3A1YG

The structure of archaeal ribosomal stalk p1/p0 complex
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
284
structure length
211
Chain Sequence
MAHVAEWKKKEVEELAKLIKSYPVIALVDVSSMPAYPLSQMRRLIRENGGLLRVSRNTLIELAIKKAAKELGKPELEKLVEYIDRGAGILVTNMNPFKLYKFLQQNRQPQPLEVGLDVLAVYEDGIVYTPDVLAIDEQEYIDMLQKAYMHAFNLAVNIAYPTPETIEAIIQKAFLNAKTVAIEAGYITKETIQDIIGRAFRAMLLLAQQLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for translation factor recruitment to the eukaryotic/archaeal ribosomes
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Ribosomal protein
molecule keywords 50S ribosomal protein P1 (L12P)
total genus 56
structure length 211
sequence length 284
ec nomenclature
pdb deposition date 2009-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00466 Ribosomal_L10 Ribosomal protein L10
G PF17777 RL10P_insert Insertion domain in 60S ribosomal protein L10P
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1730 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3a1yG01
3J7YI 3A1YG 1ZAWA 3J7Z5 5GADI 4V19J 5D8HB 4NWBA 1ZAXA 5GAGI 4UY85 1ZAVA 3JSYA 5GAHI 2QA4G 5GAEI 5D6GA
chains in the Genus database with same CATH superfamily
2CQGA 1NNDA 4FKYA 4UT4A 2PD1A 1JXEA 3NBPB 4KPCA 4CRJA 1X9WA 4LF4F 2LFVA 3IBCB 1Z2LA 2H5JB 2VA3A 2MY8A 5HBMB 1VC6A 4IFVA 5ETSA 2BE2A 2F8MA 3K5NA 1NJIT 2E5LJ 4OI6A 3CD0A 5I3UA 3IS9B 4GVBB 5IC6B 1DBDA 3OBIA 1IUJA 3CCZA 5G4DA 1JMTA 5CABA 7FDRA 3AQPA 2MPUA 1FNMA 1N5VA 4ID8A 1K8AT 1UVMA 1FJCA 3D9BA 5CD4H 2JEGA 3MOJB 1F5BA 1OSDA 1FHTA 5ETTA 1VRUB 5A8WB 2MKYA 4RKUC 3RTVA 2AWZA 3GV8B 2DRDA 3C66A 2CQPA 3CIZA 4LVNP 4ENOA 3D0IE 3M9NB 4FF4A 4OI3A 2FY1A 5KFAA 1PGZA 3WC0A 5I3PA 4USJC 1X4EA 1V5IB 2VH7A 4G1QA 2WVCA 3W61A 2HHXA 4DV0J 4C0OC 2M4MA 4EMDA 4ZHRB 1NDCA 4JI7J 3I9V9 4NEYA 1CG2A 2A6OA 5FLXU 4AL7A 1RT4B 4TN2A 3MEDB 3TJ8A 4HEA9 3QIPA 3GFHA 2XZTB 3JSYA 1SI9A 3MFHA 3GILA 5DDOC 2VICA 4FYWB 4JI8J 1R6VA 1DLOB 3TARA 1ITPA 1FEEA 1T11A 4HL9A 1RT6B 1SC6A 3DNCA 2CYYA 2CPHA 1RTIA 2P6TA 4P2FA 3U1NA 3WQPA 4B3MJ 4K4SA 4U96A 2FLLA 5FJ4A 1FD8A 2RT3A 1HBOA 2L9WA 3BSOA 2BE2B 4KPYA 3B8HA 4OZLA 1Q7YT 3KLFA 5KFSA 3IS9A 5KFTA 1BLUA 2GQQA 2IIHA 3D1HA 2DO4A 3ZO7A 3J7YI 1FRXA 4NZ6A 5J1PA 1U45A 2CJBA 3HSGA 3OD2A 3QO9B 4OI4A 4ZKAA 1IKXA 3GV5B 3CCMS 1FRIA 1FRMA 5HLFA 3KK3A 4PPDA 1P9QC 1VK8A 2I6WA 1SH2A 1HQEA 1S48A 4B08A 5G0RA 3SI8A 2AJ2A 4WFZA 2ILYA 4HACA 2IBKA 3X1LB 1RBLA 4ZP8A 1WELA 1P1TA 2DY9A 4B02A 4FBTA 2GMHA 5KFXA 2FZKB 2DO0A 3F0NA 3OTCA 4ZN3A 5LSLA 2AJQA 2YWKA 3VAGA 1D09B 2XYHB 4MK9A 2OSRA 3WBZA 4ED7A 2IDLA 4Q2MA 1L3TA 4CTAB 5HK4A 2GFFA 4LRFA 1N32F 1RU2A 2C2DA 4A8XA 3K58A 4F3QA 1BY9A 1YHQS 3T9NA 4OZ5A 2MLXA 4OJHA 3DXSX 3AJ2A 4LRCA 3ILIA 1R7IA 1W26A 2MSSA 2Y3YA 4MK7A 4MKBA 3D66A 1S6UA 4PG7A 5L8RC 3KJVA 1I6JA 1X31C 2FGCA 2DIUA 4U9RA 1HMVB 4ZPAA 2BV3A 1BHNA 2J9EA 2ZNZA 1WHVA 3I96A 1S57A 2WOMB 3IR7B 4QR1A 1A9NB 2FC8A 3HVRA 2QA4G 2XS2A 2Z56B 3WIUA 2DCLA 3Q24A 1G6BA 3FUYA 2EFPA 4LF9J 1R0BG 2F3JA 2YX4A 3EPIA 4MTPA 4FS1A 2LEPA 2ZH7A 4DV4J 1QTMA 4RWWA 2YQ0A 2RRNA 3OUYA 3L7UA 3IXQA 3DKDA 3R5GA 3R5AA 2PMWA 2BKPA 4OHVA 4QCLA 1AB8A 2ZEJA 4PWUA 2AHOB 3D5MA 1OPIA 2XSJB 4LSNA 5D4PA 3TAMB 1IJFB 4ETZA 1D1UA 4OX8A 4DZDA 3OLBA 1GMUA 5H9FK 3C15B 4P10A 2BJ8A 2YWFA 3NGTA 1FNOA 3DDIA 5KFVA 2HFZA 1RQ0A 3MZIA 1MNEA 4HHUA 4I2QA 4RW8A 3PR4A 4NA2A 4FPRA 2BDPA 2L08A 2FJXA 2LDYA 5KAKA 3M2RA 1M1KT 3OV7A 2UXDF 4KH0B 2FY8A 4ITSA 2FHJD 3SCKE 3ADAC 1T9XA 2EC0A 4LF5F 4R0EA 2QA4S 2BJEA 4IOAQ 2XSFA 3RB0A 3G86A 5BR8F 3JAMU 1C2PA 1R3NA 4P7VA 5L9XA 2YVSA 3R2DJ 3KLGB 4OFZA 1SL2A 1G3OA 4AYBD 1H2VZ 2VBZA 3N4WA 4ZCLA 3KOAA 1UEVA 1TFWA 5DZ7A 4K0KJ 2UXCJ 4F4XA 2Y1IA 2QYGA 4OJ3A 4AUKA 4RW9B 4ED1A 1R6YA 2DHHA 3M32A 4G3IA 4RNFA 2WOMA 2R8GA 3MAAA 3H59A 2ZC4A 4PPZA 4QWBA 3NGDA 2IC3B 2KB2A 5IT9U 3EJMA 1UW4A 1F3VA 4FYVB 1RABB 5A2QY 1QAIA 4OL8A 1YWXA 3GV7B 3QBCA 4GO5X 2VFUA 4AT1B 2UUBJ 5JJBA 3PNIA 2EFOA 5K14A 2ZVSA 1S77D 2E7WA 3HMJG 1Y3KA 2FLOA 3C19A 3QGPA 2WVEA 4WCEQ 3Q8PB 2SXLA 1KD1T 2LU2A 4NXNJ 3LF0A 3AOCA 2DGWA 1WG4A 5DS7A 4B9MA 2H9ZA 2DVIA 4ZCIA 4J9QA 3PM9A 3D0HE 4X2BA 3MUTP 2I1RA 2HHSA 1X4AA 2ALYB 3IGNA 2Z2LA 9RUBA 2L41A 4DS5A 1LOUA 3Q86A 3CT9A 2A1BA 1NPPA 2LXIA 2J7WA 1RAGB 1QD1A 2G2YA 4L74A 4DR1F 3DN9A 4HI1A 4TLRA 4C97A 3NNAA 1PC5A 2FHMA 1JJ2R 3CULA 3SSQA 2AD9A 2Y8WA 3DOKA 3L7OA 3MM5A 1X0PA 1TMJA 3MUVP 1QUVA 2W7OA 4MKYA 2B6AB 2RVJA 3NP5A 5T14A 1FT8A 2HVHA 3EZ5A 3NBPA 1P6TA 2AYEA 4JI6J 4L76A 2OELA 1W25A 1VC0A 1UVJA 4YOEA 3I32A 5D6GA 1U6BA 2VASA 4B9VA 2ZWOA 1U26A 1LWCB 2Z8QA 1OY8A 3VR1A 5A8RA 1I94F 2LXFA 2ZKTA 2CRLA 3IAS9 2UXCF 2UXBJ 2VFTA 1B3TA 2VQFJ 1DQAA 1X4FA 4N56A 1HI0P 3HJFA 4BWMA 4MT1A 2GGPA 3FBBA 2XYPB 3WDOA 7FD1A 5A0YB 3CO0P 5J1EA 1UCNA 3TAQA 3RRKA 2UUAF 4IQXA 2Z57B 1LWEB 2MZTA 1UPMB 1K9MT 4NRUA 5B0FA 4PG4A 4NE9C 4JI6F 1X4BA 4ZPCA 1HFEL 2F5GA 2W9BB 3E01B 3SSSA 4X4QA 3OHAA 2RQKA 3UD3P 1IKWB 1FWPA 2WSEC 3I4PA 2YTCA 2VG5B 2G0IA 3H4BA 3MPWA 1S79A 1JLAB 3BQ0A 4ZPWR 2LVWA 2JVRA 3T1AA 4RU2A 3GLJA 4NI2A 3KWMA 2PIIA 2BRKA 4PR6A 1FFWB 3MM7A 1SKUB 2CFXA 2JC1A 2Z4PA 1SJ1A 1UFLA 3FK4A 3M2VB 3QRQA 3MR7A 4IG0B 2OH2A 4QPXA 3KHRA 2ZZMA 3BQ2A 2BX6A 1NBEB 3CJ0A 4LF4J 3C14A 5EDWA 3NG8A 2X1AA 1KFSA 1HL6A 1C1BA 3PHTA 4W4MA 3UD5A 3HI9A 2K3IA 5U47A 2O1PA 5B7WA 1UZHA 4LF7F 1IBMJ 3C2PA 2QG9B 1B7YB 1NB7A 3FSIA 2ZH3A 2NYIA 3W60A 1VOMA 4F3MA 2RDDA 3VZHA 3UN5A 1TR0A 1Z2ZA 2V67A 4IFVB 2MB0B 4CO2A 3HT3A 4NYPA 2AEMA 4JI0F 4MK8A 2K06A 3AAWB 3GTYX 1F9EB 3HULA 1N5YB 2MQNA 2ZVIA 4DR5J 2CG8A 3H2UB 4ELVA 4UTGA 5HLFB 1DQ9A 6AT1B 3KLEA 4WIQA 4JI1F 3DGPA 3CDUA 3LPEA 4ZMMA 1N5TA 3OXLA 2FJVA 2BXJA 5K5MA 1FXRA 4HACB 2H65B 3SDEB 2MQLA 5CCLA 1WTBA 1NK8A 3BH7B 4DI6A 2HMIB 5HJXA 2AV5A 3BYRA 3MCMA 3NGSA 5HVHA 1BQNB 3M30A 3PXGa 3V6HA 4ECTA 2N4CA 2LEBA 5KFEA 1YK9A 3WHIA 1CJTB 1FWLA 2CQHA 1VQMS 2LDIA 5KG5A 1S1VA 3VF0B 2XI3A 3CCRS 4F0HA 3L95X 1N0VC 1TKDA 4J7CA 2G2ZA 2QYCA 2PE8A 3E3XA 3EVWA 1DLOA 3GSDA 3ZTOA 4CP5A 1ZM9A 4CLUA 4DLGA 1TVRB 1REVA 3PJWA 4KYZA 3HX9A 4KY3A 1RHRB 5KG7A 2VIHA 4B9UA 2GHVC 4OZ1A 1VJWA 1RB0A 2AIRB 2DIVA 2OLWA 3HVWA 5CYMA 5D0GA 3ZZZA 4EZ9A 3HXMA 3ZZ0A 1Q78A 3JSBA 5IOLA 4JV0A 1NU4A 1VR6A 3AB4B 1ZM2A 4IH5A 3UDEA 5DQIA 1WWHA 1Y3JA 2A3JA 3FSXA 4LREA 3RZAA 3MR2A 4R0JA 2LKZA 2QC3A 1RYSA 4DXLA 3A8KA 5KFJA 1IBKF 3CVKA 3RR8A 4IFYB 1VQSA 5EX3A 4G1IA 4K5RA 1NPRA 4J5OA 2V8GA 1IJEB 2X3GA 4CYUB 3KK2B 4N8OA 4RO0A 1EX8A 3NCPA 3AT1B 4GKJF 4JBCA 3TP2A 4NLQA 3P6YC 4JV5F 5CCMA 2ZNYA 1V5VA 4NLRA 4QWDA 4NA3A 2B9WA 1C1CB 4KRWA 1OSCA 3K5OA 1EETA 1GXUA 1Y4ZB 2VPWB 2OEKA 5J2NA 4RWXA 2DKOB 3ETOA 2C2ZB 2X51A 5DGBA 1WC0A 1TU0B 1JJHA 5E3PA 2PFFB 4DQPA 3M7VA 5BXIA 3EICA 1CULB 1FXDA 1X5OA 4I2PA 4CT9A 3QSIA 4Q45A 2O01C 3JQKA 2Q66A 2GJ2A 3G71S 4U67Q 5IFMA 1WEYA 3I5CA 2XCAA 2I2YA 2HG4A 2UVWA 2KO1A 1N33J 2EPIA 3SMZA 4ZP6A 4DUTA 4ECWA 4ICLB 3HM9A 2FZGB 3U7JA 2NR0A 1SH3A 2B3TB 2OFHX 4KV8A 1Y11A 4PG5A 2R2RA 1RHKB 1ZTWA 5AXMA 2N3OA 3KJVB 5MLCV 4DV6J 3D54A 1WC3A 4NZ0A 4DU7A 1AXQA 2QFJA 4DR3F 1ZZFA 1SIZA 2GC8A 3V5RA 3G8QA 2V94A 1FCAA 4IRDA 3C8YA 4MH8A 4XAKA 4ECUA 5F8NA 2HNDA 3R1HA 4CO4A 1IBLF 1OY9A 4H4KC 4Q44A 1SV5A 3DMJA 2JHEA 3ZC4A 3UNGC 4OX7A 2JFKA 1TK8A 4EEYA 5CH7B 3TW0A 5F8IA 3OVAA 1YJRA 1JJCB 4O4GA 5KT2A 2NXJA 2IM0A 5F3ZA 3Q89A 2B5JA 1TKXB 1RADB 2RNEA 1IQTA 3BGRB 3DHWC 4RW8B 1CLFA 2KHCA 3BBBA 1FA0A 3BM7A 4RLEA 3NCRA 2ZHAA 4OZ0A 4LRAA 3DLGA 3CDBA 4ED8A 1WOOA 2VC1A 4J37A 4ZPTR 2CQBA 2FJEB 2X3DA 1D8YA 3BS9A 2JLFA 4YR0A 4XPEA 3MECA 4DL3A 2JH3A 3MM5B 2F4VF 3PO4A 3ET6A 1EKRA 1RK8A 2CXEA 3HSJA 2ROGA 2G0JA 5BYRA 4LF5J 1KHVA 2MJNA 3W64A 5RUBA 2AJFE 3BGUA 1SQEA 4ES3A 1KQKA 3GMGA 4EO6A 5ADZA 1AYEA 1KOOA 3DOMB 1N5SA 3CCUS 1EJ7L 1NDKA 4E2FB 2V6AA 5C42A 3RRGA 3LP2B 2C2KB 4K4ZA 1LXJA 2QMUB 1Q4RA 1S1XB 3RW7A 4IRKA 4HDGA 1T9UA 5GAGI 1S7IA 1HWLA 1WOPA 4KH1B 2KT3A 2IHR1 1HQUA 2QE5A 1GXTA 4L6V3 4OHXA 5DM7Q 2ZH9A 2VHGA 4CO5A 1YI2S 3MCNA 1UFWA 2HFVA 2WSCC 4NZ7A 4AE5A 3RJMB 5KFUA 3LO3A 3K59A 4O3QA 3D3BJ 3GYNA 3FC9A 3I56S 4F0MA 1H74A 1CS4B 3CDAA 3IN5A 2N7YA 3BJYA 1K73T 4LF9F 3Q83A 1QAXA 3G2XA 2ZBCA 5SUHA 3PYDA 3ZTRA 3TUZC 3LP1B 3OVBA 2A6MA 1RYRA 1T9TA 2A18A 2XY7A 3SQGB 4QYRA 1N33F 2HHQA 1T3OA 4ZVHA 6FDRA 3DLGB 3Q8SB 2W4CA 3T3FA 2DNRA 4X4VA 1O51A 1S49A 4UUXA 4KFBA 4J9NA 5HQLA 1UVIA 3HZGA 1YITS 2D41A 2ATCB 3M8YA 1RI7A 1YRTA 2OSQA 1RAFB 5D78A 2Z58B 1ZTTA 2D3UA 4ZP7A 2H5EA 2I38A 4B9TA 4G1PA 1A7GE 4HH0A 1U1RA 1LWCA 2FZCB 4M5JA 5A8RB 2JEFA 2V8VA 4O3NA 1Q81T 2ZKUA 2Y9HA 3A4TA 2I5JB 5DZ6A 2FHKA 1PIEA 3MURP 2E5JA 3OR2A 2ZH6A 3KK1B 2UUBF 3GJRB 1PJ5A 1YZ6A 3MEEA 1WKKA 2IM3A 3AH6A 4FPIA 2HWHA 2P9GA 2RF2A 4I4BA 5J2QA 4BBYA 3BQ1A 2JLGA 1KLMB 5F9LA 3DI6A 1DFDA 5A76A 3G4SS 4LJMA 4I68A 4QR2A 4ZVQB 3UW1A 2FIUA 3RBXA 2BVZA 1IKWA 1X9SA 1Q82T 3DYAB 2VG5A 4RW7A 4DSFA 3I0SB 5F8MA 1VJQA 4TU8A 1RT5B 4YR3A 2BACA 1WORA 4FXVA 2ZUGA 4EK2A 1RKIA 4ED2A 5CXTA 2HS3A 4P2MA 4Y65A 4HYKA 2L9DA 1LV5A 2OKQA 4CO0A 3UR0A 2HVZA 4ILMA 5ETPA 2R4FA 1T05B 2YPYA 2VG6B 3M9OB 2W9CB 2ADBA 5F41A 4NMLA 4OHWA 4ZDNA 2HK3A 2I9SA 3DLHA 1GNKA 1Y00A 1X5TA 1PG5B 1LW0A 4JOUA 2DNNA 4N76A 1FVQA 2CPEA 4FF2A 3LGHA 3O8WA 4UQGA 2VFVA 1RT7B 5J2MA 3PW0A 1CSJA 3R8YA 1OQ6A 3KYLA 4ED4A 2PMHA 4A8OA 3UCGA 2F63A 5EHHA 3TR5A 5IQ6A 1PO6A 5HMWA 5IM0A 1C1BB 3GFZA 3FMBA 2B9XA 4H4OB 2XMAA 5HMXA 5LXYA 4ILRA 3CCVS 1DTQB 2E1MC 1RLDA 4WFBQ 3BR8A 1O0PA 1T02A 2EG1A 1R8AA 1RBOB 2HAFA 2EFNA 2CJQA 2F4FA 3EZUA 4K8RA 4DQQA 3B82A 4RL1A 5F8JA 3MGJA 3KLHA 3O5TB 1HD1A 3H20A 3ZTQA 2OJ3A 2XNRA 4ER8A 2XWYA 1WI6A 1MMNA 1J2VA 1U1OA 2HGMA 3P45B 5EWEA 4WFAQ 3V6JA 2DNLA 1WC6A 3SDEA 8ATCB 3NRBA 4TY8A 1ZOTA 1FE4A 4DSEA 3M6WA 5C25A 5LSRA 3KLEB 2RS2A 1U1KA 1FNXH 3FCWA 4LIRA 4ALZA 4KBIA 4KKOB 2ZD1A 2VZ9A 1FRKA 3H0PA 2B8PA 5KOXA 2XO7A 4LQ3A 1DTTB 2VA2A 5LJ5Y 5GAEI 4DU8A 2WW8A 2CPIA 4WXWA 1FJGF 3R9LA 3H2LA 2D9PA 2DK2A 2BOPA 2E66A 2GZOA 3THTA 1FKAF 3MEKA 3IFEA 1FX2A 2BKNA 3QNWB 2HHPA 4URGA 4A8KA 4PXDA 5KFYA 5E0OA 5I3QA 3I31A 1C0UB 2HNYB 1O6XA 1VMBA 3T19A 4LBHA 4DR2J 1TVRA 3BN7A 4OX9J 4C98A 2EFGA 1R27B 4DV2F 5CYQA 4EBDA 2Q1LA 3UCZP 4Y2IA 3Q8RB 2RHQB 1Y9OA 1RTDB 4WYLA 5L1LA 3G87A 1H7WA 4H4OA 1RZMA 4DOZA 3PCOB 1CQNA 1QTNB 3I5BA 3NWRA 2ZZNA 2KRBA 3JXOA 4DMZA 3KK2A 2KT2A 1RWWB 1IBMF 3LTOA 2QJ3A 3HSZA 2EFVA 2GCFA 1XNRJ 2C28A 1WC5A 3KLHB 3BEGB 5GAHI 1AFJA 2XGQA 1VRUA 1QE1A 2PA3A 3DRSA 3VGUA 4WPAA 2E7XA 4QWAA 3T5KA 4LF8J 3D67A 4CH1A 2E5GA 3EGVA 2ASDA 3DC2A 5L1IA 2B5JB 4OI0A 2NZ4A 1NUEA 7AT1B 4DSIA 4M94A 1WSRA 2LEAA 3W7BA 4DUZF 1BD6A 4DL4A 4OYZA 1X0FA 2AW0A 2DEIA 3SBMA 4YN3B 5DQHA 3HK2A 2OI2A 2XMVA 1IBCB 1CULA 2E5HA 1EKSA 3HHLA 3CD5A 3KLIA 4I2PB 4F26A 4EYIB 5HROA 3ULHA 1RUSA 1UA0A 2F4VJ 2RU3A 1VS3A 5A2QU 3H8YA 2YKOA 4RUCA 3HHNB 1T3NA 2KYXA 3NLCA 1T8EA 5I42B 4XDCA 4C8NA 2ZH2A 2RSQA 2C42A 2HBZB 4CTAA 1WJ9A 3HT0A 3UVJB 1PJ7A 2XGPA 3SZ2A 1RAAB 5ETQA 3M8ZA 4EBCA 2RUGA 3BKUA 3VALA 2AU0A 3V81B 4LT6A 1SKRA 3I6PA 2DGUA 1TKTB 2N3LA 4OZJA 4PG6A 4KGMA 4Y3CA 3KUEA 4KGZB 5D0RA 3LANA 2V34A 1RT6A 1U47A 1RTIB 1TL3B 3MDFA 1NH7A 3QATA 5CQGA 4A48A 4A8FA 1N36F 2YKMB 1SV5B 2QSFA 5AXLA 1RWPB 4CZCA 2EFQA 1I94J 1VQ5S 3SCJE 1PYOB 5ETNA 3EMTA 4DCPB 2B4OA 3OFGA 2X1FA 1F9HA 3NCQA 1T9VA 5EGYA 5KT3A 1NKEA 2VPZB 1FI4A 4X4RA 2HNDB 2B9EA 3D2WA 1S6QB 2ILZA 3FRZA 2KL8A 3M1VA 4G6VB 4JP8A 1RCXB 4JUZA 2KH9A 2O3DA 3TEHB 1HYSA 4X64F 1C4CA 2XS7A 2NUHA 4HI2A 4LIWA 4U6PA 3I55S 1XMQF 2OGUA 3EDQB 4A8WA 2IPOB 2WK4A 4IH7A 4AQYJ 4MFBB 3CC4S 1UVNA 3TUPA 3G6VA 1XERA 1KSPA 1H3DA 4ZLNA 1EIYB 1F60B 3X3UA 3BR9A 3ISND 3O1LA 4Q7AA 1YRUA 3TZYA 1E6YB 5IXUA 1Q1KA 3EX7B 1R0CB 1WDDA 3LQVA 3M8PA 4O0NA 4PXEA 3TQEA 1CPZA 2HNZB 5H9EK 1KFDA 4R8UB 1WNEA 4KFBB 2DNKA 3EZOA 4P9SA 2AJ1A 2D74B 2HS4A 4PYDA 1MN7A 4CO1A 1LXNA 3T41A 2VQEF 4J9OA 2X7IA 1JXLA 5K8OA 1UA1A 5C24B 4OYBA 2LP4A 3C6TB 4B3SJ 1VLYA 3SQOP 1GMWA 1UL3A 4QJVA 5DGAA 1I1GA 2MHEA 5DM6Q 1NMEB 1SVDA 1U0SA 2CNNB 4IQMA 4WP9A 4EWTA 4USKA 4YUDA 3OFEA 3NMAA 4MIBA 2R7XA 2DR7A 1TL7B 3R5BA 4WU2A 1D9DA 3LP2A 2ZE2A 3ZZUA 4WF9Q 4DCOB 5C2CA 3MAAB 4IO1A 1T95A 4RNMA 3KMSA 2MKCA 3J80U 4RW7B 4ES2A 1MG7A 4CLZA 3Q2SC 4OZ3A 2OAUA 3HLUA 2QGFB 1FDAA 2HGLA 3TA0A 1V6HA 2HK2A 3K89A 2DNQA 4YS2A 4ZCMA 1VRQC 1YIJS 1X5SA 2NXEA 2NREA 1HBMA 2AJ0A 1PSDA 2FQQB 5IV3A 3GWCA 3VAHA 1CS4A 5HN0A 3QZ7A 1S6OA 2DBBA 2DH7A 3CJRA 1N34F 4NXMJ 1RWUA 1TUGB 2Q79A 4ECQA 1VBKA 1WHXA 3FJ2A 3OTBA 4Z2XA 4NL5A 4DV2J 4IR1A 2E1RA 4DF8A 2V4QA 2JRSA 1FERA 3L4BC 1VFJA 2V5HG 2NPFA 2RKIB 3MPUB 3HFKA 2J0WA 2DY1A 4LR9A 5DJBA 1S4FA 3RB4A 3VWSA 3VAFA 1W2BR 4M5LA 3DLEB 1TK0A 3P4UB 3D1OA 5C24A 1FF2A 3R1LA 3W3SA 2CQ3A 5J1NA 2ZHBA 5DDQC 2XMWA 1BUXA 5J2QB 1KN6A 3FCVA 3K7RA 3CW2C 2KRRA 3RYLA 4Y00A 4DL0C 1N36J 2FLPA 3MMCB 2A2CA 1AROP 2LQ5A 3Q8VA 5KT7A 2OPPA 4NCGB 3TX0A 2ZE2B 8RUCA 3I5AA 3K8WA 3QLHA 2CQ2A 2CPDA 3THVA 4UQTA 1IR0A 1LK5A 3L7PA 1F2GA 2GGPB 3FFIB 2O67A 3MPDA 4IG3A 4DCJB 4WKRA 4LFCF 3ZZPA 1PAUB 5K14B 4LFAJ 5M2UA 1KOHA 1WF0A 1ZAXA 3WZ0A 2HHVA 3QFWA 4NLPA 2R7OA 4M5GA 3HFVA 4L3KA 1YKWA 3CCJS 1GMWD 2F8HA 1T05A 1K1QA 1RT5A 3H42A 2VG6A 1BQMA 2ZUAA 3G8TA 4CNYA 2DGSA 1XN9A 4ID5B 2MZ1A 5KT5A 1MW7A 4Z7YA 1NAQA 1RT3A 1EQMA 4KIAA 3PRDA 4PCQA 3K2YA 4ZVPB 1JQGA 4C8YA 3D6FB 2JJ4D 2VBYA 4Q5VA 1T03B 4QZVB 1RT4A 1S72S 3HDSA 3M2VA 3J7ZT 2ZM6F 3GU0A 2CNOB 3ONQA 4HHHA 1X9MA 4ED3A 2FLNA 3FZBA 3DOKB 1BWVA 2GJIA 3SCLE 4X62J 1RTZA 1DRZA 3S6EA 3K5LA 1B64A 4DPUA 2YWWA 2CWKA 4LF6J 4O3OA 5AJ3J 3W2VB 2P5VA 2OTLS 1S1WB 4N8NA 3WX4A 3PX4A 2WVFA 3OVSA 2R8JA 2OPSB 3FDSA 2XM3A 1NDPA 1IR2A 3CC2S 4F67A 3IMQJ 1ZA2B 2QO3A 3P5TL 2MQMA 2ASJA 5JXSA 3D3CJ 2FHJA 1Q7LB 1S59A 2J9CA 2AZ1A 3R5CA 4ETXA 1MU2B 2EK6A 4B3MF 4CLLA 1RT1B 3KK3B 1YX2A 3KG4A 2ZBPA 2RHSB 1Y0HA 1SIWB 5GMDA 4IOCQ 4J9KA 1RAOA 3KDOA 1XR6A 5AE2A 4I69A 1IKYA 3BYPA 3HVTB 1N0UA 1B70B 4KKOA 1NEEA 4OLPA 2N4DA 3QWPA 1JLFB 2PT0A 1KR4A 1VQLS 3R5JB 2ZBQA 4DPOA 3HHLB 3KLIB 5HROB 1ICEB 1PYTA 4ZOSA 4B3SF 4DSKA 4ZVGA 2YKAA 4MAKA 2MQ8A 3NS5A 1RTHB 1S12A 4WP3A 5CD4A 3J81Y 4B3OB 3NGKA 4WK1A 5IV4A 2PFDA 1HLWA 3D6TB 1YJWS 2HVDA 3MXHP 1LNQA 3I9ZA 3RRHA 1NK6A 2OEJA 4ZS6A 3AJ1A 2KJVA 4NXMF 4A47A 3SXLA 3FBFA 5MAOA 2W01A 4P74A 4ZVRB 1TKTA 2E44A 2Q43A 5HANA 5LMUJ 4DQIA 1RWXB 1CVJA 4MYUA 3G9CA 2ZOGA 1TL3A 1VQYA 4TYAA 5IS2A 4YB6A 2VKZG 4K4YA 4JI1J 1XQIA 5CYQB 2G13A 2UUCF 4O23A 4EBEA 1WF1A 1H2TZ 2H54B 2MZSA 4F04B 3R6LB 5KG6A 2PI4A 1UJ6A 2OO4A 1AUDA 2AYMA 3PR5B 4Z7CA 4GO7X 3NWGA 3C46A 1S6QA 2BMBA 3MOZA 1KHWA 1LWFA 1NSKL 2GO9A 3IWXA 5K8PA 3AD7C 3OUYB 1RAIB 4DV7J 4EYHB 2R7VA 1I51B 3ZNUA 4LSLB 2HQGA 2LA6A 3M4XA 3L3CA 1WHWA 3G6ES 3DLLQ 4QYZJ 3AXKA 2CG4A 1Y5IB 4EO8A 1MMLA 2CJ9A 2LQ9A 3GP9A 2EWHA 2HQ3A 3FCHA 1WUUA 3O44A 2MGZB 4DV0F 3PVXA 5KFNA 1U24A 2GO8A 2HWTA 2MHNA 4IH6A 4D3GA 4PWDB 4DSLA 1SJRA 2FPHX 1EETB 2M0GB 4DR3J 3EVMA 2AEFA 4OJGA 3CJ5A 1JJ4A 1N54B 2DB1A 4NOHA 5AXKA 4ZN1A 3RB3A 3JYTB 2RILA 4W90B 1U1MA 3BBCA 2C3YA 3U27A 3NMRA 2CQIA 1EB0A 1YBAA 4B9NA 3VZIA 5JUMA 2K7JA 2XNQA 4NA1A 1FK9A 2ZC3A 1NSQA 1OJ4A 1H7XA 3DDNA 3NAIA 1FFGB 1OO0B 1PYSB 3DLKA 3M8WA 3PHEA 2Q6BA 3MR6A 2H3EB 1IWGA 3EVOA 2QL9B 3HVAA 1Z1ZA 4KO0A 2MKIA 1GXLA 4WK3A 2PEHA 2FYXA 2JZ5A 2XZDB 3TNVA 4IFYA 1HKAA 2HLUA 2UUAJ 5K8NA 1S76D 2AP6A 2XWXA 2Z30B 4TYBA 2YQ3A 3ITHA 3DCAA 2E9ZA 4LR7A 2DHGA 2CKWA 1TAQA 1N8RT 2V50A 2ZZTA 5A8KA 2GAGC 3OTOJ 2R8HA 5KOWA 4HT7A 3CJQA 1I3OB 1SJQA 1SCJB 1TKZB 5D3GB 1XMOJ 2CZVC 4M1KA 1E6YA 2QRRA 4RU9A 1N48A 3TA1A 2FUG9 3RAXA 4DL6A 1CJVB 3VVTA 4ZA1A 5J2NB 3V4MA 2E5IA 2GHPA 2ROPA 2VFSA 2WVDA 2FVSA 4QU6A 3EXYA 4K4VA 1U0HB 1GFWB 5F0UA 5KFDA 3R97A 2WBMA 1FKPA 3OJSA 3T1HJ 2M5YA 2BQRA 1M0SA 4CLKA 4RW4B 3CPWR 2KKHA 1YLXA 3KHLA 2WB1D 4CH0S 1E6VA 1F9FA 3ET6B 2WSFC 3OHBA 4LUBA 4ZP9A 2GJFA 2PC6A 4MJKA 4J9MA 2D3O1 5H9FJ 4LFBF 1Q8BA 3H25A 2DD8S 4A46A 4B17A 4BC9A 1JNZB 4FF3A 4U7UK 1FTRA 3CWJA 2V69A 2E5LF 2BABA 4J90A 4NCGA 4M5NA 1NK5A 1TL5A 2DGXA 4X4NA 2EXUA 3IP0A 3KUHA 4DV3J 3V4IB 1VYAA 2PSZA 3C3LA 2DXFA 3LPYA 5D4NA 3MR3A 1X7VA 2C2OB 3ITHB 3MM6B 3P96A 3W2WB 3CXCR 1HBMB 4ZLLA 4K0KF 5E3RA 5A8KB 3MEGA 3EYZA 2HVEA 1BQMB 2J8AA 4KGXB 3E51A 2RAQA 4IKAA 2W8KA 4DS4A 4QQBA 1FESA 4DV5J 1BWEA 3OXFA 2R7SA 1U6FA 4TQRA 3CTRA 5EWGA 2H5IB 1SH0A 1ZM3A 4PWWA 1P9YA 1Q53A 3CIMA 3AJDA 4I7FB 1IM6A 3D7SB 1UAWA 4RUBA 4CDIA 4C0BA 5BJRA 5LMNF 1VQ9S 3M6VA 2BYCA 3NGRA 3BB5A 3DHXA 1F3FA 2EKNA 1T9YA 4K4TA 3BO3A 2HSEB 4O4RA 2KN4A 1M5OC 4GC7A 2CZ9A 4OV1A 2CPZA 4RBVA 2LLZA 4CQ1A 2HEKA 3MCSA 5B09A 2COLA 4OLOA 3K57A 2CPJA 1G1XA 2IVFB 3EGNA 4ZLPA 2HIQA 2DNZA 3OR1A 4URSA 3CJKA 4Y0FA 3FRYA 4ZJOA 3PEJA 2EKYA 3R2CJ 4WU3A 1YGYA 2HKEA 3PEHA 5B0DA 4KJIA 4Q0BA 4V1Ak 2N7CA 1KVIA 1RBAA 3CDEA 2P9EA 3QLHB 4DX8H 3FVYA 3MM6A 1F2HA 3W5YA 3IM9A 1IKYB 4E98A 1U09A 5E7OB 3OFFA 1N52B 3I0SA 4TLQA 4F7VA 3MMBB 1BQNA 2BANB 2QA2A 4J9UE 2DTJA 5KT4A 2ZH5A 2J7UA 2DPIA 4KSEB 2UVVA 2R7UA 4OYMA 1MWZA 3QSYB 3GG1A 2ROEA 4C4WA 4Z37A 3T9ZA 4OQJA 4WYWA 4HKQA 4I0WA 5M2RA 1VRTA 4ELTA 3KG1A 2G2OA 1WTFA 5F8LA 1Y7PA 3I0RA 4LF1A 4TKTA 3ENAA 1YG0A 2M88A 2RIJA 4I64A 2R9LA 1GQEA 4F02A 3PIOQ 2ZJRQ 2FGOA 2OD6A 1XK8A 4DL7A 3TVKA 3EGZA 2KI2A 3H5XA 1KBRA 2RRAA 1BMQB 3MCOA 2NQPA 1OIAA 1UJ4A 3MD1A 4Y28C 2DGVA 1FE0A 2JOQA 4PQUA 4BC7A 2QLXA 4DG1A 1S1TB 1DARA 2XC9A 5J2PA 3J7YU 1YJ9S 2DNOA 3MEEB 2ABYA 3UDCA 1Q0NA 2CJAA 2VG7A 4KQZA 3RBZA 1R8BA 5IZHA 1K1SA 4E0DA 2YNHB 1OQ3A 1VIXA 1Y5LB 5A8WA 4Q0BB 1RT1A 1LWFB 1MROA 1KEKA 1EP4B 3LH2S 4IOBA 2CQ1A 4LSLA 3HSDA 3BN4A 4USVA 2QT7A 2KVQE 3AHPA 2QMWA 4F4ZA 2CDQA 4X66F 2UU9F 1HBUA 2DGTA 3NGUA 4ZVOB 4JI2F 3KLVA 2IY5B 1SBRA 4TY8B 5CAAA 1FD2A 3G6YA 3S1TA 1SKWA 1TQLA 5L46A 4IUFA 4NLUA 3FKBA 1HPZA 1D8ZA 2BANA 2KXFA 2VONA 4JV5J 4GKJJ 2HBRB 2JX2A 3TQ1A 2C3UA 3M05A 3QGGA 4NLYA 5LJ3Y 3JSMB 2DR8A 4G1QB 3QRRA 1UJ5A 3JYTA 4RNNA 3MEDA 2C2EA 1K44A 2BW2A 2C2NA 2R2SA 3JS9A 1AFIA 3PW5A 5LL6d 3LAKA 3VAKA 2PEBA 1V3ZA 3A3NB 3I0RB 4DZ6A 4ZHRA 4X65F 1J5EJ 1HNXF 5IT9Y 1VGYA 1PILA 1ZPWX 1JLQB 4L73A 4TU9A 1GX5A 3D1QA 3ZXWA 2LYVA 3RUBL 4KV8B 4ZK7M 3OJUA 4MIAA 4YDXA 1OWXA 5LMUF 1C0UA 2HNYA 4MKVA 2B4PA 2F7VA 2KYZA 2GA7A 4USIA 2WVBA 1YSJA 4IDKA 1NB2A 1OMSA 3KDNA 3O3LA 4DG1B 4DR4J 1HBOB 2P6SA 4NXNF 4DR7F 3D6MB 3MM9B 2MYFA 3I82A 2BUNA 2YNHA 3WIVA 4X66J 3KLFB 4RBUA 4DSJA 1JB0C 2ACYA 2HZAA 5F8GA 2LECA 4J91A 2EK1A 3JQMA 2LQJA 4Y2CA 4C3MA 3IO1A 5B0AA 1FRHA 4FXDA 3K8VA 3DOLB 4FKXA 4B3RJ 3EGWB 3D28A 4CI0B 1QE1B 3DRSB 1EHWA 1M1GA 2QL5B 3BGRA 3CB4A 4TVAB 5F9NA 4KHMA 1DAXA 2B43A 2U1AA 1HQEB 2PO4A 3D68A 1NCLA 2CQ0A 1HWKA 2RD5C 3DRPB 3QJJA 1RHJB 1WOSA 3QGHA 3OL8A 1J5EF 2GIRA 1RWNB 1SC3B 2MY7A 2VBWA 4H4MB 2KM8C 1RKJA 1F5AA 2JNJA 1SJ3P 4USMA 4JB8B 1ELOA 2HLTA 1BGXT 2CAJA 3GONA 2QZ8A 3BGLA 1X4HA 2IM1A 4NRTA 4P73A 3RB6A 4I6WA 3TYTA 2KFYA 4FS2A 3QZ8A 3GR0A 2G1DA 5LXRA 2OPQA 3DXBA 3GIRA 4ZCKA 5EX0A 4WTOB 3RAQA 1HMVA 2QLBB 3ZFVA 4U7CA 4B9LA 1S9FA 3UVJA 1C0TA 1YJ7A 1B0TA 1MLAA 3DOMA 1AT1B 3ENWA 4FYXB 2XB2D 5E3AA 4UOHA 1CJKA 3W8GA 2RQMA 2DH8A 4LSZB 1TTHB 2HAIA 2AYBA 1LEOA 1NK4A 2UXBF 3PJ9A 3GQCA 2VFRA 4ZIVA 1F1BB 2C1EB 3CJ4A 4M63A 2HZVA 1H98A 3Q8UA 1F6TA 3DGVA 4KO0B 4E8UA 4F0KA 9ATCB 4DUZJ 1RAJA 3LUYA 4ANCA 4NCAA 1ROFA 4WWSA 1U8WA 2GVZB 2JEJA 1RISA 1ZAWA 2R7QA 3CJ3A 2BOAA 3EE3A 5T41A 4YQWA 5D8HB 2QA1A 1N34J 4C7QA 1WC1A 4L3NA 5THWA 3VVUA 5KFIA 1XMBA 3C15A 4FZVA 1XMQJ 3A1YG 3PDNA 1JLCA 2C2RA 4C8MA 2V9WA 3A12A 3GYGA 3LGNA 3LP1A 4OYWA 4AL6A 2RU9A 4LSNB 3H90A 1X4DA 4UW2A 3TAMA 1FKPB 5FIIA 3OSPA 3UN3A 1V3SA 2G1HA 2V0NA 3ENQA 1URNA 5EUHA 2YXLA 4H4MA 3QYYA 2B51A 2EVZA 5HP1B 1KLNA 4RW4A 4DX6A 2K7KA 1M5PC 4C3LA 2MSTA 2V4JB 3C16A 2QIFA 2DRBA 2I8EA 2FC9A 4WKYA 4R8UA 3KJNB 4J9VA 5B0CA 1LWXA 4HLBA 1CBKA 2EG2A 4C8OA 3MUMP 3V81A 2L3MA 3BO2A 2PDAA 2MZQA 2XTJP 3C6TA 4RW9A 2RS8A 2I5JA 5DG7A 3RR7A 5EWFA 2VUGA 4JI7F 1VBZA 3GJSB 1FJGJ 4C8LA 3PY8A 4ECRA 2YKPA 2UUCJ 1FXLA 1QM9A 4BLGA 3CJKB 1M5HA 3VAIA 2CWXA 5I4MA 3CCQS 3HHLD 2B9YA 2UUTA 1NK7A 4EZ6A 3H5SA 3RU0A 4CCHA 1TFYA 3TRGA 1XMOF 3H5UA 5JVHQ 1J5OA 3DYAA 5BR8J 1M5SA 5KFFA 4CIOA 2QTWA 4NLXA 3HHLC 4FXWA 3GPAA 4RUAA 1G4CA 3IAM9 3FZ2A 4UZBA 3GZ7A 3PFOA 3OL9A 1Q8KA 3N0VA 3W5XA 4RNOA 4O0IA 1N6QB 2GVDB 1KWMA 3BH6B 2WONB 2ERRA 1D0EA 1YJUA 2HQFA 2WW4A 4W92B 2HHTA 1X4CA 1RHQB 4X64J 2RQCA 2WHOA 5FDLB 1HNWJ 1RLCL 3ILJA 3ZZTA 1FKOA 2IRYA 5E2QA 4U95A 5LOQA 4BWJA 1RAHB 1RTJB 1FO1A 3AXMA 3M8PB 1Y5NB 3LGMA 2R2TA 1S5ZA 3QWUA 4P7TA 5KG3A 4EUVA 3AODA 3KHHA 2OHDA 2GX8A 2BQUA 1U1LA 1HR0J 1Q5VA 1RT7A 4R25A 3UQSA 2FJAB 2DXDA 2XMTA 2Y1RI 4OYXA 4AFFA 5J2MB 5H1SV 3AOBA 4DJBA 4C2MA 1GK8A 4K4UA 5KG4A 4DR2F 4C0HA 1NRKA 3CMAS 1DURA 2BJ3A 2LQBA 2VDHA 4DFKA 2UUWA 3CCLS 1SJFA 3OR1B 2HURA 4MKAA 5KFWA 5KT6A 3TAPA 4OHZA 1S1TA 3SSRA 4DPWA 5J2PB 3LWLA 5HO4A 4IO9Q 2KXHA 2YNIA 4YDDB 4DN9A 3HKWA 4N5SA 2CPFA 2DYAA 2LCWA 4FVMA 1P1LA 4PEOA 3SV4A 4UOFA 1YDLA 3VQSA 5C7PA 1MROB 4X62F 3BKTA 4FF1A 4G65A 1XC9A 2H51B 4PYAA 2C2MB 3IG1A 4FNHA 4KHRA 3UN2A 1JLAA 2HWIA 4WZMA 2QSWA 4IG3B 4CWBA 2VKRA 2ZJQQ 2FJDB 4YFUA 1XTZA 5C25B 2CPYA 4NI2B 5KFZA 3W8PA 2OPRB 3CJSA 2GAHC 2W9BA 1U1QA 1IBLJ 3MPVA 2HW3A 1HPZB 3M8SA 3MTJA 4M5MA 3JTNA 2HVIA 3W9HA 4DV4F 3MMBA 2MJUA 1KRPA 4USHA 2B7CB 3BGFA 3FEXB 3CNQP 5M2PA 5ETOA 2CUYA 2AZ3A 3EWGA 2JVOA 5L1JA 4WBFA 4ILLA 3NL0A 1RT2A 4NYZA 1OY6A 5DRKA 1KTVA 2HBYB 1HA1A 1VRTB 2LXUA 3GG0A 3HCXA 2YY3A 3IRXA 2PI5A 2W25A 4ELUA 1UETA 1WC4A 4Q8EA 3C14B 4RR5A 4D3HA 3BPSP 4I56A 1ZBTA 2ADCA 3MAHA 4RJVA 1ZS6A 4I6YA 3M8RA 4DUYJ 3QFHA 1VQ6S 5DQGA 1DJ0A 4MYTA 2W2PP 1HNVA 3Q8QB 2X1GA 1HWIA 3TA2A 2VG7B 2KZMA 2M9KA 2Z2YB 1O8BA 2YNIB 3EUNA 4Y2AA 4UOGA 4DF4A 1S6PA 3PKMA 3MM9A 5D4OA 4UY8T 3VQTA 2OPSA 1R31A 4XTTA 4LR8A 4CLWA 4XIUA 2CQDA 5HJYA 2NSCA 3QMQA 3DGPB 3FFIA 1UWBB 2NXCA 2G4BA 5KG1A 1S9EA 4QW8A 1S1UB 1U02A 3R7BB 4JI3J 2B4UA 1HBNA 4HT5A 4DL2A 2BW7A 2NPIA 3CGIA 2XQCA 1TV6A 1O5JA 3ILOA 1X60A 2OPRA 3DRPA 2PMZD 3JSMA 4NYOA 3KG0A 4J9SA 1YJVA 1JLFA 3NS6A 1UP1A 1QJHA 2ZDPA 4LQ9A 4OX6A 3UDVA 3RG6A 4OZ2A 1SL1A 1S0MA 4KHPF 1RT3B 3F73A 5I42A 1WACA 3BO4A 4DR1J 1UWAA 4HVZA 1CJUA 4FYDA 1T03A 4UF4A 4B3OA 2BBEA 2GHWA 2JDJA 1U1NA 4F4KA 2Y1LB 3M8QA 3IRXB 2WAQD 5HL7Q 1C0TB 5FLXY 2YKNB 2HQCA 2CJKA 1REVB 2O66A 3N6LA 3SYZA 2ZM6J 5H9EJ 3IM8A 4IDKB 4HHJA 3S8SA 3KJFB 3NOGA 2HQDA 5ETMA 4LRDA 3W2VA 4DPYA 3AQOA 2D3ZA 2YKMA 5T7LA 3A8JA 3DFEA 2ZOFA 3HHKA 2DNHA 2ALZA 3MHYA 4CLSA 2VODA 1JNRB 5KFLA 4RW6A 2XMMA 4JI5J 5KFGA 3QAUA 1S4EA 3M1VB 3POTB 3CCWA 1ZAVA 4AXIA 4A8SA 2BZ2A 1VQ7S 1QVFR 2RJZA 3AB2B 2W2QP 3EM1A 4MMOA 2KT5A 4DR5F 1NJYA 1S1UA 3GB0A 3TOQA 2CPXA 3DU6A 1HBNB 4KGKA 3KHGA 5K20B 5DG9A 1KQSR 3DOLA 1JLCB 5HVFA 3HVTA 4L72B 5A6WA 4DWIA 1S9GB 3V2UC 1LFWA 1X8DA 2MGZA 1AW0A 1PAEX 3DRYA 4K2XA 1NKBA 4O3RA 3ZZOA 1Q8IA 2FVRA 1FJ7A 1KQGB 1LW2B 1UPPA 3IR6B 2OPQB 1WF2A 3CD6S 2CJYB 4Q43A 3MF5A 3UWTA 4F4YA 2VC0A 4ICLA 2WZ1A 4NLTA 4DBQA 1XEZA 3LA0A 4R5PA 4OYPA 4NX9A 4PAAA 1YJTA 3G96A 2XY6A 3P5BP 3DLBA 1CJKB 5GAHU 3PG9A 1I5OB 2IAJB 3CJ8A 5C5JA 1TK5A 4PG8A 2Y0SD 2CNLB 4AD6A 1QAYA 2VPXB 3DLKB 4KR0B 5BYSA 5KFPA 4ATNA 3HP6A 1YJNS 1H38A 2XY5A 3NOCA 3E2EA 3BSCA 1IKVB 2F8EX 3WX8A 2YNGB 4YR2A 4ECXA 1XNQJ 1K0VA 4P75A 4RW6B 2VJUA 4A8QA 3ZZRA 1L3UA 3MTKA 1EARA 4QW9A 4DN0A 4LFCJ 3UE2A 3NXZA 1NSAA 2GVZA 2KU7A 2RUSA 3VGSA 2GVDA 2E29A 1XWLA 1BXNA 3I4HX 4UOCA 3G8SA 2W2NP 4KGVB 4ED6A 5G0RB 2FVCA 4O4GB 3T5LA 1JLBA 2EC2A 1VQPS 2JSXA 3OPKA 4CLFA 1YTYA 1TKZA 2EBEA 1RJJA 2M70A 3LOUA 3U1MA 4DLEA 3HPOA 4QIWD 3CJTA 1IN0A 1CJVA 1OYDA 2NXUA 1FRJA 2KDOA 2V8DA 3DRRB 3B54A 3UDLA 2MKJA 2MQQA 2XLJA 2RKIA 2DEJA 3FQKA 2BJ7A 3VTIA 1Y10A 2ZBRA 5BYQA 1UKUA 2GQCA 3IRWP 1S97A 2DPJA 4Q8FA 2FHOB 4DV6F 2AT1B 2EBGA 2KG0A 4R5PB 4NLGA 2HZCA 2Y0BB 1IXKA 4DEZA 5JVGQ 2J6TA 4ZVTB 1RGVA 1ZZNA 2CZ4A 4F4AA 3VAMA 2RMLA 3B6BA 3MI7X 3S01A 1E6VB 1SPBP 5KFKA 3H5YA 2R7RA 2YNFB 5L38A 5B08A 3MMCA 3OXGA 3D6HB 1HQUB 4QIVA 2DGOA 3J80Y 4C3KA 3L9ZA 1UZDA 2FVPA 5ITHA 1S1XA 1RDRA 4OX9F 2M8DB 2AF6A 1RU1A 2A2DA 3D0GE 1L3KA 2R3VA 2DR5A 2IRXA 4KE5A 5ETKA 4FP9A 1ZYQA 3D4JA 3T5HA 2C3OA 2YH0A 1U7LA 2GV1A 4RNHA 4A8MP 1N6QA 1NO8A 2WONA 4XPCA 2HRUA 3JTPA 3UNYA 1KTQA 2FTRA 3PRVA 5HQMA 3MD3A 1ZETA 2IMWP 2HHHF 2A0FB 1NK0A 4C8KA 2FD2A 4JI8F 2V8HA 1FEHA 4P6QA 4U8YA 2HRYA 3FGVA 4ANEA 2OP5A 3OTOF 1NDLA 1LQ9A 2W4DA 1FWKA 4DV5F 2IFXA 3G82B 2BJDA 4M5DA 3RW6A 1VDHA 3GIMA 3MMAB 2MMYA 4K50A 1JWWA 3F44A 4ECYA 1QDUB 3SQGA 3T6BA 4CM0A 1JKHB 3GE9A 3N28A 2KM8B 2DRAA 3QT7A 4MIWA 4FNIA 1KS2A 4K7QA 4ZVUB 1HI1A 2B4VA 2L48A 1XBWA 4PQAA 4ECZA 4DUYF 1NK9A 4LRBA 3QRPA 4ERDA 3MPYA 5LSOA 4M5KA 2J6UA 4A8YA 5HBMA 2BR0A 2B0GA 4USTA 4XK8C 1S1WA 3A3PB 2APOA 1VC5A 2E1CA 1JIHA 2MLYA 2AJ4A 3BF4A 5I3UB 1RE1B 5K8MA 3QGIA 2MQOA 1L3VA 4OI2A 3HKZD 1OPZA 3IC1A 3VCDA 3K5MA 5C2GA 4JV2A 1QSYA 5KG2A 4X4OA 2QFIA 1K47A 1UEUA 2D7SA 4QPTA 2POKA 4DX5A 2RQ4A 1KLMA 2ASYA 4P72A 2J8SA 1U25A 1YBUA 4LF8F 2XMKA 3QT5A 4H54A 1KONA 1VBXA 3QQCD 1TV6B 3CCTA 3PYGA 3C6UA 1NM2A 3PRBA 4FDFA 2E1PA 3MEGB 1HNZF 2BKOA 2ZH8A 4ZITA 4USUA 2IJNA 4PXBA 5DO2A 1VI7A 1S0VA 2VOPA 1RTHA 3G82A 2IM2A 3PW7A 2ZBIA 1GT8A 1LW0B 2F65A 4KTQA 1JLGA 4F2RA 3T5JA 1B0VA 2V2VA 2YX1A 1R0AB 1U8SA 4NLSA 2BA9A 2DNGA 5D4LA 5CYMB 4OI1A 2Y8YA 4DHVA 4DFMA 3M8QB 4RPFA 5HMZA 1ULRA 4OJ1A 3FEZA 5B0GA 2UVRA 1XNQF 2MDAA 2RRBA 3KNAA 2MKSA 3I87A 1UEKA 3V6DA 3CD7A 3R7NB 2W2MP 2JLEA 3N6MA 3IBFB 1QSSA 2VDIA 4I6AA 4TY9A 5DDRC 3ZZYA 3IGVA 3O2IA 2AMCB 2Z0GA 5AXNA 1Q86T 1DHMA 4N7TA 3R6GB 1RHUB 2M52A 5A0YA 4CM2A 4JI4F 3POTA 1S9EB 2XMJA 4WTYA 1F0XA 3GIKA 2B7BB 2HFOA 1NLKL 2P2CB 2GIQA 3W63A 5HAOA 1BC6A 2QMXA 5SZTA 1G2EA 5B0BA 3KUGA 3PFEA 3F41A 2YQ1A 2R8IA 4LFAF 2DGQA 2J6SA 4PWDA 4X4UA 1DTTA 5CHCB 1TL1A 4KC5A 3DM2B 1U48A 1QY7A 1RHMB 4O44B 1CJUB 5A6PA 5GAGU 2XCPA 2BE9B 2ZD1B 2UV8A 2ZITA 3OTEA 1LW2A 4S0MA 1Q95G 2WCXA 3OLAA 2OMLA 2YBVA 3NEKA 2DJWA 3HZEA 1LK7A 4RZRA 2QLFB 3RBEA 1PBAA 1T94A 1N4LA 2D69A 1SUQA 4LMZA 2XYGB 1FDDA 2V4RA 4UUWA 4DV1F 3GFYA 3N9UC 3U1LA 2V2QA 5LT5A 2UP1A 1FK9B 4P2SA 2CVEA 3GJQB 2VPYB 2R8KA 4V19X 1MWQA 4ED5A 1JLQA 2DHSA 5F0WA 1K0TA 1IM4A 4OIXA 1HNWF 1R8CA 5E5NA 3US5A 5L9NA 3BGOP 5JMNA 3NY0A 5L39A 2MQPA 2C3MA 3PYFA 2XZWA 1TL4A 3Q23A 4PQUB 2OUGA 2XI2A 5IT0A 1RTDA 2MKHA 4J9LA 4F8RA 1SB6A 2K1RB 2QV6A 1R8HA 5T7LB 4PKDB 3TO8A 3PV8A 3WC2A 2VOOA 3BV8A 2FJWA 4DR4F 2CNKB 1NJXA 1HD0A 4L75A 2YH1A 5HQ8A 4WJBA 1N5YA 3MWBA 2IDEA 1EP4A 3M9MB 1RWKB 1HHTP 8AT1B 2L9NA 1KVKA 5ETVA 1VCTA 4QWEA 2VU5A 3FQLA 1FVSA 2EW9A 1UMJA 4Y6IA 4K4XA 5KFOA 5D3GA 4ANDA 2BEFA 1VBYA 1NXIA 1RWVB 4LBPA 4F36A 1MMDA 2KXNB 1H6KX 3TZWA 3UO0A 2XS5A 1X5PA 1YZ7A 2MLZA 1HNIA 1TL1B 2RB7A 3B4DA 4WFXA 2R7WA 3DM2A 4OZNA 2IJRA 1S9GA 3JTOA 3QJLA 1KQFB 1JK9B 2NLWA 2W24A 3J81j 2W4PA 1PBUA 2BJ1A 3QJPA 1S1VB 4N77A 2R7TA 1VQKS 3OT9A 4ZPVR 3BBFA 5HATA 3OW2R 3DRXA 3KLGA 3KMQA 5D77A 3T1YJ 1LKZA 1HARA 1AZSA 3GFXA 3GIJA 3MM8A 3OTDA 3MFIA 4DQRA 4KB7A 3FMWA 2BJ9A 4JYAJ 1A0OB 2NUUG 3A8EA 4U7UD 1AUSL 5D0HA 3GYXB 1L3SA 3AA9A 2XG8A 3IR5B 2XLIA 3CCES 1IKVA 3W9JA 4C8ZA 4HTIA 2YNGA 4OHYA 3SIPB 2MZRA 5KFCA 4C6AA 2K1RA 3V4IA 1S7HA 3FNNA 4IR9A 4K2JA 2GQ2A 2MEWA 3G6XA 2GIFA 2VB6A 2HRTA 3CJ2A 4NLDA 1TUWA 4NCBA 5IWAF 1QUPA 1UTAA 3BZQA 5HI7A 4OYOA 1SQGA 1HW8A 2VF3A 4UZCA 3RAMA 4AXJA 1TZ0A 3V6KA 2WTFA 1HYSB 1HHSA 2M3DA 3ILLA 2CVIA 1F5CA 1CC7A 2LMIA 4B9SA 4B3RF 3CSKA 2YKQA 4XDDA 4MFBA 3JAMY 4KHPJ 2HNZA 3PJXA 1JLBB 3MMAA 1U2FA 4M5HA 5LM7E 1XR5A 1WKLA 1H2UX 2AYGA 1GAOA 5ETRA 2AQ4A 2HFSA 3TX8A 5HP1A 2PN6A 3Q22A 5E3CA 2KTQA 1NPKA 1KC8T 1IWAA 4W98A 4CO3A 4CLTA 4DFJA 3FBEA 2V4JA 3C16B 3TANA 1RWMB 1WI8A 3A8IA 1S0NA 3IWNC 2DHAA 2YWGA 5DG8A 1S10A 3ZTSA 1GX6A 1N5QA 2R2UA 1YBTA 3W9IA 1TL7A 2QLWA 4NWBA 5GVQA 3H40A 4TNOA 3PO5A 4QBUA 2B56A 3CC7S 2IA0A 1N88A 4X65J 1HNXJ 4QR0A 2JC0A 2D1CA 4BS2A 4FBUA 4DPXA 1JXVA 3SFUA 5KFRA 3GIIA 4DV3F 2DH9A 5K9FA 3DMJB 3N5FA 4JI0J 4C11A 1J27A 4JI4J 2HQIA 2VD3A 3E01A 4ZLJA 1J5OB 4ED0A 3CE8A 2EEYA 3BSAA 3AFGA 3E8OA 4DQSA 2P8IA 4LFBJ 2RDJA 3TVZA 4JI2J 4UY85 3J7A1 1C4AA 2UU9J 1T9WA 1SKSA 3B78A 2K3KA 3W66A 4YY3F 1M5KC 1PKUA 3A13A 1KP6A 3W65A 5LMNJ 4URQU 4YHHF 3H7HB 2YX7A 4GKKF 4ECSA 1R0AA 4PZVA 5CYJA 3HHDA 2LA4A 1RXOB 1FKOB 3HJVA 2E9TA 5DLFA 4PXCA 4WE1A 3THPA 2HFNA 3W5ZA 3U02A 4B3TF 2DITA 5GAEU 2XULA 4CLPA 1JKHA 3ISNC 2V9KA 2M8HA 1T0TV 3DLEA 4U8VA 3H98A 1WKJA 4IRCA 2DR9A 2X1BA 4CH7A 3GR1A 2A10A 3HFZB 2CIMA 5HVGA 2C22A 2IMOA 2ZH1A 2ZH4A 2CQ4A 2OPPB 2VJVA 4PRFA 4CNZA 3KTQA 2BM0A 4NLOA 2NCKL 3DDKA 1ACMB 2AKWB 2NXNA 3OFHA 3EXCX 3MR5A 5B0EA 2XLKA 4PABA 4EU0A 4WFNQ 1D3WA 1H72C 4J9PA 1Z4UA 1JLEA 2J7KA 2OEMA 1NHKL 3KXDA 3SEOA 1WD6A 3ELHA 3PTWA 2B8QA 1HBUB 2IVMA 3MMJA 4M8LA 2QX0A 2ZOMA 4QIEA 4F25A 4ID5A 4NASA 3TZZA 2QLJB 3SCIE 2IJFA 1HR0F 4BDPA 3ISZA 3M30B 3CF5Q 3QT6A 2MZJA 4TQSA 3NNCA 2IRUA 2HHUA 2KJWA 1SC1B 2AX0A 3N5BA 1JLGB 3CMES 2ZDOA 1U2CA 3ICLA 4M5IA 3P49B 1HI8A 3M2UB 4B3TJ 2DT9A 2ACMA 2KFNA 1FTCA 1RA7A 1RTJA 2J0XA 4Y34A 3NAHA 1X4GA 3PACA 3PIPQ 3J81U 4WE1B 4N47A 2GW8A 4KAIA 4DL5A 3P3DA 2K2PA 3PX6A 1TAUA 4FYYB 4QU7A 1VQOS 4F50A 1HWJA 3FBCA 1FX4A 2J5AA 5HMYA 4YB5A 1XJWB 2G0CA 3W62A 4YB7A 1QSLA 4H4KA 3VGVA 4DR7J 5HSPA 2ZJPQ 1IR1A 3MAQA 2G9OA 2CA9A 3V6DB 2HHWA 3Q0AA 1H0HB 2FDNA 3K0JA 3KKFA 4LF2A 3BDPA 4TXSA 4KT0C 1WEXA 2RF2B 2VV5A 1PCAA 4X84A 2J0QD 3TI0A 5KFQA 1NJWA 2UVUA 4CYUA 1HIYA 1APSA 4ZPDA 2CADA 5CA5A 5KFHA 2PA8D 1URRA 2ASLA 2FJBB 2HGNA 2HS0A 1VQNS 1WEZA 5F8HA 4DV1J 3JB9k 1GEHA 1GTHA 2GMLA 1MU2A 4FN5A 4USWA 3DLJA 4BHQA 2MXYA 1OYEA 1UWBA 2H48B 2W8LA 2VQEJ 1C1CA 1UVLA 1RA6A 3H2VE 2F9JA 4NLWA 1IBKJ 4HTJA 4N41A 3FSYA 3N79A 2LU1A 3AA8A 4O44A 5E41A 1FDBA 3PW2A 1Q79A 1HNIB 1CJTA 4LBIA 1NHUA 4DFPA 4OV6A 1UVKA 4PUOA 2K8GA 2HYIB 1OS5A 3J7AN 1R89A 3KNGA 3QIPB 4OYAA 2UXDJ 3HD2A 2D3OR 1RCOB 1KNZA 3QIDA 1RT2B 3F56A 2JEIA 2IYGA 4YY3J 4F4WA 2GNKA 1SC4B 2V63A 5IQQA 4QIGA 4CLYA 3R5DA 1SUQB 2M2BA 2XBPA 5DDPC 1P8GA 4EFAC 1NH8A 1MN9A 1DY3A 2OMOA 1WHYA 2RDIA 3AD8C 3IA0A 3Q8YA 4Y2KA 4AL5A 5IM0B 1B4SA 2UZAA 2YKNA 2J0SD 4JI3F 3HO1A 2XEXA 1DTQA 1BQXA 4GVLA 3AD9C 4GRSA 1EAYC 3UR3C 2XO6A 3OQ2A 2OFGX 2V2ZA 4GVBA 4OYIA 3OL7A 4C48A 1JX4A 1KDNA 3VHQA 3BSNA 1ZA1B 2D9OA 1HWUA 2F40A 2ATLA 3UD4P 3PX0A 2QEXS 1B99A 2NS1B 3QPIA 4WXOA 4XO0A 3EPGA 2VL1A 4DR6F 3P8BB 4I1TA 5FD1A 1U49A 4P2XA 3GSIA 2J9DA 1NZ8A 3TVYA 4A4JA 3LWMA 3FEYB 1SL0A 2XHCA 4LVOP 5CZVA 2KHDA 3GCWP 1VK3A 4NMXA 1HHQA 1TELA 1NSPA 3A3OB 1M5VC 4JV1A 4WZQA 3QT8A 3PZPA 1YQHA 3T1YF 2IVYA 2QN6B 2XMUA 2ZFHA 2AGOA 1VQ8S 1S99A 2P9CA 3NKYA 3VV2B 1NHVA 5CZXA 1CC8A 2E1AA 3TWZA 2HIYA 4PUOB 3CCSS 4YEAA 1YRXA 2NYHA 2WRMA 1R8PA 3MECB 4IYQA 4ECVA 2R42A 1U1PA 2RE1A 3J7Z5 2KG1A 2MTLA 1RP5A 3UFCX 3Q2TC 2AX1A 1G7CB 2PGCA 2Q6CA 2W1BA 3LAMA 1GTEA 5GMKa 3T1HF 3UPFA 1QVGR 1XNRF 4NPOA 3CMQA 4V19J 3OL6A 1AZSB 2FVQA 4M95A 3MM8B 2IAJA 4HR2A 2H4WB 1VHFA 3S7RA 4P71A 2W2OP 2BQ3A 4O3SA 3TEGA 1Q8LA 2HBQB 4WIIA 1N56A 2OIHA 3GCXP 2N82B 3TZXA 1V3RA 2DNPA 3CUNA 5EN1A 5DETA 4ZVEA 3AY0A 2DR6A 4DX7A 5KFBA 5E33A 3QO9A 3OSNA 1IKXB 1V9OA 3BKFA 4NEZA 1TKXA 4K5SA 4LF7J 4DR6J 3LP0A 4X4SA 4I67A 1L5UA 1N32J 2JWNA 4JI5F 1IVZA 1PJ6A 1REGX 3PYEA 1U4BA 1CQMA 2FB0A 4I2QB 4Y2MA 2ZWPA 2QL7B 2IA6A 1B0PA 1T7PA 1ZH5A 2E9RX 1KVJA 3TUIC 1QLNA 3RBDA 2XSJA 5FDLA 1NZAA 5IT4A 3NNHA 1U2RA 4K4WA 1GMVA 1WSVA 4QWCA 2HHHJ 2H1YA 4QIFA 1RSCA 1U0HA 3R7SB 1VISA 1HQ2A 2Z2MA 1HW9A 1M90T 1GH8A 1D9AA 2GS8A 2Q3PA 2UV8G 3O6QA 4ZJLA 1WG5A 5L1KA 1DZ5A 4TU7A 1TMMA 2W7PA 3PW4A 3NS7B 2GMJA 1MWYA 5C42B 3TUJC 1WG1A 2DXEA 4QYZK 1SXLA 2W7AA 1XR7A 2JFDA 3M32B 2OD4A 5GMEA 1XIQA 6FD1A 4YHHJ 4GKKJ 3KK1A 1FDNA 2W9AA 2Z2ZA 2AEJA 2WBRA 4EGLA 5AE1A 2H4YB 4GMKA 3ZTPA 3IWLA 3T6JA 3K17A 5GADI 4X4PA 1LFPA 2XHWA 2YWHA 1SQFA 1VQ4S 2BRLA 3VAJA 4DPTA 2HMIA 5E3QA 2IC3A 4WFYA 4RUHA 3IG1B 2E7VA 3L09A 4DV7F 3ZNJ1 2I0XA 2CQCA 4ZVSB 3CDWA 5ETLA 1D9FA 3HD1A 4C11B 2HPUA 2F1FA 4ZIWA 1U6ZA 1ZPVA 3HF5A 3LALA 3CO9A 3ENVA 3LP0B 3W2WA 4EI2A 2DNYA 2C3PA 5IC4B 4YB1P 4BCAA 1AA1B 1NJZA 1DQ8A 2RH3A 2MKKA 1QAJA 1M1HA 1KKHA 2IYIA 1W2IA 4ES1A 4J9RA 3LW5C 3SFGA 2CJXB 3TJ9A 5AT1B 4F3OA 2JL9A 3JQJA 3BDEA 3DRRA 5KFMA 1B7FA 2M7SA 3M2RB 3IBWA 2BE7D 2B6AA 3R3TA 1CEZA 1FFSB 2NSBA 4I7FA 3KFWX 4NLVA 4Q2LA 5DLGA 2Y1JA 1PC4A 2AGPA 2KFZA 4X4TA 3B4MA 5D0EA 2J76E 4ZPBA 3QAEA 2DHXA 4FVCA 4OMFG 5KG0A 2EI5A 4LF6F 4AQYF 4CT8A 3OR2B 1TP7A 5AE3A 5KTQA 2DNMA 4YMEA 1HNZJ 1HNVB 3ETMA 2VBXA 2YPZA 2DCUB 1P27B 3BPDA 2HFUA 3DI6B 4ZJQA 2YNFA 3BREA 5J1EB 3PKYA 1S6PB 1RAEB 2V8PA 2F9DA 1EQ0A 1LWEA 3N01A 3SV3A 4C9DA 2YWEA 5GADU 2O5DA 2V2KA 1W7WA 3AOAA 1Q16B 1WDTA 5IWAJ 2W9CA 1BE4A 5F3TA 1FRLA 1H73A 1TUVA 2ZHOA 1R43A 3KJQB 2NZCA 4O3PA 4YP3A 2V68A 1S0OA 4K59A 3RGIA 1NKCA 1UFKA 4GC6A 1JLEB 1VHIA 1VIOA 2KVIA 2OTJS 1FJEB 3MM7B 2LQ8A 1Q5YA 4P52A 3M6XA 3VGTA 3UCUP 3C6UB 5D15A 2BM1A 3M2UA 3CEDA 1SJ4P 1VLOA 3JSRA 1RWOB 1RACB 3N6NA 4IG0A 3DU5A 5AJ3F 1MSWD 4F2SA 4JYAF 2J9DE 4M5DB 4ZVFA 3GJTB 3EDRB 3HHEA 3UI3A 1EZZB 4RBTA 3W1YC 1IQZA 3TJAA 3H4DA 2DISA 2KZZA 4HDHA 3K5PA 4HH1A 2VQFF 4QOTA 2CDRB 4RX6A 2IBOA 4DDFA 2AGQA 1UW9A 1ZM4A 2WB4A 3R27A 4WP8A 2U2FA 1A6LA 3M6UA 1YVFA
chains in the Genus database with same CATH topology
2CQGA 1NNDA 1X9WA 2PD1A 1JXEA 3NBPB 1Z2LA 2VA3A 2MY8A 5HBMB 1VC6A 4IFVA 2BE2A 2F8MA 3K5NA 1NJIT 4OI6A 3CD0A 5I3UA 3IS9B 1DBDA 3OBIA 1IUJA 3CCZA 5G4DA 1JMTA 1ZTTA 7FDRA 3AQPA 2MPUA 1FNMA 1N5VA 4ID8A 1K8AT 1UVMA 1FJCA 5CD4H 2JEGA 3MOJB 1F5BA 1OSDA 1FHTA 1VRUB 5A8WB 4RKUC 3RTVA 2AWZA 3GV8B 3C66A 3M9NB 2CQPA 3CIZA 4LVNP 4FF4A 3D0IE 4OI3A 2FY1A 5KFAA 1PGZA 3WC0A 5I3PA 4USJC 1X4EA 4G1QA 2VH7A 2HHXA 4C0OC 2M4MA 4ZHRB 3I9V9 1CG2A 4AL7A 1RT4B 4TN2A 3MEDB 4HEA9 3QIPA 3GFHA 3JSYA 3MFHA 1SI9A 3GILA 5DDOC 3TARA 1DLOB 1FEEA 4HL9A 1RT6B 1SC6A 3DNCA 2CYYA 2CPHA 1RTIA 2P6TA 3U1NA 4K4SA 5FJ4A 2FLLA 1FD8A 2RT3A 1HBOA 2L9WA 3BSOA 2BE2B 4KPYA 3B8HA 4OZLA 3KLFA 5KFSA 3IS9A 5KFTA 1BLUA 2GQQA 3D1HA 2DO4A 3J7YI 1FRXA 4NZ6A 5J1PA 2CJBA 3QO9B 3GV5B 4OI4A 4ZKAA 1IKXA 3CCMS 1FRIA 1FRMA 5HLFA 3KK3A 4PPDA 1P9QC 1VK8A 1SH2A 1HQEA 1S48A 4B08A 5G0RA 3SI8A 4WFZA 2ILYA 2IBKA 3X1LB 4ZP8A 1WELA 1P1TA 4B02A 4FBTA 2GMHA 5KFXA 2DO0A 3OTCA 5LSLA 2AJQA 2YWKA 3VAGA 4MK9A 4ED7A 2OSRA 3WBZA 1L3TA 4Q2MA 4CTAB 2GFFA 1N32F 2C2DA 4A8XA 3K58A 4F3QA 1BY9A 1YHQS 3T9NA 4OZ5A 4OJHA 3DXSX 3AJ2A 4MK7A 4MKBA 1R7IA 2MSSA 5L8RC 1S6UA 4PG7A 3KJVA 2FGCA 2DIUA 4U9RA 1HMVB 4ZPAA 2BV3A 2J9EA 2ZNZA 1WHVA 3I96A 2WOMB 3IR7B 4QR1A 1A9NB 2FC8A 3HVRA 2QA4G 2XS2A 2DCLA 3Q24A 1G6BA 2EFPA 2F3JA 2YX4A 3EPIA 4MTPA 4FS1A 2LEPA 2ZH7A 1QTMA 4RWWA 2RRNA 3OUYA 3IXQA 3R5AA 4OHVA 4QCLA 4PWUA 3D5MA 1OPIA 2XSJB 4LSNA 5D4PA 3TAMB 1IJFB 4ETZA 1D1UA 4OX8A 3OLBA 2YWFA 5KFVA 1FNOA 2HFZA 1RQ0A 3MZIA 1MNEA 4I2QA 4RW8A 3PR4A 4NA2A 4FPRA 2BDPA 2L08A 2FJXA 2LDYA 5KAKA 3M2RA 1M1KT 3OV7A 2UXDF 4ITSA 2FHJD 3SCKE 2EC0A 4LF5F 4R0EA 2QA4S 2BJEA 4IOAQ 2XSFA 3RB0A 3G86A 5BR8F 1R3NA 1C2PA 4P7VA 5L9XA 2YVSA 3KLGB 4OFZA 1SL2A 1G3OA 4AYBD 1H2VZ 2VBZA 3N4WA 4ZCLA 3KOAA 1UEVA 1TFWA 4F4XA 2Y1IA 4OJ3A 4AUKA 4RW9B 4ED1A 1R6YA 4G3IA 3M32A 4RNFA 2WOMA 2R8GA 3H59A 2ZC4A 4PPZA 4QWBA 3NGDA 2IC3B 2KB2A 1UW4A 5A2QY 1QAIA 4OL8A 1YWXA 3GV7B 4GO5X 2VFUA 5JJBA 3PNIA 2EFOA 5K14A 2ZVSA 1S77D 2E7WA 3HMJG 1Y3KA 2FLOA 3QGPA 3Q8PB 4WCEQ 2SXLA 1KD1T 2LU2A 3LF0A 2DGWA 1WG4A 5DS7A 4B9MA 2H9ZA 2DVIA 4ZCIA 4J9QA 3PM9A 3D0HE 4X2BA 3MUTP 2I1RA 2HHSA 1X4AA 3IGNA 4DS5A 2Z2LA 2L41A 1LOUA 3CT9A 2A1BA 2LXIA 2J7WA 4DR1F 3DN9A 4HI1A 4TLRA 4C97A 3NNAA 1PC5A 2FHMA 1JJ2R 3CULA 3SSQA 2AD9A 3DOKA 3L7OA 3MM5A 1X0PA 2W7OA 3MUVP 1QUVA 4MKYA 2B6AB 2RVJA 3NP5A 5T14A 1FT8A 2HVHA 3EZ5A 3NBPA 1P6TA 2AYEA 1W25A 1VC0A 1UVJA 4YOEA 3I32A 5D6GA 1U6BA 2VASA 4B9VA 1U26A 1LWCB 2Z8QA 3VR1A 5A8RA 1I94F 2LXFA 2ZKTA 2CRLA 3IAS9 2UXCF 2VFTA 1DQAA 1X4FA 4N56A 1HI0P 3HJFA 4BWMA 3WDOA 2GGPA 7FD1A 5A0YB 5J1EA 2UUAF 3TAQA 3RRKA 4IQXA 1LWEB 2MZTA 1K9MT 4NRUA 5B0FA 4PG4A 4JI6F 1X4BA 4ZPCA 1HFEL 2W9BB 3E01B 3SSSA 4X4QA 3OHAA 2RQKA 3UD3P 1IKWB 2WSEC 2JEJA 3I4PA 2YTCA 2VG5B 3H4BA 1IQTA 3MPWA 1S79A 1JLAB 3BQ0A 4ZPWR 2LVWA 2JVRA 3T1AA 3KWMA 2PIIA 2BRKA 4PR6A 3MM7A 2CFXA 2JC1A 2Z4PA 1SJ1A 1UFLA 3M2VB 4IG0B 2OH2A 4QPXA 3KHRA 2ZZMA 3BQ2A 3CJ0A 5EDWA 3NG8A 2X1AA 1KFSA 1HL6A 1C1BA 3HI9A 2K3IA 5U47A 2O1PA 5B7WA 4LF7F 3C2PA 1NB7A 3FSIA 2ZH3A 2NYIA 4F3MA 1VOMA 3VZHA 1TR0A 1Z2ZA 4IFVB 4CO2A 3HT3A 4NYPA 4JI0F 4MK8A 3AAWB 1N5YB 2MQNA 3H2UB 4ELVA 5HLFB 1DQ9A 3KLEA 4JI1F 3DGPA 3CDUA 4ZMMA 1N5TA 3OXLA 2FJVA 2BXJA 5K5MA 1FXRA 5CCLA 3SDEB 1WTBA 2MQLA 1NK8A 2HMIB 2MB0B 2AV5A 1BQNB 3M30A 3PXGa 3V6HA 4ECTA 2N4CA 2LEBA 5KFEA 1VQMS 2CQHA 2LDIA 5KG5A 1S1VA 3VF0B 2XI3A 3CCRS 3L95X 1N0VC 1TKDA 2QYCA 2PE8A 3E3XA 3GSDA 1DLOA 5JUMA 2HYIB 4DLGA 1ZM9A 1TVRB 1REVA 3PJWA 3HX9A 5KG7A 4B9UA 2GHVC 4OZ1A 1VJWA 2DIVA 2OLWA 3HVWA 3ZZZA 4EZ9A 3HXMA 3ZZ0A 1Q78A 3JSBA 4JV0A 5DQIA 1NU4A 4IH5A 3AB4B 1ZM2A 3MR2A 1I6JA 2E1CA 1WWHA 1Y3JA 2A3JA 3FSXA 3RZAA 4F4KA 4R0JA 2LKZA 1RYSA 5KFJA 1IBKF 3CVKA 3RR8A 4IFYB 1VQSA 5EX3A 4G1IA 4K5RA 4J5OA 2V8GA 1IJEB 2X3GA 3KK2B 4N8OA 3NCPA 4GKJF 4JBCA 3TP2A 4NLQA 3P6YC 4JV5F 5CCMA 2ZNYA 4NLRA 4QWDA 4NA3A 2B9WA 1C1CB 4KRWA 1OSCA 3K5OA 1EETA 1GXUA 1Y4ZB 2VPWB 5J2NA 4RWXA 3ETOA 2X51A 5DGBA 5E3PA 1JJHA 2PFFB 4DQPA 1FXDA 4I2PA 1X5OA 4CT9A 4Q45A 2Q66A 2O01C 2GJ2A 3G71S 4U67Q 5IFMA 1WEYA 3I5CA 2XCAA 2I2YA 2HG4A 2UVWA 2KO1A 2EPIA 3SMZA 4ZP6A 4ECWA 4ICLB 3HM9A 3U7JA 2NR0A 1SH3A 2B3TB 2OFHX 4KV8A 4PG5A 2R2RA 1ZTWA 5AXMA 2N3OA 3KJVB 5MLCV 3D54A 4NZ0A 1AXQA 2QFJA 4DR3F 1ZZFA 1SIZA 2GC8A 3V5RA 3G8QA 2V94A 1FCAA 4IRDA 3C8YA 4MH8A 4XAKA 4ECUA 5F8NA 2HNDA 3R1HA 4CO4A 1IBLF 4H4KC 4Q44A 1SV5A 3DMJA 2JHEA 3ZC4A 3UNGC 4OX7A 2JFKA 1TK8A 4EEYA 5CH7B 3TW0A 5F8IA 3OVAA 1YJRA 4O4GA 5KT2A 2IM0A 5F3ZA 2B5JA 1TKXB 2RNEA 3BGRB 3DHWC 4RW8B 1CLFA 2KHCA 1FA0A 3BM7A 4RLEA 3NCRA 2ZHAA 4OZ0A 3DLGA 3CDBA 4ED8A 2VC1A 4ZPTR 4J37A 2CQBA 2FJEB 1D8YA 3BS9A 2JLFA 4YR0A 4XPEA 3MECA 4DL3A 2JH3A 3MM5B 2F4VF 3PO4A 1RK8A 2ROGA 5BYRA 1KHVA 2MJNA 2AJFE 3BGUA 1SQEA 4ES3A 1KQKA 3GMGA 4EO6A 5ADZA 1KOOA 3CCUS 3V6JA 1N5SA 3RRGA 5C42A 3LP2B 4K4ZA 1LXJA 1Q4RA 1S1XB 3RW7A 4IRKA 4HDGA 5GAGI 1HWLA 2KT3A 2IHR1 1HQUA 2QE5A 1GXTA 4L6V3 4OHXA 5DM7Q 2ZH9A 4CO5A 1YI2S 1UFWA 2WSCC 4NZ7A 4AE5A 5KFUA 3LO3A 3K59A 4O3QA 3I56S 3GYNA 3CDAA 3IN5A 3BJYA 2N7YA 4LF9F 1K73T 1QAXA 2ZBCA 5SUHA 3TUZC 3LP1B 3OVBA 1RYRA 2XY7A 2A18A 3SQGB 4QYRA 2HHQA 1T3OA 4ZVHA 6FDRA 3DLGB 3Q8SB 2W4CA 3T3FA 2DNRA 4X4VA 1O51A 1S49A 4UUXA 4KFBA 4J9NA 1UVIA 3HZGA 1YITS 2D41A 5D78A 1RI7A 1YRTA 2OSQA 2D3UA 4ZP7A 2H5EA 2I38A 4B9TA 4G1PA 1A7GE 4HH0A 1U1RA 1LWCA 2JEFA 5A8RB 2V8VA 4O3NA 1Q81T 2ZKUA 2I5JB 2FHKA 3MURP 2E5JA 3OR2A 2ZH6A 3KK1B 2UUBF 3MEEA 4I4BA 2IM3A 3AH6A 1Q7YT 2HWHA 2P9GA 2RF2A 5J2QA 4LF4F 4BBYA 3BQ1A 2JLGA 1KLMB 5F9LA 3DI6A 1DFDA 3G4SS 4LJMA 4I68A 4QR2A 3UW1A 2FIUA 2BVZA 1IKWA 1X9SA 1Q82T 3DYAB 2VG5A 4RW7A 4DSFA 3I0SB 5F8MA 4TU8A 1RT5B 4YR3A 2BACA 4FXVA 2ZUGA 1RKIA 4ED2A 5CXTA 2HS3A 4Y65A 4HYKA 2L9DA 1LV5A 2OKQA 4CO0A 3UR0A 2HVZA 4ILMA 1T05B 2R4FA 2VG6B 3M9OB 5F41A 4NMLA 4OHWA 4ZDNA 2I9SA 3DLHA 1GNKA 1Y00A 1X5TA 1LW0A 4JOUA 2DNNA 4N76A 1FVQA 2CPEA 4FF2A 3O8WA 4UQGA 2VFVA 1RT7B 5J2MA 3PW0A 1CSJA 1OQ6A 3KYLA 2PMHA 4A8OA 3UCGA 5EHHA 3TR5A 5IQ6A 1PO6A 5HMWA 5IM0A 1C1BB 3GFZA 3FMBA 2B9XA 4H4OB 3CCVS 5HMXA 5LXYA 4ILRA 1DTQB 2E1MC 4WFBQ 3BR8A 1O0PA 1T02A 2EG1A 1R8AA 2EFNA 2CJQA 3EZUA 5F8JA 4DQQA 3B82A 3MGJA 3KLHA 3O5TB 1HD1A 3H20A 2OJ3A 2XNRA 2XWYA 1WI6A 1MMNA 1J2VA 1U1OA 2HGMA 4WFAQ 5EWEA 2DNLA 3SDEA 3NRBA 4TY8A 1ZOTA 1FE4A 4DSEA 3M6WA 5C25A 5LSRA 3KLEB 2RS2A 1U1KA 4LIRA 4ALZA 4KBIA 4KKOB 2ZD1A 2VZ9A 1FRKA 5KOXA 2XO7A 4LQ3A 1DTTB 2VA2A 5LJ5Y 5GAEI 2WW8A 2CPIA 4WXWA 1FJGF 3H2LA 2D9PA 2DK2A 2BOPA 2E66A 3THTA 1FKAF 3MEKA 3IFEA 2HHPA 4URGA 4A8KA 4PXDA 5KFYA 5E0OA 5I3QA 3I31A 1C0UB 2HNYB 1VMBA 3T19A 1TVRA 3BN7A 4C98A 2EFGA 1R27B 4DV2F 5CYQA 4EBDA 2Q1LA 3UCZP 4Y2IA 3Q8RB 1Y9OA 1RTDB 4WYLA 5L1LA 4H4OA 1H7WA 4DOZA 1CQNA 3I5BA 2ZZNA 2KRBA 4DMZA 3KK2A 2KT2A 1IBMF 2EFVA 2GCFA 2C28A 3KLHB 3BEGB 5GAHI 1AFJA 2XGQA 1VRUA 1QE1A 2PA3A 3DRSA 4QWAA 3T5KA 2E7XA 4CH1A 2E5GA 2ASDA 4OI0A 3DC2A 5L1IA 2B5JB 2NZ4A 4DSIA 4M94A 2LEAA 3W7BA 4DUZF 1BD6A 4DL4A 1X0FA 2AW0A 5DQHA 3HK2A 2XMVA 3OJUA 2E5HA 3HHLA 3KLIA 4I2PB 3CD5A 4F26A 4EYIB 5HROA 1UA0A 3ULHA 2RU3A 1VS3A 3H8YA 2YKOA 4RUCA 3HHNB 1T3NA 2KYXA 3NLCA 1T8EA 5I42B 4XDCA 4C8NA 2ZH2A 2RSQA 2C42A 4CTAA 3SZ2A 2XGPA 4EBCA 2RUGA 3VALA 2AU0A 3V81B 4LT6A 1SKRA 3I6PA 2DGUA 1TKTB 2N3LA 4OZJA 4PG6A 4KGMA 4Y3CA 2FLPA 3LANA 1RT6A 1U47A 1RTIB 1TL3B 3MDFA 1NH7A 5CQGA 4A48A 4A8FA 1N36F 2YKMB 1SV5B 2QSFA 5AXLA 4CZCA 2EFQA 1VQ5S 3SCJE 2B4OA 3OFGA 2X1FA 3NCQA 5EGYA 5KT3A 1NKEA 2VPZB 4X4RA 2HNDB 1S6QB 2ILZA 3FRZA 3M1VA 4G6VB 4JUZA 2KH9A 2O3DA 1HYSA 4X64F 1C4CA 2XS7A 2NUHA 4HI2A 4LIWA 4U6PA 3I55S 1XMQF 4A8WA 3CC4S 2WK4A 4IH7A 4MFBB 1UVNA 3G6VA 1XERA 1KSPA 1H3DA 1F60B 3X3UA 3BR9A 3ISND 3O1LA 4Q7AA 1YRUA 3EX7B 1E6YB 5IXUA 1Q1KA 3LQVA 3M8PA 4PXEA 1CPZA 2HNZB 1KFDA 4R8UB 1WNEA 4KFBB 2DNKA 2AJ1A 2D74B 2HS4A 4CO1A 2VQEF 4J9OA 1LXNA 1JXLA 5K8OA 1UA1A 5C24B 3C6TB 1VLYA 1UL3A 4QJVA 5DGAA 1I1GA 2MHEA 5DM6Q 4IQMA 4EWTA 4YUDA 3OFEA 3NMAA 4MIBA 2R7XA 2DR7A 3R5BA 4WU2A 1D9DA 3LP2A 2ZE2A 3ZZUA 4WF9Q 4IO1A 1T95A 4RNMA 3KMSA 2MKCA 4RW7B 4ES2A 3Q2SC 2OAUA 3HLUA 3TA0A 1FDAA 2HGLA 1U45A 1V6HA 2DNQA 4ZCMA 1YIJS 1X5SA 2NREA 1HBMA 2AJ0A 1PSDA 3GWCA 3VAHA 5HN0A 3QZ7A 1S6OA 2DBBA 2DH7A 1N34F 1RWUA 2Q79A 4ECQA 1WHXA 3FJ2A 3OTBA 4Z2XA 4NL5A 4IR1A 2E1RA 4DF8A 2V4QA 1FERA 2JRSA 1VFJA 2V5HG 2NPFA 2RKIB 3HFKA 2J0WA 5DJBA 1S4FA 3RB4A 3VWSA 3VAFA 1W2BR 1TK0A 3DLEB 3D1OA 5C24A 1FF2A 3R1LA 3W3SA 2CQ3A 5J1NA 2ZHBA 5DDQC 2XMWA 5J2QB 1KN6A 3K7RA 2KRRA 3RYLA 4Y00A 4DL0C 3MMCB 2A2CA 1AROP 2LQ5A 5KT7A 2OPPA 4NCGB 2ZE2B 3I5AA 3K8WA 3QLHA 2CQ2A 2CPDA 3THVA 4UQTA 1IR0A 1LK5A 3L7PA 1F2GA 2GGPB 3FFIB 2O67A 4IG3A