5AJ3F

Structure of the small subunit of the mammalian mitoribosome
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
123
structure length
123
Chain Sequence
PRYELALILKAMQRPETAAALKRTLEALMDRGAVVRNLENLGERMLPYKISAHNQRHSRGGYFLVDFYAPATTVESMMEHLSRDIDVIRPNIVKHPLTQEVKECEGIVPVPLEEKLYSTKKRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITORIBOSOMAL 12S RRNA
publication title Ribosome. The complete structure of the 55S mammalian mitochondrial ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 18
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2015-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5aj3F00
4YHHF 1XMQF 4JI0F 5AJ3F 4DV4F 2UUBF 2KJVA 4DR7F 4JI1F 4DV2F 1N34F 2F4VF 4NXMF 2B7CB 4DV3F 2UUCF 1HNWF 4DV0F 4DUZF 1HNXF 4DV5F 4DV6F 4B3MF 4DUYF 1XNRF 1GH8A 4DR5F 2YY3A 4X66F 2UU9F 4OX9F 4LF5F 1CQNA 4LF9F 3T1YF 4B3RF 4JI4F 1HR0F 4GKKF 5BR8F 1G7CB 1XMOF 3ZZPA 4LF8F 1N36F 1RISA 2BXJA 1N32F 2HHHF 4B3SF 4B3TF 4LF4F 1J5EF 1IBKF 2UXBF 4JI6F 4KHPF 4JI7F 2ZM6F 1B64A 4DV1F 1HNZF 4DV7F 1I94F 1IJFB 2UXCF 1IBLF 2UUAF 1VMBA 4GKJF 4LFBF 1FKAF 4K0KF 1G1XA 4LF6F 4YY3F 2RJZA 2J5AA 4DR4F 1QJHA 4NXNF 4X65F 4DR3F 3T1HF 4JI3F 3OTOF 1F60B 1LOUA 2KJWA 4X64F 4LF7F 2VQEF 5LMUF 3R3TA 4LFAF 2UXDF 2BVZA 4DR2F 4JV5F 5IWAF 4AQYF 4JI5F 1FJGF 2B7BB 4DR6F 4DR1F 4LFCF 1IJEB 1CQMA 1XNQF 1N33F 4X62F 4JYAF 5LMNF 2E5LF 4JI8F 2VQFF 1IBMF 4JI2F
chains in the Genus database with same CATH superfamily
1T03A 4Y2MA 4K4UA 2GO9A 1NDKA 3TVZA 3MEKA 4DV3F 3NS6A 2APOA 2J6TA 5ETLA 3MTKA 1G3OA 5B08A 2R8HA 3I0RA 1H73A 3NBPB 1Z2LA 3H8YA 1JKHB 4DFPA 4ID5B 3OHAA 3W60A 2K2PA 5ADZA 1RT4A 2VASA 5LXYA 1RTJA 1RAHB 2W1BA 3ZZZA 5KTQA 1SUQA 2H4WB 4DV6J 3QT6A 1WELA 2UXBF 4RX6A 2DH7A 1FWKA 3ENVA 3BBBA 2V4RA 4C8KA 3JTOA 3IP0A 4WYWA 3SQOP 3OTOJ 3T19A 1ZM3A 2ZDOA 2X3GA 4TVAB 1DQAA 4DSJA 3TUJC 4RWXA 2MLYA 3Q83A 2ZUGA 5BXIA 3W9IA 2D69A 2F4FA 5LMNF 3CCZA 3I9ZA 3KK2B 5KFQA 2BW7A 1YG0A 1J27A 4WFYA 2W7PA 4CZCA 1KTVA 3H98A 1REVA 2ZOMA 1B70B 1XWLA 3NP5A 1K47A 3BQ2A 3HFVA 5A6PA 1OO0B 1WC1A 1Q8IA 1RISA 1S6QA 3T41A 4OLPA 5IXUA 5B0EA 4U7UD 1Q4RA 3JYTB 3PKMA 2JL9A 3BSNA 4O4GA 2A2CA 1JNZB 1S6UA 2DK2A 2PA8D 1UPMB 5CCLA 3BDPA 4UUXA 3CJ4A 2VZ9A 2GJFA 4R25A 2ZE2A 2A18A 5E2QA 3EICA 4OLOA 1JLQB 4X64F 4ICLA 2CXEA 3K5PA 5KFLA 1QAIA 1HNZJ 1VLOA 3DLHA 1JXLA 3KK3B 4ZA1A 4H4MB 1Y11A 1SL1A 1RAFB 2DD8S 3A8KA 1B7FA 3VQSA 3PJXA 4X62F 2DGVA 5D4LA 1PKUA 2ASDA 4N47A 4OYBA 2QMWA 2ZH2A 4MIBA 3C14B 3QGPA 3P45B 4AUKA 3I5AA 2ZNZA 1FJGJ 2R7RA 3TA2A 1RAEB 2W8KA 3W3SA 1LNQA 4ZDNA 2E5IA 5J2NB 1E6YB 1UCNA 1G4CA 4O4RA 2V63A 3TVYA 3W62A 3ZZPA 1U1OA 1TK8A 7FDRA 3BGUA 2AZ3A 3CJ0A 2RF2A 3FNNA 5KFTA 5F3ZA 1RBLA 3IC1A 1VBXA 3M9NB 1S4FA 5I3QA 3OFFA 3LPEA 2OFHX 5EDWA 1TUVA 1WF0A 1X4DA 1FDAA 3TANA 4QU7A 3BF4A 1FO1A 1OJ4A 4X4QA 1VQYA 3BM7A 1YKWA 1RT4B 3RJMB 1RTJB 1SUQB 2ZBIA 2JH3A 1YGYA 5HQMA 3RUBL 5LOQA 1VBYA 3PO5A 3KJQB 4NLRA 2XLJA 2KT2A 3CXCR 2KB2A 3BS9A 3HHNB 1HNXF 3V6KA 2PI4A 1X5PA 2UV8A 3M2UA 5IM0A 1WF2A 2EFOA 1ZAVA 2QA1A 3O5TB 3VAKA 3OW2R 1RWMB 5BR8F 3M9MB 3HVTB 3H90A 1QAXA 1WEXA 5M2UA 5HBMA 1HWUA 3LGMA 4F02A 4AL7A 3KJVA 3VAGA 2HZVA 2AQ4A 4ZVTB 4DFMA 3JQKA 2R7OA 4DSIA 3TO8A 2VKZG 5FD1A 1REVB 1F6TA 4J9MA 3TZZA 4P9SA 4RWWA 4QWAA 4CLPA 2DJWA 4JI3F 1KHWA 3R7BB 2C3MA 5KG5A 3OQ2A 1S6QB 2LCWA 1UKUA 2UUWA 3M8ZA 5DLGA 4C8MA 1HBUA 4YOEA 2LP4A 4ZIWA 1FKPA 3GG1A 4O4GB 2MGZA 3J80Y 5DM6Q 4V1Ak 2DNYA 4DX5A 2F8EX 2CVEA 2ZE2B 5D4PA 4ICLB 4WTOB 4ETXA 1V3RA 2PN6A 1Y5NB 2GIFA 4K50A 3MCMA 2HGNA 3TUPA 2MKHA 2KZZA 1XMOJ 4O23A 4RUHA 2LA6A 4UQTA 1TV6A 2BYCA 1ZH5A 2CJQA 3H42A 3MCSA 1IQTA 2KRRA 2ZM6F 4NZ0A 4ZPAA 5KFHA 1F9EB 3ZZUA 4F8RA 4O3PA 5F41A 4B9LA 1WKLA 3O1LA 3U1MA 1N5YA 3ET6B 2ACYA 2BABA 4HDHA 4JV5J 3M2VA 2WAQD 4K4WA 4JBCA 1HWLA 2D1CA 2RF2B 4RU9A 4F4ZA 1WC3A 4DR3J 1TVRA 2PE8A 4P2SA 3QMQA 1RACB 5EWEA 3I5CA 2B7CB 2W8LA 4ED3A 5GAGU 4ZVHA 1MNEA 1KOOA 4DL3A 3V6DA 2Z2MA 1R8HA 3FZBA 2QFIA 2GFFA 2OGUA 1DAXA 1ZM9A 1VQOS 1RTIA 2V9WA 1S57A 5IFMA 9RUBA 1M1KT 3SCIE 3V5RA 3PZPA 1B64A 1YLXA 5EX3A 3W8GA 4B9UA 4DV7F 4A8OA 4GKJJ 2H5IB 4LF6F 4URQU 1C4CA 3FCHA 5I42A 3KNAA 5FJ4A 3M2UB 5IM0B 2V8PA 3MMAA 1RYRA 1RT1A 3CO9A 3K57A 4DX7A 2YNHA 4DBQA 3HZEA 1WOPA 5HBMB 2WVFA 1DARA 4USIA 3KJVB 5D0EA 3SBMA 3GP9A 2K3IA 2G2OA 2IRXA 2DO4A 1YITS 4R0EA 3L7UA 9ATCB 2XYPB 3QYYA 1HNWJ 2DGTA 3NS5A 3X3UA 1XR6A 4ZVGA 2QSWA 4DX6A 3MECA 2QFJA 1K73T 5DG7A 5HP1B 4K59A 1HBUB 4U67Q 3AHPA 1FCAA 3GCWP 2YX1A 1O8BA 2KYZA 1NKEA 3PNIA 2CPEA 2MGZB 2BE2A 3QJLA 4FS1A 2WHOA 3X1LB 4RBTA 3WBZA 3I96A 2Z0GA 4ANCA 2AMCB 1HFEL 4ECZA 5DETA 4ZKAA 3GIKA 3UR3C 1WC5A 2IA0A 1RKJA 4EFAC 1LK5A 2JZ5A 3HFZB 5E5NA 1ELOA 3FZ2A 1PC4A 2XZTB 1DRZA 2IVMA 2QIFA 3M8QA 4OI0A 2RRNA 2C2MB 4UF4A 1EZZB 4ZHRA 1GFWB 4X4OA 3DI6B 5D4OA 2NYHA 1K0VA 2AIRB 3OTDA 3P8BB 4F3QA 2E5HA 1S5ZA 2EFNA 3R9LA 3DGVA 1KQGB 1N5YB 3A8EA 1RWWB 4B3MF 1D1UA 2IVYA 4ANEA 1RKIA 1RDRA 1N0UA 3M2VB 4JV1A 2VG7A 2MKIA 1FWPA 3ZZTA 2Z2LA 3TEGA 1TTHB 4YQWA 1TVRB 3M8PA 2BJ9A 2MQPA 1UW9A 1C2PA 5E3PA 1S0OA 4ZP7A 4YMEA 1TR0A 4PG4A 3PX0A 4XAKA 2VA2A 3PW7A 2O3DA 1I1GA 3V6DB 1Y7PA 4DQQA 4IG3A 4OYMA 2W9BA 4PWUA 1N6QA 1OQ6A 1T3OA 1QM9A 4KKOA 3PKYA 2FC8A 4HH0A 1RTIB 1X0FA 3UN2A 2U1AA 1QE1A 3KNGA 2ADCA 4AYBD 4DR1F 2RILA 3BQ1A 2I0XA 5IQQA 3DOLA 3DNCA 4CO0A 2MXYA 2PT0A 2H3EB 3MMAB 4XIUA 1M1HA 2LEBA 4IH6A 1S48A 2YPZA 2W2QP 5K8MA 1O5JA 2YNHB 1FE0A 1RBAA 2QL9B 4WFBQ 4DQSA 3ZZRA 5F8GA 4KY3A 2LQBA 2FD2A 1UVKA 3UR0A 3R2CJ 4ZITA 1D9DA 2BKNA 4B3TF 3MOJB 2RMLA 1KHVA 1XTZA 1HNVA 1WHWA 2XO7A 3VGSA 4A8YA 3P96A 3EYZA 1BUXA 2YH1A 2QJ3A 2HHUA 2R4FA 3VR1A 5KOWA 1HW9A 4CM2A 3HHDA 2FZCB 1S6PA 4DU8A 4LF4J 3MECB 4CRJA 1RT5A 1JIHA 4C3LA 4LIRA 2L9NA 3IS9A 3US5A 1P1TA 5EWGA 4GC7A 4W98A 4YR2A 5IT0A 3GIIA 1YBAA 2KYXA 3DLEB 2ILZA 1RQ0A 2HS3A 1FRIA 2DVIA 4WU3A 2NXUA 1TQLA 3T6BA 4A8QA 1NPPA 3PY8A 1MU2B 1TU0B 2H4YB 3CSKA 3D0HE 2Y0SD 3OVSA 4K4TA 4LQ9A 3HHLA 5JVHQ 4ELUA 1UEUA 1T0TV 2A0FB 3HKZD 1N88A 3CDEA 2M7SA 5J2PB 2FJEB 3I5BA 1VK3A 5CXTA 3CD7A 2L9WA 3G86A 4LREA 4DUTA 4HI2A 2P9CA 3GFXA 2Z30B 5KFDA 1FRLA 1DZ5A 1UVIA 4NLOA 2VG7B 3T1HF 1KQKA 4L74A 3D66A 1YZ6A 3M8PB 2DITA 5A6WA 3CCUS 4IYQA 1RXOB 1U8SA 4DS5A 1S7IA 3KG4A 1T95A 1F3VA 4ECRA 3B54A 2UP1A 4IG3B 8AT1B 4Q44A 1RZMA 1N6QB 5LMUJ 5DS7A 1XEZA 2KXNB 3CCLS 4KKOB 5E33A 5MLCV 3L4BC 1JMTA 5J1NA 1B0VA 5KG0A 4M5MA 1JXVA 3TQEA 1DFDA 3LF0A 5AXLA 3MPWA 2N3LA 2BDPA 1QE1B 1FVQA 1PC5A 4RNNA 2WW8A 4ENOA 4PYAA 3H2UB 2YNGA 4OJGA 3VZIA 3DRXA 2BM1A 3D4JA 4WCEQ 3DFEA 2FY8A 4USMA 4IKAA 2EG1A 2O1PA 4KV8A 4ZVEA 3OVBA 1XN9A 4ELTA 1MWQA 4M5GA 2E29A 1RHMB 1LWEA 5KFJA 2OLWA 4DU7A 2HFZA 4UT4A 3GV8B 3TX8A 5KG2A 2GAGC 1X9SA 3GWCA 4ED0A 3I31A 3WX8A 5IT4A 1IM6A 1Q8BA 1YJ9S 2CQCA 4LVNP 1EP4A 4A8XA 1P9YA 2MJNA 3FRYA 4HKQA 4X4NA 2EFPA 2ZH1A 2MEWA 4DCOB 1Q7LB 3IS9B 3BO2A 4Q45A 1Z4UA 1CVJA 1SJ1A 1V3SA 4M5NA 4G1IA 2NZ4A 2DYAA 1N36F 2XY6A 3PW4A 1VRTB 3J81Y 3CD6S 2B4UA 3QWUA 2UXBJ 2CQ3A 2C1EB 4X2BA 1HBOA 1UFLA 2ZHOA 1H7XA 2R8JA 5GADI 1SIWB 3HSJA 2LYVA 2ZHAA 3CGIA 2OAUA 2V6AA 2YQ1A 4NXNF 2D7SA 2FVQA 3HHLB 2ZH8A 3NGSA 2VG6A 4IR1A 3HVRA 2FGOA 5F3TA 5ETPA 3DRPA 3MEEB 4FPRA 1VBZA 1KEKA 4X65J 1L5UA 2HVHA 2V8GA 1T9XA 2GGPA 3UD5A 5F0UA 1N5VA 4H4KC 1KBRA 3G6ES 4JI1F 2KFNA 3D3CJ 3MM8A 3MMJA 1U2RA 3S6EA 3IWXA 1N5TA 2MHEA 2YX4A 3LH2S 4DEZA 5F0WA 1G2EA 5JXSA 2VFTA 3DDNA 4W4MA 2BXJA 5LM7E 4CT8A 2VODA 2QLFB 1AW0A 2W7OA 1N56A 4JI7F 2OO4A 3ZO7A 2DO0A 3PRVA 4IRCA 3VVTA 4DL0C 2KZMA 2E7WA 1VISA 2D9PA 4P7VA 5KFPA 3OFEA 3HXMA 6FD1A 1KRPA 1HHQA 3FJ2A 1R8AA 4LFAF 2HQCA 4C4WA 2KH9A 2XMKA 2B7BB 2WW4A 2YVSA 3BSCA 4OI3A 4DS4A 1FVSA 4KTQA 4KV8B 2VBZA 1LWEB 3DHXA 4O3NA 1JQGA 1S1WA 3SYZA 4OYIA 2C2EA 1FRXA 4DR6J 1GX6A 4CLWA 1JB0C 2ZVSA 3MWBA 4DN9A 4BC9A 5DO2A 1WEZA 1WHXA 4YHHJ 4LF9F 1NSAA 4OYOA 4A8FA 1RCOB 2XBPA 3IRWP 3BYPA 1BWVA 3I82A 1R0AA 2CPFA 3BH6B 4URGA 4QCLA 1JLFB 1EP4B 2WONA 1VBKA 5HL7Q 3MDFA 3EWGA 5C42B 1AA1B 2W2NP 2ZBQA 1I94F 2KO1A 1X9WA 3DHWC 3GR0A 3D1QA 3LALA 2QGFB 4JV0A 2RHQB 2CJXB 4NCBA 3BBCA 2DB1A 4J90A 5L39A 4TLQA 3C16A 1P6TA 1A9NB 2RB7A 2MZQA 4QIGA 3K5MA 3GSIA 3PW2A 3QT7A 2LDYA 3BEGB 2WVEA 2MJUA 1HNIA 1VI7A 4NMLA 1IBMF 3NGDA 3FSXA 2DGOA 2CPDA 4UOFA 2OPSA 3UCZP 4DR2J 4OI4A 5DDQC 4A47A 3GLJA 2VG6B 1JLCA 1KSPA 3LAKA 5IT9Y 5DQGA 3DRPB 3B6BA 5GAHI 4RO0A 1KTQA 2AYGA 1OYEA 4IFVA 4BCAA 2GGPB 2EC0A 2DNPA 2IYGA 5F8LA 1T9TA 3W2WA 4HT7A 4OX8A 1JLAA 1KLNA 3MM8B 3SQGB 3VAHA 3OFHA 3GYNA 2FVSA 4FYWB 2BRLA 1CJTA 1FE4A 3GJRB 3ILLA 2Y0BB 1DURA 4QU6A 3V6HA 4FBTA 4TU7A 1IWGA 4EBDA 1GT8A 4M1KA 3TAPA 3FBCA 2FZGB 2HAFA 3TYTA 2W24A 2HIYA 3BDEA 2M5YA 3QGGA 4D3HA 3W66A 1VC6A 2CQIA 3KYLA 2AU0A 4HL9A 4CLTA 3PJWA 1JLGA 2M2BA 2V0NA 3I56S 2HNZA 1XNRF 1S1VA 2DH8A 2VFUA 5HI7A 3L7OA 4U9RA 3OHBA 2KG0A 1WG1A 1PAEX 1RP5A 3DOMA 4DUYJ 4CH0S 2XEXA 3W9HA 3SV4A 4JI6F 4KHPF 1CC8A 1S1WB 4J9RA 1CEZA 4P52A 4P71A 3M7VA 3DLGA 2MQNA 1HWIA 2HFVA 3DRRB 3N79A 1WDTA 4RR5A 1M5PC 4PCQA 2PIIA 2CAJA 3C15A 4A8KA 1NDPA 3UW1A 1VQ8S 2QYCA 2GQCA 4J9UE 3VVUA 2XM3A 1R0AB 1TKDA 1RLDA 1JJHA 2WONB 1ZOTA 3E2EA 5E3AA 4FF2A 3QIDA 4PPDA 2F3JA 3UE2A 5CYMB 2MKCA 1FEEA 4DL7A 2DXFA 4M5DA 4F36A 1Q82T 2EEYA 3N9UC 2XMUA 4DV6F 3R97A 2B4PA 3C16B 5LSRA 1VCTA 2O66A 5IC6B 3JB9k 2B3TB 2HLTA 3K7RA 3EE3A 3J80U 1X5TA 5E0OA 1HNIB 4DCJB 4C8LA 2NPIA 2DRDA 2OPSB 1RAGB 5CABA 5DDOC 1S9GA 3EVWA 4DV7J 1HR0J 1RTHA 4K4ZA 3MPVA 4U6PA 3BGOP 1JLCB 4LF6J 3JXOA 3KHGA 3VTIA 4NLVA 3RYLA 4RNMA 1JX4A 4HHHA 4HH1A 2J7KA 2YNFA 4IFVB 4TQRA 2BOPA 4JUZA 3V81A 4QWBA 2O5DA 2QA4G 1D8YA 2MKJA 2DNGA 3W2WB 3MD3A 4B9MA 3HZGA 2RH3A 4CLYA 2BOAA 1EB0A 4MH8A 4ED4A 5ETRA 1JLAB 3H4BA 2H9ZA 4K5RA 3TX0A 4DN0A 2UUBF 3CJQA 3UPFA 4ITSA 1CJTB 1WOOA 4EWTA 3ZTPA 1VQKS 3UDVA 3LTOA 2HRUA 3CVKA 2H48B 3OTCA 4WTYA 2ZOFA 2G13A 3K17A 1FD2A 4ZLNA 2JSXA 2VPWB 1J5OA 4OZJA 1U6ZA 1IQZA 3R5AA 1HNZF 2CPHA 1IJFB 3NGRA 2LEPA 2DNLA 2HNZB 4C48A 1S1VB 1IKWA 1PJ5A 2J5AA 4DFKA 2XG8A 4NLQA 3CIZA 3KUGA 1EARA 2RQKA 1HBMA 4WE1A 3HK2A 2BV3A 1OY6A 3DOMB 3MR6A 3A12A 4DG1A 1S0VA 4YY3J 1FJGF 3G6VA 2MMYA 2ZH9A 3ZNUA 1D3WA 3MM6A 3RRKA 4ZPBA 3DLGB 3CTRA 4DV4F 1EQMA 1VIXA 1Q53A 3UN5A 2CYYA 3C15B 2BKOA 1Q78A 1UA1A 1XJWB 2B56A 4B3MJ 3RR8A 2JLEA 3GIMA 4FS2A 4C97A 3QAEA 1PJ6A 1GTEA 3M30A 2M0GB 1N34J 1ZA2B 5L9NA 3IMQJ 2V8DA 4B9VA 4QIWD 2DR5A 5DQHA 2XMWA 4AXJA 2AKWB 5KT2A 4IQXA 3MFIA 3CCRS 2D3OR 1S6OA 2BACA 2VFRA 1D9AA 1LWXA 4DCPB 3NG8A 3D2WA 2QZ8A 3Q2TC 1A7GE 2IJNA 3TWZA 1ZAWA 2EC2A 1F3FA 3D54A 4K8RA 5KFEA 2UVRA 3V4IB 1FRJA 5KFVA 4QPXA 3CO0P 2E1MC 2OUGA 1U09A 1FXRA 1WORA 4DR4J 2Z4PA 3FEYB 1PIEA 1IJEB 1S9GB 5H9FJ 1RTHB 4Q2MA 1DY3A 2LQ5A 5KFCA 4A4JA 2XO6A 2XCPA 3BKTA 2N7CA 3K2YA 4A8MP 4OZLA 2XI2A 4C2MA 4QWCA 2YNFB 1K8AT 2HQ3A 4JI8J 3MCOA 4C6AA 3ZTRA 3V81B 2IJRA 4JOUA 3NOGA 3HULA 3T1YF 2MQMA 1IWAA 3ZZYA 1SH3A 2ZBCA 4Q2LA 2DEJA 1MMNA 1T9YA 2P6TA 1VJQA 4OZ3A 4Y2CA 2NR0A 3M1VA 2UUAF 3QZ7A 2JDJA 1ZM2A 1N32J 2W7AA 2R2RA 2AYEA 2BANA 2ZH4A 1UZDA 3H40A 4DV1J 4P72A 3CCWA 1NB2A 5ETOA 1FF2A 4PUOA 2BE9B 1WC4A 1IBLJ 1NK0A 4K4SA 2JFDA 1N8RT 1SJFA 3VZHA 1J5OB 2JJ4D 1RJJA 1X8DA 3N6LA 5HQLA 2A3JA 3LOUA 2RIJA 4MAKA 2KU7A 4OYZA 1NSQA 1V9OA 1R8PA 2VOPA 4DJBA 2C2NA 1R8BA 2VQEJ 2HFOA 1UW4A 1YJTA 1GX5A 3PYDA 1BE4A 4FYDA 4B17A 4BLGA 5EWFA 3NMAA 1HBMB 1RB0A 2LU2A 3Q8VA 1SPBP 3AA9A 1YI2S 3PO4A 2FZKB 4WE1B 4NMXA 2GHVC 2K1RA 3KJFB 4DG1B 2JOQA 2F4VJ 1SL2A 3LQVA 2AJ2A 5K20B 3L9ZA 3TEHB 4IH7A 3MM6B 1JLEA 4KO0A 3SIPB 3IO1A 3DCAA 1VQPS 4C0OC 1G6BA 2O01C 1Q86T 4OZ0A 3TNVA 3HD1A 5K5MA 2B9XA 4RW7A 2UVWA 2J0XA 1B0TA 4FZVA 3KG0A 2ZWOA 3VALA 4DR3F 1AXQA 3M30B 2FJBB 2VKRA 2ZH7A 3EM1A 4F25A 2CNKB 3OSPA 3D9BA 2BJ3A 4WBFA 4CWBA 2GV1A 2L9DA 4ECTA 2VC1A 2WOMA 4JI0F 4MKAA 1UWBA 2R2TA 1T9VA 2Z2YB 4USWA 3BSOA 5E7OB 5A8KA 4WYLA 3GSDA 2JEFA 2F8HA 2V9KA 3CDUA 2W2PP 4FPIA 1U1KA 2CPIA 1N5QA 1UWAA 1Y4ZB 2HNDA 1IM4A 2V2KA 3EDRB 4TNOA 3SSQA 3PG9A 1QSSA 2QMUB 1FXLA 4C3MA 3P4UB 3PW0A 4L73A 4P10A 3P5TL 5DDPC 1NB7A 4PZVA 2KFZA 2R42A 1AUDA 4ETZA 1HARA 1NKBA 2E44A 2D9OA 4BBYA 1H6KX 3W8PA 1IBKJ 4NRTA 3QGHA 2EPIA 3M9OB 3UD4P 2B9WA 4U7UK 3KLEA 1FJCA 2Q6BA 2UXDF 5KT3A 2LLZA 2DXEA 5C2GA 1UJ4A 1VQSA 2RUSA 2LDIA 2AJ0A 3GYGA 2H5JB 4LMZA 1RWKB 1PYTA 5CQGA 5E3CA 3M1VB 4R5PA 2BQRA 1IR0A 3SCJE 2BANB 3C19A 2X1BA 4KB7A 1UEVA 1F9FA 1N54B 1NZAA 2WBMA 3A13A 4R8UA 4TU9A 3GV5B 4NLUA 3NL0A 2FJVA 4PUOB 1JK9B 3MEDB 1KC8T 3N5BA 2ZC4A 2B43A 2FLOA 2XNQA 3Q8YA 5EN1A 2RQCA 1N36J 5HMXA 4DV5J 3QSYB 4YR0A 3BH7B 2ZC3A 2HAIA 2XS5A 4Q5VA 2EXUA 3OSNA 1UVMA 3NGUA 5D0RA 4HACA 3QFWA 4B9SA 1C1BA 4NXNJ 1PYOB 3B4DA 1ZA1B 3ZXWA 1A6LA 1OPIA 2KN4A 3AD7C 1CBKA 1LXJA 4J9SA 2K1RB 2HSEB 4L6V3 5KFXA 4Z2XA 2IBKA 1Z2ZA 1E6VA 2OPPA 3MUVP 1JLEB 2UV8G 4KO0B 1X5SA 5IC4B 4B9NA 1T7PA 3OL6A 2BBEA 4RW7B 3GFZA 4OHVA 4ILMA 2XNRA 3OTBA 1B3TA 2CDRB 4ZN3A 1T3NA 4ZS6A 5ITHA 3A3PB 2XCAA 4UQGA 4N7TA 3A3NB 2YWHA 1HBNA 1LW2B 1KNZA 1M1GA 1S79A 2PEBA 5KFBA 1PBUA 2WOMB 3IBWA 1UWBB 4JI7J 3FMBA 2R7VA 1HWKA 2XSJA 2DISA 5A8KB 3MPUB 3PEHA 1FEHA 4EZ9A 1OQ3A 2HNDB 1DBDA 4XTTA 3CE8A 2UVUA 4PABA 3J81U 2RAQA 1CLFA 4QR1A 4LFAJ 4EYHB 1K1QA 4DSKA 2UXCJ 4JI5F 1UZHA 2OMOA 4RUAA 3ZTQA 2WTFA 3KHHA 5A8WA 1YIJS 4L3KA 1OS5A 5KG6A 1XBWA 1DTTA 5KFFA 2BJDA 4FVCA 2J6SA 4Y0FA 3V6JA 3C8YA 4F4AA 1WG5A 1N0VC 4LFCJ 3TVKA 1KWMA 3SCLE 3G82A 2RE1A 2QSFA 2GCFA 2P2CB 2P5VA 3KLEB 4TN2A 4LF9J 2OPQA 2E9TA 4NE9C 4NCGA 5K8NA 2J6UA 2YNIA 3U27A 1HWJA 2EW9A 2KXHA 3MF5A 4DSFA 3N01A 1YRXA 1SB6A 3SFGA 3QLHA 4R5PB 1FT8A 3VCDA 4LF4F 3D0IE 2UU9J 2E1CA 2CQDA 4F7VA 3NBPA 1R43A 2CDQA 2ZJQQ 2XULA 5H9EJ 4R8UB 3FGVA 3GQCA 3TRGA 1FTCA 3HT3A 2NLWA 3OT9A 1Q1KA 3A4TA 1C1CA 1NK5A 2HHHJ 2VOOA 1U6BA 2D3ZA 4NA1A 3SDEA 3CJKA 1ZTTA 1QLNA 1RAOA 1FRHA 2FJDB 1U1QA 1W26A 3HKWA 1U0HA 5JUMA 1U26A 2NQPA 1B99A 4MKBA 3HVAA 5L1KA 4HACB 1OSDA 2MLXA 5CYJA 4NLYA 1NK8A 1NUEA 1SC6A 1C1BB 3M6WA 3G4SS 1FX2A 3EGVA 4MJKA 4E2FB 4DFJA 1R89A 4MK9A 2VONA 3FUYA 2OPPB 3CJSA 1HHTP 5MAOA 3NCPA 3D7SB 3TP2A 3G96A 2M3DA 1K44A 1P9QC 4C8NA 2HYIB 2DGUA 1NH8A 3N28A 4QZVB 2X7IA 4WIQA 5LJ5Y 4OX6A 4EGLA 4PG7A 4BHQA 2J8AA 2FHMA 3UDEA 2C28A 2PFDA 1ACMB 3MM9A 4ZVUB 1MG7A 3JSMA 2OMLA 3TUIC 5K14A 4F26A 3CCSS 1LOUA 3RRGA 1UAWA 1XIQA 1HBNB 5HLFB 3SCKE 1SKWA 3OD2A 3H2VE 5LMUF 3JYTA 4QQBA 1YWXA 2HBRB 2KFYA 5J1EA 2XS7A 3BREA 2RDIA 3ZZOA 4I69A 4ZN1A 4EK2A 2XSJB 2HQFA 2FQQB 2DHXA 3BR8A 5HMYA 2RHSB 2DIVA 2ZOGA 1XR7A 3HJVA 2KG1A 3KK3A 1QAYA 3SSSA 4D3GA 4U96A 4MIAA 1XR5A 1RT6A 1FERA 3OR2A 3NMRA 5B0DA 2X1FA 4FDFA 5D0GA 2GA7A 3BGLA 4CH1A 1KQSR 1DTTB 4KHPJ 1DTQA 1U1RA 4S0MA 1U1MA 1R27B 5IT9U 3G8QA 7AT1B 5J2NA 2LQ9A 3G82B 2VDIA 4I6YA 3NNAA 2F1FA 2OPQB 5DGAA 2I1RA 5AXKA 4NCGB 2CG4A 1NLKL 3ILIA 3NAIA 2GJ2A 2YNIB 3R2DJ 2MQ8A 5AE2A 1M0SA 2AEMA 3QLHB 3QATA 5GMKa 3G6XA 2XYHB 1RU1A 5LL6d 2CKWA 1GMVA 3I32A 1TAQA 2HNYA 4I2QB 1JXEA 1YJWS 3KLIA 3SV3A 1BWEA 2Y1LB 1MROA 1C0UA 2LXFA 3DDIA 3MR3A 2V2ZA 1RCXB 3R8YA 4YB6A 2VF3A 1C1CB 4NXMF 5DG8A 3SDEB 2NXNA 1S0NA 1N4LA 5KFAA 2E5JA 2A2DA 5KFIA 3CJKB 4F04B 4QPTA 4PWDA 1U0HB 1K0TA 2AF6A 2DY1A 3IWNC 4P2FA 2VFVA 4G1QA 2XZDB 2VBWA 1XC9A 2XSFA 4F4KA 3MEGA 4OL8A 2E9ZA 1WG4A 1QSYA 2R7QA 2BMBA 2E1AA 2YKAA 2J9DE 1ICEB 1ZTWA 2XWYA 3HPOA 1U49A 1FA0A 2HIQA 2OEKA 3OJUA 3J7A1 2FGCA 3HVTA 1KFSA 4X65F 3H7HB 2ATCB 3D67A 1U1PA 2FVRA 3O6QA 2DPJA 2G0IA 3VWSA 1VQMS 3UDLA 1H0HB 1HMVA 2IHR1 1XERA 2IM3A 1NDCA 2FC9A 2V50A 4ZPWR 3THTA 1AYEA 1N33F 4ECQA 4Y2AA 3MM9B 5HVHA 4J9VA 2UUBJ 3D3BJ 3JSMB 4ELVA 2HWHA 3MZIA 1X4AA 4P74A 2PDAA 3W63A 2ZITA 3CULA 3MD1A 5K14B 1RBOB 4BS2A 2DGSA 2OTLS 3PHTA 4AE5A 2ERRA 1IKYA 3DM2A 2F7VA 2JWNA 2CPJA 1V6HA 5J1EB 3T3FA 3BO3A 1HQEA 2M8DB 1VYAA 4QJVA 2XWXA 2MLZA 2HHSA 2DHGA 4U95A 1FFSB 2V2QA 1LQ9A 3BN7A 4Y2IA 2ZDPA 2KM8C 4QW9A 1WKJA 1QY7A 1CSJA 1HQUA 4PAAA 1RT6B 5EX0A 4CI0B 4DX8H 3OR2B 4Q43A 2A6MA 4M95A 4PG8A 3BQ0A 3KLVA 1SC3B 4P75A 3W61A 5GMDA 3HHLD 5IWAF 1BQXA 1DTQB 2R8GA 4DR6F 3U02A 2Z57B 2JC1A 4DV4J 4YHHF 1F5BA 1RWPB 4GVLA 3FQLA 1CS4A 5LSLA 3ET6A 2XY7A 1FKOA 4L75A 1VGYA 3NGKA 3I0SB 2POKA 1XK8A 2QV6A 3CCQS 4CLKA 1RABB 5GMEA 3TJ9A 4ECUA 1SKUB 2YKPA 2W4CA 4KE5A 3H2LA 2HNYB 3I4HX 3KLIB 4ZMMA 4I4BA 4DV0J 3MMBA 5LT5A 3CD0A 1MROB 3SXLA 1C0UB 3OVAA 2VL1A 4LBHA 2V2VA 1URRA 3TAQA 3DRSA 2JVRA 2HVDA 1SQEA 1ZZNA 3F73A 4PWDB 2V8VA 1MMDA 1W7WA 4G1QB 3PFOA 3VF0B 5HK4A 4OI6A 3MEGB 2M9KA 2U2FA 5B0BA 2ATLA 1APSA 4DR2F 2EKNA 5KG3A 2DNQA 2QTWA 4ES3A 1UVLA 3QT5A 4IR9A 1LFWA 2MZJA 2CFXA 3AAWB 3CNQP 3T9NA 5DGBA 4DLGA 1K9MT 4G3IA 2ZKTA 5T7LA 3MI7X 1HMVB 1XMQJ 3T1YJ 5CAAA 2OELA 3PRBA 3MUMP 2DGXA 1S49A 1BGXT 4OFZA 1OYDA 2DPIA 4LR8A 4J91A 3HX9A 5KG1A 3O3LA 1X9MA 2K8GA 4ES1A 5E41A 3DN9A 2DNNA 3CF5Q 3GFYA 3L95X 5B0AA 2UUAJ 4O3QA 4UOHA 1IKYB 2XC9A 4EMDA 2ZJRQ 5HP1A 3G87A 3DM2B 2VBYA 3A1YG 1GMWA 2B5JA 1TFYA 4G6VB 4LRAA 1HQEB 2QMXA 1NJXA 1PSDA 5DG9A 4HYKA 3UWTA 1RHJB 2HWIA 1U47A 5U47A 4PXEA 2YWKA 3M2RB 1HI1A 2MB0B 3T5LA 1HI8A 3SI8A 1TKTA 4OJ1A 1MWZA 2FHOB 5C7PA 2C3UA 1B0PA 4AQYJ 1PO6A 1HQUB 3T5KA 3IGVA 3J7ZT 1ZBTA 4DUYF 2BM0A 1FNOA 5B09A 5KT7A 4Z37A 1X4FA 1T8EA 4NEZA 3DI6A 3M8YA 5BYRA 3TQ1A 3M32B 1F5AA 1VDHA 2HW3A 4A46A 3K8VA 3PJ9A 1QD1A 3T5HA 3MFHA 2G1DA 2Q79A 1CS4B 1JLBA 3OLAA 1B7YB 2VHGA 1FKOB 2GVDA 1GNKA 3D6TB 1L3KA 1RA7A 2XMMA 2IA6A 1D0EA 2CJ9A 1RWNB 2LA4A 4L72B 3MXHP 3R1LA 4ZCLA 4Y3CA 3JQMA 3M8SA 2HHQA 5E3QA 3CB4A 4USTA 3MMBB 2A10A 2H51B 5KFNA 4CH7A 4XPCA 3PRDA 1MSWD 2N4CA 3RR7A 2CNNB 3IM8A 4DOZA 2PEHA 1IR2A 1YTYA 2AGPA 3DRSB 2P9EA 4JI0J 1IKXA 5CYQA 3CPWR 1IKVA 4RNOA 1V5VA 5H9EK 3Q8QB 2B9YA 4NI2A 3EXYA 4WFAQ 1RAIB 5JVGQ 1F5CA 2WB4A 1XMBA 1VLYA 1OY9A 4ED5A 2WCXA 1X4HA 3MR2A 1HR0F 3OFGA 5K8OA 1MMLA 2ZBPA 3HSDA 3AB4B 1VRQC 2HGLA 3QZ8A 2Y9HA 1LWFA 1U4BA 3M6UA 1T9WA 2C2KB 2EFQA 3MMCB 2V8HA 2FHJA 4OHZA 1FHTA 3PACA 1NHUA 5T7LB 2AT1B 1U7LA 1SI9A 3WC2A 1U45A 2GC8A 1S1TA 1NK9A 1FDBA 2DY9A 4LBPA 2CG8A 3ZZ0A 2I2YA 1WI8A 5D4NA 4RW4A 2CWKA 2GNKA 1SQFA 2UXDJ 3D6MB 4LFBJ 4C9DA 5DZ6A 4UOGA 4M63A 4RPFA 1XNQF 1YJ7A 2IY5B 2HHVA 2R8IA 3CCJS 5AJ3F 2DNOA 1WHYA 4J9PA 2G2YA 2ABYA 2B5JB 4ILLA 3ILOA 4NPOA 2X1GA 1R8CA 1CQNA 2YBVA 4UZCA 4CTAA 4TYBA 3DLEA 4KPCA 3DDKA 2C22A 1TKTB 2V34A 2VJVA 1NH7A 1MU2A 3PHEA 4KR0B 3CDWA 3C6UA 4WFNQ 3FCWA 1NJYA 4LUBA 4OV1A 4LJMA 4YY3F 3FK4A 1RI7A 2MKSA 2QLWA 4CLSA 3HCXA 4UOCA 4I7FA 2KJWA 3DMJA 2ZZTA 2VICA 5KFZA 5J2PA 1TL1A 2ASLA 1VQ6S 1RTDA 2EFGA 4ED2A 1T05A 1JLBB 1U6FA 2WSFC 1KVKA 2NUHA 3LP1A 2FYXA 4CYUA 2KKHA 3W64A 2GVDB 2M8HA 4BWJA 1FJEB 3HI9A 1N34F 4RUBA 1AROP 2WVCA 3LWMA 2AWZA 2Y1JA 3B78A 2UUCF 4URSA 2VD3A 1GQEA 4OZ2A 4NA3A 2ZUAA 1VQLS 3AOBA 2K7JA 2CQ2A 3GB0A 3IXQA 3CC7S 2W4DA 1WC6A 3TZXA 2CPYA 2CQ1A 1IKXB 5CYQB 1VIOA 1IKVB 2R3VA 4HTIA 2VG5A 4KGZB 2XMAA 4IOCQ 2IM2A 4EZ6A 4LBIA 4NI2B 1UTAA 4XDCA 2OFGX 1FNMA 4DR4F 4Z7YA 3S7RA 2RSQA 4NASA 3CD5A 3PV8A 1EQ0A 3TA1A 4LF7F 1NZ8A 1RYSA 1LWFB 2BVZA 5KFOA 4JI5J 1URNA 5A0YA 3HLUA 3EZOA 4Q8EA 1IBCB 1CQMA 2BKPA 4JI8F 1S1TB 3AFGA 1QUVA 2YQ0A 3N0VA 1TMJA 3M4XA 2F5GA 5KFGA 2VPZB 4LR7A 4BDPA 5HVGA 4WP3A 4NRUA 4RW4B 4OZ1A 1OWXA 3R5DA 4RL1A 4ZPTR 1RA6A 3R6GB 4ID8A 2J9DA 1NHKL 1Y3JA 3IGNA 4MIWA 2ZVIA 1CPZA 2G1HA 3GPAA 1H2VZ 2HK3A 2HMIA 3TW0A 3LW5C 4UY8T 1N32F 3KMQA 1FESA 3W5ZA 1UPPA 4DV1F 3L7PA 4V19X 2E7VA 3GONA 1U2CA 3CC4S 1H98A 5J2MA 1IBLF 1FKAF 3WIVA 4HEA9 1R6VA 2DHAA 4Y6IA 2NUUG 3EUNA 3NS7B 3GFHA 4NLSA 3CDBA 4B3SJ 2Y8WA 4EO8A 2PA3A 4CTAB 4K2JA 1VRTA 3C6TA 4XPEA 2ASJA 2DXDA 2VQEF 4ZJLA 3PM9A 3H25A 2MPUA 1R6YA 3KUHA 5I4MA 2Z2ZA 2OHDA 2PC6A 2XLIA 3C6UB 2WVDA 2RQMA 1EIYB 4MKYA 1SJQA 4X4TA 1LK7A 2MKYA 4IG0A 1R0BG 2F4VF 2R7TA 4HLBA 4H4KA 1H72C 2ZNYA 3EGZA 4NLPA 4I7FB 1S12A 3MEEA 2WSCC 3DMJB 4FKYA 1TL1B 4KHMA 3L3CA 4WXOA 1MW7A 1RTDB 1KOHA 1T05B 3RW6A 2V94A 1X4BA 5F8MA 4LRBA 4C8YA 3LP1B 2XYGB 4CYUB 3DU5A 3OV7A 3ITHA 1U1NA 2JHEA 4U7CA 3FDSA 4NYZA 4F2SA 1TL4A 2OTJS 1F9HA 2HRYA 3JSYA 4NWBA 2OH2A 4DXLA 4CO1A 3B82A 4TXSA 4CCHA 2DCLA 2OKQA 3PCOB 2AX1A 4KBIA 3MM5B 3ISND 3MR7A 2RQ4A 2VG5B 4KSEB 5I3UA 3D6FB 3H59A 1T9UA 1CJUA 2CQGA 2XHCA 1KFDA 3RB6A 2EI5A 2NXEA 4YS2A 2ZH3A 3ZFVA 1S76D 2R9LA 1LKZA 2MYFA 2WSEC 3IWLA 3JSRA 1LEOA 5D78A 2DNHA 3HVWA 5A0YB 4J9OA 3PIOQ 3VAJA 4WK3A 1IUJA 3FEZA 2ZZMA 4ZVOB 1Y10A 4DSEA 3RBDA 3WC0A 2CIMA 2QLJB 3BGFA 2E7XA 1IBKF 4WF9Q 3QO9A 2BEFA 3A3OB 3KDOA 2VJUA 1HLWA 4WKYA 4I1TA 1MN7A 2OPRA 4MMOA 2IBOA 2JEIA 5HO4A 3UVJA 3WQPA 1JLFA 3RB4A 3D1OA 2HMIB 1NNDA 2FJAB 3KG1A 5C42A 2E66A 1Y5IB 1VQ9S 4ER8A 2AV5A 3VGTA 3FC9A 2KVQE 5J2MB 3U1NA 2DT9A 4NXMJ 3Q2SC 4DI6A 5SZTA 1PILA 2RU9A 2R7WA 2YWFA 5HJXA 3BJYA 3C6TB 2MKKA 4DV5F 2CQBA 1S1XA 1WC0A 4C0HA 4ED7A 1KR4A 1CJVA 3HDSA 1YHQS 4B3RF 4OZNA 1TUWA 5RUBA 2GVZB 1CJKA 1NRKA 2W4PA 3I55S 4X4SA 3K59A 4IG0B 3F41A 2DR6A 4K5SA 1J5EF 4O44B 2DRBA 5L1JA 2OSRA 2XI3A 3AOCA 3PXGa 2BRKA 2NSCA 1EJ7L 5L1LA 4I2PA 4KPYA 1DHMA 4CNYA 2ASYA 4MK7A 4W92B 5KFYA 2B9EA 2JLFA 2HHXA 3ITHB 2MZSA 1YJUA 3S8SA 5L46A 4ZJQA 3SQGA 2QEXS 1N33J 3WX4A 3ETOA 2P6SA 2GMLA 1RWXB 4I56A 3G8SA 3VQTA 4KQZA 4P7TA 2BJ7A 3TJ8A 5HJYA 4CLLA 1I3OB 3IN5A 1S1UA 3DU6A 2H1YA 5FDLA 2AYBA 5ETMA 1NCLA 1Q7YT 4DV2J 5I3UB 4GKKF 3T5JA 1CJUB 1NSPA 3LP2B 3H5XA 2QT7A 1X0PA 4DR5J 2KDOA 1C0TA 4PPZA 1RHRB 1RK8A 4LSZB 2ALYB 2QX0A 1H7WA 2UXCF 2GIQA 2BA9A 1U0SA 3LAMA 1ZETA 4NYPA 1HIYA 2CZ9A 5T14A 4USJC 1T03B 2CNOB 2AYMA 1SC4B 4NA2A 5HROA 3HT0A 1EX8A 4UY85 2H65B 1M5HA 5IWAJ 3S01A 5FLXY 4TQSA 3I0RB 1BHNA 3MOZA 2DKOB 2LXIA 4LFCF 3QO9B 3PW5A 2QC3A 2DR7A 3DRRA 1LWCA 1DLOA 2DEIA 5IOLA 2B8PA 4WWSA 2V4QA 2FTRA 1WTFA 1R7IA 2OPRB 4ZVPB 4Y2KA 3UVJB 1QVFR 2UVVA 3M8RA 2RVJA 2UU9F 4QIVA 3VAMA 3PVXA 1RHQB 4I6AA 3ZTOA 1W2BR 5ETSA 5CYMA 4FXVA 2DGQA 2XHWA 2C2ZB 4DQIA 2HHHF 1S99A 5A2QY 4KHRA 2WRMA 1RAJA 3N6MA 4HHJA 2R7XA 4J9LA 4JI4J 4I68A 4RW9A 3DXBA 2HQDA 1S1XB 1YSJA 2YKNA 3PYFA 2WZ1A 4KFBA 4OYPA 1TUGB 4HR2A 3FBFA 1CJVB 1S59A 3K8WA 2W25A 3DGPA 5CD4A 1EHWA 1GAOA 2EBEA 1RWVB 1CJKB 3BBFA 3EGNA 2D3O1 1DQ8A 4YB5A 1RGVA 1GTHA 2CPZA 1FRMA 3HHKA 3TUZC 4LQ3A 4YN3B 1P8GA 2VDHA 2GJIA 4I2PB 3AT1B 4V19J 2RD5C 4IO9Q 1IR1A 2LVWA 3K5NA 4DL6A 1MWYA 2IDLA 4MT1A 4OIXA 4EU0A 2JX2A 3D0GE 2J0QD 4CO3A 3HSGA 4YUDA 4RBUA 4TY8A 1AZSA 4FKXA 3AY0A 3GR1A 2XS2A 3JTNA 1RE1B 1S0MA 2R2SA 1S1UB 4CO4A 5L8RC 5DLFA 5FDLB 3M6VA 4CLUA 2LECA 5F9NA 3LO3A 2BQUA 1FJ7A 3K5LA 2OEJA 2MQOA 2IRYA 5D15A 4AXIA 1OIAA 3M05A 5K8PA 4N8NA 4EBCA 1C0TB 4YEAA 2VQFF 2FUG9 3CCMS 1ULRA 4UZBA 1X4EA 3H20A 2MSSA 1U48A 4HT5A 5DQIA 1AFIA 2CA9A 5HROB 1VQNS 3PIPQ 5F8NA 3SSRA 2FY1A 1OPZA 3RZAA 4OI2A 3DXSX 4A8SA 3LA0A 1TKXA 1LWCB 1DLOB 2IAJA 2HHWA 1LW0A 4WU2A 3JQJA 4EUVA 3IBCB 4X4PA 2GW8A 4DHVA 1NHVA 5JJBA 4RLEA 4MKVA 1NKCA 1BD6A 1T02A 2JEGA 4B02A 4I64A 3J7AN 5J1PA 3O2IA 3ZTSA 4ANDA 4FXDA 5C2CA 2HPUA 2FLPA 2F9DA 2BW2A 3AB2B 4DPYA 3CCTA 4RW9B 5C25A 2C3OA 2YKNB 1S72S 3V4IA 4KFBB 1R3NA 5B0CA 4Q7AA 1H2TZ 1D8ZA 3OL9A 3DGPB 3O8WA 3NGTA 4CO5A 4OQJA 3UN3A 2B6AA 4X4RA 2MZTA 3IM9A 4HI1A 2J0SD 2ZBRA 2HQIA 3EGWB 2XTJP 1WNEA 1KKHA 1SH0A 3S1TA 2PMZD 4GMKA 1FFWB 3OXLA 2YX7A 3QQCD 5KFKA 3PFEA 3NCRA 2WBRA 2OJ3A 1UFWA 1WHVA 2GAHC 5BYQA 3GILA 4F2RA 4USHA 2HVEA 1FKPB 3MM7A 1U8WA 3EMTA 3E51A 3OPKA 3FEXB 2YKOA 3LGHA 5JMNA 4Q8FA 1H3DA 4EEYA 2L48A 2AD9A 4TY8B 1AZSB 3N6NA 1XNQJ 3LPYA 1YJNS 1SVDA 5AJ3J 3NXZA 5IV3A 2EFVA 4C98A 5CHCB 1TV6B 4QYZJ 2LU1A 2HRTA 3AD9C 4DUZF 4TLRA 3RAMA 3PYEA 2VB6A 1OY8A 3D6HB 2QRRA 2I6WA 3QAUA 4PYDA 3EZUA 4KGMA 5KOXA 1B4SA 3ZC4A 1WKKA 3DYAA 4JB8B 1IVZA 3NRBA 2V67A 4GVBA 5HATA 2QO3A 2ILYA 4U8YA 4OX9J 3QBCA 5ETTA 4WKRA 1YDLA 3AQOA 3HP6A 1PBAA 4BC7A 3ADAC 2ZHBA 1WWHA 4PQUA 2NSBA 3HHEA 2FB0A 1TKXB 1WACA 3RGIA 4DF4A 2VA3A 3ISZA 4LF2A 2COLA 2D74B 1YBUA 2IAJB 3UI3A 3P5BP 1LW0B 1Z1ZA 1UVNA 2V68A 3R5JB 2EG2A 1QUPA 3GV7B 3VGVA 1BQMA 1UA0A 1Y3KA 2QYGA 2Z8QA 2GZOA 4OX7A 1FXDA 3ILJA 4ZLJA 5GADU 2UUCJ 2AJQA 2CVIA 2Y1IA 4DV0F 3R7NB 2ZZNA 2FVCA 3BPSP 2VU5A 4NLXA 4LR9A 4EYIB 4JI2J 1FNXH 4M5HA 3LANA 1NO8A 5I42B 4J5OA 2LKZA 4PG5A 1JJCB 1P1LA 5L1IA 4LF8F 1RT1B 1SXLA 5C25B 1QDUB 2FHKA 1KDNA 5KT5A 1HPZA 4IFYA 4KC5A 2B6AB 2HVZA 3NLCA 1VK8A 4EBEA 1SQGA 2DHHA 4KJIA 3TJAA 1XQIA 4C3KA 4NLTA 3NKYA 3NNHA 4LF7J 2B4VA 3RG6A 3IR5B 4FN5A 4OHXA 2H54B 3I9V9 2HHPA 2V4JA 3R1HA 3J7YI 3R5BA 2IDEA 2OEMA 2ALZA 1W2IA 2EWHA 2ZEJA 1XMQF 2XGQA 1YBTA 1JJ2R 3H5UA 4X4VA 3MM7B 1UJ5A 3KFWX 3MCNA 4I0WA 1TELA 2BE2B 5D3GA 3W2VA 3E01A 3UCGA 1VQ4S 3H5SA 3VAFA 3GMGA 3FCVA 4KAIA 4OYAA 5HAOA 4J9KA 1HYSA 3GJSB 3AH6A 3QRPA 3BKFA 4ZP9A 5B0FA 3M8QB 2Q66A 2C3PA 3MEDA 2H5EA 5KT6A 3M8WA 4ZHRB 3OL8A 3GG0A 5H1SV 2PMWA 4DPOA 3JAMY 1RWUA 2OD4A 4F4XA 2RRBA 3DYAB 3H0PA 3PDNA 2G4BA 3CWJA 1C4AA 5F8JA 4GVBB 3AXKA 1PAUB 3Q86A 4AQYF 3MTJA 3Q22A 3IRXA 3PYGA 3EXCX 4TU8A 1SKRA 3ENAA 3G2XA 1FX4A 3TI0A 4YR3A 2QA4S 4DR7F 3HO1A 1YJRA 4PQUB 4X4UA 3CIMA 2N3OA 1ZYQA 5G0RA 2VBXA 1TK0A 2RNEA 2W2MP 3PX6A 3AJ2A 2W9BB 3UQSA 3VAIA 3WZ0A 1BXNA 1U24A 1BQMB 1ROFA 3DLJA 1OSCA 2E5GA 4NX9A 2V69A 1F1BB 2N7YA 5IQ6A 4AD6A 4ZK7M 1TMMA 4NLWA 4YP3A 1IN0A 3UO0A 2OI2A 3DOLB 2AJFE 3B4MA 1LW2A 3WIUA 5DM7Q 4N76A 5D8HB 3OTEA 5GAHU 1KVJA 5K9FA 3BB5A 5AE1A 1S9FA 3FVYA 2IIHA 2IJFA 2VIHA 3GZ7A 1ZM4A 4JYAF 1HPZB 4IFYB 3P49B 1VJWA 1W25A 1Y00A 4U8VA 3W1YC 4QIEA 2NZCA 2LEAA 2VC0A 1F2GA 3BN4A 2HURA 1HNVB 3EJMA 2GHWA 2CRLA 1GH8A 1NDLA 2HZAA 3DRYA 5D77A 3LP0A 3NY0A 2RDJA 1UEKA 5DDRC 1VS3A 2G2ZA 3KOAA 2YWEA 2V4JB 1BC6A 1S6PB 4H54A 1G7CB 4ZJOA 4DV3J 3OUYA 2LFVA 1RT5B 3PX4A 1FTRA 1Q16B 2YTCA 2E1RA 3OLBA 4N5SA 3LWLA 4LSNA 5D3GB 3W2VB 3VV2B 2W2OP 4QW8A 3E01B 4LFBF 3IA0A 3RAXA 3JSBA 2PMHA 1QJHA 2RUGA 4ZPVR 2JLGA 1GEHA 3J81j 4N8OA 4RW6A 5J2QA 2FPHX 3NAHA 5BJRA 3G6YA 4DL2A 3D1HA 4F3MA 1AB8A 3MGJA 4Z7CA 2KTQA 3CMAS 1L3VA 1LV5A 1Q0NA 1YJVA 1NAQA 2DH9A 3B8HA 1HYSB 2ROGA 3DLKA 5DRKA 2A1BA 2XLKA 4M5IA 4PXCA 4ECXA 4XDDA 3RBZA 3I4PA 2HLUA 3H5YA 3HHLC 1HD1A 1X4GA 5LMNJ 1A0OB 1DQ9A 2J7WA 4B3RJ 2IPOB 2UZAA 2E1PA 3KUEA 1TAUA 1F2HA 4FP9A 3IRXB 1HHSA 2F63A 3D28A 5M2RA 3KHLA 3QJPA 4H4OA 1J5EJ 2MHNA 2CADA 1U25A 4DMZA 2EK1A 4ZVQB 1YZ7A 2M52A 5G0RB 4K0KF 4I67A 2CJAA 4R0JA 3MAQA 4FF1A 2OD6A 1M5KC 1RUSA 2ZH6A 3C46A 2DNZA 1QTMA 1SJ3P 2J7UA 3IBFB 2ZJPQ 2MZ1A 5BYSA 2Q3PA 1YQHA 4X64J 4K4VA 2D41A 4O3RA 1I6JA 2XZWA 1RT7A 1M90T 1X4CA 4DPTA 3CEDA 5HLFA 4QBUA 4FNHA 3F0NA 4F50A 1BLUA 1TKZA 4F0KA 3FFIA 3PTWA 2YNGB 5G4DA 2JFKA 4CQ1A 2FIUA 4KGVB 3K5OA 2DNKA 4X62J 3VGUA 5F9LA 1QSLA 2HKEA 1GMWD 5ETKA 3AJDA 1YVFA 2RRAA 2N82B 1HQ2A 1Q8LA 4GKKJ 1GK8A 2NXCA 3CC2S 2LQ8A 3ONQA 1X60A 3THVA 3TZWA 5A76A 4IH5A 4TY9A 4IOBA 4FNIA 3AODA 2RU3A 4USKA 4FBUA 1CULA 3PR5B 3LP0B 4M5LA 3CJ3A 3DKDA 5CZXA 1SH2A 3ELHA 4F4YA 3OUYB 4MYTA 3DOKA 1GXUA 2JC0A 2VPXB 2DIUA 2CWXA 2MQQA 5IS2A 4O0NA 2Z58B 2GMJA 1H38A 5LJ3Y 4WPAA 4LSNB 2E5LF 5B0GA 3JTPA 2KRBA 4YB1P 4YDDB 4DL5A 2HWTA 4RW6B 5J2QB 2ACMA 3N5FA 3QWPA 3HFKA 3OBIA 2D3UA 3THPA 4OJHA 2W9AA 1HBOB 3IAS9 4OHWA 1DJ0A 2GMHA 4LF5F 4I2QA 3QSIA 4ZCMA 3NWRA 5KG4A 1KD1T 3RU0A 4IUFA 3DLKB 1VQ5S 2DTJA 4NZ6A 1HNXJ 2ZWPA 2RKIA 3AA8A 4KGXB 3PEJA 4B3SF 1Y9OA 3K0JA 2EKYA 2GX8A 5KT4A 3DLBA 1JJ4A 1S10A 1K1SA 4RU2A 2G0CA 5D0HA 5BR8J 2Y8YA 4ECWA 4QYZK 2AEJA 3E3XA 3FRZA 1F0XA 4K2XA 2F8MA 5KAKA 2OSQA 3FKBA 3GCXP 1F60B 4MFBA 4AL6A 2KHDA 3R7SB 3L09A 2VV5A 4LRDA 1VQ7S 2KXFA 5IV4A 4NLDA 2QG9B 4H4OB 4OI1A 4DF8A 4JI3J 2YXLA 3QT8A 3KDNA 4UW2A 4PKDB 2HGMA 2FHJD 3RTVA 1RT3A 2IVFB 1NPKA 1NJIT 2VUGA 1YRUA 2LXUA 3TA0A 2YKQA 3ENQA 1AFJA 5FLXU 4ES2A 2IFXA 1BQNA 4X66F 2Z56B 3C2PA 2EBGA 1Y0HA 4B3OA 3D5MA 2R7UA 3AOAA 2L41A 2NREA 4PQAA 2EVZA 1WTBA 1ZAXA 1U1LA 1X31C 1HKAA 2KVIA 3Q24A 2PGCA 1EETA 3QFHA 1M5VC 5SUHA 4CDIA 5DZ7A 1RT7B 4PEOA 1EKSA 1TP7A 5DJBA 4DDFA 2XY5A 1TKZB 3FFIB 3FBEA 2DRAA 4O3SA 4M5KA 2NCKL 2F9JA 1S77D 3KWMA 2GIRA 1O0PA 1YRTA 3J7YU 4DSLA 2ZM6J 5HMWA 1P27B 5A2QU 1RAAB 1L3UA 5E3RA 2HHTA 2L3MA 5IZHA 3LGNA 5CA5A 2YQ3A 4ALZA 1UVJA 2NYIA 3M6XA 4DL4A 2VQFJ 4WXWA 1NPRA 2HVIA 1CULB 5HSPA 2KJVA 3Q23A 2Q43A 4ZPDA 3KTQA 1UL3A 2J8SA 2JEJA 3HD2A 5LSOA 3N4WA 4E98A 8RUCA 5H9FK 4GRSA 3DOKB 2LMIA 3QRRA 4NCAA 4QYRA 4P6QA 1LXNA 5AE3A 4CNZA 1YK9A 1RHUB 2YPYA 1CC7A 4CP5A 2CQHA 4OMFG 4RJVA 1FDNA 3KKFA 3I0SA 2XMVA 4A8WA 2MSTA 3U7JA 2W01A 2SXLA 3FSYA 3RBXA 3W5YA 2Y3YA 5AXNA 4ZCKA 3GJQB 2HBYB 1KQFB 1UETA 2CZVC 5GAEI 2MDAA 4KYZA 3OTOF 2DR9A 2CJYB 1NJZA 4WJBA 2QLXA 5GVQA 3JS9A 1ZZFA 2RKIB 2YWGA 3UFCX 2IYIA 3KHRA 3GTYX 4QWEA 2BUNA 1R0CB 2B8QA 4ZVRB 1S97A 1FD8A 2HBZB 3Q89A 2IMWP 3KLHA 4G1PA 1SIZA 4MFBB 3QGIA 2CZ4A 2B51A 1ZPWX 3Q8SB 1L3SA 2P8IA 1RT2A 1TL5A 4NLGA 2XB2D 4M8LA 3BPDA 2YKMA 4Q0BA 2XGPA 3EDQB 3FBBA 2AHOB 1RT3B 4J37A 3RB0A 5C5JA 2PD1A 4QR2A 4I6WA 4PWWA 3G8TA 4LIWA 3KMSA 1H2UX 3G71S 1WF1A 3NEKA 4M5JA 3TAMA 3RW7A 1D09B 4NEYA 5AT1B 1BQNB 1NBEB 2RJZA 5KFRA 3MPYA 4LVOP 4F4WA 4B3OB 3UCUP 2X1AA 4JV2A 2W9CA 1JLGB 4DZDA 2VH7A 3V4MA 1EETB 4F3OA 1PJ7A 4J9NA 4L76A 2I9SA 1VC5A 3CJ5A 2IC3A 2CNLB 3TZYA 3POTA 3K89A 1R31A 4DV2F 2P9GA 4DUZJ 3F56A 1D9FA 1I51B 2KM8B 4EI2A 5HN0A 4DR5F 3M2RA 1QAJA 4WP8A 4RUCA 1Q5VA 2DR8A 4LRFA 3R5GA 4HTJA 2M70A 3C66A 2M88A 2JVOA 1RLCL 3SEOA 3EPGA 4BWMA 1VRUA 2FVPA 1GXTA 4MTPA 2DGWA 4EO6A 1TFWA 2M4MA 4DPWA 3OJSA 1V5IB 2GO8A 3MURP 3LUYA 5KFUA 3M32A 4ED6A 3BR9A 2QA2A 1FDDA 2HEKA 3RRHA 1S4EA 2HQGA 4YDXA 4DPUA 5B7WA 4M5DB 1LFPA 3CJTA 3SZ2A 4FVMA 4ECSA 3HM9A 4ZPCA 4OYXA 4E0DA 3CW2C 4OYWA 3GIJA 4OV6A 3IAM9 1WEYA 1TK5A 3FMWA 2RDDA 1QVGR 1VHIA 4OZ5A 4DR1J 1WD6A 2Y1RI 3CUNA 4AFFA 4C0BA 3BO4A 3Q8PB 3TOQA 1FRKA 1M5SA 3MR5A 3Q0AA 4XK8C 4JI4F 4KIAA 5HANA 2ADBA 3MAAA 3OXFA 4LF8J 2HFNA 4F67A 2ZKUA 3EVMA 4DWIA 1SJRA 3TR5A 1WOSA 3CJ8A 2BJ1A 3KLHB 2CJBA 1SBRA 4C11A 4CT9A 5KFMA 1FK9A 4DQRA 4P2MA 1RT2B 2ROEA 3EZ5A 3QJJA 4B3TJ 1SV5A 3MHYA 4CO2A 3QRQA 3NWGA 4ZOSA 2YKMB 3MMCA 4MK8A 4X84A 2WVBA 2ZH5A 4Q0BB 4RZRA 2HZCA 3GU0A 1N48A 2BX6A 5F8IA 2CQPA 1X5OA 3I6PA 2HS0A 3QIPA 2QL5B 1ZS6A 4IRKA 3TAMB 2AP6A 3BYRA 3IR7B 4LRCA 2MTLA 1U2FA 3ISNC 2L08A 4RNFA 2DNRA 1RADB 2W9CB 3RAQA 1VOMA 1IKWB 4KH1B 3NNCA 4FYVB 4RNHA 3OR1A 2IC3B 4KGKA 1XMOF 2HG4A 2CUYA 2G0JA 3POTB 1GXLA 2RS2A 2UUTA 6AT1B 1HD0A 3I87A 4L3NA 5CD4H 3KLGA 2R2UA 3W5XA 3CCVS 2K7KA 1RWOB 4JP8A 4P73A 3RB3A 1HA1A 1FFGB 1MN9A 4IRDA 2ZFHA 3RBEA 1VRUB 4HVZA 4JV5F 2J9CA 1NMEB 4WIIA 3IFEA 1GMUA 1HI0P 1M5OC 3T1HJ 4O0IA 4DR7J 2OP5A 4C7QA 1WUUA 1UMJA 4DLEA 1V3ZA 4TYAA 1SJ4P 2NPFA 5KG7A 1WI6A 4DZ6A 3EX7B 4OJ3A 2HK2A 2K06A 2F65A 4K4XA 1RHKB 5L38A 3A8JA 2WK4A 2F40A 5FIIA 1NSKL 5HQ8A 2WB1D 4GO5X 3BZQA 2PFFB 4F0HA 8ATCB 1S9EA 4ATNA 4MYUA 2AZ1A 1YX2A 2DBBA 1VMBA 4GKJF 1QTNB 3IG1A 1RU2A 4WZMA 3ICLA 5CZVA 2MQLA 2FJWA 3BSAA 5AXMA 2G9OA 2R8KA 3HMJG 2MY7A 3MAAB 3E8OA 3R3TA 5THWA 2XQCA 2DNMA 3BV8A 2PO4A 4JYAJ 4C11B 2GQ2A 1FK9B 3JAMU 1NEEA 4N56A 1SV5B 2C42A 4FF4A 1Q5YA 1HNWF 4A48A 1EAYC 4ZLPA 4RBVA 5KFWA 4YFUA 4FXWA 3QIPB 3BGRA 2AX0A 1H74A 2J9EA 5A8RA 3GE9A 3CMES 7FD1A 3P3DA 3QPIA 3KK1A 4C8OA 1TZ0A 4KRWA 4OHYA 3CCES 2A6OA 5LXRA 3ENWA 1NK6A 2R7SA 3WDOA 1OMSA 2ZD1A 1VR6A 2CQ4A 2XMTA 2AJ4A 3NOCA 4PXDA 1PGZA 4J9QA 1T11A 1WJ9A 3NCQA 1WDDA 4Y34A 2CPXA 3OR1B 1ITPA 4YB7A 2BJ8A 3AXMA 2IM0A 3T9ZA 1U02A 3OXGA 4ZVFA 3IR6B 5ETNA 3R27A 3SFUA 3KLGB 2PSZA 5HVFA 2QL7B 1NK4A 4W90B 4DPXA 1KONA 4QWDA 4ED8A 2Q1LA 4DQPA 5M2PA 4LSLA 5HMZA 3EVOA 4RW8A 3VHQA 1HL6A 4ZVSB 2XMJA 4WK1A 4OX9F 3GYXB 3O44A 3EPIA 4JI1J 4ERDA 4FYXB 3K58A 4GC6A 4LT6A 4N41A 4WFXA 1REGX 5T41A 2QE5A 5GAEU 4GO7X 1FI4A 5L9XA 3A8IA 4B9TA 1TL7A 4ED1A 3AJ1A 2AEFA 4E8UA 2MZRA 3R6LB 1EKRA 4K0KJ 4ECVA 1G1XA 1VHFA 3UNYA 2KI2A 2RT3A 3V2UC 2B0GA 5C24A 4O3OA 2KL8A 4C8ZA 4ZCIA 2C3YA 4LF1A 2K3KA 4IDKA 2YH0A 4QOTA 1NM2A 1UJ6A 2YWWA 4KH0B 4IO1A 3C3LA 3H4DA 4K4YA 4USUA 4UUWA 2OIHA 1KVIA 1S9EB 1S7HA 5F8HA 3W9JA 4HHUA 4ZLLA 2X3DA 2VPYB 3CJ2A 2I5JA 4JI2F 1N52B 2AW0A 3IG1B 4PG6A 2FLNA 5EUHA 4ZIVA 5D6GA 2NXJA 4NOHA 1TL3A 3MM5A 4K7QA 4PR6A 1PCAA 1BY9A 1WSVA 3TARA 3W7BA 3DC2A 4AT1B 1X7VA 4NL5A 2LQJA 4ZP6A 3WHIA 4FYYB 4NZ7A 1HW8A 2RS8A 3P6YC 3HF5A 1BMQB 2V5HG 1UP1A 3KLFA 3U1LA 4CIOA 1KS2A 2HBQB 1KLMA 1L3TA 2GS8A 3PR4A 1PYSB 2QLBB 2FLLA 3HJFA 2E9RX 4QR0A 2JNJA 3CT9A 2JRSA 4ZP8A 1UFKA 1I5OB 4PRFA 1RTZA 4Y00A 1JNRB 3CDAA 3FSIA 3BGRB 1SC1B 5I3PA 1T94A 4ILRA 5A8RB 2HFSA 4PXBA 4B08A 2I8EA 1I94J 4TKTA 3Q8RB 3KK1B 1JKHA 5CH7B 4ID5A 3UNGC 3MPDA 2E5LJ 2IM1A 2KT3A 4WFZA 4F0MA 2ZD1B 3AD8C 3OL7A 2IRUA 2C2OB 4XO0A 3G9CA 2GHPA 2J76E 4IQMA 3UD3P 2YY3A 1O51A 2FDNA 4N77A 4LF5J 1NU4A 3J7Z5 1IBMJ 3GIRA 2ROPA 2I38A 2EK6A 1J2VA 2GQQA 5GAGI 2C2DA 5CCMA 4RKUC 1SL0A 2N4DA 1E6VB 1Q95G 3T6JA 5EGYA 3ETMA 3MUTP 4NYOA 3HSZA 4LSLB 4RW8B 2BQ3A 3AQPA 1CG2A 3DLLQ 2BZ2A 4KT0C 3KK2A 2GVZA 5ETQA 4WP9A 4P2XA 2CJKA 4AL5A 3ZNJ1 1Q81T 1N5SA 4O44A 6FDRA 1RSCA 1TL7B 3UDCA 4UTGA 2NS1B 4CLFA 2AJ1A 4Y65A 3CJRA 4IOAQ 2C2RA 2BR0A 3GJTB 4G65A 3R5CA 2PI5A 4CM0A 2AGQA 2FJXA 2IMOA 5C24B 2B4OA 2QN6B 1AT1B 1O6XA 2O67A 1Q79A 2Q6CA 3BKUA 3CMQA 4X66J 4IDKB 3FQKA 2BJEA 4WZQA 3ULHA 1Y5LB 3MAHA 5EHHA 4QIFA 1SKSA 1ZPVA 1JLQA 1NK7A 2BE7D 1FWLA 5ETVA 2DCUB 2I5JB 1WSRA 3W65A 1XNRJ 3QNWB 1NXIA 4H4MA 4Y28C 2X51A 4M94A 1KP6A 1KN6A 1TL3B 1VFJA 2AGOA 4HDGA 2VFSA 1MLAA 2HFUA 3Q8UA 1AUSL 3C14A 4CLZA 1PG5B 3F44A 3KJNB 2DHSA 5A8WB 3LP2A 4J7CA 3D68A 1Q8KA 2J0WA 1SCJB 3T1AA 4JI6J 2MY8A 1NJWA 4ECYA 2CQ0A 3KLFB 1E6YA 2KHCA 2KT5A 2HS4A 4FF3A 1VC0A 1KLMB 4USVA 1IXKA 3SMZA 3KXDA 1JWWA 5KFSA
chains in the Genus database with same CATH topology
2F3JA 1W25A 3UE2A 1T03A 5CYQA 5CYMB 3CPWR 4Y2MA 1IKVA 4RNOA 2MKCA 1Y00A 1FEEA 4K4UA 4DL7A 2GO9A 3TVZA 3MEKA 3Q8QB 4QIEA 4DV3F 2LEAA 2B9YA 3NS6A 4M5DA 2VC0A 2APOA 2J6TA 3MTKA 1F2GA 1Q82T 3EXYA 1G3OA 5B08A 2R8HA 3N9UC 4WFAQ 2XMUA 3I0RA 3BN4A 5JVGQ 1HNVB 4DV6F 1F5CA 2GHWA 2CRLA 2WB4A 1XMBA 1GH8A 1VLYA 4ED5A 3DRYA 5D77A 2B4PA 3LP0A 3NBPB 2RDJA 1Z2LA 2WCXA 3H8YA 5LSRA 1X4HA 5DDRC 1VS3A 1JKHB 4DFPA 2O66A 3KOAA 3JB9k 2YWEA 3MR2A 4ID5B 3OHAA 2B3TB 2V4JB 3OFGA 5K8OA 1HR0F 1BC6A 1S6PB 4H54A 1MMLA 1G7CB 2HLTA 3K7RA 2K2PA 5ADZA 3AB4B 2HGLA 3QZ8A 3OUYA 1X5TA 1RT4A 2VASA 5LXYA 1RTJA 5E0OA 1HNIB 3ZZZA 1RT5B 1LWFA 5KTQA 1U4BA 1SUQA 3M6UA 2EFQA 4C8LA 3MMCB 2V8HA 3PX4A 2FHJA 4OHZA 2NPIA 1FTRA 1FHTA 2OPSB 1Q16B 2YTCA 3PACA 1WELA 2UXBF 2E1RA 4RX6A 1NHUA 2DH7A 5T7LB 5DDOC 4N5SA 3OLBA 1U7LA 1SI9A 3ENVA 3WC2A 1S9GA 3LWLA 4LSNA 1RTHA 2V4RA 5D3GB 3MPVA 4U6PA 4K4ZA 4C8KA 3W2VB 1U45A 1JLCB 2GC8A 1S1TA 4QW8A 1NK9A 3JTOA 3E01B 4LFBF 3IA0A 1FDBA 3RAXA 3KHGA 3JSBA 2PMHA 4WYWA 1QJHA 2RUGA 4ZPVR 2JLGA 3T19A 4N8OA 4RW6A 3ZZ0A 2FPHX 1ZM3A 3NAHA 3VTIA 4NLVA 5BJRA 3G6YA 5J2QA 3RYLA 4RNMA 4DL2A 1JX4A 2I2YA 1WI8A 3D1HA 5D4NA 4RW4A 4F3MA 3MGJA 4HH1A 2ZDOA 2KTQA 2J7KA 2X3GA 2YNFA 3CMAS 4IFVB 1L3VA 1LV5A 2GNKA 4TQRA 2BOPA 4JUZA 3V81A 4QWBA 1DQAA 2O5DA 2QA4G 1YJVA 4DSJA 1NAQA 2DH9A 1D8YA 3B8HA 1HYSB 2MKJA 4C9DA 2DNGA 2ROGA 3W2WB 3MD3A 3TUJC 4RWXA 4B9MA 3HZGA 2RH3A 4M63A 2ZUGA 3DLKA 5DRKA 4MH8A 2A1BA 1XNQF 1JLAB 2XLKA 5LMNF 2HHVA 3H4BA 2H9ZA 3CCZA 2R8IA 4K5RA 3CCJS 5AJ3F 4DN0A 2DNOA 2UUBF 1WHYA 3I9ZA 4PXCA 4J9PA 4ECXA 3KK2B 5KFQA 4XDDA 2ABYA 1YG0A 3UPFA 4ITSA 2B5JB 3I4PA 2HLUA 4WFYA 4EWTA 4CZCA 2W7PA 3H5YA 4ILLA 3HHLC 1KTVA 3H98A 4NPOA 1REVA 1HD1A 1X4GA 1VQKS 4FYDA 2ZOMA 2X1GA 1R8CA 1CQNA 1DQ9A 2HRUA 2J7WA 1XWLA 3CVKA 3NP5A 4CTAA 2UZAA 3OTCA 4WTYA 2ZOFA 2G13A 3BQ2A 4TYBA 3DLEA 1TAUA 4FP9A 3IRXB 1HHSA 1OO0B 5A6PA 1FD2A 3D28A 1Q8IA 3DDKA 2C22A 1RISA 1TKTB 1S6QA 5M2RA 4OLPA 5IXUA 5B0EA 3KHLA 2JSXA 1NH7A 3QJPA 1MU2A 3PHEA 4H4OA 2MHNA 2VPWB 4KR0B 1Q4RA 3JYTB 1J5OA 1U25A 4OZJA 3CDWA 4DMZA 1U6ZA 3PKMA 3C6UA 2EK1A 4WFNQ 1NJYA 4LUBA 1IQZA 3R5AA 2M52A 4OV1A 1HNZF 2JL9A 2CPHA 1IJFB 4O4GA 2A2CA 3BSNA 1JNZB 5G0RB 1S6UA 2LEPA 2DK2A 4LJMA 2DNLA 2HNZB 2PA8D 4K0KF 4I67A 1S1VB 1IKWA 5CCLA 4YY3F 3BDPA 1RI7A 2J5AA 4UUXA 2CJAA 4R0JA 3CJ4A 2MKSA 2QLWA 3MAQA 2OD6A 4FF1A 2VZ9A 1M5KC 2ZH6A 4R25A 4DFKA 2XG8A 4NLQA 3CIZA 4UOCA 4I7FA 2ZE2A 2A18A 2DNZA 2KJWA 2RQKA 3DMJA 4OLOA 1JLQB 5E2QA 1HBMA 4ICLA 4X64F 5KFZA 3K5PA 5KFLA 1TL1A 5J2PA 2ASLA 1SJ3P 1QAIA 1QTMA 1VQ6S 3DLHA 1RTDA 4WE1A 3HK2A 2J7UA 2BV3A 1JXLA 3MR6A 1S0VA 4DG1A 2EFGA 3KK3B 1FJGF 4ED2A 2ZJPQ 4ZA1A 1T05A 4H4MB 1JLBB 1U6FA 2MZ1A 5BYSA 1SL1A 2WSFC 3G6VA 2MMYA 2ZH9A 2NUHA 1D3WA 2DD8S 3LP1A 3MM6A 1B7FA 2KKHA 3VQSA 3PJXA 4X62F 2Q3PA 2DGVA 5D4LA 3RRKA 4ZPBA 2M8HA 1YQHA 3DLGB 2ASDA 3CTRA 4N47A 4BWJA 2QMWA 2ZH2A 4K4VA 4DV4F 2D41A 1FJEB 4O3RA 1I6JA 4MIBA 2XZWA 1RT7A 3HI9A 1M90T 1X4CA 1N34F 1VIXA 3CEDA 3QGPA 1AROP 1Q53A 5HLFA 4QBUA 4FNHA 2CYYA 4F50A 4AUKA 3I5AA 2AWZA 3LWMA 2Y1JA 1BLUA 1TKZA 3FFIA 3B78A 2ZNZA 2UUCF 1Q78A 4URSA 2YNGB 5G4DA 2JFKA 2VD3A 4CQ1A 1UA1A 2B56A 1GQEA 2FIUA 2R7RA 3TA2A 3RR8A 4NA3A 2JLEA 3K5OA 2DNKA 2W8KA 3GIMA 4FS2A 5F9LA 1VQLS 4C97A 1QSLA 3W3SA 4ZDNA 3QAEA 2E5IA 2K7JA 2CQ2A 1E6YB 3GB0A 1YVFA 1GTEA 3M30A 5J2NB 2RRAA 2N82B 1Q8LA 2M0GB 4O4RA 5L9NA 3IXQA 2V8DA 2W4DA 3CC7S 3TVYA 3CC2S 4B9VA 3ZZPA 3ONQA 4QIWD 2DR5A 2CPYA 2CQ1A 5DQHA 1U1OA 1TK8A 1IKXB 2XMWA 3BGUA 4AXJA 7FDRA 5CYQB 3THVA 1VIOA 3CJ0A 1IKVB 4HTIA 2RF2A 3FNNA 2VG5A 5KFTA 5KT2A 4IH5A 4TY9A 4IQXA 5F3ZA 4IOBA 3IC1A 4IOCQ 4FNIA 1VBXA 2IM2A 1S4FA 3M9NB 3MFIA 4EZ6A 5I3QA 3CCRS 3OFFA 5EDWA 2OFHX 2D3OR 1S6OA 1TUVA 2RU3A 2BACA 2VFRA 1D9AA 1WF0A 4FBUA 1X4DA 3NG8A 3D2WA 3PR5B 2QZ8A 4XDCA 3Q2TC 2OFGX 1A7GE 3LP0B 1FNMA 1FDAA 3CJ3A 3TANA 4DR4F 4QU7A 2IJNA 3BF4A 1FO1A 1ZAWA 3D54A 5CZXA 3S7RA 2RSQA 1SH2A 5KFEA 4X4QA 1VQYA 3BM7A 3CD5A 3V4IB 1FRJA 2UVRA 5KFVA 3PV8A 3TA1A 4QPXA 4F4YA 2E1MC 4LF7F 3OUYB 4MYTA 1RT4B 3DOKA 1RTJB 1GXUA 2JC0A 2VPXB 1RYSA 2DIUA 1LWFB 1U09A 1SUQB 2MQQA 2BVZA 5KFOA 2ZBIA 5IS2A 1FXRA 1URNA 2Z4PA 5A0YA 3HLUA 3FEYB 2JH3A 1YGYA 4Q8EA 1IJEB 1CQMA 2GMJA 1VBYA 1S9GB 1H38A 5H9FJ 5LJ3Y 3PO5A 2E5LF 4LSNB 4JI8F 1RTHB 4Q2MA 1S1TB 5B0GA 1QUVA 2LQ5A 4NLRA 5KFCA 2XLJA 3N0VA 4A4JA 2KT2A 3CXCR 3JTPA 2KB2A 2KRBA 4YB1P 3BS9A 4YDDB 3M4XA 2XCPA 4DL5A 2HWTA 5KFGA 2VPZB 3HHNB 4BDPA 2N7CA 4RW6B 3K2YA 5J2QB 4A8MP 1HNXF 3N5FA 4OZLA 2XI2A 3QWPA 4C2MA 3HFKA 4NRUA 4RW4B 3OBIA 4OZ1A 2D3UA 3THPA 1OWXA 4QWCA 3V6KA 2YNFB 4OJHA 2W9AA 1K8AT 2PI4A 1HBOB 1X5PA 2HQ3A 3R5DA 4ZPTR 1RA6A 3IAS9 4ID8A 4OHWA 1DJ0A 2GMHA 2UV8A 3M2UA 3V81B 4LF5F 4I2QA 2J9DA 4JOUA 4ZCMA 5IM0A 1WF2A 2EFOA 1ZAVA 2QA1A 3O5TB 1Y3JA 3IGNA 3T1YF 5KG4A 2MQMA 4MIWA 3VAKA 1CPZA 3OW2R 1KD1T 3RU0A 5BR8F 3ZZYA 4IUFA 3M9MB 1SH3A 3DLKB 3HVTB 1VQ5S 1H2VZ 2ZBCA 2DTJA 4Q2LA 4NZ6A 2HMIA 3TW0A 3LW5C 3AA8A 2RKIA 4UY8T 1N32F 3PEJA 3KMQA 1MMNA 1QAXA 1WEXA 4B3SF 1Y9OA 5M2UA 1FESA 5HBMA 1HWUA 3LGMA 2EKYA 3K0JA 4F02A 4AL7A 3KJVA 3VAGA 2GX8A 5KT4A 2AQ4A 3DLBA 2P6TA 1JJ4A 1S10A 1K1SA 4DFMA 4DV1F 3L7PA 4V19X 4RU2A 2G0CA 3CC4S 1H98A 2R7OA 4Y2CA 4DSIA 5J2MA 2NR0A 3M1VA 3TO8A 4ECWA 3QZ7A 1IBLF 2UUAF 1FKAF 3E3XA 2DHAA 3FRZA 1F0XA 1REVB 2VKZG 4HEA9 4Y6IA 5FD1A 4K2XA 2JDJA 2F8MA 2NUUG 1ZM2A 3EUNA 5KAKA 4J9MA 2OSQA 2W7AA 3GFHA 4NLSA 2R2RA 3CDBA 2AYEA 2BANA 4RWWA 2ZH4A 4EO8A 2PA3A 4QWAA 4JI3F 2DJWA 4CTAB 1F60B 4MFBA 1KHWA 1VRTA 3C6TA 3H40A 4AL6A 4XPEA 2ASJA 2KHDA 2C3MA 3L09A 5KG5A 2VQEF 3CCWA 3OQ2A 3PM9A 2VV5A 3H25A 1FF2A 1S6QB 2MPUA 2LCWA 4PUOA 1R6YA 1VQ7S 4K4SA 5I4MA 1NK0A 1UKUA 2KXFA 4NLDA 2JFDA 2PC6A 1N8RT 4H4OB 1SJFA 2UUWA 4OI1A 3VZHA 4DF8A 5DLGA 2JJ4D 1J5OB 4C8MA 2XLIA 1HBUA 3C6UB 1RJJA 2RQMA 4MKYA 1X8DA 4YOEA 3N6LA 2A3JA 4UW2A 3LOUA 4PKDB 2HGMA 1SJQA 1FKPA 2RIJA 3GG1A 2KU7A 4MAKA 4X4TA 2FHJD 4O4GB 1V9OA 1LK7A 1R8PA 3RTVA 1RT3A 4DJBA 2VOPA 2IVFB 1R8BA 2MGZA 1NJIT 2VUGA 3J80Y 2HFOA 4IG0A 5DM6Q 1UW4A 1YJTA 1GX5A 2F4VF 1YRUA 2R7TA 2LXUA 2DNYA 4HLBA 3TA0A 2YKQA 3ENQA 4H4KA 4B17A 2ZNYA 5EWFA 3EGZA 4NLPA 2F8EX 3NMAA 1AFJA 4I7FB 3MEEA 2CVEA 2WSCC 2ZE2B 3DMJB 1HBMB 4ICLB 5D4PA 4ES2A 2IFXA 1TL1B 2LU2A 4KHMA 1BQNA 4ETXA 1V3RA 4X66F 3L3CA 2PN6A 3AA9A 1YI2S 4WXOA 1MW7A 3PO4A 3C2PA 1RTDB 1Y5NB 1KOHA 2EBGA 4WE1B 4K50A 2GHVC 1Y0HA 4B3OA 2K1RA 4DG1B 3D5MA 2HGNA 2R7UA 2MKHA 2JOQA 2L41A 2KZZA 2NREA 4PQAA 1SL2A 3LQVA 1T05B 3RW6A 2V94A 2EVZA 1X4BA 5F8MA 1WTBA 4C8YA 4IH7A 3LP1B 1JLEA 3MM6B 4O23A 4RUHA 1ZAXA 3DU5A 1U1LA 3OV7A 2LA6A 4UQTA 3ITHA 2KVIA 3Q24A 1U1NA 4KO0A 1TV6A 2JHEA 2PGCA 2BYCA 1EETA 3IO1A 1M5VC 1ZH5A 5SUHA 4U7CA 3DCAA 1RT7B 4C0OC 1VQPS 1G6BA 2CJQA 3FDSA 4NYZA 2O01C 3MCSA 4F2SA 1TL4A 1TP7A 2KRRA 2OTJS 2ZM6F 1IQTA 5DJBA 1Q86T 4DDFA 2XY5A 4OZ0A 1TKZB 2HRYA 3FFIB 4NZ0A 3TNVA 4ZPAA 5K5MA 3JSYA 4NWBA 5KFHA 2B9XA 2DRAA 4RW7A 4O3SA 2UVWA 2OH2A 2J0XA 1B0TA 4FZVA 3KG0A 3ZZUA 2F9JA 4F8RA 4CO1A 3VALA 3B82A 4O3PA 4TXSA 4DR3F 1AXQA 4CCHA 1S77D 3KWMA 3M30B 5F41A 2DCLA 2FJBB 2VKRA 4B9LA 2GIRA 3O1LA 1O0PA 2ZH7A 3U1MA 2OKQA 1YRTA 1N5YA 3J7YU 4F25A 4DSLA 2AX1A 5HMWA 1P27B 2ACYA 4KBIA 2BABA 3MM5B 3OSPA 3ISND 4HDHA 3M2VA 2WAQD 4K4WA 4JBCA 1HWLA 2D1CA 2RF2B 2RQ4A 2VG5B 1L3UA 5E3RA 4RU9A 4KSEB 2HHTA 4F4ZA 2L3MA 5IZHA 5I3UA 3H59A 3LGNA 4ALZA 2YQ3A 5CA5A 1TVRA 2GV1A 1UVJA 2NYIA 3M6XA 4DL4A 2L9DA 2CQGA 2PE8A 4ECTA 4WXWA 2HVIA 2VC1A 1KFDA 2WOMA 3RB6A 4P2SA 4JI0F 2EI5A 4MKAA 2KJVA 1UWBA 3QMQA 2ZH3A 5EWEA 3Q23A 3ZFVA 3I5CA 2B7CB 2R2TA 2W8LA 4ED3A 2Q43A 4ZPDA 1S76D 5GAGU 2R9LA 1LKZA 2MYFA 4ZVHA 2WSEC 1MNEA 1UL3A 3IWLA 1KOOA 3JSRA 3BSOA 4DL3A 3V6DA 2JEJA 5E7OB 5A8KA 5D78A 4WYLA 5LSOA 2DNHA 2Z2MA 1R8HA 3GSDA 3HVWA 2JEFA 3N4WA 4E98A 2F8HA 2V9KA 3CDUA 3DOKB 3FZBA 1U1KA 2LMIA 4NCAA 4QYRA 4P6QA 2CPIA 1N5QA 1Y4ZB 2HNDA 1LXNA 1IM4A 2GFFA 2V2KA 4TNOA 5A0YB 3SSQA 5AE3A 4J9OA 3PIOQ 3VAJA 1DAXA 1ZM9A 4WK3A 1IUJA 1VQOS 1RTIA 2V9WA 4CNZA 1QSSA 3FEZA 2ZZMA 5IFMA 1CC7A 1FXLA 2CQHA 4DSEA 4C3MA 4OMFG