1NPKA

Refined x-ray structure of dictyostelium nucleoside diphosphate kinase at 1,8 angstroms resolution
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
150
structure length
150
Chain Sequence
VNKERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLVPTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPLASAPGSIRGDFGVDVGRNIIHGSDSVESANREIALWFKPEELLTEVKPNPNLYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Phosphotransferase(po4 as acceptor)
molecule keywords NUCLEOSIDE DIPHOSPHATE KINASE
publication title Refined X-ray structure of Dictyostelium discoideum nucleoside diphosphate kinase at 1.8 A resolution.
pubmed doi rcsb
source organism Dictyostelium discoideum
total genus 44
structure length 150
sequence length 150
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 1994-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 1npkA00
4ANCA 1B99A 2BX6A 3VGUA 3DKDA 3ETMA 3NGRA 3NGSA 3BBBA 3ELHA 1NDKA 2HVDA 3EJMA 1S57A 3VVTA 3EVMA 3ZTPA 3L7UA 3FBEA 4C6AA 3NGUA 3NGTA 3Q8VA 1NSPA 1BUXA 4F36A 1NHKL 5CABA 1HLWA 3G2XA 4HR2A 2B8QA 1JXVA 1NB2A 1NDLA 4ANEA 5IOLA 2AZ1A 1NCLA 4F4AA 3DDIA 5BXIA 1K44A 1WKLA 1HIYA 1W7WA 4UOHA 4W98A 1NSKL 3Q8UA 1NUEA 2HURA 4DZ6A 4ENOA 3FBFA 3PRVA 3VGVA 1XIQA 3FC9A 5CAAA 3B54A 2DY9A 1NDPA 4UOFA 1S59A 1WKKA 1NSQA 1BHNA 2VU5A 3GP9A 1BE4A 3BBFA 2DYAA 1F6TA 2DXDA 5C7PA 1KDNA 1LWXA 3BH7B 2DXEA 3EVWA 3FKBA 4O0NA 1NLKL 2CWKA 3VVUA 3EICA 3FCWA 1UCNA 2BEFA 1S5ZA 1U8WA 3EM1A 4FKYA 1F3FA 1HHQA 3Q83A 2B8PA 1PKUA 4WBFA 2DXFA 3Q86A 4KPCA 1MN9A 4ANDA 3EE3A 3FBBA 3GPAA 3B6BA 3VGSA 3MPDA 1EHWA 2HVEA 3FBCA 4DI6A 4DUTA 3VGTA 2AZ3A 1NDCA 4CP5A 1B4SA 2ZUAA 1WKJA 3Q89A 1MN7A 1XQIA 1NPKA 3R9LA 3ZTSA 1ZS6A 3EMTA 1LEOA 1PAEX 3BH6B 3PJ9A 2NCKL 3EVOA 3Q8YA 3BBCA 3WX8A 3ZTOA 1VYAA 3ZTQA 3ZTRA 4EK2A 3FCVA 4FKXA 4UOGA 3JS9A 4S0MA 3ENAA
chains in the Genus database with same CATH superfamily
3U27A 5I42A 4L74A 1RAHB 2B4PA 2GAGC 4LBIA 3HCXA 1QD1A 5KOXA 3HD1A 5B0GA 4ECUA 4M5MA 4OX8A 3LPYA 3VVTA 1IBCB 3KLGB 3RR8A 4ECRA 1RA7A 5LJ5Y 3BR8A 3DOKA 4YB6A 1OQ3A 2H9ZA 1E6VA 3MUMP 4RU2A 1VBXA 1H7XA 2L08A 5A8KB 3GJRB 2RJZA 2R2SA 4ZVPB 3M2VA 3TZZA 2HZVA 3UI3A 3MECA 5GADI 1RDRA 5KFKA 3BBFA 4O44B 1T95A 3SXLA 1ZA1B 2XZWA 1N5YB 4LF9F 3Q8QB 1ZA2B 3GG1A 3TX8A 1SV5A 1TL7A 3MPWA 4Q5VA 5KFBA 4DN9A 4WKYA 4ZN3A 3VAKA 4USKA 3VTIA 3K5OA 1CS4B 4CNZA 1KR4A 3P96A 1HNZF 2HFUA 4V19X 2Q3PA 3HHKA 3RG6A 1ACMB 4LF7J 3ADAC 2YKPA 1IBLF 2UU9F 4OJHA 4WIQA 3U1NA 1IM4A 3R5AA 4DN0A 3DLEB 3GZ7A 2GW8A 2DNPA 1RWVB 1GFWB 2WVDA 5K14B 2KYZA 4KKOA 5CXTA 2VBZA 3EGWB 2GQCA 5H9EK 3O2IA 4W90B 1SQEA 1DARA 2ZWOA 3AJDA 5EX0A 4LFAJ 1SQGA 3T1YJ 1X4HA 3CDWA 3OV7A 2Z58B 3IGVA 3P4UB 1BLUA 2AEMA 1WC4A 1U0HB 1DTTA 1GXLA 5CCLA 3B6BA 4LF8F 3KUEA 4AQYJ 1RQ0A 3UVJA 3D54A 1RLCL 1OY9A 2QMXA 4DV6J 5LXRA 4C11B 3K2YA 1X5SA 2E5LJ 1KLNA 1Q95G 2E5JA 4OLOA 4LR9A 3EPGA 4LBHA 2DR6A 2HK2A 3RW6A 2J6SA 2KDOA 1RAFB 1CC7A 4O4RA 3NGTA 4UZBA 3BYRA 2BW7A 1S0VA 3ETOA 5B0BA 1GK8A 4B3MF 4I2PB 1Q86T 2W25A 2F63A 3AD8C 4YS2A 3W5YA 2LQJA 1N33F 1JLEA 1NK6A 2QLFB 2LFVA 5C5JA 4IG3B 5IT9Y 1EP4B 5DZ6A 1NK9A 2Z2LA 3CC2S 2XGPA 4KRWA 1YX2A 3QT5A 2B0GA 4B3OA 4OHZA 2W9BB 1AA1B 3IN5A 4HI1A 2MY7A 5GVQA 1APSA 2FJEB 3TRGA 4DQSA 4RKUC 3RRKA 2R7QA 3KLEB 4OX7A 3A3NB 3BBCA 3V81A 4C3LA 4DFMA 1UTAA 3OT9A 1K0TA 1YIJS 1T9XA 2XY7A 3GFHA 3Q2TC 4C4WA 3LP2A 2HPUA 3UWTA 5IT9U 3THPA 2ZH8A 1RSCA 4AFFA 1H2TZ 1RT5A 2MDAA 1HMVA 4KC5A 4RU9A 2YH1A 2QT7A 1UZHA 4U96A 5THWA 4YR3A 2FGCA 4IFYA 4ECVA 1FCAA 3B82A 2HNZA 4W98A 2IMOA 5FD1A 2JFKA 4DUYJ 3D6FB 3PRVA 3EZOA 3R5GA 5KFYA 4LF7F 2DO0A 4NXNF 2PIIA 5A0YB 3UCGA 3MAQA 5LT5A 5B0DA 4CTAA 4X4SA 2WVBA 1RT3A 4DSKA 5G0RB 2CNKB 4RNMA 3PVXA 1S1UB 2CXEA 3GE9A 2JLEA 4IR9A 1FRXA 3SV3A 4LSLA 4J9OA 2UUWA 3TZXA 5AXNA 4I7FA 1S1XA 1L5UA 2NCKL 2OAUA 2BVZA 4MH8A 1YJTA 1GMVA 2ADBA 3ZTRA 1T05A 1L3TA 2ZHOA 1UEUA 3T1YF 3HM9A 3DKDA 2JEFA 3K57A 3AA9A 1CJKB 1H38A 2IM1A 4NLWA 3PW0A 3DRPA 2ADCA 5J2PB 1I94J 4JYAJ 3OHBA 4AQYF 3KLHA 4J9MA 3G71S 2AGOA 3DRRB 1NB7A 4IUFA 5IC4B 4DV4J 4DV6F 5F8LA 4DHVA 1HWUA 3IR7B 2NR0A 1FKAF 3GU0A 2E5LF 3LO3A 1TVRB 3HD2A 4CRJA 4X4NA 5KG5A 4K5SA 5B0EA 4XO0A 1CSJA 3FRZA 4I6WA 4OV6A 2ZOFA 4LF6J 2ZE2B 2R7RA 3JB9k 4LRCA 3I87A 1DHMA 3OXFA 3LA0A 2RUGA 1VQ5S 4QU7A 3SCJE 2VG6A 2HBYB 4CLWA 2DNQA 4TU7A 5CD4A 2FB0A 3ILJA 3VWSA 3EPIA 2RRBA 2IDEA 4BWMA 2CQIA 1FDNA 4CNYA 1D3WA 2POKA 1WHYA 4B9TA 1HARA 3LALA 1TK8A 3N79A 2D1CA 4I64A 2APOA 4M5GA 3UCZP 5HROB 1FK9B 3IWLA 5KFJA 3AJ2A 2OJ3A 1H73A 3KUGA 4PPDA 2GNKA 3SDEB 1F6TA 3HKWA 5C7PA 4OZNA 2XMKA 4DDFA 2PEBA 3H8YA 1WG1A 3Q24A 2X1GA 1BQMB 1X4GA 2HFZA 1FVSA 4X4OA 1C0UB 1GNKA 2XYGB 2V9WA 2O01C 3IBCB 3RBEA 1UETA 1LXJA 3DOMA 4QR2A 4DUYF 1U25A 3D67A 1GTEA 2AKWB 4M63A 1NKCA 3KNGA 2G2YA 3BJYA 4EK2A 5K20B 2KM8B 3PR4A 5D4NA 2NXCA 4ZVUB 2XWXA 1E6YB 1HWIA 2VOOA 5HVHA 4WF9Q 1JK9B 3BSAA 4D3GA 2XHWA 2WBMA 3QLHA 1VGYA 4ZHRA 3G6ES 1V3ZA 3MM7A 5D6GA 2C2KB 1TUVA 3ITHB 1RP5A 2XNQA 2C3MA 2HLUA 4RW8A 2VL1A 5DM6Q 5IC6B 4Q0BA 2NYHA 3MR3A 3NG8A 4N8OA 5HBMB 3H42A 2KTQA 2FZKB 3NS5A 3I56S 4WK1A 4NZ0A 1I94F 4JYAF 3DYAA 3D3CJ 1R31A 2GFFA 4DBQA 4DV4F 1SC4B 4OYPA 4AD6A 2K3KA 4TLQA 2X1FA 5LOQA 2OPRA 1J5OB 1RWUA 3QSYB 2E5IA 2P9CA 1JWWA 4RUHA 4MIAA 2HBQB 1F60B 4K4ZA 2YNHB 2M5YA 3HI9A 1HQEB 1FX4A 2RKIA 4NLSA 2WTFA 4C8ZA 4WU2A 3TAMA 2C42A 5LSLA 1RHQB 2A2DA 4WFBQ 3VGUA 2MZSA 2EFOA 4RUBA 3MMBB 1KD1T 1AT1B 3ZZ0A 4FF2A 2PI4A 4LF6F 5F8HA 4PRFA 2HHUA 2HZAA 2C2EA 1NH7A 4L3KA 1S1VB 1HQUB 2NPIA 1RHJB 3TQ1A 4Y28C 1ZH5A 2XC9A 2HIYA 3T5KA 3U02A 2CQ2A 3D0HE 4UOFA 5MAOA 2M70A 4H4OB 3JSRA 5EDWA 4ELTA 5KG0A 4EMDA 3W2WA 3S01A 2F8EX 3HPOA 3MFIA 2JC1A 2VJVA 4ANDA 3FMBA 3DDKA 2YKMB 2XQCA 4IG0A 1CULB 3DMJA 4LF5F 2HHHJ 3D0IE 3CULA 1FJEB 4FDFA 3C66A 1KTVA 2E1RA 2JL9A 3ILOA 4IO1A 1O8BA 5E3PA 3KK1B 1GEHA 1B0VA 2AEJA 3QAEA 1V5IB 2HHSA 2AGPA 3CJ2A 3HULA 4C0OC 2BANB 4NEYA 2HLTA 1RAOA 4QZVB 2BQRA 1WKLA 4RL1A 4Y2KA 4G3IA 4GC6A 3OR1B 2Q66A 3T1HJ 1X4CA 1UWBA 5HL7Q 2D41A 2MKCA 4R5PB 2D3ZA 2RF2A 2MLZA 1RAGB 5C24A 5T41A 4DL7A 2C2MB 3ZNUA 2DHHA 4PUOA 3KG1A 3DU6A 4WFNQ 1ZM3A 3IRXA 4TY8B 4C8MA 4I4BA 5EGYA 1JLCB 1U4BA 1XNQJ 2KYXA 2F40A 4USVA 1BQNA 2GA7A 5DLGA 3UDCA 2FJDB 4RWWA 1GMWD 5D0GA 5HATA 3EWGA 1LW0B 3T5LA 2UXBF 2B9XA 4F02A 5F8GA 3MAHA 3D1OA 3OXGA 3SIPB 3NBPB 5EWFA 2JWNA 1FDAA 3MMAB 3EDRB 5KFTA 1MWZA 1JLQA 4P52A 2CZ4A 2RHQB 1T02A 4ECQA 1GXTA 5C25A 1LFWA 1FTCA 1S9GA 2DR5A 1I1GA 4Q8FA 4MKYA 2ZZNA 1Y5IB 1FXLA 1LWEA 2IC3B 1N34J 1NH8A 4G1PA 1VC5A 5I3QA 1FNXH 4M95A 4F04B 3RB0A 1BE4A 3H5UA 3AFGA 1VRQC 1PO6A 2DEJA 3GFXA 2YWHA 3UD3P 4USTA 8RUCA 2B5JA 2MEWA 2X7IA 3DGPA 2QJ3A 2HVZA 2ALYB 4HACA 5IS2A 5KFEA 1XJWB 1CG2A 2BOAA 2KB2A 4C7QA 4KGKA 1S99A 2DITA 1EZZB 3MGJA 5DS7A 4M5LA 1R0BG 4WK3A 3KMQA 4ILRA 3QJLA 4GMKA 1R0AB 4OZ5A 2KVQE 3CJQA 4B9UA 3MEGB 1R8HA 2QA4G 1CC8A 3CDUA 4HTJA 4K4XA 1VHIA 3GG0A 3KXDA 2H4YB 1T03B 2W9CB 1HNWJ 1C1BA 2K1RA 2DVIA 2HHHF 1N6QB 2VC0A 3JSMA 4G6VB 2KFNA 2VH7A 1FESA 3DRSA 3MPUB 3FNNA 2H48B 1XR7A 2HFOA 4HHJA 2EBEA 3GIJA 2AYMA 1XK8A 3CJ8A 3OR2B 1S59A 5L9XA 1U1RA 1TKDA 4OJ3A 3HF5A 3CD6S 1DFDA 2WVFA 3NGDA 3LQVA 2XLKA 1M5PC 1HW8A 4NLQA 3QGGA 1S6OA 1MROA 4RW7A 3FDSA 3OLAA 5C42A 5CYQA 4DG1A 2XS2A 2ZH5A 2DGOA 2EW9A 3T1HF 3M9OB 3UO0A 3WDOA 1R0CB 4X65J 2FJXA 3M9NB 4WZQA 1RXOB 2W9AA 1FRJA 3I9ZA 3OL8A 1HBOB 2G0IA 2Z30B 1EETA 3CCSS 4NLGA 3Q2SC 1XNQF 3KJVB 1RTJA 3HZGA 1GMWA 2LXFA 2JOQA 1RB0A 3R3TA 2DEIA 2BDPA 2O3DA 1SBRA 5BR8J 4USMA 4UQTA 2HWTA 2DNRA 4C8OA 3QJPA 1NLKL 3FCWA 4CT8A 4ATNA 3HDSA 5KFLA 2GO9A 3TZYA 2DRAA 3HLUA 4QIFA 5D0RA 1TKTA 4DU8A 2HQGA 3G6VA 4ZMMA 5J2NA 2EK6A 3CJKB 2HVHA 5KG4A 1YITS 1H6KX 1N34F 4KGMA 4ZCMA 2C3PA 2NYIA 3I5CA 4RNNA 2YKNB 5D4LA 2ASJA 2BMBA 1HI0P 3N6MA 3W9HA 2KFZA 1C2PA 4AUKA 2BKNA 1C1CA 3GMGA 4U6PA 5H9FK 3WIUA 5MLCV 1NK0A 1FEEA 2CG4A 3P49B 3FGVA 4EEYA 3H20A 2F1FA 1WJ9A 4TXSA 5KG6A 1T11A 2DD8S 1T94A 3G8SA 4EO8A 4URGA 4IR1A 4RW6B 4X4UA 2CNOB 3U1LA 2MQNA 3N6LA 4CM0A 1T3NA 1D9AA 1KLMB 1P9YA 2IRYA 2IM0A 2IRUA 5KT7A 4ZS6A 3IM8A 3ZZOA 1V3SA 1F3FA 3L4BC 1IKYA 1S7IA 2FTRA 2V4RA 1HNWF 1X9WA 5F9NA 2BACA 4WFYA 4TN2A 3F0NA 2FDNA 2PMZD 1R3NA 2YNGA 2WBRA 2ZDOA 2GVDB 2YTCA 2VIHA 4P7TA 2CKWA 4I68A 3VV2B 2KT3A 1HR0J 2KJWA 2OI2A 2R2UA 3I0RA 2MB0B 5L1KA 1FE4A 2VPYB 2G0CA 3VR1A 1NK7A 1X31C 4UOGA 1JXEA 2GV1A 2B4OA 2BE7D 1TV6A 3GQCA 3NCQA 1WC1A 3EVMA 3MD3A 1VBYA 4C98A 4I2QA 1JLAB 1K0VA 1EJ7L 1VIXA 3UN3A 1RJJA 4U7CA 3KKFA 4IOBA 1YHQS 1FERA 2YWEA 2N4DA 4X65F 4ED7A 5HK4A 2OFHX 4KSEB 1QE1B 4H54A 5L1IA 2GC8A 3VZHA 3MM5A 3QO9B 1QSSA 2ALZA 2HNDB 4JI2J 6FDRA 3K5MA 3W62A 4DL2A 3H98A 2DO4A 2FVPA 5BR8F 4ZJOA 3MUVP 4FN5A 2P9EA 5IQQA 4LQ9A 5J2MA 2I5JB 5HMZA 3M1VB 2EKNA 3G6YA 5E3QA 2J0XA 2FLLA 2CJ9A 3NKYA 3RW7A 4TY9A 3OFEA 3WIVA 3FUYA 4LSZB 4NASA 3UDLA 4ANCA 2LU1A 3ENWA 3NNAA 5D3GB 4FF3A 1S6PB 1B7FA 1C4CA 3QZ7A 3DN9A 4NX9A 4C97A 2NREA 1N54B 2JZ5A 2XGQA 2HSEB 3HKZD 4RJVA 1SI9A 4PABA 5DLFA 3TA0A 3GCWP 4PR6A 1PAUB 2V8HA 1FVQA 3JQKA 2RSQA 2AJ4A 1KNZA 1L3KA 1VQ9S 3MM8A 3ZFVA 2JLFA 5BJRA 2P6SA 3C15B 2VPXB 4MYUA 4DR1J 1T0TV 4A8XA 1CLFA 4FXDA 3W2VB 1HHQA 4DPOA 4ZJLA 1CVJA 3DOLA 1SJFA 2ILYA 2E1AA 2Y8YA 3DLKA 2WB4A 2V68A 2RT3A 1RAIB 5KT5A 4B17A 1YLXA 1MN7A 4MIBA 3HVAA 5J2QB 3V6DB 2E44A 4L72B 4ZPAA 4O23A 5GMKa 2J76E 3DRYA 2R8IA 1HKAA 2J0QD 2N3LA 2MHEA 1U48A 2QTWA 3LWMA 5CZVA 1WOSA 1J27A 3TW0A 1NM2A 3C16B 2PFDA 3OJUA 2CZ9A 5A8WB 4LFCF 4YMEA 3ZZTA 1ZM2A 2V2KA 3S1TA 4NLPA 2W2NP 3H5SA 1R8BA 4RW9A 5F8IA 1PG5B 2UVVA 1X0FA 2VKZG 1NO8A 2CIMA 3EE3A 1HYSB 1SC1B 1IWAA 5KFOA 2R2TA 2JC0A 1SUQA 3FFIB 5DJBA 4ZLPA 1FKPB 3K59A 1S48A 2VG7B 1F5AA 1S6QB 4NLVA 3V5RA 1RCOB 3ET6A 2RU9A 1U24A 3SI8A 4RLEA 1YSJA 1U0SA 4UW2A 1YZ7A 3JYTB 2PMHA 1Z1ZA 5FJ4A 4DL5A 3Q22A 4DL0C 5CYJA 4TQRA 4OFZA 3BN4A 1W2IA 4UOCA 4K8RA 2E9RX 2ZM6J 2KO1A 3KLGA 1JNRB 3TVZA 2AIRB 2VF3A 2UV8G 4CLUA 5A8KA 2UXCJ 3MR6A 2O66A 2HQIA 5FLXY 3CGIA 4O44A 3ISNC 1WF2A 1U8WA 1N5YA 1Q81T 5HVFA 3DLGB 1EX8A 2XS5A 2EG2A 4ZITA 2UP1A 4NRUA 3B8HA 3CJTA 1RACB 1BC6A 1SL1A 1UA0A 4ILLA 5KFZA 4E8UA 2BKPA 1R7IA 1RYSA 4NMXA 1CS4A 5FLXU 3PFOA 4DR1F 3IR5B 2EFPA 2RQMA 2CPXA 5B0AA 2C2DA 5DZ7A 3NGRA 3MEKA 3ELHA 2J8AA 1C0TB 4OHWA 2CPJA 4DL4A 3QNWB 3FBEA 2MYFA 5CABA 2FC8A 3DLEA 2HWHA 1XR6A 2VFRA 2OP5A 1K44A 1YWXA 1WTBA 5HAOA 4JP8A 4QWCA 3WZ0A 1WSRA 5K14A 5LMUF 2GMHA 2LMIA 4KGVB 4WPAA 1OWXA 1SJQA 3IS9B 3F73A 2GQQA 4IH6A 2F9DA 1LWFB 4CH0S 1KBRA 2XNRA 2DNNA 2HAFA 2MQMA 1X9SA 1RT4B 4FKYA 4TVAB 2V8GA 1VRUB 2O5DA 1U26A 3M30B 1U0HA 3C19A 3OLBA 4JV2A 1RAEB 2XCAA 4CO4A 3MF5A 4AL5A 3MPVA 1YBAA 2A6MA 1UEKA 2BJ9A 1GH8A 5DG8A 4DUZJ 2EVZA 5HQMA 4OMFG 4C11A 2QE5A 1X4BA 2U1AA 4J7CA 1JKHB 3DI6B 2YXLA 4DR5J 3HHLC 5IV4A 4IFVB 3D9BA 1NJYA 2NUUG 3CSKA 1RCXB 2PT0A 3G4SS 2DNZA 1NJXA 3Q8VA 3C6UB 2HQCA 2A3JA 5AXKA 4ZPBA 4MT1A 4QYRA 5J1PA 3OD2A 3D1HA 1QJHA 2DISA 4K2XA 1OSCA 3O5TB 1Y11A 1N5QA 2CPFA 3US5A 2RDDA 2W4DA 4I2PA 5DQHA 4KE5A 2FLPA 1RISA 3GP9A 3SQGB 1NAQA 2VBXA 2ZJRQ 4MYTA 4IG3A 3BYPA 5GAHU 1EP4A 2JH3A 2ZM6F 1DZ5A 3BSNA 3E01B 3VQSA 4CP5A 2UXCF 4JI8J 4ECYA 1REVB 2B9YA 2ZH4A 1ZTTA 1PAEX 1UFKA 3KLEA 4M94A 2NSCA 1F2GA 1HNVB 3FCVA 3JS9A 1TZ0A 4B9LA 5T14A 2HBZB 4WJBA 5HP1B 3C3LA 4F0HA 3TA1A 3VALA 1DY3A 1FEHA 2LXUA 2I0XA 2AZ1A 1M5HA 3W7BA 4DSIA 3UN5A 2ZH6A 2IA0A 2ATCB 1M5OC 2IA6A 1U1PA 1UPPA 2JX2A 2PE8A 6FD1A 3CPWR 1SKUB 2FVSA 1F1BB 4IH5A 5G0RA 3I0SB 5J1EA 5DM7Q 2CADA 2XTJP 3RAMA 2CQ1A 2ERRA 3T1AA 4DMZA 1RI7A 1S1UA 3HZEA 1KONA 1WG5A 4ZVOB 3VHQA 1U2CA 3FBCA 2CQGA 1H3DA 2J9DA 1M1GA 1G2EA 4HT5A 4K7QA 3SBMA 4NI2B 2NQPA 3AB2B 3FRYA 3KJNB 1QSYA 3LP0B 1H98A 4QQBA 4ELUA 2JVRA 3GR1A 2RQ4A 4UUXA 2B3TB 2QSWA 2IBOA 1V9OA 3CMQA 3QGIA 5FDLB 1K47A 2QEXS 1CJKA 4R8UB 2AMCB 3MPYA 2P2CB 3R7SB 4YHHJ 4C6AA 5J2PA 5KG7A 2EC2A 2MY8A 3DRRA 1TL1B 1FHTA 4LMZA 1RU2A 5C2GA 2MMYA 4YEAA 4DUZF 3NCRA 4CO1A 2QMUB 2HHXA 2HURA 2YPZA 4OJGA 2PA8D 4Y2AA 1UVKA 3N5FA 4QWDA 4M5JA 1N36J 4ER8A 1HNIB 1TVRA 3H90A 3TANA 4DR5F 1NK4A 2AT1B 3KDNA 4A8WA 1OY6A 1ZOTA 2VODA 1RWMB 4X62J 2HWIA 2CFXA 2CNLB 3W8PA 3KUHA 2ZOMA 4WWSA 2HVEA 4Q44A 2YVSA 3TP2A 2AZ3A 3UW1A 2ZE2A 5DG7A 2B4UA 4IO9Q 4BC7A 3M6WA 3QMQA 4M5HA 1GX6A 1EIYB 1MW7A 4N47A 1VFJA 5DO2A 4Y0FA 3SMZA 2ASYA 3OTOJ 4QPTA 2QLWA 2G2ZA 2LKZA 4CH7A 2YQ0A 3OVAA 2HVDA 2J0SD 1NPPA 4YR2A 2L9NA 2FLOA 1LKZA 4FZVA 4JI8F 1LFPA 5HROA 1BGXT 1FK9A 3TAQA 2DCLA 1ELOA 3G8QA 1Q0NA 3DU5A 1S10A 1D9FA 3UDEA 4O4GB 2M2BA 3W8GA 2VDIA 2FHJD 2ZD1B 3T3FA 3SDEA 2JLGA 4CT9A 2OEMA 3GONA 4CCHA 3EVWA 1EQ0A 1D8ZA 1AB8A 1KWMA 1RT2B 1Q7YT 1BQMA 5AE1A 4J9KA 4CZCA 1C0UA 1V5VA 2FD2A 4Q7AA 2QC3A 1K1QA 2XMUA 2P5VA 1NHVA 1X5OA 2KT2A 4RW4B 5KG2A 3ZTOA 2A18A 4GO7X 3KYLA 4EBDA 4U8VA 2F8MA 1VQ7S 2EG1A 1E6YA 3HJVA 5K9FA 1A6LA 3HT3A 5A76A 1G7CB 2C3UA 3NCPA 1U1OA 2CAJA 1NKBA 2BRLA 3TEGA 2JVOA 4NA1A 1Q8BA 2BQUA 1D09B 4ANEA 1RHRB 2PC6A 2YKQA 2R3VA 3ITHA 3GB0A 1NNDA 2B6AB 3P45B 1WI6A 2I2YA 1S4EA 4R0EA 4Q2LA 2YNIB 2EWHA 5AJ3J 4LIRA 1NDPA 4I0WA 2QA1A 3OJSA 3QBCA 5HBMA 3NS7B 3V4MA 4RZRA 4YHHF 4YQWA 4J37A 2KHDA 1TL3A 4L76A 2EK1A 3DM2B 3BO2A 3QIPB 2H5EA 1NJWA 3AOCA 1N8RT 3MM6B 2XSJB 1JJHA 3J7ZT 1TAUA 1J5OA 4OZJA 4DV1J 3MAAB 3HP6A 3IAM9 4OYMA 3R9LA 1CQMA 2DGUA 5ITHA 2YNHA 4A8SA 1HQEA 2OPPB 3NOGA 1X5TA 5DDRC 1QTNB 2Y8WA 2K06A 3UVJB 5B09A 2LU2A 1VQ4S 2DHXA 2Z2MA 1X4EA 4X62F 4O3QA 3MMBA 5IV3A 5K8MA 5EUHA 4NPOA 2RNEA 4F2SA 2DPJA 1IVZA 1KVJA 5JVHQ 1VK3A 3D1QA 4KGXB 2KZMA 1TAQA 5CA5A 4L3NA 3P5BP 4UOHA 3KTQA 1SB6A 4KBIA 1YZ6A 2KH9A 1U8SA 1GTHA 1S1VA 1HQUA 2FVCA 4PYAA 4V19J 2WSCC 4P2SA 2R7XA 3KHRA 4C0HA 3VZIA 1VLOA 2FY1A 3TX0A 3OTOF 3A8IA 3KK2B 4H4OA 1WSVA 3CO9A 2ZHAA 4IDKB 1KHWA 2E9ZA 4L73A 1RYRA 5E5NA 1QAIA 5D8HB 2C2NA 3P8BB 2XMWA 2N3OA 2YKMA 1CULA 4PCQA 3K5NA 5ADZA 2CJKA 1U1KA 2CDQA 3NXZA 2LA4A 3Q8YA 1VYAA 1IJFB 4QBUA 4Q45A 3D6HB 2IVFB 3KK1A 3FEYB 2LYVA 4NLDA 1JNZB 5LM7E 1O0PA 4EFAC 1LXNA 2UUCJ 3CEDA 3T41A 3AT1B 1PYOB 1Y3KA 2BANA 4W4MA 4PXCA 3ZZYA 4DV5J 3OR1A 1RT5B 2XLIA 2ZKUA 4HTIA 3UD5A 2BRKA 2M52A 4R5PA 4EYIB 3A3PB 3KDOA 3IFEA 2CPIA 2V4QA 5DRKA 4XIUA 1IUJA 2KHCA 4DR2J 3AQPA 1Q53A 2CJXB 2XMAA 2FJVA 1MG7A 4TY8A 1JLCA 2F4FA 2GGPB 1UEVA 4PWWA 3R1LA 1XERA 1RT3B 1FFGB 2XM3A 3R7BB 3Q23A 4XTTA 2ZUAA 1G4CA 4I56A 3RJMB 5AJ3F 1FT8A 4XDCA 3K5PA 1LW0A 2D9OA 4PG5A 4Y2CA 3CJ3A 4FKXA 1RHKB 3BS9A 3ZZZA 2Y3YA 2MQOA 3GSDA 4LSLB 2LLZA 3I9V9 3NBPA 1SC6A 5CZXA 5CYMB 1Q8LA 3PYDA 3UCUP 4A4JA 3MMAA 2HZCA 3BF4A 4KAIA 3F56A 1KC8T 4NCBA 3PJXA 1RADB 3GWCA 4DV1F 1UWAA 2CNNB 5JMNA 3RZAA 4YB1P 4J5OA 3UDVA 1S49A 3FEZA 1N4LA 1RHUB 2ZITA 1G3OA 1FNMA 4U7UK 2Z2ZA 3PCOB 1FDBA 1YBTA 1UCNA 4WZMA 3MEDB 1L3UA 2PGCA 2CYYA 4EGLA 3MCNA 3C2PA 3NAIA 1VJWA 1FKOB 2Z57B 2RAQA 1AROP 1HL6A 2F5GA 1B7YB 1X9MA 4K4SA 2QLXA 2XO6A 1VRTB 3DHXA 4HHHA 4LR7A 3MTJA 4DQPA 1B0TA 1R0AA 3NGSA 3MEGA 3JQMA 3ZTPA 1HWJA 5DDOC 3TO8A 3HT0A 1X7VA 1T03A 4PQAA 4KHPJ 2W9CA 4Z7CA 1YTYA 4A47A 3L7PA 3DDIA 3SFUA 3ISND 1N6QA 2PDAA 3W5XA 2FLNA 3CE8A 2XI3A 2EFVA 3H4BA 1IQTA 4I1TA 4X4RA 2XSFA 3SZ2A 3BQ2A 1N48A 2XZTB 1VC0A 1RKIA 1JQGA 3OR2A 1HQ2A 3W64A 4QYZJ 1HD1A 2UUCF 3EYZA 4DQQA 3H40A 1K1SA 1SCJB 4WBFA 3CC4S 3D6TB 2H65B 3JSBA 4FPRA 3THTA 4F3OA 3PV8A 2GVZB 2BM0A 1N33J 4DV5F 2YWKA 3ZTSA 2LVWA 3LW5C 1U1MA 3CB4A 3J7AN 4CIOA 4NYOA 2G1HA 5HVGA 4DR2F 4WXWA 4LSNB 3ETMA 2EBGA 1TL5A 1HBOA 2ZBPA 2ZVIA 1DLOB 3KJVA 3CD7A 4DX8H 4HYKA 3PJWA 5KFHA 3D0GE 1S0OA 1QAXA 1T9UA 4DL3A 3SCLE 2P9GA 2YKAA 4ED2A 4ZHRB 2C22A 4ZVQB 3MM7B 3EUNA 3CCQS 2ABYA 4DLEA 5SUHA 5LMNJ 5IQ6A 2ZH1A 5J1NA 2DXEA 2IYGA 3ZZPA 3IRWP 3CJSA 5F8NA 2HMIB 1VQLS 3NS6A 1VQKS 2UVUA 2CQPA 1TFWA 2QYGA 4K4UA 5GAHI 3G96A 4KT0C 4DPYA 4NXNJ 4N56A 3FK4A 3R5CA 3LP1B 5CD4H 3NMAA 2XB2D 3CJKA 1HI8A 1URRA 2AX0A 2RUSA 1R6YA 4YDDB 2C28A 3OL7A 4YP3A 4TNOA 2YKNA 2J9CA 3PW5A 2KXHA 4Y00A 3OSNA 5KFWA 3ZZUA 4C8YA 1LK5A 3NEKA 3T5JA 2R4FA 1WI8A 2HG4A 3VCDA 2IM2A 2IBKA 3HO1A 1EB0A 3I32A 4OL8A 3KLFB 4RW6A 5KFSA 4K4VA 2KVIA 5E7OB 1WKKA 1OYDA 1FFSB 4WXOA 4PXBA 4R0JA 4BS2A 3N5BA 2OUGA 4ZKAA 2OPSB 1U47A 2FC9A 2AHOB 3MDFA 3MD1A 4KHPF 3OUYB 2PEHA 2QN6B 2MKYA 2VFSA 1TQLA 3GV8B 2GVDA 3R2DJ 2KKHA 4PG7A 1UJ4A 4A8QA 2HK3A 2ZWPA 2W2QP 3BH6B 3CJ0A 2DR9A 2A0FB 3G82B 1R27B 3FZ2A 1VI7A 1SH2A 2MPUA 2YNFB 3UFCX 1OYEA 4OHYA 2KT5A 1LWCB 3NP5A 4NLOA 2XZDB 3W61A 3PKMA 5ETSA 4QWBA 2N7YA 1JLAA 4L6V3 2VV5A 3H5YA 3U7JA 2ZH9A 5LSRA 2VKRA 3HHEA 1RK8A 2MTLA 3Q8UA 3PW2A 3DFEA 1VDHA 4ZVFA 1Y0HA 4QWEA 5DQGA 4OHXA 2KJVA 1QE1A 1WWHA 1ZAWA 4IOCQ 4HI2A 3MEEB 3RAQA 1IKXB 2HHTA 3R7NB 3QO9A 3ULHA 1UWBB 3QYYA 3M8SA 2HNDA 5CQGA 3OFFA 2XMMA 2ZH7A 1Y00A 2RB7A 1S9EB 1EKSA 1QLNA 4ECZA 5HQ8A 5L46A 1OY8A 2J7UA 4IYQA 1W26A 1W2BR 5ETLA 4LT6A 3A1YG 3PG9A 4EBCA 2WW4A 4F0KA 1WKJA 2I5JA 3M1VA 3PM9A 4EO6A 5LMNF 4IOAQ 4OIXA 4RBTA 1I51B 1NEEA 4TYBA 1BQNB 4B3TJ 2B9WA 2ZNYA 1SQFA 4GVBB 4DF4A 7AT1B 3R6GB 3K0JA 1KOOA 5GAEU 5D3GA 1S6PA 1QTMA 2XI2A 3V6HA 2AGQA 1PCAA 5HO4A 1HBUB 3AA8A 1XMQJ 4F4AA 2VHGA 5KG1A 2G13A 3PX4A 2KN4A 2B9EA 2XG8A 2ZOGA 2RDIA 3UNGC 4MKBA 3QRQA 2DKOB 3BGUA 1RBLA 5KFXA 4P73A 1S9FA 5C25B 1XC9A 1UL3A 2IY5B 5E3CA 3KK3B 3C15A 3M8ZA 7FD1A 4NOHA 4OYWA 2VQEJ 3W2VA 3MR2A 1KOHA 1PILA 1YK9A 2RQKA 2E7WA 1EHWA 3RBDA 4USWA 3HFZB 3L3CA 1F5CA 3TVKA 1HHTP 2YY3A 2MHNA 2J8SA 2QV6A 5H9EJ 2JNJA 2Z56B 8ATCB 2OFGX 5D0HA 2CQBA 2LEPA 5J2QA 3V6DA 1X4FA 2MJUA 4IQXA 2MKJA 3DCAA 1BMQB 4AXJA 3PYGA 2GMJA 4HACB 4HL9A 3E51A 2AYBA 2B56A 1Z2ZA 2HRUA 5IT4A 3HMJG 1RGVA 3QAUA 3DLJA 3G2XA 2QFJA 4W92B 3D68A 4ZP9A 2ZC4A 3P5TL 3C16A 5A8WA 2DGVA 3VGVA 2W2MP 2NLWA 3B4DA 3OVSA 2W7PA 3GLJA 4JUZA 4TU8A 1HD0A 3JSMB 2VFUA 1KQKA 1H2VZ 3EGVA 1Q1KA 5HLFB 4DX6A 4C2MA 2OO4A 4F8RA 2ZFHA 2V4JB 4RBVA 4ES2A 1HYSA 5JUMA 4DSFA 2MGZA 2XYPB 1KFSA 3FFIA 4Z2XA 4DU7A 4V1Ak 1FKPA 5DETA 3DHWC 2ZEJA 1XMOJ 2VG7A 4U95A 1S6QA 4ES3A 3W9JA 1ITPA 1NK5A 3GYXB 3BPSP 4MJKA 3RUBL 1DQAA 4LF5J 1LQ9A 1MMNA 3PW7A 2WK4A 4J91A 1AFJA 3M4XA 3JYTA 1HBNB 5KT6A 4AL6A 1RT6B 1AUSL 1NSPA 2B51A 5CH7B 2DGSA 1NB2A 3MUTP 3KLVA 4WP3A 3CCWA 2J9EA 2WRMA 3MR7A 4HEA9 5ETQA 2H3EB 4B3TF 2JRSA 2DNOA 1UFLA 2Q1LA 2IRXA 1TK0A 2VFTA 3GJTB 4F67A 1CPZA 1S1WB 4HHUA 4EWTA 2PN6A 3B4MA 1XMQF 3C6TB 2YQ3A 3DLGA 1XWLA 2HIQA 4Y65A 2ACMA 2IAJB 1OPIA 4BHQA 4FBUA 1GQEA 4N77A 1B0PA 3A8EA 4ZP7A 1YRUA 5SZTA 3ILIA 5F0WA 4IKAA 4E98A 3RU0A 3K5LA 2HBRB 3NWRA 7FDRA 4CDIA 4ITSA 4KV8B 5KAKA 3BM7A 1JLBB 2RHSB 4KFBB 2VQEF 1YJWS 4FVMA 3I5AA 3M6XA 4DZDA 3C46A 4R25A 4J9SA 1C0TA 4OZ1A 3M2UB 1RTDB 2UXBJ 2V67A 4PG6A 2B8QA 1NDLA 4ZVHA 3CT9A 2BM1A 1T3OA 2N7CA 3QT8A 4WIIA 3FC9A 3OSPA 3IS9A 3SV4A 4ZP6A 5A2QY 2V6AA 1FRHA 1L3SA 1LWFA 3EGNA 1IM6A 1N5TA 2OGUA 5IM0A 4J9PA 1RT4A 4EI2A 1VRUA 4KPCA 1VCTA 3AB4B 3M30A 2W1BA 4RUAA 2OMLA 3R2CJ 3O44A 4CLTA 1FWLA 2CUYA 2R7TA 1NJZA 4CLLA 2DH7A 1Q8KA 3J81j 4O3SA 2DNKA 1Y3JA 3K58A 1YKWA 4NWBA 3AOAA 1JJCB 5A2QU 2GCFA 3GJSB 4S0MA 5FIIA 5B0FA 2MZQA 2ZKTA 1RWKB 2BX6A 4OHVA 4A48A 1JKHA 4F7VA 3DI6A 3FSYA 3OL9A 2UV8A 4IFVA 1O6XA 1IJEB 5DGBA 5KFMA 3HXMA 1QVFR 4MKVA 2QZ8A 3PNIA 1XN9A 4M1KA 2CJYB 2ZNZA 2Z4PA 2GAHC 1XMOF 3M8PB 4DF8A 5CAAA 5M2RA 3CCMS 1S1TB 2HFNA 1DJ0A 3GIRA 4JI0J 3SQGA 4O0NA 5C2CA 5HMYA 3GFYA 4U7UD 1M90T 3HFKA 4CM2A 5IFMA 3OHAA 4UY8T 2WHOA 5K5MA 3E01A 1EARA 2FZCB 5KFIA 1HPZB 2JDJA 2GHWA 1XQIA 4ZVGA 4FYDA 3LGMA 1REVA 4KHRA 3QPIA 1OJ4A 2CA9A 1IN0A 3ENAA 1HNVA 4RO0A 3RYLA 3FVYA 2R7WA 3GIKA 2FJBB 4OZ0A 3MOJB 3BBBA 4C3MA 1S57A 1TKZB 2F4VJ 1GMUA 4FYXB 4NYZA 2R2RA 2EEYA 1RAJA 5HP1A 1BY9A 5HSPA 5L1JA 2ZH2A 3I31A 4YFUA 2ZH3A 1KSPA 1XIQA 1C4AA 1TK5A 2DB1A 4C8NA 2MZRA 3ISZA 1IBMJ 3OFHA 3H5XA 2OEKA 2IJNA 4ECXA 2DR7A 3HVTB 3KG4A 4EUVA 2OPQB 3QIDA 4FYYB 3I0SA 1PKUA 3G86A 4DQRA 2RS2A 1UZDA 2Y9HA 3C14B 3R5JB 4K5RA 4QIGA 4YDXA 2LQ8A 3TEHB 4OX6A 1MWQA 1RLDA 1SH0A 2WZ1A 4DI6A 2LQ5A 5DGAA 2GJFA 3BQ0A 5IWAJ 5IXUA 5B08A 4NI2A 4HVZA 1ZS6A 3LP0A 1ZM4A 3D4JA 1MNEA 2YWFA 3KLIB 4NLYA 5JVGQ 2HEKA 3CXCR 2E7VA 4R8UA 3IC1A 2VD3A 1JXVA 3CCTA 4X4TA 1WHVA 1Q4RA 1TL1A 2H51B 2CDRB 4URQU 4DZ6A 3GYGA 4QIEA 2COLA 2DY9A 2AWZA 2I9SA 4ED4A 1FJGJ 3T19A 4NCGB 3MM9B 1LWXA 2UXDF 4YOEA 4F0MA 2MKHA 4LF4J 2WSFC 5GMDA 1RKJA 4ZPDA 2ZJPQ 4ERDA 4URSA 4Q2MA 2N82B 4OI1A 3PEJA 3FSIA 4LUBA 4RBUA 1MWYA 2CWXA 4RW9B 2K2PA 2R8GA 1FDDA 2MQ8A 1IR2A 3Q89A 3D6MB 1IKWB 3MZIA 2RH3A 1IR1A 3HSZA 3TYTA 1FA0A 4NYPA 4JI0F 2OD4A 3CIZA 2A1BA 3CDAA 4RPFA 2L3MA 5M2UA 2M7SA 2BYCA 4M5IA 3C8YA 3UQSA 3EJMA 1WELA 2KI2A 3DLBA 1PJ6A 2BE2B 3TZWA 1OO0B 1NCLA 2H54B 3JAMY 2M9KA 2C2ZB 4JV1A 4XPCA 3BGLA 1V6HA 2YWWA 1F5BA 4QOTA 3CCES 4F4WA 1YRXA 1PBAA 4YB5A 4ZOSA 3CDBA 2DY1A 4IRCA 2G2OA 4O4GA 1F2HA 2YX4A 2OMOA 1WOPA 2ZD1A 2IDLA 5B0CA 2F4VF 3KWMA 4CLYA 2YH0A 2DNMA 4CI0B 4F3QA 2VC1A 2LEAA 4P10A 2E66A 5KTQA 2JJ4D 3Q86A 1RT2A 4DXLA 1ULRA 1RE1B 2F8HA 3VGSA 1U2RA 4ECWA 1H0HB 3JAMU 4FXVA 3HVRA 1Y7PA 2KRRA 4WE1B 5HQLA 4QIWD 3H4DA 2H5JB 3A8KA 2K8GA 4UQGA 3AY0A 4A8KA 5DQIA 1IBMF 4RW4A 1OMSA 1SJ1A 2V50A 1GXUA 1UVNA 4IRDA 1JIHA 5HANA 1KEKA 2MKKA 3GILA 3TUZC 2ZBIA 5AE3A 4AL7A 5KT4A 1TKXB 2WOMB 1PBUA 5LJ3Y 4HLBA 1U49A 2ACYA 3QGPA 5IWAF 4ID5B 2K7JA 5E33A 3LOUA 2V0NA 1IKVB 4JB8B 2B6AA 4BWJA 2DHSA 4FNIA 4LIWA 4DQIA 3RAXA 5HI7A 2YNIA 3PKYA 3NAHA 4FYVB 3LUYA 4OV1A 3QT6A 2W8KA 1PGZA 3E8OA 1KS2A 3EICA 5AXLA 3W60A 2O67A 1N56A 1YJNS 1LK7A 3E2EA 2MKIA 1F9HA 2PMWA 4I69A 3ZO7A 3DM2A 2V8VA 3QIPA 1S76D 1UW4A 1P27B 2QA4S 3MM6A 4ETZA 2XSJA 1HBMB 2E5GA 4J9RA 4F4KA 2M88A 3MAAA 4B9SA 3CO0P 2HQFA 4AXIA 1FJGF 3J7Z5 4KB7A 3FJ2A 4WFXA 5I3UB 2OPPA 3MMCB 1B99A 4LF4F 1U09A 2DNYA 2FY8A 2LA6A 1H2UX 5GAEI 2F3JA 5KOWA 4O3OA 1AZSB 1A9NB 4NCAA 1CEZA 1UKUA 1HI1A 2CJAA 2OKQA 4Z37A 2F7VA 3O3LA 1VISA 1FF2A 1LV5A 3DC2A 3OTBA 4F4XA 4X64J 2HGLA 3ENQA 3IA0A 1VQPS 5EN1A 4QIVA 2LQ9A 3FMWA 2LCWA 3OTCA 4ID8A 2V8DA 3NGKA 1VQ6S 1KDNA 4K50A 3BREA 3M8QB 3KK2A 2BEFA 2DIVA 4IDKA 1F9FA 4ZCLA 4LFCJ 2DPIA 3IO1A 4CYUB 1NMEB 3IG1B 4LREA 4ED5A 4OZ2A 3H59A 4EBEA 2QL7B 2H1YA 1TU0B 2V34A 3PY8A 2R7OA 3I4PA 5A6WA 3EMTA 4WKRA 1T9VA 2VJUA 3MR5A 4B02A 3H2UB 2G0JA 1JLFB 2MJNA 1FRLA 5L1LA 1T9YA 4CLKA 1NZAA 4KH1B 3N6NA 4PQUB 2HGMA 2W4PA 1BUXA 3R27A 2VG5B 4J9UE 2J6UA 3W65A 1TL4A 2CQDA 1KQGB 4MFBA 3P6YC 1UVIA 4Y34A 1WEXA 2GS8A 3KG0A 4IH7A 4DCPB 1I3OB 1Z2LA 5U47A 5IZHA 3SSSA 3DXBA 5D0EA 4X84A 3PACA 4KH0B 5B7WA 3TJ8A 1M5KC 1U6ZA 4OJ1A 2QFIA 2W01A 2DHGA 1VQOS 2OTLS 2GGPA 3MWBA 2Z2YB 1EQMA 1ROFA 5DDPC 3JXOA 2NXEA 5J1EB 1HHSA 2CZVC 3HHLB 3W3SA 1RWOB 4C48A 1U45A 2WCXA 3CCUS 2WONB 1MMDA 2XMVA 4USHA 4CQ1A 1F3VA 3WHIA 1Q8IA 5CYMA 2ASLA 3PX6A 2I8EA 4OI3A 3AD7C 4LFAF 3QJJA 1KVKA 2LP4A 3BEGB 4MK7A 4G1QB 3BN7A 2NZCA 1OIAA 3EZUA 3TARA 3GCXP 1LW2B 1KVIA 3M2RB 2FPHX 4ZCKA 1RZMA 3ENVA 1S72S 5H9FJ 1SJRA 1ZPVA 2D3O1 3VVUA 4PWUA 3NMRA 4J9LA 5A8RB 4TU9A 1XR5A 3CD5A 5LMUJ 3MEDA 1ZBTA 2C3OA 1JB0C 1A7GE 2ILZA 4N8NA 2E7XA 5E41A 3CNQP 1FKOA 4OYOA 1I5OB 4X64F 3BGFA 1XMBA 5T7LB 4LQ3A 1QY7A 3M05A 2P8IA 3MXHP 1BD6A 1WEZA 5A6PA 1VRTA 3MI7X 3N0VA 2YBVA 2IMWP 4LRFA 1KRPA 2R9LA 2Y1IA 1TELA 1UPMB 2KFYA 2FZGB 1U6BA 3NGUA 2NS1B 4RX6A 5G4DA 4WP9A 3U1MA 1DURA 2HS3A 4GRSA 3EGZA 3VAFA 4Y3CA 4NLUA 2CPZA 4WCEQ 3G8TA 2Y1JA 3RB3A 2UVWA 5KFDA 3J7A1 4LF1A 3BGRB 3IBFB 3N4WA 3MURP 1I6JA 3M32B 1QAJA 5K8OA 1IQZA 2O1PA 3TAPA 3PO4A 1HWLA 4ED1A 3TJAA 3BKTA 4PG4A 3J7YU 4KIAA 2GVZA 3KJQB 3CW2C 4O3NA 1B64A 2B7BB 4TKTA 1LEOA 4DV7J 2QL9B 3JQJA 5E3RA 2BKOA 3CD0A 2XHCA 1UJ5A 3TUIC 4C9DA 4LSNA 3IWXA 1X4DA 2NSBA 9RUBA 1J5EJ 3UR0A 4ZLLA 1BWVA 1DLOA 4WTOB 3FZBA 1VLYA 2CQ0A 1ICEB 5IT0A 3OVBA 5BXIA 5BYQA 4K4TA 5K8NA 5L38A 2PFFB 2F65A 5HJYA 3OTEA 2GMLA 3LAMA 3POTB 2C2RA 1O5JA 1RTIB 1S79A 2ZDPA 2BXJA 3EM1A 1N0UA 4GO5X 5E2QA 2EI5A 5KFUA 3B78A 2HMIA 2CQCA 2L9DA 3L7OA 3TQEA 3M8RA 1ZZNA 2RVJA 1N88A 4RUCA 4I6YA 2K3IA 4YUDA 2CPYA 3LP1A 1YRTA 4N41A 1B3TA 1TL3B 2PSZA 2G9OA 1OSDA 4WYWA 1K8AT 2OHDA 2GQ2A 3HVWA 3AXMA 1IWGA 2XO7A 3HSJA 1YJ7A 1FWPA 4PG8A 3S6EA 4P6QA 2W8LA 3G6XA 1M5VC 4DR3J 3KLFA 2ZBRA 1UJ6A 1DBDA 1VMBA 2DK2A 1FJ7A 5F3TA 4JV5J 3AODA 2VBWA 3W9IA 3PIOQ 4USUA 1EKRA 1PJ7A 4Y2IA 5H1SV 1RTHB 2VZ9A 2OPSA 3SCKE 1ZAVA 4I6AA 1TUGB 2DXFA 2V2QA 2BOPA 3OUYA 3FBBA 1Q82T 2VOPA 1GX5A 1FRIA 3D7SB 5GMEA 4U8YA 1KP6A 3NOCA 3PHEA 2D69A 3AJ1A 2GX8A 3AD9C 4OI4A 3MMJA 4DPTA 1DTQB 3G87A 4A8OA 2GIFA 2KZZA 3BKUA 3BDEA 5AXMA 3G82A 5DDQC 1NKEA 2YNFA 1IXKA 1LWCA 3HSDA 3I55S 1Q5YA 1RT1B 2V69A 4P71A 2R8KA 4YN3B 1NHKL 4B9VA 1BWEA 1DQ8A 1KTQA 4WP8A 1RTZA 3OTDA 2VPWB 4DV7F 4KR0B 3BPDA 4YR0A 1TFYA 2ZBCA 1N52B 3CMES 2W9BA 3MEEA 1U1LA 1IKXA 3IBWA 2MLXA 5AE2A 2GIQA 1VC6A 3J81Y 1J5EF 2AEFA 3H2VE 2HNYB 3V2UC 1S6UA 4ZVEA 1T8EA 4A8FA 4JI3J 3WC0A 1S9EA 1WHXA 2CPDA 1S4FA 4WTYA 3CJ5A 3BO3A 4H4MB 1P1TA 1JJ2R 3UPFA 4ETXA 2AD9A 1YQHA 1RAAB 4PEOA 3Q0AA 4PPZA 3D2WA 5KFNA 2KRBA 2JHEA 3QZ8A 1AW0A 4GVBA 3J81U 2JSXA 3NRBA 4XK8C 1XTZA 6AT1B 3FQKA 1WF0A 5A0YA 1MU2B 3QGHA 3BGOP 1HBUA 3NLCA 2U2FA 2HVIA 1CJTB 1S77D 1N5SA 4PXEA 3A12A 1NSKL 2NXNA 3UR3C 1WC0A 3FQLA 4U67Q 2J7KA 2QLBB 5F8JA 4DSJA 3KOAA 2R7VA 2FQQB 2CQHA 1JLGB 4KO0B 3FKBA 3KK3A 2PI5A 3MFHA 2MZJA 2GHVC 4UT4A 3OQ2A 3M6VA 2NUHA 3P3DA 2HQ3A 4PWDB 5GAGU 4DR3F 2GJ2A 2RDJA 4ZPWR 1CJUB 2AJFE 1H7WA 3GTYX 2ROPA 4J9QA 4JV5F 2QRRA 2EFNA 2W2OP 4CO2A 1FXDA 1PC5A 2IHR1 5KFGA 4ICLB 2HS0A 2BJ3A 3PEHA 4B3SJ 2Y0SD 2BE9B 3WX4A 1Q16B 1NDKA 2Y0BB 3NNHA 2XBPA 2FIUA 5BYRA 2XYHB 2KM8C 1ZPWX 3Q8PB 4HR2A 4F25A 5F41A 3NL0A 5F8MA 2VQFJ 3PRDA 4B3RJ 4H4KC 2WSEC 1CJVB 3W1YC 1SJ4P 2QSFA 4DFPA 3CVKA 1WC5A 4DS4A 2BABA 3K89A 2A10A 3MOZA 3ZZRA 3OL6A 1RT7B 4A8MP 2XULA 5JXSA 3UD4P 3GV5B 3CCJS 1QDUB 1YGYA 1VHFA 4XAKA 5K8PA 3RRHA 1WHWA 1WD6A 4X2BA 4ZDNA 3WQPA 3CCVS 4EYHB 4BC9A 5HLFA 2AYGA 4F26A 1FRMA 5D78A 3V6JA 3V4IB 8AT1B 3KHHA 2V4JA 4ZVTB 3KHGA 3PTWA 1JJ4A 4OZ3A 3TI0A 4OZLA 4M5DB 5D4PA 4P72A 4ED8A 3BZQA 2B43A 1NBEB 5HN0A 1FWKA 3QWUA 5I42B 2GZOA 4B08A 2X1AA 1UMJA 1F9EB 1TUWA 4NLXA 2X1BA 1P9QC 3QRPA 2V94A 3LWLA 1NPRA 4JI5J 4JI3F 2FYXA 1WTFA 4JI6J 3GFZA 5ETNA 1XEZA 5D15A 1HBNA 3DOKB 1Q79A 1E6VB 1RT6A 3WBZA 1AUDA 4FS2A 1S97A 3L9ZA 4QR1A 1OPZA 2QO3A 2ROGA 3M2VB 1WDDA 3BDPA 3MECB 3DNCA 1Z4UA 2CRLA 4JI4J 1YJUA 2EPIA 2BR0A 4OI2A 3IAS9 5HMWA 1SVDA 1SV5B 1YG0A 1S1WA 1TL7B 3LGHA 2AJ1A 2M0GB 1ZTWA 3C6TA 2E5HA 2MQPA 3BQ1A 3QFHA 3VGTA 2IAJA 2BA9A 1V3RA 3D3BJ 4KY3A 2BJ8A 4AYBD 4ECSA 3A13A 4H4KA 5EWEA 1LOUA 4HH1A 4KQZA 4I67A 2KXFA 5EHHA 3RBZA 4KV8A 4A46A 4FP9A 1JLBA 5ETKA 3T6JA 3THVA 1FD8A 4KFBA 4RWXA 2IJFA 3TUPA 3MCSA 3L7UA 2YPYA 1VQ8S 1G1XA 4F36A 3M2UA 4ZK7M 1RTDA 4K4YA 4KYZA 3AXKA 1ZYQA 3CC7S 4F50A 4KKOB 1J2VA 4KHMA 2W7OA 4KPYA 4ECTA 4F3MA 3FBFA 3A3OB 1AYEA 1XNRJ 4B3SF 4MK8A 4NA3A 1NK8A 3EZ5A 3T5HA 1SXLA 3OW2R 4KJIA 2VBYA 2BJDA 2VONA 4DCOB 1DTTB 2FHOB 2AQ4A 3DLHA 3O8WA 1UVJA 4DFKA 3SYZA 2CJQA 3RB4A 2VQFF 4B3RF 3T6BA 1DAXA 2E9TA 1U02A 3WX8A 4JI7J 2XY5A 1YJ9S 4ZPCA 2DGXA 2RRAA 4DCJB 1PC4A 4ZPVR 2J6TA 4DLGA 2OELA 3IXQA 3TWZA 2GHPA 1JXLA 5KG3A 1HLWA 3PDNA 2WAQD 4Q43A 3F41A 2HRTA 1FTRA 4OI0A 4JOUA 1M5SA 2HFVA 3N28A 3M8PA 4USJC 3HJFA 1SKRA 1JLEB 1BQXA 1HFEL 1S1TA 2VFVA 4U9RA 1REGX 1RBAA 2CWKA 3AH6A 3RTVA 4JI5F 1SL0A 1GAOA 4ZVRB 2FHJA 4JI6F 1WEYA 4P2FA 4ALZA 4B3OB 3BKFA 4MKAA 5ETVA 1M0SA 2OLWA 3SSQA 4ES1A 1IR0A 3I6PA 2RD5C 1RWNB 2FJWA 1Q78A 4UY85 1HPZA 3KNAA 4E0DA 4WU3A 3V81B 3GYNA 2DT9A 4JI4F 2QG9B 3KHLA 2R7SA 3LP2B 4FNHA 2RS8A 1SL2A 4PAAA 4NA2A 2VA2A 2FJAB 4O3RA 2EXUA 2HFSA 4M5KA 2J7WA 2CJBA 4ZVSB 1HMVB 1TKZA 2QYCA 1XBWA 3TA2A 3PIPQ 2PO4A 4IFYB 5HJXA 2DR8A 2HNZB 1HIYA 3LGNA 1DRZA 3N9UC 3NWGA 4TQSA 1D8YA 2YWGA 3B54A 2R8JA 3MCOA 1RUSA 4DEZA 2V9KA 1UFWA 2A6OA 1FXRA 2KXNB 3A4TA 4CTAB 4QWAA 1HW9A 3M9MB 4J9VA 1SKWA 2D7SA 5E3AA 5KFPA 3HVTA 2HW3A 3Q83A 2Q79A 2IIHA 2OPQA 4NMLA 4GC7A 3GPAA 3C14A 1Y5LB 1IBKJ 2UUTA 1WORA 3L95X 3J7YI 3SCIE 2RILA 4DSEA 1UVMA 4YB7A 4DR6J 2E1PA 4I7FB 1S1XB 1XNRF 3VAHA 4DX5A 3KJFB 4DV3J 4P7VA 2VUGA 2DBBA 3OPKA 4LRBA 1T05B 4F4ZA 3RGIA 1VQMS 2GJIA 2KG0A 3LF0A 3SSRA 3KLIA 4CH1A 3DRPB 1ZAXA 2BJ1A 1S0MA 2IC3A 1RBOB 3KLHB 4CLSA 3ZXWA 2G4BA 3BSCA 1VR6A 2MKSA 2J0WA 1UP1A 4FBTA 1MSWD 4GVLA 1VIOA 2VASA 2WVCA 4ENOA 2VB6A 4FYWB 4JI7F 2QA2A 2LDIA 4RNHA 4MMOA 3Q8SB 2MZTA 1NSQA 3PXGa 2YX7A 1Y5NB 4J9NA 3VAMA 4NCGA 3I82A 3MM9A 1HR0F 2EC0A 3PRBA 2D9PA 2HQDA 4KGZB 3I4HX 2YQ1A 1QSLA 3LAKA 2LEBA 1FD2A 2CPHA 4DUTA 2HKEA 1U1QA 1U6FA 2D3OR 1LNQA 3T9NA 4NXMJ 2ZZMA 4FVCA 4UUWA 1IKWA 4F4YA 4X4VA 3I5BA 4NLTA 4DR4J 4P75A 2IVYA 4FPIA 4MAKA 2VG6B 4QR0A 3UN2A 3LANA 2MGZB 4C0BA 2OIHA 2JEJA 2DTJA 4LF2A 2AU0A 4ED0A 3PHTA 4HH0A 2N4CA 3BSOA 3HHNB 5KFCA 1AXQA 2BE2A 2IFXA 4JI2F 2CQ3A 4N7TA 1T7PA 5BYSA 3TJ9A 4OLPA 3BO4A 4QW9A 5F3ZA 2V5HG 1QAYA 3O1LA 3R6LB 4C8LA 4LFBJ 3D5MA 3BB5A 3BV8A 2RMLA 3HK2A 3MCMA 3JTOA 3CDEA 3PX0A 2JEIA 1TMMA 1AFIA 2EFGA 4PKDB 4D3HA 5ETMA 5KFAA 3DOMB 1KQFB 2DGWA 4PZVA 2BV3A 2M3DA 2JEGA 2HGNA 2QL5B 4WE1A 4HDGA 1TMJA 1T9WA 2OEJA 3W66A 3H7HB 2OH2A 1GT8A 5HMXA 2B7CB 1P1LA 3HFVA 3OFGA 4ZPTR 2CVIA 4EZ6A 4ZP8A 4XDDA 3EXCX 3SQOP 2B4VA 2IYIA 2WVEA 3BR9A 3QLHB 4P74A 1TKXA 2UUAJ 2WW8A 3VAIA 2HHVA 1IBKF 2I38A 2WOMA 3Q8RB 4CO3A 4ELVA 1H72C 2F9JA 4LBPA 2CQ4A 2AJ2A 4DR6F 2MQQA 1N5VA 4ILMA 3CCZA 4RW8B 2XCPA 4ID5A 4DV3F 4ED3A 3R97A 1IKVA 4Q0BB 3M8WA 2FUG9 4EU0A 4QU6A 2MSSA 4NEZA 2H5IB 5D77A 2FHMA 3GR0A 1TR0A 3SEOA 1YDLA 3HHLD 2V63A 1VQSA 3DYAB 1W25A 4UF4A 4PXDA 4AE5A 2ZHBA 3GIMA 3RRGA 5CCMA 1MN9A 2RRNA 2RU3A 3IP0A 2OPRB 3CWJA 1YVFA 2HYIB 1NRKA 4DR7J 5IM0B 1S0NA 1HBMA 1Q7LB 2RKIB 3GV7B 1YI2S 1QVGR 2D3UA 3R1HA 2ZVSA 4NRTA 3TAMB 2ZJQQ 1UAWA 2EKYA 3NNCA 1X5PA 3QSIA 5EWGA 1YBUA 4Y6IA 4RNFA 4OYIA 5I3UA 3MMCA 4NLRA 4QW8A 5LXYA 2DHAA 2Y1LB 1WF1A 2VA3A 3S7RA 4OYAA 1KLMA 1AZSA 4M8LA 1G6BA 1BXNA 1R8AA 4NXMF 5D4OA 4LVOP 1VQYA 3VQTA 2C3YA 1L3VA 4DR4F 1VOMA 4J90A 5GADU 4EZ9A 3PZPA 2XEXA 2W4CA 3W2WB 4LRDA 3M8QA 2ASDA 4DPWA 2L9WA 2B8PA 3CF5Q 2DCUB 1K9MT 1UW9A 4CYUA 9ATCB 1JX4A 2J9DE 4IG0B 3IG1A 3DMJB 3A8JA 5GAGI 4O0IA 2Q6BA 1SH3A 1SIWB 4OYZA 2OSQA 4WFZA 2P6TA 4DSLA 2L48A 2LXIA 3D66A 1NXIA 4LFBF 2M8HA 4ZCIA 2BQ3A 1R6VA 1JLFA 4P2XA 5KFFA 1FE0A 5ETRA 2IM3A 5LL6d 4PQUA 5L39A 2QIFA 3G9CA 2AP6A 2C2OB 2VG5A 2MLYA 2HRYA 4MK9A 1WG4A 4TLRA 3HX9A 1H74A 3PR5B 1N32J 2OD6A 1Y9OA 2RF2B 3SFGA 2ROEA 5C24B 2GO8A 3V6KA 2DXDA 4PUOB 4XPEA 3QQCD 4FS1A 1B70B 1OS5A 3IRXB 1X8DA 2UUAF 2HS4A 1RHMB 2DNGA 4Q8EA 1FO1A 3T9ZA 1HNXJ 4FF4A 2MZ1A 4C8KA 4JI1J 1TP7A 4DPXA 1ZETA 2H4WB 3N01A 3R5DA 2XMTA 3CJRA 4ZIVA 2KU7A 3HHLA 2HHPA 2DGQA 4HKQA 2WONA 1RA6A 5L8RC 2RE1A 1JLQB 3VAGA 3ICLA 4MTPA 3LTOA 4DR7F 1K73T 1VS3A 1KHVA 1S9GB 1WOOA 4G1QA 2QLJB 2WB1D 4L75A 1LWEB 4NZ6A 3M8YA 2M4MA 1LW2A 4C3KA 3M2RA 2UZAA 4P2MA 1PYTA 5LSOA 4N76A 2M8DB 3CCRS 3BH7B 4LJMA 2V2VA 5I3PA 2XMJA 4QJVA 3S8SA 5RUBA 1T9TA 1PJ5A 3TOQA 1WDTA 2PD1A 3UE2A 1SJ3P 2B5JB 5A8RA 1RWPB 3DGPB 2FGOA 4DV2J 2AJQA 1FX2A 2ZUGA 5T7LA 1HWKA 2XS7A 2BJEA 3IR6B 2RIJA 4WYLA 3GJQB 1YJVA 3K17A 1NJIT 3QFWA 4O3PA 1URNA 3IMQJ 4DV0J 2ZC3A 4WFAQ 3RBXA 3FSXA 3MHYA 2LQBA 1FRKA 1X4AA 3TVYA 1VQNS 1C1BB 2K1RB 3F44A 5IOLA 3DRSB 4DX7A 4BDPA 1W7WA 1WC6A 2D74B 3AOBA 1UA1A 4K4WA 1WC3A 3M7VA 3E3XA 3W5ZA 2EFQA 1TTHB 4UZCA 1BHNA 2BBEA 1NU4A 2ATLA 2KL8A 4CWBA 2X3GA 4CLPA 2Y1RI 3BGRA 2UVRA 1M1KT 1MROB 4P9SA 4Z7YA 3PYFA 4RW7B 3VAJA 3M32A 5CHCB 1WACA 3FCHA 4LRAA 5C42B 2ZZTA 5ETPA 5CYQB 2FHKA 4X66J 4DG1B 3K7RA 3CIMA 1CBKA 1SKSA 1N32F 2QGFB 2NPFA 2DH8A 2FVRA 1B4SA 2MQLA 4ZJQA 5KT2A 2HHQA 1N0VC 4YY3J 3TUJC 1SIZA 1D0EA 3PO5A 4FXWA 4JV0A 2OSRA 4RR5A 1NHUA 2AJ0A 1FI4A 5DG9A 4CLZA 3W63A 2DRBA 5KT3A 3CUNA 1FFWB 3X3UA 4GKKJ 1EETB 3TNVA 3MTKA 1FNOA 2DGTA 1RTJB 4K2JA 1HNXF 3K8WA 1QUPA 1P8GA 3ONQA 4JI1F 3OBIA 2PA3A 1PYSB 2BJ7A 1NSAA 2L41A 2E1CA 2AV5A 4OI6A 1SC3B 2V8PA 4ZLNA 3DDNA 1WUUA 2Q43A 1KN6A 2QMWA 2VU5A 1R8PA 4G65A 3IGNA 2AW0A 3POTA 2X3DA 1WNEA 1RTIA 5KFQA 4DOZA 4M5NA 1KKHA 3LPEA 3M6UA 4ZN1A 5E0OA 4DS5A 1TKTB 1R8CA 1VJQA 1RWWB 1Q5VA 3H25A 3MPDA 5J2NB 1U2FA 3AAWB 1YJRA 1FJCA 3AHPA 3QT7A 2DIUA 4ZIWA 2CVEA 2XWYA 1C1CB 1MMLA 1RWXB 1X0PA 2E29A 4F2RA 4Y2MA 2AX1A 2DNLA 3LH2S 4CLFA 2G1DA 1N36F 2Z0GA 2AYEA 4NL5A 4DV2F 3PW4A 2AF6A 1EAYC 4LR8A 4DJBA 1U1NA 2QX0A 3ZC4A 4DV0F 3K8VA 4MIWA 3DLLQ 2GIRA 1IKYB 1O51A 4GKJJ 2Z8QA 4X4QA 2BZ2A 1OQ6A 1RTHA 2JFDA 2YNGB 2R42A 4HT7A 4K0KJ 2ZBQA 1MLAA 4OQJA 1NDCA 2YKOA 3IWNC 1JMTA 3I0RB 2UXDJ 3IM9A 2OTJS 4A8YA 3PJ9A 1DTQA 4BLGA 3X1LB 4N5SA 3C6UA 2XY6A 3H0PA 1QM9A 3I96A 1TV6B 3GSIA 4QYZK 5JJBA 2LECA 4I2QB 4X66F 2NZ4A 4IQMA 4OYXA 1RT1A 4CO5A 4K59A 1A0OB 3CTRA 3NY0A 3OXLA 2V2ZA 3R5BA 4YY3F 1R89A 3EXYA 1P6TA 1VK8A 4PYDA 3ILLA 2UUBJ 4B9NA 4OX9J 4BBYA 2E1MC 3MM5B 4MFBB 4B9MA 2VPZB 4GKKF 2Q6CA 1Y10A 2YX1A 1S5ZA 2IPOB 5F9LA 3QRRA 4DWIA 4RNOA 3DRXA 5KFVA 1VBKA 2RQCA 1M1HA 2HNYA 4DFJA 5I4MA 2J5AA 5J2MB 3H2LA 2I1RA 2SXLA 4LVNP 3JTNA 2R8HA 1NZ8A 4H4MA 3QWPA 3FEXB 3HHDA 2DRDA 2XLJA 3EVOA 1R43A 4ZA1A 4DL6A 2DNHA 2DJWA 3DGVA 2W2PP 4X4PA 3R8YA 2NXJA 2A2CA 1SPBP 2CPEA 4LF9J 4UTGA 3J80Y 4NE9C 2W7AA 4CO0A 3KFWX 1Y4ZB 1HA1A 1MU2A 1D1UA 4USIA 1CJTA 1VBZA 1NUEA 5AT1B 3MM8B 4HDHA 1RABB 3DXSX 1HNZJ 1JLGA 2W24A 1D9DA 4KO0A 3TR5A 3EX7B 1IBLJ 1S12A 2UU9J 3DOLB 2KG1A 3EDQB 3DLKB 3J80U 5ETOA 4ZLJA 3QATA 4PWDA 3PYEA 4OYBA 2CG8A 1DQ9A 2X51A 2VICA 4AT1B 5FDLA 2C1EB 4ED6A 1CJUA 3HSGA 3ZNJ1 3ZTQA 5F0UA 1PIEA 3WC2A 1QUVA 3RR7A 2BW2A 4ICLA 4GKJF 1ZM9A 5L9NA 3UNYA 1PSDA 2NXUA 4K0KF 3O6QA 5EX3A 3CMAS 3JSYA 3RB6A 3CCLS 2FVQA 2HAIA 1HNIA 5KFRA 4LF8J 1RU1A 2BUNA 4G1IA 1KQSR 1UVLA 4QCLA 2LDYA 3D28A 3L09A 3AQOA 3GIIA 1CJVA 5ETTA 2MSTA 2R7UA 1X60A 4NZ7A 3KMSA 3CJ4A 4DPUA 4FF1A 2VDHA 1RT7A 2DYAA 3JTPA 2DH9A 2HHWA 2IJRA 3PFEA 1KFDA 1CQNA 1S7HA 2IVMA 4E2FB 2I6WA 1ZZFA 1U7LA 4QPXA 4KTQA 4BCAA 3VF0B 2K7KA 4IRKA 3V4IA 1SUQB 4JBCA 2UUBF 1F0XA 1NPKA 4TYAA 4OX9F 4M5DA 2MXYA 4B3MJ 3ET6B 5M2PA
chains in the Genus database with same CATH topology
4ANCA 1B99A 2BX6A 3VGUA 3DKDA 3ETMA 3NGRA 3NGSA 3BBBA 3ELHA 1NDKA 2HVDA 3EJMA 1S57A 3VVTA 3EVMA 3ZTPA 3L7UA 3FBEA 4C6AA 3NGUA 3NGTA 3Q8VA 1NSPA 1BUXA 4F36A 1NHKL 5CABA 1HLWA 3G2XA 4HR2A 2B8QA 1JXVA 1NB2A 1NDLA 4ANEA 5IOLA 2AZ1A 1NCLA 4F4AA 3DDIA 5BXIA 1K44A 1WKLA 1HIYA 1W7WA 4UOHA 4W98A 1NSKL 3Q8UA 1NUEA 2HURA 4DZ6A 4ENOA 3FBFA 3PRVA 3VGVA 1XIQA 3FC9A 5CAAA 3B54A 2DY9A 1NDPA 4UOFA 1S59A 1WKKA 1NSQA 1BHNA 2VU5A 3GP9A 1BE4A 3BBFA 2DYAA 1F6TA 2DXDA 5C7PA 1KDNA 1LWXA 3BH7B 2DXEA 3EVWA 3FKBA 4O0NA 1NLKL 2CWKA 3VVUA 3EICA 3FCWA 1UCNA 2BEFA 1S5ZA 1U8WA 3EM1A 4FKYA 1F3FA 1HHQA 3Q83A 2B8PA 1PKUA 4WBFA 2DXFA 3Q86A 4KPCA 1MN9A 4ANDA 3EE3A 3FBBA 3GPAA 3B6BA 3VGSA 3MPDA 1EHWA 2HVEA 3FBCA 4DI6A 4DUTA 3VGTA 2AZ3A 1NDCA 4CP5A 1B4SA 2ZUAA 1WKJA 3Q89A 1MN7A 1XQIA 1NPKA 3R9LA 3ZTSA 1ZS6A 3EMTA 1LEOA 1PAEX 3BH6B 3PJ9A 2NCKL 3EVOA 3Q8YA 3BBCA 3WX8A 3ZTOA 1VYAA 3ZTQA 3ZTRA 4EK2A 3FCVA 4FKXA 4UOGA 3JS9A 4S0MA 3ENAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ANC A;  1B99 A;  2BX6 A;  3VGU A;  3DKD A;  3ETM A;  3NGR A;  3NGS A;  3BBB A;  3ELH A;  1NDK A;  2HVD A;  3EJM A;  1S57 A;  3VVT A;  3EVM A;  3ZTP A;  3L7U A;  3FBE A;  4C6A A;  3NGU A;  3NGT A;  3Q8V A;  1NSP A;  1BUX A;  4F36 A;  1NHK L;  5CAB A;  1HLW A;  3G2X A;  4HR2 A;  2B8Q A;  1JXV A;  1NB2 A;  1NDL A;  4ANE A;  5IOL A;  2AZ1 A;  1NCL A;  4F4A A;  3DDI A;  5BXI A;  1K44 A;  1WKL A;  1HIY A;  1W7W A;  4UOH A;  4W98 A;  1NSK L;  3Q8U A;  1NUE A;  2HUR A;  4DZ6 A;  4ENO A;  3FBF A;  3PRV A;  3VGV A;  1XIQ A;  3FC9 A;  5CAA A;  3B54 A;  2DY9 A;  1NDP A;  4UOF A;  1S59 A;  1WKK A;  1NSQ A;  1BHN A;  2VU5 A;  3GP9 A;  1BE4 A;  3BBF A;  2DYA A;  1F6T A;  2DXD A;  5C7P A;  1KDN A;  1LWX A;  3BH7 B;  2DXE A;  3EVW A;  3FKB A;  4O0N A;  1NLK L;  2CWK A;  3VVU A;  3EIC A;  3FCW A;  1UCN A;  2BEF A;  1S5Z A;  1U8W A;  3EM1 A;  4FKY A;  1F3F A;  1HHQ A;  3Q83 A;  2B8P A;  1PKU A;  4WBF A;  2DXF A;  3Q86 A;  4KPC A;  1MN9 A;  4AND A;  3EE3 A;  3FBB A;  3GPA A;  3B6B A;  3VGS A;  3MPD A;  1EHW A;  2HVE A;  3FBC A;  4DI6 A;  4DUT A;  3VGT A;  2AZ3 A;  1NDC A;  4CP5 A;  1B4S A;  2ZUA A;  1WKJ A;  3Q89 A;  1MN7 A;  1XQI A;  1NPK A;  3R9L A;  3ZTS A;  1ZS6 A;  3EMT A;  1LEO A;  1PAE X;  3BH6 B;  3PJ9 A;  2NCK L;  3EVO A;  3Q8Y A;  3BBC A;  3WX8 A;  3ZTO A;  1VYA A;  3ZTQ A;  3ZTR A;  4EK2 A;  3FCV A;  4FKX A;  4UOG A;  3JS9 A;  4S0M A;  3ENA A; 
#chains in the Genus database with same CATH topology
 3U27 A;  5I42 A;  4L74 A;  1RAH B;  2B4P A;  2GAG C;  4LBI A;  3HCX A;  1QD1 A;  5KOX A;  3HD1 A;  5B0G A;  4ECU A;  4M5M A;  4OX8 A;  3LPY A;  3VVT A;  1IBC B;  3KLG B;  3RR8 A;  4ECR A;  1RA7 A;  5LJ5 Y;  3BR8 A;  3DOK A;  4YB6 A;  1OQ3 A;  2H9Z A;  1E6V A;  3MUM P;  4RU2 A;  1VBX A;  1H7X A;  2L08 A;  5A8K B;  3GJR B;  2RJZ A;  2R2S A;  4ZVP B;  3M2V A;  3TZZ A;  2HZV A;  3UI3 A;  3MEC A;  5GAD I;  1RDR A;  5KFK A;  3BBF A;  4O44 B;  1T95 A;  3SXL A;  1ZA1 B;  2XZW A;  1N5Y B;  4LF9 F;  3Q8Q B;  1ZA2 B;  3GG1 A;  3TX8 A;  1SV5 A;  1TL7 A;  3MPW A;  4Q5V A;  5KFB A;  4DN9 A;  4WKY A;  4ZN3 A;  3VAK A;  4USK A;  3VTI A;  3K5O A;  1CS4 B;  4CNZ A;  1KR4 A;  3P96 A;  1HNZ F;  2HFU A;  4V19 X;  2Q3P A;  3HHK A;  3RG6 A;  1ACM B;  4LF7 J;  3ADA C;  2YKP A;  1IBL F;  2UU9 F;  4OJH A;  4WIQ A;  3U1N A;  1IM4 A;  3R5A A;  4DN0 A;  3DLE B;  3GZ7 A;  2GW8 A;  2DNP A;  1RWV B;  1GFW B;  2WVD A;  5K14 B;  2KYZ A;  4KKO A;  5CXT A;  2VBZ A;  3EGW B;  2GQC A;  5H9E K;  3O2I A;  4W90 B;  1SQE A;  1DAR A;  2ZWO A;  3AJD A;  5EX0 A;  4LFA J;  1SQG A;  3T1Y J;  1X4H A;  3CDW A;  3OV7 A;  2Z58 B;  3IGV A;  3P4U B;  1BLU A;  2AEM A;  1WC4 A;  1U0H B;  1DTT A;  1GXL A;  5CCL A;  3B6B A;  4LF8 F;  3KUE A;  4AQY J;  1RQ0 A;  3UVJ A;  3D54 A;  1RLC L;  1OY9 A;  2QMX A;  4DV6 J;  5LXR A;  4C11 B;  3K2Y A;  1X5S A;  2E5L J;  1KLN A;  1Q95 G;  2E5J A;  4OLO A;  4LR9 A;  3EPG A;  4LBH A;  2DR6 A;  2HK2 A;  3RW6 A;  2J6S A;  2KDO A;  1RAF B;  1CC7 A;  4O4R A;  3NGT A;  4UZB A;  3BYR A;  2BW7 A;  1S0V A;  3ETO A;  5B0B A;  1GK8 A;  4B3M F;  4I2P B;  1Q86 T;  2W25 A;  2F63 A;  3AD8 C;  4YS2 A;  3W5Y A;  2LQJ A;  1N33 F;  1JLE A;  1NK6 A;  2QLF B;  2LFV A;  5C5J A;  4IG3 B;  5IT9 Y;  1EP4 B;  5DZ6 A;  1NK9 A;  2Z2L A;  3CC2 S;  2XGP A;  4KRW A;  1YX2 A;  3QT5 A;  2B0G A;  4B3O A;  4OHZ A;  2W9B B;  1AA1 B;  3IN5 A;  4HI1 A;  2MY7 A;  5GVQ A;  1APS A;  2FJE B;  3TRG A;  4DQS A;  4RKU C;  3RRK A;  2R7Q A;  3KLE B;  4OX7 A;  3A3N B;  3BBC A;  3V81 A;  4C3L A;  4DFM A;  1UTA A;  3OT9 A;  1K0T A;  1YIJ S;  1T9X A;  2XY7 A;  3GFH A;  3Q2T C;  4C4W A;  3LP2 A;  2HPU A;  3UWT A;  5IT9 U;  3THP A;  2ZH8 A;  1RSC A;  4AFF A;  1H2T Z;  1RT5 A;  2MDA A;  1HMV A;  4KC5 A;  4RU9 A;  2YH1 A;  2QT7 A;  1UZH A;  4U96 A;  5THW A;  4YR3 A;  2FGC A;  4IFY A;  4ECV A;  1FCA A;  3B82 A;  2HNZ A;  4W98 A;  2IMO A;  5FD1 A;  2JFK A;  4DUY J;  3D6F B;  3PRV A;  3EZO A;  3R5G A;  5KFY A;  4LF7 F;  2DO0 A;  4NXN F;  2PII A;  5A0Y B;  3UCG A;  3MAQ A;  5LT5 A;  5B0D A;  4CTA A;  4X4S A;  2WVB A;  1RT3 A;  4DSK A;  5G0R B;  2CNK B;  4RNM A;  3PVX A;  1S1U B;  2CXE A;  3GE9 A;  2JLE A;  4IR9 A;  1FRX A;  3SV3 A;  4LSL A;  4J9O A;  2UUW A;  3TZX A;  5AXN A;  4I7F A;  1S1X A;  1L5U A;  2NCK L;  2OAU A;  2BVZ A;  4MH8 A;  1YJT A;  1GMV A;  2ADB A;  3ZTR A;  1T05 A;  1L3T A;  2ZHO A;  1UEU A;  3T1Y F;  3HM9 A;  3DKD A;  2JEF A;  3K57 A;  3AA9 A;  1CJK B;  1H38 A;  2IM1 A;  4NLW A;  3PW0 A;  3DRP A;  2ADC A;  5J2P B;  1I94 J;  4JYA J;  3OHB A;  4AQY F;  3KLH A;  4J9M A;  3G71 S;  2AGO A;  3DRR B;  1NB7 A;  4IUF A;  5IC4 B;  4DV4 J;  4DV6 F;  5F8L A;  4DHV A;  1HWU A;  3IR7 B;  2NR0 A;  1FKA F;  3GU0 A;  2E5L F;  3LO3 A;  1TVR B;  3HD2 A;  4CRJ A;  4X4N A;  5KG5 A;  4K5S A;  5B0E A;  4XO0 A;  1CSJ A;  3FRZ A;  4I6W A;  4OV6 A;  2ZOF A;  4LF6 J;  2ZE2 B;  2R7R A;  3JB9 k;  4LRC A;  3I87 A;  1DHM A;  3OXF A;  3LA0 A;  2RUG A;  1VQ5 S;  4QU7 A;  3SCJ E;  2VG6 A;  2HBY B;  4CLW A;  2DNQ A;  4TU7 A;  5CD4 A;  2FB0 A;  3ILJ A;  3VWS A;  3EPI A;  2RRB A;  2IDE A;  4BWM A;  2CQI A;  1FDN A;  4CNY A;  1D3W A;  2POK A;  1WHY A;  4B9T A;  1HAR A;  3LAL A;  1TK8 A;  3N79 A;  2D1C A;  4I64 A;  2APO A;  4M5G A;  3UCZ P;  5HRO B;  1FK9 B;  3IWL A;  5KFJ A;  3AJ2 A;  2OJ3 A;  1H73 A;  3KUG A;  4PPD A;  2GNK A;  3SDE B;  1F6T A;  3HKW A;  5C7P A;  4OZN A;  2XMK A;  4DDF A;  2PEB A;  3H8Y A;  1WG1 A;  3Q24 A;  2X1G A;  1BQM B;  1X4G A;  2HFZ A;  1FVS A;  4X4O A;  1C0U B;  1GNK A;  2XYG B;  2V9W A;  2O01 C;  3IBC B;  3RBE A;  1UET A;  1LXJ A;  3DOM A;  4QR2 A;  4DUY F;  1U25 A;  3D67 A;  1GTE A;  2AKW B;  4M63 A;  1NKC A;  3KNG A;  2G2Y A;  3BJY A;  4EK2 A;  5K20 B;  2KM8 B;  3PR4 A;  5D4N A;  2NXC A;  4ZVU B;  2XWX A;  1E6Y B;  1HWI A;  2VOO A;  5HVH A;  4WF9 Q;  1JK9 B;  3BSA A;  4D3G A;  2XHW A;  2WBM A;  3QLH A;  1VGY A;  4ZHR A;  3G6E S;  1V3Z A;  3MM7 A;  5D6G A;  2C2K B;  1TUV A;  3ITH B;  1RP5 A;  2XNQ A;  2C3M A;  2HLU A;  4RW8 A;  2VL1 A;  5DM6 Q;  5IC6 B;  4Q0B A;  2NYH A;  3MR3 A;  3NG8 A;  4N8O A;  5HBM B;  3H42 A;  2KTQ A;  2FZK B;  3NS5 A;  3I56 S;  4WK1 A;  4NZ0 A;  1I94 F;  4JYA F;  3DYA A;  3D3C J;  1R31 A;  2GFF A;  4DBQ A;  4DV4 F;  1SC4 B;  4OYP A;  4AD6 A;  2K3K A;  4TLQ A;  2X1F A;  5LOQ A;  2OPR A;  1J5O B;  1RWU A;  3QSY B;  2E5I A;  2P9C A;  1JWW A;  4RUH A;  4MIA A;  2HBQ B;  1F60 B;  4K4Z A;  2YNH B;  2M5Y A;  3HI9 A;  1HQE B;  1FX4 A;  2RKI A;  4NLS A;  2WTF A;  4C8Z A;  4WU2 A;  3TAM A;  2C42 A;  5LSL A;  1RHQ B;  2A2D A;  4WFB Q;  3VGU A;  2MZS A;  2EFO A;  4RUB A;  3MMB B;  1KD1 T;  1AT1 B;  3ZZ0 A;  4FF2 A;  2PI4 A;  4LF6 F;  5F8H A;  4PRF A;  2HHU A;  2HZA A;  2C2E A;  1NH7 A;  4L3K A;  1S1V B;  1HQU B;  2NPI A;  1RHJ B;  3TQ1 A;  4Y28 C;  1ZH5 A;  2XC9 A;  2HIY A;  3T5K A;  3U02 A;  2CQ2 A;  3D0H E;  4UOF A;  5MAO A;  2M70 A;  4H4O B;  3JSR A;  5EDW A;  4ELT A;  5KG0 A;  4EMD A;  3W2W A;  3S01 A;  2F8E X;  3HPO A;  3MFI A;  2JC1 A;  2VJV A;  4AND A;  3FMB A;  3DDK A;  2YKM B;  2XQC A;  4IG0 A;  1CUL B;  3DMJ A;  4LF5 F;  2HHH J;  3D0I E;  3CUL A;  1FJE B;  4FDF A;  3C66 A;  1KTV A;  2E1R A;  2JL9 A;  3ILO A;  4IO1 A;  1O8B A;  5E3P A;  3KK1 B;  1GEH A;  1B0V A;  2AEJ A;  3QAE A;  1V5I B;  2HHS A;  2AGP A;  3CJ2 A;  3HUL A;  4C0O C;  2BAN B;  4NEY A;  2HLT A;  1RAO A;  4QZV B;  2BQR A;  1WKL A;  4RL1 A;  4Y2K A;  4G3I A;  4GC6 A;  3OR1 B;  2Q66 A;  3T1H J;  1X4C A;  1UWB A;  5HL7 Q;  2D41 A;  2MKC A;  4R5P B;  2D3Z A;  2RF2 A;  2MLZ A;  1RAG B;  5C24 A;  5T41 A;  4DL7 A;  2C2M B;  3ZNU A;  2DHH A;  4PUO A;  3KG1 A;  3DU6 A;  4WFN Q;  1ZM3 A;  3IRX A;  4TY8 B;  4C8M A;  4I4B A;  5EGY A;  1JLC B;  1U4B A;  1XNQ J;  2KYX A;  2F40 A;  4USV A;  1BQN A;  2GA7 A;  5DLG A;  3UDC A;  2FJD B;  4RWW A;  1GMW D;  5D0G A;  5HAT A;  3EWG A;  1LW0 B;  3T5L A;  2UXB F;  2B9X A;  4F02 A;  5F8G A;  3MAH A;  3D1O A;  3OXG A;  3SIP B;  3NBP B;  5EWF A;  2JWN A;  1FDA A;  3MMA B;  3EDR B;  5KFT A;  1MWZ A;  1JLQ A;  4P52 A;  2CZ4 A;  2RHQ B;  1T02 A;  4ECQ A;  1GXT A;  5C25 A;  1LFW A;  1FTC A;  1S9G A;  2DR5 A;  1I1G A;  4Q8F A;  4MKY A;  2ZZN A;  1Y5I B;  1FXL A;  1LWE A;  2IC3 B;  1N34 J;  1NH8 A;  4G1P A;  1VC5 A;  5I3Q A;  1FNX H;  4M95 A;  4F04 B;  3RB0 A;  1BE4 A;  3H5U A;  3AFG A;  1VRQ C;  1PO6 A;  2DEJ A;  3GFX A;  2YWH A;  3UD3 P;  4UST A;  8RUC A;  2B5J A;  2MEW A;  2X7I A;  3DGP A;  2QJ3 A;  2HVZ A;  2ALY B;  4HAC A;  5IS2 A;  5KFE A;  1XJW B;  1CG2 A;  2BOA A;  2KB2 A;  4C7Q A;  4KGK A;  1S99 A;  2DIT A;  1EZZ B;  3MGJ A;  5DS7 A;  4M5L A;  1R0B G;  4WK3 A;  3KMQ A;  4ILR A;  3QJL A;  4GMK A;  1R0A B;  4OZ5 A;  2KVQ E;  3CJQ A;  4B9U A;  3MEG B;  1R8H A;  2QA4 G;  1CC8 A;  3CDU A;  4HTJ A;  4K4X A;  1VHI A;  3GG0 A;  3KXD A;  2H4Y B;  1T03 B;  2W9C B;  1HNW J;  1C1B A;  2K1R A;  2DVI A;  2HHH F;  1N6Q B;  2VC0 A;  3JSM A;  4G6V B;  2KFN A;  2VH7 A;  1FES A;  3DRS A;  3MPU B;  3FNN A;  2H48 B;  1XR7 A;  2HFO A;  4HHJ A;  2EBE A;  3GIJ A;  2AYM A;  1XK8 A;  3CJ8 A;  3OR2 B;  1S59 A;  5L9X A;  1U1R A;  1TKD A;  4OJ3 A;  3HF5 A;  3CD6 S;  1DFD A;  2WVF A;  3NGD A;  3LQV A;  2XLK A;  1M5P C;  1HW8 A;  4NLQ A;  3QGG A;  1S6O A;  1MRO A;  4RW7 A;  3FDS A;  3OLA A;  5C42 A;  5CYQ A;  4DG1 A;  2XS2 A;  2ZH5 A;  2DGO A;  2EW9 A;  3T1H F;  3M9O B;  3UO0 A;  3WDO A;  1R0C B;  4X65 J;  2FJX A;  3M9N B;  4WZQ A;  1RXO B;  2W9A A;  1FRJ A;  3I9Z A;  3OL8 A;  1HBO B;  2G0I A;  2Z30 B;  1EET A;  3CCS S;  4NLG A;  3Q2S C;  1XNQ F;  3KJV B;  1RTJ A;  3HZG A;  1GMW A;  2LXF A;  2JOQ A;  1RB0 A;  3R3T A;  2DEI A;  2BDP A;  2O3D A;  1SBR A;  5BR8 J;  4USM A;  4UQT A;  2HWT A;  2DNR A;  4C8O A;  3QJP A;  1NLK L;  3FCW A;  4CT8 A;  4ATN A;  3HDS A;  5KFL A;  2GO9 A;  3TZY A;  2DRA A;  3HLU A;  4QIF A;  5D0R A;  1TKT A;  4DU8 A;  2HQG A;  3G6V A;  4ZMM A;  5J2N A;  2EK6 A;  3CJK B;  2HVH A;  5KG4 A;  1YIT S;  1H6K X;  1N34 F;  4KGM A;  4ZCM A;  2C3P A;  2NYI A;  3I5C A;  4RNN A;  2YKN B;  5D4L A;  2ASJ A;  2BMB A;  1HI0 P;  3N6M A;  3W9H A;  2KFZ A;  1C2P A;  4AUK A;  2BKN A;  1C1C A;  3GMG A;  4U6P A;  5H9F K;  3WIU A;  5MLC V;  1NK0 A;  1FEE A;  2CG4 A;  3P49 B;  3FGV A;  4EEY A;  3H20 A;  2F1F A;  1WJ9 A;  4TXS A;  5KG6 A;  1T11 A;  2DD8 S;  1T94 A;  3G8S A;  4EO8 A;  4URG A;  4IR1 A;  4RW6 B;  4X4U A;  2CNO B;  3U1L A;  2MQN A;  3N6L A;  4CM0 A;  1T3N A;  1D9A A;  1KLM B;  1P9Y A;  2IRY A;  2IM0 A;  2IRU A;  5KT7 A;  4ZS6 A;  3IM8 A;  3ZZO A;  1V3S A;  1F3F A;  3L4B C;  1IKY A;  1S7I A;  2FTR A;  2V4R A;  1HNW F;  1X9W A;  5F9N A;  2BAC A;  4WFY A;  4TN2 A;  3F0N A;  2FDN A;  2PMZ D;  1R3N A;  2YNG A;  2WBR A;  2ZDO A;  2GVD B;  2YTC A;  2VIH A;  4P7T A;  2CKW A;  4I68 A;  3VV2 B;  2KT3 A;  1HR0 J;  2KJW A;  2OI2 A;  2R2U A;  3I0R A;  2MB0 B;  5L1K A;  1FE4 A;  2VPY B;  2G0C A;  3VR1 A;  1NK7 A;  1X31 C;  4UOG A;  1JXE A;  2GV1 A;  2B4O A;  2BE7 D;  1TV6 A;  3GQC A;  3NCQ A;  1WC1 A;  3EVM A;  3MD3 A;  1VBY A;  4C98 A;  4I2Q A;  1JLA B;  1K0V A;  1EJ7 L;  1VIX A;  3UN3 A;  1RJJ A;  4U7C A;  3KKF A;  4IOB A;  1YHQ S;  1FER A;  2YWE A;  2N4D A;  4X65 F;  4ED7 A;  5HK4 A;  2OFH X;  4KSE B;  1QE1 B;  4H54 A;  5L1I A;  2GC8 A;  3VZH A;  3MM5 A;  3QO9 B;  1QSS A;  2ALZ A;  2HND B;  4JI2 J;  6FDR A;  3K5M A;  3W62 A;  4DL2 A;  3H98 A;  2DO4 A;  2FVP A;  5BR8 F;  4ZJO A;  3MUV P;  4FN5 A;  2P9E A;  5IQQ A;  4LQ9 A;  5J2M A;  2I5J B;  5HMZ A;  3M1V B;  2EKN A;  3G6Y A;  5E3Q A;  2J0X A;  2FLL A;  2CJ9 A;  3NKY A;  3RW7 A;  4TY9 A;  3OFE A;  3WIV A;  3FUY A;  4LSZ B;  4NAS A;  3UDL A;  4ANC A;  2LU1 A;  3ENW A;  3NNA A;  5D3G B;  4FF3 A;  1S6P B;  1B7F A;  1C4C A;  3QZ7 A;  3DN9 A;  4NX9 A;  4C97 A;  2NRE A;  1N54 B;  2JZ5 A;  2XGQ A;  2HSE B;  3HKZ D;  4RJV A;  1SI9 A;  4PAB A;  5DLF A;  3TA0 A;  3GCW P;  4PR6 A;  1PAU B;  2V8H A;  1FVQ A;  3JQK A;  2RSQ A;  2AJ4 A;  1KNZ A;  1L3K A;  1VQ9 S;  3MM8 A;  3ZFV A;  2JLF A;  5BJR A;  2P6S A;  3C15 B;  2VPX B;  4MYU A;  4DR1 J;  1T0T V;  4A8X A;  1CLF A;  4FXD A;  3W2V B;  1HHQ A;  4DPO A;  4ZJL A;  1CVJ A;  3DOL A;  1SJF A;  2ILY A;  2E1A A;  2Y8Y A;  3DLK A;  2WB4 A;  2V68 A;  2RT3 A;  1RAI B;  5KT5 A;  4B17 A;  1YLX A;  1MN7 A;  4MIB A;  3HVA A;  5J2Q B;  3V6D B;  2E44 A;  4L72 B;  4ZPA A;  4O23 A;  5GMK a;  2J76 E;  3DRY A;  2R8I A;  1HKA A;  2J0Q D;  2N3L A;  2MHE A;  1U48 A;  2QTW A;  3LWM A;  5CZV A;  1WOS A;  1J27 A;  3TW0 A;  1NM2 A;  3C16 B;  2PFD A;  3OJU A;  2CZ9 A;  5A8W B;  4LFC F;  4YME A;  3ZZT A;  1ZM2 A;  2V2K A;  3S1T A;  4NLP A;  2W2N P;  3H5S A;  1R8B A;  4RW9 A;  5F8I A;  1PG5 B;  2UVV A;  1X0F A;  2VKZ G;  1NO8 A;  2CIM A;  3EE3 A;  1HYS B;  1SC1 B;  1IWA A;  5KFO A;  2R2T A;  2JC0 A;  1SUQ A;  3FFI B;  5DJB A;  4ZLP A;  1FKP B;  3K59 A;  1S48 A;  2VG7 B;  1F5A A;  1S6Q B;  4NLV A;  3V5R A;  1RCO B;  3ET6 A;  2RU9 A;  1U24 A;  3SI8 A;  4RLE A;  1YSJ A;  1U0S A;  4UW2 A;  1YZ7 A;  3JYT B;  2PMH A;  1Z1Z A;  5FJ4 A;  4DL5 A;  3Q22 A;  4DL0 C;  5CYJ A;  4TQR A;  4OFZ A;  3BN4 A;  1W2I A;  4UOC A;  4K8R A;  2E9R X;  2ZM6 J;  2KO1 A;  3KLG A;  1JNR B;  3TVZ A;  2AIR B;  2VF3 A;  2UV8 G;  4CLU A;  5A8K A;  2UXC J;  3MR6 A;  2O66 A;  2HQI A;  5FLX Y;  3CGI A;  4O44 A;  3ISN C;  1WF2 A;  1U8W A;  1N5Y A;  1Q81 T;  5HVF A;  3DLG B;  1EX8 A;  2XS5 A;  2EG2 A;  4ZIT A;  2UP1 A;  4NRU A;  3B8H A;  3CJT A;  1RAC B;  1BC6 A;  1SL1 A;  1UA0 A;  4ILL A;  5KFZ A;  4E8U A;  2BKP A;  1R7I A;  1RYS A;  4NMX A;  1CS4 A;  5FLX U;  3PFO A;  4DR1 F;  3IR5 B;  2EFP A;  2RQM A;  2CPX A;  5B0A A;  2C2D A;  5DZ7 A;  3NGR A;  3MEK A;  3ELH A;  2J8A A;  1C0T B;  4OHW A;  2CPJ A;  4DL4 A;  3QNW B;  3FBE A;  2MYF A;  5CAB A;  2FC8 A;  3DLE A;  2HWH A;  1XR6 A;  2VFR A;  2OP5 A;  1K44 A;  1YWX A;  1WTB A;  5HAO A;  4JP8 A;  4QWC A;  3WZ0 A;  1WSR A;  5K14 A;  5LMU F;  2GMH A;  2LMI A;  4KGV B;  4WPA A;  1OWX A;  1SJQ A;  3IS9 B;  3F73 A;  2GQQ A;  4IH6 A;  2F9D A;  1LWF B;  4CH0 S;  1KBR A;  2XNR A;  2DNN A;  2HAF A;  2MQM A;  1X9S A;  1RT4 B;  4FKY A;  4TVA B;  2V8G A;  1VRU B;  2O5D A;  1U26 A;  3M30 B;  1U0H A;  3C19 A;  3OLB A;  4JV2 A;  1RAE B;  2XCA A;  4CO4 A;  3MF5 A;  4AL5 A;  3MPV A;  1YBA A;  2A6M A;  1UEK A;  2BJ9 A;  1GH8 A;  5DG8 A;  4DUZ J;  2EVZ A;  5HQM A;  4OMF G;  4C11 A;  2QE5 A;  1X4B A;  2U1A A;  4J7C A;  1JKH B;  3DI6 B;  2YXL A;  4DR5 J;  3HHL C;  5IV4 A;  4IFV B;  3D9B A;  1NJY A;  2NUU G;  3CSK A;  1RCX B;  2PT0 A;  3G4S S;  2DNZ A;  1NJX A;  3Q8V A;  3C6U B;  2HQC A;  2A3J A;  5AXK A;  4ZPB A;  4MT1 A;  4QYR A;  5J1P A;  3OD2 A;  3D1H A;  1QJH A;  2DIS A;  4K2X A;  1OSC A;  3O5T B;  1Y11 A;  1N5Q A;  2CPF A;  3US5 A;  2RDD A;  2W4D A;  4I2P A;  5DQH A;  4KE5 A;  2FLP A;  1RIS A;  3GP9 A;  3SQG B;  1NAQ A;  2VBX A;  2ZJR Q;  4MYT A;  4IG3 A;  3BYP A;  5GAH U;  1EP4 A;  2JH3 A;  2ZM6 F;  1DZ5 A;  3BSN A;  3E01 B;  3VQS A;  4CP5 A;  2UXC F;  4JI8 J;  4ECY A;  1REV B;  2B9Y A;  2ZH4 A;  1ZTT A;  1PAE X;  1UFK A;  3KLE A;  4M94 A;  2NSC A;  1F2G A;  1HNV B;  3FCV A;  3JS9 A;  1TZ0 A;  4B9L A;  5T14 A;  2HBZ B;  4WJB A;  5HP1 B;  3C3L A;  4F0H A;  3TA1 A;  3VAL A;  1DY3 A;  1FEH A;  2LXU A;  2I0X A;  2AZ1 A;  1M5H A;  3W7B A;  4DSI A;  3UN5 A;  2ZH6 A;  2IA0 A;  2ATC B;  1M5O C;  2IA6 A;  1U1P A;  1UPP A;  2JX2 A;  2PE8 A;  6FD1 A;  3CPW R;  1SKU B;  2FVS A;  1F1B B;  4IH5 A;  5G0R A;  3I0S B;  5J1E A;  5DM7 Q;  2CAD A;  2XTJ P;  3RAM A;  2CQ1 A;  2ERR A;  3T1A A;  4DMZ A;  1RI7 A;  1S1U A;  3HZE A;  1KON A;  1WG5 A;  4ZVO B;  3VHQ A;  1U2C A;  3FBC A;  2CQG A;  1H3D A;  2J9D A;  1M1G A;  1G2E A;  4HT5 A;  4K7Q A;  3SBM A;  4NI2 B;  2NQP A;  3AB2 B;  3FRY A;  3KJN B;  1QSY A;  3LP0 B;  1H98 A;  4QQB A;  4ELU A;  2JVR A;  3GR1 A;  2RQ4 A;  4UUX A;  2B3T B;  2QSW A;  2IBO A;  1V9O A;  3CMQ A;  3QGI A;  5FDL B;  1K47 A;  2QEX S;  1CJK A;  4R8U B;  2AMC B;  3MPY A;  2P2C B;  3R7S B;  4YHH J;  4C6A A;  5J2P A;  5KG7 A;  2EC2 A;  2MY8 A;  3DRR A;  1TL1 B;  1FHT A;  4LMZ A;  1RU2 A;  5C2G A;  2MMY A;  4YEA A;  4DUZ F;  3NCR A;  4CO1 A;  2QMU B;  2HHX A;  2HUR A;  2YPZ A;  4OJG A;  2PA8 D;  4Y2A A;  1UVK A;  3N5F A;  4QWD A;  4M5J A;  1N36 J;  4ER8 A;  1HNI B;  1TVR A;  3H90 A;  3TAN A;  4DR5 F;  1NK4 A;  2AT1 B;  3KDN A;  4A8W A;  1OY6 A;  1ZOT A;  2VOD A;  1RWM B;  4X62 J;  2HWI A;  2CFX A;  2CNL B;  3W8P A;  3KUH A;  2ZOM A;  4WWS A;  2HVE A;  4Q44 A;  2YVS A;  3TP2 A;  2AZ3 A;  3UW1 A;  2ZE2 A;  5DG7 A;  2B4U A;  4IO9 Q;  4BC7 A;  3M6W A;  3QMQ A;  4M5H A;  1GX6 A;  1EIY B;  1MW7 A;  4N47 A;  1VFJ A;  5DO2 A;  4Y0F A;  3SMZ A;  2ASY A;  3OTO J;  4QPT A;  2QLW A;  2G2Z A;  2LKZ A;  4CH7 A;  2YQ0 A;  3OVA A;  2HVD A;  2J0S D;  1NPP A;  4YR2 A;  2L9N A;  2FLO A;  1LKZ A;  4FZV A;  4JI8 F;  1LFP A;  5HRO A;  1BGX T;  1FK9 A;  3TAQ A;  2DCL A;  1ELO A;  3G8Q A;  1Q0N A;  3DU5 A;  1S10 A;  1D9F A;  3UDE A;  4O4G B;  2M2B A;  3W8G A;  2VDI A;  2FHJ D;  2ZD1 B;  3T3F A;  3SDE A;  2JLG A;  4CT9 A;  2OEM A;  3GON A;  4CCH A;  3EVW A;  1EQ0 A;  1D8Z A;  1AB8 A;  1KWM A;  1RT2 B;  1Q7Y T;  1BQM A;  5AE1 A;  4J9K A;  4CZC A;  1C0U A;  1V5V A;  2FD2 A;  4Q7A A;  2QC3 A;  1K1Q A;  2XMU A;  2P5V A;  1NHV A;  1X5O A;  2KT2 A;  4RW4 B;  5KG2 A;  3ZTO A;  2A18 A;  4GO7 X;  3KYL A;  4EBD A;  4U8V A;  2F8M A;  1VQ7 S;  2EG1 A;  1E6Y A;  3HJV A;  5K9F A;  1A6L A;  3HT3 A;  5A76 A;  1G7C B;  2C3U A;  3NCP A;  1U1O A;  2CAJ A;  1NKB A;  2BRL A;  3TEG A;  2JVO A;  4NA1 A;  1Q8B A;  2BQU A;  1D09 B;  4ANE A;  1RHR B;  2PC6 A;  2YKQ A;  2R3V A;  3ITH A;  3GB0 A;  1NND A;  2B6A B;  3P45 B;  1WI6 A;  2I2Y A;  1S4E A;  4R0E A;  4Q2L A;  2YNI B;  2EWH A;  5AJ3 J;  4LIR A;  1NDP A;  4I0W A;  2QA1 A;  3OJS A;  3QBC A;  5HBM A;  3NS7 B;  3V4M A;  4RZR A;  4YHH F;  4YQW A;  4J37 A;  2KHD A;  1TL3 A;  4L76 A;  2EK1 A;  3DM2 B;  3BO2 A;  3QIP B;  2H5E A;  1NJW A;  3AOC A;  1N8R T;  3MM6 B;  2XSJ B;  1JJH A;  3J7Z T;  1TAU A;  1J5O A;  4OZJ A;  4DV1 J;  3MAA B;  3HP6 A;  3IAM 9;  4OYM A;  3R9L A;  1CQM A;  2DGU A;  5ITH A;  2YNH A;  4A8S A;  1HQE A;  2OPP B;  3NOG A;  1X5T A;  5DDR C;  1QTN B;  2Y8W A;  2K06 A;  3UVJ B;  5B09 A;  2LU2 A;  1VQ4 S;  2DHX A;  2Z2M A;  1X4E A;  4X62 F;  4O3Q A;  3MMB A;  5IV3 A;  5K8M A;  5EUH A;  4NPO A;  2RNE A;  4F2S A;  2DPJ A;  1IVZ A;  1KVJ A;  5JVH Q;  1VK3 A;  3D1Q A;  4KGX B;  2KZM A;  1TAQ A;  5CA5 A;  4L3N A;  3P5B P;  4UOH A;  3KTQ A;  1SB6 A;  4KBI A;  1YZ6 A;  2KH9 A;  1U8S A;  1GTH A;  1S1V A;  1HQU A;  2FVC A;  4PYA A;  4V19 J;  2WSC C;  4P2S A;  2R7X A;  3KHR A;  4C0H A;  3VZI A;  1VLO A;  2FY1 A;  3TX0 A;  3OTO F;  3A8I A;  3KK2 B;  4H4O A;  1WSV A;  3CO9 A;  2ZHA A;  4IDK B;  1KHW A;  2E9Z A;  4L73 A;  1RYR A;  5E5N A;  1QAI A;  5D8H B;  2C2N A;  3P8B B;  2XMW A;  2N3O A;  2YKM A;  1CUL A;  4PCQ A;  3K5N A;  5ADZ A;  2CJK A;  1U1K A;  2CDQ A;  3NXZ A;  2LA4 A;  3Q8Y A;  1VYA A;  1IJF B;  4QBU A;  4Q45 A;  3D6H B;  2IVF B;  3KK1 A;  3FEY B;  2LYV A;  4NLD A;  1JNZ B;  5LM7 E;  1O0P A;  4EFA C;  1LXN A;  2UUC J;  3CED A;  3T41 A;  3AT1 B;  1PYO B;  1Y3K A;  2BAN A;  4W4M A;  4PXC A;  3ZZY A;  4DV5 J;  3OR1 A;  1RT5 B;  2XLI A;  2ZKU A;  4HTI A;  3UD5 A;  2BRK A;  2M52 A;  4R5P A;  4EYI B;  3A3P B;  3KDO A;  3IFE A;  2CPI A;  2V4Q A;  5DRK A;  4XIU A;  1IUJ A;  2KHC A;  4DR2 J;  3AQP A;  1Q53 A;  2CJX B;  2XMA A;  2FJV A;  1MG7 A;  4TY8 A;  1JLC A;  2F4F A;  2GGP B;  1UEV A;  4PWW A;  3R1L A;  1XER A;  1RT3 B;  1FFG B;  2XM3 A;  3R7B B;  3Q23 A;  4XTT A;  2ZUA A;  1G4C A;  4I56 A;  3RJM B;  5AJ3 F;  1FT8 A;  4XDC A;  3K5P A;  1LW0 A;  2D9O A;  4PG5 A;  4Y2C A;  3CJ3 A;  4FKX A;  1RHK B;  3BS9 A;  3ZZZ A;  2Y3Y A;  2MQO A;  3GSD A;  4LSL B;  2LLZ A;  3I9V 9;  3NBP A;  1SC6 A;  5CZX A;  5CYM B;  1Q8L A;  3PYD A;  3UCU P;  4A4J A;  3MMA A;  2HZC A;  3BF4 A;  4KAI A;  3F56 A;  1KC8 T;  4NCB A;  3PJX A;  1RAD B;  3GWC A;  4DV1 F;  1UWA A;  2CNN B;  5JMN A;  3RZA A;  4YB1 P;  4J5O A;  3UDV A;  1S49 A;  3FEZ A;  1N4L A;  1RHU B;  2ZIT A;  1G3O A;  1FNM A;  4U7U K;  2Z2Z A;  3PCO B;  1FDB A;  1YBT A;  1UCN A;  4WZM A;  3MED B;  1L3U A;  2PGC A;  2CYY A;  4EGL A;  3MCN A;  3C2P A;  3NAI A;  1VJW A;  1FKO B;  2Z57 B;  2RAQ A;  1ARO P;  1HL6 A;  2F5G A;  1B7Y B;  1X9M A;  4K4S A;  2QLX A;  2XO6 A;  1VRT B;  3DHX A;  4HHH A;  4LR7 A;  3MTJ A;  4DQP A;  1B0T A;  1R0A A;  3NGS A;  3MEG A;  3JQM A;  3ZTP A;  1HWJ A;  5DDO C;  3TO8 A;  3HT0 A;  1X7V A;  1T03 A;  4PQA A;  4KHP J;  2W9C A;  4Z7C A;  1YTY A;  4A47 A;  3L7P A;  3DDI A;  3SFU A;  3ISN D;  1N6Q A;  2PDA A;  3W5X A;  2FLN A;  3CE8 A;  2XI3 A;  2EFV A;  3H4B A;  1IQT A;  4I1T A;  4X4R A;  2XSF A;  3SZ2 A;  3BQ2 A;  1N48 A;  2XZT B;  1VC0 A;  1RKI A;  1JQG A;  3OR2 A;  1HQ2 A;  3W64 A;  4QYZ J;  1HD1 A;  2UUC F;  3EYZ A;  4DQQ A;  3H40 A;  1K1S A;  1SCJ B;  4WBF A;  3CC4 S;  3D6T B;  2H65 B;  3JSB A;  4FPR A;  3THT A;  4F3O A;  3PV8 A;  2GVZ B;  2BM0 A;  1N33 J;  4DV5 F;  2YWK A;  3ZTS A;  2LVW A;  3LW5 C;  1U1M A;  3CB4 A;  3J7A N;  4CIO A;  4NYO A;  2G1H A;  5HVG A;  4DR2 F;  4WXW A;  4LSN B;  3ETM A;  2EBG A;  1TL5 A;  1HBO A;  2ZBP A;  2ZVI A;  1DLO B;  3KJV A;  3CD7 A;  4DX8 H;  4HYK A;  3PJW A;  5KFH A;  3D0G E;  1S0O A;  1QAX A;  1T9U A;  4DL3 A;  3SCL E;  2P9G A;  2YKA A;  4ED2 A;  4ZHR B;  2C22 A;  4ZVQ B;  3MM7 B;  3EUN A;  3CCQ S;  2ABY A;  4DLE A;  5SUH A;  5LMN J;  5IQ6 A;  2ZH1 A;  5J1N A;  2DXE A;  2IYG A;  3ZZP A;  3IRW P;  3CJS A;  5F8N A;  2HMI B;  1VQL S;  3NS6 A;  1VQK S;  2UVU A;  2CQP A;  1TFW A;  2QYG A;  4K4U A;  5GAH I;  3G96 A;  4KT0 C;  4DPY A;  4NXN J;  4N56 A;  3FK4 A;  3R5C A;  3LP1 B;  5CD4 H;  3NMA A;  2XB2 D;  3CJK A;  1HI8 A;  1URR A;  2AX0 A;  2RUS A;  1R6Y A;  4YDD B;  2C28 A;  3OL7 A;  4YP3 A;  4TNO A;  2YKN A;  2J9C A;  3PW5 A;  2KXH A;  4Y00 A;  3OSN A;  5KFW A;  3ZZU A;  4C8Y A;  1LK5 A;  3NEK A;  3T5J A;  2R4F A;  1WI8 A;  2HG4 A;  3VCD A;  2IM2 A;  2IBK A;  3HO1 A;  1EB0 A;  3I32 A;  4OL8 A;  3KLF B;  4RW6 A;  5KFS A;  4K4V A;  2KVI A;  5E7O B;  1WKK A;  1OYD A;  1FFS B;  4WXO A;  4PXB A;  4R0J A;  4BS2 A;  3N5B A;  2OUG A;  4ZKA A;  2OPS B;  1U47 A;  2FC9 A;  2AHO B;  3MDF A;  3MD1 A;  4KHP F;  3OUY B;  2PEH A;  2QN6 B;  2MKY A;  2VFS A;  1TQL A;  3GV8 B;  2GVD A;  3R2D J;  2KKH A;  4PG7 A;  1UJ4 A;  4A8Q A;  2HK3 A;  2ZWP A;  2W2Q P;  3BH6 B;  3CJ0 A;  2DR9 A;  2A0F B;  3G82 B;  1R27 B;  3FZ2 A;  1VI7 A;  1SH2 A;  2MPU A;  2YNF B;  3UFC X;  1OYE A;  4OHY A;  2KT5 A;  1LWC B;  3NP5 A;  4NLO A;  2XZD B;  3W61 A;  3PKM A;  5ETS A;  4QWB A;  2N7Y A;  1JLA A;  4L6V 3;  2VV5 A;  3H5Y A;  3U7J A;  2ZH9 A;  5LSR A;  2VKR A;  3HHE A;  1RK8 A;  2MTL A;  3Q8U A;  3PW2 A;  3DFE A;  1VDH A;  4ZVF A;  1Y0H A;  4QWE A;  5DQG A;  4OHX A;  2KJV A;  1QE1 A;  1WWH A;  1ZAW A;  4IOC Q;  4HI2 A;  3MEE B;  3RAQ A;  1IKX B;  2HHT A;  3R7N B;  3QO9 A;  3ULH A;  1UWB B;  3QYY A;  3M8S A;  2HND A;  5CQG A;  3OFF A;  2XMM A;  2ZH7 A;  1Y00 A;  2RB7 A;  1S9E B;  1EKS A;  1QLN A;  4ECZ A;  5HQ8 A;  5L46 A;  1OY8 A;  2J7U A;  4IYQ A;  1W26 A;  1W2B R;  5ETL A;  4LT6 A;  3A1Y G;  3PG9 A;  4EBC A;  2WW4 A;  4F0K A;  1WKJ A;  2I5J A;  3M1V A;  3PM9 A;  4EO6 A;  5LMN F;  4IOA Q;  4OIX A;  4RBT A;  1I51 B;  1NEE A;  4TYB A;  1BQN B;  4B3T J;  2B9W A;  2ZNY A;  1SQF A;  4GVB B;  4DF4 A;  7AT1 B;  3R6G B;  3K0J A;  1KOO A;  5GAE U;  5D3G A;  1S6P A;  1QTM A;  2XI2 A;  3V6H A;  2AGQ A;  1PCA A;  5HO4 A;  1HBU B;  3AA8 A;  1XMQ J;  4F4A A;  2VHG A;  5KG1 A;  2G13 A;  3PX4 A;  2KN4 A;  2B9E A;  2XG8 A;  2ZOG A;  2RDI A;  3UNG C;  4MKB A;  3QRQ A;  2DKO B;  3BGU A;  1RBL A;  5KFX A;  4P73 A;  1S9F A;  5C25 B;  1XC9 A;  1UL3 A;  2IY5 B;  5E3C A;  3KK3 B;  3C15 A;  3M8Z A;  7FD1 A;  4NOH A;  4OYW A;  2VQE J;  3W2V A;  3MR2 A;  1KOH A;  1PIL A;  1YK9 A;  2RQK A;  2E7W A;  1EHW A;  3RBD A;  4USW A;  3HFZ B;  3L3C A;  1F5C A;  3TVK A;  1HHT P;  2YY3 A;  2MHN A;  2J8S A;  2QV6 A;  5H9E J;  2JNJ A;  2Z56 B;  8ATC B;  2OFG X;  5D0H A;  2CQB A;  2LEP A;  5J2Q A;  3V6D A;  1X4F A;  2MJU A;  4IQX A;  2MKJ A;  3DCA A;  1BMQ B;  4AXJ A;  3PYG A;  2GMJ A;  4HAC B;  4HL9 A;  3E51 A;  2AYB A;  2B56 A;  1Z2Z A;  2HRU A;  5IT4 A;  3HMJ G;  1RGV A;  3QAU A;  3DLJ A;  3G2X A;  2QFJ A;  4W92 B;  3D68 A;  4ZP9 A;  2ZC4 A;  3P5T L;  3C16 A;  5A8W A;  2DGV A;  3VGV A;  2W2M P;  2NLW A;  3B4D A;  3OVS A;  2W7P A;  3GLJ A;  4JUZ A;  4TU8 A;  1HD0 A;  3JSM B;  2VFU A;  1KQK A;  1H2V Z;  3EGV A;  1Q1K A;  5HLF B;  4DX6 A;  4C2M A;  2OO4 A;  4F8R A;  2ZFH A;  2V4J B;  4RBV A;  4ES2 A;  1HYS A;  5JUM A;  4DSF A;  2MGZ A;  2XYP B;  1KFS A;  3FFI A;  4Z2X A;  4DU7 A;  4V1A k;  1FKP A;  5DET A;  3DHW C;  2ZEJ A;  1XMO J;  2VG7 A;  4U95 A;  1S6Q A;  4ES3 A;  3W9J A;  1ITP A;  1NK5 A;  3GYX B;  3BPS P;  4MJK A;  3RUB L;  1DQA A;  4LF5 J;  1LQ9 A;  1MMN A;  3PW7 A;  2WK4 A;  4J91 A;  1AFJ A;  3M4X A;  3JYT A;  1HBN B;  5KT6 A;  4AL6 A;  1RT6 B;  1AUS L;  1NSP A;  2B51 A;  5CH7 B;  2DGS A;  1NB2 A;  3MUT P;  3KLV A;  4WP3 A;  3CCW A;  2J9E A;  2WRM A;  3MR7 A;  4HEA 9;  5ETQ A;  2H3E B;  4B3T F;  2JRS A;  2DNO A;  1UFL A;  2Q1L A;  2IRX A;  1TK0 A;  2VFT A;  3GJT B;  4F67 A;  1CPZ A;  1S1W B;  4HHU A;  4EWT A;  2PN6 A;  3B4M A;  1XMQ F;  3C6T B;  2YQ3 A;  3DLG A;  1XWL A;  2HIQ A;  4Y65 A;  2ACM A;  2IAJ B;  1OPI A;  4BHQ A;  4FBU A;  1GQE A;  4N77 A;  1B0P A;  3A8E A;  4ZP7 A;  1YRU A;  5SZT A;  3ILI A;  5F0W A;  4IKA A;  4E98 A;  3RU0 A;  3K5L A;  2HBR B;  3NWR A;  7FDR A;  4CDI A;  4ITS A;  4KV8 B;  5KAK A;  3BM7 A;  1JLB B;  2RHS B;  4KFB B;  2VQE F;  1YJW S;  4FVM A;  3I5A A;  3M6X A;  4DZD A;  3C46 A;  4R25 A;  4J9S A;  1C0T A;  4OZ1 A;  3M2U B;  1RTD B;  2UXB J;  2V67 A;  4PG6 A;  2B8Q A;  1NDL A;  4ZVH A;  3CT9 A;  2BM1 A;  1T3O A;  2N7C A;  3QT8 A;  4WII A;  3FC9 A;  3OSP A;  3IS9 A;  3SV4 A;  4ZP6 A;  5A2Q Y;  2V6A A;  1FRH A;  1L3S A;  1LWF A;  3EGN A;  1IM6 A;  1N5T A;  2OGU A;  5IM0 A;  4J9P A;  1RT4 A;  4EI2 A;  1VRU A;  4KPC A;  1VCT A;  3AB4 B;  3M30 A;  2W1B A;  4RUA A;  2OML A;  3R2C J;  3O44 A;  4CLT A;  1FWL A;  2CUY A;  2R7T A;  1NJZ A;  4CLL A;  2DH7 A;  1Q8K A;  3J81 j;  4O3S A;  2DNK A;  1Y3J A;  3K58 A;  1YKW A;  4NWB A;  3AOA A;  1JJC B;  5A2Q U;  2GCF A;  3GJS B;  4S0M A;  5FII A;  5B0F A;  2MZQ A;  2ZKT A;  1RWK B;  2BX6 A;  4OHV A;  4A48 A;  1JKH A;  4F7V A;  3DI6 A;  3FSY A;  3OL9 A;  2UV8 A;  4IFV A;  1O6X A;  1IJE B;  5DGB A;  5KFM A;  3HXM A;  1QVF R;  4MKV A;  2QZ8 A;  3PNI A;  1XN9 A;  4M1K A;  2CJY B;  2ZNZ A;  2Z4P A;  2GAH C;  1XMO F;  3M8P B;  4DF8 A;  5CAA A;  5M2R A;  3CCM S;  1S1T B;  2HFN A;  1DJ0 A;  3GIR A;  4JI0 J;  3SQG A;  4O0N A;  5C2C A;  5HMY A;  3GFY A;  4U7U D;  1M90 T;  3HFK A;  4CM2 A;  5IFM A;  3OHA A;  4UY8 T;  2WHO A;  5K5M A;  3E01 A;  1EAR A;  2FZC B;  5KFI A;  1HPZ B;  2JDJ A;  2GHW A;  1XQI A;  4ZVG A;  4FYD A;  3LGM A;  1REV A;  4KHR A;  3QPI A;  1OJ4 A;  2CA9 A;  1IN0 A;  3ENA A;  1HNV A;  4RO0 A;  3RYL A;  3FVY A;  2R7W A;  3GIK A;  2FJB B;  4OZ0 A;  3MOJ B;  3BBB A;  4C3M A;  1S57 A;  1TKZ B;  2F4V J;  1GMU A;  4FYX B;  4NYZ A;  2R2R A;  2EEY A;  1RAJ A;  5HP1 A;  1BY9 A;  5HSP A;  5L1J A;  2ZH2 A;  3I31 A;  4YFU A;  2ZH3 A;  1KSP A;  1XIQ A;  1C4A A;  1TK5 A;  2DB1 A;  4C8N A;  2MZR A;  3ISZ A;  1IBM J;  3OFH A;  3H5X A;  2OEK A;  2IJN A;  4ECX A;  2DR7 A;  3HVT B;  3KG4 A;  4EUV A;  2OPQ B;  3QID A;  4FYY B;  3I0S A;  1PKU A;  3G86 A;  4DQR A;  2RS2 A;  1UZD A;  2Y9H A;  3C14 B;  3R5J B;  4K5R A;  4QIG A;  4YDX A;  2LQ8 A;  3TEH B;  4OX6 A;  1MWQ A;  1RLD A;  1SH0 A;  2WZ1 A;  4DI6 A;  2LQ5 A;  5DGA A;  2GJF A;  3BQ0 A;  5IWA J;  5IXU A;  5B08 A;  4NI2 A;  4HVZ A;  1ZS6 A;  3LP0 A;  1ZM4 A;  3D4J A;  1MNE A;  2YWF A;  3KLI B;  4NLY A;  5JVG Q;  2HEK A;  3CXC R;  2E7V A;  4R8U A;  3IC1 A;  2VD3 A;  1JXV A;  3CCT A;  4X4T A;  1WHV A;  1Q4R A;  1TL1 A;  2H51 B;  2CDR B;  4URQ U;  4DZ6 A;  3GYG A;  4QIE A;  2COL A;  2DY9 A;  2AWZ A;  2I9S A;  4ED4 A;  1FJG J;  3T19 A;  4NCG B;  3MM9 B;  1LWX A;  2UXD F;  4YOE A;  4F0M A;  2MKH A;  4LF4 J;  2WSF C;  5GMD A;  1RKJ A;  4ZPD A;  2ZJP Q;  4ERD A;  4URS A;  4Q2M A;  2N82 B;  4OI1 A;  3PEJ A;  3FSI A;  4LUB A;  4RBU A;  1MWY A;  2CWX A;  4RW9 B;  2K2P A;  2R8G A;  1FDD A;  2MQ8 A;  1IR2 A;  3Q89 A;  3D6M B;  1IKW B;  3MZI A;  2RH3 A;  1IR1 A;  3HSZ A;  3TYT A;  1FA0 A;  4NYP A;  4JI0 F;  2OD4 A;  3CIZ A;  2A1B A;  3CDA A;  4RPF A;  2L3M A;  5M2U A;  2M7S A;  2BYC A;  4M5I A;  3C8Y A;  3UQS A;  3EJM A;  1WEL A;  2KI2 A;  3DLB A;  1PJ6 A;  2BE2 B;  3TZW A;  1OO0 B;  1NCL A;  2H54 B;  3JAM Y;  2M9K A;  2C2Z B;  4JV1 A;  4XPC A;  3BGL A;  1V6H A;  2YWW A;  1F5B A;  4QOT A;  3CCE S;  4F4W A;  1YRX A;  1PBA A;  4YB5 A;  4ZOS A;  3CDB A;  2DY1 A;  4IRC A;  2G2O A;  4O4G A;  1F2H A;  2YX4 A;  2OMO A;  1WOP A;  2ZD1 A;  2IDL A;  5B0C A;  2F4V F;  3KWM A;  4CLY A;  2YH0 A;  2DNM A;  4CI0 B;  4F3Q A;  2VC1 A;  2LEA A;  4P10 A;  2E66 A;  5KTQ A;  2JJ4 D;  3Q86 A;  1RT2 A;  4DXL A;  1ULR A;  1RE1 B;  2F8H A;  3VGS A;  1U2R A;  4ECW A;  1H0H B;  3JAM U;  4FXV A;  3HVR A;  1Y7P A;  2KRR A;  4WE1 B;  5HQL A;  4QIW D;  3H4D A;  2H5J B;  3A8K A;  2K8G A;  4UQG A;  3AY0 A;  4A8K A;  5DQI A;  1IBM F;  4RW4 A;  1OMS A;  1SJ1 A;  2V50 A;  1GXU A;  1UVN A;  4IRD A;  1JIH A;  5HAN A;  1KEK A;  2MKK A;  3GIL A;  3TUZ C;  2ZBI A;  5AE3 A;  4AL7 A;  5KT4 A;  1TKX B;  2WOM B;  1PBU A;  5LJ3 Y;  4HLB A;  1U49 A;  2ACY A;  3QGP A;  5IWA F;  4ID5 B;  2K7J A;  5E33 A;  3LOU A;  2V0N A;  1IKV B;  4JB8 B;  2B6A A;  4BWJ A;  2DHS A;  4FNI A;  4LIW A;  4DQI A;  3RAX A;  5HI7 A;  2YNI A;  3PKY A;  3NAH A;  4FYV B;  3LUY A;  4OV1 A;  3QT6 A;  2W8K A;  1PGZ A;  3E8O A;  1KS2 A;  3EIC A;  5AXL A;  3W60 A;  2O67 A;  1N56 A;  1YJN S;  1LK7 A;  3E2E A;  2MKI A;  1F9H A;  2PMW A;  4I69 A;  3ZO7 A;  3DM2 A;  2V8V A;  3QIP A;  1S76 D;  1UW4 A;  1P27 B;  2QA4 S;  3MM6 A;  4ETZ A;  2XSJ A;  1HBM B;  2E5G A;  4J9R A;  4F4K A;  2M88 A;  3MAA A;  4B9S A;  3CO0 P;  2HQF A;  4AXI A;  1FJG F;  3J7Z 5;  4KB7 A;  3FJ2 A;  4WFX A;  5I3U B;  2OPP A;  3MMC B;  1B99 A;  4LF4 F;  1U09 A;  2DNY A;  2FY8 A;  2LA6 A;  1H2U X;  5GAE I;  2F3J A;  5KOW A;  4O3O A;  1AZS B;  1A9N B;  4NCA A;  1CEZ A;  1UKU A;  1HI1 A;  2CJA A;  2OKQ A;  4Z37 A;  2F7V A;  3O3L A;  1VIS A;  1FF2 A;  1LV5 A;  3DC2 A;  3OTB A;  4F4X A;  4X64 J;  2HGL A;  3ENQ A;  3IA0 A;  1VQP S;  5EN1 A;  4QIV A;  2LQ9 A;  3FMW A;  2LCW A;  3OTC A;  4ID8 A;  2V8D A;  3NGK A;  1VQ6 S;  1KDN A;  4K50 A;  3BRE A;  3M8Q B;  3KK2 A;  2BEF A;  2DIV A;  4IDK A;  1F9F A;  4ZCL A;  4LFC J;  2DPI A;  3IO1 A;  4CYU B;  1NME B;  3IG1 B;  4LRE A;  4ED5 A;  4OZ2 A;  3H59 A;  4EBE A;  2QL7 B;  2H1Y A;  1TU0 B;  2V34 A;  3PY8 A;  2R7O A;  3I4P A;  5A6W A;  3EMT A;  4WKR A;  1T9V A;  2VJU A;  3MR5 A;  4B02 A;  3H2U B;  2G0J A;  1JLF B;  2MJN A;  1FRL A;  5L1L A;  1T9Y A;  4CLK A;  1NZA A;  4KH1 B;  3N6N A;  4PQU B;  2HGM A;  2W4P A;  1BUX A;  3R27 A;  2VG5 B;  4J9U E;  2J6U A;  3W65 A;  1TL4 A;  2CQD A;  1KQG B;  4MFB A;  3P6Y C;  1UVI A;  4Y34 A;  1WEX A;  2GS8 A;  3KG0 A;  4IH7 A;  4DCP B;  1I3O B;  1Z2L A;  5U47 A;  5IZH A;  3SSS A;  3DXB A;  5D0E A;  4X84 A;  3PAC A;  4KH0 B;  5B7W A;  3TJ8 A;  1M5K C;  1U6Z A;  4OJ1 A;  2QFI A;  2W01 A;  2DHG A;  1VQO S;  2OTL S;  2GGP A;  3MWB A;  2Z2Y B;  1EQM A;  1ROF A;  5DDP C;  3JXO A;  2NXE A;  5J1E B;  1HHS A;  2CZV C;  3HHL B;  3W3S A;  1RWO B;  4C48 A;  1U45 A;  2WCX A;  3CCU S;  2WON B;  1MMD A;  2XMV A;  4USH A;  4CQ1 A;  1F3V A;  3WHI A;  1Q8I A;  5CYM A;  2ASL A;  3PX6 A;  2I8E A;  4OI3 A;  3AD7 C;  4LFA F;  3QJJ A;  1KVK A;  2LP4 A;  3BEG B;  4MK7 A;  4G1Q B;  3BN7 A;  2NZC A;  1OIA A;  3EZU A;  3TAR A;  3GCX P;  1LW2 B;  1KVI A;  3M2R B;  2FPH X;  4ZCK A;  1RZM A;  3ENV A;  1S72 S;  5H9F J;  1SJR A;  1ZPV A;  2D3O 1;  3VVU A;  4PWU A;  3NMR A;  4J9L A;  5A8R B;  4TU9 A;  1XR5 A;  3CD5 A;  5LMU J;  3MED A;  1ZBT A;  2C3O A;  1JB0 C;  1A7G E;  2ILZ A;  4N8N A;  2E7X A;  5E41 A;  3CNQ P;  1FKO A;  4OYO A;  1I5O B;  4X64 F;  3BGF A;  1XMB A;  5T7L B;  4LQ3 A;  1QY7 A;  3M05 A;  2P8I A;  3MXH P;  1BD6 A;  1WEZ A;  5A6P A;  1VRT A;  3MI7 X;  3N0V A;  2YBV A;  2IMW P;  4LRF A;  1KRP A;  2R9L A;  2Y1I A;  1TEL A;  1UPM B;  2KFY A;  2FZG B;  1U6B A;  3NGU A;  2NS1 B;  4RX6 A;  5G4D A;  4WP9 A;  3U1M A;  1DUR A;  2HS3 A;  4GRS A;  3EGZ A;  3VAF A;  4Y3C A;  4NLU A;  2CPZ A;  4WCE Q;  3G8T A;  2Y1J A;  3RB3 A;  2UVW A;  5KFD A;  3J7A 1;  4LF1 A;  3BGR B;  3IBF B;  3N4W A;  3MUR P;  1I6J A;  3M32 B;  1QAJ A;  5K8O A;  1IQZ A;  2O1P A;  3TAP A;  3PO4 A;  1HWL A;  4ED1 A;  3TJA A;  3BKT A;  4PG4 A;  3J7Y U;  4KIA A;  2GVZ A;  3KJQ B;  3CW2 C;  4O3N A;  1B64 A;  2B7B B;  4TKT A;  1LEO A;  4DV7 J;  2QL9 B;  3JQJ A;  5E3R A;  2BKO A;  3CD0 A;  2XHC A;  1UJ5 A;  3TUI C;  4C9D A;  4LSN A;  3IWX A;  1X4D A;  2NSB A;  9RUB A;  1J5E J;  3UR0 A;  4ZLL A;  1BWV A;  1DLO A;  4WTO B;  3FZB A;  1VLY A;  2CQ0 A;  1ICE B;  5IT0 A;  3OVB A;  5BXI A;  5BYQ A;  4K4T A;  5K8N A;  5L38 A;  2PFF B;  2F65 A;  5HJY A;  3OTE A;  2GML A;  3LAM A;  3POT B;  2C2R A;  1O5J A;  1RTI B;  1S79 A;  2ZDP A;  2BXJ A;  3EM1 A;  1N0U A;  4GO5 X;  5E2Q A;  2EI5 A;  5KFU A;  3B78 A;  2HMI A;  2CQC A;  2L9D A;  3L7O A;  3TQE A;  3M8R A;  1ZZN A;  2RVJ A;  1N88 A;  4RUC A;  4I6Y A;  2K3I A;  4YUD A;  2CPY A;  3LP1 A;  1YRT A;  4N41 A;  1B3T A;  1TL3 B;  2PSZ A;  2G9O A;  1OSD A;  4WYW A;  1K8A T;  2OHD A;  2GQ2 A;  3HVW A;  3AXM A;  1IWG A;  2XO7 A;  3HSJ A;  1YJ7 A;  1FWP A;  4PG8 A;  3S6E A;  4P6Q A;  2W8L A;  3G6X A;  1M5V C;  4DR3 J;  3KLF A;  2ZBR A;  1UJ6 A;  1DBD A;  1VMB A;  2DK2 A;  1FJ7 A;  5F3T A;  4JV5 J;  3AOD A;  2VBW A;  3W9I A;  3PIO Q;  4USU A;  1EKR A;  1PJ7 A;  4Y2I A;  5H1S V;  1RTH B;  2VZ9 A;  2OPS A;  3SCK E;  1ZAV A;  4I6A A;  1TUG B;  2DXF A;  2V2Q A;  2BOP A;  3OUY A;  3FBB A;  1Q82 T;  2VOP A;  1GX5 A;  1FRI A;  3D7S B;  5GME A;  4U8Y A;  1KP6 A;  3NOC A;  3PHE A;  2D69 A;  3AJ1 A;  2GX8 A;  3AD9 C;  4OI4 A;  3MMJ A;  4DPT A;  1DTQ B;  3G87 A;  4A8O A;  2GIF A;  2KZZ A;  3BKU A;  3BDE A;  5AXM A;  3G82 A;  5DDQ C;  1NKE A;  2YNF A;  1IXK A;  1LWC A;  3HSD A;  3I55 S;  1Q5Y A;  1RT1 B;  2V69 A;  4P71 A;  2R8K A;  4YN3 B;  1NHK L;  4B9V A;  1BWE A;  1DQ8 A;  1KTQ A;  4WP8 A;  1RTZ A;  3OTD A;  2VPW B;  4DV7 F;  4KR0 B;  3BPD A;  4YR0 A;  1TFY A;  2ZBC A;  1N52 B;  3CME S;  2W9B A;  3MEE A;  1U1L A;  1IKX A;  3IBW A;  2MLX A;  5AE2 A;  2GIQ A;  1VC6 A;  3J81 Y;  1J5E F;  2AEF A;  3H2V E;  2HNY B;  3V2U C;  1S6U A;  4ZVE A;  1T8E A;  4A8F A;  4JI3 J;  3WC0 A;  1S9E A;  1WHX A;  2CPD A;  1S4F A;  4WTY A;  3CJ5 A;  3BO3 A;  4H4M B;  1P1T A;  1JJ2 R;  3UPF A;  4ETX A;  2AD9 A;  1YQH A;  1RAA B;  4PEO A;  3Q0A A;  4PPZ A;  3D2W A;  5KFN A;  2KRB A;  2JHE A;  3QZ8 A;  1AW0 A;  4GVB A;  3J81 U;  2JSX A;  3NRB A;  4XK8 C;  1XTZ A;  6AT1 B;  3FQK A;  1WF0 A;  5A0Y A;  1MU2 B;  3QGH A;  3BGO P;  1HBU A;  3NLC A;  2U2F A;  2HVI A;  1CJT B;  1S77 D;  1N5S A;  4PXE A;  3A12 A;  1NSK L;  2NXN A;  3UR3 C;  1WC0 A;  3FQL A;  4U67 Q;  2J7K A;  2QLB B;  5F8J A;  4DSJ A;  3KOA A;  2R7V A;  2FQQ B;  2CQH A;  1JLG B;  4KO0 B;  3FKB A;  3KK3 A;  2PI5 A;  3MFH A;  2MZJ A;  2GHV C;  4UT4 A;  3OQ2 A;  3M6V A;  2NUH A;  3P3D A;  2HQ3 A;  4PWD B;  5GAG U;  4DR3 F;  2GJ2 A;  2RDJ A;  4ZPW R;  1CJU B;  2AJF E;  1H7W A;  3GTY X;  2ROP A;  4J9Q A;  4JV5 F;  2QRR A;  2EFN A;  2W2O P;  4CO2 A;  1FXD A;  1PC5 A;  2IHR 1;  5KFG A;  4ICL B;  2HS0 A;  2BJ3 A;  3PEH A;  4B3S J;  2Y0S D;  2BE9 B;  3WX4 A;  1Q16 B;  1NDK A;  2Y0B B;  3NNH A;  2XBP A;  2FIU A;  5BYR A;  2XYH B;  2KM8 C;  1ZPW X;  3Q8P B;  4HR2 A;  4F25 A;  5F41 A;  3NL0 A;  5F8M A;  2VQF J;  3PRD A;  4B3R J;  4H4K C;  2WSE C;  1CJV B;  3W1Y C;  1SJ4 P;  2QSF A;  4DFP A;  3CVK A;  1WC5 A;  4DS4 A;  2BAB A;  3K89 A;  2A10 A;  3MOZ A;  3ZZR A;  3OL6 A;  1RT7 B;  4A8M P;  2XUL A;  5JXS A;  3UD4 P;  3GV5 B;  3CCJ S;  1QDU B;  1YGY A;  1VHF A;  4XAK A;  5K8P A;  3RRH A;  1WHW A;  1WD6 A;  4X2B A;  4ZDN A;  3WQP A;  3CCV S;  4EYH B;  4BC9 A;  5HLF A;  2AYG A;  4F26 A;  1FRM A;  5D78 A;  3V6J A;  3V4I B;  8AT1 B;  3KHH A;  2V4J A;  4ZVT B;  3KHG A;  3PTW A;  1JJ4 A;  4OZ3 A;  3TI0 A;  4OZL A;  4M5D B;  5D4P A;  4P72 A;  4ED8 A;  3BZQ A;  2B43 A;  1NBE B;  5HN0 A;  1FWK A;  3QWU A;  5I42 B;  2GZO A;  4B08 A;  2X1A A;  1UMJ A;  1F9E B;  1TUW A;  4NLX A;  2X1B A;  1P9Q C;  3QRP A;  2V94 A;  3LWL A;  1NPR A;  4JI5 J;  4JI3 F;  2FYX A;  1WTF A;  4JI6 J;  3GFZ A;  5ETN A;  1XEZ A;  5D15 A;  1HBN A;  3DOK B;  1Q79 A;  1E6V B;  1RT6 A;  3WBZ A;  1AUD A;  4FS2 A;  1S97 A;  3L9Z A;  4QR1 A;  1OPZ A;  2QO3 A;  2ROG A;  3M2V B;  1WDD A;  3BDP A;  3MEC B;  3DNC A;  1Z4U A;  2CRL A;  4JI4 J;  1YJU A;  2EPI A;  2BR0 A;  4OI2 A;  3IAS 9;  5HMW A;  1SVD A;  1SV5 B;  1YG0 A;  1S1W A;  1TL7 B;  3LGH A;  2AJ1 A;  2M0G B;  1ZTW A;  3C6T A;  2E5H A;  2MQP A;  3BQ1 A;  3QFH A;  3VGT A;  2IAJ A;  2BA9 A;  1V3R A;  3D3B J;  4KY3 A;  2BJ8 A;  4AYB D;  4ECS A;  3A13 A;  4H4K A;  5EWE A;  1LOU A;  4HH1 A;  4KQZ A;  4I67 A;  2KXF A;  5EHH A;  3RBZ A;  4KV8 A;  4A46 A;  4FP9 A;  1JLB A;  5ETK A;  3T6J A;  3THV A;  1FD8 A;  4KFB A;  4RWX A;  2IJF A;  3TUP A;  3MCS A;  3L7U A;  2YPY A;  1VQ8 S;  1G1X A;  4F36 A;  3M2U A;  4ZK7 M;  1RTD A;  4K4Y A;  4KYZ A;  3AXK A;  1ZYQ A;  3CC7 S;  4F50 A;  4KKO B;  1J2V A;  4KHM A;  2W7O A;  4KPY A;  4ECT A;  4F3M A;  3FBF A;  3A3O B;  1AYE A;  1XNR J;  4B3S F;  4MK8 A;  4NA3 A;  1NK8 A;  3EZ5 A;  3T5H A;  1SXL A;  3OW2 R;  4KJI A;  2VBY A;  2BJD A;  2VON A;  4DCO B;  1DTT B;  2FHO B;  2AQ4 A;  3DLH A;  3O8W A;  1UVJ A;  4DFK A;  3SYZ A;  2CJQ A;  3RB4 A;  2VQF F;  4B3R F;  3T6B A;  1DAX A;  2E9T A;  1U02 A;  3WX8 A;  4JI7 J;  2XY5 A;  1YJ9 S;  4ZPC A;  2DGX A;  2RRA A;  4DCJ B;  1PC4 A;  4ZPV R;  2J6T A;  4DLG A;  2OEL A;  3IXQ A;  3TWZ A;  2GHP A;  1JXL A;  5KG3 A;  1HLW A;  3PDN A;  2WAQ D;  4Q43 A;  3F41 A;  2HRT A;  1FTR A;  4OI0 A;  4JOU A;  1M5S A;  2HFV A;  3N28 A;  3M8P A;  4USJ C;  3HJF A;  1SKR A;  1JLE B;  1BQX A;  1HFE L;  1S1T A;  2VFV A;  4U9R A;  1REG X;  1RBA A;  2CWK A;  3AH6 A;  3RTV A;  4JI5 F;  1SL0 A;  1GAO A;  4ZVR B;  2FHJ A;  4JI6 F;  1WEY A;  4P2F A;  4ALZ A;  4B3O B;  3BKF A;  4MKA A;  5ETV A;  1M0S A;  2OLW A;  3SSQ A;  4ES1 A;  1IR0 A;  3I6P A;  2RD5 C;  1RWN B;  2FJW A;  1Q78 A;  4UY8 5;  1HPZ A;  3KNA A;  4E0D A;  4WU3 A;  3V81 B;  3GYN A;  2DT9 A;  4JI4 F;  2QG9 B;  3KHL A;  2R7S A;  3LP2 B;  4FNH A;  2RS8 A;  1SL2 A;  4PAA A;  4NA2 A;  2VA2 A;  2FJA B;  4O3R A;  2EXU A;  2HFS A;  4M5K A;  2J7W A;  2CJB A;  4ZVS B;  1HMV B;  1TKZ A;  2QYC A;  1XBW A;  3TA2 A;  3PIP Q;  2PO4 A;  4IFY B;  5HJX A;  2DR8 A;  2HNZ B;  1HIY A;  3LGN A;  1DRZ A;  3N9U C;  3NWG A;  4TQS A;  1D8Y A;  2YWG A;  3B54 A;  2R8J A;  3MCO A;  1RUS A;  4DEZ A;  2V9K A;  1UFW A;  2A6O A;  1FXR A;  2KXN B;  3A4T A;  4CTA B;  4QWA A;  1HW9 A;  3M9M B;  4J9V A;  1SKW A;  2D7S A;  5E3A A;  5KFP A;  3HVT A;  2HW3 A;  3Q83 A;  2Q79 A;  2IIH A;  2OPQ A;  4NML A;  4GC7 A;  3GPA A;  3C14 A;  1Y5L B;  1IBK J;  2UUT A;  1WOR A;  3L95 X;  3J7Y I;  3SCI E;  2RIL A;  4DSE A;  1UVM A;  4YB7 A;  4DR6 J;  2E1P A;  4I7F B;  1S1X B;  1XNR F;  3VAH A;  4DX5 A;  3KJF B;  4DV3 J;  4P7V A;  2VUG A;  2DBB A;  3OPK A;  4LRB A;  1T05 B;  4F4Z A;  3RGI A;  1VQM S;  2GJI A;  2KG0 A;  3LF0 A;  3SSR A;  3KLI A;  4CH1 A;  3DRP B;  1ZAX A;  2BJ1 A;  1S0M A;  2IC3 A;  1RBO B;  3KLH B;  4CLS A;  3ZXW A;  2G4B A;  3BSC A;  1VR6 A;  2MKS A;  2J0W A;  1UP1 A;  4FBT A;  1MSW D;  4GVL A;  1VIO A;  2VAS A;  2WVC A;  4ENO A;  2VB6 A;  4FYW B;  4JI7 F;  2QA2 A;  2LDI A;  4RNH A;  4MMO A;  3Q8S B;  2MZT A;  1NSQ A;  3PXG a;  2YX7 A;  1Y5N B;  4J9N A;  3VAM A;  4NCG A;  3I82 A;  3MM9 A;  1HR0 F;  2EC0 A;  3PRB A;  2D9P A;  2HQD A;  4KGZ B;  3I4H X;  2YQ1 A;  1QSL A;  3LAK A;  2LEB A;  1FD2 A;  2CPH A;  4DUT A;  2HKE A;  1U1Q A;  1U6F A;  2D3O R;  1LNQ A;  3T9N A;  4NXM J;  2ZZM A;  4FVC A;  4UUW A;  1IKW A;  4F4Y A;  4X4V A;  3I5B A;  4NLT A;  4DR4 J;  4P75 A;  2IVY A;  4FPI A;  4MAK A;  2VG6 B;  4QR0 A;  3UN2 A;  3LAN A;  2MGZ B;  4C0B A;  2OIH A;  2JEJ A;  2DTJ A;  4LF2 A;  2AU0 A;  4ED0 A;  3PHT A;  4HH0 A;  2N4C A;  3BSO A;  3HHN B;  5KFC A;  1AXQ A;  2BE2 A;  2IFX A;  4JI2 F;  2CQ3 A;  4N7T A;  1T7P A;  5BYS A;  3TJ9 A;  4OLP A;  3BO4 A;  4QW9 A;  5F3Z A;  2V5H G;  1QAY A;  3O1L A;  3R6L B;  4C8L A;  4LFB J;  3D5M A;  3BB5 A;  3BV8 A;  2RML A;  3HK2 A;  3MCM A;  3JTO A;  3CDE A;  3PX0 A;  2JEI A;  1TMM A;  1AFI A;  2EFG A;  4PKD B;  4D3H A;  5ETM A;  5KFA A;  3DOM B;  1KQF B;  2DGW A;  4PZV A;  2BV3 A;  2M3D A;  2JEG A;  2HGN A;  2QL5 B;  4WE1 A;  4HDG A;  1TMJ A;  1T9W A;  2OEJ A;  3W66 A;  3H7H B;  2OH2 A;  1GT8 A;  5HMX A;  2B7C B;  1P1L A;  3HFV A;  3OFG A;  4ZPT R;  2CVI A;  4EZ6 A;  4ZP8 A;  4XDD A;  3EXC X;  3SQO P;  2B4V A;  2IYI A;  2WVE A;  3BR9 A;  3QLH B;  4P74 A;  1TKX A;  2UUA J;  2WW8 A;  3VAI A;  2HHV A;  1IBK F;  2I38 A;  2WOM A;  3Q8R B;  4CO3 A;  4ELV A;  1H72 C;  2F9J A;  4LBP A;  2CQ4 A;  2AJ2 A;  4DR6 F;  2MQQ A;  1N5V A;  4ILM A;  3CCZ A;  4RW8 B;  2XCP A;  4ID5 A;  4DV3 F;  4ED3 A;  3R97 A;  1IKV A;  4Q0B B;  3M8W A;  2FUG 9;  4EU0 A;  4QU6 A;  2MSS A;  4NEZ A;  2H5I B;  5D77 A;  2FHM A;  3GR0 A;  1TR0 A;  3SEO A;  1YDL A;  3HHL D;  2V63 A;  1VQS A;  3DYA B;  1W25 A;  4UF4 A;  4PXD A;  4AE5 A;  2ZHB A;  3GIM A;  3RRG A;  5CCM A;  1MN9 A;  2RRN A;  2RU3 A;  3IP0 A;  2OPR B;  3CWJ A;  1YVF A;  2HYI B;  1NRK A;  4DR7 J;  5IM0 B;  1S0N A;  1HBM A;  1Q7L B;  2RKI B;  3GV7 B;  1YI2 S;  1QVG R;  2D3U A;  3R1H A;  2ZVS A;  4NRT A;  3TAM B;  2ZJQ Q;  1UAW A;  2EKY A;  3NNC A;  1X5P A;  3QSI A;  5EWG A;  1YBU A;  4Y6I A;  4RNF A;  4OYI A;  5I3U A;  3MMC A;  4NLR A;  4QW8 A;  5LXY A;  2DHA A;  2Y1L B;  1WF1 A;  2VA3 A;  3S7R A;  4OYA A;  1KLM A;  1AZS A;  4M8L A;  1G6B A;  1BXN A;  1R8A A;  4NXM F;  5D4O A;  4LVO P;  1VQY A;  3VQT A;  2C3Y A;  1L3V A;  4DR4 F;  1VOM A;  4J90 A;  5GAD U;  4EZ9 A;  3PZP A;  2XEX A;  2W4C A;  3W2W B;  4LRD A;  3M8Q A;  2ASD A;  4DPW A;  2L9W A;  2B8P A;  3CF5 Q;  2DCU B;  1K9M T;  1UW9 A;  4CYU A;  9ATC B;  1JX4 A;  2J9D E;  4IG0 B;  3IG1 A;  3DMJ B;  3A8J A;  5GAG I;  4O0I A;  2Q6B A;  1SH3 A;  1SIW B;  4OYZ A;  2OSQ A;  4WFZ A;  2P6T A;  4DSL A;  2L48 A;  2LXI A;  3D66 A;  1NXI A;  4LFB F;  2M8H A;  4ZCI A;  2BQ3 A;  1R6V A;  1JLF A;  4P2X A;  5KFF A;  1FE0 A;  5ETR A;  2IM3 A;  5LL6 d;  4PQU A;  5L39 A;  2QIF A;  3G9C A;  2AP6 A;  2C2O B;  2VG5 A;  2MLY A;  2HRY A;  4MK9 A;  1WG4 A;  4TLR A;  3HX9 A;  1H74 A;  3PR5 B;  1N32 J;  2OD6 A;  1Y9O A;  2RF2 B;  3SFG A;  2ROE A;  5C24 B;  2GO8 A;  3V6K A;  2DXD A;  4PUO B;  4XPE A;  3QQC D;  4FS1 A;  1B70 B;  1OS5 A;  3IRX B;  1X8D A;  2UUA F;  2HS4 A;  1RHM B;  2DNG A;  4Q8E A;  1FO1 A;  3T9Z A;  1HNX J;  4FF4 A;  2MZ1 A;  4C8K A;  4JI1 J;  1TP7 A;  4DPX A;  1ZET A;  2H4W B;  3N01 A;  3R5D A;  2XMT A;  3CJR A;  4ZIV A;  2KU7 A;  3HHL A;  2HHP A;  2DGQ A;  4HKQ A;  2WON A;  1RA6 A;  5L8R C;  2RE1 A;  1JLQ B;  3VAG A;  3ICL A;  4MTP A;  3LTO A;  4DR7 F;  1K73 T;  1VS3 A;  1KHV A;  1S9G B;  1WOO A;  4G1Q A;  2QLJ B;  2WB1 D;  4L75 A;  1LWE B;  4NZ6 A;  3M8Y A;  2M4M A;  1LW2 A;  4C3K A;  3M2R A;  2UZA A;  4P2M A;  1PYT A;  5LSO A;  4N76 A;  2M8D B;  3CCR S;  3BH7 B;  4LJM A;  2V2V A;  5I3P A;  2XMJ A;  4QJV A;  3S8S A;  5RUB A;  1T9T A;  1PJ5 A;  3TOQ A;  1WDT A;  2PD1 A;  3UE2 A;  1SJ3 P;  2B5J B;  5A8R A;  1RWP B;  3DGP B;  2FGO A;  4DV2 J;  2AJQ A;  1FX2 A;  2ZUG A;  5T7L A;  1HWK A;  2XS7 A;  2BJE A;  3IR6 B;  2RIJ A;  4WYL A;  3GJQ B;  1YJV A;  3K17 A;  1NJI T;  3QFW A;  4O3P A;  1URN A;  3IMQ J;  4DV0 J;  2ZC3 A;  4WFA Q;  3RBX A;  3FSX A;  3MHY A;  2LQB A;  1FRK A;  1X4A A;  3TVY A;  1VQN S;  1C1B B;  2K1R B;  3F44 A;  5IOL A;  3DRS B;  4DX7 A;  4BDP A;  1W7W A;  1WC6 A;  2D74 B;  3AOB A;  1UA1 A;  4K4W A;  1WC3 A;  3M7V A;  3E3X A;  3W5Z A;  2EFQ A;  1TTH B;  4UZC A;  1BHN A;  2BBE A;  1NU4 A;  2ATL A;  2KL8 A;  4CWB A;  2X3G A;  4CLP A;  2Y1R I;  3BGR A;  2UVR A;  1M1K T;  1MRO B;  4P9S A;  4Z7Y A;  3PYF A;  4RW7 B;  3VAJ A;  3M32 A;  5CHC B;  1WAC A;  3FCH A;  4LRA A;  5C42 B;  2ZZT A;  5ETP A;  5CYQ B;  2FHK A;  4X66 J;  4DG1 B;  3K7R A;  3CIM A;  1CBK A;  1SKS A;  1N32 F;  2QGF B;  2NPF A;  2DH8 A;  2FVR A;  1B4S A;  2MQL A;  4ZJQ A;  5KT2 A;  2HHQ A;  1N0V C;  4YY3 J;  3TUJ C;  1SIZ A;  1D0E A;  3PO5 A;  4FXW A;  4JV0 A;  2OSR A;  4RR5 A;  1NHU A;  2AJ0 A;  1FI4 A;  5DG9 A;  4CLZ A;  3W63 A;  2DRB A;  5KT3 A;  3CUN A;  1FFW B;  3X3U A;  4GKK J;  1EET B;  3TNV A;  3MTK A;  1FNO A;  2DGT A;  1RTJ B;  4K2J A;  1HNX F;  3K8W A;  1QUP A;  1P8G A;  3ONQ A;  4JI1 F;  3OBI A;  2PA3 A;  1PYS B;  2BJ7 A;  1NSA A;  2L41 A;  2E1C A;  2AV5 A;  4OI6 A;  1SC3 B;  2V8P A;  4ZLN A;  3DDN A;  1WUU A;  2Q43 A;  1KN6 A;  2QMW A;  2VU5 A;  1R8P A;  4G65 A;  3IGN A;  2AW0 A;  3POT A;  2X3D A;  1WNE A;  1RTI A;  5KFQ A;  4DOZ A;  4M5N A;  1KKH A;  3LPE A;  3M6U A;  4ZN1 A;  5E0O A;  4DS5 A;  1TKT B;  1R8C A;  1VJQ A;  1RWW B;  1Q5V A;  3H25 A;  3MPD A;  5J2N B;  1U2F A;  3AAW B;  1YJR A;  1FJC A;  3AHP A;  3QT7 A;  2DIU A;  4ZIW A;  2CVE A;  2XWY A;  1C1C B;  1MML A;  1RWX B;  1X0P A;  2E29 A;  4F2R A;  4Y2M A;  2AX1 A;  2DNL A;  3LH2 S;  4CLF A;  2G1D A;  1N36 F;  2Z0G A;  2AYE A;  4NL5 A;  4DV2 F;  3PW4 A;  2AF6 A;  1EAY C;  4LR8 A;  4DJB A;  1U1N A;  2QX0 A;  3ZC4 A;  4DV0 F;  3K8V A;  4MIW A;  3DLL Q;  2GIR A;  1IKY B;  1O51 A;  4GKJ J;  2Z8Q A;  4X4Q A;  2BZ2 A;  1OQ6 A;  1RTH A;  2JFD A;  2YNG B;  2R42 A;  4HT7 A;  4K0K J;  2ZBQ A;  1MLA A;  4OQJ A;  1NDC A;  2YKO A;  3IWN C;  1JMT A;  3I0R B;  2UXD J;  3IM9 A;  2OTJ S;  4A8Y A;  3PJ9 A;  1DTQ A;  4BLG A;  3X1L B;  4N5S A;  3C6U A;  2XY6 A;  3H0P A;  1QM9 A;  3I96 A;  1TV6 B;  3GSI A;  4QYZ K;  5JJB A;  2LEC A;  4I2Q B;  4X66 F;  2NZ4 A;  4IQM A;  4OYX A;  1RT1 A;  4CO5 A;  4K59 A;  1A0O B;  3CTR A;  3NY0 A;  3OXL A;  2V2Z A;  3R5B A;  4YY3 F;  1R89 A;  3EXY A;  1P6T A;  1VK8 A;  4PYD A;  3ILL A;  2UUB J;  4B9N A;  4OX9 J;  4BBY A;  2E1M C;  3MM5 B;  4MFB B;  4B9M A;  2VPZ B;  4GKK F;  2Q6C A;  1Y10 A;  2YX1 A;  1S5Z A;  2IPO B;  5F9L A;  3QRR A;  4DWI A;  4RNO A;  3DRX A;  5KFV A;  1VBK A;  2RQC A;  1M1H A;  2HNY A;  4DFJ A;  5I4M A;  2J5A A;  5J2M B;  3H2L A;  2I1R A;  2SXL A;  4LVN P;  3JTN A;  2R8H A;  1NZ8 A;  4H4M A;  3QWP A;  3FEX B;  3HHD A;  2DRD A;  2XLJ A;  3EVO A;  1R43 A;  4ZA1 A;  4DL6 A;  2DNH A;  2DJW A;  3DGV A;  2W2P P;  4X4P A;  3R8Y A;  2NXJ A;  2A2C A;  1SPB P;  2CPE A;  4LF9 J;  4UTG A;  3J80 Y;  4NE9 C;  2W7A A;  4CO0 A;  3KFW X;  1Y4Z B;  1HA1 A;  1MU2 A;  1D1U A;  4USI A;  1CJT A;  1VBZ A;  1NUE A;  5AT1 B;  3MM8 B;  4HDH A;  1RAB B;  3DXS X;  1HNZ J;  1JLG A;  2W24 A;  1D9D A;  4KO0 A;  3TR5 A;  3EX7 B;  1IBL J;  1S12 A;  2UU9 J;  3DOL B;  2KG1 A;  3EDQ B;  3DLK B;  3J80 U;  5ETO A;  4ZLJ A;  3QAT A;  4PWD A;  3PYE A;  4OYB A;  2CG8 A;  1DQ9 A;  2X51 A;  2VIC A;  4AT1 B;  5FDL A;  2C1E B;  4ED6 A;  1CJU A;  3HSG A;  3ZNJ 1;  3ZTQ A;  5F0U A;  1PIE A;  3WC2 A;  1QUV A;  3RR7 A;  2BW2 A;  4ICL A;  4GKJ F;  1ZM9 A;  5L9N A;  3UNY A;  1PSD A;  2NXU A;  4K0K F;  3O6Q A;  5EX3 A;  3CMA S;  3JSY A;  3RB6 A;  3CCL S;  2FVQ A;  2HAI A;  1HNI A;  5KFR A;  4LF8 J;  1RU1 A;  2BUN A;  4G1I A;  1KQS R;  1UVL A;  4QCL A;  2LDY A;  3D28 A;  3L09 A;  3AQO A;  3GII A;  1CJV A;  5ETT A;  2MST A;  2R7U A;  1X60 A;  4NZ7 A;  3KMS A;  3CJ4 A;  4DPU A;  4FF1 A;  2VDH A;  1RT7 A;  2DYA A;  3JTP A;  2DH9 A;  2HHW A;  2IJR A;  3PFE A;  1KFD A;  1CQN A;  1S7H A;  2IVM A;  4E2F B;  2I6W A;  1ZZF A;  1U7L A;  4QPX A;  4KTQ A;  4BCA A;  3VF0 B;  2K7K A;  4IRK A;  3V4I A;  1SUQ B;  4JBC A;  2UUB F;  1F0X A;  1NPK A;  4TYA A;  4OX9 F;  4M5D A;  2MXY A;  4B3M J;  3ET6 B;  5M2P A; 
#chains in the Genus database with same CATH homology
 4ANC A;  1B99 A;  2BX6 A;  3VGU A;  3DKD A;  3ETM A;  3NGR A;  3NGS A;  3BBB A;  3ELH A;  1NDK A;  2HVD A;  3EJM A;  1S57 A;  3VVT A;  3EVM A;  3ZTP A;  3L7U A;  3FBE A;  4C6A A;  3NGU A;  3NGT A;  3Q8V A;  1NSP A;  1BUX A;  4F36 A;  1NHK L;  5CAB A;  1HLW A;  3G2X A;  4HR2 A;  2B8Q A;  1JXV A;  1NB2 A;  1NDL A;  4ANE A;  5IOL A;  2AZ1 A;  1NCL A;  4F4A A;  3DDI A;  5BXI A;  1K44 A;  1WKL A;  1HIY A;  1W7W A;  4UOH A;  4W98 A;  1NSK L;  3Q8U A;  1NUE A;  2HUR A;  4DZ6 A;  4ENO A;  3FBF A;  3PRV A;  3VGV A;  1XIQ A;  3FC9 A;  5CAA A;  3B54 A;  2DY9 A;  1NDP A;  4UOF A;  1S59 A;  1WKK A;  1NSQ A;  1BHN A;  2VU5 A;  3GP9 A;  1BE4 A;  3BBF A;  2DYA A;  1F6T A;  2DXD A;  5C7P A;  1KDN A;  1LWX A;  3BH7 B;  2DXE A;  3EVW A;  3FKB A;  4O0N A;  1NLK L;  2CWK A;  3VVU A;  3EIC A;  3FCW A;  1UCN A;  2BEF A;  1S5Z A;  1U8W A;  3EM1 A;  4FKY A;  1F3F A;  1HHQ A;  3Q83 A;  2B8P A;  1PKU A;  4WBF A;  2DXF A;  3Q86 A;  4KPC A;  1MN9 A;  4AND A;  3EE3 A;  3FBB A;  3GPA A;  3B6B A;  3VGS A;  3MPD A;  1EHW A;  2HVE A;  3FBC A;  4DI6 A;  4DUT A;  3VGT A;  2AZ3 A;  1NDC A;  4CP5 A;  1B4S A;  2ZUA A;  1WKJ A;  3Q89 A;  1MN7 A;  1XQI A;  1NPK A;  3R9L A;  3ZTS A;  1ZS6 A;  3EMT A;  1LEO A;  1PAE X;  3BH6 B;  3PJ9 A;  2NCK L;  3EVO A;  3Q8Y A;  3BBC A;  3WX8 A;  3ZTO A;  1VYA A;  3ZTQ A;  3ZTR A;  4EK2 A;  3FCV A;  4FKX A;  4UOG A;  3JS9 A;  4S0M A;  3ENA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...