2BUNA

Solution structure of the bluf domain of appa 5-125
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
121
structure length
121
Chain Sequence
LEADVTMTGSDLVSCCYRSLAAPDLTLRDLLDIVETSQAHNARAQLTGALFYSQGVFFQWLEGHPAAVAEVMSHIQRDRRHSNVEILAEESIAKRRFAGWHMQLSCSEADMRSLGLAESRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Appa
molecule keywords APPA
publication title The solution structure of the AppA BLUF domain: insight into the mechanism of light-induced signaling.
pubmed doi rcsb
source organism Rhodobacter sphaeroides 2.4.1
total genus 28
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2005-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04940 BLUF Sensors of blue-light using FAD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2bunA00
2RMLA 1JK9B 1R6YA 1OQ3A 2K1RA 1X7VA 1YJRA 3BN7A 1FEEA 2K1RB 4OJGA 3CJKA 3HHLD 4HI2A 3CJKB 1IUJA 4HI1A 1AFIA 1CC7A 3GZ7A 5A6PA 5IXUA 2AJ0A 3BGUA 2XMUA 4DL0C 2LQBA 2HLUA 4U9RA 2FB0A 1GXTA 4FNIA 1APSA 1YG0A 4OIXA 1WD6A 2N4CA 4HH0A 2OFHX 1K0VA 3E8OA 2RILA 4NPOA 3BR8A 4DN9A 2OD6A 1V3ZA 2ACYA 1VQYA 2VV5A 3HFKA 2LDIA 2LXFA 1S6UA 3LGNA 1FE0A 4Y2IA 2BYCA 3F44A 2XMWA 4A4JA 4Y2MA 3UDCA 1TL5A 2N7YA 2ROPA 1AW0A 2XMJA 1YJVA 2GGPB 5B09A 2AJ1A 4ZA1A 1KVJA 3LGMA 2BBEA 1AFJA 1XBWA 1Q4RA 2BJEA 1FESA 3I9ZA 1Q8BA 3DCAA 3KKFA 1Y0HA 1CPZA 3BM7A 1X8DA 1SQEA 3HX9A 2JDJA 3FMBA 1FE4A 5B08A 3IWLA 2QIFA 4A47A 2VH7A 1N5TA 3T9NA 4YDXA 1KVIA 2BUNA 1YJTA 1X0PA 2PD1A 2ZDPA 2ROGA 3K7RA 3TRGA 5KAKA 1TL4A 2XMTA 1W2IA 3BDEA 3WDOA 1GXUA 1CC8A 5K9FA 1P6TA 3QMQA 2IYIA 2OFGX 2GV1A 1Y3JA 3MCSA 2FIUA 3TNVA 1TR0A 2K7KA 2OAUA 3HDSA 4Q2LA 2QYCA 1P8GA 4NL5A 4OJ3A 4Q2MA 2KT2A 1JWWA 1MWZA 5B0EA 2HQIA 2ZDOA 1N5SA 1ULRA 3KNGA 3IWXA 2IYGA 2W4DA 1FD8A 1SI9A 3FRYA 4HH1A 3MZIA 4Y2KA 2AP6A 1Q53A 2KYZA 5B0BA 2HIQA 2GA7A 2W4PA 2Q3PA 2ASYA 4OJ1A 3LO3A 5B0AA 2W4CA 1U7LA 2FTRA 3HHLA 3HHLB 2XMKA 1KQKA 1Y3KA 2XMMA 2CRLA 2OMOA 1QUPA 2BJDA 2KKHA 4A46A 5T7LA 2RSQA 2XMVA 3KG0A 5T7LB 4ZOSA 2IFXA 4DPOA 3HHLC 1URRA 2AW0A 3KG1A 4EFAC 3DXSX 1Y9OA 1Q8LA 2EW9A 2GCFA 4HL9A 4OJHA 5B0CA 2GO8A 2HFNA 1SB6A 1YRXA 1MWYA 2PGCA 2QLWA 2RU9A 1FVQA 1TUVA 1VQSA 2N4DA 2OP5A 2QLXA 5F0WA 5B0GA 3BF4A 2OKQA 5F0UA 1OPZA 2K2PA 1FVSA 2HFOA 4FNHA 1YJUA 3TOQA 3VTIA 1N5QA 2HLTA 2L3MA 2K7JA 2OD4A 4F67A 1N5VA 4A48A 1S6OA 5B0FA 2KT3A 3QGPA 2GGPA 1RJJA 2FHMA 5A6WA 3FGVA 2LQ9A 1OSDA 1TZ0A 1OQ6A 4YEAA 2G9OA 4QOTA 5B0DA 1LQ9A 2GFFA 2ROEA 3HF5A 3BB5A
chains in the Genus database with same CATH superfamily
2ZC4A 3R27A 2RDIA 2RB7A 4IFYA 2C2OB 2WOMB 2RHQB 3PV8A 5KFLA 4DSKA 1T03B 3BBBA 4FS2A 4YHHF 3N6LA 3RW6A 2GVDA 1Y5NB 1JJ2R 5C24B 1CJKA 1OS5A 4QWCA 4DQQA 5F8GA 2ZEJA 2GC8A 3OLBA 4NLPA 2HAFA 1GT8A 1L3UA 3UR0A 1OYEA 3GIRA 2W7PA 3LO3A 5B0AA 5HK4A 8RUCA 3LWLA 4DUYF 1QSLA 4K59A 3MAAB 4A8YA 1VIOA 3V4IA 2A1BA 4DOZA 4K4SA 4F4WA 2R2TA 3SSRA 1MU2B 2OP5A 1AYEA 2DCUB 4X4QA 4F2RA 5C25B 4CLPA 5ADZA 1UJ6A 5HAOA 1S0VA 1T0TV 4GC7A 1TQLA 1L3VA 1QE1B 2HKEA 4G65A 3MCOA 1AZSB 1LW0A 2BYCA 1HD1A 4CT9A 2MPUA 3MTJA 4YR3A 2M52A 1RKJA 4YHHJ 4IQMA 4P71A 1RTDB 4F4ZA 3ITHA 3VGTA 5GMDA 2ERRA 1HI8A 2P9GA 3SYZA 1C4AA 1T05B 1NK5A 4FXVA 5MAOA 5DGBA 2R8HA 2O5DA 1JIHA 4N76A 4Q2MA 4DL3A 4P7VA 4IYQA 5J2PB 4WKRA 2VG7A 2DNNA 1U1QA 2MZQA 1CJVB 3TUIC 3IRXA 1ELOA 2CG4A 4DUYJ 3F56A 2XULA 2YWFA 4ICLB 3S01A 1EHWA 2AT1B 2UZAA 1WF0A 1NU4A 2KT5A 2RKIA 1MWQA 4RW4A 4WXOA 2WB1D 3D1QA 3T1YJ 4PXBA 1X4FA 1R3NA 3KJNB 2HGMA 2HS4A 2LECA 3QSIA 5J1EA 2EXUA 3QSYB 1A9NB 3CXCR 5D0RA 4ZPBA 1OY8A 2MHEA 3B6BA 3FQLA 2BMBA 3JYTB 1ZAVA 1YRUA 4DL0C 2J7UA 3ZZUA 3M1VB 3PVXA 3MMCA 3QIDA 2KVIA 2XMWA 1LWFA 3MCMA 2R7VA 1BQMB 2AJ2A 5DDQC 3F73A 2KL8A 2KG1A 1HYSB 3LUYA 1U45A 3BYPA 5AXMA 4QWBA 2D3OR 1QSYA 3VAHA 1U0HA 3CNQP 3NMRA 2YH1A 5AXLA 5HATA 1NMEB 4WIIA 4FN5A 3I0RB 4A8FA 2O1PA 2C3OA 5KFIA 3T6JA 2VD3A 4M8LA 4QWEA 2UXDF 1BWEA 3PIPQ 4IFVA 2FLNA 5CCMA 4A8QA 5CHCB 4F02A 2ZITA 3LPYA 1U4BA 3Q8RB 1RTHB 3ZZTA 3KHGA 5DETA 1URNA 2XTJP 4USMA 4NRUA 2GQ2A 2RVJA 2PMWA 4OX9F 4F0KA 2GIQA 4DCJB 2MQNA 3OL7A 1WSRA 2OPSB 3OJUA 2A6OA 1XK8A 4F3QA 3QNWB 2IVMA 3M9MB 2AEJA 2CFXA 2XS5A 5HQLA 5J2MA 2A6MA 1S9GA 2HQ3A 2XC9A 2DO4A 2V34A 2JDJA 5KT2A 4M5IA 2MLYA 4G1IA 2Q6CA 6FD1A 4ED5A 3GR1A 2DNOA 5D3GA 2LU1A 2V69A 2KXNB 1KVKA 3M30A 3H5XA 4PXCA 1NJWA 3KHLA 2VQEF 3D5MA 1RCOB 2F63A 2IYGA 1Y00A 3HP6A 2Q3PA 4LSNB 5D8HB 1TVRB 4TU8A 1UVNA 3LP2A 4O4GB 3KNAA 3H40A 1UPPA 2I0XA 1LWEB 3BKTA 1C1BA 1DTQB 1AT1B 4QIGA 3AXKA 2UXCJ 3WC2A 4HHJA 2FZGB 1BXNA 4X4TA 1S6OA 3CJ3A 3Q8PB 5AT1B 4OX9J 1RAJA 1R6VA 2DD8S 3K17A 3V6KA 4CNZA 2F3JA 2P6SA 4OI0A 2WOMA 4FZVA 3QJJA 3PW5A 2DGVA 3LGNA 2NPFA 1T03A 1VQPS 2X51A 1NHVA 4XDDA 3UE2A 1KLMB 3T3FA 2VKRA 3C16B 2JEGA 1JLQB 5CZVA 4M5NA 1RT6B 4DQSA 4X62F 3DOKB 4HT5A 2HK2A 5BJRA 2PSZA 3CCWA 4RUAA 2KN4A 3VGVA 2VASA 1UWBB 4K0KF 1HL6A 4OV6A 3MAAA 3FVYA 2EC2A 2XMVA 3MI7X 3X3UA 3CDAA 4K4YA 3CDWA 2UP1A 3W2WB 3NGKA 1MU2A 2GX8A 3NG8A 4QCLA 2HFOA 5C25A 5DDPC 3G82B 2XYHB 2YKPA 3GCWP 2Z56B 5E2QA 3KLIB 1VLOA 5K5MA 2YVSA 3OVSA 3IRWP 2HQGA 1QE1A 3ILJA 3H7HB 4H4MB 2WSCC 1AZSA 1FRKA 4EYIB 4E2FB 1S77D 3WZ0A 3OL9A 3UDCA 5I3PA 4WTYA 3BH7B 4EWTA 3E01B 2MQOA 4DF8A 2HNDB 5EUHA 4FF2A 4ZHRB 3K7RA 1T05A 3TVKA 3HKWA 3G6ES 1D9AA 3BBCA 3GJRB 1NCLA 2MY8A 3KNGA 4GO7X 4YP3A 2B3TB 1CJVA 5JXSA 3THPA 3E51A 4K0KJ 3CJQA 3HCXA 4ICLA 3D1HA 4DPUA 2U2FA 5HBMB 1ZZFA 1C2PA 1T9XA 3A1YG 4MAKA 5M2PA 2IPOB 4UY8T 1QTNB 4BS2A 2OELA 1YRXA 4JUZA 1PCAA 4DSFA 1HIYA 4TQSA 2NLWA 3SCKE 3NS5A 3L95X 4JI0F 2VQFF 4DX6A 2JWNA 1YITS 4ZLNA 4CLFA 1MMNA 2Z4PA 2GAHC 4XPEA 5E5NA 3A3PB 3M1VA 4S0MA 3HVTB 4MYTA 1K44A 2EI5A 4LREA 2BOAA 1N36J 2XMJA 2YNFB 2PE8A 4CYUA 8ATCB 4K5RA 1BQMA 3U27A 1HYSA 3CF5Q 2DHSA 1Q86T 1NAQA 2DPIA 4OL8A 2JC0A 4CO5A 1P6TA 1RWKB 3M8QB 1XMQF 2DR9A 3ETMA 3I55S 1RAIB 2B51A 2W4DA 3FRYA 1DQ8A 1ZM3A 3Q83A 3QIPA 2JEFA 3EGVA 2DYAA 4P9SA 2HBRB 3V4MA 1MN7A 1PGZA 3P5TL 1RABB 4V19J 3W60A 1Q0NA 1LWXA 1HBOB 2M70A 4ZVFA 1RTHA 1WG4A 3PW0A 3H0PA 2W2MP 3V6HA 4NLTA 1N4LA 2VQFJ 2Z8QA 2D7SA 3EJMA 2WK4A 2OPSA 3FEYB 3G6YA 1Q8IA 7FDRA 1K0TA 2MDAA 2IJRA 1TL5A 2BOPA 1AFJA 4RW8B 3H59A 2EPIA 1FE4A 5IFMA 1NSKL 2DHAA 3O2IA 3ZFVA 3HVWA 4LF7F 1UTAA 1XMQJ 2XSJB 2OSQA 3CWJA 2ZDOA 4YY3F 1X0FA 4F7VA 4G6VB 1T3NA 2R42A 4PEOA 4RBTA 2Y3YA 4LSNA 1TVRA 2R3VA 3GILA 2BJDA 3RRGA 1FWPA 4M5LA 5GAEU 3IP0A 3V2UC 5E3QA 1LWEA 2M3DA 3SDEA 2IA6A 4DG1B 2C28A 1DTQA 2VG6A 3CSKA 1BHNA 4ZJOA 1WKJA 3R8YA 3CD0A 1C0TB 2HFSA 2BR0A 4D3HA 3TUPA 2H3EB 3IMQJ 1M5VC 2H5JB 4UOGA 2LQBA 3TAMB 3HM9A 2N4CA 5GMKa 1FKOB 1NHKL 3H90A 2AJQA 4GKJF 1YJVA 1KLMA 2O01C 1UEVA 1OIAA 4QR0A 2HMIB 3C16A 3TVZA 3K89A 2VJVA 1JLQA 1WELA 2RQCA 2A2CA 4O44A 1KVIA 1RT6A 4WCEQ 2DY1A 4LF6J 2EK6A 3Q22A 2W7OA 4URSA 4LBPA 4YY3J 3CO0P 3J81j 1UWBA 4QR1A 1U7LA 3CMQA 4NOHA 1P9QC 1N5YA 3RB6A 3QO9B 4OJHA 3W2WA 2C2MB 2RH3A 1MMDA 3SXLA 1GTEA 5HMYA 1PIEA 4NYOA 3TOQA 1Y11A 1UW4A 3G82A 3MM7A 5KG2A 2CPDA 4C3KA 3KK3B 1SJQA 3KLIA 2OO4A 2KFNA 5JVHQ 3JB9k 1N0VC 3GV5B 1CJUB 4EO6A 1L3SA 4Y34A 1ZAWA 3OXLA 4C3MA 1KFSA 4AQYF 4UOHA 3BPSP 3PW7A 3TAQA 3KXDA 3JTNA 3VCDA 2DR5A 4LUBA 3M9OB 3E01A 4RW7B 5D15A 4ZHRA 2ZZTA 4TYBA 2R2RA 3IM9A 4FDFA 4M5HA 1F9EB 1V3SA 2JFDA 2XS7A 5J2QB 2BW7A 1VJWA 1BLUA 1R31A 4ANEA 3DI6A 4A8MP 1FNMA 5KFOA 3MPVA 4FYXB 2QO3A 1OYDA 4G1QA 3MOJB 4EZ9A 5HO4A 5LXRA 4FPRA 2G1DA 3MAQA 1YVFA 2AU0A 4DV0F 3UR3C 2ILYA 4WZMA 3KUEA 1OPZA 4NA2A 3AH6A 4OZJA 1S49A 1S48A 4EU0A 2VUGA 2DXDA 1O51A 3Q89A 4MKVA 2FVQA 1BUXA 1FA0A 1Y7PA 3KMSA 3PFEA 1TAUA 1PBUA 2HHUA 2ALZA 3EZ5A 5KG4A 2YNFA 3N0VA 2NSBA 2EG1A 1F5AA 1S1XB 1KD1T 1RAGB 3DDIA 3PKMA 5IWAF 3I87A 3M8QA 4A8WA 1UZHA 1SUQA 2OUGA 3A13A 2HWTA 3NWGA 4U8YA 4RNMA 5HANA 4HH1A 5A76A 5IT0A 2KI2A 2MZRA 2VODA 3D68A 3WC0A 5HMXA 1S0OA 2P8IA 4LFAF 3T1HF 3OJSA 4ECUA 1MMLA 2O66A 3W61A 4IOAQ 4P52A 4OX6A 2BW2A 4IRDA 1H98A 1HD0A 2J0SD 2AZ3A 1WC5A 1J27A 3R2CJ 5CABA 3R7NB 5C42B 2QFJA 4WZQA 2G4BA 4KPCA 2OLWA 2SXLA 1NPKA 2D69A 2OPRA 4OIXA 2CA9A 2VV5A 5H9FK 3F41A 1VBXA 3OL6A 2JVOA 1IR2A 4RW8A 1NK6A 2XEXA 2R8JA 1GMWD 3TI0A 3MR3A 4LRFA 3ENWA 1IKVB 3M05A 4OYMA 1KDNA 3KLHB 5IWAJ 3MR7A 5D78A 2UUCJ 1UA1A 2XSJA 1Y3JA 3JTPA 1M1GA 3A8JA 4NLRA 2FVRA 3PYDA 4L3NA 3DDKA 4V1Ak 4LFAJ 1RT2B 1NSQA 3T9NA 2CADA 3I0SA 4NLQA 3OFHA 2I9SA 3GFYA 1C0TA 5A6WA 2QZ8A 4DFJA 1OSDA 2BRLA 1A0OB 4JV1A 2HGNA 2NPIA 3DM2B 1RT5B 1NRKA 4FYWB 1TMJA 2R7XA 2AF6A 1XWLA 4KRWA 1AW0A 3UD5A 2HMIA 3RBDA 2DY9A 4KHRA 3GWCA 3TVYA 3VR1A 2IBOA 3OVBA 1SH3A 2ABYA 5MLCV 2BDPA 4LVOP 3PEJA 3AJDA 2QE5A 4DR5J 3RTVA 5K8NA 2ZH8A 2AGOA 2MKSA 2F8EX 3LA0A 3GQCA 3BSOA 1WNEA 3WX4A 2LEPA 1MNEA 4LF5J 2FJVA 4BC9A 4W90B 2LCWA 3QO9A 3ENAA 3GYNA 1EQMA 1SIWB 2OKQA 4TLRA 2XI3A 1FJCA 2HQCA 2YXLA 1JJ4A 2DGOA 4ZVPB 1SJRA 5H9FJ 2FHMA 4L3KA 1WHXA 1S6QB 3NCQA 3BB5A 1OQ3A 4KGVB 2CQBA 2MXYA 1K1SA 4ID8A 2QA4G 2UUBF 4RW9A 3JQMA 1UVLA 3N5BA 2DR8A 4KHPJ 3A8EA 2FYXA 2IM2A 3LH2S 1KRPA 1YJWS 2MZ1A 4AXJA 1WG1A 4ZVUB 4DL4A 2BBEA 4KH0B 1UJ5A 4LF4F 3QAUA 2DNPA 4RW7A 2ZDPA 1WC1A 4C3LA 4OZ1A 4ED6A 3POTB 5J2QA 4ATNA 3SQOP 4O0IA 1U1PA 5ETKA 2NXEA 2WZ1A 1DRZA 5KFPA 4NI2A 3J7YU 2QL9B 4ED2A 3IFEA 2BQUA 4O3RA 4Q0BB 4OYPA 1X4CA 4ENOA 3BO4A 4I2QB 2XY7A 4OI2A 4XTTA 2K7JA 2CQDA 2YTCA 3MR5A 2DJWA 5E3AA 1YIJS 1AUDA 2GGPA 2B9XA 4YB5A 2UUBJ 5CH7B 2DIVA 1ITPA 5DG8A 3DRYA 1TKTB 3SCIE 4X66F 4B17A 2B56A 2UUTA 2E1CA 2I2YA 1W26A 3SCJE 1WHVA 4FXDA 4FF1A 5D77A 3BM7A 2G13A 3SV4A 3MMJA 2YNIB 1S1XA 1AROP 4LFBF 3CCLS 2XYGB 1REVB 3UW1A 2W8KA 2CJKA 3RR8A 4ALZA 4NA1A 1HR0F 2OJ3A 4ILLA 1FF2A 4DXLA 5B0BA 3OHBA 1Q95G 2HS0A 1IKWB 4K2JA 2BEFA 4DPOA 1IM4A 5EX0A 1WG5A 1RAFB 1U6FA 5L1JA 2F65A 2FY1A 1LEOA 1Q7LB 4H4KC 1S72S 3DHXA 2FGCA 3H42A 1ZTTA 1FX2A 1DTTB 2GIRA 5LMUJ 2BM1A 5C42A 1TZ0A 2G2OA 2XY5A 1FDDA 3BN7A 3GU0A 3M2VB 2IM1A 4KH1B 4QR2A 2HLUA 4X66J 1B0VA 1BQXA 2CAJA 3M8ZA 3M8SA 1PYOB 1D9DA 1SXLA 1WACA 4URQU 1XEZA 1JXEA 4J9NA 2CYYA 4ZPDA 2KYXA 4PQAA 3UNGC 5KFJA 2FLOA 2B7BB 1NK7A 4DUZJ 1X4GA 3ICLA 2MKJA 3BJYA 4HTIA 2FJEB 1PBAA 4YS2A 2DH9A 4OI6A 1Q53A 4EZ6A 2FC9A 3W5ZA 2J0QD 2HBQB 3KDOA 2W1BA 2GO9A 2WVEA 4OYWA 2WSFC 4DV4J 1CQMA 5D6GA 1RXOB 3ENQA 1FWLA 4DX8H 4DV5F 2C2KB 4FNHA 4UZBA 5IZHA 3OTOF 4LF8F 1DLOA 4NASA 4XIUA 1KEKA 4ETZA 3FZBA 1T9TA 4RNNA 5KFDA 2GFFA 2C3YA 4O0NA 1H7WA 1G4CA 3DM2A 1O0PA 3TP2A 3M6VA 5IXUA 1FERA 4U67Q 2XWXA 2FVPA 1NZAA 1HBUB 4ER8A 3D0HE 3CCMS 2H5EA 3BGFA 1RK8A 4R5PB 1RTZA 1Q4RA 1HWIA 4LJMA 3IBCB 2BQRA 1F1BB 2VPZB 2XMTA 2V9WA 4CQ1A 2GHPA 1TUGB 2QV6A 1CC8A 4AUKA 2VONA 3K0JA 3I32A 4JI8F 2B9YA 2QA2A 1S9EB 3FKBA 1IVZA 2QA1A 2CPXA 4MKAA 4CI0B 2X1AA 4N56A 1SJ4P 1WDTA 3MTKA 5AE1A 4DU8A 3DMJA 5KOXA 3DXBA 5GADU 2W2NP 5DO2A 3TANA 3RBEA 1I6JA 2DHXA 1M5KC 2W2QP 3TEGA 2HLTA 4LF8J 2PA3A 2PI4A 3W5XA 1S6QA 1GK8A 5DM7Q 5LSRA 2NCKL 3OUYB 2E5JA 1SC1B 1N33J 2OEMA 1NDKA 2ZWPA 3SBMA 2K3IA 4ZVHA 4MFBB 3O44A 1P9YA 4F4AA 4F4KA 1YHQS 5BR8F 5IQQA 4DR4J 4HYKA 3HSDA 4LF1A 4RPFA 2X1FA 4C0BA 3UD3P 4FYVB 1LKZA 1RQ0A 3MCNA 2YPZA 4C8NA 3DLJA 2PDAA 1UL3A 3GE9A 2G0CA 2BANA 3POTA 5A2QU 3TA2A 2H4WB 2HHXA 3QWUA 4B9VA 4NEZA 1T11A 4OV1A 4RWWA 4NA3A 2DNKA 4KO0B 1FXDA 4Q0BA 3M32A 1UFWA 4M5GA 1ACMB 4I2QA 3NGSA 3W1YC 5GAGU 2JZ5A 3NBPB 2H1YA 1AA1B 2AYBA 3DNCA 1F9HA 1FRIA 4NLDA 1YJRA 3DLGB 4TY8B 1KP6A 2CXEA 4DZDA 1TKTA 3GIKA 1NH7A 3EX7B 1XIQA 4IG3B 2JH3A 4ZCIA 4Q44A 3KLVA 2VL1A 2AD9A 1RAOA 1RHUB 2YNIA 1KNZA 2DISA 4ZN3A 3Q8UA 4KE5A 2PFFB 3CCZA 3BREA 4ZMMA 2HS3A 2P6TA 2EKNA 2FJBB 4C0HA 4PPZA 1YBAA 2W9BB 4PWDB 4DN0A 3SQGB 3L3CA 4NMLA 1YLXA 1IKWA 4DLGA 2Z57B 3TJ9A 3ZTSA 1QUPA 2DNZA 3FBEA 1MN9A 2V68A 4WTOB 2DGTA 1EX8A 4MYUA 5HQMA 5FJ4A 2Q66A 4EYHB 3ZNJ1 3TZYA 3IBWA 4H54A 3P49B 2CPHA 1U2FA 3RW7A 2XO7A 2DITA 4UTGA 5LJ3Y 1WUUA 2GQCA 3EYZA 3RU0A 3RUBL 2HHHF 3Q2SC 1S1VB 2AYEA 2Q43A 3M2VA 4I56A 2R8GA 1R27B 4QPXA 4OZ0A 3MPYA 2VFSA 2ZVSA 5L8RC 3H5UA 3TAPA 4JI4J 1QJHA 3PYEA 1X8DA 4R8UB 1PJ5A 2ZH5A 2VPWB 3PDNA 4ECXA 2F9JA 2D3ZA 2IYIA 1ZYQA 4PYAA 3AFGA 2LKZA 1RWNB 4FVCA 3A8KA 2V2VA 2QRRA 1ZBTA 2CPEA 5BYSA 1HQUB 4HDGA 1VC5A 4YR0A 1VQLS 1NK8A 4FBTA 1RT4B 3IR5B 3RAXA 3FUYA 3PM9A 4DQIA 4I0WA 2W25A 3MM9B 3KUHA 2K2PA 3ZZPA 3FNNA 3C6UB 5B0FA 2JFKA 1U49A 2ZHBA 2HHQA 1RJJA 1DAXA 3MPDA 4EBDA 4J7CA 1SKWA 1EAYC 3BO2A 2GQQA 3A3NB 1IQZA 3C66A 1RT7B 3RZAA 2D41A 3CD7A 3W8PA 1K0VA 1HBUA 3HMJG 2AX0A 3MD1A 2XQCA 3VAGA 3UD4P 2HG4A 4YDDB 4R5PA 1WHWA 4ZA1A 3T5LA 4USUA 1PAEX 2GMJA 2IIHA 3CJ2A 3QLHB 4WP3A 3ZTOA 1FT8A 2A2DA 2OPPA 2LFVA 5IV4A 3M7VA 4R25A 3ETOA 5FLXU 3NNAA 4DF4A 1S9EA 3I31A 1SQFA 1H2TZ 3P3DA 3T41A 4DR1J 1IQTA 3R5JB 1XMBA 2HIQA 2MKYA 4KV8A 4DL5A 4LR7A 2ADCA 1S12A 4B3MJ 2CRLA 3R3TA 5C2CA 1YBUA 1X5SA 2MKHA 2E7VA 1GNKA 4HTJA 1SKSA 1N88A 5KT5A 3IS9B 3EVWA 4HL9A 3EPIA 2IAJB 1MWYA 2FJWA 1FX4A 3UN2A 3MECB 3VALA 4WE1B 3CJSA 2LXIA 3FQKA 1HKAA 1ICEB 2MLXA 2XMAA 3MMBB 1N56A 1UEUA 4IKAA 4F0HA 3OUYA 4RO0A 1Z2ZA 2CWXA 4C4WA 4FNIA 1U8SA 2B8PA 4J90A 3OTEA 1VQ7S 1S99A 2R7WA 5L1LA 3W7BA 4X4RA 1KQFB 4KGXB 1RAHB 2DEIA 2UUWA 3D3BJ 3RGIA 2DRBA 2GMLA 1RYRA 1T9UA 3P4UB 4QZVB 4E98A 4X64F 1WWHA 2MHNA 2ASJA 2IRUA 4YB7A 2RT3A 3JTOA 3LOUA 1SI9A 3MZIA 5CYMB 4IO1A 5F3ZA 1K9MT 3G86A 1CG2A 1HW8A 4KKOB 2E29A 4KO0A 4I6YA 3TARA 4FS1A 1ZOTA 4YMEA 3IM8A 8AT1B 4LIRA 2XGQA 1YJUA 1EARA 2ZBRA 3NBPA 2IMWP 1HHQA 4CLWA 1IBCB 3DKDA 1U26A 1S57A 2G9OA 4WIQA 2M7SA 3DLGA 2WONB 4TY8A 5A8RA 1S0NA 2J76E 2XI2A 1NB7A 2IVYA 2ZH4A 1F0XA 2EFQA 4IG3A 4OHWA 2JEJA 1S6UA 3HVAA 1YRTA 5KFZA 1M0SA 3FDSA 1VK8A 2FQQB 2QT7A 4X64J 3NLCA 4KBIA 4DFMA 3BGRB 1JXLA 3CCUS 3D6MB 1X4HA 3D6HB 4ES1A 2E9TA 3HZEA 1N5SA 2W9BA 1SBRA 2N7CA 4PWDA 5DQGA 1N32J 3UPFA 4MTPA 2ZH7A 4ZLPA 4I69A 3K57A 4K7QA 2R4FA 3UDLA 2JX2A 4R0JA 4B9NA 4OI4A 1IBLJ 5HVHA 2MQMA 2XHCA 1O5JA 3H4BA 2DGXA 4X4PA 1SL1A 5KFCA 1S1VA 3N9UC 5H9EK 4CIOA 3PR5B 4KSEB 2DNYA 2RF2A 4N47A 2XS2A 3FEZA 3C46A 4KQZA 1B0PA 2ZOMA 5GAEI 4R8UA 4Y3CA 4K4UA 3FMBA 2PFDA 1P27B 1A7GE 2XNQA 4ZP6A 2KG0A 4TYAA 4DFKA 1T9VA 5ETTA 1UJ4A 4O3PA 4RNFA 5DLFA 5GAHI 4ECZA 1CULB 3IC1A 1C4CA 3D7SB 5T41A 3MPWA 3MEGB 2BX6A 4AXIA 2MQ8A 3QFHA 1HQUA 3LP1B 1VBYA 4JI7F 2YKAA 4P2FA 4CLLA 4USWA 2KXFA 1RT4A 1VYAA 4JYAF 4K4WA 2QYGA 2W8LA 3KYLA 3FFIA 2L9WA 1PSDA 2RU9A 2QA4S 3MM9A 1S4FA 2MSTA 4WFNQ 3BS9A 3C6UA 2VU5A 5JJBA 1IBMJ 2XBPA 1RTIB 1EQ0A 1RT7A 2ZZNA 4NX9A 2JSXA 2AJ0A 3BV8A 3HFVA 2YH0A 2OFHX 3HZGA 2ACYA 5KOWA 4DSEA 4DQPA 3NRBA 3HT0A 1I3OB 3G8QA 3BDPA 2MJNA 3QLHA 1ROFA 1U1KA 4X2BA 4MIWA 5AJ3F 4PQUA 2YKMA 4P72A 4ZVRB 2HSEB 4NXMF 4HLBA 1FXRA 2M0GB 2WAQD 2RRBA 1M90T 4X4NA 2VBWA 2E5HA 4JI7J 3K5NA 1XNRF 1NK4A 3Q2TC 2VPXB 1X4BA 2ZBIA 2M8DB 2KKHA 1F3FA 3CDEA 3DGPB 3KG1A 4ED3A 3IS9A 1VMBA 2IAJA 2VB6A 1X9MA 5H9EJ 3BF4A 3VZHA 3GP9A 3T9ZA 4WE1A 3NGTA 3EZOA 4P2SA 3EVOA 3HF5A 4R0EA 2PI5A 1IJEB 2MKCA 2LU2A 2PT0A 5KFGA 5B09A 3A12A 1JLFB 4JI1F 1RTJB 3D3CJ 1TMMA 3RJMB 3ZTPA 4DMZA 5ETVA 2DB1A 3KK1B 2E5LJ 5AJ3J 4C98A 1L3TA 3RBXA 4NXMJ 3T5KA 3KJQB 3FBBA 1RHJB 5JMNA 4OYAA 5IQ6A 5CYMA 1R43A 5U47A 3MUTP 1U2RA 2CQGA 2ASYA 1UZDA 3JSYA 4F4YA 1I94J 2HYIB 1FCAA 5KT7A 1IXKA 1PKUA 4KKOA 4GVLA 4YB1P 5ETPA 2YNHB 3C6TB 1NLKL 3ENVA 3EPGA 4XDCA 4ZIWA 1D9FA 1DQ9A 3GV7B 5I3QA 4LRBA 3R5GA 3J7Z5 1Q7YT 2Y1RI 4IG0A 1NH8A 3C19A 1IR0A 2LVWA 4F50A 2LQ5A 4QWDA 5F41A 1JK9B 1X4DA 3M8WA 2F5GA 3BZQA 4O3OA 2DCLA 2F8HA 2UUAF 5E33A 4ZVQB 2D9PA 4H4OB 2IDLA 1PJ7A 2V8GA 4N8OA 1Q82T 4TQRA 2CPJA 3LTOA 2E1PA 3PZPA 4ED1A 4JI1J 1XBWA 3OR1B 1VHFA 3HSGA 4OZ3A 1HI1A 5HMWA 2AGPA 4DR3F 5DM6Q 3G4SS 3BGRA 3AB4B 3I9V9 4WFXA 2PD1A 3TRGA 4ECWA 4A8SA 1U8WA 2Y0SD 1VGYA 3B82A 2OAUA 4DR6F 1RAAB 2J8SA 2H54B 2XG8A 1SC4B 5HVFA 1SH0A 4DR7F 2V4JB 4ANCA 4LT6A 1HBNA 3NS6A 1FO1A 3SZ2A 2V50A 3DRRB 4HACB 3DXSX 2BZ2A 2NS1B 1BQNB 1IWAA 1BWVA 1HNZF 3QT6A 2KVQE 3OR2B 1RAEB 2R9LA 4ED4A 2OEKA 3OFGA 2BJ3A 1LW2B 2XHWA 1UVMA 4TN2A 2EK1A 2EFOA 3IG1B 2VFUA 4DZ6A 3TW0A 3D2WA 3L7PA 4KC5A 1QAIA 3T5HA 3RR7A 2R2UA 2YX7A 3PACA 4YN3B 2Y1LB 2UUAJ 2MZSA 1YK9A 3ONQA 3FSIA 2HHWA 2EFNA 1SQGA 1U6ZA 3ZZZA 5ETOA 1HNWF 2M5YA 3VAKA 2GHWA 3P8BB 4NLYA 4JI5J 2YNGA 4L74A 1NDPA 2V5HG 2EFVA 2D3UA 4RNOA 1S97A 2BUNA 1ZZNA 1SIZA 1QLNA 3DOMB 4CM0A 4EK2A 1QAYA 4EBEA 3ZO7A 1CULA 4OJ3A 1SV5B 5B0EA 5LJ5Y 3QZ8A 1WF2A 3CEDA 3MEGA 3SFGA 1D3WA 2DNLA 3LP1A 4NZ7A 5BXIA 2XLJA 4C11B 3DRXA 3W2VB 3EVMA 5ETLA 1R8CA 1QTMA 5HI7A 5ETSA 3M8PA 3DOLB 2L9NA 1HNZJ 4PXDA 3QBCA 3US5A 2NXNA 4J37A 1RWUA 4K5SA 5CQGA 4U7CA 2FGOA 1RTIA 2GS8A 2IM0A 1E6VB 1JJCB 3HHLD 3K5MA 1HNWJ 2RILA 1D8YA 3M2UB 2LDIA 1N6QB 2R7UA 4A4JA 4HHHA 4X65F 2MB0B 1U48A 1NSAA 4RNHA 1YX2A 4J9SA 1H7XA 4KGZB 2YWKA 4V19X 1UKUA 2KH9A 3MEKA 2NR0A 1W2IA 4WU3A 1VRTB 2KTQA 2UV8G 3ILOA 1H72C 4NL5A 2ZD1B 2E7WA 5IM0B 3OV7A 3BSCA 1W7WA 2POKA 2E44A 3JSBA 3OT9A 2AKWB 1B3TA 3RB0A 1ZA1B 2CPZA 1Y3KA 2RD5C 2AJFE 3WIVA 2KZMA 2HGLA 3WQPA 2Z0GA 1Q8LA 4PR6A 3MAHA 2GJ2A 1SB6A 1X9WA 1D1UA 1TV6B 2W9CA 1QM9A 3MURP 1T8EA 4DV1F 2DH7A 2CJBA 3D1OA 2FUG9 4PAAA 4Q7AA 3EUNA 3T5JA 2FLPA 3NAIA 3I82A 4QJVA 3CCTA 5I4MA 1KQSR 3CCJS 3B8HA 2EKYA 1H38A 4Y2AA 2UVRA 4X65J 2Q6BA 3PO5A 3B54A 2KFZA 3W3SA 5FDLB 2AV5A 4GO5X 1Q8BA 1NNDA 1VI7A 1RTJA 2V8VA 3N5FA 2VZ9A 2HNYB 3KK1A 1HNVB 1NXIA 5KT3A 4WPAA 2FJXA 1JLAB 2VIHA 4F2SA 3QMQA 2OFGX 3CGIA 1FKPB 4JI6F 2CQ2A 4Y6IA 3DLKB 1UCNA 1RYSA 3X1LB 4ED8A 2EVZA 1FJEB 4M5KA 4UW2A 2NREA 3JAMY 4DWIA 1U25A 2NSCA 4NLXA 3JQJA 2AHOB 3C6TA 4IUFA 4NCAA 1DJ0A 2FY8A 4DV1J 2C2RA 3NL0A 3T6BA 1FTRA 2B9EA 4DV6F 4B9TA 2L08A 3FMWA 4KFBB 2VFTA 5SUHA 2CQCA 4C8MA 3D67A 1CC7A 2V2ZA 3KLGA 4DSLA 1S1TB 4F25A 2HRYA 2NXUA 5KFSA 4H4OA 3QYYA 2LXFA 2E66A 1HI0P 3QGIA 2KM8C 2Y9HA 3CJ8A 3L09A 3OR1A 2ZH6A 2E7XA 5DG9A 1BC6A 5KFRA 3LALA 4WFBQ 2UXDJ 2J0XA 4M5DA 1RE1B 2FD2A 2XWYA 4TVAB 3W63A 3TZZA 2HNZB 4DUTA 2GV1A 4JI6J 2BE7D 4CP5A 3GYGA 3FK4A 5F8MA 2UXBF 1WC3A 3R5CA 2V4JA 4OJ1A 2CJQA 2YKNB 3DRRA 4HACA 1EKRA 1S59A 3NP5A 4EO8A 3DYAA 1GQEA 1BQNA 2MYFA 1HARA 2CNNB 3OR2A 2V0NA 1QVGR 1T7PA 3CC7S 1LW2A 2HPUA 2XGPA 2AGQA 3KG4A 5LSLA 2QFIA 3IG1A 2ZOFA 4ZDNA 4NZ0A 4LBHA 1R6YA 1KTQA 2K1RB 1TL3B 5C24A 1DARA 4ZVEA 4DS5A 2RQ4A 1KKHA 4Y00A 3E8OA 5DZ6A 1NUEA 3UI3A 1VK3A 2CDQA 3Q0AA 1HNXF 2VQEJ 2QMWA 2XYPB 2F4VF 1SH2A 3DOMA 4AE5A 2ILZA 2HQFA 1TFYA 3GTYX 2XCAA 2DNHA 2J5AA 1O8BA 1SV5A 3TUZC 1WC0A 1NKEA 1ULRA 3NNHA 1FRHA 3O5TB 4X4OA 4Y65A 2H5IB 4ZVSB 4C9DA 5K8MA 2R7RA 4C11A 3W9IA 3W2VA 5CCLA 3TJAA 5HSPA 5T7LB 5FD1A 4ECTA 2BE2B 3DOLA 3OBIA 1KN6A 1HHTP 1BGXT 3S7RA 3J7A1 1RADB 1JKHB 2WRMA 2JLGA 2V8PA 5LMNF 2HAIA 5G4DA 4ECRA 3BSNA 1RTDA 5J1NA 3H5SA 3CCVS 1E6VA 2E1AA 4ZKAA 4X62J 3M2UA 1FRXA 1N6QA 4ZVTB 1HNXJ 2DGWA 3LW5C 4UY85 5J2PA 4BLGA 4L73A 4J9KA 2F4VJ 3IWLA 4JV2A 2ZOGA 1RKIA 1ZPWX 1VRTA 4FPIA 4XO0A 2ZD1A 5L39A 2HQIA 5ETRA 2AJ4A 2XMMA 4OZ2A 4P73A 1NK9A 1VFJA 2YY3A 2M2BA 4CM2A 4OFZA 1F6TA 4K4XA 4ERDA 3JYTA 2HFNA 1FDAA 1TV6A 5LMNJ 4ZVOB 2CPYA 1J5OB 3H20A 2VDHA 2FHKA 1NDLA 2NXJA 2CVIA 2KRBA 3SV3A 2QG9B 2NYIA 3R7SB 1WC6A 2ZE2B 5KG1A 2NXCA 4OZNA 2YBVA 4RR5A 3I0RA 3KKFA 1CPZA 3D54A 3U1MA 4BC7A 1GH8A 3L7UA 1HNVA 3N01A 3ISND 4WWSA 2IC3B 4IFYB 1YJTA 4FXWA 4F8RA 3HD1A 3AOCA 3PHTA 1FKPA 2HBZB 1JWWA 1U6BA 2FDNA 3AXMA 4NYZA 1FJ7A 2KYZA 2PMZD 3FSYA 3UCZP 3CT9A 2ZZMA 2LMIA 1OPIA 4JI0J 2BJ8A 3PO4A 1UVKA 5DQHA 3R5AA 2D1CA 1VC0A 2QLXA 1JQGA 2RHSB 3H98A 2AZ1A 1GEHA 2CQHA 3PEHA 4ILRA 5LT5A 3JSMB 3TZXA 5KFVA 5DS7A 2KDOA 4LFCF 3KHHA 2LQ9A 1OQ6A 3V4IB 5K14B 2ROEA 3GG0A 2NZ4A 1I1GA 4NZ6A 1YQHA 1XMOF 1Y4ZB 2XMUA 1S1TA 2J9CA 4USVA 1APSA 3LGHA 5KT4A 2CUYA 1RWMB 3PY8A 3CW2C 3AODA 1IWGA 5EX3A 2QC3A 2RDJA 3G2XA 2J6TA 4P6QA 3K59A 2IMOA 3THVA 1RWWB 4C7QA 5DLGA 3OLAA 4OZ5A 3QRRA 3BEGB 1NK0A 2HNZA 4O4GA 4LF9F 1LW0B 4AL7A 1TR0A 3AY0A 1T9YA 2XM3A 1NPRA 2DIUA 3CDUA 3TR5A 3CIMA 3EM1A 4LSLB 3R5DA 1PYSB 1CEZA 2YKNA 3D66A 5L38A 2CWKA 4EFAC 4PWUA 4NCGB 2GCFA 1TUWA 5KG3A 1GX5A 1GAOA 1LV5A 3ZNUA 1S9FA 4J9QA 5ETQA 4WU2A 3PRBA 4LFCJ 3DRPB 5M2UA 3GFXA 2RKIB 2VC0A 2K1RA 4Z7CA 1X7VA 5A8KB 1YBTA 3D6FB 1RA7A 4LF7J 1TK5A 2MQPA 4L6V3 3DOKA 4JP8A 2M4MA 2AJ1A 4Y0FA 3CDBA 5B7WA 4NXNF 3OW2R 3P96A 2MTLA 2FHJA 4LF9J 4RUHA 1F2HA 2YX1A 4OLPA 4TXSA 2RQMA 4KAIA 2G1HA 3BO3A 2QSFA 1BE4A 4MT1A 1Q81T 5CAAA 2F7VA 1JLEB 4OHYA 3MXHP 4FF4A 1TK8A 1QDUB 1U02A 5E3PA 1U0HB 3HPOA 4ZPAA 4DLEA 5T7LA 2BE2A 4ES2A 3JSRA 2KJVA 3CPWR 3HHEA 3TYTA 1VQSA 3PJXA 2C3MA 1JKHA 4H4MA 3DDNA 4GKJJ 3G9CA 3KTQA 4B9LA 5L46A 2K3KA 1CBKA 1QAXA 2CIMA 4QOTA 4U6PA 3DU6A 1KWMA 1YSJA 1VQ4S 4OJGA 5DRKA 1WI8A 3D28A 4WJBA 2EEYA 2HNDA 4ZLLA 1ZA2B 1IR1A 2GHVC 2Y8WA 3G71S 1WOSA 1RBLA 1VHIA 5KG0A 4ECVA 2VOPA 1N54B 4WYLA 1RP5A 2CKWA 2QLBB 1KONA 5HBMA 4DU7A 4ILMA 2EFPA 5HVGA 2MMYA 3ILIA 2ZKUA 2J0WA 5J2MB 2A10A 4Y2KA 4RBUA 3TA0A 3THTA 2W4CA 1TKXB 3NEKA 5K8OA 2FZCB 4DHVA 1DFDA 5D3GB 1WKLA 4MKYA 4P74A 3U7JA 3M30B 4OZLA 1HMVB 3BQ1A 1WEYA 4LSZB 3BPDA 3HLUA 3HI9A 3S8SA 5J2NB 3HVTA 4M5JA 2HVHA 3NKYA 4QPTA 3SEOA 2C3PA 4AQYJ 2OD4A 4F3MA 1J5OA 2QLJB 3IGNA 3QGPA 1SJFA 5DDOC 3LP2B 2Z2MA 4CLTA 2BXJA 2CNOB 5KFXA 3VZIA 3K2YA 2FHJD 3ISZA 2CQPA 1GXTA 5DGAA 3AD9C 2YQ0A 2NQPA 2ZE2A 1CLFA 4QW8A 2H4YB 2DK2A 2ZJPQ 4PXEA 4U96A 5IC6B 1KHVA 1S4EA 5KG5A 4J9VA 2LLZA 2VBYA 3Q8SB 1N5TA 3AHPA 2BACA 2IC3A 2OHDA 5E41A 4U7UD 4CZCA 3EGWB 1IN0A 4N41A 5K9FA 3E3XA 3MR2A 2ZH1A 1G2EA 4DV0J 2F1FA 3Q86A 4IOBA 2KU7A 4BWMA 1HBOA 2GA7A 1KFDA 3BQ0A 1FRLA 1GMUA 2WBRA 1U1NA 4MJKA 3BBFA 4ZCLA 4NLOA 4J9LA 4AL6A 4QQBA 2HRTA 1EB0A 3BGOP 4CLYA 1Y5IB 1FTCA 3JSMA 2GW8A 2WCXA 4B3OB 3L7OA 2HFUA 2PEHA 3FGVA 4EI2A 4ELTA 5K14A 2XZWA 5KFEA 2XNRA 4W92B 4CNYA 4PUOB 1GXLA 5D4NA 3T1YF 2W9AA 1ZM9A 2CZ4A 3BQ2A 1R0BG 4AL5A 2CQ4A 4CT8A 5L9XA 3HX9A 1S6PB 4PCQA 5KAKA 4USTA 3T1HJ 5EWEA 3RRHA 3EICA 3J80U 4DG1A 3LF0A 2MGZB 4ANDA 4I6WA 2AP6A 2RUGA 1QVFR 4LSLA 2IA0A 4U8VA 3AAWB 2VOOA 3PG9A 2BA9A 2FTRA 3CJ0A 4NRTA 4OMFG 3T19A 3K5LA 4NCGA 1WHYA 3BR9A 3DU5A 2OTLS 2DEJA 3TAMA 1FKOA 4YUDA 1FVSA 1DQAA 2JOQA 4K4TA 2RRAA 3DRPA 4JB8B 3AD8C 2ZKTA 1RU2A 3CMAS 2MZJA 2DRAA 2V6AA 5HROB 3M8YA 3IO1A 5A8KA 3NGDA 1T3OA 1WI6A 3HFZB 5ITHA 2DXFA 2KM8B 1VQMS 4F04B 1T9WA 2AEFA 4ZJQA 5EWFA 2C2ZB 3PX0A 1T94A 2DVIA 1IBKF 4DSIA 1VRUB 2DGQA 5CXTA 1VQ6S 1FRJA 2VFRA 3QWPA 2YPYA 3RB4A 2FC8A 2Z2ZA 1HW9A 4CO4A 4YFUA 2I38A 1EP4B 2FIUA 1K1QA 1Q78A 1X4EA 1JLEA 4CYUB 1TP7A 1UFLA 2VHGA 2R2SA 3IBFB 4CDIA 1WOOA 2CJXB 2BVZA 4UZCA 3CO9A 5D0EA 1SKRA 1RU1A 1HQ2A 3CC2S 4DPWA 4QYZK 3KK3A 2J9DE 3CUNA 2HHPA 1V3RA 2HFZA 1R89A 2RQKA 3MM5B 1CJUA 2PGCA 4ZPCA 3QIPB 3TQEA 3O6QA 3W9JA 2HHVA 2C1EB 5M2RA 3CB4A 2KT3A 4Y2CA 2ZH3A 2LEAA 5F8NA 2HIYA 3KLFB 2DT9A 1WSVA 1VS3A 3R97A 5A2QY 4L72B 2UXCF 4X4VA 4Y2MA 5HL7Q 1PILA 1J2VA 1VC6A 3CCSS 3CVKA 1IBKJ 2UVWA 4EEYA 3DC2A 1VR6A 3QAEA 2C2EA 5IS2A 2MSSA 3GCXP 4Q43A 2CQ1A 4UF4A 4A47A 2VH7A 3M6WA 4F4XA 1S1UB 1QD1A 3BDEA 5IT9U 5F9NA 1JLBB 3HSJA 4QIEA 4ELUA 5KTQA 3IWXA 1UFKA 2C2DA 3G6VA 3W64A 3FEXB 1YJ7A 3DLLQ 5KFNA 1Q5YA 1XERA 1TKXA 4LBIA 4YQWA 4PG7A 1KQKA 3VGUA 1UWAA 2DPJA 2NUHA 2FVSA 2I1RA 4PG4A 4MK8A 1HMVA 2AEMA 4KB7A 3D9BA 1F9FA 3PYGA 1SVDA 9RUBA 1FVQA 1TUVA 1OO0B 5J2NA 5F9LA 1NZ8A 2XO6A 2IVFB 4IOCQ 2V2KA 2P9CA 1X5OA 1LXJA 2ZBQA 4LF4J 4URGA 2OEJA 1OJ4A 4TNOA 3SDEB 3PW4A 5HP1B 3OL8A 3S6EA 2VG6B 4Z7YA 4DBQA 5J1PA 2OD6A 4LRAA 2HVIA 1JLCB 1KSPA 2FJAB 2ROPA 2W2PP 1B64A 2F9DA 1UVIA 4UOCA 2QL7B 2RNEA 1FHTA 1C1CB 4B02A 1I5OB 2DKOB 4GKKF 1WF1A 4MK9A 2J6SA 1GXUA 4Z2XA 2BM0A 1CJTB 4QYZJ 4Q2LA 1RLCL 2V67A 5A0YB 3QT7A 1DHMA 4O44B 4XAKA 2GZOA 1KLNA 5KFFA 1WTBA 4ETXA 1H6KX 3PXGa 1VQ5S 2XZTB 4J9PA 1YTYA 2B6AB 3G8SA 5C7PA 4CH1A 1B7FA 1EZZB 4B3OA 1N5YB 2J7WA 3ZTQA 4L76A 4PUOA 1C0UB 2BRKA 3MHYA 1OMSA 2L48A 1IKVA 1ZM2A 4LFBJ 5K8PA 3KLHA 4LMZA 1FFGB 3LP0B 4HH0A 3A8IA 2VA2A 3M4XA 4PKDB 4Y2IA 1HR0J 1I51B 2F40A 3MM7B 3NWRA 3VAFA 2ZHOA 2EWHA 1S6PA 1VQKS 1ZPVA 4FKXA 4GKKJ 4ZCMA 4DL6A 4LRCA 4OHXA 3IWNC 2OH2A 2WB4A 3BKUA 4CRJA 3LANA 2XY6A 1RT2A 4OHVA 3G96A 4LF2A 1N36F 1LOUA 2MGZA 4OYBA 2ASLA 3ZC4A 2XLKA 2AMCB 2ZVIA 1B4SA 1HWUA 1XN9A 1O6XA 3N79A 1B7YB 1VISA 2HFVA 4DCOB 2E5IA 3QGHA 3WX8A 1P1TA 1Y9OA 1RT5A 3DFEA 4ZJLA 3M2RB 5HN0A 3DI6B 3AA9A 1H3DA 2V8HA 4CTAB 4G1QB 2FZKB 1R8BA 3BSAA 4X84A 5HROA 4K4ZA 7AT1B 4WP8A 1UA0A 1L3KA 3RBZA 4OYZA 5FLXY 4DL7A 5HLFB 3EZUA 4EBCA 2J7KA 1PAUB 3R6LB 2DBBA 1RUSA 4O23A 1VRUA 3SI8A 4TLQA 1JXVA 3CCRS 2DGSA 3P5BP 1XR7A 1CVJA 2MEWA 3QFWA 5B08A 1RISA 2HVDA 2C3UA 1TK0A 3GR0A 3JXOA 3I96A 2Q79A 1EP4A 2MQLA 4A8OA 1UW9A 4DV5J 3KK2B 1B70B 4B9MA 5KFBA 1SL2A 1V5IB 3IR7B 1R8HA 3N6MA 5AE3A 3OTOJ 1LFPA 4U95A 1VQ9S 1JB0C 2W7AA 1KHWA 1SUQB 3MF5A 2V4QA 3MM5A 4MK7A 3EXYA 3MFHA 5E3RA 3NOGA 1NPPA 2CJ9A 2MY7A 4IDKB 1F3VA 4WBFA 2E1RA 5FIIA 2MKIA 2YQ1A 4KIAA 4C2MA 3OPKA 4YEAA 3KOAA 2A18A 1RBOB 2WVFA 4M5MA 3B4MA 3VAJA 3DLEB 3KLFA 1VBKA 3GZ7A 3HT3A 1V9OA 2KHDA 3TQ1A 1D8ZA 4DV3F 4JI8J 2QMXA 6AT1B 3AQPA 1XQIA 3LPEA 5DJBA 3JAMU 1Y0HA 4UQTA 3CCES 1TTHB 3FZ2A 1S1UA 2OPRB 3H5YA 1X5PA 3W5YA 1JLBA 3OXGA 1DZ5A 3UDVA 4WXWA 2FJDB 1JLGB 3PYFA 2OTJS 4GVBB 5F8JA 4FYDA 3GFHA 3WHIA 1Y10A 1YJ9S 2OPQB 2J6UA 1RGVA 2QX0A 3K5PA 2GMHA 3C14B 1RWPB 3HXMA 3B78A 5HJYA 4LF6F 3D4JA 3SCLE 3ZTRA 2RSQA 1N48A 2Q1LA 2ZNYA 3GV8B 4DFPA 5B0CA 1VCTA 1MSWD 4P2MA 3QZ7A 2RS8A 2DNGA 4I7FB 4MKBA 3J81Y 2A0FB 5KG6A 4HHUA 3CCQS 5BR8J 3EE3A 3OTDA 1KTVA 5HP1A 1REVA 3I0SB 3R9LA 5DZ7A 2X3GA 4K8RA 4DV3J 1JLCA 3GMGA 1YKWA 5L1IA 2ZJRQ 5GAHU 3I9ZA 5EWGA 5F8IA 4Q8FA 1C1CA 1IKYB 3L4BC 3PX6A 3SSQA 2R7TA 5H1SV 2I5JB 2RS2A 1K73T 2UVUA 1CJTA 3PFOA 2DRDA 5THWA 2PO4A 4ES3A 3SMZA 1MWZA 3IXQA 1NKBA 4USIA 5A0YA 2DTJA 2QN6B 4ZS6A 3NAHA 3GIMA 1DTTA 3KFWX 4D3GA 2XMKA 3MM6B 1G1XA 3VGSA 3R1HA 3UN5A 2ALYB 1Q5VA 4AT1B 2HK3A 1VQNS 1JX4A 2B6AA 4DS4A 1S10A 2WW8A 3HULA 2KB2A 2QLWA 4M1KA 4PYDA 1VBZA 2HHSA 2XCPA 3GLJA 3VTIA 2H51B 2VA3A 1L5UA 5F3TA 2GAGC 2W01A 2R8KA 3VVTA 1YWXA 1C0UA 5LOQA 1N34F 1SJ1A 1ZS6A 3LP0A 3HHKA 4C8KA 2AYMA 3K5OA 4HKQA 4UUXA 3TWZA 1LK5A 2RU3A 3TJ8A 5C2GA 1ZM4A 2UVVA 1WORA 5HQ8A 1SQEA 4CLZA 4YB6A 1RHKB 5EN1A 4RLEA 4RW9B 3LAKA 3D0GE 5IT4A 2K7KA 1TFWA 2KT2A 4RWXA 4RU2A 5KFQA 4ZPVR 2W4PA 1TL7B 1PC4A 4ZIVA 4EGLA 4CH7A 1YGYA 4ZP8A 1BY9A 3TEHB 1RB0A 1KOOA 2HHHJ 5IOLA 4MMOA 5D4PA 2L41A 3NGRA 5DG7A 2W24A 3M2RA 2GIFA 1GMWA 1Q1KA 4B3TF 1N5QA 4WFAQ 2VG5B 4NI2B 4CTAA 2U1AA 2WSEC 1N34J 4N8NA 1M5HA 2JLEA 4N7TA 4DV7F 2B43A 5HLFA 3GJTB 1V3ZA 1DY3A 3G8TA 2GGPB 2NYHA 2ZBCA 3W8GA 2ATLA 2D74B 4KJIA 2KRRA 3ZZRA 1FEHA 3WIUA 3O3LA 1UPMB 4ED0A 2BQ3A 2IRXA 2C2NA 1FI4A 4KGMA 2JEIA 1EKSA 3BH6B 1HA1A 3C15B 3VWSA 1FD2A 3KK2A 3NNCA 3PRVA 2EG2A 3PHEA 3P45B 2AQ4A 2BJ1A 4TU9A 2BKNA 5C5JA 2HW3A 1XJWB 1ZAXA 3GIIA 4K2XA 2UUCF 4HT7A 5KFUA 5KFKA 4USKA 2R7QA 3H2LA 3MUVP 4KPYA 2MJUA 1H73A 4GRSA 3M9NB 4IDKA 1VLYA 1X5TA 4B3TJ 4DX7A 4KGKA 4MFBA 4A48A 2CPIA 3VQSA 2BE9B 1BMQB 1PO6A 5LM7E 1HBMB 3MFIA 1IUJA 3DLEA 4TU7A 1OY9A 4DV7J 3FCHA 3AJ1A 3C3LA 3MEDB 1WD6A 2LQJA 1SC3B 4C8OA 2X1GA 2PC6A 2QJ3A 2DHGA 5BYRA 4KT0C 1HHSA 4N77A 2HWIA 5KFMA 4Q45A 3DRSB 1S7HA 5KFWA 4YDXA 1P1LA 4FYYB 3PIOQ 4NLUA 1SPBP 4ZPTR 2CZ9A 1JLGA 3TNVA 2QEXS 4GVBA 2OGUA 4KHMA 4DDFA 2H9ZA 4E0DA 3HSZA 4UUWA 2OPQA 3GPAA 3GFZA 4A8XA 3C14A 4P75A 4IQXA 4O4RA 2X3DA 4DR5F 1Z1ZA 4RU9A 3RB3A 3Q8YA 4IH5A 5B0GA 4RUBA 1CS4B 1NO8A 4I7FA 4W98A 4FP9A 2C22A 4GC6A 5IV3A 4LF5F 1RSCA 3D6TB 4HEA9 3EMTA 4NYPA 3HHDA 4JI2F 3AOBA 5EHHA 3W66A 4NLVA 5E0OA 1VQYA 2WVCA 4ZP7A 1DLOB 5E3CA 1MW7A 3FC9A 3SFUA 4WP9A 3M6XA 3SQGA 4JV5F 4P7TA 1IKYA 1H2VZ 2ZBPA 2I5JA 4KHPF 1U09A 2VF3A 4XPCA 3H4DA 2IRYA 2K8GA 2J9DA 1P8GA 5E7OB 3QGGA 1NJIT 1S79A 1PJ6A 4ZITA 5HMZA 3BGLA 1RWOB 4RZRA 3MM6A 4LR8A 1NJXA 3NS7B 1AUSL 2IFXA 3GYXB 1PYTA 3FBCA 3FSXA 1ZTWA 3MPUB 1YZ6A 4U7UK 5ETNA 4ZK7M 1IKXB 4F67A 2ASDA 3CJ4A 1K47A 2CNKB 3DMJB 1VIXA 3AJ2A 4DPTA 4JI2J 1YI2S 3GJQB 3ADAC 1TU0B 2M9KA 3HFKA 4NWBA 3RAQA 3F44A 2FLLA 1S7IA 1RT3B 4RUCA 3ZXWA 4JV5J 5EDWA 1RBAA 4OX8A 4EUVA 4WK3A 1QUVA 3EGNA 3MDFA 1TL4A 2FPHX 3M8RA 2P5VA 2CQ3A 3P6YC 4DCPB 2XB2D 4F26A 4I64A 1R8AA 2CZVC 1W2BR 2Z2LA 2HVZA 1TL7A 4J91A 3A4TA 2V9KA 1GMVA 3HHLC 4OHZA 2BANB 1Q16B 4A8KA 1QSSA 3IR6B 2PEBA 2L3MA 2VG5A 4WKYA 4K4VA 2HURA 1KS2A 2H48B 3R6GB 5F8LA 1AXQA 3J7AN 3M32B 2DR7A 4OI1A 2APOA 2R7OA 3D0IE 2IHR1 3VVUA 3O1LA 4RJVA 1S1WB 1FDNA 5CA5A 5LMUF 4C8ZA 3ZZ0A 1SKUB 3QPIA 2V94A 2Y1JA 1U1OA 2WVBA 2R8IA 1T02A 2MLZA 4JYAJ 4IO9Q 3C15A 2B4UA 4B3RF 2Z58B 1FD8A 4QU7A 3FJ2A 3MECA 2V63A 4G1PA 4DV2F 3RG6A 2RE1A 4DUZF 3MUMP 6FDRA 2YWHA 3MMBA 1RHQB 1NM2A 3TUJC 3PJ9A 4OYIA 2LEBA 2YKOA 2A3JA 3BKFA 2YWWA 1G3OA 1YZ7A 4DV4F 3CULA 1HBMA 3TO8A 4DJBA 4HI2A 7FD1A 4HI1A 4ZCKA 1RT1B 5KFYA 3MEDA 3QJPA 1R0AB 3QT5A 3MD3A 4WK1A 4J9RA 4RKUC 3H8YA 2WHOA 4CCHA 3U1LA 2D3O1 2H65B 4ZPWR 4CH0S 3UN3A 4QW9A 4OQJA 2I8EA 3DCAA 5DDRC 3UCUP 3DRSA 4USJC 1XNRJ 1FWKA 2ZWOA 4ITSA 1BD6A 1RWXB 1EIYB 4KR0B 2ZUGA 2G2YA 2QYCA 2VFVA 1LK7A 4B3RJ 4C6AA 5JVGQ 4PABA 4DV2J 1DBDA 2FVCA 3NY0A 3RYLA 5LSOA 5L1KA 4DR2F 2UU9F 4DQRA 3MGJA 2DH8A 3OFFA 2PMHA 1NKCA 3TX8A 4JV0A 2VDIA 4UOFA 2WONA 4J9UE 5RUBA 2EW9A 4W4MA 2BJ9A 5KFTA 4ELVA 3PW2A 1CS4A 2E1MC 4JBCA 2M88A 1NEEA 3K8VA 1M5OC 1UETA 1IJFB 5EGYA 5B0DA 2HVEA 2YX4A 3GB0A 1WKKA 5A6PA 1TKZB 4U9RA 3H2VE 3AT1B 2UV8A 1XTZA 3BR8A 4HR2A 3HKZD 1RI7A 3MEEB 4I2PB 3KJFB 1VJQA 2DR6A 2LYVA 4PG5A 3PJWA 1X60A 2YWGA 3GIJA 1S5ZA 1MROB 1X0PA 1N33F 5L9NA 3NMAA 2WBMA 3V81B 1X9SA 3IAS9 3OQ2A 3G6XA 3R1LA 4C97A 1OY6A 1F2GA 3EDRB 1RWVB 4DR4F 2OPPB 1Z4UA 2O3DA 2V2QA 4TY9A 4DR2J 3NOCA 4FF3A 2UU9J 2YWEA 3ZZYA 2IY5B 2CJYB 1SC6A 1F60B 4FVMA 4JOUA 4KV8B 2KZZA 1TL1B 1IKXA 1FNOA 2HBYB 3FCVA 3VF0B 3PR4A 5AXKA 3VAMA 3IAM9 4O3SA 2ZJQQ 2N3OA 1VOMA 4IRCA 4DR3J 4IR1A 1CSJA 4ZN1A 1H0HB 2O67A 2ZH9A 2Y8YA 4M95A 4O3QA 2MZTA 1FE0A 1EJ7L 3I5CA 2ADBA 4DR6J 1RT3A 1M5PC 3LGMA 3DLBA 4QIFA 1UVJA 3KMQA 4CWBA 4DR7J 4PG6A 4LRDA 3PX4A 1T95A 4I6AA 4HVZA 4MIAA 3PTWA 4H4KA 2ZNZA 4FBUA 2RUSA 2XSFA 3QRQA 1KC8T 1JNZB 3I5AA 4Z37A 2HZCA 4NMXA 3LAMA 3MM8B 1VRQC 2ATCB 1KOHA 2CDRB 3KLEB 4NLSA 2GJFA 4ECQA 2BV3A 2VC1A 3V5RA 5I3UB 2I6WA 3T1AA 4QBUA 4L75A 4QIVA 5KFHA 5HJXA 4OLOA 5CD4A 3CIZA 2JL9A 2K06A 1NJZA 1PC5A 1J5EF 5IC4B 1U0SA 4CLUA 4ED7A 4G3IA 2FB0A 3S1TA 3DN9A 4DN9A 4Q8EA 1S0MA 2N82B 1S1WA 2B7CB 4RW6B 5I42B 4DPXA 2Z2YB 1F5BA 3GSDA 2GVZB 5A8RB 4YR2A 2QIFA 1H2UX 1NSPA 5T14A 2N3LA 9ATCB 4QIWD 4RX6A 3N6NA 3PRDA 3MCSA 3DGPA 1KQGB 5A8WB 4DX5A 2JVRA 4JI4F 1U1LA 4LIWA 2DNMA 3W9HA 4FKYA 3UWTA 2OMOA 3KDNA 3UDEA 4BWJA 3ET6B 5D0GA 2B9WA 3HD2A 1WC4A 3GG1A 3J7YI 3I56S 3CJRA 2LXUA 1SJ3P 2YKQA 4GMKA 2ZM6F 3R2DJ 2ZC3A 1JLFA 3AD7C 1J5EJ 3ISNC 3F0NA 1RT1A 3VV2B 1NDCA 2VBXA 3FCWA 1R0AA 3H2UB 3QT8A 2DO0A 2G0JA 5CYJA 1FFSB 1X4AA 2HHTA 2LQ8A 1KVJA 1XNQF 3PKYA 3KUGA 3OVAA 4BCAA 3SIPB 1AB8A 2B5JB 2OI2A 1WEXA 2ROGA 2RF2B 3WDOA 1NB2A 1FJGF 1D09B 2YNHA 2XZDB 1E6YB 3U02A 1FDBA 4ZLJA 2IJNA 3TX0A 2IBKA 4DSJA 2VICA 2HWHA 5CZXA 2OMLA 3IGVA 3I4PA 1R8PA 5AE2A 5DQIA 3MMAB 3KHRA 1M1HA 2PN6A 1N0UA 2VKZG 2IM3A 3U1NA 1XR5A 3C2PA 2LA4A 2NUUG 4DR1F 1LWCB 2G0IA 1HPZB 3AQOA 3GSIA 4B3MF 1N5VA 2ZM6J 3UVJB 4I67A 4KTQA 2V4RA 2RJZA 2L9DA 3R5BA 1WEZA 3CE8A 3Q24A 3FFIB 3CJKB 1VDHA 4CO1A 4P10A 3C8YA 2CVEA 1TKZA 4BDPA 1HNIB 1TAQA 2AIRB 4NPOA 1KBRA 2E9RX 5K20B 4N5SA 1A6LA 3MEEA 4I2PA 4B9UA 4J9OA 1XNQJ 3FBFA 2W2OP 3VAIA 4EMDA 4LQ9A 1TKDA 2YQ3A 1MROA 4X4UA 2HZVA 3BN4A 3QQCD 4BHQA 2AX1A 3V81A 4M63A 1REGX 3PNIA 1FJGJ 4JI3F 5D0HA 3HDSA 1XR6A 3JS9A 2LA6A 3Q8VA 3I6PA 1FK9B 2P9EA 2X1BA 3TA1A 5ETMA 4ECSA 5KFAA 3MWBA 1U24A 2ZFHA 4PQUB 2YKMB 4ZOSA 4DV6J 2JHEA 2AW0A 2RRNA 4C8YA 4QYRA 1F5CA 1Q79A 1TL1A 1G7CB 2HEKA 2HQDA 2G2ZA 2DXEA 2X7IA 1M5SA 1AFIA 3OD2A 1LFWA 3NCRA 4J9MA 2F4FA 4MH8A 2GNKA 3IN5A 1VQOS 4IH7A 5D4OA 5CD4H 2UXBJ 5D4LA 1YJNS 1UAWA 1CQNA 1EETB 1UEKA 1Q8KA 3ELHA 1V6HA 3HHNB 2ZUAA 2VPYB 2C42A 1HQEB 5JUMA 4JI3J 5BYQA 1G6BA 3HVRA 2QMUB 2RDDA 3M6UA 4ID5B 4B3SF 2B8QA 3KJVB 4OYOA 1HWLA 1WJ9A 4F3OA 3MM8A 2MQQA 3KLEA 4I68A 1URRA 4QWAA 3UNYA 4DL2A 5I3UA 1VQ8S 4P2XA 1N32F 2ZHAA 5F0UA 1D0EA 2B4OA 2QL5B 5GADI 1GTHA 1UMJA 4I4BA 3V6DB 1IBLF 2B4PA 1IM6A 2EFGA 1YG0A 2HRUA 1JNRB 3N4WA 2QLFB 5G0RB 2MKKA 2Z30B 3Q8QB 4RW6A 4YOEA 3LQVA 5I42A 2N7YA 4IG0B 5AXNA 4IR9A 1SL0A 5IM0A 2B4VA 3A3OB 5KT6A 1QAJA 2GVZA 2DGUA 1SCJB 2B0GA 5CYQB 4ZP9A 5A8WA 1JMTA 3J81U 2BABA 1RLDA 4AFFA 4B3SJ 2PIIA 1HWJA 4PZVA 2VJUA 3HHLB 3OHAA 1RDRA 2BJ7A 2COLA 4F0MA 1XC9A 1PG5B 1NBEB 4DEZA 4OYXA 1N8RT 4M94A 4DPYA 3N28A 3ET6A 2F8MA 1HLWA 4X4SA 2JLFA 3HJVA 3W62A 1HBNB 5FDLA 2CPFA 3L9ZA 1RHMB 1FEEA 4TKTA 2HNYA 3UQSA 4I1TA 3BGUA 5GAGI 1S76D 1JLAA 4LR9A 2ZH2A 1N52B 3DHWC 1IBMF 2DHHA 2BJEA 4NLGA 3DLKA 2GVDB 3AB2B 2KO1A 4PRFA 3O8WA 2B5JA 1CJKB 1UP1A 1U1MA 2BKOA 4IH6A 3UFCX 3TZWA 4B08A 1E6YA 2Y0BB 1NHUA 2YNGB 3CJ5A 3CC4S 3MOZA 2Y1IA 1R0CB 2KXHA 3GJSB 2CQ0A 3MR6A 5GVQA 4WFZA 2EC0A 3MMAA 3OTBA 1KR4A 2CNLB 4RBVA 3UO0A 1K8AT 2PA8D 4KFBA 1JJHA 1W25A 2GO8A 2JC1A 4NCBA 5F0WA 1YDLA 1WTFA 2EBEA 2LP4A 4NEYA 1LWCA 1HPZA 3OSPA 4UQGA 3UVJA 3EDQB 4C48A 4C8LA 3M8PB 1B0TA 3GONA 2KJWA 2RMLA 1FFWB 2RAQA 3CJKA 2DNQA 1RA6A 1TELA 3IA0A 4LQ3A 2NZCA 1HNIA 3RRKA 4HDHA 2JNJA 3J80Y 4ZVGA 2IJFA 3I4HX 3EWGA 5GMEA 3SSSA 1FNXH 4XK8C 3ITHB 2E9ZA 4OI3A 2AYGA 3ULHA 3R7BB 4B9SA 5KG7A 3CTRA 3PCOB 4IRKA 1FK9A 3HK2A 2VG7B 1U47A 3AA8A 3IRXB 3OXFA 2FHOB 2E5LF 3EXCX 3H25A 5F8HA 4Y28C 4CO2A 3AOAA 3I5BA 2XLIA 1WOPA 2WVDA 1QY7A 2CJAA 2QGFB 1FRMA 4RW4B 1TL3A 1XMOJ 3OFEA 1FXLA 4E8UA 1I94F 1Z2LA 5J1EB 4K50A 1GFWB 3DLHA 1LQ9A 3B4DA 3UCGA 1LXNA 3QJLA 4WFYA 2M8HA 3ZZOA 1B99A 4LVNP 2W9CB 1FKAF 3WBZA 3NGUA 3K58A 4F36A 4PWWA 3MMCB 3RAMA 1ZH5A 1LWFB 4CO0A 3QATA 1FESA 2D9OA 2WW4A 1Y5LB 1EETA 4Q5VA 5LXYA 1OSCA 4CLKA 1HQEA 3JQKA 4KY3A 3OTCA 1DURA 1ZETA 3EGZA 2CG8A 3LWMA 4ECYA 2OIHA 2JRSA 3ILLA 2J9EA 4ID5A 5SZTA 2LDYA 3NXZA 1MG7A 3E2EA 4PG8A 1OWXA 3KJVA 3VQTA 1LNQA 2ACMA 3K8WA 4IFVB 1HFEL 4AYBD 4A46A 1MLAA 2IDEA 4NE9C 2EBGA 3V6JA 1V5VA 2P2CB 4J5OA 3Q23A 4PPDA 2N4DA 4OX7A 1U2CA 4WYWA 1HWKA 1NJYA 3DGVA 2QSWA 4NXNJ 2AWZA 2BKPA 4NLWA 2GJIA 1RCXB 4WF9Q 3BYRA 3V6DA 1RZMA 5IT9Y 4CO3A 2J8AA 3NCPA 4UT4A 4CLSA 4QU6A 5G0RA 3CD5A 2JJ4D 3CMES 4USHA 3QRPA 3KWMA 2QTWA 1S9GB 2HZAA 2E5GA 2RIJA 2KHCA 2V8DA 1M1KT 3KLGB 5CYQA 3OSNA 3J7ZT 5LL6d 1RHRB 3HJFA 4JI5F 1R7IA 2R7SA 3HHLA 4RL1A 4M5DB 4DI6A 1X31C 3G87A 3HO1A 4KYZA 4BBYA 3W65A 3KG0A 1RACB 2WTFA 2CQIA 1GX6A 2VBZA 3FRZA 4O3NA 2DNRA 1WDDA 2OSRA 4AD6A 1C1BB 4C0OC 2KFYA 3CD6S 1H74A 3CJTA 4MIBA 3VHQA 1U1RA 3DYAB
chains in the Genus database with same CATH topology
3H5SA 3CCVS 2ZC4A 1H7WA 1E6VA 1HBMB 3MFIA 3DM2A 2E1AA 3R27A 1IUJA 2RDIA 3DLEA 4ZKAA 4TU7A 1O0PA 2RB7A 3FCHA 3TP2A 3M6VA 5IXUA 3AJ1A 1FERA 3C3LA 4U67Q 4IFYA 3MEDB 2XWXA 1WD6A 2LQJA 2WOMB 4C8OA 3M2UA 2FVPA 1NZAA 1FRXA 1HBUB 2X1GA 3PV8A 1N6QA 2PC6A 5KFLA 4DSKA 2DHGA 1T03B 5BYRA 4KT0C 1HHSA 3D0HE 2DGWA 3CCMS 2H5EA 3BGFA 1RK8A 3LW5C 4R5PB 4FS2A 4YHHF 1Q4RA 4N77A 4UY85 3N6LA 5J2PA 2HWIA 1HWIA 3RW6A 1Y5NB 4LJMA 1JJ2R 5KFMA 2BQRA 4Q45A 3DRSB 5C24B 4J9KA 1S7HA 3IWLA 5KFWA 4YDXA 1P1LA 4JV2A 1OS5A 4QWCA 2VPZB 4DQQA 5F8GA 3PIOQ 2XMTA 2ZOGA 1RKIA 1ZPWX 1VRTA 2GHPA 2GC8A 2QV6A 1CC8A 4NLUA 4AUKA 4CQ1A 2VONA 4XO0A 3K0JA 3I32A 4ZPTR 3OLBA 1JLGA 3TNVA 4JI8F 2ZD1A 2QEXS 2B9YA 2QA2A 1S9EB 5L39A 4KHMA 4NLPA 2HQIA 2CPXA 2QA1A 4MKAA 2H9ZA 4CI0B 4DDFA 1GT8A 4E0DA 1L3UA 3UR0A 2X1AA 4UUWA 2OPQA 4N56A 1SJ4P 3GFZA 2W7PA 3LO3A 5B0AA 4DUYF 3LWLA 2AJ4A 4A8XA 1QSLA 2XMMA 4K59A 4IQXA 1NK9A 3MTKA 1VFJA 2YY3A 5AE1A 1VIOA 4O4RA 4A8YA 3V4IA 2A1BA 4DOZA 2M2BA 4OFZA 3DMJA 4K4SA 4DR5F 5KOXA 4ERDA 3DXBA 4K4XA 4F4WA 1Z1ZA 5GADU 4RU9A 3RB3A 4IH5A 3JYTA 2HFNA 5DO2A 2R2TA 3SSRA 1MU2B 1FDAA 1TV6A 2OP5A 5B0GA 3TANA 3RBEA 1I6JA 2DCUB 4X4QA 2DHXA 1M5KC 4F2RA 5C25B 5ADZA 1NO8A 2HLTA 4I7FA 4FP9A 2C22A 1UJ6A 4GC6A 2CPYA 1J5OB 4LF5F 1S0VA 3H20A 2PA3A 2PI4A 4HEA9 1S6QA 2FHKA 5DM7Q 2CVIA 5LSRA 4NYPA 3OUYB 2KRBA 2E5JA 3HHDA 3SV3A 4GC7A 1TQLA 4JI2F 2NYIA 5EHHA 1L3VA 1QE1B 4NLVA 5E0OA 2ZE2B 5KG1A 1VQYA 2K3IA 4ZVHA 1LW0A 2BYCA 4MFBB 4OZNA 4ZP7A 1HD1A 4CT9A 1DLOB 2MPUA 3MTJA 5E3CA 2M52A 4YR3A 1RKJA 3O44A 1MW7A 4IQMA 3I0RA 1RTDB 3SFUA 4F4KA 1YHQS 5BR8F 3KKFA 5IQQA 1CPZA 3D54A 3ITHA 3M6XA 3SQGA 3U1MA 4F4ZA 4HYKA 4JV5F 4BC7A 2X1FA 1GH8A 1HNVA 4C0BA 4P7TA 1IKYA 3UD3P 3N01A 2ERRA 1HI8A 3ISND 1H2VZ 2IC3B 2P9GA 4IFYB 1LKZA 1YJTA 3SYZA 4FXWA 2I5JA 1RQ0A 4F8RA 1C4AA 1T05B 1NK5A 4FXVA 4KHPF 1U09A 5MAOA 5DGBA 4XPCA 4C8NA 3H4DA 3DLJA 2PDAA 2R8HA 2O5DA 1UL3A 3GE9A 1FKPA 2IRYA 2G0CA 1JIHA 2BANA 2K8GA 2J9DA 1P8GA 3POTA 4N76A 4Q2MA 4DL3A 1JWWA 1U6BA 4P7VA 5E7OB 3TA2A 3QGGA 2FDNA 4IYQA 1NJIT 1S79A 5J2PB 4WKRA 4NYZA 2VG7A 2DNNA 2HHXA 1U1QA 2MZQA 1FJ7A 2KYZA 5HMZA 3BGLA 3TUIC 3IRXA 3QWUA 1ELOA 2CG4A 2PMZD 4RZRA 3F56A 3FSYA 3UCZP 2XULA 4B9VA 3CT9A 3MM6A 2LMIA 2YWFA 4ICLB 2ZZMA 1OPIA 3S01A 3PO4A 4OV1A 4RWWA 2UZAA 1NJXA 1UVKA 1WF0A 5DQHA 4NA3A 2DNKA 4KO0B 1FXDA 1NU4A 2IFXA 3GYXB 2KT5A 2RKIA 3R5AA 2D1CA 4Q0BA 3M32A 1VC0A 4RW4A 4WXOA 2WB1D 1UFWA 3D1QA 4PXBA 1X4FA 3FSXA 1ZTWA 1R3NA 4I2QA 2QLXA 3H98A 4U7UK 2HGMA 5GAGU 3PEHA 2CQHA 2HS4A 2LECA 2JZ5A 4ILRA 4ZK7M 1IKXB 5LT5A 3JSMB 3NBPB 4F67A 5J1EA 5KFVA 5DS7A 2KDOA 1A9NB 2AYBA 4LFCF 3DNCA 3KHHA 3CXCR 2LQ9A 3CJ4A 2ASDA 1OQ6A 3V4IB 4ZPBA 5K14B 2MHEA 2ROEA 3GG0A 2NZ4A 3DMJB 1FRIA 4NLDA 1YJRA 3FQLA 1VIXA 3DLGB 4TY8B 1I1GA 4NZ6A 1YQHA 3AJ2A 3JYTB 1YI2S 1ZAVA 1YRUA 1XMOF 1Y4ZB 2XMUA 4DL0C 1TKTA 2J7UA 2M9KA 1S1TA 2J9CA 1NH7A 3GIKA 1APSA 3ZZUA 3M1VB 3PVXA 5KT4A 3EX7B 3MMCA 3HFKA 4IG3B 3PY8A 3QIDA 2JH3A 4NWBA 3RAQA 2KVIA 5EX3A 3F44A 2XMWA 4ZCIA 2FLLA 2RDJA 4Q44A 2J6TA 1LWFA 1RT3B 3KLVA 4P6QA 4RUCA 3K59A 2VL1A 2AD9A 2R7VA 1BQMB 2IMOA 3THVA 5DDQC 4C7QA 5DLGA 5EDWA 3F73A 2KG1A 2YNIA 4OX8A 1HYSB 3LUYA 1U45A 4EUVA 1KNZA 2DISA 4WK3A 3OLAA 5AXMA 4OZ5A 4QWBA 1QUVA 3BEGB 3EGNA 3MDFA 2D3OR 1TL4A 1QSYA 3VAHA 4KE5A 2FPHX 1NK0A 2HNZA 2PFFB 3M8RA 3CCZA 4O4GA 3NMRA 4LF9F 1LW0B 3BREA 4ZMMA 4AL7A 2YH1A 1TR0A 2HS3A 3AY0A 2P6TA 2P5VA 2CQ3A 5AXLA 3P6YC 4WIIA 2FJBB 4FN5A 3I0RB 4PPZA 4C0HA 2XB2D 1YBAA 4F26A 2W9BB 4I64A 1R8AA 2CZVC 4DN0A 2O1PA 1W2BR 4A8FA 4PWDB 3SQGB 2DIUA 3CDUA 3L3CA 2Z2LA 3TR5A 2HVZA 2C3OA 3CIMA 4LSLB 5KFIA 4NMLA 3R5DA 1IKWA 3T6JA 2VD3A 4M8LA 4QWEA 4DLGA 2UXDF 3PIPQ 1BWEA 1CEZA 4IFVA 2V9KA 1QUPA 2YKNA 2FLNA 2DNZA 5CCMA 5L38A 3HHLC 4A8QA 4OHZA 4EFAC 5CHCB 2BANB 4PWUA 2ZITA 4F02A 4NCGB 2GCFA 2DGTA 4MYUA 5KG3A 1GX5A 3LPYA 1GAOA 5FJ4A 2Q66A 1LV5A 4EYHB 1Q16B 1U4BA 4A8KA 1S9FA 3Q8RB 1RTHB 1QSSA 3IR6B 3ZZTA 3KHGA 4J9QA 2L3MA 3IBWA 4H54A 3P49B 2VG5A 4WU2A 3PRBA 2CPHA 1U2FA 5DETA 1URNA 4WKYA 3RW7A 2XO7A 4K4VA 4NRUA 1KS2A 2GQ2A 3DRPB 2DITA 5LJ3Y 2RVJA 5F8LA 2GQCA 4OX9F 5M2UA 3GFXA 3EYZA 3RU0A 1AXQA 2RKIB 2VC0A 2GIQA 2K1RA 2HHHF 1X7VA 3M32B 3Q2SC 1S1VB 2DR7A 2AYEA 2MQNA 2Q43A 3M2VA 4I56A 4OI1A 3OL7A 2R8GA 2APOA 5A8KB 2R7OA 1R27B 2OPSB 3D0IE 3OJUA 2IHR1 4QPXA 4OZ0A 1XK8A 4F3QA 3MPYA 1RA7A 2VFSA 1TK5A 2MQPA 3O1LA 3DOKA 4L6V3 2ZVSA 2IVMA 3M9MB 5L8RC 2M4MA 1S1WB 1FDNA 2CFXA 5CA5A 5LMUF 2XS5A 4C8ZA 2AJ1A 4Y0FA 3H5UA 3CDBA 3TAPA 1QJHA 5B7WA 5J2MA 3ZZ0A 1S9GA 2HQ3A 1X8DA 3QPIA 4R8UB 2DO4A 2XC9A 4NXNF 3OW2R 2V94A 2JDJA 3P96A 5KT2A 2Y1JA 1U1OA 2ZH5A 4G1IA 2FHJA 2Q6CA 2VPWB 2R8IA 1T02A 6FD1A 4ED5A 3GR1A 2DNOA 3PDNA 5D3GA 2LU1A 4RUHA 4IO9Q 2KXNB 2YX1A 4ECXA 2F9JA 2D3ZA 2IYIA 3M30A 3H5XA 4OLPA 4TXSA 4PXCA 2RQMA 1ZYQA 4KAIA 2B4UA 3BO3A 1NJWA 3KHLA 2VQEF 2QSFA 3D5MA 1Q81T 4B3RF 2IYGA 1JLEB 2F7VA 2LKZA 1FD8A 4QU7A 3FJ2A 3MECA 4FVCA 1Y00A 4G1PA 4OHYA 3MXHP 2QRRA 1ZBTA 2CPEA 4FF4A 3HP6A 2Q3PA 5BYSA 4LSNB 1TK8A 4DV2F 5D8HB 1TVRB 1HQUB 2RE1A 4TU8A 1UVNA 4DUZF 4HDGA 3MUMP 1VC5A 5E3PA 4YR0A 6FDRA 3HPOA 4ZPAA 3LP2A 4DLEA 5T7LA 1NK8A 1VQLS 4FBTA 1RT4B 4O4GB 3KNAA 2BE2A 3IR5B 2YWHA 4ES2A 3H40A 3JSRA 3MMBA 3RAXA 2KJVA 3CPWR 3PM9A 4DQIA 3HHEA 2I0XA 1LWEB 4I0WA 3TYTA 3TUJC 2W25A 1VQSA 3MM9B 1C1BA 3PJXA 2C3MA 1JKHA 2YKOA 4H4MA 2LEBA 3DDNA 1DTQB 2A3JA 2K2PA 4QIGA 3ZZPA 1G3OA 3G9CA 3WC2A 4HHJA 4X4TA 3FNNA 1S6OA 3C6UB 5B0FA 2JFKA 3CJ3A 1U49A 3KTQA 4B9LA 4DV4F 2ZHBA 2HHQA 3Q8PB 2K3KA 1RJJA 3CULA 1QAXA 2CIMA 1DAXA 4QOTA 4U6PA 1RAJA 3DU6A 4EBDA 1YSJA 1SKWA 1VQ4S 4OJGA 1HBMA 2DD8S 5DRKA 1WI8A 3D28A 3TO8A 3BO2A 4WJBA 4DJBA 2GQQA 4HI2A 7FD1A 3V6KA 4HI1A 4ZCKA 1IQZA 3C66A 1RT7B 2HNDA 1RT1B 2D41A 2F3JA 3RZAA 4CNZA 2P6SA 5KFYA 3MEDA 4OI0A 3CD7A 3QJPA 1R0AB 2WOMA 4FZVA 3MD3A 4WK1A 1K0VA 3QJJA 2GHVC 4J9RA 4RKUC 1HBUA 3HMJG 3H8YA 2AX0A 2WHOA 2DGVA 3MD1A 3U1LA 3G71S 3VAGA 3LGNA 3UD4P 3PW5A 2NPFA 1T03A 1VQPS 2X51A 1NHVA 2HG4A 4XDDA 4YDDB 4ZPWR 4CH0S 4R5PA 3UE2A 1WHWA 4ZA1A 4QW9A 1KLMB 3T5LA 5KG0A 3T3FA 4OQJA 4ECVA 2VOPA 2GMJA 2I8EA 3DCAA 2VKRA 2JEGA 3CJ2A 3QLHB 1N54B 5DDRC 1FT8A 1JLQB 3UCUP 2A2DA 2OPPA 3DRSA 4CCHA 4WYLA 5CZVA 1RP5A 2CKWA 4USJC 4ITSA 1RT6B 1BD6A 1KONA 4DQSA 4X62F 5HBMA 4ILMA 3DOKB 2EFPA 4HT5A 4R25A 4KR0B 3ETOA 2ZUGA 3NNAA 5BJRA 2PSZA 2MMYA 3CCWA 4DF4A 2QYCA 1S9EA 2VFVA 3I31A 1LK7A 2ZKUA 4RUAA 2KN4A 2J0WA 1H2TZ 3P3DA 5J2MB 5JVGQ 2A10A 1IQTA 4Y2KA 4RBUA 3TA0A 1XMBA 3THTA 2HIQA 4KV8A 2VASA 1UWBB 1DBDA 2FVCA 3RYLA 4DL5A 2ADCA 2W4CA 1TKXB 4K0KF 1HL6A 5K8OA 5LSOA 5L1KA 4DR2F 2UU9F 4DHVA 4DQRA 2CRLA 3R3TA 1DFDA 3MGJA 2DH8A 3OFFA 2PMHA 5D3GB 1X5SA 3FVYA 2MKHA 2XMVA 3MI7X 1NKCA 3X3UA 3TX8A 4JV0A 1GNKA 4HTJA 4MKYA 3U7JA 3M30B 4OZLA 1SKSA 1HMVB 3CDAA 3BQ1A 1N88A 2WONA 2EW9A 5KT5A 4K4YA 3IS9B 5KFTA 4HL9A 3EPIA 3CDWA 1WEYA 2UP1A 3HLUA 3NGKA 3W2WB 1MU2A 2IAJB 3HI9A 1MWYA 3S8SA 2FJWA 4ELVA 3PW2A 2GX8A 3MECB 3NG8A 5J2NB 3HVTA 4QCLA 2HVHA 2HFOA 3VALA 5C25A 3NKYA 5DDPC 4WE1B 4QPTA 3SEOA 2E1MC 2C3PA 2LXIA 4JBCA 2M88A 2OD4A 1NEEA 4F3MA 3FQKA 1J5OA 3IGNA 3QGPA 3K8VA