2MKJA

Solution structure of tandem rrm domains of cytoplasmic polyadenylation element binding protein 4 (cpeb4) in free state
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
202
structure length
202
Chain Sequence
SHQNGERVERYSRKVFVGGLPPDIDEDEITASFRRFGPLIVDWPHKAESKSYFPPKGYAFLLFQDESSVQALIDACIEEDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGEIDKRVEVKPYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation regulator
molecule keywords Cytoplasmic polyadenylation element-binding protein 4
publication title A fly trap mechanism provides sequence-specific RNA recognition by CPEB proteins
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 202
sequence length 202
ec nomenclature
pdb deposition date 2014-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16367 RRM_7 RNA recognition motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2mkjA02
3G8TA 2M52A 2GO9A 1L3KA 1WG5A 1DZ5A 3UCZP 1HL6A 2DNYA 4W92B 2DH9A 2DHGA 2MZ1A 1N88A 2XSFA 3MD1A 2MGZA 4C4WA 2D9PA 3B4MA 2KXHA 4PKDB 2PE8A 2N3LA 4WCEQ 2QA4S 4C7QA 2ADBA 2RRAA 2M8DB 1KD1T 1VQ8S 1U1QA 2MKJA 5DDPC 2XB2D 5GAEU 2CPFA 3MUMP 5DDRC 2M8HA 3DXBA 1OWXA 2I38A 3ZZZA 1VQLS 3D2WA 2MHNA 5D78A 1WF1A 3CCQS 1W2BR 1X4EA 2OSQA 1VC0A 2LECA 1WF0A 4QU6A 3CMES 1OO0B 4OZ0A 2XS2A 2CQ4A 1X4DA 1VC6A 1YJ9S 2QFJA 1VBXA 2CPJA 2DHAA 5IQQA 5IFMA 4YB1P 2LXUA 5GAGU 2K8GA 1VQ4S 1WG1A 1OPIA 2L9WA 2KT5A 2MQOA 3FEXB 1VQ6S 2KFYA 1NO8A 1YI2S 1WI6A 2AYMA 2X1GA 1U1RA 5CXTA 5H1SV 2JVRA 3LPYA 2L08A 3NS6A 3DLLQ 3NMRA 2MZTA 3U1LA 1X5OA 2RT3A 2MSSA 1K9MT 1AUDA 2CPZA 2KM8B 2UP1A 1YJWS 1F9FA 2N82B 2LEAA 2F9DA 1RKJA 3EGNA 3VAIA 3MDFA 1WHWA 1B7FA 1YITS 2F9JA 2DHXA 5LJ3Y 5GAHU 3BO4A 2LMIA 2DNGA 4FXVA 3CPWR 2DB1A 3P3DA 3J7ZT 5LSLA 3CCVS 1UAWA 1N52B 2DGWA 2KN4A 4CIOA 2LXIA 3CCLS 2DNNA 2OSRA 1X4AA 2KH9A 2YH0A 1HA1A 3LQVA 2VOPA 4IOCQ 2DNKA 3BS9A 3N9UC 2CPXA 2HGLA 1YIJS 1U2FA 1D9AA 2AYEA 2OJ3A 1M5KC 2JRSA 2DO0A 1FHTA 3CCJS 3SDEB 1YTYA 3G6ES 5LJ5Y 2EK1A 2DNPA 1M90T 4F25A 1IQTA 1DHMA 2FC9A 1YHQS 2MQQA 1VBZA 2VONA 1WHYA 2MQNA 3ZZYA 2RU3A 3THTA 2CQCA 2U2FA 4C0OC 2DGQA 2RQ4A 3PIPQ 1M5OC 1X4GA 4IUFA 2U1AA 5LXYA 3BO3A 4RU2A 1QVFR 1FJEB 2MY8A 4ED5A 2V94A 3SMZA 2A3JA 2KRRA 2O3DA 2LYVA 1NU4A 2JX2A 4UY8T 3THPA 4V19X 1SJQA 3VAFA 2MKIA 1WHXA 5LSOA 2MYFA 3MUVP 4TLQA 1H2TZ 2J0SD 2MKKA 4LJMA 4TU8A 2RNEA 4WFBQ 2DGXA 2CQ2A 4BS2A 2E44A 2DGOA 2D3OR 5EN1A 1X0FA 4FXWA 1S79A 1H2UX 3FEYB 3UCUP 3NNCA 1UW4A 2D9OA 2M9KA 2RVJA 2LCWA 2OIHA 2E5JA 1RK8A 5LXRA 3VAJA 4YOEA 4Y00A 3EX7B 4W90B 2ZJRQ 3B4DA 1S72S 2M4MA 5DM6Q 5D77A 4UQTA 1H6KX 1PGZA 3TO8A 1N54B 1WWHA 1SJFA 4WFAQ 2Q79A 5HO4A 1HD1A 2J8AA 2MKHA 2DK2A 5DETA 2DGVA 5JVHQ 4OZ1A 1M5PC 3VF0B 2CPEA 1VQOS 2CPIA 4J5OA 2CQIA 2XS7A 1U1OA 2FC8A 4LMZA 1N8RT 2LKZA 1O0PA 3RW6A 3BEGB 1X5PA 3H2UB 5GADU 1R8HA 3MUTP 2CPYA 2DNQA 1URNA 2PEHA 4QQBA 3VAMA 3UWTA 1U1KA 2VOOA 1YWXA 2F3JA 2I2YA 3CTRA 4WIIA 2DITA 4A8XA 4F02A 3G8SA 3S7RA 2YH1A 1VQKS 3V4MA 5IM0B 3S6EA 4QPTA 2KYXA 2HGNA 4WF9Q 2KG0A 2DGUA 5HL7Q 3P49B 3CF5Q 3Q2SC 5BJRA 1WTBA 1X4CA 2MY7A 1P1TA 2JWNA 2XNRA 2BOPA 1G2EA 2YWKA 2LQ5A 2MZJA 1K73T 3CMAS 2RUGA 2EK6A 2DNOA 5FJ4A 3MI7X 2G0CA 2DHSA 2E5IA 1UFWA 1D8ZA 2ZJPQ 3PIOQ 2KM8C 2WBRA 2DNHA 2DNZA 1FT8A 2DIUA 1VC5A 2BZ2A 2CQ3A 3CUNA 3J7YU 2ZJQQ 1SJ4P 1Q82T 2G4BA 3NS5A 1U1MA 1X5SA 2CQ0A 3BO2A 2CQPA 2HGMA 2G1DA 2MKSA 2MQMA 2MGZB 1X4HA 5GVQA 3K0JA 2MXYA 3CCUS 2MB0B 2CPHA 2MZQA 2MZSA 2M2BA 3R27A 1FJ7A 2YTCA 2M0GB 3VAGA 4EGLA 3CD6S 4Y0FA 1KC8T 3CC4S 3SXLA 3L3CA 1HD0A 1WEYA 4M5DB 3CC2S 1VQ7S 2DO4A 2N3OA 1JMTA 2MKCA 2DNRA 5CYJA 1A9NB 2HZCA 2FHOB 3G9CA 1OIAA 3CCMS 3CXCR 1U1PA 1JJ2R 5JVGQ 3UD3P 2J0QD 2M88A 4PRFA 2M70A 1X4BA 3UE2A 4P6QA 5MLCV 2NLWA 2DH7A 3JB9k 3VALA 4U67Q 1X4FA 4QU7A 2VODA 2MQPA 1A7GE 4F26A 3G71S 1WEXA 2MMYA 2FPHX 1SJRA 2HYIB 4CH0S 3SDEA 3G4SS 2E5GA 1SJ3P 1ZZNA 3TYTA 2CQDA 1VQNS 1VQ9S 1WELA 2X1FA 1VQ5S 3HI9A 2MJNA 4IOAQ 3US5A 5CA5A 2QEXS 2CQHA 2EVZA 1FJCA 1U1NA 2RS8A 3U1MA 4WKRA 3G96A 2E5HA 2MZRA 1SXLA 3VAHA 2X1BA 4TU7A 2K3KA 2DH8A 5GMKa 1WEZA 2XNQA 2LA6A 3CCES 2AYBA 2GHPA 1VQPS 2CQ1A 2LEBA 2AYGA 1FO1A 1BY9A 1QVGR 1VQMS 2CJKA 1ZH5A 2JVOA 3MD3A 2N7CA 2KG1A 4ZKAA 2CQGA 1M5VC 1U1LA 2KI2A 4ERDA 2L41A 5DDOC 1WG4A 1H2VZ 3NNHA 1UP1A 3MURP 1Q86T 3MXHP 2RRBA 3HHNB 1Q81T 3ULHA 2DIVA 2ADCA 3MOJB 3TP2A 2XS5A 3CC7S 2CPDA 1U6BA 2DGSA 3CCRS 4Z2XA 1DRZA 2DNLA 1Q7YT 3UCGA 1P27B 2X1AA 2B0GA 5DDQC 1NJIT 3I56S 2KU7A 2KVIA 2RS2A 1QM9A 3CCSS 2KXFA 3P5TL 3UD4P 1K8AT 4IO9Q 3Q2TC 2HVZA 1KOOA 1FNXH 3R1HA 1PO6A 4CQ1A 4YUDA 1M1KT 3H2VE 1ZZFA 1XN9A 2MSTA 2KRBA 3S01A 1DBDA 4CH1A 1JJHA 2SXLA 1R8PA 2DNMA 2KHCA 1YJNS 5ITHA 1WHVA 4WFNQ 5IM0A 1WF2A 1KOHA 4LIRA 2DGTA 2AD9A 2J76E 1U6FA 2YKAA 3R1LA 2CQBA 3S8SA 1FXLA 2MJUA 2MPUA 4PR6A 3EGZA 3NNAA 2KXNB 3VAKA 3OW2R 3IWNC 1VBYA 2OTJS 1WI8A 2OTLS 2RQCA 2LA4A 2NZ4A 3CULA 3RW7A 2M7SA 3IRWP 2FY1A 3P6YC 2MQLA 1CVJA 1X5TA 5DM7Q 4TU9A 1KQSR 1JJ4A 2DISA 3I55S 2ERRA
chains in the Genus database with same CATH superfamily
1EARA 1Z1ZA 2R8GA 1L3KA 2C3UA 2ZH9A 2NR0A 3G2XA 2DT9A 4W92B 4F3QA 1I1GA 2VPZB 3B82A 1BMQB 2UU9F 4K4ZA 1KWMA 4PZVA 5KT4A 3OLAA 1X0PA 1XJWB 4UZBA 1O6XA 4B9MA 4LRAA 2O67A 3PJXA 4DV3F 5AXLA 8RUCA 1FDBA 2D1CA 3QRRA 2KT2A 5HMXA 1EX8A 5E3CA 3HMJG 1SC6A 3FEXB 3BSCA 3OTDA 4X62J 4Y2CA 1TAQA 3TW0A 3DLLQ 2HHUA 4MKVA 3TX0A 3R5BA 2VH7A 1JQGA 2CDRB 1FWLA 4TYBA 5J2QB 4ZMMA 3PVXA 3R7SB 3NCRA 5LSLA 4PUOA 3PYEA 1RTHA 3I4HX 3KLEB 1F2GA 1HA1A 4F2SA 1B0VA 3LQVA 5EX0A 9ATCB 4M94A 2HFZA 3DXSX 1R31A 5I3QA 4OFZA 3J7A1 3R3TA 1HNVA 3IRXB 2DO0A 4YB7A 1CULB 3UNYA 5KFGA 5E2QA 1XNQF 4OJHA 2YXLA 2LDYA 3QIPA 4FYDA 5IV4A 2ZZMA 3KNAA 3R5CA 1VBZA 3D3BJ 4Q0BA 3FZ2A 4C0BA 3KLIA 5KOWA 4YDDB 2J9CA 3AB4B 4ZJLA 2LFVA 2GMLA 3CMQA 5IS2A 4WP3A 3OPKA 3GFZA 2ACMA 5JUMA 2LYVA 4LQ3A 1UFKA 3THPA 4A8WA 3BSNA 2FJDB 2MYFA 3G6VA 3GSIA 4M5KA 2J0SD 3UQSA 1U6ZA 3HVTB 1X0FA 1SQEA 2ZE2A 3FEYB 4KPCA 3ICLA 2V9KA 3LP0B 1NSQA 2M4MA 3H5YA 1EIYB 5CAAA 2QL5B 5HO4A 1HR0J 2ATLA 3MAHA 2YNGB 3KHLA 1TMJA 2B6AA 1LFPA 1N8RT 2LKZA 5ETTA 4PWWA 2W2NP 2JFDA 2VFVA 1O8BA 1JLEA 2OLWA 1F60B 4H4MB 1KQKA 2NXNA 1S1VA 2YH1A 2XYHB 2Y1LB 1TUGB 1V5VA 3ZO7A 1WTBA 1SKRA 1RA6A 3BGUA 2NXJA 3VGTA 2O5DA 1K73T 1FWPA 2G0CA 1D8ZA 2JLEA 4AD6A 2DNZA 2BZ2A 3GV7B 2FJBB 1YKWA 1RHQB 4MT1A 3GZ7A 3QJJA 3T3FA 1AA1B 1X4HA 5GVQA 4IR1A 2F4FA 4OLOA 4AUKA 4IRDA 4ZIWA 4RW6B 3TQEA 2Z2LA 4KHPJ 3VQTA 1V3ZA 4M5DB 3CC2S 1JMTA 2FHOB 3UN2A 2CXEA 3X1LB 4EK2A 3AH6A 4WFXA 3GU0A 3RB6A 5BYSA 1RBAA 3DLGB 4QU7A 1UVJA 5FD1A 2Z58B 2VQFJ 3AD7C 3HT0A 5KFQA 3W3SA 4TY9A 3NBPB 3DDNA 4M1KA 3JYTB 2IMOA 3H59A 4ZPAA 3HDSA 1NH7A 1U1NA 1RTJB 3EWGA 1FXRA 3HHDA 1K1QA 3BBBA 5HLFB 2H51B 4OMFG 3D4JA 1GXLA 4J9MA 2DH8A 2HS4A 1QE1B 2YPZA 2B8QA 5DGBA 4OYMA 2IVYA 2FVSA 1S1TA 1KP6A 3GQCA 1LW0B 1WG4A 3FBCA 4NMXA 2XY6A 1J5OB 3CO9A 3MM8B 4P7VA 3T5HA 4JV0A 4NLDA 1FTRA 1NZ8A 1ZM4A 5JJBA 4K4XA 2XY7A 1W26A 3FKBA 3DMJA 4IO9Q 4YR2A 3OTBA 2FLPA 1NCLA 2H9ZA 4ENOA 4B9UA 5KT5A 1H7XA 1CPZA 3V6KA 4IRKA 2HKEA 5ITHA 1WHVA 2BXJA 3KFWX 4NLGA 2IAJA 1FXLA 4OX8A 4DSJA 4RW9A 3MGJA 1FKOB 3UVJA 2W2OP 1GX6A 3CULA 1RT1A 4Y6IA 1HNZJ 4M95A 1S77D 1KKHA 2CIMA 2ERRA 1SH3A 2QMXA 4UF4A 1AB8A 2W9AA 2HPUA 2D9PA 3OL7A 3B4MA 3VVUA 2HFNA 4CLKA 2RQMA 4ZCMA 3IN5A 3QSIA 5J1EB 4GO7X 3DRXA 2XM3A 1H38A 4L6V3 2MTLA 3WHIA 1VQLS 5KT6A 2RDJA 2IYGA 1QTMA 3MR5A 2JEIA 2LECA 1U0HA 4LREA 1TKTA 2DHAA 3KKFA 4AXIA 2BRLA 1R0BG 2R7XA 5GAGU 3T1HJ 3KLFB 3DHXA 3G6YA 2H54B 5ETPA 1RUSA 1WI6A 2JH3A 2JOQA 2ZUGA 1HQEA 1Q1KA 5CYQA 1VQYA 4RWXA 3TUZC 3ZTPA 1IM6A 1Y3KA 4OYWA 2Y0BB 1JLBB 1Q79A 1UZHA 2UVVA 3ENQA 5A8RB 1VI7A 1NJZA 2FY8A 1FD2A 5GAEI 2XGQA 3NS7B 3PY8A 1AZSA 2V0NA 1WORA 2PC6A 3N6LA 4Y28C 3N5FA 4OLPA 4OI2A 1T9TA 1RP5A 1YJ7A 1ZBTA 3HHLB 2OD4A 1N56A 1B0TA 1WC6A 1B7YB 2LU1A 4C8MA 3DDKA 2VJUA 1DHMA 2FC9A 3V4IB 2MQQA 4A47A 3KJNB 2VONA 1GFWB 4ZPTR 2AZ3A 2KZZA 1NDCA 1XNRF 2JFKA 3OV7A 3D9BA 1BWEA 3V6JA 2IHR1 3NGSA 3QRPA 1H2TZ 2DTJA 4LJMA 3EZOA 4WFBQ 1TV6B 4Q44A 4ED0A 3F44A 3ITHB 3UCUP 3AODA 3WIVA 2J6TA 3A4TA 5LXRA 1EKRA 4CLTA 1WACA 4NLWA 3TO8A 1WWHA 2IM0A 4IRCA 3JSMA 3ONQA 1HD1A 5AT1B 1M1HA 3QMQA 2LLZA 1VJWA 3CDUA 2GIQA 4DFJA 4QPXA 4S0MA 3KJVA 3CTRA 5IT9U 1RHUB 4DFKA 4KJIA 2XMWA 1PG5B 1NKBA 5ETLA 2AJ2A 2PDAA 3LAKA 2DNOA 5FJ4A 3DOMA 2CRLA 3OR1B 3D0IE 3R7BB 9RUBA 2WBRA 3TZYA 1L5UA 3SQGB 2MDAA 2E7WA 5C5JA 4IH7A 1ZAVA 1JX4A 1N5SA 1NK5A 3MEEA 1UKUA 4LSNB 1FNOA 3PHTA 3HJVA 3WC2A 1LWEA 5F8NA 2PMWA 2V50A 5BR8F 2HNDA 1FVSA 4PRFA 3M8PA 2M70A 4LF9F 3M2UB 4NCAA 3W8PA 5L9NA 1WSRA 3PG9A 1HMVA 1SJRA 2OPQA 3WX4A 2E5GA 1VQNS 3MMCB 4ECWA 2E5LF 4J7CA 3R6LB 1FJCA 4C8YA 1P1LA 1XNQJ 3CVKA 4A8KA 3LO3A 2XMTA 2HQCA 3HD1A 4CO0A 2FJWA 1Q7LB 3VV2B 1GXTA 2FJVA 2ZC4A 4CWBA 4DR2J 4CRJA 2B5JB 3DU5A 3PX4A 4WFZA 5DDOC 2XHWA 5A0YB 2ADCA 2XQCA 2XS5A 5BYQA 3CCRS 4DV7F 1DRZA 1XR7A 2DY1A 5DDQC 3TI0A 3EICA 1RHMB 4J9VA 1PO6A 2XMUA 2R7WA 1ZS6A 1XN9A 5C24B 3QWUA 1KBRA 4AE5A 4DG1A 5D0HA 2YKAA 2JDJA 3GV8B 4OYBA 2RHQB 1KQFB 1I94J 2W2QP 1KEKA 1CJTB 2OEMA 3PM9A 2V67A 1M1GA 2R2RA 4AQYF 2MQLA 4GC7A 1VIXA 1FDDA 5EGYA 1VQ8S 3LOUA 1LW2B 1WG5A 2GO9A 4L76A 2DNYA 1ZM2A 4YY3F 1FKAF 3GLJA 1UVMA 2QA4S 4N77A 4RU9A 2XMVA 2EG2A 2C2DA 1C2PA 3Q24A 3ZZZA 3GFXA 4HT5A 2ZEJA 4PG7A 4CLYA 2G2ZA 1MSWD 1WF0A 1Q8IA 4OV1A 5IWAF 2DVIA 4HHJA 5IQQA 4B3MJ 4DR6J 4QIWD 2G0JA 1YI2S 2D7SA 3ET6B 4DPYA 1JLFA 1SPBP 4NXMJ 1KLMB 1Y3JA 4GVBA 3R5GA 2GZOA 4XK8C 4QYZK 3LP2B 4PG8A 1WDTA 2H3EB 3PJWA 1D1UA 2QL9B 2ZOMA 1RT7A 1WHWA 1ZTWA 4KC5A 1YITS 1ELOA 2DHXA 3NP5A 4ITSA 3HSGA 4ZVHA 3K5PA 3W62A 3PEJA 2QA1A 3HSJA 1N5YA 2LXIA 1LK5A 3GFHA 1RT3B 4J9UE 5HANA 2GW8A 4DR5J 4ID5B 1E6YA 4ZITA 4DWIA 4UUWA 3MECA 4N8NA 1GNKA 2ZH2A 2C42A 3IA0A 2YBVA 1VLOA 1RTZA 4LR8A 2W7OA 5IC6B 4AXJA 3B78A 3K8VA 1UETA 3T19A 2DHHA 3PRDA 2VD3A 3GIMA 3M30B 4ETXA 5U47A 2RU3A 3GFYA 3H98A 4M5NA 2CYYA 1CJVB 1LWCB 3MPYA 4HLBA 2OMOA 2MY8A 3HHLD 4WKYA 1PBAA 4TLQA 3X3UA 4JI7F 1EAYC 3FBBA 1S79A 3R5JB 1RAIB 5B0AA 1JJCB 4YOEA 3B4DA 3MMAA 2OPPA 2RF2B 4EEYA 1S9FA 5ETKA 2AT1B 5ETOA 2WSFC 1WSVA 1TUWA 5GMEA 4LMZA 5L8RC 4OJ3A 2HFVA 2ZDOA 3O8WA 1YWXA 2I2YA 1UA0A 3R2DJ 2GJ2A 3T5KA 1RT2A 3W9JA 3R5AA 3DYAA 2XCPA 3IBCB 2V34A 1LXNA 2Q66A 2RUGA 3AFGA 1GMUA 2RE1A 5KFIA 1XIQA 1EP4A 2C22A 1DQ8A 1VC5A 3J7YU 3NS5A 4DMZA 4DU7A 4F4XA 2H5EA 1QD1A 1SV5A 5M2UA 1FE0A 3ZTSA 3JXOA 3LWLA 5KG5A 1FJ7A 2RKIB 3AY0A 2CFXA 2DXDA 4PXBA 3ILLA 2MQ8A 3PXGa 1VQ7S 1A9NB 4C9DA 3MAAB 3CXCR 2K7JA 2CJ9A 4MK7A 1T94A 3OHBA 3AA9A 3BB5A 2OEKA 1YDLA 3M8QB 1GT8A 4DSFA 3CW2C 4R0JA 5KT2A 2CADA 2Z57B 2D3UA 1OY6A 3I0SB 4K0KF 4NEZA 2QLXA 4LF6F 3QT6A 3OXFA 4RNMA 4U7CA 4PQUB 1PYTA 1XERA 2W25A 1HPZB 2RS8A 1RT6B 3UO0A 2Z4PA 3KXDA 3TA2A 2HW3A 2WK4A 3VWSA 2ROPA 3MZIA 2XNQA 3NKYA 4JI5J 4JI1J 3M7VA 2V8HA 2AW0A 3MD3A 4DXLA 4U7UD 1KTQA 1PC5A 3M9NB 5IQ6A 1X60A 3KNGA 4RW7B 2XZWA 4WZQA 2YPYA 3KLGA 3TP2A 2XZTB 2LP4A 3UR3C 2HHHF 5ETQA 2UUCJ 1TKXA 4ZS6A 1AROP 5FLXU 1XR5A 4QWDA 5EWFA 5F8GA 1W7WA 1IKWB 4F0HA 3NOGA 2SXLA 1R8PA 3ZXWA 1UVIA 3GIRA 3ISNC 1DTQB 3BGOP 3ZZ0A 2MPUA 2JHEA 4PR6A 3HHEA 3VAKA 4I56A 2PT0A 2H4WB 4B9TA 5GAGI 3GCXP 1C1BB 2K3IA 2RHSB 2GVDA 4URGA 4O3NA 4M5HA 1HL6A 3HM9A 2MZ1A 2MGZA 3PW4A 2AJFE 1N33F 2PE8A 4RUCA 3LP1B 1KVIA 2WAQD 2E9RX 4YHHF 2E9TA 1SI9A 2AGOA 3L7OA 2PFFB 3GJQB 1WF1A 5KFNA 5E5NA 4QIEA 3TEGA 1VC0A 4E0DA 4WTYA 1YJ9S 2BE9B 1OQ6A 4O23A 1WG1A 3LALA 4A8FA 4ZHRA 4HEA9 2PA8D 3M2RB 1YJWS 3ENWA 3ZNUA 1SKUB 1TKZB 3EJMA 2Q1LA 2DCUB 1RACB 3DM2A 1FFSB 2VDHA 3CCVS 3LUYA 3GIIA 5DZ7A 2AWZA 3CB4A 1RWWB 3DGVA 1QAXA 4IOCQ 4JV5J 3BQ0A 3HSZA 3K17A 5K8NA 1MU2B 3BF4A 1FEHA 1HHQA 1N34F 1BQNA 1S6PA 1N32F 2EFQA 2G0IA 4ECRA 1OYEA 4ZVRB 3MM9B 5D4NA 1PBUA 4RNNA 4DV4J 3HVWA 4DCJB 2MQNA 3KK2A 4JI3F 1H98A 2DGQA 3BYPA 1X4GA 2HVHA 2MLXA 3BO3A 2CA9A 3CCTA 1PYOB 2RJZA 4DQPA 4URQU 2JX2A 1L3UA 1CJKA 1S9GA 3PYFA 4TY8B 5D0EA 2DGXA 1Z2LA 5F8MA 4QWCA 3R7NB 5F8IA 2XSJB 1TVRB 3MR3A 1HKAA 2D3ZA 2RB7A 4AQYJ 2YWWA 4OJ1A 1VR6A 4IQMA 4R8UB 2FIUA 2MKHA 2A6OA 2DGVA 2OUGA 3KYLA 4YY3J 3M6UA 1P6TA 5KG1A 3JS9A 4WBFA 4BCAA 3OSPA 4DFPA 2G1HA 4DI6A 4C8OA 3LP0A 3N4WA 2BR0A 3BSAA 4JYAF 4F36A 1JLCA 3L09A 4QYRA 4NCBA 1HWKA 1KN6A 4B9VA 3S1TA 1DARA 4DOZA 3DGPA 1LWFB 4YMEA 4HI2A 4MIBA 3SCJE 4X64F 1UJ5A 2VFRA 2KM8C 4DSLA 1FT8A 3CWJA 4XPCA 3HLUA 1UEVA 2FLOA 5CZVA 2WVCA 4FYVB 2DPIA 3JAMY 1FRLA 1TUVA 2W4DA 5DQGA 3I5CA 3RYLA 2GHVC 3M32A 1N6QB 4N76A 2J9EA 1RYSA 1M5SA 1WEYA 4K50A 1QSSA 4DL5A 2VB6A 1X4BA 2PEBA 4DPUA 4NRTA 4PWDA 4Z37A 1SJ3P 2E1MC 4C2MA 4PYAA 1NDKA 2CNKB 4OL8A 2QEXS 4PXEA 3NL0A 1IBLJ 1QDUB 3GR0A 3FRZA 5E3AA 1GQEA 3UD5A 4WXOA 3FDSA 5HK4A 3IS9A 3N6MA 4LUBA 3MMBA 3UNGC 2AYGA 2V4QA 4PUOB 1RTHB 1KNZA 2N7CA 2NS1B 3HCXA 3LGNA 3D6FB 3K2YA 4CH7A 3A12A 4Q2MA 2GFFA 1RTJA 2NSCA 1Q5VA 1HNVB 4C0HA 4QR0A 4QYZJ 2F1FA 1PAUB 3A13A 1ICEB 2G9OA 2B0GA 1YRXA 2NCKL 4MJKA 1RI7A 3QIPB 1YBUA 2QL7B 3HSDA 4Q0BB 1KVKA 4CH1A 2EXUA 3KLIB 4NA3A 3M9MB 3OT9A 4BC9A 2J5AA 3NGDA 4FKXA 3CJTA 3ZZOA 3DU6A 3HX9A 4DV5J 1SH2A 3ZC4A 1RZMA 3MM8A 5KFFA 1YLXA 2DRBA 4RBUA 5GMDA 2ZBRA 2ZE2B 2HHWA 3QJLA 1OYDA 5KFXA 1GTHA 1W25A 4M5GA 3UCZP 3LPEA 4R25A 2JC0A 5K8PA 3JTPA 2DRAA 2L9NA 4F04B 4PKDB 1FE4A 4USHA 4G65A 2IJRA 2MKJA 3W1YC 5DJBA 1TQLA 3WIUA 3DXBA 2B6AB 5D78A 1JLEB 2HRYA 3ZTOA 5LMUJ 2YQ0A 1LNQA 1VBXA 4Y34A 2BQ3A 4B3SF 2UV8A 1I3OB 4FDFA 1ZA1B 4JV1A 4HDHA 5T7LB 4I2QA 5KFMA 3TWZA 4BLGA 4ELTA 1VRTA 3POTA 1VYAA 3R5DA 5D0RA 1B99A 3TVZA 3LPYA 2L08A 3NMRA 1YJVA 2RT3A 1LEOA 3MPVA 1CQMA 2DYAA 8AT1B 4Q43A 4RNOA 1YX2A 1KS2A 2B9WA 5LJ3Y 2A1BA 2COLA 2E9ZA 2VPXB 4ZPDA 5L46A 1WC5A 1U0SA 1GMWA 2BYCA 1T02A 4KSEB 4KKOA 2VG5A 2W7AA 4A8YA 4HTJA 3N28A 1D9AA 3FUYA 2AYEA 2EI5A 5B0BA 3CCZA 3J81Y 2PI5A 3MFHA 4F25A 1H3DA 4LF4F 2FZCB 3T5LA 1QLNA 1CS4B 2IFXA 1P8GA 3SMZA 1PJ5A 2A3JA 3W5YA 4RKUC 4P9SA 3M6WA 4UY8T 4Q45A 1XR6A 3UPFA 2VBXA 4UZCA 3SFGA 3H42A 3JTNA 1Y0HA 3IO1A 5EN1A 2MEWA 4L75A 1S1TB 2V68A 1SC4B 3EYZA 3SCIE 4LFBF 1ZOTA 3KOAA 3KG0A 4MH8A 3AJ1A 3Q0AA 2I8EA 1XMQF 2W01A 3DLHA 1NPKA 4K5RA 3MR2A 1RB0A 2YNIA 1TFYA 3DMJB 1NLKL 4JI8F 2E1CA 1SIZA 3QZ7A 5B0DA 1G7CB 3TRGA 4YHHJ 2IJFA 4RUBA 2PMHA 2UXDF 4G6VB 3BR8A 3BYRA 3S7RA 2BEFA 1V5IB 3UN3A 2ZOFA 3S6EA 4DBQA 2IAJB 5HL7Q 2HG4A 1IBMF 3CF5Q 2B51A 4RW9B 3UVJB 2JWNA 3BJYA 4ZVSB 1JWWA 2ZJPQ 3W2VB 3CUNA 1BE4A 3O44A 2CQPA 2CUYA 4WYWA 2EEYA 5AJ3J 1HIYA 1LKZA 3CCUS 1AYEA 1VCTA 3GE9A 2YTCA 2AJ4A 3K59A 1BHNA 3F41A 5F3ZA 3B6BA 2UVUA 1HWUA 4OQJA 2N3OA 1D3WA 1OIAA 2BKNA 2V69A 2C2ZB 4I67A 1U0HB 2HNZA 5E3QA 1TKTB 1FRXA 1S1XA 4NLRA 2VODA 2ZVSA 3SDEA 4O3QA 5CYQB 1HQEB 4OHVA 5IC4B 1N32J 1S10A 1UEKA 2BE2A 3FCVA 4OX9F 2VC1A 2YX1A 3OJSA 4USVA 4LSLA 3VZHA 4JI3J 3W9IA 1WEZA 2HMIB 2RILA 3AHPA 3OTEA 1RLCL 1FESA 4P2MA 5KG2A 1AZSB 4C8ZA 1KSPA 3T1YJ 2X7IA 3LF0A 2XMAA 1QY7A 6FDRA 4NA1A 4Y3CA 1SL2A 4WE1A 4EZ9A 2MHEA 1ACMB 5AXMA 3UCGA 4WU2A 4YB6A 3PW7A 3AQOA 2DKOB 5D0GA 3UD4P 1FDAA 5LSRA 4DUTA 3S01A 2B5JA 3FNNA 4R5PA 4C8NA 1ZETA 4AL6A 5HBMB 5KAKA 2LQJA 2L9DA 4MTPA 1TK8A 2WVBA 1QAIA 2IM2A 1QSLA 4NA2A 1IR1A 3A3OB 1DZ5A 3SV4A 3C14B 4ZCLA 2R8KA 3MD1A 1YQHA 2GNKA 1VQSA 4WIQA 1X8DA 3SIPB 2BJEA 3JSMB 2EFNA 2DBBA 4KRWA 4QBUA 4IDKA 4LVNP 4FPIA 5DDPC 1TMMA 1WUUA 2OD6A 2HFOA 1X4EA 1BXNA 2YX4A 4F8RA 2YQ1A 3KJVB 1VC6A 2QFJA 2Z0GA 1NK0A 4P2XA 1NEEA 3PJ9A 1ZPWX 1UCNA 1K47A 3UN5A 3AOCA 5HJXA 4EZ6A 3DOMB 4UOFA 4O0IA 1S1UA 2J7KA 3C15A 1T9UA 4DV2J 1VRQC 4OHXA 2BJ8A 1YRTA 4U7UK 4U6PA 2EWHA 3Q8UA 1S1WA 5SZTA 3OD2A 3MEEB 1UAWA 4ANEA 3KG4A 4J9NA 3SSQA 2V8VA 4DV0J 4DHVA 3FVYA 4X4VA 4Q5VA 2D3O1 1LWEB 1HNWF 1KHVA 4OYZA 1KLMA 2HNDB 2DNKA 3N9UC 1YIJS 3C19A 2HAIA 2QYGA 4GMKA 2QYCA 4USWA 1HMVB 3GILA 2OPQB 3MEDB 3PO4A 3NGKA 1M90T 2XMKA 4EFAC 2C2NA 2E1RA 1Q8BA 3EXCX 5EWGA 3M8WA 2KRRA 4P52A 4IKAA 2ZH1A 1NB7A 1Y00A 2UZAA 1T9WA 2IA6A 1JLQA 4XO0A 1CBKA 2EFPA 1HARA 1MLAA 3A3NB 4ECTA 3ZZRA 4W90B 1CJVA 1SC3B 2IMWP 2NPIA 4DUZF 2BABA 1IVZA 5D3GB 2H1YA 1CLFA 4QWEA 1YJTA 2ZC3A 4OZ2A 1J5EJ 3TZZA 3UWTA 2VOOA 3GG0A 5A8WA 2HLTA 4A8XA 1FWKA 3L4BC 3DCAA 4NPOA 4WF9Q 2RF2A 2GJIA 3PYGA 5HP1A 1KVJA 2A2CA 2LQ5A 5M2PA 3PEHA 3KDOA 5C25A 2OI2A 3B54A 2E5IA 4WTOB 1O5JA 2CQ3A 4NASA 4ANCA 1FEEA 2W1BA 3RR7A 4DCOB 1TP7A 3K5LA 5EDWA 4ED6A 3JSYA 1HBUA 4K4YA 1UTAA 3RRHA 1TL3A 1WD6A 3T6JA 3SFUA 3M8RA 3FC9A 4P75A 1FJGF 2HVDA 2ZITA 3I4PA 3SXLA 5CABA 4WJBA 3KK1A 3CD0A 3PRVA 3QO9A 1U2CA 1IBKJ 4DV6F 2FD2A 1JJ2R 1AT1B 3HHLC 4EO6A 2V63A 2J6UA 3VALA 4DFMA 5T41A 1A7GE 3BDEA 5F0UA 5KFEA 2FGCA 5KFDA 1HLWA 1VISA 1LV5A 4GKJJ 3ENVA 3BGRB 1JLFB 3GYGA 2A18A 3AA8A 4GVBB 5K14A 4C3KA 4WKRA 3I6PA 2H48B 4LF4J 1F3VA 4GRSA 3QJPA 2P5VA 1RCXB 2V8DA 1RT7B 1CG2A 1Z4UA 4L74A 1NJYA 3CCES 2AYBA 4G1QA 2FVPA 3TZXA 1N5YB 3OJUA 3TARA 2L41A 4RZRA 1H2VZ 1T03B 3HHNB 3OUYB 3MECB 4NCGA 1Q81T 1U6BA 3ETOA 4MKYA 3RAQA 2CG4A 2KVIA 2RS2A 2EKNA 3BQ1A 1XMQJ 2XYGB 1EJ7L 2JEFA 2YKQA 3FJ2A 2B9EA 2FVRA 4USMA 5IM0A 4O0NA 2NYIA 1UFLA 3S8SA 2MJUA 3IWNC 2AGQA 5DLFA 3LWMA 1TK5A 3BPDA 3NWGA 2NZ4A 3RW7A 4FF1A 2Y8WA 2NYHA 1UPMB 1CVJA 1X5TA 2B7CB 2X51A 4K7QA 2KL8A 4LF5F 3BQ2A 5KTQA 3ZTRA 3MMAB 4C4WA 4LRCA 2OPPB 2I6WA 5HMYA 4WXWA 3TOQA 1BQXA 2GHWA 4LF8J 4MYUA 1DTQA 2H5IB 3ZTQA 3V81A 3IM9A 4DPOA 5GAEU 1S7IA 1L3VA 1FRJA 3C2PA 3OLBA 2EBGA 2WOMA 1OO0B 4N41A 2CQ4A 2HHSA 4ZLJA 1D09B 2OEJA 1RT2B 4YB1P 1VQ4S 4NZ7A 1YJUA 3PO5A 3DYAB 2R8HA 3LP1A 5THWA 2GVZA 2ZBCA 2VQEF 2HQFA 2UXBJ 5CD4A 1KTVA 1EP4B 2CNNB 3G87A 1PAEX 2C2RA 1AUDA 2CPZA 4M5LA 1HW8A 2KJVA 1F9FA 3MFIA 2HBZB 3I87A 2AX0A 3MDFA 1SV5B 3VQSA 5HMWA 3C8YA 3TEHB 1GEHA 4DLEA 3N5BA 3EPGA 3NCQA 2HWHA 1FERA 2F63A 2XBPA 1ZM3A 5D15A 2YNFA 4USIA 2XLKA 4MKBA 4DPWA 2A2DA 4E98A 3I9V9 2BE7D 1TKZA 4I69A 1F9HA 3H4DA 2EKYA 1IQTA 1D9FA 1YHQS 1HWLA 3ZZYA 3ETMA 1U02A 4DS4A 5F9NA 4OI1A 4ILMA 4A8QA 4H4KA 2GC8A 4I6AA 3I5AA 1SJQA 2N4DA 2HS0A 1R3NA 1TR0A 5C42B 3QGPA 4O3RA 2FZGB 2OIHA 4Y00A 2AJQA 1H6KX 3KLGB 1SJFA 1UVLA 5L38A 3RRKA 2ASDA 3N01A 2GIFA 4J9QA 5JVHQ 3MEGA 1TKXB 2A10A 4J5OA 4YR3A 4DR3F 1X5PA 3MUTP 5J2PA 2DNQA 4CM0A 2XWYA 4G3IA 3V6DA 1NKCA 3TR5A 1TZ0A 4LFCJ 4DQSA 5G0RA 5IT9Y 5DQHA 2QA2A 4MIAA 3RBEA 1BUXA 1P1TA 4AT1B 2YWKA 3I96A 5LMNF 3DN9A 1UFWA 5I42A 4ZOSA 5E41A 2GVDB 4P7TA 4F67A 2DNHA 3P45B 4ER8A 2MGZB 3M8ZA 1XMBA 4F3MA 1I6JA 3R27A 4DX8H 4XPEA 1T9VA 2XYPB 3FBEA 3I0RA 2OKQA 1K1SA 1RWMB 2MKCA 2DNRA 5CYJA 3W8GA 3C6TB 1U1PA 4A48A 1FXDA 2HBQB 2DH7A 1N5VA 2Q6CA 3AOAA 3IWXA 4LRDA 1RSCA 4LBIA 3G4SS 4ZHRB 3DNCA 2ZKTA 3IMQJ 2RUSA 3HI9A 3BPSP 2MJNA 5HVFA 4J9PA 2AJ1A 4IFVA 1N6QA 3RGIA 3D7SB 4NZ6A 3ILIA 1VHIA 2GMHA 2ASJA 1HWIA 5K8MA 2IA0A 1ROFA 4V19J 1WC0A 2JEJA 1UA1A 1NRKA 2K1RA 4JI2J 2GHPA 3DM2B 2CQ1A 2LEBA 1BY9A 1C0UA 4QOTA 1DJ0A 2VUGA 1S6QB 1VFJA 3D6MB 4UOHA 1TELA 3NGRA 3H25A 2GQQA 3CNQP 3EE3A 2VZ9A 4FZVA 2UUAF 3AJDA 1APSA 1BQNB 1S6PB 3CDWA 2J7WA 1KFSA 1BGXT 3Q2TC 3KK2B 4UQGA 4JI4J 4WWSA 1HNXF 2RH3A 3TJ8A 2F4VF 4JI0F 2OPSA 3PX0A 1HHSA 3EGZA 3NNAA 1RQ0A 1CJKB 3HD2A 1QJHA 1S9GB 5K9FA 5CCLA 2V4JB 4RLEA 2BM0A 3F56A 3PACA 4C3MA 4AL7A 1SQFA 4Y2KA 2BOAA 2F8HA 1OSCA 2M52A 3TAQA 2HHTA 2D41A 3V5RA 1RAHB 3W7BA 2XTJP 4CI0B 3Q8YA 3GJTB 4P2SA 2GIRA 4P72A 1WKJA 4NLSA 2YKOA 2M8HA 4GKKF 1TU0B 3KUEA 3D2WA 1JLGA 2B9YA 4X4NA 2YX7A 4DR1F 2BV3A 4FP9A 3M2VA 1RTIA 4HTIA 2WVEA 1F2HA 4DV6J 1JLCB 1WTFA 3A1YG 1S99A 2K8GA 3A8JA 4TNOA 3U1NA 3DOKA 1G1XA 3H7HB 1B64A 3DGPB 1U1RA 4LT6A 5H1SV 3H40A 1XTZA 3O2IA 4BBYA 4B3RJ 1K9MT 1RTDA 3QRQA 4KGKA 3BH7B 2F9DA 4H54A 1HI0P 3QT8A 4IG3A 3VAIA 3JQJA 4RJVA 3CPWR 2DB1A 5AE1A 1R7IA 3FGVA 3TUPA 4MK8A 2W9CB 4RUAA 3M32B 3QSYB 4ZVQB 5T7LA 3FQLA 3BR9A 3D1HA 3QAUA 2RD5C 5HQMA 1G3OA 4X2BA 1EKSA 4OYPA 3D1QA 4LFAF 5D6GA 1X9SA 1S6UA 2OH2A 1TL1A 2HURA 4CP5A 4HVZA 3QT7A 4PWDB 4LF7F 4X66J 2DNPA 4NZ0A 4DEZA 3NAIA 4Y2IA 4M5IA 2B4VA 5J2NB 4B3OB 1FNMA 2XG8A 5DLGA 1NU4A 3I82A 4FKYA 3BKTA 5E33A 2P2CB 3IS9B 1CEZA 4ILLA 1YG0A 3JSRA 1UL3A 3QAEA 3MMBB 1PCAA 2D3OR 1IWAA 3AXKA 2GS8A 1UPPA 4FXWA 1KFDA 1UW4A 1NDLA 1VRUA 4I68A 3VAJA 3H2LA 1CS4A 4JP8A 4B02A 2J8AA 3OVBA 1F1BB 4OZLA 1FFGB 1M5PC 3HKWA 1T7PA 2HFSA 3T41A 2DR5A 1GH8A 4P10A 1SQGA 2YWHA 4DUYF 3H2UB 4CZCA 4RNFA 4X4UA 2F3JA 2XHCA 5J1PA 1Q5YA 2GCFA 1VQKS 4LF2A 2DR7A 1F6TA 3RJMB 1U48A 4JOUA 5KFLA 4MYTA 5KFPA 3MPUB 3TX8A 2YWFA 4CTAA 2KTQA 2OO4A 4KPYA 4NLVA 3OFGA 4ED7A 2DHSA 1TAUA 4LBPA 4HHHA 4OZ5A 1SJ4P 2HRTA 1MMDA 1U1MA 3IR7B 3Q8VA 3MM7A 2AX1A 5DGAA 1XBWA 2GX8A 4KGXB 3CC4S 4B9LA 5K20B 3CIMA 3G9CA 3PHEA 2QTWA 3W2VA 3GWCA 1EQMA 1HYSA 4IG0A 3VGVA 3Q8SB 1R0AA 2P9EA 2HBRB 4K4WA 3NWRA 5KFWA 4I2QB 4MFBA 1VRTB 3POTB 3V2UC 4DU8A 5KFCA 2D69A 3BN4A 2MZRA 1ITPA 2K3KA 5GMKa 1B70B 1JIHA 4X65J 1BQMA 2F8EX 3QQCD 1T9XA 1Q53A 4A8SA 3IWLA 4J91A 3H0PA 2HNYA 4KFBA 4ZKAA 2ZD1A 3FRYA 5JXSA 2DRDA 5KG4A 2VFTA 4FVCA 5C2GA 4KKOB 3T9NA 2W7PA 2VG5B 3ULHA 4CO5A 5IT0A 3T9ZA 4A8OA 3B8HA 2HMIA 1VIOA 4ICLA 3P5TL 5FLXY 2HQ3A 1S12A 5AXKA 2P8IA 1JK9B 1JJHA 4CLFA 2KHCA 1LQ9A 1ZTTA 4DN9A 3HKZD 1H74A 4IFYB 2DGTA 4GVLA 4LR9A 1V6HA 3SCKE 3LTOA 1VBYA 3L95X 3TQ1A 4BWJA 2WTFA 3P6YC 1Q8KA 4RX6A 1X9WA 4XDCA 2ZM6J 3RR8A 2IC3A 2YVSA 4X62F 5DG8A 2IVMA 2DH9A 1N88A 2N3LA 4C7QA 1DFDA 2CJYB 5HROA 5HBMA 1U1QA 2YNIB 4KHRA 2CZ9A 4KH0B 4ZPVR 1QAYA 2AHOB 2GQ2A 4OI0A 1JXVA 1RAEB 2IM1A 4QIVA 1A0OB 3CGIA 2UXCJ 1UVNA 2CJQA 4OZ0A 3OSNA 2M5YA 3C14A 2L48A 2LXUA 5E3RA 7AT1B 1HNIB 1QAJA 3HP6A 2ALZA 4DL0C 3I9ZA 1MN7A 4I6YA 3AJ2A 1OMSA 2UU9J 3KJQB 1CC7A 2XC9A 1EETA 2FLLA 4ZP9A 5CH7B 1DURA 3FSIA 4DQIA 4DV3J 3W9HA 1N52B 4C8KA 4URSA 2V9WA 1HQ2A 2QSWA 3VZIA 2IBOA 2YH0A 3BH6B 2ABYA 4HH0A 4EBEA 3PNIA 3AD9C 1U2FA 2HNZB 3DC2A 2HVIA 4TQRA 2P6TA 3LAMA 1S1XB 2OJ3A 4ED4A 5A2QU 1FHTA 1RYRA 3Q23A 3SDEB 4YP3A 4F7VA 5KG6A 2UUAJ 1IKYA 1HR0F 5F0WA 2V2QA 4OHYA 3IGNA 4PQAA 2HHQA 2NUUG 2U2FA 2BE2B 2R7VA 1N0UA 4ED5A 2V94A 5J1NA 5HAOA 4LSLB 3M8YA 5GAHI 1MN9A 4ZIVA 2NZCA 1G4CA 3BDPA 1H72C 1SJ1A 2CNLB 3DRSA 5E0OA 4KGMA 3MEDA 2NUHA 4A8MP 3NNCA 1RXOB 2D9OA 1WC1A 3FFIB 2WW4A 4RW8A 4K2XA 1NMEB 3I5BA 2WRMA 4ZJQA 4ZVFA 3BGFA 3G8QA 2B9XA 2V4RA 4WE1B 2DK2A 1S6OA 1N36F 2Y8YA 2HQIA 4EWTA 5LOQA 2PEHA 2CWXA 4Y2MA 1XEZA 2ZBIA 4R5PB 4KHPF 1T9YA 1SUQA 3G8SA 4KTQA 4K4SA 4QPTA 2IJNA 2EFVA 3GG1A 3CJ5A 5D3GA 2VQFF 4EU0A 3PIOQ 1FCAA 2DIUA 2W4CA 4A46A 4QJVA 2DXEA 4ZLNA 2N4CA 5I3PA 1Y4ZB 5D4LA 2QLJB 1NPRA 3AAWB 4IDKB 3Q86A 3DRRA 4RNHA 4JBCA 3SCLE 1FK9A 3IAM9 1KC8T 2C28A 2UVRA 3FCWA 3EMTA 2MLZA 3GYXB 3CJ8A 2QG9B 3BBFA 1JLAA 3NAHA 4U67Q 1X4FA 3G71S 1WEXA 4CH0S 2VG6A 2FQQB 4DR4F 1S4EA 2BW7A 2X1FA 1NUEA 1DLOA 3MTJA 3CO0P 1S1UB 3C15B 4YEAA 1M0SA 5KT3A 1VK3A 3HJFA 1S1WB 5B0GA 2LA6A 4CO3A 3D66A 2QJ3A 2JVOA 3HVAA 2KG1A 1RDRA 2I5JB 3BGRA 4OI4A 4LRFA 1N5TA 2EG1A 4ILRA 3MURP 2CNOB 5M2RA 2EBEA 1HNZF 4DZDA 4UW2A 3MR6A 3I56S 4Z7YA 4FS1A 3R1HA 3TUJC 3H2VE 1GMWD 3D6TB 3PYDA 5A8KA 1DBDA 2W9BA 1HBOA 2CVEA 3UDEA 3MM5A 1R8AA 1T3NA 2YKMA 4LIRA 2AD9A 1T03A 3OUYA 4ZPCA 3W64A 4LQ9A 2PO4A 2ZNZA 1S0NA 1Y9OA 2WB4A 4E2FB 2KXNB 2UUBF 1RWUA 3IG1A 3WC0A 5HN0A 2FUG9 2WBMA 1JLQB 1F5CA 2HIYA 3T1HF 3UDVA 5KG7A 2RSQA 5L1KA 5C7PA 3I55S 5B0EA 4EUVA 1RT5A 4JI6F 5KFUA 4X84A 8ATCB 2DHGA 3MM6A 1T8EA 2J0WA 4OHZA 3CE8A 3WX8A 4I2PA 3D28A 1H73A 4PYDA 2XB2D 2D74B 4Q8EA 1J2VA 1YVFA 1P9QC 2MHNA 2B4PA 2QT7A 3FMWA 3OFHA 1NHVA 3CCQS 3R97A 2P9CA 2ROGA 2VKRA 3H20A 5A8WB 1U26A 2G13A 3ZFVA 5F3TA 2VL1A 4PXCA 3TVKA 2HQDA 2X3GA 4CYUB 2MQOA 3BREA 5HP1B 2XMJA 5C25B 2QC3A 1UEUA 2AIRB 6FD1A 4UOGA 5FDLA 4KIAA 4OZNA 2Q6BA 4FYXB 1VJQA 3T1AA 3EGNA 1ZAWA 2R7TA 1HBUB 3H8YA 2Y9HA 1EB0A 1TL3B 2DGWA 3CCLS 3ZNJ1 5DRKA 3SSRA 3KK1B 3QO9B 5IT4A 2FTRA 3CJKA 4ATNA 3QATA 4OZ3A 3J80U 2RAQA 3HT3A 3GIJA 2EK1A 4FNIA 1C0TA 1TL7A 4WU3A 5K14B 4FBUA 2Z2MA 3L7PA 4LF1A 1PJ6A 1KQGB 4GO5X 2O3DA 3O3LA 3VAFA 2DR6A 5LSOA 3FBFA 3MWBA 4G1QB 1MMLA 1R8CA 4BS2A 4ANDA 1U49A 1Y5LB 4CLLA 2LCWA 5ETVA 1Y5IB 5SUHA 3R8YA 3EPIA 2PIIA 4UUXA 2K2PA 4NCGB 4G1PA 5D77A 3MCOA 4IQXA 2BJ1A 3MPWA 1FRKA 3BBCA 2IDEA 2JLGA 3DRPB 2LEPA 2CQIA 1RAGB 1XNRJ 1RCOB 1O0PA 3BEGB 5C42A 1R8HA 2C3PA 4IH6A 2JNJA 1MROA 3D6HB 3CDBA 3ELHA 3QPIA 4F0MA 5IM0B 2F40A 4KE5A 2ZZTA 2FJEB 2AEFA 1CJUB 2UUWA 3NOCA 5HVGA 2XNRA 3LGHA 1YBAA 4P74A 2VC0A 2C2MB 3FMBA 2ZJQQ 1R0CB 1VBKA 1REGX 2G1DA 1WDDA 3FCHA 2MZSA 2B3TB 1WOOA 1RBOB 3ILJA 3V81B 2R42A 3K57A 2FGOA 4EGLA 1F9EB 5GADI 3L3CA 2DO4A 2QLWA 3OL8A 2J0QD 3UR0A 2WOMB 3D67A 2RMLA 3UE2A 4C8LA 4DR2F 4K4VA 5K5MA 5ETRA 1C4AA 2GVZB 4X4TA 1ZZNA 2ZBPA 2K06A 3CEDA 4L72B 2CQHA 4C48A 1Q16B 2E5HA 1AUSL 3C6TA 1O51A 1PSDA 4LBHA 2HWTA 2ZH5A 3KHHA 1VQPS 5BR8J 4LF9J 2DR9A 2LQ8A 1S97A 1I94F 2XLIA 2YNFB 3K58A 3LA0A 1Q86T 4ECXA 1OQ3A 2V8GA 2BM1A 1MWYA 2DY9A 2R2UA 3ZZUA 4JB8B 2E5LJ 4N7TA 1YZ6A 4PXDA 1OPZA 2KXFA 5ETSA 3PFEA 2HVZA 2YWEA 4X4OA 4I6WA 1N36J 2OMLA 1S6QA 2E29A 2K7KA 4U8YA 2WZ1A 1E6VA 1DY3A 1NKEA 1QUPA 3DLBA 5I3UA 1IR2A 3R1LA 3AOBA 2GV1A 3GYNA 3NY0A 4O4GA 2HHXA 2LVWA 4PPZA 2LA4A 4ZP8A 1S9EA 3UFCX 2M7SA 2VFUA 4B3MF 1FKPA 3VVTA 3LGMA 4DR6F 4MIWA 2R7OA 3UDLA 4DV7J 3MMJA 2AMCB 3KHRA 4NXMF 3GTYX 3UW1A 3ADAC 4KB7A 4J37A 2HQGA 3MEGB 2HRUA 4CDIA 4HR2A 4ZVEA 3MUMP 1DTTA 2ZHOA 2VICA 1OWXA 2V4JA 5EUHA 2VHGA 5J2PB 1R43A 3V6DB 2VDIA 2CPJA 2R4FA 4DR5F 4BWMA 5G0RB 1OPIA 1FD8A 3CCWA 2I0XA 3O6QA 4O44A 4LSZB 5I42B 4DR4J 4NXNF 1SC1B 2AEMA 3RB0A 1RKJA 4M5JA 1FX2A 1HWJA 3CD5A 3J7ZT 2R7QA 4KO0A 2VG7A 2J0XA 1IKVA 4C3LA 1OSDA 3I0RB 4KGZB 5IWAJ 1LFWA 1X4AA 2IM3A 3QGGA 4NYPA 4NLYA 4I4BA 4ECUA 2EC0A 1AW0A 2O1PA 2C3MA 1IBCB 2ZH7A 3AB2B 1RWVB 3EZ5A 3MTKA 3OQ2A 3Q8QB 2CAJA 4NYZA 3C46A 3DOLA 2W9CA 4IFVB 2V5HG 2RQ4A 1Q78A 1N5QA 1RAAB 4QR2A 4OHWA 1FRIA 2Y0SD 2RU9A 2YWGA 3NG8A 1NK6A 4V19X 4ZPWR 4P73A 2K1RB 1SCJB 2WVFA 2WSEC 1XC9A 1C0UB 2QIFA 3HFKA 2UUBJ 1Q95G 4XTTA 2ZJRQ 3LW5C 5DM6Q 4WFYA 4RR5A 1N54B 2W2PP 5IZHA 5J2NA 2BKOA 4B3OA 4LR7A 4JI6J 1PJ7A 2CPIA 2XS7A 3SZ2A 1FRHA 2CZVC 4DPTA 4MAKA 4M8LA 1QUVA 4TQSA 3W66A 2FJAB 4FYYB 4F02A 3QZ8A 3TJ9A 2YKPA 4NE9C 4JI7J 5KFBA 4NL5A 2KG0A 2OPSB 3EZUA 1G2EA 2VFSA 2OFHX 2EK6A 4JUZA 1Q8LA 2BUNA 5F41A 3BO2A 2HGMA 3K0JA 5CYMA 3RB3A 2KB2A 3KTQA 3W2WA 2V6AA 3NEKA 3MCSA 3KLVA 4JI5F 4JI1F 3DLEA 1JLGB 5JVGQ 5KFYA 2I1RA 1YSJA 2NLWA 3M2VB 1RTIB 3JB9k 4KV8B 4LIWA 1KDNA 2W8LA 2H65B 1RLDA 1RHJB 3GJSB 3DOKB 4C11A 4FS2A 4I1TA 2IVFB 4CLPA 3PKMA 1S0OA 4DQQA 2VF3A 4KHMA 1CSJA 4IOAQ 2WSCC 1IN0A 3KUHA 2UUCF 2BA9A 4MKAA 3U1MA 1RTDB 2FHMA 3QWPA 5CHCB 3IFEA 4ID8A 5AE3A 3MCMA 1HQUA 2CJAA 3TVYA 4IG3B 1T05B 4ECYA 4NX9A 3LANA 4W4MA 1LXJA 3GMGA 1QVGR 4QCLA 2R9LA 2FHJA 4N8OA 3W5XA 4KY3A 2CQGA 1U1LA 4ERDA 3KMSA 3WBZA 1FA0A 4NLOA 3HF5A 1T0TV 3KUGA 2KFNA 1SVDA 2GGPA 5KFVA 3EUNA 1B3TA 4L3KA 3K5OA 2R2TA 1TL1B 2ZBQA 4K0KJ 4Z2XA 4LF6J 5H9EK 2X1AA 2ZH8A 2KU7A 2HVEA 1JXEA 1XMOF 1HBNA 2YNHA 4YS2A 1M1KT 2DNMA 1DQAA 1MWZA 3RZAA 2BJ3A 2BQUA 3OVSA 2J76E 2HHVA 3IRWP 1U25A 5LM7E 3RUBL 3BSOA 5DM7Q 3OTOF 1V3SA 1VRUB 2HWIA 2HHHJ 2GO8A 2KXHA 4ZN3A 4IFYA 3A3PB 5L9XA 2CVIA 1YZ7A 4PG4A 3VGUA 3O5TB 2KFZA 4J9RA 3GP9A 2I38A 2B56A 4YFUA 4GC6A 1YBTA 4KR0B 1VK8A 3R9LA 5IOLA 3QIDA 2QA4G 5A6WA 2BANB 2XCAA 3LH2S 4XDDA 1NPPA 3F73A 4JV5F 2L9WA 1NO8A 4CTAB 2ZWPA 2YQ3A 2X1GA 2F5GA 2JVRA 1RWOB 2EFGA 1CC8A 1K44A 1RBLA 5DG7A 1N33J 3CIZA 4RWWA 1RHKB 2Z2YB 3F0NA 4DV4F 2GMJA 5KFSA 1F0XA 3HFVA 2LXFA 2N82B 1VHFA 2LEAA 3MM7B 1NM2A 3QFWA 1RADB 3JQMA 2DNGA 4FXVA 4K59A 2WVDA 1HNIA 2PMZD 2QLBB 3EM1A 3GB0A 2I9SA 4CT8A 1NH8A 3M4XA 4HKQA 1XWLA 1FDNA 3AD8C 2LU2A 1KLNA 1RISA 1HYSB 4G1IA 3RBDA 1MWQA 4IG0B 1M5KC 2QFIA 3TA1A 5JMNA 1R0AB 2QZ8A 3RRGA 5LJ5Y 4CO2A 2NSBA 2R8JA 4MFBB 1UJ4A 4V1Ak 2AU0A 3D68A 5H9FK 4WK1A 4OYXA 4PG5A 2E66A 4IUFA 1UVKA 3NMAA 3KK3A 3M1VA 3NGUA 1WJ9A 1QTNB 3GJRB 3QBCA 1IXKA 2JSXA 3MUVP 1BQMB 2RNEA 4OV6A 2DGOA 2BX6A 1H2UX 2HNYB 4KFBB 2E5JA 1RK8A 2ZD1B 1N34J 5G4DA 3TANA 1GMVA 3TA0A 4QIFA 4EYIB 1PGZA 4ZLPA 3PR5B 2Z30B 2XEXA 5DETA 2B4OA 4CCHA 4OZ1A 1C1CA 3VF0B 4EBDA 3MPDA 3DLKA 5IXUA 4ICLB 4KH1B 1SL1A 1SH0A 4PAAA 2XLJA 4CT9A 4FVMA 3Q8RB 5HATA 1P9YA 3FFIA 1S76D 3ZZTA 3KLHA 5HQLA 2C2OB 1SKWA 3CJ4A 1NJWA 1UWBA 2E1AA 4ZA1A 1X4CA 2BOPA 1PKUA 4L3NA 4WYLA 3OXLA 5E3PA 2V2VA 2H5JB 2IC3B 4PEOA 2GA7A 3VCDA 3IM8A 4ZN1A 4DJBA 4NWBA 2C2KB 2MB0B 2Y3YA 2XY5A 1IBLF 4UTGA 4NXNJ 1NBEB 5EX3A 5HROB 2XMMA 2OPRA 1RE1B 3Q8PB 1M5HA 3TAMA 2XI2A 1Y7PA 4JYAJ 4N47A 1N0VC 2IRUA 1RAOA 4RW4A 3OR2A 1JKHA 1RT4A 3G82A 4F26A 4X64J 4NI2B 3OXGA 5L1LA 2R7RA 5L1JA 4W98A 4KT0C 2HK3A 1U4BA 3C66A 4DCPB 2UVWA 4NLPA 3VAHA 2A6MA 2HHPA 1QSYA 1IWGA 3NRBA 1EETB 2CWKA 5L1IA 4ZVPB 4BDPA 5KFHA 2FDNA 3UI3A 1ZH5A 2B4UA 3PW5A 4DV5F 3GSDA 1R27B 3W63A 3TJAA 5A76A 3J7Z5 2QLFB 3IP0A 1WOPA 3NNHA 1UP1A 4DV1F 3E01B 3DHWC 1VOMA 1OY8A 3CC7S 2DGSA 3MAQA 3AQPA 3KDNA 1IKXA 4CO4A 1IKYB 1KOOA 1NSKL 3N0VA 1PIEA 3ENAA 3TAPA 2W24A 3NGTA 2ZVIA 4XAKA 2I5JA 1A6LA 3EVMA 5J2MA 4WFNQ 5CZXA 3RBZA 1U7LA 2PD1A 4O3PA 5LMUF 4DQRA 3QNWB 4HACA 1EZZB 1V3RA 4TXSA 1S49A 2RQCA 1YGYA 3DRSB 1OY9A 1VMBA 2BKPA 1RJJA 3HHKA 2ZH6A 3EVOA 4UOCA 4RW8B 4U95A 4YQWA 1R6VA 4I7FB 5HMZA 3IGVA 4OX6A 2IIHA 4WP9A 4FYWB 2EW9A 3U27A 4LVOP 3PR4A 2KYZA 3OTCA 2CPFA 3D54A 1LOUA 1Z2ZA 3HFZB 4ZPBA 3DDIA 1K0TA 1U47A 2WHOA 3EGVA 3HZEA 3TZWA 2OSQA 3CJQA 4ECSA 2PA3A 2QSFA 1SUQB 1KONA 3VTIA 3IBWA 2KT5A 1VQ6S 3QLHA 2EPIA 3CJ2A 4DPXA 3CDEA 2AF6A 4KAIA 2HAFA 3P8BB 2C3YA 3JSBA 2W4PA 1Q0NA 4ZLLA 2O01C 1HW9A 1B7FA 2F9JA 5ADZA 1S0VA 3MF5A 3CJSA 3P3DA 5ETMA 3DRRB 2HBYB 1FK9B 4CYUA 2QN6B 2DNNA 4QIGA 5B0CA 1BC6A 4F4AA 2YKNA 4B3SJ 1HBMA 2VOPA 3BS9A 2V2ZA 1JLAB 4X4QA 3OFEA 2OFGX 2DD8S 2JRSA 4DL6A 3MCNA 1YTYA 2VG6B 3G6ES 2L3MA 2B43A 2LDIA 2ZWOA 3DI6A 1FFWB 2WONA 2CQCA 1DLOB 3PIPQ 2C2EA 1XMOJ 2PFDA 5LXYA 3C6UA 3PTWA 2MKIA 4PCQA 2MKKA 7FD1A 4TU8A 4HHUA 2H4YB 1FI4A 4FPRA 2NPFA 4AYBD 4UT4A 4WZMA 3PW2A 4H4OA 2XI3A 4BC7A 1S59A 4ZVUB 2OELA 4UQTA 2Q79A 5KFTA 3FK4A 4Z7CA 3OTOJ 3C16B 5KOXA 3EGWB 3HVRA 3IC1A 2CPEA 4ETZA 2Y1IA 5CCMA 2WCXA 5AJ3F 3FEZA 3SI8A 4CLZA 2RDIA 4PPDA 4U9RA 2ZHAA 1JNRB 1URNA 3PZPA 5A8KB 2W9BB 1HBOB 2BACA 6AT1B 3MM5B 4FF4A 2CJBA 2YKMB 3FZBA 4RBVA 4IO1A 1NK9A 4ZVTB 2QE5A 2ZKUA 4QW9A 4ZCKA 5D4PA 4DSIA 3PRBA 2W2MP 2MY7A 4LFBJ 3IG1B 3DRPA 4ED2A 5KFZA 2KVQE 5B0FA 3OVAA 5H9EJ 2HK2A 3TUIC 1Q82T 4B3TF 2G4BA 1I5OB 1RT5B 1REVB 2CQ0A 4YR0A 2MKSA 4KGVB 4FBTA 1U2RA 4CNZA 2ILZA 1ZM9A 3MM6B 5J2QA 2DR8A 4JI8J 1HI8A 3QFHA 4I2PB 4BHQA 4ECZA 4K2JA 2Q43A 1CJUA 3JQKA 2M0GB 3E2EA 2UXDJ 3IAS9 3KLEA 5KG0A 2PN6A 3ISZA 1IBMJ 3UD3P 1UWAA 3QGIA 4NLXA 3OL6A 2G2YA 3T1YF 5DO2A 3IRXA 2RQKA 4IH5A 4DR7F 1CULA 4FN5A 2HYIB 4ED8A 1HI1A 2CQDA 1N4LA 1WELA 3OHAA 3M8SA 4C98A 2HEKA 5FDLB 2Z56B 2BMBA 1X9MA 1GAOA 4J90A 1FRMA 4TYAA 3W60A 3RBXA 2ZFHA 1U24A 3J81j 1UJ6A 4QZVB 2CJKA 3HVTA 1NZAA 3VGSA 2WW8A 3H90A 1NK4A 2DEIA 2KI2A 4TVAB 4P71A 3CJKB 3MOJB 1MW7A 1R8BA 2YNGA 2DNLA 4HL9A 1S0MA 1T11A 1NJIT 2F7VA 4OX9J 1QM9A 1C4CA 3CCSS 4ZDNA 1RAFB 4EYHB 1C0TB 1B0PA 2CJXB 2VV5A 2KRBA 4HYKA 1TL7B 4H4MA 3SYZA 1IM4A 2OAUA 3N79A 1L3SA 4Q8FA 1K0VA 2QGFB 2FLNA 2XWXA 4U8VA 1JB0C 1NSPA 4EBCA 3WZ0A 2E7XA 1PC4A 4TU9A 2BJ9A 3G8TA 3E51A 2AV5A 2HLUA 3CJRA 3V6HA 1YK9A 3WQPA 5H9FJ 4Y65A 2ADBA 2RRAA 2M8DB 4DV2F 3IR5B 5D4OA 3AT1B 4RW6A 1NSAA 3GCWP 2XO7A 2J9DE 4M5DA 1URRA 2BVZA 3CSKA 5DZ6A 3PX6A 2FVQA 1MROB 4EI2A 4WPAA 2XS2A 4DV0F 1X4DA 3DLGA 2O66A 4HI1A 4QR1A 5I4MA 1AFJA 4I64A 5DG9A 1RU1A 1RWXB 4OYIA 2BRKA 5CXTA 5KFKA 3NBPA 5EHHA 3JYTA 3U1LA 4KQZA 3BZQA 4OI6A 2MSSA 1NK7A 4OYOA 3H5SA 2ZH4A 2BJ7A 5HLFA 2UP1A 3PKYA 1QE1A 4DX6A 3BO4A 5GAHU 2VPWB 3JTOA 3HPOA 2Y1JA 1LW0A 4TN2A 2KH9A 2VPYB 4K4TA 1J5OA 3CDAA 2ZZNA 1S57A 3O1LA 3PCOB 4O3OA 3IR6B 5A2QY 2FZKB 4DV1J 5LL6d 2ASYA 1V9OA 3FSYA 3THTA 4C0OC 3GR1A 2MKYA 3G86A 2U1AA 3BN7A 2AEJA 3RU0A 2Z8QA 1J5EF 1L3TA 1FKOA 1D9DA 1RKIA 3C3LA 4Y2AA 1BD6A 1HNWJ 2C1EB 4ED3A 2CQ2A 4ZVGA 1S48A 4OYAA 2W8KA 4IOBA 1S1VB 2JL9A 1TK0A 4F4KA 4ECVA 5J1EA 4USKA 4ZCIA 2M3DA 1Y10A 1G6BA 1HFEL 5HVHA 3KWMA 2POKA 1W2IA 5DQIA 2RRNA 1E6VB 3V4MA 5I3UB 1IBKF 3W5ZA 1NB2A 2HGNA 3KLFA 2AP6A 3NXZA 3Q2SC 3W61A 4O4GB 1S9EB 3CMAS 2GJFA 3GONA 1JXLA 1FKPB 3HULA 4WK3A 4ALZA 4AL5A 2KHDA 1JNZB 1NXIA 3HXMA 4DUZJ 1D8YA 4PABA 4GKJF 1X5SA 1JLBA 5HI7A 4HDGA 5AE2A 2OP5A 4NOHA 5A8RA 2CPHA 2MZQA 3KG1A 4N5SA 3R2CJ 1RA7A 5B7WA 1NJXA 3CD6S 3PW0A 1DTTB 4DN0A 2KT3A 4YB5A 2R7UA 2BJDA 3HHLA 5MLCV 5MAOA 2DCLA 3K89A 1CQNA 1GX5A 1VDHA 4J9KA 4EMDA 3OBIA 4D3GA 1LK7A 4YN3B 3TYTA 2PI4A 3V4IA 3T5JA 2RDDA 2AQ4A 4O44B 5KG3A 3J7YI 3G96A 4NMLA 1FJGJ 2FHKA 5BXIA 5KFRA 4AFFA 3GPAA 4NRUA 4KV8A 4XIUA 4CLWA 2UUTA 1TV6A 4KO0B 4HH1A 4USTA 4DL7A 4NLQA 3ITHA 2VG7B 1IKVB 4ED1A 4USUA 1RAJA 3MXHP 2RRBA 5AXNA 1TFWA 4HT7A 2ZHBA 2IRYA 2DXFA 3VHQA 2CPDA 2DPJA 3BGLA 3RG6A 1HHTP 1P27B 4NLUA 1RT1B 1T05A 3N6NA 2NREA 4LF8F 3DOLB 1FX4A 1FNXH 2EFOA 2FVCA 4F4ZA 4YUDA 1ZZFA 4FF2A 2MSTA 1RWNB 2NXUA 1FF2A 4RO0A 4QWBA 1KOHA 1WNEA 4ES1A 5F8LA 1U6FA 3GV5B 4B17A 2F8MA 4PWUA 4DL2A 2OTJS 4R0EA 4JV2A 3DRYA 7FDRA 2FY1A 3HK2A 3P5BP 3OR1A 1JJ4A 2DISA 3SQGA 3FSXA 2UXBF 2IYIA 2HZAA 1TL5A 3SQOP 4ES2A 4CO1A 4WCEQ 2VA3A 1BLUA 2E7VA 2DJWA 3AXMA 4B3TJ 1NAQA 3PDNA 4LSNA 4ZK7M 1WOSA 3PFOA 4OIXA 3A8IA 1ZPVA 5ETNA 1WKLA 3OL9A 1W2BR 4O4RA 2R2SA 3R6GB 4NEYA 1X7VA 4QU6A 1RWPB 2F65A 3M2UA 2JJ4D 4OI3A 3GIKA 3Q89A 2VBWA 1OJ4A 5IV3A 2AYMA 4LF5J 3MMCA 2MZTA 4DR7J 1X5OA 4L73A 3U02A 2XGPA 4USJC 3QYYA 3H5UA 2ROEA 1EHWA 4ZP6A 1Y11A 1B4SA 5CYMB 1PYSB 2MLYA 2LMIA 3W2WB 2BANA 2G2OA 3Q22A 1IR0A 2OSRA 2LQBA 2Q3PA 1SIWB 2NQPA 3DLEB 1MG7A 2CPXA 2HGLA 3RAMA 5A0YA 1FVQA 2VKZG 2ALYB 3KJFB 2VQEJ 4DS5A 1OS5A 2KDOA 3EVWA 1T3OA 3J80Y 3CCJS 4C11B 4DSEA 1WHYA 4CM2A 5C24A 3KMQA 4D3HA 1GK8A 1YJRA 3H5XA 1QVFR 4RU2A 4H4KC 1HQUB 2GAHC 5T14A 1TTHB 1H7WA 4B9NA 2VU5A 1CJTA 5HJYA 1GXUA 1VLYA 2E44A 3Q83A 4C97A 2AKWB 1MMNA 4LFCF 4RL1A 2PGCA 2M9KA 2RVJA 1U8SA 3SBMA 2ACYA 1LW2A 5FIIA 3EX7B 2VBYA 4IR9A 4X4SA 2GGPB 3P96A 4WFAQ 2ZH3A 3W65A 2FB0A 4P2FA 5B08A 1VQOS 1RWKB 3BM7A 2FC8A 2VA2A 5KFAA 2XO6A 3RW6A 1HBNB 2YNHB 5GADU 2IBKA 1F5AA 1SB6A 1U1KA 2QV6A 2QMWA 3EDRB 3CD7A 4WIIA 1R6YA 4TLRA 4MMOA 2KYXA 3MR7A 4K5SA 2J8SA 2ASLA 4ZVOB 3ET6A 4DZ6A 3KHGA 4DSKA 2VBZA 3TNVA 4EO8A 3MI7X 3D0HE 4QWAA 1BWVA 3M8PB 2BQRA 1F3FA 3LP2A 1IUJA 4DF4A 2P9GA 2MQMA 4X4PA 2ZUAA 3WDOA 3T6BA 1RHRB 3JAMU 4LRBA 4DR3J 3QGHA 3THVA 2CKWA 3D0GE 4Y0FA 1RT3A 2J6SA 1HD0A 4ID5A 4JI2F 4X4RA 2HZCA 4PG6A 2XZDB 4DL4A 2P6SA 5BYRA 5LMNJ 2MQPA 2MMYA 2FPHX 2QRRA 4RUHA 1VQ9S 3DFEA 1VQ5S 2VASA 5HQ8A 3M30A 1IQZA 2A0FB 2PSZA 3K5NA 1J27A 1UZDA 1I51B 1LWCA 2JLFA 1SXLA 4ZJOA 4F4WA 4JI4F 4NLTA 4QW8A 3RAXA 4M5MA 2XULA 4F4YA 2JC1A 4NI2A 1VQMS 1N48A 3L7UA 2JEGA 2GAGC 1Q4RA 5C2CA 3MEKA 2IPOB 2V8PA 3FQKA 4F2RA 3HO1A 4DG1B 2VIHA 3MHYA 3E3XA 1Q7YT 2X3DA 5F8HA 1K8AT 1S5ZA 2BW2A 1RABB 4CNYA 3P4UB 1U09A 5EWEA 3E01A 2QO3A 4WP8A 3KK3B 3M1VB 4OZJA 3H4BA 1DQ9A 3M6VA 2CG8A 4K4UA 1NDPA 3RTVA 1KQSR 2HFUA 2BBEA 2XSFA 4A4JA 4B3RF 2ILYA 5K8OA 2KO1A 3M05A 1KD1T 2RKIA 1C1CB 2IY5B 1HNXJ 3DLKB 5D8HB 5DDRC 5F8JA 1UMJA 2J9DA 4KBIA 2F4VJ 4OX7A 3MAAA 3OFFA 1S4FA 4JI0J 1ZYQA 3CMES 5B09A 1VS3A 3KLHB 3I31A 1Y5NB 4DX5A 2QX0A 3M6XA 1UWBB 4I7FA 5IFMA 3M8QA 1XK8A 2V2KA 2DEJA 1PILA 2KFYA 2APOA 3I0SA 5E7OB 3NS6A 1E6YB 3DLJA 4DX7A 4PQUA 5DS7A 1HPZA 2B8PA 4B9SA 1RT6A 2KM8B 4X66F 2Y1RI 4I0WA 4CLUA 3HZGA 4IYQA 2LQ9A 4GKKJ 2NXEA 5KFJA 1DAXA 2HIQA 1S7HA 2KN4A 4F50A 1KR4A 1GTEA 2EC2A 1AXQA 2OPRB 4CIOA 4DR1J 3TAMB 1U8WA 1TKDA 1X31C 4E8UA 4RW7A 4RW4B 4ECQA 3OR2B 1JKHB 2BDPA 4F0KA 1RT4B 2GQCA 3G82B 3J81U 2OHDA 3SEOA 4FNHA 4UY85 2HSEB 3A8KA 2ZNYA 4Q2LA 4ZP7A 1NK8A 1IKWA 4NYOA 5KFOA 1M5OC 2ATCB 3ZZPA 4OJGA 1FJEB 2Z2ZA 1KHWA 1D0EA 1SBRA 2WB1D 1WHXA 3UDCA 2E1PA 3BKUA 3SV3A 1C1BA 3D3CJ 3DKDA 2KZMA 2IDLA 4FXDA 4LFAJ 2B7BB 3M9OB 1ULRA 2C3OA 1IJEB 1ZAXA 3BKFA 1S72S 1ZA2B 1F5BA 2AJ0A 4LF7J 1FTCA 1NHKL 1NHUA 3ILOA 4RPFA 3K5MA 4DDFA 5RUBA 2RIJA 3IXQA 1U1OA 1IKXB 4TKTA 4CLSA 2NXCA 2CPYA 2FHJD 4QQBA 3VAMA 2UV8G 5L39A 2QMUB 2DITA 5J2MB 2CZ4A 4ES3A 2N7YA 1NNDA 1WC4A 2DGUA 1EQ0A 3P49B 4HACB 5BJRA 1IJFB 3C16A 2MZJA 4J9LA 4U96A 4MK9A 2JZ5A 3M2RA 3J7AN 4M63A 1XQIA 1R89A 2FJXA 1U45A 2MXYA 1WKKA 3EDQB 4DUYJ 2CDQA 3ISND 1KRPA 5LT5A 2M2BA 2ZOGA 3VAGA 1AFIA 4X65F 2HS3A 2IRXA 1UW9A 3CCMS 2OGUA 2M88A 3PV8A 4P6QA 1MU2A 1RU2A 1REVA 2R7SA 3MM9A 3VR1A 4O3SA 4B08A 3QLHB 3E8OA 1LWXA 3US5A 5CA5A 2EVZA 1MNEA 4Q7AA 1RGVA 1T95A 2ZDPA 2X1BA 4TU7A 4DL3A 3I32A 2AGPA 4C6AA 5A6PA 1VGYA 3G6XA 4K8RA 4TY8A 2YY3A 1FO1A 2AZ1A 3U7JA 3CJ0A 3SSSA 3QT5A 1M5VC 3CJ3A 4J9OA 2XSJA 1TVRA 5CD4H 2R8IA 5KT7A 1YRUA 1H0HB 2YKNB 1HBMB 1TL4A 5HSPA 3IBFB 5CQGA 2DIVA 4R8UA 2ZM6F 3K7RA 1SKSA 4KYZA 4F3OA 2FYXA 3K8WA 2HZVA 3BV8A 2KJWA 3DI6B 4CQ1A 1WC3A 3D1OA 4J9SA 3CT9A 5F9LA 2WONB 2R3VA 4ELVA 3MOZA 3EXYA 1SL0A 3NCPA 1YJNS 4DF8A 4RBTA 1WF2A 2VJVA 2KKHA 3L9ZA 4FF3A 3RB4A 2CQBA 3C6UB 3D5MA 2UXCF 3NLCA 3OW2R 1WI8A 2OTLS 1LWFA 4N56A 4DLGA 2J7UA 3A8EA 4H4OB 4ELUA 4YDXA
chains in the Genus database with same CATH topology
1Z1ZA 2ZH6A 2R8GA 1W25A 4UOCA 1L3KA 2C3UA 4RW8B 2ZH9A 2YVSA 4X62F 5DG8A 3UCZP 2NR0A 4YQWA 2DT9A 2IVMA 4R25A 4W92B 2DH9A 2JC0A 5K8PA 1N88A 3JTPA 4I7FB 4F3QA 2DRAA 2L9NA 5HMZA 1I1GA 2VPZB 3IGVA 3B82A 4OX6A 4PKDB 2N3LA 1FE4A 4USHA 2UU9F 4C7QA 2EW9A 1DFDA 3U27A 5HROA 4LVOP 4K4ZA 5HBMA 1U1QA 5KT4A 2MKJA 5DJBA 3PR4A 3OLAA 1X0PA 2KYZA 3OTCA 1TQLA 2CPFA 2YNIB 3DXBA 3D54A 2B6AB 4KHRA 4ZPVR 1LOUA 1Z2ZA 5D78A 4B9MA 4ZPBA 1QAYA 2O67A 3PJXA 1U47A 2GQ2A 2WHOA 3HZEA 1JLEB 2HRYA 4OI0A 1K0TA 4DV3F 2OSQA 2IM1A 4QIVA 3CGIA 5AXLA 1FDBA 2D1CA 4ECSA 1UVNA 2PA3A 2CJQA 4OZ0A 2KT2A 2QSFA 3OSNA 1SUQB 1VBXA 1KONA 2M5YA 4Y34A 5HMXA 2BQ3A 2L48A 2LXUA 4B3SF 5E3RA 3VTIA 1CEZA 2UV8A 3IBWA 1HNIB 5E3CA 3HMJG 1SC6A 1QAJA 2KT5A 4JV1A 3FEXB 1VQ6S 4HDHA 5T7LB 3QLHA 4I2QA 5KFMA 3HP6A 2EPIA 3BSCA 3OTDA 4ELTA 1VRTA 3CJ2A 3POTA 3R5DA 2ALZA 4Y2CA 1TAQA 3TVZA 3CDEA 2L08A 3I9ZA 3LPYA 3TW0A 4DL0C 3DLLQ 3NMRA 4I6YA 1YJVA 2AF6A 2HHUA 4KAIA 2RT3A 3AJ2A 3MPVA 1CQMA 2C3YA 3JSBA 2W4PA 3R5BA 1CC7A 2VH7A 4Q43A 2O01C 4RNOA 2XC9A 1EETA 1HW9A 1KS2A 2FLLA 4ZP9A 4TYBA 5J2QB 1B7FA 2B9WA 5CH7B 1DURA 2F9JA 4ZMMA 5LJ3Y 3FSIA 5ADZA 3PVXA 1S0VA 2A1BA 2COLA 3MF5A 3P3DA 4DQIA 3NCRA 5LSLA 2E9ZA 2VPXB 4ZPDA 3DRRB 4PUOA 1N52B 4C8KA 1FK9B 1RTHA 4URSA 2BYCA 2V9WA 3I4HX 1T02A 2DNNA 4QIGA 2QSWA 4KSEB 5B0CA 3KLEB 3VZIA 2IBOA 1F2GA 2YH0A 1HA1A 4F2SA 1B0VA 2ABYA 1BC6A 3LQVA 5EX0A 4HH0A 4KKOA 2YKNA 4EBEA 1HBMA 2VOPA 4M94A 2HFZA 3DXSX 2VG5A 3BS9A 3PNIA 2W7AA 1U2FA 1R31A 2HNZB 4A8YA 3DC2A 4HTJA 2HVIA 3N28A 5I3QA 4OFZA 4TQRA 1D9AA 1JLAB 2P6TA 3J7A1 3R3TA 4X4QA 3LAMA 1HNVA 3OFEA 1S1XB 2AYEA 2EI5A 2OFGX 5B0BA 2OJ3A 3IRXB 3CCZA 2DD8S 2JRSA 3J81Y 2DO0A 1FHTA 4YB7A 1RYRA 4DL6A 2PI5A 5KFGA 3Q23A 5E2QA 3SDEB 1XNQF 1YTYA 2VG6B 4YP3A 3MFHA 3G6ES 4OJHA 2L3MA 5KG6A 2B43A 2LDYA 2LDIA 3QIPA 4FYDA 4F25A 1H3DA 1IKYA 4LF4F 2ZZMA 1HR0F 3KNAA 3R5CA 1VBZA 5F0WA 3DI6A 4OHYA 4Q0BA 3IGNA 4PQAA 2WONA 2HHQA 2CQCA 2NUUG 1DLOB 3FZ2A 4C0BA 2U2FA 3T5LA 2BE2B 1QLNA 3KLIA 5KOWA 4YDDB 2J9CA 2R7VA 2IFXA 1P8GA 3AB4B 3PIPQ 2C2EA 1N0UA 5LXYA 4ED5A 2GMLA 5IS2A 2V94A 5J1NA 3OPKA 3SMZA 3GFZA 2A3JA 4RKUC 4LSLB 3C6UA 5JUMA 2LYVA 5GAHI 4LQ3A 3M6WA 4UY8T 3THPA 4A8WA 3BSNA 2FJDB 4Q45A 2MKIA 3BDPA 1XR6A 3UPFA 2MYFA 3G6VA 1SJ1A 4PCQA 2J0SD 2MKKA 7FD1A 2VBXA 4TU8A 3DRSA 3SFGA 5E0OA 3JTNA 4KGMA 3UQSA 1U6ZA 1Y0HA 3HVTB 3IO1A 3MEDA 4FPRA 1X0FA 2NPFA 5EN1A 2NUHA 1SQEA 4AYBD 2ZE2A 3FEYB 4A8MP 4WZMA 1S1TB 3PW2A 3NNCA 4H4OA 2D9OA 3ICLA 2V9KA 3LP0B 3EYZA 3SCIE 3FFIB 4LFBF 1ZOTA 3KOAA 4RW8A 2XI3A 4BC7A 3KG0A 4K2XA 3I5BA 4MH8A 2M4MA 3AJ1A 3Q0AA 2WRMA 2I8EA 4UQTA 3H5YA 2Q79A 4ZVFA 5KFTA 3BGFA 3G8QA 2B9XA 5HO4A 2V4RA 1XMQF 4WE1B 3DLHA 2ATLA 2DK2A 3MAHA 2YNGB 3KHLA 1S6OA 5KOXA 3EGWB 3HVRA 3IC1A 2CPEA 4ETZA 1N36F 2Y1IA 5CCMA 2WCXA 4K5RA 3MR2A 5AJ3F 2YNIA 3FEZA 3SI8A 1TFYA 2B6AA 3DMJB 1LFPA 4JI8F 1N8RT 2LKZA 2RDIA 2E1CA 2HQIA 1SIZA 2JFDA 4EWTA 2VFVA 4PPDA 3QZ7A 5B0DA 4U9RA 1O8BA 2ZHAA 1G7CB 1JLEA 3TRGA 1JNRB 2IJFA 1URNA 2PEHA 3PZPA 2OLWA 2PMHA 5A8KB 2W9BB 2UXDF 4Y2MA 1XEZA 1HBOB 2BACA 1F60B 2ZBIA 4G6VB 4R5PB 3BR8A 4KHPF 4H4MB 1KQKA 1SUQA 3G8SA 1S1VA 3MM5B 3S7RA 2YH1A 4FF4A 2CJBA 2YKMB 2ZOFA 3FZBA 3S6EA 4RBVA 4KTQA 4IO1A 4DBQA 4QPTA 4K4SA 1NK9A 2IJNA 2IAJB 2QE5A 2ZKUA 5HL7Q 2HG4A 4ZCKA 4QW9A 1IBMF 5D4PA 2EFVA 3CF5Q 4DSIA 3PRBA 2B51A 4RW9B 1WTBA 1SKRA 2MY7A 1RA6A 2JWNA 3BGUA 3IG1B 3DRPA 3GG1A 2O5DA 1K73T 4ED2A 5KFZA 3CJ5A 5D3GA 3BJYA 2G0CA 5B0FA 2VQFF 1JWWA 4EU0A 1D8ZA 2ZJPQ 3OVAA 2JLEA 3PIOQ 1FCAA 2DNZA 5H9EJ 2DIUA 3W2VB 2BZ2A 3CUNA 3TUIC 1Q82T 3GV7B 4B3TF 2G4BA 2W4CA 2FJBB 1RT5B 1REVB 3O44A 2CQ0A 4A46A 2CQPA 4QJVA 4YR0A 2MKSA 3GZ7A 4FBTA 1U2RA 4WYWA 4CNZA 3T3FA 3QJJA 1X4HA 2N4CA 5GVQA 2ILZA 1ZM9A 3MM6B 1LKZA 5J2QA 2DR8A 5I3PA 1Y4ZB 5D4LA 3CCUS 4IR1A 1HI8A 3AAWB 4OLOA 3GE9A 4I2PB 4BHQA 4ECZA 2Q43A 4IDKB 4RNHA 3DRRA 4AUKA 4JBCA 2YTCA 3SCLE 2AJ4A 4IRDA 2M0GB 3K59A 3E2EA 1FK9A 3F41A 3IAM9 3IAS9 5F3ZA 1KC8T 4RW6B 2C28A 2Z2LA 2UVUA 1HWUA 2UVRA 3VQTA 3KLEA 1V3ZA 4M5DB 4OQJA 3CC2S 2N3OA 1JMTA 1D3WA 2FHOB 1OIAA 5KG0A 3GYXB 2PN6A 3X1LB 3ISZA 3AH6A 4WFXA 3UD3P 4I67A 2HNZA 3RB6A 5BYSA 5E3QA 3QGIA 1TKTB 4NLXA 1JLAA 1FRXA 3OL6A 3DLGB 3NAHA 1S1XA 4U67Q 3T1YF 1X4FA 4NLRA 5DO2A 3IRXA 2VODA 2RQKA 4IH5A 1UVJA 5FD1A 4QU7A 2ZVSA 3G71S 1WEXA 4DR7F 4FN5A 2HYIB 4CH0S 4ED8A 3SDEA 4O3QA 2VG6A 1HI1A 4DR4F 5CYQB 5KFQA 2CQDA 1HQEB 1N4LA 3W3SA 1WELA 3OHAA 3M8SA 4TY9A 2X1FA 4C98A 4OHVA 3NBPB 3DDNA 1S10A 4M1KA 3JYTB 2IMOA 1DLOA 3H59A 4ZPAA 3HDSA 2BE2A 1NH7A 1U1NA 1RTJB 4OX9F 1FXRA 3HHDA 5FDLB 3MTJA 1K1QA 5HLFB 1S1UB 2VC1A 4OMFG 2YX1A 3OJSA 1GXLA 1X9MA 4YEAA 1GAOA 4LSLA 1FRMA 1M0SA 5KT3A 3VZHA 4J9MA 2DH8A 2HS4A 1VK3A 3HJFA 1S1WB 5B0GA