3A1YG

The structure of archaeal ribosomal stalk p1/p0 complex
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
284
structure length
211
Chain Sequence
MAHVAEWKKKEVEELAKLIKSYPVIALVDVSSMPAYPLSQMRRLIRENGGLLRVSRNTLIELAIKKAAKELGKPELEKLVEYIDRGAGILVTNMNPFKLYKFLQQNRQPQPLEVGLDVLAVYEDGIVYTPDVLAIDEQEYIDMLQKAYMHAFNLAVNIAYPTPETIEAIIQKAFLNAKTVAIEAGYITKETIQDIIGRAFRAMLLLAQQLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein P1 (L12P)
publication title Structural basis for translation factor recruitment to the eukaryotic/archaeal ribosomes
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Ribosomal protein
total genus 56
structure length 211
sequence length 284
ec nomenclature
pdb deposition date 2009-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00466 Ribosomal_L10 Ribosomal protein L10
G PF17777 RL10P_insert Insertion domain in 60S ribosomal protein L10P
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1730 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3a1yG01
1ZAVA 3JSYA 3J7YI 1ZAWA 5D6GA 2QA4G 5GAHI 4NWBA 3J7Z5 4UY85 4V19J 3A1YG 5GADI 1ZAXA 5GAGI 5D8HB 5GAEI
chains in the Genus database with same CATH superfamily
3MMAB 4PG4A 1S0VA 5DM7Q 2CFXA 5AT1B 1AUDA 1OQ3A 5ETVA 1T9YA 2CQGA 4EO6A 2YPYA 1YKWA 2IRYA 4NRTA 1M5SA 1RABB 1S9EA 2FZGB 3PX0A 1ZM2A 4YMEA 1Z2LA 4YY3J 3ADAC 4C8ZA 3GFHA 4F4XA 1HNWF 1FNMA 4CT8A 2HHSA 2FHMA 4DG1A 2M9KA 4P74A 3T6JA 3UPFA 3F41A 1PILA 3GYGA 2WB4A 3OL8A 2KHDA 3ILIA 3K5OA 1AZSB 2ZFHA 5KFJA 3VGUA 4JV5F 2XMAA 3RU0A 5IM0B 2YKMA 1CQNA 3U1NA 1YTYA 2ZHAA 5T7LB 5D3GA 3IWXA 4ZN1A 3H5YA 3J81j 4U8YA 6AT1B 2IRXA 1WNEA 2KRRA 2LQ8A 3QRRA 3NGSA 2MKSA 2APOA 2GO9A 2HK3A 3L4BC 5GAGU 3OW2R 2XEXA 1U1KA 4BWJA 1XBWA 2WRMA 3IRXA 3TAMB 3QMQA 4OQJA 4AUKA 1S79A 3FZ2A 3ETOA 1MMDA 3T5HA 1Q1KA 2LQ9A 3KLFB 2WSFC 3CO9A 1TL3A 4MYTA 5GAGI 2HAIA 3CVKA 1NXIA 1NZAA 3C16B 3KK2A 3HXMA 3NNAA 1HQEA 5CQGA 5D78A 2XS7A 3QBCA 1T9VA 4X4QA 3RBXA 4KT0C 4DPOA 3N5BA 3UDLA 1S1WB 1KBRA 2YQ3A 2DNRA 1FA0A 4GKJJ 2DRDA 2HQCA 1NK4A 2LDIA 1QE1B 2KTQA 3BKUA 1SH3A 2CPJA 1L5UA 2H5EA 2MQLA 2XS2A 1URRA 2CPIA 2QTWA 3BQ2A 2FJAB 3HFKA 3VCDA 4DSFA 1OSCA 1U8SA 2CYYA 2IYGA 3TX0A 3G87A 3VGVA 3MF5A 1E6VB 4IUFA 3HF5A 1WOSA 1VRTB 1NCLA 5IT9Y 3RRKA 4O3QA 4PXBA 2ZH3A 2QA4S 2HFVA 1UCNA 2DNGA 1HWLA 4NCBA 4PKDB 1VJWA 3TA2A 2YQ0A 1NPKA 4H4MA 3CCZA 2W24A 4RW9A 1MROA 4OX8A 1SKWA 1XJWB 3IBWA 1SC6A 2C42A 1OQ6A 3O2IA 1S97A 3ILJA 2X1AA 2NPIA 2PIIA 1B7FA 2HZAA 4B9VA 1IBKF 2DD8S 3WC2A 1RHQB 2XM3A 2IFXA 2F4VJ 4W4MA 3HSJA 1O51A 3OTDA 3WDOA 2DO0A 1BXNA 5DGBA 2VL1A 1KEKA 3PYDA 4C8MA 4ILMA 2GQ2A 4I6YA 2HVHA 3EPIA 3NBPA 2ATLA 2DEIA 2G13A 2JOQA 4KTQA 2Z30B 4EBCA 5CYMA 4NPOA 2DR5A 3TP2A 2ZBQA 3W66A 1BC6A 2DTJA 4ELTA 1IKWB 2ZHBA 1Y3JA 1CBKA 3MECA 3D4JA 3CCRS 2OMOA 2OTJS 5AXLA 2R7QA 1M1GA 2ZOMA 3IWLA 4CLKA 3IGVA 2E7XA 1RCOB 4DR3J 2F63A 2PA3A 1HIYA 2N82B 1ZOTA 1Q8KA 4ID5B 2F4VF 1RYSA 5DZ6A 1RHMB 3LPYA 3H4DA 1U2RA 3H8YA 3HCXA 1BLUA 2I38A 3FSXA 1MNEA 4DR7J 1NHKL 2QMXA 3JYTB 4ECSA 3PIPQ 2XYGB 2FYXA 2B6AA 2ZC4A 5K5MA 3M8QA 2YBVA 4LSNA 4IG3A 3CDWA 2YWHA 2D9PA 4K4YA 1SQEA 2YKNB 2IC3B 3A8KA 3SMZA 3BGLA 4QQBA 5KFRA 3VAHA 4OFZA 4WTOB 1QSLA 3DYAB 2GX8A 2P8IA 3HP6A 3BSNA 1K9MT 4K50A 2RS8A 4FVCA 4O3PA 3L09A 3VAIA 3UD5A 2D1CA 3CC2S 3SV4A 4FS1A 2I2YA 1VDHA 2IHR1 3W8GA 4RUAA 1AT1B 4A8QA 3EJMA 4TQSA 4WIIA 3J7A1 4MIAA 5KG4A 4DFMA 2KVIA 1GT8A 1VQ7S 3RZAA 1C1CA 4NL5A 5K8OA 1NDPA 4I1TA 4JI5F 1N54B 1J5OA 5KFYA 4XO0A 2O66A 3GJRB 4RNOA 3ITHA 5CABA 3UVJB 2O3DA 3D1QA 1U1NA 1H98A 3TAPA 2X3GA 2AV5A 1U47A 4WFBQ 4OJHA 1T03A 1KLMA 2HFNA 1C4CA 4HHJA 4A8SA 2M7SA 2DJWA 4IR9A 4AL5A 2UVWA 2F1FA 5L9XA 5IV4A 1T9WA 2WK4A 4DDFA 4DR4F 3JQKA 1HNXF 3GIRA 3B54A 3GPAA 3QJLA 3Q8RB 1PAUB 1N0VC 3MTJA 4KBIA 1SKSA 3PYGA 1WC4A 2DCUB 2M4MA 2UUAJ 1P9YA 3KTQA 3G6XA 1Y9OA 2YNHB 4IYQA 1LW2A 4LF5J 1S77D 2L48A 3SEOA 1RT4A 4FYDA 1RU2A 3X3UA 2XY7A 2EK1A 1HQ2A 4W92B 4ECQA 2VG6A 3OFHA 5KFIA 2AGOA 4N47A 2KM8C 3ISND 3R6LB 2Q6BA 4DSJA 1IQTA 1LWEA 4GO5X 1FKAF 1G4CA 1S6QA 2G0CA 2E5GA 3KNAA 1PAEX 2R7XA 4TY9A 4PG8A 1NK8A 4WPAA 3CDUA 2JSXA 1N6QB 2FJBB 1PYSB 4UUXA 1H38A 5A8WB 2XCPA 2JL9A 2GIQA 5DDRC 3V81A 1WF2A 2KB2A 2YWEA 2LA4A 2OPRB 2QV6A 1CJUB 1S49A 2CQ4A 3MEKA 2DNLA 2EFQA 2OO4A 3GILA 5A8RA 1JNZB 3OTBA 3OUYB 1Z1ZA 4G1QA 3CCVS 2RKIB 4WP8A 1HR0J 5FIIA 3KG0A 1YHQS 4M5DA 5FD1A 4D3HA 2Y8YA 4MAKA 5CD4H 3MMBA 2KZMA 3M2RA 1QUVA 3CDBA 1S7IA 1RBOB 1V5VA 4G65A 1M0SA 2N7YA 2V8PA 3KWMA 5ETLA 2GIRA 4OZ5A 4HL9A 4XIUA 1WACA 3HT3A 1G2EA 4TKTA 4Q2MA 4CCHA 2HS3A 8RUCA 2RAQA 2Z56B 3HHLC 5K8NA 4LFBJ 3VQTA 2CWKA 4JI4J 3DOMA 2X51A 1IR0A 3FDSA 3M2UB 2JHEA 4HVZA 2ZD1B 4Y2MA 4G1IA 3CF5Q 3KUHA 1G3OA 4ZVRB 1S4FA 3OLBA 1SH2A 2CDRB 1HL6A 2AU0A 4NA3A 1I3OB 2M88A 2ZWOA 5HROB 4OX7A 4ECRA 3PM9A 1U2CA 3IFEA 3T9ZA 2RU3A 3NAIA 5HQ8A 3HJVA 4PPDA 2PN6A 3QZ7A 2JWNA 2QA4G 1OSDA 3V4IB 3BGUA 4PQUB 2YPZA 2FJEB 1XMOJ 1OIAA 2ZUAA 1S1TA 3LOUA 1S1XB 4IFVB 4NMLA 3NGDA 5F8NA 1SL1A 4DV0F 2F4FA 4DJBA 1HBOB 2ZE2A 2O01C 4QWAA 1ZPWX 4JI4F 2V2KA 1UVNA 1MW7A 3HFVA 3CJQA 2JNJA 1ZM3A 1JMTA 2GHWA 1UPPA 2CG8A 4RW7A 3DGPB 4V1Ak 2VJUA 1FRMA 2H65B 2KYXA 4X65F 4Y3CA 3L7PA 4QWDA 4HHHA 1JLFB 1PC5A 2WOMA 3DM2B 2CQ1A 3MXHP 2ZH5A 5E3RA 2VFVA 2HBRB 2PI4A 5EWEA 3TVZA 1EKRA 5KT7A 4DV5J 2QFJA 3HJFA 2KFZA 3T5KA 3THTA 1J2VA 1YGYA 1RT1A 2K8GA 2P9EA 2OIHA 3VAGA 3K57A 1RACB 1TKZA 3M8YA 2DNQA 5KFBA 2ZZTA 1N5VA 4WIQA 4I64A 3IP0A 3AB4B 3I4HX 1IKYA 4LQ9A 2ZKUA 2XWXA 2R7UA 2OD4A 3UFCX 2XMVA 1N5YA 5D4LA 2FVCA 1S12A 4IQXA 2DH9A 3GIIA 3H25A 3MOJB 3DRRA 1S4EA 2RSQA 1RA6A 4JI2J 1HNVA 2DNYA 3FQLA 5C24A 3HHDA 2V4QA 3HT0A 3HI9A 4NLWA 2RQMA 2PSZA 1WORA 4OLPA 5JJBA 2BRKA 2FC9A 3HSDA 5CYQA 4ZJQA 4JV2A 1NSQA 3VZIA 3E2EA 2MLXA 2AX1A 4KHRA 3T5JA 5G0RB 4DL3A 3AHPA 4LRAA 1RB0A 3SSQA 4NLOA 3T5LA 2HIQA 1EAYC 5DDOC 3BQ0A 3CO0P 3IXQA 5KFAA 3FEXB 3TUJC 4Q0BA 1NK5A 1Q82T 1R0AB 2MGZA 4KFBA 1GAOA 2VQFJ 4WFAQ 4DV2J 2MQPA 2GQCA 1S0NA 1OJ4A 1FRIA 3CGIA 3MMAA 2CA9A 1NKEA 2KM8B 2L9DA 2VHGA 4H4KA 2JLFA 2BUNA 1RDRA 2G2ZA 2ZUGA 1IQZA 1F3FA 4F26A 4NZ6A 4CO3A 1LKZA 3HK2A 3DOKB 2QL9B 3KLHB 4PEOA 3DLHA 3MM5B 1IKXB 5IFMA 5GAHI 2BXJA 3JAMY 3FBEA 5HATA 2Z8QA 2ABYA 3EPGA 2A3JA 2G9OA 3CC7S 1NPRA 3M8PB 1B64A 1HWIA 4DI6A 2CIMA 1FERA 2NS1B 5HL7Q 2R8IA 4X64J 3SCLE 5IM0A 3CD7A 4Y6IA 2FIUA 4QIGA 1WUUA 3QZ8A 1Q0NA 5A8KB 3DXSX 5E7OB 2VQFF 4DV2F 3AFGA 5L9NA 1JLQA 4A8YA 1LV5A 4C2MA 3FZBA 3KLGB 2QE5A 4X2BA 5L38A 1NK7A 2DY1A 4CYUA 2ZDOA 1Z4UA 2JZ5A 1Q81T 4Q44A 5F8IA 2FVPA 4FF4A 1F3VA 5D6GA 3ZZRA 1J5EJ 1RA7A 1ZS6A 3C66A 3OT9A 3SFUA 3TAMA 3MM8A 2DH8A 1TL5A 4DUYJ 3KLFA 5LSRA 3PG9A 4QIVA 4DPXA 3C16A 4MT1A 3L7OA 3GFZA 4KYZA 3N6NA 4F3QA 1FRJA 2AKWB 2CPHA 5EDWA 1R6YA 1S1WA 2DRBA 1QVGR 1DLOA 3GJTB 3V6JA 4AFFA 4USHA 1SVDA 4PWUA 4DF8A 4P72A 3DRYA 4LF7J 1GQEA 3D6HB 5C7PA 1QE1A 1VQ5S 1HBMB 3FQKA 2QO3A 4QJVA 1P1TA 5KFPA 3N79A 1H3DA 1XR5A 4A4JA 2XLKA 4DXLA 4UW2A 1ZM9A 3QRQA 2B7BB 2OPPB 4KR0B 5E33A 3POTB 5LM7E 4EBEA 4DU7A 2HQIA 4Y2AA 4ZPWR 3IR5B 4DUYF 3JSRA 7FD1A 3UN5A 2VIHA 1E6VA 3GJQB 3QFWA 4ICLB 3TR5A 1Y5LB 2J6SA 3PW7A 3EVOA 1HI8A 2LEAA 2OP5A 5CA5A 1VRTA 2LYVA 3ZFVA 2QMWA 4OI0A 2MZSA 1NH8A 5C2GA 2DR6A 7FDRA 2OELA 2LXIA 1JXLA 5HMZA 3D9BA 3DHWC 5D8HB 1YJWS 4X4TA 1RZMA 1NUEA 4NXMF 1ZYQA 1TUWA 1ICEB 3WZ0A 1B99A 4EEYA 3L3CA 1W2IA 1BY9A 2J0SD 1A6LA 4YR3A 3OXFA 3VF0B 1MLAA 4KH1B 4LIWA 3J81U 3D3CJ 4QU7A 1UVJA 1HMVA 3SI8A 1V9OA 3CXCR 2HGLA 4F0KA 3NXZA 5ETPA 5HJYA 5BYSA 1H2UX 4C6AA 2E1MC 1XMBA 4ANDA 4LF9J 3PR4A 3O3LA 2GCFA 4DPUA 5C2CA 1H72C 3BSAA 4EUVA 1VHFA 1FD8A 1EB0A 1Y3KA 2ASYA 3AA9A 2DNPA 2HBYB 1KONA 4GC7A 2Z2LA 1WI6A 1OY6A 1IKWA 4LSZB 1VQNS 4WZMA 4X4PA 4YUDA 2ASJA 2ZH2A 3UDEA 4EYHB 3G8SA 1DARA 3IR7B 3I0RB 4A46A 3DHXA 3IAM9 2YX1A 3CULA 1RJJA 4USTA 4C0HA 2YKOA 4ID5A 2WSEC 1FJ7A 2B4PA 1KRPA 3T1YF 1I51B 2ALYB 1CVJA 1K73T 1X9SA 3HFZB 4NRUA 3MD3A 4I2QB 3JYTA 2V34A 1PJ6A 4J9SA 2E29A 2NYHA 5BYQA 2IBKA 1ZA1B 2KN4A 2YKNA 2IC3A 2C2KB 5E0OA 4ZPAA 3Q23A 4QCLA 1RLDA 1OMSA 2R7RA 2AJ1A 3K7RA 2VG7A 2YNFB 4J91A 4MFBB 1EKSA 3W60A 4GKKJ 4QYRA 1EX8A 2V6AA 1ULRA 4RUCA 4G3IA 2WZ1A 4RWXA 2G0JA 4P2FA 3MTKA 3DLGB 2G1DA 3OR1A 2MQMA 4DFKA 2DNZA 4P7VA 2VBWA 2MZRA 4U95A 5H9EK 2R7SA 5CH7B 4EGLA 5KFDA 3BDPA 2AP6A 3ZZOA 2QA2A 4WFNQ 4ES2A 1WC1A 1FFGB 4WXOA 1REVB 2B56A 4OLOA 5DG7A 1A0OB 2Z2ZA 3FMWA 3JTOA 3CMES 1WG4A 2HVEA 2V4JB 3IM9A 4NXNF 5F8JA 2MJNA 4B17A 5KAKA 2EPIA 5LMNF 4ENOA 4P6QA 2LQ5A 4LRCA 2C3PA 2DGOA 3RB4A 1WHYA 3M9NB 3QSYB 4QU6A 1GXUA 1HW9A 2B4OA 3JQJA 2CG4A 1IVZA 3OFFA 1VJQA 1U1LA 1TAQA 2YKPA 4M95A 2HS4A 1UEVA 1VYAA 4RBUA 2WAQD 4YR2A 1FKPB 2M5YA 8ATCB 1HW8A 1ZA2B 1CS4A 2YNHA 5KT2A 2LECA 3ZZUA 1JJ2R 2IBOA 4K4SA 3IA0A 2W2PP 5DQGA 1HWKA 2FHJA 2G1HA 2WBMA 2DR7A 4KO0A 3KK1B 2V2VA 4OJ3A 2N7CA 4B3MJ 1V6HA 3FFIB 4M94A 1KP6A 1IXKA 2HNDB 4R8UB 1NSKL 5FLXY 4F02A 3OTCA 1NHUA 2CAJA 3UN2A 3RR8A 2KT2A 1N6QA 2RU9A 5HMWA 1YZ7A 3P3DA 4A8KA 5A8WA 2UU9F 2CJ9A 4Y2KA 1TKDA 1DFDA 3MI7X 1KSPA 1K0VA 4AXIA 3TZXA 4ES3A 4RW6A 3D67A 2HFOA 2OPRA 4LFAF 2QLWA 5K20B 2PFDA 2ZH4A 4DSEA 3Q8VA 5CCMA 3C14B 1TK8A 1IBMF 4J9VA 3KLIB 4TLQA 3EGZA 1RAOA 4DLEA 1L3UA 3OUYA 3I9V9 1JWWA 4YDXA 3CIMA 3H2VE 1M5PC 3W8PA 3MAAB 3D7SB 1LOUA 5DM6Q 3M6UA 3HHLD 3H42A 2G2OA 1AXQA 3H59A 1AFIA 1SB6A 3MR2A 4F0HA 3PW2A 5GAEI 2JEFA 3EDRB 3VVTA 1VQYA 4Q43A 1IR1A 1ELOA 4O44A 2HWIA 3K5LA 4DCPB 2KG0A 1GEHA 4ZVFA 5IQQA 2B5JB 3NMAA 4ELUA 4YB6A 3OR2A 1WSRA 3GR0A 2CQBA 2XWYA 2B8QA 3I96A 1OPZA 4ZP7A 5KFVA 2ZOFA 2ZBRA 4NYZA 2NZ4A 2VPYB 5F8HA 2ZZMA 3OVBA 2ALZA 3DN9A 3MFIA 1QTNB 3IMQJ 1EETA 4I69A 1F9HA 1S99A 3CD0A 4K4ZA 2NXEA 1FDDA 2W1BA 1R8BA 2E1AA 4RJVA 1HLWA 5EHHA 4DR1J 3IN5A 5DJBA 3RGIA 2JEGA 1V3ZA 4KHMA 3ZZ0A 4HKQA 3OSPA 1RAHB 4DV4J 3BN7A 3V4IA 3PRBA 1SIZA 2F7VA 2KU7A 1S0OA 5LL6d 1X4DA 2KVQE 3GIKA 2MMYA 3G6ES 1S1XA 2IAJA 1R8AA 5D0EA 3MR7A 1CJTB 3SQGA 1HD0A 2XMJA 4DUTA 4FF2A 2UUWA 4ECUA 2OMLA 1JLAB 4EO8A 1XC9A 4NYOA 4O4GA 4ZHRA 2R7TA 4QR1A 2M8DB 2OSQA 1RWUA 5B0AA 5CYJA 2GMJA 1U1RA 3DM2A 4DR1F 4C4WA 3OBIA 2R9LA 2VPXB 1HI0P 5ETQA 2CNNB 1VLOA 4LR9A 1B7YB 1NKCA 1SXLA 3G4SS 3Q8YA 4UY85 4DV1J 2FLLA 2ZC3A 2LFVA 3LW5C 1J27A 1WHXA 3OTOF 1ZZNA 2Q3PA 4LT6A 3FBCA 3D54A 1TL3B 4C98A 5T14A 1H0HB 4PWWA 4DV3J 2ZVSA 3X1LB 1BQXA 1UA1A 5JUMA 1HQEB 3DMJA 1RHKB 2C2MB 3DLLQ 4HR2A 1XMQJ 4P7TA 4ECYA 4EZ9A 3T9NA 2NUUG 1EP4B 2J8SA 2BJDA 2GAHC 2MJUA 3LA0A 2P9CA 1MN7A 1RCXB 3N28A 2RB7A 1VRQC 3BR9A 1KN6A 5LXYA 5A6WA 1PJ5A 1TUVA 2BABA 4FXWA 2VA2A 4J9PA 2BKPA 2DHHA 2VFSA 3A3PB 3CCTA 4DV1F 1T3NA 1NLKL 4ER8A 3J7YU 4NLXA 4KHPF 2I5JB 2KO1A 5GMEA 3PEJA 4DQIA 3R1HA 3EWGA 2XI3A 1QDUB 4DV3F 2YQ1A 1YBTA 4ILLA 1R0AA 3NG8A 2CZ4A 4KE5A 2JEIA 2EC2A 3E8OA 1UZDA 4TU8A 3VAMA 3EXCX 4YB7A 2E5JA 3J7YI 1ACMB 2MZ1A 4EWTA 4J9MA 2QFIA 5GVQA 3FUYA 3R5BA 4H4MB 3TYTA 4JI6J 2RDIA 3DOKA 4J9UE 1MROB 4C7QA 2E7WA 2FVQA 3AY0A 2XS5A 1IKXA 3A3OB 4N56A 3I0SA 1VRUA 1LFWA 3FCWA 1CQMA 3WX4A 3PW4A 4CLTA 1LWCA 2XBPA 4KSEB 3M8PA 4E98A 1T02A 2X1GA 3BM7A 2HAFA 2LEBA 1WDDA 3HX9A 1H2TZ 2AZ1A 5KFZA 4UOGA 1RTJB 4YDDB 5A8KA 2JX2A 1GNKA 3R5JB 1NB2A 4OYMA 3DU6A 3K8VA 4F8RA 2VUGA 3OLAA 5KFSA 3KJQB 2A6OA 1RTZA 2RQKA 3GG1A 5CYMB 1UVMA 1X0PA 2BDPA 4AXJA 3FSIA 4B9MA 2DEJA 2MKJA 4KC5A 3CD6S 5JVHQ 2GQQA 1RBLA 3MM7B 3CJ2A 2ZWPA 2AGPA 4J9QA 3V5RA 1F5BA 1YVFA 4F50A 3ENAA 1TKTA 4ZJLA 2ZH6A 4CLSA 2ZITA 1XQIA 5LOQA 1IWGA 4FKXA 1P8GA 2LDYA 3PKMA 3SXLA 4OJGA 2B6AB 4TN2A 1HBMA 2BKNA 5A6PA 2V2ZA 1TKXA 2MPUA 4IG3B 2C28A 3L7UA 1NZ8A 3ZNUA 3OVAA 1P9QC 4CO0A 1QY7A 4WFZA 4LRDA 5KFMA 5IXUA 4F4WA 3POTA 1SJFA 5J2PB 1U48A 4JI1J 2HFZA 2XYHB 4F4KA 1AB8A 4KB7A 1XNQJ 2DCLA 4ICLA 1K44A 4DL5A 1PCAA 4XPEA 3R5CA 4LVOP 3W3SA 5MLCV 2DGQA 3S1TA 2BOPA 5EX3A 2KG1A 3EZOA 1SKUB 3WC0A 4RLEA 4DMZA 2X7IA 3QATA 4RBTA 2HFSA 1N36J 3U02A 3BPSP 2UV8A 3VAFA 5ETKA 1M90T 5ETSA 4ZK7M 3BGFA 2G2YA 5B09A 1SUQB 3NGRA 3W2VA 1HYSB 1VQMS 2PMWA 5F41A 1WKJA 2BYCA 4QIEA 1REGX 4NLVA 5D4NA 4ZIWA 1SBRA 5HN0A 1RHRB 3SDEB 2F9JA 4A47A 3J80Y 1VQ6S 1XNQF 2WW4A 2MZQA 4ECZA 2FY1A 1WOOA 3AQPA 2MKIA 2RUSA 1Q16B 2GS8A 2XSJB 3KMQA 4B9UA 3AOCA 1L3VA 1UFKA 1JLEB 4KQZA 3PYFA 4R0EA 5I3PA 4NCAA 1LNQA 3MPDA 3DLEA 1GX6A 3DOLB 4DX5A 1UFLA 2XMMA 4FP9A 4QWBA 3BPDA 2VBYA 4P71A 4J9RA 1RYRA 1XNRF 3TW0A 2V5HG 1RISA 1RSCA 1RT7B 2EFNA 2H4WB 3I0RA 1XK8A 5HSPA 3M32A 4ZS6A 3TWZA 1M5OC 3PFOA 1A9NB 1VBYA 4DN9A 3TRGA 3F0NA 5DO2A 2B4UA 4YN3B 3HSZA 2HQFA 4P2MA 2C3MA 2VG6B 2HGMA 2CZ9A 2BJ8A 1JJCB 1TAUA 4H4KC 1LWEB 3KK3A 1T9XA 4BS2A 4J37A 2AF6A 4I2QA 5DRKA 1RWVB 3R2CJ 4CM0A 3FK4A 3QT8A 2DGUA 3VAKA 2UVVA 2HW3A 2AMCB 3FNNA 2GVDB 5BR8F 1AYEA 4C0BA 5FJ4A 2H5IB 2V4RA 1S0MA 4M5KA 2VC0A 2MYFA 3M05A 1TR0A 4NLYA 2V67A 3A8EA 3K5NA 1YRUA 3V81B 1SH0A 4ID8A 3ICLA 4U96A 3AAWB 2V9KA 4ZP9A 2YNFA 2BMBA 4MFBA 4PAAA 1HFEL 5MAOA 2ZH7A 5A8RB 4M5LA 3TOQA 4ZVSB 4DQSA 2N4CA 2VPWB 4OX9J 2DPIA 4CDIA 2VB6A 4G1QB 2RNEA 4M5DB 4W98A 2DK2A 3M2RB 3MR5A 2IJFA 3F73A 2LQJA 2ZOGA 5KT4A 1O8BA 1Q53A 3W5ZA 3EX7B 4PCQA 1REVA 1Q5VA 5DS7A 5H9EJ 1PSDA 3MEDB 1H74A 2KXHA 1G1XA 2VH7A 2J9CA 1VQOS 1HD1A 4KJIA 2JJ4D 2OTLS 3RAMA 4JI0J 2JLGA 2FLNA 1W25A 1JLCA 3NGTA 1QAXA 5FDLA 4UOFA 3DOMB 3UQSA 2BBEA 1C0TA 4ED5A 3R8YA 4CLLA 2YNIB 3OV7A 3TZWA 3RBDA 4YB5A 3KUEA 4OX9F 4QOTA 5B0GA 2GJFA 2HRYA 4TVAB 2UXCJ 1MU2B 1HQUB 2KJWA 1FRKA 1R8HA 2DHSA 3PHEA 5K8MA 4ZLJA 2ILYA 1QSYA 4N41A 3PEHA 2HQ3A 3CD5A 2MLYA 1ZBTA 4G1PA 2F8EX 2DHXA 1FKPA 5GMKa 3G86A 2RJZA 4AT1B 4CLUA 4N7TA 1NAQA 3GMGA 2NZCA 4DZ6A 2BJ1A 3SZ2A 4JI0F 4ECVA 3D2WA 5C5JA 1S1TB 3O1LA 2KFYA 3N01A 4ES1A 3LANA 3KUGA 3MUVP 3I55S 2ZE2B 1FRLA 4WU2A 4A8WA 1H7WA 4RW7B 3D66A 2HNDA 1HKAA 5F0WA 2EFVA 4JYAF 3CJ0A 2HHPA 5AJ3J 4CRJA 2UXCF 3CCWA 2EC0A 2HMIA 4OZ0A 2WOMB 4USJC 3GV8B 3IWNC 1KR4A 4ETXA 4DL7A 3FBBA 1Y5IB 3HM9A 1SIWB 3BS9A 4DPTA 1FJGF 1N88A 2MB0B 2F65A 3PNIA 2ACYA 1X4AA 1RT1B 4RNHA 2QMUB 3KJVB 2WONB 1VLYA 1TKZB 3C14A 3KLIA 4P10A 1S9GB 2KXFA 1VC5A 2NREA 4D3GA 4NE9C 1WELA 2V0NA 2CQ3A 1IKYB 2VBZA 4RZRA 1JJHA 3KG4A 4TNOA 3MAAA 1HNIB 4NLDA 3SBMA 5K9FA 4ETZA 1N5TA 4AQYF 4JB8B 1MMLA 5KFNA 2OD6A 4F2SA 5AJ3F 1TZ0A 2QT7A 3SCIE 4WP9A 2IM1A 4MMOA 2BACA 5K8PA 2HNYA 4Z7YA 4Q45A 1B0PA 1WOPA 3DCAA 1BQMA 4XPCA 1HNWJ 3TVKA 4ED3A 1WG5A 3P4UB 4B9NA 4RUBA 2HVZA 3NOCA 5E3AA 4DF4A 1NB7A 1FF2A 2K7JA 4CQ1A 2A1BA 1XERA 1U45A 3BBCA 4BC9A 4JV5J 1VIXA 1I94F 4K8RA 2VQEF 1FWLA 1CG2A 1RLCL 3CCUS 1FESA 4IOCQ 3MZIA 4KIAA 4DSLA 4LR8A 4KFBB 1S1UA 3T1AA 1FTRA 4M5GA 3OL7A 1HBUA 4MH8A 5HO4A 3FJ2A 3QQCD 2NUHA 2QEXS 2JRSA 5IQ6A 3KJNB 1FK9A 3PW0A 2PO4A 4C8NA 1MN9A 5H1SV 1WKKA 1U1MA 2MSTA 3BGOP 2HLUA 1CJTA 4DCOB 3WIUA 1TP7A 4OYPA 5KFEA 3HD1A 3EMTA 5KT6A 2DHAA 5BXIA 4DBQA 3W9HA 2MQ8A 3BZQA 4O3NA 1JLAA 2L3MA 2FVSA 2OKQA 1WC6A 3CJSA 2J8AA 1ZM4A 2B43A 3IM8A 4ECWA 5EN1A 1QAJA 2MHEA 2DBBA 3RUBL 1JLQB 2MHNA 4ZMMA 4C3KA 4RU2A 2AD9A 3TARA 2BVZA 2HRTA 4CYUB 4M5NA 1QD1A 4TQRA 1T9TA 4YOEA 5K14A 2PDAA 1RWKB 3MM8B 1C4AA 2VG5B 4PG7A 5A76A 2RRNA 2DR8A 1YJNS 1PJ7A 3T41A 1S6UA 1DTQA 3UR0A 4J9NA 4J9OA 2EFPA 1VK3A 4ZITA 2BJ7A 2ADCA 3SCJE 4WFXA 4X66F 3H7HB 2IA6A 5L1IA 3NOGA 2RMLA 4B02A 1LFPA 4ZVPB 2EI5A 1NU4A 3W2WA 4CWBA 2OPSA 4JI8F 3GYNA 3ILOA 1DLOB 3FRYA 3C3LA 2Y1RI 4OI6A 3R1LA 3PFEA 2ZKTA 1Z2ZA 1EP4A 1E6YB 4XTTA 1NHVA 2HYIB 2ZDPA 2WVDA 2BM0A 5J2NA 2CNOB 1PKUA 4DHVA 2KHCA 1O0PA 1D0EA 1CEZA 4USKA 1YBAA 1YRXA 2Q6CA 3Q8PB 1DHMA 3BO4A 3ZNJ1 1N34J 1IBKJ 1JNRB 1JLGA 2XGPA 1VQPS 3K17A 4IH7A 4DV6J 3BGRB 1YSJA 1HARA 3LTOA 2I5JA 4Y0FA 2UUCJ 3I9ZA 5HP1B 3CT9A 4Y2CA 2J6UA 4LQ3A 1TL1A 3DLJA 3EICA 1W2BR 3B82A 1H6KX 3PZPA 5B08A 2XMTA 1FI4A 2FZCB 3PIOQ 3QT7A 3ZXWA 2J7KA 3M6XA 1N0UA 1VR6A 4UY8T 3BV8A 1YBUA 1VOMA 4R25A 3VR1A 4ZIVA 3QT5A 2HEKA 1JLBB 3KDNA 3IRWP 1HHSA 3CC4S 4O0NA 2RIJA 2NXJA 2RDJA 2EK6A 3ET6B 5IWAF 4K4UA 2M0GB 2AZ3A 2AYGA 3DRPB 2Y1JA 1NH7A 4X4VA 1N34F 3RW6A 2R2TA 4F4YA 1TUGB 3F56A 4DV6F 4B08A 4J9KA 3O44A 2UUCF 5LT5A 1TK5A 4OHWA 3M8ZA 1HMVB 1RTIB 3NCQA 4FBTA 1RTJA 4DS4A 4R5PA 3CJ4A 1YI2S 2AT1B 1RP5A 4W90B 4FYVB 1ROFA 1WHVA 4FZVA 2ZH1A 3PRDA 2IRUA 2F9DA 4RNFA 3TEGA 4OZNA 3I5BA 5KFLA 2Z58B 1SI9A 1TMMA 1X5TA 4Q8EA 3ZZTA 3Q86A 2DISA 1UEUA 2YTCA 1I6JA 1SL2A 2J6TA 1N32F 1Y11A 5E3CA 1GTEA 3MCNA 4NLTA 1FFSB 2IM3A 3EGWB 3V6DB 4CP5A 4O0IA 1YJ9S 2QL5B 2EBEA 2K06A 3AOBA 3CCLS 3EM1A 2XLIA 1S48A 3Q8SB 3MM7A 4QWEA 2NCKL 1NO8A 1BE4A 1RKJA 1S1VA 4UUWA 4KGZB 4N8NA 5AE1A 5B0CA 1Y0HA 4I7FB 2GO8A 4HDHA 5CD4A 4LFCJ 5KT5A 1Q79A 3CMAS 3BYRA 2XNRA 2KYZA 1ZH5A 4XAKA 1UPMB 3BJYA 5J2MB 1DTTA 2MQNA 4NLGA 3FEZA 4JI5J 4FF1A 2C2OB 5J2PA 3FGVA 3S6EA 2DVIA 4OYWA 3KHRA 1YJUA 1QUPA 1RAJA 1KD1T 5B7WA 2VG7B 2ZBIA 2OSRA 4DX6A 2KJVA 4DZDA 1SJQA 2HS0A 3JSYA 4OL8A 1L3TA 2IJRA 2QZ8A 2QYGA 4HACA 1SQFA 2MKKA 3UCGA 3OR1B 4MK9A 4DR4J 4Q7AA 4LFCF 4URSA 1NK0A 1HNXJ 3TNVA 5I3UA 4UF4A 4CLPA 3KOAA 2PMZD 1SCJB 2WSCC 2BJEA 2M2BA 1IR2A 1SUQA 4B9SA 1UAWA 5ETNA 1HYSA 2V8GA 3C6TB 3CE8A 2UV8G 4NASA 1I1GA 1Y00A 2QLFB 3JSMB 3SQOP 3KFWX 3SDEA 3QGPA 5IV3A 2B7CB 3OJUA 5C42A 4M5JA 4CNYA 3W5YA 4PXDA 5IC6B 5DDQC 1BUXA 2XSJA 4L3KA 2GJIA 1JLEA 2LCWA 3R7NB 3UO0A 5HI7A 3LGMA 2HHUA 2ERRA 2IYIA 2YWKA 2CUYA 2KDOA 2SXLA 2XMUA 3DOLA 3ELHA 2JEJA 2RE1A 2Q66A 2W9BB 1VC0A 2WVCA 1O5JA 3IO1A 2FJDB 3FRZA 3PJWA 1RT7A 2HG4A 1CS4B 4FPIA 5CCLA 1X9MA 2RS2A 4GMKA 4ZVGA 1S10A 3UWTA 4IKAA 1UA0A 4GC6A 2CDQA 4C8LA 2QSFA 4KO0B 2BRLA 3IG1A 2VICA 4X4SA 1C0UB 1WWHA 1RAGB 3RBEA 1KDNA 3AOAA 1SJ4P 2AGQA 2MTLA 2MZTA 4AE5A 4RW4B 2GC8A 2GVDA 5A2QY 1P1LA 3OHAA 2WW8A 6FDRA 1U02A 1IJEB 3G6YA 3HMJG 3D3BJ 1Q95G 3CJ5A 2ROPA 2CJAA 2J9EA 4RW6B 1U1OA 1MSWD 1PGZA 4JI3F 5KOXA 1FWKA 4BWMA 2DH7A 3OL9A 3GFXA 4OV6A 1KQFB 2MY8A 1EJ7L 3MPWA 1HHQA 4URGA 1KLNA 3N6LA 1VCTA 1QM9A 4K0KF 2PT0A 2V8HA 2JLEA 3LWMA 2ZVIA 3CMQA 3PYEA 2VDIA 3HVWA 3FKBA 3W61A 3R97A 1M5HA 5E41A 3H0PA 4OYBA 4IRCA 2CADA 1WHWA 2UUBJ 3US5A 3MEDA 4OHVA 5HVHA 3H5XA 1M1HA 4O44B 4A48A 4IQMA 5M2PA 3SFGA 2GA7A 4DV0J 3PO5A 2GIFA 1D09B 3OR2B 4ALZA 2C2RA 1RAFB 3K5MA 2Y3YA 5M2RA 3KHGA 4LF4F 4PRFA 4BBYA 5F3ZA 2YNIA 5IT9U 4P73A 5DQIA 2H5JB 5HBMB 3OD2A 2GGPB 4DX7A 3CJKB 5JMNA 4X65J 3H5SA 1EETB 4IRDA 1MWYA 4K59A 1PIEA 4I6AA 1MU2A 1HQUA 3AT1B 3PKYA 4GVBB 4HDGA 1UEKA 4HH1A 4EZ6A 3M9MB 1XEZA 4USIA 4HI1A 1BWVA 4A8FA 2HHHF 3DI6A 2E5LF 1KQKA 2UUBF 4Y00A 1RI7A 2FJVA 1GMWD 2XZDB 1KFDA 3HPOA 4F25A 3CSKA 3ZTSA 4RPFA 2V69A 3D68A 2KI2A 3NCPA 2IAJB 3K89A 1TTHB 3EGNA 3SQGB 5KFWA 2CNLB 3QIDA 5DGAA 3EVWA 3QSIA 1B3TA 4USWA 3S8SA 2XHCA 4K2JA 4RR5A 4WE1A 2YNGB 3DKDA 3PXGa 3GYXB 3D6TB 4O4GB 4ZHRB 2B51A 2ASDA 2J5AA 3UR3C 2DB1A 4E8UA 1PBAA 4EYIB 3G8TA 3QAUA 5I4MA 2YKAA 3MCSA 1FDNA 1RT5A 1R43A 1OY8A 3K5PA 4Q2LA 4QW9A 3E51A 2E5HA 1VI7A 1WG1A 2PE8A 1DZ5A 2OPQB 4JI7J 1ZAVA 3KJVA 2WONA 4KV8A 2DNMA 2HVDA 2MEWA 1OYDA 3LQVA 1S9GA 1KC8T 1BMQB 1Q7LB 3KNGA 2IVYA 3LF0A 4I56A 3CWJA 2G4BA 2F8HA 3VAJA 4ZPTR 1HNIA 3HKZD 1P27B 1YDLA 3DMJB 2EG1A 3NNCA 3RYLA 3UDVA 3I5AA 3GIJA 2HSEB 2D3OR 1FXLA 2CQPA 8AT1B 3D28A 2VKRA 1X4BA 4YEAA 4CT9A 3TUZC 3QGGA 3DGVA 2HHWA 2LKZA 2OLWA 4ZJOA 4DPWA 4OYIA 5F8LA 2YVSA 1EARA 1NDKA 4JI7F 4LF1A 3QJPA 2AYMA 1S6OA 5EGYA 2QG9B 1JXVA 1LK5A 1R8CA 2Q1LA 4WZQA 3TO8A 3JXOA 2FTRA 2D3ZA 3N5FA 4GO7X 2EFGA 1KWMA 2AEJA 1UTAA 4LSLB 5CZXA 5GAHU 1KKHA 2LMIA 1JB0C 3HLUA 5DQHA 1URNA 1FRHA 3PDNA 5HVGA 3TANA 2A2DA 2FQQB 2POKA 2J76E 1YJ7A 4HT5A 1UJ4A 2R8KA 2R8GA 2C3YA 3DDNA 2GHVC 3I0SB 1VRUB 5KFGA 2IJNA 1WC0A 4PUOB 3H40A 1LWCB 5HLFA 3TA0A 5JVGQ 3H98A 2L41A 1U6ZA 5HQMA 4P52A 2X1FA 2YXLA 1PBUA 1I5OB 4YQWA 1Y10A 4I2PB 1NJIT 3PHTA 3M2VA 4FNIA 3CW2C 2W2MP 1NJZA 1S9FA 1PYOB 3HULA 1ZZFA 4ITSA 2DGTA 2I1RA 2NXUA 4J7CA 2COLA 3MCOA 4OMFG 3T1HF 4DFPA 1PO6A 3AB2B 3J7Z5 1BQNB 2GHPA 2Z2MA 1EQ0A 3MAQA 4WKRA 4IG0B 2GMHA 2DKOB 2ZBCA 2VG5A 5AXMA 1N4LA 1VC6A 1LXNA 1VQSA 3CNQP 3MGJA 3LP2A 2W4CA 4DN0A 3VGSA 3V6HA 2UXBJ 3QT6A 1VBKA 3AD9C 1UVKA 2D3UA 3NL0A 1CJVA 4NOHA 2FHJD 3CCJS 3JQMA 2D7SA 1TKTB 4B3OA 3R5DA 2CVEA 3GG0A 5A2QU 4ED0A 1E6YA 5KOWA 5JXSA 4NXMJ 4M8LA 3Q24A 4U9RA 2CQ2A 2DNKA 1TKXB 4WKYA 4ZA1A 1NSAA 4DR5J 3I87A 3TQEA 4PWDA 3VHQA 2N3LA 3HHNB 3D0IE 4ZP6A 3SYZA 3O5TB 3BGRA 3AA8A 4L75A 1UJ6A 5HP1A 2ZM6J 3AJ1A 4YY3F 3GV7B 1OS5A 2HWTA 2Y9HA 3CPWR 2UXBF 4MIWA 2G0IA 2C3OA 2HBZB 2F3JA 1W26A 3I31A 1FNOA 3IGNA 4ATNA 1RAEB 4IO9Q 1U4BA 1JLBA 3MD1A 2PEHA 1LWXA 2ZNZA 3EZUA 4URQU 1CPZA 4LRBA 4U6PA 3OXGA 3W2VB 3ET6A 4DR5F 2AJ4A 3CCMS 2HHQA 3DRPA 4X4OA 3NNHA 4UZCA 1RWPB 1RHJB 1SC4B 3TX8A 4OZJA 2XG8A 5LSOA 1RBAA 1CULA 2J9DA 4NCGA 2ZM6F 3PJXA 3T1YJ 1WTFA 1RTIA 2DHGA 3N9UC 2UVRA 3DLBA 4PXCA 2WBRA 2AHOB 1HBNA 3W9IA 3FBFA 3N6MA 3CB4A 1X8DA 2V94A 4MYUA 1O6XA 1SQGA 3BN4A 3QGHA 2F8MA 2K3KA 1R6VA 3PX6A 4HT7A 4WK3A 3FCVA 3DLEB 3VTIA 3PTWA 2CKWA 3QGIA 1K1SA 4ZVOB 3HSGA 4GKJF 1X4GA 4WYWA 2R7VA 3ZC4A 2ZJQQ 2A6MA 3IAS9 2A2CA 3N0VA 5CAAA 3V6DA 4O3OA 2RF2B 1IM6A 3M32B 4IFYA 5RUBA 2W7OA 1DQ8A 2EBGA 2MXYA 1FE0A 5ETRA 2BZ2A 3RB0A 3M8RA 2W4DA 5LXRA 5KT3A 4TU7A 2P2CB 4LUBA 1RXOB 5H9FK 4I7FA 3KK3B 5D0GA 2FLOA 1UW9A 2EVZA 4Y65A 3MCMA 4HI2A 4IH6A 2CJXB 2OAUA 4CTAB 4CZCA 4NEZA 3GLJA 3QNWB 4PXEA 5J2MA 2C3UA 1RT2B 2W2OP 5HANA 4RNNA 4NXNJ 3OFEA 2FHOB 5LMNJ 3B6BA 3VZHA 2QC3A 3BH7B 2VD3A 2DY9A 4RL1A 2J0QD 4MKYA 3AD7C 3M6VA 3FEYB 2EG2A 4CNZA 1T94A 2AEMA 4M5HA 3AD8C 1N33J 2C2EA 1RWNB 2F5GA 3H20A 3GE9A 3QO9B 2DNHA 4KY3A 4BHQA 3U27A 3EE3A 3UW1A 5L1LA 2WHOA 5DG9A 5J1EB 1SJ3P 4NEYA 2I8EA 4A8OA 2OUGA 3RR7A 2W9CA 4Z37A 1WEYA 1PC4A 3C6TA 2VC1A 2DXDA 2VONA 4UQTA 2AYEA 2GJ2A 2D41A 1TL7B 3V6KA 3JSMA 1LW0B 3R5GA 4U7CA 1JLCB 5DETA 3FCHA 4HYKA 1VQ9S 5KG7A 5FDLB 1R0CB 4MK8A 1OWXA 4UQGA 1RHUB 1C0TB 1NJYA 4ANCA 4RW8A 1HPZB 1NMEB 4NLRA 4BC7A 4DR3F 1G7CB 3KHLA 4WP3A 2Y0BB 4DFJA 2BJ3A 1KFSA 1FEHA 1N33F 2C1EB 4RX6A 5I42A 2VBXA 2W7AA 4HH0A 2YH1A 1GH8A 1SV5B 2VJVA 4F04B 2UU9J 2CQ0A 3HHKA 4CLFA 2NSBA 2W9BA 4DR7F 3IS9A 2XMWA 3ENWA 2KT3A 3H2LA 2C2NA 3JAMU 3VVUA 4OV1A 3MWBA 2PA8D 3MM6A 4N8OA 1LWFA 3C2PA 4LFAJ 3JTPA 5L1JA 3MURP 1U7LA 3VWSA 1IBMJ 2A0FB 1KS2A 2W01A 2K1RB 2W2NP 1RT6B 1LK7A 2VODA 5IT4A 4KGKA 3RAQA 1GTHA 2B9YA 1WDTA 2CQDA 1C0UA 4X84A 2KFNA 1U8WA 3V2UC 1KVIA 3PJ9A 1N56A 3DLKB 1NK9A 4MKBA 2Y0SD 2WCXA 1Q86T 2FZKB 4OHXA 3BR8A 3OTEA 4B3TJ 4RW4A 2HMIB 4LBPA 3HKWA 1UW4A 4LBIA 5SUHA 4J90A 4KPYA 4QYZJ 2XSFA 3L95X 2R4FA 1UVIA 1F2GA 1D9AA 5GMDA 1W7WA 1IN0A 4WYLA 3SIPB 4DSIA 1S7HA 3NLCA 4RKUC 4ZP8A 4V19X 1GFWB 3IC1A 5GAEU 2D3O1 3BYPA 2FUG9 4PYDA 2R7OA 3G8QA 3BH6B 3MM9B 2DPJA 4USMA 2GW8A 1D9DA 2ADBA 3KG1A 1EIYB 3B8HA 2NXNA 4XK8C 4LF6J 5ETOA 2HNZB 3MOZA 3D6FB 1KTQA 4FYXB 4B3TF 4FF3A 2VA3A 1X4CA 1BWEA 4I0WA 4P9SA 1YJTA 4Z2XA 2PC6A 2HNYB 3GSIA 1DJ0A 3LO3A 4L73A 1F5AA 2N3OA 5LJ3Y 1YWXA 3PVXA 1D9FA 1BQMB 1F60B 1KHVA 2B4VA 3F44A 2J9DE 1SJ1A 2D74B 3Q89A 1FVSA 2DIUA 1S6PA 2BKOA 3E01A 2UUAF 4E0DA 3NS6A 4F36A 5HBMA 4P75A 4ZVQB 2GGPA 4ECTA 4LF5F 2W9AA 3CJKA 4FDFA 2NPFA 4M5IA 1VHIA 3D6MB 5AE2A 4NA1A 2DNOA 3W9JA 1S1UB 2XYPB 3MUMP 2EW9A 4GVBA 4YHHJ 4LF6F 3BBBA 3THPA 1NK6A 4ECXA 5F3TA 5E3PA 1HBUB 4S0MA 2DO4A 1ZPVA 2P6TA 1V3RA 3D0GE 1FK9B 1Q8IA 3HHEA 4ZOSA 3MAHA 1VQ8S 3M30B 2HHVA 4RNMA 2K2PA 4ERDA 3OTOJ 4DUZJ 2HVIA 4E2FB 3BO3A 3CJRA 2HURA 4KPCA 3BBFA 3ZTQA 1GXTA 1PYTA 4NYPA 2E9ZA 4ZVEA 3QIPB 3E3XA 3NS5A 5KG0A 4ZCIA 2YNGA 1WJ9A 1D1UA 4NA2A 2XY6A 3J81Y 4L72B 2YX7A 1YX2A 4YHHF 1RTDB 3W65A 1HR0F 1FKOA 3BSCA 4WXWA 4ED7A 3NCRA 2J0WA 1JIHA 4C48A 4U8VA 1Y7PA 2RD5C 4H4OB 2DIVA 2JC0A 1BHNA 1TV6A 4KGVB 3KLEB 2BQRA 2XLJA 4U7UD 2OPQA 5K14B 5KFHA 4LF8J 1TELA 2CQCA 2M8HA 1BD6A 3DFEA 4KHPJ 2JC1A 2XB2D 1IM4A 2LU1A 2OHDA 5B0EA 4P2XA 1DTQB 3WX8A 1SJRA 4DUZF 4YS2A 3BDEA 4ZN3A 1TFYA 3BREA 3R9LA 3HVTA 5J2QB 3V4MA 4LFBF 3QRPA 3KXDA 2PD1A 2HZCA 3W2WB 2QX0A 2OPSB 2W25A 2X1BA 4WU3A 1U25A 1IJFB 2LLZA 2I9SA 5J2NB 1U49A 2CPDA 2QL7B 2BEFA 1YK9A 4C3MA 4WF9Q 1U0HB 3DRSB 4F4AA 2V50A 3GQCA 2OJ3A 1RK8A 3PO4A 4NZ0A 2JDJA 2VKZG 2B9WA 5HMXA 4LF8F 3HVAA 1JLGB 2M70A 1Q8LA 5U47A 4F3MA 1G6BA 4LMZA 2PGCA 4WK1A 3CJ3A 1RWWB 1YIJS 5LMUJ 1XMOF 4FNHA 4F2RA 1FD2A 3OSNA 4V19J 1GMUA 1TL1B 2HHTA 2ZHOA 3WIVA 1QTMA 4OHYA 4CLWA 4LSLA 2DXFA 3T6BA 3P96A 3THVA 2RUGA 3GR1A 3Q22A 4FVMA 3BSOA 4L3NA 4ELVA 1K47A 5DDPC 1WI8A 4I4BA 4C11B 4DS5A 1FJEB 2DR9A 2YWGA 4UTGA 4DEZA 2KRBA 3SCKE 3RTVA 2FLPA 4PYAA 3O8WA 3IBFB 3LP1A 4KGMA 1TU0B 1YLXA 3CIZA 3C15A 4PUOA 5EWFA 1CSJA 3RJMB 5E3QA 1CJKB 3LPEA 4DV5F 3GP9A 4CO1A 2GAGC 3C19A 1UJ5A 2CQIA 3C6UA 4PG6A 1UWBB 2Q79A 1IUJA 2QRRA 4BDPA 2GV1A 4CO5A 2VPZB 5LMUF 2RVJA 3TEHB 3Q83A 3MUTP 3MFHA 1TL4A 4B3SJ 4FPRA 1UKUA 1KQSR 4R5PB 1D8ZA 3BB5A 2XZWA 4PABA 1RQ0A 3GONA 1F2HA 4I2PA 3EYZA 5C25A 2FGCA 5KG2A 2OH2A 1SC3B 4WCEQ 2BE2B 4F4ZA 1JX4A 3WQPA 4JI2F 2LP4A 1XIQA 4Z7CA 1BQNA 4IG0A 1KOHA 1TFWA 4N76A 1MWQA 2H54B 2W2QP 4PQAA 2AJ2A 1DQ9A 3R7SB 3PW5A 2EEYA 3ILLA 2A18A 4OI3A 1MMNA 5AE3A 2DITA 4O3SA 5FLXU 1L3SA 1AZSA 5IC4B 4B3SF 3TJ9A 4YB1P 1S1VB 2R3VA 2ACMA 5EWGA 4CI0B 5T7LA 3OHBA 1Q5YA 2BA9A 4FYWB 4JBCA 3OL6A 1S59A 4K4XA 2O67A 4N77A 4ZVTB 1X4FA 2V68A 3G2XA 3MR6A 3AJ2A 3DXBA 4OYZA 3D5MA 5KFKA 2NYIA 2YKQA 1DTTB 5IZHA 2MDAA 2X3DA 4YR0A 1U09A 3U7JA 3NKYA 1NJWA 3GTYX 2MSSA 4CIOA 4ZPBA 1S57A 5I3QA 1YJVA 4ANEA 1T05B 4L76A 1NM2A 1KQGB 2FGOA 3M1VB 2P5VA 3U1MA 4AL7A 4K4TA 4HACB 1FXRA 1YITS 4FYYB 2IPOB 4IH5A 3UDCA 2HIYA 3VGTA 3J7ZT 3HHLB 1X5SA 4X64F 2DRAA 5F0UA 4ZCMA 2OGUA 1TK0A 1D8YA 3RB6A 2CPZA 2HWHA 5I3UB 3GCWP 5DLFA 1FTCA 2QJ3A 2NLWA 5D77A 3EGVA 1XNRJ 1S5ZA 4U67Q 3HZGA 2QLBB 2PMHA 5IS2A 4DQPA 4K4WA 3GU0A 5J1NA 2DGWA 2C22A 1QLNA 2Y1IA 5M2UA 5IT0A 5THWA 3RRHA 1J5EF 2IY5B 3H4BA 5E5NA 1VS3A 5KFXA 2JVRA 2Z4PA 3VQSA 3W5XA 4DQQA 5C42B 1JK9B 3MMCB 1Q8BA 2B9EA 3ZO7A 4C0OC 2XGQA 1HNZJ 1T0TV 2JH3A 1UL3A 4DL6A 4TXSA 2CPEA 4IR1A 2EFOA 4NLUA 2BANB 5DLGA 2IM2A 3SSSA 3P45B 4KAIA 3ONQA 5BR8J 2GVZB 4WTYA 4C97A 1GMWA 1HHTP 2ASLA 3MHYA 3CCQS 1WEZA 4LF7F 2IM0A 1F1BB 4M63A 4CH7A 2HK2A 4ED6A 3ZTPA 1GK8A 2EWHA 4OYAA 4USUA 1WF0A 2RF2A 4ZDNA 4RWWA 5A0YB 1RWMB 1DURA 4ZCKA 5EX0A 1X5PA 1FVQA 3CCSS 3W7BA 2U1AA 4PZVA 3JSBA 2IMWP 3R2DJ 2PEBA 2HZVA 4PG5A 1X5OA 3IG1B 2Z2YB 1HNZF 1T7PA 4FN5A 5IOLA 2KL8A 3S01A 1KHWA 2LQBA 1NRKA 1X4EA 9ATCB 1GX5A 1KVKA 5H9FJ 1UETA 1K1QA 2B0GA 3LGNA 3K0JA 4B3RJ 4CTAA 3C46A 5CHCB 3EXYA 3NY0A 1B4SA 2YWWA 1RT2A 2H3EB 3UI3A 1VMBA 4IOAQ 3HDSA 3TA1A 4FKYA 1Q78A 5BJRA 3OQ2A 1AROP 1FRXA 1AW0A 2EXUA 1U26A 1QAYA 1T9UA 3MR3A 4UOHA 5KFFA 3UNYA 3I82A 2L9NA 5HJXA 2FVRA 3H2UB 1FFWB 2GMLA 1JXEA 4RU9A 3MPUB 3GB0A 1V3SA 3D0HE 3EVMA 1VIOA 2VASA 2QLXA 3QO9A 3J7AN 2WB1D 1NEEA 2BQ3A 3ZZPA 1U2FA 5J1EA 1YZ6A 3MEGB 4LF9F 3PCOB 1XR6A 4B3RF 4QIWD 2ZH9A 2Z57B 4JUZA 2ROGA 2UUTA 1D3WA 2AX0A 1RAAB 2F40A 3D1OA 2BW2A 1TL7A 1LW0A 2FC8A 3UCZP 3QWPA 1WC3A 4PR6A 1JKHB 1FE4A 1LQ9A 2HKEA 1HWJA 2CVIA 2L08A 3MPYA 2FJXA 1N48A 4OX6A 4GRSA 2HBQB 1F9FA 1HPZA 1FWPA 1FX4A 1SL0A 2PFFB 4X62J 2I6WA 3DYAA 3CJ8A 4JYAJ 4NI2B 2MQQA 1VQLS 3ENVA 1V5IB 1H73A 5KG3A 1FEEA 1UFWA 1SV5A 4A8XA 1X9WA 4ZLNA 2AWZA 4Y34A 4K5RA 3DI6B 1FJGJ 4UOCA 3LALA 1FXDA 2BV3A 2OEMA 2V8DA 2ILZA 4IDKB 5G4DA 1R7IA 3TUIC 1U6FA 2IIHA 2HHXA 2K1RA 1RT6A 4PPZA 3QPIA 3UVJA 2YY3A 2PI5A 2AQ4A 4RUHA 3D1HA 3B78A 1U0SA 4GKKF 4X62F 1XTZA 3I5CA 4Y2IA 2M3DA 4WE1B 4AQYJ 2XZTB 3DLKA 1FDAA 4ZPCA 3A8JA 5KG5A 2E9RX 3QFHA 4ED8A 2XTJP 2E1CA 3QAEA 2WTFA 2OFHX 1RT5B 2J7UA 5D4OA 4QWCA 1M5VC 4TLRA 5CXTA 1NDLA 4KV8B 1RKIA 2UP1A 2MKYA 4AYBD 4CH0S 3QLHB 3H5UA 4QPTA 1I94J 2VQEJ 4NX9A 1UP1A 5HK4A 1VQKS 1NNDA 3MM9A 2RH3A 1R31A 4BLGA 3CDEA 2W8KA 5LSLA 3LGHA 1VK8A 5KTQA 2HNZA 1F9EB 1YQHA 1F6TA 2E1PA 4MKAA 2V63A 3SSRA 2YX4A 1EHWA 3Q2TC 3MEEB 3PRVA 2IMOA 3TJ8A 4OI1A 4UZBA 2V2QA 1Q7YT 2E7VA 1RTHB 2BJ9A 2OEJA 1T3OA 2W4PA 1TVRB 4OZ3A 1FNXH 3RW7A 1FO1A 1CJUA 1H7XA 3PACA 2QYCA 1EQMA 1DAXA 3TUPA 4HLBA 1C1BB 3IR6B 4F0MA 4TYAA 2RKIA 1H2VZ 5L39A 1K0TA 2CQHA 4MKVA 4TY8B 4B3MF 2QIFA 1VISA 1RT3B 2BM1A 5B0BA 1X60A 1CC7A 1M5KC 5ITHA 3G82B 4C8OA 4FBUA 1T11A 3M30A 4EMDA 4HTIA 3NAHA 3J80U 1S76D 2VZ9A 3OXLA 1NDCA 4LREA 3LP0B 2AYBA 2FJWA 3OFGA 5HLFB 4X66J 4OZLA 3M6WA 3PV8A 3AXMA 5ETMA 3KLVA 4JV1A 4FS2A 4DR6J 4Q5VA 3QIPA 2RQCA 1IBCB 3M2UA 4NMXA 1KOOA 2VF3A 2ZD1A 3M4XA 4JI8J 1APSA 3GWCA 4KKOB 1JQGA 3M2VB 2CWXA 1RTDA 3MDFA 5HROA 5J1PA 4K4VA 2M52A 3A12A 4H4OA 1IKVB 4TYBA 3UD4P 4NLPA 4ILRA 4G6VB 2CJYB 3P6YC 2KT5A 3KLEA 3JS9A 4DL0C 2GNKA 1X7VA 4EI2A 5ADZA 3EZ5A 5SZTA 4ZVHA 1S9EB 1OYEA 4PQUA 2CJKA 1X4HA 3RG6A 1ZAWA 2P9GA 3LP2B 4IFVA 2E66A 5J2QA 4DG1B 3ZTOA 1HBOA 1IWAA 3DDKA 4DR6F 1CJVB 1FCAA 2CJQA 3ZZYA 1ZTWA 1FHTA 2BE9B 4RBVA 1WSVA 1S72S 4B3OB 3DGPA 2YKMB 5DZ7A 2XQCA 3B4DA 2AJ0A 3IBCB 2J7WA 5D3GB 2NR0A 3UN3A 1M1KT 1JLFA 2E5IA 4ZVUB 4C3LA 1OO0B 1NSPA 1U0HA 1R8PA 3DRSA 3DU5A 5IWAJ 3EDQB 4RO0A 4PWDB 1QAIA 4QW8A 4MK7A 2W8LA 4DV4F 2YWFA 2DGXA 4DL4A 1VBXA 3IRXB 2B8PA 4EU0A 3CEDA 4MTPA 1KVJA 1KTVA 4USVA 2QLJB 2R2UA 2ZJPQ 2HPUA 3UD3P 1OPIA 4IRKA 2H48B 5D15A 1EZZB 3KK2B 2ZNYA 1B0TA 4C11A 4DLGA 3RB3A 3G96A 5BYRA 3KYLA 3NMRA 1ZETA 2CPYA 3M8SA 2L9WA 1N52B 2VU5A 3GZ7A 1N32J 2ATCB 3WBZA 3CTRA 3BKTA 1R89A 3G71S 2XY5A 4OI4A 3P49B 1CJKA 1F5CA 2I0XA 3P5BP 3W1YC 2CPXA 1UWBA 5G0RA 4I68A 1CULB 4NCGB 1LXJA 4ZPVR 2ROEA 1HBNB 2NXCA 3CUNA 2ZZNA 5LJ5Y 3K59A 1YG0A 2R8HA 3GV5B 2Q43A 4DCJB 3BEGB 3M9OB 2BE2A 3DC2A 1XMQF 2E1RA 4UT4A 3EUNA 2RQ4A 3RBZA 2H51B 4HEA9 1U24A 3NGKA 1U1PA 2MQOA 3KDOA 5KG1A 1QJHA 2FPHX 4I6WA 4DSKA 4RW9B 4C8YA 2RHSB 4C9DA 3LWLA 3KLHA 1X31C 3KMSA 3A4TA 3MM5A 2D9OA 4QPXA 1KNZA 3P5TL 4LBHA 3TQ1A 3U1LA 2A10A 3KKFA 4IFYB 4LVNP 1WF1A 1RE1B 5EUHA 4ZCLA 3NWGA 4N5SA 3W64A 4M5MA 4ZKAA 2H1YA 4U7UK 1CLFA 1C2PA 2HLTA 2YH0A 2QN6B 3OPKA 5AXNA 4J9LA 2HGNA 2LEPA 3A1YG 3FC9A 4OZ1A 5L8RC 3GSDA 3VV2B 3Q8QB 5D0RA 3BKFA 4FXDA 1FDBA 2B3TB 4F67A 1N5SA 4LIRA 3AODA 3NBPB 5GADU 3ZZZA 2FD2A 3KLGA 2ZEJA 3TI0A 3I6PA 4DWIA 2CZVC 5KFOA 2XCAA 1WKLA 4JI6F 3A13A 1L3KA 2EKYA 2IDLA 2XHWA 1VFJA 1T05A 3G9CA 3MECB 1UMJA 3M1VA 5GADI 3JB9k 3NWRA 2MKHA 3NS7B 3RRGA 4B9LA 2HQDA 2VDHA 4JOUA 3HHLA 2MY7A 3ETMA 3Q0AA 1GMVA 3I56S 2CNKB 2AEFA 3ZTRA 1UWAA 3ISZA 4WJBA 4HHUA 3P8BB 1RWXB 2W9CB 3I32A 1R0BG 2R8JA 5HVFA 3HO1A 5F8GA 3M8QB 2GZOA 4LSNB 3PR5B 3BF4A 4MJKA 2BR0A 1JJ4A 2OPPA 2Z0GA 3BO2A 4XDDA 2NQPA 2H4YB 3Q8UA 2D69A 3DNCA 1FX2A 3MMCA 4L6V3 3PX4A 4NWBA 4OI2A 2AJQA 3I4PA 3TAQA 4EFAC 1XWLA 4RW8B 1GXLA 3OVSA 2LXUA 1NBEB 2H9ZA 4DQRA 2BANA 3KJFB 3TZZA 3A3NB 5I42B 3K8WA 5DG8A 2GVZA 2EKNA 7AT1B 3IS9B 2Y1LB 2RT3A 3MMJA 3PY8A 4OYOA 1VQ4S 3UE2A 3MM6B 4NZ7A 3NP5A 1N8RT 1LWFB 2B9XA 3CJTA 3QJJA 2KKHA 4JI3J 1C1CB 2VFRA 5A0YA 4CH1A 1HA1A 2QSWA 4YFUA 3TVYA 1MG7A 4WBFA 2DGVA 5ETTA 1J5OB 9RUBA 1DQAA 4K2XA 4JI1F 2CXEA 4TU9A 3O6QA 4K0KJ 3A8IA 3ITHB 5HMYA 2JFDA 1F0XA 3MPVA 4DR2J 1RU1A 5B0DA 1R3NA 3OJSA 3DDIA 2DYAA 2ZBPA 2LXFA 4M1KA 1T03B 3SV3A 4LRFA 1KLMB 4QYZK 3QYYA 2P6SA 4DV7J 3GCXP 2KH9A 2ZJRQ 1N36F 4X4NA 3LAMA 2BX6A 4WFYA 5KG6A 2FB0A 3FSYA 2LU2A 2HQGA 3M8WA 4O4RA 1LEOA 4LF2A 1R27B 2XI2A 2DT9A 3R5AA 4LF4J 6FD1A 3AH6A 1LW2B 1RT4B 1A7GE 2MZJA 4ZPDA 1T8EA 4DR2F 3LAKA 4A8MP 3GIMA 4R0JA 3MEGA 1RADB 4LR7A 4QBUA 3LUYA 2XNQA 4JP8A 2VFTA 1VBZA 4QIFA 2HHHJ 2E5LJ 1S6QB 3M7VA 4DV7F 4AL6A 4K5SA 5L1KA 1K8AT 4L74A 3N4WA 2AW0A 4QR2A 3R27A 3ISNC 1WD6A 2FDNA 3QWUA 4DX8H 4ZLPA 4MIBA 2R2RA 1JKHA 3T19A 4DU8A 2CPFA 1ZTTA 1S6PB 1T95A 4KGXB 3E01B 1DRZA 3HD2A 2U2FA 3BQ1A 2V8VA 2UZAA 5D4PA 4NI2A 1OY9A 2E9TA 1PG5B 3NGUA 3H90A 3DLGA 4Q8FA 4F3OA 2W7PA 3TJAA 1B0VA 2VOPA 5KFQA 3MMBB 1AA1B 1SPBP 2OFGX 2UXDJ 3ENQA 1SKRA 1BGXT 2RDDA 1Y5NB 4IDKA 1ITPA 5B0FA 1SC1B 4CM2A 2IDEA 2E44A 4OIXA 2V4JA 4OJ1A 2O1PA 1U1QA 1X0FA 2RRAA 1DBDA 1WEXA 2CJBA 2J0XA 3S7RA 2LA6A 2AIRB 4B9TA 3C8YA 2WVEA 2DNNA 2LVWA 2IVMA 3NEKA 3K2YA 2XC9A 3DRXA 2BQUA 4ED2A 3R3TA 3NRBA 2C2DA 2R42A 1FKOB 2XULA 5E2QA 4CLZA 2QA1A 2UXDF 2JVOA 1NPPA 1QVFR 4K7QA 1TV6B 3AJDA 2CRLA 3W63A 3L9ZA 1MWZA 1XR7A 4KRWA 1HWUA 3HZEA 2HRUA 4GVLA 4EK2A 5L46A 4QZVB 4HTJA 3QLHA 1QSSA 1TQLA 2O5DA 4XDCA 4DL2A 4LJMA 4BCAA 5D0HA 3HVTB 4X4UA 2VFUA 3Q2SC 4ED1A 2XMKA 4NLQA 4QR0A 3KK1A 1RWOB 2WVBA 3FFIA 3FVYA 3GJSB 2BE7D 3UNGC 2RILA 1AFJA 1RAIB 2N4DA 4R8UA 2DXEA 1FJCA 3W62A 3T3FA 5F9LA 5F8MA 1NJXA 3RAXA 2K7KA 1YJRA 4JV0A 4Y28C 3TZYA 3MEEA 1UZHA 2C2ZB 1RTHA 3ULHA 2XO7A 4CLYA 4NLSA 5KFCA 1TVRA 2BOAA 5AXKA 5KFTA 3KHHA 1RGVA 3FMBA 4IO1A 4WWSA 3WHIA 1VGYA 5KFUA 2OI2A 5T41A 2FY8A 1C1BA 3G6VA 4DPYA 3LH2S 4O3RA 3B4MA 4FXVA 1AUSL 2AJFE 1IBLJ 4J5OA 4F7VA 4TY8A 1N5YB 3K58A 2Y8WA 4OZ2A 2JFKA 1CC8A 2UVUA 4OYXA 1RT3A 4O23A 2BW7A 3DRRB 4YP3A 1HNVB 2QGFB 5C24B 3T1HJ 2ZH8A 2HFUA 2KZZA 3G82A 5HQLA 4CO4A 1N5QA 3R6GB 2MLZA 4DOZA 2MKCA 2GFFA 3LP1B 2VOOA 2RRBA 5F9NA 3GFYA 3C15B 5CYQB 2WVFA 2RHQB 2XO6A 3CDAA 3LP0A 4KH0B 4H54A 1XN9A 3CCES 1UVLA 2R2SA 2B5JA 2R7WA 2FHKA 1ZAXA 3C6UB 4P2SA 1B70B 4I67A 1Q4RA 3JTNA 1P6TA 1WC5A 4EBDA 1YRTA 1NKBA 4OHZA 2KXNB 2DGSA 2K3IA 1DY3A 3VALA 2OEKA 3AXKA 1U6BA 4KKOA 1TMJA 3UCUP 4ED4A 4IOBA 5C25B 2NSCA 1HI1A 4Q0BB 1IBLF 2VV5A 4X4RA 4AD6A 3R7BB 5CZVA 1WTBA 2V9WA 1FT8A 2IA0A 2MGZB 5HAOA 1Y4ZB 4CO2A 3AQOA 2IVFB 3HVRA 4C8KA 1RUSA 1IKVA 4ZLLA
chains in the Genus database with same CATH topology
2FGOA 3M1VB 3MMAB 2P5VA 3KLIB 4PG4A 2JEJA 1S0VA 5DM7Q 4TLQA 3EGZA 2CFXA 2RE1A 1AUDA 2Q66A 1OQ3A 2W9BB 1VC0A 3U1MA 4AL7A 4DLEA 1L3UA 3OUYA 1O5JA 2CQGA 3IO1A 4EO6A 2FJDB 4K4TA 1FXRA 1YITS 2IRYA 3I9V9 3FRZA 1JWWA 4YDXA 4IH5A 4NRTA 3CIMA 3H2VE 3PJWA 1M5SA 3UDCA 1M5PC 1S9EA 3J7ZT 3HHLB 1RT7A 2HG4A 1X5SA 4X64F 2DRAA 5F0UA 4ZCMA 3PX0A 1ZM2A 1LOUA 5CCLA 4YMEA 1TK0A 1Z2LA 1D8YA 4C8ZA 3GFHA 4F4XA 1X9MA 1HNWF 5DM6Q 1FNMA 3RB6A 2CPZA 3M6UA 2HWHA 3HHLD 4CT8A 5I3UB 2RS2A 5DLFA 4GMKA 2HHSA 4ZVGA 2FHMA 4DG1A 1FTCA 1S10A 3UWTA 1AXQA 2M9KA 4IKAA 1UA0A 3T6JA 2NLWA 2CDQA 3H59A 3UPFA 4GC6A 1AFIA 1SB6A 5D77A 3MR2A 4C8LA 3PW2A 2QSFA 3F41A 1PILA 4KO0B 5GAEI 2BRLA 4U67Q 2JEFA 3HZGA 2WB4A 3IG1A 3OL8A 2KHDA 2PMHA 3K5OA 1VQYA 1C0UB 4Q43A 1WWHA 2ZFHA 5IS2A 5KFJA 4X4SA 4DQPA 4K4WA 1ELOA 4JV5F 4O44A 5J1NA 2HWIA 3RU0A 5IM0B 3K5LA 3RBEA 2DGWA 2C22A 2YKMA 2KG0A 1QLNA 1CQNA 3U1NA 4ZVFA 5IQQA 1YTYA 2ZHAA 2Y1IA 5M2UA 5T7LB 2B5JB 5IT0A 5THWA 5D3GA 1SJ4P 2AGQA 3IWXA 4ELUA 3RRHA 3NMAA 3H5YA 1J5EF 4YB6A 3H4BA 3OR2A 2IRXA 1VS3A 3GR0A 2JVRA 5E5NA 5KFXA 2CQBA 2Z4PA 3VQSA 2MZTA 2XWYA 1WNEA 3I96A 4AE5A 2KRRA 4DQQA 1OPZA 5C42B 1JK9B 3MMCB 2MKSA 4RW4B 4ZP7A 1Q8BA 2GC8A 5KFVA 2APOA 2GO9A 5A2QY 1P1LA 2ZOFA 2WW8A 3OHAA 4NYZA 5GAGU 4C0OC 3OW2R 6FDRA 2XGQA 2XEXA 1IJEB 2JH3A 2NZ4A 3G6YA 1U1KA 2VPYB 1UL3A 5F8HA 2ZZMA 4BWJA 3HMJG 3OVBA 3CJ5A 4DL6A 2ALZA 4TXSA 3DN9A 3MFIA 1XBWA 2CPEA 2ROPA 1EETA 4IR1A 2EFOA 2CJAA 2J9EA 4I69A 1S99A 3CD0A 4NLUA 4K4ZA 2BANB 4RW6B 2WRMA 3IRXA 1U1OA 5DLGA 3TAMB 1MSWD 1PGZA 4JI3F 3QMQA 1FDDA 5KOXA 1R8BA 2E1AA 4OQJA 4BWMA 2DH7A 2IM2A 3SSSA 4AUKA 5EHHA 3OL9A 3GFXA 3IN5A 1S79A 3FZ2A 4KAIA 3ETOA 3ONQA 1MMDA 5DJBA 1KQFB 3T5HA 1Q1KA 2MY8A 4WTYA 2LQ9A 3KLFB 4C97A 2JEGA 1HHTP 3MPWA 1V3ZA 2WSFC 3CO9A 1TL3A 3MHYA 4KHMA 4MYTA 4URGA 2HAIA 1WEZA 5GAGI 3CCQS 3CVKA 1KLNA 3N6LA 1NZAA 3ZZ0A 2IM0A 4LF7F 1QM9A 4HKQA 4K0KF 3OSPA 2PT0A 2V8HA 4M63A 4CH7A 3BN7A 3V4IA 3PRBA 2JLEA 3KK2A 1SIZA 2F7VA 3LWMA 2KU7A 3HXMA 4ED6A 1HQEA 5CQGA 3NNAA 1S0OA 5LL6d 2EWHA 5D78A 1X4DA 2XS7A 2ASLA 1WF0A 2RF2A 4ZDNA 3GIKA 3HVWA 4X4QA 2MMYA 4RWWA 5A0YB 4KT0C 4DPOA 3N5BA 3UDLA 3G6ES 1S1XA 1DURA 1S1WB 4ZCKA 5EX0A 1X5PA 2DNRA 1R8AA 2IAJA 1FVQA 2YQ3A 3CCSS 1FA0A 2U1AA 3W7BA 1M5HA 3JSBA 2IMWP 5E41A 3SQGA 1HD0A 4IRCA 1WHWA 4PG5A 1X5OA 1NK4A 3US5A 2LDIA 2XMJA 3MEDA 1QE1B 3IG1B 2KTQA 1SH3A 4FF2A 4OHVA 2CPJA 1HNZF 1L5UA 2H5EA 1T7PA 3H5XA 4FN5A 2MQLA 2UUWA 4O44B 4ECUA 2XS2A 2OMLA 1URRA 2CPIA 4A48A 1JLAB 4IQMA 5M2PA 3S01A 3SFGA 3BQ2A 1KHWA 4EO8A 1XC9A 2LQBA 1NRKA 1X4EA 2FJAB 4NYOA 2GA7A 1GX5A 4O4GA 4ZHRA 3HFKA 3PO5A 3VCDA 2R7TA 4DSFA 4QR1A 1OSCA 1U8SA 3OR2B 5H9FJ 4ALZA 1UETA 2CYYA 1RWUA 2OSQA 2M8DB 2C2RA 1K1QA 2B0GA 2IYGA 3LGNA 5B0AA 3K5MA 3K0JA 5CYJA 4CTAA 2GMJA 3C46A 1U1RA 3DM2A 4DR1F 5CHCB 5M2RA 3KHGA 4LF4F 3EXYA 4PRFA 4C4WA 3OBIA 2R9LA 2VPXB 4BBYA 1HI0P 5F3ZA 2YNIA 1RT2A 5DQIA 3MF5A 1E6VB 4IUFA 5HBMB 1NKCA 2GGPB 3UI3A 1SXLA 3HF5A 3G4SS 3CJKB 1VMBA 3H5SA 4IOAQ 3HDSA 1EETB 4IRDA 1VRTB 1MWYA 4K59A 3TA1A 1Q78A 4I6AA 5BJRA 1MU2A 1HQUA 3OQ2A 1AROP 4UY85 5IT9Y 3RRKA 2FLLA 2ZC3A 1FRXA 3PKYA 3LW5C 4O3QA 1AW0A 4PXBA 1WHXA 4HDGA 2ZH3A 1U26A 2QA4S 1QAYA 4HH1A 4EZ6A 3OTOF 1XEZA 4USIA 3M9MB 2DNGA 1HWLA 1ZZNA 4NCBA 2Q3PA 4LT6A 3MR3A 4HI1A 5KFFA 4PKDB 1VJWA 3D54A 1TL3B 3TA2A 3I82A 4C98A 5T14A 4A8FA 1H0HB 2HHHF 3DI6A 3CCZA 4H4MA 2E5LF 2L9NA 1KQKA 2W24A 2ZVSA 2FVRA 2UUBF 3X1LB 1BQXA 4Y00A 3H2UB 1RI7A 4RW9A 1MROA 2GMLA 2FJVA 1JXEA 4OX8A 1SKWA 4RU9A 1KFDA 3HPOA 1UA1A 5JUMA 1HQEB 3GB0A 4F25A 3CSKA 1SC6A 1V3SA 2C42A 3D0HE 3DMJA 3IBWA 3DLLQ 1OQ6A 1VIOA 2VASA 3O2IA 1S97A 2QLXA 3QO9A 2KI2A 2WB1D 2X1AA 1NEEA 4P7TA 3NCPA 4ECYA 2NPIA 2PIIA 1B7FA 2IAJB 2BQ3A 3ZZPA 4EZ9A 1U2FA 5J1EA 3MEGB 3T9NA 4B9VA 1IBKF 4LF9F 2DD8S 1XR6A 2NUUG 3EGNA 1EP4B 3SQGB 3WC2A 4B3RF 4QIWD 2BJDA 2ZH9A 2MJUA 4JUZA 2ROGA 2P9CA 2UUTA 5KFWA 3QIDA 2IFXA 5DGAA 1D3WA 3N28A 2AX0A 2RB7A 1O51A 3OTDA 2F40A 3D1OA 3WDOA 2BW2A 2DO0A 3S8SA 3BR9A 1KN6A 5LXYA 5A6WA 5DGBA 4WE1A 1LW0A 1TUVA 2FC8A 2BABA 2VL1A 2YNGB 4FXWA 1KEKA 3UCZP 3QWPA 4J9PA 2VA2A 3PXGa 3GYXB 4PR6A 1JKHB 4O4GB 4ZHRB 4C8MA 2VFSA 2B51A 4ILMA 1FE4A 2GQ2A 4I6YA 2HVHA 3CCTA 4DV1F 2ASDA 1T3NA 3EPIA 1LQ9A 3NBPA 2ATLA 2J5AA 3UR3C 1HWJA 2CVIA 2DB1A 4E8UA 2L08A 3J7YU 3G8TA 4EYIB 4NLXA 3MPYA 3QAUA 4KHPF 2I5JB 2KO1A 2FJXA 2G13A 2JOQA 5I4MA 4KTQA 2YKAA 3MCSA 3PEJA 1N48A 4DQIA 3R1HA 4OX6A 1FDNA 1F9FA 1HPZA 1RT5A 1R43A 1SL0A 3K5PA 2PFFB 2XI3A 4Q2LA 3DYAA 4EBCA 5CYMA 4NPOA 4QW9A 4DV3F 2MQQA 3E51A 1VQLS 2DR5A 2E5HA 3TP2A 4ILLA 3ENVA 1R0AA 1VI7A 1WG1A 1BC6A 2DTJA 2PE8A 4ELTA 3NG8A 2CZ4A 1DZ5A 2OPQB 1IKWB 4KE5A 2ZHBA 5KG3A 1Y3JA 1ZAVA 3KJVA 1FEEA 1UFWA 2WONA 4KV8A 2JEIA 3MECA 2DNMA 1SV5A 3CCRS 2OMOA 2OTJS 3LQVA 5AXLA 4A8XA 1X9WA 2R7QA 3E8OA 4TU8A 1S9GA 3VAMA 2ZOMA 3EXCX 3IWLA 4YB7A 3IGVA 2E5JA 3J7YI 1KC8T 2E7XA 1Q7LB 3KNGA 2AWZA 4Y34A 2MZ1A 4EWTA 4J9MA 5GVQA 2PA3A 2IVYA 3R5BA 4K5RA 3DI6B 4H4MB 3LF0A 3TYTA 4UOCA 4I56A 2RDIA 3CWJA 3DOKA 2G4BA 3LALA 1FXDA 1MROB 1ZOTA 2BV3A 2N82B 2F8HA 3VAJA 4ZPTR 1HNIA 2V8DA 2E7WA 4ID5B 4C7QA 2FVQA 3HKZD 2F4VF 3AY0A 1P27B 2XS5A 3DMJB 2EG1A 1IKXA 1RYSA 2ILZA 4N56A 3I0SA 1VRUA 1LFWA 3RYLA 3NNCA 3LPYA 1CQMA 1U2RA 4IDKB 5G4DA 3H4DA 3I5AA 3GIJA 1R7IA 3WX4A 3PW4A 3H8YA 3TUIC 1U6FA 1LWCA 1BLUA 2D3OR 1FXLA 2HHXA 2I38A 2K1RA 2XBPA 2CQPA 3FSXA 4KSEB 1MNEA 3M8PA 3D28A 1RT6A 4E98A 1T02A 2VKRA 2QMXA 1X4BA 3JYTB 3PIPQ 4ECSA 4PPZA 4YEAA 3QPIA 2B6AA 2ZC4A 2X1GA 2YY3A 2PI5A 5K5MA 4CT9A 2AQ4A 3M8QA 4RUHA 3BM7A 2LEBA 3D1HA 4LSNA 4IG3A 3HX9A 3B78A 3TUZC 4GKKF 1H2TZ 3CDWA 5KFZA 3QGGA 2HHWA 4X62F 1XTZA 3I5CA 1RTJB 4Y2IA 2YWHA 2OLWA 2M3DA 2LKZA 4WE1B 4YDDB 2D9PA 3DLKA 5A8KA 4K4YA 5F8LA 2YVSA 2JX2A 1FDAA 1GNKA 1SQEA 4ZPCA 3DU6A 4JI7F 3K8VA 2YKNB 2IC3B 4F8RA 5KG5A 2AYMA 3QJPA 2VUGA 2E9RX 1S6OA 3OLAA 5EGYA 4ED8A 3SMZA 1LK5A 5KFSA 1R8CA 2E1CA 3BGLA 4QQBA 5KFRA 2Q1LA 3VAHA 4WZQA 3TO8A 3QAEA 2FTRA 2WTFA 2D3ZA 2OFHX 1RT5B 4OFZA 2J7UA 3N5FA 5D4OA 1QSLA 4GO7X 2EFGA 4QWCA 2RQKA 1M5VC 3DYAB 3GG1A 5CYMB 1UVMA 2GX8A 4LSLB 1X0PA 2BDPA 5CZXA 3HP6A 5GAHU 3BSNA 1K9MT 4K50A 4AXJA 2LMIA 2RS8A 4TLRA 5CXTA 4FVCA 4O3PA 3FSIA 1JB0C 3HLUA 3L09A 3VAIA 4KV8B 5DQHA 4B9MA 1RKIA 2D1CA 3CC2S 3SV4A 2UP1A 4FS1A 2I2YA 4AYBD 2MKJA 2IHR1 4CH0S 4RUAA 1URNA 3QLHB 4KC5A 3H5UA 3CD6S 1FRHA 3PDNA 4QPTA 3TANA 4A8QA 2A2DA 2POKA 4TQSA 4WIIA 5JVHQ 4NX9A 1UP1A 3J7A1 2J76E 4MIAA 4HT5A 5KG4A 4DFMA 1UJ4A 2KVIA 1VQKS 2R8KA 2GQQA 1NNDA 3MM9A 1GT8A 2RH3A 1VQ7S 3RZAA 3MM7B 3CJ2A 1R31A 1C1CA 2AGPA 4J9QA 2R8GA 2C3YA 3DDNA 4NL5A 1F5BA 1YVFA 2GHVC 3CDEA 3I0SB 1VRUB 3V5RA 5KFGA 4F50A 5K8OA 2IJNA 2W8KA 5LSLA 4PUOB 3H40A 4I1TA 1LWCB 1TKTA 1VK8A 4JI5F 1N54B 5KTQA 2HNZA 2ZH6A 1J5OA 5KFYA 2ZITA 5HLFA 4XO0A 2O66A 3TA0A 1YQHA 1P8GA 5JVGQ 2LDYA 3PKMA 4RNOA 3SXLA 3H98A 4OJGA 3ITHA 2L41A 4MKAA 1U6ZA 2B6AB 4TN2A 1HBMA 5A6PA 2O3DA 3D1QA 3SSRA 1TKXA 2X1FA 1U1NA 1H98A 2MPUA 4IG3B 2YX4A 2C28A 3Q2TC 3MEEB 3TAPA 3OVAA 2X3GA 1P9QC 4CO0A 2AV5A 2IMOA 1U47A 1QY7A 4WFBQ 4WFZA 4OI1A 4OJHA 5KFMA 5IXUA 1Q7YT 4YQWA 4F4WA 3POTA 1RTHB 1T03A 1KLMA 2HFNA 1SJFA 4I2PB 1NJIT 1C4CA 4HHJA 5J2PB 3M2VA 4A8SA 2M7SA 1T3OA 2DJWA 1U48A 2HFZA 4IR9A 4FNIA 4AL5A 4F4KA 2W4PA 2UVWA 1TVRB 4KB7A 2F1FA 5L9XA 1NJZA 1S9FA 1FNXH 3RW7A 1FO1A 2WK4A 2DCLA 4DDFA 4DR4F 1ZZFA 4ICLA 1H7XA 4ITSA 3PACA 2QYCA 4DL5A 2DGTA 2I1RA 2NXUA 1DAXA 1HNXF 2COLA 4HLBA 4OMFG 1C1BB 4XPEA 3R5CA 3T1HF 3IR6B 3QJLA 4LVOP 4DFPA 1PO6A 3Q8RB 3W3SA 3AB2B 3J7Z5 5MLCV 2DGQA 4TYAA 1BQNB 2GHPA 2Z2MA 1N0VC 3MTJA 3S1TA 4KBIA 3MAQA 1SKSA 2RKIA 1H2VZ 4IG0B 2GMHA 5L39A 2BOPA 4WKRA 2ZBCA 1K0TA 5EX3A 2VG5A 2KG1A 2CQHA 5AXMA 1N4LA 1VC6A 4TY8B 4B3MF 2DCUB 2M4MA 3KTQA 3G6XA 1LXNA 3WC0A 1VQSA 4RLEA 1Y9OA 4DMZA 2YNHB 4RBTA 3MGJA 2QIFA 3LP2A 3U02A 4IYQA 1LW2A 2UV8A 1RT3B 2W4CA 3VAFA 2BM1A 1S77D 1M90T 2L48A 3SEOA 4DN0A 4ZK7M 1RT4A 4FYDA 3X3UA 3V6HA 3BGFA 5B0BA 2XY7A 1CC7A 2EK1A 4W92B 4ECQA 1M5KC 5ITHA 1UVKA 5B09A 2VG6A 2D3UA 3OFHA 4C8OA 3NL0A 4FBUA 1SUQB 5KFIA 2AGOA 4N47A 4NOHA 3M30A 3W2VA 2KM8C 3ISND 4HTIA 2FHJD 3CCJS 1HYSB 2D7SA 2Q6BA 3NAHA 1VQMS 1S76D 2VZ9A 3OXLA 4DSJA 3LP0B 5F41A 2AYBA 1TKTB 4B3OA 2BYCA 1LWEA 3R5DA 1IQTA 4QIEA 4NLVA 5D4NA 4GO5X 2CVEA 1FKAF 3GG0A 2FJWA 3OFGA 1SBRA 4ED0A 5HLFB 1E6YA 5HN0A 4OZLA 3M6WA 3PV8A 5KOWA 1S6QA 5JXSA 2G0CA 2E5GA 3SDEB 2F9JA 4A47A 3J80Y 3KLVA 3KNAA 1VQ6S 4JV1A 4M8LA 3Q24A 2R7XA 1XNQF 4TY9A 4U9RA 4FS2A 2CQ2A 2DNKA 4PG8A 1TKXB 1NK8A 4Q5VA 2MZQA 3CDUA 2JSXA 3QIPA 2FJBB 3M2UA 4ZA1A 4WKYA 2RQCA 4ECZA 1N6QB 2FY1A 1KOOA 2ZD1A 3M4XA 3I87A 4UUXA 1H38A 5A8WB 3AQPA 2MKIA 1APSA 4PWDA 3GWCA 2XCPA 1Q16B