2MKJA

Solution structure of tandem rrm domains of cytoplasmic polyadenylation element binding protein 4 (cpeb4) in free state
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
202
structure length
202
Chain Sequence
SHQNGERVERYSRKVFVGGLPPDIDEDEITASFRRFGPLIVDWPHKAESKSYFPPKGYAFLLFQDESSVQALIDACIEEDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGEIDKRVEVKPYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytoplasmic polyadenylation element-binding protein 4
publication title A fly trap mechanism provides sequence-specific RNA recognition by CPEB proteins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Translation regulator
total genus 31
structure length 202
sequence length 202
ec nomenclature
pdb deposition date 2014-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16367 RRM_7 RNA recognition motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2mkjA02
4PR6A 1YHQS 3THPA 3BO4A 2KM8B 1QM9A 2NLWA 2DB1A 1VBZA 5GAEU 1ZZNA 1M5KC 2FC9A 1FJEB 2YKAA 4C7QA 2X1FA 3TYTA 3CPWR 2DO4A 4QQBA 2LEBA 2B0GA 1WTBA 2J76E 2OSRA 5GADU 2DGOA 2YH0A 2MQLA 1RKJA 2DH8A 3TP2A 4WFBQ 2F9DA 2E5GA 2MQPA 1M90T 3EX7B 2DNRA 2G1DA 2MJNA 2E5JA 1VQ8S 3BO3A 1VQ6S 2KM8C 4PRFA 2DNQA 2DNNA 2SXLA 5HO4A 2YH1A 2CQPA 1VC0A 2D9OA 2V94A 4FXWA 2YWKA 3LPYA 5LXRA 1X5PA 5FJ4A 4IOCQ 1XN9A 4ED5A 1KC8T 3G71S 4C0OC 2MSSA 1UP1A 2JVOA 2DHXA 1S72S 1WEZA 2FHOB 2XS2A 2DNYA 3EGNA 4LJMA 2L41A 2QEXS 3UD4P 1VQPS 2CQBA 4QPTA 4QU6A 3MDFA 2LQ5A 1U6FA 3CC7S 4ERDA 3B4MA 3IWNC 2EK6A 3CCJS 5LJ3Y 3ZZYA 2F3JA 3IRWP 2HGLA 1X4AA 3P5TL 2MQNA 1JJ2R 2OJ3A 1X4EA 5JVHQ 1YIJS 5CXTA 2ZJPQ 2VOPA 1KOHA 1UW4A 2LYVA 1X4CA 3MOJB 4WFNQ 3G8SA 5LJ5Y 2J0SD 2DGTA 3NNCA 3L3CA 2KXNB 1IQTA 1WG1A 2N7CA 4TU8A 1B7FA 3US5A 2DNKA 2CPIA 1FO1A 2M8HA 1YWXA 5LSLA 3UD3P 4WIIA 2DGQA 4CH1A 4EGLA 3CF5Q 1G2EA 2MXYA 3CUNA 2CQGA 3D2WA 2FC8A 2MKJA 5IM0B 2KRBA 2M8DB 2HVZA 2CQ0A 3DLLQ 3CCVS 1H2VZ 1X4HA 1M1KT 2CQDA 2M52A 4OZ1A 3H2VE 2MZ1A 1URNA 2HGMA 1W2BR 3CXCR 3CCQS 4WFAQ 1D8ZA 2RS8A 1Q82T 2CQHA 1F9FA 4ZKAA 2LKZA 1UAWA 1VBYA 1FNXH 2KH9A 3UWTA 1U1RA 5GAGU 1AUDA 3G9CA 1OO0B 2DNOA 2DNMA 3P6YC 1VC6A 3PIPQ 2AD9A 2MKIA 5D77A 2RQ4A 1DBDA 2DO0A 2MKCA 2E5IA 3VAFA 2DNHA 2RUGA 2G4BA 4WKRA 1M5PC 2DNLA 1SJ3P 2CPEA 2AYEA 2E5HA 2FY1A 1SJQA 4Z2XA 3MXHP 2KRRA 1PO6A 3CCUS 1HA1A 1WF0A 4QU7A 2K8GA 3CC4S 2MZTA 1KOOA 3MD3A 3G8TA 2M70A 3G4SS 2RNEA 3U1MA 2M0GB 3BO2A 2D3OR 2X1BA 1P1TA 2MY8A 1WI8A 2E44A 2M9KA 1X4GA 4V19X 1U1MA 2NZ4A 5LXYA 3UCZP 3S7RA 2PEHA 2WBRA 4UQTA 1VQLS 2VOOA 1WEXA 3DXBA 3RW6A 3MD1A 3U1LA 4IUFA 2XB2D 3NMRA 1R8HA 1H2UX 2VONA 2DNGA 5DM7Q 2DHAA 3V4MA 5GMKa 3UCGA 1DRZA 3CD6S 3R27A 2O3DA 3I56S 2CQ3A 2M7SA 2I38A 2MKSA 3S01A 2CPDA 2GO9A 2KI2A 1YTYA 5IM0A 3VAHA 1QVGR 1JMTA 3Q2SC 2MQQA 1WHVA 2CPHA 3B4DA 1WELA 2JX2A 2MQOA 1VQ5S 2AYBA 4TU7A 2CPJA 2CJKA 1WF1A 2DGUA 2M4MA 1N54B 2X1GA 2XS5A 1X5OA 1O0PA 4CH0S 3BS9A 2DGVA 3CMES 2ZJRQ 1D9AA 2CQIA 2MPUA 1WI6A 2DHSA 1WHYA 3MURP 3MUTP 2D9PA 2KT5A 4U67Q 2LXIA 4WF9Q 2RRAA 1X5SA 5MLCV 2QFJA 4IO9Q 4YB1P 1PGZA 5IQQA 4IOAQ 1S79A 2JVRA 2VODA 3CTRA 2CPXA 2DH7A 2N3OA 2XS7A 2MZJA 2RT3A 2X1AA 3VAGA 1VQOS 3LQVA 2HYIB 1WEYA 2PE8A 2RQCA 1FJCA 3G6ES 2HGNA 1WG4A 2CQ4A 2ERRA 4F02A 1VQNS 1X4BA 1FHTA 3N9UC 2DISA 5BJRA 2RVJA 3VAMA 4F26A 1VQMS 1YJNS 4C4WA 4W92B 2OSQA 4PKDB 2KVIA 2I2YA 1K73T 1VC5A 2U1AA 1X0FA 1U1PA 1CVJA 2YTCA 2LMIA 3SDEB 3VF0B 4J5OA 2L9WA 3I55S 1NJIT 4YOEA 3CCMS 3RW7A 2J0QD 5IFMA 1P27B 2HZCA 4P6QA 2GHPA 5GAHU 3J7ZT 2KG0A 1DZ5A 5LSOA 3VAKA 1X4FA 1A9NB 1SJFA 1SJ4P 1M5VC 3P49B 3Q2TC 1QVFR 2KXFA 1YJ9S 3CCSS 1YI2S 1U1KA 3VAJA 1FT8A 3THTA 2RS2A 3CCRS 1WHXA 1Q7YT 3NNAA 2LEAA 2OTLS 1WF2A 1WHWA 4F25A 2K3KA 2KU7A 2MQMA 4TU9A 3R1LA 3SXLA 2JWNA 4UY8T 3K0JA 2RRBA 1ZZFA 1OIAA 1WG5A 2MB0B 2MZRA 2DITA 2DIVA 3NS6A 3FEYB 2CQCA 3UCUP 1U6BA 2XNRA 1X5TA 3ULHA 2M88A 4M5DB 5DDOC 1U1QA 5CYJA 1K9MT 3FEXB 1KD1T 3JB9k 4RU2A 2MMYA 2XSFA 2DIUA 2CQ1A 1H6KX 1OWXA 3H2UB 2G0CA 2N82B 2KG1A 4CIOA 3ZZZA 3BEGB 1NO8A 3MUVP 2J8AA 1KQSR 4TLQA 1SXLA 2KN4A 2AYGA 4YUDA 2MGZB 2KXHA 1H2TZ 3VALA 1UFWA 1WWHA 2N3LA 2MHNA 5GVQA 5DETA 4BS2A 5JVGQ 1FJ7A 1VQ4S 3SDEA 2MKHA 2MYFA 1HD1A 1N8RT 2DNZA 1N52B 2A3JA 1SJRA 2MSTA 2MJUA 4A8XA 1L3KA 3S6EA 1K8AT 1ZH5A 5D78A 1HD0A 2F9JA 3EGZA 2LXUA 5CA5A 1FXLA 1X4DA 3HI9A 1U1OA 3SMZA 2LCWA 1Q81T 2XNQA 3R1HA 2KFYA 2MZSA 2EK1A 2LA4A 2L08A 1DHMA 3MI7X 3PIOQ 2DNPA 3J7YU 1YJWS 3OW2R 4W90B 1HL6A 5DDPC 4LIRA 4LMZA 2DGWA 2AYMA 2CQ2A 4Y00A 5DM6Q 1U2FA 3UE2A 5DDQC 1JJ4A 1VBXA 3TO8A 5H1SV 3CCES 2QA4S 2KYXA 5DDRC 2ADBA 1JJHA 1OPIA 2RU3A 2DGXA 1VQ9S 2LECA 1R8PA 5ITHA 2BOPA 3CMAS 4CQ1A 1YITS 2ZJQQ 3CULA 2DK2A 2CPFA 3CC2S 1VQ7S 2OTJS 2U2FA 3S8SA 2MZQA 2UP1A 1N88A 2Q79A 4OZ0A 3HHNB 2CPYA 5HL7Q 3NNHA 2DGSA 1U1NA 3CCLS 4FXVA 1Q86T 1M5OC 3NS5A 1VQKS 2JRSA 2BZ2A 2MY7A 5EN1A 2KHCA 4WCEQ 1A7GE 2FPHX 2DH9A 2M2BA 4Y0FA 2ADCA 2DHGA 2LA6A 1RK8A 3MUMP 1BY9A 3G96A 3VAIA 1NU4A 3P3DA 2MKKA 1U1LA 2EVZA 2MGZA 2CPZA 2OIHA
chains in the Genus database with same CATH superfamily
3W5XA 4FF3A 1T03B 1NMEB 1C0TB 3PG9A 2YKAA 3RBDA 4C7QA 2QJ3A 3OBIA 1RU1A 4RUAA 3MMJA 1Q8IA 4PYDA 3UDEA 1RE1B 1HPZA 3K57A 3VGSA 1XR5A 1VC0A 3OTCA 3FC9A 2DR5A 1NK4A 1XN9A 1W7WA 1RDRA 4NLYA 3HXMA 1UFLA 2ZHAA 4ZPVR 5L8RC 4RWWA 5L1LA 4ID5A 2OJ3A 4DWIA 2VOPA 3M8SA 1X4CA 4JI8F 5KFNA 2OPQB 1I1GA 4WFZA 2B4VA 4ICLA 4JI6J 2KT2A 4QYZJ 3L9ZA 2XM3A 3K8VA 2D3O1 3TJ9A 4L75A 1Q16B 2HGMA 2I8EA 1W2BR 4WFAQ 1D8ZA 2RUSA 3J7A1 3MEKA 4LFBF 1Y3JA 2DNMA 1JKHB 2XMVA 3RR8A 3D28A 1Q4RA 1W2IA 2ZC4A 1GT8A 1NPKA 2FY1A 4URQU 1SQGA 1SJQA 1UKUA 3R2DJ 1N4LA 3BQ1A 2MZTA 1KOOA 1JNRB 3BO2A 5KOWA 1FVQA 3OR2B 3DM2B 8ATCB 2KJVA 3ETOA 2RIJA 3RW6A 3R9LA 4PWWA 3M6XA 4B3MF 1CPZA 4U6PA 3UCGA 2FZKB 2AGPA 3C2PA 2FHJA 1U47A 2Q43A 2ZWPA 1CS4B 1HMVA 4F36A 1PAUB 2GIQA 5KFQA 1BQXA 1V5IB 1QVGR 2XZDB 3HLUA 4FXDA 2CJKA 2N4DA 2DY9A 1Q5YA 3V6DA 5HQMA 3L95X 4ECTA 2B8QA 4GRSA 2ZJRQ 2CG4A 1WHYA 1YJTA 2X7IA 2VG5A 3PYFA 2J7UA 4EYHB 2P5VA 1BHNA 2FUG9 1RWXB 2IA6A 4NLXA 2LDIA 2YKNA 2VODA 1RAHB 3DU6A 3EZOA 2XS7A 4DF8A 2VJUA 4DV6J 4P2MA 1WEYA 3FQKA 2V2VA 2QMWA 4QIVA 2HRUA 1O5JA 3K5MA 3Q8SB 2EG1A 3OFFA 1VQNS 1FHTA 3N9UC 3I9V9 2LXFA 3AB4B 3CE8A 3C15A 3ZC4A 2NSBA 2FVRA 2HWIA 2J9EA 1NJYA 2A2CA 1DZ5A 1XR7A 3TAQA 2IM1A 3NCPA 4LF9J 4DX6A 1M5VC 3HP6A 4GKJF 4L6V3 1EQ0A 2QZ8A 2FLOA 3M32A 4C8MA 5IZHA 2JOQA 3H5SA 4GMKA 4DL6A 3JXOA 2OP5A 3R1LA 4FYXB 5SUHA 2A6MA 4M95A 2B9EA 3DNCA 3A8KA 2DIVA 3NS6A 4V1Ak 2Y0BB 2ZKUA 4MIAA 3ULHA 1HBOA 2M88A 4P73A 4IKAA 1HKAA 1SV5B 5HMZA 2GJ2A 5CYJA 4KT0C 4U95A 4YDXA 3NGDA 2XMTA 1R8BA 2EFGA 3TZXA 4L3KA 1TU0B 4C97A 3JQJA 3ZNJ1 1X9MA 2V2KA 1MMNA 3ZZRA 2KXHA 3VALA 1WWHA 5HMWA 4QYZK 1N52B 4PAAA 2YQ3A 4ZJQA 2G9OA 1RAJA 3JTOA 4YHHJ 3ENVA 4DU7A 4TQSA 2BANA 2LCWA 3R1HA 1Q53A 5J2MA 1GMUA 4ZVSB 3VQTA 5E3CA 3CJTA 2NR0A 1NPRA 2AYMA 4NASA 4OYPA 2ROPA 5RUBA 5IOLA 3IG1A 3D54A 1XIQA 1HNVB 2FD2A 4PXDA 2GGPA 3D68A 3FBCA 2W8KA 2Q79A 1T3OA 2UUCF 3M8ZA 3CCLS 1HQ2A 1T8EA 4DG1B 3DOMB 3ITHB 2DH9A 3MECB 4MMOA 1CJTB 2CZVC 4B3TF 2WVDA 4PR6A 3HMJG 2WW8A 1KN6A 2I9SA 3CPWR 4OFZA 3A3OB 4A48A 3E01A 2IBOA 5GADU 2ZH7A 5FLXY 2ZOGA 4MIWA 3JS9A 3BPSP 2Z2MA 2WRMA 3H40A 2MJNA 1XNQF 1I94F 4ED1A 1RSCA 3M8PA 2YKPA 4PWUA 4KGZB 1DTQB 2FLLA 3CVKA 3H4BA 1RYSA 1U8WA 3GPAA 3W9IA 2HHWA 5HLFB 2CQBA 1R7IA 4ER8A 2AQ4A 4DV4F 1U6FA 3B78A 1TVRA 3CCJS 3T1YF 4N41A 2HGLA 3GQCA 4F3QA 5T7LA 3PW4A 5KFTA 4CI0B 5KFRA 2KXNB 2YKQA 1IQTA 1WG1A 4TU8A 3H90A 5JXSA 2GNKA 5E3AA 1FX4A 2ZEJA 1KLMA 1RT4A 2NXJA 3W61A 4CH1A 3PX4A 2AJ1A 1IN0A 2XO6A 3MFIA 3EDRB 3QRQA 3FDSA 3QT8A 3TZWA 4MK8A 4USKA 5LMUJ 2OI2A 2V69A 1VBYA 1S6QB 2QX0A 4DN0A 4XPEA 4IDKB 4K4TA 2VFVA 2OEMA 2RQ4A 3PVXA 1VGYA 1S1UB 2DBBA 1YZ7A 2AYEA 1XMQF 3S1TA 1CEZA 4V19X 4LR7A 3S7RA 3TX0A 3GSDA 2PEHA 3D9BA 4K4YA 2AWZA 1TZ0A 2DXDA 4L72B 2EKYA 2OPQA 3KK2A 2E5LJ 1U48A 2FZGB 2YNGB 3TQEA 1NJWA 3CD6S 2HAFA 3UDVA 2IC3B 3BDPA 4DR7J 4E2FB 4ECWA 4LR8A 2IM0A 1WHVA 4JB8B 2CPHA 5CAAA 4B9NA 4YMEA 3OSPA 3HK2A 3LTOA 4ZCKA 2UUBF 2Z2YB 1RWPB 4W4MA 1F3FA 4B3MJ 1T02A 1FRHA 1YRUA 5CD4H 1U09A 3TAMA 3MURP 1JKHA 2WOMB 1NK8A 4AL7A 1S4FA 2Z2ZA 4UQGA 5B0AA 4AL5A 1CG2A 4DX7A 3OJSA 3BM7A 1IBMF 3OR2A 3DM2A 2G1HA 4J9NA 1IQZA 5KFDA 3WX8A 4LF6F 5CYMB 5DG9A 4HTJA 2KVIA 2FVCA 1RYRA 1K73T 2YTCA 3RRGA 3JQMA 1SPBP 5E0OA 5M2UA 4X62F 1CS4A 4OZ5A 4P6QA 4HL9A 1IXKA 1NZAA 4N8NA 3ZTQA 5DLGA 2GHVC 3RZAA 1ROFA 1TK8A 4C48A 5J1PA 1RA7A 2KZZA 1OIAA 2FJBB 3MCNA 3LP0A 4RW4B 4LF4J 1U26A 2EBGA 5HSPA 1IWGA 3SFGA 4GKJJ 2MHEA 1Q8KA 2V50A 2XSFA 1F1BB 4HT7A 2DXEA 3LUYA 4DEZA 3K5LA 2H5EA 2AYGA 4USIA 3CDBA 3M6WA 4JOUA 1N8RT 3D0IE 2DNZA 2PIIA 1HQUB 1R43A 1RWMB 1JXVA 1OY6A 3MM7B 4M5IA 1NDKA 1N5SA 1U1OA 4CO5A 2RF2B 4NLSA 2WK4A 1Y4ZB 3MAQA 4CP5A 2UXBF 2CJAA 3J81U 1G1XA 1WSRA 2EBEA 3KLGB 1BMQB 5DQGA 3AD9C 4HI1A 3OL9A 2GJIA 2F65A 2XY6A 1GEHA 1WKKA 3DYAB 3CDAA 3S8SA 1SV5A 2UP1A 1S49A 1H74A 2XG8A 2QLFB 2Z57B 2JRSA 2MY7A 5EN1A 2KHCA 5L39A 3AXMA 1ACMB 2K3IA 3MUMP 3TR5A 2MKKA 4OHWA 3BO4A 1NB2A 1DLOB 2DB1A 1ZZNA 5DLFA 2VPZB 1ZBTA 1SQEA 2RQMA 3I0RB 4USWA 1OYEA 3OVSA 1SIWB 1OMSA 2MQLA 2D3ZA 3HD2A 2FZCB 3BGRA 3D4JA 2OPPB 2E5JA 1DTTB 5KG4A 2EFQA 3BSAA 2XHCA 2WSCC 4RBUA 2BJ8A 2MSSA 3RB3A 2JEJA 3BDEA 1FRJA 4G6VB 3O3LA 4ILLA 2RHQB 3MMBB 4H4MA 5LJ3Y 1QAJA 3OUYA 2RU9A 3MR7A 1JJ2R 1KLNA 4O4RA 3QRRA 5KFKA 3G8SA 4U7UK 4B9LA 4R5PB 4HYKA 4Q0BB 4DG1A 2PGCA 3DOMA 3ITHA 3MECA 1CJTA 1DY3A 4ALZA 5KT3A 3A8EA 1S0MA 4USMA 4DV4J 1HR0F 1M1KT 1SBRA 2UUAF 1URNA 1S57A 3D67A 3A12A 2C28A 1NZ8A 4ZKAA 1WD6A 4J9SA 2B5JB 4ZLJA 3NOGA 1SKWA 5HBMB 3FRYA 4KR0B 4LF5J 1VYAA 4DFPA 1DTQA 3W3SA 1QTNB 4MKYA 1TELA 1GMVA 2W2PP 1R89A 5HLFA 3NMAA 1WF0A 3QLHA 1BWVA 3AQOA 3Q24A 1ZETA 1HHSA 3DI6A 3K2YA 5EUHA 1RLCL 1H2UX 3PM9A 2DNGA 2HZAA 1IKYB 3HVWA 2OPRB 2GO9A 4OJ1A 4YR3A 1FF2A 4ECVA 1RCXB 3DLHA 4ZP7A 2AYBA 2R8HA 1WF1A 3CCWA 4KE5A 3TUZC 1ITPA 1S6QA 4R8UB 1HHQA 2OLWA 1S6UA 2FLNA 2MPUA 3G8QA 3ETMA 4FBUA 4WU2A 5KFUA 4GO7X 2C2NA 1S1UA 5I3UB 2LQ8A 1QE1B 1V9OA 2DH7A 3GFXA 1UZDA 3QQCD 3U02A 1S1VA 3P4UB 4UUXA 3RGIA 4DCOB 4PXBA 1RT6B 4NRTA 2WCXA 1TR0A 3KOAA 5KG7A 2XWYA 3TAPA 2AEMA 3PX6A 3EVMA 2CA9A 2YNGA 1TK5A 2L9WA 3BZQA 3I55S 1MN7A 2QV6A 3WC2A 3HFKA 1JNZB 1FESA 2GHPA 3I96A 5EDWA 3HSZA 3GG1A 3GCWP 3C6TB 1P1LA 4ED3A 3THTA 5KG1A 4WKYA 2UXCF 3CIZA 3CJSA 3PNIA 3MR3A 3TVYA 4YFUA 3VZHA 2HKEA 1FWKA 4F67A 2DITA 3FEYB 4I6AA 1O6XA 2DR9A 3H25A 2AKWB 4M5HA 2V4QA 5DRKA 1KD1T 3JB9k 2ASLA 2CNKB 5A0YB 2G0CA 4B9SA 4CIOA 1QY7A 4RW9B 2PC6A 1AT1B 2BRKA 3UN2A 1PJ7A 4C8ZA 3FSXA 3HSGA 3RAMA 4ANDA 3W5YA 3KLFB 3TA2A 1FJ7A 1N5VA 4JI4F 2R8GA 2IPOB 4OV1A 3OLBA 3W5ZA 2XNQA 5K5MA 3A1YG 2ZH4A 4YY3J 4W90B 2HVEA 2PMHA 1KBRA 3C16B 3BB5A 2J7WA 1S9GB 3CCES 3FCVA 3CSKA 5H9EJ 1JJHA 1BQMB 5CHCB 3KLEA 3K7RA 2VV5A 1NKEA 1HARA 5B0CA 1IKWB 3R6GB 3L7UA 1NKCA 2R7OA 1PYTA 1Y00A 1ZM9A 4Y0FA 1ZA2B 1VR6A 3W8PA 4TY8B 5DZ6A 2XMKA 4Y65A 2CPZA 3LALA 1FRMA 1Q79A 3BGLA 1M5KC 5AT1B 2O1PA 1QTMA 4U7UD 3MM7A 1FK9B 3T5KA 4CWBA 1U6ZA 3W62A 2QRRA 4DPYA 2RF2A 4AYBD 4DR3F 1J2VA 2CIMA 3AJDA 1NB7A 2E29A 3SIPB 4UOGA 3N6NA 2BJDA 1VIOA 2V8VA 2DEIA 2G2OA 3KLGA 1HW9A 2CJYB 1HWLA 4DUZJ 4I67A 3M8QB 4R25A 3DYAA 3MM5B 2ZVSA 3DKDA 2ZJPQ 1TL5A 2LYVA 3ZTOA 1N0VC 2FIUA 5L9NA 5HMYA 3PZPA 1YWXA 2HHTA 2GMHA 2DGQA 3BGOP 4NYZA 3CF5Q 2CZ4A 2QFIA 3KNGA 5HMXA 2XGQA 1DLOA 3CDWA 1Q0NA 1JXLA 1TQLA 2CQDA 3H2VE 3I0RA 2YKOA 4FZVA 3TW0A 2FVPA 1PYSB 3P6YC 3AH6A 1DTTA 4I2PB 5D77A 2MKCA 4UY85 4HVZA 1CBKA 3R6LB 2O5DA 4DX8H 1APSA 4TKTA 1M5PC 4ED0A 4WE1A 1X0PA 4JI7F 5D4NA 3J81Y 3MMBA 5CCMA 4CCHA 2IRUA 2R2SA 1VQLS 2VOOA 1WEXA 4R5PA 5KFZA 1IBLF 4Q0BA 4JV2A 5GMKa 3LGMA 4A8FA 1XMOF 4ZVQB 2VQFJ 2OGUA 4PCQA 4NYOA 5B08A 1SVDA 1IR1A 1U02A 5K14B 3MCMA 3MEEB 2W7PA 4EBDA 2DD8S 2H5IB 2E9RX 4KQZA 3CNQP 3KK1B 2KYZA 4X4SA 3BS9A 1NSQA 2QSWA 5HBMA 5B0FA 1GXTA 2XY7A 4F4AA 4YB5A 5CABA 4C3KA 5L46A 5IWAF 1NXIA 3CIMA 4ANEA 2GV1A 3H0PA 4ATNA 5A8KB 5BYQA 1T9WA 4F02A 3CJ5A 2B43A 1MWZA 1VQMS 5HVHA 1QSSA 4PKDB 3J80U 2YNHB 3SDEB 3KLHB 1IKYA 1S0NA 4OHZA 4KHRA 4DSJA 2Q6CA 5IFMA 4DSLA 1RTHA 1JLGB 5GAHU 3TJ8A 1TAUA 1IM6A 3T9NA 5E3PA 1UETA 4Q44A 4JYAF 1RP5A 1R31A 3UDCA 3SV4A 4R8UA 3FSYA 2LEAA 4QWBA 5BR8F 2OTLS 2J8SA 3W2VB 1REGX 4MKBA 1EKRA 1VK3A 5I3UA 4LBIA 4Q45A 4PG8A 1QE1A 1FWLA 4PABA 2QA4G 2ZH1A 5KOXA 4M5DB 1SL0A 1WOOA 4WXWA 3CDUA 2CQ1A 1RT6A 1RAEB 4JI1F 4Y34A 2ASYA 2FJXA 1URRA 3QWUA 2BKOA 1KVIA 4YUDA 2EC0A 2YNFB 4JI0F 3GYNA 3MZIA 4B02A 2C22A 5D78A 4IRDA 4DQQA 2V34A 1RWKB 2KKHA 4L74A 2VHGA 4NA1A 5HQ8A 4GC7A 2EW9A 3C6TA 2L08A 2NXUA 4C0HA 3QZ7A 3MOZA 4ES1A 1U2FA 3LANA 5DDQC 3KK3B 4JI4J 1F2HA 3KJVB 3SCJE 1J5OB 3FCWA 1OPIA 1EARA 1VQ9S 4X66J 1YITS 3GE9A 2CVEA 4F8RA 3UVJB 2XQCA 5A0YA 4A8WA 2KHDA 1A7GE 4WFXA 4RW9A 4X4QA 4WK3A 1HNXF 1RAOA 1RK8A 3LAMA 4B9TA 2JFDA 2W2OP 4KGVB 3AJ2A 1VHFA 2VPYB 2BEFA 5AXNA 1NJXA 2VDIA 4L3NA 2YXLA 4C9DA 1MW7A 4A8OA 2LEBA 1SIZA 1S9EB 1LK7A 4GVBB 1DFDA 2HHVA 1NKBA 3ILJA 1TAQA 4OYBA 4DV2F 1IJFB 4KKOB 1V3RA 3RAQA 3H98A 1KS2A 4UUWA 4ZP6A 1D3WA 3G71S 3MR5A 3LGHA 2DHXA 1UJ6A 2L41A 1IVZA 4P9SA 2HVHA 2NXEA 3B4MA 3IWNC 2EK6A 3ZZYA 2VA3A 3IRWP 1TKZB 1X4AA 1IKWA 5F9LA 1IBKF 2XMWA 4PG4A 2ZOMA 1RAGB 4ZVOB 2ZDOA 4IYQA 3HSJA 1PG5B 3A3PB 2MKYA 4EO6A 5A2QU 4TY8A 3ENAA 4GO5X 2GQCA 4KV8B 3SQGB 1OSCA 5C7PA 4WJBA 4DR2J 2E9ZA 2MZ1A 3C6UB 2KB2A 1FK9A 2H65B 2CQHA 1UAWA 1FNXH 2WAQD 3C46A 5C2GA 3B6BA 2R7UA 1HWJA 1CJKB 4EYIB 4OYMA 4AQYF 4DDFA 1RWWB 3QGPA 1RTDB 4HDGA 3PYDA 5IT9U 2C3YA 4ECXA 3OL6A 3M8QA 4ECUA 3HHKA 5F0WA 3DGPB 3GONA 3G4SS 3MM5A 4WU3A 1WI8A 2CWKA 3IBWA 1NDPA 3PKMA 3UCZP 2J6SA 2F4VF 2VU5A 4J37A 2VD3A 3DDNA 2VZ9A 3JSRA 3LGNA 2ZBPA 3DHWC 5DM7Q 3V4MA 1R3NA 1VIXA 3E8OA 2VUGA 3EVWA 4KY3A 3I87A 3VAHA 2QGFB 3RBZA 3IMQJ 2IVYA 4J9KA 3T9ZA 2JX2A 3AA8A 4DQIA 2Q66A 1X5OA 3U7JA 3TX8A 4ZLPA 2DGVA 4PXEA 1D9AA 1YX2A 4TYAA 1B70B 2OUGA 4I2PA 3PO5A 4RUHA 1X5SA 1FD2A 4O44B 4F4XA 3RBEA 3CD5A 2YWGA 1EHWA 3ZXWA 3D66A 1FJGJ 2MEWA 2Q3PA 3BJYA 5D3GB 2PE8A 5B7WA 3G6ES 1WG4A 1SC3B 3EXCX 1LXNA 3RRHA 1WC5A 2RVJA 3TUJC 1H38A 4MKVA 2VPWB 1U1PA 2LMIA 4C3MA 4J5OA 1TV6A 3C19A 2J0WA 4ZVFA 3OR1B 4I64A 3AB2B 5K14A 3PW0A 2LDYA 3IR6B 3MEEA 2R7RA 1SJ4P 5H9FJ 5JJBA 1NLKL 2YWFA 3UR3C 1U1KA 3VAJA 1FT8A 3KK1A 2VG7B 3V4IA 4DN9A 1T11A 1Q7YT 4Q8FA 1WHWA 4C11B 2B56A 3ZZPA 2DRBA 2ZE2A 1WG5A 1XBWA 1UCNA 3GILA 2MZRA 5ETLA 1X9WA 1QLNA 1NSKL 4N47A 2HPUA 2C3OA 1DURA 2CNNB 5A8KA 3UO0A 2KG1A 1M0SA 1UVNA 4DFJA 4NXNF 3I31A 4ILRA 2YQ0A 2YNHA 3F44A 5DETA 3SDEA 3KLHA 1I6JA 3BPDA 1JLGA 1RA6A 5HVGA 2L48A 4ZP9A 4ED7A 4LVNP 5JUMA 2XCPA 4QBUA 2FJAB 2ZH5A 3QSYB 3IP0A 2RAQA 3MI7X 3VR1A 3J7YU 7FDRA 4TY9A 4LIRA 1T9VA 2CQ2A 4XAKA 1C1BB 3W2VA 3IAM9 2ZHBA 1KVKA 5E5NA 4IFYB 1X60A 1AB8A 4CTAB 3PW7A 1IWAA 3QMQA 6FD1A 3V6JA 1FTCA 2HQGA 2CPFA 4M5DA 1Y3KA 2IYIA 2IMOA 4MK7A 1LWCB 5C24A 4LSZB 2HURA 4JBCA 1S5ZA 4H4KA 1AFJA 4WBFA 3OVAA 3UD5A 4HDHA 2YNFA 2V63A 3OTBA 4WZMA 2WZ1A 5IT4A 2W24A 3MEGB 3AJ1A 2DO4A 2NXCA 3M8WA 4PUOB 1RKJA 4Y3CA 2E5GA 3GG0A 3BN7A 2R7TA 5I3QA 2QMUB 2YWKA 2Z4PA 1T0TV 3KK3A 2VC1A 3KJVA 5LMNF 1J5OA 4LJMA 4IO1A 5DJBA 3LP1B 4UOHA 4NX9A 3GYGA 3UVJA 3RB4A 1X4EA 1YIJS 4WP8A 3Q89A 4H4KC 4DV2J 2FGOA 4NYPA 3OL7A 2IVFB 1CC8A 3KLIB 1EP4B 2HFZA 3KUGA 1RT5B 3HCXA 1YJVA 2MXYA 3D2WA 5IC4B 2N4CA 2ATCB 3GTYX 4FS2A 2R7VA 4EFAC 2YKMB 5ETSA 4FNHA 3J7Z5 2IDEA 4OHXA 4FKXA 3OFHA 5H9FK 3IS9B 2WHOA 4ZPWR 2ZZNA 2UZAA 1S9EA 1CLFA 2HQCA 4GVBA 1LFWA 1SKRA 4M5LA 1F6TA 3G9CA 3H42A 9ATCB 3BH6B 3MAHA 2HS4A 4KKOA 1OQ3A 3VAFA 1NK9A 2RH3A 3ZO7A 4WKRA 2P2CB 1R0AB 4JI5F 2IY5B 1B64A 2CPEA 4F2SA 2PEBA 4OHYA 3JSMB 1H72C 3UI3A 4LRBA 2M70A 1F60B 2BBEA 2M9KA 1X4GA 1TKZA 4JV1A 4KB7A 4BCAA 3DC2A 4ZDNA 3HHLC 4I7FB 3CD0A 4ZOSA 2VH7A 1TMJA 4EMDA 4CLUA 1WC1A 1TP7A 3GMGA 2OPSB 3HT3A 3R27A 4NCGB 1WKLA 1ZM3A 3PJXA 2MKSA 3S01A 4F7VA 3G6XA 3CJ2A 4KV8A 3SQGA 5CYQB 1DQ9A 3PRBA 4HR2A 3R2CJ 3OPKA 2WVEA 2AJQA 5B0EA 5E3RA 1VQ5S 1J27A 3C6UA 4WYLA 2M4MA 3HVRA 1P9QC 4NLGA 3KUHA 1S10A 5KFHA 3F73A 4RU9A 1CJKA 1N5QA 1WI6A 2DHSA 3T5JA 4O3RA 4FDFA 5AJ3J 2QFJA 4FYDA 3JQKA 2ZNZA 4RBTA 5BXIA 3AAWB 1RTDA 3CTRA 2R7WA 4OI2A 3IWLA 4ZMMA 1C1CB 3DGPA 5F8HA 5KT6A 5KT4A 2CQ4A 2ERRA 4HT5A 2R7QA 2O66A 1HNWF 1TFYA 4C8OA 5DGBA 2KO1A 2CKWA 4YOEA 4O0NA 4JV5J 1WC6A 1MROB 5D0EA 4CLLA 2O01C 4N5SA 4DV3J 4DL3A 4DFKA 1SI9A 3NRBA 3GB0A 3PKYA 4FVCA 3UDLA 1T3NA 3IR7B 3D6HB 2ZH9A 2KVQE 1L3UA 3G6YA 4F25A 1S0VA 3QAUA 2BX6A 2NXNA 1T9YA 2UV8G 3OHAA 3NCQA 5LM7E 2HLTA 4DL2A 4O44A 3EVOA 2XNRA 4HKQA 2ZM6J 1VHIA 2OEJA 4KPYA 5D3GA 4DL4A 3QYYA 4N8OA 4RU2A 2RJZA 3NBPB 2GFFA 1OWXA 2VC0A 2GQ2A 2Y0SD 2ATLA 3MAAA 2KN4A 5GVQA 4JI6F 2IM2A 3N0VA 4RBVA 3Q8PB 2MJUA 4ED2A 2OO4A 1S6PB 3EGZA 5CA5A 2GIFA 3SBMA 4CLWA 4IH6A 1HWKA 1S1TB 1JLCB 4NRUA 1U2CA 1RT1B 4TXSA 2ILYA 4NZ0A 3GIJA 2AU0A 1VRUA 1GXLA 3PIOQ 2VG7A 2M5YA 3OW2R 3KHHA 4G1QB 4OI0A 2ZD1B 2M3DA 4LMZA 5DM6Q 4C11A 1NRKA 3DRXA 1RTIA 4DSEA 3C14B 1QUVA 4I69A 4J9VA 3ILIA 3DRSB 3GV7B 3BBFA 1FXRA 3IWXA 4RX6A 2L3MA 3VQSA 2DK2A 3L09A 3MM6A 3OT9A 1NSAA 5KFYA 1KTVA 2F63A 2WVFA 2V5HG 1R8AA 1YLXA 1KTQA 2FVSA 4FXVA 1M5OC 5ADZA 2GCFA 3H20A 3PR5B 5A8RB 3PFEA 4NMXA 3VAIA 2EVZA 4KH0B 4HHHA 5GAEU 3MPWA 3P8BB 1VDHA 1LOUA 1FJEB 2IJNA 4DPUA 3TYTA 2YPYA 4EO8A 2IYGA 2GS8A 2FJVA 1Y5IB 3KG4A 3K5OA 2W7AA 3QO9B 2EPIA 4LRAA 4A4JA 1LFPA 4IOCQ 2ZVIA 4QOTA 4HI2A 1LEOA 1KKHA 1R6VA 1Q5VA 4IFYA 4CTAA 3GIMA 2QEXS 1V3ZA 3IO1A 4BLGA 3I6PA 4DV6F 4XTTA 2DT9A 1HW8A 3RR7A 2AV5A 2R3VA 5LJ5Y 4OX6A 2DGTA 1LWCA 1B7FA 4LRDA 1TUGB 1DQAA 5IT0A 3GU0A 2P8IA 2V67A 1G2EA 4USUA 2MKJA 4DMZA 2CQ0A 1LW2A 1FE0A 2AJ2A 2H5JB 5K9FA 1ICEB 3MEGA 4LF9F 3O2IA 4PUOA 3T3FA 5FLXU 2QSFA 2Y9HA 2KH9A 3TARA 1RWOB 5CH7B 2F8MA 4W98A 4OYWA 2I5JB 4NLQA 3MMCB 4IH5A 4LFCF 4KBIA 3GIRA 2VB6A 1YK9A 4EZ6A 4FS1A 1VRTB 2ZC3A 4WP3A 1PO6A 2ZBQA 4FF2A 3RJMB 1JXEA 3LP1A 3RG6A 1OYDA 2RNEA 2MY8A 1KSPA 1BD6A 4NLUA 5LXYA 5D0GA 1RQ0A 1CC7A 3KLIA 3NLCA 1EP4A 2UVWA 5ETPA 1FRXA 4ZVTB 2DCUB 1RT5A 2W7OA 4ZITA 4BC7A 3PDNA 2HS3A 4CM0A 2I38A 3IM9A 5L1IA 4O3SA 4OYZA 1KONA 2YKMA 3AT1B 4WPAA 4YHHF 2ASJA 2D74B 4LF2A 4ZVUB 3IS9A 4M5GA 4BDPA 1S76D 1Q78A 2K7KA 4XDCA 1UW9A 4K50A 1UEUA 2KT5A 5GADI 2RRAA 2GMLA 4ED8A 4TYBA 4PG5A 4A8KA 3DRYA 2X1AA 3JSMA 2BM0A 4OJHA 1U4BA 3OTOJ 1RKIA 1GXUA 2DRAA 2HMIA 1C2PA 3D1OA 4PEOA 3SEOA 4I7FA 3PW2A 1N33J 2A1BA 2DTJA 2V9KA 3TNVA 5DZ7A 3IR5B 4K4UA 4M1KA 4C4WA 4M5NA 3EGWB 2OPSA 3I5CA 4NXMJ 1CVJA 1BXNA 4NCGA 5T41A 4TQRA 4KFBB 2XC9A 2UUTA 1HI8A 5CYQA 4B3SJ 2VKRA 2KG0A 2RDJA 5D6GA 2GO8A 1ZAXA 1X4FA 1K44A 2K2PA 3NCRA 5K8MA 1TKXB 1X8DA 3G86A 1B0PA 1OQ6A 3LO3A 2KDOA 1WF2A 4USVA 2KU7A 1XR6A 5A76A 1NK0A 3BSOA 2BUNA 4CYUB 5HI7A 1K0VA 3MM8B 4KSEB 3CDEA 2IA0A 4P74A 1X5TA 4ZPCA 3I5AA 1C1CA 3FCHA 3C3LA 4C8KA 1RB0A 2HFOA 4DQSA 5B0DA 2MLZA 4WXOA 2LLZA 3IRXB 4ZPAA 3NWRA 3K59A 1N6QB 2AJ4A 4DJBA 3NL0A 1MROA 1FXLA 5LMUF 4AFFA 4KRWA 3G82A 2VBXA 2DR7A 2EK1A 4Z7YA 2P9GA 3DN9A 4QWAA 3VV2B 3JAMY 3P96A 1UVIA 4LT6A 5ITHA 2A0FB 4K5SA 2UU9F 3HM9A 2C2OB 1N48A 2QYGA 3QFWA 2DY1A 2Y8WA 5ETVA 2GVZB 5J1EB 3NNHA 3NBPA 5D8HB 4ZA1A 2CG8A 2H9ZA 5ETQA 1AYEA 1N32J 2E5LF 5F8JA 3O6QA 4OMFG 3IGNA 2IRYA 2R8KA 2ZOFA 3OHBA 2HVDA 5E2QA 2ZDPA 2NLWA 4DR7F 4KJIA 4U8YA 3SCIE 5M2RA 1S6PA 3MMAB 4QJVA 3V2UC 4F3OA 4Q7AA 2DGOA 3R3TA 1S1TA 1JLCA 3UN5A 1RT1A 4P7TA 2F9DA 3BO3A 2KM8C 2MQ8A 3V81B 4G1QA 2D9OA 2ZD1A 4DQPA 2QC3A 2PFFB 3BN4A 3IAS9 1UWAA 3JSYA 1KC8T 5DG7A 3C14A 3D3BJ 2W4PA 3TANA 3UD4P 2BKNA 2B6AB 4F4WA 3DRSA 5C25B 4QU6A 2LQ5A 1A6LA 5KFSA 1RHKB 2E1MC 1KOHA 1Q8BA 3QJPA 5FD1A 1MNEA 2DKOB 3Q8UA 3THVA 3NWGA 4P52A 1JLQB 1FFSB 2NUHA 4AXIA 3K5PA 1FRKA 1FD8A 1NK5A 3A8IA 4F0MA 4OZ1A 3UPFA 2HNYA 2RS8A 4DQRA 4NLVA 4RO0A 2C1EB 1FEHA 1H73A 1R8CA 3QO9A 3BGFA 1VC6A 4FF1A 3LA0A 3KG1A 1TK0A 3DRRB 4USTA 1MU2B 1SJ3P 4LF4F 3BV8A 3I4HX 4Z2XA 1M5SA 3CCUS 1HA1A 1UEKA 2CZ9A 1BE4A 4DR4J 1QSLA 2DCLA 3T1HF 1C4CA 4ZCMA 1N5YB 1Q7LB 4QYRA 1UJ4A 1R8HA 2VONA 3FEZA 4OX8A 4LFCJ 1F5CA 4OYOA 2O3DA 3I56S 1NAQA 3AA9A 1NUEA 4PPDA 4FNIA 3VZIA 5KG5A 2MQQA 4WP9A 2HQIA 2W4DA 1OPZA 3M30B 2ZKTA 1RZMA 5MLCV 3MMCA 2ILZA 4ILMA 4NPOA 5HROB 1VRTA 2WSEC 3DLKB 2C3PA 2C2DA 2HGNA 1SL2A 2W01A 3CGIA 3ONQA 1M5HA 1KEKA 4ZPBA 2AMCB 1VC5A 3QT7A 4Z7CA 2AGOA 3CCMS 4P72A 4YEAA 1P27B 2HZCA 5LSOA 3VAKA 5LOQA 1R0CB 5A8WB 3ILLA 3NNAA 2EC2A 4CO3A 1AA1B 3RB6A 3F56A 2VFTA 5KFVA 4K4VA 2FB0A 4I2QA 4KC5A 5ETNA 1PSDA 4HH0A 3ISND 4X4OA 4DV0J 1UFWA 1IM4A 5KFJA 2HNZB 3CWJA 4ZK7M 4ZPTR 4DL5A 1SJRA 2PT0A 4LVOP 4M8LA 3H4DA 2HHHJ 1HD0A 3UNYA 4S0MA 4OLPA 3WIVA 2HRTA 2VQEF 3HO1A 1SB6A 1WC3A 2D1CA 3PJ9A 4B3RJ 1TKXA 1EX8A 2E1RA 4Q8EA 1KWMA 1ZS6A 1SH0A 2ZH8A 2IJRA 2QL5B 5DDPC 3GWCA 1V5VA 1PBUA 3FRZA 4LF5F 1EQMA 2KZMA 1T03A 1C0TA 4CNZA 4IRCA 4CYUA 4DXLA 3MM8A 5J2NB 1R8PA 2ZJQQ 3ENWA 2MZQA 5D0RA 3HHNB 1NDLA 2K1RB 3AY0A 4CT8A 1YBUA 4F4ZA 2GMJA 3U1NA 4JV0A 4MJKA 3IRXA 1D09B 2EG2A 1RJJA 2UU9J 1ZA1B 1CULB 3D6MB 2C2EA 4ZCLA 5KG6A 4KHMA 2XCAA 2BW2A 4LREA 3TP2A 5F0UA 1YGYA 5THWA 2G1DA 3M1VB 2DNQA 3ZFVA 4IFVB 1S9FA 1LWEB 3OJUA 3M8RA 2XZWA 3IA0A 2JVOA 1O8BA 1KQKA 1BQNB 3HDSA 4OI1A 1MG7A 4MIBA 4CLFA 2DPIA 2EFNA 3HJFA 5GMEA 3HSDA 4DUYF 1T9UA 2GVZA 1OS5A 5J1EA 3MOJB 3R7BB 1SH3A 3R8YA 2YVSA 3E3XA 4NLDA 2WBMA 2CPIA 1NHKL 2M8HA 3UD3P 1I3OB 2V8HA 2LP4A 3EUNA 3M4XA 1FKOB 3TJAA 3DLLQ 1KR4A 2YWHA 2HW3A 1FWPA 1TL1B 2B51A 3OL8A 3MMAA 2XSJB 3MEDB 4BHQA 5AXLA 4GKKJ 3UW1A 1OO0B 4D3GA 3MPDA 3V81A 2HAIA 1U24A 2DO0A 1CJVB 3F0NA 2RUGA 5I3PA 2JDJA 2B7BB 2BACA 4OI6A 1ZAWA 1K0TA 1C4AA 1KFDA 2B6AA 2HQFA 2JFKA 4R0EA 3TI0A 5C25A 3SI8A 3U1MA 1YBTA 1VFJA 5F41A 4K7QA 4QR2A 2VJVA 2WBRA 4DR6F 3MD1A 2JSXA 4K4SA 1LV5A 5KFOA 1EJ7L 1JLQA 2JJ4D 1PBAA 2KI2A 3KUEA 5K20B 2ALZA 1S77D 3B82A 3HVAA 3B4DA 4RR5A 2JC1A 1D9DA 5EGYA 4LFAJ 3T1HJ 1HBNB 4O3OA 4YY3F 1Q95G 3CMES 1XNRJ 1B0VA 2GAGC 4LSNB 2D9PA 2BW7A 2HFNA 2O67A 4IO9Q 2XMUA 4PG6A 3FJ2A 1YBAA 2NCKL 3QJLA 1MU2A 2DYAA 3UNGC 1ZPWX 3G2XA 2GVDB 2J9DA 3KKFA 4DV1J 1U8SA 1HI1A 1P9YA 2X51A 1VMBA 2BQ3A 2DR8A 3V6DB 4WWSA 2HHXA 2DISA 2RE1A 4MH8A 1T94A 1N5YA 1YVFA 3LPEA 1YJNS 1RLDA 1WORA 4YB7A 1M1HA 4AXJA 2LQBA 3VF0B 3MPVA 4Q2MA 4XK8C 4I6YA 1U49A 3V6KA 1HBUB 2R4FA 2R7XA 1F5BA 5U47A 1YJ9S 3M30A 5F8MA 3SFUA 5ETRA 5I42B 1H0HB 2XULA 3KNAA 2WTFA 2A2DA 3Q83A 4TU9A 3K5NA 1JX4A 3O44A 3UR0A 4DUZF 3RBXA 5HROA 2CQCA 2NREA 5E41A 2H51B 2HS0A 3DLKA 5KFWA 2W9BB 3HF5A 3EDQB 4DV7J 2N82B 3GFZA 3PW5A 3FBBA 3M32B 3GSIA 4DU8A 1WACA 5LL6d 3HZEA 2Y1RI 3T5HA 2VA2A 4X4UA 1HNVA 2ASDA 1GX6A 2OMOA 2XLIA 2FQQB 1F9EB 2YX4A 3TUIC 1T9TA 1VK8A 1X4DA 1SQFA 4RNNA 5F8GA 1M1GA 1XC9A 5A8WA 3W8GA 2KFYA 2HFUA 2ZWOA 4OQJA 1YJWS 2RILA 1RGVA 2AX1A 3I5BA 3SCLE 2PSZA 1FNMA 1AW0A 2COLA 2YQ1A 5C2CA 2HG4A 4DLGA 2QA4S 1IKXB 4CLTA 5DDRC 3CMAS 2VQEJ 2JNJA 5DQIA 4K0KJ 1L5UA 2ZH6A 3OXGA 1Q86T 4MKAA 3MGJA 4A46A 4X64F 1VQKS 3HT0A 5D4LA 1XWLA 4B17A 4RUBA 2VFRA 3MTKA 3N5FA 2VQFF 2BKPA 1VBZA 1I51B 2HNZA 1VCTA 1R27B 1E6VB 1ZM4A 3IG1B 1SKSA 2J6TA 4OX9J 1LKZA 4X65J 2H4WB 3DRPB 3OFEA 4F0KA 3HFVA 1AFIA 2DNRA 2F1FA 4J9MA 2AT1B 3D0HE 5GAHI 4PRFA 2BA9A 4RNOA 4J9UE 1DAXA 4B9VA 3P45B 2B8PA 4DSKA 4P7VA 4TN2A 1FDBA 4NEZA 4DFMA 2VL1A 4WYWA 3QT6A 4ANCA 1GQEA 2PD1A 2DNYA 2YWEA 5J2NA 3GZ7A 1TFWA 4UW2A 4KGXB 1SC4B 3BKUA 3PX0A 2VG6B 4IDKA 4ZLLA 3FBFA 4WFNQ 3G6VA 1N5TA 4KGKA 2K1RA 3L3CA 2PDAA 3RAXA 3DLJA 1FRLA 4QWEA 5LSLA 4H4OB 2E1CA 2RD5C 1V6HA 3M8PB 4J9QA 3CUNA 3RRKA 4LIWA 2H1YA 2C2MB 2FHKA 2WVBA 2MLYA 4DUYJ 1CULA 2GAHC 1FVSA 1F9FA 2XZTB 3BR9A 4C6AA 3DLBA 3M1VA 3UQSA 2APOA 1AUDA 5L38A 1KRPA 4IFVA 1IKVB 2BE2B 3EXYA 4U8VA 2IC3A 4LQ9A 2JEFA 1LWEA 3M2VB 3OTDA 1RHRB 1HYSB 3N6LA 2E5HA 3MXHP 5B0GA 3POTB 4CLZA 5G0RB 4UZCA 1YJ7A 2WONB 4UF4A 2I6WA 3I82A 1VI7A 2WOMA 1N34J 4HHJA 4N77A 3H5YA 3FNNA 3L4BC 2CQ3A 1RWNB 1FKOA 1EAYC 3GJQB 3TQ1A 3T1AA 1TL1A 2XSJA 4USJC 3MEDA 3UFCX 4DR6J 5CYMA 3FMWA 3ELHA 4CO0A 4U67Q 3MFHA 2GX8A 2LXIA 3CJ0A 4M5MA 3KK2B 1B4SA 1AUSL 3K89A 1CJVA 4YB1P 3LOUA 2UVUA 5IQQA 4F0HA 3PV8A 4X66F 4JI3J 2ALYB 3SZ2A 3W9HA 2BJ3A 1VQOS 1O51A 2HZVA 4OZ2A 4IR1A 4LF7F 4UTGA 3CMQA 2ZH3A 2V8GA 4F4KA 5BJRA 4DLEA 3A13A 2GW8A 1XTZA 3IM8A 3I9ZA 2I2YA 3TAMB 2KTQA 2IM3A 1Y5NB 1XK8A 4RW4A 2CJQA 3RW7A 4XO0A 2GHWA 4RKUC 2PA3A 2PMWA 4NWBA 1SJFA 5IQ6A 3P49B 1QVFR 2UVVA 1FDNA 1HBNA 2IVMA 4HLBA 2VBZA 4QZVB 3CCRS 4A47A 2RQKA 3MF5A 1HNZJ 4LSNA 1JWWA 2JH3A 5E7OB 5KFLA 1UA1A 4RW7B 3PHTA 3OV7A 3H5XA 1HQUA 3HHDA 5J2QB 1FFWB 1VQYA 4RW6B 3AD7C 2GVDA 3FEXB 1TUVA 1K1QA 1TKTB 4CO4A 3DFEA 3H2UB 2H4YB 4AD6A 4URGA 1AROP 1IUJA 3A3NB 2RKIB 4DR5J 1TL7B 1H2TZ 3DU5A 2R7SA 1VQ4S 1C0UB 3E2EA 3PY8A 2A3JA 2MSTA 4OYXA 1TL4A 3S6EA 5GMDA 4DR2F 3LP0B 5J1NA 2FGCA 3SMZA 1IBCB 3Q0AA 1EB0A 1HNIB 5L9XA 1HBUA 1QAYA 2QO3A 5F8NA 2F40A 1EETB 1VOMA 3L7PA 2AX0A 5A6PA 4JI2J 5I42A 3QBCA 2CXEA 4BBYA 4D3HA 3Q8RB 4LUBA 2ADBA 2RU3A 3KHGA 4CQ1A 3CJ4A 3IGVA 2AHOB 4C8NA 3GV5B 2W9BA 2OPPA 3KJFB 1JLAB 1FXDA 2DGSA 4LF8J 2DEJA 2ZNYA 3ISZA 4ED4A 3W63A 4ECZA 2DVIA 1NU4A 1U1LA 4OI3A 3THPA 4YDDB 4YS2A 2CUYA 3KJQB 2BE9B 5JMNA 3AFGA 1GTHA 1RTJB 3OXFA 1OY8A 5KT7A 2DH8A 2P6TA 4X64J 2QLXA 4L76A 1KQGB 1VQ8S 1RT2B 1NBEB 3DOKB 2HRYA 2DNNA 4EWTA 3JYTB 4FXWA 3KYLA 2QA2A 4QPXA 4O3NA 4DR1J 4C0OC 1XMBA 1S72S 1WEZA 2XYGB 3RYLA 2XS2A 3EGNA 4FYVB 1FJGF 1IKXA 3MDFA 4ERDA 3IBCB 4DV5J 4DBQA 2B5JA 2CADA 2HWTA 1WOSA 4Q43A 5JVHQ 3FGVA 3Q8VA 4NLWA 2H48B 2QN6B 3KXDA 4P71A 3IN5A 2I0XA 5D15A 2N7CA 3BGRB 2D69A 4B9MA 1H7WA 1FO1A 1JJCB 2ZITA 2E66A 2V2ZA 3AODA 3Q8QB 6FDRA 2KRBA 4G1PA 3VGTA 2WB4A 1GFWB 2EFOA 1E6VA 2AZ3A 1GNKA 1DQ8A 4H4MB 2LKZA 3OUYB 3DRPA 1R6YA 1S7IA 3NEKA 1NSPA 5GAGU 5KFGA 4U96A 1E6YB 3SCKE 3PIPQ 2MKIA 1MMLA 2Q6BA 3J7AN 5F9NA 3R5CA 2OPRA 4NI2B 4OL8A 1YDLA 3CO9A 3J7YI 2DNLA 1FDDA 3BKFA 1JLEB 3VGUA 4C0BA 1NNDA 1P1TA 1ZYQA 3M05A 4I56A 4YN3B 1D9FA 2NZ4A 2RB7A 2VG6A 2CNLB 1H7XA 1UA0A 4UQTA 3TA0A 4HTIA 3NMRA 4E98A 4EI2A 2DRDA 4GC6A 2DHAA 3EZUA 4H4OA 4UOFA 3PTWA 4DS5A 1HHTP 2XMMA 3BSNA 2HBRB 4CDIA 1GMWA 4O4GB 4J9PA 1FA0A 2R9LA 3D5MA 2MQOA 3QLHB 4P2XA 1BC6A 2NPFA 3GFHA 3DI6B 5IS2A 2HFVA 3KG0A 2B3TB 1IKVA 2BE2A 1WC0A 3M2VA 2JVRA 1T05B 3ZTSA 1PILA 2CPXA 4OJGA 4N56A 3GR0A 3B54A 2RT3A 1HYSA 3ZTRA 3FZBA 1PKUA 3POTA 3EE3A 1FJCA 5G0RA 3GFYA 3Q8YA 2WONA 1PJ6A 4LRCA 4JI8J 4OZ3A 4C98A 1AZSB 2NS1B 4ZVHA 2E9TA 1VS3A 3WZ0A 4AL6A 2EFVA 1VBKA 2JL9A 5CD4A 2R8JA 1LNQA 4ZIVA 1YRXA 7FD1A 8RUCA 1FNOA 4LF7J 3Q2TC 3QRPA 4FN5A 4X4PA 1S1WB 1S1VB 5KG2A 1BLUA 3KMSA 4DOZA 3H2LA 2RS2A 2L9DA 3ICLA 4LFBJ 1LWXA 3BBBA 3KLFA 1S48A 4UY8T 4Q5VA 1LWFB 4CT9A 2FHJD 2E7VA 4PXCA 3C8YA 3QIDA 1F2GA 2AGQA 1B0TA 4Y2CA 1TUWA 2RHSB 3I4PA 4EBEA 4RLEA 2HSEB 1HWUA 1QUPA 2WW4A 3LW5C 3GIKA 4I68A 3C16A 2BM1A 1S9GA 4K5RA 2MYFA 1HD1A 4DZDA 1BQMA 2PI4A 1BWEA 1ZH5A 2LFVA 1UVMA 3LP2B 1VRQC 3D0GE 1AXQA 1Q81T 5KG0A 4FPIA 2Y1IA 3GR1A 1QAXA 1DHMA 4OYIA 2ZHOA 4MK9A 3DLEB 3UE2A 2H54B 1N0UA 3Q86A 4ZPDA 4DI6A 2Z30B 4RW7A 5EX3A 4LQ3A 2HHSA 2DGXA 3Q23A 4K2JA 3N5BA 3JTPA 5J2QA 3CULA 4RW6A 2YY3A 2Z8QA 1RXOB 3CJ3A 1TKTA 2C3UA 3KWMA 4KO0B 2QLBB 2FPHX 1RHJB 2M2BA 2RKIA 1TL7A 2OFHX 1YG0A 1K1SA 3U27A 2ZZTA 3FFIB 4J9LA 3M6VA 1C0UA 2CRLA 3MTJA 3OTEA 1NH7A 3HFZB 2OAUA 3KLEB 1QDUB 1HNIA 2YH0A 1FRIA 4J9OA 1S0OA 2MQPA 1EETA 4KHPF 3CJ8A 5DS7A 5HO4A 1GTEA 1X5PA 5FJ4A 5AJ3F 2JEGA 4EBCA 1RHQB 2HFSA 4QPTA 3CC7S 1I5OB 2W2MP 3QT5A 3BYPA 2F3JA 3C66A 3A8JA 3P5TL 4BWMA 1UW4A 5L1JA 1JLAA 3IFEA 5D4OA 2HIYA 1HIYA 2DNKA 2IJFA 2OD4A 2QLJB 3N6MA 2GQQA 2BVZA 1G3OA 5K8OA 1SUQB 2FHMA 4DSIA 5IM0B 1YSJA 2HVZA 3FBEA 4JV5F 2LEPA 4F50A 1PJ5A 4DV3F 4NCAA 1N36F 3PFOA 1RTJA 1Q82T 1CQMA 1N56A 2OFGX 3NAIA 1RT2A 3DOKA 2W9CB 3JYTA 4FVMA 1YZ6A 2OHDA 1Y11A 2CNOB 2QL7B 4ITSA 3FMBA 4RNMA 1D1UA 2ZM6F 2K8GA 3CC4S 7AT1B 2V8DA 3MD3A 2W1BA 3RUBL 4ZJLA 2D3OR 4K2XA 3JTNA 2W9AA 1YKWA 2UUCJ 3CJQA 2XTJP 2B9XA 3I32A 3PCOB 2FY8A 2HK2A 5F8IA 3O8WA 3HPOA 1GX5A 4K4XA 1MWQA 4B3TJ 4EEYA 2LQJA 4P2SA 1MLAA 1RBOB 3CJKB 4QWCA 1GMWD 4ZVPB 2CYYA 4IG3B 5HAOA 1JLFB 4WE1B 2CPJA 4RPFA 2X1GA 1EKSA 5GAEI 2NPIA 1O0PA 4CH0S 3WIUA 3KHRA 5IXUA 4RWXA 4NLRA 1XNQJ 1I94J 1E6YA 4NA2A 1WTFA 1NK7A 4LBPA 4NI2A 1PGZA 4K8RA 2N3OA 2MZJA 2F7VA 1JLEA 4QR0A 3Q22A 9RUBA 2RQCA 1XERA 2XO7A 1NK6A 3T1YJ 3I0SB 4NEYA 1YRTA 3EGVA 3EICA 1QJHA 2ZZMA 4OLOA 4W92B 2G0IA 3QPIA 2CJ9A 4KIAA 4LBHA 3OLAA 2GJFA 4U9RA 4PYAA 4DF4A 1S6OA 4A8MP 2Y1LB 2VBWA 4O4GA 1PC5A 2G2YA 3FK4A 1YI2S 2K7JA 1CQNA 1LW0B 3VVUA 1FE4A 2C2KB 2JLGA 2XLKA 5E3QA 1B3TA 4WTYA 2KL8A 4WTOB 1UWBB 2IHR1 4C3LA 1T05A 1RAAB 3N4WA 1L3TA 3GLJA 1XMQJ 3DGVA 1RTHB 5C5JA 1U1QA 1K9MT 2AEJA 1H6KX 1XQIA 4XDDA 3ADAC 1Y0HA 2BJ1A 4CRJA 2VICA 1AZSA 5HK4A 4DZ6A 4QWDA 5J2PB 2CJXB 2E7XA 2Z56B 1FFGB 1EIYB 3EM1A 3NGKA 1FTRA 2UUBJ 5KFBA 1UFKA 1SL1A 1S1WA 2MZSA 1RU2A 4FKYA 2ZFHA 2DNPA 2H3EB 3EPIA 4NZ6A 2FTRA 3NAHA 4Y00A 1Q8LA 4CLPA 1JJ4A 1VBXA 3NY0A 4ED6A 1LWFA 4E0DA 2C42A 3WHIA 3T5LA 1X7VA 4ECQA 3CC2S 2QYCA 4OX7A 3VCDA 1RWVB 1IBMJ 5IV3A 3EWGA 4CNYA 3NS5A 4LF6J 2HQDA 1WKJA 1WC4A 1FKPB 3G96A 1RT3B 2YX1A 2W2QP 4K4WA 1FI4A 1PIEA 4X62J 2Q1LA 2B0GA 3N79A 2OSRA 3LP2A 2BXJA 3EMTA 5ETTA 1UJ5A 5EWGA 1IR0A 1RCOB 4WFBQ 1M90T 5D4PA 1V3SA 1VQ6S 1U7LA 4I4BA 2YH1A 3DLEA 3D1QA 2V8PA 1ZTWA 2XHWA 1RWUA 1UP1A 3JAMU 4QR1A 2QL9B 4EK2A 2ZUGA 2KFZA 2D7SA 3OD2A 2XMAA 3OTOF 4KHPJ 2VKZG 3SSRA 5CXTA 2CAJA 3DMJB 3LH2S 2J9DE 1N33F 4KO0A 3US5A 5DQHA 4O23A 4NXMF 4X4VA 4EGLA 2BJEA 2NUUG 1RADB 3FFIA 3MR2A 2JHEA 1H2VZ 4PWDB 4B3SF 3CW2C 4DL0C 1ZPVA 5F3ZA 1UZHA 1RBAA 2GIRA 1DJ0A 2A10A 3HULA 2UXBJ 3K8WA 4NA3A 6AT1B 3QIPB 3MR6A 2DNOA 2C3MA 4OV6A 3LWMA 2GA7A 2MDAA 2HLUA 1G6BA 4NLOA 1TL3B 2HQ3A 1KP6A 2BJ7A 5AXMA 4P75A 3CJRA 4O0IA 1N36J 4X4RA 3ET6B 3G8TA 3K58A 2M0GB 1S99A 2ZH2A 1U1MA 2LU2A 5AXKA 4AE5A 3KDNA 3DXBA 3JSBA 1BUXA 4NL5A 1VJQA 1DRZA 1SUQA 1ZAVA 2CPDA 1Z1ZA 1YTYA 5IM0A 4Y6IA 2HEKA 2KFNA 5G4DA 2V68A 3PEHA 3H8YA 3Q2SC 3X3UA 2XBPA 4IQXA 5KT5A 4UT4A 5EWEA 2DGUA 2UV8A 2V2QA 2EEYA 1N54B 2IBKA 2XEXA 3D1HA 2DR6A 5KT2A 3CB4A 2IMWP 1RT7B 2IAJB 4X84A 3WBZA 3M7VA 3MUTP 2W9CA 3EYZA 4ENOA 2K06A 1NH8A 3CCZA 3OR1A 3AOBA 3DHXA 3QZ8A 4RL1A 4AUKA 3LQVA 2HYIB 3V5RA 1UVJA 4F04B 3MHYA 2PMZD 1X4BA 3R5AA 4B3OB 4O3PA 4OI4A 1N32F 2R2RA 1HFEL 1KDNA 2YNIB 3FQLA 4J7CA 2FJEB 3L7OA 3FZ2A 2U1AA 2CDRB 1NJIT 4MYUA 1F9HA 1X31C 1HI0P 3CJKA 1HR0J 3J7ZT 4IG3A 4KGMA 1JLFA 4ZN3A 2UUAJ 1A9NB 4DCPB 2Z2LA 4RW8B 3AOCA 1K47A 1BGXT 5HANA 4B9UA 2HVIA 4WZQA 1GAOA 4A8QA 4DPXA 2WVCA 3W9JA 2MQMA 1GH8A 1Y9OA 1TV6B 2BYCA 3W66A 4LSLB 5C42B 3KLVA 3I0SA 5K8PA 2XI2A 1ZOTA 2QIFA 2QG9B 3BEGB 1C1BA 3V4IB 2J8AA 2RDIA 2IRXA 3HKWA 4ECYA 3M9MB 2MHNA 4ELTA 4X2BA 1NPPA 5JVGQ 2BR0A 3RU0A 4YP3A 5FDLB 5MAOA 2ZE2B 1L3KA 5H9EK 1QD1A 3HI9A 4ZHRB 1TMMA 3P5BP 4F4YA 2YPZA 3KDOA 5HVFA 4ZLNA 4FPRA 2HBYB 3QATA 2V4JB 4QW8A 1LW0A 1LXJA 1HL6A 2ACMA 2ROGA 4CH7A 3QAEA 2D3UA 1WJ9A 4G1IA 3ZZUA 2HWHA 5H1SV 1UPMB 1UWBA 2UVRA 5HATA 4J91A 1S7HA 3TUPA 4DR4F 3R5DA 2OTJS 2W2NP 1N88A 3TEGA 5HL7Q 1WNEA 1SKUB 3BGUA 4A8YA 2WB1D 4CO2A 2BQRA 1S59A 1FEEA 2ADCA 2LA6A 3O5TB 2OD6A 2YWWA 3X1LB 1MN9A 1YHQS 1QM9A 3FSIA 1RAIB 3PACA 3R5BA 2VASA 2F4FA 2FC9A 5J2PA 1U25A 3D6FB 3DXSX 4WK1A 3QWPA 4CLYA 3VWSA 3DOLB 4C8LA 3FVYA 4K59A 3MPYA 3BYRA 3NGTA 1X9SA 4ZP8A 5C24B 2CQPA 2UXCJ 2ROEA 3LWLA 1Q1KA 4ECSA 1YQHA 3W1YC 4DPTA 4KYZA 3EPGA 2R2UA 1UVLA 1UTAA 1MSWD 2Y1JA 2XYPB 2A18A 1WOPA 4M94A 2HK3A 4OZLA 2J0SD 3DDKA 4N76A 3LF0A 2CWXA 4X4TA 1WDTA 3T19A 1FKPA 3AOAA 2CQGA 1R0AA 5EX0A 2FC8A 5IC6B 1RT3A 4K4ZA 1VQSA 5CZVA 2UXDF 2BOAA 2C2RA 3H5UA 3V6HA 3HHLB 1HLWA 2JLFA 3D7SB 5I4MA 2G4BA 3HHEA 4YQWA 2GZOA 2R42A 2KRRA 2XWXA 2G0JA 1TKDA 1KHVA 1W25A 1L3SA 2RRNA 2YBVA 4MFBB 3KMQA 1FERA 3DMJA 3DLGB 2WSFC 1YJRA 4ELUA 4DV0F 2J0XA 2M7SA 4O3QA 3CT9A 3BF4A 2FYXA 3NGSA 1F3VA 1ELOA 2HHHF 4NCBA 4PWDA 2W4CA 1JMTA 2DXFA 4HACB 4ZIWA 1WELA 5M2PA 5LSRA 4ETZA 3TEHB 3LAKA 4B3RF 4DR3J 4NLPA 3GP9A 4QIEA 3PYEA 4Y2AA 3QIPA 4X4NA 4IG0B 1SH2A 5L1KA 3QNWB 2PFDA 1J5EF 1REVB 1KFSA 1TL3A 4FF4A 3HVTB 3F41A 3ET6A 1Y7PA 5B0BA 4ECRA 3J81j 2BMBA 1NM2A 4Q2LA 5T14A 4DSFA 4F26A 4TVAB 1P8GA 4AT1B 4CO1A 2XI3A 5FIIA 5F8LA 5LT5A 5KFEA 3ISNC 3W64A 2VDHA 2HNDB 3BSCA 1FX2A 1PYOB 3OFGA 1OSDA 4LF1A 1ULRA 2XYHB 1RT7A 2IAJA 5KFAA 2G13A 3OVBA 4P10A 2EI5A 1U0SA 4DPWA 4QIGA 1HBMB 4I1TA 2ZBRA 3CCTA 1A0OB 3QFHA 2RMLA 2OH2A 4JI7J 2Y3YA 2OMLA 2POKA 4ES2A 1U0HB 2E1PA 1RI7A 2DIUA 4TNOA 2IDLA 1QAIA 1RUSA 2XMJA 4B3OA 2IIHA 1NO8A 1KQSR 1IBLJ 1SC1B 2YNIA 4TLQA 4BC9A 2GC8A 4J90A 2LU1A 2RSQA 2MGZB 4RNFA 2MKHA 1XMOJ 2PA8D 5KAKA 3R5JB 1K8AT 3WDOA 2C2ZB 2B9YA 2LXUA 4C2MA 2QLWA 4Y2KA 4RJVA 3GJTB 1VLYA 1HQEB 4RW8A 3BQ2A 1RAFB 3TOQA 4ETXA 2LA4A 4GKKF 5A8RA 2VIHA 1U45A 2DGWA 1L3VA 3BH7B 3WX4A 2MTLA 3MAAB 3A4TA 4G3IA 1F5AA 1XEZA 5IWAJ 3QJJA 3ZZ0A 2U2FA 3NS7B 4OZ0A 4LSLA 2YX7A 1KQFB 5C42A 2CPYA 3IXQA 4OIXA 3DDIA 1VRUB 4NMLA 4ZVEA 4WCEQ 2OELA 1HWIA 2XY5A 1OY9A 4I6WA 1BY9A 1SCJB 4B08A 3SYZA 3NOCA 2JLEA 1RTIB 4EUVA 5FDLA 2X3GA 2X1FA 3PO4A 4PG7A 4QQBA 4PQUB 1WTBA 4ZHRA 4ID8A 4LFAF 3MM6B 4QCLA 5SZTA 3NGRA 1RTZA 3EX7B 4ES3A 1ZTTA 2DJWA 1LK5A 3TRGA 4JYAJ 2V4JA 1XNRF 1G7CB 1T9XA 2SXLA 5BR8J 5HJYA 5LXRA 1RHUB 3M2UB 4ED5A 2F8EX 3UN3A 1JK9B 2VPXB 2FHOB 4ZS6A 1VQPS 4DV1F 1S1XB 3GYXB 2MQNA 3MCSA 5DG8A 4CZCA 4FYWB 3NNCA 4JI1J 2EFPA 2I5JA 3HX9A 2AIRB 2FJDB 4CLSA 4ZVGA 4JI0J 2VFUA 3CCVS 5HN0A 1X4HA 4KPCA 2KT3A 3AD8C 2DHHA 2M52A 3B8HA 3WC0A 3G87A 4Y2MA 5A6WA 3CXCR 3QGHA 4OZJA 3MM9B 3DOLA 3PRVA 3HKZD 3T41A 5CZXA 3UWTA 2ZUAA 2P9EA 5ETOA 1PCAA 3NGUA 1DBDA 2E5IA 1UMJA 1F0XA 5HP1B 2DNHA 4U7CA 3KTQA 1NEEA 2N7YA 1LW2B 2XLJA 2UXDJ 2E44A 4DX5A 2AP6A 4DV7F 3EJMA 4HEA9 3VGVA 4FYYB 3TZYA 3R97A 3J80Y 1RABB 2BV3A 4TLRA 1S97A 4M63A 1HNXJ 4EZ9A 4V19J 1WDDA 3GJSB 1DARA 3BQ0A 2AZ1A 2L9NA 4E8UA 2A6OA 3WQPA 5D0HA 4TU7A 3GV8B 4DPOA 2XS5A 4M5KA 2VBYA 2BQUA 3ZZTA 2ABYA 3ZZOA 3O1LA 2B4OA 2I1RA 4KFBA 3HHLA 4IOAQ 2NZCA 3T6BA 3W60A 3MPUB 5CCLA 1CJUB 2BJ9A 1FDAA 4F2RA 3OXLA 4K0KF 2EWHA 5DO2A 4FBTA 1IBKJ 4KTQA 3M2RB 4QW9A 4MFBA 3DLGA 4CLKA 3KFWX 1H3DA 5HQLA 2EXUA 2NSCA 2W8LA 1X0FA 1J5EJ 1P6TA 4OYAA 4NLTA 2V4RA 3ENQA 2P6SA 4DUTA 5ETKA 4M5JA 4URSA 3RB0A 4HACA 4OX9F 4X65F 4QIWD 1U2RA 2FVQA 2E7WA 3DCAA 3PYGA 5AE2A 2HMIB 3NG8A 3W2WB 2JEIA 4F3MA 4HHUA 4PZVA 4AQYJ 4IG0A 1D0EA 1N6QA 4ELVA 3SXLA 3K0JA 2RRBA 1ZZFA 4Y28C 4I0WA 1D8YA 1REVA 1G4CA 3H59A 3SV3A 3HD1A 1U6BA 3HVTA 5BYSA 1JLBB 5KFXA 2J9CA 4NOHA 3NKYA 2ZBIA 3PXGa 4GVLA 2F4VJ 1KHWA 1EZZB 2W25A 2NYIA 2G2ZA 4IOBA 4ZN1A 2X3DA 3CD7A 3W65A 4BS2A 4IRKA 1WUUA 4PQAA 5F3TA 3SQOP 4UOCA 4A8XA 1VJWA 4IH7A 4FP9A 4N7TA 4A8SA 2HNDA 2F8HA 5KG3A 4PPZA 1HPZB 3ILOA 2J6UA 2ZBCA 3M6UA 2QMXA 1HBMA 3TO8A 1CSJA 4WIQA 3NP5A 2KYXA 2PI5A 3BR8A 2LECA 3OQ2A 4ID5B 1VQ7S 4KAIA 1U0HA 5KFPA 3E51A 1U1NA 1FCAA 3G82B 2OKQA 1OJ4A 1Y5LB 1N34F 2BZ2A 3AXKA 5K8NA 4DHVA 5A2QY 4LR9A 2MLXA 3TWZA 4C8YA 2CDQA 3SSSA 2MGZA 4ICLB 2KM8B 1RACB 1TTHB 3HJVA 5BYRA 3H7HB 3D3CJ 5EWFA 2J76E 3R7NB 4OZNA 1HQEA 1UPPA 3OSNA 1B99A 3AQPA 1NJZA 1XJWB 3KHLA 3FKBA 1NCLA 3ZTPA 3D6TB 2PN6A 2FLPA 2V94A 5KFCA 2QE5A 3LPYA 1R0BG 2BRLA 4CM2A 5IT9Y 1S12A 4NZ7A 2QT7A 3TA1A 3N28A 4JI3F 4YR0A 5KFFA 1GK8A 3CO0P 3PEJA 1JB0C 5CQGA 1T7PA 2JZ5A 2OEKA 2D41A 4USHA 1VLOA 3TZZA 4NXNJ 4WIIA 5IV4A 3DRRA 2RDDA 2BE7D 2AW0A 1HMVB 2M8DB 2KJWA 5E33A 3R7SB 5EHHA 3M8YA 2AEFA 1KVJA 4PQUA 2QTWA 3CCQS 2Y8YA 2UUWA 1QSYA 2VFSA 1Y10A 4JUZA 4RUCA 3PJWA 2HIQA 1U1RA 2NQPA 1NHUA 2VF3A 1HNZF 1UVKA 1SC6A 4XPCA 2AD9A 2VG5B 4DL7A 1NHVA 3QGIA 4NE9C 3KJNB 3TVKA 3M2UA 4Y2IA 2YKNB 2EKNA 3MCOA 2AJ0A 4MT1A 4QU7A 2B7CB 2BABA 1S1XA 5AE1A 4LRFA 2X1BA 2HNYB 4BWJA 4H54A 4R0JA 4ZJOA 1FKAF 3BREA 5KFIA 3U1LA 3C15B 4IUFA 2XB2D 1JIHA 1YJUA 4DR5F 2FJWA 3QSIA 2J7KA 2PO4A 1IR2A 2QA1A 2F5GA 3BKTA 2ACYA 3HZGA 2R2TA 1T95A 3VTIA 1B7YB 3MWBA 3FUYA 4WFYA 5DGAA 4YB6A 3MM9A 1LQ9A 3N01A 2Z0GA 1S4EA 3GCXP 3RTVA 4JI2F 3M9NB 1KNZA 1RHMB 2CQIA 1ZM2A 2B4UA 4RZRA 2HBZB 8AT1B 3W7BA 4WF9Q 2FDNA 3QGGA 3HHLD 5HP1A 1S79A 4L73A 5LMNJ 4ZCIA 3VVTA 1HBOB 3PR4A 3VAGA 1PAEX 3NXZA 4YR2A 1UEVA 4MAKA 1VISA 2B9WA 2E1AA 4JP8A 4UZBA 2HHQA 1Z2ZA 4OHVA 4EU0A 4LF8F 1JQGA 4KH1B 2DPJA 4IQMA 3GJRB 3IBFB 4P2FA 3VAMA 1PC4A 5AE3A 3CEDA 2OSQA 3R5GA 3VHQA 3ZNUA 2CFXA 2J0QD 2BANB 2AF6A 2KXFA 2Z58B 5J2MB 3CCSS 5ETMA 5B09A 3TVZA 2CVIA 4Z37A 2JC0A 4DS4A 1WHXA 1MMDA 3GIIA 2K3KA 2XGPA 4DR1F 2B4PA 2JWNA 1W26A 2MB0B 1RBLA 5GAGI 4JI5J 4XIUA 1CJUA 3UCUP 2GGPB 2CJBA 4DV5F 3M9OB 5DDOC 2HBQB 3K17A 2MMYA 3M2RA 5KFMA 3ZZZA 2NYHA 4J9RA 3MUVP 1WSVA 1SJ1A 1NDCA 2V6AA 1SXLA 3BBCA 2N3LA 4MYTA 2AJFE 1IJEB 1UL3A 2F9JA 3E01B 4MTPA 4I2QB 1MWYA 2J5AA 3AHPA 1RISA 2HHUA 3W2WA 4DCJB 1Z4UA 4QIFA 2LQ9A 1H98A 2P9CA 5HJXA 2V0NA 4OJ3A 2R8IA 4ZVRB 1TVRB 3T6JA 2BOPA 1JLBA 2HHPA 5T7LB 4HH1A 2V9WA 3EZ5A 4G65A 1Z2LA 2IFXA 3PHEA 5KTQA 4RNHA 3SSQA 4IR9A 1HNWJ 1KLMB 1RT4B 3PRDA 2DHGA 2BDPA 3IC1A 3P3DA 2LVWA 2OIHA 1BQNA
chains in the Genus database with same CATH topology
2YX1A 3AJ2A 4FF3A 1T03B 2EG2A 4K4WA 1VHFA 2VPYB 1RJJA 1C0TB 5AXNA 1NJXA 2YKAA 3RBDA 4C7QA 4L3NA 4C9DA 1MW7A 4A8OA 2LEBA 2Q1LA 2B0GA 3N79A 3OBIA 1SIZA 4ZCLA 2OSRA 3LP2A 2C2EA 2BXJA 5KG6A 4RUAA 3MMJA 4KHMA 1Q8IA 2XCAA 2BW2A 1S9EB 1UJ5A 5EWGA 3TP2A 1LK7A 1IR0A 5F0UA 1DFDA 2R7TA 4WFBQ 1YGYA 1M90T 2HHVA 1NKBA 5D4PA 1TAQA 5THWA 2G1DA 3M1VB 1V3SA 4DV2F 1VQ6S 1IJFB 1HPZA 2DNQA 1U7LA 4I4BA 3K57A 1XR5A 4KKOB 3ZFVA 1V3RA 4IFVB 3RAQA 3H98A 2YH1A 1KS2A 1VC0A 1S9FA 3OTCA 3DLEA 2DR5A 4UUWA 4ZP6A 3D1QA 1D3WA 1NK4A 1LWEB 1XN9A 3OJUA 3M8RA 1ZTWA 3G71S 3MR5A 2XHWA 1RWUA 2XZWA 3IA0A 1UP1A 2JVOA 1RDRA 1O8BA 2DHXA 1UJ6A 1KQKA 1BQNB 3HDSA 4NLYA 4QR1A 4OI1A 2L41A 3HXMA 2ZUGA 1UFLA 2ZHAA 4MIBA 2KFZA 2D7SA 2DPIA 2EFNA 2HVHA 4ZPVR 3B4MA 3IWNC 5L8RC 2EK6A 3OTOF 3HJFA 4RWWA 3ZZYA 2VA3A 3IRWP 5L1LA 4ID5A 1TKZB 1X4AA 1IKWA 5F9LA 4DUYF 1IBKF 2VKZG 3SSRA 2OJ3A 4DWIA 2XMWA 4PG4A 3DMJB 5CXTA 2ZOMA 3LH2S 1OS5A 2J9DE 5J1EA 1X4CA 3M8SA 3MOJB 4JI8F 2VOPA 2ZDOA 1SH3A 4IYQA 1N33F 2YVSA 5KFNA 3E3XA 4KO0A 4NLDA 3US5A 5DQHA 2WBMA 2OPQB 2CPIA 2M8HA 4O23A 3UD3P 4EO6A 1I1GA 4NXMF 4TY8A 4WFZA 4X4VA 4GO5X 4EGLA 2BJEA 2NUUG 2V8HA 2GQCA 3FFIA 2B4VA 3EUNA 4ICLA 3M4XA 1FKOB 2KT2A 3MR2A 3DLLQ 2JHEA 4QYZJ 4KV8B 3SQGB 1KR4A 2YWHA 1H2VZ 2HW3A 1OSCA 4PWDB 4B3SF 1TL1B 2B51A 4DL0C 3K8VA 4WJBA 2E9ZA 2MZ1A 1ZPVA 3OL8A 3MMAA 1Q16B 2HGMA 2I8EA 2KB2A 1FK9A 2XSJB 3C6UB 5F3ZA 1W2BR 4WFAQ 1D8ZA 3MEDB 2CQHA 2GIRA 1DJ0A 4BHQA 3J7A1 1UAWA 2A10A 1FNXH 2WAQD 3K8WA 4NA3A 3C46A 5AXLA 2R7UA 1HWJA 3MEKA 3QIPB 3UW1A 3MR6A 1OO0B 4LFBF 2DNOA 4D3GA 1Y3JA 2DNMA 2C3MA 1JKHB 2XMVA 4EYIB 3V81A 3LWMA 2GA7A 4AQYF 3RR8A 2MDAA 2HAIA 4DDFA 1U24A 2DO0A 2HLUA 3D28A 1G6BA 3QGPA 4NLOA 1Q4RA 2RUGA 5I3PA 1W2IA 1RTDB 2JDJA 2ZC4A 4HDGA 2C3YA 1TL3B 2B7BB 2HQ3A 1GT8A 2BACA 4OI6A 4ECXA 1ZAWA 5AXMA 2FY1A 4URQU 3OL6A 1K0TA 1SJQA 3M8QA 1UKUA 1C4AA 1KFDA 4ECUA 1N4LA 4O0IA 2B6AA 4R0EA 2JFKA 3TI0A 5C25A 4X4RA 3BQ1A 3SI8A 2MZTA 1KOOA 3HHKA 5F0WA 3G8TA 3G4SS 3K58A 1JNRB 3MM5A 3U1MA 2M0GB 3BO2A 4WU3A 1VFJA 1WI8A 1S99A 5F41A 2ZH2A 1U1MA 3IBWA 3PKMA 2LU2A 5KOWA 1FVQA 3UCZP 3OR2B 3DM2B 4QR2A 5AXKA 2KJVA 3ETOA 4AE5A 2WBRA 2RIJA 2J6SA 2F4VF 3DXBA 3RW6A 3MD1A 3JSBA 4DR6F 2JSXA 4J37A 2VD3A 3M6XA 4B3MF 3DDNA 4K4SA 2VZ9A 1LV5A 3JSRA 3LGNA 5KFOA 1CPZA 3DHWC 4U6PA 4NL5A 5DM7Q 3V4MA 1R3NA 3UCGA 1DRZA 1VIXA 1JLQA 2JJ4D 2AGPA 3C2PA 2FHJA 2VUGA 3E8OA 1SUQA 1U47A 1ZAVA 2CPDA 2Q43A 1Z1ZA 2KI2A 3I87A 1HMVA 5IM0A 3VAHA 4Y6IA 1YTYA 2KFNA 2GIQA 5G4DA 5KFQA 2ALZA 1S77D 1BQXA 3B82A 3PEHA 3HVAA 2IVYA 3HLUA 4J9KA 3H8YA 1QVGR 3Q2SC 4FXDA 3T9ZA 3X3UA 2XBPA 3B4DA 5KT5A 2JX2A 3AA8A 4IQXA 4DQIA 2JC1A 2CJKA 2N4DA 1D9DA 5EWEA 2DGUA 2UV8A 5EGYA 3V6DA 1HBNB 1N54B 2Q66A 2IBKA 2XEXA 3L95X 3D1HA 4O3OA 1X5OA 5KT2A 3CB4A 3U7JA 4YY3F 4ECTA 2IMWP 1RT7B 2IAJB 3TX8A 4ZLPA 2DGVA 4PXEA 4X84A 3WBZA 3CMES 2ZJRQ 1B0VA 4LSNB 1D9AA 2CG4A 1WHYA 3MUTP 2D9PA 4TYAA 2W9CA 4I2PA 1YJTA 2HFNA 2VG5A 4RUHA 3EYZA 3PO5A 2J7UA 1X5SA 4EYHB 2P5VA 1FD2A 2O67A 4IO9Q 2FUG9 1NH8A 2XMUA 3CCZA 3OR1A 4PG6A 3FJ2A 2IA6A 1YBAA 2LDIA 2YKNA 4NLXA 2VODA 3QJLA 4O44B 4F4XA 3DU6A 3RBEA 1MU2A 3CD5A 2YWGA 3UNGC 1ZPWX 2XS7A 3DHXA 3QZ8A 4DF8A 2Q3PA 3BJYA 5D3GB 4AUKA 2J9DA 3KKFA 3LQVA 2HYIB 1WEYA 3V5RA 1UVJA 3FQKA 1U8SA 2PE8A 1HI1A 5B7WA 3G6ES 2X51A 2QMWA 1WG4A 3MHYA 1VMBA 1O5JA 2HRUA 4QIVA 2PMZD 2EG1A 3OFFA 3Q8SB 3K5MA 2BQ3A 3V6DB 2DR8A 1VQNS 1X4BA 3EXCX 3N9UC 1FHTA 3I9V9 2HHXA 1LXNA 2DISA 2LXFA 2RE1A 3AB4B 1T94A 3CE8A 3R5AA 4MH8A 1N5YA 4O3PA 3RRHA 4B3OB 1YVFA 4OI4A 1N32F 2R2RA 2RVJA 3ZC4A 1HFEL 3FQLA 2YNIB 1YJNS 2FJEB 3TUJC 1H38A 3L7OA 3FZ2A 4YB7A 2NSBA 2VPWB 2FVRA 2U1AA 2HWIA 1U1PA 4AXJA 2LQBA 2LMIA 4C3MA 3VF0B 4J5OA 1TV6A 1NJIT 2J9EA 4MYUA 3MPVA 2J0WA 4ZVFA 3OR1B 1NJYA 1HI0P 4I64A 3CJKA 3AB2B 2A2CA 4Q2MA 3J7ZT 4XK8C 1DZ5A 1XR7A 4IG3A 4I6YA 2IM1A 4KGMA 5K14A 3NCPA 3TAQA 1JLFA 2LDYA 3PW0A 1A9NB 3IR6B 1U49A 3V6KA 3MEEA 1HBUB 2R4FA 2R7RA 1SJ4P 2R7XA 1M5VC 2Z2LA 4RW8B 1F5BA 3HP6A 5H9FJ 5JJBA 5U47A 4GKJF 4L6V3 2QZ8A 1YJ9S 3M30A 2FLOA 5F8MA 2YWFA 3M32A 1BGXT 3UR3C 3VAJA 1U1KA 1FT8A 3KK1A 2VG7B 3SFUA 4DN9A 5I42B 3V4IA 4B9UA 4C8MA 5IZHA 2HVIA 2JOQA 4WZQA 1Q7YT 1GAOA 1H0HB 4A8QA 2XULA 3KNAA 3H5SA 4GMKA 4DL6A 4Q8FA 1WHWA 4C11B 2WTFA 2OP5A 2A2DA 2MQMA 4TU9A 3K5NA 2B56A 3R1LA 1JX4A 5SUHA 3ZZPA 4M95A 2DRBA 3O44A 2ZE2A 1WG5A 1XBWA 3UR0A 1GH8A 1Y9OA 3DNCA 3GILA 4DUZF 1TV6B 2MZRA 1X9WA 1QLNA 2DIVA 5HROA 3NS6A 2BYCA 2ZKUA 2CQCA 4MIAA 4N47A 2HPUA 2C3OA 2NREA 5E41A 3ULHA 1HBOA 2M88A 1DURA 4IKAA 2HS0A 1SV5B 5HMZA 2GJ2A 5CYJA 3DLKA 4LSLB 4KT0C 5KFWA 5C42B 3KLVA 2W9BB 3HF5A 3I0SA 5A8KA 4YDXA 3NGDA 2XMTA 5K8PA 2XI2A 2N82B 2KG1A 1ZOTA 1R8BA 2QIFA 3GFZA 3PW5A 3M32B 2EFGA 1M0SA 3BEG