3A1YG

The structure of archaeal ribosomal stalk p1/p0 complex
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
284
structure length
211
Chain Sequence
b'MAHVAEWKKKEVEELAKLIKSYPVIALVDVSSMPAYPLSQMRRLIRENGGLLRVSRNTLIELAIKKAAKELGKPELEKLVEYIDRGAGILVTNMNPFKLYKFLQQNRQPQPLEVGLDVLAVYEDGIVYTPDVLAIDEQEYIDMLQKAYMHAFNLAVNIAYPTPETIEAIIQKAFLNAKTVAIEAGYITKETIQDIIGRAFRAMLLLAQQLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein P1 (L12P)
publication title Structural basis for translation factor recruitment to the eukaryotic/archaeal ribosomes
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Ribosomal protein
total genus 56
structure length 211
sequence length 284
ec nomenclature
pdb deposition date 2009-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00466 Ribosomal_L10 Ribosomal protein L10
G PF17777 RL10P_insert Insertion domain in 60S ribosomal protein L10P
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1730 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3a1yG01
5GADI 5D8HB 5GAEI 5D6GA 4UY85 4V19J 3J7YI 3J7Z5 1ZAVA 3JSYA 2QA4G 1ZAWA 5GAHI 5GAGI 3A1YG 4NWBA 1ZAXA
chains in the Genus database with same CATH superfamily
1XMQJ 4RWWA 4ID5A 4YR3A 2BRKA 4UTGA 2HAFA 2HMIB 3CGIA 4EO6A 3J7ZT 4QYZK 2VPYB 3DU5A 1VJQA 4OIXA 3ZNJ1 1FWPA 4DR6J 4UUWA 3WX8A 3M6WA 2WBRA 1XR7A 3HKZD 3ET6A 5L46A 2OJ3A 1H0HB 2GIRA 1TVRB 4FPRA 3M4XA 3I5AA 1S76D 2XBPA 4JI5F 2W8LA 5HQ8A 5J1NA 4L73A 4CLLA 2MZTA 1JLEB 2R8IA 2QV6A 3RB0A 1FESA 1FNXH 2WW8A 1WHWA 2XMKA 3I4PA 3F41A 3IR5B 1D9FA 3U27A 4BCAA 3A12A 3ZXWA 1VISA 5HLFB 3C16B 5I3UA 3PX6A 2ZH3A 3NWGA 1NHKL 4KGZB 3BEGB 1UWAA 1XMBA 3L4BC 4J9SA 4OZLA 1YBAA 1BXNA 3IR6B 2NUHA 1FEHA 4CCHA 4I4BA 3UCZP 5GAHU 2UUAF 1RT7A 3M2RA 4X62F 1GXUA 3KK3A 5B0DA 4C2MA 2NCKL 1UFKA 3NP5A 4AQYF 2W8KA 3GJRB 3T41A 3W5ZA 5KT3A 1LWEA 2N4DA 2E9TA 2E5IA 3QZ8A 3ET6B 2ATLA 4CLYA 4C0HA 2IA0A 2HGMA 2IRUA 2A10A 4K5SA 1TQLA 2D9PA 5DDPC 4P10A 2UUTA 2RT3A 4HEA9 4EBDA 2VICA 3MZIA 4KR0B 4X62J 3SI8A 1NDCA 3NLCA 5B09A 1F9HA 4ZVPB 1WUUA 4K2JA 1B64A 5IT0A 2OELA 3BPDA 2L9DA 2HHVA 1S9FA 1TFYA 4IYQA 3BH7B 2BR0A 2FC9A 2ZH7A 4KH0B 1S1WA 1Z2LA 2E1MC 2WONA 1FJGF 2BE2A 5IWAF 3CDUA 2YKAA 3PY8A 1RT7B 3M2RB 4N7TA 2ZZNA 1OQ3A 4IFYB 4U8YA 4JV0A 2B51A 4URQU 2IRYA 1VQ8S 2DHXA 1HI1A 4KH1B 3LP0A 2QZ8A 4TVAB 2CVEA 1FRJA 3AD9C 1RT3A 2KVQE 2KM8B 4ZVQB 2DNLA 4CLWA 2VH7A 3TW0A 2AV5A 2HHTA 2OTJS 3EICA 4WF9Q 2ZBIA 1NSQA 2D3UA 2JDJA 3TANA 5GAEI 2MSSA 4UOGA 1K8AT 2YNHA 2JEJA 1YVFA 1FJGJ 4WFXA 4CO0A 4PQUA 4C97A 3RGIA 2FVQA 2XMTA 1FD2A 2QYCA 4IRDA 4N41A 2FZGB 3H7HB 1KNZA 2GW8A 1VGYA 2HAIA 5J2MA 4CM2A 2XNQA 2VASA 2RS2A 3T6BA 2HVDA 2WRMA 2DNOA 4F2RA 3HHLC 5A8WB 4UY85 1B7YB 1FKOA 2J5AA 2JFDA 2RS8A 4ZDNA 2WVEA 3MR3A 2IHR1 4MFBA 3ITHA 4ZPAA 4H4MA 2GIFA 1HIYA 3LP0B 3MR2A 2ZZTA 1VQNS 1RT3B 1WC3A 4DV6F 1G3OA 4DQSA 1TL4A 4A8QA 3H59A 4CO2A 4Y6IA 2QA2A 3K7RA 3VALA 3RUBL 5GMKa 2XZWA 2GVZB 3CW2C 4OI4A 1SQGA 3PRDA 3C2PA 2B8QA 2RHQB 4UF4A 4PZVA 4PQUB 3TA2A 2JRSA 5K8MA 4RBUA 3D1OA 2HHHF 2CQPA 2FQQB 2KXFA 2KJWA 4A8OA 1URRA 2BUNA 1OYDA 1LNQA 2EEYA 2JC1A 3BR8A 4DV6J 4WK1A 2ADCA 4A46A 2CPYA 2CG8A 4CTAA 4ZITA 5KG5A 1W7WA 2AIRB 3AD7C 2V67A 2GFFA 1KVKA 4ZLLA 4LUBA 4I2QA 1EETA 4R8UA 3MMJA 2KFNA 4CLSA 4FPIA 1S99A 4ED5A 4KTQA 2W4PA 2HHHJ 4MJKA 4CYUA 2C2KB 4KGMA 1KOOA 2HSEB 1U47A 1FVQA 4CH0S 3BGFA 4V19J 2BKNA 4MKVA 3UE2A 5AJ3F 4C3KA 3HFKA 4Z37A 1RLCL 1UFLA 1RBAA 1HR0F 1T03A 3WC0A 4P7TA 3GFYA 3M8YA 3RB4A 2W2OP 2X1AA 2HQDA 2G4BA 1CJVB 4TQSA 4XO0A 2YNFA 4DCPB 2WBMA 1JNZB 1R8HA 3T1YJ 3M9MB 4E8UA 3IN5A 3DRXA 3QFWA 1YLXA 4ETXA 4CTAB 3TJ9A 2VPXB 4YOEA 2ALZA 2FTRA 5AJ3J 1EETB 2PN6A 1HNWJ 1FE0A 2EC0A 4OYOA 2H5JB 4OI6A 5IQQA 1R0AA 5EN1A 1HR0J 3P5BP 2O3DA 2LA4A 2XLIA 7AT1B 3HULA 2QFIA 4LVNP 5ETMA 3D0HE 3IXQA 5BXIA 1FNOA 1ZYQA 3DRSA 2KJVA 3PNIA 2R2TA 1P1TA 4RO0A 3TQEA 2VBWA 4ZLNA 2D74B 3OV7A 2AYBA 3R8YA 1S6OA 3CMQA 3H0PA 4ZVGA 1QAIA 3SV4A 4JOUA 1HI0P 1VIOA 3UR3C 1YDLA 4DMZA 3OQ2A 1T03B 4ALZA 2ZOMA 2BX6A 2X1GA 4X4VA 4PWWA 2G1DA 4J9UE 1RWMB 1PG5B 4P74A 4L75A 2BJ8A 2IM3A 3MTKA 2KZMA 1VQ4S 2BKOA 1NK6A 1S97A 3G87A 3FFIA 4NLRA 4FKXA 4Y3CA 3KLEA 4M5IA 3CCUS 1RACB 5B0EA 3MGJA 2ZVIA 1PSDA 2P6SA 3DHXA 4Y2IA 3J80Y 3UWTA 2MKIA 2J8AA 2FDNA 1WC0A 2Y3YA 4NEYA 4UQTA 4YUDA 3KDOA 3ICLA 1Y3KA 5KFVA 4DN0A 3R97A 1U1NA 4NCGB 4X4RA 3IAS9 2OHDA 4KSEB 4PWUA 3N6LA 4B3TF 2DIUA 2UXBF 4EEYA 2WCXA 5JXSA 4BS2A 3QT8A 2ZNZA 3PYEA 2WSFC 4ANEA 5HMXA 4DR7J 3CMES 3A8IA 3VAFA 4UZBA 3NNHA 2N7YA 2W24A 3EGWB 1NK7A 3OR1A 1NSAA 2QT7A 3KKFA 4CRJA 3KJNB 3CUNA 2C2EA 2J9DA 3GCWP 1KSPA 2P2CB 2YQ1A 1VQYA 3KLEB 1RTZA 4LREA 3CJRA 1VC0A 4NRUA 2N7CA 4WE1A 3EXCX 4X4PA 1KTVA 1TL3A 1HARA 1RAHB 4QYZJ 1TU0B 1UFWA 3TWZA 4DPWA 2J7UA 4LSNA 5I3PA 3LGNA 3MFIA 3I0RB 4K0KJ 4OL8A 2E9ZA 2WB1D 1SKWA 4HL9A 2AD9A 1U25A 3N01A 1JLQA 3UPFA 3W5YA 3D2WA 3PW0A 4DSLA 1IM4A 1JLAA 1LQ9A 4JP8A 4OZ5A 2MZRA 5D78A 2J6UA 2RB7A 4C8YA 3LP2B 3EGVA 3W9JA 1S1TA 2A2DA 3OR1B 4DR2F 4X64J 4CWBA 4ILRA 2UUCF 1ZPWX 2R3VA 3ENAA 3OR2A 2NQPA 3VQSA 5KFKA 1B0TA 5EHHA 2NZCA 1T9YA 1VJWA 2XGQA 2XC9A 1ELOA 2LU1A 1WEZA 2ZC3A 3HHLA 5IZHA 3SZ2A 4NXMF 2OEKA 4O3SA 3SEOA 3R7BB 3TRGA 4RW8A 3FNNA 2J9CA 5GAEU 4ICLA 4BBYA 2XO6A 2ZKUA 4LSNB 1OY6A 4PG7A 3OUYB 2HHUA 4A8MP 3KXDA 4F26A 4UQGA 5AE2A 2QLFB 5LSLA 2YVSA 3DCAA 1WSVA 4DV0J 1EP4B 2DGTA 2IM1A 2UUCJ 2OPRB 3LA0A 3OTEA 2B9XA 2FLPA 3M8ZA 4FYYB 4OJHA 1NHUA 4IH5A 1HBMA 2YWHA 5SZTA 4QIGA 1YJ7A 3IC1A 2R7XA 2M2BA 2FHMA 5K8PA 1KQGB 1S7IA 3ZZRA 2E1PA 5HAOA 2L08A 5JJBA 2XS7A 1MMLA 4F3QA 3OR2B 3J80U 1PBUA 4BWMA 1IBKJ 3DLHA 4OX8A 5D4PA 3PDNA 4DI6A 4FP9A 4C48A 4RW8B 3PJXA 1RHQB 2DY1A 2YKMA 3NNCA 3GFHA 2HK2A 3UD5A 2J8SA 4HTJA 2MZSA 1K9MT 2B9EA 1L3KA 4X84A 1WACA 1W25A 1NPPA 1REGX 1U24A 3B8HA 3A3PB 3G8TA 3BF4A 1OIAA 1IR2A 4X65F 2GV1A 2NPFA 3BBCA 4NXNJ 1N48A 1S5ZA 3UN3A 4DV5F 3CPWR 4N47A 1EARA 4K4VA 1HBMB 4J91A 2J9EA 3GV5B 4C8MA 1WTFA 2C1EB 2HYIB 3KUEA 1LW2A 1X5TA 1QDUB 1FTRA 3TEGA 3TP2A 3FSYA 4DU8A 1HI8A 4LBIA 2P9CA 2Z0GA 3BO4A 1U4BA 4X65J 4LMZA 2R8HA 3ADAC 4EK2A 3EZ5A 4Q2LA 1EAYC 3MMBB 3VAMA 1HQEA 1NZ8A 2Q1LA 4TU8A 1N33J 2E5JA 5LMUJ 2AJ2A 2YKMB 2LVWA 3NEKA 1SPBP 2V8GA 4MAKA 4RW9B 1DTTB 3S01A 3WIVA 2CJXB 3TO8A 4DF4A 5KG1A 4MTPA 4KE5A 3CC2S 3T5HA 3GMGA 2NPIA 1PCAA 2QEXS 1HKAA 4ECSA 2DHSA 2GO8A 1KTQA 1F9EB 4PUOA 2VG7A 1F60B 2GJIA 3MPUB 4JI2F 5JVGQ 1FA0A 2EBEA 4G65A 1S49A 2DCLA 3KDNA 3RRKA 4FVCA 3DDNA 3MCOA 2R42A 2CADA 3V2UC 1EZZB 3LP1A 1KHWA 4BDPA 1LW2B 2C2ZB 4ZN3A 1RB0A 3OXLA 3KG0A 3MF5A 3PYDA 1AXQA 1H7WA 2ZH1A 4ETZA 2UVUA 3UN5A 2WVFA 4CZCA 2ILZA 4RWXA 1FEEA 1NDPA 1P6TA 2R8GA 3IRXA 5GADI 4ZLJA 1NEEA 1VBYA 4M95A 1HQEB 1X9SA 2ZD1A 1Q95G 2H51B 4A8WA 3IS9A 4RX6A 3ZO7A 1SJ1A 2X1FA 4PG5A 1D9DA 1NKEA 1X8DA 3IWNC 2HNDA 4FXWA 2HLUA 3CWJA 1RP5A 1G2EA 5F8LA 4KHRA 3I32A 5K20B 3Q86A 4P72A 3KLFB 1Q53A 1KONA 2DNYA 5AXLA 2ADBA 2VG7B 4UZCA 5AE3A 4ILLA 5I4MA 1UPMB 1ZS6A 1LK5A 4JYAF 1CQNA 5ETQA 4DR4F 4A8XA 1NLKL 5HP1A 3T5JA 3PM9A 3LP1B 3MURP 2MKHA 1QSYA 2XEXA 3HX9A 4W92B 1K73T 1AW0A 1AFJA 1RAEB 3W5XA 1UA1A 2V2VA 1N6QA 1B7FA 4URSA 1HD1A 3IWLA 1KVJA 2ZD1B 4QYRA 2J76E 1TL7A 3LO3A 3UNGC 1QTMA 2VODA 1N8RT 3M05A 3MPYA 2M52A 1Q81T 2Z2LA 4JYAJ 2GHPA 1F9FA 1RT4A 3C8YA 2HNDB 4YHHF 3CDAA 4LBHA 3OFGA 2QLBB 2DR9A 1M1KT 1RAFB 4F36A 7FDRA 3Q8QB 4HTIA 2DTJA 3UNYA 1F0XA 3P96A 1BUXA 3CD0A 3FVYA 2ASDA 3CJKA 4DOZA 3ZZPA 3OLAA 5HVHA 4USVA 5HP1B 1CC7A 4Q43A 1NDLA 4DS4A 2GX8A 1LW0A 4DSKA 3SCJE 4P6QA 4PG8A 1T95A 3NS7B 4ELTA 2BQRA 1FKPB 2DYAA 1JIHA 3GFXA 2EKNA 2FGOA 2QG9B 4O23A 4YHHJ 2OEMA 1YBUA 1N6QB 2DKOB 3QGPA 2BZ2A 1P1LA 2IYGA 3JTNA 5KFRA 3J81Y 3TA1A 1TL7B 4CLFA 2ILYA 2VC0A 1NH8A 3TQ1A 3PJWA 2YQ3A 5GMDA 3D7SB 4PG4A 2U1AA 5LM7E 3CCWA 3WHIA 4ZVHA 4FF4A 2FZKB 2FY1A 1SJ3P 2MDAA 4P9SA 1LXNA 4OHZA 5BYRA 1Q79A 2MTLA 5EUHA 4DV4F 3C6UA 2CQIA 4QIWD 3GIMA 4Z7CA 4F04B 1U1QA 2H5IB 4M63A 4RR5A 3MMAA 3SFGA 2DIVA 4MIBA 1FDDA 1NJIT 1PAEX 1AB8A 3R3TA 4DUYF 1MU2B 2V2ZA 2VQEF 2HQ3A 2XZTB 5A8KA 3K5MA 4DQQA 1U7LA 1JJHA 5FLXY 3QBCA 3R5BA 2CYYA 1LW0B 2VG6A 3VAHA 5AE1A 2AU0A 2CPZA 1X0FA 3DKDA 1C1BA 1M5SA 4B3RF 1Q8LA 2CUYA 1KD1T 1TMMA 5D8HB 3TUIC 1XQIA 4DV1J 4DQIA 2YKNA 2H4WB 3DLLQ 4L3KA 2H9ZA 4KGKA 2C3OA 2FLOA 1V5IB 2LA6A 1X31C 3FBCA 5JUMA 1RAOA 4O3OA 2ZE2A 1M0SA 5L39A 5L9NA 4TU7A 4ELUA 5ETLA 4EZ6A 4DUYJ 1HNXJ 1FX4A 2BOPA 2IYIA 3OJSA 5AT1B 2VQEJ 1SIWB 3GJTB 4ZIWA 2KRRA 3MEKA 1K1SA 2WOMA 1UW9A 3T19A 1LWCA 4IG3A 2CRLA 2BANB 1GQEA 4J9KA 4DV3F 1R6YA 4A8SA 4KO0A 4I6AA 4F4KA 1FRLA 3FBEA 4WU2A 3H5SA 4B3RJ 4OI0A 4LF7F 3EGZA 2I0XA 1HNZF 3MAHA 2E66A 3RBXA 2GAHC 5D4NA 2IJRA 1OSDA 3MM6A 1T8EA 1H6KX 4D3HA 2OGUA 2VG6B 3Q0AA 4LRCA 1VQSA 4NLVA 4CI0B 4DZDA 2YY3A 2VOPA 4F3OA 3JSMB 2QGFB 4ZCKA 5BR8J 3V4MA 2FZCB 1UVJA 6AT1B 3DOKA 1GXLA 5K5MA 1FRIA 4ZVOB 2VUGA 5KT6A 2BVZA 2MHNA 1FRXA 2WVBA 2CJ9A 2ZE2B 5F8JA 1G1XA 3DFEA 3CC4S 2W9AA 3UDCA 1N0VC 1PJ5A 4ECTA 1RTJA 1F5AA 4ECZA 3PIPQ 2MHEA 2CQ4A 4XDCA 2OP5A 2WOMB 2VPWB 1N36J 2XYHB 2QLWA 1LWCB 2A2CA 3AODA 2E7WA 4IG3B 2EFVA 2DCUB 1KBRA 2FGCA 1EKSA 5D0HA 2I2YA 1FDNA 4W90B 2UV8G 2K06A 1V3SA 2BE9B 4RW7A 4KPYA 3OTBA 1HFEL 3H2LA 3RR8A 2HQFA 1UVLA 3PEHA 2DHHA 2GCFA 4C3LA 3I87A 3AT1B 1AZSA 1PYTA 2FYXA 3M9OB 3BN4A 2I8EA 2XZDB 3MM6B 4ED8A 5KFUA 4TU9A 3SQGB 2FUG9 5B0BA 3RB3A 4OZ3A 1L3TA 4I6WA 4JI0F 3SXLA 1JKHA 4LFBF 3OTDA 1N4LA 3FEYB 1E6VA 3PFOA 1BLUA 2F40A 2MQ8A 1WOOA 2JZ5A 3EXYA 2OPSA 2NR0A 3U1LA 3K0JA 2FJDB 2IJNA 3W8PA 3RW7A 5HI7A 2GQQA 1DY3A 1ZA2B 3P8BB 1E6YA 1WG4A 3DRPA 2KU7A 1IKYA 2FJWA 5KFTA 4YMEA 1NJZA 3JAMY 1RTJB 2DEJA 3CDBA 4CM0A 1S77D 2QC3A 2VOOA 1WF2A 4G6VB 4JI0J 2L3MA 2UUWA 3NGUA 1FWLA 4LFBJ 3MUVP 3Q8RB 1NK9A 1WDTA 1ACMB 4X2BA 4I1TA 2CPFA 5FLXU 1V9OA 1VQ7S 1TKZB 3DI6B 5LOQA 1CJTA 1QUVA 2MQLA 1EB0A 4ED6A 1I1GA 2P8IA 8AT1B 2KG1A 2PD1A 1BWVA 5IT9Y 3M32A 4ANDA 4WFZA 4ECRA 3IR7B 2BJEA 5GADU 2FVPA 1JKHB 1BQNA 4KT0C 2HLTA 5L1LA 1E6VB 4BHQA 1RT6A 4O0NA 2R7QA 2V69A 1NSPA 3H5UA 3UR0A 2DGWA 3O3LA 3PW2A 2PMHA 5B0CA 2OPSB 1Z4UA 1R7IA 1XR5A 5FDLA 1IBMF 4YDDB 2V63A 4TYAA 2RU9A 1ZM4A 1YJVA 3GB0A 1WKKA 4WWSA 2V34A 5KOWA 1X4HA 1E6YB 3B4DA 2DNGA 1IKYB 1V3RA 1RT2A 5HN0A 2C2MB 1HHTP 1RWPB 2Y0BB 1B99A 2YPYA 4C7QA 3N28A 3H42A 1C4CA 1NDKA 2V8HA 2CJKA 1RAGB 1IR0A 4ED1A 2OIHA 4PQAA 3FSIA 4YP3A 2GNKA 4K4WA 2HIYA 4BC7A 1Y3JA 1S1XB 4QCLA 4ZVEA 3F44A 1CJTB 4OFZA 2DGXA 1DJ0A 4WP9A 3AOCA 2CDRB 1SC1B 2VA3A 1IBMJ 1MWQA 3M32B 1APSA 1YI2S 2POKA 2NREA 4E0DA 2BE7D 1NM2A 1BQNB 4HH0A 1RT1A 2O67A 1RT6B 5KFQA 1FWKA 2E9RX 3QZ7A 2HS0A 4LF2A 5K14B 1ZPVA 2BV3A 3HHDA 4MK8A 4AT1B 3N5FA 5KAKA 5IM0A 5C2CA 4DJBA 1IVZA 1LKZA 2OSQA 4KV8B 1ZA1B 2JJ4D 1QVGR 4HYKA 3LW5C 2PI5A 1MWZA 1WTBA 2F4VF 1RT2B 3AFGA 3ZTQA 1WDDA 3RB6A 2MXYA 2C28A 1I5OB 2IC3A 2K1RB 5DS7A 4RPFA 1FRKA 3L7PA 1MG7A 3QRRA 4U67Q 3FZBA 1FRHA 1X5SA 2XS5A 3M2UA 4NCBA 1O8BA 2HFVA 1RKIA 1BGXT 2YPZA 3TZXA 2I5JB 2HNZB 4YY3J 4RUHA 1TK8A 4NE9C 2C2DA 4LFAF 2LQ9A 4I68A 1JJCB 2HQIA 2OPQA 1DURA 2CPJA 3PO4A 2F4VJ 4LF4F 4CDIA 2B4OA 5I3QA 2O01C 3NBPA 5E33A 5D77A 4B3MF 2MQPA 2EWHA 1K0TA 5KFDA 2ROEA 3JAMU 2HHQA 2CQ3A 2Y1JA 2DHAA 5EDWA 4OJ3A 1TK0A 3ISNC 1NU4A 4B9MA 2CXEA 2ZH4A 4FXVA 1XNQF 2H1YA 2BM0A 1TKXB 3HFZB 2J0QD 3MR5A 1FK9A 2E44A 4J7CA 2J0WA 4P71A 2ZNYA 5JMNA 2W4DA 1HWLA 3HP6A 4C11A 5ITHA 5IT9U 4AL5A 5HMWA 1WOPA 3CO9A 4TN2A 7FD1A 2RILA 4FN5A 2RF2B 2OO4A 1SQFA 2LQ8A 4HHUA 3MOJB 1HMVA 2AX0A 3NCRA 4QJVA 2OAUA 4B9NA 3ILOA 3I82A 4NLPA 3THPA 2NLWA 4I6YA 3QGGA 3OVBA 1BQXA 1M5OC 1RTDA 2OPQB 1TAUA 4A4JA 3GSDA 1DARA 2UUBJ 2AMCB 3BPSP 4ENOA 3NBPB 4RNHA 1YJWS 2QIFA 4JI7J 5CYQA 5KG7A 4B3SJ 1X7VA 4OX9F 3UN2A 3W2VA 1H2TZ 4UUXA 3PACA 1TL1B 1GT8A 5MAOA 1N32J 4CNZA 5C24A 3ZTSA 2ROGA 2QA4S 2QFJA 3M30A 2VJUA 4GO5X 1UJ5A 5IQ6A 3D28A 2DJWA 1RWWB 1I94F 3RR7A 2R7WA 2MGZB 2XNRA 2VFTA 5LXYA 1BC6A 4QPTA 4ZPBA 2RU3A 1S12A 5DZ7A 5E3RA 3KUHA 3DOLA 1FHTA 2IBOA 1VRUA 2M8DB 4DLEA 4N8OA 1FD8A 4NA2A 4JUZA 1GK8A 2BACA 3KUGA 3RBEA 3JQJA 5FJ4A 1ZAVA 4DPXA 2LEPA 4OYWA 3MOZA 2DGOA 2CJBA 4KJIA 2OSRA 3NGTA 2HZAA 1WHYA 4V1Ak 4OLPA 3KJVB 2J6TA 2F9DA 3QRPA 4K4XA 1RTDB 4NLGA 3GLJA 3DLKA 3N79A 1Y7PA 3D0GE 4DDFA 1U1RA 1RK8A 4RKUC 3OD2A 3TA0A 3CCJS 4FS2A 1PYSB 3HPOA 2HBQB 4F4ZA 3FMWA 3FK4A 2QMXA 3QT7A 4ZIVA 3CCZA 4DG1B 1YGYA 4O44B 4ECUA 3D6FB 4I67A 1H74A 3DDIA 1QUPA 2HFSA 3V5RA 1MMNA 4BC9A 5SUHA 2XWXA 3DMJA 3UCGA 2V4JB 3DYAA 1SH3A 1FNMA 2DXFA 5C24B 2ABYA 1HQUA 2R4FA 4LRAA 3KK2A 1TR0A 1S9GB 4LFCF 2BEFA 3ENVA 2MY7A 5M2RA 4RW4A 4Y2AA 2UV8A 1U8SA 1TKTA 4MIAA 1W26A 1QM9A 2ZVSA 4WIIA 5HQLA 5A6PA 3CXCR 5HQMA 5F8MA 1VI7A 1YK9A 3I9ZA 2YWEA 5L1JA 1PO6A 3R5AA 1GMUA 5I42A 3I31A 1RZMA 2Z30B 3POTA 5D6GA 3IM9A 2A18A 2IBKA 3HD2A 2FVCA 4JI3F 3NGKA 3ZZUA 1CS4A 1NH7A 4ED3A 2HVHA 5BJRA 2RHSB 2ZH9A 2KT3A 2ZFHA 1KDNA 1SJRA 4OJGA 1HWIA 5B0FA 2V94A 5DJBA 1RAIB 2DITA 3VF0B 1KKHA 4IFVA 4CLKA 5CQGA 5CZVA 3DLGA 3BREA 4ZP9A 2OPPA 2HQCA 2ZBRA 3ILJA 5DM6Q 3DYAB 1LXJA 3UQSA 1HQUB 3HKWA 1JXEA 1LV5A 3CD7A 4DU7A 1N5VA 4X4QA 4USTA 1IKXB 1R31A 3H2VE 4RW4B 2Z4PA 1TKTB 4M5KA 2AGQA 1NJXA 4GC7A 3C6TB 2JSXA 4L72B 2M9KA 1NPKA 4F50A 5A2QY 1KEKA 4DCOB 5HVFA 1D8YA 1JNRB 1KLMB 2V4RA 4NYOA 5L9XA 2V0NA 4RL1A 1IQZA 1AFIA 1CVJA 1FXLA 3L09A 3CC7S 2D69A 4CP5A 5DZ6A 4QIFA 5LT5A 1YRTA 1G4CA 1V5VA 3BGOP 1WNEA 5KT5A 2D3ZA 2LQBA 1X5OA 1IUJA 3I96A 5HSPA 4IFVB 4JI8J 2LECA 3BGLA 1CJUA 3LWLA 1XR6A 1EKRA 4KHPJ 4DR5F 2ZUGA 3R2DJ 4ZPDA 4GKKF 3ZFVA 2MZ1A 4DSEA 3RU0A 4BLGA 2MJUA 3TZZA 3JTPA 3KHHA 5G4DA 2IJFA 1UETA 3HI9A 4I2PA 3K5OA 1MW7A 4I7FA 3A3NB 1UEVA 1R89A 3EPIA 2ZDOA 4J9QA 1O6XA 1VHFA 1J27A 1FJ7A 2W9BA 1HBNA 2VF3A 3UFCX 1VBKA 2RVJA 3GP9A 4ZMMA 3KOAA 1ZBTA 4YN3B 5HK4A 2MQNA 3CCVS 1OSCA 3VV2B 2B7BB 3TVYA 1NZAA 4PR6A 2XG8A 5A76A 1UA0A 3RRGA 2B4VA 3NXZA 4LSLA 2HRTA 3D5MA 3MPWA 2MKYA 4FBUA 3DNCA 2MKSA 1NHVA 4ED4A 1PGZA 1CJUB 5DG8A 4LF8F 2UU9J 1FI4A 2DGQA 2W1BA 1DAXA 3R6LB 4PWDB 3PYGA 4S0MA 2Y1RI 3JS9A 4YFUA 4TY8A 1N34J 1IKVA 2N82B 2P6TA 2DGSA 4F02A 3LH2S 2DNRA 3MEEA 3SCIE 4JI4J 4WBFA 1CULB 1REVB 4I7FB 1F3FA 1TUGB 4AFFA 4FZVA 2I1RA 5J2PA 4E98A 2HVZA 1ITPA 1HWJA 1JLCB 4DUZF 5KTQA 3F0NA 1HBNB 4U6PA 4LF8J 1HBUA 3JQMA 3B78A 3D6HB 1I6JA 3PFEA 3JSYA 3BYRA 3V6DA 4H4OB 2R2SA 3IG1A 3NS6A 1D0EA 2YQ0A 1BY9A 1U1KA 4LRBA 4CO4A 1CPZA 2HK3A 2YWKA 1SB6A 1QJHA 4A8FA 3FCHA 2EW9A 2CPXA 4GMKA 3CCSS 3NNAA 3PIOQ 1SC3B 4IOCQ 3PW7A 1SQEA 3S7RA 4TLQA 2PFFB 1S79A 2E1RA 5CYMA 2VZ9A 2CJQA 2BJDA 4G1IA 2V8VA 3EM1A 4RNMA 4M5JA 1GX6A 2HHPA 4DUZJ 5HROB 1RYSA 1MROA 2CJYB 1NKCA 1IKVB 5CD4A 1XMOF 4X4UA 2V5HG 5HBMA 2DH8A 4X4NA 4CLPA 5KFBA 3T5KA 1KQSR 4K7QA 1TUWA 3NOGA 5A2QU 3NY0A 4ITSA 3TUJC 5J2PB 3MUTP 3C15A 2KT5A 3QYYA 2VDIA 5E7OB 2NSCA 3FKBA 3EWGA 3L95X 1SV5A 5EX3A 4J9VA 1UVIA 2FJEB 1OYEA 1HNVB 1WD6A 1Q5VA 1HBUB 5LMNF 3W61A 2XMAA 3TZYA 2HFZA 4U7UD 4DL2A 1IKWA 3H40A 4Q5VA 3V6DB 2UXDJ 3IG1B 2DPJA 2VPZB 3OW2R 3TVZA 3FUYA 3HDSA 4CO3A 2V9WA 1Y10A 1FXRA 3HSZA 3HHNB 1IBLF 2CPEA 3EYZA 4Z2XA 4OHYA 2K3IA 2KB2A 2ASLA 5CYMB 4MT1A 1WI8A 2AJ1A 3EPGA 1SUQA 4C98A 2BMBA 1XTZA 1FXDA 5CAAA 4ECXA 1Z1ZA 3QO9A 2M8HA 1QAYA 1YKWA 4K50A 2F4FA 5RUBA 1HWUA 1JXVA 2VC1A 1SXLA 1KHVA 2MY8A 2BW7A 3C15B 2J7KA 4NYPA 2MKJA 2XMWA 4P2XA 4ID5B 4JI5J 2D1CA 2LCWA 1IBLJ 2HFUA 3VAJA 3V4IA 3ZNUA 2RKIA 2NXUA 2FJBB 5IV4A 2GMHA 4ZCIA 3QJPA 2CJAA 1NBEB 1P27B 4IDKA 2CQGA 3G96A 5KG4A 1HYSA 1RTIA 1RTHA 3QJJA 1UEKA 3KLGA 2YNIA 1U0HA 2UUAJ 2VJVA 2EKYA 2R9LA 2EG2A 4IG0A 1PYOB 1YX2A 2BXJA 3QATA 5ETTA 5I3UB 4AQYJ 2FY8A 1EHWA 4J37A 1TELA 5EWGA 1R0BG 5E3AA 2MZQA 1WELA 2JVOA 1IQTA 2AF6A 4B02A 4KPCA 1NMEB 2YWFA 3Q8YA 2AEMA 3KK3B 3KWMA 5KFSA 4F4YA 3CIZA 1XBWA 3V4IB 3Q89A 3DM2A 1QY7A 4DHVA 2DNQA 3K5PA 4R25A 1LWEB 1Y00A 3DLBA 1NKBA 4BWJA 3J81j 3H8YA 4CT8A 5E5NA 1S1VA 5E2QA 2ZEJA 3NKYA 3AA9A 1VQ9S 1RCOB 1RTHB 3TNVA 2E1AA 3MEGA 4ZJOA 3X1LB 5IWAJ 3O8WA 2E5LF 2UVVA 2YNIB 1RAJA 4LF5F 3VZIA 5E41A 3FQLA 2K7KA 3GG1A 4TLRA 4M5MA 3CULA 2SXLA 2APOA 2DBBA 4HH1A 4K4TA 1URNA 4XPCA 2WZ1A 9RUBA 5J2NA 3P4UB 1FJEB 2B6AA 3HLUA 4KYZA 2MJNA 5M2PA 1S1WB 4PPZA 2WONB 1WJ9A 3NGSA 5E3CA 2BE2B 5F8GA 4XTTA 2C3YA 2VBYA 4N8NA 3Q8PB 1GX5A 2ZH8A 2W7OA 1JB0C 4B17A 4KFBA 4DL4A 5L8RC 2E5LJ 1TV6A 2I9SA 4LF5J 2HBRB 3HT0A 2IDLA 2N3LA 4R5PA 3JSRA 2ZZMA 2R8KA 3U7JA 3C14A 3ZZOA 1N56A 2HFNA 3DOMA 1DTQA 1NUEA 2YNHB 5HATA 3OLBA 4OI2A 3E2EA 4KKOA 3KLVA 4JI6F 3MEGB 4X66F 1LOUA 3TAQA 4OI3A 3N5BA 1YIJS 3O1LA 1H3DA 5KG2A 2HHSA 1Q7YT 2DNPA 4IR9A 5J2MB 3DGVA 4Y00A 2Y8WA 4GKJF 2NXCA 1RUSA 2HEKA 4DV2F 2V9KA 2XYPB 2R7RA 5J2NB 1JJ2R 3U1NA 2PT0A 4QZVB 1SC6A 3RBZA 4OYZA 1FKOB 4M5GA 3J7Z5 3QWPA 3CDWA 2G0CA 3DLJA 4MFBB 1S57A 3ITHB 4PCQA 3QIPA 2NYHA 1ZTTA 4H4MB 4KFBB 4JI6J 1F3VA 3W62A 3PYFA 1TV6B 2LP4A 4TYBA 2Z8QA 3S6EA 2BABA 3MAAA 4R5PB 4FYWB 1SKUB 4PABA 1PILA 3Q24A 2CQCA 3QMQA 3WX4A 2JLEA 3VGTA 4EO8A 1H2VZ 4ZS6A 1AT1B 3C14B 3I56S 2EFQA 1UZHA 1Q7LB 1LWFA 3N0VA 4C8NA 1VQ5S 2D9OA 3KNGA 3D1QA 3KHGA 3DXBA 4YDXA 2KG0A 3BSAA 3TJ8A 1UCNA 1NAQA 3T5LA 3HHLD 1P8GA 2NSBA 5J1PA 1BQMA 4FYDA 4TKTA 4QWAA 4A8YA 1NK0A 2JEIA 2RUSA 2G2ZA 3BGUA 4ZP7A 3NS5A 4M5LA 3IWXA 2H54B 1P9QC 4AL7A 4N76A 1UAWA 3SIPB 2B7CB 1Q82T 4ECWA 3TAMA 2BDPA 4DX7A 4QR2A 2M3DA 4O3PA 1FX2A 4FF3A 4F0HA 4PYAA 2AEJA 2RRNA 2HRYA 3Q22A 4I2QB 4R8UB 1HLWA 4TXSA 2JLFA 4DL0C 2RQCA 2W9CA 4Y65A 2DHGA 3MD1A 2W01A 1WOSA 2DB1A 2KL8A 4C6AA 4NASA 1N5SA 4CYUB 2LQ5A 3HVTA 4DL3A 2PGCA 2KKHA 5FIIA 4F2SA 4PEOA 2GHWA 3OVSA 3AJ2A 2AP6A 3FEXB 1X4AA 1RHUB 4M5DA 2YNFB 1WWHA 4U8VA 3D3CJ 2DRBA 3O6QA 1PJ7A 5DDRC 4JB8B 3AQOA 5T14A 2CNOB 3SSRA 2XQCA 5CYJA 5B7WA 1U2FA 2VG5A 2Y1LB 2G2OA 3VWSA 1WF0A 2B3TB 4KQZA 2JL9A 1DHMA 3TAMB 1LFPA 2XSJA 2RSQA 2KM8C 4F25A 2DR6A 4WTYA 2MQQA 3CCLS 1S0NA 1CJKA 1H98A 1R0AB 2WSEC 2NZ4A 1DRZA 1QAXA 1J5OA 4PXDA 1U45A 1GH8A 4HR2A 1S9EA 2R2UA 1UL3A 1T11A 3HVTB 4IOBA 2MQMA 5C25A 3KLIA 1Q8IA 3IGVA 2KFZA 2G13A 5C42A 3DRSB 3CDEA 4HT7A 3DXSX 5F9LA 1TAQA 3EVOA 2QL5B 4FF2A 1IM6A 4HHHA 4NCAA 3TEHB 2CNLB 5K9FA 4ELVA 3BYPA 1KC8T 2WW4A 4NLWA 4L3NA 2CZVC 3NGDA 1YHQS 2DISA 3GFZA 3K5NA 1JLGA 2GS8A 4K5RA 1Y5LB 3M8QA 1JX4A 1M1GA 3FFIB 2EFPA 1OMSA 1U49A 3T9ZA 3W60A 2K8GA 3HCXA 2VG5B 5L38A 3EJMA 1X5PA 3C66A 1QVFR 2KFYA 4Y34A 5D3GA 3IRWP 4B3TJ 3Q8UA 2UXBJ 4J90A 5B08A 3HT3A 3GIJA 4IH7A 1CJKB 2EI5A 5CCLA 1C1CA 5DM7Q 4QWCA 2AZ1A 2YNGA 4NLSA 3BQ2A 1U48A 4DPYA 2AGPA 5HANA 3VQTA 5C25B 3QSYB 3W8GA 2HZCA 5C42B 8ATCB 1IXKA 3ZZYA 3VVUA 4B9UA 3LGHA 1S1UA 5KFEA 1AUDA 2AJ0A 3UW1A 2VA2A 3TARA 3ULHA 1G6BA 1FKAF 2A6MA 4LF1A 3GZ7A 3OTOF 5MLCV 3K58A 5F3ZA 1FFSB 2J0XA 2Z56B 3T1HF 4O3QA 3A3OB 2B9YA 1TKDA 4DSFA 4AXJA 1SJFA 3M8PA 4MKAA 1RWUA 2DPIA 1XNRF 2DO0A 3UI3A 2VD3A 1VQMS 2ZKTA 5KFLA 2PE8A 3BGRA 4OV1A 1UWBA 2FHJA 1N0UA 3LAMA 3LTOA 1LK7A 4GVLA 3SCLE 1QSSA 5KT7A 4WE1B 4ZJLA 1FVSA 3VZHA 2CZ4A 2CFXA 4J9OA 5F8HA 3NOCA 5D3GB 3CB4A 5KFXA 1TL3B 2RNEA 5H9FK 3BBFA 2YKQA 3T1HJ 5KFNA 3TUPA 5JVHQ 2HVEA 1T9WA 3MEDA 1C1CB 1RHKB 1V6HA 2A0FB 4OZ1A 4KGXB 2YNGB 2BRLA 4EI2A 4DV7F 4DR2J 1SC4B 4AUKA 1NXIA 1YQHA 2FC8A 1SH2A 1JLQB 1NJYA 3CD6S 4MK7A 1T05A 4XAKA 4DXLA 4X4TA 4CNYA 1JLAB 5DG7A 1P9YA 1VMBA 4NXMJ 2YXLA 3C19A 4DEZA 1ZZFA 3D54A 4DFPA 1S1TB 5ETSA 3ILIA 2DY9A 3BGRB 1UVKA 2Q6BA 2IIHA 3MPDA 2B8PA 4FYXB 3D3BJ 2M88A 4UY8T 1FT8A 4O0IA 3HHLB 3QT5A 2HMIA 1WC5A 2VFUA 1IBCB 4ICLB 3CIMA 4NEZA 3MEDB 4ZP6A 2KXNB 3EDQB 4DL6A 1TVRA 1Q4RA 2VL1A 1NSKL 4OYAA 1WEXA 1XMQF 2XCAA 1R43A 2LEAA 4E2FB 1YZ6A 4C8OA 1Q5YA 2GQCA 1JLEA 4U95A 1T05B 2CQ2A 1AA1B 4NLDA 4DR6F 1TTHB 1WHVA 4QOTA 5HLFA 5KFFA 4LIRA 4PYDA 3V6JA 4WU3A 3EE3A 3CE8A 3AHPA 1MN9A 1RHRB 1NK4A 1VDHA 4P7VA 2L41A 4DFKA 4USKA 1FO1A 1HD0A 3MXHP 3TX8A 3K17A 1SL1A 4DZ6A 3R7SB 2PO4A 4UW2A 2G0JA 4ERDA 4LR8A 2R2RA 3EZOA 4HACA 4DV5J 2G1HA 2MKKA 2CPHA 1YJUA 5KFJA 1N5QA 2A1BA 4USHA 2LYVA 3NG8A 1S6UA 3F56A 4RW6A 2IDEA 1RWKB 4RZRA 5ETVA 3ETMA 5KFCA 3GCXP 5A8RA 3PHEA 3TX0A 4OJ1A 4USWA 4MMOA 3F73A 3P6YC 3RAXA 2HWTA 3ISZA 3NMAA 3UVJA 2EBGA 1W2IA 1VQOS 3OL6A 3BB5A 2EK1A 5J1EA 3U1MA 2AJQA 1HHSA 5D0RA 1T0TV 4JI1F 4ZHRA 2MLYA 3UD3P 4C8KA 4DN9A 2H48B 3QPIA 1YWXA 4RNFA 3GIIA 2BM1A 3RW6A 4IO9Q 5ETKA 1TUVA 1F5BA 2XO7A 5HL7Q 2KHCA 1DLOA 4IFYA 1FFWB 4CQ1A 3MECA 1KOHA 4HACB 1Q78A 1T9XA 4FYVB 4ZVFA 1VLOA 2BQUA 2I38A 2EXUA 2GJFA 1VHIA 4JI2J 4USJC 3MUMP 4OHXA 4JI1J 2BW2A 4RW6B 2VKRA 2ERRA 4QR0A 1HBOA 3D6TB 3M6UA 5A8RB 1F1BB 2HZVA 3S8SA 4NX9A 2AYGA 1OY9A 1SL2A 5AXMA 2PA3A 3EDRB 3VGVA 2A3JA 3CJSA 3UVJB 3N6NA 3VTIA 4Y2CA 1IJEB 2YKOA 2F9JA 3BR9A 3HVRA 1ZM9A 2FVSA 4PUOB 5J1EB 3ZZZA 3M8RA 1RWVB 2XHCA 4A48A 5LSRA 2ZBQA 3TJAA 4HI1A 4ZHRB 2RDIA 4QW8A 2W2QP 1B4SA 4NYZA 2WAQD 2KZZA 2QA4G 1WG1A 3CMAS 3L7UA 5A8WA 3QSIA 3PTWA 1BE4A 4CT9A 4KAIA 1HQ2A 4YB1P 1K44A 5H1SV 1RWOB 4EYIB 2E7XA 4OYXA 4Q0BA 1C2PA 1FRMA 1DLOB 4OYMA 3IRXB 3MECB 3IMQJ 2L9WA 2H4YB 2D41A 5CXTA 2M4MA 3RRHA 4LF6F 2F65A 3M1VA 2ACMA 3MCMA 3IS9B 2MLXA 4KRWA 4ILMA 1YG0A 4X4OA 2HRUA 3OSNA 3PRBA 4DR4J 1HBOB 5IOLA 5IFMA 4LRDA 2MZJA 2GVZA 4ZP8A 4XDDA 1A0OB 2YBVA 3PG9A 4LVOP 3WIUA 4F7VA 2V68A 1GXTA 5ETOA 1A9NB 4GRSA 3H4BA 3B54A 4O4GA 4NZ6A 2LXFA 4MYUA 2IMWP 4QR1A 5KG0A 3Q8VA 4DLGA 2VQFF 4I69A 3OFFA 3GV7B 1R3NA 2JHEA 2A6OA 1ZH5A 1QE1A 4LF6J 2XB2D 4HLBA 2ZH2A 2XGPA 5ETPA 4I0WA 2AQ4A 2OKQA 4FXDA 4DSIA 1FF2A 3BBBA 3PX0A 2E7VA 1RT5A 2DEIA 4Q0BB 5KG3A 4NLUA 1TL5A 4OQJA 2FPHX 1NK8A 3DU6A 3M1VB 3KHRA 1Q8BA 4PXBA 3A8EA 5IS2A 2VQFJ 2B5JA 1X4EA 1RT4B 2KYXA 5DLFA 1N5YA 3D66A 2JLGA 3CD5A 1RI7A 3OSPA 4MH8A 1U0SA 1N54B 4DWIA 5KOXA 4ZPCA 2RDDA 3QJLA 3B82A 2GMJA 1QD1A 2V2KA 1VC5A 4O4GB 2C42A 4PG6A 1KWMA 1VBZA 3CJKB 3IP0A 3G9CA 2MYFA 1PKUA 3CJ5A 4Y2MA 1CJVA 1QE1B 3BH6B 2P9GA 1RQ0A 1VRTA 5KFHA 4J9PA 3K89A 3PHTA 1YJ9S 2EC2A 2IRXA 2GA7A 4DV4J 2LMIA 3SYZA 2AWZA 1RT5B 2XLKA 3BN7A 4Z7YA 2MPUA 3CJ0A 1VIXA 4OHWA 1UMJA 1NK5A 2C3UA 1KQKA 3OFEA 2F3JA 4WFAQ 3T1YF 1B3TA 1QTNB 3GJQB 5DETA 2B5JB 4QWDA 1VFJA 3ZTRA 1Q8KA 1HL6A 4DR1F 2HHXA 1N5YB 3C6UB 2NS1B 3BKTA 3ONQA 1VQLS 1N88A 2HURA 3SMZA 3CNQP 3K57A 3MMAB 1YJNS 1HNWF 1OJ4A 4ZPTR 3SBMA 1OO0B 5K8NA 2FVRA 4M5HA 2W4CA 1GTEA 2B9WA 3O44A 5A8KB 3BQ1A 4O3RA 2MLZA 3HZGA 1Z2ZA 3IFEA 1XC9A 1VRTB 5LXRA 5AXNA 5F0UA 1WORA 1Y0HA 3DC2A 1ULRA 4MIWA 1C1BB 4DR1J 3AAWB 5KG6A 5T7LA 2DNHA 2YKNB 4IKAA 4DV3J 4YB7A 3O5TB 1AYEA 4AD6A 5H9FJ 4LF7J 4B08A 1KP6A 1HNZJ 4HKQA 4P2FA 4AYBD 1WHXA 2GVDA 3K2YA 5KT4A 4P2MA 2IM0A 3SV3A 3T3FA 3KTQA 3OTCA 3C46A 3GR0A 1WEYA 3D68A 2C2NA 2AGOA 4NCGA 4KO0B 2VU5A 1OQ6A 1X0PA 2AW0A 5LJ5Y 3W63A 3G6ES 2BBEA 4M8LA 1RCXB 8RUCA 5KT2A 3K8WA 3HVAA 3MR6A 4MYTA 1ZETA 4EYHB 1XN9A 3THTA 4QWBA 3W66A 2XY6A 4IH6A 1RABB 2RQMA 3TVKA 2IA6A 2HWIA 4OYIA 2CIMA 2CWKA 3I0SA 3J81U 2ZBCA 4NLQA 1S0OA 1D1UA 5T7LB 3GYXB 1JWWA 2OH2A 3DOKB 2HNYA 1MLAA 3J7YI 3OL9A 4YR0A 1CC8A 3E51A 2V6AA 4EMDA 1UKUA 4XIUA 2NYIA 4DR7F 3EGNA 4R0EA 1R8PA 2E29A 5F9NA 4AL6A 2LEBA 2GVDB 3GONA 2IAJA 4NA1A 3KG4A 2R7SA 1CLFA 2XSFA 1UPPA 3GQCA 1H38A 4P75A 3I0RA 5KFMA 1H2UX 4J5OA 1U1PA 2Y8YA 1YRXA 2F7VA 3AJ1A 4RW7B 2PEHA 1YTYA 4WCEQ 1RU2A 1F2GA 1S4EA 3CJ2A 5M2UA 4D3GA 3R9LA 1AZSB 2XM3A 4KY3A 2B4PA 2QA1A 2IY5B 4OZ0A 3LP2A 4ZJQA 4K0KF 4OHVA 5LL6d 1H72C 3I0SB 2EFOA 2UXCF 3G6YA 1ZM2A 4L6V3 3R6GB 3NAHA 2KH9A 2HNYB 3CF5Q 3KJQB 4U9RA 3AB4B 6FD1A 4FS1A 4ZA1A 4X64F 2QX0A 4ZVRB 2IAJB 3DRPB 1ICEB 2OMLA 4I64A 3OUYA 4NA3A 4UOFA 2FJXA 2XI2A 3TOQA 2KDOA 2B0GA 1KS2A 3BSCA 3J7A1 3PV8A 1KR4A 4KIAA 3M6VA 1EP4A 3FZ2A 3UCUP 2OPRA 3JTOA 2UXCJ 2CKWA 3A8JA 3H2UB 1SBRA 4OZJA 1VYAA 2ZC4A 1YZ7A 3TI0A 4NMLA 3HXMA 3EUNA 3NRBA 2L48A 2DH7A 4MKBA 4IO1A 4DV0F 1NO8A 4ID8A 3BM7A 3LPYA 2DNMA 1DQ9A 2PIIA 4USMA 3FBFA 1H73A 3R5CA 4C0BA 3NL0A 1R8BA 5FDLB 3IBFB 2VFVA 4EU0A 3G86A 3KFWX 3VGSA 3UD4P 3T9NA 3Q2TC 2XWYA 2QMUB 1GMWD 3NCQA 2BQ3A 2MMYA 4GC6A 4ED0A 2QSWA 3LGMA 3D9BA 1K1QA 2J0SD 1S59A 3W65A 5BYSA 4F4XA 3HFVA 3CJ4A 2C3MA 1IBKF 3M6XA 3OL8A 3P5TL 3LAKA 5DGBA 2XULA 2OD6A 1JXLA 3MR7A 2LXUA 4J9LA 2Q3PA 3P3DA 1BD6A 3H98A 1KRPA 3Q83A 2AHOB 4N56A 5IXUA 1VBXA 2ZDPA 4OYBA 3KMSA 4F3MA 2F8HA 3IGNA 3M9NB 3PCOB 2RQKA 2WB4A 1ROFA 2DH9A 3HHEA 1RT1B 3LF0A 1Y5IB 1U09A 4NXNF 1TZ0A 4GVBA 2W2PP 1FFGB 3Q8SB 3MPVA 1IJFB 1KFSA 2JH3A 4OZNA 1RISA 3PRVA 3MMBA 1T9UA 5DO2A 2ZOFA 5IM0B 4DX5A 2RRBA 2BJ9A 1CSJA 1VQ6S 3BDEA 4FBTA 1UTAA 1T94A 4Q8FA 4Y28C 4N5SA 4RW9A 1DTTA 2U2FA 4FF1A 2J9DE 1ZTWA 3MTJA 5ETRA 3IAM9 4LF9F 1U1OA 4NLYA 3CT9A 1SKRA 9ATCB 3CEDA 3CCMS 4JV5F 4LFAJ 2IC3B 1U02A 3JXOA 2IVYA 2HFOA 1U6BA 4LF4J 3P49B 3RJMB 2RUGA 1S6PA 3PVXA 1N33F 2PEBA 2BJ1A 4B3MJ 5LMUF 3M2UB 5CD4H 5H9EK 4IRKA 4RU2A 2ASJA 3CO0P 1FDAA 1S48A 4C4WA 1J5EF 5A0YA 2DR7A 4NRTA 3H20A 1VCTA 3MD3A 3VR1A 1XNQJ 4H4KC 1HW8A 4LF9J 3JQKA 4GVBB 3VAKA 5IT4A 3TUZC 3EMTA 4JV5J 5DGAA 1Q0NA 3ZTPA 4FDFA 4TY9A 3KHLA 5D15A 2MQOA 4WZQA 5LSOA 4ZVUB 3FCVA 1BHNA 2BA9A 3SDEA 4QBUA 1F6TA 5CABA 3SSSA 1RJJA 1U1LA 4RLEA 2P9EA 2O66A 2LFVA 2K2PA 3SCKE 1S0VA 1FK9B 2ALYB 1J5EJ 4ED7A 1RGVA 5HMZA 3GR1A 2R7OA 3G82A 5ETNA 4C11B 2JWNA 4URGA 1S6PB 6FDRA 3KLFA 1DFDA 3OT9A 4KB7A 1Y4ZB 2HW3A 3WC2A 4OX9J 3AD8C 3RZAA 3BZQA 1VR6A 3M8SA 1W2BR 2ZBPA 2P5VA 4PXEA 3BSNA 3NAIA 1HMVB 2Q66A 1UJ6A 3OHBA 3I55S 2YX1A 1YBTA 4ZN1A 2XMUA 5A0YB 3QAUA 4DQPA 4FNIA 2L9NA 1NJWA 2CVIA 4B9LA 2HBYB 2GAGC 4IQXA 2IMOA 2ZH6A 1S0MA 4L74A 5IV3A 1I94J 3H5XA 1YJRA 3GYNA 3ISND 3KMQA 3A13A 5CYQB 3Q2SC 1RSCA 5D0GA 1VK8A 3W2VB 1XEZA 2DRDA 2MSTA 2WHOA 4EFAC 5E3PA 1DBDA 5HVGA 4M1KA 4A47A 4PAAA 4J9MA 1RU1A 3SDEB 1RA6A 3M30B 4DX6A 3GG0A 3OVAA 4Y0FA 3PEJA 1O51A 1UVNA 3SQOP 5FD1A 3AOAA 3W3SA 1LFWA 1QAJA 1XWLA 2XI3A 3G82B 2BJ3A 1RWXB 5GAGI 3DOLB 2OI2A 5D4LA 1VRUB 3CCES 3MWBA 3G8QA 3KG1A 2GQ2A 1GMWA 4WXWA 4QPXA 1Y11A 2O1PA 3LUYA 3W2WA 1M90T 1F5CA 4YEAA 3J7YU 3BDPA 3O2IA 3W9IA 4M94A 2B56A 2GO9A 3GSIA 4LFCJ 5EGYA 3DLKB 1FKPA 1S10A 3E01A 4IRCA 2VFRA 1YRUA 5G0RA 2F63A 3RAMA 1PBAA 3V81A 1AROP 2D3OR 5T41A 1X4CA 4NPOA 3DMJB 1L3UA 1RA7A 3FEZA 1WI6A 5DQGA 3KLHA 1U1MA 3KK2B 1C0TA 3G2XA 2OMOA 5DG9A 4RU9A 1HW9A 5D0EA 4B3OA 4HDHA 2HS3A 1J2VA 1OPZA 1FCAA 4JI3J 4LT6A 1KN6A 2Y9HA 3JSBA 4C3MA 3GE9A 5AXKA 5CCMA 2EFNA 4PRFA 1N5TA 3R27A 1BWEA 4IUFA 2CPDA 4F0MA 2H65B 4ANCA 4CLTA 4ZVTB 3QNWB 1DQ8A 5I42B 5C7PA 2BKPA 4EZ9A 1MU2A 3POTB 2JVRA 2XS2A 3BQ0A 2QE5A 3W2WB 5DQHA 1EJ7L 1R8AA 3R7NB 1CS4B 2RIJA 3W64A 4WXOA 2E1CA 1U26A 3VCDA 3MM7A 2UP1A 3CCQS 4C9DA 3HHKA 3E01B 1EX8A 3BKFA 3RG6A 5G0RB 5L1IA 4P52A 4QU6A 1M1HA 3V81B 4B9SA 4ES2A 3AXKA 4IOAQ 3DLGB 4NOHA 3KYLA 2OPPB 1CG2A 4DX8H 3MMCA 2ZUAA 3B4MA 2HQGA 3KLHB 4B9VA 3G6XA 3PW4A 1C0TB 2GJ2A 5HMYA 4B3OB 1U8WA 4Q8EA 1SJQA 4XPEA 2BANA 4DV1F 3DGPA 3EVMA 3AJDA 4L76A 4ECYA 4HI2A 3AY0A 2DT9A 5CHCB 5DLGA 4CH7A 2FJAB 3H5YA 4OZ2A 1U6FA 4DR5J 1HNXF 1XIQA 4LBPA 4GKKJ 3GILA 2VBZA 3GYGA 2M70A 4Q2MA 2LDIA 3D4JA 1R0CB 4NLOA 3IA0A 2ZJQQ 1TP7A 5L1KA 2KTQA 2HGNA 3MM7B 2VKZG 2QL7B 2WVDA 3JSMA 4Q45A 2JEFA 3NWRA 4QIVA 4KGVB 3N9UC 1FERA 1FTCA 4B9TA 1GFWB 1V3ZA 3BO3A 3TYTA 1CEZA 2XY5A 3KK1A 3MMCB 3OBIA 1ZM3A 3PKMA 3AB2B 2EG1A 3FRYA 2K7JA 2YWWA 2QTWA 4I2PB 2WSCC 2D7SA 1WC6A 4RBVA 1FE4A 4DL5A 3EZUA 2AJ4A 5BR8F 4KBIA 5K8OA 2ZM6F 1JQGA 3BO2A 3DGPB 5EWFA 1B70B 4N77A 2Z2ZA 5KFWA 2FLNA 1UP1A 2BYCA 3DRRA 2CAJA 3ZZ0A 1UVMA 2W9BB 1CBKA 1Q86T 2IFXA 3K59A 4QU7A 3N6MA 3FCWA 2B43A 4DSJA 3SQGA 3ZTOA 1N36F 1B0PA 4TQRA 4NLXA 2Q79A 1EQMA 1KLNA 4WPAA 1ZZNA 4LSLB 2XCPA 2K3KA 1OPIA 2GIQA 1ZAWA 3I5BA 2ZM6J 4DBQA 2YX7A 2YWGA 4H4KA 4EUVA 3HZEA 2CG4A 2R7TA 1SCJB 3M7VA 2M5YA 3QGHA 3CSKA 3KK1B 4K4SA 4UOHA 2XMVA 2V8PA 1S4FA 3SFUA 4TY8B 1HNIA 5DQIA 3MEEB 2PC6A 3IO1A 2XMMA 1VS3A 5CZXA 3IBCB 4WP8A 5B0GA 1HHQA 4DPTA 1JJ4A 2KI2A 4WTOB 2UVWA 2PFDA 5ADZA 3DHWC 2COLA 2KO1A 3DRRB 3VHQA 2Z57B 1TKZA 3DI6A 4ECQA 3OJUA 4KHMA 3HSGA 3H25A 3V6KA 2PMZD 3LOUA 2KXHA 4ECVA 2IPOB 2V50A 4NMXA 4LR7A 2V2QA 2OUGA 3RBDA 1XMOJ 1OS5A 2YH1A 2F1FA 2ZHBA 3NMRA 4RBTA 1SVDA 1I51B 4PKDB 1RHMB 1TMJA 2C3PA 1SJ4P 4DPOA 5HJYA 2DGUA 2GHVC 2RQ4A 2LXIA 3MM5A 3B6BA 4WFBQ 2ROPA 3W1YC 1TK5A 4RNOA 2PI4A 1MROB 4WKRA 1O0PA 1S7HA 2EVZA 5LMNJ 2NXEA 1HNIB 4NL5A 5HBMB 1M5HA 2WVCA 1I3OB 5CA5A 4MK9A 3QFHA 1RAAB 2H5EA 1X4DA 4K8RA 1Y9OA 2G2YA 2QLJB 2HGLA 1SV5B 3E3XA 1WKLA 1MMDA 1GAOA 1YJTA 2UZAA 1CQMA 4WK3A 2HPUA 5H9EJ 1L3VA 4G1QA 4CLUA 2QO3A 4LRFA 2X3DA 4OX6A 3AXMA 1S1XA 3DRYA 3FBBA 4YS2A 4ZKAA 1C4AA 2WK4A 1BMQB 4NI2A 1IKWB 3WBZA 2GMLA 1HA1A 1M5VC 4DL7A 3MCSA 2M7SA 3QRQA 3CCRS 4PPDA 4K4ZA 4DFMA 3DN9A 1R6VA 1U2RA 2EFGA 2ZITA 3CVKA 4F67A 3FRZA 2OFGX 5K14A 3OFHA 3ZC4A 3RAQA 1D8ZA 4WZMA 1T02A 3PKYA 2PA8D 1KVIA 5IC4B 2RH3A 2LLZA 4X4SA 1M5KC 3MM5B 1SUQB 2QMWA 4KV8A 4Y2KA 2CNKB 4WJBA 5GAGU 3QO9B 4TNOA 2HS4A 5GVQA 2ATCB 2AYMA 1RADB 3PW5A 1D09B 5C5JA 4GO7X 3QIDA 3FDSA 3BV8A 3D6MB 2K1RA 4OLOA 3IBWA 3LALA 1EQ0A 2AX1A 4DCJB 4WKYA 4G1QB 2O5DA 1QLNA 2DK2A 2AEFA 4K4YA 2I5JA 2HNZA 3BJYA 2RKIB 1UW4A 4NI2B 3P45B 1T3NA 3KNAA 1TFWA 3CCTA 1SIZA 2W7PA 4NZ0A 5KFOA 2MKCA 4C8ZA 1MNEA 1SKSA 3FGVA 3BS9A 2QL9B 3R5DA 4F0KA 1KQFB 4IDKB 2YKPA 4U7CA 4P73A 4G3IA 1HYSB 3S1TA 1RTIB 4WYLA 1NPRA 4UOCA 4YQWA 4ED2A 1VLYA 3R1HA 3KLGB 3HJFA 3PR4A 3GIKA 1U0HB 4K59A 3NGRA 2CZ9A 2RDJA 3FMBA 4YY3F 2HG4A 4IG0B 3AA8A 1NRKA 3HM9A 1N52B 3U02A 2DNZA 1X60A 1WG5A 2JEGA 4ZPWR 2F8EX 1TKXA 1F2HA 3PZPA 4R0JA 2ZOGA 1FJCA 2JC0A 4WYWA 2ZJPQ 2OEJA 2RMLA 2DR5A 2FJVA 4LIWA 4NWBA 3US5A 2AT1B 1LEOA 4DR3F 2XTJP 2RF2A 3DLEA 3DM2B 1AUSL 3VAGA 3V6HA 3EX7B 3R5JB 3PO5A 5F3TA 2DVIA 1PJ6A 3HK2A 4YB5A 4NZ7A 1S1VB 3H4DA 1D3WA 2EK6A 2DXEA 3G8SA 1T9VA 1K0VA 1G7CB 2N4CA 1UEUA 3HJVA 2HBZB 1S72S 3HD1A 2NXNA 4ZOSA 1TL1A 4ES3A 1RHJB 3CJQA 2V4QA 4U96A 2D3O1 4DR3J 3R1LA 4ES1A 2E5HA 2WTFA 1JLBA 2VV5A 4ZCMA 5EWEA 2UUBF 2B6AB 3PX4A 4JV1A 1RBOB 2VFSA 4OMFG 3LWMA 4JI7F 2V8DA 1DQAA 2MGZA 2G0IA 2F8MA 1GTHA 4B3SF 5EX0A 1QSLA 5U47A 4OV6A 1T9TA 4RUBA 1X9WA 2JNJA 3H90A 3AQPA 3GJSB 1N32F 4X66J 1WC4A 3DLEB 1Q16B 2R8JA 1RWNB 5F8IA 3OXFA 2MEWA 2UVRA 3LPEA 5B0AA 2VONA 1GNKA 2QRRA 3D67A 3KJVA 3T1AA 3PJ9A 2W2NP 4GKJJ 3DOMB 4AE5A 1DTQB 4DV2J 5THWA 5KFZA 3OXGA 3L7OA 4W98A 3QWUA 3TR5A 1SL0A 2FHJD 3G6VA 3CJ3A 3MFHA 4KKOB 1RDRA 1UZDA 4DG1A 1UJ4A 1ZOTA 4O44A 1JK9B 4J9RA 4USUA 2CPIA 3J7AN 3MM8A 3HVWA 3OPKA 2X7IA 1FDBA 1GMVA 5KFGA 4U7UK 2VHGA 1SI9A 4DQRA 2V4JA 4RUCA 4YB6A 4O4RA 3MI7X 1VC6A 1MWYA 4DFJA 4ZVSB 1S9GA 5C2GA 3E8OA 1IR1A 3BKUA 1JLBB 1JMTA 2Q43A 3I5CA 2QLXA 1WC1A 4XK8C 4HHJA 2ACYA 2CNNB 3FSXA 4DF8A 2AJFE 3MDFA 2ZHOA 4W4MA 2YTCA 3TZWA 4ER8A 3QIPB 4P2SA 2GC8A 4USIA 2LQJA 3R5GA 1VK3A 3QT6A 1IWGA 2CDQA 2CQ1A 1PIEA 4FKYA 2IM2A 3MAAB 4WIQA 5GAHI 3K5LA 3OL7A 2X3GA 4WP3A 3GPAA 5KFPA 2OFHX 1LWFB 1XERA 4PXCA 4LSZB 2CQHA 2CWXA 1C0UA 2VDHA 3OHAA 2I6WA 2DD8S 2J7WA 2JX2A 3L9ZA 4UT4A 2XLJA 3HSDA 5HO4A 1HWKA 2C2OB 2DNNA 4LQ3A 3MM8B 2Z58B 1BQMB 2BOAA 2Z2YB 2LU2A 2OD4A 5IC6B 4AXIA 3PR5B 3QLHA 2DRAA 3D0IE 2ZWOA 4F4WA 1IN0A 1PC4A 3CTRA 4K4UA 1NCLA 4KC5A 1IKXA 4M5NA 3GV8B 3HF5A 2RD5C 2Z2MA 3C6TA 4DS5A 2IVFB 2RAQA 2J6SA 2X1BA 3T6JA 2ZJRQ 4DUTA 3N4WA 3JB9k 3BSOA 5DDQC 3MM9A 2R7VA 4DPUA 1KLMA 3D1HA 2AKWB 2W9CB 2AYEA 4Q44A 1LWXA 2YX4A 2IVMA 2LKZA 2Q6CA 2R7UA 4OX7A 1RYRA 1XK8A 4C8LA 1GEHA 4WFYA 3ETOA 3GTYX 1PAUB 4K2XA 1RLDA 3UDVA 2EPIA 3QQCD 3VAIA 1C0UB 4EBCA 2KHDA 1OY8A 3HMJG 5E3QA 1L5UA 4LJMA 3C3LA 2QSFA 2HHWA 4RJVA 4ZLPA 2MB0B 3HO1A 4I56A 3MHYA 2KVIA 3MAQA 4M5DB 3QLHB 2CQ0A 2QN6B 2FHOB 2GGPA 2VBXA 4FVMA 3I9V9 3QAEA 2DNKA 1NB7A 4QWEA 4V19X 4EGLA 5KFIA 5DDOC 4JI8F 3Q23A 2FB0A 1VRQC 4KHPF 2XSJB 4H54A 2QJ3A 3DDKA 3LANA 3I4HX 4QIEA 2CA9A 3MM9B 1HPZA 5F41A 4QQBA 2FIUA 2VIHA 1YITS 3ELHA 2GZOA 4C0OC 3M8WA 3ILLA 3G71S 1J5OB 3ZZTA 1VQKS 1VQPS 1NNDA 1S9EB 3K8VA 1SH0A 2H3EB 1U6ZA 3KLIB 2C2RA 2LDYA 2CQDA 5LJ3Y 2QYGA 1DZ5A 4HDGA 1JLFA 2ZHAA 3M2VA 2DO4A 3CJTA 2XHWA 1A7GE 4WFNQ 4LR9A 4MKYA 4OI1A 1S6QA 4F8RA 4QW9A 2PMWA 4PWDA 1KFDA 3A8KA 4YR2A 1WKJA 3IM8A 1NB2A 1X9MA 1RBLA 4CO5A 2F5GA 3L3CA 2ZH5A 3MCNA 2GGPB 5KFYA 2RJZA 1B0VA 2G9OA 1JLGB 5CH7B 3NCPA 3M8QB 5HJXA 4OYPA 3VVTA 4ATNA 1CULA 4LQ9A 1REVA 4JBCA 1O5JA 4IR1A 1VOMA 2FD2A 2UU9F 5J2QA 5F0WA 5E0OA 2NUUG 3X3UA 3GU0A 1JLCA 4IQMA 3AH6A 3OTOJ 3A1YG 1WSRA 4ZPVR 3I6PA 1HPZB 3UDLA 1N34F 2DR8A 1OWXA 1XJWB 1A6LA 4H4OA 4JI4F 4JV2A 1YSJA 2ZWPA 4EWTA 3G4SS 3A4TA 1XNRJ 3CJ8A 4EBEA 2Y0SD 3JYTA 1JLFB 1S1UB 4ZK7M 3HSJA 3M2VB 2HKEA 3AOBA 4Q7AA 1MSWD 1WF1A 2FHKA 3THVA 5BYQA 2VB6A 1S6QB 1R8CA 1R27B 2JOQA 1ZAXA 1H7XA 4RNNA 2DGVA 4CH1A 2X51A 2PDAA 5HROA 4F4AA 3M8PB 2OTLS 3QGIA 2B4UA 2E5GA 3ENWA 3PXGa 2YH0A 2JFKA 1L3SA 1X4GA 2N3OA 1UWBB 2XYGB 5D4OA 3EVWA 5KFAA 3FC9A 1M5PC 4DV7J 4FNHA 3R2CJ 4O3NA 1MN7A 5J2QB 2W7AA 3RTVA 3UDEA 2W2MP 4CO1A 3RYLA 3WQPA 2BJ7A 2AZ3A 1HNVA 3GWCA 4J9NA 3GIRA 3FJ2A 2KYZA 3FQKA 2OLWA 3TAPA 2C22A 1T3OA 1PC5A 2CQBA 2HIQA 2XY7A 3ENQA 3KJFB 2DXDA 3W9HA 4RUAA 1T7PA 4G1PA 1X4FA 3JYTB 1RKJA 5F8NA 2KN4A 1X4BA 1Y5NB 3W7BA 2XMJA 4HVZA 3UO0A 2PSZA 4A8KA 2RE1A 5GMEA 2UXDF 2HWHA 4NLTA 2W25A 3C16A 2NXJA 2KT2A 4ZCLA 2ASYA 1RXOB 2RRAA 2HVIA 5A6WA 1K47A 1U2CA 1Q1KA 3SSQA 1RE1B 5DRKA 4HT5A 3WZ0A 2M0GB 3LQVA 1IWAA 3VGUA 1D9AA 3WDOA 4CIOA 1EIYB 4CLZA 2FLLA 2Y1IA 2KRBA
chains in the Genus database with same CATH topology
3CC4S 3TAMA 2W9AA 2BDPA 3UDCA 4RWWA 4ID5A 1RJJA 1N0VC 3SSSA 4YR3A 1U1LA 4QR2A 4RLEA 2M3DA 4ECTA 2P9EA 1RTJA 1F5AA 2BRKA 4O3PA 4ECZA 4FF3A 2O66A 3PIPQ 2HMIB 2MHEA 2Q66A 2CQ4A 4XDCA 3CGIA 2K2PA 2OP5A 3SCKE 2WOMB 4EO6A 2VPWB 2RRNA 2HRYA 3Q22A 1S0VA 4I2QB 2QLWA 1LWCB 2A2CA 4R8UB 1FK9B 2E7WA 4IG3B 3J7ZT 2EFVA 4ED7A 1RGVA 2DCUB 2VPYB 5HMZA 3GR1A 4TXSA 3DU5A 2FGCA 2JLFA 4OIXA 4DL0C 2RQCA 2W9CA 4Y65A 2DHGA 2I2YA 2R7OA 4UUWA 3MD1A 1FDNA 4W90B 2UV8G 4C11B 3M6WA 2WBRA 1V3SA 2JWNA 1XR7A 4RW7A 3HKZD 2DB1A 4URGA 1S6PB 6FDRA 4KPYA 3OTBA 1HFEL 3KLFA 3H2LA 3RR8A 1N5SA 1DFDA 4KB7A 2LQ5A 1UVLA 1Y4ZB 3HVTA 2OJ3A 4DL3A 2PGCA 2HW3A 3WC2A 1H0HB 2GIRA 3PEHA 1TVRB 4FPRA 2KKHA 3M4XA 2GCFA 5FIIA 4C3LA 3RZAA 3BZQA 3I5AA 3I87A 4F2SA 1S76D 2XBPA 4JI5F 3M8SA 1W2BR 2P5VA 4PXEA 3M9OB 3BSNA 3BN4A 2I8EA 3NAIA 2GHWA 1HMVB 5HQ8A 2W8LA 3MM6B 4ED8A 5KFUA 4TU9A 3SQGB 1UJ6A 2FUG9 5J1NA 5B0BA 3OHBA 3RB3A 1L3TA 3OVSA 3I55S 3AJ2A 2MZTA 2AP6A 1JLEB 2YX1A 2R8IA 4I6WA 2QV6A 4JI0F 3SXLA 2XMUA 5A0YB 3RB0A 1FESA 1FNXH 1JKHA 2WW8A 3QAUA 4DQPA 4FNIA 4LFBF 1WHWA 2L9NA 2XMKA 3OTDA 1NJWA 2CVIA 4B9LA 3I4PA 1N4LA 3FEYB 1E6VA 3F41A 4IQXA 3FEXB 2IMOA 3IR5B 3PFOA 1X4AA 3U27A 2ZH6A 1S0MA 4BCAA 1D9FA 3H5XA 1BLUA 5HLFB 1YJRA 2F40A 3GYNA 3ISND 3KMQA 4M5DA 5CYQB 3Q2SC 5I3UA 3PX6A 2YNFB 2ZH3A 3NWGA 1WWHA 3BEGB 2JZ5A 3EXYA 1VK8A 2OPSA 1XMBA 2NR0A 3U1LA 3W2VB 3K0JA 2DRBA 2FJDB 3O6QA 5DDRC 3AQOA 2IJNA 1XEZA 5T14A 3RW7A 4J9SA 4OZLA 2MSTA 5HI7A 2WHOA 1YBAA 4EFAC 5E3PA 3IR6B 3SSRA 2NUHA 1DBDA 2GQQA 1FEHA 5CYJA 5B7WA 1U2FA 4M1KA 4A47A 2VG5A 4CCHA 3VWSA 1WF0A 4J9MA 4I4BA 3SDEB 3UCZP 1E6YA 1RA6A 1WG4A 2B3TB 3M30B 4KQZA 5GAHU 2UUAF 3GG0A 3OVAA 1RT7A 1DHMA 1IKYA 1LFPA 2KU7A 1GXUA 2JL9A 3DRPA 3M2RA 2XSJA 5KFTA 4YMEA 4Y0FA 4X62F 1NJZA 2RSQA 3KK3A 3PEJA 3JAMY 2KM8C 1O51A 1RTJB 5B0DA 4C2MA 1UVNA 4F25A 5FD1A 3CDBA 4WTYA 3NP5A 2MQQA 1S77D 4AQYF 2VOOA 1WF2A 3CCLS 4G6VB 2W8KA 1S0NA 3W3SA 2L3MA 2UUWA 1LFWA 1H98A 1QAJA 1R0AB 2WSEC 2NZ4A 5KT3A 1XWLA 3MUVP 3Q8RB 1LWEA 2XI3A 1NK9A 1DRZA 2N4DA 1QAXA 4X2BA 2E9TA 1J5OA 4I1TA 5GAGI 2E5IA 4PXDA 3QZ8A 3DOLB 1U45A 2CPFA 1V9OA 1GH8A 1VQ7S 5D4LA 1TKZB 1S9EA 1VRUB 2R2UA 3CCES 3MWBA 1UL3A 3DI6B 2ATLA 3HVTB 3G8QA 4IOBA 2MQMA 5C25A 3KG1A 2GQ2A 4QPXA 4WXWA 3KLIA 4C0HA 1Q8IA 3IGVA 2IA0A 1QUVA 2KFZA 2MQLA 2G13A 5C42A 4ED6A 1I1GA 2HGMA 3DRSB 3LUYA 2O1PA 2IRUA 3CDEA 4HT7A 3DXSX 5F9LA 1TAQA 2KG1A 2PD1A 3W2WA 5IT9Y 2A10A 1M90T 4K5SA 1F5CA 1TQLA 3M32A 4YEAA 4WFZA 3J7YU 3BDPA 4ECRA 3IR7B 3O2IA 2BJEA 4FF2A 4M94A 2D9PA 5GADU 5DDPC 4NCAA 2B56A 2GO9A 2FVPA 1JKHB 1BQNA 2UUTA 2RT3A 4HEA9 4EBDA 4KT0C 5EGYA 2HLTA 3MZIA 4KR0B 5L1LA 3DLKB 5K9FA 3SI8A 1E6VB 4BHQA 1FKPA 1RT6A 3NLCA 5B09A 1S10A 4ELVA 2R7QA 3E01A 4IRCA 3H5UA 3UR0A 2VFRA 4NLWA 1KC8T 1B64A 1YRUA 2DGWA 4L3NA 5G0RA 2CZVC 5IT0A 3O3LA 3NGDA 1YHQS 3PW2A 2PMHA 3RAMA 2L9DA 3V81A 5B0CA 1AROP 2OPSB 2DISA 3GFZA 3K5NA 2D3OR 2HHVA 1S9FA 1Z4UA 1JLGA 4K5RA 1TFYA 1R7IA 1XR5A 1Y5LB 3M8QA 4IYQA 2BR0A 1JX4A 2FC9A 5FDLA 2ZH7A 5T41A 1S1WA 1Z2LA 3FFIB 1X4CA 4YDDB 2E1MC 1IBMF 2EFPA 4NPOA 4TYAA 1U49A 3T9ZA 2WONA 1FJGF 3DMJB 1L3UA 1RA7A 3FEZA 2BE2A 2K8GA 2RU9A 1WI6A 1ZM4A 2VG5B 1YJVA 5L38A 5DQGA 3GB0A 5IWAF 3CDUA 3KLHA 1U1MA 2YKAA 5KOWA 1X4HA 1X5PA 1E6YB 3B4DA 3PY8A 3KK2B 3C66A 1C0TA 2DNGA 1QVFR 1RT7B 3M2RB 1IKYB 4Y34A 1V3RA 2KFYA 1RT2A 2ZZNA 1OQ3A 2OMOA 4IFYB 5HN0A 5DG9A 4RU9A 4JV0A 1HW9A 3IRWP 5D3GA 4B3OA 4HDHA 1HHTP 2B51A 2HS3A 4URQU 1J2VA 1OPZA 2IRYA 1VQ8S 1FCAA 2DHXA 1HI1A 4LT6A 1KN6A 4C7QA 3N28A 1C4CA 3JSBA 3LP0A 5B08A 3HT3A 4C3MA 3GIJA 4IH7A 2QZ8A 2V8HA 2CVEA 1FRJA 1RT3A 2EI5A 3GE9A 2CJKA 5AXKA 5CCLA 2KM8B 1C1CA 1IR0A 4ED1A 5DM7Q 5CCMA 2DNLA 4QWCA 2VH7A 2OIHA 2EFNA 4PRFA 4PQAA 3FSIA 3TW0A 2AV5A 2HHTA 1N5TA 3R27A 1BWEA 2OTJS 2YNGA 4YP3A 4IUFA 4WF9Q 2ZBIA 4NLSA 2GNKA 3BQ2A 2CPDA 4K4WA 2D3UA 1U48A 4BC7A 2AGPA 1DQ8A 3VQTA 5I42B 5C25B 1Y3JA 1S1XB 2JDJA 4QCLA 4ZVEA 3F44A 2HZCA 3TANA 4EZ9A 1MU2A 3POTB 4OFZA 2JVRA 2MSSA 5GAEI 2DGXA 5C42B 1DJ0A 1K8AT 2XS2A 2YNHA 3BQ0A 1IXKA 3ZZYA 4B9UA 2VA3A 1S1UA 2QE5A 5KFEA 2AJ0A 3W2WB 1AUDA 3UW1A 5DQHA 2JEJA 2VA2A 3TARA 3ULHA 1YVFA 1G6BA 3M32B 1FKAF 1R8AA 1APSA 3GZ7A 3OTOF 5MLCV 3K58A 4WFXA 1YI2S 2POKA 2RIJA 4CO0A 2NREA 5F3ZA 4E0DA 4PQUA 2J0XA 3T1HF 4C97A 2FVQA 4O3QA 2XMTA 1BQNB 1FD2A 4WXOA 2QYCA 4HH0A 4IRDA 1RT1A 2E1CA 4N41A 1U26A 1KNZA 2O67A 2GW8A 3VCDA 3MM7A 1RT6B 2UP1A 2B9YA 3CCQS 4C9DA 1TKDA 3HHKA 3E01B 4DSFA 5KFQA 4AXJA 2E9RX 3QZ7A 1VGYA 2HAIA 1SJFA 5J2MA 3M8PA 2HS0A 4MKAA 2XNQA 5G0RB 5L1IA 1RWUA 2VASA 5K14B 4QU6A 1ZPVA 2BV3A 2RS2A 3HHDA 3T6BA 2DPIA 1XNRF 2DO0A 4MK8A 3V81B 2WRMA 4B9SA 3UI3A 2DNOA 4F2RA 2VD3A 4ES2A 1VQMS 2ZKTA 4IOAQ 3DLGB 3HHLC 5KFLA 2PE8A 4NOHA 5A8WB 3KYLA 3BGRA 4OV1A 2OPPB 4UY85 1UWBA 3N5FA 5KAKA 2FHJA 1N0UA 5IM0A 1CG2A 3LAMA 4DX8H 4DJBA 3MMCA 1LK7A 1LKZA 2OSQA 3SCLE 4KV8B 3B4MA 1FKOA 2J5AA 2JFDA 2JJ4D 3KLHB 1QSSA 5KT7A 2RS8A 1QVGR 4ZDNA 4HYKA 3LW5C 2PI5A 4WE1B 4B9VA 3G6XA 3PW4A 1C0TB 3MR3A 1FVSA 1MWZA 3VZHA 1WTBA 2CZ4A 2GJ2A 2F4VF 1RT2B 2CFXA 5HMYA 2IHR1 4MFBA 4J9OA 3ITHA 5F8HA 4ZPAA 5D3GB 4H4MA 4B3OB 3CB4A 5KFXA 4Q8EA 1TL3B 3RB6A 2RNEA 1SJQA 4XPEA 2MXYA 2C28A 2BANA 4DV1F 2YKQA 2IC3A 3LP0B 5KFNA 2K1RB 5DS7A 3DGPA 3MR2A 5JVHQ 1VQNS 1RT3B 1FRKA 3MEDA 4DV6F 1C1CB 3L7PA 1G3OA 4DQSA 4ECYA 1V6HA 4HI2A 1TL4A 3AY0A 2DT9A 4A8QA 4OZ1A 3H59A 4U67Q 3FZBA 1FRHA 1X5SA 4CO2A 2XS5A 5CHCB 2YNGB 5DLGA 4Y6IA 2BRLA 3M2UA 4CH7A 2FJAB 4NCBA 1O8BA 2QA2A 1RKIA 3K7RA 3VALA 4DV7F 5GMKa 2XZWA 3H5YA 1BGXT 4AUKA 2FC8A 1YQHA 1HNXF 1U6FA 2I5JB 2HNZB 1SH2A 1JLQB 3GILA 1NJYA 4RUHA 2VBZA 4OI4A 1TK8A 3PRDA 2M70A 3C2PA 3CD6S 2C2DA 4MK7A 4Q2MA 2LDIA 1T05A 4XAKA 4X4TA 4LFAF 4PQUB 4CNYA 2LQ9A 1JLAB 3TA2A 5DG7A 4I68A 2HQIA 2OPQA 1DURA 2CPJA 1VMBA 4NLOA 3PO4A 3IA0A 2ZJQQ 1TP7A 5L1KA 2JRSA 2KTQA 2HGNA 3MM7B 4LF4F 2VKZG 2B4OA 5I3QA 2O01C 3NBPA 5E33A 4DEZA 5D77A 5K8MA 4RBUA 3D1OA 2HHHF 2CQPA 3JSMA 4B3MF 4Q45A 1ZZFA 3D54A 2MQPA 2KXFA 2KJWA 4DFPA 2EWHA 2JEFA 4A8OA 4QIVA 1K0TA 1S1TB 1URRA 2BUNA 3N9UC 5KFDA 2ROEA 1FERA 1FTCA 4B9TA 2JC1A 1V3ZA 2HHQA 2CQ3A 3BR8A 3BO3A 2Y1JA 4WK1A 2ADCA 2DHAA 5EDWA 3BGRB 3TYTA 4A46A 1CEZA 2XY5A 2CPYA 4OJ3A 1TK0A 3ISNC 3KK1A 1UVKA 3MMCB 2Q6BA 1NU4A 4CTAA 4B9MA 5KG5A 3OBIA 1ZM3A 3PKMA 2ZH4A 4FXVA 3AB2B 2M88A 4UY8T 1XNQF 1FT8A 2EG1A 4O0IA 3FRYA 3HHLB 2BM0A 2GFFA 2K7JA 1TKXB 4I2PB 2HMIA 2WSCC 2D7SA 4LUBA 4RBVA 1FE4A 2VFUA 2J0QD 4I2QA 1EETA 4DL5A 4R8UA 3EZUA 3MMJA 1FK9A 2AJ4A 2E44A 3MR5A 5BR8F 2KFNA 4KBIA 2J0WA 5K8OA 4ICLB 2ZM6F 2ZNYA 3BO2A 5EWFA 2W4DA 4N77A 1HWLA 5KFWA 3CIMA 3HP6A 4C11A 3MEDB 5ITHA 4ZP6A 2FLNA 1UP1A 1S99A 2BYCA 3DRRA 4ED5A 2KXNB 4KTQA 3ZZ0A 2W4PA 5HMWA 4AL5A 4MJKA 1UVMA 4DL6A 3CO9A 4TN2A 7FD1A 2W9BB 2RILA 4FN5A 2RF2B 2OO4A 1Q86T 4KGMA 2IFXA 1TVRA 1Q4RA 3K59A 1KOOA 2VL1A 3N6MA 4QU7A 1XMQF 1WEXA 2B43A 1U47A 2XCAA 1FVQA 4CH0S 1R43A 2LEAA 3BGFA 4DSJA 1HMVA 2AX0A 3UE2A 4V19J 3MOJB 3NCRA 4QJVA 2OAUA 4C8OA 3SQGA 5AJ3F 4B9NA 3I82A 3HFKA 4C3KA 1N36F 4NLPA 3THPA 1B0PA 4Z37A 2GQCA 2NLWA 1JLEA 4I6YA 3QGGA 3OVBA 4TQRA 1T05B 1BQXA 4NLXA 1M5OC 2Q79A 1RTDA 1UFLA 1HR0F 2OPQB 2CQ2A 1KLNA 1T03A 4NLDA 4DR6F 3WC0A 1ZZNA 1TAUA 4P7TA 4A4JA 1WHVA 3GFYA 3GSDA 4LSLB 1DARA 4QOTA 2XCPA 3RB4A 2X1AA 5HLFA 3NBPB 4RNHA 5KFFA 4LIRA 3V6JA 2K3KA 2G4BA 4WU3A 1YJWS 1OPIA 2GIQA 2QIFA 5CYQA 1ZAWA 3CE8A 3I5BA 3AHPA 5KG7A 4TQSA 4XO0A 2YNFA 4DBQA 1X7VA 2YX7A 2WBMA 1JNZB 1R8HA 2YWGA 4OX9F 3W2VA 1NK4A 4H4KA 1H2TZ 4EUVA 4P7VA 3M9MB 3HZEA 4UUXA 2CG4A 2L41A 4E8UA 2R7TA 3PACA 3IN5A 4DFKA 1TL1B 3DRXA 1GT8A 2M5YA 3QGHA 3CSKA 5MAOA 1FO1A 4ETXA 3KK1B 4CNZA 4K4SA 5C24A 1HD0A 3MXHP 2ROGA 4CTAB 3TX8A 2XMVA 2QA4S 2QFJA 3M30A 1S4FA 3SFUA 4TY8B 4GO5X 1SL1A 2VPXB 1UJ5A 5IQ6A 4YOEA 2PO4A 1HNIA 2ALZA 3D28A 4UW2A 2DJWA 2FTRA 5DQIA 1I94F 3MEEB 3RR7A 2PC6A 4ERDA 2R2RA 2R7WA 3IO1A 2XMMA 1VS3A 1EETB 2MKKA 2PN6A 1FE0A 5CZXA 2MGZB 2EC0A 2CPHA 5B0GA 1YJUA 5KFJA 2XNRA 4OI6A 5IQQA 2KI2A 2VFTA 5LXYA 1R0AA 1JJ4A 1N5QA 5EN1A 2UVWA 2A1BA 4USHA 2LYVA 1BC6A 3NG8A 4QPTA 5ADZA 4ZPBA 3DHWC 1S6UA 3F56A 2COLA 4RW6A 2RU3A 2O3DA 2KO1A 3DRRB 5E3RA 2LA4A 2XLIA 4RZRA 3DOLA 5KFCA 1FHTA 2IBOA 1TKZA 4LVNP 1VRUA 5A8RA 2M8DB 3D0HE 3IXQA 3DI6A 3PHEA 4ECQA 4OJ1A 3OJUA 4DLEA 4N8OA 1FD8A 4NA2A 4KHMA 4JUZA 2BACA 3H25A 1FNOA 3RBEA 3V6KA 5FJ4A 1ZAVA 3DRSA 1ZYQA 4MMOA 2KJVA 3PNIA 3F73A 2LEPA 3P6YC 2R2TA 1P1TA 3MOZA 3RAXA 2PMZD 2DGOA 2HWTA 2CJBA 2VBWA 3ISZA 3NMAA 2D74B 4KJIA 3LOUA 2KXHA 2OSRA 3OV7A 2EBGA 4ECVA 2AYBA 1W2IA 1WHYA 3KJVB 4OLPA 1S6OA 2J6TA 1VQOS 2F9DA 4ZVGA 3BB5A 3OL6A 1QAIA 2EK1A 4K4XA 3SV4A 3RBDA 1RTDB 4JOUA 5J1EA 4NLGA 1HI0P 1VIOA 3U1MA 3UR3C