3A1YG

The structure of archaeal ribosomal stalk p1/p0 complex
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
284
structure length
211
Chain Sequence
MAHVAEWKKKEVEELAKLIKSYPVIALVDVSSMPAYPLSQMRRLIRENGGLLRVSRNTLIELAIKKAAKELGKPELEKLVEYIDRGAGILVTNMNPFKLYKFLQQNRQPQPLEVGLDVLAVYEDGIVYTPDVLAIDEQEYIDMLQKAYMHAFNLAVNIAYPTPETIEAIIQKAFLNAKTVAIEAGYITKETIQDIIGRAFRAMLLLAQQLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosomal protein
molecule keywords 50S ribosomal protein P1 (L12P)
publication title Structural basis for translation factor recruitment to the eukaryotic/archaeal ribosomes
pubmed doi rcsb
source organism Pyrococcus horikoshii
total genus 56
structure length 211
sequence length 284
ec nomenclature
pdb deposition date 2009-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00466 Ribosomal_L10 Ribosomal protein L10
G PF17777 RL10P_insert Insertion domain in 60S ribosomal protein L10P
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1730 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3a1yG01
1ZAVA 1ZAWA 5GAGI 3J7YI 4V19J 4UY85 5D8HB 5GAEI 4NWBA 2QA4G 3J7Z5 3A1YG 5GAHI 3JSYA 5D6GA 5GADI 1ZAXA
chains in the Genus database with same CATH superfamily
3DRPB 2CQIA 4H4MA 2OPQB 2QSFA 2CVEA 3RBEA 4OI1A 3MUVP 4ED6A 4EBDA 5DZ7A 2BW7A 3AD7C 2BM1A 3A3PB 2ADCA 3PCOB 3Q8YA 5EGYA 4RNHA 2G4BA 3GYNA 3MEDB 3UNGC 5E33A 3ZZYA 3DU6A 2VBZA 4CQ1A 4R5PA 3M32B 1FJGF 2IM0A 3Q8RB 4RW9B 1TL1A 2D7SA 2YH0A 3TEGA 2W4CA 3S8SA 4NI2A 4OX9F 1U1NA 4CP5A 2DNLA 5I3PA 3NS6A 1Q8LA 2VBYA 3DOMB 3A8JA 1O0PA 2ZE2B 2Q66A 3UN5A 2NXCA 4JYAJ 3DHXA 4OZ2A 3EWGA 2RSQA 3HDSA 3Q22A 4CH1A 4KHMA 2D3OR 1KBRA 4LF4J 2CG4A 4LRDA 3CDUA 3AFGA 2J7WA 5IT4A 1WC1A 4YR3A 4FNIA 1LWCA 2CADA 2DH7A 3PFOA 4KPCA 3IRXA 4DPXA 3RB6A 3PR5B 2OUGA 1S49A 3MFIA 3PO5A 4JYAF 5GAHI 2QFIA 2BMBA 1EETA 4ECUA 3C19A 1BHNA 3JQKA 4QW9A 1DQ8A 1SJQA 2DNGA 3EXYA 3KLVA 4LF4F 5AXKA 4M5JA 1DAXA 3NGRA 3W1YC 1KEKA 2YNHA 4JP8A 2HHVA 2OPPB 2KFYA 3QT7A 2JLEA 2PMWA 1IKXA 2YBVA 5KG3A 3VWSA 3O8WA 3V4IB 2BQUA 3AXMA 2ZJRQ 1B99A 2FLLA 4PCQA 4OJHA 4CWBA 3SDEB 4L6V3 1FRHA 3GIMA 3DGPB 3BDEA 4ZN3A 2OELA 4EYIB 4B08A 4KFBA 2RKIB 3HHDA 4JOUA 1KQGB 3JSMA 3VGVA 1B0PA 4NOHA 1UWBB 3JQMA 1KSPA 3KHLA 3D5MA 1TR0A 2KT5A 5CYQB 2QA4S 1ROFA 3T3FA 5BYQA 2CNKB 4OJGA 2LDIA 4DR1J 4LF5J 4Q0BB 2FHKA 1CEZA 2LVWA 1AA1B 1OPZA 1C1BB 1NB2A 1P1TA 5KFUA 2EI5A 3AODA 5DDPC 2ZBPA 3HSZA 1SJ3P 2CDRB 4LF9J 4LF1A 4K4SA 1N5VA 2FZKB 2C3MA 4DN9A 1S59A 2ZOMA 3LP2B 2DO4A 4KQZA 5D3GB 5HMXA 4EFAC 4QIEA 3S7RA 1ZZNA 1RT6A 4K7QA 3D6TB 2J9CA 4PR6A 3FMBA 4DR1F 4X4SA 4LF5F 2ZKUA 5C42B 3HLUA 3KK1A 2R8IA 3WIUA 3B4DA 1KTVA 1S6OA 2MXYA 2RD5C 1UJ5A 2DGWA 2HVEA 3IM8A 4ENOA 3CXCR 5KFPA 3M8PA 3P45B 4LF9F 4RUHA 1HNZJ 5H1SV 5F0WA 1TL3A 3JS9A 4GKJJ 3DYAB 3QATA 3D54A 3R2CJ 1T9UA 2P2CB 4OHVA 4DUTA 1NSQA 3W65A 5L1JA 3CDBA 5KFCA 1SC6A 5HP1A 1SL0A 2FJBB 2C2DA 2Y8YA 3N01A 4ZPVR 1D8YA 1D0EA 1RACB 3Q83A 2BJ1A 1JLCA 2FY1A 2AYGA 2QA4G 3M30B 2CJQA 1HNZF 4G1PA 4C8ZA 4J9SA 4X4UA 4GKJF 3GJQB 5D0RA 4X4OA 1N6QB 2AEMA 3LP1B 5L39A 3KUGA 1F3VA 1WC0A 2MYFA 2OIHA 1U6ZA 4OV6A 4DSKA 3QJJA 2XSJA 5D0EA 2DVIA 5CYMA 4D3GA 2U2FA 2C3UA 5CCMA 3CCTA 4DFKA 1U45A 4C8YA 2ZFHA 4RW6A 2LP4A 2D74B 2ZD1B 2CQGA 1RT1A 1N0UA 5M2UA 3MTJA 1DRZA 1P9QC 5F3TA 2I2YA 1UWAA 1FWKA 4A46A 3PG9A 1JX4A 2ASYA 2XG8A 1T05B 4KE5A 2BJEA 4X4VA 5B7WA 4USTA 3AOAA 2DR6A 2WW8A 3MFHA 5AE3A 3T1YJ 1Y4ZB 2IM1A 3ZTRA 3N79A 2HNZB 2B5JA 1WF1A 1IR2A 1M5SA 3R5GA 3SFGA 2CWKA 1X4DA 5DGAA 4WFBQ 1OSCA 2D9PA 5HJYA 5HLFA 1T7PA 2WONB 4WYWA 3TZWA 4G3IA 2OFHX 4BC9A 3HP6A 1SQFA 1YDLA 1IJFB 1D8ZA 2ZBRA 2R42A 3OUYB 1JXLA 3G82B 2F8HA 3AD8C 3T1YF 3TA2A 1X4GA 2PIIA 3FEZA 4OJ3A 4P2MA 1DLOA 2VC0A 1TV6A 4PPZA 2ZH3A 3V6DA 1BWEA 1DURA 5G0RA 4NE9C 2EFVA 4X62J 1VQPS 3SV3A 1TUGB 3HF5A 3T5KA 3DFEA 1J5OB 4JI2J 1IVZA 4IUFA 4AL6A 3C14A 3VZIA 5DG8A 3KHHA 4ECTA 2UUWA 4WE1A 2VBXA 3ZTQA 4A8KA 1X4AA 2MZQA 1NMEB 2FLNA 2BE7D 2VFVA 4LRAA 5GMDA 3FEXB 1EHWA 5DQIA 2MJUA 1AFJA 4B17A 2XZTB 1A7GE 3MAQA 5DDOC 2QZ8A 2W2QP 3VAJA 1SB6A 4DPOA 1YSJA 4ZS6A 4X62F 2LFVA 5KAKA 3BH6B 1KDNA 3MM5B 4JI2F 4ECRA 3Q8SB 3F41A 2DXFA 1C4AA 4TLRA 4M5MA 2IVFB 2R8JA 2BV3A 4LBHA 1RADB 2BE9B 3CT9A 4DHVA 3D67A 2PA8D 4U7UK 3SIPB 4LMZA 2A6OA 4ZCLA 4ED4A 1NBEB 4CLWA 5KFNA 4DS5A 3MMBB 4K4VA 2VG5B 3CCRS 2V9WA 4X4QA 1TKDA 4WFAQ 1SKUB 2V4JB 2DRAA 1RAJA 2EFPA 4NA1A 5J2NB 2YX1A 2MY7A 4ZCIA 2QE5A 4PXBA 3BGRA 1JWWA 4FXWA 2F4VJ 5AE2A 3HHNB 4KGVB 4DWIA 3W2WA 1JNRB 4ZVUB 3BBCA 2H9ZA 2HGLA 4NZ7A 1LXJA 1YHQS 2K06A 2JRSA 5F8IA 3MOJB 2WSEC 2OLWA 3LGMA 2O66A 4A8OA 3MR2A 3BJYA 3W2VA 4F2SA 2Y0SD 2QG9B 3CD0A 4FKXA 3W63A 1JLFB 3NNHA 2RRBA 2KFNA 1REVA 4ECQA 4N41A 3KK2A 2Z8QA 4PXCA 2ZUAA 4URGA 2F4VF 5A0YA 4V19X 1E6VB 2MHEA 2VDIA 2E1RA 3THPA 4DFMA 3NBPB 2GIRA 4JI6J 1RDRA 3LUYA 4G1IA 3O2IA 4AL5A 5KT3A 1VS3A 2UVVA 3C3LA 1KWMA 2RF2B 1FESA 3JSBA 2NZCA 2NPIA 1RTIA 4F3MA 1U6BA 1U1KA 4ID8A 4P52A 3PYFA 3HT0A 3QSYB 1UEVA 2M3DA 4OX8A 2K3IA 3CD5A 3DOLA 3DKDA 2GAHC 1H38A 1V6HA 5ETVA 4ZMMA 2GJFA 4F0HA 3FDSA 1SI9A 2I9SA 4FPRA 1FRXA 4CNYA 3NRBA 2HS3A 3H2LA 1Y3JA 3SSSA 4NCAA 5THWA 1LWXA 1HMVA 1NPRA 1MLAA 4QU7A 1WG5A 3TUIC 3HVTB 1YVFA 2AJ2A 1U02A 3QAUA 4KAIA 1W2BR 3AOCA 3EJMA 2HWIA 3LTOA 2WZ1A 1F6TA 4PEOA 5KFJA 5GAEU 2XGQA 1RT2A 2ZZTA 4K4YA 2HMIB 4OHZA 4GVBA 3MM8A 1VK3A 4TKTA 2DY9A 4FNHA 1UVLA 2M52A 1QVGR 1X5OA 3V81A 4KBIA 2RDIA 1HQ2A 5L8RC 3KLFB 1H2VZ 1RABB 1ZETA 1VC6A 2VICA 2WVFA 2KHCA 5K14B 3R5AA 2DPIA 3GWCA 4B3OB 1C0UB 4RLEA 3NS5A 2E1CA 3TJAA 1WG4A 1V3SA 2KZMA 5A8KA 3O3LA 3M6VA 1K1SA 2Q1LA 3HVRA 2B9YA 2ZKTA 2QMXA 1TKTB 3U02A 3PJXA 3CCVS 1RU2A 1VLOA 4QIWD 1SC1B 5DG9A 3U1LA 1YJ7A 3TEHB 1FVSA 5DM7Q 3GSDA 5F0UA 1BQMA 2KHDA 2KG0A 2E44A 3G8SA 1TL5A 5I4MA 3GIKA 2K2PA 3BDPA 4M63A 3TZYA 1V5VA 1RT7A 5CYJA 7AT1B 2KJVA 3JYTA 4TN2A 2JEIA 1C1CB 2HHQA 5ITHA 1HNIA 5CABA 3GYGA 4HEA9 2JX2A 4CO5A 3HFZB 2XTJP 3ITHA 5EWGA 3W8GA 3IFEA 3ZZ0A 1U7LA 3MPDA 1IKYB 3DM2A 1T9YA 2R7SA 3GYXB 2K7JA 4PYAA 1CJTB 3LP0B 2FJVA 4WFNQ 3CJKA 4PUOB 1HBMA 6FDRA 2YKOA 4QBUA 4RNFA 2V9KA 3KOAA 2DKOB 5C24B 5I3UB 4NLXA 5J2PB 1KC8T 1MNEA 5ETOA 1P27B 2QL9B 1Q78A 2LQ8A 3CCES 2EG2A 2MY8A 3RB3A 1S0OA 1I6JA 1SQEA 4PG7A 4M94A 1ZA2B 4C97A 2YWEA 1S72S 1NM2A 2DHAA 4OZ0A 2BQRA 3O1LA 2HQCA 4DG1B 3T9ZA 2NXNA 3MM9A 1N5YB 3EE3A 3M1VA 2R8HA 4TU8A 4CCHA 2MZTA 3OXGA 4LJMA 1RU1A 1TK8A 1CS4A 1ZAXA 2CQCA 2UUTA 2Z2MA 3HPOA 3PO4A 5T7LA 5B0AA 4KHPJ 5K8OA 3HVWA 1Y5LB 4H4MB 4UOGA 3CMES 3M2UA 5KFIA 2AGQA 3U7JA 3I56S 2XMKA 2XGPA 3EYZA 1WI6A 4H4KC 5SUHA 4WU3A 4DS4A 4OV1A 1WDTA 3F56A 1FXRA 4IRKA 1VBKA 5G4DA 5A8WA 4CLFA 3OVAA 4P71A 2IMWP 5F8JA 3FCVA 3PYGA 1U8SA 4PKDB 1URRA 3VALA 4R5PB 1S4EA 3HD1A 1XWLA 1DQ9A 4KHPF 1TL1B 2CQ4A 1I1GA 3KK3A 3IXQA 1EKRA 4HH1A 2HS0A 3DMJA 4NI2B 3A8KA 3LO3A 2Q6BA 2ZH4A 3DLEA 5DZ6A 2VA3A 1CQMA 4RL1A 8RUCA 4QCLA 2YX4A 4R25A 2IFXA 2EFGA 1QTNB 4UW2A 1IBLJ 2D9OA 3MR3A 2HFNA 1WOOA 2F63A 3G6XA 1NDLA 3UDVA 4CM0A 1GX5A 2HBYB 1NAQA 2NQPA 1GX6A 1APSA 4DL7A 3QGGA 1LWCB 1JKHA 1O5JA 3MM7A 3IRXB 3ETMA 4AXJA 1RTDA 4OJ1A 2H5JB 4KRWA 3QFHA 5KFVA 2J8SA 5FLXY 4Q44A 5CXTA 1EETB 1O8BA 3BKTA 4YR2A 5ETNA 1IBLF 3QIDA 1CBKA 4NMLA 3NGUA 2ZM6J 4DV3J 3CE8A 3I96A 1HARA 1VBYA 1QSSA 2YNHB 1T02A 9RUBA 2GMHA 1S1XA 1HHSA 2KB2A 2YQ0A 1IKXB 2VKRA 3CCZA 3M2RA 4M5HA 2OEKA 3QBCA 1NK9A 3JTOA 2XHWA 1DARA 1BD6A 4KFBB 5B0CA 2ZM6F 4DV3F 3JSMB 1IBKJ 3EX7B 1HWIA 2NYIA 4Q43A 4O3OA 4AFFA 4CO4A 1I94J 3FCWA 3UD3P 3N0VA 4FZVA 4NL5A 2BANA 2IA0A 2V63A 1VI7A 1VQNS 5KFGA 1OPIA 5T41A 3T9NA 1HQUA 3BEGB 3A12A 5FJ4A 1RWXB 4USUA 4QU6A 1R27B 3UD5A 3K57A 4F4XA 3SCIE 2MQ8A 5EDWA 2DJWA 2RAQA 1HPZA 3I5CA 2G2YA 1I94F 5AXMA 3ZC4A 2LEBA 1RT6B 2P8IA 4WBFA 1JXVA 1R8CA 3AY0A 3DDKA 5KFKA 3KK1B 1OY6A 3OJUA 3K0JA 5A6WA 1NKBA 3W5YA 1FA0A 1NSPA 3M8PB 2X1AA 3R5DA 3NNAA 1RKJA 3IBWA 3I31A 5HQLA 1TL3B 1C4CA 2DGQA 1KR4A 2IRXA 4LT6A 1YJNS 2F7VA 2H65B 4TU7A 5ETLA 5HP1B 1TVRA 4WK1A 3KUEA 1X31C 4KHRA 4FVCA 1MWYA 3IS9A 1VQ9S 3TX8A 3ETOA 2AX1A 4JV2A 1XR5A 2HVZA 4JBCA 4QR2A 4ZVQB 2HHSA 1FERA 1JLCB 1CLFA 1IKWA 4P2XA 4RW4A 1FKOA 2DB1A 1QTMA 1O6XA 5JJBA 1XMQJ 3NCRA 5BYRA 3DHWC 4O0NA 3Q0AA 1ZH5A 4DL5A 1WELA 3ULHA 2XLIA 2XSJB 1VRTA 1ICEB 4KGMA 5CYMB 4I69A 2XBPA 4ZHRA 2XS7A 2KN4A 4RW6B 3IR7B 4N7TA 2AT1B 1RWVB 1ZM2A 3ILJA 4DR6J 3CC7S 5FLXU 4TXSA 5GAGU 3UD4P 5KFFA 3G2XA 1QSLA 1RLCL 1DFDA 1XMQF 2VPWB 1HHQA 1KHWA 1VQMS 3H5XA 1YJ9S 3R7NB 4KTQA 4OZ3A 1KQFB 3BSNA 2CQPA 4QJVA 3HCXA 1HNVA 4I4BA 4LF2A 2B56A 4DQSA 1FK9A 3EGNA 2J0QD 2K3KA 3FK4A 5AJ3J 4DR6F 2X3DA 4NASA 4CLLA 2VFSA 1IR0A 2B5JB 2IIHA 3H25A 1GFWB 1AYEA 1K0VA 3VTIA 2CPJA 2O3DA 1H0HB 2FHMA 4A8SA 4L3NA 2BJ8A 5HLFB 3M8RA 3OSNA 5F8HA 5L9XA 3M8ZA 5LXRA 1U4BA 2V50A 3K5NA 2XQCA 1IXKA 4YHHJ 2YKPA 5AJ3F 2J8AA 4NRTA 4FF2A 1DLOB 3K8WA 2AYBA 2L48A 2AJ0A 4GC7A 2EWHA 1BC6A 4TLQA 3Q8VA 3AJDA 5G0RB 2HW3A 4ZKAA 4UQTA 1S7HA 4OYXA 3L4BC 2X7IA 3D2WA 4RUAA 3OSPA 2VOOA 4NLSA 2XULA 4IRDA 1PJ6A 4QYRA 2WTFA 2R7QA 1JIHA 2FJWA 3MDFA 3Q89A 3JAMU 3C14B 3C15A 4DV4F 2ZC3A 4J90A 4E8UA 4NLQA 4DF4A 1YJUA 4YHHF 4WE1B 3EUNA 2IC3A 1F9HA 3E8OA 3KXDA 1QDUB 4ID5A 1OS5A 3MCOA 3ILLA 2WVCA 4NA3A 3WQPA 1NJIT 3RU0A 2E1MC 2W01A 1WKJA 4WFZA 2MQOA 2WW4A 3PRVA 1B0VA 2ZBQA 3BR9A 5A6PA 1I51B 4ZPDA 1JB0C 2X1BA 2JFKA 1KQKA 3CCQS 4OI6A 3H98A 4DUZJ 2Y1LB 3TAPA 1U1PA 3ZO7A 2W2MP 2FLPA 3OTBA 2YXLA 4A4JA 2MGZA 1DQAA 4Y2IA 1ULRA 3G96A 3GPAA 2V8VA 3H5SA 4HLBA 4QIVA 1NSKL 3ZZUA 1GXLA 5FD1A 3RAQA 5KFQA 1FRKA 2E5IA 3LGHA 4X4PA 3A8EA 1WUUA 2JHEA 1MMNA 2HSEB 3BGRB 4DI6A 1TZ0A 2ASJA 2QC3A 4OYOA 1HWKA 3QLHA 1Q1KA 4DUZF 1Y5IB 1U2CA 3W2WB 5IQ6A 2JC1A 5JUMA 4QQBA 4RBUA 3ICLA 1VK8A 1HHTP 1UTAA 5DM6Q 2Z4PA 4IRCA 1EQMA 2PE8A 4AT1B 8AT1B 4DV1J 3OVBA 4XDCA 3W2VB 3IWLA 1T9XA 4M5LA 1BXNA 5KFRA 2ZITA 3RW7A 3UCUP 4RR5A 1REVB 3KK2B 5KFDA 3FSIA 3FUYA 1CULA 2DR8A 3UDCA 5A0YB 1VISA 2AQ4A 4A8WA 2UUAJ 5EX3A 4AD6A 4DV1F 2YX7A 1PCAA 2B8QA 4CDIA 1H6KX 1YX2A 2YPZA 3DNCA 5KG7A 5H9EK 2C22A 1HQEA 2V8GA 3G8TA 2RHSB 1EIYB 3NEKA 5KG1A 3J7A1 1SXLA 5ETRA 1RT5A 3DOLB 4I2PA 1YJWS 3ZTPA 2JC0A 2NXUA 1XIQA 3MAAA 4DPWA 2UUAF 1YZ7A 1HL6A 5KFAA 4ECWA 2NUHA 3I0RA 4C0BA 2KXFA 1M5HA 1HMVB 1FE4A 2G1DA 2HWHA 2RJZA 1VBXA 1AFIA 4O3RA 2QA1A 3V6JA 4NPOA 3DLKA 3D0GE 4NCGA 4C3LA 4ZLNA 1S9FA 1KVIA 4DFPA 1X8DA 4O4GA 2M8HA 4LVNP 4J91A 3KJFB 1RT2B 3M8SA 1JJHA 4GVBB 2P5VA 3MM8B 2QEXS 3H2UB 3M9NB 4JI3J 1WJ9A 2FY8A 2DPJA 3V81B 4E98A 2I5JA 2HWTA 3I9V9 3CVKA 4I1TA 5HQMA 2PT0A 1YLXA 1HWUA 1WORA 3N6MA 4FS1A 3OD2A 4OLPA 4OX7A 4V19J 4AL7A 1RWMB 5A8KB 5MAOA 2VJVA 2YWKA 2BKPA 1K0TA 4JI3F 2H48B 2YQ3A 5ETTA 3VAMA 3OHBA 4IKAA 1BQMB 2AX0A 2DNNA 1D9AA 1XK8A 3C6UA 3NGSA 5E41A 2YNGA 1RT7B 2J76E 5D15A 2HAIA 2ASLA 3THVA 1ZBTA 3JYTB 2HNDA 2HBQB 2CQ0A 4Y2CA 4UQGA 1HNIB 2IY5B 1WC3A 1S76D 4U7CA 1P1LA 5E5NA 3ITHB 3K5OA 1IWAA 5GMKa 3D1HA 1R6VA 3CTRA 4RWWA 1Z4UA 1ELOA 1JJCB 3DM2B 2Z0GA 5LSRA 3PVXA 3CJKB 2MQPA 1IN0A 1HBMB 3MZIA 1RBLA 3EVOA 3C6TA 5DLFA 1S6QA 2EKYA 2OJ3A 2ZWPA 2CDQA 2GVDA 4IG0A 4YR0A 3EPGA 4B9VA 2GO8A 3SFUA 3BO4A 3H4BA 4XDDA 4X66J 1WHVA 2F1FA 2XMVA 2Y9HA 2YWGA 1CJVA 3SI8A 2HNYA 4V1Ak 4MK7A 4ANCA 2HHHJ 4I64A 3MPUB 1S5ZA 3MM9B 3TWZA 1X4CA 1FWPA 3M1VB 4QR1A 5KT4A 5DQHA 2HZAA 1H7XA 3RW6A 1NSAA 1CS4B 1FNOA 2O1PA 2VKZG 4WK3A 5T7LB 3DLJA 3NWGA 1VQ5S 1TAUA 2BE2A 4NYPA 3FZ2A 5HL7Q 8ATCB 4LR8A 3E01A 3M2UB 2XYGB 5HI7A 4X66F 1F1BB 3R7SB 3NOGA 2GMLA 4YP3A 1WC6A 4EYHB 2HHHF 1RHUB 2FJEB 2FVPA 4N77A 1NNDA 5DJBA 1NKEA 3RB4A 5A8WB 4HACA 3GR0A 1NH7A 2J9EA 2M7SA 3Q8PB 2HRTA 3W8PA 3AJ1A 1NDPA 2X3GA 2IDEA 1MMDA 4F26A 2E5HA 3KK3B 3OR1A 4C8LA 3DMJB 4DPYA 3MEGA 2ZOGA 1XEZA 1TUVA 2W9BA 1HFEL 3CJQA 4C2MA 1X5PA 4DF8A 3FQLA 3H4DA 3DLEB 3TI0A 1DJ0A 4KT0C 3KDOA 2VFRA 2XO6A 2MKYA 3GMGA 3GG1A 1RKIA 1RT4A 2N4DA 1S57A 2M2BA 1EARA 3EDQB 4FF4A 4J9LA 4EGLA 3HKWA 2E7XA 4ED7A 4LR7A 3TUJC 2WSCC 3WC2A 4QWDA 3HXMA 4U6PA 3D4JA 1DBDA 5RUBA 1ZAWA 1JKHB 3PW7A 3NXZA 3MM7B 3H5UA 4OYBA 1RTDB 3FRYA 3ZFVA 2QRRA 2DGVA 2V6AA 4IQMA 2MKJA 1WOPA 1SH3A 4KIAA 1R6YA 1VQ8S 1RZMA 3I6PA 5KG4A 5HMZA 1UVMA 2VFTA 3WBZA 1VQ7S 2KVIA 3LWMA 2XHCA 1FNMA 1WNEA 4K50A 3MURP 4XO0A 1S1XB 1WTBA 4NX9A 1OSDA 1TU0B 1U0SA 2ZBIA 5DRKA 3MD1A 2Z2LA 1UVJA 4RKUC 5JXSA 3H7HB 3M2RB 3CDEA 4CLKA 2AP6A 2MQQA 5F9LA 3BQ1A 3LAKA 2DBBA 4DN0A 4WP3A 3MR7A 4HTJA 4EZ9A 2ZH6A 4HT5A 4BWMA 3BH7B 3AQPA 5GMEA 3OHAA 4MKBA 4RWXA 3IP0A 2VG7A 4RJVA 4KH1B 3V5RA 1B7YB 2M4MA 1U2FA 1FJEB 3LF0A 2BANB 3GFHA 4OHWA 4ECXA 3M6UA 4KSEB 2CQ2A 4KYZA 2MKIA 2O01C 2V5HG 1RYSA 4RW7A 5ADZA 1F5CA 1HQUB 2CJXB 2GGPA 1V3RA 2ZDOA 6FD1A 2ZH7A 4A8FA 2FLOA 3N9UC 4KGXB 3W9JA 5LJ5Y 1SC4B 2XZWA 1WC4A 3W9IA 2H4WB 1HPZB 4JV0A 2QL7B 2N7CA 5HAOA 2HIQA 4QOTA 4DR5J 4JI1J 4LQ9A 2G1HA 3UDLA 2W4PA 3DOKA 5K5MA 2B6AA 2PN6A 5F8MA 2RVJA 3T5LA 1MW7A 1S12A 4MTPA 5AT1B 2VOPA 1LWEA 3EZUA 2DCLA 1YBTA 3CO0P 1LWFA 5KFTA 4F4YA 1BQNA 4RBVA 3N6NA 4DR7J 3E2EA 2LYVA 5IQQA 2HFZA 2GIQA 4IG3A 4JI1F 2KDOA 1Q5VA 1UPPA 4FS2A 4ES1A 1RP5A 2DH8A 2WCXA 1YBAA 2KU7A 3K2YA 1TVRB 4NYOA 4FN5A 2YKQA 1S1VA 1DZ5A 3HJVA 3IS9B 2P9EA 4PWDA 1MMLA 3PZPA 3I9ZA 3GLJA 1IKWB 5E3PA 1FEEA 1FKOB 3OPKA 2HFOA 1Z2ZA 2F8MA 2OMLA 1RHQB 1U8WA 4HL9A 2MKSA 1ZPWX 2HVDA 1RAHB 2A3JA 3NLCA 3VGUA 4ZJOA 2PI4A 2NSBA 1FDBA 3FSXA 3GB0A 3GV8B 2AGPA 1VRTB 1JLBB 4ZA1A 2BOPA 5D0HA 2DTJA 4NXMF 3CDAA 4CH7A 3KNAA 4ZHRB 2AYMA 4IO9Q 2FGCA 3F44A 4NLVA 2XLKA 1UVNA 4J9QA 3V2UC 4LF8J 4YB5A 1PG5B 3QT5A 3PHEA 2A6MA 4C8OA 3G86A 1TKZA 4USIA 1LW2A 3RJMB 4DQQA 2F9JA 3R1LA 4I2QA 5GAEI 4YQWA 3VAKA 2G0IA 4K4WA 4NYZA 2YQ1A 4K5SA 2E7VA 3PHTA 5ETMA 2L08A 4UTGA 2ERRA 3QRQA 2RU3A 1HNVB 2XO7A 2AJ4A 1UETA 1HBNA 1EQ0A 1FK9B 2CIMA 1RHMB 2VG6A 3RBDA 1X5TA 4LF8F 2OTLS 3JB9k 2HK3A 2CPXA 2B8PA 1GNKA 4USMA 1X0PA 5U47A 3KG1A 5EX0A 4DU8A 3TJ9A 3CGIA 3M8YA 2RQMA 3ILIA 3PYDA 2RMLA 5DETA 1JJ4A 1UW9A 2HGNA 1Q16B 2AEFA 4DSJA 1RQ0A 4OLOA 5KOXA 4UY8T 2WOMA 4OHYA 4PZVA 3CIZA 2OAUA 3B78A 3GU0A 2QO3A 4LFBF 3IG1A 1NHKL 4Y65A 4M5DA 1Q7YT 2ZZNA 3GFYA 2WVDA 2PMZD 3NKYA 2L41A 4WXOA 2VL1A 3NNCA 3PYEA 2QLFB 1I5OB 1TL4A 2EBGA 1RWUA 4UUXA 1TTHB 3VVUA 3WHIA 3C15B 1RWPB 1R8BA 1GXUA 1H2UX 2QN6B 1T3NA 2AZ1A 1TL7A 4NLWA 2IC3B 1UJ6A 4F36A 4ANDA 2W9AA 4ID5B 1IUJA 2MZ1A 4P2SA 1IBMJ 2P9GA 4EK2A 3V4MA 4ZP8A 2LECA 1VC5A 3IBCB 2HBZB 3L7UA 5E3RA 1VQ6S 4B9TA 2V69A 1PYOB 4TYBA 2LMIA 4OX9J 4HVZA 3QNWB 2CNOB 3D7SB 1VGYA 3JTNA 1A6LA 4USJC 4F8RA 4LQ3A 1FNXH 4WYLA 3ZZTA 1QJHA 1HI0P 2V67A 4Q5VA 1S9EA 4UUWA 1RYRA 2MGZB 3CULA 4DR3J 5LMUJ 1IBMF 1EJ7L 1RGVA 3IBFB 1OQ6A 1VQYA 1LOUA 4WKRA 3OL9A 3VAHA 4O3NA 2UVUA 3I32A 2VPZB 1T03A 2B4PA 2HQIA 3DLLQ 1PAUB 1VIXA 1CC7A 1SJFA 2B9XA 3QLHB 1T11A 1S4FA 3MMCA 3SQOP 4ED8A 2DHGA 2DGUA 2IM3A 2B7CB 3MECA 2R8GA 1VHIA 4O0IA 3FBFA 2AHOB 3IN5A 3R97A 4XPEA 2IVMA 3RBZA 4DR3F 5LMUF 4A8YA 1G6BA 5B09A 4HR2A 1K44A 4DQIA 1NPKA 3UCZP 4P72A 5CCLA 1PJ5A 1YRTA 3ZTSA 4YDXA 5LL6d 1UZDA 1CULB 2I0XA 2ZJPQ 3MMAA 1WI8A 3TO8A 1YRUA 3ONQA 4WZQA 4IOCQ 3FMWA 1SQGA 5M2PA 1NUEA 2M5YA 1UKUA 3VAIA 1LW0A 2FVRA 2IYGA 3LA0A 2H5IB 3QWUA 3S1TA 4RO0A 3VHQA 3CB4A 3B82A 3M6XA 5H9EJ 3DRSA 4ICLA 4MJKA 4FKYA 1BMQB 2VZ9A 2PFFB 2LXFA 2CQDA 2NCKL 3MPVA 1RT5B 1N88A 4I2PB 3HK2A 1TP7A 2MLZA 3BO2A 2BJ9A 3MAAB 2E1AA 5C2CA 1YITS 3N5FA 3I0RB 2W9CA 5KT6A 2AGOA 3SEOA 3E51A 2I1RA 2XM3A 2VB6A 1QAJA 4A8QA 1U09A 3UPFA 4J9PA 1NJZA 1SJRA 4NLOA 3VGSA 3DLKB 4CIOA 4U67Q 1VDHA 2FPHX 3PW4A 2V34A 3FZBA 5A2QU 3UE2A 2YNFA 4O4GB 5L38A 3LPYA 2ZHBA 2RUGA 3EZOA 3EZ5A 4IDKA 4LBPA 5HBMA 4ED5A 4J9OA 3LWLA 3KFWX 4P2FA 4JUZA 4L75A 4GRSA 1HKAA 2K7KA 2OH2A 3D66A 4UT4A 1VQLS 2VU5A 5EWEA 2I5JB 1GMUA 1DTQA 2L9WA 1E6YA 3OFHA 3RTVA 2ADBA 2DNMA 4FBUA 2VA2A 2RE1A 1YIJS 1RHJB 2M8DB 2RHQB 2MZRA 3HFKA 2BA9A 2XEXA 1RA7A 2L3MA 4OZJA 4LFCJ 3W61A 3NCQA 5F8LA 1MSWD 4LVOP 3W7BA 2HAFA 5I42A 2JEJA 5BR8J 1G7CB 3BGFA 1RUSA 2LQ9A 3C6UB 3SV4A 2YNGB 3GJSB 3OTCA 2FHJD 2HNDB 2UXCJ 5A76A 1YBUA 2FHJA 3KMQA 2W2OP 3NS7B 4LFCF 2QX0A 2QGFB 4IOBA 1N54B 1XC9A 1YKWA 2PEBA 4UOHA 2MSTA 2E1PA 4OZ5A 2ZJQQ 5BR8F 2XS2A 3P5BP 4QIGA 1HYSA 5F9NA 4WPAA 3DYAA 1MN7A 3POTA 4N56A 3G8QA 3OFEA 1WWHA 2ZH5A 1KS2A 2MLYA 1PBUA 3MXHP 2FJAB 4KV8A 4O3PA 3C6TB 1SL2A 2JJ4D 2UXCF 1S6QB 3PFEA 3D6FB 2DEIA 2GVDB 4IG0B 4MYUA 2IMOA 2B4VA 3UN3A 4ZLJA 2W7AA 2HURA 2KXHA 2K8GA 3AJ2A 4J9MA 4G65A 1ZM9A 1CJVB 2L9NA 2HNYB 4NZ6A 4ZCMA 3TARA 3W3SA 2VQFJ 2N4CA 2X1GA 1I3OB 3CJSA 1Q5YA 4BWJA 2LEAA 4R8UA 4DEZA 2P6SA 3BGOP 2BE2B 1QUPA 5KG0A 4AXIA 2R2TA 3E01B 1PYSB 4IO1A 1Y3KA 3MM6A 1WKKA 3DRXA 1KHVA 3AQOA 2V8HA 3QJLA 3FSYA 3VCDA 2GW8A 2VC1A 5GAGI 3UVJA 2VQFF 4LRCA 2W7PA 2I6WA 4RU9A 4RX6A 4QIFA 4KKOA 4HACB 2V68A 3UNYA 2M70A 2OTJS 4WF9Q 2KG1A 2Q3PA 1Y9OA 1NJXA 2M9KA 4ZLPA 1FRLA 2EVZA 3DDIA 3OR1B 4OL8A 1U1MA 1HW8A 4RNOA 5GADU 3MEGB 3P3DA 3I4HX 2BVZA 2E66A 1ZAVA 3IGNA 1RE1B 2W9BB 4DUYJ 2LQ5A 1TKXA 3UO0A 3N28A 1S79A 1LQ9A 4LREA 4M95A 1WDDA 4WJBA 4JI8J 3OL7A 2HHWA 1RT4B 2MKCA 4J9KA 4NRUA 3MMJA 3TX0A 2KXNB 1VBZA 3PW0A 2WB1D 2J6UA 1NK7A 4URSA 3QYYA 1WC5A 2R7OA 4DJBA 4K5RA 2QLJB 1ZM4A 4UOFA 3SBMA 3X1LB 2BZ2A 2DITA 2JFDA 1Z2LA 4DUYF 1RSCA 2CPYA 5J2MA 1KRPA 3CDWA 4I6AA 4W90B 3QRRA 1EKSA 1RWWB 4ZIWA 4JI8F 1F2GA 2DXDA 4PXDA 1FXDA 1PILA 2Y1RI 4UOCA 2SXLA 4DZ6A 2KL8A 1LK5A 1J5OA 1UZHA 3M9MB 4BS2A 1JLAA 1FFGB 3HZEA 1RXOB 1G4CA 4ZK7M 2CPDA 3BSOA 4DX7A 1RJJA 3R6LB 1EP4A 2PSZA 4EWTA 3BBBA 1Y0HA 4MKYA 2KTQA 4DR2J 2KH9A 3DGVA 2MDAA 3TZXA 5K8MA 3HX9A 4X64J 4OYMA 3UR3C 2CPIA 3TUPA 2ROPA 3GV7B 1X5SA 3KLIA 4WFYA 2HQDA 2E7WA 2C3YA 1WACA 1LFPA 2MLXA 2QTWA 2VG7B 1PJ7A 2BACA 1S0MA 4GVLA 1U47A 4WXWA 5ETSA 4ELTA 4K2XA 1FFWB 2V2ZA 2YKAA 3QFWA 4DR2F 3CJ0A 1JLQA 1N4LA 4AQYJ 3GILA 4IFVA 1QY7A 3AD9C 1H98A 4X64F 2K1RA 3KLEA 5E0OA 4RW7B 3OXLA 1N5QA 1S6PA 3EVWA 1CJUA 2ABYA 3OL8A 1XMOJ 2GGPB 5CZXA 4A8XA 1Y11A 2EFOA 2QYCA 2J0SD 2B9EA 2VDHA 3KG0A 2CZVC 2AWZA 1KVJA 3BSAA 4NEZA 4DCJB 3MCMA 2GVZA 1VRUB 4P74A 1U48A 4F2RA 2EG1A 3AB2B 4AQYF 2W2NP 3AAWB 3DOKB 4ZVGA 1R0CB 2PEHA 2CRLA 4PQAA 2XNQA 2B6AB 2AZ3A 1TMJA 1X9WA 4FP9A 3R1HA 5HMWA 1XMOF 1C0TA 1LWEB 5LOQA 2X51A 4E0DA 1B70B 4HDGA 2VJUA 4ZVFA 1LWFB 4QPTA 1BQNB 1EZZB 2WBRA 3NP5A 3A3NB 2C2MB 1SIWB 3H8YA 2VPXB 5L1LA 4KB7A 4IG3B 4WKYA 3TW0A 2APOA 1VRQC 3TZZA 2FYXA 5HVHA 4IFYA 5KFYA 1X60A 2HQGA 1LKZA 4J9RA 4DLGA 4PWDB 1MROA 4PG5A 2CJBA 2ACMA 2AU0A 2JLFA 2CPHA 1H74A 1MU2A 5KFMA 1KTQA 5KFXA 1RHKB 3OT9A 4FYXB 4ZPCA 1NJWA 3LAMA 3TANA 2FVSA 1QM9A 5D4OA 2ZHOA 5HVGA 3R7BB 4ILLA 3PX6A 2W8KA 2VODA 3ILOA 3TAMA 4L76A 1FCAA 3A13A 1BY9A 3ZNUA 3HJFA 1H72C 4XAKA 4Y28C 2J9DA 4GC6A 2ZH2A 2VONA 4YFUA 3CSKA 2CWXA 4H4OA 3CUNA 1NHUA 3U1MA 2ZDPA 2N82B 2BR0A 1TKZB 1LW2B 2E5JA 4I2QB 5JMNA 1VJWA 2BQ3A 1ZTTA 2VF3A 4GO5X 2U1AA 5HK4A 1ZPVA 1FX4A 5DLGA 2B43A 1GT8A 4YOEA 2RDDA 2HIYA 3HD2A 1HBNB 1RLDA 5CD4H 3D1QA 4OI2A 2GIFA 1SH2A 2CKWA 2VG6B 5IM0A 3D6MB 2YPYA 1R8PA 5T14A 1XMBA 3EGVA 2F3JA 1F0XA 4NXNJ 3OQ2A 3HMJG 2J0XA 4LRFA 2R2UA 3CD7A 2AJFE 1U0HA 4J9UE 3G87A 3VF0B 1VHFA 3I0SA 2NPFA 2BRLA 2Z57B 4F3QA 4B3TJ 2RH3A 3M2VA 3MEEA 2RQCA 3RR8A 1YGYA 1ITPA 3I5AA 1W2IA 3PXGa 3D1OA 2WOMB 1D1UA 2FHOB 1EB0A 1FWLA 3BR8A 3IG1B 3PRDA 4M5DB 4ALZA 4LF6J 4NXNF 1QLNA 4KO0A 5IOLA 4FF3A 4XIUA 1SUQA 1B3TA 1QUVA 3N6LA 1WEXA 1RI7A 1TK5A 4OYAA 4JB8B 4C48A 3BREA 4UY85 2PDAA 3HHLA 2V8PA 2ZVSA 2XI3A 2CXEA 4B3TF 4I6WA 1TL7B 5J2QA 4WZMA 3FKBA 1S48A 2ZZMA 4IH5A 1UA0A 1NCLA 1S0VA 1L3SA 3KJVA 2LA6A 4ZOSA 3N5BA 4IR9A 4LF6F 5CA5A 3KLGA 1W25A 3CCMS 3IR6B 2ROEA 3H2VE 2A1BA 1VLYA 2A0FB 1HI8A 5KOWA 4RZRA 2MB0B 3FVYA 3OW2R 2WVBA 3T1HJ 2F4FA 2OEJA 4LRBA 1NK4A 3TUZC 5B0DA 2W7OA 3ET6A 3A8IA 4ZN1A 3QO9A 2EBEA 2JSXA 3CIMA 2DYAA 1S9EB 2E5GA 4Y2AA 1BE4A 3G6ES 4ED3A 5J1EA 4EBCA 3IMQJ 2GAGC 1CJKA 4ZCKA 3Q8QB 3SCKE 3GTYX 3GCXP 3TP2A 5DG7A 1RB0A 4FYDA 4CLZA 4F7VA 1T03B 2HKEA 1U1OA 3KHGA 2RRNA 1YI2S 3T1HF 1M0SA 3MMCB 3GE9A 4U7UD 3ISZA 1C2PA 7FD1A 3T6JA 4ZP7A 5J1PA 3MECB 1RAEB 4P73A 3TNVA 4PABA 2RILA 3C2PA 1SV5A 3HHEA 3UQSA 2PFDA 2V2VA 3Q8UA 2FGOA 1NRKA 1FKAF 1HI1A 5D4NA 1RWKB 1FEHA 3T5HA 4ZIVA 3Q24A 2B4OA 1Q8KA 3RAXA 3MMAB 3I55S 4OI3A 4A8MP 2XC9A 4DL6A 4MH8A 4KGKA 4GMKA 3PY8A 2ZVIA 5LT5A 1LW0B 2V4QA 2C2EA 3MUTP 3ZZOA 4CT8A 3PDNA 2HZCA 2DIUA 2AW0A 3DRSB 4ICLB 2XZDB 1GTEA 1WHWA 1YQHA 4W4MA 2KO1A 3KLHA 4PG8A 4OI4A 1TUWA 1REGX 1UVIA 3TAQA 2W9CB 5KFZA 4DQRA 3Q86A 1HW9A 2CPEA 4LF7J 4O3QA 1U1QA 4F4KA 4NLDA 2UUCJ 4F0KA 2DR5A 4C8KA 2R3VA 2QLWA 2DO0A 1WSVA 1JQGA 1DY3A 4DL0C 2AJ1A 4ED1A 2BJDA 3M6WA 2YNFB 1VQSA 2CJAA 3OJSA 2HGMA 4YS2A 4IDKB 5HBMB 4C98A 2Y0BB 2JOQA 4N5SA 1NZ8A 3C8YA 6AT1B 4LF7F 2UUCF 2DH9A 3EM1A 3PX0A 4ELUA 5IC4B 1YTYA 3L7OA 4B02A 1DTQB 4TY8A 1E6YB 2WBMA 4LSZB 2JWNA 3CCSS 4K8RA 1IM4A 5HANA 1NJYA 2JNJA 3GP9A 3DCAA 3JAMY 1B0TA 4G1QA 1XJWB 2NREA 3P96A 4DV0J 4FVMA 4P7TA 4JV5J 2C2KB 2VBWA 5I42B 2YNIA 1HA1A 3IM9A 1NXIA 2ALZA 3AH6A 3U27A 1TK0A 4PXEA 1IQZA 3CF5Q 4DZDA 3DRRA 1OY8A 3DLGA 3ZZRA 1OYDA 4M1KA 4Q2MA 3T6BA 1NDKA 4Y2MA 1AUDA 2W2PP 4ED0A 3BN4A 1HD1A 2R7VA 3CJ2A 1S1UA 1O51A 4HI1A 4DV0F 4AE5A 1XR6A 5H9FJ 4OHXA 3D0HE 4JV5F 4ZVRB 3GONA 1R89A 1Q4RA 2CG8A 2ZNZA 4OYIA 1HR0J 3BN7A 1HYSB 3POTB 1M5KC 2BUNA 4N8NA 3NMAA 1S99A 5E3AA 3D68A 4NLYA 2HYIB 1HWLA 2KT3A 3PTWA 5M2RA 4CO2A 1WKLA 4KV8B 2GFFA 3DU5A 2YWHA 1MWQA 5FDLA 4FF1A 3BKFA 2Y1JA 2OPRA 3VR1A 4B3RJ 3AXKA 3L7PA 4MKAA 3G4SS 3M8QA 5FIIA 1HR0F 1FO1A 3J7ZT 2DNQA 3PW5A 3V6KA 3O5TB 5AXNA 1JXEA 2GA7A 4LBIA 2GJ2A 4ES2A 2EFNA 4OYZA 3K58A 1RAFB 2EEYA 3HZGA 4YB7A 2XMAA 2CVIA 4R8UB 3VVTA 3FNNA 3T1AA 2JVRA 2E9RX 1Q8IA 1WF2A 2PGCA 4PRFA 1RT1B 2OPSA 2GV1A 2OP5A 1RTZA 4XK8C 2GX8A 1X9SA 4ILMA 2E5LJ 3MM6B 3MF5A 4MYTA 4B3RF 5DS7A 4F4AA 4NCBA 3UW1A 5HROA 1KP6A 2LXUA 4BDPA 1DTTA 1RTHA 4GO7X 1FT8A 3UVJB 3TA1A 1F9FA 2Q6CA 3HULA 3MEKA 3J7AN 3DN9A 1WTFA 1KKHA 3GJTB 1JNZB 2YVSA 4HDHA 4KKOB 2KI2A 1LK7A 3BGUA 1N48A 4CH0S 3RRHA 4OZLA 3S6EA 4XPCA 4PQUA 2DISA 1G3OA 2GCFA 4B9SA 3K5MA 2Z2YB 3ENAA 2E5LF 1Q7LB 1Y7PA 3G6VA 1F60B 1WEZA 1N5SA 2BM0A 3KWMA 2WK4A 3EDRB 1QVFR 1TKXB 2RS8A 2UUBJ 1F5AA 4ZJQA 3EPIA 1T94A 1FHTA 1HD0A 1VIOA 1N52B 2JZ5A 4CLTA 4NLRA 5IV4A 4ZVOB 2F8EX 1HWJA 4DV4J 4EO8A 1A0OB 1T3OA 4CO0A 1OYEA 2DGOA 2CJ9A 3SCJE 1V9OA 1TV6B 1RTJA 3V6DB 2Z56B 1G2EA 4C7QA 2YH1A 2CPZA 2DIVA 4ITSA 3W5ZA 3CJ4A 3HSJA 4O44A 2DY1A 2MZJA 2DNZA 5J2MB 2FVCA 2UUBF 3J81Y 3R8YA 1LV5A 2HBRB 3OFFA 2CAJA 4EZ6A 1NLKL 1X0FA 4ZPAA 3K59A 1JLAB 4JI7J 3CJRA 4U8VA 5EHHA 4HI2A 5ETQA 2XS5A 1EP4B 2JH3A 1NEEA 2E9TA 2QMUB 1R0BG 3BS9A 4ZLLA 2XWYA 3JQJA 4K4ZA 1AB8A 1U2RA 2QLXA 4HYKA 2NS1B 4JI7F 3KLIB 3PX4A 4KPYA 3DXSX 1S7IA 2B3TB 4JI5J 1UAWA 1S77D 2C2OB 4CZCA 2YKNA 2QL5B 2R7UA 4CT9A 4QWEA 3UDEA 1JLQB 2MKKA 4IFVB 4ECVA 2VPYB 3CJ5A 1RWNB 4F3OA 2K1RB 3KLEB 2GHPA 1JLEA 4AYBD 5L1KA 2V94A 3R6GB 3QZ8A 1S6PB 1JK9B 1CJUB 4HH0A 4ER8A 3MI7X 3HSDA 4ZITA 5KFSA 4Y3CA 4JI5F 1NZAA 3V6HA 3NAHA 1SKWA 3O44A 2GVZB 2BEFA 4ZVHA 3NL0A 4MIWA 3OTEA 1R0AA 1OQ3A 2GHVC 2XMWA 4ED2A 3Q23A 1NO8A 4R0EA 1VYAA 4ZVEA 2HQ3A 1BLUA 5K9FA 3H42A 3LQVA 5E3QA 1G1XA 1C0TB 3UN2A 1B7FA 2H4YB 3PKMA 4QYZJ 1FDDA 5AE1A 1H73A 2DR7A 3F73A 4R0JA 4DSLA 3GJRB 2DNYA 5KG2A 2LA4A 4RUCA 3BPDA 2FC9A 4M5NA 3PEHA 1UCNA 4CNZA 3M05A 5D4PA 5HQ8A 1RTIB 1YK9A 1PIEA 2Z2ZA 5JVHQ 1FRMA 4OX6A 1ZM3A 4QZVB 1D3WA 1GTHA 2KM8B 1X4EA 4IFYB 1S6UA 3KNGA 4WP8A 2R7XA 2UP1A 4O3SA 1FRIA 4ILRA 3TOQA 4OQJA 5KFHA 3WZ0A 3FBCA 1MROB 4KR0B 4WIIA 3K5PA 5C5JA 5KFLA 1UP1A 4EI2A 1U24A 1T0TV 3IWXA 3PR4A 2OD4A 2FB0A 1MU2B 4Q8EA 1OIAA 3TA0A 4C4WA 3HVAA 5B0BA 2VIHA 5KFWA 3D28A 4JI6F 2HRUA 2YWWA 3HFVA 5F41A 5HVFA 2MQNA 1XQIA 4DX8H 3ADAC 4DR4J 1LFWA 4LFAJ 3SMZA 4K59A 3W5XA 3TAMB 2IRUA 3THTA 2LDYA 1LNQA 2CJKA 4WP9A 1KQSR 4CYUA 1WOSA 4C8MA 3JXOA 1N0VC 1ZYQA 3FC9A 2QA2A 3J81U 2HVIA 2HHTA 4FYWB 2QV6A 2XY7A 3QZ7A 4NWBA 4TU9A 2B7BB 4RW8A 2EW9A 4H4OB 2Y8WA 1TFWA 2W25A 4MFBA 3CCJS 3VAGA 2IAJA 4F4WA 3MHYA 4F0MA 4EBEA 3W64A 4DR4F 4X2BA 4LFAF 5LMNJ 2WAQD 2DGXA 2DEJA 2IYIA 2D1CA 2JL9A 3CD6S 3CMAS 4OIXA 1YG0A 1M1KT 1R3NA 4B9MA 3WX8A 4YEAA 3FCHA 1OMSA 2FDNA 4GKKJ 3GCWP 1H3DA 2VFUA 1ZA1B 1JMTA 5IXUA 4K4TA 3PIPQ 1NB7A 1VCTA 3K5LA 2JVOA 5IM0B 2MEWA 1KLMA 3NY0A 4FDFA 3VV2B 2HRYA 2F9DA 5LMNF 4UZCA 3BB5A 2RRAA 1GMWD 2P9CA 2IHR1 4PG6A 1VQ4S 4QPXA 1U0HB 1GMWA 3C66A 1ZS6A 3I0SB 3ZZZA 4TNOA 1K47A 2LLZA 1FKPA 2NZ4A 1N36J 2L9DA 3CW2C 4GKKF 1M1HA 5LSOA 2CNNB 3D0IE 2D69A 3ZZPA 2LQBA 2QIFA 4ZVPB 3M2VB 2M0GB 4G6VB 1AT1B 3MEEB 3A1YG 4Z2XA 1TFYA 5KFEA 2IM2A 4LUBA 1P8GA 2DGTA 1FI4A 2FD2A 1IBCB 1X4BA 4WWSA 3JTPA 4YN3B 3GFXA 3OVSA 4KO0B 1M5PC 5IT0A 1CC8A 2ALYB 2BABA 2DHXA 2QT7A 1SUQB 5KT2A 4K0KJ 1FJCA 1FE0A 2IPOB 5GVQA 1XNQJ 2BOAA 1CSJA 1FD8A 2RQ4A 3HHLB 2CQ1A 1N36F 1NPPA 5EN1A 2OSRA 1M1GA 3K7RA 5C25A 1AXQA 2BYCA 2MQMA 5J2QB 3HHKA 5EUHA 3QGPA 3ZNJ1 3TVKA 3HSGA 1KVKA 3L95X 3KJVB 4DOZA 1FDAA 3ENQA 3OFGA 3ISNC 5CH7B 3RGIA 3BSCA 3KLGB 5F8GA 2Z58B 2G0CA 3DDNA 1Q82T 4K0KF 4A48A 4WTOB 3J7YI 3DC2A 4KC5A 3DLBA 1XNQF 4ZP6A 4F25A 4N8OA 1PC5A 4C11A 2DR9A 2WRMA 3RZAA 1RT3A 3E3XA 1PO6A 1SBRA 5KTQA 2ZHAA 3ISND 4RPFA 3QSIA 3CCWA 2V8DA 3ET6B 2CFXA 3PV8A 2W24A 3MUMP 2MQLA 3QO9B 2V2QA 3OR2A 1TQLA 1MG7A 3QGIA 1U49A 4EEYA 5J1EB 3EGWB 2B9WA 3GG0A 3QMQA 4Q2LA 4TY9A 2EKNA 1CJKB 5L46A 1VMBA 1RAIB 1W26A 1J27A 1UEKA 4USKA 2UV8A 1BWVA 4CTAA 3M9OB 3NOCA 2CJYB 1CG2A 4DDFA 5HJXA 1RAAB 1GQEA 3IO1A 3KUHA 1S9GA 1QE1A 2G2ZA 2FVQA 2C2RA 3WIVA 2AKWB 1FTRA 2LU1A 3NMRA 4H4KA 4PG4A 2N3LA 1SV5B 2MJNA 3FFIA 1HIYA 3FGVA 2D3ZA 5GADI 2IDLA 3CNQP 1Y10A 1R8AA 4Q7AA 2HHPA 4LSLA 2PMHA 2MPUA 3NGDA 4PYDA 2KYXA 2G9OA 2R4FA 5GAHU 4JI0J 1U25A 2CQHA 1GAOA 2R2SA 2V0NA 2NR0A 3SZ2A 1UW4A 1IJEB 3Q2SC 4P9SA 2W1BA 3X3UA 2BRKA 2HK2A 2RNEA 4MK9A 5DDQC 1ACMB 1F9EB 1X9MA 3ENWA 3OLBA 3NAIA 4TQSA 1T8EA 5K8NA 2LEPA 3KLHB 4JI0F 4Y0FA 1AW0A 1S1TA 2F40A 2O67A 1IWGA 1N34J 4QW8A 5LM7E 1WG1A 3BBFA 2IRYA 4Y00A 2VASA 2XMUA 3UI3A 3TYTA 1X4FA 1S1WA 1PBAA 3MCNA 3VQTA 3QJPA 2ROGA 3W66A 4IH6A 1J5EJ 1WHXA 4EU0A 1P6TA 2H1YA 3MR6A 2KRBA 2G2OA 4O4RA 2AV5A 1KOOA 3EMTA 4M5GA 1XNRJ 4ETXA 1AZSA 2WVEA 1GMVA 1N34F 3CPWR 1JJ2R 3B4MA 3OTDA 3MPWA 2DNHA 3H90A 2PC6A 4J37A 1FFSB 2LCWA 4DX5A 3LGNA 4OFZA 5KFOA 4K2JA 4B3MJ 1K1QA 2J6SA 4TY8B 1J5EF 1WHYA 3CEDA 3BKUA 2DRDA 5HMYA 3DLHA 1VJQA 4U8YA 4HKQA 1RWOB 1XNRF 3BYPA 1AROP 5JVGQ 1N56A 4G1QB 3M8WA 3C16A 1IBKF 2J6TA 5MLCV 1RCXB 1KFDA 1UL3A 2YNIB 2XCAA 1B64A 2M88A 3T41A 2EPIA 3CWJA 1HBOA 2XMJA 2H3EB 1IKVA 2C3PA 1NKCA 3LPEA 3DRRB 4NA2A 3TQ1A 4B3MF 3DLGB 1KD1T 2GO9A 3SSRA 1H2TZ 3LH2S 3IRWP 2WHOA 3PIOQ 3LANA 2NXJA 2NYHA 4ETZA 9ATCB 4LR9A 4ECZA 1MWZA 2CPFA 2ZOFA 5D0GA 1S1UB 1WF0A 2UXDJ 3CJ8A 2HFSA 2CNLB 1Q95G 2AMCB 2KJWA 3SYZA 2QYGA 2XYHB 2J7KA 2GHWA 2NSCA 2POKA 4ZPWR 4Y2KA 1GEHA 1FTCA 3IWNC 3SXLA 1XTZA 4DL3A 3H20A 4LSNA 4NXMJ 2C3OA 2FZGB 1Y5NB 4J5OA 3SQGA 3Q2TC 4TQRA 3JSYA 2EC2A 1NDCA 2UZAA 3SSQA 3CC2S 2ZH9A 4RW4B 2BKNA 3EVMA 2Q79A 2XLJA 3HI9A 2UXDF 5IZHA 3OXFA 5CZVA 1N33J 1NU4A 3QT8A 5FDLB 4UF4A 2LU2A 4MK8A 1OJ4A 2RT3A 2OPRB 2RDJA 2QLBB 4DSEA 2BJ3A 3M8QB 2W8LA 1RHRB 2G13A 2XCPA 3PEJA 4H54A 1RBAA 5A8RA 2BX6A 1JLBA 3R5JB 3CCUS 3MPYA 2VD3A 2VUGA 1RAGB 2LXIA 1PSDA 1YWXA 3QAEA 5D78A 1N33F 2OPSB 5K20B 3BM7A 3K89A 3RYLA 3J7Z5 4WCEQ 4OMFG 1N32J 3FQKA 4U95A 3CC4S 1K9MT 4CLYA 5KG6A 5HROB 1YJTA 2RUSA 4I7FA 1DTTB 1YJRA 2DNRA 1RTHB 2J9DE 4NLTA 3RRGA 4Q8FA 4BC7A 3B54A 1HBUA 5K8PA 2XWXA 4OI0A 3U1NA 3P49B 3HT3A 3J80Y 1IM6A 2AEJA 1HNXJ 2A2CA 3I5BA 4PQUB 2R7RA 5B08A 3HM9A 3W62A 1QAIA 2CQ3A 4YB1P 1Q86T 4LFBJ 1OO0B 2KRRA 1OY9A 2ATLA 3R5BA 1SH0A 3RBXA 1N32F 4DPUA 3IC1A 4Q45A 3FJ2A 2OFGX 4W92B 4RNMA 4BLGA 2HFVA 4M5KA 4C6AA 4WU2A 4LIRA 3PRBA 3IAS9 1W7WA 3CMQA 2HLUA 2ILYA 2XY5A 4C0HA 2XB2D 2O5DA 1HNXF 3P4UB 4M8LA 4BCAA 2Z30B 2FJDB 1RTJB 3FEYB 3EICA 5A2QY 3DI6A 2EK1A 2MHNA 1GH8A 2GQ2A 4NLPA 2HZVA 1NK0A 1S97A 3D3BJ 4O44B 3GQCA 2CZ9A 5CHCB 2IVYA 5DQGA 5IFMA 4ATNA 3M4XA 4TVAB 4ZPTR 2RU9A 4W98A 1PKUA 2GC8A 3BF4A 1BQXA 3G71S 2IJRA 1L3TA 3QIPA 2ZC4A 1EX8A 1JLGA 4J9VA 1HLWA 1URNA 5HN0A 2ZH1A 4DL2A 3OL6A 2FQQB 5CQGA 1U6FA 1UMJA 2OMOA 2YKMA 3KTQA 4P10A 4OYPA 2C42A 3NG8A 2R7WA 2KYZA 4MT1A 3W9HA 3DRPA 1UFWA 1S10A 2CA9A 3GIRA 4Z7CA 2OPQA 3US5A 3A3OB 4NZ0A 2YKNB 1N8RT 3QGHA 5E7OB 4L3KA 5KG5A 2GNKA 2C1EB 1RBOB 4YUDA 1T9VA 3R3TA 4PWUA 1QD1A 4A47A 3MEDA 3PACA 3KYLA 4ZJLA 4B9NA 2Q43A 1WSRA 2F65A 4TYAA 2ZBCA 2R2RA 1JLEB 3M32A 1R8HA 1UJ4A 1VQKS 4RW9A 4HHJA 4DXLA 3MD3A 1Y00A 4FYYB 2DNOA 3DRYA 3H0PA 1OWXA 5DGBA 3DOMA 1U1LA 1WD6A 4HHHA 1D09B 2ZE2A 1KONA 4ZVTB 2IJFA 3AHPA 4MAKA 2MTLA 2OKQA 1R0AB 3TRGA 1FRJA 3P8BB 4HHUA 1NK5A 1TELA 3L9ZA 2GQQA 2DGSA 4KY3A 3FRZA 3B8HA 2XSFA 5IS2A 3N4WA 1DHMA 2VQEJ 3MOZA 2V4RA 2PD1A 5I3QA 4Z37A 4DX6A 2JLGA 3T19A 3RUBL 1FF2A 1HQEB 4C9DA 3J80U 2GS8A 4HTIA 2DXEA 1IR1A 1Q0NA 3VQSA 2J5AA 4Y34A 3MR5A 7FDRA 3BGLA 1M5VC 2XYPB 1U26A 4EO6A 3AT1B 5BJRA 2WSFC 3AB4B 3BQ0A 2VQEF 3L09A 4FBTA 3OLAA 5B0FA 2OPPA 4JI4J 2JDJA 2ZEJA 5D8HB 2UV8G 4OYWA 2HHXA 1D9FA 1B4SA 3V4IA 3GSIA 1R31A 4X4TA 4NCGB 5CAAA 2I8EA 3SDEA 2A10A 3W60A 3L3CA 3DGPA 3B6BA 4DFJA 1A9NB 2RKIA 2HQFA 3PM9A 2N7YA 4DL4A 4WTYA 2RB7A 3CJ3A 4B3SJ 3BO3A 4CYUB 2W4DA 2GJIA 4JI4F 1UWBA 3BPSP 2F5GA 2BJ7A 2FZCB 2RIJA 4RW8B 3GFZA 4DU7A 1ZZFA 4DV2J 4MFBB 5CYQA 2IAJB 2KZZA 2QFJA 4CI0B 4RUBA 4CO3A 4CM2A 3SCLE 2NXEA 2FJXA 4Q0BA 2YY3A 2DNKA 5D4LA 4UZBA 4ECSA 4KGZB 4MIBA 3KHRA 1C1BA 4C8NA 1SC3B 2J7UA 4B3SF 1GXTA 3R5CA 1WEYA 4BBYA 3H59A 2XMMA 1SCJB 1SJ1A 3LP2A 5EWFA 3IAM9 5D3GA 1FDNA 4O23A 1KLMB 3ENVA 4IH7A 4DV2F 3K8VA 3I87A 1KNZA 2DD8S 3MWBA 4YY3J 1VR6A 1RISA 5C42A 2IBOA 4F4ZA 4I0WA 1FVQA 2QJ3A 1M90T 5H9FK 2FUG9 2YWFA 5ETPA 1FKPB 2DCUB 2XI2A 1LEOA 3OBIA 2CUYA 5L1IA 1L3KA 2VH7A 2ZUGA 2XMTA 3LW5C 3FBBA 3MGJA 5J1NA 2R7TA 1UA1A 4QWBA 2FTRA 2RQKA 4DV5J 2IJNA 2E9ZA 4YY3F 1ZTWA 2X1FA 2IBKA 1TAQA 4ZDNA 1KFSA 4IR1A 1L3VA 4NLUA 2AD9A 2DT9A 1BUXA 2MSSA 3FBEA 4CLPA 4AUKA 2E29A 3CCLS 2UVRA 3R2DJ 5C25B 3J7YU 3M30A 4RBTA 2OO4A 2IA6A 3KG4A 1UEUA 3M7VA 3D6HB 3QT6A 4P75A 2EK6A 3BYRA 2FIUA 1N6QA 2QMWA 4I56A 4DV5F 3LP1A 4DLEA 1T9TA 1BGXT 2KFZA 1K8AT 1T9WA 2OEMA 3NGTA 3VZHA 1PAEX 1Q8BA 4DSFA 4N47A 2COLA 2KVQE 2VV5A 4KH0B 1XBWA 4CRJA 2ZD1A 3RAMA 4C11B 1YJVA 5F8NA 3OTOJ 1RT3B 3PNIA 1RK8A 1SJ4P 3ELHA 3TR5A 2H54B 3KJQB 4KJIA 4MMOA 3OR2B 4HT7A 4J9NA 2BKOA 1Q53A 3MTKA 4X84A 5SZTA 4USWA 3KKFA 2EXUA 2HG4A 1XR7A 1T05A 5D6GA 3C46A 4ANEA 1MN9A 4QR0A 3CJTA 4WIQA 2HHUA 2ACYA 4CTAB 2UVWA 3OTOF 5LJ3Y 3R9LA 3MCSA 1UPMB 4Z7YA 1S9GB 2HNZA 1QE1B 4YMEA 5BXIA 3GIIA 3HKZD 3D9BA 5CD4A 4DCPB 1F2HA 2WONA 1T95A 3FFIB 4I68A 4P7VA 1VFJA 1EAYC 3OV7A 3HO1A 1UFLA 2I38A 2DHSA 4DBQA 3OUYA 4BHQA 1KN6A 2C2ZB 4LSLB 2AIRB 3G82A 3TQEA 4USVA 2ZWOA 4B9UA 5AXLA 4ZPBA 2ILZA 1RA6A 2B0GA 2YTCA 3BV8A 4DQPA 2CYYA 4L74A 1R7IA 2JEFA 4DCOB 4DMZA 4YDDB 2Y3YA 4K4UA 4ZP9A 4ES3A 1QAXA 2QSWA 2Y1IA 1SIZA 2H5EA 2MMYA 5IT9Y 1H7WA 1CQNA 5DO2A 1SKRA 3NGKA 2KT2A 4RU2A 4USHA 1S1TB 2D3UA 1L3UA 3RRKA 3AA9A 1GK8A 5HATA 2C2NA 3DXBA 3UR0A 3MAHA 2UXBJ 2B51A 2GQCA 3MM5A 3WX4A 1S1WB 3JSRA 3G9CA 3KJNB 3NCPA 1X7VA 2LKZA 2LQJA 1KLNA 2AJQA 3IR5B 2HLTA 4CLSA 4EMDA 4RNNA 1YZ6A 5DDRC 3PW2A 1AZSB 1KOHA 4I6YA 1RCOB 4C0OC 2HPUA 3MMBA 4ZVSB 2VG5A 3WDOA 2V4JA 3QQCD 2OD6A 4X4RA 2XNRA 5IV3A 5C7PA 2UXBF 5J2NA 4X4NA 2JEGA 3G6YA 4L72B 2J0WA 5HSPA 3K17A 3H40A 5D77A 1P9YA 2HS4A 2P6TA 1CPZA 3KMSA 1SPBP 1FJ7A 3NWRA 1J2VA 2BXJA 3D3CJ 3CO9A 1X4HA 2B4UA 4ELVA 5E3CA 4F67A 3C16B 2GZOA 4MIAA 3F0NA 1VRUA 5B0EA 3AA8A 1JLFA 3R27A 1HBOB 3P6YC 1YRXA 4QYZK 1IKVB 4URQU 3I4PA 3IGVA 2KM8C 2RS2A 5E2QA 4DV7J 2EC0A 3UFCX 1E6VA 4JV1A 2UU9J 1AUSL 3NBPA 4MKVA 3ZXWA 1UVKA 4B9LA 1HNWJ 4X65J 1U1RA 4I67A 1SKSA 1F5BA 1NH8A 2CQBA 4FPIA 2RF2A 4LSNB 4DR5F 2R9LA 4NLGA 1S1VB 2HFUA 3P5TL 4C3MA 3O6QA 1CVJA 3RB0A 3SQGB 2AF6A 5IWAJ 2DNPA 4WFXA 1RAOA 1NK8A 4DV7F 3VGTA 3I82A 2HVHA 2OGUA 1FD2A 4D3HA 2UU9F 4E2FB 3UWTA 2BBEA 1UFKA 3IA0A 4K4XA 5LSLA 5KT7A 1HNWF 4X65F 5ETKA 4DR7F 4F04B 2OI2A 2C28A 3HVTA 1NHVA 4YB6A 2GMJA 2OHDA 5IWAF 5HO4A 2R8KA 5A8RB 4M5IA 2PA3A 3KDNA 5KT5A 4F02A 1N5TA 3BZQA 1QAYA 1Z1ZA 3WC0A 2HMIA 3GZ7A 3GV5B 1SVDA 2AYEA 4PAAA 2DHHA 2ATCB 1ZOTA 2H51B 5BYSA 4FYVB 1VOMA 2NUUG 4DPTA 4I7FB 3EGZA 1VQOS 3KLFA 5KFBA 1F3FA 5IT9U 1M5OC 3T5JA 4Y6IA 4NMXA 2MZSA 1HBUB 2N3OA 5K14A 4IOAQ 4B3OA 4FXVA 1C0UA 4LIWA 2D41A 4IYQA 2EFQA 1XN9A 3RG6A 3TJ8A 1TKTA 1FXLA 3VAFA 2DRBA 4DSIA 2NLWA 1PC4A 2HEKA 4CO1A 4EUVA 3PJWA 4N76A 3GIJA 4OZNA 4J7CA 3TVYA 2VHGA 4PPDA 3AOBA 2A18A 4L73A 3S01A 4QWCA 2D3O1 4F50A 1XERA 5B0GA 3UCGA 1C1CA 2PO4A 4PWWA 4XTTA 3HHLC 1V5IB 5LXYA 1D9DA 4FXDA 1NK6A 3DI6B 1SL1A 3A4TA 5C2GA 1L5UA 2MKHA 2ZH8A 1IKYA 2A2DA 2WB4A 4CLUA 2FC8A 3QRPA 2ZNYA 1CJTA 3LP0A 3HHLD 3PKYA 2BW2A 3PJ9A 2V2KA 3ZTOA 4DV6J 3QWPA 4NEYA 2CZ4A 4PUOA 1Q81T 4U96A 4ERDA 1K73T 4C3KA 4S0MA 3QIPB 5C24A 2OSQA 5I3UA 1IQTA 4P6QA 4ECYA 5J2PA 3RR7A 1LXNA 1QSYA 2ASDA 1FX2A 1JLGB 2PI5A 2KKHA 1TMMA 1Q79A 3EXCX 1V3ZA 3BQ2A 3LALA 3TVZA 1S0NA 4DG1A 2YKMB 1N5YA 3QPIA 3LOUA 3H5YA 4DV6F 1VC0A 5L9NA 3GR1A 4IQXA 5IC6B 1PYTA 5F3ZA 2XY6A 2DK2A 4QWAA 1PGZA 2G0JA 4OZ1A 2BDPA 1R43A 1FJGJ 4U9RA 3J81j
chains in the Genus database with same CATH topology
3QYYA 3DRPB 2CQIA 2IC3A 1GQEA 2R7OA 4H4MA 3E8OA 3IO1A 4DJBA 4K5RA 1S9GA 1QE1A 2OPQB 2QSFA 1ZM4A 4ID5A 2C2RA 2CVEA 2FVQA 3RBEA 3X1LB 1OS5A 2BZ2A 4OI1A 3MUVP 4ED6A 2DITA 4NA3A 2JFDA 1FTRA 1Z2LA 4DUYF 2CPYA 1NJIT 2LU1A 3NMRA 4H4KA 3RU0A 4PG4A 4EBDA 2N3LA 5J2MA 1KRPA 3CDWA 2BM1A 2E1MC 1SV5B 2ADCA 4I6AA 2MJNA 4W90B 3FFIA 4WFZA 2MQOA 3FGVA 2D3ZA 4JI8F 5EGYA 5GADI 1F2GA 1B0VA 4RNHA 4PXDA 1FXDA 1PILA 1R8AA 4Q7AA 2Y1RI 2G4BA 4UOCA 3GYNA 3MEDB 3UNGC 2SXLA 3BR9A 5E33A 5A6PA 3ZZYA 4ZPDA 1JB0C 1LK5A 2X1BA 1J5OA 3DU6A 2HHPA 2JFKA 2VBZA 1KQKA 3CCQS 4LSLA 3M9MB 4BS2A 4OI6A 3H98A 4CQ1A 4R5PA 3M32B 2PMHA 1JLAA 1FJGF 2IM0A 2MPUA 4RW9B 1TL1A 3HZEA 2D7SA 3Q8RB 3NGDA 2YH0A 4ZK7M 2W4CA 3S8SA 2KYXA 2CPDA 4OX9F 3BSOA 1U1NA 2G9OA 2R4FA 5GAHU 2DNLA 3TAPA 1U1PA 5I3PA 1U25A 2CQHA 2FLPA 1RJJA 3NS6A 1GAOA 1Q8LA 3OTBA 2R2SA 2VBYA 1EP4A 4A4JA 1O0PA 2MGZA 1DQAA 4Y2IA 2ZE2B 2PSZA 4EWTA 2V0NA 1ULRA 3G96A 3SZ2A 1UW4A 2NR0A 2Q66A 1IJEB 1Y0HA 2V8VA 3H5SA 4HLBA 4QIVA 4MKYA 3Q2SC 2KTQA 3ZZUA 1GXLA 5FD1A 3DHXA 2KH9A 3RAQA 5KFQA 1FRKA 2E5IA 2MDAA 3X3UA 4X4PA 2BRKA 2RSQA 3A8EA 2RNEA 5K8MA 2JHEA 4MK9A 3HDSA 1MMNA 3HX9A 5DDQC 3UR3C 1X9MA 2CPIA 3BGRB 3Q22A 2ROPA 1TZ0A 3ENWA 3OLBA 3NAIA 2ASJA 4TQSA 1HWKA 4CH1A 3GV7B 3QLHA 4KHMA 2D3OR 1X5SA 1Q1KA 4DUZF 3KLIA 4WFYA 1Y5IB 3W2WB 2E7WA 5IQ6A 2JC1A 2C3YA 2CG4A 4QQBA 1WACA 5JUMA 1T8EA 1LFPA 5K8NA 2LEPA 3CDUA 3KLHB 4RBUA 4JI0F 4Y0FA 3ICLA 1VK8A 1HHTP 1AW0A 1S1TA 2F40A 2VG7B 2J7WA 2BACA 2O67A 5IT4A 5DM6Q 2Z4PA 1S0MA 4YR3A 4FNIA 1LWCA 2DH7A 4IRCA 3PFOA 4QW8A 1WG1A 2PE8A 1U47A 3IRXA 4WXWA 4ELTA 4K2XA 2IRYA 3OVBA 4XDCA 3W2VB 3IWLA 2YKAA 3RB6A 3PR5B 1S49A 4Y00A 3MFIA 4DR2F 3PO5A 4JYAF 3CJ0A 1JLQA 2VASA 1N4LA 5GAHI 3GILA 4IFVA 1QY7A 5KFRA 1EETA 4ECUA 2XMUA 2ZITA 3UI3A 3TYTA 1X4FA 3RW7A 1S1WA 3UCUP 1H98A 3VQTA 2K1RA 4X64F 1REVB 3KLEA 3KK2B 4QW9A 3QJPA 1DQ8A 1SJQA 5KFDA 5E0OA 2DNGA 3EXYA 2ROGA 4RW7B 3OXLA 3FSIA 3KLVA 1N5QA 1S6PA 2ABYA 4IH6A 3OL8A 1WHXA 4EU0A 2DR8A 4LF4F 5AXKA 2GGPB 5CZXA 3UDCA 5A0YB 1P6TA 4A8XA 3MR6A 2EFOA 1DAXA 2KRBA 4O4RA 2QYCA 2AV5A 1KEKA 1KOOA 2J0SD 2AQ4A 2YNHA 4ETXA 3KG0A 4A8WA 2HHVA 2OPPB 2CZVC 2AWZA 1KVJA 3BSAA 2KFYA 2JLEA 1N34F 5EX3A 3CPWR 1JJ2R 1IKXA 3B4MA 5KG3A 1VRUB 3OTDA 3MPWA 3VWSA 4DV1F 1U48A 2DNHA 2YX7A 4F2RA 1H6KX 2EG1A 3O8WA 3DNCA 5KG7A 2PC6A 3AB2B 3V4IB 4J37A 4AQYF 2BQUA 2ZJRQ 2C22A 2FLLA 2LCWA 1HQEA 2V8GA 3G8TA 4PCQA 3AAWB 3DOKB 3LGNA 4OJHA 4ZVGA 2PEHA 2CRLA 4PQAA 4OFZA 3SDEB 4L6V3 2XNQA 1FRHA 5KG1A 5KFOA 2B6AB 3GIMA 3BDEA 4EYIB 1K1QA 2J6SA 4B08A 4TY8B 1J5EF 3J7A1 1X9WA 1WHYA 3CEDA 4FP9A 4KFBA 2RKIB 3HHDA 4JOUA 5HMWA 3R1HA 1XMOF 1C0TA 5HMYA 3DLHA 1SXLA 1KQGB 1LWEB 4HKQA 3JSMA 1RT5A 2X51A 4E0DA 3DOLB 4I2PA 1YJWS 2JC0A 1XNRF 2NXUA 4HDGA 4ZVFA 1AROP 1B0PA 5JVGQ 4NOHA 1LWFB 2UUAF 1UWBB 4QPTA 1BQNB 1HL6A 4G1QB 5KFAA 1N56A 4ECWA 1KSPA 1IBKF 2WBRA 3NP5A 2NUHA 2J6TA 5MLCV 3I0RA 3KHLA 1SIWB 3H8YA 2VPXB 5L1LA 4C0BA 3D5MA 1KFDA 1TR0A 1UL3A 4KB7A 2KXFA 2YNIB 4IG3B 1M5HA 4WKYA 2KT5A 3TW0A 1HMVB 2XCAA 1B64A 5CYQB 2QA4S 1FE4A 1ROFA 2APOA 2M88A 3T3FA 2EPIA 2G1DA 5BYQA 3CWJA 2HWHA 1HBOA 2XMJA 2RJZA 1VBXA 1AFIA 4O3RA 1IKVA 2QA1A 4OJGA 2LDIA 2C3PA 1NKCA 3V6JA 4NPOA 3DRRB 4Q0BB 4NA2A 3TQ1A 2FHKA 4B3MF 3DLGB 3DLKA 3D0GE 4NCGA 4IFYA 1KD1T 2GO9A 5KFYA 4C3LA 1CEZA 2LVWA 3SSRA 1H2TZ 3LH2S 3IRWP 2WHOA 1S9FA 3PIOQ 1KVIA 1OPZA 3LANA 1LKZA 4J9RA 4ETZA 4DLGA 4DFPA 1C1BB 1P1TA 4PWDB 4ECZA 1MWZA 1MROA 2CPFA 1X8DA 4O4GA 2M8HA 4LVNP 4PG5A 5KFUA 2EI5A 2ZOFA 5DDPC 2CJBA 1S1UB 1WF0A 1SJ3P 2AU0A 1RT2B 2JLFA 4K4SA 1N5VA 2CPHA 3M8SA 2KJWA 3SYZA 2C3MA 1MU2A 2J7KA 5KFMA 2GHWA 2NSCA 2POKA 4ZPWR 4DN9A 1KTQA 1JJHA 2ZOMA 3LP2B 2DO4A 5KFXA 2P5VA 4KQZA 4Y2KA 3MM8B 5HMXA 3H2UB 5D3GB 4ZPCA 4EFAC 2QEXS 3M9NB 1FTCA 3IWNC 4QIEA 3LAMA 3S7RA 1NJWA 3TANA 1ZZNA 1QM9A 2FVSA 3SXLA 1XTZA 1RT6A 5D4OA 2ZHOA 4DL3A 3H20A 4LSNA 2DPJA 2C3OA 3V81B 4E98A 1Y5NB 2I5JA 2J9CA 4PR6A 4ILLA 2HWTA 3FMBA 3I9V9 3PX6A 3CVKA 2W8KA 4X4SA 4DR1F 4LF5F 4J5OA 2ZKUA 5C42B 3SQGA 3HLUA 3KK1A 3TAMA 2VODA 3Q2TC 4I1TA 4TQRA 2R8IA 1FCAA 2PT0A 3B4DA 3JSYA 1KTVA 1S6OA 2MXYA 1HWUA 2RD5C 1UJ5A 2DGWA 3N6MA 2UZAA 3SSQA 3CXCR 1BY9A 3CC2S 2ZH9A 5KFPA 4FS1A 3M8PA 4RW4B 3HJFA 4OLPA 4OX7A 2Q79A 2XLJA 4XAKA 4Y28C 4AL7A 4LF9F 4V19J 3HI9A 2UXDF 5A8KB 5IZHA 3OXFA 2J9DA 5CZVA 1NU4A 4RUHA 4GC6A 2ZH2A 2VONA 5FDLB 4YFUA 3CSKA 5H1SV 4H4OA 5MAOA 3CUNA 2LU2A 5F0WA 4MK8A 1NHUA 3U1MA 2ZDPA 2N82B 2BR0A 1TL3A 2RT3A 1TKZB 3DYAB 1LW2B 2OPRB 2YWKA 3D54A 2RDJA 1K0TA 4JI3F 2E5JA 4DSEA 4OHVA 4I2QB 3M8QB 2YQ3A 2W8LA 5L1JA 3VAMA 3CDBA 3OHBA 5KFCA 1VJWA 4IKAA 2G13A 1SC6A 5HP1A 1BQMB 2AX0A 2DNNA 1SL0A 2FJBB 2XCPA 2BQ3A 3PEJA 1D9AA 4H54A 1ZTTA 1XK8A 2C2DA 3C6UA 4GO5X 3N01A 2U1AA 4ZPVR 1D8YA 5E41A 1ZPVA 1D0EA 5A8RA 2YNGA 1RT7B 2J76E 2HAIA 2ASLA 3THVA 5DLGA 1JLBA 1ZBTA 2B43A 1GT8A 3CCUS 4YOEA 3JYTB 3MPYA 2VD3A 2VUGA 2HNDA 1HBNB 2CQ0A 2LXIA 4Y2CA 5CD4H 4UQGA 1HNIB 1JLCA 1PSDA 3D1QA 4OI2A 2FY1A 2AYGA 1YWXA 1S76D 1SH2A 3QAEA 5D78A 1P1LA 2CKWA 4U7CA 2QA4G 1N33F 3M30B 2OPSB 2VG6B 2CJQA 5IM0A 3BM7A 5E5NA 1HNZF 4G1PA 3RYLA 3J7Z5 4C8ZA 4J9SA 4WCEQ 4X4UA 3ITHB 3K5OA 4OMFG 4GKJF 3FQKA 1R8PA 5T14A 1XMBA 5GMKa 3CC4S 4X4OA 1N6QB 3D1HA 1K9MT 2F3JA 3LP1B 5L39A 3CTRA 4RWWA 5KG6A 5HROB 1YJTA 1Z4UA 2MYFA 1F0XA 4I7FA 2OIHA 1ELOA 1U6ZA 3DM2B 4DSKA 1DTTB 3OQ2A 1YJRA 2DNRA 1RTHB 2J9DE 3HMJG 2XSJA 3QJJA 2Z0GA 5LSRA 4NLTA 2J0XA 3RRGA 4Q8FA 3PVXA 4BC7A 2DVIA 5CYMA 4D3GA 2R2UA 1HBUA 5K8PA 3CD7A 3CJKB 2AJFE 2MQPA 1IN0A 2U2FA 2XWXA 2C3UA 5CCMA 1HBMB 4OI0A 3MZIA 3U1NA 3CCTA 4DFKA 1U45A 3VF0B 1VHFA 4C8YA 3I0SA 2ZFHA 3P49B 3C6TA 4RW6A 5DLFA 3HT3A 2NPFA 2BRLA 3J80Y 1S6QA 2D74B 2EKYA 2ZD1B 2OJ3A 2A2CA 4F3QA 3I5BA 2RH3A 4PQUB 2CDQA 2CQGA 2R7RA 3M2VA 5B08A 4IG0A 3HM9A 4YR0A 3EPGA 3MEEA 2RQCA 3RR8A 1YGYA 1QAIA 4B9VA 2GO8A 3SFUA 2CQ3A 3I5AA 4YB1P 3BO4A 1W2IA 1OO0B 1Q86T 2KRRA 2ATLA 1RT1A 3R5BA 3PXGa 3D1OA 3H4BA 1SH0A 2WOMB 4XDDA 1WHVA 1D1UA 1N0UA 2FHOB 1N32F 3BR8A 2F1FA 5M2UA 3MTJA 2XMVA 3IC1A 4Q45A 2YWGA 3FJ2A 3SI8A 2OFGX 1DRZA 2HNYA 4W92B 4RNMA 1P9QC 3IG1B 5F3TA 4MK7A 3PRDA 4M5DB 4ALZA 2I2YA 4NXNF 1QLNA 4A46A 4I64A 4KO0A 4FF3A 3MM9B 4XIUA 1SUQA 1X4CA 1JX4A 3M1VB 4WU2A 4LIRA 1QUVA 2ASYA 3N6LA 4QR1A 2XG8A 1T05B 1WEXA 3PRBA 5KT4A 4KE5A 1RI7A 2BJEA 1TK5A 4X4VA 5DQHA 3IAS9 1H7XA 3BREA 3RW6A 1FNOA 2PDAA 4UY85 2O1PA 2HLUA 3HHLA 2VKZG 2ILYA 4WK3A 2XY5A 2ZVSA 4C0HA 5B7WA 2XB2D 2XI3A 2O5DA 1HNXF 2WW8A 5T7LB 3DLJA 4M8LA 3NWGA 1VQ5S 4B3TF 1TAUA 2BE2A 4NYPA 3MFHA 4I6WA 5AE3A 3FZ2A 4BCAA 1Y4ZB 2IM1A 2FJDB 5J2QA 1RTJB 4WZMA 3N79A 3FEYB 5HL7Q 5A2QY 1S48A 3DI6A 3E01A 2HNZB 3M2UB 2B5JA 1WF1A 2EK1A 4IH5A 1UA0A 2MHNA 2ZZMA 1GH8A 2GQ2A 1S0VA 5HI7A 1M5SA 4X66F 3SFGA 3KJVA 1L3SA 4NLPA 1X4DA 2LA6A 5DGAA 4ZOSA 1NK0A 1S97A 3N5BA 4O44B 4WFBQ 4IR9A 1OSCA 2GMLA 4YP3A 3GQCA 2D9PA 5CHCB 5HLFA 4LF6F 5CA5A 3KLGA 1W25A 2WONB 3CCMS 4WYWA 4EYHB 2HHHF 2FJEB 1T7PA 3IR6B 2ROEA 2FVPA 2IVYA 4N77A 4G3IA 3H2VE 1NNDA 2A1BA 5DQGA 1VLYA 5IFMA 5DJBA 4ATNA 1NKEA 3RB4A 3M4XA 2OFHX 5A8WB 1HI8A 4BC9A 3HP6A 4ZPTR 3GR0A 2RU9A 5KOWA 1NH7A 2J9EA 2M7SA 4RZRA 3Q8PB 2GC8A 3BF4A 1IJFB 1BQXA 1D8ZA 2MB0B 3FVYA 3G71S 3OW2R 3AJ1A 3OUYB 2X3GA 1L3TA 3QIPA 1JXLA 2F8HA 1NK4A 1MMDA 4F26A 3T1YF 2E5HA 3TUZC 3KK3B 5B0DA 3OR1A 3TA2A 2W7OA 1X4GA 4C8LA 2ZC4A 3DMJB 2PIIA 3FEZA 4OJ3A 1JLGA 1DLOA 3MEGA 2ZOGA 1XEZA 2VC0A 1TUVA 1URNA 1TV6A 4PPZA 2ZH3A 5HN0A 3V6DA 3QO9A 2EBEA 2JSXA 3CIMA 1HFEL 2W9BA 1BWEA 4C2MA 1X5PA 2ZH1A 1S9EB 3FQLA 3OL6A 1DURA 4DL2A 4DF8A 5G0RA 3H4DA 2E5GA 3DLEB 4Y2AA 5CQGA 3TI0A 1DJ0A 1U6FA 4KT0C 3G6ES 1UMJA 2EFVA 2OMOA 2YKMA 4ED3A 5J1EA 4EBCA 3KTQA 2VFRA 1VQPS 3SV3A 2C42A 3NG8A 4ZCKA 3GMGA 3GG1A 1RKIA 1RT4A 3HF5A 3SCKE 3Q8QB 3DFEA 3T5KA 3TP2A 2N4DA 1J5OB 2M2BA 5DG7A 4IUFA 4FYDA 2R7WA 4FF4A 4J9LA 4EGLA 2KYZA 1T03B 3HKWA 4AL6A 1U1OA 3KHGA 2RRNA 2E7XA 3VZIA 5DG8A 3KHHA 1YI2S 3T1HF 4ED7A 4ECTA 2UUWA 4WE1A 3TUJC 1M0SA 2VBXA 3MMCB 3GE9A 4A8KA 3DRPA 1UFWA 2WSCC 3ISZA 1X4AA 1C2PA 7FD1A 3WC2A 4QWDA 1S10A 2MZQA 3T6JA 4ZP7A 2FLNA 5J1PA 2OPQA 3MECB 3HXMA 4U6PA 2VFVA 3US5A 1DBDA 4NZ0A 2YKNB 3FEXB 1N8RT 1ZAWA 3QGHA 5E7OB 5DQIA 2MJUA 3TNVA 1AFJA 4B17A 1A7GE 1JKHB 3MAQA 5DDOC 2RILA 3C2PA 3PW7A 5KG5A 1SV5A 3MM7B 2GNKA 2QZ8A 3H5UA 3HHEA 1RTDB 3FRYA 1SB6A 3UQSA 3ZFVA 4DPOA 3VAJA 4YUDA 1YSJA 2ZH8A 4ZS6A 2QRRA 4X62F 3R3TA 4PWUA 5KAKA 2DGVA 3MM5B 2FGOA 1NRKA 4JI2F 4ECRA 3Q8SB 1FKAF 4IQMA 2MKJA 4A47A 3MEDA 1SH3A 3PACA 4KIAA 3KYLA 1HI1A 3F41A 2Q43A 1C4AA 4TLRA 1R6YA 4B9NA 1VQ8S 3I6PA 5D4NA 5KG4A 1FEHA 2IVFB 3T5HA 4TYAA 2ZBCA 2R2RA 2R8JA 2BV3A 1JLEB 5HMZA 3CT9A 4DHVA 3M32A 1R8HA 1UJ4A 1UVMA 1VQKS 4RW9A