1NPKA

Refined x-ray structure of dictyostelium nucleoside diphosphate kinase at 1,8 angstroms resolution
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
150
structure length
150
Chain Sequence
VNKERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLVPTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPLASAPGSIRGDFGVDVGRNIIHGSDSVESANREIALWFKPEELLTEVKPNPNLYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NUCLEOSIDE DIPHOSPHATE KINASE
publication title Refined X-ray structure of Dictyostelium discoideum nucleoside diphosphate kinase at 1.8 A resolution.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Phosphotransferase(po4 as acceptor)
total genus 44
structure length 150
sequence length 150
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 1994-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 1npkA00
2BEFA 1NPKA 4ENOA 3ENAA 2DYAA 2HVEA 4FKXA 3VGVA 3VGTA 1NB2A 4F36A 3FBCA 1HIYA 1VYAA 1S59A 3BBFA 5BXIA 3EMTA 1XIQA 3BH6B 3EM1A 3VGSA 4UOGA 3B54A 1W7WA 1B99A 3FBEA 1HHQA 3ELHA 3EICA 1LWXA 3FBFA 1WKJA 1NCLA 2ZUAA 4O0NA 3Q8UA 4WBFA 3Q83A 1NDPA 1NUEA 4DZ6A 1NSQA 1ZS6A 1NHKL 2BX6A 3PJ9A 3FCWA 1EHWA 4ANEA 3MPDA 1MN7A 1F3FA 4C6AA 3JS9A 1NSPA 3ZTQA 3Q8VA 1KDNA 1NDCA 3EVWA 3NGSA 5CABA 1WKKA 3EVOA 1B4SA 3Q86A 1LEOA 3B6BA 4CP5A 1HLWA 4DI6A 1NDKA 3WX8A 2DXDA 4ANDA 1UCNA 4S0MA 4UOHA 3ZTPA 2DXFA 3FC9A 4FKYA 1BE4A 1NLKL 3EVMA 3Q8YA 4EK2A 4ANCA 3GP9A 3DDIA 2DY9A 1PAEX 2AZ3A 3BBCA 5IOLA 3ZTRA 4F4AA 3R9LA 1NDLA 3PRVA 1WKLA 1XQIA 4KPCA 3BBBA 1BHNA 2AZ1A 3VGUA 2B8QA 3L7UA 2HURA 1NSKL 3FCVA 3ZTOA 3ETMA 1K44A 3VVUA 2DXEA 1S57A 3GPAA 5CAAA 2NCKL 2HVDA 2VU5A 3NGTA 2CWKA 3FBBA 4DUTA 4UOFA 3EJMA 1BUXA 3Q89A 1MN9A 3EE3A 3BH7B 1PKUA 3NGUA 3VVTA 3G2XA 1JXVA 1U8WA 5C7PA 1S5ZA 1F6TA 3FKBA 3NGRA 4W98A 2B8PA 4HR2A 3DKDA 3ZTSA
chains in the Genus database with same CATH superfamily
4YQWA 1G3OA 2A2CA 3JTOA 3OXLA 4F67A 4C8MA 5KFLA 2FGCA 1FXRA 2D9OA 3F56A 4CM2A 4R0JA 5HQMA 3HHLA 2ZBQA 2C2DA 1D09B 4X4SA 4P6QA 4FYVB 4UW2A 2KFNA 1C1BB 2QEXS 3FZ2A 3VGUA 2FJEB 2OFGX 1URRA 4LRFA 3CJ3A 5J2PA 2DR6A 2AP6A 2H1YA 1APSA 2VQEF 4DUYJ 1VQ4S 3IR7B 4I6YA 3KLHB 3W66A 3I96A 2ZFHA 1T7PA 1N48A 3NP5A 3NS5A 3U02A 4LSLA 2JLGA 3MAHA 3SZ2A 4NYPA 2BEFA 2CPFA 2VC1A 1WTBA 3B4MA 4XIUA 5DDPC 3H5XA 4XO0A 2AYMA 1GFWB 4WKRA 4C8ZA 1UJ4A 3PX0A 1NDPA 2OSQA 3M32B 3DI6A 4P52A 5KG1A 2P9CA 3KUEA 4RW6B 4TN2A 3ULHA 2LQ8A 2MKKA 2CPIA 4FKYA 1U48A 1J5EJ 1YJTA 2O01C 4CNZA 4I2QB 3GQCA 4RR5A 3CB4A 1RT6A 4NEZA 2BE2A 2MZTA 3DLKB 1Q7YT 1X0PA 2YNHA 5K20B 4KPYA 4YDDB 1I1GA 5DZ6A 3HP6A 1NK8A 1TKDA 2B0GA 4DG1A 3Q0AA 5DG7A 1NXIA 3VGTA 4ID5A 2W01A 4JV5F 2E1PA 2QL5B 2U1AA 1XMOJ 1X7VA 3PJWA 2KKHA 1UJ6A 2V50A 5GAEU 4ZVEA 2A0FB 2WCXA 3GR1A 2IBKA 3KXDA 5D0HA 3IAS9 4HYKA 4C8YA 4DS4A 3M8PA 1LXNA 1I94F 3MM9A 1L3UA 2AT1B 1WOPA 4J9NA 1OPZA 1CQNA 2R7TA 4RBTA 3U7JA 1KP6A 2WAQD 3CC7S 1U0SA 1KOHA 2OO4A 3CCSS 3ISND 3JXOA 4YY3J 3AOCA 3QGGA 1S6PA 3TZXA 1FJEB 2I1RA 3I6PA 2DNGA 2VOOA 4LBIA 2R8JA 1U1OA 2KXNB 1H3DA 2KT3A 2KYZA 1FKAF 1D9FA 5L9XA 4ERDA 4XPCA 1FNOA 2CDRB 3PV8A 5KFIA 1SIZA 1QY7A 1EAYC 4P2XA 2DEJA 2B4VA 2HZAA 3GIRA 2GIFA 2K2PA 4NA2A 4JI1F 4JI3F 1HR0J 1PC5A 3ZZZA 2FJBB 4NLSA 2VG5A 1S72S 2LP4A 3CIZA 1PJ6A 4DN9A 1YJ7A 3NEKA 3DLBA 1N5YA 3VAFA 5A2QY 4K59A 1TK8A 4RUHA 3LP0B 3OUYA 1LKZA 1VHFA 1SL1A 1SKUB 5JJBA 2H4WB 2GJFA 2IAJA 5LT5A 5HO4A 2P6TA 3C6TA 1N33J 1IM6A 1Q4RA 1RT2B 2RSQA 3U1LA 1VQ5S 2R9LA 2DT9A 4J9KA 4LBPA 4CO3A 3BSNA 2DXEA 5B0CA 1OY9A 1U26A 3IN5A 3R3TA 4M8LA 4QWCA 5AJ3J 4NL5A 1EB0A 3IM9A 2DHGA 4UOFA 2B56A 4DR3F 3A3NB 4XDDA 4YHHJ 3MOJB 4P72A 1SXLA 2XZDB 1T0TV 5AXLA 3PFEA 1HNIB 3BEGB 2DYAA 2EFNA 2DNKA 1X9SA 2K3KA 1AUDA 1WACA 1UA1A 2RKIB 4Y0FA 2GW8A 3C15B 3EPGA 1HW9A 2AEMA 4OYOA 3D6FB 4DLEA 2Z2YB 1B64A 2ZNYA 3ZTQA 3NCQA 3HZGA 1MWZA 1CBKA 2VICA 1RAGB 2HIYA 4JI8J 5RUBA 1PILA 1QSSA 3AJ2A 3ZTPA 2FVRA 4G65A 2XZWA 5SZTA 5FD1A 4LJMA 2FZGB 4ANCA 5KFZA 1PAUB 2E5HA 1REVA 3AXKA 4E8UA 2KJWA 2EFGA 3W9HA 3J7AN 1S1UB 4PABA 4O4GB 1N34F 4WFBQ 4DBQA 4WFYA 2BOPA 4H4KA 1F9EB 1KHWA 3R5CA 4LRAA 4OYXA 3HDSA 1SUQB 4DFKA 3LA0A 2HHTA 1IBKF 3LPEA 3C16B 4DQPA 4LQ9A 2H51B 3NCPA 2HMIA 4FKXA 2CQCA 3J80Y 1X5PA 3J7Z5 4YP3A 4J9PA 1BWEA 1UL3A 1S7IA 1Q8IA 5ETNA 2G1DA 4DV3J 1YGYA 4F0KA 2DNOA 5KFRA 3BDPA 3V4IB 1TFYA 2JEGA 2A6MA 3OR2B 5GADU 3ZNJ1 4EZ9A 3PHEA 4PXDA 1P27B 2GAHC 1T9XA 2YNFA 2H54B 4RW6A 4WFXA 4F4WA 1E6YB 2ZH8A 2Y1LB 3QGPA 5F8GA 3CJ2A 4RW7B 4IOBA 2H5EA 3LO3A 5HJXA 2M8DB 2NXCA 5KFPA 3EE3A 3CCTA 4O0IA 2W9CB 5KG4A 1CJVB 3PX6A 1FCAA 1OIAA 4NCBA 5D0EA 1XNQJ 4WXOA 3EX7B 1QVGR 1TVRA 2EBGA 2BBEA 3DLEB 1F9FA 2W4PA 2ZH5A 4L74A 2DR9A 2BXJA 3TEHB 3MR5A 2F9JA 1N0UA 1NCLA 4FPRA 1U09A 4FZVA 4ZHRB 5HLFB 4QIWD 2PA8D 1NSQA 1R43A 2R2TA 1EETA 1RT7B 4KR0B 1Q81T 1VBZA 4W92B 2ZWPA 4RO0A 2AJQA 2DK2A 1KONA 1BE4A 4KH0B 1H2UX 3OVSA 5EX0A 2ZKUA 3C66A 1TKXA 3M8QA 3DYAB 3NGDA 5DETA 4URQU 1JLEB 1X9WA 1TL1B 4I0WA 2C2NA 4WE1A 1CULB 5K14B 4LRBA 1P9YA 1HL6A 1L3TA 3OTCA 1DTTB 2M2BA 2BQRA 4TKTA 4BWMA 1FNXH 5C42A 2C3MA 5KFTA 1S59A 2EFQA 5CZXA 2XGPA 1DRZA 4ATNA 1ZAWA 4GO7X 2E1AA 1FRIA 1RU1A 2B6AA 1RZMA 3ICLA 4DV4J 4DV1F 3EZOA 3OFFA 4DL5A 2VD3A 1LK7A 1DQAA 2OPPA 4PYDA 1FWLA 3PCOB 4IFYB 3PYDA 3BQ2A 2AGOA 3RR7A 3PIOQ 2IDLA 1JLFA 2HZVA 3O3LA 1CLFA 4P2SA 3DRXA 4ZVUB 4KTQA 4QZVB 1CJKB 1GQEA 1RGVA 1X0FA 1HWUA 1RBOB 3H7HB 1NAQA 1GMWD 3VQSA 1C0TA 4M5DA 5DG8A 3GYXB 4GKKJ 4OJGA 1X60A 3CDWA 3HFVA 2BANA 4LF6J 4KT0C 3TW0A 2VODA 3AQPA 4R5PA 1SQGA 1B0PA 4DV6F 2HQFA 3MM6B 3DRPB 1XIQA 3M6UA 1HNWJ 1HHQA 2BJ9A 1DBDA 4IRDA 2AGPA 3JSYA 1I51B 2Z30B 2Q3PA 1OJ4A 4HHUA 3CT9A 2KXFA 2AIRB 3D1HA 1T05B 1HNIA 1RAOA 2CPHA 5KFNA 5EWGA 2DCUB 1RUSA 2KYXA 1SV5A 1VR6A 5KFHA 3ZZUA 4OYPA 1UMJA 1EKRA 4B9UA 3C15A 2QFJA 3H2UB 1WC3A 2VB6A 3TO8A 4FXDA 3OVAA 1EKSA 1N5VA 4JB8B 3CNQP 3E3XA 4FYYB 3BJYA 2QA2A 2V8DA 3OTOF 4EI2A 2F65A 4IH6A 2NCKL 3CJKB 1KSPA 3VAKA 1RWMB 4USIA 2RJZA 2F8MA 4O3SA 1IKVB 2UVVA 4WYLA 3IAM9 1HI1A 3NAIA 1QTNB 2UXCJ 3KK3A 1B7FA 4ZOSA 4ALZA 1U6FA 1OQ3A 1Z4UA 1B99A 1P1TA 2ALYB 1OY8A 2HEKA 3AQOA 2A3JA 5HBMB 3W1YC 3UI3A 1TUWA 1AFJA 1N32J 2OMOA 4DSJA 4ECZA 4YB1P 1FD2A 2CQHA 2EFOA 4QWAA 1RLDA 4MIBA 5CYJA 1TUVA 4Z7YA 4DR6F 4V19J 1VRQC 3ZO7A 3FGVA 2WVBA 1PAEX 2AZ3A 2BM0A 1MU2B 3KDOA 1U1PA 4ZVOB 1NJIT 2LXUA 2C2MB 1UA0A 3Q8RB 4EBDA 2JHEA 4A8SA 4TXSA 3ETMA 3KJVB 1Q5VA 2OPSA 4B3RF 4R25A 3NGTA 1FK9A 2DVIA 4U6PA 4USUA 3QIPB 2XWXA 2YKQA 3AFGA 3DN9A 3JYTA 3OXGA 4U7UK 4FXWA 2DCLA 5IC4B 4GC6A 3DRRB 3G6ES 3NGKA 3T1HF 5FJ4A 1HNXF 5KT5A 5K8MA 2W9CA 2RS8A 2ZVIA 3QGHA 2YQ1A 2BYCA 4DL4A 4K7QA 3D1OA 4AQYJ 4LF5F 4DV0J 2JRSA 2GMLA 1RTIB 3WC2A 3RB6A 1KDNA 5DM7Q 1HBMB 2MQPA 1HBNB 3FQLA 2G2YA 2CJKA 1TV6A 3DDKA 4I68A 3BM7A 3LW5C 3NS7B 2Y8YA 1M5HA 3WZ0A 2J0QD 5KT3A 2RUGA 2R2UA 4N56A 4OZ3A 4E0DA 3KUGA 1EARA 3MPYA 2XWYA 2FPHX 5IT0A 4Q5VA 2W25A 2V94A 4LF4J 4RW8A 2RF2B 4ECSA 4LSNB 5J2MA 2IVYA 4DFJA 2JDJA 5D4OA 3PACA 2VH7A 1E6VB 2KI2A 3NOCA 2OHDA 3WIVA 2CPYA 4KKOA 4P7VA 5A8WB 1M1HA 3W62A 2YWKA 4X4NA 4ZCLA 3SI8A 2RAQA 3LAKA 2E9RX 3BPDA 1N52B 2EWHA 5KFOA 3PW4A 2HVIA 1RTHB 3GB0A 1HBOB 2ROPA 1S9EA 4TYBA 4BCAA 3TEGA 4J90A 3UVJB 1LNQA 2KDOA 4MYUA 2Y1RI 2X1BA 1HQEB 1AXQA 4OX9J 2YPZA 3M30A 1WSRA 4CP5A 1RAIB 2W8LA 3AB2B 3FSXA 1SKWA 1DARA 2DY9A 5IOLA 4FXVA 5T7LB 1U1MA 4NA1A 2PA3A 2DISA 1IKXA 3RR8A 1EZZB 4MIAA 4JP8A 1A9NB 3S01A 4PQAA 3LP2A 5DLGA 4DL3A 4RNMA 3NL0A 3FK4A 3E2EA 1ZPVA 3GPAA 2VASA 3MCMA 5A8KA 4PG8A 3P96A 3MECA 3TAPA 1CJKA 1FI4A 3G2XA 1U24A 1CC8A 3QLHB 2QIFA 2DRDA 2GHWA 2MQQA 1DZ5A 3F44A 3CPWR 4WK3A 1TZ0A 1WC4A 5GMEA 3KK2A 4I7FA 4ZLLA 1B7YB 5CD4H 5EWEA 5D78A 1Q1KA 1C4AA 3LGMA 1FEEA 4KHMA 2MYFA 2J9DA 3OW2R 3CCQS 3IBWA 1H38A 1IM4A 1WHVA 2XSJA 1YJNS 1WNEA 3PW2A 4ZVSB 2GVDA 4DUZF 1RADB 1XNRJ 1H2VZ 2UVWA 4OYBA 1IBLJ 4MKYA 3PKYA 1WG1A 3TARA 3JSMA 1NSKL 2A1BA 3ENQA 4Y65A 4G1IA 1T94A 3CCUS 2CFXA 2MLYA 4CYUB 1YRXA 1SC1B 4ZVHA 4IDKA 2HNDB 3KTQA 3QFWA 3EGVA 4PUOB 3CC4S 1KTVA 4Y2IA 2LEAA 2FHKA 2YWWA 1SVDA 3LGHA 3SXLA 2QGFB 1SJ1A 3EM1A 5L8RC 1BQXA 5C2GA 5U47A 2PGCA 1TMJA 4NLUA 2E1MC 3TA2A 2VBWA 4X65J 1UWBA 5LOQA 1Z1ZA 2D3ZA 3TVZA 3QT6A 1FJ7A 1PYSB 1S79A 4IR9A 5E3AA 2W24A 3LAMA 2DTJA 4DFPA 1UFKA 4Q8FA 4OHXA 3UD3P 3N01A 4C0OC 3RAQA 1GX6A 3DDNA 4ECYA 4ILLA 3PFOA 1R0CB 2MKHA 5F3TA 3T1YF 5DDRC 1T9UA 5F8LA 5A0YA 2M8HA 4PR6A 1R0AB 1QJHA 1JLBB 4PZVA 2R7WA 2MZQA 3PYGA 2VL1A 2YKMA 5AE1A 1KHVA 4GKJJ 1LWFB 2PI5A 1HD1A 4HT7A 4AT1B 5LJ3Y 4NLGA 4ES1A 1WJ9A 4FNHA 1AW0A 1H6KX 2OD6A 4LFCJ 4OI2A 1RACB 1FJGF 2VG6B 3PKMA 1VK3A 4OMFG 4Q45A 3I4HX 2MQ8A 3ZC4A 3CCJS 2HHPA 1UFLA 1RXOB 3PTWA 2DR5A 4H4OA 4FF3A 2YNGB 3DOMB 2HWHA 3K5NA 1SKSA 2CPDA 2XQCA 2XLIA 2DH7A 1R7IA 3D6TB 3TJ8A 5I3QA 2MSTA 1RTIA 1JK9B 1KQKA 1S97A 3AOAA 3JAMY 1Q8LA 1YBUA 2F4VJ 3M1VB 1FKPA 1PBUA 5J2NB 5LJ5Y 1GEHA 4IFVA 3VAHA 1S7HA 5E3QA 1PC4A 1N0VC 3MAAA 2MPUA 3UCGA 4NYOA 3ZZ0A 3OBIA 1S9GB 2F63A 2IYGA 4CLZA 3TNVA 5HSPA 1XK8A 1X4DA 3CMQA 2B8PA 2UZAA 2RRAA 1AYEA 3TUJC 5HROB 5L9NA 3I0RB 2C3UA 5BJRA 2NUHA 3GIMA 4QQBA 4NCGB 4OV6A 2LXIA 2OEJA 3R1LA 3BV8A 4C8NA 3D54A 4ZPBA 4AL7A 1YZ7A 1YJ9S 2GJIA 3OJSA 4GVLA 2OI2A 4MT1A 4OYWA 1RU2A 1ROFA 2O67A 4FBUA 1NSAA 3D4JA 2OPQB 5KFEA 5AE2A 3LTOA 3HJFA 5A8RA 3V6JA 2Y1IA 4HDGA 5LMNJ 3HVTA 3PRVA 1UW4A 4PG6A 1HQEA 3RB0A 3R97A 3EZ5A 3ZZOA 2OMLA 1T3OA 3AXMA 5DM6Q 4OHWA 4DV2F 4JUZA 2CQ3A 2MZJA 4M1KA 4DSFA 2G2ZA 5T7LA 5IM0A 3VZIA 1MROA 4PCQA 2W4DA 3CSKA 3QSYB 2PEBA 4CTAA 1OYDA 3H2VE 3RBEA 5JUMA 4Q8EA 2XM3A 5BXIA 3HT0A 3M6XA 3GV7B 2R8KA 3NCRA 4X64F 3IP0A 2LYVA 3GV8B 2F1FA 2OPRB 1F3FA 5CH7B 2RE1A 3ET6A 3T5LA 2JFKA 3GR0A 4O3PA 3OVBA 3W2WB 1AZSA 1V5VA 3I5AA 1F5BA 1M0SA 3DGPA 1UCNA 4EBCA 2JWNA 2NZ4A 2HYIB 4N77A 2CJQA 3BO3A 3O2IA 4IH7A 1U0HB 2FJDB 3FVYA 1T11A 3PYFA 3T5KA 4HLBA 2GIRA 1HNVB 2CQ2A 2XCAA 3ZFVA 4QCLA 2W2OP 2HVDA 4ZVGA 4ECRA 3OQ2A 2CWKA 1TAQA 2LCWA 1X4CA 4MH8A 1NPRA 1S0MA 1FJCA 1BQMB 2CVEA 3D6HB 1CJTA 3BGRA 2FC9A 1GTEA 4CYUA 2V8GA 4MK9A 4OLOA 4ED4A 2VQEJ 2MQLA 3RYLA 3G8SA 1Y0HA 1G6BA 4PKDB 3DRSA 3QZ7A 2CPXA 4C48A 4W90B 2QYGA 4D3HA 1CSJA 1KNZA 2AMCB 1UEUA 4HTJA 3UE2A 4Z7CA 3PG9A 4EZ6A 1TKTA 1KLNA 3RU0A 2IM2A 2QTWA 5H9FJ 3UN3A 1U6ZA 2ZH1A 1PBAA 4B9LA 3CCZA 2EBEA 1TMMA 2PE8A 1UVKA 4IRCA 5H9EK 5I4MA 4X62F 3DOLA 2MZSA 4KO0A 1UVMA 4I64A 2QMUB 1JKHB 1UWAA 2YQ3A 3MEEA 1ZETA 1YTYA 1JXEA 5A2QU 1NH8A 2QLJB 4UF4A 2C3YA 2UU9F 3W63A 5KFYA 5KG2A 4ED0A 1BY9A 2R7VA 2P5VA 3I0SB 4YB6A 1RHKB 3TVYA 2EEYA 1DURA 1HI0P 4QIVA 1TR0A 1LWFA 3G6VA 1UKUA 3QNWB 3G71S 3CD5A 3N0VA 3MPDA 3MCSA 1N36F 3OXFA 3GFHA 1IVZA 2ZC3A 4M5JA 2ASLA 2ZZNA 3CCES 2J7KA 3AHPA 3R2DJ 4AD6A 4JV2A 3DOMA 3CMES 1S12A 2GHVC 1KFDA 3W8GA 2FYXA 2ZNZA 5H1SV 3JSRA 3K57A 4RW9A 4HHJA 3VVUA 2HVZA 1WF1A 5E3CA 3TJ9A 4USKA 1OYEA 2OEKA 3OLAA 3RRGA 1U8WA 4I6AA 4KGXB 4TVAB 2HQCA 5J2NA 2YWHA 2KJVA 2XULA 4DF4A 1S6QA 2XNQA 3MM7B 2ASJA 2ZOFA 3AH6A 2HK3A 2Y1JA 4NXNF 5G4DA 3BB5A 3NWRA 1M5SA 1S1XB 5J2QA 5F0UA 1VBXA 1RTDB 2HFSA 2DR7A 1RP5A 4OX8A 2ZH3A 3W60A 1J27A 2JLFA 3R2CJ 4JI4F 3UNYA 4JI3J 3SSRA 4USWA 1ZOTA 2GCFA 4C3MA 1O5JA 1F0XA 5ETKA 2DHHA 4UTGA 3L3CA 2HPUA 1Y7PA 4LFBF 1HWLA 2EG1A 3BF4A 3DLHA 4DWIA 2QSWA 4ECQA 1WUUA 5IQ6A 1WOSA 2ZBIA 2BJEA 1FRMA 3P5BP 1FVQA 3RGIA 4HKQA 3KHRA 2VPXB 3CJ5A 3CDAA 1NHUA 2V67A 1DTQB 1ZH5A 3DCAA 2CADA 4UT4A 3MMCB 2CQBA 1IBMJ 1NKEA 2D74B 1N8RT 1N6QA 1FXLA 2Z8QA 3V5RA 4DR3J 1PIEA 4DSKA 3DU6A 3R5DA 1NO8A 1RWVB 1FX2A 3D0HE 1T8EA 2V69A 1Y9OA 2DD8S 2N7YA 1LV5A 2V4QA 1TKZB 4A48A 2E5JA 4UOHA 2YKAA 1V3SA 1TELA 2QZ8A 1JX4A 2O3DA 1Q95G 1NK0A 1W26A 1KVIA 2RMLA 3JTPA 3FCVA 3UDCA 1YWXA 4ZLPA 3HSGA 3O1LA 5HMZA 4QWBA 2QMXA 2OIHA 3UCZP 1LWCA 3TANA 3WX4A 4FVCA 3CJRA 2HNYA 1XWLA 1WC5A 4IQXA 4K0KF 1HNVA 2QLFB 3UD5A 4C9DA 2V63A 3BDEA 1F5AA 1N34J 2A18A 4H4MB 1GT8A 2YY3A 4GVBA 3VGSA 2WVDA 1CC7A 3VR1A 1IQZA 4O3QA 3GJQB 1BQNA 3FFIB 2AF6A 1IBKJ 2BABA 3ILOA 3QAEA 5SUHA 5HP1B 2P9GA 3TQ1A 3TYTA 5B0AA 4B9NA 1WC1A 2DNMA 4QR1A 2DXDA 4QPTA 2QO3A 2FGOA 2KTQA 5J1EB 4F4ZA 4DR4F 1S6UA 4PXCA 2B8QA 5D4NA 1L3SA 3A3PB 4OI0A 2HHUA 2DKOB 1RHMB 4RKUC 4DUYF 2VUGA 2GC8A 2RNEA 2Z2ZA 3ILLA 2JLEA 1RAAB 2G0IA 5DDQC 2J9CA 1JXVA 4C2MA 2CNOB 5HMYA 4CLPA 1JLQA 1JKHA 1RI7A 3FBCA 3DFEA 1YKWA 3M7VA 1KWMA 4BLGA 3MTKA 4YDXA 4OI1A 1HYSB 3BQ1A 2R8GA 5H9FK 4QIGA 2V4JA 1RT1B 1YBAA 2HHSA 2IJRA 4DL2A 1J5EF 2RDJA 3W5ZA 6FD1A 1KTQA 1RT3B 3QJJA 4ID8A 3BQ0A 3QSIA 4USMA 1QDUB 2BW2A 3RJMB 2DNHA 1C0UA 3MM5B 1Q53A 2F3JA 1K0VA 3A8KA 3FCHA 4WU3A 8RUCA 4JOUA 2YH0A 2XY7A 2I6WA 3N79A 3OLBA 4NLRA 1SC6A 3KLFA 1IR0A 3P4UB 3FKBA 2PMWA 5CQGA 2KM8C 2E9TA 1ZAVA 4GRSA 1VBYA 2Z58B 4KY3A 3EGNA 4A47A 4TNOA 2HFZA 2EFVA 4IKAA 1VFJA 4DQSA 2JSXA 1QSYA 5HI7A 3F73A 1ZS6A 3KG0A 2WOMB 3MM7A 3SYZA 1IKWB 2J9DE 5DJBA 1R8PA 4U7UD 2F4FA 2VBZA 2FVQA 1R0BG 1VC5A 2U2FA 3MDFA 3U1NA 2XMMA 1RTDA 4WKYA 2FJVA 1N5SA 4YY3F 2FC8A 3Q8SB 1YITS 3TI0A 2PSZA 4OI3A 1HQ2A 4X4VA 4H54A 1B3TA 2OLWA 5C25B 1VRTB 2KM8B 4DX7A 5F8MA 4YFUA 3OTEA 3SMZA 4NLXA 4J9OA 5LMUF 1Y5NB 2BQ3A 5I3UA 1UVIA 2FLPA 2GO8A 4HR2A 4NLOA 3PO5A 5KOWA 3M2UA 3W3SA 4MK7A 2KFZA 5IT9U 4LR8A 1RT5A 3HHDA 4FF4A 2VA3A 5GAGI 1UEVA 4K5SA 1QD1A 1Q16B 3GZ7A 2AJ0A 3IG1B 4C11A 2FVPA 2B9WA 2AQ4A 3D3BJ 1NDCA 1G1XA 1CJUA 4A8XA 2PO4A 3ENWA 3G6XA 1FRJA 4NLWA 1DAXA 1UVLA 1MMNA 3WX8A 4P2MA 2NYHA 4S0MA 3WIUA 1V5IB 1N33F 3RTVA 3GP9A 5F8IA 1LW2B 2ABYA 4Y34A 3SDEB 1AB8A 2AD9A 5F0WA 1BLUA 1C1CB 1TKZA 1O0PA 4OJ3A 4C4WA 2LU2A 4I69A 1DQ9A 2JNJA 4V19X 2M52A 4ER8A 4DU8A 4UQGA 1VC0A 5IS2A 4YHHF 3M8SA 2W4CA 2BVZA 1VHIA 1KRPA 3KYLA 3BH7B 3HXMA 5T41A 1D3WA 4EWTA 2M70A 4A8WA 1JLAB 4F7VA 3MTJA 4X4RA 2HS4A 2VFTA 3LH2S 3US5A 1Q8BA 1IQTA 3KLEB 2OKQA 2HQGA 3CCRS 4KB7A 2EC0A 5B0FA 2AV5A 3JSBA 4MIWA 2V2QA 2EKNA 1UTAA 4LVNP 3QT8A 2MTLA 3MMBB 3QZ8A 3KNGA 3MGJA 4BC7A 4V1Ak 3HVWA 3AD9C 2R7UA 4H4MA 3UN5A 4CRJA 2E1CA 3FUYA 4JI8F 3RZAA 2I8EA 5KFGA 1P1LA 3MUMP 3B6BA 3BKUA 4F2RA 1ZM9A 4J91A 2KHCA 1KOOA 3IWNC 2AKWB 3T6BA 2YKPA 4KBIA 1DLOA 4U7CA 3DLLQ 1I3OB 1VQ9S 1JNRB 1R8CA 4DX8H 3CCMS 1BMQB 2IPOB 4TY8B 4DR1J 4X66J 3DMJB 4ILMA 4DR6J 5LM7E 2HBRB 3GIIA 2I2YA 1TFWA 5D4LA 3T5JA 2LEBA 2NYIA 4QPXA 3M9NB 1UP1A 3CCVS 1H0HB 1VMBA 3LUYA 2ZE2B 1O6XA 4EYIB 4N41A 1TP7A 1W7WA 2LKZA 5B0DA 2DGOA 4DV3F 3O44A 1JWWA 3OJUA 4DV7F 5BYQA 1I5OB 4NMLA 2DGUA 4RW4A 5CXTA 1V3ZA 4PAAA 4LMZA 3GILA 4JI5F 1CVJA 3EXCX 3DLGA 1NLKL 1AA1B 1K1QA 5G0RB 4QIFA 1NJZA 3CJ4A 4LF5J 3KNAA 2KZZA 1UZHA 1KLMB 2GGPA 4O23A 4NE9C 5JVHQ 3MEDB 3C14B 4F4KA 1JNZB 2KO1A 3L7UA 1V3RA 1VJQA 1HWJA 3D66A 3GU0A 3ILJA 5E3PA 2BW7A 2HRUA 4QW9A 5CAAA 4C8LA 1RT3A 2EVZA 1HHSA 2PDAA 2E29A 1MMDA 4OZLA 2M0GB 2CJXB 2JL9A 1QAYA 1NH7A 4CO1A 1N56A 1RBAA 1RT4B 4MKAA 1FD8A 5IC6B 1T03A 1YLXA 2BZ2A 3MPWA 4EFAC 3OFEA 2BKOA 2OAUA 1VRUA 2HHWA 1WDDA 2N7CA 3WHIA 2A6OA 4LQ3A 2G1HA 5HAOA 3B8HA 1PYOB 2BJ3A 2N4CA 5HK4A 2XSFA 1LWEA 3Q86A 3T41A 2GQQA 3GWCA 4K5RA 4K4TA 2BACA 2FHOB 2XMVA 1M1GA 5CYMA 2Z4PA 3HKWA 2J76E 1VQNS 4QYRA 2ZZTA 5LL6d 3TAQA 2XEXA 4P73A 4IYQA 1GH8A 5K8OA 2EI5A 3G4SS 2KRBA 2HBYB 1HHTP 4PWUA 2J8SA 2ACMA 3IRXA 4LVOP 2RIJA 1Q7LB 1FA0A 3KLIB 2HHHF 4N8NA 2QA1A 1EIYB 3TAMB 1M5VC 5B0BA 4ECVA 4G1QB 4CWBA 2YH1A 3A4TA 2HHVA 4BS2A 3HT3A 2GVZB 4DV4F 1SKRA 4XAKA 4RJVA 3KJNB 1S4EA 4B17A 3E01A 2IVMA 1Y00A 3W61A 4AXIA 3SFUA 3BYRA 2DGSA 5EX3A 2KT2A 3N28A 1VQMS 5GVQA 5BYSA 1LK5A 1EP4A 1R8BA 5E7OB 1UAWA 1IWAA 2GFFA 4CLTA 3KHLA 5IFMA 1XEZA 3W65A 2Y0SD 4N8OA 2EKYA 3UNGC 4JYAF 4RPFA 3W7BA 4ED8A 4LUBA 2ZD1B 2JC1A 3BSCA 2GZOA 2GJ2A 3TX8A 4F4YA 1UW9A 1NB7A 2HNZB 3PW5A 4K2JA 1MN9A 1TL5A 4C0BA 2H5JB 4MMOA 2MY7A 2MB0B 1PKUA 2JEJA 4IR1A 2N3LA 4ZP9A 4U67Q 3TX0A 4DUZJ 1FWKA 3AB4B 2X3DA 4I1TA 4WTOB 2BA9A 3VGVA 3OSPA 2M7SA 3ONQA 1N54B 1X4GA 2HW3A 4UOCA 4ZCKA 2ASYA 3KLGB 4OX7A 3EZUA 4D3GA 3QAUA 4TQRA 2CJ9A 3JAMU 4NLTA 1TUGB 3MM8B 1JLGA 1JJCB 2G4BA 4LFAJ 3L7OA 2YKNA 3MMAB 1SI9A 5HN0A 2B9EA 4A8YA 2XO6A 3ZNUA 4U96A 1NKBA 1KEKA 2XYHB 1U1QA 3BO4A 4A8MP 4YS2A 4UY85 1Q86T 3C6UA 5CYQB 2R2RA 2HRTA 2DGTA 3W8PA 3BS9A 2HURA 4UZBA 3N6MA 4FYDA 3UQSA 3HULA 5ETVA 1S1VB 1WC6A 2UUAF 2CQPA 1REGX 2LXFA 2UXCF 1H73A 1KQGB 4OYMA 4TU7A 4AL6A 4RWWA 1S1WB 4ZVTB 2NXJA 5A6WA 1KN6A 3IS9B 4CM0A 5D8HB 4QYZK 1NHVA 1CS4B 2NZCA 5KG7A 4ZN3A 2Z56B 2NXUA 5EHHA 2ZUAA 2BE7D 1H2TZ 2ZE2A 1N32F 3KKFA 2BQUA 1HPZB 5JXSA 3CEDA 4WP8A 2NS1B 2CNLB 1R31A 1G2EA 3KOAA 1U2CA 3OFHA 3M9MB 4X4UA 2NR0A 3Q8YA 5ETTA 4ELUA 4LREA 3K0JA 2C2EA 3R5JB 2N4DA 5HMWA 3AJ1A 4F2SA 4KFBA 4ZLJA 3Q23A 2YWFA 1HW8A 4MKVA 2JZ5A 4ZS6A 4NX9A 1KD1T 3QJLA 4BBYA 3NMAA 4DEZA 4DXLA 1U2RA 2YBVA 3GFZA 3HF5A 3EDRB 4NASA 3L7PA 4IG3B 2CYYA 2UUBF 1GMVA 3NNAA 2XG8A 2WTFA 3AY0A 1YRUA 2E7XA 3OL8A 4NLVA 4ILRA 4B3SJ 3R5GA 3UR0A 3GJTB 4DR7J 2PFFB 2MHEA 1BD6A 2MMYA 4PG7A 3G8QA 1NNDA 1PYTA 3VAGA 3LGNA 1D0EA 2IHR1 1RT4A 4B08A 4TYAA 2FJXA 1FRKA 3K5MA 1FFWB 4U8VA 1Q8KA 1YZ6A 2W9BB 2OJ3A 1C1BA 2LA4A 1HFEL 4J9VA 2L3MA 4ICLB 7FDRA 3FEXB 4RLEA 5CA5A 2MKCA 5DDOC 1BC6A 1U47A 3JTNA 1RLCL 2O66A 2QG9B 5I42B 2XGQA 3KLHA 2DHAA 2K3IA 3V6DB 2HAFA 3RRKA 3JQKA 3R1HA 1SQEA 3N9UC 2AEFA 4KV8B 4Y6IA 2J8AA 2C22A 3TR5A 3I32A 7FD1A 3TZZA 1KVKA 2XO7A 1YJUA 4ECUA 3M32A 3TAMA 5KFFA 2J5AA 2R4FA 1GXUA 1NHKL 3M2VB 3FCWA 4TLQA 5DS7A 1RTJB 4NRTA 1RQ0A 4OX9F 1NZ8A 2ZJRQ 2E7WA 3Q2TC 4YEAA 3F41A 3IR5B 1NKCA 2LLZA 2LA6A 3W64A 2KHDA 4X64J 3CDBA 2VV5A 4I2QA 3BGOP 4FYXB 2VJVA 3QGIA 4CCHA 3CDEA 2BKPA 4C3LA 2D69A 2YQ0A 3HHLC 3DLKA 1CG2A 2JEFA 3U1MA 3IBFB 3OHBA 1YJVA 1S57A 1YG0A 2FUG9 4CH0S 2VQFF 3IFEA 3QO9B 4QBUA 3MUTP 1FHTA 1HWIA 4OZJA 1S48A 2RQMA 4O44B 5MLCV 2V9KA 2PT0A 2ZD1A 4ZCMA 3QRPA 3TQEA 1RWXB 5K8PA 1B0TA 1HBUB 4NPOA 1G4CA 2HWTA 4PXEA 2UXDJ 4LF9J 5M2UA 3CJ0A 1TL7B 3UR3C 3GG1A 4CLSA 3SV3A 3VWSA 4ZPTR 4P74A 3QRQA 4LBHA 1VCTA 2CRLA 2HVHA 2NPFA 3HHLB 4KGZB 2ZM6J 4JBCA 2BE9B 2QA4S 2VFRA 4N7TA 1G7CB 2V2KA 3MPVA 4JV1A 2C2OB 1KQFB 3I5BA 1IBLF 1WC0A 3MM8A 5IWAJ 4E2FB 3KLVA 1KKHA 1AROP 4RX6A 2HFOA 4CLFA 3SCJE 4C7QA 2I9SA 5LXRA 3H98A 1OQ6A 3SEOA 4O3NA 1Q79A 1WELA 5J2PB 4DHVA 5DO2A 1VQOS 3SQOP 1U1KA 1CPZA 1PCAA 1RA7A 1U02A 1SBRA 1UETA 1WWHA 2VDHA 4LSLB 1VQ8S 3PW7A 4F4XA 1S1VA 2DGVA 2HVEA 3RAXA 4RNOA 3BBFA 3Q24A 4NYZA 1RB0A 4X65F 2J7UA 3QATA 3HVAA 3EYZA 2G9OA 4IH5A 1RAJA 3DI6B 4A4JA 4YUDA 3IS9A 2UUTA 3LP0A 1UPMB 3D9BA 2VFSA 4LF7J 2ZH9A 2Y9HA 2E5LJ 4B3TF 4A8OA 4X4OA 3S7RA 4IQMA 5E0OA 4NXMF 1U1LA 2XMKA 2OFHX 2R2SA 2KG1A 2D41A 2GMHA 3CO9A 4A46A 4EK2A 1KQSR 1RT2A 1SCJB 7AT1B 3M9OB 2VIHA 1WKLA 1ULRA 3L09A 2NQPA 1RT6B 4L76A 4KC5A 2BE2B 1RCOB 2BMBA 2DNQA 5F8JA 5DQHA 2HQ3A 2YVSA 5KFXA 3LPYA 4MK8A 4ZDNA 2RHSB 2E44A 4DR2F 1GX5A 2NXNA 3HSZA 3M6WA 4F50A 3THVA 4NMXA 4FDFA 1RBLA 3TJAA 2VA2A 1IBCB 1HD0A 1F2GA 2XLKA 2RKIA 4DL6A 4B3OB 3V4MA 1NMEB 5IT4A 4EBEA 2WONB 1VDHA 2EW9A 2DRAA 3AOBA 2H5IB 3C8YA 2W8KA 1YIJS 3M8PB 3MM9B 4IRKA 2VPWB 5AXKA 4HT5A 1PGZA 2MY8A 2UP1A 3FJ2A 3CMAS 3M8YA 4WU2A 3S6EA 1S6PB 4WP3A 1S1UA 4O4GA 2Q66A 3ZTOA 4Y00A 3HVRA 4FP9A 5KTQA 4ICLA 1R27B 2J0XA 3EJMA 3QMQA 2CQDA 4WF9Q 1VLOA 3OD2A 4JI6J 1SUQA 1FWPA 3TWZA 2IBOA 4LFBJ 4K4WA 2DNYA 3C16A 4JI7F 1RABB 3ISNC 4AYBD 3HHKA 3QWUA 5I42A 4LR7A 3VHQA 4BHQA 1RHQB 5BR8F 5IT9Y 4RUCA 4CLWA 3IGVA 1RHJB 2KG0A 3HMJG 4K4UA 2VG5B 4KRWA 4F04B 3K8WA 2Z0GA 4U9RA 4ELVA 3SCIE 3T9ZA 4J9RA 1N5YB 2BX6A 5L38A 1YK9A 4TU8A 2DHXA 3R6GB 3Q8VA 3V4IA 1GK8A 2KU7A 3THPA 1ZYQA 4USJC 4N76A 3OUYB 4CLUA 1B4SA 5KFVA 4UUWA 3OTBA 3OR2A 2LQ5A 1URNA 1H98A 1RAFB 1XMQJ 3MFHA 1UFWA 2IAJB 2V9WA 3QJPA 2CZVC 2O1PA 3MAQA 2RHQB 3M8RA 3PR4A 4J9QA 3D6MB 4RNFA 4Y2AA 1FFSB 3JQMA 1HMVB 1E6YA 4AE5A 1XR6A 3MWBA 4MFBB 4HH0A 3IXQA 3Q8QB 1O51A 4RW7A 2ZDPA 4P7TA 3VF0B 1D8ZA 3FMWA 2UV8A 2QLWA 1CJVA 1TTHB 3CF5Q 3FSYA 2C2RA 4HI2A 3DLEA 3D0GE 3OV7A 1NB2A 3ETOA 3MURP 4FN5A 1JLCB 2F7VA 4TQSA 4WFNQ 2CA9A 4KHPJ 2FHJA 4O44A 3E51A 3DRYA 2IMOA 1OSCA 4ZHRA 2FLOA 5HLFA 2CZ4A 2RQ4A 1JJ2R 4W4MA 4K0KJ 1TL7A 5FLXY 1K1SA 4PQUB 2LVWA 1RT7A 2YX1A 2VJUA 1SC4B 2FY1A 2JC0A 1VQSA 2MKSA 3Q8PB 2IRYA 4LIRA 2ZH2A 4XPEA 2CNNB 3CO0P 1QAJA 3ITHB 1S10A 3I5CA 2YWEA 1REVB 1NK4A 3MFIA 3DYAA 3HHNB 2Q6CA 1JLEA 1TL1A 1XTZA 3U27A 3QFHA 3W5YA 2W2PP 4F3QA 2F9DA 2YKOA 1CULA 1ZM3A 2HGLA 3N5FA 5K14A 3NGUA 4DR4J 1DTTA 2LQ9A 2GQ2A 1TQLA 2HMIB 2ZEJA 2ADCA 2VG7B 3SFGA 4RNNA 2LFVA 3KHHA 2UUCF 2WRMA 3DXBA 4KQZA 1FKOB 4Y2MA 2NUUG 5B0GA 4Q2LA 4ZK7M 1SB6A 1QVFR 3J81Y 4DX6A 2ZBRA 2SXLA 4ZP7A 1ICEB 1FT8A 4IO9Q 2NXEA 1AFIA 5ETLA 1U4BA 3TOQA 2AYGA 3QPIA 3AODA 3E8OA 3TUIC 1Y10A 1RWKB 4IFYA 1MNEA 1GMUA 3OPKA 5EUHA 1ITPA 3FC9A 3DXSX 1ZTWA 5CD4A 3AAWB 1IR1A 3GFYA 3H5SA 5KFQA 1KC8T 3PY8A 1OMSA 5DRKA 1R8AA 2GV1A 2WK4A 2YNFB 4CDIA 2UXBJ 4KAIA 3H5UA 2P2CB 4CH7A 4OYZA 2V0NA 2CNKB 2GHPA 1XMBA 2L9WA 4QJVA 2E66A 3BSAA 2QC3A 4KE5A 1FXDA 4J9MA 4CLYA 2E9ZA 2KVIA 1RK8A 2HBQB 5HATA 4M94A 2NLWA 1NBEB 1VQKS 3NGRA 1T02A 3MM6A 2FD2A 5HQLA 3DRPA 1TVRB 2K7KA 3M8ZA 1U49A 4EGLA 3CD0A 3MPUB 2QFIA 2CVIA 5ETPA 1XERA 2IRUA 1T05A 3FNNA 4CI0B 4ZP6A 3UD4P 1RISA 3HJVA 1P6TA 3DC2A 3KFWX 1HQUB 4B3OA 1EETB 3BR9A 4L3NA 4L73A 3C2PA 1IKYB 2WONA 3CJ8A 1S0NA 3BBCA 1T9YA 4M5KA 4DSIA 2AJ1A 3CWJA 1TKXB 2OH2A 2HFUA 2RD5C 5GAHI 3M8QB 4ECTA 3M05A 4EEYA 5H9EJ 4USVA 3PM9A 1RWUA 4DPXA 1S0OA 4ZJLA 2UV8G 2MEWA 3CDUA 2ZC4A 3CJKA 4I67A 1IKVA 2C2ZB 4WE1B 5FIIA 2VPZB 1QAIA 3ISZA 5C7PA 1RE1B 5ETSA 2JX2A 4Z37A 2A2DA 2DPJA 3ZXWA 5C42B 1ZM4A 4EO6A 1VYAA 2DH9A 4OQJA 1X8DA 1BXNA 1XR5A 1FDNA 3PJXA 5LMUJ 2ZDOA 1VQ7S 2F8HA 5HBMA 2B6AB 4WZQA 1MWYA 1FEHA 4LF1A 1S1TB 3H42A 3RBXA 1SL2A 5K9FA 2OPPB 2Q43A 1LEOA 2M5YA 4CO5A 1M1KT 4ZKAA 2PMHA 1HNZF 4LF8F 1JLFB 3EVMA 1R89A 4RUBA 1AUSL 1OS5A 2PEHA 1YJWS 1MU2A 1MMLA 3IM8A 2DR8A 4NCAA 3OTDA 3KJQB 3TZYA 4A8FA 4DQIA 2RILA 3BREA 2B9XA 2GAGC 4RU9A 4ELTA 3MI7X 5GAGU 3KJVA 3M8WA 2XI2A 3P45B 4P75A 1S6OA 1C0TB 4M5DB 1P8GA 2MKIA 3QIPA 2R42A 3K59A 4DR5F 1HMVA 3BSOA 1SJQA 2BANB 5HJYA 4RWXA 4MFBA 2MLXA 4NLYA 1IBMF 3WBZA 4R5PB 3W2VB 2IIHA 3DRRA 2WBRA 1T9VA 4X84A 2CPJA 3G9CA 3G96A 3HK2A 3PHTA 3D67A 1SH0A 4R8UB 3N4WA 1HWKA 4DV5J 1TK5A 3TUPA 1H72C 1JLCA 2V2VA 1NJYA 5KG6A 1YVFA 5D15A 4EMDA 1HBMA 1SV5B 2VONA 1L3VA 3B82A 3HSDA 1HBNA 5AXNA 2ATLA 1W25A 4QR2A 1NJWA 3GSIA 3JB9k 2F40A 3C19A 3HCXA 3LQVA 3P5TL 4PQUA 1X4FA 1BWVA 4DN0A 2RH3A 2RRBA 1WF2A 5KG0A 2RF2A 4LSNA 4DDFA 3T3FA 2ZVSA 2G0CA 1Y3JA 1E6VA 1D9DA 2CPEA 3ITHA 3QYYA 1V9OA 5C2CA 5AXMA 2CQGA 2HHQA 1C2PA 5A8WA 3W9IA 1WDTA 4F26A 2DITA 2B3TB 1ZM2A 1RYSA 2XS7A 1SJ4P 3KK3B 2R7XA 4JI2F 5KFSA 2V5HG 5KFKA 2FDNA 3FEZA 3I31A 4OHZA 4U95A 1RTHA 1HBOA 1JXLA 1NU4A 4O4RA 1NRKA 3UVJA 3OL9A 4F0HA 2CPZA 1R6VA 4U8YA 2BUNA 1U7LA 2X1AA 2VG7A 1M90T 1YSJA 4P71A 4QOTA 1FKOA 4KGKA 3NGSA 2HFNA 1PG5B 2RDDA 1OY6A 2JJ4D 4XTTA 4F3MA 2D7SA 4MJKA 4DV7J 3AA8A 5KT6A 4NA3A 1U1RA 3IBCB 2R3VA 4CT8A 1RWPB 3VAMA 2MSSA 4BDPA 2V4RA 2CG8A 3J7YI 3OR1B 2CUYA 2M3DA 4PPZA 1FTRA 5E41A 4ZA1A 1F2HA 2IRXA 2PMZD 2DRBA 2OPSB 5KT2A 4JI5J 4M5LA 1VOMA 1A7GE 2NPIA 2QLBB 1Q78A 1FK9B 3NG8A 3CJTA 1N4LA 1F3VA 3O6QA 4ITSA 3JYTB 3O5TB 3QLHA 4I2PB 3BZQA 2AU0A 1RWWB 3PR5B 5D4PA 4L75A 2E5IA 5C24B 3M4XA 5IXUA 3AD7C 1WKJA 1UEKA 3DLJA 2AJ4A 2QN6B 2M4MA 3CD6S 3BGUA 4MAKA 4M5MA 4DPTA 1YRTA 3TUZC 2LDYA 2E5GA 3P3DA 1L3KA 2W7OA 1VQ6S 1TV6B 2RVJA 2ZHBA 3K89A 3SIPB 3QT5A 3LOUA 1HQUA 4M63A 4B9VA 3H20A 2FY8A 4GO5X 1D1UA 1RAHB 3W9JA 1IKYA 1WI8A 3CJQA 4FS1A 1WG5A 4RW8B 1TL3B 3CCLS 2DB1A 5FDLB 1YX2A 2HS3A 5J2MB 4K4SA 3K58A 2KN4A 5KFCA 1K9MT 5L1JA 3PEJA 4ZIVA 5D0GA 1B0VA 4ED1A 5DQGA 3D5MA 2HNDA 4KKOB 2ZUGA 5HVHA 2IFXA 4DCPB 3GMGA 4PUOA 3LANA 4MYTA 3R7BB 5CHCB 2MKJA 4KGVB 3BO2A 1RAEB 3ENAA 1SIWB 1S4FA 4RZRA 3VAIA 5D6GA 1T3NA 3NY0A 3HO1A 1LWXA 2XI3A 3GJSB 1S9EB 4P10A 1X5OA 4HTIA 1IXKA 2HHHJ 2ILZA 4F02A 1NEEA 1QTMA 4G6VB 2PIIA 1VK8A 5CABA 4DLGA 1U1NA 3H90A 5F3ZA 3M30B 1PJ7A 2XHCA 4YB5A 1JJHA 1K73T 3ZTRA 3FRZA 4ES2A 1S1TA 4I56A 2HRYA 1Y5IB 1IKXB 2KL8A 3SQGB 5B08A 3V81B 1N5TA 3LP2B 2X7IA 2G2OA 2BM1A 1R0AA 2D9PA 2EPIA 4NZ6A 1JLBA 3PRBA 1GXTA 5A8KB 4ED5A 3MECB 5KOXA 2XYPB 2JVRA 3PO4A 3MEKA 4OJ1A 1LOUA 2L9NA 5F41A 3PIPQ 2DBBA 4JYAJ 1S0VA 3H5YA 4KH1B 5KFMA 5MAOA 1VLYA 3HKZD 2H3EB 4ZLNA 3GE9A 2XBPA 2ZKTA 2RU9A 2KH9A 2VG6A 2XLJA 2C42A 1ZTTA 4AXJA 3RG6A 4KJIA 3HX9A 1A6LA 3K7RA 4M5HA 3CUNA 3NBPB 2VZ9A 4JV5J 2DGWA 4NLDA 2ILYA 4USHA 4DPUA 4DF8A 2V6AA 3W2VA 3QWPA 4L6V3 4OX6A 3KDNA 4E98A 3KK2B 2FZCB 2BRLA 2YNGA 5L1IA 4I7FB 1JJ4A 2H65B 5HANA 2MDAA 4WFZA 5B09A 4KIAA 1I94J 4R8UA 2WVEA 3G82B 2DXFA 3R6LB 3L4BC 2HGNA 4QIEA 2XSJB 4TU9A 1MSWD 3K2YA 2GVDB 4EU0A 1SL0A 1HKAA 2AZ1A 3M1VA 4Q43A 4FS2A 1OSDA 1SC3B 3SV4A 1QUPA 2VDIA 2VHGA 1K44A 3JSMB 3D1QA 4Q2MA 4PRFA 2VC0A 4AL5A 4B3MF 2OSRA 2EK6A 1S9GA 2DO4A 4ECWA 2H9ZA 5KG3A 4PEOA 3ILIA 4IDKB 5M2PA 5KFWA 1HARA 5HROA 5ITHA 3I0RA 1FNMA 4NCGA 3K5LA 1PJ5A 2DGQA 5JMNA 1O8BA 4LR9A 3HD1A 2VBYA 1WG4A 2QRRA 2RDIA 3UN2A 2UUAJ 1GMWA 4JI1J 3DM2B 1A0OB 8ATCB 3HI9A 4QWDA 5J1NA 2XMTA 4WYWA 1UWBB 2J0WA 2EG2A 1D9AA 3TP2A 4ED2A 3SCKE 5DG9A 2EC2A 4NRUA 4OHYA 2OPQA 4WJBA 2N3OA 5KG5A 2OEMA 2J9EA 5M2RA 2N82B 2MZ1A 5L1LA 4DL7A 4DR1F 1OPIA 4X66F 2M88A 1WD6A 2NREA 3ZZTA 5A0YB 2QL7B 3K8VA 1Q5YA 4WP9A 4F0MA 3OL7A 1XC9A 2YKMB 3OR1A 4ZPVR 1RKJA 2BKNA 2WHOA 2ATCB 4PWDB 2ERRA 2XYGB 5D0RA 3UWTA 2OTJS 2IDEA 3D28A 3WC0A 2FJWA 1S9FA 3VAJA 2HAIA 2ZBPA 4KHRA 2UUBJ 3H0PA 4BWJA 2VKRA 4I2PA 2OPRA 1RJJA 1DQ8A 3BN4A 4ZPDA 3GCWP 3EWGA 4ZIWA 4F3OA 5C24A 4H4OB 1Q82T 3MEGB 3W2WA 2MLZA 3NOGA 1ZBTA 4IG0B 2CQ1A 3WDOA 3A8EA 1QLNA 1K47A 1R6YA 3DDIA 4JI0F 2OTLS 1U0HA 2O5DA 3H2LA 4UY8T 4LF2A 3CD7A 2ZJQQ 1FKPB 4M95A 4WIIA 1F9HA 3FQKA 3MCNA 5T14A 4IFVB 1RTZA 1ZAXA 3MAAB 3KK1B 5K5MA 4B9MA 3UDVA 1BQMA 1NZAA 2CG4A 3PNIA 1TL3A 5CCMA 5FDLA 3ZTSA 3I9ZA 4ENOA 2VKZG 5IV4A 1RCXB 4DJBA 4NEYA 2X3GA 4RBUA 4UUXA 1H7WA 1VC6A 3IR6B 1EHWA 4OZ1A 4ANEA 1MN7A 2IC3B 5LSOA 2YNIB 5LXYA 2JH3A 3QQCD 2MGZB 3GONA 2UVUA 4L3KA 2IYIA 3S8SA 5A8RB 2RU3A 4F4AA 3QIDA 3HVTB 2W7AA 2W2QP 5E2QA 4FF2A 1FERA 1P9QC 4DMZA 4ZJQA 5HMXA 2GS8A 2HQIA 1XJWB 2G0JA 3IMQJ 2C2KB 5IM0B 4YMEA 4PYAA 4YOEA 4DCJB 3SQGA 2OELA 1EJ7L 4MTPA 1MROB 3V81A 1IR2A 3HHEA 3A3OB 4CTAB 1YHQS 9RUBA 3BKTA 1JB0C 3I0SA 1JIHA 2DIVA 2DGXA 2VQFJ 3BH6B 3TA0A 3DGVA 2WB4A 2GA7A 2ZJPQ 3Q8UA 2ZZMA 2K1RB 5HL7Q 3R5BA 4K2XA 2M9KA 1X5TA 4NZ7A 2LEPA 1UPPA 3ET6B 3I87A 2HSEB 3NBPA 3AA9A 3L95X 4X4PA 1AZSB 3DGPB 2IJFA 3UDLA 4IUFA 1XBWA 2LU1A 4HACB 2L08A 4PWWA 2QLXA 2MJUA 1EX8A 5GAEI 3A8IA 3CE8A 1XR7A 1YQHA 3G82A 1XN9A 1IJFB 3CCWA 2IMWP 1WEYA 2VF3A 4ZN1A 4LT6A 3DOKB 2B9YA 3NS6A 1XMOF 4DX5A 4Q0BB 3UW1A 1RWNB 3SSQA 3GSDA 4DQRA 2GX8A 1ZA1B 4YN3B 4EYHB 2IM1A 3J7ZT 3GJRB 2ZOGA 2E7VA 3P49B 1HI8A 4J5OA 2OGUA 1CJTB 3BGRB 3LWLA 3G6YA 5L39A 3KMQA 1S1XA 4PPDA 4O3RA 3DRSB 4LFAF 2WB1D 3NRBA 4DV1J 4TLRA 1GXLA 2HWIA 4DPYA 3RAMA 3CW2C 1J5OB 2GQCA 3DM2A 5ETRA 2HLTA 4RL1A 4J37A 2HLUA 3CULA 4OL8A 1FDDA 1TKTB 3PX4A 5DZ7A 9ATCB 4ED7A 3V2UC 2FLNA 1UVNA 4B3TJ 2W2MP 3NWGA 5KT7A 5KFUA 4NXMJ 4OYAA 3DOLB 2MKYA 2CJAA 4KO0B 3SBMA 1HR0F 5BYRA 4GMKA 1PO6A 2I0XA 2WVFA 3MEEB 1DTQA 2XMAA 3H4DA 4WTYA 3MMCA 3KMSA 5CZVA 4HL9A 2WSEC 2DO0A 4DV6J 1Z2ZA 2RQKA 4ES3A 3BGFA 2K7JA 3J81j 2FB0A 3FDSA 4J7CA 4ETZA 1NK6A 4RUAA 5D3GB 1GTHA 2QV6A 3OFGA 4DR2J 4PWDA 4ZITA 4QW8A 5E33A 4XDCA 1S99A 3CJSA 1NSPA 3D7SB 3D0IE 3MF5A 3EVWA 4P9SA 2ZWOA 3LF0A 4NOHA 1RYRA 5AJ3F 3HFKA 2CJBA 3BPSP 3MEGA 2EXUA 2CQIA 4HVZA 1FE4A 4IG0A 4RW9B 1EQMA 2GMJA 4R0EA 3OTOJ 4DUTA 1BUXA 3MR3A 2J6SA 4OZ2A 2K06A 4MKBA 3I4PA 1NK9A 6FDRA 4FYWB 4B3SF 4ZMMA 5KFAA 5FLXU 3DKDA 4DR7F 4I4BA 3V6HA 3H25A 2B7CB 1ZA2B 1S6QB 2R8IA 4QYZJ 2L9DA 3KK1A 3T9NA 4UQTA 4DS5A 3EMTA 4C97A 3FBEA 1S77D 3H8YA 1YDLA 1Y4ZB 1FO1A 1U25A 2VFVA 2FVSA 3FFIA 5J2QB 4OV1A 4Y2CA 3PDNA 3HSJA 4JI7J 1F5CA 4HHHA 2B4UA 3VQTA 3H40A 5HP1A 2CJYB 2R8HA 4OI4A 2J7WA 2LQBA 5BR8J 3RB3A 4DI6A 2PD1A 3R8YA 4AUKA 5J1EA 2MHNA 5JVGQ 5ETOA 2IC3A 1R3NA 1YI2S 2BJDA 2JOQA 3R5AA 3M6VA 1QAXA 1MWQA 3AT1B 2YNIA 2EK1A 3FMBA 2J6TA 2AYEA 2MGZA 2LDIA 2LECA 5KT4A 2KFYA 4B3RJ 3RBZA 3RUBL 2V34A 3J81U 5GADI 1WEXA 3ADAC 4NLQA 1X4HA 3SCLE 3AD8C 4Y2KA 3HM9A 2QX0A 4F36A 3N6NA 1X4BA 3QRRA 4WFAQ 4C3KA 4CO0A 2I5JB 3A1YG 3EXYA 3LWMA 3ELHA 4K4VA 4ZP8A 2XY6A 1N6QB 3T1HJ 1RKIA 3POTB 4EUVA 8AT1B 1HNXJ 4YR0A 2FQQB 1HYSA 2ZH4A 3EUNA 1VQPS 2ZBCA 1RWOB 1RT1A 3GCXP 3NLCA 4J9UE 1M5PC 1VJWA 1LFWA 2K1RA 2GIQA 5E3RA 2CZ9A 5THWA 3DNCA 3BGLA 1IN0A 3PVXA 1S76D 2DPIA 4CO4A 1XNQF 3GG0A 5A76A 2HG4A 1DY3A 2L48A 3MM5A 5F8NA 4TY9A 4KYZA 4HACA 2QSFA 3VALA 4C0HA 1LFPA 3UCUP 1CQMA 3Q89A 1LWCB 2HNYB 3G86A 2B5JB 3GFXA 4WPAA 3OHAA 4Y3CA 2IM0A 1S5ZA 3PEHA 2UXDF 4LF9F 3DOKA 2QJ3A 2VFUA 2DH8A 1NPKA 2ZITA 1ELOA 4Q0BA 1X31C 3THTA 2XC9A 1Q0NA 3RB4A 5EDWA 5CCLA 4GVBB 4G1PA 1NK7A 1SPBP 2CKWA 3PW0A 2WOMA 1S49A 1H7XA 1BQNB 1IKWA 1V6HA 2XB2D 1VIXA 2BRKA 2ZM6F 4XK8C 1WHWA 2WSFC 1U45A 5HVFA 1M5KC 3BKFA 2YXLA 3MUVP 3MR2A 2W9AA 2UUCJ 1KBRA 2XCPA 2FTRA 1RHUB 1EQ0A 1WHXA 5IWAF 5DQIA 2R7RA 2KXHA 2CIMA 1D8YA 4PG4A 5C25A 1J5OA 1VRTA 3GLJA 5F8HA 2OUGA 1WSVA 3Q22A 5KFBA 3I82A 2VU5A 3IC1A 4G3IA 2V8VA 2DNPA 5B7WA 5HVGA 4NZ0A 2D1CA 1W2BR 2KVQE 4CT9A 1F6TA 1LW0B 1MG7A 4FPIA 4X4QA 3K5PA 1JLQB 5LSLA 2ZHAA 3VCDA 1Z2LA 4N47A 2Z2LA 1KS2A 3K17A 4ZPAA 3GTYX 3C3LA 4PG5A 1N88A 2HZCA 4B02A 1FRXA 2E1RA 3HFZB 2B7BB 5K8NA 1ACMB 4B9SA 3IG1A 2KRRA 4LF7F 3RW7A 2E5LF 2COLA 5IQQA 1VI7A 3J7A1 5IV3A 3G8TA 2V4JB 2CQ0A 2PC6A 2QA4G 3T6JA 2PI4A 1RSCA 5D3GA 1Y3KA 2MJNA 4RNHA 4DFMA 4GKKF 2DHSA 1LW2A 4WZMA 1CEZA 2V2ZA 3SDEA 4JV0A 1IWGA 2GNKA 4LF6F 2CQ4A 3I55S 2DJWA 4OZ0A 1C1CA 3UPFA 3KUHA 1BHNA 4Y28C 4ZPCA 4X4TA 1C0UB 2Y0BB 2NSBA 2PFDA 3V6KA 4OIXA 2NSCA 3N5BA 1VGYA 3MR7A 4F25A 1HNWF 2WBMA 2X1GA 2RRNA 1SJFA 3T1AA 4CLKA 1OWXA 3ZZPA 1AT1B 3KLFB 4WK1A 2LMIA 3AJDA 1FTCA 3HPOA 1JLAA 2MQNA 1U2FA 2IJNA 2BJ8A 5HQ8A 1X4AA 2MQOA 5GMDA 4CO2A 3SSSA 2D3UA 3KLEA 3N6LA 4FBTA 2W7PA 2HQDA 4K50A 1C4CA 4FNIA 3FBFA 4KGMA 4NLPA 4K4XA 2RQCA 3BN7A 2AGQA 3S1TA 2FZKB 5GAHU 2XMUA 3MMBA 4DZ6A 1Y5LB 2WW8A 3CC2S 2AWZA 1M5OC 1WTFA 3I9V9 4CNYA 3IRWP 3HLUA 2Z2MA 1MW7A 4OFZA 4ANDA 3UFCX 2B4OA 3D68A 4FF1A 3OL6A 2XS5A 3KHGA 3BYPA 4WCEQ 3MMJA 4BC9A 1DJ0A 5J1PA 3R7NB 3MR6A 2ROGA 3NMRA 5D77A 2DNLA 3K5OA 5ADZA 3PYEA 4TY8A 3NAHA 2CAJA 3DMJA 1TL4A 3T1YJ 2VBXA 2BR0A 3FSIA 1KVJA 1HNZJ 2APOA 2PN6A 4LF8J 4JI6F 3NXZA 1GAOA 3VV2B 5GMKa 2C28A 3QBCA 4RU2A 5F9LA 4N5SA 2HKEA 2UUWA 1RHRB 4USTA 1WI6A 5I3UB 2VOPA 3J80U 1NPPA 4IOAQ 4CH1A 2XMJA 1FVSA 3M2UB 5DGBA 2IY5B 2B51A 1RT5B 4NI2B 3MOZA 2BV3A 1FFGB 2QMWA 1KFSA 1FJGJ 4ECXA 4DR5J 4Q7AA 4O0NA 2W1BA 5AE3A 1VQLS 2AJ2A 2X51A 4C11B 2BDPA 2QT7A 2YX7A 1F1BB 2I5JA 1T9TA 3W5XA 1CJUB 1FRHA 2AJFE 4K4ZA 3POTA 1XMQF 3DHXA 3X1LB 1YJRA 1NM2A 4URSA 3FRYA 2YPYA 1VIOA 5KAKA 2I38A 5G0RA 2L41A 4C98A 2QE5A 3NNCA 1KLMA 3MXHP 1R8HA 3EPIA 4WIQA 3MEDA 3C14A 3L9ZA 3DU5A 1LQ9A 1W2IA 1H74A 3QT7A 2R7SA 4LRDA 4C8OA 3Q2SC 4ZVPB 4DPWA 2MZRA 3LP1B 4DU7A 2YX4A 4O3OA 2DY1A 3EGWB 3MZIA 3IWLA 1TAUA 3H59A 4AQYF 1NJXA 3RRHA 4DV0F 4ZPWR 2AW0A 4F8RA 4EO8A 3CIMA 3A8JA 4AFFA 4KHPF 3VTIA 2DEIA 4I6WA 2WSCC 2X1FA 2B5JA 2RT3A 4DCOB 5IZHA 1WEZA 4WBFA 1NUEA 4YB7A 4K4YA 2Q79A 3A12A 4IOCQ 3T19A 5EGYA 4LF4F 4JI2J 3RBDA 2JVOA 3TZWA 1WKKA 2DNRA 1NDKA 3ZZRA 4CZCA 2A10A 1DHMA 2C3OA 2P9EA 3TVKA 1DLOB 3MD3A 2MXYA 1X4EA 1IJEB 4OZNA 5L46A 1U6BA 1FDAA 2FLLA 3TA1A 5EWFA 5A6PA 4DV2J 1PSDA 4ZVRB 2V8HA 3FBBA 1SJ3P 3MD1A 3IGNA 3A13A 4CIOA 2ADBA 3KLIA 2MQMA 2ZOMA 2WVCA 3EGZA 1UJ5A 4A8QA 4G1QA 2Z57B 2D3OR 1U8SA 2F5GA 1HIYA 2HK2A 1VBKA 4KSEB 1VISA 4ED3A 3ENVA 4Q44A 3PZPA 1QM9A 2GVZA 2AYBA 1SH2A 1LW0A 1B70B 3J7YU 3Q83A 5E5NA 4DZDA 3D2WA 2GO9A 4IO1A 4RW4B 1UZDA 4QR0A 1QSLA 4OLPA 2V68A 2KT5A 2DIUA 1QE1B 3DLGB 4QWEA 2FHMA 3HZEA 4J9SA 2UXBF 3CVKA 3PRDA 2XZTB 2GGPB 4CQ1A 3FZBA 4LIWA 1K0TA 4ZVFA 4M5GA 3M2RB 2HNZA 2W2NP 3P8BB 2AX1A 2P8IA 2WZ1A 3H4BA 3TRGA 3IA0A 2KB2A 2ROEA 2HIQA 3CXCR 2IA0A 3KG4A 4W98A 3MHYA 1WORA 3KWMA 3WQPA 4Z2XA 3KLGA 1RDRA 1T03B 3B54A 3JQJA 2Y8WA 2VPYB 1VS3A 1VRUB 2ZHOA 3B78A 2EFPA 5EN1A 3PJ9A 5ETQA 1XNRF 4OI6A 2KZMA 4CLLA 2B43A 4DPOA 3MMAA 4HDHA 5KFDA 1ZZNA 5AT1B 1LWEB 3OSNA 1T9WA 5C5JA 2QYCA 3D3CJ 4ZCIA 2JFDA 5CYQA 5LSRA 3R9LA 1NDLA 4YR2A 1SJRA 1ZZFA 1JQGA 1RA6A 5CYMB 3GYNA 5DGAA 2D3O1 2OD4A 1TK0A 4RBVA 3LALA 2Y3YA 1IUJA 4PXBA 4URGA 4X62J 2HFVA 2YWGA 2DNNA 4UZCA 3IRXB 1F60B 3I56S 2ASDA 2HBZB 2FIUA 5ETMA 5I3PA 2F8EX 3GIJA 1S1WA 3BR8A 4HEA9 2B4PA 2UU9J 3G87A 3IO1A 2YTCA 2HHXA 1CS4A 3KG1A 1VQYA 2XS2A 1FE0A 1LXJA 3MCOA 4C8KA 4ED6A 4ZVQB 1HPZA 2DNZA 3E01B 3KJFB 1FX4A 4NI2A 3GYGA 1N36J 1EP4B 3OT9A 4WWSA 3F0NA 2CDQA 2HS0A 1TU0B 1WHYA 2CWXA 3IWXA 2ZH6A 4DL0C 3HD2A 1N5QA 3UO0A 2YNHB 4GKJF 4OHVA 3C46A 4K8RA 2OP5A 1XQIA 4OJHA 3BBBA 2ZH7A 4DG1B 2XY5A 4YR3A 3ZZYA 2BJ7A 2RB7A 1T95A 4NWBA 4LFCF 2POKA 2QL9B 1KR4A 4ID5B 2RS2A 1FDBA 4DSEA 4IG3A 5L1KA 4HI1A 3VVTA 5DLFA 2H4YB 2CXEA 3PXGa 3R7SB 2ALZA 4GC7A 3R27A 3LP1A 3FEYB 1BGXT 2IA6A 2XTJP 3EDQB 2FVCA 3RW6A 4ETXA 4B3MJ 3DHWC 4X2BA 4DV5F 3CTRA 2IVFB 2FJAB 4L72B 4NXNJ 2JEIA 4OYIA 2HGMA 4LSZB 2C1EB 1X9MA 1MLAA 1DFDA 1FF2A 2R7OA 2F4VF 1JLGB 2Q1LA 4DQQA 4DSLA 4M5IA 2YKNB 1WOOA 2C3PA 1OO0B 2W9BA 1UVJA 4JI4J 2XNRA 2R7QA 2J0SD 2XHWA 2V8PA 2UVRA 3C6UB 2P6SA 2K8GA 3NKYA 2FHJD 3O8WA 3UDEA 1NK5A 4ZJOA 4FVMA 3V6DA 2BJ1A 1K8AT 2ACYA 2AHOB 1YBTA 3GV5B 6AT1B 4KV8A 1FRLA 2WW4A 2G13A 4HH1A 2LQJA 4J9LA 1Y11A 4UOGA 3EICA 1WF0A 2BOAA 3HHLD 4A8KA 3M2VA 5LMNF 1L5UA 2AX0A 1RTJA 3C6TB 3NNHA 4C6AA 3P6YC 1J2VA 3JS9A 1I6JA 3GIKA 1FESA 3EVOA 4M5NA 1SH3A 1HLWA 1SQFA 4QU6A 4LRCA 2J6UA 4B9TA 1JMTA 3CGIA 3T5HA 1X5SA 4OZ5A 5B0EA 4KPCA 1HA1A 2H48B 4KFBB 5KFJA 1QE1A 4P2FA 3B4DA 2IM3A 1GNKA 2XMWA 4QU7A 2AEJA 2RUSA 3QO9A 2Q6BA 5F9NA 4JI0J 1QUVA 4H4KC 3VZHA 3X3UA 1HBUA 3M2RA 4WXWA 4DOZA 1ZPWX
chains in the Genus database with same CATH topology
2BEFA 1NPKA 4ENOA 3ENAA 2DYAA 2HVEA 4FKXA 3VGVA 3VGTA 1NB2A 4F36A 3FBCA 1HIYA 1VYAA 1S59A 3BBFA 5BXIA 3EMTA 1XIQA 3BH6B 3EM1A 3VGSA 4UOGA 3B54A 1W7WA 1B99A 3FBEA 1HHQA 3ELHA 3EICA 1LWXA 3FBFA 1WKJA 1NCLA 2ZUAA 4O0NA 3Q8UA 4WBFA 3Q83A 1NDPA 1NUEA 4DZ6A 1NSQA 1ZS6A 1NHKL 2BX6A 3PJ9A 3FCWA 1EHWA 4ANEA 3MPDA 1MN7A 1F3FA 4C6AA 3JS9A 1NSPA 3ZTQA 3Q8VA 1KDNA 1NDCA 3EVWA 3NGSA 5CABA 1WKKA 3EVOA 1B4SA 3Q86A 1LEOA 3B6BA 4CP5A 1HLWA 4DI6A 1NDKA 3WX8A 2DXDA 4ANDA 1UCNA 4S0MA 4UOHA 3ZTPA 2DXFA 3FC9A 4FKYA 1BE4A 1NLKL 3EVMA 3Q8YA 4EK2A 4ANCA 3GP9A 3DDIA 2DY9A 1PAEX 2AZ3A 3BBCA 5IOLA 3ZTRA 4F4AA 3R9LA 1NDLA 3PRVA 1WKLA 1XQIA 4KPCA 3BBBA 1BHNA 2AZ1A 3VGUA 2B8QA 3L7UA 2HURA 1NSKL 3FCVA 3ZTOA 3ETMA 1K44A 3VVUA 2DXEA 1S57A 3GPAA 5CAAA 2NCKL 2HVDA 2VU5A 3NGTA 2CWKA 3FBBA 4DUTA 4UOFA 3EJMA 1BUXA 3Q89A 1MN9A 3EE3A 3BH7B 1PKUA 3NGUA 3VVTA 3G2XA 1JXVA 1U8WA 5C7PA 1S5ZA 1F6TA 3FKBA 3NGRA 4W98A 2B8PA 4HR2A 3DKDA 3ZTSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BEF A;  1NPK A;  4ENO A;  3ENA A;  2DYA A;  2HVE A;  4FKX A;  3VGV A;  3VGT A;  1NB2 A;  4F36 A;  3FBC A;  1HIY A;  1VYA A;  1S59 A;  3BBF A;  5BXI A;  3EMT A;  1XIQ A;  3BH6 B;  3EM1 A;  3VGS A;  4UOG A;  3B54 A;  1W7W A;  1B99 A;  3FBE A;  1HHQ A;  3ELH A;  3EIC A;  1LWX A;  3FBF A;  1WKJ A;  1NCL A;  2ZUA A;  4O0N A;  3Q8U A;  4WBF A;  3Q83 A;  1NDP A;  1NUE A;  4DZ6 A;  1NSQ A;  1ZS6 A;  1NHK L;  2BX6 A;  3PJ9 A;  3FCW A;  1EHW A;  4ANE A;  3MPD A;  1MN7 A;  1F3F A;  4C6A A;  3JS9 A;  1NSP A;  3ZTQ A;  3Q8V A;  1KDN A;  1NDC A;  3EVW A;  3NGS A;  5CAB A;  1WKK A;  3EVO A;  1B4S A;  3Q86 A;  1LEO A;  3B6B A;  4CP5 A;  1HLW A;  4DI6 A;  1NDK A;  3WX8 A;  2DXD A;  4AND A;  1UCN A;  4S0M A;  4UOH A;  3ZTP A;  2DXF A;  3FC9 A;  4FKY A;  1BE4 A;  1NLK L;  3EVM A;  3Q8Y A;  4EK2 A;  4ANC A;  3GP9 A;  3DDI A;  2DY9 A;  1PAE X;  2AZ3 A;  3BBC A;  5IOL A;  3ZTR A;  4F4A A;  3R9L A;  1NDL A;  3PRV A;  1WKL A;  1XQI A;  4KPC A;  3BBB A;  1BHN A;  2AZ1 A;  3VGU A;  2B8Q A;  3L7U A;  2HUR A;  1NSK L;  3FCV A;  3ZTO A;  3ETM A;  1K44 A;  3VVU A;  2DXE A;  1S57 A;  3GPA A;  5CAA A;  2NCK L;  2HVD A;  2VU5 A;  3NGT A;  2CWK A;  3FBB A;  4DUT A;  4UOF A;  3EJM A;  1BUX A;  3Q89 A;  1MN9 A;  3EE3 A;  3BH7 B;  1PKU A;  3NGU A;  3VVT A;  3G2X A;  1JXV A;  1U8W A;  5C7P A;  1S5Z A;  1F6T A;  3FKB A;  3NGR A;  4W98 A;  2B8P A;  4HR2 A;  3DKD A;  3ZTS A; 
#chains in the Genus database with same CATH topology
 4YQW A;  1G3O A;  2A2C A;  3JTO A;  3OXL A;  4F67 A;  4C8M A;  5KFL A;  2FGC A;  1FXR A;  2D9O A;  3F56 A;  4CM2 A;  4R0J A;  5HQM A;  3HHL A;  2ZBQ A;  2C2D A;  1D09 B;  4X4S A;  4P6Q A;  4FYV B;  4UW2 A;  2KFN A;  1C1B B;  2QEX S;  3FZ2 A;  3VGU A;  2FJE B;  2OFG X;  1URR A;  4LRF A;  3CJ3 A;  5J2P A;  2DR6 A;  2AP6 A;  2H1Y A;  1APS A;  2VQE F;  4DUY J;  1VQ4 S;  3IR7 B;  4I6Y A;  3KLH B;  3W66 A;  3I96 A;  2ZFH A;  1T7P A;  1N48 A;  3NP5 A;  3NS5 A;  3U02 A;  4LSL A;  2JLG A;  3MAH A;  3SZ2 A;  4NYP A;  2BEF A;  2CPF A;  2VC1 A;  1WTB A;  3B4M A;  4XIU A;  5DDP C;  3H5X A;  4XO0 A;  2AYM A;  1GFW B;  4WKR A;  4C8Z A;  1UJ4 A;  3PX0 A;  1NDP A;  2OSQ A;  3M32 B;  3DI6 A;  4P52 A;  5KG1 A;  2P9C A;  3KUE A;  4RW6 B;  4TN2 A;  3ULH A;  2LQ8 A;  2MKK A;  2CPI A;  4FKY A;  1U48 A;  1J5E J;  1YJT A;  2O01 C;  4CNZ A;  4I2Q B;  3GQC A;  4RR5 A;  3CB4 A;  1RT6 A;  4NEZ A;  2BE2 A;  2MZT A;  3DLK B;  1Q7Y T;  1X0P A;  2YNH A;  5K20 B;  4KPY A;  4YDD B;  1I1G A;  5DZ6 A;  3HP6 A;  1NK8 A;  1TKD A;  2B0G A;  4DG1 A;  3Q0A A;  5DG7 A;  1NXI A;  3VGT A;  4ID5 A;  2W01 A;  4JV5 F;  2E1P A;  2QL5 B;  2U1A A;  1XMO J;  1X7V A;  3PJW A;  2KKH A;  1UJ6 A;  2V50 A;  5GAE U;  4ZVE A;  2A0F B;  2WCX A;  3GR1 A;  2IBK A;  3KXD A;  5D0H A;  3IAS 9;  4HYK A;  4C8Y A;  4DS4 A;  3M8P A;  1LXN A;  1I94 F;  3MM9 A;  1L3U A;  2AT1 B;  1WOP A;  4J9N A;  1OPZ A;  1CQN A;  2R7T A;  4RBT A;  3U7J A;  1KP6 A;  2WAQ D;  3CC7 S;  1U0S A;  1KOH A;  2OO4 A;  3CCS S;  3ISN D;  3JXO A;  4YY3 J;  3AOC A;  3QGG A;  1S6P A;  3TZX A;  1FJE B;  2I1R A;  3I6P A;  2DNG A;  2VOO A;  4LBI A;  2R8J A;  1U1O A;  2KXN B;  1H3D A;  2KT3 A;  2KYZ A;  1FKA F;  1D9F A;  5L9X A;  4ERD A;  4XPC A;  1FNO A;  2CDR B;  3PV8 A;  5KFI A;  1SIZ A;  1QY7 A;  1EAY C;  4P2X A;  2DEJ A;  2B4V A;  2HZA A;  3GIR A;  2GIF A;  2K2P A;  4NA2 A;  4JI1 F;  4JI3 F;  1HR0 J;  1PC5 A;  3ZZZ A;  2FJB B;  4NLS A;  2VG5 A;  1S72 S;  2LP4 A;  3CIZ A;  1PJ6 A;  4DN9 A;  1YJ7 A;  3NEK A;  3DLB A;  1N5Y A;  3VAF A;  5A2Q Y;  4K59 A;  1TK8 A;  4RUH A;  3LP0 B;  3OUY A;  1LKZ A;  1VHF A;  1SL1 A;  1SKU B;  5JJB A;  2H4W B;  2GJF A;  2IAJ A;  5LT5 A;  5HO4 A;  2P6T A;  3C6T A;  1N33 J;  1IM6 A;  1Q4R A;  1RT2 B;  2RSQ A;  3U1L A;  1VQ5 S;  2R9L A;  2DT9 A;  4J9K A;  4LBP A;  4CO3 A;  3BSN A;  2DXE A;  5B0C A;  1OY9 A;  1U26 A;  3IN5 A;  3R3T A;  4M8L A;  4QWC A;  5AJ3 J;  4NL5 A;  1EB0 A;  3IM9 A;  2DHG A;  4UOF A;  2B56 A;  4DR3 F;  3A3N B;  4XDD A;  4YHH J;  3MOJ B;  4P72 A;  1SXL A;  2XZD B;  1T0T V;  5AXL A;  3PFE A;  1HNI B;  3BEG B;  2DYA A;  2EFN A;  2DNK A;  1X9S A;  2K3K A;  1AUD A;  1WAC A;  1UA1 A;  2RKI B;  4Y0F A;  2GW8 A;  3C15 B;  3EPG A;  1HW9 A;  2AEM A;  4OYO A;  3D6F B;  4DLE A;  2Z2Y B;  1B64 A;  2ZNY A;  3ZTQ A;  3NCQ A;  3HZG A;  1MWZ A;  1CBK A;  2VIC A;  1RAG B;  2HIY A;  4JI8 J;  5RUB A;  1PIL A;  1QSS A;  3AJ2 A;  3ZTP A;  2FVR A;  4G65 A;  2XZW A;  5SZT A;  5FD1 A;  4LJM A;  2FZG B;  4ANC A;  5KFZ A;  1PAU B;  2E5H A;  1REV A;  3AXK A;  4E8U A;  2KJW A;  2EFG A;  3W9H A;  3J7A N;  1S1U B;  4PAB A;  4O4G B;  1N34 F;  4WFB Q;  4DBQ A;  4WFY A;  2BOP A;  4H4K A;  1F9E B;  1KHW A;  3R5C A;  4LRA A;  4OYX A;  3HDS A;  1SUQ B;  4DFK A;  3LA0 A;  2HHT A;  1IBK F;  3LPE A;  3C16 B;  4DQP A;  4LQ9 A;  2H51 B;  3NCP A;  2HMI A;  4FKX A;  2CQC A;  3J80 Y;  1X5P A;  3J7Z 5;  4YP3 A;  4J9P A;  1BWE A;  1UL3 A;  1S7I A;  1Q8I A;  5ETN A;  2G1D A;  4DV3 J;  1YGY A;  4F0K A;  2DNO A;  5KFR A;  3BDP A;  3V4I B;  1TFY A;  2JEG A;  2A6M A;  3OR2 B;  5GAD U;  3ZNJ 1;  4EZ9 A;  3PHE A;  4PXD A;  1P27 B;  2GAH C;  1T9X A;  2YNF A;  2H54 B;  4RW6 A;  4WFX A;  4F4W A;  1E6Y B;  2ZH8 A;  2Y1L B;  3QGP A;  5F8G A;  3CJ2 A;  4RW7 B;  4IOB A;  2H5E A;  3LO3 A;  5HJX A;  2M8D B;  2NXC A;  5KFP A;  3EE3 A;  3CCT A;  4O0I A;  2W9C B;  5KG4 A;  1CJV B;  3PX6 A;  1FCA A;  1OIA A;  4NCB A;  5D0E A;  1XNQ J;  4WXO A;  3EX7 B;  1QVG R;  1TVR A;  2EBG A;  2BBE A;  3DLE B;  1F9F A;  2W4P A;  2ZH5 A;  4L74 A;  2DR9 A;  2BXJ A;  3TEH B;  3MR5 A;  2F9J A;  1N0U A;  1NCL A;  4FPR A;  1U09 A;  4FZV A;  4ZHR B;  5HLF B;  4QIW D;  2PA8 D;  1NSQ A;  1R43 A;  2R2T A;  1EET A;  1RT7 B;  4KR0 B;  1Q81 T;  1VBZ A;  4W92 B;  2ZWP A;  4RO0 A;  2AJQ A;  2DK2 A;  1KON A;  1BE4 A;  4KH0 B;  1H2U X;  3OVS A;  5EX0 A;  2ZKU A;  3C66 A;  1TKX A;  3M8Q A;  3DYA B;  3NGD A;  5DET A;  4URQ U;  1JLE B;  1X9W A;  1TL1 B;  4I0W A;  2C2N A;  4WE1 A;  1CUL B;  5K14 B;  4LRB A;  1P9Y A;  1HL6 A;  1L3T A;  3OTC A;  1DTT B;  2M2B A;  2BQR A;  4TKT A;  4BWM A;  1FNX H;  5C42 A;  2C3M A;  5KFT A;  1S59 A;  2EFQ A;  5CZX A;  2XGP A;  1DRZ A;  4ATN A;  1ZAW A;  4GO7 X;  2E1A A;  1FRI A;  1RU1 A;  2B6A A;  1RZM A;  3ICL A;  4DV4 J;  4DV1 F;  3EZO A;  3OFF A;  4DL5 A;  2VD3 A;  1LK7 A;  1DQA A;  2OPP A;  4PYD A;  1FWL A;  3PCO B;  4IFY B;  3PYD A;  3BQ2 A;  2AGO A;  3RR7 A;  3PIO Q;  2IDL A;  1JLF A;  2HZV A;  3O3L A;  1CLF A;  4P2S A;  3DRX A;  4ZVU B;  4KTQ A;  4QZV B;  1CJK B;  1GQE A;  1RGV A;  1X0F A;  1HWU A;  1RBO B;  3H7H B;  1NAQ A;  1GMW D;  3VQS A;  1C0T A;  4M5D A;  5DG8 A;  3GYX B;  4GKK J;  4OJG A;  1X60 A;  3CDW A;  3HFV A;  2BAN A;  4LF6 J;  4KT0 C;  3TW0 A;  2VOD A;  3AQP A;  4R5P A;  1SQG A;  1B0P A;  4DV6 F;  2HQF A;  3MM6 B;  3DRP B;  1XIQ A;  3M6U A;  1HNW J;  1HHQ A;  2BJ9 A;  1DBD A;  4IRD A;  2AGP A;  3JSY A;  1I51 B;  2Z30 B;  2Q3P A;  1OJ4 A;  4HHU A;  3CT9 A;  2KXF A;  2AIR B;  3D1H A;  1T05 B;  1HNI A;  1RAO A;  2CPH A;  5KFN A;  5EWG A;  2DCU B;  1RUS A;  2KYX A;  1SV5 A;  1VR6 A;  5KFH A;  3ZZU A;  4OYP A;  1UMJ A;  1EKR A;  4B9U A;  3C15 A;  2QFJ A;  3H2U B;  1WC3 A;  2VB6 A;  3TO8 A;  4FXD A;  3OVA A;  1EKS A;  1N5V A;  4JB8 B;  3CNQ P;  3E3X A;  4FYY B;  3BJY A;  2QA2 A;  2V8D A;  3OTO F;  4EI2 A;  2F65 A;  4IH6 A;  2NCK L;  3CJK B;  1KSP A;  3VAK A;  1RWM B;  4USI A;  2RJZ A;  2F8M A;  4O3S A;  1IKV B;  2UVV A;  4WYL A;  3IAM 9;  1HI1 A;  3NAI A;  1QTN B;  2UXC J;  3KK3 A;  1B7F A;  4ZOS A;  4ALZ A;  1U6F A;  1OQ3 A;  1Z4U A;  1B99 A;  1P1T A;  2ALY B;  1OY8 A;  2HEK A;  3AQO A;  2A3J A;  5HBM B;  3W1Y C;  3UI3 A;  1TUW A;  1AFJ A;  1N32 J;  2OMO A;  4DSJ A;  4ECZ A;  4YB1 P;  1FD2 A;  2CQH A;  2EFO A;  4QWA A;  1RLD A;  4MIB A;  5CYJ A;  1TUV A;  4Z7Y A;  4DR6 F;  4V19 J;  1VRQ C;  3ZO7 A;  3FGV A;  2WVB A;  1PAE X;  2AZ3 A;  2BM0 A;  1MU2 B;  3KDO A;  1U1P A;  4ZVO B;  1NJI T;  2LXU A;  2C2M B;  1UA0 A;  3Q8R B;  4EBD A;  2JHE A;  4A8S A;  4TXS A;  3ETM A;  3KJV B;  1Q5V A;  2OPS A;  4B3R F;  4R25 A;  3NGT A;  1FK9 A;  2DVI A;  4U6P A;  4USU A;  3QIP B;  2XWX A;  2YKQ A;  3AFG A;  3DN9 A;  3JYT A;  3OXG A;  4U7U K;  4FXW A;  2DCL A;  5IC4 B;  4GC6 A;  3DRR B;  3G6E S;  3NGK A;  3T1H F;  5FJ4 A;  1HNX F;  5KT5 A;  5K8M A;  2W9C A;  2RS8 A;  2ZVI A;  3QGH A;  2YQ1 A;  2BYC A;  4DL4 A;  4K7Q A;  3D1O A;  4AQY J;  4LF5 F;  4DV0 J;  2JRS A;  2GML A;  1RTI B;  3WC2 A;  3RB6 A;  1KDN A;  5DM7 Q;  1HBM B;  2MQP A;  1HBN B;  3FQL A;  2G2Y A;  2CJK A;  1TV6 A;  3DDK A;  4I68 A;  3BM7 A;  3LW5 C;  3NS7 B;  2Y8Y A;  1M5H A;  3WZ0 A;  2J0Q D;  5KT3 A;  2RUG A;  2R2U A;  4N56 A;  4OZ3 A;  4E0D A;  3KUG A;  1EAR A;  3MPY A;  2XWY A;  2FPH X;  5IT0 A;  4Q5V A;  2W25 A;  2V94 A;  4LF4 J;  4RW8 A;  2RF2 B;  4ECS A;  4LSN B;  5J2M A;  2IVY A;  4DFJ A;  2JDJ A;  5D4O A;  3PAC A;  2VH7 A;  1E6V B;  2KI2 A;  3NOC A;  2OHD A;  3WIV A;  2CPY A;  4KKO A;  4P7V A;  5A8W B;  1M1H A;  3W62 A;  2YWK A;  4X4N A;  4ZCL A;  3SI8 A;  2RAQ A;  3LAK A;  2E9R X;  3BPD A;  1N52 B;  2EWH A;  5KFO A;  3PW4 A;  2HVI A;  1RTH B;  3GB0 A;  1HBO B;  2ROP A;  1S9E A;  4TYB A;  4BCA A;  3TEG A;  4J90 A;  3UVJ B;  1LNQ A;  2KDO A;  4MYU A;  2Y1R I;  2X1B A;  1HQE B;  1AXQ A;  4OX9 J;  2YPZ A;  3M30 A;  1WSR A;  4CP5 A;  1RAI B;  2W8L A;  3AB2 B;  3FSX A;  1SKW A;  1DAR A;  2DY9 A;  5IOL A;  4FXV A;  5T7L B;  1U1M A;  4NA1 A;  2PA3 A;  2DIS A;  1IKX A;  3RR8 A;  1EZZ B;  4MIA A;  4JP8 A;  1A9N B;  3S01 A;  4PQA A;  3LP2 A;  5DLG A;  4DL3 A;  4RNM A;  3NL0 A;  3FK4 A;  3E2E A;  1ZPV A;  3GPA A;  2VAS A;  3MCM A;  5A8K A;  4PG8 A;  3P96 A;  3MEC A;  3TAP A;  1CJK A;  1FI4 A;  3G2X A;  1U24 A;  1CC8 A;  3QLH B;  2QIF A;  2DRD A;  2GHW A;  2MQQ A;  1DZ5 A;  3F44 A;  3CPW R;  4WK3 A;  1TZ0 A;  1WC4 A;  5GME A;  3KK2 A;  4I7F A;  4ZLL A;  1B7Y B;  5CD4 H;  5EWE A;  5D78 A;  1Q1K A;  1C4A A;  3LGM A;  1FEE A;  4KHM A;  2MYF A;  2J9D A;  3OW2 R;  3CCQ S;  3IBW A;  1H38 A;  1IM4 A;  1WHV A;  2XSJ A;  1YJN S;  1WNE A;  3PW2 A;  4ZVS B;  2GVD A;  4DUZ F;  1RAD B;  1XNR J;  1H2V Z;  2UVW A;  4OYB A;  1IBL J;  4MKY A;  3PKY A;  1WG1 A;  3TAR A;  3JSM A;  1NSK L;  2A1B A;  3ENQ A;  4Y65 A;  4G1I A;  1T94 A;  3CCU S;  2CFX A;  2MLY A;  4CYU B;  1YRX A;  1SC1 B;  4ZVH A;  4IDK A;  2HND B;  3KTQ A;  3QFW A;  3EGV A;  4PUO B;  3CC4 S;  1KTV A;  4Y2I A;  2LEA A;  2FHK A;  2YWW A;  1SVD A;  3LGH A;  3SXL A;  2QGF B;  1SJ1 A;  3EM1 A;  5L8R C;  1BQX A;  5C2G A;  5U47 A;  2PGC A;  1TMJ A;  4NLU A;  2E1M C;  3TA2 A;  2VBW A;  4X65 J;  1UWB A;  5LOQ A;  1Z1Z A;  2D3Z A;  3TVZ A;  3QT6 A;  1FJ7 A;  1PYS B;  1S79 A;  4IR9 A;  5E3A A;  2W24 A;  3LAM A;  2DTJ A;  4DFP A;  1UFK A;  4Q8F A;  4OHX A;  3UD3 P;  3N01 A;  4C0O C;  3RAQ A;  1GX6 A;  3DDN A;  4ECY A;  4ILL A;  3PFO A;  1R0C B;  2MKH A;  5F3T A;  3T1Y F;  5DDR C;  1T9U A;  5F8L A;  5A0Y A;  2M8H A;  4PR6 A;  1R0A B;  1QJH A;  1JLB B;  4PZV A;  2R7W A;  2MZQ A;  3PYG A;  2VL1 A;  2YKM A;  5AE1 A;  1KHV A;  4GKJ J;  1LWF B;  2PI5 A;  1HD1 A;  4HT7 A;  4AT1 B;  5LJ3 Y;  4NLG A;  4ES1 A;  1WJ9 A;  4FNH A;  1AW0 A;  1H6K X;  2OD6 A;  4LFC J;  4OI2 A;  1RAC B;  1FJG F;  2VG6 B;  3PKM A;  1VK3 A;  4OMF G;  4Q45 A;  3I4H X;  2MQ8 A;  3ZC4 A;  3CCJ S;  2HHP A;  1UFL A;  1RXO B;  3PTW A;  2DR5 A;  4H4O A;  4FF3 A;  2YNG B;  3DOM B;  2HWH A;  3K5N A;  1SKS A;  2CPD A;  2XQC A;  2XLI A;  2DH7 A;  1R7I A;  3D6T B;  3TJ8 A;  5I3Q A;  2MST A;  1RTI A;  1JK9 B;  1KQK A;  1S97 A;  3AOA A;  3JAM Y;  1Q8L A;  1YBU A;  2F4V J;  3M1V B;  1FKP A;  1PBU A;  5J2N B;  5LJ5 Y;  1GEH A;  4IFV A;  3VAH A;  1S7H A;  5E3Q A;  1PC4 A;  1N0V C;  3MAA A;  2MPU A;  3UCG A;  4NYO A;  3ZZ0 A;  3OBI A;  1S9G B;  2F63 A;  2IYG A;  4CLZ A;  3TNV A;  5HSP A;  1XK8 A;  1X4D A;  3CMQ A;  2B8P A;  2UZA A;  2RRA A;  1AYE A;  3TUJ C;  5HRO B;  5L9N A;  3I0R B;  2C3U A;  5BJR A;  2NUH A;  3GIM A;  4QQB A;  4NCG B;  4OV6 A;  2LXI A;  2OEJ A;  3R1L A;  3BV8 A;  4C8N A;  3D54 A;  4ZPB A;  4AL7 A;  1YZ7 A;  1YJ9 S;  2GJI A;  3OJS A;  4GVL A;  2OI2 A;  4MT1 A;  4OYW A;  1RU2 A;  1ROF A;  2O67 A;  4FBU A;  1NSA A;  3D4J A;  2OPQ B;  5KFE A;  5AE2 A;  3LTO A;  3HJF A;  5A8R A;  3V6J A;  2Y1I A;  4HDG A;  5LMN J;  3HVT A;  3PRV A;  1UW4 A;  4PG6 A;  1HQE A;  3RB0 A;  3R97 A;  3EZ5 A;  3ZZO A;  2OML A;  1T3O A;  3AXM A;  5DM6 Q;  4OHW A;  4DV2 F;  4JUZ A;  2CQ3 A;  2MZJ A;  4M1K A;  4DSF A;  2G2Z A;  5T7L A;  5IM0 A;  3VZI A;  1MRO A;  4PCQ A;  2W4D A;  3CSK A;  3QSY B;  2PEB A;  4CTA A;  1OYD A;  3H2V E;  3RBE A;  5JUM A;  4Q8E A;  2XM3 A;  5BXI A;  3HT0 A;  3M6X A;  3GV7 B;  2R8K A;  3NCR A;  4X64 F;  3IP0 A;  2LYV A;  3GV8 B;  2F1F A;  2OPR B;  1F3F A;  5CH7 B;  2RE1 A;  3ET6 A;  3T5L A;  2JFK A;  3GR0 A;  4O3P A;  3OVB A;  3W2W B;  1AZS A;  1V5V A;  3I5A A;  1F5B A;  1M0S A;  3DGP A;  1UCN A;  4EBC A;  2JWN A;  2NZ4 A;  2HYI B;  4N77 A;  2CJQ A;  3BO3 A;  3O2I A;  4IH7 A;  1U0H B;  2FJD B;  3FVY A;  1T11 A;  3PYF A;  3T5K A;  4HLB A;  2GIR A;  1HNV B;  2CQ2 A;  2XCA A;  3ZFV A;  4QCL A;  2W2O P;  2HVD A;  4ZVG A;  4ECR A;  3OQ2 A;  2CWK A;  1TAQ A;  2LCW A;  1X4C A;  4MH8 A;  1NPR A;  1S0M A;  1FJC A;  1BQM B;  2CVE A;  3D6H B;  1CJT A;  3BGR A;  2FC9 A;  1GTE A;  4CYU A;  2V8G A;  4MK9 A;  4OLO A;  4ED4 A;  2VQE J;  2MQL A;  3RYL A;  3G8S A;  1Y0H A;  1G6B A;  4PKD B;  3DRS A;  3QZ7 A;  2CPX A;  4C48 A;  4W90 B;  2QYG A;  4D3H A;  1CSJ A;  1KNZ A;  2AMC B;  1UEU A;  4HTJ A;  3UE2 A;  4Z7C A;  3PG9 A;  4EZ6 A;  1TKT A;  1KLN A;  3RU0 A;  2IM2 A;  2QTW A;  5H9F J;  3UN3 A;  1U6Z A;  2ZH1 A;  1PBA A;  4B9L A;  3CCZ A;  2EBE A;  1TMM A;  2PE8 A;  1UVK A;  4IRC A;  5H9E K;  5I4M A;  4X62 F;  3DOL A;  2MZS A;  4KO0 A;  1UVM A;  4I64 A;  2QMU B;  1JKH B;  1UWA A;  2YQ3 A;  3MEE A;  1ZET A;  1YTY A;  1JXE A;  5A2Q U;  1NH8 A;  2QLJ B;  4UF4 A;  2C3Y A;  2UU9 F;  3W63 A;  5KFY A;  5KG2 A;  4ED0 A;  1BY9 A;  2R7V A;  2P5V A;  3I0S B;  4YB6 A;  1RHK B;  3TVY A;  2EEY A;  1DUR A;  1HI0 P;  4QIV A;  1TR0 A;  1LWF A;  3G6V A;  1UKU A;  3QNW B;  3G71 S;  3CD5 A;  3N0V A;  3MPD A;  3MCS A;  1N36 F;  3OXF A;  3GFH A;  1IVZ A;  2ZC3 A;  4M5J A;  2ASL A;  2ZZN A;  3CCE S;  2J7K A;  3AHP A;  3R2D J;  4AD6 A;  4JV2 A;  3DOM A;  3CME S;  1S12 A;  2GHV C;  1KFD A;  3W8G A;  2FYX A;  2ZNZ A;  5H1S V;  3JSR A;  3K57 A;  4RW9 A;  4HHJ A;  3VVU A;  2HVZ A;  1WF1 A;  5E3C A;  3TJ9 A;  4USK A;  1OYE A;  2OEK A;  3OLA A;  3RRG A;  1U8W A;  4I6A A;  4KGX B;  4TVA B;  2HQC A;  5J2N A;  2YWH A;  2KJV A;  2XUL A;  4DF4 A;  1S6Q A;  2XNQ A;  3MM7 B;  2ASJ A;  2ZOF A;  3AH6 A;  2HK3 A;  2Y1J A;  4NXN F;  5G4D A;  3BB5 A;  3NWR A;  1M5S A;  1S1X B;  5J2Q A;  5F0U A;  1VBX A;  1RTD B;  2HFS A;  2DR7 A;  1RP5 A;  4OX8 A;  2ZH3 A;  3W60 A;  1J27 A;  2JLF A;  3R2C J;  4JI4 F;  3UNY A;  4JI3 J;  3SSR A;  4USW A;  1ZOT A;  2GCF A;  4C3M A;  1O5J A;  1F0X A;  5ETK A;  2DHH A;  4UTG A;  3L3C A;  2HPU A;  1Y7P A;  4LFB F;  1HWL A;  2EG1 A;  3BF4 A;  3DLH A;  4DWI A;  2QSW A;  4ECQ A;  1WUU A;  5IQ6 A;  1WOS A;  2ZBI A;  2BJE A;  1FRM A;  3P5B P;  1FVQ A;  3RGI A;  4HKQ A;  3KHR A;  2VPX B;  3CJ5 A;  3CDA A;  1NHU A;  2V67 A;  1DTQ B;  1ZH5 A;  3DCA A;  2CAD A;  4UT4 A;  3MMC B;  2CQB A;  1IBM J;  1NKE A;  2D74 B;  1N8R T;  1N6Q A;  1FXL A;  2Z8Q A;  3V5R A;  4DR3 J;  1PIE A;  4DSK A;  3DU6 A;  3R5D A;  1NO8 A;  1RWV B;  1FX2 A;  3D0H E;  1T8E A;  2V69 A;  1Y9O A;  2DD8 S;  2N7Y A;  1LV5 A;  2V4Q A;  1TKZ B;  4A48 A;  2E5J A;  4UOH A;  2YKA A;  1V3S A;  1TEL A;  2QZ8 A;  1JX4 A;  2O3D A;  1Q95 G;  1NK0 A;  1W26 A;  1KVI A;  2RML A;  3JTP A;  3FCV A;  3UDC A;  1YWX A;  4ZLP A;  3HSG A;  3O1L A;  5HMZ A;  4QWB A;  2QMX A;  2OIH A;  3UCZ P;  1LWC A;  3TAN A;  3WX4 A;  4FVC A;  3CJR A;  2HNY A;  1XWL A;  1WC5 A;  4IQX A;  4K0K F;  1HNV A;  2QLF B;  3UD5 A;  4C9D A;  2V63 A;  3BDE A;  1F5A A;  1N34 J;  2A18 A;  4H4M B;  1GT8 A;  2YY3 A;  4GVB A;  3VGS A;  2WVD A;  1CC7 A;  3VR1 A;  1IQZ A;  4O3Q A;  3GJQ B;  1BQN A;  3FFI B;  2AF6 A;  1IBK J;  2BAB A;  3ILO A;  3QAE A;  5SUH A;  5HP1 B;  2P9G A;  3TQ1 A;  3TYT A;  5B0A A;  4B9N A;  1WC1 A;  2DNM A;  4QR1 A;  2DXD A;  4QPT A;  2QO3 A;  2FGO A;  2KTQ A;  5J1E B;  4F4Z A;  4DR4 F;  1S6U A;  4PXC A;  2B8Q A;  5D4N A;  1L3S A;  3A3P B;  4OI0 A;  2HHU A;  2DKO B;  1RHM B;  4RKU C;  4DUY F;  2VUG A;  2GC8 A;  2RNE A;  2Z2Z A;  3ILL A;  2JLE A;  1RAA B;  2G0I A;  5DDQ C;  2J9C A;  1JXV A;  4C2M A;  2CNO B;  5HMY A;  4CLP A;  1JLQ A;  1JKH A;  1RI7 A;  3FBC A;  3DFE A;  1YKW A;  3M7V A;  1KWM A;  4BLG A;  3MTK A;  4YDX A;  4OI1 A;  1HYS B;  3BQ1 A;  2R8G A;  5H9F K;  4QIG A;  2V4J A;  1RT1 B;  1YBA A;  2HHS A;  2IJR A;  4DL2 A;  1J5E F;  2RDJ A;  3W5Z A;  6FD1 A;  1KTQ A;  1RT3 B;  3QJJ A;  4ID8 A;  3BQ0 A;  3QSI A;  4USM A;  1QDU B;  2BW2 A;  3RJM B;  2DNH A;  1C0U A;  3MM5 B;  1Q53 A;  2F3J A;  1K0V A;  3A8K A;  3FCH A;  4WU3 A;  8RUC A;  4JOU A;  2YH0 A;  2XY7 A;  2I6W A;  3N79 A;  3OLB A;  4NLR A;  1SC6 A;  3KLF A;  1IR0 A;  3P4U B;  3FKB A;  2PMW A;  5CQG A;  2KM8 C;  2E9T A;  1ZAV A;  4GRS A;  1VBY A;  2Z58 B;  4KY3 A;  3EGN A;  4A47 A;  4TNO A;  2HFZ A;  2EFV A;  4IKA A;  1VFJ A;  4DQS A;  2JSX A;  1QSY A;  5HI7 A;  3F73 A;  1ZS6 A;  3KG0 A;  2WOM B;  3MM7 A;  3SYZ A;  1IKW B;  2J9D E;  5DJB A;  1R8P A;  4U7U D;  2F4F A;  2VBZ A;  2FVQ A;  1R0B G;  1VC5 A;  2U2F A;  3MDF A;  3U1N A;  2XMM A;  1RTD A;  4WKY A;  2FJV A;  1N5S A;  4YY3 F;  2FC8 A;  3Q8S B;  1YIT S;  3TI0 A;  2PSZ A;  4OI3 A;  1HQ2 A;  4X4V A;  4H54 A;  1B3T A;  2OLW A;  5C25 B;  1VRT B;  2KM8 B;  4DX7 A;  5F8M A;  4YFU A;  3OTE A;  3SMZ A;  4NLX A;  4J9O A;  5LMU F;  1Y5N B;  2BQ3 A;  5I3U A;  1UVI A;  2FLP A;  2GO8 A;  4HR2 A;  4NLO A;  3PO5 A;  5KOW A;  3M2U A;  3W3S A;  4MK7 A;  2KFZ A;  5IT9 U;  4LR8 A;  1RT5 A;  3HHD A;  4FF4 A;  2VA3 A;  5GAG I;  1UEV A;  4K5S A;  1QD1 A;  1Q16 B;  3GZ7 A;  2AJ0 A;  3IG1 B;  4C11 A;  2FVP A;  2B9W A;  2AQ4 A;  3D3B J;  1NDC A;  1G1X A;  1CJU A;  4A8X A;  2PO4 A;  3ENW A;  3G6X A;  1FRJ A;  4NLW A;  1DAX A;  1UVL A;  1MMN A;  3WX8 A;  4P2M A;  2NYH A;  4S0M A;  3WIU A;  1V5I B;  1N33 F;  3RTV A;  3GP9 A;  5F8I A;  1LW2 B;  2ABY A;  4Y34 A;  3SDE B;  1AB8 A;  2AD9 A;  5F0W A;  1BLU A;  1C1C B;  1TKZ A;  1O0P A;  4OJ3 A;  4C4W A;  2LU2 A;  4I69 A;  1DQ9 A;  2JNJ A;  4V19 X;  2M52 A;  4ER8 A;  4DU8 A;  4UQG A;  1VC0 A;  5IS2 A;  4YHH F;  3M8S A;  2W4C A;  2BVZ A;  1VHI A;  1KRP A;  3KYL A;  3BH7 B;  3HXM A;  5T41 A;  1D3W A;  4EWT A;  2M70 A;  4A8W A;  1JLA B;  4F7V A;  3MTJ A;  4X4R A;  2HS4 A;  2VFT A;  3LH2 S;  3US5 A;  1Q8B A;  1IQT A;  3KLE B;  2OKQ A;  2HQG A;  3CCR S;  4KB7 A;  2EC0 A;  5B0F A;  2AV5 A;  3JSB A;  4MIW A;  2V2Q A;  2EKN A;  1UTA A;  4LVN P;  3QT8 A;  2MTL A;  3MMB B;  3QZ8 A;  3KNG A;  3MGJ A;  4BC7 A;  4V1A k;  3HVW A;  3AD9 C;  2R7U A;  4H4M A;  3UN5 A;  4CRJ A;  2E1C A;  3FUY A;  4JI8 F;  3RZA A;  2I8E A;  5KFG A;  1P1L A;  3MUM P;  3B6B A;  3BKU A;  4F2R A;  1ZM9 A;  4J91 A;  2KHC A;  1KOO A;  3IWN C;  2AKW B;  3T6B A;  2YKP A;  4KBI A;  1DLO A;  4U7C A;  3DLL Q;  1I3O B;  1VQ9 S;  1JNR B;  1R8C A;  4DX8 H;  3CCM S;  1BMQ B;  2IPO B;  4TY8 B;  4DR1 J;  4X66 J;  3DMJ B;  4ILM A;  4DR6 J;  5LM7 E;  2HBR B;  3GII A;  2I2Y A;  1TFW A;  5D4L A;  3T5J A;  2LEB A;  2NYI A;  4QPX A;  3M9N B;  1UP1 A;  3CCV S;  1H0H B;  1VMB A;  3LUY A;  2ZE2 B;  1O6X A;  4EYI B;  4N41 A;  1TP7 A;  1W7W A;  2LKZ A;  5B0D A;  2DGO A;  4DV3 F;  3O44 A;  1JWW A;  3OJU A;  4DV7 F;  5BYQ A;  1I5O B;  4NML A;  2DGU A;  4RW4 A;  5CXT A;  1V3Z A;  4PAA A;  4LMZ A;  3GIL A;  4JI5 F;  1CVJ A;  3EXC X;  3DLG A;  1NLK L;  1AA1 B;  1K1Q A;  5G0R B;  4QIF A;  1NJZ A;  3CJ4 A;  4LF5 J;  3KNA A;  2KZZ A;  1UZH A;  1KLM B;  2GGP A;  4O23 A;  4NE9 C;  5JVH Q;  3MED B;  3C14 B;  4F4K A;  1JNZ B;  2KO1 A;  3L7U A;  1V3R A;  1VJQ A;  1HWJ A;  3D66 A;  3GU0 A;  3ILJ A;  5E3P A;  2BW7 A;  2HRU A;  4QW9 A;  5CAA A;  4C8L A;  1RT3 A;  2EVZ A;  1HHS A;  2PDA A;  2E29 A;  1MMD A;  4OZL A;  2M0G B;  2CJX B;  2JL9 A;  1QAY A;  1NH7 A;  4CO1 A;  1N56 A;  1RBA A;  1RT4 B;  4MKA A;  1FD8 A;  5IC6 B;  1T03 A;  1YLX A;  2BZ2 A;  3MPW A;  4EFA C;  3OFE A;  2BKO A;  2OAU A;  1VRU A;  2HHW A;  1WDD A;  2N7C A;  3WHI A;  2A6O A;  4LQ3 A;  2G1H A;  5HAO A;  3B8H A;  1PYO B;  2BJ3 A;  2N4C A;  5HK4 A;  2XSF A;  1LWE A;  3Q86 A;  3T41 A;  2GQQ A;  3GWC A;  4K5R A;  4K4T A;  2BAC A;  2FHO B;  2XMV A;  1M1G A;  5CYM A;  2Z4P A;  3HKW A;  2J76 E;  1VQN S;  4QYR A;  2ZZT A;  5LL6 d;  3TAQ A;  2XEX A;  4P73 A;  4IYQ A;  1GH8 A;  5K8O A;  2EI5 A;  3G4S S;  2KRB A;  2HBY B;  1HHT P;  4PWU A;  2J8S A;  2ACM A;  3IRX A;  4LVO P;  2RIJ A;  1Q7L B;  1FA0 A;  3KLI B;  2HHH F;  4N8N A;  2QA1 A;  1EIY B;  3TAM B;  1M5V C;  5B0B A;  4ECV A;  4G1Q B;  4CWB A;  2YH1 A;  3A4T A;  2HHV A;  4BS2 A;  3HT3 A;  2GVZ B;  4DV4 F;  1SKR A;  4XAK A;  4RJV A;  3KJN B;  1S4E A;  4B17 A;  3E01 A;  2IVM A;  1Y00 A;  3W61 A;  4AXI A;  3SFU A;  3BYR A;  2DGS A;  5EX3 A;  2KT2 A;  3N28 A;  1VQM S;  5GVQ A;  5BYS A;  1LK5 A;  1EP4 A;  1R8B A;  5E7O B;  1UAW A;  1IWA A;  2GFF A;  4CLT A;  3KHL A;  5IFM A;  1XEZ A;  3W65 A;  2Y0S D;  4N8O A;  2EKY A;  3UNG C;  4JYA F;  4RPF A;  3W7B A;  4ED8 A;  4LUB A;  2ZD1 B;  2JC1 A;  3BSC A;  2GZO A;  2GJ2 A;  3TX8 A;  4F4Y A;  1UW9 A;  1NB7 A;  2HNZ B;  3PW5 A;  4K2J A;  1MN9 A;  1TL5 A;  4C0B A;  2H5J B;  4MMO A;  2MY7 A;  2MB0 B;  1PKU A;  2JEJ A;  4IR1 A;  2N3L A;  4ZP9 A;  4U67 Q;  3TX0 A;  4DUZ J;  1FWK A;  3AB4 B;  2X3D A;  4I1T A;  4WTO B;  2BA9 A;  3VGV A;  3OSP A;  2M7S A;  3ONQ A;  1N54 B;  1X4G A;  2HW3 A;  4UOC A;  4ZCK A;  2ASY A;  3KLG B;  4OX7 A;  3EZU A;  4D3G A;  3QAU A;  4TQR A;  2CJ9 A;  3JAM U;  4NLT A;  1TUG B;  3MM8 B;  1JLG A;  1JJC B;  2G4B A;  4LFA J;  3L7O A;  2YKN A;  3MMA B;  1SI9 A;  5HN0 A;  2B9E A;  4A8Y A;  2XO6 A;  3ZNU A;  4U96 A;  1NKB A;  1KEK A;  2XYH B;  1U1Q A;  3BO4 A;  4A8M P;  4YS2 A;  4UY8 5;  1Q86 T;  3C6U A;  5CYQ B;  2R2R A;  2HRT A;  2DGT A;  3W8P A;  3BS9 A;  2HUR A;  4UZB A;  3N6M A;  4FYD A;  3UQS A;  3HUL A;  5ETV A;  1S1V B;  1WC6 A;  2UUA F;  2CQP A;  1REG X;  2LXF A;  2UXC F;  1H73 A;  1KQG B;  4OYM A;  4TU7 A;  4AL6 A;  4RWW A;  1S1W B;  4ZVT B;  2NXJ A;  5A6W A;  1KN6 A;  3IS9 B;  4CM0 A;  5D8H B;  4QYZ K;  1NHV A;  1CS4 B;  2NZC A;  5KG7 A;  4ZN3 A;  2Z56 B;  2NXU A;  5EHH A;  2ZUA A;  2BE7 D;  1H2T Z;  2ZE2 A;  1N32 F;  3KKF A;  2BQU A;  1HPZ B;  5JXS A;  3CED A;  4WP8 A;  2NS1 B;  2CNL B;  1R31 A;  1G2E A;  3KOA A;  1U2C A;  3OFH A;  3M9M B;  4X4U A;  2NR0 A;  3Q8Y A;  5ETT A;  4ELU A;  4LRE A;  3K0J A;  2C2E A;  3R5J B;  2N4D A;  5HMW A;  3AJ1 A;  4F2S A;  4KFB A;  4ZLJ A;  3Q23 A;  2YWF A;  1HW8 A;  4MKV A;  2JZ5 A;  4ZS6 A;  4NX9 A;  1KD1 T;  3QJL A;  4BBY A;  3NMA A;  4DEZ A;  4DXL A;  1U2R A;  2YBV A;  3GFZ A;  3HF5 A;  3EDR B;  4NAS A;  3L7P A;  4IG3 B;  2CYY A;  2UUB F;  1GMV A;  3NNA A;  2XG8 A;  2WTF A;  3AY0 A;  1YRU A;  2E7X A;  3OL8 A;  4NLV A;  4ILR A;  4B3S J;  3R5G A;  3UR0 A;  3GJT B;  4DR7 J;  2PFF B;  2MHE A;  1BD6 A;  2MMY A;  4PG7 A;  3G8Q A;  1NND A;  1PYT A;  3VAG A;  3LGN A;  1D0E A;  2IHR 1;  1RT4 A;  4B08 A;  4TYA A;  2FJX A;  1FRK A;  3K5M A;  1FFW B;  4U8V A;  1Q8K A;  1YZ6 A;  2W9B B;  2OJ3 A;  1C1B A;  2LA4 A;  1HFE L;  4J9V A;  2L3M A;  4ICL B;  7FDR A;  3FEX B;  4RLE A;  5CA5 A;  2MKC A;  5DDO C;  1BC6 A;  1U47 A;  3JTN A;  1RLC L;  2O66 A;  2QG9 B;  5I42 B;  2XGQ A;  3KLH A;  2DHA A;  2K3I A;  3V6D B;  2HAF A;  3RRK A;  3JQK A;  3R1H A;  1SQE A;  3N9U C;  2AEF A;  4KV8 B;  4Y6I A;  2J8A A;  2C22 A;  3TR5 A;  3I32 A;  7FD1 A;  3TZZ A;  1KVK A;  2XO7 A;  1YJU A;  4ECU A;  3M32 A;  3TAM A;  5KFF A;  2J5A A;  2R4F A;  1GXU A;  1NHK L;  3M2V B;  3FCW A;  4TLQ A;  5DS7 A;  1RTJ B;  4NRT A;  1RQ0 A;  4OX9 F;  1NZ8 A;  2ZJR Q;  2E7W A;  3Q2T C;  4YEA A;  3F41 A;  3IR5 B;  1NKC A;  2LLZ A;  2LA6 A;  3W64 A;  2KHD A;  4X64 J;  3CDB A;  2VV5 A;  4I2Q A;  3BGO P;  4FYX B;  2VJV A;  3QGI A;  4CCH A;  3CDE A;  2BKP A;  4C3L A;  2D69 A;  2YQ0 A;  3HHL C;  3DLK A;  1CG2 A;  2JEF A;  3U1M A;  3IBF B;  3OHB A;  1YJV A;  1S57 A;  1YG0 A;  2FUG 9;  4CH0 S;  2VQF F;  3IFE A;  3QO9 B;  4QBU A;  3MUT P;  1FHT A;  1HWI A;  4OZJ A;  1S48 A;  2RQM A;  4O44 B;  5MLC V;  2V9K A;  2PT0 A;  2ZD1 A;  4ZCM A;  3QRP A;  3TQE A;  1RWX B;  5K8P A;  1B0T A;  1HBU B;  4NPO A;  1G4C A;  2HWT A;  4PXE A;  2UXD J;  4LF9 J;  5M2U A;  3CJ0 A;  1TL7 B;  3UR3 C;  3GG1 A;  4CLS A;  3SV3 A;  3VWS A;  4ZPT R;  4P74 A;  3QRQ A;  4LBH A;  1VCT A;  2CRL A;  2HVH A;  2NPF A;  3HHL B;  4KGZ B;  2ZM6 J;  4JBC A;  2BE9 B;  2QA4 S;  2VFR A;  4N7T A;  1G7C B;  2V2K A;  3MPV A;  4JV1 A;  2C2O B;  1KQF B;  3I5B A;  1IBL F;  1WC0 A;  3MM8 A;  5IWA J;  4E2F B;  3KLV A;  1KKH A;  1ARO P;  4RX6 A;  2HFO A;  4CLF A;  3SCJ E;  4C7Q A;  2I9S A;  5LXR A;  3H98 A;  1OQ6 A;  3SEO A;  4O3N A;  1Q79 A;  1WEL A;  5J2P B;  4DHV A;  5DO2 A;  1VQO S;  3SQO P;  1U1K A;  1CPZ A;  1PCA A;  1RA7 A;  1U02 A;  1SBR A;  1UET A;  1WWH A;  2VDH A;  4LSL B;  1VQ8 S;  3PW7 A;  4F4X A;  1S1V A;  2DGV A;  2HVE A;  3RAX A;  4RNO A;  3BBF A;  3Q24 A;  4NYZ A;  1RB0 A;  4X65 F;  2J7U A;  3QAT A;  3HVA A;  3EYZ A;  2G9O A;  4IH5 A;  1RAJ A;  3DI6 B;  4A4J A;  4YUD A;  3IS9 A;  2UUT A;  3LP0 A;  1UPM B;  3D9B A;  2VFS A;  4LF7 J;  2ZH9 A;  2Y9H A;  2E5L J;  4B3T F;  4A8O A;  4X4O A;  3S7R A;  4IQM A;  5E0O A;  4NXM F;  1U1L A;  2XMK A;  2OFH X;  2R2S A;  2KG1 A;  2D41 A;  2GMH A;  3CO9 A;  4A46 A;  4EK2 A;  1KQS R;  1RT2 A;  1SCJ B;  7AT1 B;  3M9O B;  2VIH A;  1WKL A;  1ULR A;  3L09 A;  2NQP A;  1RT6 B;  4L76 A;  4KC5 A;  2BE2 B;  1RCO B;  2BMB A;  2DNQ A;  5F8J A;  5DQH A;  2HQ3 A;  2YVS A;  5KFX A;  3LPY A;  4MK8 A;  4ZDN A;  2RHS B;  2E44 A;  4DR2 F;  1GX5 A;  2NXN A;  3HSZ A;  3M6W A;  4F50 A;  3THV A;  4NMX A;  4FDF A;  1RBL A;  3TJA A;  2VA2 A;  1IBC B;  1HD0 A;  1F2G A;  2XLK A;  2RKI A;  4DL6 A;  4B3O B;  3V4M A;  1NME B;  5IT4 A;  4EBE A;  2WON B;  1VDH A;  2EW9 A;  2DRA A;  3AOB A;  2H5I B;  3C8Y A;  2W8K A;  1YIJ S;  3M8P B;  3MM9 B;  4IRK A;  2VPW B;  5AXK A;  4HT5 A;  1PGZ A;  2MY8 A;  2UP1 A;  3FJ2 A;  3CMA S;  3M8Y A;  4WU2 A;  3S6E A;  1S6P B;  4WP3 A;  1S1U A;  4O4G A;  2Q66 A;  3ZTO A;  4Y00 A;  3HVR A;  4FP9 A;  5KTQ A;  4ICL A;  1R27 B;  2J0X A;  3EJM A;  3QMQ A;  2CQD A;  4WF9 Q;  1VLO A;  3OD2 A;  4JI6 J;  1SUQ A;  1FWP A;  3TWZ A;  2IBO A;  4LFB J;  4K4W A;  2DNY A;  3C16 A;  4JI7 F;  1RAB B;  3ISN C;  4AYB D;  3HHK A;  3QWU A;  5I42 A;  4LR7 A;  3VHQ A;  4BHQ A;  1RHQ B;  5BR8 F;  5IT9 Y;  4RUC A;  4CLW A;  3IGV A;  1RHJ B;  2KG0 A;  3HMJ G;  4K4U A;  2VG5 B;  4KRW A;  4F04 B;  3K8W A;  2Z0G A;  4U9R A;  4ELV A;  3SCI E;  3T9Z A;  4J9R A;  1N5Y B;  2BX6 A;  5L38 A;  1YK9 A;  4TU8 A;  2DHX A;  3R6G B;  3Q8V A;  3V4I A;  1GK8 A;  2KU7 A;  3THP A;  1ZYQ A;  4USJ C;  4N76 A;  3OUY B;  4CLU A;  1B4S A;  5KFV A;  4UUW A;  3OTB A;  3OR2 A;  2LQ5 A;  1URN A;  1H98 A;  1RAF B;  1XMQ J;  3MFH A;  1UFW A;  2IAJ B;  2V9W A;  3QJP A;  2CZV C;  2O1P A;  3MAQ A;  2RHQ B;  3M8R A;  3PR4 A;  4J9Q A;  3D6M B;  4RNF A;  4Y2A A;  1FFS B;  3JQM A;  1HMV B;  1E6Y A;  4AE5 A;  1XR6 A;  3MWB A;  4MFB B;  4HH0 A;  3IXQ A;  3Q8Q B;  1O51 A;  4RW7 A;  2ZDP A;  4P7T A;  3VF0 B;  1D8Z A;  3FMW A;  2UV8 A;  2QLW A;  1CJV A;  1TTH B;  3CF5 Q;  3FSY A;  2C2R A;  4HI2 A;  3DLE A;  3D0G E;  3OV7 A;  1NB2 A;  3ETO A;  3MUR P;  4FN5 A;  1JLC B;  2F7V A;  4TQS A;  4WFN Q;  2CA9 A;  4KHP J;  2FHJ A;  4O44 A;  3E51 A;  3DRY A;  2IMO A;  1OSC A;  4ZHR A;  2FLO A;  5HLF A;  2CZ4 A;  2RQ4 A;  1JJ2 R;  4W4M A;  4K0K J;  1TL7 A;  5FLX Y;  1K1S A;  4PQU B;  2LVW A;  1RT7 A;  2YX1 A;  2VJU A;  1SC4 B;  2FY1 A;  2JC0 A;  1VQS A;  2MKS A;  3Q8P B;  2IRY A;  4LIR A;  2ZH2 A;  4XPE A;  2CNN B;  3CO0 P;  1QAJ A;  3ITH B;  1S10 A;  3I5C A;  2YWE A;  1REV B;  1NK4 A;  3MFI A;  3DYA A;  3HHN B;  2Q6C A;  1JLE A;  1TL1 A;  1XTZ A;  3U27 A;  3QFH A;  3W5Y A;  2W2P P;  4F3Q A;  2F9D A;  2YKO A;  1CUL A;  1ZM3 A;  2HGL A;  3N5F A;  5K14 A;  3NGU A;  4DR4 J;  1DTT A;  2LQ9 A;  2GQ2 A;  1TQL A;  2HMI B;  2ZEJ A;  2ADC A;  2VG7 B;  3SFG A;  4RNN A;  2LFV A;  3KHH A;  2UUC F;  2WRM A;  3DXB A;  4KQZ A;  1FKO B;  4Y2M A;  2NUU G;  5B0G A;  4Q2L A;  4ZK7 M;  1SB6 A;  1QVF R;  3J81 Y;  4DX6 A;  2ZBR A;  2SXL A;  4ZP7 A;  1ICE B;  1FT8 A;  4IO9 Q;  2NXE A;  1AFI A;  5ETL A;  1U4B A;  3TOQ A;  2AYG A;  3QPI A;  3AOD A;  3E8O A;  3TUI C;  1Y10 A;  1RWK B;  4IFY A;  1MNE A;  1GMU A;  3OPK A;  5EUH A;  1ITP A;  3FC9 A;  3DXS X;  1ZTW A;  5CD4 A;  3AAW B;  1IR1 A;  3GFY A;  3H5S A;  5KFQ A;  1KC8 T;  3PY8 A;  1OMS A;  5DRK A;  1R8A A;  2GV1 A;  2WK4 A;  2YNF B;  4CDI A;  2UXB J;  4KAI A;  3H5U A;  2P2C B;  4CH7 A;  4OYZ A;  2V0N A;  2CNK B;  2GHP A;  1XMB A;  2L9W A;  4QJV A;  2E66 A;  3BSA A;  2QC3 A;  4KE5 A;  1FXD A;  4J9M A;  4CLY A;  2E9Z A;  2KVI A;  1RK8 A;  2HBQ B;  5HAT A;  4M94 A;  2NLW A;  1NBE B;  1VQK S;  3NGR A;  1T02 A;  3MM6 A;  2FD2 A;  5HQL A;  3DRP A;  1TVR B;  2K7K A;  3M8Z A;  1U49 A;  4EGL A;  3CD0 A;  3MPU B;  2QFI A;  2CVI A;  5ETP A;  1XER A;  2IRU A;  1T05 A;  3FNN A;  4CI0 B;  4ZP6 A;  3UD4 P;  1RIS A;  3HJV A;  1P6T A;  3DC2 A;  3KFW X;  1HQU B;  4B3O A;  1EET B;  3BR9 A;  4L3N A;  4L73 A;  3C2P A;  1IKY B;  2WON A;  3CJ8 A;  1S0N A;  3BBC A;  1T9Y A;  4M5K A;  4DSI A;  2AJ1 A;  3CWJ A;  1TKX B;  2OH2 A;  2HFU A;  2RD5 C;  5GAH I;  3M8Q B;  4ECT A;  3M05 A;  4EEY A;  5H9E J;  4USV A;  3PM9 A;  1RWU A;  4DPX A;  1S0O A;  4ZJL A;  2UV8 G;  2MEW A;  3CDU A;  2ZC4 A;  3CJK A;  4I67 A;  1IKV A;  2C2Z B;  4WE1 B;  5FII A;  2VPZ B;  1QAI A;  3ISZ A;  5C7P A;  1RE1 B;  5ETS A;  2JX2 A;  4Z37 A;  2A2D A;  2DPJ A;  3ZXW A;  5C42 B;  1ZM4 A;  4EO6 A;  1VYA A;  2DH9 A;  4OQJ A;  1X8D A;  1BXN A;  1XR5 A;  1FDN A;  3PJX A;  5LMU J;  2ZDO A;  1VQ7 S;  2F8H A;  5HBM A;  2B6A B;  4WZQ A;  1MWY A;  1FEH A;  4LF1 A;  1S1T B;  3H42 A;  3RBX A;  1SL2 A;  5K9F A;  2OPP B;  2Q43 A;  1LEO A;  2M5Y A;  4CO5 A;  1M1K T;  4ZKA A;  2PMH A;  1HNZ F;  4LF8 F;  1JLF B;  3EVM A;  1R89 A;  4RUB A;  1AUS L;  1OS5 A;  2PEH A;  1YJW S;  1MU2 A;  1MML A;  3IM8 A;  2DR8 A;  4NCA A;  3OTD A;  3KJQ B;  3TZY A;  4A8F A;  4DQI A;  2RIL A;  3BRE A;  2B9X A;  2GAG C;  4RU9 A;  4ELT A;  3MI7 X;  5GAG U;  3KJV A;  3M8W A;  2XI2 A;  3P45 B;  4P75 A;  1S6O A;  1C0T B;  4M5D B;  1P8G A;  2MKI A;  3QIP A;  2R42 A;  3K59 A;  4DR5 F;  1HMV A;  3BSO A;  1SJQ A;  2BAN B;  5HJY A;  4RWX A;  4MFB A;  2MLX A;  4NLY A;  1IBM F;  3WBZ A;  4R5P B;  3W2V B;  2IIH A;  3DRR A;  2WBR A;  1T9V A;  4X84 A;  2CPJ A;  3G9C A;  3G96 A;  3HK2 A;  3PHT A;  3D67 A;  1SH0 A;  4R8U B;  3N4W A;  1HWK A;  4DV5 J;  1TK5 A;  3TUP A;  1H72 C;  1JLC A;  2V2V A;  1NJY A;  5KG6 A;  1YVF A;  5D15 A;  4EMD A;  1HBM A;  1SV5 B;  2VON A;  1L3V A;  3B82 A;  3HSD A;  1HBN A;  5AXN A;  2ATL A;  1W25 A;  4QR2 A;  1NJW A;  3GSI A;  3JB9 k;  2F40 A;  3C19 A;  3HCX A;  3LQV A;  3P5T L;  4PQU A;  1X4F A;  1BWV A;  4DN0 A;  2RH3 A;  2RRB A;  1WF2 A;  5KG0 A;  2RF2 A;  4LSN A;  4DDF A;  3T3F A;  2ZVS A;  2G0C A;  1Y3J A;  1E6V A;  1D9D A;  2CPE A;  3ITH A;  3QYY A;  1V9O A;  5C2C A;  5AXM A;  2CQG A;  2HHQ A;  1C2P A;  5A8W A;  3W9I A;  1WDT A;  4F26 A;  2DIT A;  2B3T B;  1ZM2 A;  1RYS A;  2XS7 A;  1SJ4 P;  3KK3 B;  2R7X A;  4JI2 F;  5KFS A;  2V5H G;  5KFK A;  2FDN A;  3FEZ A;  3I31 A;  4OHZ A;  4U95 A;  1RTH A;  1HBO A;  1JXL A;  1NU4 A;  4O4R A;  1NRK A;  3UVJ A;  3OL9 A;  4F0H A;  2CPZ A;  1R6V A;  4U8Y A;  2BUN A;  1U7L A;  2X1A A;  2VG7 A;  1M90 T;  1YSJ A;  4P71 A;  4QOT A;  1FKO A;  4KGK A;  3NGS A;  2HFN A;  1PG5 B;  2RDD A;  1OY6 A;  2JJ4 D;  4XTT A;  4F3M A;  2D7S A;  4MJK A;  4DV7 J;  3AA8 A;  5KT6 A;  4NA3 A;  1U1R A;  3IBC B;  2R3V A;  4CT8 A;  1RWP B;  3VAM A;  2MSS A;  4BDP A;  2V4R A;  2CG8 A;  3J7Y I;  3OR1 B;  2CUY A;  2M3D A;  4PPZ A;  1FTR A;  5E41 A;  4ZA1 A;  1F2H A;  2IRX A;  2PMZ D;  2DRB A;  2OPS B;  5KT2 A;  4JI5 J;  4M5L A;  1VOM A;  1A7G E;  2NPI A;  2QLB B;  1Q78 A;  1FK9 B;  3NG8 A;  3CJT A;  1N4L A;  1F3V A;  3O6Q A;  4ITS A;  3JYT B;  3O5T B;  3QLH A;  4I2P B;  3BZQ A;  2AU0 A;  1RWW B;  3PR5 B;  5D4P A;  4L75 A;  2E5I A;  5C24 B;  3M4X A;  5IXU A;  3AD7 C;  1WKJ A;  1UEK A;  3DLJ A;  2AJ4 A;  2QN6 B;  2M4M A;  3CD6 S;  3BGU A;  4MAK A;  4M5M A;  4DPT A;  1YRT A;  3TUZ C;  2LDY A;  2E5G A;  3P3D A;  1L3K A;  2W7O A;  1VQ6 S;  1TV6 B;  2RVJ A;  2ZHB A;  3K89 A;  3SIP B;  3QT5 A;  3LOU A;  1HQU A;  4M63 A;  4B9V A;  3H20 A;  2FY8 A;  4GO5 X;  1D1U A;  1RAH B;  3W9J A;  1IKY A;  1WI8 A;  3CJQ A;  4FS1 A;  1WG5 A;  4RW8 B;  1TL3 B;  3CCL S;  2DB1 A;  5FDL B;  1YX2 A;  2HS3 A;  5J2M B;  4K4S A;  3K58 A;  2KN4 A;  5KFC A;  1K9M T;  5L1J A;  3PEJ A;  4ZIV A;  5D0G A;  1B0V A;  4ED1 A;  5DQG A;  3D5M A;  2HND A;  4KKO B;  2ZUG A;  5HVH A;  2IFX A;  4DCP B;  3GMG A;  4PUO A;  3LAN A;  4MYT A;  3R7B B;  5CHC B;  2MKJ A;  4KGV B;  3BO2 A;  1RAE B;  3ENA A;  1SIW B;  1S4F A;  4RZR A;  3VAI A;  5D6G A;  1T3N A;  3NY0 A;  3HO1 A;  1LWX A;  2XI3 A;  3GJS B;  1S9E B;  4P10 A;  1X5O A;  4HTI A;  1IXK A;  2HHH J;  2ILZ A;  4F02 A;  1NEE A;  1QTM A;  4G6V B;  2PII A;  1VK8 A;  5CAB A;  4DLG A;  1U1N A;  3H90 A;  5F3Z A;  3M30 B;  1PJ7 A;  2XHC A;  4YB5 A;  1JJH A;  1K73 T;  3ZTR A;  3FRZ A;  4ES2 A;  1S1T A;  4I56 A;  2HRY A;  1Y5I B;  1IKX B;  2KL8 A;  3SQG B;  5B08 A;  3V81 B;  1N5T A;  3LP2 B;  2X7I A;  2G2O A;  2BM1 A;  1R0A A;  2D9P A;  2EPI A;  4NZ6 A;  1JLB A;  3PRB A;  1GXT A;  5A8K B;  4ED5 A;  3MEC B;  5KOX A;  2XYP B;  2JVR A;  3PO4 A;  3MEK A;  4OJ1 A;  1LOU A;  2L9N A;  5F41 A;  3PIP Q;  2DBB A;  4JYA J;  1S0V A;  3H5Y A;  4KH1 B;  5KFM A;  5MAO A;  1VLY A;  3HKZ D;  2H3E B;  4ZLN A;  3GE9 A;  2XBP A;  2ZKT A;  2RU9 A;  2KH9 A;  2VG6 A;  2XLJ A;  2C42 A;  1ZTT A;  4AXJ A;  3RG6 A;  4KJI A;  3HX9 A;  1A6L A;  3K7R A;  4M5H A;  3CUN A;  3NBP B;  2VZ9 A;  4JV5 J;  2DGW A;  4NLD A;  2ILY A;  4USH A;  4DPU A;  4DF8 A;  2V6A A;  3W2V A;  3QWP A;  4L6V 3;  4OX6 A;  3KDN A;  4E98 A;  3KK2 B;  2FZC B;  2BRL A;  2YNG A;  5L1I A;  4I7F B;  1JJ4 A;  2H65 B;  5HAN A;  2MDA A;  4WFZ A;  5B09 A;  4KIA A;  1I94 J;  4R8U A;  2WVE A;  3G82 B;  2DXF A;  3R6L B;  3L4B C;  2HGN A;  4QIE A;  2XSJ B;  4TU9 A;  1MSW D;  3K2Y A;  2GVD B;  4EU0 A;  1SL0 A;  1HKA A;  2AZ1 A;  3M1V A;  4Q43 A;  4FS2 A;  1OSD A;  1SC3 B;  3SV4 A;  1QUP A;  2VDI A;  2VHG A;  1K44 A;  3JSM B;  3D1Q A;  4Q2M A;  4PRF A;  2VC0 A;  4AL5 A;  4B3M F;  2OSR A;  2EK6 A;  1S9G A;  2DO4 A;  4ECW A;  2H9Z A;  5KG3 A;  4PEO A;  3ILI A;  4IDK B;  5M2P A;  5KFW A;  1HAR A;  5HRO A;  5ITH A;  3I0R A;  1FNM A;  4NCG A;  3K5L A;  1PJ5 A;  2DGQ A;  5JMN A;  1O8B A;  4LR9 A;  3HD1 A;  2VBY A;  1WG4 A;  2QRR A;  2RDI A;  3UN2 A;  2UUA J;  1GMW A;  4JI1 J;  3DM2 B;  1A0O B;  8ATC B;  3HI9 A;  4QWD A;  5J1N A;  2XMT A;  4WYW A;  1UWB B;  2J0W A;  2EG2 A;  1D9A A;  3TP2 A;  4ED2 A;  3SCK E;  5DG9 A;  2EC2 A;  4NRU A;  4OHY A;  2OPQ A;  4WJB A;  2N3O A;  5KG5 A;  2OEM A;  2J9E A;  5M2R A;  2N82 B;  2MZ1 A;  5L1L A;  4DL7 A;  4DR1 F;  1OPI A;  4X66 F;  2M88 A;  1WD6 A;  2NRE A;  3ZZT A;  5A0Y B;  2QL7 B;  3K8V A;  1Q5Y A;  4WP9 A;  4F0M A;  3OL7 A;  1XC9 A;  2YKM B;  3OR1 A;  4ZPV R;  1RKJ A;  2BKN A;  2WHO A;  2ATC B;  4PWD B;  2ERR A;  2XYG B;  5D0R A;  3UWT A;  2OTJ S;  2IDE A;  3D28 A;  3WC0 A;  2FJW A;  1S9F A;  3VAJ A;  2HAI A;  2ZBP A;  4KHR A;  2UUB J;  3H0P A;  4BWJ A;  2VKR A;  4I2P A;  2OPR A;  1RJJ A;  1DQ8 A;  3BN4 A;  4ZPD A;  3GCW P;  3EWG A;  4ZIW A;  4F3O A;  5C24 A;  4H4O B;  1Q82 T;  3MEG B;  3W2W A;  2MLZ A;  3NOG A;  1ZBT A;  4IG0 B;  2CQ1 A;  3WDO A;  3A8E A;  1QLN A;  1K47 A;  1R6Y A;  3DDI A;  4JI0 F;  2OTL S;  1U0H A;  2O5D A;  3H2L A;  4UY8 T;  4LF2 A;  3CD7 A;  2ZJQ Q;  1FKP B;  4M95 A;  4WII A;  1F9H A;  3FQK A;  3MCN A;  5T14 A;  4IFV B;  1RTZ A;  1ZAX A;  3MAA B;  3KK1 B;  5K5M A;  4B9M A;  3UDV A;  1BQM A;  1NZA A;  2CG4 A;  3PNI A;  1TL3 A;  5CCM A;  5FDL A;  3ZTS A;  3I9Z A;  4ENO A;  2VKZ G;  5IV4 A;  1RCX B;  4DJB A;  4NEY A;  2X3G A;  4RBU A;  4UUX A;  1H7W A;  1VC6 A;  3IR6 B;  1EHW A;  4OZ1 A;  4ANE A;  1MN7 A;  2IC3 B;  5LSO A;  2YNI B;  5LXY A;  2JH3 A;  3QQC D;  2MGZ B;  3GON A;  2UVU A;  4L3K A;  2IYI A;  3S8S A;  5A8R B;  2RU3 A;  4F4A A;  3QID A;  3HVT B;  2W7A A;  2W2Q P;  5E2Q A;  4FF2 A;  1FER A;  1P9Q C;  4DMZ A;  4ZJQ A;  5HMX A;  2GS8 A;  2HQI A;  1XJW B;  2G0J A;  3IMQ J;  2C2K B;  5IM0 B;  4YME A;  4PYA A;  4YOE A;  4DCJ B;  3SQG A;  2OEL A;  1EJ7 L;  4MTP A;  1MRO B;  3V81 A;  1IR2 A;  3HHE A;  3A3O B;  4CTA B;  1YHQ S;  9RUB A;  3BKT A;  1JB0 C;  3I0S A;  1JIH A;  2DIV A;  2DGX A;  2VQF J;  3BH6 B;  3TA0 A;  3DGV A;  2WB4 A;  2GA7 A;  2ZJP Q;  3Q8U A;  2ZZM A;  2K1R B;  5HL7 Q;  3R5B A;  4K2X A;  2M9K A;  1X5T A;  4NZ7 A;  2LEP A;  1UPP A;  3ET6 B;  3I87 A;  2HSE B;  3NBP A;  3AA9 A;  3L95 X;  4X4P A;  1AZS B;  3DGP B;  2IJF A;  3UDL A;  4IUF A;  1XBW A;  2LU1 A;  4HAC B;  2L08 A;  4PWW A;  2QLX A;  2MJU A;  1EX8 A;  5GAE I;  3A8I A;  3CE8 A;  1XR7 A;  1YQH A;  3G82 A;  1XN9 A;  1IJF B;  3CCW A;  2IMW P;  1WEY A;  2VF3 A;  4ZN1 A;  4LT6 A;  3DOK B;  2B9Y A;  3NS6 A;  1XMO F;  4DX5 A;  4Q0B B;  3UW1 A;  1RWN B;  3SSQ A;  3GSD A;  4DQR A;  2GX8 A;  1ZA1 B;  4YN3 B;  4EYH B;  2IM1 A;  3J7Z T;  3GJR B;  2ZOG A;  2E7V A;  3P49 B;  1HI8 A;  4J5O A;  2OGU A;  1CJT B;  3BGR B;  3LWL A;  3G6Y A;  5L39 A;  3KMQ A;  1S1X A;  4PPD A;  4O3R A;  3DRS B;  4LFA F;  2WB1 D;  3NRB A;  4DV1 J;  4TLR A;  1GXL A;  2HWI A;  4DPY A;  3RAM A;  3CW2 C;  1J5O B;  2GQC A;  3DM2 A;  5ETR A;  2HLT A;  4RL1 A;  4J37 A;  2HLU A;  3CUL A;  4OL8 A;  1FDD A;  1TKT B;  3PX4 A;  5DZ7 A;  9ATC B;  4ED7 A;  3V2U C;  2FLN A;  1UVN A;  4B3T J;  2W2M P;  3NWG A;  5KT7 A;  5KFU A;  4NXM J;  4OYA A;  3DOL B;  2MKY A;  2CJA A;  4KO0 B;  3SBM A;  1HR0 F;  5BYR A;  4GMK A;  1PO6 A;  2I0X A;  2WVF A;  3MEE B;  1DTQ A;  2XMA A;  3H4D A;  4WTY A;  3MMC A;  3KMS A;  5CZV A;  4HL9 A;  2WSE C;  2DO0 A;  4DV6 J;  1Z2Z A;  2RQK A;  4ES3 A;  3BGF A;  2K7J A;  3J81 j;  2FB0 A;  3FDS A;  4J7C A;  4ETZ A;  1NK6 A;  4RUA A;  5D3G B;  1GTH A;  2QV6 A;  3OFG A;  4DR2 J;  4PWD A;  4ZIT A;  4QW8 A;  5E33 A;  4XDC A;  1S99 A;  3CJS A;  1NSP A;  3D7S B;  3D0I E;  3MF5 A;  3EVW A;  4P9S A;  2ZWO A;  3LF0 A;  4NOH A;  1RYR A;  5AJ3 F;  3HFK A;  2CJB A;  3BPS P;  3MEG A;  2EXU A;  2CQI A;  4HVZ A;  1FE4 A;  4IG0 A;  4RW9 B;  1EQM A;  2GMJ A;  4R0E A;  3OTO J;  4DUT A;  1BUX A;  3MR3 A;  2J6S A;  4OZ2 A;  2K06 A;  4MKB A;  3I4P A;  1NK9 A;  6FDR A;  4FYW B;  4B3S F;  4ZMM A;  5KFA A;  5FLX U;  3DKD A;  4DR7 F;  4I4B A;  3V6H A;  3H25 A;  2B7C B;  1ZA2 B;  1S6Q B;  2R8I A;  4QYZ J;  2L9D A;  3KK1 A;  3T9N A;  4UQT A;  4DS5 A;  3EMT A;  4C97 A;  3FBE A;  1S77 D;  3H8Y A;  1YDL A;  1Y4Z B;  1FO1 A;  1U25 A;  2VFV A;  2FVS A;  3FFI A;  5J2Q B;  4OV1 A;  4Y2C A;  3PDN A;  3HSJ A;  4JI7 J;  1F5C A;  4HHH A;  2B4U A;  3VQT A;  3H40 A;  5HP1 A;  2CJY B;  2R8H A;  4OI4 A;  2J7W A;  2LQB A;  5BR8 J;  3RB3 A;  4DI6 A;  2PD1 A;  3R8Y A;  4AUK A;  5J1E A;  2MHN A;  5JVG Q;  5ETO A;  2IC3 A;  1R3N A;  1YI2 S;  2BJD A;  2JOQ A;  3R5A A;  3M6V A;  1QAX A;  1MWQ A;  3AT1 B;  2YNI A;  2EK1 A;  3FMB A;  2J6T A;  2AYE A;  2MGZ A;  2LDI A;  2LEC A;  5KT4 A;  2KFY A;  4B3R J;  3RBZ A;  3RUB L;  2V34 A;  3J81 U;  5GAD I;  1WEX A;  3ADA C;  4NLQ A;  1X4H A;  3SCL E;  3AD8 C;  4Y2K A;  3HM9 A;  2QX0 A;  4F36 A;  3N6N A;  1X4B A;  3QRR A;  4WFA Q;  4C3K A;  4CO0 A;  2I5J B;  3A1Y G;  3EXY A;  3LWM A;  3ELH A;  4K4V A;  4ZP8 A;  2XY6 A;  1N6Q B;  3T1H J;  1RKI A;  3POT B;  4EUV A;  8AT1 B;  1HNX J;  4YR0 A;  2FQQ B;  1HYS A;  2ZH4 A;  3EUN A;  1VQP S;  2ZBC A;  1RWO B;  1RT1 A;  3GCX P;  3NLC A;  4J9U E;  1M5P C;  1VJW A;  1LFW A;  2K1R A;  2GIQ A;  5E3R A;  2CZ9 A;  5THW A;  3DNC A;  3BGL A;  1IN0 A;  3PVX A;  1S76 D;  2DPI A;  4CO4 A;  1XNQ F;  3GG0 A;  5A76 A;  2HG4 A;  1DY3 A;  2L48 A;  3MM5 A;  5F8N A;  4TY9 A;  4KYZ A;  4HAC A;  2QSF A;  3VAL A;  4C0H A;  1LFP A;  3UCU P;  1CQM A;  3Q89 A;  1LWC B;  2HNY B;  3G86 A;  2B5J B;  3GFX A;  4WPA A;  3OHA A;  4Y3C A;  2IM0 A;  1S5Z A;  3PEH A;  2UXD F;  4LF9 F;  3DOK A;  2QJ3 A;  2VFU A;  2DH8 A;  1NPK A;  2ZIT A;  1ELO A;  4Q0B A;  1X31 C;  3THT A;  2XC9 A;  1Q0N A;  3RB4 A;  5EDW A;  5CCL A;  4GVB B;  4G1P A;  1NK7 A;  1SPB P;  2CKW A;  3PW0 A;  2WOM A;  1S49 A;  1H7X A;  1BQN B;  1IKW A;  1V6H A;  2XB2 D;  1VIX A;  2BRK A;  2ZM6 F;  4XK8 C;  1WHW A;  2WSF C;  1U45 A;  5HVF A;  1M5K C;  3BKF A;  2YXL A;  3MUV P;  3MR2 A;  2W9A A;  2UUC J;  1KBR A;  2XCP A;  2FTR A;  1RHU B;  1EQ0 A;  1WHX A;  5IWA F;  5DQI A;  2R7R A;  2KXH A;  2CIM A;  1D8Y A;  4PG4 A;  5C25 A;  1J5O A;  1VRT A;  3GLJ A;  5F8H A;  2OUG A;  1WSV A;  3Q22 A;  5KFB A;  3I82 A;  2VU5 A;  3IC1 A;  4G3I A;  2V8V A;  2DNP A;  5B7W A;  5HVG A;  4NZ0 A;  2D1C A;  1W2B R;  2KVQ E;  4CT9 A;  1F6T A;  1LW0 B;  1MG7 A;  4FPI A;  4X4Q A;  3K5P A;  1JLQ B;  5LSL A;  2ZHA A;  3VCD A;  1Z2L A;  4N47 A;  2Z2L A;  1KS2 A;  3K17 A;  4ZPA A;  3GTY X;  3C3L A;  4PG5 A;  1N88 A;  2HZC A;  4B02 A;  1FRX A;  2E1R A;  3HFZ B;  2B7B B;  5K8N A;  1ACM B;  4B9S A;  3IG1 A;  2KRR A;  4LF7 F;  3RW7 A;  2E5L F;  2COL A;  5IQQ A;  1VI7 A;  3J7A 1;  5IV3 A;  3G8T A;  2V4J B;  2CQ0 A;  2PC6 A;  2QA4 G;  3T6J A;  2PI4 A;  1RSC A;  5D3G A;  1Y3K A;  2MJN A;  4RNH A;  4DFM A;  4GKK F;  2DHS A;  1LW2 A;  4WZM A;  1CEZ A;  2V2Z A;  3SDE A;  4JV0 A;  1IWG A;  2GNK A;  4LF6 F;  2CQ4 A;  3I55 S;  2DJW A;  4OZ0 A;  1C1C A;  3UPF A;  3KUH A;  1BHN A;  4Y28 C;  4ZPC A;  4X4T A;  1C0U B;  2Y0B B;  2NSB A;  2PFD A;  3V6K A;  4OIX A;  2NSC A;  3N5B A;  1VGY A;  3MR7 A;  4F25 A;  1HNW F;  2WBM A;  2X1G A;  2RRN A;  1SJF A;  3T1A A;  4CLK A;  1OWX A;  3ZZP A;  1AT1 B;  3KLF B;  4WK1 A;  2LMI A;  3AJD A;  1FTC A;  3HPO A;  1JLA A;  2MQN A;  1U2F A;  2IJN A;  2BJ8 A;  5HQ8 A;  1X4A A;  2MQO A;  5GMD A;  4CO2 A;  3SSS A;  2D3U A;  3KLE A;  3N6L A;  4FBT A;  2W7P A;  2HQD A;  4K50 A;  1C4C A;  4FNI A;  3FBF A;  4KGM A;  4NLP A;  4K4X A;  2RQC A;  3BN7 A;  2AGQ A;  3S1T A;  2FZK B;  5GAH U;  2XMU A;  3MMB A;  4DZ6 A;  1Y5L B;  2WW8 A;  3CC2 S;  2AWZ A;  1M5O C;  1WTF A;  3I9V 9;  4CNY A;  3IRW P;  3HLU A;  2Z2M A;  1MW7 A;  4OFZ A;  4AND A;  3UFC X;  2B4O A;  3D68 A;  4FF1 A;  3OL6 A;  2XS5 A;  3KHG A;  3BYP A;  4WCE Q;  3MMJ A;  4BC9 A;  1DJ0 A;  5J1P A;  3R7N B;  3MR6 A;  2ROG A;  3NMR A;  5D77 A;  2DNL A;  3K5O A;  5ADZ A;  3PYE A;  4TY8 A;  3NAH A;  2CAJ A;  3DMJ A;  1TL4 A;  3T1Y J;  2VBX A;  2BR0 A;  3FSI A;  1KVJ A;  1HNZ J;  2APO A;  2PN6 A;  4LF8 J;  4JI6 F;  3NXZ A;  1GAO A;  3VV2 B;  5GMK a;  2C28 A;  3QBC A;  4RU2 A;  5F9L A;  4N5S A;  2HKE A;  2UUW A;  1RHR B;  4UST A;  1WI6 A;  5I3U B;  2VOP A;  3J80 U;  1NPP A;  4IOA Q;  4CH1 A;  2XMJ A;  1FVS A;  3M2U B;  5DGB A;  2IY5 B;  2B51 A;  1RT5 B;  4NI2 B;  3MOZ A;  2BV3 A;  1FFG B;  2QMW A;  1KFS A;  1FJG J;  4ECX A;  4DR5 J;  4Q7A A;  4O0N A;  2W1B A;  5AE3 A;  1VQL S;  2AJ2 A;  2X51 A;  4C11 B;  2BDP A;  2QT7 A;  2YX7 A;  1F1B B;  2I5J A;  1T9T A;  3W5X A;  1CJU B;  1FRH A;  2AJF E;  4K4Z A;  3POT A;  1XMQ F;  3DHX A;  3X1L B;  1YJR A;  1NM2 A;  4URS A;  3FRY A;  2YPY A;  1VIO A;  5KAK A;  2I38 A;  5G0R A;  2L41 A;  4C98 A;  2QE5 A;  3NNC A;  1KLM A;  3MXH P;  1R8H A;  3EPI A;  4WIQ A;  3MED A;  3C14 A;  3L9Z A;  3DU5 A;  1LQ9 A;  1W2I A;  1H74 A;  3QT7 A;  2R7S A;  4LRD A;  4C8O A;  3Q2S C;  4ZVP B;  4DPW A;  2MZR A;  3LP1 B;  4DU7 A;  2YX4 A;  4O3O A;  2DY1 A;  3EGW B;  3MZI A;  3IWL A;  1TAU A;  3H59 A;  4AQY F;  1NJX A;  3RRH A;  4DV0 F;  4ZPW R;  2AW0 A;  4F8R A;  4EO8 A;  3CIM A;  3A8J A;  4AFF A;  4KHP F;  3VTI A;  2DEI A;  4I6W A;  2WSC C;  2X1F A;  2B5J A;  2RT3 A;  4DCO B;  5IZH A;  1WEZ A;  4WBF A;  1NUE A;  4YB7 A;  4K4Y A;  2Q79 A;  3A12 A;  4IOC Q;  3T19 A;  5EGY A;  4LF4 F;  4JI2 J;  3RBD A;  2JVO A;  3TZW A;  1WKK A;  2DNR A;  1NDK A;  3ZZR A;  4CZC A;  2A10 A;  1DHM A;  2C3O A;  2P9E A;  3TVK A;  1DLO B;  3MD3 A;  2MXY A;  1X4E A;  1IJE B;  4OZN A;  5L46 A;  1U6B A;  1FDA A;  2FLL A;  3TA1 A;  5EWF A;  5A6P A;  4DV2 J;  1PSD A;  4ZVR B;  2V8H A;  3FBB A;  1SJ3 P;  3MD1 A;  3IGN A;  3A13 A;  4CIO A;  2ADB A;  3KLI A;  2MQM A;  2ZOM A;  2WVC A;  3EGZ A;  1UJ5 A;  4A8Q A;  4G1Q A;  2Z57 B;  2D3O R;  1U8S A;  2F5G A;  1HIY A;  2HK2 A;  1VBK A;  4KSE B;  1VIS A;  4ED3 A;  3ENV A;  4Q44 A;  3PZP A;  1QM9 A;  2GVZ A;  2AYB A;  1SH2 A;  1LW0 A;  1B70 B;  3J7Y U;  3Q83 A;  5E5N A;  4DZD A;  3D2W A;  2GO9 A;  4IO1 A;  4RW4 B;  1UZD A;  4QR0 A;  1QSL A;  4OLP A;  2V68 A;  2KT5 A;  2DIU A;  1QE1 B;  3DLG B;  4QWE A;  2FHM A;  3HZE A;  4J9S A;  2UXB F;  3CVK A;  3PRD A;  2XZT B;  2GGP B;  4CQ1 A;  3FZB A;  4LIW A;  1K0T A;  4ZVF A;  4M5G A;  3M2R B;  2HNZ A;  2W2N P;  3P8B B;  2AX1 A;  2P8I A;  2WZ1 A;  3H4B A;  3TRG A;  3IA0 A;  2KB2 A;  2ROE A;  2HIQ A;  3CXC R;  2IA0 A;  3KG4 A;  4W98 A;  3MHY A;  1WOR A;  3KWM A;  3WQP A;  4Z2X A;  3KLG A;  1RDR A;  1T03 B;  3B54 A;  3JQJ A;  2Y8W A;  2VPY B;  1VS3 A;  1VRU B;  2ZHO A;  3B78 A;  2EFP A;  5EN1 A;  3PJ9 A;  5ETQ A;  1XNR F;  4OI6 A;  2KZM A;  4CLL A;  2B43 A;  4DPO A;  3MMA A;  4HDH A;  5KFD A;  1ZZN A;  5AT1 B;  1LWE B;  3OSN A;  1T9W A;  5C5J A;  2QYC A;  3D3C J;  4ZCI A;  2JFD A;  5CYQ A;  5LSR A;  3R9L A;  1NDL A;  4YR2 A;  1SJR A;  1ZZF A;  1JQG A;  1RA6 A;  5CYM B;  3GYN A;  5DGA A;  2D3O 1;  2OD4 A;  1TK0 A;  4RBV A;  3LAL A;  2Y3Y A;  1IUJ A;  4PXB A;  4URG A;  4X62 J;  2HFV A;  2YWG A;  2DNN A;  4UZC A;  3IRX B;  1F60 B;  3I56 S;  2ASD A;  2HBZ B;  2FIU A;  5ETM A;  5I3P A;  2F8E X;  3GIJ A;  1S1W A;  3BR8 A;  4HEA 9;  2B4P A;  2UU9 J;  3G87 A;  3IO1 A;  2YTC A;  2HHX A;  1CS4 A;  3KG1 A;  1VQY A;  2XS2 A;  1FE0 A;  1LXJ A;  3MCO A;  4C8K A;  4ED6 A;  4ZVQ B;  1HPZ A;  2DNZ A;  3E01 B;  3KJF B;  1FX4 A;  4NI2 A;  3GYG A;  1N36 J;  1EP4 B;  3OT9 A;  4WWS A;  3F0N A;  2CDQ A;  2HS0 A;  1TU0 B;  1WHY A;  2CWX A;  3IWX A;  2ZH6 A;  4DL0 C;  3HD2 A;  1N5Q A;  3UO0 A;  2YNH B;  4GKJ F;  4OHV A;  3C46 A;  4K8R A;  2OP5 A;  1XQI A;  4OJH A;  3BBB A;  2ZH7 A;  4DG1 B;  2XY5 A;  4YR3 A;  3ZZY A;  2BJ7 A;  2RB7 A;  1T95 A;  4NWB A;  4LFC F;  2POK A;  2QL9 B;  1KR4 A;  4ID5 B;  2RS2 A;  1FDB A;  4DSE A;  4IG3 A;  5L1K A;  4HI1 A;  3VVT A;  5DLF A;  2H4Y B;  2CXE A;  3PXG a;  3R7S B;  2ALZ A;  4GC7 A;  3R27 A;  3LP1 A;  3FEY B;  1BGX T;  2IA6 A;  2XTJ P;  3EDQ B;  2FVC A;  3RW6 A;  4ETX A;  4B3M J;  3DHW C;  4X2B A;  4DV5 F;  3CTR A;  2IVF B;  2FJA B;  4L72 B;  4NXN J;  2JEI A;  4OYI A;  2HGM A;  4LSZ B;  2C1E B;  1X9M A;  1MLA A;  1DFD A;  1FF2 A;  2R7O A;  2F4V F;  1JLG B;  2Q1L A;  4DQQ A;  4DSL A;  4M5I A;  2YKN B;  1WOO A;  2C3P A;  1OO0 B;  2W9B A;  1UVJ A;  4JI4 J;  2XNR A;  2R7Q A;  2J0S D;  2XHW A;  2V8P A;  2UVR A;  3C6U B;  2P6S A;  2K8G A;  3NKY A;  2FHJ D;  3O8W A;  3UDE A;  1NK5 A;  4ZJO A;  4FVM A;  3V6D A;  2BJ1 A;  1K8A T;  2ACY A;  2AHO B;  1YBT A;  3GV5 B;  6AT1 B;  4KV8 A;  1FRL A;  2WW4 A;  2G13 A;  4HH1 A;  2LQJ A;  4J9L A;  1Y11 A;  4UOG A;  3EIC A;  1WF0 A;  2BOA A;  3HHL D;  4A8K A;  3M2V A;  5LMN F;  1L5U A;  2AX0 A;  1RTJ A;  3C6T B;  3NNH A;  4C6A A;  3P6Y C;  1J2V A;  3JS9 A;  1I6J A;  3GIK A;  1FES A;  3EVO A;  4M5N A;  1SH3 A;  1HLW A;  1SQF A;  4QU6 A;  4LRC A;  2J6U A;  4B9T A;  1JMT A;  3CGI A;  3T5H A;  1X5S A;  4OZ5 A;  5B0E A;  4KPC A;  1HA1 A;  2H48 B;  4KFB B;  5KFJ A;  1QE1 A;  4P2F A;  3B4D A;  2IM3 A;  1GNK A;  2XMW A;  4QU7 A;  2AEJ A;  2RUS A;  3QO9 A;  2Q6B A;  5F9N A;  4JI0 J;  1QUV A;  4H4K C;  3VZH A;  3X3U A;  1HBU A;  3M2R A;  4WXW A;  4DOZ A;  1ZPW X; 
#chains in the Genus database with same CATH homology
 2BEF A;  1NPK A;  4ENO A;  3ENA A;  2DYA A;  2HVE A;  4FKX A;  3VGV A;  3VGT A;  1NB2 A;  4F36 A;  3FBC A;  1HIY A;  1VYA A;  1S59 A;  3BBF A;  5BXI A;  3EMT A;  1XIQ A;  3BH6 B;  3EM1 A;  3VGS A;  4UOG A;  3B54 A;  1W7W A;  1B99 A;  3FBE A;  1HHQ A;  3ELH A;  3EIC A;  1LWX A;  3FBF A;  1WKJ A;  1NCL A;  2ZUA A;  4O0N A;  3Q8U A;  4WBF A;  3Q83 A;  1NDP A;  1NUE A;  4DZ6 A;  1NSQ A;  1ZS6 A;  1NHK L;  2BX6 A;  3PJ9 A;  3FCW A;  1EHW A;  4ANE A;  3MPD A;  1MN7 A;  1F3F A;  4C6A A;  3JS9 A;  1NSP A;  3ZTQ A;  3Q8V A;  1KDN A;  1NDC A;  3EVW A;  3NGS A;  5CAB A;  1WKK A;  3EVO A;  1B4S A;  3Q86 A;  1LEO A;  3B6B A;  4CP5 A;  1HLW A;  4DI6 A;  1NDK A;  3WX8 A;  2DXD A;  4AND A;  1UCN A;  4S0M A;  4UOH A;  3ZTP A;  2DXF A;  3FC9 A;  4FKY A;  1BE4 A;  1NLK L;  3EVM A;  3Q8Y A;  4EK2 A;  4ANC A;  3GP9 A;  3DDI A;  2DY9 A;  1PAE X;  2AZ3 A;  3BBC A;  5IOL A;  3ZTR A;  4F4A A;  3R9L A;  1NDL A;  3PRV A;  1WKL A;  1XQI A;  4KPC A;  3BBB A;  1BHN A;  2AZ1 A;  3VGU A;  2B8Q A;  3L7U A;  2HUR A;  1NSK L;  3FCV A;  3ZTO A;  3ETM A;  1K44 A;  3VVU A;  2DXE A;  1S57 A;  3GPA A;  5CAA A;  2NCK L;  2HVD A;  2VU5 A;  3NGT A;  2CWK A;  3FBB A;  4DUT A;  4UOF A;  3EJM A;  1BUX A;  3Q89 A;  1MN9 A;  3EE3 A;  3BH7 B;  1PKU A;  3NGU A;  3VVT A;  3G2X A;  1JXV A;  1U8W A;  5C7P A;  1S5Z A;  1F6T A;  3FKB A;  3NGR A;  4W98 A;  2B8P A;  4HR2 A;  3DKD A;  3ZTS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...