5AJ3F

Structure of the small subunit of the mammalian mitoribosome
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
123
structure length
123
Chain Sequence
PRYELALILKAMQRPETAAALKRTLEALMDRGAVVRNLENLGERMLPYKISAHNQRHSRGGYFLVDFYAPATTVESMMEHLSRDIDVIRPNIVKHPLTQEVKECEGIVPVPLEEKLYSTKKRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITORIBOSOMAL 12S RRNA
publication title Ribosome. The complete structure of the 55S mammalian mitochondrial ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 18
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2015-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5aj3F00
1N33F 1IJEB 4DR7F 1IBMF 2J5AA 5LMUF 1FJGF 5LMNF 1IJFB 2UXCF 1HR0F 1XMQF 4DV2F 4OX9F 2B7BB 2RJZA 4X66F 4DR1F 1J5EF 1N34F 4DR5F 4DUYF 2KJWA 4DV6F 4LFAF 2HHHF 4JYAF 4DR3F 2UU9F 4X64F 4DV4F 1IBKF 2UUBF 3T1YF 4DUZF 4LFBF 2YY3A 4JV5F 4JI4F 4JI0F 4GKKF 1HNWF 4DR4F 2UXBF 4NXNF 2KJVA 4X62F 4JI6F 4YY3F 4B3SF 4LF7F 4DV3F 1LOUA 4JI5F 4LFCF 1IBLF 1G1XA 4DV5F 5AJ3F 4KHPF 4JI1F 1HNXF 4YHHF 4X65F 5IWAF 4B3MF 1XNQF 2E5LF 4DR6F 1GH8A 1VMBA 4JI3F 4DR2F 4LF8F 1N32F 4DV1F 2UXDF 2ZM6F 2UUCF 2BVZA 4AQYF 1HNZF 4JI7F 1QJHA 3OTOF 1F60B 4JI8F 1XMOF 4LF9F 4LF5F 1G7CB 1RISA 1CQMA 4DV7F 2UUAF 1I94F 4B3RF 4K0KF 3T1HF 4NXMF 1B64A 3ZZPA 4LF6F 2VQFF 1N36F 2VQEF 1XNRF 4JI2F 3R3TA 2B7CB 1FKAF 4B3TF 1CQNA 4DV0F 5BR8F 4LF4F 4GKJF 2F4VF 2BXJA
chains in the Genus database with same CATH superfamily
4OIXA 4LMZA 5K14B 5LM7E 2H5JB 2JVRA 4E8UA 1H0HB 3NWRA 4USJC 4DCOB 1W25A 2VA3A 3PFEA 5D8HB 4F2SA 2JOQA 2C2OB 1C2PA 1F5BA 4QQBA 4O4GA 4GRSA 4O44B 5CQGA 3EM1A 3KHRA 2QRRA 1LOUA 1UEKA 2BRKA 1EKSA 4RUAA 3RTVA 2L48A 2E1CA 4QIVA 2HURA 1CG2A 1NDPA 1N8RT 1RTDB 2XWXA 4FKYA 3GV5B 3R5GA 3OTDA 1OY6A 2PI5A 2B9XA 1C1BB 4NI2A 2YWWA 3UE2A 4GKJJ 2HZAA 1WHXA 4FYWB 1BE4A 2HFVA 1HHQA 3DLKA 3K17A 3UR0A 4DPYA 4CTAA 2BJ3A 3D9BA 4RWWA 5D0EA 3MXHP 5IT9Y 1WOOA 1TELA 2V6AA 3MM5A 2A6OA 1X4FA 2YNFB 1UL3A 3GSDA 2DGXA 1YJWS 4EEYA 5DGBA 1S72S 2OD6A 1S1VB 2W8KA 3G8QA 4DFKA 2W9BB 4OYXA 3KHGA 1KN6A 2EPIA 2UXBF 4JI3J 3MPDA 2HHUA 2YKQA 3SDEA 1QVGR 3D68A 2E5IA 1NHVA 1OQ3A 3CJ8A 4FYXB 4DLGA 5K8OA 2XCPA 3G2XA 4J9NA 1VOMA 5IQ6A 3K8WA 1YTYA 4YHHF 1NHKL 3CDUA 5F3ZA 5KFJA 3PW5A 3MMBB 4ZVGA 1RGVA 2CJKA 2POKA 1HI8A 4MKVA 2HK3A 5F8JA 3GV7B 1XMOJ 4RZRA 1SH2A 1NB2A 1RT6A 1JKHB 3HHLD 3DN9A 3PYEA 2HYIB 3M6XA 5DQIA 2BM1A 1RUSA 4ED5A 2HEKA 3ZZUA 2R42A 4C11B 4KQZA 5K20B 2F65A 3H20A 3MOJB 1F6TA 2ZWOA 4ZCIA 3V4MA 1HD1A 1IJFB 4Q8EA 1IKYA 5L46A 4NPOA 5KG6A 2C2EA 4NLPA 4U7UD 4FPIA 1T8EA 2MQMA 3M8PA 5IQQA 1BQXA 5KT2A 1RWKB 2IAJA 3N5BA 4KTQA 1RK8A 2VL1A 1EQMA 2MEWA 2WTFA 4I7FA 3PHEA 3PX6A 4PAAA 4DXLA 4DV5F 1P1TA 1SQGA 4R25A 3ZZ0A 2HFSA 5CYQA 5H1SV 3GONA 3CWJA 4W92B 4LIRA 1VMBA 1QAIA 2VFUA 2ZM6J 1VGYA 1BQMB 4B3OB 2Z57B 5DZ6A 5HATA 5A0YB 2GCFA 2KVIA 2V68A 3DOKA 2HHTA 4QWBA 2VG7B 2Q43A 1E6VA 1URRA 1A0OB 2BE9B 1EHWA 3N0VA 2VHGA 1KFSA 4OI4A 3W62A 2K7KA 3KK3B 1S9EB 2HNZB 5B0DA 3QT5A 4QR2A 4HT5A 2IBKA 3B6BA 2IVMA 3NGUA 4ZP8A 3MMAB 1VQSA 1RAGB 5E2QA 1RAJA 4O23A 2NZCA 2D74B 3D3BJ 4LRFA 4DQPA 1MN7A 4X65J 4J9KA 2HHSA 4DUZJ 2FJDB 4ZVRB 4CO5A 1NUEA 2DNGA 4YDXA 2KN4A 2XMVA 2CXEA 1PC5A 5KFMA 3P49B 5C5JA 2Z56B 3DRPA 4PG4A 1JLAB 4ZDNA 2AJ0A 1VCTA 5J2PB 1MMNA 2ALYB 4F26A 3TEHB 3HHLA 3SFUA 2YKMA 4CH1A 1NRKA 4JI8F 3FQLA 4PG8A 3MUMP 1U6BA 1X5SA 5HP1A 3CPWR 2A18A 2H9ZA 3M6UA 4IH7A 2HBZB 2PC6A 1FHTA 5T14A 4PRFA 2KI2A 2L9WA 1GTEA 1UVLA 1SQFA 2AJ1A 3Q22A 1F9HA 2XB2D 1RAEB 3TUIC 1HWIA 1H38A 4RW8A 3MEDB 3ZZYA 5GAGI 4MJKA 2VPZB 1LWEB 3IO1A 3RRGA 2AGQA 1J5EF 4OV6A 4CH0S 4C3LA 4F67A 4DDFA 3EX7B 3T1AA 1WEZA 4RPFA 1NKEA 1CBKA 3IBWA 1U1PA 2V94A 1KR4A 4ZVFA 4ZOSA 1RHMB 3OFEA 3Q89A 2G0JA 4OJGA 2P9EA 4P2FA 2XSFA 4KPYA 3NMRA 1Y5IB 2QLXA 2UV8G 5F41A 3PJWA 4U7UK 3K2YA 2OEKA 4QWEA 1YRXA 1FXRA 3ITHB 3TAMA 4KY3A 4RNNA 3HK2A 5D0RA 5C2CA 2CPZA 3N79A 5E33A 1D1UA 1GX5A 5KG0A 2LDYA 5E0OA 2NLWA 3TA1A 3ZTQA 2ZBRA 1N6QA 5ADZA 2WSEC 1VRQC 2HS0A 3FEXB 1VJWA 3EYZA 4HKQA 3GQCA 3EDQB 3FMWA 1CJVB 1TKZB 2EFOA 3NS6A 5BJRA 1R27B 1HQUA 3W9HA 1F5AA 1IBLJ 1ZA2B 3LTOA 1RACB 2QG9B 3MR7A 2DR6A 2LQJA 3A3NB 2WBMA 3W66A 5HLFB 2E7XA 1UWBA 5KFIA 3G4SS 1HKAA 1RXOB 3H4DA 4F04B 1F2HA 3BGUA 5G0RA 4Q45A 4YB5A 1U6ZA 1RJJA 2V8VA 1NSKL 3KK2A 1Z4UA 2QA4G 1TKDA 2JRSA 3PTWA 2RE1A 5HI7A 3NOCA 4OJ3A 3BQ0A 2JLFA 1N56A 4IG3B 1FX4A 2H54B 4MIWA 1VQ4S 2E29A 1TAUA 2CYYA 3UCZP 5KG3A 1LWXA 2NYHA 1IBMF 4ZPCA 3US5A 2ZOGA 2W9BA 3VV2B 3HVAA 3UR3C 3MPYA 4QR0A 3TJ8A 2HKEA 3UD4P 1HI0P 1XBWA 4P7VA 3RU0A 5H9FJ 2K2PA 4I1TA 3TJ9A 4DL7A 2IM3A 5KG1A 3CCVS 4GVLA 4A8YA 2R2RA 4RW6A 4DR4J 2VA2A 5KFSA 2DNZA 2AQ4A 2DXDA 1B0VA 1M0SA 3CGIA 2DHAA 1NK0A 2OH2A 4ED7A 3NGDA 3D7SB 4ZVHA 2LU2A 2GMLA 5DG9A 3LGNA 1U2RA 1CJTA 2A0FB 2ZHBA 3J81U 2XCAA 2MHNA 4Y6IA 1I5OB 2AEFA 1NK7A 1U48A 1Q4RA 1L3KA 4A8OA 4ERDA 2ZEJA 3AA8A 5D0GA 4LF9J 3D0IE 1S49A 3GP9A 5HSPA 1GK8A 2V2KA 2HZCA 2VD3A 1TKTA 3H2UB 2M52A 3MI7X 5A8RA 1PYOB 4ZVQB 2YNHB 1IQTA 3VGVA 1X7VA 2FHJD 3OJSA 4PXEA 2HBYB 1H73A 5G4DA 1RI7A 3A12A 4RR5A 9RUBA 1QUVA 4CLSA 1B3TA 3OUYA 2YY3A 2LECA 2AYEA 2AF6A 1VRTB 3GPAA 4R0JA 3PYFA 2E9RX 3HSGA 3SFGA 4HH1A 4RNFA 1MWZA 4KR0B 1TP7A 1JLCB 1R8BA 4DX7A 2QSFA 4RLEA 5IWAJ 3MM6A 1M1HA 3C16A 1NJZA 5E3QA 2UVUA 4WP8A 5M2UA 4Z37A 1S48A 3M9NB 1SIZA 3GMGA 2HNZA 4QJVA 3HT0A 1OY8A 3AOAA 3JAMU 1E6YB 2F3JA 3EZOA 1ZH5A 4EBCA 3FCVA 1IKXB 4DV0F 4QIWD 2XM3A 3KG4A 1SJ4P 3HX9A 1A9NB 5LMUF 5DDPC 1A7GE 3K5OA 2CKWA 2MZSA 3OL7A 4EBEA 1SUQA 4LFBJ 2MKIA 4OZ0A 2DYAA 4HHHA 2B4UA 2GNKA 3IWXA 1NJIT 4YB7A 4OZLA 3V6DB 2J6UA 3H2LA 2ACMA 4X2BA 4LFAF 1JLAA 2HHHF 4U67Q 2M8HA 2UU9J 3RBZA 2XYGB 2LP4A 3FFIA 4DL4A 2D9PA 3L7OA 3KJVB 1U02A 4ZLJA 3HHKA 5KFKA 1PGZA 1YBUA 4PPZA 2HQIA 3V5RA 1P9QC 4OZ5A 1DARA 3IS9B 2CVEA 4K4TA 5CYJA 1YRTA 2DY9A 2HFOA 2CQPA 2UUCF 1FRIA 2QE5A 2ZOFA 3CCJS 4FP9A 4V19J 3V6KA 4OJHA 4N8NA 2LEBA 5J2MB 2KHCA 1LKZA 2NR0A 1RA6A 1T05A 1Q8BA 2CQBA 1NPKA 4ES2A 1JLBB 3NAHA 4GMKA 2XO6A 3MTJA 4B3TF 4B9MA 1S1WA 5H9FK 4RW7B 1FFGB 4AD6A 2LDIA 2LYVA 4B9VA 2LXFA 3DYAA 4LF1A 1JLEA 2RNEA 2N7YA 2ASDA 4ED8A 1U1LA 3UO0A 4NZ7A 1WWHA 2DVIA 4HR2A 4NASA 1KONA 3T1YF 4CLFA 4JV5F 1V6HA 3UQSA 1JLFB 2VZ9A 3G8SA 4WKYA 3HHLC 4FVCA 2HVZA 3RJMB 4WFZA 5DG7A 1T3NA 2HQFA 4J9PA 2YX1A 1VBYA 4F36A 1CJKB 3VQTA 3HMJG 1KQFB 4AE5A 5M2RA 3RAQA 3CJSA 2DPIA 2M4MA 3VVTA 3DOLB 2BJ9A 1VQ6S 2X3DA 1NM2A 5B0FA 2E9ZA 3WHIA 5BYQA 1FKOB 2DTJA 2QYGA 5IM0B 4DFMA 2VV5A 2ZVIA 2ZH1A 5DM6Q 1R0AA 3QMQA 2P6TA 3GJTB 1TKXB 1IJEB 2RF2A 3SYZA 1NSQA 4Z2XA 2RSQA 1T94A 3P45B 4XPCA 4J37A 4ETXA 4LRCA 2VDIA 2Y8WA 1N48A 2HMIA 3HKWA 1HA1A 3QLHB 2ILZA 5DRKA 1WEXA 2XZDB 2EFVA 2VF3A 4O0IA 4JI6F 2MKYA 3HM9A 4CLTA 5J2NA 2OMLA 3ISND 2YWKA 3EZUA 2OFGX 3UVJB 2VASA 2GHWA 1JLQA 3CT9A 1ZS6A 2J0SD 3TANA 4BS2A 1QAXA 1S6QB 3PW2A 2NQPA 3M6WA 2OPRA 1YDLA 2MQOA 3D4JA 3TUZC 4CWBA 3QIPB 2ZZNA 4F4AA 1I3OB 4GVBB 1N36F 2HW3A 4C8MA 4F4XA 2D7SA 3K0JA 2JC0A 2QL5B 1YZ7A 2JL9A 4WE1B 3QRQA 4L6V3 1J5OB 5IT4A 3EGZA 1T9UA 4F3OA 5E5NA 3CCSS 4OX9F 5CZVA 4UUWA 3JQKA 1TK8A 1BGXT 2W4CA 3AODA 4NLXA 4F4KA 2BUNA 3OSNA 3QT8A 5L9NA 4HI1A 1YHQS 3DLLQ 4RL1A 1MMDA 2FGCA 3BGRA 3KLEB 4DQRA 1KC8T 2DHSA 1RAOA 5DZ7A 4FN5A 3MAAA 1H98A 4FF1A 5FLXU 5D4NA 4P9SA 3Q8VA 3KLVA 1B99A 3VAMA 4DR6F 1HBOA 2AD9A 3FBEA 4LT6A 4NXMJ 2E66A 4FVMA 5L1IA 2AJFE 3KNAA 1S6OA 2Z2ZA 3ENVA 2FZGB 3KUHA 1PYTA 1T02A 2XLKA 1Y5LB 3I5BA 3S7RA 1N5YB 4LF6F 2QL7B 2V4JA 2GW8A 4P6QA 2Y1RI 1XWLA 4HLBA 1OIAA 2FJXA 2G0IA 3IG1A 4ATNA 1IBKJ 1WACA 1L5UA 2M8DB 4NEZA 1S9FA 1VJQA 2RU9A 3K5LA 2Z2LA 2CPYA 4IO1A 3RG6A 2DHXA 2M2BA 1Y7PA 4P2MA 2H65B 1HLWA 2CQ1A 3QGPA 4Y0FA 5C42B 3ZTPA 2B6AA 2K7JA 3GU0A 4QWAA 5AXKA 2VBXA 3CMQA 4YHHJ 1EARA 1E6YA 3R5JB 1XQIA 4KSEB 3KUEA 2OPQB 4QYZJ 3UDCA 2MB0B 4OHWA 1NXIA 1TZ0A 6AT1B 4IH5A 2ZH7A 4QIFA 1U24A 2BMBA 1S7IA 3OR2A 4ZVEA 1D9DA 1PBAA 2DR5A 4TYBA 3I31A 1RAHB 4L3NA 2BE2B 2X1BA 1FRMA 3AD9C 3UNYA 1RSCA 3NG8A 3NXZA 5BR8F 3LAMA 3NWGA 2GO8A 3HFZB 4B9LA 2B4VA 4HI2A 3PRVA 4XPEA 1NJXA 1CS4A 2MY7A 3UD5A 3CDAA 3D3CJ 5D77A 4CO3A 4CQ1A 2BX6A 3JSMA 3H59A 1KRPA 1RAAB 2MHEA 3P4UB 4DF4A 3M8QA 2MSTA 2Q6BA 4RW9B 3JTOA 2QLFB 4U95A 3TARA 3A8KA 4QPTA 4DV5J 2DNRA 5DM7Q 4FZVA 1WC0A 2A3JA 5A6PA 3NNCA 5CAAA 1UVJA 5J2MA 3MEGA 3ICLA 2RT3A 4OL8A 2Y3YA 2JFKA 1RHJB 3EGWB 1T9VA 1Q8KA 2CQ0A 1X4BA 3P96A 1LWFB 2GVDA 4IOAQ 1C4AA 2XSJB 4PKDB 4W4MA 3F44A 3B82A 2CNOB 4OV1A 2VQEF 2RUSA 4FF4A 2AZ3A 2MJUA 2U2FA 2J7UA 4CLKA 1NCLA 1I1GA 4FBTA 4NLVA 4WFXA 3AY0A 2J0QD 2V2VA 2J5AA 3THVA 1PC4A 2V9WA 2VG5B 1JNRB 1H2TZ 3C6UA 3DXBA 2ZBPA 2HVHA 1OWXA 4G1QB 4NZ6A 2EBEA 2LQ8A 2X1FA 3V4IA 5LXYA 3PW4A 2IJNA 2OHDA 3WBZA 2GHPA 2OMOA 4UF4A 2RS8A 2WK4A 3FSYA 2ZKTA 3OVBA 2WOMA 3K58A 5LOQA 1T11A 2QGFB 2E7WA 3DOLA 1VIXA 1VS3A 3NBPB 4DV3F 1R8PA 3U7JA 3Q8QB 2CPFA 4JI1F 3G96A 3WZ0A 3G82B 4I2QB 2NCKL 1BQNB 5IM0A 4MKBA 1RT5B 5GAGU 4ECZA 1YJRA 2YNGB 4NX9A 3KKFA 4C8KA 3OT9A 1F60B 4JI8J 3C8YA 4MKAA 3IGVA 1S97A 3QO9B 1VK3A 1TR0A 1FE4A 4IFVA 2J0WA 2GMHA 2WW4A 1KOHA 2GS8A 1M5KC 3IR6B 1ACMB 1R3NA 4Y28C 3TW0A 2DH9A 4F7VA 4KB7A 4EYIB 2HHPA 2W2MP 4K7QA 3BSNA 2XYHB 2LVWA 1RAIB 3W5ZA 2FJVA 2ZKUA 2QA2A 5DGAA 3CJ2A 2JEFA 1GNKA 4C0OC 4RBTA 1HWUA 1Y11A 3TYTA 1OQ6A 4QYZK 1DBDA 3N01A 4YR3A 4WKRA 1RCXB 4RW4B 1WF1A 1B0TA 1TL7A 2IA6A 1JLGB 5F8LA 2FLOA 1Q16B 2X1AA 4UUXA 3MR5A 3V6HA 2VC1A 2R8GA 3L4BC 1AYEA 1SH3A 3NCPA 2MJNA 2AEJA 2LCWA 3TVZA 3EGNA 4U7CA 1BWVA 3K5PA 3NOGA 2UUTA 5HROA 1R6VA 5IZHA 1FTCA 2FB0A 1S7HA 1U0HA 1WTFA 3EWGA 5AE2A 4YN3B 1YBAA 2GMJA 3PIPQ 2UXCF 4M5IA 1LEOA 2EG1A 3FK4A 5HN0A 3SSSA 3CB4A 3QJLA 2DBBA 3R1LA 4LVNP 2APOA 1RHRB 2F63A 3DOMA 4PG6A 3MCSA 1RLCL 5K8PA 3ZZZA 4O4RA 2AW0A 5HJYA 3AOBA 2KTQA 1TTHB 5ETNA 2XG8A 2C3UA 3I5CA 2CPJA 2GAHC 3LP2A 4W90B 4K4YA 1DAXA 3L3CA 2V4QA 3BO3A 5JJBA 4NE9C 3OTOF 2VH7A 3PEHA 2UUAF 1VLOA 4ZHRB 4FF2A 3VR1A 2YX4A 2H1YA 5A6WA 5E3RA 3PCOB 2ZH5A 1LXJA 4H4OB 2EW9A 1SJ1A 4Q7AA 1N5VA 2VU5A 3OTCA 5LMNF 4TY8B 2X7IA 4O3SA 1X8DA 4U8YA 1WC5A 1IR2A 2D3O1 3MD3A 3D6MB 4KH1B 4PPDA 1ZAWA 2Y0SD 3FC9A 2CQHA 5F8MA 2IRXA 1HQEB 4ANEA 1UZDA 4RKUC 2LU1A 5BYSA 1S1TB 1FKPA 2FZKB 3W8GA 4IFYB 4TQRA 1T7PA 4IUFA 2MKHA 1VQ5S 1GXUA 1RTHA 1UTAA 3CD5A 2E5LF 4FF3A 4UOFA 4KT0C 5IS2A 5B0GA 2DD8S 2UXDF 2I0XA 4FBUA 5D15A 1SXLA 5AE1A 2OPPA 4QBUA 2DGOA 2FVPA 3I55S 4NLSA 1RAFB 2AX0A 5KFPA 4DSEA 2HHXA 5B0EA 2VKZG 3MM9A 3JS9A 2VG6A 2IM1A 2AP6A 5DDRC 1C0UA 2C3PA 3M2RA 3MPUB 2I9SA 4N41A 4F0KA 2FY1A 3DRRB 2R9LA 3H5XA 1F9EB 3R6LB 4CNYA 4ID5B 2VBWA 3DLGA 1Y4ZB 1S6UA 4RW9A 1FWPA 3W63A 4HTIA 3C6TA 3F73A 2G1DA 4G1PA 1EP4B 3MMCB 2WCXA 1F0XA 4B3MJ 1EAYC 3H42A 3ZNJ1 3PXGa 5J1PA 5AT1B 1YJTA 5LSOA 5RUBA 3RYLA 4FNIA 3UCGA 4NMXA 5F8GA 7FD1A 3CSKA 4OHVA 1HL6A 1YZ6A 2V4RA 3MM7A 4ZK7M 2ROPA 5DQHA 3BM7A 2RUGA 1FF2A 2MLXA 3OFHA 2I8EA 3VZIA 3LA0A 3Q23A 4NCGB 4KGZB 1X4AA 2ZZMA 2MKSA 4JP8A 1Y9OA 5B7WA 4G6VB 2JVOA 4LBIA 2R7TA 1TL3A 4KO0A 4LUBA 4K50A 4WZQA 2GX8A 2XHWA 3MCNA 3DGPB 3NGKA 3PR4A 4DV0J 3E51A 3MUTP 1JMTA 2CQ2A 2W1BA 3G6VA 1V9OA 2CG8A 5KFGA 3Q2TC 1XMQF 1WKLA 2PGCA 2V69A 2IYIA 4DUYF 3ILIA 3BYPA 4LFAJ 3U02A 4G1IA 1EZZB 4P10A 3J7Z5 4KFBB 4I2QA 1GTHA 4F02A 1RT7B 3OJUA 5D6GA 4ZVOB 1SJRA 4C8ZA 2N82B 1ULRA 6FD1A 4YY3F 2NSCA 1U1MA 5HVGA 3BR8A 2QMUB 2GHVC 2BJ1A 4YEAA 1TV6A 3SQGB 5IT9U 2OPSB 4B3RJ 3U1LA 2ATLA 3THTA 1GH8A 4CYUB 3W2VB 2UUCJ 4NLYA 1FTRA 4RBVA 1U8WA 2DH7A 2EFQA 3PV8A 2IJFA 3CTRA 1DHMA 4X4NA 3RAXA 3SMZA 4PYAA 4P72A 4LRDA 1VHIA 4W98A 1V5VA 3J81j 3GFZA 3M30A 4A4JA 2HG4A 2KXHA 4QZVB 2B5JB 5T7LA 2ILYA 4ICLB 1DTQB 2K8GA 3B54A 2WVBA 4PG7A 4ES3A 1S79A 5HO4A 2CQGA 2J9EA 1WG4A 4R0EA 4Q2MA 1JXLA 2ROGA 3DC2A 1M5OC 2GVZA 4F4YA 1RWPB 2CPHA 2EK1A 5E3AA 3RGIA 1RU1A 1D3WA 1RABB 4X64F 3OLAA 3UW1A 2IC3A 4Y2MA 4M5DB 4JV5J 2XZWA 2CADA 4WXOA 4HTJA 2JEIA 2RRBA 1S1XA 2KM8B 3AB2B 2DNQA 1U4BA 2C3YA 3FDSA 4HH0A 3LAKA 1R0CB 2QLBB 3EZ5A 4ZPBA 2C2KB 2R7UA 1RTZA 3OR1A 1GQEA 2KYXA 3SCKE 1KHWA 2V9KA 4LRBA 5L9XA 4CLPA 4NA1A 2Z8QA 1S10A 3A3OB 5I42A 2F1FA 2FVQA 1TAQA 4MAKA 4NYZA 4WXWA 2ZITA 3ENAA 3T9NA 2EBGA 2E44A 5EHHA 1WSRA 3G6ES 4USVA 1HPZB 5B08A 1WI8A 2ZBCA 3CO0P 3DMJA 4EMDA 5L39A 4X84A 3JYTA 4KIAA 5LT5A 2CQ4A 3I56S 1OY9A 4L72B 4V1Ak 2FC9A 5KG5A 1YG0A 4H4MA 4HL9A 1SV5B 1NH7A 1FRLA 2G4BA 2ZC4A 5EDWA 2KT2A 3VF0B 1S12A 1LWCB 4PXBA 4JI6J 3T6BA 1S6PB 1X4HA 2XY5A 1LW0A 4WP9A 4LF2A 5B09A 4ZPDA 2HQ3A 3S8SA 2PE8A 4J9OA 4IDKA 3QFWA 3C19A 3RUBL 3DXSX 1KFDA 2NZ4A 2ZD1A 4KGMA 2FIUA 2R8KA 4MIAA 2DGUA 3MCMA 4LF4J 1P9YA 3LP1B 2BEFA 1RT4B 1B4SA 2ZE2B 1RKJA 4I68A 1VIOA 2R7QA 2B9YA 1QUPA 3RB6A 1AB8A 3FCWA 3BO2A 2EWHA 4I2PA 4KKOB 4YB6A 1OS5A 1NKBA 2EC0A 2R4FA 3H0PA 1T0TV 1LK7A 3C15B 4PXCA 1X4EA 3NS7B 3QATA 3MURP 5IC4B 2ASJA 4DX6A 1T9TA 4YUDA 3LW5C 4OX9J 1NDKA 3UI3A 3OTBA 3V81B 4J9QA 3M32B 4DMZA 1P8GA 1Y3KA 3M2UA 5J2QB 3CD7A 1UEVA 2FDNA 2GQQA 2ZDOA 4DWIA 2ZHOA 1EX8A 3IWNC 4UY8T 1P6TA 1TFWA 1Y10A 2CIMA 4UOHA 1FE0A 4LSNA 5HL7Q 2HBQB 1WEYA 5ETKA 5KFLA 2YTCA 2JEGA 4TQSA 4C2MA 2U1AA 3PNIA 4TU8A 3S6EA 2IJRA 2WBRA 1WOSA 4M5MA 2AT1B 4IH6A 3FCHA 2VBYA 1DTTB 3LUYA 1SCJB 2OJ3A 2HHVA 4LF6J 1HBUB 1XNRF 2LMIA 3C14A 5HVFA 4DR5J 5A8KB 1NPRA 3DLBA 5L1KA 1CJUA 3TJAA 5CCLA 4JI4J 2W7PA 3KMQA 1U25A 1EETB 3DRYA 3TUJC 3HHEA 2CG4A 2ZH4A 4R8UA 1FFWB 2DKOB 2W9CA 1DQ8A 5GMEA 2NXEA 2FY8A 3R1HA 1GFWB 4ANCA 3ZZTA 4M1KA 3CCMS 2OSRA 4N7TA 1JK9B 1HI1A 4NCGA 2YH1A 1WC3A 4LF8J 4DL3A 2PEBA 3GG0A 2WVDA 3UFCX 3T3FA 4CH7A 2E9TA 4KC5A 3R7BB 4TXSA 2O66A 1RT2B 1HBNA 2AMCB 4P52A 2WONA 2KU7A 3R8YA 1UJ4A 4Q0BA 1KSPA 3RBEA 4MKYA 3P3DA 4JB8B 5EX3A 4IR1A 2IDLA 4CP5A 4GO5X 2MGZA 2KZZA 2HWIA 1B7YB 1G4CA 1SKSA 4LR7A 3W2WB 1OO0B 4ELVA 3GIRA 1FKAF 4DU8A 4C6AA 2Z30B 4P74A 2YWFA 3QSYB 2DR7A 4KFBA 2WVEA 1RT7A 1H7WA 4ID8A 3DI6A 4YMEA 4MK7A 4RWXA 1X31C 2N3OA 3CEDA 2HNDA 2EKYA 2BW2A 4RUCA 2HHWA 3GYNA 4USTA 4DV6F 2SXLA 4DV4F 1MROA 4B9SA 1S4EA 3EMTA 4AXIA 1ZTWA 1MG7A 2NS1B 5HQMA 1D9AA 1X60A 1L3VA 4LFCF 4MYUA 3R2CJ 4KHPF 3AD7C 3HVTA 2Z2MA 3HHDA 4USHA 4AT1B 4DR2F 2D9OA 3I82A 2XC9A 5A76A 3TAQA 4CLWA 3KLFB 2H5EA 2RQKA 3W5YA 2WSCC 5GAEI 2P8IA 1DTQA 1EQ0A 5HMXA 4IO9Q 5ETSA 1VHFA 2Q6CA 2IRYA 4B9NA 4M94A 3MEEA 2HGNA 5KFBA 2VQEJ 2I2YA 3TX0A 2BKPA 3MR2A 2QYCA 2HQGA 4ZVSB 1CEZA 2ZZTA 3AB4B 4WTOB 3T41A 4EO6A 2M5YA 2LQBA 5A2QY 3M9OB 2A2DA 2WVCA 3HF5A 2ALZA 3KFWX 2J6TA 2ADCA 1R8HA 4M5KA 1TUWA 1QE1B 1W2IA 1N0UA 1HNXJ 3EPGA 5HQLA 2H4YB 4HACA 3HO1A 3NP5A 1XR7A 3B4DA 2J9DA 1SC4B 2DNPA 1PG5B 1RT1A 3KUGA 3KOAA 2GZOA 2BV3A 2RB7A 1L3UA 4NLRA 4JI1J 4U8VA 2V50A 3OXFA 2VONA 5D3GA 1DY3A 1ELOA 4ELTA 2YNIB 4G65A 5GMDA 1IR1A 4WFBQ 3QJPA 2BKOA 2QTWA 2C2ZB 2L08A 4Y34A 1WKKA 2Y8YA 4WFNQ 1F1BB 2VQFF 3LO3A 1UFLA 4CT9A 4N5SA 2HNYB 3GJSB 4LSLA 1HNIA 1KBRA 2N4CA 1WNEA 1NB7A 4P75A 1WOPA 1X0PA 4ZN1A 3KHHA 1BXNA 3IBFB 3QGIA 1N34F 1REVB 3I0RB 3BR9A 4UZCA 4NRTA 4ZJQA 3L09A 1RWWB 1TL1A 3GJQB 1BC6A 2QT7A 4PWDA 1UP1A 3OSPA 4LF7F 4YQWA 3R7NB 3KDNA 3FEYB 5CYMA 4RUHA 2R7OA 4QWCA 4P2XA 4BWMA 2AYMA 1IXKA 2XMJA 3T5JA 1HMVA 2HRYA 4ZIWA 2GIRA 2VC0A 4FDFA 3HSZA 5D4LA 4KKOA 4L73A 3PR5B 3DFEA 4F2RA 1NK5A 4DU7A 3T5HA 2FHKA 2CZ4A 1G7CB 4V19X 1X5PA 1X4CA 3GJRB 3D5MA 2HQCA 2BRLA 4Y65A 3M2VA 1N5SA 1NJYA 4FPRA 5DDOC 4GKJF 3SBMA 3IMQJ 4NLWA 3VZHA 2CJXB 1DLOA 2A6MA 4URGA 4CIOA 5J2QA 1K47A 1D0EA 1X4DA 3C2PA 2UXCJ 3Q0AA 1H7XA 4X62J 3BDPA 4ZJLA 3K89A 2LQ5A 1UMJA 1K9MT 3BGLA 2DCLA 1HYSA 3MDFA 4M5JA 4OYIA 2I5JA 4ANDA 2RIJA 2O1PA 2OEJA 1DRZA 3M8YA 3MAHA 4GC6A 1Q86T 4C3MA 4ILLA 1O8BA 1Z2ZA 1IWGA 2M88A 3DLHA 1UKUA 2QIFA 4KGXB 2H5IB 1AXQA 3KLHA 1RA7A 1DTTA 2NREA 3GR0A 2BE7D 4JI3F 1HBUA 2XTJP 4P2SA 5BYRA 3NEKA 3OTOJ 3NGRA 4MK9A 4DG1A 2HZVA 2DRBA 3O1LA 2PFFB 1Y3JA 2M3DA 1HR0J 5FDLB 4J9UE 1F5CA 2AGPA 1FESA 1KQGB 1U2CA 1ZM9A 3PIOQ 3OXGA 4FS1A 4QIGA 4CI0B 3M7VA 3P5BP 5LMNJ 4ZCMA 1TVRA 3SSQA 2KZMA 3MOZA 1SPBP 4CZCA 2BANB 1SH0A 1KD1T 2FVCA 3TUPA 4ZKAA 4I0WA 3PRDA 3CC7S 4A8QA 1F9FA 5LSLA 3KLIA 2DNOA 4ZPAA 4ZN3A 1A6LA 2E5LJ 1VBKA 5KFWA 1FK9B 2JH3A 3LP0B 4UTGA 1RTJA 3RR7A 3EUNA 4YR0A 1CULB 4DN9A 4CO0A 1BMQB 4K4VA 2IPOB 4K0KF 2YPYA 1AROP 2XMMA 2C2DA 2GA7A 2JLGA 2F40A 1M5VC 4DF8A 4DSKA 3K5MA 2F4VF 1FI4A 3HULA 1N33F 1YWXA 3DM2B 1SKUB 3TO8A 3UN5A 2MYFA 3EE3A 5KG2A 5THWA 1VQ7S 1NZ8A 3LWMA 4R5PA 2Z4PA 1GXLA 2IA0A 2KDOA 1FNXH 2LA6A 2PDAA 3WQPA 2ROEA 2XO7A 2KYZA 1LW2B 1VC6A 1FNOA 4I4BA 3KLFA 1H72C 4PABA 2QO3A 2DO4A 4X65F 4DL6A 3KMSA 1IKWA 3AA9A 2BQ3A 2MLZA 2CPXA 2R7RA 2G2OA 5EWGA 4CLUA 4Z7CA 1ZM4A 4Y2CA 1KVIA 3U1NA 4TU7A 4LF5F 2VIHA 1D8YA 4FXVA 3SEOA 4DQIA 1PAUB 3MAQA 1R31A 1QE1A 4DPUA 1DFDA 2R7XA 4Q44A 3QRPA 1FVQA 5F0WA 1Q82T 2ACYA 3G86A 2Q1LA 3WIVA 2B7BB 2UVVA 3O8WA 2MZRA 4DUYJ 2BQRA 2XLIA 4IRCA 3W8PA 4HHJA 3MPVA 2GJIA 3DGVA 1SL0A 2VODA 4ZMMA 1MU2A 1VQ9S 4YY3J 2LEPA 2PMHA 2D3OR 3CCTA 3NLCA 2V34A 3TA2A 4NCBA 4LVOP 1XC9A 2MMYA 3BEGB 3POTB 2B56A 4C8LA 3HD2A 2W4PA 3WIUA 1NDCA 3EVWA 3MFHA 4M63A 3D28A 4BBYA 2NXUA 2J76E 1WD6A 3OFFA 4ILMA 1C1CB 4TNOA 1W7WA 1HNVB 3KJNB 1VLYA 3DRSB 3RBDA 3KLGA 3D0HE 3HP6A 1RTIB 2KM8C 2ZWPA 3ET6B 3PM9A 5L8RC 4ED2A 1OSDA 3IP0A 5H9EJ 4AYBD 3KJFB 3CUNA 4MIBA 4DQSA 1K1QA 4EK2A 3LOUA 5KFZA 5I3QA 2MZQA 1BUXA 1UAWA 2V5HG 2A10A 3I0SB 4X64J 2GIQA 3MECA 1XERA 5A8WB 4USIA 4KV8B 4JV0A 4P73A 5C7PA 5HBMB 2KJVA 2HGMA 1RBAA 4IRDA 3VCDA 3BO4A 1GAOA 4CT8A 1IBLF 2G2ZA 3UD3P 5K14A 2VFSA 1VQKS 4PYDA 2ZBIA 2HPUA 3OW2R 1FXDA 3R2DJ 3A13A 2MZ1A 5LXRA 1JXEA 3ENWA 2GGPB 5CABA 1NLKL 3E01B 3RW7A 4QIEA 3QGHA 1SJFA 3N9UC 1VI7A 3M8SA 1RWUA 1RBOB 2YX7A 2OGUA 3TZWA 1BY9A 4O44A 1VRUB 4QW8A 1Q5YA 3FKBA 3P5TL 1WI6A 2CRLA 4WZMA 4X4VA 1VR6A 2EKNA 1RTDA 3ZTRA 3VGSA 4X4RA 1C1BA 1ZYQA 2CA9A 3GV8B 4YB1P 4JV1A 1AA1B 5HMWA 4A8MP 2CJBA 4QPXA 4NLQA 3G9CA 3ILJA 1H6KX 3IR7B 4TU9A 1VYAA 3D66A 4KPCA 4KHRA 4OLPA 2DH8A 2HSEB 2R7WA 2YNFA 3UWTA 1RWXB 4OI3A 1MNEA 2ASLA 4OMFG 3PYGA 3PO5A 2JNJA 2BVZA 5DLGA 4DZ6A 5DJBA 2CNNB 2DGTA 1S1VA 1SBRA 4CCHA 1CQMA 1U1KA 1U8SA 3L95X 2CZ9A 3CCUS 3CDEA 4O4GB 3F56A 2MKJA 2IBOA 4DR1J 1WORA 2YKNB 3CDWA 1JJCB 4QU6A 3N5FA 5CXTA 3GR1A 4AFFA 5DDQC 2D3UA 1AUDA 3MMBA 4MYTA 1NSPA 4NI2B 1Y5NB 3DLKB 4A8XA 1JKHA 2P2CB 2XS2A 1RWMB 4BLGA 2BOPA 2AX1A 1FK9A 4CTAB 3IR5B 3KTQA 3PX0A 3FMBA 4C11A 1UEUA 1CULA 4DN0A 1SL2A 7FDRA 3MM5B 1HWJA 4DV7J 4C8NA 1VQYA 4D3GA 4IKAA 2E1RA 1UFWA 3MZIA 3NAIA 4N47A 1YLXA 3D67A 2R8HA 4IOBA 2AIRB 2N4DA 3VGTA 2VKRA 5H9EK 5T41A 1I94F 4L76A 1QAYA 1R6YA 2PMWA 2W9AA 1XNRJ 2DXFA 3QQCD 5KOXA 2CDRB 3WDOA 1U1NA 2ZC3A 3U1MA 4TYAA 5JMNA 2L41A 2VPXB 2MZJA 4K4SA 2PEHA 1H74A 5IV3A 2YKAA 2CFXA 4DS5A 1WF0A 1NSAA 3HD1A 3BKUA 3PEJA 1BQMA 3M05A 2E7VA 4JBCA 4B3OA 5A0YA 1U1OA 2KJWA 2VG7A 1NMEB 1UA0A 3SZ2A 2BZ2A 1SL1A 4HDHA 1RT6B 4LFBF 2DITA 5FJ4A 4I56A 2CQ3A 2IYGA 2W2QP 1N32J 4EFAC 4WJBA 3KK3A 1S9EA 5GADI 4ED4A 2V8GA 1NAQA 4F3QA 2E1MC 5JXSA 2L9NA 3IM8A 3HDSA 5U47A 1VFJA 1S57A 1IKYB 4ZCLA 1MWQA 3MMAA 1TUVA 4MT1A 4DV1F 1U6FA 2ERRA 3E8OA 2XS7A 1SVDA 3KK1B 3JTPA 2W01A 2UP1A 1WG1A 3CCES 2ADBA 3BSAA 2IAJB 1S1UB 2BQUA 4I7FB 2M7SA 2FQQB 3JSBA 4OYAA 1NEEA 4C98A 1RWVB 5J2PA 1FA0A 1UCNA 1PBUA 1MMLA 1M1GA 2FZCB 1OYEA 5CYQB 3I6PA 8ATCB 2RRAA 1QVFR 3BQ1A 1HHSA 1DQAA 1NHUA 2PT0A 1NBEB 3M4XA 1RYSA 3DOKB 2VFRA 5ETTA 2ZJPQ 3TZXA 1XNQJ 4Q8FA 1E6VB 5ETMA 5GAEU 5E3CA 2KT5A 1DQ9A 2YVSA 1QM9A 2G13A 1W2BR 3F0NA 1X4GA 5K5MA 2V2ZA 1U7LA 4Y3CA 2JEJA 2HIYA 4JUZA 3MEDA 4KHPJ 1LWEA 3CXCR 5KFTA 1UVNA 1WDDA 2HFNA 2BABA 3H4BA 1MSWD 4RX6A 2KG0A 4DR2J 1AUSL 3IFEA 3KHLA 3AAWB 2PI4A 2R8JA 1N0VC 2JHEA 4A8KA 4URQU 5ITHA 4Z7YA 3RRKA 2RKIB 2AJ4A 3VQSA 4I6WA 2V8PA 1JX4A 4HVZA 2HWHA 1VQOS 3R3TA 3IXQA 1RDRA 4KE5A 3OL6A 2KFZA 2PA3A 3DRPB 4ECSA 2IY5B 2FLLA 3ITHA 4LREA 4ZLPA 1MLAA 1Q81T 3HHLB 2O5DA 4I69A 3ZC4A 1B70B 3M8RA 1KTVA 2YKMB 3TP2A 3R27A 1BWEA 3FEZA 5HP1B 4YDDB 2E1PA 1MN9A 4WIQA 3M8ZA 4J9MA 4IQMA 1LFPA 2W7OA 4NXNF 3H7HB 2GGPA 3BQ2A 2WHOA 4USMA 2F7VA 2NXNA 4EWTA 3Q8YA 1KVJA 3EVOA 6FDRA 1FDNA 4RW8B 5ETRA 2EG2A 1CJVA 2E5GA 1TKZA 4Y2IA 1ZETA 3CCWA 5IT0A 5IC6B 3PRBA 4PG5A 3UPFA 4C4WA 4IRKA 2OP5A 2AEMA 4ZIVA 2QEXS 5HLFA 2DISA 2LEAA 2B8QA 4CLLA 2DRDA 2C22A 2VB6A 5EX0A 2R8IA 5CZXA 4TVAB 4NMLA 5K8NA 4HYKA 4MTPA 3BBFA 1RB0A 4KRWA 1HW8A 3TAMB 2VICA 4USWA 2PFDA 2RQ4A 1N34J 1Q78A 1F2GA 2EC2A 2BA9A 2MQLA 5C24B 4IG3A 3FZ2A 4EZ6A 2QJ3A 3ILOA 1QSLA 1HARA 4A47A 2M9KA 4LF7J 1HWKA 4TN2A 1N6QB 4TLRA 4RJVA 1JXVA 2K06A 3GB0A 2VDHA 4QW9A 3FSXA 3ULHA 4BCAA 2YKNA 3R5CA 4LBHA 1HQUB 5F8NA 5SUHA 3FUYA 4K8RA 1S0VA 2GO9A 2RRNA 3D54A 1TMMA 3V6JA 3OD2A 4MMOA 5C25B 4DX8H 4FS2A 1TMJA 4NXMF 4PXDA 2CAJA 2VUGA 1PKUA 2YKPA 1UWBB 4NCAA 1NH8A 3R5AA 5G0RB 3B78A 3D6TB 3KK2B 1ZOTA 3N6MA 3K57A 3RBXA 1YJNS 3A1YG 2F5GA 3TWZA 4HEA9 1FDBA 3Q8SB 4G3IA 1IBKF 1ZM2A 4U96A 3DU5A 3R6GB 4B17A 2X3GA 4URSA 4JI5F 3AD8C 2XS5A 1UW9A 1B7FA 2GV1A 1M5HA 2YNHA 1YX2A 4QR1A 4C0BA 1RP5A 3MPWA 4OQJA 4GO7X 3D6HB 4OLOA 2MQ8A 4ECQA 4JI7F 5DO2A 1FWKA 1B0PA 1SJQA 3H5SA 1N54B 2ZFHA 1QY7A 4Y2AA 4ZVUB 3AQPA 1OYDA 1RHKB 1VRTA 4RW6B 3BH7B 2E1AA 1Q8IA 1FDDA 1UZHA 3KNGA 1JLCA 2XWYA 1APSA 5LJ3Y 1RWOB 1CJTB 3LWLA 4L75A 4DSJA 3J80Y 2UXBJ 2R3VA 1KQKA 3J7YI 3OHBA 5KT4A 2PMZD 4ENOA 3FRZA 3NGTA 3M6VA 2WW8A 4X4TA 2AHOB 2B9WA 1SC6A 2UUBF 5M2PA 4DSLA 2G0CA 2RQCA 2O67A 3CE8A 3QWPA 1TKTB 1IKXA 3N6NA 3GFYA 2YQ1A 3KK1A 3DHWC 2B8PA 2DR9A 5A8RB 1NDLA 4I64A 4QWDA 3TNVA 1H2VZ 2VJVA 4WCEQ 1U0SA 4DOZA 1S1UA 2BM0A 5F9NA 2FLPA 3V6DA 1K0TA 3W61A 3O5TB 2CZVC 1KVKA 4ER8A 9ATCB 2OAUA 1JIHA 4CO1A 3BBBA 2B9EA 3OUYB 4K0KJ 5CCMA 4USUA 2J0XA 3KJVA 4FXWA 3L9ZA 3VAJA 3HCXA 2F4VJ 4DX5A 2NSBA 4DCJB 3EGVA 1N33J 2BJ8A 4C8OA 3IS9A 3MM6B 3LANA 4EZ9A 3C16B 4J9SA 3AOCA 5KT5A 4PCQA 3G71S 2FJBB 4MK8A 1U26A 3UCUP 1RCOB 2AU0A 4XAKA 2KHDA 4DEZA 2FHOB 4WU3A 2IHR1 4KH0B 2XI2A 4WFYA 1AW0A 2WRMA 4B3SF 1JLBA 2ZH8A 3OTEA 3BPDA 2XMKA 4RW7A 2D1CA 2CJYB 4C8YA 3W7BA 3JQMA 1XEZA 3ZO7A 1SUQB 2QV6A 2RKIA 1IKVB 3Q83A 3PKYA 4AL7A 3J7AN 3BGOP 3PACA 4AQYF 5KFCA 3H25A 3WC2A 2DPJA 2ASYA 4LF5J 3LALA 2ZUAA 2DHHA 2PIIA 1O5JA 5HVHA 2Z0GA 5JVGQ 1JLFA 3T1HF 3IBCB 3FFIB 3CDBA 2C2MB 4PR6A 3KYLA 4KGVB 3GIMA 3MGJA 4K4UA 1CJKA 1SIWB 3PJXA 5AE3A 3F41A 4AL5A 2DXEA 3CJ0A 3CCZA 3KXDA 2BW7A 2QFIA 4ZLNA 2J7WA 3X3UA 3DKDA 1LFWA 3PY8A 4WF9Q 3NNHA 3OFGA 1FKOA 3HFKA 4PQAA 2XLJA 2ZH6A 3MEKA 3MMJA 3OLBA 5E41A 1T05B 2BR0A 1OPZA 4HDGA 2CDQA 1TKXA 1FRKA 3O44A 3A4TA 1S1WB 3BH6B 5HMZA 4DPOA 1UVMA 4ES1A 4RNOA 2FC8A 2ZVSA 1IN0A 3GIJA 3DYAB 3QZ7A 1S76D 1XTZA 3TZYA 1JLEB 1R7IA 3EDRB 2R2UA 4MH8A 5E7OB 3QJJA 4F50A 4F4WA 2RS2A 4OHZA 3QLHA 3CF5Q 1M5SA 3FZBA 3CJRA 1S77D 4RUBA 2JC1A 4FKXA 2OIHA 1QSSA 1J5EJ 1Q8LA 4DPWA 5AXMA 4J9LA 4ZPTR 5C24A 3UVJA 4RU2A 5LSRA 4Y2KA 3ADAC 1DJ0A 3D6FB 1FJGF 2DGWA 1U47A 3N28A 2CVIA 3LPYA 1S6QA 2OEMA 2H3EB 2RVJA 2DNNA 2D41A 2DR8A 1KNZA 2HBRB 5K9FA 3QIPA 5KT7A 4PWUA 3DRXA 3RAMA 4GVBA 1YIJS 1J27A 1R0AB 4M5NA 5DLFA 4J5OA 1D09B 4WE1A 1M90T 2XGPA 3T5KA 1J5OA 2RF2B 1NK8A 3R97A 4DSIA 1KDNA 3TOQA 5F8HA 2YWHA 5C25A 3FJ2A 2B4PA 2KXFA 3DLJA 2HMIB 1NK6A 2DEJA 5GAHI 5ETVA 1RLDA 1IVZA 5F9LA 2HLTA 1NJWA 4J91A 2HAFA 2IM0A 4JV2A 2LXUA 3H98A 3KLEA 1HBMB 4LSZB 2ABYA 4X4SA 2L9DA 2HS3A 3TEGA 5J2NB 5KFYA 3GSIA 3TVKA 2W8LA 1JLQB 5ETPA 2IVFB 1X5TA 1U1RA 4WWSA 4K5SA 2W25A 2OPRB 4B08A 2DGVA 2IDEA 1N5YA 3CD0A 1UA1A 1VC0A 1VISA 3DDKA 2YQ3A 5AJ3F 2P9GA 5D0HA 3BDEA 1YQHA 4WP3A 2XMAA 5BXIA 2RD5C 1T9XA 3JSYA 3HPOA 2EEYA 2E5JA 1HNZF 5A2QU 1L3TA 1IBMJ 3BREA 4CRJA 5C42A 2VFTA 2V0NA 3BGRB 4ZVPB 2CQIA 5HAOA 3UDEA 3MAAB 4HT7A 3CJQA 4LJMA 3JTNA 2L3MA 3M9MB 5KAKA 4NA3A 1HBOB 4JOUA 4DV2F 1RQ0A 2OPQA 3PX4A 2GJ2A 5FD1A 3B4MA 3HZGA 5L38A 3PZPA 2FJAB 5F8IA 1ICEB 2WZ1A 4WFAQ 1UW4A 4NLGA 2CWKA 4F8RA 1HNWF 3QGGA 2BE2A 1VBZA 3CCRS 4DL5A 3BF4A 2V4JB 1TL5A 4D3HA 2GJFA 1YGYA 3MHYA 3IG1B 2P9CA 4X4QA 4B3MF 1MWYA 3D0GE 1XMBA 1R43A 1NNDA 4ELUA 4DS4A 3QFHA 1X9SA 1HW9A 1I94J 2QA4S 1HIYA 3ZZPA 2HFUA 4A8WA 3QBCA 2WVFA 2AGOA 2B6AB 1ZAVA 2QN6B 1FNMA 2W2OP 3HJFA 5GADU 3AJ1A 3GIKA 2WAQD 3CIMA 2MZTA 2LQ9A 2F9JA 4M5GA 3LH2S 1WHYA 1S0MA 4CDIA 2K3KA 5KG4A 1LWFA 1U1QA 3UDVA 2OLWA 2E5HA 1VC5A 5KOWA 3GE9A 2XSJA 3DDIA 3OR2B 1WTBA 1IKVA 3W3SA 3FGVA 3R5DA 2GIFA 1CPZA 3SIPB 1H3DA 4XK8C 1FEHA 4U9RA 1REGX 1PJ5A 4ZPWR 2F8EX 2VG5A 3TAPA 2MDAA 1CS4B 3HLUA 4G1QA 4DV1J 4E0DA 1RBLA 5AXLA 1T9WA 5JVHQ 2GQCA 2RH3A 5LMUJ 1QTMA 3RB3A 4DZDA 4B3RF 1GMVA 3JSMB 1YK9A 1KTQA 3GCWP 3S01A 3VVUA 3NBPA 3M8QB 3THPA 2HHHJ 2GC8A 2HS4A 3HFVA 3G82A 1CC7A 4BC7A 4FXDA 1BQNA 4FYVB 3MEGB 1RT5A 2V63A 2FHJA 2B3TB 1UPMB 4ITSA 3QYYA 2YNGA 3IWLA 2AWZA 3SXLA 3NCRA 2M0GB 3CIZA 2Q79A 4O3NA 2FJWA 3ZNUA 1EB0A 2GVDB 4DR3F 1T95A 3QO9A 4IR9A 4O3QA 1GX6A 3ELHA 1R8CA 3R9LA 3I87A 3QIDA 4M95A 2CQDA 3MFIA 4MFBB 4OYWA 1V3RA 4KGKA 5F0UA 4OX6A 2QA1A 3C6UB 2Y1JA 3VAKA 3IAS9 1DZ5A 5EWFA 4B3TJ 3C3LA 4ECTA 3V4IB 3RB4A 4ZPVR 1WG5A 2FHMA 1UVIA 2F9DA 2FJEB 2DNMA 3W64A 2XNRA 3O2IA 1QLNA 2WOMB 4F4ZA 3JQJA 4E2FB 3V2UC 1TK5A 1JNZB 1KKHA 4RW4A 3HZEA 5C2GA 3T1YJ 1JLGA 1IR0A 3SV3A 3B8HA 3H5UA 4L3KA 4UW2A 1YJ9S 2Y1IA 2BJEA 1JJ4A 3OVSA 1W26A 2HRTA 1MW7A 1OPIA 4E98A 5B0BA 4ED3A 4C0HA 4PQUB 4EO8A 3C66A 3MD1A 3BKFA 2CJQA 4NXNJ 2W7AA 4IFVB 3PO4A 1J2VA 3WC0A 2XMUA 5IFMA 1X5OA 2CJ9A 2OI2A 3PW7A 4FYDA 2XY6A 1VQPS 2HQDA 1HBMA 1KEKA 3HXMA 1EKRA 2VBZA 3PW0A 4XTTA 1WHVA 3CC2S 1IM6A 3CMAS 4TLQA 1WC4A 2DEIA 3FNNA 1O51A 2EXUA 4LF4F 1Q1KA 2W2PP 2ATCB 2JX2A 4UQTA 2MQPA 2FYXA 3W9JA 1UETA 5KT3A 2D69A 1TL7B 2IFXA 4OZ3A 3CJ5A 2M70A 3CO9A 3DDNA 2MSSA 2QC3A 2O01C 1YITS 5I3UB 1NPPA 3EXYA 5ETLA 4ZHRA 3IAM9 1L3SA 1T03B 4Q2LA 4K4WA 3VHQA 2JWNA 3L7UA 5HROB 2K1RB 4H4OA 3OL9A 1WHWA 1TUGB 4AUKA 2BDPA 1U0HB 4M8LA 4K4ZA 4DSFA 1OJ4A 4TY8A 2IVYA 3VAIA 2HAIA 4YP3A 3R7SB 1N36J 3NKYA 3KG0A 3HSDA 4A48A 1IQZA 1SJ3P 2DNYA 3AQOA 4KAIA 2JJ4D 3ILLA 1HQEA 3DOMB 1S1TA 5F3TA 1XN9A 4DJBA 3EJMA 2HLUA 4JI2F 2NYIA 4IFYA 1UFKA 1Z2LA 2G2YA 1PIEA 4OZ2A 2KT3A 3ETMA 2DNHA 5B0CA 4DR7F 3OL8A 2CUYA 2JZ5A 2DIVA 4ZP7A 4C9DA 3LP2B 4C48A 2RDDA 4PUOB 1UJ5A 3ETOA 4GC7A 1PCAA 3UN2A 3ONQA 4DR5F 2YWEA 3I4PA 4OI6A 5IV4A 1FO1A 3GZ7A 3JXOA 3BPSP 4DR6J 4JI4F 2DRAA 2EFGA 3K5NA 3D1OA 3DHXA 2OTJS 2GFFA 4JI5J 2ZJQQ 4UY85 4ALZA 4OHYA 2FLNA 4QOTA 2HIQA 5HMYA 3DRRA 3CCLS 2BJ7A 4ZITA 2HK2A 4ID5A 4LBPA 3QAUA 3ISZA 5K8MA 4LF8F 3TA0A 4JI7J 1IUJA 3J7YU 1FX2A 1EP4A 2QMXA 3MMCA 3VWSA 2NXCA 3QSIA 2MLYA 2ZNZA 2BACA 1QTNB 2X1GA 4ECUA 1CLFA 1JWWA 1K8AT 2B0GA 3FVYA 1U45A 4OHXA 3H90A 1FKPB 1M5PC 4YS2A 3GILA 1G6BA 2Y0BB 3PJ9A 2A2CA 2B43A 4B9UA 1RTHB 3TQ1A 4QCLA 2NUHA 3N6LA 2ZH9A 3CJ4A 4K2JA 5CD4H 3BBCA 1T9YA 3TQEA 2OPPB 5CD4A 4OFZA 3ZTSA 4QU7A 3BYRA 3HVWA 2UUBJ 5HQ8A 4KHMA 1FFSB 3DGPA 3MM9B 2Z58B 3GYGA 2XYPB 4B02A 2VG6B 4FYYB 1C0UB 3M2RB 3CMES 3CJ3A 2CWXA 2JDJA 3GCXP 3P8BB 3MR3A 3FSIA 1S0OA 3D2WA 2AV5A 3DLGB 5BR8J 2MTLA 1YRUA 3C6TB 4IQXA 3NY0A 3U27A 3KG1A 3KJQB 1FCAA 4O3OA 2CPEA 5J1EB 1S5ZA 4NLDA 3W9IA 4ED6A 1FVSA 3AXMA 4BWJA 2Q3PA 1PILA 5D4OA 1SI9A 2EK6A 1S9GB 4NLTA 3SQGA 2OPSA 3MM7B 4NL5A 1S4FA 3OPKA 4QYRA 3PYDA 4RU9A 2DJWA 1XR5A 1Q5VA 3H2VE 3ZFVA 4CYUA 3VAHA 4OZJA 3IRWP 4X66F 3W2VA 2UVWA 3HJVA 3SSRA 4MFBA 2YH0A 2C3MA 1TL3B 3I9V9 2AYBA 1TQLA 2G9OA 4KO0B 2RILA 4B3SJ 4ECRA 3EVMA 1TU0B 1K0VA 3G87A 2FGOA 4OX8A 2B5JA 1HFEL 4WU2A 1K44A 4ICLA 1HNXF 4DFJA 5KFUA 2FVSA 2FTRA 3N4WA 4L74A 3HVRA 2ZBQA 4N77A 3HKZD 4ETZA 4Y00A 4AXJA 4AL6A 2ZDPA 1CSJA 4WK1A 2HVIA 4AQYJ 2MY8A 2J9CA 1FEEA 2HRUA 1U09A 4YOEA 3LQVA 3TI0A 3AH6A 5CA5A 2J6SA 1RWNB 5KFXA 1LK5A 4DUTA 2PN6A 2RDIA 1CVJA 4H4KA 4M5DA 2CNKB 3W5XA 4U6PA 4DLEA 3T1HJ 1PJ6A 1C0TB 4LIWA 4NWBA 2DGQA 3E3XA 3J81Y 4PQUA 2J8AA 1TV6B 5GVQA 3G6XA 4CM0A 2KFNA 4C3KA 4OZ1A 2QMWA 4WIIA 4DV3J 2KH9A 5I3PA 2RU3A 3OHAA 1PYSB 2F8HA 4JYAF 1QD1A 1RHUB 2HHQA 1KS2A 3D1HA 4JI0F 4EUVA 2ZJRQ 4GKKF 1OMSA 3O3LA 2OSQA 1NZAA 2WSFC 3CVKA 4UOCA 1FRJA 3M30B 3HI9A 3JB9k 5T7LB 3ZXWA 1HPZA 5AXNA 2VOOA 1NU4A 4CO4A 2CNLB 3K8VA 1YI2S 2GVZB 1S99A 1R8AA 1XIQA 1FERA 3LF0A 3NL0A 1SV5A 1T3OA 2B51A 4OYBA 4ZP9A 3MTKA 4EBDA 4KBIA 3UDLA 2UVRA 5J1NA 2IC3B 3D1QA 1ZPVA 1LWCA 3NRBA 3T9ZA 4LQ3A 1S6PA 4H54A 3UNGC 1S1XB 2COLA 1CQNA 2BXJA 2XMTA 5I3UA 3QNWB 1FJGJ 4NRUA 1V3ZA 4DFPA 1T03A 3QT7A 3BJYA 1SKWA 3AT1B 2DCUB 2K1RA 3LP1A 3OR1B 3JAMY 1RT4A 1ZAXA 2ZE2A 5GAHU 3SCLE 5I42B 3BKTA 5LJ5Y 1PAEX 3LGHA 4X62F 3K59A 2EFPA 1YVFA 1K73T 4IG0B 5L1LA 1LXNA 4TKTA 4F0MA 2LFVA 2XQCA 4CM2A 3C15A 3EXCX 1R0BG 2V8HA 4RNHA 2H48B 4NZ0A 1VQNS 1VQLS 3DMJB 3JYTB 2NPIA 1AT1B 3VAGA 3V81A 3AHPA 3T19A 3M32A 1PJ7A 5HK4A 4EU0A 4H4MB 4O3RA 1NO8A 2OKQA 2IMOA 1VDHA 3TR5A 1BD6A 3A8IA 4PUOA 2AJ2A 3DLEB 1LW0B 5CHCB 4F0HA 3I32A 2KO1A 3MUVP 4IDKB 4UOGA 4UZBA 1HR0F 2KB2A 3TVYA 2ZD1B 4NLUA 1LQ9A 3CD6S 1HHTP 2YBVA 5EN1A 3H5YA 3ZZRA 3VAFA 3OQ2A 1RKIA 1KP6A 5I4MA 3TX8A 1N4LA 1JB0C 4I2PB 4EGLA 4ECYA 2XI3A 1IM4A 3QZ8A 4ECVA 1YJUA 5A8KA 2I38A 1DURA 2MQQA 3R5BA 5AJ3J 2UUAJ 4WK3A 2J7KA 5KFVA 1EETA 4NLOA 2XZTB 1HNZJ 3AJ2A 1QJHA 5KFNA 2C2NA 1XMOF 5EWEA 1YJ7A 1U49A 3RZAA 3M2UB 1N52B 5JUMA 5KFQA 1FRHA 2RAQA 2EVZA 2B7CB 4ZS6A 3QT6A 3MR6A 4N76A 2UZAA 2J8SA 3IGNA 1RT2A 2UV8A 4LSNB 1WSVA 4DV2J 3Q8RB 3KDOA 2R7VA 2RJZA 3IC1A 4ECXA 1NKCA 3SCIE 3M8WA 5KFDA 1I6JA 4F3MA 1RZMA 3ISNC 4X4PA 1R89A 1M1KT 1HNWJ 2RQMA 3BSCA 3W2WA 2UXDJ 2VPWB 2QLJB 2NXJA 2O3DA 1FJ7A 3C14B 2J9DE 2MXYA 1G1XA 2C1EB 4S0MA 1CJUB 1FDAA 5J1EA 4USKA 2ZM6F 1BHNA 1FRXA 2LXIA 3W1YC 3NGSA 5LL6d 4R8UB 2W9CB 5KTQA 3OXLA 1S9GA 2RMLA 4OI2A 4NOHA 4Q5VA 2R2TA 1KLMB 3BZQA 2LLZA 5KFFA 2AYGA 3W60A 5SZTA 3SQOP 2DIUA 3CW2C 3JSRA 3BGFA 2EFNA 5IXUA 5GMKa 2GQ2A 3WX4A 2NPFA 7AT1B 3VGUA 1HBNB 2W4DA 2H4WB 4EI2A 4NYOA 1LNQA 5EUHA 2BOAA 3X1LB 4RO0A 3BN4A 2WONB 4IOCQ 4Q0BB 4XIUA 3E2EA 3WX8A 3J7ZT 2AKWB 2KXNB 1Q79A 2D3ZA 3ENQA 5CH7B 4DUZF 2MGZB 2CJAA 1O6XA 4LRAA 4OX7A 5IOLA 2OTLS 1HWLA 3QAEA 2VOPA 5ETQA 1EJ7L 4J9RA 2QSWA 3IRXB 4N8OA 1RT3B 4ZVTB 1FD2A 1YSJA 3DI6B 4O0NA 1UWAA 1RYRA 1GEHA 3Q8UA 2HNDB 1C0TA 3J7A1 5HANA 2F4FA 4WYWA 3H40A 1AZSB 2KVQE 2WB1D 1MROB 1EIYB 2BJDA 1XMQJ 3RB0A 2KL8A 5KT6A 5FLXY 4PEOA 1KWMA 1QSYA 4RNMA 2N3LA 2ZNYA 3AXKA 2P5VA 1X9WA 3HVTB 2XY7A 2R7SA 2YNIA 1O0PA 3PHTA 1Q7YT 4WTYA 1XK8A 1D9FA 1VQ8S 2AJQA 2WB4A 4DR3J 4ZA1A 3TRGA 1PSDA 1X9MA 4C7QA 3C46A 2C28A 3MEEB 3LPEA 2HNYA 3GLJA 2DK2A 2XHCA 3I5AA 4LR9A 2HWTA 1Z1ZA 1H2UX 3EPIA 2JLEA 2V67A 3GWCA 4DPXA 5KFRA 2PA8D 1HQ2A 2F8MA 3MM8B 4H4KC 2JSXA 4FNHA 2QZ8A 3FBBA 1REVA 3J80U 5MLCV 3I0RA 2CPDA 1XJWB 2QLWA 2FVRA 1TFYA 2AZ1A 4HACB 4DCPB 4OYMA 4WYLA 4XDCA 2XMWA 2Q66A 1RADB 4LR8A 1S59A 1GXTA 1RT1B 2YPZA 3LGMA 1N5TA 4CLZA 1NK9A 3RRHA 3AJDA 4EYHB 4BHQA 2OELA 5D3GB 3K7RA 4UQGA 4KJIA 2XGQA 2RDJA 1ZA1B 1WUUA 4IG0A 1YJVA 3GFXA 1IWAA 2XNQA 1JJHA 4CO2A 3SV4A 2V8DA 1FXLA 3I96A 3W65A 1RU2A 4B9TA 3PKMA 2IMWP 4DBQA 5DETA 5KFEA 3NMAA 1Q53A 4LSLB 1HNIB 3GYXB 3AFGA 2R2SA 2OUGA 2YXLA 2QX0A 1N5QA 3CJKB 1WJ9A 3Q86A 4I6AA 3IM9A 2H51B 3DLEA 1QAJA 4OI1A 2V2QA 2Y1LB 2XULA 4OJ1A 3PDNA 4OI0A 2DNKA 1SQEA 2C2RA 1TL1B 3M1VB 3DU6A 4PWDB 1G3OA 4CNZA 1GMUA 2IRUA 1RHQB 1YBTA 5CYMB 2KKHA 1WC6A 3MF5A 2MQNA 1HMVB 1WKJA 4A8FA 2OO4A 4KYZA 3UN3A 4K4XA 4DR1F 2DO0A 1WF2A 2I6WA 1SC1B 3OBIA 2MPUA 5FIIA 2CQCA 5KFAA 2DHGA 1JQGA 1XR6A 2CPIA 2JFDA 2FD2A 5FDLA 1SKRA 4DR4F 5KFHA 2IM2A 3M2VB 3H8YA 4P71A 4X4UA 5KFOA 3RR8A 1DLOB 4OYZA 1UPPA 1X0FA 1Y0HA 4DL0C 2BANA 3BN7A 4OYOA 2XEXA 3IN5A 3G6YA 4LF9F 1HYSB 2P6SA 3PVXA 3VALA 4NA2A 4DV7F 1KLNA 2I5JB 3VTIA 3A3PB 2N7CA 8RUCA 2YQ0A 1SC3B 1N88A 3GFHA 4I6YA 3GIIA 1V5IB 3GTYX 4J7CA 4JI2J 2HGLA 2DY1A 4DR7J 2FPHX 3CCQS 3KLHB 4P7TA 1QDUB 3BS9A 1WDTA 1P27B 3QWUA 3LP0A 5EGYA 2BBEA 3CULA 4ED1A 1ZBTA 4DI6A 4DG1B 4LQ9A 5MAOA 2VPYB 1AFJA 2LA4A 4WBFA 1UVKA 3DNCA 3IA0A 3BV8A 1GMWD 5HJXA 4M5HA 3ZZOA 3OV7A 4NYPA 3FQKA 4ECWA 3DM2A 4ED0A 5IWAF 1KLMA 4K59A 1TVRB 3PG9A 2ZH2A 2KG1A 1N32F 3SDEB 2KRBA 5DS7A 1FWLA 5E3PA 2HVEA 1RISA 1RE1B 2QL9B 3A8EA 2PSZA 3SCJE 3QRRA 1B64A 1LW2A 2NUUG 2DB1A 4IYQA 3G8TA 3Q24A 1VQMS 3KLIB 1PO6A 3MWBA 4OZNA 4YFUA 2YWGA 2A1BA 8AT1B 1FJEB 2DT9A 4N56A 1RTJB 1VBXA 4K2XA 2UU9F 3IRXA 3QPIA 1RT3A 4BDPA 5D4PA 4YR2A 4A46A 1LV5A 2W24A 2Y9HA 2C42A 3HSJA 5DG8A 1F3VA 3M8PB 1AFIA 1ZTTA 1AZSA 4PZVA 1FD8A 5D78A 1XNQF 1ROFA 1Y00A 2BKNA 4XO0A 1ZZFA 1NK4A 4RBUA 4F25A 4XDDA 2ZOMA 2B4OA 1WC1A 3HT3A 2LKZA 2XBPA 3CC4S 1Q95G 4R5PB 2ZHAA 1F3FA 1S0NA 4ZCKA 4DHVA 1VK8A 1JJ2R 3NS5A 3A8JA 4DL2A 1HD0A 4DV6J 1KOOA 1GT8A 4DV4J 3POTA 1KHVA 2PO4A 3BB5A 3I4HX 1SB6A 1I51B 5L1JA 1IKWB 4X66J 1YKWA 4LFCJ 2FUG9 3KWMA 1GMWA 1C1CA 3Q8PB 3FRYA 1HNVA 2W2NP 3MM8A 3FBCA 3DRSA 4J90A 1P1LA 2MKCA 1RTIA 2X51A 4ZJOA 1WELA 3ET6A 2GAGC 4X4OA 2VJUA 3O6QA 2I1RA 2KFYA 4M5LA 2BYCA 5B0AA 1KQSR 1FJCA 2ZH3A 2RHSB 2MKKA 4BC9A 3ZTOA 4PWWA 3CNQP 1TK0A 3CJTA 3DCAA 3I0SA 2HFZA 4O3PA 1TL4A 5A8WA 4DQQA 4KV8A 4WPAA 5HBMA 3NCQA 1MU2B 3PFOA 2PD1A 4ILRA 2K3IA 2G1HA 4DPTA 3P6YC 3FBFA 2Z2YB 3EICA 4I67A 3L7PA 1ZM3A 1V3SA 3E01A 1FT8A 1IBCB 3T6JA 1U2FA 4JYAJ 4CLYA 4J9VA 1ZZNA 2IIHA 2DNLA 3T5LA 4OYPA 1VRUA 4C97A 1ITPA 3BSOA 3CJKA 4JI0J 1ZPWX 4GKKJ 3I9ZA 4K5RA 3MCOA 1CC8A 1URNA 1C4CA 5KG7A 1K1SA 4HHUA 4TY9A 2KRRA 3SI8A 1Q7LB 3HHNB 3KLGB 3RW6A 2OFHX 2YKOA 3Q2SC 3M1VA 4ZP6A 4UT4A 2VFVA 1D8ZA 2DGSA 2VQFJ 1OSCA 3GG1A 2RHQB 4Q43A 1BLUA 2OD4A 2C3OA 2UUWA 2EI5A 2HVDA 3S1TA 3NNAA 4NEYA 5ETOA 3TZZA 3MECB 3OVAA 4A8SA 2QFJA 1Q0NA 4ZLLA 1G2EA 1UJ6A 5DQGA 2ZUGA
chains in the Genus database with same CATH topology
4OIXA 2CRLA 2JX2A 4LMZA 4WZMA 5K14B 1S7HA 4UQTA 2MQPA 1WTFA 5AE2A 4X4VA 1UETA 5KT3A 1RTDA 1YBAA 2GMJA 2JVRA 4E8UA 2IFXA 1H0HB 3PIPQ 3CJ5A 4USJC 2UXCF 4X4RA 1C1BA 1ZYQA 2M70A 2EG1A 3CO9A 1W25A 3DDNA 2MSSA 2VA3A 3PFEA 3GV8B 5HN0A 3SSSA 4YB1P 5D8HB 3CB4A 4F2SA 3QJLA 2DBBA 2JOQA 3R1LA 2O01C 4JV1A 4LVNP 1C2PA 5HMWA 4A8MP 1YITS 5I3UB 1F5BA 2APOA 3EXYA 4QQBA 3DOMA 2CJBA 4PG6A 4ZHRA 4QPXA 4NLQA 3IAM9 3G9CA 1H6KX 1L3SA 4O4GA 3MCSA 4O44B 1T03B 4Q2LA 4K4WA 2JWNA 3IR7B 5CQGA 5K8PA 4TU9A 3KHRA 3ZZZA 4O4RA 2QRRA 1LOUA 2BRKA 2AW0A 5HROB 4KHRA 2K1RB 4H4OA 4OLPA 3OL9A 2DH8A 1WHWA 4RUAA 3RTVA 4AUKA 2BDPA 2KTQA 2XG8A 2C3UA 2L48A 3I5CA 2E1CA 4QIVA 4M8LA 2R7WA 2YNFA 2CPJA 1CG2A 3UWTA 1N8RT 1RTDB 4K4ZA 4DSFA 2XWXA 3GV5B 4OI3A 4TY8A 2IVYA 1MNEA 3LP2A 4K4YA 3VAIA 2HAIA 3OTDA 2ASLA 2PI5A 4W90B 1DAXA 4OMFG 4YP3A 2B9XA 1C1BB 3PO5A 3NKYA 3L3CA 3KG0A 4A48A 2BVZA 2V4QA 3BO3A 5DLGA 5JJBA 5DJBA 2DGTA 3UE2A 3OTOF 1S1VA 1WHXA 2VH7A 1SBRA 1IQZA 4CCHA 1SJ3P 2DNYA 3AQOA 4KAIA 1CQMA 2JJ4D 1U1KA 1HQEA 3DLKA 3PEHA 2UUAF 1U8SA 3L95X 3CCUS 4ZHRB 4FF2A 3VR1A 1S1TA 2YX4A 3UR0A 3CDEA 4O4GB 5F3TA 3F56A 2MKJA 5A6WA 4CTAA 2IBOA 4RWWA 1XN9A 5E3RA 4DJBA 2HLUA 2YKNB 4JI2F 2NYIA 3CDWA 4IFYA 2ZH5A 1Z2LA 3MXHP 4QU6A 2KT3A 3N5FA 1LXJA 5IT9Y 4H4OB 2DNHA 5CXTA 2EW9A 3GR1A 5B0CA 4AFFA 1SJ1A 4DR7F 3MM5A 4Q7AA 5DDQC 1N5VA 3OL8A 1X4FA 2JZ5A 2YNFB 2DIVA 2D3UA 4ZP7A 1AUDA 3OTCA 4C9DA 5LMNF 1UL3A 3GSDA 4TY8B 3LP2B 4O3SA 2DGXA 1X8DA 3MMBA 1YJWS 4MYTA 4EEYA 4PUOB 3MD3A 1UJ5A 3ETOA 4GC7A 4PPDA 5DGBA 1ZAWA 1S72S 3ONQA 4DR5F 2Y0SD 2YWEA 2OD6A 3I4PA 1S1VB 2W8KA 4OI6A 1FO1A 3G8QA 1Y5NB 4DFKA 3GZ7A 2CQHA 5F8MA 2IRXA 2W9BB 1HQEB 3DLKB 3KHGA 4A8XA 1JKHA 2XS2A 4RKUC 2LU1A 2EPIA 5BYSA 1S1TB 4JI4F 1KN6A 2BOPA 2AX1A 2UXBF 1FK9A 4CTAB 2DRAA 3IR5B 1FKPA 2EFGA 3K5NA 2HHUA 2YKQA 3D1OA 3KTQA 3DHXA 3PX0A 3SDEA 1QVGR 2OTJS 4IFYB 2E5IA 1NHVA 3FMBA 2GFFA 4C11A 1UEUA 1OQ3A 4TQRA 4DLGA 5K8OA 2ZJQQ 4DN0A 1T7PA 4IUFA 2XCPA 1SL2A 4UY85 2MKHA 4ALZA 7FDRA 1VOMA 4J9NA 3MM5B 4QOTA 5IQ6A 3K8WA 2FLNA 4OHYA 1YTYA 2HIQA 1GXUA 1HWJA 1VQ5S 4YHHF 1RTHA 4C8NA 3CDUA 5HMYA 1VQYA 3CD5A 2E5LF 3DRRA 4D3GA 4IKAA 5F3ZA 3CCLS 4FF3A 2E1RA 5KFJA 1UFWA 4ID5A 3MZIA 3PW5A 3QAUA 4KT0C 3ISZA 3MMBB 4ZVGA 3NAIA 5K8MA 1RGVA 2CJKA 4N47A 5B0GA 2DD8S 2POKA 5IS2A 4LF8F 3TA0A 2UXDF 1IUJA 1HI8A 2I0XA 4FBUA 5F8JA 3J7YU 1SXLA 3GV7B 5AE1A 2OPPA 2R8HA 4QBUA 1EP4A 2QMXA 3MMCA 4IOBA 3VWSA 2DGOA 4RZRA 2N4DA 2FVPA 1SH2A 2VKRA 2ZNZA 2BACA 2X1GA 5T41A 4ECUA 1I94F 1RT6A 3I55S 4NLSA 1JKHB 1QAYA 2AX0A 3HHLD 1CLFA 1R6YA 3DN9A 1K8AT 5KFPA 4DSEA 1JWWA 2B0GA 2HHXA 5B0EA 2HYIB 3FVYA 3M6XA 1U45A 4OHXA 5DQIA 2VKZG 2BM1A 2W9AA 1FKPB 3MM9A 4ED5A 5KOXA 3ZZUA 1M5PC 3WDOA 1U1NA 4C11B 2VG6A 2ZC3A 2IM1A 4KQZA 3GILA 2AP6A 5DDRC 3U1MA 1C0UA 2C3PA 3M2RA 1G6BA 2I9SA 3H20A 3MOJB 2A2CA 4TYAA 4ZCIA 2L41A 3V4MA 2B43A 4B9UA 4N41A 1RTHB 2FY1A 3TQ1A 4QCLA 2NUHA 2VPXB 3N6LA 1IJFB 2MZJA 2ZH9A 4K4SA 2PEHA 1HD1A 3CJ4A 4Q8EA 1IKYA 3DRRB 2R9LA 5CD4H 3H5XA 4NPOA 2YKAA 2CFXA 4DS5A 4CNYA 5KG6A 4ID5B 1WF0A 2C2EA 2VBWA 3DLGA 1Y4ZB 4NLPA 1S6UA 4RW9A 3PEJA 1BQMA 3M05A 4JBCA 4B3OA 5A0YA 1U1OA 2KJWA 1T8EA 2MQMA 4HTIA 3C6TA 3M8PA 5IQQA 3F73A 2G1DA 2OPPB 1BQXA 4G1PA 5KT2A 1EP4B 2VG7A 3MMCB 4OFZA 1UA0A 4QU7A 2WCXA 3SZ2A 1F0XA 3HVWA 2BZ2A 2IAJA 1SL1A 4HDHA 1RT6B 4LFBF 3N5BA 4KTQA 1RK8A 3PXGa 5J1PA 2DITA 2VL1A 5FJ4A 4I56A 1YJTA 5HQ8A 5LSOA 2WTFA 4KHMA 2CQ3A 4I7FA 2IYGA 3RYLA 4EFAC 4WJBA 3DGPA 3MM9B 4FNIA 3UCGA 3KK3A 3PHEA 3PX6A 1S9EA 5F8GA 5GADI 4B02A 2VG6B 7FD1A 3CSKA 4OHVA 1HL6A 1P1TA 4DV5F 1C0UB 2V8GA 1NAQA 3M2RB 2V4RA 3MM7A 3CJ3A 3CMES 4R25A 4ZK7M 2ROPA 4F3QA 2E1MC 2JDJA 2L9NA 3BM7A 5JXSA 3ZZ0A 5DQHA 3HDSA 5CYQA 5H1SV 2RUGA 5U47A 1FF2A 1VFJA 3MR3A 3CWJA 4W92B 3FSIA 1IKYB 2I8EA 3OFHA 3VZIA 4LIRA 4ZCLA 1S0OA 3Q23A 1VMBA 3MMAA 2VFUA 1QAIA 4NCGB 3D2WA 1TUVA 2AV5A 4DV1F 1U6FA 2ERRA 3E8OA 2XS7A 3DLGB 1VGYA 3KK1B 1BQMB 1X4AA 2ZZMA 2MKSA 4B3OB 5A0YB 2GCFA 1YRUA 3JTPA 2KVIA 3C6TB 2UP1A 4IQXA 3DOKA 3U27A 1Y9OA 5B7WA 2HHTA 1WG1A 4QWBA 3KG1A 2VG7B 3CCES 2Q43A 1FCAA 4G6VB 2ADBA 4O3OA 2JVOA 1E6VA 2CPEA 1URRA 3BSAA 2IAJB 2R7TA 1TL3A 5J1EB 1S1UB 4NLDA 4ED6A 4KO0A 3N0VA 2BQUA 1FVSA 4LUBA 1KFSA 4K50A 4OI4A 4I7FB 2GX8A 2M7SA 4BWJA 4WZQA 2XHWA 2K7KA 2Q3PA 3JSBA 1NEEA 3KK3B 3NGKA 4C98A 3PR4A 1PILA 1S9EB 5D4OA 1SI9A 2EK6A 3E51A 3MUTP 1S9GB 2HNZB 5B0DA 4NLTA 1JMTA 3SQGA 1FA0A 2CQ2A 4QR2A 5J2PA 4HT5A 2OPSA 3G6VA 1MMLA 1V9OA 3MM7B 1S4FA 4NL5A 5KFGA 2IBKA 3OPKA 3Q2TC 4QYRA 2IVMA 4RU9A 5CYQB 2DJWA 1XR5A 1XMQF 3H2VE 3I6PA 3ZFVA 4ZP8A 2RRAA 3VAHA 4OZJA 2PGCA 3IRWP 4X66F 3MMAB 3W2VA 1VQSA 1QVFR 3BQ1A 1HHSA 5E2QA 1DQAA 1NHUA 1RAJA 2UVWA 2PT0A 2IYIA 4DUYF 4O23A 2D74B 3SSRA 4MFBA 3U02A 3M4XA 4G1IA 4DQPA 1RYSA 3DOKB 2VFRA 3J7Z5 4KFBB 4I2QA 1GTHA 2ZJPQ 4F02A 1RT7B 2YH0A 4J9KA 3OJUA 4Q8FA 5D6GA 2HHSA 1E6VB 5GAEU 2C3MA 5E3CA 2FJDB 1TL3B 3I9V9 2AYBA 2KT5A 1DQ9A 1TQLA 2YVSA 4CO5A 1SJRA 4C8ZA 2G9OA 1QM9A 2DNGA 2G13A 2N82B 1W2BR 1ULRA 6FD1A 1X4GA 4KO0B 2RILA 4YDXA 4YY3F 5K5MA 2NSCA 4ECRA 2KN4A 1U7LA 2XMVA 1U1MA 1K0VA 1PC5A 5KFMA 4Y3CA 3P49B 5C5JA 3BR8A 3DRPA 2FGOA 4PG4A 4OX8A 2JEJA 2B5JA 1JLAB 1HFEL 4WU2A 2GHVC 4ZDNA 4JUZA 2AJ0A 4ICLA 3MEDA 1TV6A 4YEAA 4DFJA 1HNXF 3SQGB 5KFUA 5J2PB 2FVSA 2OPSB 1MMNA 1LWEA 5KFTA 3CXCR 2FTRA 3N4WA 3U1LA 4F26A 1UVNA 3HVRA 3HHLA 4N77A 3HKZD 4ETZA 2HFNA 4Y00A 2ATLA 2BABA 4AXJA 3H4BA 1MSWD 4RX6A 3THTA 4AL6A 2ZDPA 1GH8A 1CSJA 2KG0A 4WK1A 3W2VB 2HVIA 4NLYA 2MY8A 3SFUA 2J9CA 1FEEA 2HRUA 1U09A 3IFEA 1FTRA 4RBVA 3KHLA 2YKMA 4YOEA 3LQVA 4CH1A 1NRKA 3TI0A 3AH6A 5CA5A 3AAWB 4JI8F 3FQLA 2J6SA 4PG8A 3MUMP 2PI4A 5KFXA 2R8JA 1LK5A 1U6BA 1N0VC 2PN6A 1X5SA 2RDIA 2JHEA 2DH7A 2EFQA 5HP1A 3PV8A 1CVJA 2IJFA 3CTRA 3CPWR 4H4KA 1DHMA 2A18A 4A8KA 2H9ZA 4URQU 3M6UA 4M5DA 4IH7A 2PC6A 1FHTA 5T14A 5ITHA 4X4NA 4PRFA 3RRKA 2RKIB 4U6PA 2KI2A 2AJ4A 3VQSA 4I6WA 2L9WA 4DLEA 3RAXA 1GTEA 3SMZA 1JX4A 4HVZA 2HWHA 1VQOS 3R3TA 1UVLA 2AJ1A 1C0TB 4LIWA 4NWBA 3IXQA 2DGQA 3Q22A 1RDRA 3E3XA 3GFZA 4KE5A 3M30A 3OL6A 2XB2D 2KFZA 4A4JA 2HG4A 2PA3A 3J81Y 3TUIC 1HWIA 3DRPB 1H38A 4ECSA 2KXHA 4PQUA 4QZVB 2B5JB 2J8AA 5T7LA 4RW8A 2ILYA 4ICLB 1DTQB 2K8GA 1TV6B 3MEDB 3ZZYA 2FLLA 4PG7A 5GAGI 4MJKA 5GVQA 2VPZB 1LWEB 4ES3A 3ITHA 1S79A 3G6XA 2KFNA 5HO4A 2CQGA 2J9EA 4C3KA 4ZLPA 1WG4A 4R0EA 4Q2MA 1Q81T 1JXLA 2ROGA 3HHLB 4OZ1A 3DC2A 3IO1A 1M5OC 2QMWA 2O5DA 4WIIA 3RRGA 2AGQA 4F4YA 1J5EF 2KH9A 5I3PA 2RU3A 4I69A 3OHAA 3ZC4A 3M8RA 2CPHA 1KTVA 2YKMB 2EK1A 3TP2A 2F8HA 5E3AA 4CH0S 3R27A 4JYAF 4C3LA 1BWEA 3FEZA 1D3WA 4F67A 4DDFA 4X64F 3OLAA 3EX7B 5HP1B 2HHQA 4YDDB 3UW1A 3T1AA 1KS2A 1WEZA 1NKEA 3D1HA 3IBWA 2IC3A 4J9MA 4Y2MA 1U1PA 4M5DB 2V94A 1KR4A 4ZVFA 4JI0F 4ZOSA 4IQMA 2XZWA 1LFPA 4EUVA 2W7OA 3OFEA 4HTJA 4WXOA 4GKKF 4NXNF 2JEIA 3O3LA 2RRBA 1S1XA 1NZAA 2GGPA 2OSQA 4OJGA 3BQ2A 2KM8B 2P9EA 3AB2B 2DNQA 2WHOA 2XSFA 2WSFC 3CVKA 4UOCA 1FRJA 2F7VA 4KPYA 3NMRA 1Y5IB 2QLXA 2UV8G 3M30B 5F41A 1U4BA 4EWTA 2C3YA 3FDSA 3HI9A 3PJWA 4U7UK 1KVJA 3K2YA 3JB9k 6FDRA 1FDNA 4HH0A 3LAKA 4RW8B 5T7LB 1HPZA 4QWEA 1YRXA 3EZ5A 4ZPBA 5AXNA 1FXRA 2EG2A 2VOOA 1NU4A 3ITHB 3TAMA 4CO4A 2E5GA 1TKZA 4Y2IA 4RNNA 3K8VA 3HK2A 1YI2S 2CPZA 1ZETA 2R7UA 3N79A 1S99A 5E33A 1R8AA 1FERA 3CCWA 3LF0A 3OR1A 5IT0A 1GQEA 2KYXA 1D1UA 3SCKE 1GX5A 1KHWA 2V9KA 5L9XA 3NL0A 1SV5A 1T3OA 2B51A 3PRBA 4NA1A 4PG5A 2Z8QA 5KG0A 4ZP9A 3MTKA 3UPFA 4EBDA 4KBIA 1S10A 4C4WA 4IRKA 2OP5A 5I42A 3UDLA 2UVRA 2LDYA 2F1FA 5J1NA 2FVQA 2IC3B 5E0OA 2NLWA 3D1QA 1ZPVA 1LWCA 1TAQA 3NRBA 4MAKA 3T9ZA 3TA1A 5HLFA 2QEXS 2DISA 4LQ3A 1S6PA 2LEAA 4H54A 4NYZA 3UNGC 1S1XB 4WXWA 2COLA 2ZITA 1CQNA 2C22A 5ADZA 2VB6A 2BXJA 1N6QA 2WSEC 2HS0A 5EX0A 3FEXB 3T9NA 5CZXA 2R8IA 2XMTA 4NMLA 2EBGA 5K8NA 5I3UA 2E44A 4HYKA 1VJWA 5EHHA 3G6ES 4MTPA 5B08A 1HPZB 3EYZA 4HKQA 3GQCA 1WI8A 2ZBCA 3DMJA 4NRUA 1V3ZA 3FMWA 4DFPA 5L39A 4X84A 3JYTA 4KRWA 1T03A 1HW8A 4KIAA 3TAMB 5LT5A 2CQ4A 3I56S 3BJYA 1TKZB 2EFOA 3NS6A 5BJRA 1R27B 1SKWA 4L72B 2RQ4A 2FC9A 1Q78A 1HQUA 1F2GA 3LP1A 2DCUB 2K1RA 1F5AA