1FEEA

Crystal structure of copper-hah1
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
67
structure length
67
Chain Sequence
PKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords COPPER TRANSPORT PROTEIN ATOX1
publication title Structural basis for copper transfer by the metallochaperone for the Menkes/Wilson disease proteins.
pubmed doi rcsb
source organism Homo sapiens
total genus 19
structure length 67
sequence length 67
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1feeA00
1URRA 2VH7A 1IUJA 1Q4RA 2K7JA 2XMJA 2QYCA 1V3ZA 2Q3PA 4FNIA 3KG1A 1FE0A 2PGCA 2CRLA 1LQ9A 2KT2A 1YJRA 2ACYA 2HIQA 1RJJA 3HHLA 4A47A 2ZDPA 1P8GA 2GV1A 3FMBA 2QLWA 5IXUA 1Q8LA 4ZA1A 2RILA 1SB6A 2VV5A 4Q2LA 2HLTA 3FRYA 2OFHX 5F0UA 3WDOA 1FESA 1TUVA 2GFFA 2HLUA 1KVJA 2HFNA 2GO8A 3HHLC 1Y3JA 3I9ZA 2L3MA 2N4CA 4NL5A 2OAUA 1FVQA 2FIUA 4YEAA 2XMUA 3HX9A 3KG0A 1GXUA 3LGNA 1Y3KA 4OIXA 5B0CA 1KQKA 5B0BA 4NPOA 2IFXA 3LO3A 3HHLB 2HQIA 3QGPA 4F67A 2OD6A 1R6YA 2K1RB 2BJDA 2FHMA 2IYGA 5T7LB 2LQBA 1OSDA 2K1RA 1AW0A 1TL4A 2ASYA 5T7LA 1W2IA 4HH1A 5B09A 2W4CA 1N5TA 3BF4A 1MWZA 1MWYA 1SQEA 2PD1A 4OJHA 5B0DA 5B0FA 2N7YA 4OJ1A 2FB0A 1AFJA 1S6OA 4A4JA 3KNGA 4DL0C 2IYIA 3K7RA 2BUNA 1CC7A 2RSQA 2GA7A 5A6WA 3IWXA 1N5SA 2JDJA 2QIFA 3CJKB 5A6PA 1GXTA 2GCFA 1YJUA 2AJ0A 2W4DA 1QUPA 3HF5A 1KVIA 4OJGA 2OFGX 3CJKA 1YG0A 1JWWA 1JK9B 4U9RA 2AW0A 2K7KA 2OMOA 2QLXA 5B0GA 3FGVA 3MZIA 4EFAC 1FE4A 4DPOA 2RU9A 1Q53A 5B0AA 1YJTA 2W4PA 2HFOA 3E8OA 3HHLD 1Q8BA 1SI9A 2OD4A 3BDEA 3LGMA 2XMKA 3MCSA 2AP6A 2OP5A 1FVSA 1FEEA 3F44A 1WD6A 1VQYA 4A46A 4Y2IA 1FD8A 1OQ6A 1X7VA 1CPZA 1Y0HA 1Y9OA 4Y2MA 3TRGA 2BBEA 2OKQA 4HI1A 3TOQA 3KKFA 1X8DA 3BGUA 3HDSA 4FNHA 2BYCA 3BB5A 2KKHA 4Y2KA 5KAKA 1AFIA 2LDIA 3DCAA 4Q2MA 2LQ9A 2KYZA 1N5VA 3UDCA 4A48A 4DN9A 1XBWA 3BN7A 1TL5A 4HL9A 1YRXA 1S6UA 2G9OA 5F0WA 2ROGA 1ULRA 4HI2A 5B08A 1K0VA 1N5QA 1APSA 1VQSA 2EW9A 2XMTA 3QMQA 3TNVA 1YJVA 3HFKA 2N4DA 1P6TA 2K2PA 4OJ3A 4YDXA 4HH0A 5K9FA 2ROEA 1OQ3A 2ZDOA 1U7LA 3T9NA 2AJ1A 2LXFA 1TR0A 1TZ0A 4ZOSA 2XMMA 2ROPA 3IWLA 2FTRA 3DXSX 4QOTA 3GZ7A 2RMLA 5B0EA 2BJEA 2XMWA 1OPZA 1CC8A 2GGPB 3BM7A 2XMVA 3VTIA 3BR8A 2KT3A 2GGPA 1X0PA
chains in the Genus database with same CATH superfamily
2VUGA 4YOEA 3KFWX 4MH8A 3DGPB 4DOZA 2YQ0A 4DQRA 2VQEF 3RAQA 2FGOA 5J1PA 1T8EA 4PYDA 4K4TA 4N77A 4K4YA 2Z2LA 2H48B 2GVDB 1SVDA 4LR9A 3ONQA 1VHFA 1S0NA 3CDEA 2Y3YA 3MHYA 5HSPA 1S6OA 2CDQA 2Y8WA 1PSDA 2XZWA 4JOUA 1RT2A 5D4NA 2DJWA 4Y0FA 1FRLA 5KG1A 4LF6F 4JV2A 1YRUA 1VLYA 3UNYA 2L9NA 2A10A 1BGXT 3M8RA 2H5JB 4JV0A 4CO4A 3QNWB 3RB0A 2CNOB 3VGSA 1XNQF 4J9UE 3RRHA 1S4EA 4JI7J 3CPWR 2FDNA 4LJMA 5EWEA 2V4RA 2PSZA 3M8ZA 2BJ7A 3BO3A 5J2NA 3SQGA 1SPBP 3NNHA 3QGHA 2JLGA 1PJ6A 3MM9B 4YUDA 3OXGA 3RUBL 1CLFA 1CS4B 2QLWA 2BW7A 2HS3A 4NLOA 1FRMA 3NOGA 1FESA 2KRRA 4LIWA 3FFIA 3BGOP 2W7AA 4ERDA 2YXLA 3G71S 4RKUC 5KG6A 3KHLA 4X65F 2EKYA 1LWXA 4H4MB 1JJCB 3OR1A 1S1XB 5K20B 1F5CA 3KLEA 3LP2A 1AUSL 1HQ2A 2Z58B 3DRPA 2NXNA 1S57A 5EX0A 1YHQS 2Z0GA 1JK9B 2EFOA 2GVZB 3H2UB 1GX5A 4EWTA 3D6FB 3DDNA 4K59A 1EP4B 4ECRA 2V2ZA 4JI2F 2VA2A 1FJGF 4DV2J 3NY0A 2W7PA 4C7QA 2ZM6J 3R5AA 3HKWA 3OSNA 3T41A 4DS5A 3BO4A 3DHXA 3BJYA 2ZFHA 2RQMA 4Q45A 2EKNA 2O3DA 1RP5A 2N3LA 3AD9C 3LGHA 3LP1B 3W9JA 4DSJA 3PW0A 1GMUA 3T1HF 4L3KA 2AHOB 4TQRA 2QMUB 4OHXA 3GG1A 3IC1A 2HIYA 2PFFB 3MECB 1S77D 3H5UA 1J27A 2JC0A 1JWWA 4ELVA 2AGOA 2QLXA 4YDDB 1HPZB 4JV1A 1IQZA 3D3BJ 3EGNA 3CCTA 5KG3A 1DTQB 3VZIA 3M9MB 2R42A 5CAAA 5J2PB 1TL5A 3MOJB 2F5GA 4HHJA 4OMFG 1S1TB 5CYQA 1B99A 1HNXF 1R0CB 3W8PA 1KSPA 1FKPB 4IRKA 1C0TB 2E44A 5D0GA 2DNGA 2CRLA 2WBRA 2JFDA 1TU0B 1UAWA 4B08A 1OJ4A 3O44A 4C98A 2XLIA 1T95A 2N4CA 3W5XA 1HHSA 2H3EB 3Q83A 5KFDA 2QN6B 2FHMA 2DRDA 2HKEA 2IDLA 1S1UB 4J9LA 2BQ3A 3M2VA 2PD1A 4DR2F 1KQGB 3CDAA 4MKVA 4DV1J 3JSRA 2GJIA 2FY1A 5DS7A 4I69A 3MR3A 1HI1A 3RB3A 5MLCV 3GYNA 3OUYB 3EPIA 2PE8A 3M7VA 1OYEA 4ILLA 4OYWA 4PR6A 5GAEI 1MN7A 2CDRB 4KGXB 2B9EA 3OV7A 3THPA 5KT2A 1JLEB 5KG2A 2ZWOA 1WELA 2AYMA 3IR5B 2RU3A 2J9CA 3RTVA 4DU7A 1BLUA 2KYXA 2VV5A 2BANB 1YI2S 3NGRA 4RR5A 2LQ5A 1DJ0A 2DIVA 4LVNP 2CJXB 2B5JB 1WOPA 2B51A 1X31C 2W25A 5KFVA 3WBZA 4ER8A 1RWUA 3M8PB 4UY85 2HQIA 1MMDA 2LYVA 4X4NA 1JLBA 4X4VA 2NXEA 1RT7B 3N6MA 4V19X 2GMHA 5K8MA 2W24A 4DG1A 3UD4P 1NJYA 1C0UA 3TX8A 1FKOA 5FLXU 3HMJG 4DLGA 4ZMMA 3OBIA 2DKOB 4G1QB 5HVFA 2VQFF 2KFZA 3QSYB 2IC3A 4QPTA 2YQ3A 2PN6A 2KKHA 2HRTA 4ANDA 2EFQA 2DXEA 3OR2A 3CVKA 4C0OC 5KFRA 2QMWA 1VHIA 1IR1A 2M2BA 4LF1A 3TWZA 3LAKA 5AT1B 3NBPB 2CJ9A 2ACYA 1NK0A 2JHEA 2YNGA 3FEXB 5LJ5Y 2HLUA 4PG7A 1UEVA 1M1KT 3VR1A 1RAJA 4C48A 2UUCF 2HHVA 4LBPA 3GG0A 3RB6A 2D9OA 2FLLA 3UDEA 4AD6A 1RU1A 2CPYA 5A8KA 3DLEB 2D3OR 4DZ6A 1N56A 4QBUA 1X5TA 4U7UK 2DY9A 2H9ZA 2GIRA 2EBEA 4ENOA 1EETA 2DNQA 4F3QA 1AYEA 3VAHA 3AH6A 1WKJA 3P5TL 3EVWA 4G1PA 1M5OC 5JVHQ 2DPJA 4W98A 1NSAA 3DOKB 4MK7A 2UXBJ 4P73A 3C6TA 2DR6A 1RHJB 3EZOA 2CZ4A 1TQLA 3CCWA 1S76D 4WP3A 1FKAF 5KT5A 3GFZA 2F65A 2HVHA 4A8WA 1IBKF 3HFZB 3M8SA 3D0HE 1V9OA 1QY7A 3NS6A 3K8VA 1H2TZ 3H90A 2UV8G 4A8XA 4V1Ak 4FBUA 4WYLA 4QIFA 3G6ES 2BJ3A 1YX2A 2BJDA 2AT1B 1Z2ZA 3CE8A 1R8AA 1DLOA 2XWXA 3CJ8A 5HI7A 2VFVA 2FLNA 1YJNS 3IWXA 4DFMA 1GXTA 2VC0A 2A1BA 1FRKA 3RBXA 1YJTA 2HFOA 3K57A 2J9EA 4Y00A 3LALA 1HNWJ 2BRKA 3GJRB 1RAAB 1LWEB 3TRGA 1R8HA 2E29A 2M88A 1CJTB 1N5VA 5F0WA 2G9OA 1G1XA 3EJMA 3H2VE 1FRHA 2EPIA 1WSRA 2Y1JA 1K0TA 3H5SA 4IDKA 2DIUA 1MSWD 3IGNA 4CRJA 2MZSA 2W8KA 2GHWA 5F8GA 4F3OA 2MSSA 3OXLA 3W8GA 1SC3B 2KI2A 2ADBA 2C42A 4DR5J 2E7WA 2AJ2A 1ZETA 2C22A 1K1SA 2KN4A 4RUAA 1FDNA 4CO5A 3TAMA 4CT9A 1U1OA 1FXDA 2H4YB 5DJBA 1RCOB 2HK2A 1H74A 4WPAA 4DWIA 3D0IE 1TKTA 3RR7A 4OYBA 2RVJA 4B3TJ 1MMLA 1RBLA 5HAOA 3GWCA 2BUNA 3MUTP 4F4ZA 4L76A 4FDFA 3CJSA 1XERA 1RAFB 3AT1B 1K47A 1T9XA 2XGQA 2OLWA 2OPRB 2H54B 3UI3A 3TANA 3HCXA 2RHSB 3GV5B 1NJXA 4LBIA 5L8RC 1CPZA 4C4WA 1U6ZA 3C14B 3AA8A 3MPUB 5GMKa 3BN7A 3D6TB 2QA4S 3KHGA 2IVMA 4HACA 1X4CA 4QYZK 2VBYA 4O4RA 1OPZA 2CJAA 3KUHA 1J5EJ 3SCJE 4F7VA 5ETLA 4WU2A 4KHPF 3PM9A 1R89A 2HHXA 2HURA 4U8YA 1Y3JA 3AJ2A 1V3SA 4GKJJ 4R0EA 4B3SJ 1RWNB 1GFWB 5C25A 2M52A 4O3NA 3KNAA 1YGYA 4U67Q 2RDDA 5I3QA 4O0IA 2DHHA 1VBZA 2QA1A 3BQ0A 1QTMA 1GK8A 3KJVB 2XMKA 2HBZB 1IXKA 3CIMA 2CUYA 4FF2A 5DDPC 2QTWA 3PYEA 3ICLA 1IR2A 4Y2KA 1T7PA 2ERRA 3BSOA 3PYGA 2M7SA 3CJTA 2XMTA 3IMQJ 2ZNZA 3V4IB 3CDUA 3I5CA 3W66A 5F3ZA 3M8WA 2QA2A 2B9YA 5A0YB 2MGZA 1BHNA 4C3MA 1S49A 5ETKA 3M6UA 3Q8QB 1VQ8S 3JTNA 1VQMS 1YKWA 2FJBB 2UU9J 3Q86A 5C24B 3IA0A 3DRXA 3QAEA 6FDRA 4DCOB 2MJNA 4NXMF 1V5IB 4RW4A 2E5JA 3IR7B 4ECXA 3HVAA 4ED2A 2LVWA 2DCUB 2DK2A 3PYFA 1FE4A 1HW9A 5A8WA 1U1RA 3CD0A 3GV8B 2X7IA 3QLHA 4W90B 3CCES 3W65A 2VKZG 3MR2A 5CYMB 1RTZA 3PKMA 2C2OB 1KQSR 3MF5A 1C4CA 2X3DA 3FVYA 2VJVA 4PZVA 4NI2B 1KDNA 3OLAA 2DTJA 2PDAA 3RRGA 1RKIA 2JEGA 4AE5A 1MW7A 2ACMA 3POTB 3G8SA 3ENAA 5ETSA 1Y10A 1HBOA 2CJQA 4FP9A 5GAEU 2KO1A 2V6AA 5GMEA 3EX7B 2QZ8A 3QFHA 2LEBA 2WVEA 4Q8EA 3NXZA 1ZPWX 4JI0F 3W60A 1R8CA 4RBTA 1HI0P 4LBHA 2NYHA 5F8MA 4DR4F 3CJ2A 2MQNA 3SMZA 2G1DA 5LL6d 5HBMA 2CJKA 4YS2A 4CYUA 3SDEA 2BQRA 3ZXWA 3CD5A 1IBMJ 5F3TA 1X8DA 1HW8A 2LA4A 1W26A 1NK6A 1HBMB 3DHWC 2FZKB 1N5QA 1D9FA 4F3MA 3K5NA 1E6YB 1M5KC 4ZVUB 3JYTA 4MIWA 3D1QA 2UUWA 2R8JA 2IAJA 1N32J 1OS5A 2QL5B 3K0JA 3FK4A 4ECUA 4TNOA 2UXCF 4DV7J 1TUVA 3SSQA 1VC0A 3D9BA 5D8HB 3RB4A 2RF2A 4X62J 3I31A 4USWA 1XWLA 4ZCLA 3R8YA 2O5DA 3GLJA 1AW0A 4IUFA 5CA5A 4AL7A 4HH1A 3TAPA 4HLBA 3KJFB 2EEYA 1VQ4S 5BXIA 2IM1A 2FLOA 3FEYB 1RT6A 3BH7B 3VGUA 4B02A 3EWGA 1T9UA 4PCQA 4LF4J 3NWGA 3Q8VA 3SFUA 3AFGA 1OSCA 3QJPA 4Q0BA 3FBEA 2UUBJ 3DLHA 1WUUA 1M5SA 3KLGB 1RHKB 1SUQB 1QVGR 1R7IA 1RAOA 2NYIA 3NEKA 3D67A 2DRBA 2GIFA 5HROB 3ET6A 4NLUA 2H5IB 5I3UA 3CCRS 2ROPA 1R0AA 1V6HA 4CI0B 1CC8A 3I0RA 5U47A 4N8NA 3UDLA 1NSKL 5JUMA 2IA0A 3UE2A 3UN2A 3ZTPA 1QJHA 2FVRA 3GIIA 4J9MA 2RQKA 4WFBQ 4JI8F 4WKRA 3MM6B 5KFNA 4E0DA 2CJBA 3FDSA 2CIMA 3IRWP 3KK3A 3HX9A 1GT8A 1VBKA 5B0BA 4MAKA 4IYQA 3DFEA 1AT1B 1W2IA 3HVTA 1WSVA 2QA4G 1NJIT 2O66A 2AKWB 1I94J 4FYYB 4IG3A 1SCJB 3CCJS 1D3WA 1S4FA 5IOLA 5HATA 3FBFA 4FF1A 3BSNA 3NCRA 3LPEA 1IR0A 3CMES 2X1AA 4N5SA 2ASJA 1RT1A 5LOQA 3Q23A 2P5VA 2RU9A 1ZM2A 2O67A 2WONB 2HQDA 2XS5A 1RWKB 2AJ4A 2AP6A 3F44A 3M1VB 4KGMA 4Y2IA 4JI6F 4OYAA 1BWVA 2OEJA 5KAKA 1GAOA 4HT7A 2DXDA 1HR0J 3MTJA 1AA1B 2AX0A 2OPPA 1RYSA 3MM7B 4Z7CA 1JNZB 1UVMA 1DAXA 4M5HA 4NEYA 4IKAA 4TLRA 2ZITA 2OUGA 4BC9A 4MFBA 4O3SA 1YITS 1RABB 1TK0A 2OTJS 1D09B 1SB6A 2JWNA 3PJWA 4DV4J 4I2QA 1N33F 2KB2A 2HLTA 3CSKA 3RAXA 2QC3A 5IWAJ 2FZGB 3BEGB 3I0SA 2KVIA 2FVPA 1H2UX 3BSCA 4RNMA 1KEKA 5DM6Q 1I51B 2V0NA 3T1AA 2LU1A 1KWMA 3I56S 2OJ3A 4KTQA 3GIRA 1W25A 1YBUA 4USTA 2DPIA 4A8MP 2DGQA 1XMOF 3K5PA 4IO1A 4O3QA 2FY8A 3R9LA 3KHRA 1TK5A 1KVIA 1U0HA 2I6WA 1RYRA 1KTVA 3BGRA 2JX2A 2MZTA 4LRFA 3MMBB 1UEKA 2A0FB 1RT2B 1RTJA 2FJDB 3VCDA 4OZ0A 5HMXA 1XNRJ 4IH5A 4YR0A 4HHHA 1KLMA 2K8GA 3T19A 4FBTA 3DRRB 3R6GB 4P52A 5G0RB 3R5JB 2Q3PA 4WFNQ 4A47A 2ZDPA 1IBCB 3BPDA 4DX5A 2E9RX 3KOAA 4B9MA 3MM5A 2DH7A 4HTJA 1H72C 2OI2A 1S6PA 2OAUA 2Z2YB 1U1PA 5J2NB 1A0OB 3FNNA 2RKIB 4OHVA 1UFLA 3KLIA 2VA3A 5H1SV 2KFNA 1F5AA 1TP7A 4F25A 5KFGA 3CUNA 2GA7A 4USUA 1GMWA 1N54B 1WDTA 3R6LB 3TARA 3LP2B 2D69A 2GAHC 2MZJA 4A8OA 3DRPB 1EIYB 2R2RA 3FJ2A 3MEDB 4J9VA 5H9FJ 3Q2TC 3EYZA 2UP1A 1KKHA 4UZBA 2IY5B 2N4DA 1H2VZ 4USIA 5F9LA 4WKYA 3DMJA 2FTRA 2DGSA 2C2RA 1DTTB 2VPXB 1SJFA 4NRUA 4OL8A 3L3CA 4OYMA 4UOFA 3MWBA 4RNOA 5ETOA 4N76A 4HHUA 4DL5A 4C9DA 3BSAA 2KJVA 3IAS9 3CO0P 1UFWA 4DV5F 3S7RA 4DI6A 1HBNA 2YY3A 1FNMA 4USHA 4ID5A 3W1YC 1CQMA 4F4WA 3G82A 1RAHB 2MTLA 5BYRA 3KYLA 2QEXS 1A7GE 4ZHRA 4CCHA 3I6PA 2GHVC 3TZXA 3HZEA 5AXKA 2RB7A 1YJUA 1B0PA 2NQPA 3FGVA 1KONA 1XC9A 1EZZB 4WF9Q 3DGVA 2AGQA 3BBCA 3GV7B 2KG0A 1YZ6A 2NSBA 3NP5A 4E2FB 3IBFB 1N34J 4OQJA 4PXDA 1T9WA 3S1TA 2WSEC 1N52B 2M4MA 2DT9A 4XK8C 3NMAA 4NCGA 4IG0A 2LXFA 5E2QA 4NLXA 4DPUA 2VB6A 4WCEQ 4NOHA 1FFGB 3FBCA 3EVOA 5CYQB 2APOA 3FMBA 3AXKA 1Y5LB 1EKRA 2VPZB 1J2VA 1U24A 1P1TA 3J7A1 1FRXA 4OYIA 1GMVA 1VI7A 4BS2A 3PO4A 3T5LA 3CF5Q 3PX6A 4M5GA 5IS2A 3G6XA 2RS2A 2V94A 5ETRA 2ZKTA 2ZWPA 1T9VA 1VQKS 1H7XA 1OIAA 5DRKA 3Q8RB 4FF4A 2GHPA 2CQBA 2XCAA 2VOPA 4ANCA 1XMQJ 3OVSA 4NMLA 3BBBA 5H9EJ 1SL1A 2BV3A 3MXHP 2FUG9 5D4PA 2VG6A 3PCOB 4AQYF 3JXOA 3J80Y 2HNZA 2AQ4A 2EFNA 2YKMA 4LF9F 2XLKA 1Y5IB 4O3RA 2XMVA 3AD7C 3AOBA 1RT5A 5DLFA 5F9NA 4JUZA 4B9LA 4X84A 3CO9A 5KFTA 2MZRA 4PXBA 3D7SB 2C28A 2CQPA 2RIJA 3TZYA 1L3UA 3ZZTA 4DUYF 1VIXA 4WWSA 1WI6A 1KLNA 3V6JA 3RBDA 5HL7Q 1IM4A 4O44A 3GU0A 4LFCF 1JLBB 3US5A 2MSTA 1B0TA 5DQIA 4K7QA 5KFXA 2QSFA 3UCUP 5LMNJ 2POKA 4FF3A 4YQWA 4DG1B 1CVJA 5BR8F 3FSIA 2IRYA 1FKOB 4YB5A 2J0WA 4B3RF 4KY3A 2KZMA 1KRPA 4K4XA 5B08A 1APSA 4KR0B 2E1AA 3T6BA 1WC3A 2MHNA 1ZM9A 4KGKA 4L73A 4QWCA 3VVTA 1Q5YA 1H38A 1XIQA 1FE0A 1TKZB 4J9KA 2LKZA 3H2LA 2ZHOA 1FF2A 5ITHA 2XB2D 3B4DA 1J5OB 4RW7B 1QE1A 2R7OA 4DR1F 2GNKA 1PAUB 3OLBA 3VV2B 2FHOB 4LUBA 2O1PA 3HSZA 4NX9A 2M3DA 2J7KA 2VBWA 2WVCA 4P2FA 3TA2A 2MHEA 1C2PA 3UQSA 4J9NA 1TVRB 1WHWA 1S0VA 1A9NB 3IGVA 2UV8A 3LWMA 2AU0A 2ALZA 3PX4A 4DCJB 4QU6A 3G8QA 3VQSA 3TZZA 4J9RA 3HHNB 1U2FA 1N36J 2XNQA 3ZZOA 2BMBA 1OQ6A 3QIPA 3GSIA 4IQMA 2BBEA 2YNIB 2XSFA 3ZZYA 1XN9A 3ITHB 2UUAF 2R8GA 5GAHU 2ZDOA 4ED8A 2XMMA 1MMNA 1CJUA 3BM7A 2YH0A 1WG4A 3I5BA 4AQYJ 3C6TB 2I9SA 3EGWB 5JVGQ 2HSEB 5IT9U 4DQSA 1BQMB 2DITA 2RRBA 1R31A 3RU0A 1CEZA 3NS5A 5D0EA 4BHQA 1RT4B 1NSQA 4NPOA 5C42A 2QG9B 2HHWA 4I7FB 4DX7A 2DNZA 4WU3A 5KFUA 2WTFA 2W4CA 2JH3A 2FB0A 4ICLA 1VIOA 3H40A 1IKWA 3NRBA 4USVA 4X66F 2I0XA 3JSBA 2BABA 4UOGA 1NKCA 3BDEA 1M0SA 2ZUAA 4EO6A 4OX9F 4R8UA 4RNFA 4JI1F 3ZZPA 2RUGA 3UR3C 2I8EA 1YIJS 4CWBA 3C15A 4KAIA 2B4PA 1I1GA 3C6UA 3P96A 4J5OA 4ZIVA 5ETTA 2C3OA 3OHBA 3Q8PB 3DRSA 3AB4B 3CB4A 5E3PA 4PUOA 2D7SA 3D68A 2V4JB 3AB2B 3J7Z5 4DL4A 2GW8A 3S8SA 3W3SA 2DY1A 1D9AA 1SBRA 4NWBA 4H54A 4OLOA 1U47A 2XHCA 2MKSA 1EQ0A 4I6YA 1MLAA 2PMHA 4IDKB 3WDOA 4L3NA 4OI6A 1RTDB 4YEAA 3I4HX 3UWTA 2HHPA 2HVZA 2KT5A 1QSSA 5KFLA 1F2HA 4DL6A 1PILA 1QTNB 5D77A 3LANA 5CXTA 3BN4A 1JQGA 5E3CA 2CPHA 1JLQA 2IM3A 2BJ8A 5HQLA 4RU9A 2FC8A 3EGZA 3TAMB 4CO1A 3MPYA 3RBEA 5IZHA 1U09A 2VBXA 3KJQB 1O6XA 3H0PA 4K4SA 2W7OA 4OI3A 3IM8A 4IRDA 2OD4A 3A1YG 1LKZA 2YWFA 1M5VC 2HQGA 1S9GB 1I5OB 4KT0C 4FKYA 1YTYA 4OX7A 4BBYA 1UPMB 1RTIA 3L4BC 4CLWA 3IO1A 3P5BP 3D6MB 1CJKA 1JLAA 2ZH8A 2BACA 5DG7A 2DVIA 4YB1P 3OW2R 4WE1A 1G2EA 1N0VC 2NXJA 1QAIA 3MEGA 3MUMP 1EARA 2UUAJ 1ZZNA 1RJJA 4U96A 2GV1A 5DDRC 7FDRA 1WORA 3IS9A 3NAIA 3ZZZA 4ZVRB 4WTOB 2YQ1A 2CPJA 1WTFA 1SQFA 4JYAF 4LF5F 4RWXA 2QJ3A 3BF4A 3WQPA 2PO4A 2IVFB 4M5IA 1S9FA 1TL1A 4J90A 1JNRB 3FRZA 1T9YA 1F60B 1QSLA 4C97A 3HXMA 3Q8SB 4I6AA 2J7WA 4NLTA 3BYPA 4DMZA 2MJUA 4X66J 4IQXA 1LWFA 4OZ3A 4O4GB 1ZTWA 1YRXA 2ZZNA 1ULRA 3QGIA 1ZPVA 4HI2A 4UQTA 1HWKA 2F7VA 2XY6A 4P7TA 1ZBTA 5DZ7A 2JJ4D 1Q7YT 4I1TA 3TA1A 3VTIA 4DUZF 2E1MC 3TUPA 5THWA 4AXIA 4P6QA 1SV5A 2XZTB 2GO9A 2Y1RI 2EI5A 1DARA 1TUGB 4ATNA 2MGZB 2K1RB 4FPIA 1CQNA 4FYDA 3SV4A 2ZUGA 4ED3A 1SQEA 4I56A 2YNHB 2ALYB 1MN9A 2DB1A 4EGLA 3TP2A 4DX6A 1TMJA 4RBVA 5D6GA 2XSJA 2NCKL 3CD7A 3HT0A 3R2CJ 1LFWA 5J2QA 4CLKA 1VRUA 1JLFB 1RGVA 4ZN3A 1SH0A 4DX8H 5IM0A 4PG8A 4RW4B 4A46A 4JV5J 3EXCX 2V2KA 3OJUA 3P45B 1VQ9S 3NS7B 1FX4A 1JLCA 1VQSA 2VL1A 5A8WB 2HNDA 1YJVA 1P6TA 4HR2A 1U0SA 3W2VA 2QL9B 1S79A 2D1CA 3MMAA 2UVUA 1SKSA 2NUHA 3QLHB 2YPZA 2IBKA 1HQEA 2K7JA 3NOCA 4UY8T 3HO1A 3N01A 3CJ5A 5F8NA 2FQQB 3CWJA 5F8JA 1T11A 2JEFA 2HHUA 2H51B 3TQ1A 5HQMA 2HHTA 2CPXA 1S6QA 2HQ3A 1M1HA 1CJVA 5BYSA 4J91A 1HBOB 1L3TA 2IVYA 3PHEA 4OZLA 4DR7F 4R5PB 2BE7D 4U9RA 4G3IA 3H98A 4DR3F 1VQPS 2F40A 3VALA 1FK9B 1WWHA 4QPXA 4PXEA 5IQ6A 2GC8A 2NZ4A 1SKUB 1LK5A 1D9DA 3N6NA 4IH7A 3KKFA 1UA1A 5HBMB 3EVMA 3OT9A 2HAFA 2BKOA 2JVOA 2KZZA 1Q95G 3M6XA 2ZVSA 3P6YC 3N5BA 2FGCA 2D9PA 3TJ8A 2VG5B 4M63A 3MR6A 5D3GA 1WJ9A 3DGPA 1WACA 4UT4A 5E0OA 1NCLA 4YHHJ 2C2DA 1WF2A 3CJ0A 4F04B 3PW4A 1VISA 4PKDB 1Y11A 5L46A 3G8TA 2KXNB 1X9SA 4C3LA 4P9SA 2I5JA 4PQAA 5EN1A 1N6QA 3CJKB 4WIQA 5HP1A 2BM0A 1TUWA 3TZWA 3W64A 1D1UA 3T5JA 3A8KA 3U7JA 4ZJOA 4DV3F 1Q82T 4C11A 2Y1IA 2W2OP 2B56A 3KDNA 4PG6A 5KFFA 2N7CA 1Q86T 2PA8D 5FDLB 3TNVA 4WP9A 4LF8F 4J9SA 3PFOA 3DOLA 3QZ8A 2LQ9A 3TEGA 4A8QA 2VG7B 1SL0A 1KS2A 2IMWP 3U1NA 3HP6A 1WC5A 5I3UB 1WC1A 1R0AB 9ATCB 3I0RB 1GQEA 3PO5A 5BYQA 2V67A 3M6VA 3QGPA 4H4MA 1VQLS 4ALZA 3DYAA 1S1XA 3PRDA 2RQ4A 2CXEA 5EGYA 4TU9A 5CZXA 3KK3B 2DNOA 4DSFA 4XDCA 4X4QA 2V63A 1FFSB 2PFDA 2KRBA 2EWHA 4CLYA 3FZBA 4DFJA 1R8BA 4LSLB 1C1BA 3HVTB 3QYYA 5AJ3J 2JC1A 1Y00A 2GVZA 4CTAB 1EAYC 2HZVA 4F2RA 2DNMA 2CQGA 4K0KJ 3OL9A 2BKPA 3AQOA 2QL7B 2E5LJ 3NLCA 4LSNA 1RT1B 1B70B 2FJVA 3TJ9A 4X2BA 5HJYA 2J0SD 4ELTA 1TR0A 1PC4A 3VGTA 2MLYA 1H3DA 3DN9A 2KHCA 3MAAA 4DSIA 1L3SA 2KL8A 2QGFB 3EUNA 3UVJB 4CLUA 5SZTA 3NGKA 3MURP 3HHEA 5LSRA 2IRUA 2CADA 4NYOA 3BR9A 4X64F 3EXYA 4M8LA 4GKKF 5D4LA 4EZ9A 2XULA 4OX6A 4MFBB 1RT3A 1LNQA 2K06A 3NCPA 3I5AA 3OHAA 1HWUA 4WZMA 1FRIA 3MPWA 5GAGI 2KFYA 3JQMA 3HJFA 1TL4A 4GMKA 4L75A 1Q79A 3A8JA 1RWOB 4MYUA 3KLHA 3I0SB 3KLFB 2B9XA 2B7CB 2F63A 5L9NA 2ZH5A 1NLKL 1RUSA 1Y5NB 4ZDNA 3QBCA 1IM6A 1R43A 2JEJA 5F41A 1HI8A 1QAXA 5CCLA 1U0HB 5J2PA 4ZPCA 4QW9A 2NPIA 2E1CA 4FXVA 4UOHA 4ZOSA 5D4OA 2B6AB 1SC6A 1NK8A 5I3PA 4C8YA 1F6TA 4XDDA 3RRKA 1C0TA 2MDAA 3LWLA 4ED4A 1RXOB 1KQFB 4UUWA 5L9XA 2JLEA 3N0VA 4PWUA 4DFKA 1KLMB 5AE3A 1NDCA 2GO8A 2P9EA 5HMWA 1XQIA 2FIUA 3AD8C 1U48A 4B3MF 5M2PA 1NB2A 3OFEA 1KFDA 4OIXA 2IFXA 5A8RA 3SZ2A 3SYZA 4IFYA 3H5YA 3FQKA 4JI5F 1S1UA 2CVEA 1S6PB 3QT8A 2CPEA 1BQNA 3K7RA 2OFGX 3IR6B 1PG5B 3C46A 3KLIB 5KFAA 4DS4A 4X4UA 3OL6A 5LXYA 3OUYA 1T02A 3CT9A 1FNOA 2LQ8A 1FD8A 4ECZA 2RJZA 1S72S 2DBBA 5LSLA 1FA0A 1S1VA 2I38A 2BKNA 2DH8A 2J9DA 4H4OA 4UZCA 4NMXA 4AL6A 1CULB 4LR7A 1OPIA 1JLEA 4LFBF 4O0NA 2BR0A 1X0FA 2KJWA 4HT5A 2YBVA 1TMMA 2YX1A 4WFYA 3CCQS 1K44A 2K3IA 2XC9A 2OO4A 1YJRA 3ZTOA 1SKRA 4ZN1A 3UFCX 3BH6B 4JI4F 2BANA 3KJNB 1TAQA 4F02A 2B5JA 3FSYA 3IBCB 2IBOA 4LF7F 5E5NA 5JXSA 2OPSA 5J1EB 3GJTB 1F2GA 2L48A 5CYJA 3RW7A 1A6LA 5HLFB 2HBYB 4EO8A 4DSEA 1BY9A 5A76A 3OTOJ 1B3TA 4ID5B 3DDIA 4RX6A 1ZAXA 2J6TA 3TR5A 1BMQB 3G2XA 4ZHRB 5LJ3Y 3CW2C 2ZJRQ 4Y2MA 2VC1A 3OTEA 1ACMB 2FYXA 1JLGA 2AF6A 2ROGA 1AZSA 3D0GE 4Q43A 3C16A 3E01B 4FKXA 3HHDA 3WZ0A 1D0EA 1IKXB 1H98A 3UN3A 2IHR1 4DF8A 2XWYA 2HHQA 4DSKA 2ZOFA 3E51A 2MKJA 4DV6F 5AE1A 3NBPA 2VQEJ 2UXDF 3PIPQ 4LF2A 2AEMA 1AROP 4IG0B 1LWCA 2NREA 2BOPA 2CPFA 5KG0A 3HSGA 1NKEA 1U8WA 4KSEB 2ZH3A 3WIUA 2WHOA 4YY3F 3FUYA 4F67A 4JI3F 3ISZA 4ZLPA 3HPOA 4L6V3 1NK5A 3DI6A 1TL7B 4OJ1A 3DLEA 1DURA 5A2QY 2Q43A 4HDGA 1QSYA 3GJSB 2MQQA 3UNGC 4LF6J 1X60A 5D15A 2XY5A 1NEEA 2Z4PA 1S7HA 3E3XA 1Y0HA 1WI8A 1XNQJ 2F4VF 3HDSA 2HWIA 5L1LA 4MJKA 4LREA 2RH3A 2VDHA 1T03A 1PYTA 1EB0A 5KFSA 2HGNA 1LXNA 2OPQB 4QIVA 5GMDA 4ECQA 2VG6B 1UVJA 3A4TA 1U1MA 3D54A 3MCOA 5K8PA 5KFZA 1X5PA 2YKMB 3CCUS 3PR4A 4X65J 3TJAA 1RT5B 3JTPA 1M5HA 4NZ6A 4ZVQB 1NJZA 4RZRA 2HEKA 2HVIA 5C5JA 4ZPTR 4DPYA 5CH7B 2OMLA 3R5DA 3NMRA 1VRTA 1GX6A 3K2YA 4ES1A 1HA1A 3MD1A 1Q0NA 2PMWA 2YWHA 5EUHA 5LSOA 5B0GA 2CQ3A 4RO0A 5LT5A 3GMGA 4JP8A 4IR1A 4GRSA 4QR2A 4M5DA 2IM0A 4JI2J 1X7VA 3QGGA 4KB7A 3MDFA 3M2UB 1RI7A 1FJGJ 4O44B 3K8WA 3DCAA 4N7TA 2GS8A 4YFUA 1XR5A 4PQUB 2QT7A 1IBLF 2G13A 1SJ1A 3F0NA 3MM8B 5LXRA 3FBBA 3I96A 1XR7A 4QOTA 2ZC3A 3GZ7A 2LFVA 1U4BA 4ZCKA 3N6LA 1FHTA 2W8LA 2V69A 2CVIA 2Y1LB 3V2UC 1M1GA 3V6HA 2GFFA 4WK3A 1HNVA 2ZBCA 2XCPA 3AA9A 1QM9A 3N9UC 4KFBB 3U02A 4DEZA 3T1HJ 3PEJA 1P1LA 1RWMB 4RW9A 5CABA 2W2NP 3D66A 2M8DB 2ZC4A 5JJBA 1CC7A 5A6WA 4QQBA 2DGUA 2IMOA 4GC6A 3TVZA 4KIAA 2DHGA 1SI9A 2VFTA 2DHSA 4PEOA 1SC1B 3VAFA 1X5SA 4KO0A 4BLGA 1KHWA 4AFFA 4K4VA 4ILRA 3C14A 3PW7A 1GXLA 1URNA 1HNXJ 5J2MB 3OD2A 4DV0F 3DOMA 1R8PA 3O6QA 3SQOP 2CQHA 4OJ3A 1BUXA 4YDXA 1DHMA 4CT8A 3QIPB 3IG1A 2KHDA 3AQPA 3TQEA 3B54A 2WVFA 4MYTA 3PEHA 2J9DE 3TW0A 1FJCA 4ZCMA 3PTWA 1DRZA 2HFVA 1UW9A 3SCIE 3BGFA 1SH2A 1CJUB 2BVZA 4QR0A 4O3PA 4FPRA 2WSFC 2XHWA 2G2YA 1NHUA 3LQVA 2LQBA 3DLKA 1C4AA 4DR2J 1HWJA 5KFYA 4ZS6A 2ZBRA 1UA0A 2QLBB 4LFAF 2ZKUA 5MAOA 3HJVA 1JXVA 4Q7AA 5C42B 1O8BA 4W92B 4DSLA 2AWZA 3WX4A 3KJVA 3GIKA 4OZJA 2C3MA 1HMVB 5ETNA 4TU7A 2WW4A 1Q16B 3JS9A 3V5RA 1HNZF 5LMUF 1IKWB 1U1NA 1WOOA 5GAGU 2EBGA 1WG1A 2XEXA 2OEKA 1UTAA 3L7OA 3Q22A 2FJWA 4Y28C 1TZ0A 1GNKA 3DLBA 2C2MB 4L74A 2XS7A 1NHVA 3C15B 2KT3A 3M6WA 3C6UB 2L41A 2R7QA 3HVWA 1B7FA 3DRSB 4R25A 3VAMA 4FYWB 4CO0A 4PUOB 3T1YF 3KUEA 4DL2A 4N47A 4NLGA 5KFPA 4GVLA 2ZOMA 1QVFR 4PPDA 3UD3P 3ZO7A 3HD1A 5KFOA 4M5MA 2C2NA 4X4TA 1VQOS 4F2SA 4QW8A 3UCGA 3I32A 2YX4A 3HF5A 2LU2A 2BDPA 1BWEA 1F1BB 3M9OB 1JLQB 2VQFJ 3DM2B 3K89A 2R7UA 1PO6A 5K14B 3J7YI 4XIUA 3GFHA 2YWWA 2LP4A 1F3FA 5FJ4A 3MFIA 4RUBA 4X4OA 1U25A 4K5SA 1Y4ZB 2Y0BB 1WOSA 1HYSA 5CYMA 2ROEA 3SXLA 3G4SS 1W2BR 1PGZA 2W2MP 3HM9A 1SJ4P 2V68A 2DNKA 3JAMY 4C0HA 1U1LA 1IUJA 4C8KA 4NI2A 3HHLA 1RTIB 2MY7A 2C2EA 2R2TA 1NHKL 2NPFA 5F0UA 1TAUA 4RUHA 5HO4A 2UUCJ 4WE1B 1EJ7L 2FZCB 4G65A 3Q0AA 3MTKA 3OTBA 1JKHB 4HTIA 4ED7A 1K9MT 2AGPA 4ECSA 1N4LA 2WAQD 1T05A 2L08A 1RTHA 5B0FA 2MLZA 4IFVB 4P75A 1Z4UA 2GCFA 4OJGA 1QD1A 2R8KA 2CFXA 2QLFB 4ZVPB 1RCXB 2R3VA 2HFZA 3GR0A 2HHHF 5HK4A 2DHXA 3ILOA 3E8OA 2HMIB 4ZP7A 5DLGA 1SJRA 2B0GA 5KG5A 3L95X 4NLVA 2B9WA 3PY8A 1HBMA 3MPDA 1IKYA 2B7BB 2H65B 2CNKB 2DH9A 5LM7E 1E6YA 3FC9A 3N4WA 1U02A 1X4DA 5BJRA 5HN0A 2G2OA 3ILIA 4A8FA 1IBKJ 2F8MA 1VBXA 3BBFA 3KG1A 4ZVTB 2DGWA 2G2ZA 3BKTA 2Q6CA 1WHYA 3DLGA 4DF4A 3OVBA 4QZVB 1GXUA 1EKSA 4BDPA 4CP5A 4DPXA 5KFCA 5B09A 3BV8A 1S1WA 3M8QA 2YWKA 2XTJP 4CH1A 2DGTA 2WK4A 2CQDA 4MTPA 4QWBA 4DHVA 1XK8A 4IR9A 1FD2A 2LA6A 3TEHB 4OV6A 3ZZ0A 2ZHBA 2V8PA 3OJSA 2QV6A 2R7VA 2OKQA 4FNHA 5DGAA 3A3OB 3KLGA 5J2QB 2J5AA 4M1KA 2AEJA 1V5VA 1VRUB 3OXFA 2CQIA 5IM0B 2A3JA 5HROA 3SIPB 4JI7F 2GGPB 1FO1A 1RA7A 1IJFB 1V3ZA 2OTLS 1JLCB 2HZAA 1K8AT 3W2VB 3ZC4A 2OELA 2M9KA 2YH1A 3MMAB 3MM6A 3R7NB 4FN5A 2WVDA 1HLWA 4X4PA 3N79A 4HDHA 3SCLE 2CJYB 4MIBA 3H25A 3GB0A 1XJWB 4DL7A 1NH8A 4AT1B 1RWXB 1CBKA 3OFHA 3EDQB 1RADB 1OYDA 4A4JA 2FPHX 3Q2SC 3D5MA 1NNDA 2MQPA 1N5SA 3RG6A 2FVSA 1S6QB 4U95A 4HKQA 2CG8A 3BKUA 4DQPA 2RNEA 3MEEB 3J81Y 1CJVB 2WONA 4FXWA 3MAQA 1VQYA 1YK9A 3A3PB 3M30B 4ANEA 4RUCA 1XBWA 4M5JA 4U8VA 1VQ7S 3MR5A 1SIWB 3R97A 2YKAA 1PBUA 2HVDA 3MM7A 1NBEB 2QX0A 3S01A 2OHDA 5IT0A 4DV2F 3PACA 1TV6B 2ZM6F 1D8ZA 1ICEB 1UWBA 3LPYA 2BRLA 2AYBA 4I0WA 2JEIA 4URQU 4KHPJ 3R1LA 4KBIA 1FERA 4CLZA 1TKXA 1YLXA 2VPYB 1JB0C 5KTQA 4Q8FA 5AXNA 2HFNA 1ZOTA 1KOOA 3IN5A 1TKDA 2P9CA 2FD2A 2CZ9A 5D3GB 3EMTA 5KFKA 2Y8YA 3HSDA 4USJC 5DDQC 2YKOA 1NO8A 3EDRB 4NZ7A 4ZIWA 4L72B 5A6PA 4IOAQ 1VFJA 3HFVA 2J0QD 3KHHA 3PG9A 1ZM4A 2ZH9A 3H4DA 4BCAA 2I5JB 1JJ4A 4KPCA 2X1BA 4I2PA 2ZH1A 3M4XA 1YDLA 3MMBA 3FSXA 3QSIA 1N6QB 1PBAA 5HP1B 1RA6A 2ZD1A 3W62A 2EW9A 2F4FA 3HFKA 4C11B 3VAGA 1ZH5A 2J0XA 2P6SA 8RUCA 2KVQE 4RNHA 1Z2LA 3DRRA 3KK1A 1Q8IA 1Q4RA 1JX4A 1S5ZA 5G0RA 2MKHA 3HK2A 1LEOA 3LTOA 1BE4A 2OFHX 3RYLA 1OO0B 1VC5A 1VQ6S 3DOLB 3CIZA 2W9BB 3PV8A 1HQUA 2WB1D 1VC6A 1Y3KA 3VHQA 4XPEA 2RKIA 4NXMJ 2CYYA 3JSMA 3RGIA 1N5YB 2FVQA 2BA9A 2OEMA 4KYZA 3HKZD 4JB8B 1R0BG 4M5NA 1TL3B 3MMJA 4DJBA 2CNNB 1YZ7A 4J37A 1B0VA 4DV1F 2G4BA 3DYAB 2MQMA 5KFMA 4CM2A 2X51A 1KD1T 4ZLJA 4C2MA 3J7ZT 5L1KA 1AFIA 3DNCA 7AT1B 4KV8B 1U6FA 3MEDA 1UVKA 1C1BB 4ZPWR 1LFPA 1S10A 4U7UD 4ZVHA 2DNLA 4K2JA 4CQ1A 3TUJC 3J80U 4LSNB 4CIOA 1DTTA 1C1CB 2DNHA 4LRAA 4CLFA 2EVZA 3FZ2A 4MKBA 2MLXA 1F3VA 5GAHI 3K17A 1NZAA 2MQOA 1VOMA 5GADI 2AD9A 2DRAA 3MAAB 4JI0J 3GILA 1REVB 3CCVS 4KKOA 5T7LB 4DR4J 2Z56B 1IQTA 1FT8A 5DDOC 5KG4A 5B0DA 2AEFA 3R5BA 3MR7A 1KTQA 3K5OA 1RT3B 2UZAA 1KNZA 3BYRA 2FJEB 2HWTA 3BQ2A 5E33A 3J81j 3QIDA 4NCBA 4YN3B 1U26A 1RHQB 2E1RA 2GMJA 4O23A 3KLHB 3DU6A 4HI1A 4LRBA 2AJQA 4CO2A 2KYZA 2EXUA 1B4SA 2ATCB 4Q5VA 1VGYA 3AODA 3PFEA 1SQGA 3N28A 4Z37A 1SL2A 3QQCD 3ETMA 2DNNA 1F5BA 4RU2A 1RK8A 2MKIA 3H5XA 2OIHA 2HYIB 1UVIA 1L3KA 1LQ9A 2UXCJ 2P8IA 1M90T 4QR1A 1FX2A 1LW0A 4D3GA 3J7YU 5HVGA 2UVRA 3Q89A 1S12A 3GP9A 2V2QA 2V4QA 4QJVA 1L5UA 2X3GA 4DU8A 2B4UA 4M5KA 4OYXA 2QE5A 4WP8A 1K1QA 4OJHA 1RAIB 1DQ8A 3GYXB 4RWWA 3X3UA 1FJEB 4ILMA 2IDEA 1FWPA 3H42A 5KT3A 1X9WA 4TN2A 5A8RB 3PZPA 3MPVA 2A18A 1VRQC 4IFYB 2HNYA 2E9TA 4OYPA 3K58A 5C2CA 1BQXA 3MMCA 1BQNB 4NA3A 1B64A 4ZPVR 3MCNA 4H4KA 5AXLA 1ROFA 4OI4A 1TK8A 4F36A 4A8YA 2UXBF 4ZJQA 2IRXA 2V8GA 2R4FA 1WHVA 3ZTRA 1S1VB 4RW6A 2ZOGA 3SQGB 3SSSA 4H4OB 4JI8J 2KXHA 3MOZA 2BX6A 3ILLA 3OL8A 5IV4A 4UF4A 3WC0A 3WC2A 2QO3A 3FFIB 3THVA 4IOBA 4OHYA 3A8EA 4F4AA 1YWXA 3R1HA 3ZFVA 3R7SB 2NXCA 1RBAA 1RAEB 4Q44A 3ZTSA 4X4SA 3RBZA 4PWDA 1NH7A 3OR1B 1O51A 3BKFA 4C8LA 3KLEB 2CQ2A 2IA6A 4OZ5A 1DBDA 4CZCA 2W1BA 3R2DJ 3G6YA 4DL0C 1OMSA 1ZAVA 3G96A 2OPSB 4QWAA 5CD4H 2HRYA 2VHGA 1HNIA 2W4PA 4JI6J 3GCXP 1HL6A 4ZPAA 2AZ1A 3GTYX 2R7TA 3R7BB 2HS4A 1HNWF 2V9KA 2EFPA 1VYAA 3W2WA 5AXMA 3U27A 4USMA 3W5ZA 1E6VA 2XZDB 4LR8A 4KC5A 3CJ4A 4AYBD 1JLGB 2QYCA 1AZSB 2FHJD 1N33J 3C16B 1TKZA 1LXJA 1HD0A 1VCTA 3Q24A 1J5OA 4RW7A 4DR5F 4WFXA 3ZNJ1 2XLJA 5DO2A 1KQKA 5D0HA 5L38A 4ZK7M 4NLWA 1TVRA 1LWCB 2CQ4A 1XMOJ 3JSYA 3IBWA 4YB6A 1X4AA 4QIEA 1Q1KA 1RKJA 1N8RT 3HHKA 1IKVA 2ZH2A 4B3TF 3AHPA 3IM9A 4U7CA 3A8IA 3VZHA 2XY7A 5E3QA 4CLSA 4EFAC 1U1KA 2R9LA 1MU2A 1WF0A 3DI6B 3PVXA 1S0MA 1NDPA 3EICA 2ZH4A 3CDBA 3BGUA 2AX1A 4J9PA 4P2SA 5KFJA 2P9GA 4EBDA 2IJRA 2R7XA 2YNIA 3TI0A 5KFWA 3HI9A 3ITHA 1YBTA 4F26A 1T0TV 5HANA 1RBOB 4LIRA 2V8HA 4ZCIA 4KH0B 3OTCA 4DN0A 5IV3A 5JMNA 4CNYA 2E7XA 2WRMA 1QAJA 1MG7A 2HZCA 1T03B 1LK7A 2WB4A 3UR0A 1BQMA 4BWMA 2MQLA 1J5EF 4EUVA 3IP0A 2XO7A 2IPOB 1OY9A 3HD2A 2SXLA 3KG0A 4F4KA 3BDPA 2KG1A 4PABA 1RT4A 2ZE2A 4EMDA 3NGUA 1FXRA 2DISA 4I7FA 3M2VB 2R8HA 3W9IA 4GKJF 1HD1A 2XS2A 3IXQA 4B3SF 2UVVA 4LVOP 5HMZA 5T41A 4EBCA 4DCPB 2NSCA 2BJ1A 2RS8A 3TAQA 3GSDA 1KR4A 2M8HA 1VRTB 4J9OA 3PXGa 2D3UA 2V8VA 4M95A 3CJ3A 1RSCA 2BM1A 2GZOA 2G0JA 3H8YA 1NK9A 4M5DB 4NEZA 2W2QP 2G0CA 2V4JA 3K59A 4QCLA 3Q8UA 3BPSP 2V34A 1LW2A 2K3KA 3IRXA 4DV5J 4ECWA 2FHKA 1NDLA 3HZGA 4NL5A 3KMSA 2E66A 3KK2A 4B9VA 2XMUA 1RTDA 1WHXA 1R6YA 2BZ2A 3A3NB 2XYGB 4I6WA 3EM1A 2ZBPA 2MPUA 1RAGB 2LQJA 3CMAS 2DR5A 4FS2A 2E7VA 4YMEA 2UU9F 1HNVB 4ZVSB 2DXFA 5HMYA 2MMYA 2MEWA 4I67A 1SXLA 1C0UB 3U1LA 3L9ZA 4ED5A 1HBUA 2JOQA 1RZMA 2YWGA 3CXCR 4RW9B 2VONA 1WEZA 3FKBA 2CWKA 2ZJQQ 3CC7S 4AUKA 2IC3B 3UDVA 1ZS6A 1CSJA 1S9GA 1AB8A 4ECYA 1DZ5A 4TY8A 3OR2B 3D6HB 3X1LB 3ENQA 5KG7A 4NE9C 2MY8A 2CWXA 3GE9A 4KO0B 4OI0A 2H1YA 2D3ZA 4RBUA 2VH7A 3DOMB 3NWRA 2YNGB 4B3OA 2UUTA 2YKNA 1R3NA 3B8HA 3IG1B 2KXFA 3VGVA 2A6MA 2QLJB 1ZA1B 2LEPA 5A8KB 2R7RA 4KGVB 2MKKA 3PW2A 3ILJA 2N7YA 4P74A 4UW2A 2J7UA 1EETB 3RR8A 2LLZA 2W4DA 1VBYA 5M2UA 2R2UA 2BW2A 3P3DA 3DLKB 5G4DA 3QJJA 3PJ9A 3THTA 5CD4A 2J76E 1YJWS 2HGMA 1YJ9S 3B6BA 5GADU 4IO9Q 4PG4A 1YBAA 5ETPA 2BQUA 5DQHA 1HARA 1BXNA 4O4GA 4HL9A 1IBMF 4KPYA 4LF9J 2HWHA 1VR6A 2R8IA 4OZ1A 2WBMA 2FJXA 4AXJA 3T3FA 2IIHA 3AJ1A 5KT6A 3M2RA 2HIQA 4PWWA 4EYHB 3PW5A 4BWJA 1Z1ZA 4ZA1A 4OZNA 1N32F 3NNAA 3O1LA 3HHLC 4ZPDA 4DV7F 1R6VA 4NCAA 3LGNA 1FWKA 2WOMA 1T3OA 4DUYJ 1V3RA 4X62F 2K1RA 1DLOB 2CPZA 2W2PP 5FLXY 4Y2AA 2YNHA 4LFCJ 3O8WA 4LRDA 4PG5A 1T9TA 5DQGA 1ZA2B 2FJAB 2XI2A 3P8BB 3QT6A 2L9WA 5M2RA 1QUPA 1QDUB 3G87A 1JLFA 2F9DA 2Q6BA 3AJDA 3QT5A 2IM2A 4DPWA 5IC6B 5BR8J 4LF4F 1N0UA 4B3RJ 3FQLA 2ZVIA 1MROA 2BYCA 1UPPA 2UUBF 2GJFA 1NK4A 3CNQP 4MMOA 3CCZA 4XAKA 4CH7A 4HH0A 2HS0A 3O2IA 1PIEA 1RU2A 1EHWA 2RQCA 4K5RA 1IVZA 3IWLA 4IH6A 2AYEA 2RMLA 3QATA 3BGLA 4FYVB 4NA1A 1RHRB 2W01A 2VFSA 4N56A 4DR1J 4OYOA 1AUDA 3IFEA 4WK1A 1HYSB 1FCAA 1LV5A 5C2GA 4WZQA 3PYDA 2CKWA 3UD5A 3I4PA 5IQQA 2W9CA 1OWXA 3FCVA 3HHLB 1TKTB 1H6KX 4XTTA 2V5HG 2DNRA 3M32A 3L09A 2BE9B 4PAAA 1I94F 4C6AA 2VIHA 3V81A 4R5PA 3V6DA 1G7CB 2AW0A 4AL5A 1T05B 2J6SA 1RTHB 1CG2A 5DGBA 1FK9A 5SUHA 2YX7A 1N48A 4TY9A 1WF1A 1QAYA 2Q66A 4P7VA 1RWVB 3NGTA 4S0MA 4HACB 1RWPB 4OFZA 1HR0F 2Y9HA 2LMIA 4NLQA 3QFWA 2VKRA 1GH8A 4ZVEA 1NKBA 4K8RA 2XMAA 1NAQA 4ES3A 3AAWB 1RLCL 3DXSX 3R5CA 3TO8A 5F8IA 3BO2A 2AV5A 3GIMA 4BC7A 3D4JA 4FNIA 3GJQB 2VG5A 2KM8C 1IKYB 2QRRA 3EPGA 5ETVA 1S97A 4P2XA 2VDIA 4DV4F 2JVRA 1WDDA 5E3RA 5IWAF 5T14A 2OD6A 4WJBA 3W7BA 3ADAC 2MKYA 4P72A 1X4FA 5C25B 3DC2A 2ZBQA 3DRYA 3UPFA 4DPTA 2A6OA 3DLGB 1I6JA 3MCMA 3OPKA 1HWIA 3CJKA 1YG0A 2CPIA 2FVCA 4TYBA 2DR8A 3TUZC 2PEHA 4OX9J 4JI1J 1S1WB 2DHAA 3M8QB 4FZVA 1N88A 1UKUA 2EK1A 5ETMA 2C1EB 5KOXA 3QT7A 4GVBA 3MFHA 4DN9A 1VJWA 1W7WA 2YNFA 1MNEA 4DZDA 3NCQA 1GTEA 4PXCA 5FDLA 2ZH6A 3K5MA 3K5LA 5EX3A 1U7LA 3U1MA 4ELUA 1XNRF 1YSJA 5B0EA 4MK9A 3C19A 3FMWA 3LP0A 1URRA 3H59A 4RW8A 1UVNA 2VG7A 1Q8LA 2CQCA 3FRYA 1UJ6A 1PYSB 2KM8B 4GO7X 2YPYA 1L3VA 2QFIA 4NYZA 1KFSA 4EBEA 3QO9A 4CLTA 5L39A 4C3KA 1N5TA 4Y2CA 1TFYA 2LCWA 2F1FA 5DG9A 4K2XA 2LDYA 4P10A 4ES2A 1NPPA 5ETQA 5I42A 2CQ0A 5D78A 4LSLA 2XO6A 3GQCA 4CTAA 1NSPA 2HQFA 3RJMB 4OI2A 3H20A 2M70A 3C66A 1EX8A 2HPUA 3MGJA 3RW6A 2C2ZB 5K8OA 3G9CA 4DUTA 2B4OA 2XYPB 1G3OA 1ZYQA 2KT2A 4ZVGA 1S9EA 3UVJA 3PDNA 1DFDA 2BE2A 2GAGC 2DGOA 2U1AA 3F56A 4ZKAA 4JYAJ 1UWBB 1KP6A 3SEOA 1Y7PA 4O3OA 4LF5J 3MEKA 1O5JA 2RUSA 3R27A 2XNRA 1UJ5A 1VK3A 4WXWA 1TKXB 2V2VA 4ETXA 1XMBA 2B8PA 3KMQA 4A8KA 1QLNA 1WC4A 2A2DA 3ETOA 3KLFA 2IJNA 4DBQA 1UJ4A 4CYUB 2ILZA 4I68A 2XGPA 2HBQB 4E98A 3SDEB 1Q8BA 1F9EB 1FVSA 2ZNYA 4DL3A 1RLDA 1PJ5A 2GQQA 5HJXA 1YRTA 4P2MA 4WTYA 3OL7A 4DQQA 1N34F 4DR6F 4I2PB 4FYXB 3JYTB 4DUZJ 2E5HA 1UMJA 3FCHA 2B6AA 2R7SA 2WCXA 5F8LA 2IAJB 2ZD1B 2GVDA 3S6EA 1P8GA 5E7OB 2ZHAA 3KUGA 2RILA 3CCMS 1UEUA 7FD1A 1NB7A 2J6UA 1VS3A 2RF2B 4Z7YA 2BJ9A 3KK1B 3VQTA 5DM7Q 1OY8A 4LQ9A 4FVMA 4U6PA 2VU5A 4ECTA 2COLA 2E5GA 2Q1LA 2B43A 3V6KA 1HQUB 2YKQA 4Y65A 1SJ3P 1RT6B 2RT3A 3TUIC 2DR7A 1WC0A 3GCWP 2MQ8A 3JSMB 3RAMA 4OHZA 3D1OA 4E8UA 5A2QU 4Q0BB 1XMQF 3TVKA 1FEEA 1FDBA 4ZPBA 4WBFA 1REGX 1HIYA 4PYAA 1DQAA 3GPAA 5KFIA 1HHQA 4JBCA 3MM9A 8ATCB 5KFHA 2U2FA 1CS4A 3ET6B 1PAEX 4URSA 2GQ2A 1CULA 3ENVA 2V8DA 4WYWA 3BQ1A 2KU7A 5DETA 2JL9A 3NKYA 3NL0A 3HLUA 2CG4A 1FNXH 1U2RA 3CULA 1NPKA 1UZDA 1FTRA 5IXUA 4CDIA 1SC4B 1UP1A 4ZLNA 4ZITA 2NZCA 1ITPA 4UOCA 1RACB 2L3MA 4F50A 4EK2A 4C0BA 2JZ5A 1SJQA 2V9WA 5KOWA 4RLEA 2EC0A 5L1IA 3LO3A 2F8HA 4YR3A 3MAHA 5J1EA 1F9FA 4DDFA 2GQCA 4MK8A 2ZH7A 4DR7J 4IG3B 1X5OA 4YP3A 5HLFA 2YWEA 4ED6A 2J8AA 1EP4A 4CO3A 4DR3J 2X1GA 4KKOB 1PCAA 3F41A 1F0XA 2DO4A 1XEZA 1UL3A 1FRJA 4QIWD 3DU5A 1T3NA 2OP5A 3V4MA 2Y0SD 1WD6A 5K8NA 4QWDA 3TA0A 1BC6A 1D8YA 5LMNF 5KFQA 1JXEA 2OPPB 4MKYA 5IT4A 4WFAQ 1S59A 3QRQA 2K2PA 4H4KC 3BREA 3E01A 4QYRA 1IKXA 1ZAWA 4NZ0A 3EZ5A 3SBMA 4C8NA 4XO0A 5HQ8A 3LP1A 4QIGA 4LT6A 3JQJA 4CNZA 3M8YA 4DR6J 3CC2S 2OSQA 4I2QB 1Q8KA 4F8RA 3R3TA 1UCNA 3LOUA 3NNCA 1KBRA 3MECA 3PRBA 4EU0A 4ED1A 2DYAA 4YR2A 4HEA9 1PC5A 1HPZA 3LAMA 1LW0B 4W4MA 6AT1B 1VLOA 1AFJA 3D28A 4Y6IA 2B3TB 1TL7A 1P9YA 2IYIA 3LF0A 1DTQA 3O5TB 2E9ZA 4DV3J 2ZZTA 1JIHA 1EQMA 4OZ2A 2G1HA 2Z8QA 1NK7A 1S1TA 2Z57B 3BGRB 4TVAB 1FKPA 1N36F 2D41A 1WNEA 2I2YA 4B9UA 2EC2A 1RTJB 2HVEA 3UO0A 3IAM9 3ISNC 2HNYB 4LF8J 1FDAA 2DNYA 3AXMA 1FXLA 2ADCA 4Z2XA 3MMCB 2VBZA 3DXBA 3N5FA 2OPQA 3H7HB 3OSPA 3PX0A 2WW8A 3MM5B 3LW5C 1JXLA 4RW6B 3FEZA 1NDKA 2X1FA 1RHUB 4J9QA 1G4CA 1U6BA 2MXYA 1XTZA 2EK6A 4K4ZA 4KRWA 4P71A 3QRRA 4Y34A 2AJ0A 4PWDB 3G86A 4RL1A 2W9AA 3MZIA 4DPOA 3CCLS 2RE1A 2QMXA 3IWNC 4ZVOB 3MCSA 3UN5A 4F0HA 1VQ5S 2ZZMA 4K4WA 2XM3A 2F3JA 3M2UA 3T5KA 3D3CJ 2AIRB 1HNIB 2A2CA 3RZAA 4PQUA 2VZ9A 9RUBA 2N3OA 3CCSS 2F9JA 2RAQA 3DMJB 2PI5A 3MM8A 3E2EA 1NXIA 2BJEA 3BZQA 1FDDA 2BOAA 3W2WB 1PYOB 3M8PA 4FXDA 4TKTA 3PR5B 4X64J 4GKKJ 2CA9A 2DCLA 1TTHB 2JNJA 1RT7A 2VF3A 3W5YA 2ATLA 1E6VB 2MZQA 1HBNB 4EYIB 1NPRA 4KFBA 3G82B 1RWWB 3Q8YA 2ASYA 4OI1A 4RNNA 4LSZB 1U1QA 3HT3A 4NLDA 4G1QA 3KNGA 2UVWA 1U2CA 5DG8A 4R0JA 1M5PC 5D0RA 4ZP8A 4C8ZA 5E3AA 2M0GB 3KTQA 3HHLD 5AE2A 3LGMA 1IJEB 1PJ7A 1O0PA 3JB9k 3ZZUA 2IJFA 1IKVB 3GFYA 4ZP9A 3PJXA 2BEFA 2HHSA 3DLLQ 5J2MA 1FJ7A 2XYHB 3CC4S 1WTBA 8AT1B 1K0VA 2HG4A 1MU2B 1KHVA 4NCGB 4KQZA 2OH2A 4MIAA 2HFSA 5DZ6A 4TLQA 5KFEA 1XR6A 1HHTP 4Y3CA 2P6TA 1U8SA 4CLLA 1TFWA 1UETA 2EFGA 1NU4A 2RD5C 2E1PA 1QUVA 3JAMU 4B3MJ 3I9V9 1YJ7A 2ASLA 2C3UA 3KDOA 4USKA 5EWGA 4LMZA 4NLSA 4B9SA 3HVRA 5B0CA 4JI5J 4NRTA 1H73A 3GFXA 3P4UB 2QYGA 4TYAA 3QPIA 3C8YA 2Z2ZA 1WEYA 2Z2MA 1U45A 3W63A 2ABYA 2NS1B 3DOKA 1RISA 2HW3A 2ZE2B 4F0MA 5C7PA 1AXQA 1HFEL 2RDJA 1JMTA 1SIZA 4LRCA 5KT4A 5EWFA 1HMVA 3ELHA 2RDIA 3ZNUA 2HK3A 3JTOA 2JLFA 4KHRA 3QAUA 1Q78A 3A13A 3M9NB 1NM2A 1IN0A 1YQHA 2HNZB 4LFBJ 1X4BA 4ZJLA 4ITSA 5K5MA 4M5LA 5IFMA 1G6BA 1HWLA 1ZTTA 5E41A 4NLYA 5RUBA 3EGVA 4JI4J 3I87A 3O3LA 5CHCB 4LF7J 4X4RA 3TX0A 1TELA 4NLPA 4EZ6A 1LW2B 1S7IA 2IYGA 4HYKA 3WHIA 2BXJA 3IRXB 1X4EA 4RPFA 2H5EA 3KK2B 2RRAA 4EEYA 1LWEA 3ENWA 2QIFA 1UVLA 3MD3A 5CZVA 1CJTA 4WFZA 3PKYA 1X9MA 4ID8A 2K7KA 3ULHA 2O01C 4ZP6A 4TQSA 4B17A 2HAIA 3DM2A 1WKKA 1P27B 2LXIA 1UW4A 5K14A 2FHJA 3P49B 4Q2MA 4JV5F 4A48A 1HBUB 2CQ1A 3GONA 3QMQA 2DD8S 2QFJA 1KN6A 4OYZA 3QZ7A 2WVBA 1SH3A 5K9FA 1OQ3A 4DQIA 4ZLLA 3KG4A 1NUEA 5CQGA 1FI4A 4DV6J 4M94A 2UXDJ 5HVHA 2GIQA 2G0IA 3SI8A 4TY8B 3VWSA 3LUYA 3OVAA 1FFWB 1ZM3A 1QE1B 1VJQA 4PPZA 3GYGA 4QWEA 4YY3J 3CTRA 2PI4A 4JI3J 2HQCA 2PIIA 5F8HA 1JKHA 2LEAA 1GTHA 4K50A 4B3OB 2R7WA 1H7WA 2YKNB 2YKPA 1WC6A 4MKAA 3AY0A 4FS1A 2OPRA 2CPDA 1Q5VA 1ZZFA 2HRUA 3C3LA 5EDWA 3NAHA 2NLWA 4KJIA 4IFVA 3G6VA 2Q79A 2DR9A 2CAJA 1H0HB 2AMCB 4GO5X 4OV1A 5B0AA 2JRSA 2F4VJ 2HMIA 4ETZA 3QWUA 4NASA 3BB5A 2LDIA 2D3O1 3J81U 1S6UA 1RB0A 2HGLA 2V50A 3PNIA 4K4UA 3I55S 3T9NA 2AJ1A 4GC7A 2PT0A 2NR0A 3QWPA 1RQ0A 1X0PA 2P2CB 3VF0B 3CD6S 4QU7A 4DFPA 1NRKA 3I9ZA 3ZTQA 3DDKA 3B78A 4YHHF 1K73T 1I3OB 3M2RB 1S99A 1UWAA 2OGUA 4ICLB 4KHMA 3BS9A 2JFKA 2RSQA 3OFFA 2WOMB 5CCMA 1WKLA 4WIIA 2GJ2A 4J7CA 4F4XA 2VFRA 4R8UB 1UFKA 3KLVA 3V4IA 1B7YB 4CM0A 2VJUA 3DLJA 1IBLJ 4I4BA 3UDCA 3SFGA 4OLPA 1SKWA 2D74B 3CJQA 1S0OA 5IC4B 5KFBA 5A0YA 2C3PA 4UTGA 3L7PA 4TXSA 1X4HA 4N41A 4KE5A 1MROB 5GVQA 4I64A 2GGPA 3KXDA 2HFUA 3T9ZA 3B4MA 3QRPA 5C24A 4D3HA 3CEDA 2MYFA 2VD3A 2B4VA 1U49A 1KVKA 2CZVC 2I1RA 2PMZD 2WZ1A 1ELOA 2ZJPQ 1OY6A 2EG2A 1GEHA 5FIIA 3TVYA 4FVCA 3T6JA 1DY3A 1MWZA 1MWYA 5B7WA 4YB7A 4NA2A 1VDHA 5FD1A 1RDRA 5EHHA 3ZZRA 2R2SA 2W9CB 3DKDA 3W9HA 1WEXA 3MEEA 1MWQA 1IWAA 3M32B 1Q81T 3F73A 2YTCA 5AJ3F 1RHMB 4DV0J 3M30A 3V81B 3CJRA 3MUVP 4OX8A 3V6DB 4URGA 4K0KF 2MKCA 1KOHA 4F4YA 3OTDA 1CJKB 4ED0A 2E5LF 1JLAB 3UCZP 3NG8A 1YVFA 3POTA 5IT9Y 2PA3A 1TV6A 2J8SA 2DEJA 3MEGB 3D1HA 3J7AN 4ECVA 1VMBA 4IRCA 1VK8A 3IS9B 4WXOA 3TYTA 2YVSA 3QJLA 4NXNF 2DGXA 3VAKA 2VODA 1T94A 2OSRA 4UUXA 4G6VB 1FTCA 4NLRA 2H4WB 4LFAJ 3EZUA 3WX8A 3CDWA 2LECA 1TL1B 3GR1A 1JJHA 3A12A 3PRVA 1NZ8A 2FLPA 3SV3A 2VPWB 4OHWA 2AJFE 4KH1B 4N8OA 2RHQB 2VASA 4B9TA 5H9FK 2XI3A 1HNZJ 5LMUJ 6FD1A 2VFUA 3NGDA 1LWFB 3T5HA 3EE3A 4G1IA 3KWMA 2MZ1A 2MB0B 3PHTA 3NGSA 2GMLA 1BD6A 1KC8T 4B9NA 1LOUA 2EG1A 2XMWA 4GVBB 2KTQA 3SSRA 2ZBIA 4XPCA 2YNFB 3VVUA 2KDOA 2LXUA 2ZEJA 3SCKE 3T1YJ 1SV5B 4Q2LA 2F8EX 3UW1A 1DQ9A 4ZVFA 2W9BA 1F9HA 3M05A 3LP0B 3LA0A 3I82A 4RW8B 5J1NA 1OSDA 2C2KB 4C8OA 4QYZJ 2AZ3A 3MI7X 1N5YA 5ADZA 2DO0A 4TU8A 3AOAA 2L9DA 2XQCA 2XSJB 2XG8A 1TL3A 1SUQA 2DEIA 3FCWA 2JSXA 4UQGA 3QO9B 2AYGA 1Q53A 1NJWA 2KH9A 2QSWA 3C2PA 2EFVA 4RJVA 3CMQA 1NMEB 3JQKA 4C8MA 2M5YA 3B82A 3TOQA 2E5IA 1P9QC 2VOOA 4KGZB 2VICA 1GMWD 4KV8A 2HNDB 3H4BA 5I42B 2ILYA 3VAJA 4MT1A 3R5GA 2NXUA 2XBPA 1VQNS 1JJ2R 1HQEB 2GX8A 2RRNA 3CGIA 1IWGA 4EI2A 2XMJA 3LH2S 5L1JA 2DNPA 2PGCA 1C1CA 2N82B 3HULA 1KVJA 2FC9A 2HBRB 2WSCC 3GIJA 2ASDA 1FVQA 3ISND 3L7UA 1WG5A 4IOCQ 2Z30B 1S9EB 1REVA 4PRFA 4NXNJ 2C3YA 5T7LA 3W61A 5I4MA 2BE2B 3PIOQ 3VAIA 1HKAA 3D2WA 5H9EK 3M1VA 1UZHA 2B8QA 4LQ3A 2PEBA 2HHHJ 2JDJA 2PC6A 4A8SA 2NUUG 1R27B 4F0KA 4NYPA 1FWLA 3OTOF 2OMOA 4DXLA 2CNLB 5KT7A 1S48A 3WIVA 3OQ2A 4CH0S 1Q7LB 3HSJA 1Y9OA 1FEHA 4V19J 4CLPA 1RE1B 3AOCA 1X4GA 4DLEA 3OFGA 2DGVA 4HVZA 1PKUA 3BR8A
chains in the Genus database with same CATH topology
2AV5A 3GIMA 2VUGA 4YOEA 4BC7A 3KFWX 4FNIA 4MYTA 3PEHA 2J9DE 4MH8A 3TW0A 1FJCA 5CYQB 2VG5A 4ZCMA 2KM8C 2APOA 4DOZA 3FMBA 1IKYB 2QRRA 1DRZA 1Y5LB 3EPGA 4DQRA 2VQEF 2VPZB 1S97A 3SCIE 3BGFA 1SH2A 1J2VA 3RAQA 1U24A 2BVZA 4QR0A 4DV4F 2FGOA 2JVRA 5J1PA 1P1TA 1T8EA 3J7A1 4K4TA 5E3RA 4N77A 4O3PA 4K4YA 2Z2LA 4FPRA 2WSFC 5IWAF 2XHWA 1FRXA 5T14A 2OD6A 1NHUA 4WJBA 3W7BA 1VI7A 4BS2A 3LQVA 3PO4A 2LQBA 3T5LA 1X4FA 3DLKA 3CF5Q 1C4AA 5C25B 3PX6A 3DC2A 1HWJA 3ONQA 3DRYA 1VHFA 3UPFA 5KFYA 4ZS6A 1S0NA 5IS2A 3G6XA 2RS2A 3CDEA 3MHYA 3DLGB 1UA0A 1I6JA 1S6OA 2V94A 2CDQA 4LFAF 2ZKUA 2ZKTA 1VQKS 5MAOA 1PSDA 3OPKA 1HWIA 1H7XA 2XZWA 4JOUA 1OIAA 4Q7AA 5DRKA 5C42B 1RT2A 1O8BA 5D4NA 3CJKA 3Q8RB 4FF4A 4W92B 2DJWA 1YG0A 2GHPA 4DSLA 2CPIA 2AWZA 2CQBA 4Y0FA 2XCAA 2VOPA 2FVCA 3WX4A 1FRLA 4TYBA 2DR8A 3OVSA 5KG1A 3TUZC 3KJVA 2PEHA 3GIKA 4NMLA 1S1WB 2DHAA 5H9EJ 4OZJA 4LF6F 2C3MA 4JV2A 3M8QB 1HMVB 4FZVA 1N88A 1UKUA 2EK1A 4TU7A 1YRUA 1SL1A 1VLYA 2BV3A 3MXHP 1Q16B 3V5RA 5KOXA 1HNZF 5LMUF 1IKWB 2L9NA 2FUG9 2A10A 1U1NA 3MFHA 1BGXT 3M8RA 5GAGU 4DN9A 4JV0A 1VJWA 4CO4A 2EBGA 1WG1A 2YNFA 3RRHA 5D4PA 2VG6A 3RB0A 1XNQF 1MNEA 2XEXA 4AQYF 3L7OA 3Q22A 3NCQA 1GTEA 3J80Y 4PXCA 5FDLA 2HNZA 2ZH6A 3CPWR 2FDNA 3K5MA 3K5LA 5EX3A 4LJMA 2FJWA 1U7LA 3U1MA 4Y28C 4ELUA 2AQ4A 2EFNA 5EWEA 1TZ0A 1GNKA 2V4RA 3DLBA 1XNRF 2YKMA 4LF9F 1YSJA 2XLKA 5B0EA 1Y5IB 4O3RA 2PSZA 2XS7A 1NHVA 4MK9A 2XMVA 3FMWA 3BO3A 5J2NA 2KT3A 3M6WA 3LP0A 1URRA 3H59A 1RT5A 3SQGA 5DLFA 3C6UB 3NNHA 5F9NA 4RW8A 1UVNA 3QGHA 4JUZA 2L41A 2JLGA 4B9LA 3MM9B 2VG7A 3OXGA 4YUDA 1CLFA 2R7QA 3HVWA 4X84A 2QLWA 3DRSB 2HS3A 1B7FA 1Q8LA 4NLOA 1FRMA 4R25A 3VAMA 2CQCA 3FRYA 4CO0A 1UJ6A 4PUOB 3CO9A 1FESA 5KFTA 3T1YF 2KRRA 4LIWA 2KM8B 2MZRA 3FFIA 2W7AA 4GO7X 4PXBA 4ERDA 3G71S 1L3VA 4DL2A 4N47A 4RKUC 5KG6A 4NLGA 3KHLA 4NYZA 2C28A 5KFPA 4X65F 2CQPA 2RIJA 2ZOMA 1QVFR 1KFSA 1L3UA 2EKYA 4H4MB 4EBEA 3ZZTA 4DUYF 3OR1A 3QO9A 1VIXA 1S1XB 5L39A 4PPDA 4C3KA 1F5CA 3KLEA 1N5TA 3LP2A 4Y2CA 3UD3P 5KFOA 1TFYA 4X4TA 1VQOS 4F2SA 2LCWA 4QW8A 1WI6A 2F1FA 1KLNA 3UCGA 3V6JA 3RBDA 5DG9A 3DRPA 4K2XA 5HL7Q 2LDYA 3I32A 5EX0A 1IM4A 2YX4A 4ES2A 4O44A 1YHQS 3HF5A 4LFCF 2LU2A 2BDPA 2Z0GA 1JK9B 1BWEA 1JLBB 3M9OB 3US5A 2EFOA 2CQ0A 1JLQB 5I42A 2MSTA 1B0TA 3H2UB 5DQIA 5D78A 1GX5A 4LSLA 3DM2B 5KFXA 2QSFA 3UCUP 3GQCA 4EWTA 4CTAA 2R7UA 3DDNA 1PO6A 2POKA 4FF3A 4K59A 5K14B 4YQWA 3J7YI 4XIUA 4DG1B 3GFHA 5FJ4A 1EP4B 4ECRA 4OI2A 1CVJA 5BR8F 3MFIA 4JI2F 3FSIA 2VA2A 3H20A 2IRYA 1FKOB 2M70A 2J0WA 3C66A 4YB5A 4B3RF 4X4OA 2KZMA 1FJGF 1KRPA 4K4XA 5B08A 1U25A 4K5SA 2W7PA 4KR0B 1Y4ZB 2E1AA 2HPUA 4C7QA 1APSA 3T6BA 3R5AA 3HKWA 2MHNA 3MGJA 1ZM9A 1HYSA 5CYMA 2ROEA 3OSNA 3RW6A 4DS5A 3SXLA 5K8OA 3G4SS 3G9CA 1W2BR 3BO4A 3DHXA 1PGZA 4KGKA 3HM9A 1SJ4P 3BJYA 2DNKA 2B4OA 4C0HA 3JAMY 4QWCA 1U1LA 1IUJA 1G3OA 1ZYQA 1H38A 2ZFHA 4C8KA 1FE0A 2KT2A 1TKZB 2RQMA 4ZVGA 3HHLA 4J9KA 4Q45A 1RTIB 2LKZA 1S9EA 3H2LA 2O3DA 1RP5A 2ZHOA 1FF2A 5ITHA 2MY7A 3PDNA 2C2EA 2XB2D 3B4DA 2R2TA 1J5OB 4RW7B 1DFDA 1QE1A 2N3LA 2R7OA 4DR1F 2GNKA 5F0UA 2NPFA 1TAUA 4RUHA 5HO4A 2BE2A 3OLBA 4WE1B 2FHOB 2DGOA 2U1AA 3F56A 4ZKAA 4LUBA 3Q0AA 1UWBB 2O1PA 3MTKA 4NX9A 2M3DA 1JKHB 3OTBA 4HTIA 3SEOA 2J7KA 2VBWA 4ED7A 3LP1B 1K9MT 2AGPA 3TA2A 1Y7PA 2MHEA 4O3OA 3MEKA 4ECSA 1C2PA 3UQSA 1N4LA 1O5JA 2WAQD 3R27A 4J9NA 2XNRA 1TVRB 1UJ5A 4DSJA 1VK3A 1WHWA 3PW0A 4WXWA 1TKXB 1S0VA 1A9NB 3IGVA 3T1HF 4ETXA 1XMBA 1T05A 2UV8A 2L08A 3KMQA 4A8KA 4TQRA 3LWMA 1QLNA 1RTHA 2AU0A 5B0FA 2A2DA 4OHXA 3GG1A 3PX4A 2ALZA 4IFVB 3IC1A 3ETOA 2PFFB 3KLFA 2IJNA 3MECB 4QU6A 1Z4UA 1S77D 4DBQA 2GCFA 3G8QA 3H5UA 3VQSA 1UJ4A 4OJGA 2JC0A 2R8KA 2CFXA 1JWWA 4ELVA 2ILZA 4I68A 4J9RA 2AGOA 2QLXA 2HFZA 3GR0A 2XGPA 2HHHF 3HHNB 4E98A 4YDDB 2DHXA 1HPZB 1U2FA 4JV1A 3E8OA 3SDEB 2HMIB 1Q8BA 4ZP7A 2XNQA 1IQZA 5DLGA 1SJRA 3ZZOA 1FVSA 2ZNYA 1OQ6A 4DL3A 2B0GA 3EGNA 3QIPA 3CCTA 5KG3A 4IQMA 2BBEA 1DTQB 3VZIA 5KG5A 3L95X 2GQQA 3M9MB 4NLVA 1YRTA 5J2PB 2YNIB 2XSFA 1TL5A 3ZZYA 3MOJB 1XN9A 4HHJA 4OMFG 2B9WA 3PY8A 1S1TB 5CYQA 1HNXF 1HBMA 4WTYA 1IKYA 2B7BB 3ITHB 3OL7A 2UUAF 2R8GA 4DQQA 2DH9A 1N34F 1KSPA 5GAHU 4DR6F 2ZDOA 1E6YA 4I2PB 4ED8A 1FKPB 3JYTB 3N4WA 1X4DA 2XMMA 2E5HA 1MMNA 1UMJA 4IRKA 1C0TB 2E44A 3FCHA 3BM7A 2YH0A 1WG4A 2B6AA 5BJRA 5HN0A 2R7SA 2WCXA 4A8FA 3I5BA 2F8MA 5F8LA 2IAJB 3C6TB 1VBXA 2DNGA 2ZD1B 2I9SA 3EGWB 5JVGQ 3KG1A 2CRLA 2WBRA 3S6EA 2JFDA 2DGWA 1P8GA 1BQMB 4DQSA 5E7OB 2ZHAA 1UAWA 2DITA 2RILA 2RRBA 4B08A 3O44A 3CCMS 1UEUA 4C98A 1R31A 3RU0A 7FD1A 1NB7A 1CEZA 2J6UA 3NS5A 1VS3A 2XLIA 2Q6CA 2RF2B 1WHYA 3DLGA 1T95A 2N4CA 4DF4A 3OVBA 4BHQA 3KK1B 3VQTA 4QZVB 1HHSA 5DM7Q 1GXUA 4LQ9A 1RT4B 4BDPA 4FVMA 4NPOA 5C42A 5KFDA 2HHWA 4U6PA 2FHMA 4I7FB 4ECTA 2DNZA 4WU3A 5KFCA 5KFUA 2COLA 2E5GA 5B09A 1S1UB 2Q1LA 2WTFA 2W4CA 4J9LA 2JH3A 1S1WA 3M2VA 2PD1A 2BQ3A 2B43A 3M8QA 3V6KA 2FB0A 2YWKA 4ICLA 4DR2F 1HQUB 4CH1A 2YKQA 1VIOA 4Y65A 2DGTA 2WK4A 1SJ3P 1KQGB 1RT6B 2CQDA 3CDAA 4MTPA 3H40A 1IKWA 4QWBA 3NRBA 4DHVA 2RT3A 4X66F 2I0XA 3JSRA 3JSBA 2GJIA 3TUIC 2BABA 2DR7A 5DS7A 1XK8A 2FY1A 4I69A 3MR3A 1HI1A 4IR9A 1FD2A 2LA6A 3RB3A 3JSMB 1NKCA 3ZZ0A 2ZHBA 5MLCV 3GYNA 3RAMA 3OUYB 3EPIA 3BDEA 4OHZA 3D1OA 4E8UA 4Q0BB 1XMQF 1M0SA 3TVKA 2PE8A 4EO6A 1FEEA 3OJSA 4OX9F 2QV6A 4R8UA 4RNFA 4JI1F 4ILLA 3ZZPA 1FDBA 2RUGA 4PR6A 3UR3C 2I8EA 2R7VA 2OKQA 4ZPBA 1YIJS 4FNHA 5DGAA 5GAEI 4KAIA 3KLGA 5J2QB 1DQAA 5KFIA 2B4PA 1I1GA 2J5AA 3C6UA 3P96A 4J5OA 4M1KA 4JBCA 3MM9A 5KFHA 1VRUB 2U2FA 2C3OA 3OXFA 3OHBA 2CQIA 5IM0B 3Q8PB 3DRSA 3OV7A 4URSA 2GQ2A 2A3JA 3THPA 3AB4B 3ENVA 1JLEB 2V8DA 4WYWA 5KG2A 2KU7A 3CB4A 5E3PA 3BQ1A 5HROA 5DETA 2JL9A 4PUOA 2D7SA 1WELA 4JI7F 2AYMA 2V4JB 3NKYA 3NL0A 2GGPB 3HLUA 2CG4A 3AB2B 3J7Z5 4DL4A 1FO1A 2GW8A 1RA7A 3IR5B 3S8SA 3W3SA 1IJFB 1D9AA 1SBRA 1JLCB 1U2RA 1V3ZA 4H54A 2J9CA 4NWBA 2RU3A 1FNXH 2OTLS 3CULA 4OLOA 1K8AT 1U47A 3RTVA 1FTRA 5IXUA 1BLUA 2KYXA 2VV5A 1UP1A 2BANB 2MKSA 3W2VB 3ZC4A 4I6YA 1YI2S 2M9KA 2PMHA 2YH1A 4IDKB 3MMAB 2LQ5A 3WDOA 1DJ0A 4L3NA 2DIVA 4LVNP 3MM6A 2B5JB 2B51A 4UOCA 2L3MA 4OI6A 4FN5A 1RTDB 4F50A 4YEAA 2W25A 3I4HX 3UWTA 4C0BA 2JZ5A 1SJQA 5KFVA 3N79A 4HDHA 3WBZA 5KOWA 2V9WA 2HHPA 4RLEA 3SCLE 2HVZA 1RWUA 4MIBA 3M8PB 3H25A 2KT5A 3GB0A 5L1IA 3LO3A 4UY85 2HQIA 2EC0A 2F8HA 4DL7A 1QSSA 5KFLA 4YR3A 1MMDA 3MAHA 4DL6A 5CXTA 1PILA 2LYVA 5D77A 3LANA 5J1EA 1F9FA 1JLBA 3BN4A 4X4NA 5E3CA 1NH8A 2CPHA 4DDFA 1JLQA 2IM3A 3OFHA 2GQCA 4MK8A 2ZH7A 4X4VA 4IG3B 1RT7B 1X5OA 4RU9A 2FC8A 4YP3A 5HLFA 2YWEA 3N6MA 2FPHX 4A4JA 3TAMB 3EGZA 3Q2SC 4CO1A 4ED6A 4V19X 3MPYA 2GMHA 3RBEA 5IZHA 5K8MA 2W24A 3D5MA 1NNDA 1U09A 2J8AA 4DG1A 1N5SA 2MQPA 3UD4P 1EP4A 1NJYA 2FVSA 1C0UA 1S6QB 2VBXA 4CO3A 4HKQA 2X1GA 3TX8A 1FKOA 4KKOB 3F41A 4DQPA 3HMJG 1F0XA 2RNEA 2DO4A 1XEZA 3MEEB 1UL3A 4ZMMA 4DLGA 3J81Y 4K4SA 2W7OA 4OI3A 1FRJA 4IRDA 2OD4A 3OBIA 4QIWD 2WONA 3DU5A 4FXWA 1T3NA 4G1QB 3A1YG 2OP5A 3V4MA 3MAQA 2Y0SD 1WD6A 1VQYA 5K8NA 1LKZA 2VQFF 2KFZA 2YWFA 1M5VC 3M30B 1S9GB 4QWDA 2IC3A 4QPTA 3TA0A 1BC6A 1D8YA 2YQ3A 4KT0C 5LMNF 2PN6A 2KKHA 4RUCA 5KFQA 1YTYA 1JXEA 1XBWA 2OPPB 4OX7A