2MKJA

Solution structure of tandem rrm domains of cytoplasmic polyadenylation element binding protein 4 (cpeb4) in free state
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
202
structure length
202
Chain Sequence
b'SHQNGERVERYSRKVFVGGLPPDIDEDEITASFRRFGPLIVDWPHKAESKSYFPPKGYAFLLFQDESSVQALIDACIEEDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGEIDKRVEVKPYV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytoplasmic polyadenylation element-binding protein 4
publication title A fly trap mechanism provides sequence-specific RNA recognition by CPEB proteins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Translation regulator
total genus 31
structure length 202
sequence length 202
ec nomenclature
pdb deposition date 2014-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16367 RRM_7 RNA recognition motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2mkjA02
2YKAA 2CQIA 1SJ3P 2X1FA 2D9OA 2RRAA 2DGUA 1YWXA 1W2BR 2OTLS 2MY8A 1SJFA 2MSTA 4OZ1A 1Q86T 1VQ4S 1FHTA 5DDQC 3BO3A 2L08A 1U6FA 3HI9A 2LEBA 1VQMS 5FJ4A 2J76E 1XN9A 5GVQA 3PIOQ 4PR6A 2DGVA 3UCZP 2MQNA 1NJIT 1X4GA 2VODA 2ZJPQ 3OW2R 3Q2TC 1X4HA 5LJ5Y 5HO4A 2PE8A 2M7SA 4TU8A 3EGNA 2DO0A 2PEHA 2V94A 2MZRA 1WTBA 2QEXS 2DGQA 2DNPA 3SMZA 4FXWA 3SXLA 4F25A 3BO4A 2LXUA 1Q81T 3RW7A 1AUDA 4Y00A 2MKSA 5CYJA 5GMKa 2E5HA 3S6EA 3VAGA 2CJKA 1CVJA 4C4WA 4WFNQ 3D2WA 2MMYA 3CF5Q 2QFJA 5DM6Q 1U1RA 2X1GA 3EX7B 3NMRA 1WF0A 5DM7Q 1YHQS 2OSRA 1VC6A 3NS6A 2AYMA 2RQ4A 1DZ5A 2XS5A 4U67Q 4F26A 3THTA 2RU3A 2MQQA 2CQDA 2RUGA 1M5OC 2MY7A 2HGMA 2NLWA 1RKJA 2KM8B 1X4CA 1D9AA 2K3KA 2RRBA 2MKKA 3CCQS 2AYBA 2FHOB 1OO0B 2LXIA 2L9WA 3G96A 3MUTP 3BO2A 5LSLA 2VOPA 2DNGA 3ZZZA 1VQ7S 1WG5A 2DNKA 1N88A 2MQPA 1K73T 5D78A 3LPYA 3TYTA 3TP2A 1ZZFA 2EK6A 4EGLA 4QU6A 1VQPS 4IOCQ 3ULHA 2LECA 2LCWA 1L3KA 1F9FA 2KG0A 2MPUA 5GADU 2F9DA 4QPTA 3G71S 2OSQA 1H2UX 5IFMA 3H2VE 2KRRA 4CH0S 2DNZA 1VQKS 1X4DA 1OIAA 1SJ4P 2VONA 3N9UC 1FJ7A 2JWNA 2MZ1A 5JVHQ 1N52B 4PKDB 1HL6A 5BJRA 2ZJRQ 2KFYA 1DHMA 2MSSA 1QVGR 5D77A 3P6YC 3DXBA 1HD0A 4OZ0A 3I56S 1G2EA 2DHGA 1VQOS 2HZCA 3VAJA 2ZJQQ 2E5JA 4Z2XA 1HA1A 1WWHA 4QU7A 1URNA 2DNYA 1D8ZA 1R8HA 3VAFA 1K9MT 4IUFA 2MZQA 2DGOA 2YTCA 2KN4A 4FXVA 3NNHA 1WHWA 1SJQA 2XNRA 2CQGA 2YWKA 2CQHA 1N8RT 2AYEA 4IOAQ 3IWNC 3FEYB 2CPDA 2KU7A 2MGZB 2E5IA 3VF0B 5GAGU 2OJ3A 2MKCA 2MQMA 2M8DB 4F02A 2RS2A 3DLLQ 2MQLA 2MGZA 1RK8A 2OIHA 3US5A 2M0GB 1WG4A 2Q79A 2M2BA 2DH7A 1U1LA 2HYIB 1X0FA 1A9NB 5DDPC 1KOOA 1M90T 2CPXA 3R1LA 4M5DB 1X4EA 1U1MA 2HVZA 3P3DA 3SDEB 5LJ3Y 3B4MA 1WI6A 1P1TA 3UD3P 3CULA 1NU4A 2RT3A 2CPHA 1VQNS 1WHVA 2UP1A 3S8SA 4CIOA 1VC0A 2KT5A 1M5KC 2LA6A 1PGZA 1UW4A 3SDEA 1JJ2R 2DHAA 2B0GA 3UCUP 3H2UB 1X4AA 2ERRA 4Y0FA 2CQ0A 2CQ2A 1FT8A 2DNNA 2MZSA 1X5SA 2GHPA 3CCLS 2MJUA 2DK2A 2MB0B 2OTJS 2RQCA 2KXFA 2EVZA 4C7QA 1U1KA 5LSOA 4ZKAA 2DISA 1FNXH 1H2TZ 2DH8A 3L3CA 3EGZA 4PRFA 2DNLA 2BOPA 1UFWA 3CCES 1JMTA 2M88A 3VAKA 3G9CA 4P6QA 2SXLA 1JJ4A 1BY9A 2M8HA 3MXHP 2MHNA 1X5TA 1ZH5A 3UD4P 2XSFA 1S72S 3G6ES 2N3OA 2M70A 2MKJA 5DDRC 4YUDA 4YOEA 3CCUS 1VBZA 2D3OR 3J7YU 1VQ5S 3B4DA 4CH1A 2CQ4A 2KG1A 4TU7A 1KOHA 2RS8A 2CPEA 2L41A 3UCGA 1SJRA 2CPYA 2JVRA 4QQBA 3MI7X 2DIUA 4WF9Q 1WELA 1U1QA 5GAHU 1U1NA 5HL7Q 5LXYA 4W90B 2CPZA 2RVJA 1R8PA 2KVIA 2DH9A 2N7CA 3LQVA 4IO9Q 3VAMA 3MD3A 1YJNS 2DNQA 2U1AA 2F3JA 2G4BA 3Q2SC 2J0SD 2X1AA 2AYGA 1KC8T 3NNCA 3PIPQ 3CXCR 1ZZNA 2BZ2A 3MURP 1B7FA 2M52A 3S7RA 2DB1A 3JB9k 4LJMA 2CPIA 2G1DA 2YH1A 1X5OA 3CC4S 2J0QD 1UP1A 2WBRA 5CXTA 3P49B 2LEAA 1KQSR 2KHCA 5DETA 4LMZA 2E5GA 3VAHA 2DGXA 2CPJA 2ADCA 2VOOA 4WCEQ 2N3LA 1U2FA 2DHXA 2E44A 3TO8A 2MJNA 3CMAS 3CC7S 3CD6S 1FJCA 2M9KA 5IQQA 3G4SS 1VBXA 2MKHA 2M4MA 2KH9A 3U1MA 1M5PC 4V19X 3U1LA 1OWXA 1YTYA 2XS7A 3UWTA 2DIVA 1K8AT 1WHXA 5CA5A 1VQ6S 3CUNA 2O3DA 2JRSA 2N82B 1S79A 1QVFR 2J8AA 3THPA 2CQ3A 1Q7YT 4UY8T 2XB2D 3V4MA 3CCJS 2AD9A 1WHYA 3FEXB 4BS2A 5IM0B 2MYFA 1H6KX 2DGWA 3BS9A 2DGSA 2FY1A 2KM8C 5H1SV 1WG1A 1KD1T 3CCRS 2D9PA 1N54B 3VALA 2DNOA 1FXLA 5IM0A 5EN1A 2MZJA 2K8GA 4YB1P 4LIRA 2X1BA 3CCVS 1SXLA 3IRWP 2FC9A 3CTRA 3MUVP 2CQCA 4TU9A 5DDOC 2LMIA 3CC2S 2DNHA 2KRBA 5GAEU 2F9JA 2XS2A 2HGNA 2G0CA 3S01A 3R27A 3MDFA 2MKIA 1IQTA 3CCSS 1X5PA 3RW6A 1DRZA 1WF2A 2LQ5A 3MD1A 1WEXA 4TLQA 2DHSA 1QM9A 2LKZA 3P5TL 1WF1A 2KXHA 2DNMA 1NO8A 1OPIA 2DO4A 2MXYA 2MZTA 4UQTA 1M1KT 1FO1A 1YIJS 1H2VZ 1UAWA 1YJWS 3G8SA 2U2FA 4RU2A 2KYXA 3NS5A 5ITHA 2NZ4A 2QA4S 2CQPA 2KXNB 3BEGB 1A7GE 3I55S 1HD1A 1WI8A 4CQ1A 3CCMS 1YITS 2DITA 2YH0A 2MQOA 3MOJB 1PO6A 2A3JA 5LXRA 2FC8A 3MUMP 1YJ9S 2CQBA 2ADBA 1WEYA 3G8TA 3NNAA 2I2YA 2JVOA 3VAIA 1VQ9S 2EK1A 2RNEA 4C0OC 1X4BA 4A8XA 1X4FA 1O0PA 3K0JA 2DNRA 2LYVA 3ZZYA 4W92B 1WEZA 2CQ1A 3UE2A 4J5OA 1P27B 1VBYA 1M5VC 3J7ZT 2KI2A 4ED5A 2DGTA 1VC5A 1Q82T 1DBDA 2GO9A 1U6BA 3HHNB 1VQLS 1JJHA 5JVGQ 1VQ8S 1U1OA 1YI2S 2CPFA 4WFBQ 4ERDA 4WIIA 4WFAQ 1FJEB 3R1HA 2HGLA 2FPHX 1U1PA 2JX2A 2I38A 3CMES 3CPWR 5MLCV 2LA4A 2XNQA 4WKRA
chains in the Genus database with same CATH superfamily
3ZTQA 1MWYA 2CDRB 1YWXA 3N6NA 4OZ3A 2MSTA 1OQ3A 1FHTA 1SIZA 1KHWA 1N0VC 3F44A 3L95X 4ECWA 3SI8A 2I6WA 2VODA 2BJ8A 3KG0A 2D3O1 4O0NA 3MMCB 2XMAA 1FD2A 4F2RA 2HSEB 2Y1IA 2E5HA 4JB8B 1CVJA 1OY8A 1FVSA 1NPRA 2ZH6A 1K0TA 3MPWA 3NLCA 1Y7PA 1VC6A 4LVOP 3A3PB 2XZTB 4NLUA 1WUUA 4RW8A 1S77D 3C16A 2NS1B 5J1EA 4ZCKA 4F0KA 4PWDA 1Z2LA 4Q0BA 1RWUA 1QSSA 3IN5A 4L74A 2ZH7A 4OX7A 2RDDA 3OLAA 3C6TA 5D78A 5J2PA 4EGLA 3EXYA 4K0KJ 3M05A 4X4PA 3PW0A 2B56A 4YY3F 1OY6A 5L9XA 3QO9A 2HHPA 3RYLA 2VIHA 2GAGC 3BSCA 4CH0S 3VCDA 3GIKA 4Q2MA 1IJEB 4IOBA 2VONA 4HH1A 3P8BB 2H65B 1L3SA 2AZ3A 4A8WA 5A2QU 4K2JA 2XY7A 3DXBA 1NJYA 2JZ5A 4Q8EA 2CRLA 1RWOB 1G2EA 3M1VA 4Y3CA 1GAOA 2VHGA 2YTCA 3HDSA 3W7BA 1F5CA 3F0NA 5B0CA 2B9XA 4DPXA 2E5IA 3MHYA 2HFUA 4J9RA 3SIPB 2HFZA 4F02A 2OD4A 1RHRB 1CPZA 2EC0A 1TL1B 4N8NA 1RK8A 1JWWA 3DOLB 2Q79A 2M2BA 4MMOA 4B3TJ 1DLOA 3L4BC 1SQFA 2K7JA 3R1LA 1NDKA 1X4EA 1WACA 1JLGB 1JLFA 4Q7AA 3MCNA 1NK7A 1UW4A 2YNIA 5D8HB 2OTJS 3KJVB 5DQIA 5HVFA 3M8YA 1XEZA 2XMTA 3M6WA 4JI8J 3G9CA 3NMAA 4G1PA 2Y1JA 2BABA 1QE1A 4J9VA 4BDPA 1VBZA 2D3OR 2BM1A 3H5YA 3ITHB 2W8LA 3B4DA 4RPFA 4CH1A 1M5SA 4TU7A 1EETA 1U1QA 5K8NA 3BGLA 3K57A 1OJ4A 3M6XA 4NZ7A 2DH9A 4IKAA 2IMWP 1TUVA 1NK4A 4J9QA 1SC6A 3H7HB 4PG8A 1FX4A 4A8SA 3PIPQ 3MURP 1HQUA 4NI2B 1U0SA 2GVZA 3DU6A 4LF6F 4USTA 2FD2A 1I5OB 2VDHA 2XBPA 2YH1A 1LV5A 1K1SA 3OTOJ 1LWEB 1J5OA 1HPZA 2W01A 3EJMA 4ZS6A 1WSRA 2ZVSA 1CJTA 2PSZA 5AXMA 3G4SS 1VBXA 5B7WA 3LUYA 2DIVA 3CJQA 5F8HA 5CA5A 2O3DA 3R5BA 3I31A 2VG5B 1S1WB 3T1YJ 3FZ2A 2R2RA 4F50A 2BANB 1RT3A 1SL1A 1YRXA 4C11A 5J1NA 4MYTA 4CNZA 2G9OA 5IM0A 3ZZRA 3BPSP 3ELHA 4YB1P 4LIRA 2PFFB 5DRKA 1TK5A 5I42A 1QLNA 1HBOB 3DLKA 2HGNA 1RCOB 2Z2ZA 1BQNB 2JDJA 4XDDA 1QM9A 2VPWB 1WF1A 3OXFA 3DNCA 1IWGA 4E8UA 1O5JA 1C2PA 3AJ2A 4ILLA 1LW2A 3JTOA 1M5HA 4NRTA 1VS3A 4NMLA 4ZVUB 5LMNJ 3D6MB 2PGCA 5HROA 3VGVA 1FDNA 1TL5A 1NEEA 3V4IA 4LF8J 2IM3A 5L9NA 3CJSA 5DGBA 4Q45A 4NL5A 5BXIA 2DGTA 3RTVA 1RI7A 1VQLS 1N0UA 1PAUB 1T0TV 3HHLD 4WFAQ 3GLJA 3GFZA 2F8HA 4KHPJ 1HWUA 3AOAA 2Z8QA 4WKRA 1W25A 2RRAA 2DGUA 2VV5A 2FJXA 1U6ZA 3CJRA 2ZNZA 3QMQA 2W4PA 3BO3A 2LFVA 2G1HA 2LDYA 3KFWX 4HDHA 5L1LA 2JJ4D 2VU5A 2WHOA 1N5QA 4DCPB 4G3IA 1MMLA 2HMIB 3J7Z5 2C1EB 3I32A 4AL5A 3GTYX 1YJVA 3MMCA 1Y10A 2HZAA 2P6TA 3NMRA 4MIBA 1BWVA 4EBCA 2YY3A 1M5OC 1OSDA 2QYCA 4NZ0A 4GMKA 5BR8J 5AJ3F 4K2XA 1RAAB 2CYYA 3CDAA 2JOQA 2D3UA 3A8IA 2W1BA 5KOWA 2PFDA 2IAJB 1S0VA 2KG0A 1SH0A 5GADU 4DQRA 2KL8A 2OSQA 2KFNA 4OZJA 3B8HA 3DN9A 2VD3A 5D4OA 1UZHA 1NSAA 2I5JB 3D67A 3MFHA 3H4BA 3HHDA 4RW9B 3PACA 3NAIA 3RBDA 2KFYA 4ZVGA 3N01A 1XNQJ 3GJQB 3FZBA 4M94A 3UW1A 1NK9A 3BBCA 2BKNA 3O3LA 2UUWA 5E33A 1OMSA 2EBEA 3TUIC 2F63A 1C1BB 4L3NA 2BW2A 1E6VB 4F4WA 2C3OA 3RR8A 4DV6F 3CNQP 1WDDA 1NHKL 3A8JA 3KLFB 1WG4A 4DSFA 4JI1F 2IVFB 4USHA 5B0GA 4RNMA 1FKOB 3A8EA 4HH0A 2HK2A 1TL1A 2GIRA 5HSPA 3MZIA 4WFYA 1VQNS 4OLPA 1KWMA 1JLGA 2KZMA 3DFEA 2OEKA 2WB1D 3I5BA 1MMNA 2VQEJ 2CXEA 4DQPA 2B6AB 1H0HB 3MMBB 3TJAA 2BOPA 3KJVA 4IRKA 3DRSB 3MXHP 4PXDA 4N5SA 2ZM6F 3EUNA 2R7TA 1XQIA 2IVMA 3TR5A 2RS8A 4ED3A 1S0MA 2N7YA 3ITHA 3N4WA 3L7OA 4PXEA 3T1HF 3UNGC 4ES2A 3RJMB 3GSIA 2I9SA 5KFWA 4OFZA 1FKPB 3PRVA 3GB0A 4R5PB 2BZ2A 4M5IA 4LRCA 4UOFA 4JBCA 3OL6A 2K7KA 4TKTA 3HULA 3VTIA 4CCHA 3GR0A 4F4XA 4NI2A 1HNXJ 1UP1A 5HJYA 4IYQA 5G0RB 5DETA 5I3PA 1SI9A 3VAHA 1MLAA 1U24A 4EI2A 3CD6S 1LWEA 3VGSA 5IQQA 1TU0B 3GV7B 1M5PC 2P9EA 4F4AA 1JX4A 4CTAB 4NXMJ 3EVOA 4ZPDA 4ZK7M 1WHYA 2VQFF 2HQFA 4PPDA 2EKYA 3BS9A 1JLQB 2BA9A 4K4UA 3AH6A 3FKBA 3NBPB 2VG5A 2MZJA 1S1WA 2K8GA 3T6JA 2BANA 4NLOA 4LFCJ 3N5FA 5C2GA 2F9JA 4WXWA 5KFBA 4MK9A 3MF5A 3GP9A 2MKIA 1RJJA 1KR4A 1WEXA 1HBOA 4UUWA 2DNMA 1BQNA 4UQTA 2E7WA 3PNIA 5IT9U 1H2VZ 1UAWA 2MLYA 5CZVA 4M95A 4NZ6A 1UJ4A 4RU2A 5ITHA 3CJ4A 1CSJA 2CQPA 1FTCA 4O0IA 2I8EA 3PY8A 4A8QA 4ZP8A 5KT5A 1EZZB 1NSKL 3CCMS 2V6AA 1LEOA 3TX0A 3NOGA 4DOZA 2YXLA 2V50A 4C0HA 4ZP9A 5D0EA 4CT9A 3CDEA 3ZZYA 3QJLA 4QW9A 1VQYA 4BCAA 2IMOA 3TANA 1TUWA 5KFSA 2GW8A 3T5HA 2CPFA 2JEIA 1UVJA 1Y3JA 1GXTA 2I38A 2UXCF 4JV5J 2IJFA 1S1VB 2YKPA 1W2BR 3RZAA 4Q44A 3JS9A 5ETMA 1T94A 2UZAA 4C8NA 5K20B 2DJWA 3QT5A 5A2QY 1Q5VA 1VJWA 4YHHJ 2PE8A 4OL8A 3DRYA 3EGNA 4KHMA 2DNPA 2HMIA 3E51A 4DR5F 2OEJA 3GONA 4YQWA 4U96A 4Y28C 1PBAA 1U1RA 1DZ5A 1TL4A 2EI5A 4DFPA 4F26A 4H4KA 4XPCA 2CQDA 1O8BA 2ZHOA 4IG3B 4DF8A 2GFFA 2ZITA 3OXLA 4PEOA 2V4RA 1VIXA 2FHOB 3G96A 2EEYA 4KH1B 8RUCA 2HWTA 4S0MA 3SQGB 3OVAA 4CP5A 3HKWA 4DFJA 1RAGB 1XNRF 2WVDA 1U09A 4F04B 2V2KA 3ZTPA 1FXRA 1J2VA 3TQEA 1TKXB 2IAJA 2I0XA 4A46A 3C19A 2OMLA 1NNDA 5IV4A 2MKYA 4LF9J 4DR3J 1FERA 4OHZA 4JUZA 3TAQA 3D1HA 3I9V9 3TZWA 3BN4A 3OPKA 1S9GB 3M4XA 4CH7A 1R6YA 4WFXA 1V3SA 2B4OA 2I5JA 4OYPA 5M2UA 2XQCA 2IRXA 1UPMB 4Q43A 5HQLA 1IM6A 2GCFA 2B5JB 1IM4A 2AW0A 1ACMB 2GIQA 4OQJA 2YX4A 4DX7A 4IH6A 4JV0A 4FYYB 2OJ3A 2RF2B 3IMQJ 1C1BA 1QAYA 4QIVA 2L9NA 2W7OA 1E6VA 2D74B 4DV1J 5GAEI 1P9YA 4PCQA 5DDPC 1IKVB 2Y8WA 3UD3P 2JLEA 1FKOA 5I3UA 1M5KC 1PGZA 2NSBA 3DDIA 1GTHA 5KAKA 4ELUA 3DDKA 4I7FA 3CCES 2B9EA 2AWZA 2V67A 1FWPA 5HI7A 1TVRB 2O67A 2M8HA 3BDPA 2MHNA 2B6AA 5E2QA 2EFOA 4FF3A 4M8LA 3DRSA 3WQPA 4X64J 3GQCA 4IRDA 1Q78A 2CPEA 2ZZTA 2BOAA 2X3DA 2VKRA 2GQQA 3HX9A 1VR6A 4A4JA 4AXIA 1RTDA 2N7CA 4IO9Q 3PW7A 2EFNA 3PYEA 4JI5J 2DNQA 2R8IA 3HO1A 2XWYA 1B7FA 1S99A 3V6JA 1FKPA 4G6VB 4R5PA 2BVZA 1BGXT 4MTPA 3TVYA 4LR9A 2RUSA 5CXTA 4ED0A 1NUEA 1X0PA 3BM7A 3I9ZA 1YLXA 1HW9A 2MJNA 5B0DA 1ZM3A 4FKYA 5G0RA 3U1LA 4DR1F 2ZUGA 3UWTA 3NS7B 1KN6A 1RAIB 2OHDA 4OIXA 3H5UA 4DQSA 2GQ2A 2QLJB 3MCMA 2FIUA 2HQCA 3C14B 4CTAA 5HBMB 1KD1T 2UUCF 1JNRB 2HNDB 3K5NA 1JLQA 2CDQA 2X1BA 4OLOA 3IRWP 1KKHA 3NBPA 3BQ1A 5KFDA 2D7SA 3DLGA 2XSJB 3G87A 1T8EA 1DRZA 3HK2A 1FRIA 1X31C 3QAUA 1OPIA 2AJQA 4OX6A 3MM6B 3RBEA 4LVNP 4OX9J 5DJBA 2KXNB 2VG6B 3BGUA 3M8QB 3I55S 1FJGF 3MOJB 2B9YA 1WTFA 1CQMA 1RACB 1RTIB 3GIMA 2E1MC 3RAXA 1ULRA 2WB4A 1O51A 1CS4B 1U8SA 4J5OA 4RNHA 1U02A 4I68A 3WHIA 3TI0A 3KHGA 3KMQA 4LFBJ 3NGRA 4NYPA 2VG7B 5B0FA 1Y4ZB 1RWXB 2LA4A 3M30A 1BMQB 2X1FA 2ACYA 5K8PA 4LT6A 2HS3A 4OI3A 1S1VA 3D54A 2KFZA 2IYIA 3NWGA 2JFKA 3EWGA 4KGVB 2E9RX 4UZCA 2GMLA 4U8YA 2AF6A 4ZJOA 3P5BP 5T7LB 3QYYA 4CLLA 2OPSB 4FXWA 4RW7B 4HTJA 4OYZA 4QBUA 1FJGJ 3HVWA 1H98A 4NE9C 3CF5Q 5DM6Q 3EX7B 2DPJA 4TN2A 4CLTA 3PFOA 4OMFG 1UWBA 4JI4F 2BW7A 3GMGA 3ISND 5IV3A 3J7YI 4ETXA 4C3LA 3BYPA 2E9TA 3EGVA 2KM8B 4ED7A 3PYFA 3HHKA 2LXIA 3R3TA 3HM9A 3BGFA 4IG3A 3ZNUA 4AXJA 5AXKA 2MQPA 1JXLA 3SQGA 1L3KA 5EHHA 5L46A 2DNZA 1OY9A 2VA2A 3SV3A 4LF7F 4ED1A 1TKXA 1RLDA 5BJRA 2C3MA 2C28A 2RJZA 4C0BA 1S9GA 2E66A 3P6YC 1HD0A 4OZ0A 1T7PA 3KOAA 4DV2F 2QIFA 4U6PA 5FLXU 4ZCIA 4NPOA 2FHMA 4I0WA 2DTJA 5HK4A 4LR7A 2ZFHA 5SUHA 3I0RA 2XMMA 1RWKB 1Y5NB 2JNJA 3O6QA 1TTHB 1S12A 3FJ2A 2BJ9A 1FVQA 1PC4A 2RF2A 2E1AA 4OV1A 2WSCC 1HIYA 3EXCX 4GKJF 3MEGB 3ENAA 1WHVA 4PWWA 2HFNA 3AA8A 2EFPA 1ZA2B 4WIQA 4EFAC 1LWCB 2CJQA 4Z7CA 2WRMA 1SC3B 2WVFA 1FNXH 1H2TZ 2UU9F 5I3QA 2OMOA 1RWNB 1JMTA 1IBKJ 5EUHA 4MKVA 2QMUB 2ZD1B 1NB7A 2CNLB 2E1CA 4NOHA 2HAIA 2EFGA 2NUHA 3GG0A 3MMAB 1TVRA 1V5VA 4QYZK 4LR8A 1YRUA 1R6VA 4EUVA 2HIQA 3QGGA 3JSMB 4DL2A 2V9WA 4MIWA 2MLXA 5KFHA 7FD1A 1F2GA 3Q2SC 2Q43A 5IT9Y 2Z57B 3ET6B 3BPDA 2F40A 4P71A 3EZUA 2ZH9A 5KG4A 3VGTA 1QAXA 5E41A 1Q0NA 1PYTA 4EZ6A 3M32B 2ZH5A 4LMZA 2F7VA 5KFZA 4O23A 1GFWB 2OGUA 2W4CA 3TRGA 2DHXA 4OV6A 3KUHA 5KG3A 1UEUA 1K8AT 2WOMB 3KKFA 1RABB 2UV8A 3D66A 5A8WB 2XG8A 1S79A 2J8AA 2AD9A 1RHUB 2IIHA 2XMWA 4J9NA 4J9SA 3VR1A 1FXLA 3BH7B 2QRRA 3C14A 3GPAA 1DQAA 5HBMA 2VL1A 2FLLA 2ZBQA 3J81Y 2HRUA 2HNDA 2G0CA 1MROB 1IQTA 3PW2A 4M5GA 4MH8A 3DLJA 2XSJA 5IT4A 3KLEB 1RBLA 2BXJA 2RE1A 5ETOA 2JC0A 2XM3A 1SKRA 4AL7A 1RHMB 2NZCA 4CLZA 4IRCA 1F5BA 2Q1LA 1Q53A 4Q8FA 3MM6A 2W25A 3D4JA 4RBVA 2ALYB 2WW4A 3GSDA 3IBWA 1WEYA 2RRNA 3B54A 2VG6A 3FQLA 3G8TA 3M8QA 4OYMA 3MMJA 4RBTA 2RNEA 4DR6F 4LF5F 3GR1A 1FRMA 4F0MA 1RTIA 2VPXB 4UW2A 4ED5A 2PA8D 4JV2A 1PILA 2AJFE 3MEKA 4R8UA 3W65A 3CMES 3QWPA 4NA1A 2XNQA 5CYMB 3PKMA 1WSVA 5DO2A 1SVDA 2CQIA 2B8QA 4IO1A 3ZZ0A 4Y2KA 2VG7A 1HBUB 1VQ4S 5KG2A 4DQIA 5DDQC 1MWQA 2ZKUA 1XN9A 3WC0A 2HBRB 1L3UA 2AJ4A 4KT0C 2C2OB 3H98A 5LMUF 4DZDA 3JSBA 3ZNJ1 3MECB 1WC6A 1AA1B 5BYRA 5ETNA 3P45B 4HTIA 4K4WA 1KTQA 5T7LA 3EICA 4LBHA 4FYDA 1RUSA 2OPSA 4DL5A 3KLGB 1RE1B 4LF5J 3TOQA 2ILZA 4P2MA 5D0RA 2V4JA 5F8IA 1U0HB 1N5TA 4DR7F 3MUTP 2CNKB 2P2CB 3KHHA 2I1RA 5IOLA 1UVKA 3R6GB 3QBCA 5KFYA 3KK3B 1NDLA 3TUPA 3ENWA 3ULHA 1HWKA 5A6PA 2ACMA 2X7IA 2ZOFA 1H2UX 1V3RA 2HBQB 2K2PA 4I4BA 1F60B 4KGMA 1T03B 2C2KB 1FJ7A 4JI7F 1N52B 1RWWB 2YQ3A 1W7WA 2W4DA 2O66A 3C66A 2NPIA 3I56S 3M2RB 4RUBA 3V6HA 3HSGA 2QMWA 3AQPA 1WWHA 2B4UA 3RG6A 3TVZA 2KN4A 3EDQB 2H48B 2HAFA 1R8CA 2CQGA 1YBAA 2DRDA 4OJHA 2GJIA 1MW7A 1RT6B 2B7CB 2ASYA 3M8SA 1XMQJ 2WVBA 3MR5A 3SV4A 3HKZD 2OIHA 4FP9A 2M0GB 1XMOJ 3FDSA 1HYSA 2DH7A 1AFIA 4GKKJ 1LFWA 1Q8IA 2CPXA 2A0FB 4DSKA 2ASDA 4ZVSB 5EWGA 4ZHRB 4NXNJ 1T9TA 3DRXA 1K44A 3NWRA 4R25A 3J80U 1XK8A 2CQ2A 3HLUA 4DXLA 5IZHA 3TARA 3LF0A 1K1QA 2ZVIA 3ENVA 1LWCA 2IDLA 2W7AA 2CG4A 3QZ7A 1UJ6A 5F3TA 1SC4B 1EQ0A 3T6BA 3N6MA 1S6UA 4NLDA 5D0GA 2HWHA 2MKJA 5DDRC 1HR0J 2BJ1A 1MNEA 4B3MF 2DY9A 4PG6A 2ZD1A 1S6QB 3THVA 3A3OB 2ZBRA 2QA1A 1FNMA 2UUAF 4QCLA 2AJ2A 3UCGA 4GO5X 1SJRA 2CPYA 4ZPBA 3MMAA 2B9WA 1S1UA 3CDUA 1NXIA 4KR0B 1YGYA 2WAQD 1RCXB 2AV5A 3DCAA 5D4PA 1R0CB 2DPIA 4NLSA 4W4MA 3QZ8A 1RAHB 4CLWA 5KG6A 3DDNA 1IN0A 2C2EA 3ET6A 4NYZA 2WSFC 4FBUA 3UDVA 2WBRA 3W2VB 1BHNA 3HPOA 2KHCA 3DGPB 2NQPA 3G2XA 3RAMA 2E44A 3M32A 1J27A 3PVXA 3V2UC 1OWXA 2KDOA 2G13A 3KHLA 1VQ6S 2V69A 1GK8A 5DQHA 2ILYA 3AOBA 5KT3A 2WOMA 4K50A 1FFWB 5A8WA 1FA0A 3TZYA 5I4MA 2M5YA 5EN1A 3D28A 3LAMA 3AAWB 1XR5A 4N47A 4DI6A 2JH3A 1VLOA 1C0UA 3AFGA 1X60A 2RDIA 4PXBA 2LKZA 1U2RA 5HQ8A 3D5MA 4Y65A 2V8DA 2B43A 1QAIA 5K8MA 4RWXA 2W9CB 4JI2J 4WKYA 5IC6B 1IBMF 2DXFA 2FJAB 4B9UA 2OUGA 1KS2A 4AQYJ 3MTJA 1N32F 3KLEA 2H4YB 2J9DA 3LP2B 2UVWA 1KEKA 2QSFA 2HIYA 1X4BA 1XWLA 2YNFB 4UOHA 2DR7A 2GS8A 2F8MA 4DV0F 5T41A 4HEA9 2XY6A 1KQFB 4DPWA 4URGA 3Q86A 4RNOA 3H0PA 3T3FA 3NGKA 3R5GA 3GZ7A 4LRBA 1K47A 1SH2A 2C3PA 4MKAA 5BYQA 2AU0A 4B3SJ 4XO0A 3IWLA 1FRHA 2IHR1 5E5NA 2L08A 5CYMA 1U6FA 3ZTSA 1NH7A 1B4SA 3MM9B 4DJBA 2XO6A 4OI4A 1JQGA 1HBUA 1X4GA 4KKOB 1CQNA 3RAQA 3OQ2A 2CFXA 5FLXY 4CLPA 3JSYA 5CCMA 1M1HA 4DWIA 3SXLA 1NCLA 4X65J 4BWJA 1HWLA 1WC5A 3OTDA 2F8EX 4KB7A 4J9OA 2MMYA 1UVMA 3MECA 3MGJA 2OSRA 2G2ZA 4JI0J 2XS5A 4U67Q 2O01C 4X66F 1Z1ZA 2MQQA 3KLGA 1VGYA 2KKHA 5HMYA 4PAAA 4X4VA 2EC2A 3VVTA 2LDIA 2K3KA 5K9FA 2XHWA 4MKBA 1U0HA 2ASLA 1FE4A 1Q79A 3DKDA 2LECA 4DG1B 3KK3A 3RU0A 4M63A 4GVLA 3UN2A 4C48A 4ZJQA 5IFMA 2P6SA 1UEVA 4FPIA 2R8GA 3TUZC 1X4DA 2Y9HA 1SJ4P 2JWNA 5HQMA 5JVHQ 2Z4PA 4Q5VA 4ECSA 6FDRA 5A8RB 2DBBA 4ES1A 2MSSA 2AEMA 1T03A 2YKNA 5DGAA 1TL3B 2E1RA 3LGMA 4DSLA 4ITSA 1FDDA 5AE1A 4I64A 4B3RJ 2VA3A 4YR3A 3W64A 3M2RA 3W5YA 2C2RA 4K4VA 1SJ1A 1KVKA 3K89A 5F41A 3VF0B 1G3OA 4DR2J 4C3MA 1IBCB 2VC1A 4KGKA 1RT6A 4C8LA 2GMJA 1X0FA 1VISA 4QWDA 1M90T 1T3OA 2HVZA 1U4BA 4ZPTR 3SDEB 2QL7B 3G6XA 2VFUA 3I4PA 3FRZA 2KT5A 4LF4J 3K7RA 4ZHRA 3RRGA 4N76A 1DJ0A 1GMVA 3H42A 2KXFA 3VGUA 1B0PA 3NOCA 4CO0A 3L3CA 2IY5B 2M88A 1ZYQA 4BLGA 2ZUAA 3UFCX 1S0OA 3JQMA 2GNKA 3PHEA 3BKTA 1ZH5A 3OHBA 4F3MA 3HZGA 3K59A 4USUA 2L3MA 3IBCB 1F1BB 3GJTB 2DIUA 4ZP6A 1WKJA 1HI1A 4RUCA 1S6QA 3OT9A 3Q83A 4ATNA 3TEGA 4J9UE 5DG8A 1V5IB 2VDIA 1IKYB 3D3BJ 1X7VA 4NLRA 2AYGA 1KC8T 1UL3A 4DSJA 2HHTA 2AX1A 1SBRA 3MWBA 3QATA 3PO4A 3H5XA 1SKWA 2XGPA 4WK1A 3S7RA 1MMDA 4AD6A 5F8LA 4ZVHA 3MR2A 1RA6A 3KLVA 2CG8A 2PMHA 1KFDA 4F7VA 1N36J 1UVLA 2HNZB 3QGIA 3Q8SB 4MIAA 3W2VA 3DLEB 3DGPA 2HVIA 3THPA 1Q7YT 3H4DA 3W63A 3HJVA 1U47A 2OFGX 3AD8C 2ZBIA 2DGWA 2N4CA 1RKIA 3C8YA 3HZEA 2FY1A 5H1SV 3NXZA 3HD2A 1S4EA 3FBFA 4OYBA 2DHHA 2H3EB 3CCVS 4NLTA 3IG1B 3R7SB 1J5EF 2HBZB 1Y5LB 1TFYA 3QT6A 1QDUB 3BGOP 1LKZA 3ZZPA 3D68A 3TAMB 1WF2A 3M9NB 5G4DA 5GADI 2VKZG 3WZ0A 2F1FA 4QIEA 2ZH1A 2W8KA 5J2PB 1REVB 1N34J 1HQ2A 2KYXA 4MAKA 3M7VA 4O3PA 2W9CA 4QIWD 2Y1RI 2QG9B 5AT1B 3J81j 1PO6A 3EZOA 1BQXA 1VQSA 3EE3A 2W2PP 3HT0A 2ZE2B 2EXUA 2IPOB 3UE2A 2CQ1A 1AUSL 1I94F 1FE0A 3OXGA 2YNFA 3KXDA 2GO9A 3NGSA 1U6BA 1M0SA 2UXDF 2XULA 3M1VB 4RNNA 3Q8UA 2BACA 4F4YA 3CPWR 2NCKL 4NLYA 2EG1A 3N5BA 4C8MA 1SJ3P 1BD6A 4O4GB 4USJC 2V63A 1XR6A 4J9MA 2BRKA 1VI7A 3DOKB 1VQMS 2FGCA 2LU2A 3M8RA 4QWEA 4ZITA 2DGVA 4HKQA 1R7IA 3MM9A 4TU8A 2DO0A 4KKOA 1AUDA 2MKSA 2HHWA 5GMKa 3S6EA 2ZH3A 2C22A 4OYXA 5KG5A 2YNIB 4R0EA 3NRBA 3J7A1 4DX8H 4QYZJ 4L6V3 4EBEA 2OAUA 1BWEA 2HGMA 5C24B 2CUYA 1EAYC 3M2VA 3OTCA 3OFGA 2V8HA 1G7CB 2BE9B 3MAHA 4DBQA 4O44B 2AYBA 2DNGA 4U8VA 3ZFVA 4AL6A 1QY7A 4KGXB 2WW8A 1QJHA 3LP0B 1K73T 3UN3A 3BKFA 3T19A 3CVKA 3TP2A 4WU3A 5D0HA 3OVBA 3AB2B 4ZVPB 4TNOA 3J80Y 4N8OA 3H2VE 4CLUA 1PYOB 2QJ3A 5J1PA 3Q8RB 4O3SA 5IC4B 1S9EB 1RU1A 3KWMA 4PKDB 4LFAJ 1K0VA 5M2PA 5D77A 1ZOTA 3OL7A 5A8RA 3FQKA 3K17A 5DLGA 1J5OB 5ADZA 1TL3A 2YKMA 3EM1A 1D8ZA 1R8HA 1JB0C 1LQ9A 5DG9A 1B0VA 1TV6B 5GAGU 1KHVA 1T9UA 3FMWA 2BE2B 4P2XA 1EIYB 2XEXA 4QR0A 1S48A 1A9NB 2YWFA 2FVCA 1DQ9A 1FRXA 1ZTWA 5LJ3Y 3O44A 1WI6A 5D3GB 3JAMU 1D09B 2VASA 2UP1A 3QFHA 4EEYA 1OYEA 3SDEA 1LXJA 4BC9A 1FT8A 2YBVA 2GHPA 1RISA 2RQCA 5L1IA 4LIWA 3CJ8A 3EGZA 4DV3F 4I67A 4P52A 4C2MA 4KY3A 4PUOB 3CT9A 1SPBP 3ILIA 1S6PB 4CWBA 2AP6A 3PHTA 2AKWB 1IBLJ 4W98A 4UY85 4YOEA 2GO8A 1FF2A 4J9KA 3OVSA 5HROB 4ELVA 3V4IB 3C46A 1H38A 1DY3A 3EGWB 3QFWA 1LK5A 1JLCB 1JJCB 4DX6A 3ICLA 2G4BA 4FYXB 1P1LA 1C1CB 4NX9A 4DUZF 2P9GA 3VHQA 1NPPA 1IKYA 1ROFA 4DU7A 3CWJA 2G1DA 4MFBB 1WC1A 9RUBA 2PC6A 1W2IA 2AZ1A 2CWXA 3UR0A 3FFIA 5EX3A 2YKOA 1T9WA 4V19X 4JI6J 1WHXA 4C6AA 2HNZA 1T3NA 2RDJA 2APOA 4JYAF 5KFPA 5L39A 1QVFR 3OUYB 4DV7F 3DLEA 1PSDA 3K5MA 1H6KX 3GG1A 2DGSA 3DGVA 3RB3A 1VRTB 2HHSA 2BKOA 4KPCA 2Z58B 2JLGA 4ED2A 4NLWA 2FC9A 4HHUA 3FCVA 3F73A 4PQUA 2IRYA 1UA0A 3IG1A 4EK2A 3P5TL 4RZRA 4FS2A 2J8SA 3TAMA 2Z0GA 1EHWA 2OP5A 5D6GA 3AY0A 4RX6A 2YWWA 2G2OA 3BEGB 1C0TB 1REVA 1YITS 1KVIA 2A3JA 1WORA 2Z2LA 2CQBA 3NG8A 4I1TA 4C0OC 2ZKTA 4RWWA 1EB0A 3NCQA 4WYLA 3WX8A 3QGHA 2XLJA 2H5JB 5KFQA 1GTEA 2ZE2A 3VZIA 4X62F 3HHNB 1S76D 3TJ8A 1N5VA 4C3KA 4ERDA 4B17A 3BR9A 1SB6A 4HT7A 1NJZA 3BKUA 4LRAA 2AJ1A 4HR2A 4KGZB 2YKAA 2A10A 2D9OA 2KJWA 4OZ1A 2Y1LB 4H4KC 2XCPA 4HLBA 2J76E 1B99A 1VBKA 3ONQA 3PIOQ 4O4GA 3FNNA 2NXJA 2ZJPQ 3BQ2A 3DOKA 3UR3C 4EYIB 4DPTA 2PEHA 3P4UB 1IJFB 2MZRA 2Y8YA 1B0TA 4Q2LA 2JL9A 1BC6A 1F6TA 2LEPA 3HMJG 3AXMA 4YY3J 2PMZD 3NS6A 1T9VA 3CJ3A 3CE8A 4OZ2A 1D9FA 1RKJA 3EPIA 2RRBA 1FD8A 3NGTA 1OO0B 5JMNA 3KMSA 3ZZZA 2F5GA 5C24A 4NCBA 1N88A 4O44A 2RHSB 2EK6A 2JFDA 4QU6A 1AT1B 4IQMA 5A0YB 2IBOA 3BSNA 1S1TB 3LP0A 3ZTOA 5SZTA 1FWLA 3T5JA 4C97A 1RT5B 4HL9A 2ZH4A 5KFUA 2F4VF 4GO7X 2E5LF 2AGOA 2PEBA 1TK8A 1CULB 2GHWA 4LF1A 1DHMA 3BV8A 2FZCB 1S9EA 2R8HA 2F4FA 2HS4A 5B08A 2AMCB 2VB6A 4Z2XA 4ANEA 2MEWA 2DGOA 1WDTA 4RL1A 4F3OA 3QIPA 2CWKA 1YJ7A 2Q6CA 5C5JA 2MKCA 3MPUB 1RZMA 1TV6A 1VHIA 1CBKA 3FCHA 3H40A 2D69A 1S7HA 2BE2A 3KLIB 2KHDA 2GMHA 4CM0A 5F8JA 2FVPA 1RTHB 4DUYF 2BJEA 3S8SA 4LREA 5ETPA 4PG4A 5D3GA 4NYOA 2MZSA 4X4TA 2NXUA 3W3SA 3SBMA 1TELA 2DNLA 3D0HE 2FHJA 5F0UA 4KHRA 3IM8A 3UD4P 2ZWPA 4LF6J 4FDFA 1HARA 4YUDA 4MKYA 4PUOA 1VQ5S 3C15B 1S6PA 4O3OA 2CKWA 2L41A 4ZIVA 4WF9Q 1HNWF 2ZHBA 1U1NA 4RKUC 4B08A 3CMQA 1JIHA 2R7OA 3GJRB 3OJSA 1AROP 3FC9A 1FRKA 1D9DA 5HJXA 2K06A 3HVTA 1JLCA 3IRXB 1GX5A 4FF1A 2QLFB 3JB9k 1C1CA 3A13A 5HANA 4B9MA 1V9OA 3CC4S 2V2ZA 3PTWA 4KSEB 2DYAA 3GV8B 2UUBF 2HRTA 1OYDA 2FJWA 4MFBA 3UPFA 2CZVC 2HBYB 3KG4A 4USWA 2LLZA 3OV7A 1UETA 3CUNA 2CQ3A 3SCLE 2PA3A 1RYRA 2R3VA 3FBCA 3L7UA 3OUYA 4I2PB 4WU2A 3CCRS 2D9PA 1KTVA 2BUNA 2J7WA 4DSEA 3SCKE 1UZDA 1VRTA 4M5KA 2LMIA 5HVHA 2DNHA 4F67A 2V0NA 2P5VA 2HLUA 2X51A 2HG4A 2J6UA 4RR5A 2DHSA 4OHXA 2PN6A 2PO4A 4Y2MA 4LQ3A 4F36A 2PIIA 1FO1A 2AEJA 3K2YA 2IYGA 5JUMA 2XO7A 3GWCA 5EGYA 1FCAA 3I5AA 3T9NA 4A47A 4M5JA 5EX0A 4ED6A 3LPEA 4DCJB 2JVOA 1C0TA 3O1LA 1MG7A 5IWAF 1WEZA 4CO3A 3RRKA 3DOMB 4EU0A 3HF5A 1AXQA 1VQ8S 2QL5B 4M1KA 1U1PA 2CIMA 2YQ0A 4UF4A 1F9HA 3TA1A 1NH8A 1T9XA 4ICLB 4C8KA 1EKSA 4USKA 4Z7YA 3BR8A 5KFXA 2CNNB 1H3DA 4DFMA 2R2TA 3HXMA 3Q2TC 5HO4A 1ZAVA 4PYDA 5L1KA 5AJ3J 1D8YA 1JXEA 3A12A 1ITPA 2FVRA 2LXUA 5CYJA 2VBWA 3U02A 4X84A 2CJKA 5I3UB 4WFNQ 1P8GA 1Q1KA 1H7WA 3NGDA 2OH2A 1F5AA 4TYBA 3SSQA 2UXBF 4I7FB 2CA9A 5KFKA 2WSEC 3D1QA 3R2DJ 1D3WA 2RQKA 4EMDA 1S5ZA 2DXEA 1FRJA 4ECZA 1QD1A 5LT5A 2JSXA 1WG5A 3JAMY 5GMEA 3SYZA 4USVA 1YJRA 3FBEA 4KPYA 3P96A 5IS2A 2F9DA 4EZ9A 2PD1A 1RTDB 3AOCA 2DCLA 5A0YA 3X1LB 1S1TA 1TQLA 2MLZA 1Z2ZA 1FFSB 2ROGA 1QUPA 1UCNA 1RT5A 4DV6J 4H4OB 4BC7A 1IQZA 3I96A 3ZZOA 2JLFA 4JI1J 3CGIA 1CULA 4P2SA 2GGPB 4QU7A 4DV4F 3UDCA 1CJKB 3LOUA 2LQJA 2XGQA 3ADAC 3W60A 4QWBA 2W2NP 1KFSA 1KLMB 4UOCA 2XCAA 1S7IA 1Y3KA 3QRPA 1TMMA 2ZM6J 1RSCA 1KOOA 1RU2A 4DR4F 1U1MA 3BGRB 3M8WA 5A6WA 4HVZA 5C42B 1CJVB 3KLIA 4ZLNA 1OPZA 2LA6A 4TY9A 2R2SA 2DNNA 3FGVA 4NMXA 1RTHA 2A1BA 1U1KA 4ZKAA 3DLGB 1DFDA 3T1HJ 1WKKA 3R7BB 1F0XA 2ZBCA 3EDRB 3W9IA 1FK9B 2RSQA 4JV1A 2ROEA 4E98A 3LGNA 4YMEA 2KG1A 4QIGA 2P8IA 3I4HX 1N33F 5E0OA 3PEJA 3C15A 5GAHU 2YWEA 3GFHA 4P74A 6FD1A 5EWFA 2EWHA 1T95A 1OSCA 2J5AA 4B9SA 4R0JA 2HHHF 3KDOA 1NK8A 5KFEA 3EVMA 4WFZA 2VQFJ 1ELOA 4IR9A 3I0SB 1WOSA 3H5SA 2VJVA 2FY8A 3M30B 3IRXA 2J0QD 4HI2A 2ZWOA 4I6WA 4DDFA 3P49B 4IQXA 2HFOA 2R7XA 3AT1B 1RT1B 4O3QA 2J6SA 3TO8A 1SQEA 1JLBB 1FJCA 3OL8A 4FVMA 3V6KA 4CLFA 3BQ0A 4J37A 5E3PA 4DL7A 4WJBA 1VIOA 4RNFA 4UQGA 4I6YA 3J81U 2XB2D 1SH3A 3FEXB 3HFKA 1S59A 4FS1A 3GYNA 1UWBB 1FXDA 5U47A 4CO1A 4I2PA 1ZPVA 3PKYA 4TU9A 4U95A 2BM0A 2IDEA 5DZ7A 3HFZB 3MDFA 1APSA 2LQ5A 3V81B 2JEFA 4PWUA 3TJ9A 4KV8B 3GIJA 1UTAA 4ZJLA 2U2FA 2Y0SD 2UXCJ 1WOPA 3PO5A 2C3UA 2QA4S 1KQKA 1RTJB 2M3DA 2KTQA 3PRBA 3ZC4A 3B78A 1YJ9S 3NKYA 2CNOB 3VAIA 2EK1A 2DNRA 2BJ7A 1NDCA 4V19J 3AHPA 3WIVA 4ECYA 3ILOA 3L09A 5FDLB 2IM1A 2BQ3A 2BV3A 4ZLJA 4KQZA 3DOMA 3PXGa 1FJEB 4DR5J 4DMZA 4QWAA 5F8MA 2FZGB 1HNZF 1R0AB 3WBZA 4OYIA 3I0RB 1U2CA 1R0BG 1B64A 5EDWA 3BH6B 4X4SA 3M8PB 4X4QA 4JI3F 4ICLA 4RLEA 7AT1B 4QZVB 1LNQA 2Q6BA 5F8GA 3OR1B 3I5CA 1UFLA 1HFEL 1OS5A 5HLFB 4IFVB 1DTTB 2DD8S 3FSYA 4A8YA 1DURA 1Y9OA 2LVWA 1XNRJ 4UUXA 3D2WA 3D6HB 3N79A 1YHQS 3THTA 2PI4A 2MY7A 3LP1B 2MKKA 1GEHA 2L9WA 4OZ5A 4O3NA 2JC1A 2B4VA 3MM5B 3FUYA 2GAHC 4DN9A 3LPYA 4KBIA 3TYTA 4L72B 5CZXA 2ZC3A 4WP3A 1XJWB 2E1PA 1RT7B 2DEIA 1F9FA 2V8PA 3LANA 2CVEA 3U1NA 5HN0A 1ZA1B 3VVUA 1HI8A 4N7TA 1I3OB 2XHCA 4DU8A 2EFQA 4NRUA 5B0EA 4CO2A 3CB4A 3M9OB 2LXFA 4H4OA 3BDEA 4A8KA 2D1CA 2HZCA 3V6DB 4TYAA 4UTGA 4K0KF 5IT0A 1URNA 4RW6A 3RB6A 3D6FB 1VJQA 4C9DA 3R5AA 1WHWA 4FF2A 2GGPA 4RUHA 4DL6A 4F8RA 2CQHA 1N8RT 4KC5A 3IWNC 3FEYB 1CJKA 2XYGB 3CDBA 4YEAA 5ETTA 3TEHB 3R6LB 2M8DB 1T02A 2QA4G 3DLLQ 2ZC4A 3SZ2A 2B51A 1VK3A 4M5DB 2V5HG 1KLMA 1NU4A 3RBZA 4ER8A 1PBUA 4XTTA 3BGRA 5C7PA 3VWSA 3JYTA 1AFJA 3HHLC 5L1JA 2HQ3A 3MEDB 5C42A 1CJVA 3BREA 2J9CA 2EVZA 3BYRA 5HP1B 2DH8A 2HKEA 4P6QA 3H8YA 3DLBA 1QUVA 1CG2A 4B3TF 3MAQA 5HVGA 2VPYB 3FCWA 4EO6A 1FK9A 4Y2IA 2AJ0A 4QQBA 1R89A 3D9BA 4LUBA 4X4UA 3AJ1A 2HLTA 3D7SB 5KFOA 3HSDA 4DR1J 3HFVA 4TQRA 4JI8F 2X1AA 1RA7A 2DVIA 4R8UB 2AGQA 4ED8A 1HKAA 1FFGB 4DEZA 5DQGA 1NKEA 2CPIA 2GC8A 1A0OB 1TFWA 2UUCJ 2WTFA 1O6XA 1RHKB 4QW8A 4RU9A 3I0SA 4OX8A 2IRUA 3IS9B 4DCOB 4PQAA 1RT1A 1YTYA 3L9ZA 2V68A 1RB0A 4USIA 1JLBA 4TLRA 5L8RC 3B82A 2V8VA 3D1OA 3HD1A 1ZETA 4NA2A 4B9TA 4GVBB 1N54B 1XR7A 1X8DA 3OTOF 1LW0B 5JXSA 3EYZA 3SCIE 4HACB 1VMBA 3CC2S 2V4JB 2CADA 3S01A 3R97A 3RW6A 1RT4A 2NPFA 2HS0A 4ZPWR 1QTNB 2PDAA 2WBMA 3BJYA 2Q66A 2MXYA 3T5LA 3V81A 2BMBA 3CW2C 4OZLA 3T1YF 1U48A 2VFRA 3VQSA 1JKHB 1SQGA 1NHVA 4KV8A 1S9FA 2XLKA 4OJ3A 1NKBA 5LXRA 2ADBA 3UO0A 3NNAA 1RTJA 8AT1B 4ZVQB 3A4TA 4ILRA 1WKLA 3BSAA 3R2CJ 2FDNA 3SEOA 1P27B 2VPZB 1RAOA 2GJFA 4BHQA 4NA3A 5HATA 1U1OA 3PYGA 4K4XA 4IFYB 2ZEJA 2R8KA 5FDLA 9ATCB 1V6HA 2OTLS 5LMNF 4OI1A 4JI4J 2W2QP 3UDEA 3LA0A 4MJKA 1R0AA 4LF8F 1ZM9A 3HSZA 3QJPA 1F9EB 4J90A 3SCJE 1TP7A 3U7JA 1MWZA 2ALZA 1HYSB 3M8PA 4ZVEA 1BQMB 2GHVC 4DS5A 2QEXS 2DGQA 4UZBA 3FBBA 3R8YA 3OR1A 2Z2YB 4KHPF 5HLFA 2OPPB 2QFJA 4IFVA 1DTTA 2X1GA 3IC1A 2R7SA 1RXOB 4WYWA 3MCSA 1FDAA 2IC3B 3FEZA 1KBRA 2HQIA 4LSZB 4LF7J 4B9NA 3IM9A 1X4CA 1D9AA 3BO2A 3PYDA 2VOPA 5CD4A 3Q23A 5T14A 3LP1A 4DV2J 1NHUA 1REGX 1WJ9A 3AB4B 1S1UB 5CABA 3MM5A 2CJYB 2MPUA 1PIEA 2ZH2A 1RGVA 1AZSB 1RT7A 3TVKA 1VQKS 4X2BA 2GQCA 2MZ1A 1UEKA 5BR8F 2VFTA 4GKJJ 4FZVA 4V1Ak 2VZ9A 3VAJA 1MU2B 5FIIA 2FGOA 4J9PA 3CO9A 4DL4A 5LL6d 5B09A 2OELA 1K9MT 2FQQB 2A6OA 3DHXA 3V6DA 1FEEA 4URQU 4F0HA 2YWKA 1VOMA 4IOAQ 1VCTA 5KFLA 3IR7B 1VRQC 2UU9J 1SIWB 4U7UK 4L76A 4X4OA 1AW0A 1IR2A 3SSSA 2A18A 2IFXA 1XNQF 1U1LA 2KYZA 4ZCMA 2AT1B 2IA0A 2FLNA 2HWIA 2ABYA 5EWEA 1YBTA 4DPYA 1IUJA 4J9LA 1YRTA 2LU1A 3R9LA 2MQ8A 4WTOB 3B6BA 2EW9A 4FXDA 4M5DA 2AGPA 2ZOMA 2DHAA 3Q0AA 1JJ2R 3N28A 4FVCA 1C0UB 4OYOA 1FRLA 4NCAA 2DISA 3KLHB 4H4MB 3MEDA 4I6AA 1B3TA 1EARA 1FNOA 1G1XA 3IO1A 5HP1A 3IGNA 2XSFA 1S72S 1BUXA 4CT8A 2CJXB 3QQCD 3CCUS 1U26A 1FEHA 4Y6IA 2FLPA 2B4PA 5F9NA 4ID5B 2QGFB 1W26A 3I82A 5LXYA 4W90B 2VBZA 1R8PA 3I87A 2FHJD 3LQVA 2OI2A 2VQEF 1YQHA 2MHEA 3BZQA 3RGIA 1SV5B 1NBEB 1ZZNA 1URRA 5CYQB 1SL2A 3DYAB 3MM8B 4PYAA 4D3HA 3PEHA 3DXSX 2XI3A 3TZXA 5DLFA 1SC1B 1KQGB 2VOOA 2N3LA 3RR7A 1VLYA 3WIUA 3QT8A 3D3CJ 2B8PA 3IS9A 2N82B 4CNYA 2FVSA 5ETLA 3V4MA 3CCJS 1UW9A 4ZLLA 3A8KA 4NLGA 5M2RA 3DOLA 3RRHA 2QV6A 4NEYA 1Y00A 1NM2A 3M2UB 3LGHA 4C8OA 4BWMA 2DNOA 3LWMA 1HNXF 4CLYA 3KK2B 4GVBA 5JJBA 4JOUA 1FTRA 2G0JA 2FVQA 4M5LA 3CTRA 2CQCA 4NEZA 3QAEA 3LO3A 4FYWB 1LW0A 4DR6J 2VH7A 2GA7A 1X5PA 4HACA 3MEEB 1Q8BA 2R9LA 4EBDA 4A8FA 4NXMF 2W2MP 3W5ZA 4WP8A 3NL0A 1M1KT 1YIJS 1YJWS 3W9HA 2BQRA 4ID8A 4ECXA 2RMLA 3EMTA 5CCLA 2UVRA 2MQOA 1JKHA 3PJXA 1ICEB 1DTQB 1N5SA 3K5LA 1S49A 4LFCF 3W66A 3QSYB 1V3ZA 2YKNB 2H54B 3GILA 1ZAWA 2W9BB 4EWTA 1IVZA 5LMUJ 2GIFA 4K4ZA 3QLHB 3R5CA 3SFUA 3OJUA 5GAGI 3TA0A 2JX2A 2PMWA 4K5RA 4O4RA 4KJIA 4B02A 1NZAA 2G0IA 2Z30B 2MY8A 2NREA 3UDLA 4IFYA 1D1UA 2GVDB 3HI9A 3J7AN 4TXSA 4PABA 5AXLA 4DFKA 4ZVOB 3PX6A 2RIJA 3VQTA 1RTZA 5KT4A 1WNEA 4DR7J 2K3IA 3W5XA 2QT7A 1TUGB 2QX0A 4L75A 4F25A 2NXCA 3CEDA 4LSNB 5KFNA 2FHKA 4JV5F 2ASJA 1BQMA 4KIAA 1GMWA 3VAGA 1TL7B 5H9FK 3MR3A 4XDCA 2FJEB 4HT5A 4YB7A 1RBOB 2QYGA 2LP4A 3O8WA 2WONB 2OPPA 5DZ6A 3IGVA 4WPAA 2HHUA 2F65A 5GMDA 4JI7J 2IC3A 4FPRA 4NCGB 4YHHF 4C98A 4MK7A 3DRPB 4KFBB 5KFTA 3GFYA 1ZZFA 1RLCL 3CCZA 1VQPS 3N6LA 4OYAA 3QWUA 2QLBB 2KRRA 2IA6A 3KNAA 3OFEA 2DR9A 5AXNA 1TR0A 3PX0A 2RILA 3H2LA 3PJWA 4TY8B 1AZSA 3CCTA 4KH0B 4Y2CA 2BE7D 2BR0A 3JQKA 2OPQB 1Y5IB 1EX8A 1YKWA 2Y0BB 1FX2A 5KFAA 4HHJA 3T1AA 1TKTB 3VAFA 4RUAA 5DS7A 1KP6A 4WK3A 4FXVA 1MU2A 2XC9A 2DY1A 2AYEA 5A76A 1L3TA 2J0XA 4LF9F 4FNIA 3DHWC 4DR3F 3OLBA 1NDPA 2MGZB 5D4LA 3Q8VA 3PG9A 1F2HA 1VRUB 3EVWA 3W62A 2HYIB 3FSIA 3OFHA 3PDNA 4B3MJ 3KNGA 2UUAJ 1JNZB 1H74A 3GE9A 3F41A 1VDHA 3UCUP 2C3YA 3CCLS 2MB0B 3KDNA 3TX8A 4RJVA 3H20A 1KNZA 1HHQA 3HVRA 3KLHA 1R43A 1X5TA 3MTKA 4H4MA 4DV1F 3CJKB 1XTZA 1NRKA 4ZP7A 3KJQB 2NYIA 1KONA 2PT0A 4DX5A 1NB2A 1WELA 1LWXA 2R42A 3W8GA 2E29A 5E3CA 2YX1A 3Q8PB 3CJ0A 4ID5A 1U49A 3K8WA 2FJVA 3NAHA 3WDOA 3GCWP 3WX4A 4NLVA 1JK9B 3ISNC 4RW9A 4CLKA 1PJ5A 3SSRA 1SV5A 2EFVA 1UKUA 2WCXA 4LJMA 2BRLA 1Q8LA 4X64F 3UVJB 1CJUB 2CZ4A 5CYQA 2CJBA 2QO3A 3DYAA 3MM8A 1LK7A 4NLPA 3QJJA 3GFXA 1R27B 4ILMA 2M9KA 1R3NA 2M4MA 2CVIA 3CJTA 4JI5F 2OPRB 3DU5A 3KUEA 3OSNA 2JRSA 3JXOA 4UY8T 1X9SA 3KTQA 5J2QB 4KYZA 3KLFA 1IBMJ 3PFEA 4WP9A 4QWCA 1N32J 2RAQA 4JP8A 1VHFA 3FSXA 1YX2A 2XZWA 1HNIB 2HFVA 4UT4A 3M2UA 1IXKA 3KK2A 3M2VB 2BJDA 4MT1A 4DV0J 2FLOA 3MMBA 5HAOA 3T9ZA 1NAQA 2KZZA 4MK8A 2J0WA 2MZTA 1XIQA 3PW5A 1UWAA 3C2PA 3MEEA 3PZPA 3NCPA 2NZ4A 5J2NB 1F3FA 1OQ6A 2FC8A 2YWGA 4X4NA 3O2IA 1VQ9S 1YDLA 1X4FA 2LYVA 2NXEA 4QOTA 1DTQA 1VC5A 2IM2A 1GX6A 1Q7LB 1H7XA 2FPHX 2W9BA 2YKMB 5MLCV 4OX9F 2H1YA 4I56A 3QLHA 3F56A 2UVVA 1Q86T 2O5DA 4X66J 3TQ1A 1C4AA 2RH3A 4KAIA 3SQOP 2HVHA 2GVDA 2ZNYA 1RAJA 4FN5A 1WTBA 3SMZA 3BO4A 1GMUA 3R7NB 3AD9C 3KK1B 4LFBF 2WVEA 3TW0A 3M6VA 4LSNA 4AE5A 1TL7A 1NSPA 2RU3A 1NLKL 2GV1A 4A8OA 1AB8A 2WONA 2L9DA 1VQ7S 4ED4A 1HI0P 3AA9A 4NCGA 4XK8C 5H9EK 3WC2A 3ENQA 2ZZNA 3DRPA 4KFBA 3G82B 2QSWA 4IOCQ 3DM2B 3G6VA 5KFFA 3NEKA 1CLFA 3DMJB 1SCJB 2ZH8A 2DXDA 1NMEB 3KYLA 3IWXA 1YK9A 3N9UC 3ILJA 4WXOA 3OFFA 2V9KA 2NUUG 3OD2A 2IJRA 2EG2A 4TY8A 2ROPA 4ALZA 1S1XB 2OPQA 1HWJA 3FFIB 1BLUA 4J91A 5KT7A 5E3QA 1TKTA 5HMXA 4B3OB 2MQMA 4YFUA 4U7UD 2H51B 1Y11A 3U27A 2MGZA 3R5JB 3UNYA 3K8VA 1IR0A 1VRUA 2XYPB 1T9YA 3B4MA 1N5YB 3CULA 4GC7A 1HW8A 4CIOA 1XERA 4PQUB 1YZ7A 1GT8A 2DK2A 1ZS6A 4M5MA 2ZHAA 3D0GE 4C7QA 1F3VA 5A8KB 3C6UB 4DS4A 1UFWA 4CDIA 4LBPA 3VAKA 4CO5A 1KLNA 2DT9A 4LSLB 1JJ4A 2R7VA 4K8RA 3G6ES 4K5SA 4ECRA 4RO0A 3CJKA 1KOHA 1DAXA 2JVRA 3MI7X 3QNWB 1WC3A 2CPZA 2WZ1A 1TK0A 4LF2A 2KVIA 1P6TA 5AE2A 1RWPB 1T11A 3VAMA 3TWZA 3ZTRA 1AYEA 2U1AA 1IBKF 2J0SD 4FNHA 2FB0A 3NNCA 2GX8A 3G6YA 4HI1A 2M52A 3E01B 1RT2B 2VF3A 4WZMA 1FWKA 5KTQA 3DC2A 4ZN1A 5KFJA 3AODA 4QJVA 2E5GA 2B5JA 1NPKA 4YP3A 4GRSA 4C8YA 1YG0A 3UVJA 5HMWA 1J5EJ 2ADCA 1CJUA 2OFHX 4AUKA 1U2FA 3CC7S 1WOOA 2H5IB 4E2FB 3BN7A 2B3TB 3GYGA 2Q3PA 4K4SA 1I51B 3G8QA 4DLEA 5D15A 4WBFA 4OZNA 5C2CA 3RBXA 1HMVB 4G1QB 2OPRA 3MPDA 1QAJA 2V2QA 1FESA 2LQ8A 1H73A 1DARA 1MN9A 1IKVA 4CRJA 4IR1A 1IKWB 1L5UA 5J2QA 1IKXB 4ZN3A 1RHJB 3MUVP 4OJGA 4ELTA 4DZ6A 2O1PA 1S4FA 2ZBPA 1HNIA 3BB5A 2V8GA 1I94J 4B9LA 4KRWA 3RUBL 2UXDJ 3HHLB 4ECUA 2KT3A 3A1YG 3NS5A 2A6MA 2YPYA 4QR2A 1HHTP 4CQ1A 2FZKB 2E9ZA 4F3QA 2OLWA 3QGPA 1WC0A 1VK8A 2CJ9A 3K0JA 3MCOA 5J2NA 2BKPA 6AT1B 5C25B 2KI2A 3J7ZT 1YSJA 1RQ0A 5BYSA 3HT3A 4LQ9A 4LRFA 4EYHB 5KG1A 5K5MA 1CC8A 1HWIA 3CIZA 4P2FA 4CI0B 1UPPA 1N4LA 3NP5A 2OD6A 3KG1A 3QT7A 1NK6A 1CC7A 3VV2B 2XI2A 3QIPB 2RHQB 2VFVA 2BJ3A 2LEBA 3BSOA 5FJ4A 3T5KA 4X4RA 3UCZP 2MQNA 2W24A 1NJIT 3OW2R 1X4HA 3AQOA 1WD6A 2BX6A 2M7SA 4KE5A 2NXNA 1JLAB 4DLGA 1RADB 4Y00A 1UMJA 1Q4RA 4OI0A 1RWVB 2J9DE 1I6JA 3KK1A 4ZIWA 3W1YC 3DLHA 3M6UA 3Q22A 1UVNA 3ZXWA 1QTMA 2NLWA 1E6YB 3UN5A 5GAHI 4ZPVR 1I1GA 4DL0C 2QL9B 4A8MP 2HHQA 2LQBA 2DNKA 3IR5B 1HBNB 5D4NA 3NGUA 2LCWA 1KSPA 2QLXA 4NWBA 4K59A 4QPTA 4K4YA 3G71S 1Y0HA 3G82A 2VBYA 3DM2A 3LTOA 4DL3A 4TVAB 1OIAA 3POTB 3DMJA 2XYHB 4ZOSA 3HVTB 4H54A 2XMJA 5ETKA 1CS4A 1PJ6A 3IR6B 1XMBA 2IBKA 4D3GA 1H72C 2COLA 3BF4A 1VQOS 3ZO7A 2RKIB 2E5JA 2QC3A 1HA1A 4PXCA 1PYSB 1JLEB 4ES3A 3LAKA 1HNVB 1S1XA 1SJQA 2XNRA 5ETSA 3MFIA 1IR1A 4CO4A 2KU7A 3MPVA 4E0DA 4IG0B 4DV3J 4YN3B 2A2CA 3ZZUA 3H25A 4B3OA 2VJUA 3US5A 2YVSA 2DR8A 2CJAA 3QIDA 1T05B 3RB0A 2UVUA 4RW7A 5E3RA 2CPHA 2RT3A 1S57A 4ENOA 4ZPCA 4YR0A 3TA2A 3HJFA 1X4AA 1XBWA 1N5YA 2NSCA 4XAKA 5MAOA 4DV5F 5LSOA 4YDDB 2OEMA 1U25A 4PRFA 1XMQF 1SKUB 3IXQA 4DUZJ 1XMOF 5A8KA 3C6UA 3CIMA 4GKKF 4I2QB 2H4WB 4LSLA 2CQ4A 3OSPA 4NXNF 2PI5A 4USMA 3IP0A 2ATCB 1RYSA 2GZOA 4NLQA 1LOUA 1KDNA 1QSYA 4WE1B 2KO1A 1YJNS 3C3LA 4KO0B 3T41A 2YX7A 4JYAJ 4CLSA 4DV7J 4DPUA 3CXCR 2JEGA 5KFVA 2DR6A 1EKRA 1PKUA 2DB1A 1HR0F 3L7PA 4YR2A 2KB2A 3H90A 3E01A 4P73A 1RT2A 2LEAA 2C2DA 1KQSR 3PM9A 4DV5J 2DGXA 1TAUA 4HHHA 4WCEQ 2V34A 5H9FJ 5RUBA 2MKHA 3OTBA 3U1MA 3V5RA 3AD7C 2J6TA 1S6OA 2J9EA 5F9LA 2MYFA 1N56A 2VBXA 4DN0A 1NZ8A 3CDWA 1ZBTA 8ATCB 1JXVA 3PR4A 4OHVA 1QSLA 3VALA 4PPZA 1HMVA 2HQDA 4G1QA 4HYKA 3MEGA 2Z2MA 3O5TB 4FKXA 2DKOB 2HURA 1SXLA 3I6PA 1GH8A 2EBGA 1IKWA 3GJSB 1IKXA 5GAEU 2XS2A 3W2WB 1SKSA 3HVAA 3MD1A 4TLQA 5AE3A 3QSIA 2B7BB 4X62J 4AT1B 2DO4A 4XIUA 2N4DA 2VUGA 4ECTA 2AQ4A 3HHLA 1A7GE 3PV8A 3TAPA 4DPOA 1EP4B 1U8WA 2G2YA 2C2NA 5CAAA 3JSMA 2QTWA 2ZDPA 1P9QC 4PG5A 3W8PA 4L3KA 1Q95G 1Q82T 1DBDA 4WZQA 3HP6A 1BE4A 5DG7A 4JI2F 1VYAA 5C25A 1GXLA 3KHRA 4ECQA 3MM7B 4AQYF 4AFFA 3ILLA 2FJDB 1RP5A 2IM0A 3GIRA 5LOQA 5KFRA 1R31A 3Q89A 5KOXA 2AX0A 2XTJP 5GVQA 3PJ9A 5ETVA 3GYXB 2R7UA 5LJ5Y 4J7CA 3UD5A 2POKA 5FD1A 2BQUA 4IDKB 2HHXA 1TKDA 3RW7A 2YNGB 2FJBB 1MN7A 1JLAA 4C4WA 1YBUA 4MYUA 3MAAB 2W7PA 2E7XA 1WF0A 5DM7Q 4B3SF 2AYMA 4Y2AA 2NYHA 2QZ8A 2F4VJ 1RAEB 4URSA 1RDRA 1XC9A 2E5LJ 1ZTTA 1NKCA 2VC0A 3CCQS 1MROA 3LWLA 3PCOB 4A48A 4TQSA 1GMWD 1E6YA 4BBYA 5K8OA 4X65F 3KUGA 1HLWA 4WWSA 1YJUA 1FDBA 3EPGA 4JI0F 1ZM2A 1HBNA 2EPIA 1LWFB 1SL0A 5LM7E 3D0IE 5E3AA 2XWXA 1HL6A 1YVFA 2P9CA 2CAJA 3POTA 2QFIA 1UA1A 2DHGA 5CD4H 4ZPAA 2ZJQQ 1SUQB 4DUYJ 2DNYA 2K1RB 4IUFA 5CH7B 2MZQA 3AJDA 3JQJA 2R2UA 3NCRA 3NNHA 2RKIA 5K14B 3MOZA 1TKZB 2CPDA 1NSQA 2HK3A 1JLEA 1HNVA 3K58A 4PG7A 5B0AA 3DI6B 4IG0A 2J7UA 3GU0A 2E7VA 4ZVFA 4DUTA 4QR1A 4B3RF 7FDRA 1T05A 4CZCA 3HCXA 1HNWJ 1VC0A 4N56A 2HPUA 2YWHA 4OI2A 2ERRA 2HFSA 2MJUA 4I69A 2W9AA 5LSRA 1ZAXA 1RAFB 4DR2F 2SXLA 4P10A 4UOGA 5E7OB 3CJ2A 1LXNA 2N3OA 2M70A 1N48A 4KTQA 2DR5A 3J7YU 5IQ6A 4RW4B 4IH7A 4F4KA 2HRYA 3X3UA 5F8NA 5B0BA 4I2QA 4LF4F 1D0EA 2UUBJ 5HL7Q 3JTPA 1IWAA 3FRYA 2RVJA 3TNVA 1Z4UA 1B7YB 3CD5A 3OL9A 1HQEB 3MD3A 2YKQA 3E8OA 2HNYB 2F3JA 4U9RA 1U7LA 3JTNA 3Q8QB 3CO0P 4DSIA 4NASA 1RBAA 4HDGA 4WE1A 3PRDA 3PR5B 4KO0A 2DRBA 2AHOB 2EKNA 2UUTA 1X5OA 3ETMA 2ATLA 4G65A 1S10A 2RB7A 3OR2B 2R7WA 3ISZA 2FTRA 5J2MB 3RB4A 2XS7A 5ETQA 2JHEA 2C42A 2YQ1A 2Y3YA 2YNHB 1BXNA 1WG1A 2UV8G 2XMUA 4CYUB 5F0WA 5H9EJ 3ZZTA 4GC6A 1HBMB 1N36F 2DCUB 1KRPA 2IJNA 3R27A 1Q16B 3CCSS 5IWAJ 4YB6A 3K5OA 2KXHA 2XMKA 2D3ZA 3IAS9 3W2WA 4ZCLA 3W61A 2HQGA 3GIIA 2ZDOA 2J7KA 2BDPA 3NY0A 1RWMB 3UQSA 1HD1A 1WI8A 2FUG9 1S97A 1GXUA 2V2VA 1N6QB 4K4TA 2DITA 2YH0A 2ZOGA 3FVYA 5KFCA 4N41A 5KG0A 3UI3A 4RBUA 2I2YA 2R7RA 3E2EA 1O0PA 4W92B 1EP4A 1X9MA 3DRRB 1FKAF 4OYWA 5JVGQ 1GQEA 1YI2S 1NK0A 2HGLA 3N0VA 1N34F 3K5PA 4RW6B 2X3GA 4OI6A 2R4FA 3LALA 2CZ9A 1SJFA 3G86A 3MM7A 1KVJA 2UXBJ 3CSKA 2BYCA 1VFJA 2HVDA 1M1GA 4B9VA 4DF4A 5HMZA 4PR6A 3CD7A 1PAEX 2KVQE 3W9JA 3VZHA 2V94A 4ZLPA 4P9SA 1Q81T 2QMXA 4FF4A 1G4CA 2QN6B 1UVIA 3CCWA 4QIFA 1X9WA 4IDKA 2HHVA 1B70B 3JYTB 1TAQA 4G1IA 4RW8B 3C16B 2YNGA 1NK5A 5J1EB 2RQ4A 2QE5A 2AIRB 2V4QA 2OKQA 4PWDB 2LQ9A 4Q0BB 3MAAA 2RUGA 4ZVRB 5KFGA 1TMJA 1EQMA 3PW4A 2R7QA 3C6TB 3HHEA 5KG7A 3R5DA 5LSLA 4LBIA 2QA2A 1HHSA 2RU9A 3QO9B 1YZ6A 4P7TA 4DV4J 2XY5A 3KJFB 2D41A 3LP2A 5L38A 4YDXA 1LFPA 2A2DA 1GNKA 5IXUA 1S0NA 1LWFA 4PZVA 2ZJRQ 3CJ5A 2HVEA 4N77A 4ZVTB 1QVGR 4M5NA 1PCAA 4FYVB 4K7QA 1PC5A 2VICA 4Y34A 4DR4J 2DRAA 3QPIA 3OTEA 3CD0A 2ZZMA 4U7CA 2IVYA 3OBIA 4ZA1A 2FYXA 1SUQA 4ZMMA 2K1RA 4YS2A 3ETOA 5K14A 1RHQB 1DLOB 2RD5C 2RS2A 4DHVA 4ECVA 4LFAF 3GV5B 1TKZA 2YPZA 4NLXA 4F4ZA 2MQLA 1JLFB 4OHYA 4YB5A 2H9ZA 4FBTA 3TUJC 3FK4A 3P3DA 3DI6A 1P1TA 4AYBD 1N33J 2BEFA 1CEZA 3MPYA 1Q5YA 4Z37A 2B0GA 3H2UB 2W2OP 4Y0FA 5KT2A 2CQ0A 1U45A 1R8BA 1X5SA 2WVCA 4ANDA 3LW5C 1RT4B 1C4CA 2HHHJ 3IBFB 2GJ2A 2C2ZB 3S1TA 3H59A 1QE1B 2KJVA 4XPEA 1BY9A 3BBBA 3Q8YA 1ZM4A 3D6TB 1PJ7A 5ETRA 5CHCB 2RQMA 1EETB 3SFGA 2VFSA 2MTLA 4RW4A 4CM2A 4DG1A 3Q24A 1A6LA 3QRQA 1HQUB 1NJXA 1UFKA 2L48A 2GVZB 4ZDNA 1NJWA 1L3VA 3IA0A 1HQEA 1FI4A 2HNYA 1IBLF 1HPZB 3GCXP 1R8AA 5CQGA 5KFIA 1CJTB 3FMBA 3HSJA 3M8ZA 1UJ5A 2NR0A 3BBFA 2CPJA 3MR6A 3CMAS 4P7VA 2HW3A 4QYRA 2XMVA 3M9MB 3KJNB 2KH9A 3OR2A 1RT3B 4P72A 3LH2S 2QLWA 4C11B 5J2MA 2WK4A 4BS2A 5IM0B 4M5HA 3QRRA 2OO4A 5I42B 3JSRA 2KM8C 5THWA 4DQQA 4ETZA 2KT2A 3DLKB 1G6BA 4L73A 2YNHA 2HZVA 2H5EA 2C2MB 2Z56B 4EO8A 5DDOC 3A3NB 2KRBA 4OJ1A 4CYUA 4IH5A 4JI6F 3IFEA 1HBMA 1YJTA 3EZ5A 2JEJA 1LW2B 3TZZA 4O3RA 1NO8A 3IAM9 4OHWA 4F2SA 2HEKA 3G8SA 2MDAA 5F3ZA 2XLIA 1HNZJ 4C8ZA 2BBEA 4LRDA 1ZPWX 2DEJA 4WTYA 2AEFA 3AXKA 3MUMP 4JI3J 2XZDB 1N6QA 3E3XA 4A8XA 1PG5B 4QPXA 1TZ0A 5KFMA 3OHAA 4P75A 1Q8KA 1DQ8A 1EJ7L 1VBYA 1M5VC 2R8JA 4ANCA 1MSWD 1WC4A 3MR7A 1JJHA 4WFBQ 4WIIA 3DRRA 3R1HA 5KT6A 3PX4A
chains in the Genus database with same CATH topology
3PKMA 5DO2A 1MWYA 2CQIA 4IO1A 1YWXA 3ZZ0A 3F56A 4ICLB 4Y2KA 2UVVA 3N6NA 4C8KA 2MSTA 1HBUB 2O5DA 2VG7A 1Q86T 3TQ1A 1VQ4S 1OQ3A 5KG2A 4DQIA 1FHTA 5DDQC 1SIZA 1KHWA 1C4AA 2ZKUA 3BR8A 2RH3A 1N0VC 3F44A 5KFXA 1XN9A 3WC0A 1H3DA 3L95X 4KAIA 4DFMA 2R2TA 4ECWA 2HVHA 3SI8A 1L3UA 3HXMA 2VODA 3Q2TC 2AJ4A 5HO4A 1ZAVA 4KT0C 5L1KA 1D8YA 2ZNYA 1JXEA 3H98A 3KG0A 1RAJA 5LMUF 3MMCB 4FN5A 1WTBA 3JSBA 3SMZA 1FD2A 2FVRA 3BO4A 2LXUA 4F2RA 3MECB 5CYJA 2VBWA 3KK1B 4LFBF 5BYRA 3U02A 2Y1IA 2E5HA 4HTIA 1KTQA 4X84A 5T7LA 4K4WA 2CJKA 5I3UB 1CVJA 4WFNQ 3TW0A 4FYDA 1FVSA 2OPSA 2ZH6A 1P8GA 1K0TA 3MPWA 3NLCA 4DL5A 1Y7PA 3KLGB 1Q1KA 3M6VA 4LSNA 4LVOP 1VC6A 1H7WA 3NGDA 2OH2A 1F5AA 4TYBA 4NLUA 3SSQA 2UXBF 4AE5A 4I7FB 3TOQA 5KFKA 2ILZA 2RU3A 2WSEC 2GV1A 3D1QA 4A8OA 4RW8A 1S77D 2NS1B 5J1EA 4ZCKA 2V4JA 5F8IA 1D3WA 2RQKA 4PWDA 2WONA 1Z2LA 1N5TA 4Q0BA 1FRJA 1RWUA 1QSSA 3MUTP 4ECZA 4DR7F 2L9DA 3IN5A 3KHHA 2I1RA 2ZH7A 5LT5A 4OX7A 2JSXA 1VQ7S 1WG5A 1UVKA 3AA9A 3JAMY 1HI0P 3OLAA 3C6TA 4NCGA 4XK8C 5KFYA 3KK3B 5D78A 5J2PA 3SYZA 3WC2A 1YJRA 3ENQA 4EGLA 2ZZNA 3EXYA 3DRPA 4KFBA 4KPYA 3M05A 2QSWA 4X4PA 3PW0A 3ENWA 3DM2B 3P96A 3ULHA 1HWKA 5A6PA 4IOCQ 2B56A 5IS2A 4YY3F 3G6VA 5L9XA 5KFFA 3QO9A 1CLFA 2F9DA 2HHPA 3DMJB 4EZ9A 2PD1A 3RYLA 1RTDB 2ZOFA 1H2UX 1V3RA 2DCLA 2K2PA 3BSCA 4CH0S 3VCDA 5A0YA 2ZH8A 3GIKA 3X1LB 4Q2MA 4I4BA 1S1TA 1F60B 1TQLA 1IJEB 4KGMA 3KYLA 4IOBA 1T03B 3IWXA 2VONA 1Z2ZA 4HH1A 3N9UC 1FJ7A 2ROGA 1QUPA 4WXOA 4JI7F 1RT5A 1N52B 1L3SA 2YQ3A 3OFFA 4H4OB 2V9KA 2NUUG 4A8WA 2W4DA 4BC7A 1IQZA 3I96A 3ZZOA 2JLFA 2O66A 2XY7A 3DXBA 1NJYA 2EG2A 2JZ5A 3C66A 3CGIA 2NPIA 2CRLA 4Q8EA 3I56S 4TY8A 1G2EA 2ROPA 4ALZA 3M1VA 4P2SA 3M2RB 4Y3CA 1S1XB 2GGPB 3V6HA 2QMWA 3AQPA 1WWHA 2OPQA 2B4UA 4QU7A 1HWJA 4DV4F 3UDCA 3FFIB 3LOUA 3TVZA 1GAOA 1BLUA 2YTCA 2KN4A 3HDSA 3W7BA 1F5CA 1R8CA 5KT7A 2LQJA 5B0CA 2CQGA 2XGQA 2B9XA 1YBAA 5E3QA 1TKTA 5HMXA 4OJHA 4B3OB 2GJIA 1MW7A 4QWBA 1RT6B 2E5IA 3MHYA 2B7CB 2ASYA 4J9RA 3M8SA 2MQMA 2HFZA 4F02A 2OD4A 4YFUA 1KFSA 3MR5A 4JYAF 1KLMB 4UOCA 1CPZA 3U27A 2EC0A 1TL1B 4N8NA 2MGZA 1RK8A 3HKZD 2XCAA 1Y3KA 4FP9A 3DOLB 2M0GB 3SV4A 3FDSA 2OIHA 1HYSA 1JWWA 2Q79A 2M2BA 2DH7A 3K8VA 4MMOA 1AFIA 1IR0A 1DLOA 1LFWA 1Q8IA 1VRUA 1KOOA 2K7JA 2CPXA 3R1LA 1X4EA 4DSKA 4DR4F 1WACA 1JLGB 3BGRB 1U1MA 2ASDA 1JLFA 3B4MA 5EWGA 4ZHRB 1N5YB 5A6WA 4HVZA 4Q7AA 5C42B 3CULA 4GC7A 1HW8A 3KLIA 4CIOA 1NK7A 3DRXA 1OPZA 1XERA 2LA6A 4TY9A 1UW4A 2R2SA 2YNIA 5D8HB 4PQUB 4R25A 1XK8A 2CQ2A 3HLUA 2DNNA 3FGVA 1GT8A 1RTHA 2DK2A 2OTJS 2ZHAA 3D0GE 2A1BA 4C7QA 1U1KA 4ZKAA 3DLGB 5IZHA 3KJVB 3TARA 1DFDA 3LF0A 5A8KB 5DQIA 1K1QA 3C6UB 4DS4A 1F0XA 1UFWA 3ENVA 1LWCA 1XEZA 2XMTA 3VAKA 3M6WA 3G9CA 4CO5A 3NMAA 1KLNA 2W7AA 2CG4A 3QZ7A 1UJ6A 2DT9A 5F3TA 2ZBCA 4G1PA 4LSLB 1JJ4A 1FK9B 3T6BA 3N6MA 2R7VA 2Y1JA 1S6UA 2RSQA 3G6ES 4NLDA 4JV1A 2BABA 2ROEA 2HWHA 2MKJA 5DDRC 1QE1A 1MNEA 4BDPA 1VBZA 2D3OR 4B3MF 4PG6A 4E98A 2ZD1A 3LGNA 4K5SA 2BM1A 1S6QB 3H5YA 3ITHB 2W8LA 4ECRA 3THVA 3B4DA 4YMEA 4CH1A 4QIGA 2KG1A 1M5SA 2QA1A 1FNMA 1KOHA 3I4HX 3CJKA 4TU7A 2UUAF 4QCLA 1N33F 1DAXA 3UCGA 4GO5X 1SJRA 2CPYA 2JVRA 3MMAA 2B9WA 3MI7X 4ZPBA 5E0OA 1EETA 1S1UA 3CDUA 3PEJA 1U1QA 5K8NA 3BGLA 4KR0B 5GAHU 3K57A 2CPZA 2YWEA 3M6XA 1YGYA 3GFHA 4NZ7A 1TK0A 6FD1A 2KVIA 2DH9A 5EWFA 4IKAA 2EWHA 2WAQD 2IMWP 1TUVA 1T95A 1P6TA 1NK4A 5AE2A 1OSCA 4J9QA 1SC6A 2J5AA 2AV5A 3VAMA 4B9SA 3DCAA 5D4PA 4R0JA 4PG8A 2HHHF 2U1AA 1IBKF 2J0SD 4FNHA 2DPIA 2FB0A 4NLSA 1NK8A 4A8SA 5KFEA 3NNCA 3PIPQ 2GX8A 3MURP 1HQUA 3G6YA 4HI1A 3QZ8A 4WFZA 2M52A 3DU6A 5KG6A 3E01B 4LF6F 1ELOA 1RT2B 3DDNA 1IN0A 2C2EA 4IR9A 3I0SB 3H5SA 4WZMA 5KTQA 3DC2A 3M30B 4NYZA 2FD2A 3IRXA 2XBPA 2WSFC 2YH1A 1LV5A 4FBUA 1K1SA 5KFJA 2J0QD 4HI2A 1LWEB 4I6WA 2WBRA 4DDFA 3P49B 3W2VB 1J5OA 4IQXA 4QJVA 3HPOA 1HPZA 2KHCA 2E5GA 2B5JA 2HFOA 4YP3A 2R7XA 1RT1B 4ZS6A 2ZVSA 4C8YA 2NQPA 4O3QA 1YG0A 3RAMA 5HMWA 2ADCA 2J6SA 4AUKA 2OFHX 1U2FA 2E44A 3TO8A 3CC7S 1SQEA 1JLBB 1FJCA 3M32A 2PSZA 3OL8A 3BN7A 4FVMA 5AXMA 3G4SS 3PVXA 3V2UC 5B7WA 2B3TB 3V6KA 1VBXA 3LUYA 1OWXA 2KDOA 3BQ0A 4J37A 2DIVA 2G13A 5E3PA 4DL7A 5F8HA 2Q3PA 4WJBA 5CA5A 3KHLA 1VIOA 4RNFA 4UQGA 4K4SA 1VQ6S 2O3DA 3G8QA 4DLEA 4I6YA 5DQHA 3R5BA 2XB2D 2ILYA 4OZNA 1SH3A 3I31A 1HMVB 4G1QB 3FEXB 5KT3A 2OPRA 3HFKA 2VG5B 2WOMA 1QAJA 4K50A 1S1WB 3FZ2A 1FESA 2R2RA 2BANB 4F50A 1RT3A 5A8WA 1SL1A 4FS1A 1YRXA 1FA0A 1DARA 4C11A 1IKVA 5J1NA 5I4MA 4IR1A 1IKWB 2M5YA 4MYTA 3GYNA 4CNZA 2G9OA 5J2QA 1L5UA 5IM0A 5EN1A 3D28A 1UWBB 1IKXB 1FXDA 3ZZRA 4YB1P 4LIRA 5U47A 2PFFB 5DRKA 1TK5A 5I42A 1QLNA 4CO1A 4I2PA 1ZPVA 3MUVP 3PKYA 3LAMA 4OJGA 4TU9A 1HBOB 4ELTA 3AAWB 2O1PA 3DLKA 2HGNA 1XR5A 4N47A 1S4FA 2BM0A 2JH3A 1C0UA 3MDFA 1HNIA 1BQNB </