMB 4OV1A 3OJSA 1B0PA 1LWFA 1J5EJ 1OMSA 3FCVA 4L72B 2JFKA 1FJ7A 4DFPA 1U6ZA 1D8ZA 3BGRB 5CD4A 2QL9B 2WAQD 1WNEA 3HVWA 3DRYA 1Y9OA 3EPGA 4G6VB 4B3SF 2D7SA 2OPRA 2Y1RI 2CQHA 2AMCB 4LFCF 4IYQA 3M9OB 1KWMA 5HATA 4RW4B 2FYXA 2MZRA 3DDKA 2XEXA 5IT0A 3Q86A 2R8JA 2XTJP 3HHDA 3BBBA 1UWBB 1W26A 5DLGA 4J9LA 2DHHA 1S9EA 2XYPB 2HHHF 5ETSA 2BA9A 3I6PA 1NH8A 4KGZB 1HWKA 3GSDA 4KC5A 4KE5A 3NOCA 4K4SA 5KFDA 3DLLQ 2YQ1A 2FZGB 2ZH8A 3CC4S 3MWBA 4DN0A 5ETLA 1P9YA 2L41A 2E5LF 1J27A 3RUBL 4M5HA 2ZBIA 4QWAA 2JNJA 5E0OA 3GFHA 3GIIA 3FSXA 1VBXA 4C0OC 2KG1A 3C6UA 3TW0A 1NUEA 1X0FA 4QWEA 1FKPA 3CD7A 5HMXA 3W7BA 5CYQA 3G6YA 3W3SA 1RT6A 1B99A 3HMJG 2UZAA 1FI4A 3FFIB 4CLZA 1RAEB 1ZAVA 1H38A 4RW6A 3DLKB 3HJVA 2NPFA 2AHOB 3AD9C 5F9NA 4ICLB 2HAFA 2RKIB 1OS5A 1NB7A 2CNOB 3SCJE 2BW2A 1NSPA 5L1IA 3BGOP 4FPIA 2W9BB 4IDKA 2KM8B 1WOOA 1S0MA 2NREA 4L73A 4EI2A 2NXUA 3GIRA 2FHOB 3JB9k 1S1XB 1UW9A 4FPRA 3AAWB 3UN2A 2HHXA 1FRLA 4O23A 3I56S 4XPEA 3TUPA 2KKHA 4NLTA 4FYVB 3R1LA 3GE9A 3MPYA 4RWWA 2IM2A 4DX7A 2CZ9A 4KFBB 2IAJB 2DB1A 4WWSA 1WOPA 1S9GB 4DZDA 3IWNC 3TOQA 4X66J 1QDUB 3N6LA 3KUHA 3LALA 1VQ6S 2OD6A 3R9LA 3EZ5A 4ATNA 3GIKA 1JNRB 2HNZA 3V6DA 2FUG9 2M8HA 2V34A 3H5YA 2CJBA 2FLNA 1NDKA 4TVAB 2NUUG 4RUCA 1A9NB 2I5JA 3QWPA 4ZDNA 2IDEA 2XI2A 2K8GA 3V6JA 3W2VB 2V4JA 4ENOA 4Y2MA 1FX2A 2ZH3A 1APSA 3I0RB 3IAS9 3EUNA 4K7QA 2OSQA 3BJYA 4X62F 5J2QA 4MKYA 1NZ8A 2YTCA 1NHKL 2F8MA 2N3LA 1LWEA 1RAGB 4Q8FA 1WKKA 5KG4A 2DH8A 4I2PB 4NRTA 2OEJA 1RGVA 3CDUA 4FBTA 1LW2B 1FWKA 3D1OA 2GO8A 5HP1B 1E6YA 2C28A 3EYZA 3VR1A 3BO3A 2GV1A 1G1XA 4AQYJ 5H9EJ 2V67A 4KGMA 2X3DA 2APOA 1EETA 3AD8C 3KG1A 2LQ9A 4XAKA 1IKYA 3NGRA 5CA5A 4P74A 4PG6A 1JLAB 3UR0A 1HHQA 1MWYA 3B8HA 3NGTA 4K4YA 2E1PA 1TR0A 3QFHA 4NI2A 2WOMB 2R8GA 2FY8A 1U48A 4Z7CA 2HPUA 1HD1A 1IQTA 1PCAA 2RS8A 3W66A 5SZTA 4L74A 3QGHA 2LFVA 1HMVA 1Y5LB 4DFJA 4ELUA 3SCLE 3QPIA 3CDWA 5LMUF 5HMZA 3BBCA 1KSPA 2WK4A 3OHBA 2FJXA 1ZM3A 2HQFA 3LW5C 4UY85 2FIUA 3MAHA 4OHZA 2DNHA 1NXIA 3LWLA 4A47A 1WF1A 4QR2A 2J7KA 1X9SA 3M8YA 1ICEB 1YBTA 5LXYA 5GAHI 3CO9A 2GX8A 4K0KF 3K59A 4GMKA 2YNHB 4YB1P 5BXIA 2LQ8A 2ROEA 1EAYC 2CVIA 4I64A 2MQ8A 2MXYA 3MAQA 2V9WA 3ZNUA 2G2OA 5A8RB 1TKXA 1C0UB 2A2DA 4AL5A 4ED3A 2WCXA 2QIFA 2EI5A 3GIMA 4FXDA 1UW4A 1N36J 3GYXB 3CXCR 5F8HA 2E7VA 4C0BA 4X4RA 2OTLS 1BHNA 4Y3CA 2MZTA 4RNOA 3CJQA 2Z56B 4O44B 3J7YU 1B64A 1HI8A 1VJWA 3WX8A 2MKYA 2V5HG 3RYLA 1VBZA 1T05B 3Q83A 1HNIA 2AEMA 4DPYA 1HD0A 1LXJA 1RTHA
chains in the Genus database with same CATH topology
3DM2A 2GHPA 2KZMA 1S6OA 3N5FA 3R5DA 4X4TA 3RB0A 1L3UA 3PKYA 5KFFA 2FGCA 2XMWA 2CQPA 4ZHRA 2R4FA 2YKNA 3I4HX 3NNHA 1H98A 2IJNA 2MZ1A 3DRPB 3N28A 1QVGR 1O51A 2AW0A 1K1SA 4HT7A 4WK1A 5FLXY 2G4BA 2VPZB 5LT5A 3TAPA 1DLOB 4DV5F 1TK0A 3CC7S 3CCJS 4EBDA 2JX2A 4F50A 2EG2A 5KG0A 2JDJA 1U1PA 1SI9A 1T3OA 2NSCA 4G1IA 5F3TA 1SB6A 2CZ4A 2RRBA 4EGLA 5T7LA 2V9KA 2Z8QA 4MIBA 2FJVA 3JSYA 4M8LA 3DGPA 4FZVA 3M8PB 4N5SA 4PXDA 2I38A 2XSFA 3DOKB 2AYGA 5KFXA 3N6MA 5FJ4A 3ITHB 2FHJD 5E3PA 1VLYA 3L7PA 2CJAA 1RYSA 1TKZB 2UUAF 4ILLA 3A1YG 2M2BA 4PXBA 1FKOB 1T95A 1SQEA 5LSOA 1T02A 2WSEC 5J1EA 2ZZNA 4K4VA 3V5RA 4K4XA 5K14A 1BWEA 1WD6A 3IG1B 3X1LB 2J6SA 2XS5A 1X4EA 5A6WA 4USHA 3M8SA 4CT9A 5BR8F 2M52A 3LWMA 2VONA 2A10A 1S1WB 4LJMA 2HWIA 1JIHA 1FXLA 5I3PA 3V4MA 2CQ1A 3IWLA 3K5PA 3KKFA 1IJFB 1LKZA 4IR1A 2WRMA 2HLUA 3KJVB 2YNHA 4IFVB 4K2XA 4I7FB 2YWFA 3QAEA 1HI0P 1O8BA 3ULHA 1YHQS 6FD1A 3N01A 4HH0A 2PE8A 4BC9A 4OX9F 1M1KT 4ETXA 4ALZA 4DL6A 2CPJA 5GVQA 2YX7A 4H4KA 4RNFA 1C1CB 1KTVA 1OWXA 2QA1A 2LA6A 1KHWA 2HHWA 5KFUA 3LP2B 2DIUA 1V3RA 4DLGA 2I9SA 4NXMF 1VIOA 1VI7A 3RTVA 1SKSA 1ZM2A 3AA8A 3MZIA 2ASDA 1XMQF 4YHHF 4BCAA 3C46A 2RF2A 3DRXA 3QMQA 2VKZG 1HW9A 1WI8A 1NHVA 1JXEA 1N5YB 2MB0B 1U6BA 4DS4A 3FGVA 1R8HA 3D54A 2MKKA 1D9FA 2DCUB 5M2PA 1DJ0A 1F5BA 4R8UB 1C0UA 2GA7A 3IRWP 2DGXA 1JLQA 1NK0A 1SJFA 5GAEU 2ZBCA 3I5AA 5DM7Q 2AGPA 1VQOS 2X3GA 3UD4P 2UUCF 4HLBA 1FNOA 2CJ9A 2P5VA 4ZPWR 5F8NA 4KTQA 2W7OA 4KB7A 3F41A 1H2TZ 2MKSA 1NJIT 1H7XA 3TA2A 2CJKA 1CSJA 2MQLA 2HRUA 3G6XA 4A48A 2GGPB 2KN4A 1M5PC 4NPOA 4O0IA 5BYRA 1S0VA 1DTTB 2JJ4D 5K9FA 1UFLA 5KT4A 2BE2A 5FIIA 1NK7A 4DLEA 1NK6A 1XERA 2P9EA 3GYNA 3O6QA 1MWZA 4DEZA 1W2BR 3OV7A 4QU6A 4UQTA 3TQ1A 1JLCB 2OPSA 2EW9A 1JLEB 4O44A 3BSNA 4ECWA 1FRXA 2XMJA 5KG2A 5D4PA 4D3HA 3PACA 2HMIA 4CO4A 1X9WA 4LSLA 2EFNA 3CD0A 2ADCA 1OPZA 3T1AA 1L3TA 1J5OA 1ZZFA 3MHYA 1JJ4A 1U2FA 4CCHA 2UXDF 1O5JA 1O0PA 3IWXA 1RKJA 3I9V9 4FF3A 3CTRA 3UDLA 2GC8A 1GNKA 3VALA 4WTYA 2O5DA 1JLGA 1R8BA 2HHSA 3KFWX 1X4CA 3TVZA 3QZ7A 3PX0A 3AJ2A 2RDIA 1QTMA 2GMLA 5L8RC 3PO5A 3PRBA 4PRFA 2J8AA 5KOXA 4U7CA 3M32A 4J9NA 3ZZTA 4OHXA 5E7OB 3PVXA 2AX0A 2NLWA 4TYAA 1DLOA 4LIWA 4MJKA 5HQ8A 3OPKA 1NKEA 7FD1A 4OI0A 4AUKA 4NLPA 4RW4A 4DS5A 2E1MC 3MF5A 4PUOB 2M9KA 3NWGA 3KTQA 2RUGA 4K4ZA 2GMJA 1LFWA 1SUQB 1HPZB 2HGMA 1IM4A 2O3DA 3H5UA 4H4MB 3TUJC 5KG5A 2HGLA 4NZ7A 3VAGA 2VPWB 3DOKA 3O5TB 2JLFA 1KFDA 3ITHA 2QRRA 1MROB 2BABA 1UWBA 3US5A 1ZAXA 3CULA 5CYMA 4LF8F 2XI3A 5J2PB 3V81B 2JC1A 5E2QA 2W4DA 1FKOA 4YUDA 3HXMA 4DUYF 1AXQA 2C3PA 4I67A 2FB0A 3K7RA 4JI6F 2MQMA 2IA0A 1U1RA 2UU9F 3RRGA 1KQSR 1BQXA 2VPXB 4EU0A 5BJRA 4EFAC 3LP1B 4UW2A 5DQHA 2B4VA 2F3JA 3G86A 2F9JA 3MXHP 3MMBB 4N47A 2R9LA 3R5AA 4FF2A 1PILA 1R7IA 5DG7A 3I5BA 4LUBA 3VQTA 1FKAF 2PEHA 4IFVA 2MKIA 3ZZYA 2EC0A 4TY8A 3K5NA 4ED1A 3SQGB 4RLEA 5L1KA 2DNGA 4TU8A 4MTPA 2K3IA 4PG5A 3RAMA 3ZC4A 1N48A 3PFOA 2VFUA 2C3OA 3NRBA 2KRBA 3QLHA 3LP2A 1IN0A 3GQCA 4G3IA 1KHVA 5E3RA 3D2WA 3BQ0A 1URRA 3OFGA 4PKDB 4NRUA 1VGYA 4E98A 1V3SA 2BACA 4HI1A 2IC3B 2FDNA 3JTNA 2LDYA 4J9SA 3THVA 1LQ9A 2AYMA 3QYYA 1JK9B 4X84A 2EFOA 2XC9A 4C8MA 2V0NA 2ZH4A 2CQ2A 2KVIA 4QWBA 1MMDA 4LFBF 5AXLA 3KMQA 3SYZA 4DV4F 2A18A 2NPIA 4R5PB 3T9NA 2I8EA 4B3TF 2MZSA 2XLIA 4DBQA 2RS2A 1E6VA 2J0QD 1VQMS 5KG3A 3ZFVA 5F8GA 1G3OA 1AFJA 3BSAA 3CDEA 1QAYA 1DBDA 2CIMA 4B3MF 2HNYB 2HVIA 4OJGA 4DFKA 2IYIA 2IM3A 2OTJS 3I0SB 3NAHA 4RU2A 4DR7F 4KV8B 3MMCB 3J7YI 1QE1B 1HARA 1MU2B 1YRTA 4RUHA 2HS4A 3BF4A 3DXSX 4C8ZA 4F4ZA 1XNQF 2YKOA 3W2WB 4QIVA 2OH2A 5A2QY 1P1TA 1VMBA 5B0AA 5DQIA 1VFJA 1IKWB 4K5SA 3GB0A 1U47A 1VQPS 3A8EA 3NKYA 3CB4A 4ZVFA 5I42A 3OR1B 1HL6A 4DPOA 4K4WA 3TA1A 3N4WA 5IFMA 1Y00A 2XY5A 2FLPA 3HZGA 3GWCA 2DR7A 2BZ2A 1A6LA 4DR6F 2JHEA 3U1NA 5GMKa 2MKHA 3MEKA 5D3GB 2VZ9A 1RT1A 3G71S 2B5JB 4DHVA 2FVCA 3NCPA 2Y1JA 5IXUA 4I56A 1SJ4P 4DSJA 4LVOP 4OI4A 3JTOA 2ROPA 3PX6A 3E2EA 4NZ6A 4JV0A 1HNVA 4RNHA 3DRRB 1SL0A 1XMOF 1FA0A 4OFZA 1IKVB 1VRUB 3ZZUA 3SXLA 3RRKA 1K1QA 4B3OB 6FDRA 4DV3F 4RW9A 4NLSA 1Y5NB 4WFZA 3H59A 3HHLC 2MZJA 4KAIA 3QO9B 3OL7A 4NA3A 1KNZA 2IM0A 2MQOA 2BQUA 1UJ6A 2QYCA 3DN9A 4MMOA 4CQ1A 2U2FA 4DSEA 1TP7A 5J2NB 1YI2S 2FHJA 2YWHA 5F8LA 1RTJB 4PPDA 4UQGA 2NQPA 2LDIA 3DLEB 3MI7X 4CNZA 2BQ3A 3VF0B 4RBUA 2DNMA 5EWFA 1YJ9S 3GV8B 2DD8S 2ZE2B 4I68A 5B0CA 5J1PA 2HGNA 2QLWA 3CCVS 1HBUB 2ZJQQ 4HL9A 4DUZF 1UVMA 1SH0A 2RNEA 2ZH5A 4EBEA 3Q23A 4P7VA 3RR7A 3HDSA 3PJWA 1XN9A 2VFRA 2WONB 2DHSA 3KLIB 2YNFB 1NK9A 3E51A 4LFAF 2OMLA 2OPPA 1SBRA 1CEZA 1VC0A 2R7WA 2I2YA 5KFYA 5HLFB 3TP2A 2EVZA 3FQKA 3KG4A 4KFBA 3SQGA 3EGWB 1U1NA 2XB2D 2IAJA 1FRHA 3KK2B 1QAXA 2X1FA 2JFDA 5DO2A 2K7KA 2R8HA 5KFWA 2IBOA 2KHDA 2FTRA 1F5AA 2RB7A 4IH7A 4IH6A 4KBIA 2E29A 1I94F 1ZTWA 5DLFA 2FJDB 3IS9B 4NZ0A 2LEBA 4J9QA 1RKIA 4Q2MA 2VKRA 3FEZA 1SKRA 1U09A 1UJ5A 1JXLA 2V4RA 3CD5A 5H1SV 3PKMA 4CO1A 1UVIA 4K59A 2AX1A 2IC3A 1YG0A 4RKUC 2ZC4A 1FE4A 1MMNA 3BDPA 4RBVA 2C2RA 5GAEI 1TK8A 4X4PA 1X0PA 2XULA 3OSPA 4I2QB 4MKBA 3T5LA 1RT4A 4R5PA 2KFZA 3CCZA 1YRXA 2X51A 3KHGA 3H8YA 4FP9A 1DTQB 1S7HA 3QAUA 3TA0A 2OMOA 4CH1A 1JLBB 4PG7A 1JJHA 4D3GA 3HF5A 2UVVA 2DNRA 1H2VZ 1C4CA 4NLOA 1QSSA 4PQUB 5LSRA 4HEA9 3UDCA 4L3NA 1FE0A 1RT7B 2E7XA 4HVZA 4IO9Q 4R0EA 3OUYB 2D9OA 3I0SA 4AE5A 2DO0A 1D8YA 1QE1A 4ZP8A 1HBMA 3MUVP 2GQ2A 3L7OA 1U1OA 4EZ6A 3Q22A 2JEIA 5I3QA 2Q66A 1L3KA 2YKQA 5D77A 4HH1A 4Y2AA 4DQIA 2RQ4A 2KO1A 4HTIA 4C8LA 3W2VA 1URNA 2F8EX 1S48A 4OI2A 3NNAA 3VAFA 4ILMA 3LANA 2MYFA 2AGOA 2ZITA 2KZZA 1FXRA 2ZHAA 1S72S 2CPZA 5LJ5Y 4IOBA 4PWDA 1LWFB 1LK7A 5EHHA 1N5QA 4LSNB 2VC0A 4YB5A 1XEZA 2W8KA 3P3DA 4BC7A 4ED0A 3H40A 3HHKA 3CJKB 3B4DA 2VC1A 5KAKA 4RNMA 2XMVA 4N41A 2COLA 3BEGB 2LU1A 4CI0B 4F4WA 2Q3PA 2WBRA 3CIMA 4KO0B 4DR3F 4OQJA 1VRUA 2BANB 5D4NA 4DF8A 3PDNA 2J9DE 1RI7A 2JEGA 1KS2A 3KLHB 1FDAA 1UA0A 1RA6A 4URQU 4PCQA 4CH0S 2OPRB 4X4OA 5AE1A 4U9RA 2IM1A 3PRDA 2R2UA 1VQLS 4JV2A 2PMZD 4MK8A 2QT7A 5IT9Y 2GNKA 2HW3A 5J2NA 1P8GA 4J9KA 1RTJA 3BGUA 4OJ1A 5J2MB 2GFFA 1DHMA 1GX6A 3B82A 2FJWA 2CQIA 4TLQA 4I2PA 2ZE2A 3P5TL 3PHEA 4K4UA 4DQPA 5KFHA 1HBUA 1K8AT 3UR3C 3FDSA 5KG1A 1LW2A 3PXGa 5JJBA 4WE1B 1HFEL 1GT8A 3DYAB 3I4PA 3RZAA 4CO0A 5JVHQ 2M0GB 4DR4F 4N8NA 2MY7A 2WONA 4C8NA 2VQEF 1P1LA 4BDPA 1UAWA 3LO3A 3QIDA 3ZZZA 2P9GA 4C3MA 3ISNC 2LXFA 3TR5A 1CG2A 5CH7B 1S6QA 1IUJA 5J1NA 3G8SA 1S9EB 2WBMA 4CO5A 1FD2A 3FVYA 4ED8A 4X64F 5L9NA 2YWEA 3KK3B 2MY8A 3SMZA 3Q2SC 4C8YA 4H54A 4NLUA 4Y00A 3KK2A 3AHPA 1QUVA 2UXCF 1HI1A 1N5SA 4B08A 3MEGA 3KOAA 1S1VA 4JI0F 4CNYA 4PG8A 3PW0A 1QVFR 2H9ZA 4OX8A 1YVFA 2VFSA 1AUDA 2FY1A 3UQSA 2LQBA 2OD4A 3MURP 3IBWA 2PA3A 3OTDA 3QGGA 4I6AA 4N77A 2JEFA 1REVA 3MTJA 1WHYA 4UUWA 1S76D 1S1TA 4QPTA 2E5IA 1TL4A 4LF7F 2C3YA 4YQWA 3PW2A 5I42B 1MNEA 4RU9A 2VG6B 1JLAA 1RT5A 1QAJA 1Y0HA 1RISA 4Q7AA 2Q6CA 2W4CA 3PM9A 4J9PA 3UCZP 1FNXH 2UVRA 3FEYB 1X5PA 2QEXS 4EYHB 1SIZA 3LPYA 3MOJB 5L9XA 1N56A 1ZM9A 3N6NA 4M63A 3CE8A 4PG4A 4DL5A 1YJNS 1U49A 2QE5A 5HBMB 4TNOA 1W25A 2HFZA 4JI8F 4O3QA 3Q8SB 2R7VA 4ZPCA 3J7ZT 3H98A 1VQ9S 5B08A 3L3CA 3GZ7A 4I0WA 1SJQA 1Q8LA 2F40A 4OZ1A 1XR5A 3D0IE 2A3JA 4X4SA