1FEEA

Crystal structure of copper-hah1
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
67
structure length
67
Chain Sequence
PKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COPPER TRANSPORT PROTEIN ATOX1
publication title Structural basis for copper transfer by the metallochaperone for the Menkes/Wilson disease proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 19
structure length 67
sequence length 67
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1feeA00
1OQ3A 3IWLA 3MCSA 4OIXA 2FB0A 2ROPA 3HDSA 2OD4A 1VQYA 1X7VA 4DN9A 3LGMA 2OFGX 2N4CA 2VV5A 1Y3KA 2QYCA 2ROEA 1N5TA 2BBEA 3UDCA 1OPZA 1YJTA 2IYIA 1IUJA 2RMLA 4OJHA 4U9RA 1YG0A 1N5SA 2ROGA 4HI1A 2W4CA 1R6YA 2VH7A 1JK9B 2KT2A 2RU9A 2K1RA 2OFHX 3KG0A 4A48A 2XMVA 2GGPB 2XMUA 4HI2A 4A47A 5A6PA 1Q8LA 3TNVA 1Q4RA 4Y2IA 2K1RB 2OP5A 1N5VA 1QUPA 2IFXA 3GZ7A 4HL9A 2W4PA 2G9OA 3FGVA 2AP6A 3KNGA 3DCAA 1X8DA 5B09A 3F44A 4FNIA 2CRLA 1TL5A 4DPOA 1KQKA 2AJ1A 3E8OA 5K9FA 3QGPA 1XBWA 3FMBA 2K2PA 2OD6A 3WDOA 1FD8A 3BN7A 1JWWA 1KVIA 2FTRA 1GXTA 4OJ1A 2GGPA 2IYGA 4OJ3A 3HHLD 4YDXA 2BYCA 3BDEA 4ZOSA 5T7LB 2LXFA 1S6UA 2XMTA 3IWXA 4HH0A 1ULRA 3K7RA 1U7LA 2GO8A 3LO3A 4A4JA 1P8GA 2HLUA 1MWZA 1RJJA 1CC8A 1FESA 5B0BA 3BF4A 4OJGA 1X0PA 2FHMA 2PD1A 1FVSA 2BUNA 3KKFA 5B0GA 1Q53A 1FEEA 2HFNA 4Y2KA 2LQ9A 1VQSA 2XMJA 3I9ZA 4FNHA 5B0AA 1P6TA 5B0DA 5B08A 2KT3A 2HQIA 1TR0A 2K7JA 1YJUA 2AJ0A 2BJEA 2RILA 3BGUA 5F0UA 1KVJA 4Y2MA 2AW0A 1Y9OA 4DL0C 1S6OA 1W2IA 5T7LA 1SI9A 3KG1A 1SQEA 3BR8A 3DXSX 2ZDOA 2ASYA 2LQBA 5B0FA 5KAKA 1APSA 3HFKA 4HH1A 1LQ9A 4ZA1A 2HIQA 1SB6A 1TUVA 1TZ0A 2LDIA 2PGCA 2QLXA 3HHLC 3HHLB 3HX9A 4QOTA 4YEAA 5IXUA 4A46A 2EW9A 2XMMA 1FVQA 2GCFA 3LGNA 3CJKB 3TRGA 1YRXA 4EFAC 2QIFA 2BJDA 3HF5A 1K0VA 4NPOA 2XMKA 1TL4A 2FIUA 4NL5A 2OAUA 1FE4A 1Y0HA 2ZDPA 1OQ6A 1AFJA 2QLWA 5F0WA 5B0EA 3FRYA 1GXUA 1MWYA 2KKHA 1N5QA 1FE0A 1CC7A 1OSDA 2JDJA 2RSQA 3BB5A 3MZIA 4F67A 2K7KA 2XMWA 5B0CA 1YJRA 2W4DA 3T9NA 2ACYA 2HFOA 5A6WA 1V3ZA 2GV1A 2GA7A 2GFFA 2OKQA 2OMOA 3HHLA 1WD6A 2L3MA 3TOQA 1Q8BA 1YJVA 3BM7A 1AW0A 2N7YA 1CPZA 2HLTA 4Q2MA 2Q3PA 2KYZA 1Y3JA 3CJKA 3QMQA 3VTIA 1AFIA 4Q2LA 2N4DA 1URRA
chains in the Genus database with same CATH superfamily
3M9NB 3LA0A 1WC6A 3SSRA 3Q0AA 5BR8J 1F5AA 1BWEA 4TU8A 1E6YB 4B3OA 5H9FJ 2KN4A 5K14A 2UVVA 1BQXA 2R7RA 4FNIA 4DPOA 3H4BA 3E8OA 5ETSA 2YKMB 4DEZA 4OJ1A 4ZJLA 2AU0A 3Q2TC 5ETLA 2FVCA 4TXSA 2MMYA 3TVKA 1HQUB 2DBBA 4MMOA 2AW0A 1W2IA 4C0OC 4EYIB 1U49A 2KG1A 3PJ9A 2CNKB 4YEAA 4H4OA 1S7IA 1R8AA 4TU7A 4I64A 3CEDA 4DSKA 4LBIA 4QR2A 1DTTB 2HVDA 4F04B 1LWCA 1N48A 1WORA 3MEDB 1IJFB 1TKTB 1NUEA 4WWSA 1AW0A 4RNNA 1W25A 1Y10A 4IYQA 1S12A 1W26A 1W2BR 3HDSA 2ADCA 3A4TA 3L7PA 2DRDA 4M94A 1QAYA 1RSCA 4NLUA 3FCVA 3H40A 4JUZA 2JWNA 3MECA 2MKHA 5E3RA 2CPXA 2CPFA 1TKXB 5CYJA 1WHVA 4QJVA 1V3SA 1NPKA 3CD7A 2DPIA 5K9FA 1WJ9A 1SKRA 2LP4A 2E9TA 3PX0A 2VDIA 1HHTP 3R5JB 3HJVA 2FJDB 4I7FA 1CQNA 3D1QA 2VASA 4FBUA 3RBDA 3PX6A 2FHJD 3DYAB 1GT8A 4J9KA 1FKOA 3AD9C 2DGXA 3SIPB 1KQFB 3CE8A 1U1LA 4K2XA 3IAS9 3V6DB 5DRKA 1FRIA 1NHKL 4OYPA 1CBKA 4A46A 4KJIA 2Z8QA 2F4VJ 2LMIA 2CZ9A 3VWSA 4LFCF 2B3TB 2P6TA 2CNLB 3IRXB 3NY0A 4LBPA 1R8CA 3SCKE 1H7WA 1G4CA 4J9UE 4NXMF 4Q2LA 1X7VA 1FF2A 3J81U 3D1HA 2GMJA 4HI1A 4ZVUB 1U47A 1XR7A 2MHEA 4I6WA 3LW5C 5J1EA 3PRDA 4RW6B 2D3ZA 2UZAA 1UL3A 1NDKA 3OV7A 3KJVA 2XZTB 3SDEB 2MKIA 4OYAA 3SZ2A 4DV0J 4N8OA 2MB0B 1EKSA 4PXEA 1ZAWA 1NB2A 3W8GA 1O0PA 4NA2A 1DTQB 2BA9A 2WVCA 5HROB 1RAJA 2MKCA 1N33F 4DFMA 5J2MA 2OGUA 2KDOA 4DR6F 2K3KA 1MMDA 2V8PA 4J9QA 3KHLA 2V2QA 4EFAC 2MQOA 1X9WA 4ZPDA 5J2QA 3G71S 2HHXA 3BSAA 3DOKA 4GC7A 2B9EA 3CVKA 2N3OA 5LMNJ 3Q8UA 4M8LA 4WK1A 1RZMA 2XHCA 3CCLS 2EFNA 3K58A 3TP2A 4ZVGA 2XY5A 3IWLA 2ROPA 5IOLA 4FBTA 1N0VC 3C8YA 1JLGA 2HNDB 4WCEQ 3B54A 2OFHX 2OPPB 3X1LB 5BYSA 4IOBA 4QWBA 1RU1A 1YZ6A 4YFUA 5J2NA 1QD1A 3OL8A 4IH5A 1TVRB 1BWVA 5HBMB 1CG2A 2C3YA 3HHLD 2QA4S 4CM0A 4DL5A 2YWHA 1HYSA 4O3OA 2G1HA 4ZPWR 3CJSA 1LWXA 3NCQA 4WK3A 4N77A 4FS2A 2NPIA 4F02A 5K5MA 3D0HE 4XAKA 3T1HF 1RYRA 3QWUA 1R43A 3IM8A 4KH1B 2AD9A 2VIHA 3PV8A 2UUWA 1S1UB 1DAXA 3D66A 3MAAA 3QT8A 4ZPCA 2HGMA 1J5OB 4K7QA 2KYZA 4DUYJ 1XWLA 1IBMJ 3PM9A 2ZKTA 4OIXA 1HD1A 3ZZZA 1ICEB 5D0HA 3M8WA 5KG0A 2F8HA 5SZTA 3QSIA 3GLJA 3K57A 4DUZJ 4C48A 2DGUA 2PI4A 2M7SA 4Y2IA 1BHNA 2B51A 2R2RA 4R5PA 2A2CA 3D68A 5B09A 2XGQA 1DHMA 3THPA 2H5IB 5H9EJ 1TL3B 5DG7A 2PSZA 2DD8S 4NYOA 2GGPA 1JIHA 3G87A 1JKHB 1NK5A 1PILA 4HHJA 3SCLE 2RDDA 4USJC 1C2PA 1CC8A 1JXVA 3RGIA 1BC6A 3CW2C 5JMNA 5DM6Q 2YNGB 1A9NB 3T1YF 1P27B 3D6FB 4B9SA 3H42A 1UEKA 2YKNB 3PW0A 5EX0A 5BR8F 4ZA1A 3W2VA 2XMMA 9ATCB 5DLFA 2DH9A 4CCHA 2MY8A 3DGVA 3JYTA 4NZ6A 1MNEA 2UXBJ 1YBTA 4TVAB 3LF0A 2XC9A 3HHDA 3RAQA 4C11B 3RBZA 3VF0B 2R7XA 3VAKA 1MN9A 2BR0A 4ANEA 4R25A 1Y4ZB 4DR7J 1K47A 4ECRA 3NWRA 4ZP7A 5EWEA 4PWDB 3QBCA 4J9RA 4CLYA 2VBWA 3TAQA 3G82A 3IN5A 1U1PA 1JXLA 4GVBB 1HBNB 4ECUA 1UFKA 4UW2A 2R8JA 2V0NA 2A6OA 4E0DA 1Q7YT 1UJ6A 1X0FA 3WDOA 1N6QB 3H8YA 1RT7A 3CO0P 2XMTA 1QTNB 2HG4A 1UWBA 2H4WB 1VOMA 1SJFA 1WC0A 3Q24A 4FF4A 4ZVQB 3M9MB 1J5EF 2Q79A 3JXOA 1AXQA 4WTYA 4MKBA 1W7WA 2J9DA 3P6YC 3KLHA 1VQPS 5KFLA 4J7CA 2RE1A 2E1PA 4OHWA 4QWCA 1URNA 1VBZA 4NLVA 1AYEA 1TUGB 2IJNA 5F8GA 3TAPA 3WIUA 3N9UC 2HZVA 1N5QA 3BGRB 4YOEA 1TL7B 1RT3B 1VS3A 3ZFVA 1JLQA 4P75A 2I5JB 2DK2A 4ECXA 2BBEA 1JJ4A 2XLIA 3FQLA 3PACA 2DGWA 1ZETA 2KXHA 2AGOA 3QLHA 3M30B 2O5DA 5HQMA 4NA3A 2W2NP 1NDPA 4YMEA 5EN1A 1CJTB 3C16A 4AQYF 2E9ZA 5KFAA 3VVUA 1R3NA 5A2QU 2F4VF 1VI7A 2GO8A 1Q78A 3E01B 2G4BA 1IR0A 2FPHX 2Z2MA 5KFTA 3GV8B 5D77A 4A8MP 5HLFB 4RW9B 2OPQB 3GG0A 3FKBA 3QIPB 4CM2A 3BR8A 5BJRA 2FY1A 2FLNA 4X4UA 1VLOA 4FYWB 1XMQJ 2KVQE 1KWMA 3UDLA 4CQ1A 5KFOA 3K5OA 2YWWA 3KLFA 3PZPA 3QGHA 1SQFA 3CC7S 2VBZA 4K2JA 3FBFA 4J9NA 4TY8B 2XYPB 3GIRA 4B3OB 2PA8D 1HNVA 3C66A 4RO0A 4Q0BB 5K14B 2EFOA 4DV0F 3A8EA 2FB0A 2ILZA 4USUA 1F60B 4RU2A 2CZVC 2E5IA 3FSXA 3R5AA 1MU2A 2F8MA 4DV2J 3DU6A 3TJ9A 4QR1A 3DCAA 3NWGA 4AFFA 2GHVC 1G6BA 3PFEA 1NK7A 1C4CA 4G3IA 2C3UA 5ADZA 2C3MA 1SH3A 5M2RA 1M0SA 5DG8A 2UUCJ 1CJUA 3SQOP 4OJGA 1X0PA 4H4OB 4MKAA 1TKDA 2VODA 3M6UA 3UCGA 5F8NA 4Z7YA 3EPGA 1SI9A 1LWCB 4B08A 2QLXA 1F0XA 4FN5A 2B4OA 2O01C 3BKUA 4O3NA 2ZH2A 2AEFA 3PYFA 3HXMA 3RUBL 3MECB 4FKYA 4CLSA 5DQIA 2HLTA 4KR0B 3CJKA 2IRUA 4E98A 2DH7A 2HPUA 1VBYA 4HDHA 2VV5A 5LMUJ 2RUSA 4OYMA 5G0RA 4HR2A 5A6PA 1NCLA 4I7FB 2HMIA 2ILYA 3AT1B 4ZPVR 4X4OA 2I8EA 1R7IA 3WC0A 3QGGA 2FLPA 4B3RF 2KYXA 1TKZB 1TK8A 3HHNB 2YBVA 4NLQA 1MWZA 5KFSA 5DQGA 3EE3A 2FJWA 4B3SJ 3OFEA 4C3KA 2FVPA 2LQ9A 3ITHB 4DUYF 3KDNA 3WQPA 2HBQB 2YNFB 1X9MA 4GKKF 3EGWB 4O3PA 5A2QY 2GNKA 2EW9A 1U25A 2HVZA 4DUZF 4QPTA 4U7UD 1KC8T 4I69A 4ELVA 3NMRA 1UMJA 3M4XA 4JI5F 5GAEI 1KFSA 1SKUB 4Y3CA 4DU7A 1HI1A 2RRAA 1KTVA 5I3QA 2B56A 3MR7A 5K8PA 3MEGA 5J1EB 3NCRA 4KSEB 2R42A 3DXBA 4DQIA 2ZH6A 3FZBA 4ER8A 2HFUA 3BV8A 2JFKA 2XMVA 3KJVB 1DJ0A 3KDOA 4JI4F 3M32A 4OX9J 3O1LA 3PKMA 3BSOA 1K44A 1T11A 5J2MB 1NSKL 3V6KA 4DX5A 4FYYB 4FDFA 1S57A 1MMLA 3N5FA 2HHVA 4J91A 3FJ2A 4ZN1A 1WDTA 2IMWP 4J9PA 2HQDA 1GTHA 3BJYA 5J2QB 3FQKA 4QYZJ 3R6LB 4GMKA 3DOKB 4Y6IA 1WSVA 3DXSX 4DR7F 1JNRB 4KH0B 1LQ9A 2H3EB 4OQJA 3UNGC 5IXUA 1NPPA 4PYAA 2L08A 4MYUA 2PFFB 5DQHA 4RW8B 1X5PA 1SH2A 4FPRA 2HHSA 2QN6B 4B3MJ 1N54B 1LWFA 1OY6A 2G0JA 3LOUA 4P72A 5D8HB 2U1AA 1S0OA 2IVYA 1YJRA 3QT7A 4OZNA 4OV1A 3C6UB 1NJXA 1Q79A 4HKQA 4QYZK 1XTZA 1A6LA 1TTHB 4WFXA 5FLXU 2RRNA 2HNYB 3OXFA 2V63A 3GIIA 1NJIT 3W5ZA 1NK9A 4F4YA 4A8WA 4UZBA 2KI2A 2R7SA 1IN0A 3PHTA 2M0GB 2PN6A 2VDHA 3PYDA 1WG4A 3ENWA 1HYSB 5I3PA 3TA2A 4M5DA 2XSJB 2K2PA 3CJRA 1PO6A 4Y28C 3RRHA 2ZITA 4RKUC 3JQJA 3QO9A 1YWXA 3I5CA 1UFWA 2QYGA 3DOLB 5E5NA 2ACMA 1VYAA 3J7A1 1NZ8A 5LL6d 3TJ8A 2WZ1A 3MAAB 3AXMA 4QZVB 2I9SA 1MMNA 3MR5A 1ZM4A 3PY8A 2CKWA 4LF6J 2RSQA 1SC3B 5GAEU 1GMWA 5D4LA 3IG1A 4JOUA 1M1KT 2DNMA 4USWA 1NO8A 4R5PB 5KT5A 3JSRA 3LP1A 3J7ZT 4K4WA 5K8MA 4DN0A 3KMSA 1SIWB 2GGPB 4U96A 2RT3A 3OHBA 4I2QB 2C1EB 4ES2A 4RL1A 2HVEA 2V67A 3KFWX 2LU1A 1XMQF 4N7TA 2RF2A 5H1SV 2AQ4A 1LWEA 1ZOTA 3FFIB 2GJIA 4X66J 4ED3A 1EETA 1X60A 1LW2A 3MEEB 1ZM2A 2HAIA 3W2VB 4CO0A 3W5YA 2MJUA 3E51A 1Y5LB 4ELTA 4AXJA 1I6JA 4A8FA 1FDBA 2CUYA 3BN4A 3JYTB 3O44A 3SV3A 2W2OP 2ABYA 3SQGB 2ZWPA 2DKOB 4NEYA 1TUVA 3HHLC 3QPIA 3D7SB 5LM7E 4ZLLA 4DV2F 2BE2A 3H7HB 1NKCA 4FF1A 2DGSA 2CWKA 3H90A 2CNOB 4Q8FA 1T03A 1RAAB 1FWKA 3UD3P 2P9CA 3KXDA 2W7OA 2HKEA 2F63A 5DZ7A 3EVWA 2UUCF 4M5LA 2N3LA 1D0EA 2CIMA 3R2CJ 4A8XA 4ID8A 4C97A 1RT7B 3ZZ0A 3POTA 2AKWB 4ZVRB 4KHMA 4IH7A 1FXRA 2P2CB 3NG8A 3MM9B 4IFVA 4LR7A 3ILJA 5KFRA 5ETRA 3UI3A 1WEXA 3H59A 1T0TV 4DPTA 3U02A 2YH0A 5GADI 4H4KC 3WX8A 4N76A 5KFMA 2AJFE 3ZTOA 1SUQA 3B6BA 3I9ZA 1DQ9A 1U1QA 1IQZA 1JJ2R 1BXNA 2VONA 1UW9A 2BJ7A 4NLPA 5LMUF 3CXCR 2HIQA 1TZ0A 1UZDA 1CQMA 3C15A 1ZA1B 4YR3A 2DITA 3NEKA 5K8NA 4USKA 2BJDA 2FC8A 2XY6A 1FJCA 1JLQB 4UT4A 3HFZB 1X4DA 4GO5X 3OR2A 1TMMA 3Q8QB 3FEXB 3MUTP 3KK3A 1BUXA 4EBCA 4NYZA 3HMJG 2BV3A 1N5TA 3QGIA 4B02A 3D9BA 3MEKA 5KFBA 2BKOA 2PI5A 2HZAA 5J1PA 3ICLA 4FVMA 1CJKB 4JI6J 4AD6A 3HP6A 3BR9A 3PTWA 1GH8A 1RTIA 2I6WA 2J76E 2QZ8A 4PPDA 5AE1A 1Q95G 1YZ7A 2M88A 3CT9A 4ZPTR 1VQ8S 4YR0A 2PD1A 2QMXA 1NB7A 1VDHA 2IJFA 3KLFB 1T8EA 2OHDA 1HFEL 1DARA 3A8JA 3GYNA 2R3VA 3M6WA 2F5GA 2YWFA 4QW8A 4P2XA 1HNVB 4HACB 3V6JA 1AB8A 4ETXA 4OX9F 4OI4A 1S48A 2LFVA 1MWQA 1BY9A 1MU2B 3MPDA 4IUFA 2JEFA 2A3JA 4KGXB 2KHCA 1SL0A 4USMA 3V4MA 4EZ9A 4FYXB 3DM2B 3G86A 4UOHA 2D9PA 1CJUB 5DDOC 4UUWA 2OSQA 3CTRA 2BQ3A 4N41A 5HK4A 4B3MF 2ZH5A 4U6PA 1Q5YA 3EVOA 1JB0C 4WE1B 3FBEA 4YY3J 3FRZA 1LW0B 4HVZA 5GADU 3MM8A 2YX4A 5B0BA 1R6VA 3NP5A 2E7XA 4NCGA 1Q5VA 3MAHA 4QPXA 4LFBJ 2OPRA 1RTDB 3ETMA 3ELHA 3DN9A 3D54A 1FEHA 4ZVOB 2PEHA 3CJKB 3HPOA 2QIFA 1U0SA 1RI7A 1GNKA 1K9MT 2JDJA 2J7KA 5G0RB 4WYWA 1EAYC 2Q3PA 3RR7A 2QA1A 4JI7J 2X3DA 5ITHA 3THTA 2KFNA 1YQHA 4ICLA 4ECYA 4JI2J 4K0KJ 3GJTB 4PG8A 2HYIB 3JTNA 1HI0P 3TJAA 2UXCJ 4KO0A 1UA1A 1RE1B 5CYMA 3MPVA 4I2PA 2IVFB 1A0OB 2CQPA 4WP9A 2A18A 1S1WB 2OTJS 1T9TA 4W4MA 4RR5A 2R7OA 4LF6F 1YBUA 2CJYB 2AX0A 4CRJA 1ZS6A 3CO9A 2CJ9A 4BDPA 2YNHA 3Q22A 2CFXA 3Q23A 1WUUA 2XNRA 2HQFA 1J2VA 3M2RA 2LQ5A 1WHXA 4X4QA 1MW7A 4ZP9A 4KV8A 3TX8A 3PXGa 4DR5J 1IR1A 3F56A 3HX9A 3RW7A 4DV6J 1EX8A 2R8IA 4C8KA 2RKIA 4NZ0A 3NGKA 4RW4B 1NU4A 2RVJA 1B7YB 3NGUA 4ZJOA 2HQ3A 4WXWA 4X66F 2B5JB 1VQYA 1NRKA 3M32B 5I3UA 3I87A 1S9FA 5IT9U 3ILIA 2Y8WA 2RU9A 2NUHA 4A48A 1QAIA 3VQTA 5C25A 1S0VA 3O3LA 1H73A 3EGVA 2E66A 2VUGA 1FXLA 2LXIA 2ZZMA 2UVWA 1NLKL 4CLPA 1V5VA 1S7HA 6FD1A 1DRZA 2ZH7A 3FEYB 2J9DE 3TYTA 3OJSA 1LWFB 1NDCA 2FZKB 2ASYA 4JYAF 1S76D 4CO3A 1SBRA 5JXSA 4BWJA 4NCAA 3C19A 1F9HA 2EBEA 3D2WA 4OYZA 3F73A 3GPAA 1X4FA 4LSNA 3UD4P 4DV5J 3X3UA 5HAOA 5GVQA 2DGOA 1F5BA 2ZJRQ 5LSOA 1YJVA 4KIAA 2GO9A 1JLBA 2J5AA 3U7JA 4PUOA 4O4GA 3ZZYA 4EBDA 2JZ5A 2DGVA 4TU9A 2Y0SD 2JEGA 5THWA 3JAMU 2A6MA 2QL7B 4M5DB 1JK9B 3I9V9 3G96A 3OTEA 3QO9B 1YI2S 3K89A 3DU5A 5C42A 5J2PB 2D3O1 3RTVA 3UCUP 2PMWA 1ACMB 2XS7A 3MM7B 2U2FA 1LFWA 4K59A 3ZTPA 2MZQA 3M1VA 5HMWA 3EJMA 2VC0A 2R2TA 2R2UA 4M5IA 2KO1A 2WONA 4P2MA 3PEHA 2XMAA 2IRYA 4C9DA 1QTMA 4AXIA 3HFKA 1L3UA 2CQ1A 3HD2A 2DR5A 3IG1B 4NA1A 2MHNA 1HHSA 3MMCA 2FHOB 4LSLA 1ZTTA 5JVGQ 2W2QP 3CC2S 4X84A 3LTOA 3LP1B 1C1CB 5AXKA 1FE0A 1X4BA 3SEOA 3DRXA 1RWUA 1NKEA 5F9NA 3RBEA 2HFZA 2P6SA 3VAJA 3DRRB 5AXMA 1WG5A 1LWEB 4LRFA 1EETB 4LIWA 1LW2B 2X3GA 4DX7A 1WTBA 3EXCX 1RXOB 5KFPA 4CYUA 4ANCA 4ID5A 4UQTA 4OYXA 1UVJA 3IGNA 5HMYA 4OJ3A 2DNLA 5IT9Y 2W24A 4MTPA 3BF4A 4LF5J 2H4YB 2XO6A 4ENOA 3BGFA 2IC3A 1HQ2A 2RS8A 4DL0C 1RT6A 2VOPA 2K8GA 2EI5A 4A8QA 2COLA 3BSNA 4IRCA 5KFVA 4K8RA 2ZD1A 4JP8A 2C22A 1VQNS 1HMVB 3K8VA 2AYGA 2EFPA 1M5HA 3POTB 2DNOA 4RUBA 7FDRA 2XYHB 1U2FA 3AXKA 4IFVB 3UW1A 1UPMB 5D3GB 2YKQA 3HZGA 4J9MA 3CJ3A 4LFBF 2PDAA 1KDNA 1IWAA 4UQGA 1I94J 4MK9A 1XNQJ 2QE5A 4K4SA 5ETMA 3H5SA 2CPEA 1RK8A 3OVBA 2CQ3A 4TYAA 1WHYA 3MM6A 3C15B 3RZAA 4LF4J 4MAKA 2ZH3A 4RUAA 3QFWA 3MF5A 3MOJB 3I55S 4QIEA 5CYQA 1HNWF 4F3QA 1SQEA 3OR2B 3AH6A 5E3AA 4JI2F 3T41A 3R7SB 2QLFB 4K0KF 1WOSA 2JJ4D 3KK3B 2UXCF 3QNWB 1RWPB 3MCMA 2MJNA 2FGCA 2OLWA 3KTQA 5FD1A 4F67A 3ZZOA 2NXJA 2XB2D 4DV1J 2B9WA 3VGUA 2BE9B 4BBYA 4LF2A 1RQ0A 1VC6A 3QMQA 2CPDA 2N4DA 1KQGB 1RTIB 2NYIA 5JVHQ 1KQSR 5C5JA 2ZVSA 4PKDB 2YWGA 5F8MA 1NKBA 1DURA 4RU9A 3M05A 1RAIB 4DR5F 2R7VA 2Z2YB 4Y34A 2VOOA 4L3NA 2WOMA 2E29A 5EUHA 4DR4F 2AZ3A 3BDEA 1PBUA 2RHSB 2VFSA 3TANA 1U24A 3AB4B 4DQPA 3CJTA 4KHPJ 4I6YA 1LK5A 3T5KA 4M5HA 1RADB 5U47A 3CMQA 4ZPAA 3KG1A 2MKKA 5HJXA 4A8OA 2WSEC 2K3IA 2EKYA 1DTTA 2V4RA 5KOWA 2HEKA 3K2YA 3MEDA 1RAHB 2KKHA 3BPDA 1TKTA 1AUDA 1NK8A 3B4DA 2GZOA 2NCKL 3KLEB 3S7RA 4JI1J 3CNQP 1TV6A 2GFFA 4U7UK 3L09A 3R5DA 2RIJA 4B3TJ 3KJFB 4QWEA 2E7WA 1VISA 5HQ8A 2ZOFA 5F41A 1Z1ZA 4PG4A 4CO1A 4IG0B 3BH7B 1HW8A 1VQ9S 2OP5A 1N5VA 2B4VA 2XM3A 3W9IA 4C8ZA 2JLEA 3MM8B 4HYKA 5A8KA 1DFDA 3GE9A 3I31A 4C3LA 3VAHA 4NCGB 1FFSB 3T1AA 2ZH4A 3AQOA 4DOZA 2XS2A 3T3FA 2CXEA 2G2YA 2OPRB 4EO6A 4DV5F 3OSNA 4HT5A 3DYAA 4ECWA 4USHA 2VPYB 4WKYA 3HT3A 3TA0A 2K7JA 3BGUA 3HKZD 4P52A 4K5RA 3PW4A 4HTIA 3FSIA 1L3VA 1LFPA 5KAKA 3M8PA 3DLHA 1Q1KA 1Y7PA 2BE7D 2X7IA 2FUG9 1TL4A 2HVHA 2VQEJ 2DNPA 4ICLB 2GJ2A 3CJ4A 4QIGA 2VQFJ 3UD5A 1ZM9A 3T9NA 2L3MA 2PFDA 1WKJA 4KO0B 5CYMB 4LBHA 4X65J 4I2PB 1QAXA 2AEJA 2FHJA 1T02A 3CIMA 2XY7A 1HA1A 1KFDA 1VQKS 2ZBRA 2WSFC 3ETOA 2A1BA 1C0UB 3VR1A 2DHGA 2RDIA 4EEYA 1RLDA 5KOXA 1KNZA 3DC2A 3SDEA 1PJ6A 3BO2A 1QSYA 4ZOSA 1Q0NA 1L5UA 4KV8B 1H3DA 1NPRA 2VZ9A 5DG9A 3GSIA 2RKIB 2W2PP 4ED2A 1XC9A 3OTBA 3QZ8A 1JX4A 1R89A 3OXGA 1N34J 1XNRJ 3LGNA 4NLXA 1K8AT 4H54A 3ENQA 1FE4A 5I3UB 3GFYA 2C3OA 1L3SA 3CD5A 1PKUA 4YUDA 2WVDA 3NGSA 5C25B 2R7TA 4ED4A 3JSBA 1EQ0A 4LF5F 1RHKB 2NSCA 3HSGA 5CAAA 4HI2A 2E5LJ 2EVZA 4DR3F 2R7QA 1WNEA 3DLGA 4DQQA 4URGA 3H0PA 3K5MA 4LFAF 2BXJA 1WC4A 3CJ8A 3BN7A 1T9VA 5KG1A 2DRAA 5L8RC 2RQKA 5KFCA 1JJHA 2BQRA 2WVFA 1RA7A 1DLOB 1VQ7S 2Z56B 2E44A 2G0CA 2MZSA 4WIQA 1RKIA 5KFEA 2HQIA 2MZRA 2HGLA 1T05B 3THVA 4KRWA 5B7WA 1UKUA 1PYTA 2V69A 2J8SA 5D0EA 1JLBB 3NNHA 4O4GB 2IPOB 3TW0A 2BJ9A 2DO4A 2HHQA 1U1RA 1S9GB 1D1UA 2FVRA 1I94F 3HHLA 3OFGA 4PXBA 4B9UA 3U1NA 3OXLA 5C7PA 3M8RA 4JV5J 2B9YA 3WBZA 4KTQA 1KBRA 5C42B 2M8DB 2AHOB 1HBUA 1RUSA 5LSRA 4LF4F 4P74A 6FDRA 2J0WA 4NRTA 1WWHA 1P9YA 1VQ6S 3M1VB 1KRPA 2MEWA 3SBMA 2W8LA 5KFZA 2WONB 5I4MA 2CQ4A 3CCVS 2CYYA 1UVLA 3K7RA 1G3OA 3KYLA 4NLTA 3EGZA 4WZMA 4DV1F 2GC8A 3OJUA 3J7YU 3MMCB 2XMJA 4LSLB 3P5BP 4KC5A 5D78A 8AT1B 2J9CA 2XYGB 1RA6A 2DNQA 2YKNA 1M5VC 2AF6A 4DSEA 5IT0A 4KGKA 3ZNUA 4DV4J 2AYEA 3EGNA 5L9NA 4H4KA 5IQ6A 1C1BA 3GJSB 2AJQA 2OH2A 4LT6A 2I2YA 2EXUA 2IY5B 1R0AB 3CMES 5B0CA 3VGTA 4WFZA 4C11A 2OMOA 3QYYA 2XTJP 3AOBA 4NLGA 5BYRA 4MJKA 9RUBA 1YJ9S 2DNHA 4CLLA 2OEKA 3PEJA 2M3DA 1N8RT 4KHPF 3R7NB 2RJZA 2DY1A 4CYUB 4ID5B 5HATA 4MKYA 2BW7A 4ES1A 2AX1A 4CWBA 3UVJA 4WIIA 1WOOA 1H98A 4CO5A 1N6QA 3I96A 1F5CA 1RT6B 2GVDA 3NOGA 4LF8F 2OELA 3FEZA 4JI1F 1FNXH 2QC3A 4M5JA 1Q53A 4Y2KA 1NXIA 2CA9A 2W01A 2Z57B 4B3TF 4CH7A 3VAIA 1SV5A 1S6OA 3EVMA 2DR9A 3MMAA 1QY7A 3VAMA 4FPIA 3ISZA 3AOCA 1WI8A 2FVQA 2BACA 1VQ5S 3BGRA 1MLAA 2WSCC 1HD0A 3CCMS 2D7SA 3HKWA 2HHPA 1RT3A 2YVSA 1IBCB 1RCXB 1T9XA 2I5JA 1S6QA 1VRTA 1KOHA 3Q8RB 1YG0A 3M30A 3CF5Q 3CUNA 5CCLA 2E5GA 5KT2A 2KRBA 4KAIA 2SXLA 4QCLA 1R31A 3CD6S 4F0KA 3MM6B 5KFDA 4P9SA 4DQSA 1TAQA 4PWUA 3QJJA 3CJQA 3DRPB 1KQKA 1I5OB 2BJ3A 2LXUA 3CCSS 1RWNB 4FXDA 1UZHA 2VQEF 5CYQB 5GMDA 3LH2S 4OYWA 2HHWA 4LF9F 1WC1A 1RWOB 2VQFF 5CABA 2HBYB 1IKXB 1UJ4A 1WSRA 5E3CA 4X65F 3PFOA 1RCOB 3OQ2A 2LCWA 3EZOA 2JEIA 3T1YJ 5D4OA 8ATCB 3ENVA 5KG3A 1D09B 2HQGA 4K5SA 4TY8A 1YJWS 2DY9A 4CLKA 1V3ZA 2EBGA 4Q0BA 2RD5C 3KHGA 3KK2A 3D1OA 2N4CA 4KGZB 4CNYA 4IQXA 4DHVA 4ED1A 2F40A 4K4ZA 3N6MA 3OLBA 1NM2A 1N5SA 3F41A 2WOMB 1S5ZA 3TX0A 1FJ7A 2ZM6J 5HMZA 4LSZB 2J0SD 4PWWA 3P5TL 2LA6A 3N4WA 1N34F 1XNRF 2P5VA 1X5SA 1RAFB 5GAGU 4LUBA 4DXLA 4QR0A 4E8UA 3PO4A 3OLAA 2ASDA 2ZBCA 5B0GA 3ZXWA 2ZNZA 4TQRA 1P6TA 2G13A 1B0TA 1Y9OA 1AROP 3RB4A 2E5HA 4MYTA 1TV6B 1KVIA 3W65A 2NREA 4DS5A 1J5EJ 3KK1B 3EPIA 3MMBB 4PR6A 3TRGA 2E5LF 1H38A 3QT5A 4DFPA 2B7CB 4ZCMA 4ED5A 3H98A 2M70A 2QL9B 4J37A 7AT1B 1S59A 2C2EA 4Q2MA 2V2VA 2NLWA 1GMUA 5KFQA 1UCNA 2LA4A 5L38A 2MDAA 1R8HA 5A8KB 2J9EA 3JTOA 4NI2B 2UP1A 2FD2A 5CH7B 4OHZA 1U2RA 1ZBTA 2K1RB 1PAEX 4OX8A 3TAMA 3RU0A 2AYMA 3HLUA 4Y65A 3PW7A 4LF7F 1REGX 2DRBA 4AE5A 4EYHB 2MQLA 1TKZA 5KFIA 1GXTA 3BBBA 3H2VE 1UETA 2KM8B 4AQYJ 3M8PB 1RAGB 2QFIA 3PRBA 3FVYA 1UEUA 3ITHA 3O5TB 2BANB 4JV5F 2C2NA 4FYVB 3MI7X 1Z4UA 2YNFA 2KZMA 1KHVA 3A12A 3GR0A 3N79A 4RNOA 2GQQA 2KFZA 3GR1A 1FKPA 3KLIA 4Z7CA 2F1FA 3RRGA 5KT4A 4UY8T 1GFWB 2OAUA 4CLTA 1DBDA 1QUVA 4LQ3A 4A8SA 4X4NA 1S1TB 1FERA 2XO7A 1BE4A 2HIYA 4ZVHA 3KG4A 3J7Z5 3PYEA 2ZUGA 4NEZA 3FDSA 5HQLA 2Y1JA 3I82A 2CG4A 2HW3A 3BO3A 2IM2A 4DV4F 5KG7A 3HVWA 5K20B 3TZWA 4ZVTB 2YQ1A 3NS5A 1B0PA 4DSIA 2LXFA 2JL9A 3E2EA 1E6VA 2XWXA 1FX4A 3EM1A 4RPFA 3IA0A 3MAQA 2EK6A 3I0SA 4O44A 2GMHA 3L7UA 1Q16B 3EYZA 1U09A 4CNZA 4O23A 3EMTA 2G2OA 3KUHA 4WZQA 4PZVA 4RW8A 3C14A 1N32F 3Q8PB 1NK4A 1RHMB 4E2FB 2J6UA 1KVKA 4KT0C 1QAJA 1X31C 1SL2A 1OSDA 2XMWA 3C6UA 4TN2A 2HBRB 5AXNA 3IRWP 3HVRA 3VALA 2HNYA 3AD8C 3AA9A 3DLGB 4DL4A 3TUJC 3RB0A 3JSYA 1KEKA 4USIA 2YKPA 1IUJA 1YJ7A 4CH1A 1ITPA 2LEBA 1EB0A 2QJ3A 4ZLJA 1Z2ZA 3GZ7A 2B9XA 2W8KA 3BREA 2DJWA 2XSJA 2F65A 1V5IB 4PXDA 4DL3A 4UTGA 4XDDA 3DGPA 3D0IE 3AA8A 1S99A 3MUVP 2EPIA 2DHSA 2Y9HA 3DOLA 2CPIA 3IR6B 4B3RJ 4DWIA 2GHWA 4BHQA 3FBCA 5B0DA 2D3OR 4Y2CA 1NK6A 3DNCA 5D4NA 1UJ5A 3NS6A 2RRBA 2H1YA 1AZSA 3BSCA 2L9NA 2R8HA 3HHLB 3L9ZA 2C42A 5L1IA 4K4VA 3CWJA 1HLWA 2R9LA 4GKKJ 1HBUB 3C6TA 3KLGB 2BRLA 5LXRA 1S79A 1FRKA 4J9LA 2YKAA 3I32A 2MYFA 2N7YA 1NHVA 1RWWB 2DO0A 3BM7A 2HS0A 2VG5A 4JI5J 1IBKJ 2G0IA 3M9OB 1XEZA 4KPYA 3OL9A 2LEAA 2F9DA 3IS9A 3J81Y 4I2QA 3OVSA 3TNVA 1SVDA 3J7AN 3GB0A 3BGLA 4OZ2A 5HANA 1VQLS 5DDPC 4A8KA 2NXUA 1YGYA 2GJFA 3FFIA 4NX9A 2Y8YA 3MEEA 3QAEA 4JI4J 3KOAA 1S6UA 3JB9k 4FXVA 3UNYA 4ZKAA 3T6BA 3UCZP 3H4DA 5IC6B 3W8PA 4ECSA 1C1BB 3R97A 2X51A 2B0GA 3SQGA 4R0EA 4NMXA 4DPXA 2C3PA 2L9DA 5LOQA 3D67A 4IOCQ 4A8YA 4WFAQ 2ZM6F 5AJ3J 1OYDA 4NMLA 1KLNA 3BKFA 2L9WA 2AGPA 3MDFA 4F8RA 5KG5A 3OTOF 1Y11A 4RWWA 4KYZA 4OI1A 1YITS 3UWTA 3UVJB 4F36A 1U1KA 4L72B 4P7TA 5E33A 5E3PA 2KHDA 2VH7A 2WW8A 1PJ7A 2WBRA 3NCPA 2GVDB 5A76A 1VR6A 1CSJA 2IAJB 4DL7A 4BCAA 1T7PA 3MM9A 2XZDB 2EFGA 2QA4G 3QRQA 1VK3A 4YHHF 3IBWA 4QQBA 1SV5B 2E1CA 1IBLJ 1SC4B 1QSSA 1G2EA 3MMAB 2PO4A 1RJJA 4ZP6A 3A3NB 3TEHB 3W5XA 4ES3A 2EC0A 2B4PA 2MQQA 2BM1A 3WX4A 4I4BA 3IO1A 3H5YA 3B4MA 4NLWA 4DG1A 1X4AA 4QU6A 1RBAA 2E1AA 1FTRA 4MT1A 3OTDA 4FP9A 3OT9A 1UEVA 2UUTA 1S6QB 2WBMA 2WAQD 5C2GA 1VRTB 2AGQA 2K7KA 3I0RA 3H25A 2MY7A 1RAEB 4Q7AA 1P1TA 1WD6A 2DNKA 4IKAA 4V19X 2MSSA 3TI0A 3VTIA 4MFBA 1CULB 4AT1B 5DDRC 3N6NA 2BW2A 5MLCV 1CJKA 1NJZA 4U7CA 3O6QA 1CLFA 2CQHA 2QL5B 5DJBA 3F44A 4G1QA 3QRRA 2DISA 3IR7B 1JNZB 1NH7A 2FGOA 2IYGA 1GQEA 4TKTA 3WZ0A 3GCXP 2ZJPQ 3G6YA 3GJRB 2VPXB 4CLZA 1BMQB 2F8EX 1K1SA 1NNDA 2MLXA 5EHHA 1MROA 3GWCA 3ILLA 3ZZPA 3NNAA 3M8ZA 4Y2MA 5KFUA 2JSXA 2OEJA 4X4TA 4K4XA 3IWNC 2F7VA 2MQNA 3MR6A 4HACA 2UXDJ 2YPYA 1CEZA 4LJMA 2W1BA 3KK2B 1KHWA 2CPJA 4UOFA 3W7BA 3MUMP 1LK7A 1Q8BA 1FRHA 3TEGA 3QRPA 4URQU 3OSPA 3T19A 1OJ4A 2J8AA 2PE8A 3LAKA 2GAHC 2V5HG 3DM2A 1T94A 2W7AA 2RQMA 3RW6A 3W3SA 2OUGA 2RB7A 2BJ8A 4I67A 1M90T 2J0QD 2UV8A 2AP6A 3BQ2A 2DGQA 2CJBA 2RQ4A 1YK9A 3NGDA 4D3GA 2V34A 2AT1B 4WE1A 2D41A 1O51A 3PJWA 1VBKA 1LW0A 2IM3A 3ZO7A 1S97A 2J6TA 2JRSA 4JV2A 4Q45A 2RILA 3PRVA 1XIQA 2ERRA 4OL8A 2R8GA 1RTDA 5KFYA 2ASLA 4IOAQ 4L76A 4PQAA 4MIAA 1IWGA 3TUPA 2P8IA 3FC9A 1D3WA 4NLYA 2OEMA 1FVQA 5DETA 2FIUA 1Y0HA 2NYHA 1ZYQA 4RUCA 2VKZG 5CQGA 3W66A 1VCTA 1H0HB 3FZ2A 1H2VZ 4P73A 1OQ3A 3TAMB 4C98A 3PR5B 4U95A 2DHAA 3FUYA 4EO8A 3O2IA 5I42A 2IYIA 1QDUB 2XWYA 4DX8H 2KXFA 2H51B 4OYOA 2FLLA 1YBAA 1VC5A 2Q6CA 2JOQA 5ETOA 3RG6A 4C3MA 1S1WA 3RJMB 4C8LA 3ISND 5A8WB 1QVGR 2RAQA 1XMOJ 4YDXA 4O4RA 2AEMA 4DPWA 4IRKA 1N5YA 3GYGA 2ZBQA 4A4JA 5ETQA 2HLUA 1NJWA 1FKPB 3KLIB 1FD2A 1RT5B 5G4DA 4F4KA 3R5GA 1IBKF 3ADAC 3VGSA 3DLBA 3GV5B 2VD3A 2YTCA 2OTLS 4RW4A 2MGZB 1EJ7L 3AODA 1JXEA 4DZDA 1HNZJ 5ETNA 2B4UA 2UUBJ 1HQEB 1D9AA 3TZZA 3CCES 3NNCA 3EX7B 4R8UB 2B5JA 3H20A 2E9RX 1RWXB 1ZAVA 3U27A 2KM8C 1P9QC 1Q4RA 2EK1A 2ZBPA 1B64A 2C2MB 1E6VB 3LPEA 4BS2A 2X1GA 2JLFA 3QGPA 4S0MA 1UAWA 5AJ3F 3I0SB 4ETZA 4O44B 3D28A 1WEZA 3NS7B 3MOZA 2HRYA 2DIVA 4MIBA 3Q89A 2MQMA 3CCTA 2BOAA 3C14B 1YVFA 3I6PA 1WTFA 2XZWA 5FDLB 2AJ0A 3B82A 2PMHA 3JS9A 5T41A 1TQLA 2VHGA 1DZ5A 3JSMA 2NZCA 4I1TA 4NPOA 1FI4A 2MKYA 2NS1B 1QJHA 2ZNYA 2H5JB 3LP2A 1NDLA 2JH3A 3OR1A 2NXNA 2W4DA 3TOQA 2W9AA 4B9NA 2YNIB 2JX2A 4LR9A 1IBLF 2XCPA 3GG1A 2OD4A 1D8ZA 4ZVPB 2DXDA 3LGMA 2HVIA 4OJHA 1VHIA 3I5AA 3DGPB 1Q8LA 5HI7A 4IG3A 4YDDB 1U1NA 4HL9A 5J2PA 1SKWA 4F25A 3Q86A 5AE2A 2QTWA 4ZCLA 2XS5A 1U6ZA 4CI0B 3G6VA 2RU3A 4DR2J 3MM7A 1HNIA 3MR3A 1FA0A 4MH8A 3K17A 1AZSB 1PYOB 1WI6A 3V4IA 3H5UA 4HHUA 2WB1D 3GFHA 5IS2A 2DIUA 3RAXA 1VQSA 1RISA 4QIFA 2E5JA 4BC7A 3SI8A 1IKWB 1HBOB 2IA0A 2GQCA 3R27A 3TVYA 3C6TB 3TO8A 4HH1A 2QLBB 1SB6A 1CJVA 2Y1LB 1S10A 1FNOA 1FT8A 4EBEA 2VG5B 4ZP8A 1OY8A 1C1CA 1V3RA 1SCJB 1GXUA 2P9GA 1CS4A 1N0UA 5H9FK 1CC7A 2DGTA 3IS9B 4RBVA 1JLEB 5BYQA 4Q43A 3N01A 4DV7J 4GKJF 2QA2A 4IH6A 1HI8A 1TUWA 5BXIA 5L39A 3DRRA 1FRLA 5EGYA 4OI6A 3UDCA 1ZAXA 3HO1A 3EICA 3SSQA 4CLWA 1M1HA 4KHRA 2PT0A 4PRFA 4FYDA 4ZHRA 2XNQA 2D74B 3S6EA 4WP3A 2FDNA 1VMBA 2UXDF 3F0NA 4N47A 3LO3A 2Q43A 1BQNA 5AXLA 5CXTA 2CPHA 4ILLA 3IGVA 5LT5A 2FJBB 1MSWD 3OD2A 3D6MB 2ZEJA 3DOMB 3D0GE 1WG1A 3R3TA 2R4FA 3ILOA 3QWPA 5HN0A 3DI6B 1S1XB 1LOUA 4JYAJ 4X64F 3VVTA 1HMVA 1HW9A 4L73A 3NLCA 2ADBA 5IM0A 1B99A 2DXEA 4ZVSB 4WFYA 3ZZRA 3G2XA 2Z0GA 3PX4A 3BEGB 5FLXY 3LWMA 3CC4S 3DLLQ 5D3GA 1HWIA 3QIDA 3LAMA 4PYDA 4JI0J 2CJAA 4X62J 3ZTRA 1RT4A 4DR1J 1X4GA 4DG1B 4ED0A 4AYBD 4QWAA 1FK9B 2CZ4A 4OHVA 2QFJA 4FNHA 5D15A 3B78A 2ZBIA 2R8KA 1UP1A 3I0RB 3QATA 1WEYA 2C2KB 3I5BA 4OZ1A 1WHWA 5EDWA 4MFBB 3CDBA 3Q8SB 2ZDPA 2QLWA 4ZCKA 4HLBA 2V8VA 4Y0FA 3PKYA 4CTAA 2GQ2A 1XMOF 1TFYA 3VGVA 3HHEA 4G1PA 2O1PA 2MKSA 1HWLA 4G1QB 4GO7X 1JLAB 3UN2A 1PC4A 1U1MA 2LLZA 1T9WA 3ENAA 2MPUA 2G9OA 2E1MC 1KONA 1MROB 3DDIA 1Y5IB 2FQQB 2D69A 4GVLA 4I68A 3CB4A 4NE9C 4BLGA 4M63A 1WC5A 4KE5A 1HNZF 1VIOA 3P49B 3QJPA 4OX7A 2UUBF 4NLRA 1OS5A 2CQCA 2GIFA 2RNEA 3OW2R 3R7BB 1TR0A 2BJEA 5DGBA 3QJLA 2LQBA 4KFBA 3HVAA 1NBEB 1TL1A 1FHTA 3HZEA 4N8NA 2QV6A 3H5XA 3KLEA 4I56A 1YHQS 4O0IA 1VQ4S 5JUMA 4QW9A 3VZHA 1TU0B 2QRRA 4JV1A 3GYXB 4OV6A 4QBUA 3NMAA 3DKDA 4F4WA 1RTJA 1XN9A 4CH0S 4JI3J 4EI2A 3GU0A 5E0OA 5ETPA 4DN9A 2OFGX 3G6ES 3RR8A 2QYCA 4O0NA 4RNFA 5KT3A 4IG0A 4NRUA 4CIOA 4F4XA 3L7OA 3HJFA 2R2SA 2EG2A 3MFIA 3KMQA 3SMZA 4JI8J 2GW8A 4FXWA 2CRLA 2VU5A 4IO9Q 2DCUB 2J0XA 4OHXA 2RS2A 4WFNQ 2HS3A 2F3JA 4YB1P 2JVRA 4ZCIA 3OFHA 2LECA 2BQUA 4IFYA 2DTJA 3JQMA 2DNRA 4ZLPA 1SKSA 1N36J 3VZIA 4GC6A 1NEEA 2WVBA 2HHHJ 1HNWJ 1TK0A 4DX6A 2KXNB 5I42B 2C2ZB 2BEFA 5SUHA 4DR2F 2QEXS 2OKQA 2YPZA 4LVOP 3AD7C 5H9EK 1SJQA 3A8KA 2A0FB 2PA3A 1PBAA 2WK4A 1H6KX 1KS2A 4M5NA 2EC2A 1OPZA 5E2QA 5EWFA 2RMLA 2ZZNA 3AFGA 1FXDA 1M1GA 2OJ3A 4A47A 4YB7A 1C0UA 1QUPA 4ZK7M 1N5YB 1I3OB 1TMJA 4DSJA 3SYZA 5HO4A 1GXLA 1RKJA 1FJGJ 4IR1A 3OBIA 4CLFA 2QMUB 5E3QA 1F3FA 1NK0A 2LQ8A 4DPUA 2R7UA 2BYCA 2ZC3A 3L95X 2CDQA 3V5RA 1LKZA 4DV7F 3OL6A 2HFNA 2V68A 2BKNA 4DR4J 1T95A 3MFHA 4V1Ak 2W25A 2JHEA 5CD4H 3CMAS 2GVZB 4ERDA 1RHUB 3MGJA 4C8NA 1NSQA 4YB5A 1G7CB 1OYEA 4UOGA 1CVJA 4XPEA 3W64A 3IBCB 3K5NA 3MWBA 5DS7A 1OMSA 1PGZA 2CQGA 4F50A 1QE1B 4X4RA 1XQIA 2VBYA 3MM5A 1NMEB 2PMZD 2UU9J 4ILMA 3NKYA 3SV4A 1RTHB 2OPSB 5C24A 2WRMA 4G65A 2KT2A 3R1HA 1GMVA 5KT6A 4CDIA 1RBOB 4QIVA 1VLYA 3UDEA 3DRSA 1U4BA 1IXKA 3MPWA 2MZJA 1T9YA 1F6TA 4XPCA 1EIYB 1DLOA 5KFNA 2YH1A 1REVB 5DDQC 3EDRB 4QWDA 2JFDA 1WF2A 3CDUA 3JSMB 4TNOA 2X1FA 1T05A 1H74A 3A8IA 3ISNC 2O3DA 2VC1A 3LP2B 2DH8A 2ZC4A 5GAHI 3OR1B 2CQIA 2DPJA 1BQMA 1SJRA 2VB6A 2L41A 1S9GA 1X4HA 2W9CA 2CQBA 1TP7A 5F0WA 5B0EA 3W62A 2ZHBA 4IQMA 4UOCA 1YTYA 4JI0F 5HP1A 2VFUA 3K59A 4C0HA 4X62F 2ACYA 4O3QA 4DR1F 3TARA 1IM6A 3PCOB 2LKZA 3BYRA 4IG3B 5IV4A 3US5A 2W7PA 1NSPA 5IC4B 1HNIB 2ROGA 3EWGA 3HSJA 1KTQA 1IKVA 4YS2A 4FKXA 3OVAA 3V4IB 3H2LA 3BKTA 5KT7A 1PIEA 3ULHA 4Q5VA 3DLKA 2ZE2A 1OY9A 1FKAF 2FTRA 4AL6A 1VBXA 2GHPA 3QSYB 1RB0A 5K8OA 1ELOA 3SFUA 1FESA 3QQCD 1CJVB 1N56A 1VQMS 1RWVB 4Z37A 3ZC4A 4KPCA 5LJ5Y 5ETKA 1CS4B 1FNMA 3K8WA 3MPUB 2Z58B 4TY9A 1RBLA 2B8QA 3R6GB 4CO4A 5LMNF 1OIAA 3LANA 1Z2LA 1IVZA 2XMKA 1R0AA 4C8OA 1OO0B 3P4UB 3AOAA 4QIWD 3KUGA 2YWKA 1J27A 2HFOA 3M6XA 1VK8A 2HURA 1WF0A 4JV0A 4DLGA 4YN3B 4DSLA 2VKRA 4ZHRB 2WW4A 2C2RA 1VHFA 3M2UA 4OHYA 3A1YG 3S01A 1DQAA 1V9OA 3M8YA 5D4PA 1BQNB 1UVNA 1C0TA 1KSPA 3GSDA 2UVUA 4DJBA 4LR8A 2XHWA 3LPYA 5DGAA 3SXLA 4DR3J 4DL6A 1B70B 3GV7B 5KG2A 5GMKa 6AT1B 4DFKA 3NBPA 1RLCL 1H7XA 4LFAJ 1S72S 4EU0A 1UW4A 1S49A 1SC1B 3TVZA 4JI3F 3TWZA 4USTA 1FKOB 1SL1A 2KG0A 1U2CA 3SCJE 2WCXA 3SSSA 5GAHU 2ZH1A 5IM0B 1SIZA 2IBKA 2PGCA 2OI2A 4RLEA 4NYPA 2VA3A 1S0MA 4J5OA 4JI8F 2CG8A 1IBMF 2V50A 3V6HA 2MZ1A 4OYIA 2KU7A 3UE2A 1HNXJ 4Q44A 3R5CA 3UN3A 4FZVA 2W4CA 1R6YA 1HWUA 1RT4B 3JAMY 3P8BB 4G1IA 2KJVA 4HTJA 1N36F 4NXNJ 5HVFA 3R5BA 4NZ7A 1Q7LB 3DRPA 3WHIA 4WBFA 4DL2A 3GFXA 2NPFA 1Y00A 3PG9A 1IQTA 2VA2A 4C4WA 1S9EA 2FZGB 1HBMA 2HHHF 1XR6A 3VCDA 2RHQB 3PIOQ 2HWHA 3W61A 1UTAA 1YJNS 8RUCA 2WTFA 4X4PA 1Q82T 1IKXA 1SQGA 1OSCA 4AL7A 4NLSA 2QMWA 5DZ6A 3CCRS 2C2DA 1FWLA 1U1OA 5T7LA 3RBXA 4DDFA 1L3KA 4CTAB 2UXBF 2LDIA 1CPZA 4KBIA 4Q8EA 4ANDA 3CDAA 4UY85 2YQ0A 4WPAA 5KFWA 4NL5A 3NOCA 1AFJA 5FIIA 2VJUA 2V6AA 1FJGF 4RBTA 3VV2B 1JQGA 3G8TA 2FHKA 2MQ8A 1M5OC 3GFZA 5D6GA 1LNQA 4U9RA 1JLGB 1KP6A 4F4AA 3CCZA 3NAHA 2EG1A 2R7WA 2MXYA 5A0YA 2VG7A 4DI6A 5KFJA 3M8SA 2W9BA 3CIZA 2MZTA 1TL5A 3PVXA 1M5PC 5KFFA 3LQVA 5IT4A 5KG4A 5J2NB 4RUHA 4ECTA 2EEYA 3NL0A 4KFBB 7FD1A 2GIRA 1P8GA 3DLEA 2XSFA 4RJVA 2M9KA 4DCOB 3UO0A 2V9WA 1NH8A 4ED6A 1TL1B 2UU9F 4LF8J 4ALZA 2ZDOA 4ZITA 4OLPA 1APSA 3IP0A 2IJRA 3KK1A 5L46A 2V8GA 3MMBA 2VPWB 1RTJB 2RQCA 2AYBA 1XJWB 2PC6A 1SH0A 3D6HB 1Q86T 2Q6BA 2HZCA 4B9TA 1RGVA 1RT2A 3DHXA 2ZH9A 5CCMA 1PCAA 3BQ1A 1AFIA 1FO1A 1KKHA 3PR4A 2N7CA 2MKJA 1VRUA 4NI2A 4F7VA 3KJQB 1X4CA 2K1RA 1K0TA 2GX8A 1S77D 2KVIA 2DR8A 4YR2A 2KZZA 3D3CJ 2ALYB 2J7UA 4IFYB 4P2FA 2ZJQQ 1YRTA 5ETTA 4HH0A 3CGIA 2Y1IA 3PDNA 1VQOS 2BANA 2Z2LA 3K5PA 2LDYA 3LGHA 5A8RA 4WJBA 1GX6A 1XK8A 2BOPA 4WU2A 3V81A 4K4YA 4LF9J 2WB4A 1B4SA 1U8SA 2KT5A 3HT0A 1F2HA 1SJ4P 3PIPQ 1R27B 1D9FA 5ETVA 3WIVA 3I4PA 2VBXA 3CCJS 1NJYA 1EARA 4PXCA 3GTYX 1WKKA 5HVHA 4ZIWA 2F4FA 2NXCA 2V4QA 5A6WA 2FC9A 4WFBQ 1S1TA 4RW7A 1M5SA 3D4JA 2HBZB 2XGPA 1LV5A 3G8SA 3TUZC 1YDLA 3KLVA 1SJ1A 3G82B 3CULA 4IO1A 2BRKA 4X4SA 5EX3A 3J7YI 1KLMA 1FRMA 2IM1A 4P71A 2BABA 5IWAJ 4OMFG 4M1KA 2ATLA 1P1LA 1X5TA 4HDGA 2C28A 1XMBA 2DB1A 1FVSA 3C46A 3HVTA 1UWBB 2MSTA 2YWEA 3KNAA 1JLFA 4DLEA 2CNNB 2H48B 3KLHB 3KUEA 3NAIA 3MM5B 1KR4A 4FF2A 2VG6A 2AV5A 2LU2A 1OQ6A 5C24B 2V4JA 4BC9A 2CDRB 1T3OA 3MZIA 5AT1B 1HPZA 2GV1A 2LEPA 1ZPVA 5CD4A 4KGVB 4NOHA 1MG7A 2HRUA 2CVIA 2ATCB 3MXHP 4UF4A 4RBUA 4IR9A 1UVMA 2FJXA 3DRSB 1O6XA 3UFCX 2GAGC 3QLHB 2NUUG 3GIKA 3T5JA 3FGVA 2DNYA 4WKRA 3C16B 4F0MA 3SFGA 4ZPBA 2V2KA 4B3SF 1FD8A 5J1NA 4ZVFA 3G9CA 1UWAA 4MIWA 3DMJA 4LF7J 5F8IA 2BKPA 1BQMB 4JB8B 5KFKA 4DCJB 3M8QA 5B0AA 2W9CB 4DF4A 1HNXF 1U6FA 1X5OA 2IDLA 2YX1A 3FNNA 4HT7A 5HP1B 1DY3A 2JVOA 1JLCA 3CD0A 1N4LA 3MMJA 4Y2AA 2GCFA 4OZJA 4JBCA 1XERA 1LXNA 4NXNF 5KG6A 4L6V3 1S6PA 4TQSA 5F9LA 3KLGA 2XCAA 2ZUAA 3MCOA 4LRBA 4RNMA 4EUVA 3MD3A 1IKVB 2D3UA 1FTCA 2YXLA 2HWIA 3VAFA 2J6SA 2XULA 4PQUA 5E41A 4C8MA 3W60A 4OX6A 1F9EB 3DLKB 2ZE2B 1IKYA 4CLUA 4LQ9A 2VICA 3ZTSA 3IFEA 2AZ1A 2C2OB 4RZRA 2AJ1A 3FMBA 2OD6A 3MPYA 2NQPA 4ZIVA 3RB3A 2ASJA 4ECQA 4MKVA 4PAAA 2VFTA 4IDKA 1AT1B 5F3TA 3QFHA 2L48A 4N56A 1EQMA 1D8YA 2Z30B 3M2VA 2ZHOA 5B0FA 3U1MA 1RT1A 1ZZFA 2ZHAA 4PABA 5KFGA 3P45B 1PJ5A 2H54B 4F3MA 2HSEB 1N32J 3M2UB 4GRSA 2Z2ZA 1HWJA 2XI3A 2GA7A 4FF3A 1RU2A 4FS1A 3BO4A 1LXJA 5LSLA 2HQCA 1WC3A 1C0TB 1Q8KA 1VJQA 1X9SA 2IA6A 5GAGI 3UN5A 3LP0A 4LREA 2WVEA 2OSRA 4J90A 1B7FA 2CQDA 3NBPB 1ZPWX 2BZ2A 4P7VA 2IAJA 4LRCA 2W4PA 3G8QA 4USVA 3TA1A 2HMIB 3T6JA 2M52A 5L1KA 3PW5A 3Q2SC 2NR0A 3OPKA 4EWTA 3HSZA 2QSWA 2HK3A 3LWLA 3AHPA 1F1BB 2KT3A 4F4ZA 2F9JA 3AJ1A 4DQRA 2DEJA 4DFJA 4YB6A 1L3TA 3S1TA 3ZZUA 1U45A 1R8BA 3HFVA 3HF5A 3C2PA 2X1BA 1FJEB 3FK4A 1AUSL 2V94A 3GMGA 3JQKA 3O8WA 3W9HA 4C0BA 3MD1A 2CADA 1CULA 4ITSA 5KFXA 3MEGB 1K1QA 1U48A 5DM7Q 1GEHA 3BDPA 4M95A 1S9EB 4XDCA 3TZYA 1HBMB 2FJAB 2GS8A 4ZVEA 4RWXA 4U8VA 1UFLA 4L74A 2K06A 1PG5B 1K73T 1WF1A 4F0HA 1HARA 2DNZA 5F8LA 4DSFA 5RUBA 1KOOA 3GIJA 3AQPA 4OZ0A 5T7LB 3A13A 3OL7A 4K4UA 3W1YC 3N0VA 4ZMMA 1R0BG 2FHMA 2BUNA 2KRRA 2IIHA 3TQEA 4NASA 1RAOA 4C6AA 4C8YA 1GX5A 4QOTA 4WYLA 3VHQA 5F8HA 1K0VA 1UVKA 2VF3A 2AWZA 4OZLA 1S4EA 2M2BA 4RNHA 3GCWP 2M4MA 4J9VA 4FVCA 5IWAF 3J81j 1A7GE 4V19J 3WC2A 3BGOP 2HWTA 5A0YB 3SCIE 2VG7B 5M2PA 4QU7A 2W9BB 3OTOJ 3CDEA 5CZVA 2A10A 4DF8A 4TLQA 1RHJB 3DLEB 4KKOA 2XBPA 4OZ3A 2M5YA 1VC0A 3GP9A 1NAQA 2XLJA 2G1DA 1EP4A 4B17A 1U6BA 1GMWD 3HHKA 3ET6A 3QZ7A 4EK2A 3J80U 1XR5A 1YIJS 3KHRA 4M5GA 3V2UC 1HR0J 3BS9A 4YHHJ 2KB2A 2Q66A 2YQ3A 3KHHA 1S1VA 1LEOA 3I4HX 2BMBA 3U1LA 2Q1LA 4AUKA 2POKA 4ATNA 1RT2B 5EWGA 4EMDA 3HSDA 1V6HA 2CPYA 2Y0BB 2MLZA 4NLDA 1QM9A 2A2DA 3NXZA 2OO4A 1R0CB 1TELA 4LVNP 1VRUB 3AY0A 4LRAA 1VFJA 2Y1RI 2HFSA 3UR3C 1D9DA 4KGMA 3MCSA 3MR2A 3Q8VA 4P6QA 4JI6F 1ZH5A 3H2UB 4ELUA 5T14A 2ZOMA 3NGRA 4H4MA 3HK2A 3RRKA 4CO2A 4N5SA 2KL8A 3ZZTA 1RHQB 2FY8A 5A8WA 2BX6A 1X4EA 4LF1A 5LJ3Y 1RDRA 2E1RA 2QSFA 3A3OB 2QX0A 5A8RB 4C7QA 1JJCB 4OI3A 3V81B 1GK8A 3BQ0A 2RF2B 3CJ0A 1B3TA 4OFZA 2MLYA 4P2SA 4P10A 1MN7A 1RT5A 1OWXA 3DLJA 3KKFA 4I0WA 3N28A 2FLOA 3W2WA 3AJDA 4XK8C 3M6VA 3GILA 1O8BA 2ZKUA 4K4TA 3DFEA 3K0JA 4C2MA 2QO3A 4RW7B 2MGZA 1RYSA 3Q83A 2ZWOA 3R1LA 1FDNA 3CCQS 3T5HA 5KFHA 2JC0A 1YKWA 2RH3A 2BE2B 1MWYA 3Q8YA 2ALZA 2B6AA 1HQEA 3BB5A 2DR7A 3BZQA 1EZZB 4R8UA 1T03B 2HNZA 2YY3A 1SPBP 1HIYA 4HHHA 1ZA2B 2VJVA 3RB6A 1I51B 1KLMB 2DHXA 3RAMA 4NWBA 1H72C 2HK2A 5L1JA 4DU8A 1IM4A 3JTPA 4YY3F 3OUYA 3HVTB 4K50A 4DMZA 4PCQA 4J9SA 1JLFB 2V9KA 2UUAJ 2GIQA 1Q81T 3CDWA 2IDEA 3G4SS 1Q8IA 2Z4PA 5FDLA 4UZCA 5IQQA 2VG6B 4OLOA 2CQ0A 4ED8A 1SUQB 1DQ8A 2V4JB 4PG5A 3NGTA 1YRUA 4ZJQA 1C4AA 3BH6B 1HPZB 3J80Y 2X1AA 1EHWA 3PNIA 4JI7F 3BPSP 2JLGA 2B43A 3CPWR 2YNIA 3ZNJ1 4KB7A 1HKAA 3PO5A 1U0HA 1BLUA 4WXOA 3FCWA 2KTQA 3MTKA 2B7BB 3DMJB 3D3BJ 3M8QB 2DR6A 4IRDA 5HL7Q 2EFQA 1XBWA 3EZUA 4M5KA 5D0GA 1E6YA 1ULRA 2PIIA 3VAGA 4PPZA 1WOPA 1JLCB 2IRXA 1UA0A 4WTOB 1SXLA 1IKWA 2YKMA 1HBOA 4DV6F 3EZ5A 5F0UA 1S6PB 4YP3A 2IBOA 3TQ1A 1QSLA 2UV8G 2CJKA 3OFFA 3K5LA 3EDQB 2V2ZA 4B9VA 4U67Q 5E7OB 1F3VA 4DUTA 1HQUA 4PQUB 1JLEA 1FDAA 3T5LA 1IKYB 3P96A 1JMTA 2QGFB 4J9OA 2DT9A 2AMCB 2W2MP 2NXEA 4MK7A 3KG0A 2XMUA 1EKRA 1NZAA 2ZVIA 2YX7A 3GONA 4IDKB 3R2DJ 2QT7A 1NHUA 4W92B 2DNNA 2FVSA 3M2VB 1PAUB 1RT1B 2I38A 1TKXA 5L9XA 2G2ZA 4KQZA 1FCAA 3N6LA 5B08A 4ECVA 1ZZNA 2KFYA 4WF9Q 5AE3A 4F3OA 3DOMA 3BBCA 1N52B 1H2TZ 1WDDA 4LRDA 4EGLA 3DI6A 1F9FA 3I56S 1WACA 1S1XA 1YRXA 2ZH8A 1B0VA 4XIUA 1VIXA 3IM9A 3TR5A 2JEJA 3B8HA 2J7WA 4HEA9 3LP0B 3V6DA 2KH9A 2HRTA 5KTQA 3L3CA 3T9ZA 1RP5A 2JC1A 4F26A 3PHEA 2ZZTA 4QYRA 4KY3A 4ZS6A 3UR0A 1HR0F 4MK8A 3PW2A 1T9UA 3IRXA 1FWPA 1S4FA 3ZTQA 3R9LA 2ZFHA 2RDJA 1U8WA 2E7VA 1FFWB 3KNGA 1BD6A 2LYVA 4DV3J 2Y3YA 1PSDA 4CT8A 2OMLA 3M7VA 4XO0A 4Y00A 3EXYA 2VL1A 5M2UA 1U7LA 4CT9A 1FK9A 5CA5A 1SJ3P 4RW6A 4X4VA 2LQJA 2YNHB 2DCLA 3LALA 2IVMA 3DRYA 3GJQB 5IV3A 5C2CA 3M2RB 4ZN3A 2H5EA 4OI2A 4B9MA 2KJWA 1DTQA 2CQ2A 5HROA 1HHQA 3KWMA 2V8HA 3R8YA 2QLJB 2DEIA 2HHTA 4ECZA 3HM9A 3AJ2A 4D3HA 4ZLNA 5F3ZA 3CCUS 3VQSA 3FCHA 2JNJA 4RX6A 1YJTA 4GKJJ 4NLOA 5F8JA 1JLAA 4I6AA 2QG9B 3UQSA 4ZDNA 4DPYA 4DZ6A 1X8DA 1ZTWA 4URSA 1HWKA 2RUGA 1YSJA 2HNDA 2AJ2A 4R0JA 1VGYA 4ED7A 2OPPA 3DDNA 3IWXA 1U02A 2VPZB 2CAJA 1HL6A 3AB2B 3UDVA 4BWMA 1FEEA 3AAWB 3FSYA 1WELA 4B9LA 4PEOA 2O67A 2VFRA 1WKLA 2XLKA 1TVRA 1FFGB 1YJUA 5HBMA 3PYGA 2IM0A 3KJNB 3OHAA 2CJXB 3FBBA 2DVIA 4CZCA 2H9ZA 1RHRB 2DYAA 2HFVA 3EUNA 1BGXT 5HSPA 4X2BA 4OYBA 4LSNB 2ZOGA 5GMEA 2FYXA 4X64J 2AJ4A 2UUAF 4PUOB 1SC6A 4F2RA 2YKOA 3N5BA 2D9OA 4KKOB 3LUYA 1S1UA 2APOA 2HAFA 5IZHA 1EP4B 2I1RA 3CJ5A 3W9JA 4U8YA 1XNQF 2HHUA 1ROFA 3ET6B 1J5OA 2CVEA 2UVRA 4W90B 2HGNA 1RTZA 1GTEA 4LFCJ 4PG7A 4Z2XA 3W63A 1S1VB 1QLNA 1JWWA 2BDPA 2LVWA 2IHR1 3IC1A 4L3KA 4NXMJ 4WU3A 2XI2A 3HULA 1FRJA 1FRXA 2FJEB 5CHCB 2HS4A 2B8PA 3DDKA 1PC5A 1Y5NB 1TL3A 1UPPA 1OPIA 2M8HA 3UPFA 4O3SA 2I0XA 2H65B 1UVIA 1JKHA 3CSKA 4UUXA 2DNGA 3GIMA 4EZ6A 2YNGA 2N82B 1KD1T 4YQWA 3TZXA 5HVGA 1IJEB 3NRBA 4DCPB 3RYLA 4DBQA 4H4MB 2XQCA 1GAOA 4NCBA 3CJ2A 3MHYA 2FZCB 4LIRA 3E3XA 1N33J 2EKNA 1URRA 2IMOA 1YLXA 5IFMA 1R8PA 1AA1B 1Y3KA 1RWKB 4W98A 5D0RA 3TUIC 3QAUA 5DLGA 4DR6J 4XTTA 2FJVA 1YX2A 1O5JA 2WHOA 1RACB 3BBFA 2MTLA 3D6TB 3A3PB 3MURP 2P9EA 2PEBA 3S8SA 5DO2A 1TAUA 4PWDA 1FDDA 3MTJA 2DXFA 3W2WB 1U26A 1S0NA 2CPZA 2DHHA 1I1GA 4AL5A 3HI9A 1G1XA 2D1CA 4GVBA 1VJWA 2O66A 1HBNA 3ONQA 4L75A 1TFWA 1IR2A 2IC3B 3OTCA 1KVJA 2BM0A 1PYSB 2NZ4A 2B6AB 2GVZA 2MQPA 2XG8A 3HCXA 2HNZB 4O3RA 4LMZA 3BYPA 3IXQA 1F2GA 2AIRB 2ZD1B 2BJ1A 3FRYA 2BVZA 5CZXA 3C3LA 2CWXA 4WP8A 3HD1A 1QE1A 1VRQC 3MCNA 5FJ4A 1TK5A 1RWMB 1RTHA 1Y3JA 3L4BC 2OPSA 3IMQJ 2ROEA 4PG6A 3OUYB 3G6XA 3PJXA 3T1HJ 2NSBA 1TL7A 1M5KC 2V8DA 4OZ5A 4OI0A 2IFXA 1KN6A 3IR5B 1ZM3A 2EWHA 3QT6A 4F2SA 1REVA 2OIHA 1FX2A 1RABB 3D5MA 1T3NA 5HJYA 1CJTA 4ILRA 3P3DA 2EFVA 4TYBA 4G6VB 3DHWC 1N88A 1H2UX 1NSAA 3IBFB 3IAM9 3CCWA 3E01A 5L1LA 4DS4A 5HLFA 3FMWA 2GMLA 4RW9A 3GQCA 2VFVA 4M5MA 2OPQA 1QVFR 5HMXA 2CJQA 4TLRA 1U0HB 5MAOA 3QIPA 4CP5A 5LXYA 4DV3F 5JJBA 2XEXA
chains in the Genus database with same CATH topology
3PR4A 1VQYA 1NRKA 3UWTA 3M32B 2N7CA 3M9NB 5I3UA 2MKJA 1U1KA 4L72B 4P7TA 3SSRA 3I87A 1S9FA 1VRUA 5E33A 5E3PA 2KHDA 3Q0AA 1F5AA 1X4CA 2VH7A 2RU9A 1BWEA 2K1RA 2NUHA 2GX8A 4A48A 4TU8A 1QAIA 1K0TA 2WW8A 3VQTA 1E6YB 5C25A 3O3LA 1S0VA 4B3OA 2WBRA 3NCPA 1S77D 5H9FJ 2KVIA 2KN4A 5K14A 2UVVA 2E66A 1CSJA 1BQXA 2DR8A 2VUGA 2IAJB 4YR2A 2KZZA 2R7RA 4DL7A 4BCAA 1T7PA 3MM9A 4FNIA 2J7UA 1FXLA 2LXIA 4DPOA 3H4BA 2EFGA 3E8OA 2QA4G 1VK3A 4IFYB 4YHHF 2YKMB 2ZZMA 4DEZA 2ZJQQ 2UVWA 3IBWA 1YRTA 4QQBA 4OJ1A 1SV5B 2E1CA 4HH0A 3CGIA 1QSSA 1G2EA 2Y1IA 3PDNA 3MMAB 2AU0A 1VQOS 2PO4A 1S7HA 1RJJA 3Q2TC 6FD1A 1DRZA 2BANA 2Z2LA 2ZH7A 3FEYB 4ZP6A 3K5PA 2FVCA 2LDYA 2J9DE 5A8RA 4ES3A 4WJBA 1GX6A 1XK8A 3TYTA 4WU2A 3V81A 2BOPA 3OJSA 2EC0A 4TXSA 1LWFB 4K4YA 2MMYA 3TVKA 2WB4A 1HQUB 2DBBA 4MMOA 2AW0A 2B4PA 1U8SA 2MQQA 1W2IA 4C0OC 2BM1A 3WX4A 4I4BA 2KT5A 4EYIB 3IO1A 2ASYA 3H5YA 1U49A 4JYAF 1S76D 3B4MA 4NLWA 4CO3A 4DG1A 2KG1A 1X4AA 4QU6A 2E1AA 4YEAA 1SJ4P 1FTRA 3OTDA 1R27B 4H4OA 4FP9A 3PIPQ 1SBRA 1D9FA 1UEVA 3I4PA 1R8AA 5JXSA 4TU7A 4BWJA 4I64A 4NCAA 2UUTA 1S6QB 2WBMA 2WAQD 2VBXA 3CEDA 2EBEA 3CCJS 4DSKA 4QR2A 3D2WA 1DTTB 1NJYA 3F73A 4PXCA 1X4FA 4LSNA 1VRTB 1LWCA 3UD4P 3MEDB 3X3UA 1N48A 2AGQA 1IJFB 2K7KA 3I0RA 5GVQA 1TKTB 2V4QA 2DGOA 2MY7A 3H25A 1F5BA 2FC9A 5A6WA 1S1TA 4RW7A 4Q7AA 5LSOA 1P1TA 1WD6A 1M5SA 2DNKA 4IKAA 1YJVA 2ZJRQ 4KIAA 2GO9A 1W25A 1JLBA 2J5AA 4IYQA 3U7JA 4RNNA 2XGPA 4PUOA 4O4GA 3ZZYA 4EBDA 2MSSA 4V19X 3TI0A 3VTIA 2JZ5A 1YITS 4MFBA 1W2BR 2DGVA 4TU9A 1LV5A 2Y0SD 2JEGA 3HDSA 2ADCA 3G8SA 5THWA 5DDRC 3L7PA 3N6NA 3TUZC 4M94A 1QAYA 4NLUA 2BW2A 3KLVA 4M5DB 3H40A 4JUZA 1JK9B 1SJ1A 2JWNA 5MLCV 3I9V9 3G96A 3MECA 1NJZA 4U7CA 2MKHA 3CULA 3O6QA 5E3RA 3OTEA 4IO1A 2CPXA 3QO9B 1CLFA 2CPFA 2BRKA 4X4SA 1TKXB 5EX3A 3J7YI 1YI2S 5CYJA 3DU5A 1KLMA 1WHVA 2CQHA 5C42A 4QJVA 5DJBA 1FRMA 1V3SA 5J2PB 1N4LA 3F44A 4G1QA 2IM1A 3CD7A 3RTVA 2DISA 3UCUP 3IR7B 1JNZB 1NH7A 2DPIA 2XS7A 5K9FA 1SKRA 2BABA 3MM7B 2FGOA 2E9TA 4OMFG 2IYGA 1GQEA 2U2FA 4M1KA 3PX0A 2ATLA 1LFWA 4K59A 4TKTA 1P1LA 2MZQA 3WZ0A 1HHTP 1X5TA 4HDGA 2C28A 3M1VA 2ZJPQ 5HMWA 3G6YA 2FJDB 2VPXB 1CQNA 2VC0A 4I7FA 1XMBA 2DB1A 2F8EX 1K1SA 1NNDA 3D1QA 2R2TA 5EHHA 2R2UA 2VASA 1FVSA 3C46A 1MROA 4FBUA 3RBDA 3HVTA 2KO1A 2FHJD 1UWBB 3GWCA 3PX6A 3DYAB 1GT8A 2WONA 2MSTA 3ZZPA 2YWEA 3KNAA 3NNAA 4J9KA 1FKOA 3PEHA 4Y2MA 2IRYA 2DGXA 1KQFB 4C9DA 3CE8A 5KFUA 2JSXA 1U1LA 1JLFA 4K2XA 4DLEA 3IAS9 1QTMA 4AXIA 3V6DB 5DRKA 3HFKA 1L3UA 2CQ1A 1FRIA 4X4TA 4K4XA 2DR5A 3IWNC 3KLHB 2F7VA 2MQNA 3IG1B 4A46A 4NA1A 2MHNA 3MR6A 4KJIA 1HHSA 2Z8QA 3MMCA 3NAIA 3MM5B 1CEZA 1KR4A 2FHOB 4LSLA 2VG6A 2AV5A 4FF2A 4LJMA 2LU2A 3KK2B 1ZTTA 5JVGQ 1OQ6A 2LMIA 2V4JA 5C24B 3CC2S 4BC9A 4X84A 1KHWA 3LP1B 1C1CB 5AXKA 1FE0A 3VWSA 4LFCF 1T3OA 2B3TB 2P6TA 3IRXB 3MZIA 1X4BA 1R8CA 1HPZA 2GV1A 2LEPA 2CPJA 3SEOA 1ZPVA 3MUMP 3W7BA 3SCKE 1LK7A 1Q8BA 3DRXA 1FRHA 1RWUA 1H7WA 4NOHA 1NKEA 5F9NA 3RBEA 4NXMF 4Q2LA 2HRUA 2HFZA 4URQU 2P6SA 3OSPA 3T19A 1X7VA 2CVIA 2J8AA 3MXHP 1FF2A 4RBUA 3VAJA 4IR9A 1UVMA 2PE8A 2FJXA 3DRSB 3DRRB 3D1HA 5AXMA 3LAKA 2GMJA 2V5HG 3DM2A 4HI1A 1T94A 2W7AA 3UFCX 1WG5A 2RQMA 1LWEB 3RW6A 1U47A 1XR7A 1EETB 2MHEA 3W3SA 2RB7A 4I6WA 4LIWA 1LW2B 4I67A 3QLHB 1M90T 2NUUG 3LW5C 5J1EA 2J0QD 3GIKA 2X3GA 2UV8A 3FGVA 2AP6A 3PRDA 3BQ2A 3T5JA 1WTBA 2DGQA 2CJBA 3EXCX 4RW6B 2DNYA 4WKRA 2D3ZA 2UZAA 5KFPA 3SFGA 2RQ4A 4ZPBA 4ID5A 2V2KA 1UL3A 3NGDA 1FD8A 4B3SF 4UQTA 4D3GA 5J1NA 1UVJA 3IGNA 5HMYA 4WE1A 3OV7A 3KJVA 2D41A 4OJ3A 3SDEB 1O51A 4ZVFA 2MKIA 2DNLA 5IT9Y 3PJWA 3G9CA 2W24A 3SZ2A 4MIWA 3DMJA 1LW0A 4N8OA 4MTPA 2MB0B 5F8IA 4PXEA 2IM3A 1ZAWA 1BQMB 3BF4A 1O0PA 5KFKA 4NA2A 3M8QA 1DTQB 1S97A 2BA9A 2J6TA 3BGFA 1RAJA 2IC3A 5HROB 2MKCA 5B0AA 2JRSA 4JV2A 2W9CB 4DF4A 1N33F 1HNXF 4Q45A 2RILA 1U6FA 1X5OA 2RS8A 2ERRA 4DL0C 4OL8A 4DFMA 1RT6A 2YX1A 1RTDA 2R8GA 3FNNA 5J2MA 4HT7A 5KFYA 5HP1B 2ASLA 2JVOA 4IOAQ 2VOPA 4PQAA 2K8GA 1JLCA 4MIAA 2EI5A 2KDOA 4A8QA 2K3KA 4DR6F 1D3WA 3CD0A 4NLYA 1MMDA 2COLA 3MMJA 4Y2AA 1FVQA 2GCFA 4OZJA 4JBCA 1XERA 3KHLA 3BSNA 4J9QA 4IRCA 1LXNA 4EFAC 5KFVA 2MQOA 1X9WA 4NXNF 2ZD1A 4ZPDA 5DETA 5J2QA 2FIUA 5KG6A 3G71S 1Y0HA 4L6V3 1S6PA 4TQSA 5F9LA 3KLGA 2HHXA 3BSAA 2C22A 4RUCA 1ZYQA 3DOKA 2VKZG 4GC7A 3CVKA 2N3OA 2XCAA 1HMVB 1VQNS 3K8VA 5CQGA 4RNMA 4M8LA 4EUVA 4WK1A 2AYGA 3MD3A 1IKVB 2D3UA 1H0HB 3CCLS 1FTCA 2EFNA 3K58A 3TP2A 3FZ2A 1H2VZ 4ZVGA 1OQ3A 2XY5A 2EFPA 3IWLA 3TAMB 4C98A 3PR5B 2HWIA 2ROPA 3VAFA 2J6SA 4FBTA 1M5HA 2DHAA 2XULA 1N0VC 3POTB 4EO8A 3C8YA 2DNOA 4PQUA 5E41A 1JLGA 4C8MA 3O2IA 5I42A 2IYIA 2XWYA 4DX8H 2KXFA 4OX6A 7FDRA 2HNDB 3DLKB 4WCEQ 1U2FA 2ZE2B 1IKYA 4IFVB 3UW1A 2OFHX 5D3GB 2YKQA 3HZGA 4LQ9A 2OPPB 2FLLA 4J9MA 1YBAA 3CJ3A 1VC5A 2Q6CA 2JOQA 3X1LB 4LFBF 2PDAA 5BYSA 4IOBA 4QWBA 4C3MA 1S1WA 4UQGA 4C8LA 4YFUA 3ISND 5A8WB 3IFEA 4MK9A 5J2NA 4RZRA 2QE5A 2AJ1A 3OL8A 4IH5A 4K4SA 3FMBA 1QVGR 2OD6A 1TVRB 3MPYA 3H5SA 2NQPA 5HBMB 1CG2A 2CPEA 2C3YA 3HHLD 4YDXA 2QA4S 3RB3A 2ASJA 1RK8A 4O4RA 4ECQA 4IRKA 3OVBA 2CQ3A 4TYAA 1N5YA 4A4JA 1WHYA 3MM6A 2HLUA 1NJWA 4DL5A 2VFTA 2YWHA 4IDKA 3RZAA 1FKPB 3KLIB 4O3OA 1FD2A 1HYSA 1RT5B 5F3TA 4ZPWR 5G4DA 3NCQA 4MAKA 4WK3A 4RUAA 2ZH3A 2L48A 4N56A 3MF5A 4N77A 4F4KA 1D8YA 4FS2A 3MOJB 3I55S 2NPIA 4QIEA 1IBKF 3M2VA 4F02A 5CYQA 1HNWF 5K5MA 1SQEA 4F3QA 3D0HE 2ZHOA 3AH6A 3OR2B 5E3AA 5B0FA 3U1MA 4JI2F 1RT1A 4XAKA 3DLBA 1ZZFA 2ZHAA 3GV5B 2VD3A 3T1HF 4K0KF 1RYRA 2JJ4D 3KK3B 2UXCF 2YTCA 3QWUA 4RW4A 2MGZB 2OTLS 5KFGA 1R43A 2MJNA 2FGCA 2AD9A 1JXEA 3PV8A 2OLWA 2UUWA 1S1UB 1DAXA 3KTQA 5FD1A 4F3MA 4F67A 2B4UA 3ZZOA 3M2UB 2XB2D 1HWJA 1HQEB 1D9AA 2XI3A 2B9WA 2GA7A 4ZPCA 4FF3A 2HGMA 3CCES 4FS1A 3NNCA 4BBYA 3EX7B 4R8UB 2B5JA 1RQ0A 3BO4A 1J5OB 1LXJA 3H20A 2KYZA 5LSLA 3QMQA 1VC6A 1XWLA 2CPDA 3PM9A 2N4DA 2ZKTA 2E9RX 4OIXA 1C0TB 1HD1A 3ZZZA 1X9SA 1KQGB 1RTIB 2NYIA 5JVHQ 2IA6A 5GAGI 1ZAVA 1KQSR 3LP0A 5KG0A 3U27A 2F8HA 5SZTA 5C5JA 2OSRA 3K57A 2ZVSA 1B7FA 2KM8C 2CQDA 4PKDB 2DGUA 2YWGA 2PI4A 1P9QC 1Q4RA 2M7SA 2EK1A 3NBPB 1ZPWX 2BZ2A 4P7VA 4Y2IA 2IAJA 5F8MA 1NKBA 1B64A 2B51A 1DURA 2W4PA 4RU9A 1E6VB 2R2RA 4R5PA 3M05A 2A2CA 3G8QA 3TA1A 5B09A 2XGQA 4BS2A 4DR5F 1DHMA 3THPA 2HMIB 2R7VA 3T6JA 4Y34A 5H9EJ 2X1GA 2M52A 2JLFA 1TL3B 5L1KA 2VOOA 3QGPA 4L3NA 2WOMA 3PW5A 2E29A 1UAWA 5EUHA 3Q2SC 5AJ3F 5DG7A 3OPKA 2PSZA 3I0SB 2NR0A 2DD8S 4NYOA 4EWTA 2GGPA 1JIHA 3D28A 4O44B 4ETZA 4DR4F 1WEZA 3BDEA 1JKHB 1NK5A 2VFSA 3MOZA 2HRYA 1PILA 2DIVA 4MIBA 2QSWA 4HHJA 3SCLE 3TANA 1U24A 2MQMA 4USJC 3CCTA 1C2PA 1CC8A 3AB4B 1BC6A 3LWLA 1YVFA 4DQPA 5DM6Q 4I6YA 2YNGB 1LK5A 3I6PA 3T5KA 1A9NB 3AHPA 1WTFA 2XZWA 2KT3A 3T1YF 5FDLB 4F4ZA 1P27B 2F9JA 2AJ0A 5U47A 3B82A 4B9SA 4ZPAA 2PMHA 3KG1A 3AJ1A 4DQRA 2YKNB 3PW0A 5EX0A 2MKKA 5BR8F 4ZA1A 4DFJA 3W2VA 4YB6A 5T41A 1TQLA 1L3TA 4A8OA 1DZ5A 3S1TA 2XMMA 3JSMA 3ZZUA 2WSEC 5DLFA 1U45A 4I1TA 2DH9A 2K3IA 1R8BA 4CCHA 2EKYA 3C2PA 1DTTA 2MY8A 3HF5A 2X1BA 4NPOA 2NS1B 2V4RA 5KOWA 1FJEB 1QJHA 3JYTA 2ZNYA 3K2YA 3MEDA 4NZ6A 1MNEA 3LP2A 2KKHA 2V94A 1TKTA 1AUDA 3GMGA 2JH3A 1NK8A 3B4DA 3KLEB 3OR1A 3S7RA 2W4DA 3LF0A 1TV6A