5AJ3F

Structure of the small subunit of the mammalian mitoribosome
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
123
structure length
123
Chain Sequence
b'PRYELALILKAMQRPETAAALKRTLEALMDRGAVVRNLENLGERMLPYKISAHNQRHSRGGYFLVDFYAPATTVESMMEHLSRDIDVIRPNIVKHPLTQEVKECEGIVPVPLEEKLYSTKKRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITORIBOSOMAL 12S RRNA
publication title Ribosome. The complete structure of the 55S mammalian mitochondrial ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 18
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2015-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5aj3F00
2RJZA 3ZZPA 5LMNF 1N34F 4DV7F 4LF8F 4DR7F 4LFBF 4K0KF 2BVZA 1LOUA 1IBLF 2HHHF 3T1HF 2J5AA 2UXCF 4LF5F 4DR1F 4JV5F 2UXBF 1B64A 4JI6F 4LF6F 4JI8F 4JI0F 1I94F 1FJGF 4JYAF 4LF4F 4DR4F 1XMOF 4NXMF 1XNQF 4JI3F 1GH8A 4DR2F 2ZM6F 2B7CB 4JI4F 1CQNA 1N33F 4B3SF 1VMBA 5LMUF 1FKAF 4DV2F 4B3TF 2BXJA 4YHHF 4JI5F 1IJFB 1IBMF 2YY3A 4YY3F 1G7CB 4NXNF 1HNZF 2UUCF 4DR6F 4DV1F 4X65F 1F60B 1XMQF 5IWAF 1N32F 2UXDF 5AJ3F 4X62F 4DR3F 1HNWF 1HR0F 2F4VF 4AQYF 2VQEF 2B7BB 2UUAF 2KJVA 3OTOF 4X64F 4B3MF 4LFCF 3R3TA 1J5EF 4GKJF 1CQMA 4X66F 1IJEB 1RISA 4JI1F 1XNRF 2KJWA 4KHPF 4DUZF 4DR5F 4JI7F 1G1XA 2UU9F 4DV6F 1QJHA 3T1YF 4LF9F 1N36F 4DV4F 1HNXF 5BR8F 4DV3F 2VQFF 4LFAF 4DV0F 4LF7F 2UUBF 4OX9F 4B3RF 4DV5F 4DUYF 2E5LF 4GKKF 1IBKF 4JI2F
chains in the Genus database with same CATH superfamily
1YDLA 1SL2A 1OMSA 2B5JA 4G3IA 2ZNZA 1M90T 2ZC4A 1RLCL 5F8IA 1NB7A 4YDDB 2A2CA 3SFGA 4OYXA 1VQ7S 2DR5A 5KG2A 2LVWA 3NGKA 4IDKB 3J7YI 2D9OA 4XK8C 1H38A 3MMCA 4Q0BB 4LR7A 3TO8A 3CW2C 2P5VA 4HT7A 1PAUB 1WOSA 4EO6A 3UN3A 1VRTB 3B6BA 3QPIA 4KHPJ 3MTJA 5DJBA 2X1GA 3PXGa 4DS5A 2MEWA 2HK3A 3A3NB 3HJVA 2R7VA 3CCLS 1EZZB 4FNIA 1JLAB 1C4CA 2AMCB 3WQPA 4ECYA 4CLPA 4ZIWA 2VASA 2OEKA 1U0HA 3H4DA 5EWGA 1KOOA 2XM3A 4ZVRB 3QO9A 4ECQA 4DV4F 1XERA 3PCOB 4LFAF 5C24A 5ETRA 4CQ1A 3KHGA 2YWFA 3DOKB 4UY8T 1U6BA 1T0TV 3BH6B 3F0NA 5EN1A 3QRQA 3VAMA 4KGXB 2DNRA 1BWEA 2DKOB 3UDVA 1QUPA 2VH7A 2AD9A 4IYQA 2XS5A 3CNQP 4EYHB 1Q8IA 2V4RA 4NEZA 1XNQF 2E5GA 2OPPA 1JLQB 4MKAA 5H1SV 3QSIA 2EFPA 2H9ZA 2WK4A 3I9ZA 2N3OA 4CYUA 2NYIA 3HKZD 1R0AB 4ZS6A 1VRUB 1FXLA 4PPZA 2AYEA 4UUWA 3IP0A 5EGYA 2UUAJ 1RKJA 1VC5A 7FD1A 3QMQA 3PIPQ 4BC7A 1NKBA 2KKHA 1CSJA 2IDLA 4NI2A 2UU9F 1JX4A 3T1YJ 3VHQA 5EWFA 3M2RB 5LJ3Y 3PYFA 1B7YB 3DRRB 1T9UA 3WIVA 4RW7B 3ZTSA 3FQLA 3RBEA 4JI2F 1X9SA 3GV7B 3DLBA 2VIHA 3LANA 1LW2B 3FGVA 3JTNA 2GQCA 2X1FA 2D7SA 1RWMB 1ITPA 2QL5B 1TL7B 4JI0F 3CF5Q 3I0SB 2CJYB 3HFKA 4IH6A 3Q23A 2I8EA 3U1MA 4MKBA 4RZRA 3GYXB 1VLOA 1SIWB 3TUPA 5SUHA 2EW9A 2YX1A 3PEHA 2NCKL 5DDRC 4FYXB 3NWRA 2OMOA 3KK2B 2LDIA 4J9RA 1FHTA 1BQNB 4P6QA 5HVFA 1YX2A 1KRPA 1VRQC 4ED1A 4H4KA 2ZBCA 4DUZF 2OUGA 1N6QA 3BQ0A 3IM8A 1H0HB 3DM2A 4N47A 1PAEX 3R1HA 5KG1A 4I56A 2JEFA 1U45A 2DT9A 3HM9A 1GXUA 2FHJD 3ZZTA 1N56A 2F40A 4QW9A 1TK5A 2IJFA 1R43A 4ED8A 2RT3A 1SVDA 1JXLA 1MLAA 3GPAA 3KLGA 3HVRA 5KFRA 2UXBF 2PMZD 2HQGA 2VPWB 3PEJA 1NK6A 2M8DB 3BSOA 5KAKA 1H73A 4KFBB 5LSLA 1TK0A 1A9NB 5KFYA 4F04B 3B4MA 1YKWA 2AW0A 2KFNA 3U27A 3BYPA 3W2WB 1IBMJ 2O1PA 4WP3A 1QD1A 1VJWA 2KM8C 1IKVB 3N5FA 2NS1B 2HSEB 1S1WA 3QGHA 1ZPWX 3TWZA 1BE4A 4KV8A 3RB4A 2Y1JA 3M8RA 2JOQA 4IO1A 3HHLB 3NNHA 4C8OA 2J0SD 4NCBA 1AXQA 4DL3A 5AXKA 3VAHA 2NXNA 2V2VA 4QBUA 5GAEI 4DN9A 3H7HB 1U8SA 3VQTA 6FD1A 1RABB 2DH7A 3AH6A 1KLMB 2B9EA 2XYGB 4TY9A 3IN5A 2ZOMA 2LQ5A 3MM6A 4ZCMA 3PJXA 1LEOA 2H1YA 3JSBA 2ZOGA 3CGIA 1OY8A 4LIWA 4LBHA 2RRNA 3PO5A 3C15B 1HWIA 3JXOA 3IRXB 2FLNA 1M5PC 2IC3A 3QATA 1ZAWA 1HMVA 3M1VB 9RUBA 1WC5A 1NH8A 3PTWA 2AIRB 7AT1B 2A18A 2HMIA 4ZP7A 5F0WA 4LT6A 1WORA 2HWTA 2HFUA 4ZOSA 1FDAA 4ANDA 3KK1A 5BJRA 2OPRA 3CCQS 4M5LA 3HVTB 1K44A 2BANA 1GMWD 4MKVA 1Q1KA 3CMES 3FBCA 1KQKA 5J1EB 2V9KA 4TN2A 2YWHA 4K4SA 4DV5J 4USTA 2RVJA 2K2PA 2E1AA 2YNGB 2ZUAA 1SJQA 4NLTA 4QW8A 4DG1B 1MW7A 5CYMB 5HLFB 1PC4A 4P2FA 2MJUA 3Q0AA 2F4FA 1G4CA 4RWWA 4J9KA 3ZFVA 1IQZA 2R7TA 4PWUA 3AT1B 1F5CA 5KT6A 1FNXH 4DSIA 3BQ1A 2E66A 3GG1A 3SXLA 2D41A 1TUVA 2NXUA 2IHR1 5E3PA 3UQSA 4F36A 2VPZB 1FE0A 4R0EA 1BQMB 2XHCA 2VC0A 3P96A 1RT5B 4C9DA 2R7SA 4U67Q 1I3OB 1RI7A 3CC7S 2MTLA 2DH9A 3ZTPA 2CPYA 5F3ZA 3MUTP 3MEEA 4UQTA 1WEYA 3CIMA 2N4DA 5D0HA 3KJVB 3M8PB 2P6SA 3GFHA 2VONA 4X4NA 1Q5VA 4LIRA 1R6VA 5H9FJ 4NLRA 1UJ6A 5C2GA 4QWAA 3G8TA 1WC6A 1S4EA 3QQCD 1VQYA 1XMOJ 2C2KB 1FRIA 4DPYA 4A8YA 2NZ4A 4LQ3A 3CJTA 2W1BA 4ZDNA 2CZ4A 3S01A 4ANEA 2JH3A 4N77A 2ZH8A 4JI6J 2J9DE 4NPOA 2CAJA 3VZHA 1Q0NA 2WHOA 2HHTA 5SZTA 5DGAA 2QMWA 3EWGA 1TKTB 4F4ZA 3MEDA 2RSQA 1R6YA 4DX6A 5AE2A 1CQNA 2QZ8A 1SXLA 5HI7A 3NLCA 4DL4A 3GWCA 2GZOA 5DG7A 3JAMU 4ID5A 2FJDB 2MQNA 3LF0A 3W66A 2HQDA 3PKMA 3IXQA 3NGDA 3OD2A 2WVCA 4IG0A 3T6BA 3CE8A 4M5DB 2KB2A 3HP6A 1T3OA 3MUMP 5A0YA 2QRRA 4Q0BA 2DIUA 2V68A 3H4BA 1VRTA 2F9DA 2AGQA 4LF1A 1KHVA 1Y5IB 2KRRA 3Q8SB 2V8VA 3D3CJ 4A48A 1SJ1A 5AXLA 1YJNS 1JLAA 2DXEA 3Q86A 4KYZA 2Z2ZA 4W92B 3TP2A 2U2FA 2A1BA 5CCLA 2I6WA 3MPUB 3HHDA 2I0XA 5CZVA 2ASLA 1RLDA 1TL5A 2YTCA 1FKAF 3BSNA 5BYQA 3GYGA 2J7UA 1M5VC 4WFBQ 2CQPA 3HKWA 1NUEA 1T05B 4MMOA 2UUAF 2CPIA 2D74B 3IGVA 2V8HA 5F41A 1JMTA 2CPDA 3NXZA 2WB4A 4GRSA 4XIUA 1JJ2R 1QVFR 1S9FA 3T1YF 1RT6A 1JLGA 5L1LA 1D1UA 2LQ8A 4OX9J 3N6MA 3GTYX 2NR0A 3CCUS 2RNEA 4NLSA 3L7OA 1RT7B 2JSXA 4C11B 1VRUA 4R8UB 4RU9A 2HVEA 5K14B 3DOMB 4WTYA 2QIFA 2KG0A 4KAIA 5IM0B 1KONA 4IQXA 1URNA 3NMAA 1R8CA 2EKYA 1UVKA 1MROB 4C7QA 1SC6A 2F8HA 4X4TA 4ES2A 4L3KA 1YJRA 2KU7A 3M2RA 1SQEA 3EDRB 4O4GA 4LBIA 1R8HA 1NSQA 3DYAA 1CJVB 5JVHQ 1F6TA 3G87A 5KFNA 3KG4A 2FZGB 1QVGR 4IUFA 4GO5X 5D8HB 2XO7A 2VC1A 1U1NA 4NZ6A 4H4OB 4K4VA 4FS1A 2H54B 3VAJA 2GVDB 1AFJA 3I0SA 1TVRB 2VA3A 1NK8A 3LGHA 3D1HA 1A7GE 3AAWB 2JLGA 4EO8A 3GJQB 1QAYA 4ENOA 2K8GA 6FDRA 4FNHA 3VZIA 4K50A 3P4UB 2XEXA 4W98A 2J76E 3KK2A 4ED6A 4IOBA 1GK8A 4QPXA 1BQNA 1S57A 2H4YB 1F5AA 3KHRA 2MLZA 2YX4A 1K1SA 1S6OA 4AE5A 1UVNA 1VMBA 3EICA 3M9MB 3DI6B 4RW6B 4WFXA 1QTMA 3CPWR 1IBMF 3KKFA 1M0SA 1IWGA 2WCXA 4OHXA 1OS5A 2Y3YA 3SSQA 1AYEA 4ZLPA 2I9SA 1VBXA 5DETA 1O5JA 5KFSA 1DTQA 2M9KA 3KUHA 3GG0A 1KLNA 5BYSA 1TZ0A 1U02A 3WX4A 3M6UA 2XMMA 5CCMA 1P27B 3FJ2A 3QFWA 1EX8A 1RTHB 3BO3A 2HBRB 2R7UA 3M7VA 1X5OA 4KFBA 3NNCA 1JIHA 2OPSA 5K20B 2XLJA 3MM8B 2R3VA 2VJUA 3IS9B 4PYDA 2WB1D 1U1OA 1WJ9A 2IM1A 3C6TB 1JJ4A 4ED0A 2PIIA 1IKVA 3LH2S 3Q8YA 3EDQB 1VC6A 2DR6A 1JJHA 5HROA 2MQPA 2HIQA 1I94J 2XO6A 3DLKB 2V5HG 3EM1A 1V5IB 3HHLA 2KN4A 1HNIA 5A6WA 4NLWA 2C2NA 3I5CA 4CH0S 3UE2A 3BREA 2VUGA 2CQGA 4FN5A 4FP9A 1ZH5A 4KPCA 1CEZA 3FCVA 1KLMA 2OI2A 2O3DA 3W9HA 4NLOA 3KG1A 4AT1B 3P3DA 1KS2A 3ZNJ1 4PQUB 5M2PA 2B9YA 4QR1A 2KYXA 3C15A 3IAS9 1T9YA 2AF6A 3IRXA 2DGUA 4FKXA 3M1VA 5E3CA 4DV5F 5HO4A 3FZBA 4ZVQB 4TQRA 2UUWA 4DF4A 2EVZA 1RAOA 4FDFA 1U6ZA 3BKFA 2LA4A 3MM5B 1LK7A 1SC4B 4NX9A 1S4FA 3RB3A 1Q82T 1U25A 2OLWA 3C46A 1RE1B 1J27A 2QLWA 3SEOA 4C6AA 2R8HA 1GXLA 2HHUA 5J1EA 4J9UE 4DU7A 2HNZB 1JLEA 3T5LA 2C2ZB 4DBQA 4YR2A 5EX0A 3HFVA 2HVHA 2V8PA 1X4CA 3GIRA 4ZVOB 4DG1A 3CTRA 1YZ7A 4CM0A 2GMLA 2ZH3A 1IJEB 3L95X 1X5PA 4U9RA 1TAQA 4P73A 1FO1A 2FQQB 3B82A 2FY8A 3M6XA 3HSJA 5KG6A 1CJKB 3EZOA 2XS2A 2PI5A 4PWDA 4J9QA 2DPJA 2CQ2A 3T9ZA 4ECUA 1Y5NB 1XMOF 3MWBA 4TYAA 4DF8A 1HNVB 2CRLA 1HHQA 2UZAA 3I5BA 3E2EA 3IRWP 4U7UK 1RT5A 3FK4A 1NJXA 4X4QA 5KFPA 2ZOFA 4JI6F 4PR6A 5E3AA 4Y2CA 3GIJA 1N5YB 3BJYA 2YWEA 4L72B 3HSZA 2CG8A 3W1YC 2RE1A 3KJVA 2ROEA 3IFEA 2M70A 2Y0BB 2YXLA 3KWMA 4ZCIA 3NEKA 3MMAB 5CQGA 2BRKA 4J37A 3OL8A 2DGSA 4AFFA 3G6YA 1JB0C 4ZLJA 2JDJA 4OX6A 2KT5A 4C3MA 4LRCA 2R8GA 3OL9A 1DRZA 5H9EK 3RW7A 2MQQA 4WZMA 1FVQA 5E2QA 1FWLA 3M8SA 4WXWA 3HZGA 2LKZA 4RUCA 3FUYA 3BV8A 1TKTA 2KTQA 3T6JA 4NL5A 1GXTA 4KJIA 2B0GA 1WACA 2HNDB 4U8YA 4NYPA 4DSJA 3KHLA 4S0MA 1X9MA 2OIHA 3I6PA 4DL6A 3TVZA 1TKDA 2MZQA 4Y0FA 1RGVA 3E3XA 4DQQA 4LUBA 4QIWD 3QAUA 1LK5A 3SCLE 3GE9A 1G2EA 4M5DA 1UW9A 3T5JA 4Q44A 1MN7A 4IRKA 1WD6A 8ATCB 1R8AA 2ZBPA 4WFNQ 3CDEA 3RR8A 3OFGA 2HBYB 2GQQA 2RU9A 2Q79A 2ZKTA 3QZ8A 2L08A 1VIXA 5GAGI 4F25A 1J5EJ 4ZPAA 4GKJJ 4DFKA 3D3BJ 1SKUB 4RW8B 1GX5A 3J7YU 3TZWA 2CA9A 4O0IA 4PRFA 3RZAA 4WTOB 3HVWA 4OX9F 3HT3A 3EVOA 3RAMA 2ZVSA 2AU0A 2BOPA 4KGKA 1IBKJ 1QSYA 1NK9A 1VBYA 1S12A 4U96A 3CD7A 2E9ZA 2CQ3A 2Y9HA 4DCJB 5DLGA 3DRSB 3LP2B 2R2SA 5FDLB 1IKYA 1GNKA 2OFGX 2IDEA 2YQ0A 1XR5A 4F3QA 2LFVA 4HKQA 2HHQA 1TK8A 2KT2A 2A10A 1SBRA 4OJ1A 2SXLA 1RDRA 3JSRA 4LSNB 2BZ2A 4PG6A 1XR7A 3BQ2A 3D0HE 4CLWA 4Q8FA 3CMQA 1C1CB 3CD0A 4Y2MA 2GO9A 1U7LA 3ZZOA 4M5KA 1Y5LB 2R8IA 1RAJA 1U2FA 2XTJP 4I68A 3MR5A 2KJVA 4YQWA 3W60A 1FXDA 3W9IA 2V69A 3DOMA 1L3SA 5CA5A 4NASA 5FLXU 2VOPA 1HBOB 3CJ0A 3R5CA 1MROA 1RTDB 3QNWB 1LWCB 2HZVA 2LQJA 1X4EA 3CDUA 1MWQA 3V6HA 3OV7A 1RAIB 2R8JA 2W7OA 1CJVA 3CJQA 3MPDA 2AEJA 4NLQA 4B9UA 1CPZA 1YGYA 3N28A 3BKUA 1T02A 3WIUA 4BCAA 4I2PA 3TQ1A 3P6YC 3UD3P 5F8GA 3CIZA 4A8KA 2B8PA 3DMJB 4H4OA 3OXGA 3QGGA 1RT2A 2LECA 2X3DA 4WZQA 1TVRA 2VPXB 1HW8A 4XDCA 3LP1B 3V6DB 4DR6J 1MMDA 3H5XA 3I87A 5C25A 4Y6IA 2PEBA 1A0OB 1HNWF 1KDNA 4WFZA 1OO0B 3BZQA 2A2DA 3OL7A 1WF0A 2VFTA 4IFVA 1S7IA 2LXUA 3HHLD 2ALZA 4L73A 4DV6J 1XR6A 5L1JA 3BDPA 4HACA 5HJYA 2BJ3A 3R5DA 5F9NA 2DHHA 1RT1A 3P5TL 4CO5A 4OV1A 1MWYA 1U48A 3MMBA 4X2BA 3GJTB 3DI6A 3POTB 1TMJA 2DEIA 3PM9A 2QMUB 3AHPA 2EFOA 3UDEA 3TJAA 3I0RA 2ZH5A 2LDYA 4OZ5A 1TUGB 2QYGA 4RX6A 5HBMB 4OYPA 3OSPA 3MM7A 1I94F 1FFGB 1JLCA 3BDEA 5L9NA 1X31C 1VQ8S 1M1GA 1RTHA 4HYKA 2BJ7A 3SQGB 2AYMA 1HPZB 2UV8A 1B99A 2XG8A 3MM8A 4P2MA 2QSFA 5KFFA 5JUMA 3LPYA 4JOUA 2FLLA 1S1UB 3DLKA 2UVRA 3EVWA 5B7WA 4ECRA 1Q16B 4IFYA 4B3OB 5LOQA 4I69A 3EUNA 1ZM9A 4WK3A 1BUXA 2MQLA 1MSWD 1KQFB 3IR6B 2QGFB 2YQ3A 2IM0A 2Z57B 2ZE2B 2CQDA 1S6PA 2JEIA 5D6GA 2YNHB 4DSKA 2BE2A 1UAWA 5RUBA 3VGSA 1SJRA 3SI8A 3HK2A 1N52B 1XEZA 2HVDA 1TV6B 2OEJA 3MDFA 3ZZZA 3M32B 5GAEU 2EPIA 3ITHB 1YJUA 4KHRA 3PX0A 1SUQB 2YY3A 4NWBA 3M30B 1DLOB 4DV1F 1S7HA 3J7Z5 4K4TA 3FSIA 1TL1A 1VHIA 4K5SA 3BGOP 3GV5B 2MLXA 4NMXA 1QLNA 4WBFA 4FXWA 2DGTA 3MM5A 4NYOA 4RUBA 3FEYB 2R2TA 3RRHA 4E0DA 5IT4A 5ETVA 2ZH2A 3D68A 4F2RA 2F63A 2R9LA 4AL6A 4ZP8A 4ZKAA 2MZ1A 3H2LA 4OZNA 2AEMA 2DNQA 2A6MA 3GB0A 3KJQB 3EGVA 3DLGB 4CT9A 3VVUA 2Q1LA 3T1HJ 2DNGA 1H7WA 2DHAA 2MZRA 1S77D 1KR4A 1WOOA 2J0QD 1U1PA 4MKYA 3NCRA 2J8SA 2LU2A 4PXBA 1CJKA 1KQSR 5AE1A 4PUOB 1UPPA 2CYYA 3DNCA 1SB6A 3A8JA 2RS2A 3R5JB 2J7KA 2G1DA 4J9SA 1N32J 1EP4B 5JVGQ 3BGRB 1X0FA 2GHWA 2RB7A 4UF4A 2G2YA 5D3GB 1SJFA 1C1BB 4MK7A 4WKRA 3SDEA 2DISA 3PNIA 4ECZA 4H4MA 1F9EB 2BE9B 3CJ3A 1QAJA 2VBWA 3ZXWA 1UCNA 1H2VZ 3RUBL 1NJIT 2RQKA 1XQIA 1J5OB 4O0NA 2PGCA 2B43A 2APOA 5IFMA 2VJVA 4I1TA 4G1PA 2DY1A 4EK2A 2GA7A 4AD6A 3OFEA 4Q45A 3US5A 2VG6B 3RBDA 5HL7Q 1LOUA 4YOEA 2MKKA 2AEFA 2YNFA 5KOXA 4MFBB 1TFYA 2ZJRQ 5IQ6A 4HTIA 4X84A 1FJGJ 5J2QB 3JYTA 2HRTA 1AFIA 1FE4A 1I6JA 3QIPA 1QE1B 1ZM4A 3KUEA 3K58A 3IWNC 1YIJS 4YHHJ 1RAAB 2HLUA 4C48A 4TQSA 3GU0A 3T3FA 2D1CA 1M5OC 2ATLA 1DQ9A 2DB1A 2HNDA 4EWTA 3FNNA 1Z2ZA 3BSAA 1DQ8A 3QT5A 1J5EF 4GKJF 4ED2A 3SSRA 2J0WA 1T03B 2C22A 3ZZ0A 2EFNA 3MZIA 2QL9B 4J9PA 2HNYA 2HZCA 4B3RJ 3ULHA 4EBDA 3P8BB 3M6VA 4NEYA 2GAGC 1IBKF 2ZDPA 2CVIA 1N34J 1NHUA 5HP1B 4ATNA 3R5BA 4TLQA 4J9NA 3UNYA 2MSTA 3KLIB 3DLEA 1UVLA 5CD4A 3W64A 3HULA 2B5JB 2XBPA 1M5SA 3NNAA 2EC2A 1X0PA 1OPZA 1ACMB 1DFDA 2ZD1B 4NE9C 3ETMA 1HHTP 4LR9A 5CXTA 3C3LA 4X4UA 1GMUA 1EQ0A 3TEGA 1APSA 2QSWA 3KK3B 3QGIA 2ZH9A 3T1AA 2YKOA 3OTOJ 4UOFA 4I2QA 3D4JA 1L3UA 4GKKJ 1XMBA 1HA1A 1VYAA 2QJ3A 3DRSA 4O3SA 5FDLA 1S5ZA 3CJ4A 4ID8A 1NJZA 4JUZA 5ETPA 2NUUG 4EBCA 2C28A 4LSNA 4USVA 3ZO7A 3R2DJ 3QO9B 1EKSA 3R5GA 3VAGA 5HQMA 3K5PA 1L3VA 1Q95G 1PO6A 2W2PP 2DNHA 2VG5A 4ECVA 3K59A 2RRAA 4RNHA 4YB7A 2QA2A 3CT9A 1Y3KA 2IM2A 3SMZA 4A4JA 1IKWB 2DD8S 2HW3A 1RAGB 2Q66A 5L38A 3MOJB 1PC5A 2V4JA 3GSDA 3TARA 1RTDA 1JKHB 4Z7CA 3RBXA 4M5HA 4IO9Q 4ECWA 3UWTA 3ZZUA 1RA6A 4DR6F 4LRAA 2ZH7A 2KHCA 1WTFA 3X1LB 5IC4B 1Q79A 4CYUB 5D4NA 1WC0A 3PG9A 3DLHA 4DV6F 4WP9A 1V3ZA 1U1QA 2AWZA 2R7QA 2RMLA 2QLBB 3DMJA 3DDKA 3CD5A 4IOCQ 4CNYA 1FKOB 1YRUA 1VI7A 1BHNA 3Q8RB 5I42B 4KTQA 3LP1A 1UKUA 1RB0A 1IBLJ 1EARA 1H2TZ 2W8KA 2QX0A 1RZMA 1WG5A 5HQLA 3G9CA 2OTLS 2CIMA 4PG5A 3MCSA 4QJVA 4LF4J 4UW2A 1FTCA 2RUSA 4QPTA 3RAXA 3AJDA 1ZAVA 3ZZRA 4WXOA 4DX8H 1QY7A 1K0VA 2IM3A 3BO2A 4F4YA 3O2IA 1LV5A 1KSPA 2HK2A 3M2VB 4HH1A 2N7CA 2FJXA 2VPYB 3TA0A 3J7ZT 2VBYA 1PJ5A 1S0MA 3R3TA 2JFDA 1JLFB 2AQ4A 2LEAA 3B54A 4DZDA 3LQVA 3OR1B 2GJFA 2OSQA 3W2VA 1X60A 3VGVA 3TAMA 2E5LF 1N6QB 4NA2A 4JBCA 3SQGA 3DM2B 3AA8A 2JVOA 3JTPA 4CWBA 1VQLS 3TVYA 2CQ4A 2M52A 2NLWA 4ES1A 1F0XA 1RXOB 2ZHAA 1HWLA 3KLGB 3U1NA 1S1UA 2B7CB 4I6AA 1SIZA 2MHEA 2RHQB 2KVQE 1WEXA 4OI6A 1ZETA 4B3OA 4KQZA 8RUCA 3NL0A 4WU2A 1S9EA 4F3MA 4N41A 4XDDA 2Y1LB 1WC1A 4AQYJ 3GIIA 1ZAXA 2XGQA 2ZE2A 2GGPB 5HQ8A 2G0JA 2KJWA 1FJ7A 1ZS6A 3HHNB 2AJ2A 2FB0A 3OHBA 5C2CA 2KG1A 4R25A 4DL7A 2E5JA 1DAXA 4KV8B 3GZ7A 4CTAB 4HR2A 3M32A 1HQEA 2L9NA 3LGMA 3OR2A 1IM4A 3CEDA 3JSYA 3RJMB 3ITHA 2W24A 2JC0A 1X8DA 8AT1B 1SUQA 5KT2A 1FESA 3LP0B 2FUG9 5KG7A 3T1HF 3E01B 3UFCX 5KFLA 1R0CB 1UMJA 3I96A 4PQAA 4OHYA 4CLFA 5MLCV 2BJ1A 4ZPWR 4DJBA 3IR7B 3R27A 3L9ZA 1T7PA 5KT3A 3HT0A 1H7XA 4TKTA 1Q8BA 3QIDA 4XO0A 3KLFB 2XY6A 1SKSA 2R7OA 2E44A 1F5BA 2IC3B 5F9LA 5KG4A 4DS4A 1HMVB 3GIKA 1SI9A 1N32F 2OD4A 3DLGA 2Z4PA 1JK9B 2E29A 2HMIB 4OZ0A 3FRYA 2NPFA 2RILA 2VKZG 2X7IA 1QSLA 2XS7A 5B08A 3R7SB 5IOLA 3KK1B 2HKEA 2OPRB 2BMBA 2FZCB 4BHQA 4FPIA 3BN4A 3N9UC 3HF5A 3D6MB 4K2JA 3VR1A 4J9MA 1UFLA 3C14A 4AYBD 1NK7A 3P49B 1YJWS 4OI0A 4KT0C 3CCES 4KGZB 3AXMA 2VOOA 2IBKA 4DSLA 4ICLA 4NLDA 2HHHJ 2IJNA 1EP4A 4RO0A 4DR1J 4ZA1A 1V9OA 5DM6Q 4QR0A 5D3GA 1C1BA 1FJGF 3RTVA 1X4GA 3D9BA 3TAQA 4P71A 2CDQA 5E3RA 2BRLA 4ED3A 4YHHF 2W8LA 5KFJA 3PX4A 3TA1A 3SV4A 2PA3A 3CDAA 3F44A 3M6WA 2CVEA 2OPQA 5A2QY 2NZCA 2VG6A 2DGWA 2B7BB 1UEVA 4B3MJ 5KFEA 2IVMA 4MFBA 2JL9A 2ZH4A 5ETOA 2ADBA 2VKRA 2ACMA 2MKCA 1XN9A 1VIOA 5J2QA 1OPIA 1VDHA 3J81U 3NOGA 1TL3B 4Q2LA 3IR5B 3MEEB 2W01A 5CYQA 2UUBJ 4B3RF 2BOAA 5DO2A 1KN6A 1TL4A 2V8GA 2ZKUA 2PFDA 4ZPBA 4L6V3 1N34F 3C16A 2FC8A 3G6XA 4B08A 1KEKA 1NB2A 1NDKA 1IN0A 2XMAA 4FBUA 1M1HA 4PABA 4ZVSB 4JV2A 2CADA 2AJ0A 2JZ5A 1UEKA 1OWXA 3R6GB 2FJAB 2JLFA 1T3NA 3D7SB 2RD5C 1K1QA 4DX5A 1UVIA 4GVLA 2KXNB 2UUTA 2RIJA 4QYZJ 1VHFA 6AT1B 1UA0A 3ADAC 1K8AT 2QG9B 1S1TB 2G0CA 1RWVB 5IT9U 2GVZB 2QA4G 1D8YA 2AX1A 3PRBA 3TUJC 3BSCA 2DNMA 2VDIA 4FYYB 4OX8A 3RB0A 2UXDJ 5AXMA 3MM9A 4LJMA 3W62A 5ETQA 3KLIA 2UVWA 3OTOF 1R0BG 3THTA 4Y2IA 1KTVA 4BWMA 2OHDA 2HHWA 1HBMA 5D4OA 3UO0A 1WHXA 2IPOB 4YR3A 4F0KA 4LF9J 2CXEA 4PXDA 2HFZA 4K4YA 2IFXA 4IG0B 5KFVA 1S76D 2E1MC 4FZVA 2JRSA 2ZD1A 2AJQA 4MIAA 2H4WB 1NPKA 1H2UX 4LF8J 3DHXA 4M1KA 5A0YB 4WJBA 4K2XA 3KK3A 5GAGU 1Q4RA 2PA8D 4A8OA 2VFRA 4DFPA 4NLVA 1B4SA 3NGUA 3A12A 3ZTRA 4DR2J 2CQHA 1VR6A 4TU9A 2J6UA 1VLYA 2PE8A 2IRUA 1UWBA 3EVMA 1HR0J 1D9AA 3OTCA 4HDGA 4DFMA 4RNOA 2XGPA 1OSDA 4NLXA 3HO1A 2CNKB 1V5VA 1REGX 3Q8QB 1CS4A 2XCAA 1IKWA 4C97A 1BD6A 4KHMA 1X7VA 4YEAA 3BGUA 3LUYA 4EI2A 4GO7X 3AFGA 2BUNA 4OJHA 2GMJA 2HHVA 1JKHA 4C98A 1RCOB 2G0IA 4TVAB 1RT6B 1JLGB 3OXFA 2V63A 1UFKA 1WTBA 1TTHB 4ETXA 3MAHA 1IBLF 2CNNB 4JV0A 3CDWA 2KXHA 5DS7A 2DNPA 5K9FA 4QCLA 3FBFA 2FVQA 4ILLA 4LF4F 1RWUA 4JI3F 3BO4A 1OY6A 3TANA 1S0VA 4UZCA 3L4BC 2KZZA 4C3KA 3TNVA 1VQ5S 2F3JA 3RU0A 1FKOA 1P1TA 5I42A 1V3RA 1QUVA 3IG1A 3J7A1 1J2VA 4RW9B 4O4GB 2E7VA 3H59A 2V2ZA 2W2OP 4I4BA 3DYAB 3C2PA 1T11A 3LALA 3KHHA 5DZ6A 2L48A 3U1LA 3JB9k 2BW2A 1X5SA 3OUYA 5LT5A 4MT1A 4DV0J 1FFSB 2FVCA 4N8OA 1LWEA 3LGNA 3H98A 4DQIA 3NAHA 1Q8LA 4AUKA 1B0TA 5ADZA 2NREA 1Q7YT 2W9CB 2HS0A 1EB0A 3M2VA 3A4TA 4LF5J 3RW6A 2DY9A 2M3DA 3GIMA 3NGTA 2EBEA 2FTRA 2ZJQQ 1JLFA 2COLA 2YKMB 4RBVA 2WVEA 2ZM6J 3VALA 2CPZA 1JNZB 3F73A 1UETA 3OR1A 2CWXA 4YR0A 4NLYA 3CJ5A 1H74A 2W2MP 5BXIA 1XIQA 3D0GE 3TX8A 1E6YA 1WF2A 4USUA 4DR3J 4KO0B 2K7JA 4AQYF 4F8RA 5LJ5Y 2ASJA 1RWOB 3OLBA 4OQJA 2G13A 2MY8A 3KNAA 2W2QP 3UVJA 1RSCA 1TQLA 3DFEA 1DTQB 2E7XA 1W26A 5K8MA 2VFSA 5KFBA 3PRDA 4WFYA 2P9EA 2WW4A 2W7AA 4CLUA 1IM6A 1IQTA 2LLZA 1AUDA 4X4OA 4JP8A 3IO1A 2OPSB 3DU5A 1NO8A 2DH8A 2GGPA 4F7VA 1VJQA 1NDLA 3OFFA 1H98A 1NU4A 3I31A 2G1HA 4LREA 1I5OB 2KYZA 4DL0C 2E1CA 4NXMJ 1XWLA 2N3LA 2N4CA 3FC9A 1U2CA 1UZDA 5F3TA 3AODA 4YB1P 5EX3A 5HROB 1N4LA 4CTAA 2VG7B 1NHVA 4GVBA 4FF3A 1OQ6A 2PMWA 1SC3B 4CZCA 1HNIB 1VQSA 2YWKA 4P7TA 3LP0A 1G6BA 1U1RA 2E9TA 1VC0A 3W5YA 4ED7A 2P8IA 3E01A 1NLKL 1R7IA 3KOAA 3V4MA 1VQ6S 4A47A 2AYBA 3ILLA 2JVRA 1N54B 1S1VA 2XQCA 2XI2A 2V0NA 3QBCA 1ZTWA 4RPFA 4NRTA 2VQFJ 2BBEA 3W7BA 4FXVA 1VOMA 3AB4B 2YX7A 4W90B 1UJ5A 4OHWA 3KLFA 5J2PB 5KOWA 1O0PA 4USIA 5K8PA 1FNMA 3T5HA 3NAIA 1WKLA 1ZZFA 5F8JA 3I5AA 4K4XA 2X51A 5F8NA 2NSBA 2HHHF 3KTQA 2B9XA 4DR1F 3N5BA 4LBPA 3J80Y 2DXFA 5A8KB 4NCGA 4CO0A 3O8WA 1ICEB 4DR4J 3ONQA 3GR1A 3VAIA 4ZVHA 1IKXB 2ATCB 1P9YA 2KM8B 1RAEB 3PACA 4OX7A 1NXIA 3QAEA 4MTPA 4ZP9A 2IA0A 2QMXA 4OZLA 1MN9A 3PHTA 4ZP6A 2ZJPQ 1VBZA 1N8RT 3HMJG 3SYZA 3P45B 1WSRA 1JLEB 5EWEA 2E5IA 4B3MF 4RBTA 5CAAA 2RH3A 4R0JA 2HGLA 1HHSA 4KRWA 2PC6A 4WKYA 2VU5A 4L75A 4LRFA 2Z58B 2Y0SD 3M8WA 2HWIA 2BM1A 4DV3J 3BN7A 4V19X 2UUBF 1FRMA 2PSZA 2N7YA 5T7LB 3N4WA 3S8SA 4OFZA 4QU6A 4OI3A 4PWDB 3JQMA 2VBXA 3N01A 3CCVS 1AB8A 1P6TA 1KQGB 1S1XA 1L3KA 5KFCA 1C4AA 3PW0A 1BWVA 4O44B 4OYMA 2IA6A 3R8YA 3V5RA 4F26A 1RYRA 2R7XA 4JYAJ 3C66A 3EJMA 2C2OB 4J9OA 1W2BR 2WW8A 2EFQA 4QIGA 1ELOA 1RTIB 1TL3A 5LMUJ 4DQSA 3BEGB 1JLBB 4YMEA 2CUYA 1U49A 4ZK7M 2RHSB 2WONB 3LPEA 5J1PA 2UXDF 1VISA 2LMIA 3R9LA 3GJRB 5KFMA 3MEGA 1LXNA 4QOTA 2B8QA 3GFYA 3EGZA 3K5MA 3PRVA 2XMWA 1TMMA 1KBRA 3EX7B 4LF9F 5KG3A 2AT1B 1QTNB 3FVYA 5HAOA 5LSRA 3PR5B 1F3FA 3FCHA 1S1TA 2RJZA 2C2MB 2GVZA 4LF8F 5I3PA 1RHMB 2VL1A 3UDCA 2BVZA 4NA3A 2R4FA 3G2XA 1B0VA 1RWNB 2Y1IA 2YVSA 5KFAA 2H51B 4LRDA 2CPEA 2WSEC 2POKA 3AOCA 2LEBA 2UP1A 4P74A 4FYWB 1GH8A 2FLOA 4DR2F 5D0RA 4HL9A 4R5PA 2YKPA 4PZVA 1RKIA 1X4DA 2MB0B 3PYDA 3EPIA 4USHA 1F60B 3VV2B 1U24A 5I4MA 3CC2S 1F2GA 1HR0F 3TRGA 4X4RA 4ELUA 2KL8A 2GS8A 5HMXA 2Q3PA 3HDSA 2ROGA 3GLJA 4ZJQA 4RR5A 1SV5A 1TKZA 2MQOA 5JJBA 1OJ4A 2BQUA 2LU1A 2XSJA 1VQOS 4TY8A 2J7WA 1TAUA 4GMKA 2OP5A 4C0HA 1JXVA 3H2UB 3CCZA 1Y11A 3CJ8A 3OVSA 3SIPB 3K5OA 2LA6A 1RHQB 5J2NA 1S10A 4ZN1A 3G6ES 4DFJA 2ZH1A 3QYYA 3ZTOA 5CD4H 1LW0B 2R7RA 1CBKA 3FMBA 2I2YA 4IOAQ 3LAKA 2V9WA 1IKYB 2OO4A 1S97A 4USMA 2DJWA 1G7CB 2EG2A 4H54A 3S1TA 4N76A 3MAAA 4OYAA 2QA4S 1ZA1B 1T8EA 1DY3A 4PG8A 2VQEJ 1HQUA 1I51B 1FRHA 2B6AB 1ZPVA 4YUDA 2C3PA 4DX7A 2YKQA 4CT8A 2DTJA 2FHOB 3CULA 2AGOA 5ETNA 4D3GA 3ZZYA 3FKBA 4C8ZA 4DUTA 4FYDA 2J6SA 3M4XA 4IG3A 2B9WA 4O23A 4DV0F 2J8AA 5ETMA 4ZVUB 1ZOTA 1NNDA 2HQIA 4OYBA 2YH1A 1VQ9S 3BKTA 3ZZPA 1RUSA 2RQCA 2QT7A 1GTEA 3W61A 2FIUA 1GQEA 4MIBA 2ZBQA 4CCHA 4ZHRA 2NUHA 4LVOP 5E7OB 1WKJA 4LF5F 5DQGA 4RW9A 1P9QC 3OSNA 3EMTA 3G71S 2QN6B 2YNIA 2MGZB 2CPFA 2CZVC 2WAQD 3BPSP 3VGTA 1UW4A 3CXCR 2QTWA 3K5LA 3PO4A 2ZM6F 4I2PB 4ILRA 5ETSA 3QRPA 3OQ2A 4MAKA 3GR0A 5L39A 5DQHA 2VFVA 3SZ2A 1FRLA 1RT2B 2QLJB 4I7FA 4RWXA 2BM0A 3MCNA 4DR3F 4KGMA 3UI3A 1OIAA 2W9CA 3HVAA 5M2UA 3CCSS 4TXSA 3KYLA 5C25B 1AZSA 1HL6A 5DM7Q 2BJ8A 5C5JA 4KE5A 3TZYA 4JI7J 3WC0A 2LCWA 5D77A 1REVB 1SJ3P 2YKMA 3SFUA 2W4DA 5ITHA 1U09A 4IFVB 2BDPA 4DQRA 3IBWA 5I3UB 2HHPA 1YITS 4HACB 5HSPA 3MR2A 4DV7J 4Z7YA 4ZCKA 3AQOA 1RT1B 3UW1A 3MMBB 2XI3A 4KO0A 3E51A 2EEYA 3T41A 2HZAA 3A8KA 3MHYA 4G1QA 4CLYA 2VD3A 3I0RB 4NXMF 4XPEA 4F4WA 2FD2A 1HNWJ 5KFKA 4OZ2A 4Z2XA 2QFJA 3OW2R 4LR8A 4X4VA 3K5NA 3MM7B 4DV2J 2ADCA 1JLCB 2DGQA 2WVDA 3PFOA 2FPHX 2AJFE 2DGOA 1T95A 5HATA 2CKWA 1VK8A 4ZIVA 3L7PA 4FVCA 3CWJA 2IRYA 1SJ4P 1R8PA 4B9NA 3KFWX 2XHWA 2HQFA 4BLGA 1N36J 2ZFHA 1FK9B 2VQFF 1N5TA 2FYXA 4KBIA 2MKYA 1LFPA 3A13A 1FFWB 2XZWA 3D6TB 2VG7A 2RF2A 5LMNJ 1WHVA 2CJ9A 1WOPA 4IFYB 4C4WA 3LTOA 2DPIA 2JEGA 4ELVA 5L1KA 1U1LA 3A3PB 2L9DA 1HWUA 2IAJB 3CO0P 5F8MA 4LF2A 3SCIE 4DR4F 1S6PB 4OLOA 3I9V9 4P10A 4EZ6A 2BE2B 3TEHB 2Q6BA 4ILMA 2C3OA 3ZNUA 2AV5A 2R2RA 2QEXS 1DBDA 4KIAA 2CQCA 2XMTA 1FRXA 1FDNA 1HBUA 3RYLA 4FVMA 1Q8KA 5IWAJ 2H5JB 5J2PA 2AYGA 2XNQA 1TELA 4KR0B 1RWWB 2DHXA 4OYZA 4RW4A 5F8LA 3BYRA 4YS2A 2PN6A 1GT8A 1KFDA 3FBEA 4CM2A 2BJEA 1Q7LB 3MFIA 1XNRJ 1FI4A 1TL1B 4WPAA 5A8KA 4WYWA 3FRZA 1TR0A 4B9MA 1GX6A 2ZC3A 4URGA 5BR8J 1HNXF 4DV3F 1U1MA 4Y28C 1IKXA 3ICLA 1VQPS 1B3TA 1DURA 2E1PA 1YLXA 1B70B 1WDDA 4ANCA 1T94A 1QAIA 3IC1A 1GMVA 3AD8C 3GMGA 4Q2MA 4ZJLA 4MK8A 1KFSA 1Q5YA 5H9FK 1GEHA 2F8MA 1KP6A 2QLXA 4UOHA 3VTIA 4EGLA 5IZHA 3J81j 4DV1J 3G8QA 2VZ9A 1HWKA 3GSIA 4JYAF 3HHEA 2K3KA 2WRMA 2AJ1A 2PD1A 2Z8QA 3LWLA 2CZ9A 5JMNA 4CO1A 5BYRA 1YG0A 1YQHA 4UOGA 2LP4A 1S0OA 2DHGA 5LMUF 1HQ2A 2V34A 3OPKA 5GMKa 2X1AA 4FKYA 3OVAA 3D1OA 4TLRA 1EETB 2WVFA 4EU0A 5T7LA 3M05A 4ZPTR 4C8MA 3TR5A 1NSAA 1HW9A 5AT1B 2CWKA 1EIYB 2Z2YB 2W25A 2RRBA 4A8QA 4O44A 3KLEA 4FYVB 1NHKL 2Z2MA 4NCAA 3QGPA 3PX6A 1CULB 3RR7A 1M1KT 3O3LA 3SDEB 3R7BB 4H4MB 1RTIA 4OZ3A 3G86A 1JLBA 1FDDA 1PBAA 4GC6A 3L7UA 1Y0HA 2D3OR 4ZVFA 2OEMA 2WONA 2UXCJ 2Z0GA 4WP8A 1B64A 4Q7AA 5A76A 3DOLA 1A6LA 1L3TA 2GW8A 2YNFB 1CJTA 1S79A 4CLSA 1SH0A 3KLHB 4DHVA 2B4PA 2HFSA 2YKNA 3BS9A 3QZ7A 1LFWA 1YTYA 4TNOA 3JYTB 4JI5F 1N5VA 1VQNS 4CRJA 2E9RX 3QIPB 1C0UB 4ECXA 1XMQJ 1O51A 5GADU 2ZVIA 5EHHA 2P9GA 3I4PA 1P8GA 1YK9A 4K59A 4NMLA 4Y34A 3OL6A 2C2DA 1WG1A 2KO1A 2Y1RI 4J9VA 3FSYA 4K8RA 1DQAA 4RUHA 2QO3A 2I5JB 3ET6A 1FTRA 4KPYA 3HXMA 3MXHP 3RAQA 3DRYA 4G1IA 5KFXA 4LF7J 2DNZA 3HHLC 2A3JA 4DL2A 3IWXA 1NSKL 2HNYB 3MECA 4WF9Q 4HI1A 4OIXA 3D54A 1FT8A 3UDLA 5FJ4A 2V4QA 3CJKB 2DR8A 3UCUP 1RJJA 2CQ0A 2NQPA 3ILIA 1WSVA 4HVZA 4K4ZA 2HHXA 3DLEB 3BGLA 4DDFA 5AE3A 1HI8A 5HVHA 2OFHX 5B0AA 3ISZA 2ZITA 1ZM3A 2OELA 3QJPA 3UD4P 4YY3J 1UTAA 4CH1A 4BC9A 4OZJA 3Q22A 3CVKA 2KXFA 5T14A 2VQEF 2OMLA 2BR0A 5G0RA 2XLKA 2BE7D 4CLTA 3TX0A 1CG2A 2MDAA 3PYEA 2PI4A 1D8ZA 4CO2A 4DR5J 1YWXA 1G1XA 4IKAA 3QSYB 5J2MA 3EZ5A 1LW0A 2IY5B 3QLHB 4I2QB 3WC2A 1RADB 4HH0A 2LQBA 4DU8A 4OZ1A 3H2VE 3BR9A 1CC8A 4HHHA 3M8QB 2IYGA 2D3UA 2J9EA 2DNNA 2K06A 2VDHA 4CIOA 3AB2B 2F5GA 4P72A 4F4AA 1BLUA 4JV5J 3G82A 2B6AA 4LF6J 1H6KX 2QYCA 2DEJA 3NCPA 1U0SA 2VG5B 1RWKB 2MKSA 3AA9A 2HVIA 2R8KA 1EHWA 3PZPA 1LWXA 3MGJA 3BBBA 3A8IA 2V4JB 5LXYA 1URRA 1O6XA 1PJ6A 5IT0A 4O3QA 1MU2B 1Y4ZB 3HFZB 3QJJA 1HBNA 1ZZNA 1KNZA 1W2IA 3MUVP 2HQ3A 2I38A 5LXRA 4JI7F 1YRTA 1WEZA 3P5BP 2MGZA 4BDPA 3OT9A 4A8MP 1S59A 4HT5A 3H0PA 1ZA2B 2HEKA 4OJGA 1KHWA 2BA9A 2HURA 5FD1A 2LXIA 1HWJA 2HVZA 4DV7F 5B0DA 3ISNC 1F3VA 2KH9A 1OY9A 1TKXA 4F67A 2LXFA 4KY3A 3MCMA 1Y00A 2VA2A 1W7WA 3M8YA 2YWWA 4MYTA 2KVIA 1WI8A 2HGNA 1AW0A 4F2SA 3O6QA 5F0UA 4LSLA 1Z2LA 1QM9A 2DRAA 1REVA 2FJVA 4ZITA 1BMQB 4B3TJ 2C3UA 4DV2F 2DRDA 2DNYA 3MF5A 2UUCJ 5GVQA 5I3UA 4RL1A 2E5HA 4CI0B 3C6UA 3EGNA 4ECTA 2V6AA 4MK9A 3K17A 3NWGA 1Q81T 1VS3A 3CD6S 4Y3CA 3KXDA 2JEJA 2RKIA 3DDNA 4EMDA 2IVFB 2CFXA 3B8HA 3CJRA 1GFWB 2FGOA 1N36F 2DITA 4YN3B 2V50A 5KFWA 2DIVA 3FCWA 1RACB 2HFNA 1LXJA 2DGVA 2MZJA 4E98A 5LMNF 4ZVGA 4DR7J 1JWWA 1PG5B 1C0TB 2H48B 3R5AA 2CNOB 3W2VB 5A8RB 2QC3A 5IC6B 3TAMB 3NCQA 2Z30B 1U26A 1PKUA 3N6NA 2MXYA 2W9AA 4NRUA 3JAMY 3NP5A 2B4UA 3JSMB 2RS8A 4OJ3A 2XZTB 2GX8A 3MTKA 2XSFA 5L9XA 3SBMA 2CJQA 1FK9A 1WHYA 1DZ5A 2BXJA 1WC4A 1SL1A 2WOMA 4L3NA 1W25A 1XBWA 5DDQC 1WKKA 3DLJA 5IWAF 2WSCC 5J1NA 3CCRS 4OMFG 4XTTA 4L76A 5LSOA 3W3SA 2BKOA 4FS2A 4X66J 2P9CA 1S9EB 4G65A 2E5LJ 4WE1A 1UFWA 4P52A 1XNRF 4KHPF 4HDHA 3GYNA 5D15A 1BQXA 2IAJA 2BABA 4HHUA 2VB6A 1UVJA 1HYSA 1PIEA 2JX2A 3E8OA 4M5IA 5BR8F 4QWBA 1EJ7L 1LKZA 3KDOA 3X3UA 4KH1B 2RAQA 3EYZA 3ILJA 4N56A 4YFUA 5D0GA 4Q43A 3WDOA 4IDKA 2J9CA 1HQEB 3OR2B 2MKIA 2N82B 3NS6A 3DC2A 4DEZA 2GHPA 1WDTA 2QE5A 3PW2A 1L5UA 4UOCA 1PYTA 3HI9A 1NSPA 4XAKA 4NLPA 2EKNA 5M2RA 2HPUA 3NG8A 2B51A 4QWEA 3IA0A 4G6VB 3UN2A 2FC9A 5H9EJ 4F50A 1BY9A 3O5TB 5ETTA 2HHSA 4URQU 5HK4A 3DRPB 2BEFA 2DVIA 3RG6A 4PCQA 2JJ4D 5KT7A 3DU6A 2PO4A 1DARA 2XNRA 3DOKA 3D6HB 1WNEA 1VQKS 2NXJA 3OVBA 3H20A 2YPZA 3C8YA 4CLZA 1EETA 3C14B 4RJVA 2UXCF 2NSCA 1JLQA 4U8VA 5HANA 2CJBA 4HEA9 4M63A 4ICLB 5F8HA 2WBRA 2HGMA 1X4HA 1R0AA 4JI4J 2L3MA 4QU7A 1N5QA 2GIRA 1NK5A 1N33J 4Y2AA 1CULA 1NKCA 1NK4A 2AZ1A 1SCJB 1OSCA 3H5YA 2B4OA 3JQKA 3QWPA 1Q78A 5K5MA 3VVTA 4DMZA 1XMQF 4IH5A 4RU2A 4M95A 5B0FA 2YWGA 2EC0A 1RHKB 4I6WA 3DRRA 2NXCA 1R31A 4CLLA 2KHDA 4RW7A 2CPXA 2OPQB 1X4FA 1FVSA 3AD9C 1LW2A 1YBUA 2CQIA 1XTZA 3KLHA 2XWXA 4LF7F 3RGIA 4NYZA 1AT1B 4EEYA 3V4IB 1SPBP 2RU3A 1U47A 3TI0A 1TL7A 4P2SA 3TJ8A 4ZVPB 2MPUA 2P6TA 5CYQB 1C0UA 3AJ1A 2C2RA 5CZXA 5KFGA 3C19A 4PPDA 1AUSL 3C16B 1R27B 1RQ0A 3MMJA 1HD0A 3R6LB 4WFAQ 3EGWB 2I5JA 2HQCA 4M5GA 5T41A 4FF1A 4J91A 4NLGA 2WSFC 4YY3F 2AGPA 3MR7A 3QRRA 4P2XA 1YJVA 1MG7A 3K0JA 5LL6d 3NS5A 3JTOA 2OSRA 3S6EA 3KMSA 1NMEB 4DL5A 3H8YA 3S7RA 3OJUA 2JNJA 3MM9B 3CJKA 5GAHU 2ROPA 4DR5F 2B56A 2U1AA 3ZC4A 5CABA 2HBQB 3BBFA 1HBMB 3D1QA 4K4WA 2M88A 4DN0A 4ZCLA 2HIYA 3W5XA 2HYIB 3D0IE 3EPGA 4JV5F 2HRYA 4J5OA 1M5HA 3UNGC 4LF6F 3L3CA 2DR9A 1S99A 1BXNA 3TAPA 2V2QA 3HX9A 3H5UA 3W2WA 2YQ1A 2XYHB 2BKPA 2IMWP 3M2UB 5ETLA 3KG0A 3QLHA 2V8DA 4C8LA 3OHAA 3NY0A 2RDDA 2GQ2A 4ES3A 2GNKA 3M8QA 1D9DA 2L9WA 1NBEB 4URSA 3QT7A 1YJTA 4BBYA 2NYHA 1FD8A 4I67A 3PY8A 3EE3A 1UWBB 3MAQA 4PG7A 1OYEA 4EYIB 2ZDOA 3OBIA 3LOUA 4RNNA 2DCLA 1KD1T 1CS4B 3Q24A 1FEHA 1LWFB 1Y3JA 1HLWA 3D28A 5CHCB 1N0VC 3PR4A 4K4UA 1BGXT 1MU2A 2EG1A 3D67A 2DO4A 2MYFA 2DXDA 4TU8A 2XY7A 4KKOB 4JI8J 1WWHA 3CC4S 4ZPDA 4ER8A 4OYIA 5HJXA 3DGPB 3QJLA 4B3SJ 4CLKA 2FLPA 1WF1A 1UEUA 4B3TF 4IQMA 2CNLB 2YBVA 1IBCB 1HD1A 5KFOA 3VAKA 2UUCF 4ZMMA 2WZ1A 4MJKA 4C2MA 3HVTA 1EAYC 2XYPB 3NKYA 1QDUB 1MNEA 3WHIA 1HIYA 4JI1J 5DLFA 2B4VA 1FF2A 5C42B 3N0VA 3IG1B 2XULA 2YNGA 4Y2KA 2EXUA 5L46A 2C42A 2K7KA 5CYMA 1UJ4A 4F02A 5HLFA 2MKHA 3SCJE 5A8WB 4KC5A 2FJBB 3OUYB 4DR7F 4JI3J 2C2EA 4P7VA 4LQ9A 1AROP 2W4CA 5E0OA 1LWEB 3CCTA 1F9HA 5IS2A 3MFHA 2PEHA 1RAFB 3GQCA 1PYOB 2NXEA 1PBUA 2HS4A 2YH0A 3U7JA 4QIVA 3GFZA 2RDIA 1BQMA 3DHWC 9ATCB 2M2BA 3CSKA 3IGNA 3R2CJ 4NXNJ 3I82A 3QWUA 4QQBA 1IR0A 1X4BA 1JXEA 4TYBA 4L74A 1S48A 1KKHA 5KT4A 1VQMS 3R97A 3M8PA 4F0HA 1C0TA 1RWXB 1BC6A 2V67A 2WBMA 4B9SA 5A8RA 1VQ4S 3V81B 4X66F 1RT3B 1E6YB 3TUZC 5G4DA 3V6JA 2BV3A 5IQQA 1SH2A 3JSMA 2BQ3A 2XCPA 3UVJB 2Q43A 4AL5A 3FFIB 3F56A 3DRXA 3G8SA 4OHVA 2MMYA 4LFBJ 1IR1A 2J6TA 4U7CA 3V6KA 3CDBA 5KFTA 3MD3A 3I4HX 5KTQA 2GJIA 4C8KA 2GJ2A 4F0MA 4BWJA 3BB5A 3NRBA 1ZBTA 2MZTA 2M4MA 2ASYA 3MPYA 3UR0A 4TU7A 4FF2A 4C8YA 5DDPC 1RBLA 3THVA 2CJAA 3VWSA 4OLPA 1VK3A 2AP6A 2OAUA 2BJDA 4K5RA 3IBCB 3ZTQA 1AA1B 1SQGA 3I32A 1O8BA 3PYGA 3KDNA 5HVGA 1WHWA 2AJ4A 2HFOA 3U02A 2DHSA 1U6FA 1IR2A 1RYSA 4GVBB 3RB6A 4X64J 4PWWA 3K8VA 1S6QB 2GHVC 3H40A 2CPHA 4DLGA 2OD6A 4NA1A 2AX0A 2Q6CA 1HARA 1KVJA 1E6VB 3ENWA 2GMHA 1RCXB 3TW0A 1SKWA 3UR3C 3DLLQ 2AKWB 4F4KA 1S1VB 4A8WA 4K0KJ 4FF4A 3AOAA 1NRKA 4DCOB 3A8EA 2ZHBA 1ULRA 2HLTA 4JV1A 2G2OA 1NPRA 5KG0A 2EFGA 5JXSA 5KFUA 2W9BB 4M94A 3DRPA 1GAOA 3TJ9A 4RKUC 2F1FA 5IXUA 4JI4F 2R7WA 1T05A 4QR2A 2BACA 4NCGB 1N33F 1N88A 2OJ3A 4OI4A 4V19J 4USWA 1YVFA 1U2RA 1CLFA 4E8UA 5FLXY 3Q8UA 1S49A 3TYTA 3O1LA 1OQ3A 4USKA 3GP9A 5LM7E 5AJ3J 1DJ0A 2DBBA 2LEPA 2A0FB 2M5YA 3VAFA 3M9OB 3IMQJ 2FGCA 1KC8T 5K8NA 1F2HA 2K1RB 5B0GA 1Y7PA 4IRCA 1RT7A 4U6PA 1FDBA 5E5NA 4C11A 4R8UA 5K14A 3HD1A 3IBFB 3PFEA 1TP7A 3MURP 5IM0A 2F7VA 4A8FA 3LA0A 4OYWA 3BPDA 4HI2A 1X4AA 4OYOA 4J7CA 3T5KA 3D6FB 1KOHA 5KFIA 5KG5A 2W7PA 2H5EA 3FDSA 2HWHA 2PDAA 4F3OA 3PJ9A 2YKAA 1CC7A 3WX8A 2EBGA 1S1XB 4DI6A 2VBZA 1UA1A 1Y9OA 3AXKA 2JC1A 4WYLA 5IV4A 3MR3A 2HRUA 3H5SA 1IJFB 3ILOA 4O3PA 3V4IA 4X65J 4WCEQ 1SQFA 4U7UD 1WI6A 4V1Ak 1YZ6A 1QAXA 3MD1A 3L09A 5KFZA 2VHGA 2HAIA 3CCWA 2GVDA 1IWAA 4DSEA 2VICA 4ELTA 3Q8VA 4IRDA 5GADI 3W8GA 3W9JA 1RTJB 3MEGB 2DO0A 4J9LA 2V94A 2MLYA 2FHKA 5A2QU 2L41A 2CG4A 4DQPA 1RU1A 2Y8YA 3Q2SC 4PXCA 4EUVA 2M7SA 1R3NA 3F41A 4DZ6A 3TVKA 4CNZA 5KFQA 4ETZA 3NBPB 1CJUB 4DSFA 4Y00A 3EZUA 1WC3A 4RW6A 4DPWA 5DZ7A 2EK6A 2BKNA 5E33A 3GJSB 3ELHA 3DDIA 2MZSA 2DNLA 3DXBA 3SCKE 1V6HA 4CO3A 3TZZA 1VGYA 1NZAA 4ED5A 1NCLA 2GIFA 4C0BA 3AOBA 2WVBA 2UV8G 3G96A 4R5PB 4DLEA 3HSGA 2MQMA 1FKPB 4O3RA 1HI1A 4M5MA 1S72S 2PMHA 1NJWA 1YBTA 1EQMA 3FZ2A 1K47A 3QT6A 1S6UA 4NZ0A 3HZEA 3PVXA 3K57A 1FRJA 3IS9A 2GFFA 3EXCX 4M5NA 1DTTB 2C3MA 2FY1A 3C6TA 3M2UA 3QFHA 2QFIA 2YPYA 2OKQA 1SV5B 3OTDA 1TKZB 2BJ9A 4ERDA 1C2PA 4YB6A 2XSJB 3KJNB 4TY8B 1SKRA 1ZYQA 2LQ9A 5IV3A 5D4PA 2J5AA 5GMEA 2UVVA 2B3TB 2Z2LA 4LMZA 4O4RA 1RBAA 4JI8F 2CPJA 5D78A 1FJEB 4N8NA 3HJFA 1PILA 3W63A 2R42A 1S9GB 5J2NB 1F1BB 3BH7B 4PG4A 3CMAS 4A8SA 4B3SF 2ZZNA 4DOZA 5U47A 3RBZA 2V2KA 4M8LA 2GIQA 2GAHC 1LWFA 4PQUA 2XMUA 1D3WA 1OYDA 2CQ1A 4WIIA 1YHQS 2DGXA 2UVUA 5L1IA 4LFCJ 1ZTTA 4KGVB 4Y65A 2PFFB 4OL8A 2GO8A 4QWDA 1JNRB 3DKDA 4JI1F 3D5MA 3MAAB 4KKOA 1HQUB 4DWIA 2MJNA 4AL7A 3DGPA 2MHNA 3SV3A 3B4DA 2FVPA 4IG3B 3Q2TC 4I64A 4O3OA 2KI2A 2VF3A 3ISND 1Y10A 3HSDA 4B17A 2KFYA 3OFHA 3AY0A 2HNZA 3H90A 4ZHRB 3GILA 1RT4B 5C42A 2Y8WA 5A6PA 2XY5A 4Z37A 2YNIB 3TQEA 3MPVA 2BW7A 4RBUA 1HNZJ 5A8WA 4NXNF 5KFDA 1YJ9S 3B78A 2ASDA 2XMVA 5B0CA 4ZPVR 2F4VJ 2AZ3A 3R7NB 2AHOB 3UN5A 1D0EA 3MOZA 1FA0A 4ZVEA 2XMKA 2I1RA 2A6OA 4B9LA 4I7FB 2ZH6A 2RDJA 2ZBIA 1NH7A 1RBOB 1UVMA 1HNVA 3M9NB 2JWNA 3PKYA 1AZSB 3DXSX 1IXKA 4USJC 5HMZA 2NPIA 2JFKA 2H3EB 2KT3A 4WIQA 3Q8PB 1IVZA 4LFBF 1UPMB 2QA1A 3FEXB 5CYJA 2DK2A 1N5YA 2HAFA 1NKEA 1RHJB 3W5ZA 2DCUB 4EZ9A 3RRGA 3MMAA 3KLVA 5DG9A 3V81A 2G4BA 1RT3A 2CJXB 4ITSA 4QIEA 1VBKA 3AJ2A 3UD5A 1XJWB 2EK1A 1NAQA 2M0GB 1U4BA 2IVYA 4G1QB 5GMDA 2OH2A 3FFIA 3THPA 4HTJA 3FBBA 5D4LA 1YJ7A 2ZUGA 4JB8B 4X62J 1SL0A 5B0EA 1NDPA 2D69A 3ENAA 4X64F 2G9OA 1RA7A 4FPRA 2D3ZA 7FDRA 1TFWA 3GFXA 1D9FA 3FQKA 4CH7A 5FIIA 5HMWA 1RWPB 4K7QA 3RRKA 4C0OC 4EFAC 3PJWA 3GCWP 5DG8A 4K0KF 3AQPA 1T9VA 4N5SA 4I6YA 1EKRA 3LWMA 3M8ZA 2QL7B 1RK8A 2RF2B 1PJ7A 2E7WA 3ENQA 1U8WA 1S6QA 2J0XA 2HG4A 2ZHOA 3WBZA 3NOCA 4XPCA 2XC9A 3R1LA 1E6VA 3OXLA 2WTFA 4QIFA 4W4MA 2RQ4A 1HI0P 4ZPCA 5E41A 4MIWA 1VCTA 4FXDA 2ERRA 3HD2A 5AJ3F 2EFVA 1KVKA 4RW8A 4C8NA 3ETOA 1FWKA 5I3QA 2XWYA 1B7FA 1B0PA 1S0NA 1X9WA 1HBUB 3DGVA 2VODA 5DRKA 5DGBA 3MMCB 4DPXA 2W9BA 3D2WA 1FXRA 1FCAA 4RW4B 3KUGA 4P75A 3PW4A 2JHEA 3CB4A 4DUYJ 4J90A 3LW5C 1PYSB 3LP2A 3NGRA 2K3IA 1YBAA 1NM2A 1HKAA 1R89A 2BX6A 1NEEA 3MPWA 4PXEA 1FRKA 4B9TA 2IJRA 1U0HB 3IWLA 3OJSA 1RU2A 1UL3A 1C1CA 3K8WA 4RNFA 2K1RA 1ZM2A 2HFVA 2RUGA 3VCDA 5C24B 1T9XA 4RLEA 2M8HA 3J80U 1YSJA 2KDOA 4X65F 4MH8A 1Z1ZA 2ALYB 4RUAA 1HNXJ 2VFUA 2E1RA 2W2NP 4ECSA 3LAMA 2QV6A 3BBCA 1HBOA 4NOHA 4N7TA 4QYZK 2KFZA 2ZNYA 1LWCA 1T9TA 4HLBA 1NDCA 3K89A 2OPPB 4ZN3A 1RP5A 2IMOA 3KJFB 3H25A 4ZLNA 3KNGA 1ROFA 3OTEA 3TA2A 4DV4J 1FX2A 1Q53A 3J7AN 4KSEB 3UCZP 1SH3A 4LFAJ 5DQIA 3HCXA 3IAM9 2X3GA 3KLEB 3V2UC 1Z4UA 3WZ0A 3IM9A 3PDNA 2DYAA 2F65A 3D66A 4H4KC 4ZJOA 5EDWA 4WU3A 5C7PA 1I1GA 4NI2B 4UZBA 3I56S 4PAAA 4CP5A 1QSSA 3V6DA 1XNQJ 4A8XA 1RTJA 2IYIA 1M5KC 2DR7A 2J9DA 1X5TA 2MKJA 3DOLB 1HFEL 2QLFB 4IH7A 2GV1A 2ZEJA 1CJTB 1H72C 1UZHA 5D0EA 1KWMA 2IIHA 3I55S 4LRBA 1MWZA 2CQBA 2FHMA 2YKNB 1MMNA 3T9NA 1RHUB 3PHEA 1GTHA 3JQJA 2P2CB 1XC9A 3NBPA 5DDOC 2BQRA 1CJUA 1JQGA 1WELA 2BYCA 5K8OA 4I0WA 2D9PA 2UU9J 2ILYA 3FSXA 1QJHA 3LO3A 3QT8A 3POTA 1RTZA 5HN0A 3A1YG 3VF0B 4UY85 4CDIA 3A3OB 3AD7C 4JI2J 5GAHI 3Q83A 1TUWA 4KH0B 3ET6B 5HBMA 3N79A 2JLEA 5L8RC 1FKPA 3DCAA 4JI5J 4ED4A 3MECB 2LYVA 2X1BA 4ALZA 4JI0J 2OGUA 1FX4A 1YRXA 4NZ7A 4YB5A 1F9FA 1FD2A 3HPOA 3N6LA 1PCAA 1HPZA 1K9MT 3CO9A 4QWCA 1DTTA 1N0UA 4DPTA 2IBOA 4GC7A 1NJYA 1JJCB 3VGUA 1N5SA 2OTJS 1FERA 2EWHA 4LFCF 4UUXA 2PT0A 4EBEA 3OLAA 1FWPA 4PKDB 2FJWA 1FJCA 3BF4A 4DUZJ 4DXLA 1XK8A 5G0RB 4KB7A 2G2ZA 3EXYA 2FVRA 1S9GA 3VQSA 3G4SS 4D3HA 3MEKA 4E2FB 3GV8B 2YNHA 2ZWPA 3Q89A 4ZVTB 5J2MB 2ZZTA 4F4XA 1SC1B 3SQOP 1S1WB 4OV6A 1Q86T 2W4PA 1TV6A 2UXBJ 2MQ8A 2D3O1 1YI2S 1TU0B 4X4SA 2MSSA 3M30A 3GCXP 1DLOA 3G82B 2DRBA 2ZWOA 2F8EX 4UTGA 5THWA 2RQMA 3UCGA 3HLUA 2FHJA 4OI1A 3NGSA 2ABYA 1HNZF 3UPFA 2Z56B 1LQ9A 3G6VA 4P9SA 5MAOA 3MM6B 3K2YA 1R8BA 1WUUA 3DN9A 4UQGA 2O66A 2F4VF 1RAHB 2O5DA 2FDNA 3SSSA 2C3YA 2ZZMA 5AXNA 3CCMS 2XMJA 5EUHA 4B9VA 4Q8EA 2DNKA 3PIOQ 5KT5A 3MCOA 4LVNP 1UP1A 2EI5A 3T19A 2ILZA 1HBNB 4MYUA 4NLUA 1RT4A 3CJSA 2XB2D 3W65A 2KRBA 3NS7B 5B09A 3TZXA 3NMRA 4RNMA 3PW5A 4QYRA 1IUJA 4ZLLA 3JS9A 2O01C 4AXJA 3ENVA 2BANB 4PUOA 1NPPA 1PSDA 1FEEA 2GCFA 1TKXB 4O3NA 3O44A 3PV8A 4A46A 1NZ8A 3BGRA 1D09B 4U95A 1UWAA 2FVSA 4PEOA 4DPUA 1MMLA 4LSLB 2CJKA 1P1LA 2H5IB 3GONA 3J81Y 4X62F 2HBZB 2VV5A 1CQMA 2MY7A 2R2UA 1J5OA 1RISA 3CCJS 1U1KA 3C6UB 1K0TA 1RHRB 2DNOA 2FZKB 3PW7A 2IRXA 3BR8A 4UT4A 2HS3A 4CO4A 4HHJA 1KVIA 2CDRB 2RKIB 2ZBRA 3MR6A 2XLIA 3BGFA 5B0BA 5ETKA 4WK1A 4YP3A 1V3SA 3CJ2A 3MI7X 4QZVB 4OHZA 2GC8A 1QE1A 3CUNA 3FEZA 5IT9Y 3H42A 4WWSA 2XZDB 3OTBA 2C1EB 4DCPB 1GMWA 4M5JA 2O67A 2ACYA 4Q5VA 4OI2A 3FMWA 4IR1A 1H3DA 4PYAA 1K73T 4YDXA 3TOQA 4B02A 2F9JA 5HMYA 1N48A 1WG4A 4FBTA 5E3QA 1T03A 4DPOA 3KMQA 2FJEB 5CH7B 1CVJA 2KZMA 3BM7A 3K7RA 4AXIA 3HHKA 2WOMB 4X4PA 1PGZA 1VFJA 1G3OA 1KTQA 1T9WA 5KFHA 3TUIC 1FNOA 1NK0A 4BS2A 3MEDB 5HP1A 4C3LA 1LNQA 4LSZB 4WE1B 4IR9A 1DHMA 2H65B 4DUYF 3W8PA 4GKKF 1HYSB 4ID5B
chains in the Genus database with same CATH topology
1FEHA 1LWFB 3N4WA 3DI6A 1SL2A 1Y3JA 2B5JA 3S8SA 3POTB 4G3IA 3D28A 4OFZA 4QU6A 2ZNZA 4OI3A 4PWDB 3PM9A 5CHCB 1N0VC 1M90T 2VBXA 3N01A 3CCVS 3AHPA 1P6TA 2EFOA 2ZC4A 1KQGB 3I0RA 1S1XA 3PR4A 1L3KA 4K4UA 2ZH5A 5F8IA 1NB7A 1BGXT 1MU2A 5KFCA 2EG1A 4YDDB 1C4AA 2DO4A 2LDYA 2MYFA 3PW0A 4OZ5A 4O44B 4TU8A 4RX6A 5HBMB 2XY7A 2A2CA 3SFGA 2IA6A 4KKOB 3V5RA 4F26A 3OSPA 1VQ7S 2DR5A 5KG2A 3MM7A 1RYRA 2LVWA 1JLCA 1I94F 2R7XA 1WWHA 3NGKA 4IDKB 3CC4S 3BDEA 3J7YI 4ZPDA 3C66A 2D9OA 5L9NA 4XK8C 1VQ8S 1H38A 3MMCA 4J9OA 1W2BR 2WW8A 2EFQA 4Q0BB 3TO8A 4QIGA 1ELOA 3QJLA 1RTIB 1RTHA 2P5VA 1TL3A 4HT7A 4DQSA 4HYKA 2FLPA 3BEGB 1JLBB 1WF1A 4YMEA 4EO6A 1UEUA 4B3TF 1VRTB 4IQMA 3SQGB 3QPIA 1U49A 1HD1A 3MTJA 5DJBA 2X1GA 5KFOA 3PXGa 2AYMA 4DS5A 3VAKA 2UUCF 4ZK7M 4ZMMA 1HPZB 2WONB 4MJKA 2UV8A 3HVTA 4C2MA 2XG8A 3MM8A 2R7VA 3CCLS 5J1PA 2UXDF 4FNIA 2LMIA 3NKYA 2QSFA 5KFMA 3MEGA 1LXNA 1JLAB 1MNEA 5KFFA 1C4CA 4QOTA 4ECYA 5JUMA 3LPYA 5DLFA 2B4VA 3GFYA 4JOUA 1FF2A 2VASA 3EGZA 5C42B 3K5MA 2XMWA 2FLLA 3H4DA 3N0VA 1S1UB 5EWGA 3IG1B 2XULA 2YNGA 3DLKA 1KOOA 4Y2KA 3EX7B 2UVRA 5B7WA 3QO9A 4ECQA 4LF9F 4DV4F 5KG3A 1XERA 4ECRA 2C42A 2K7KA 1Q16B 5CYMA 1UJ4A 4IFYA 4B3OB 4LFAF 4F02A 5HLFA 2MKHA 3SCJE 3FVYA 5LSRA 5A8WB 3PR5B 5C24A 4I69A 3EUNA 1ZM9A 4KC5A 4WK3A 2FJBB 3FCHA 2MQLA 1S1TA 1MSWD 2RJZA 4CQ1A 1KQFB 3OUYB 3KHGA 2YWFA 3IR6B 3DOKB 4UY8T 4LF8F 4DR7F 2YQ3A 5I3PA 2IM0A 1U6BA 2VL1A 2C2EA 3UDCA 2BVZA 4NA3A 2ZE2B 2R4FA 4P7VA 4LQ9A 5EN1A 2CQDA 1S6PA 2JEIA 5D6GA 3VAMA 2DNRA 1B0VA 2YNHB 1AROP 2YVSA 2W4CA 2Y1IA 5E0OA 4DSKA 1BWEA 1LWEB 5KFAA 3CCTA 2BE2A 1UAWA 5IS2A 1QUPA 2VH7A 3MFHA 2AD9A 4IYQA 2PEHA 2XS5A 1SJRA 2CPEA 3SI8A 3GQCA 2WSEC 2POKA 3HK2A 4EYHB 2LEBA 2HS4A 2UP1A 1Q8IA 2V4RA 2YH0A 1N52B 1XEZA 1XNQF 2E5GA 2OPPA 1JLQB 1TV6B 3MDFA 3ZZZA 4MKAA 5H1SV 3M32B 4QIVA 3GFZA 2EFPA 2FLOA 1BQMA 2RDIA 3DHWC 3U7JA 4DR2F 1GH8A 2M2BA 4HL9A 5GAEU 4R5PA 2H9ZA 2EPIA 2WK4A 3ITHB 3CSKA 2YKPA 3I9ZA 1YJUA 1RKIA 2N3OA 3IGNA 1X4DA 4KHRA 3PX0A 2NYIA 3HKZD 1SUQB 1R0AB 2YY3A 4NWBA 3M30B 3I82A 3QWUA 4QQBA 2MB0B 1IR0A 1DLOB 1JXEA 1X4BA 4TYBA 4ZS6A 3EPIA 4USHA 4DV1F 1S48A 1S7HA 1VRUB 3J7Z5 5KT4A 1F60B 1U24A 1FXLA 4PPZA 4K4TA 1VQMS 2AYEA 4UUWA 5I4MA 3CC2S 3FSIA 3M8PA 5EGYA 1TL1A 1F2GA 4K5SA 1HR0F 1C0TA 1BC6A 3GV5B 3TRGA 4X4RA 4ELUA 1RKJA 1VC5A 2WBMA 1QLNA 4B9SA 5A8RA 1VQ4S 7FD1A 4FXWA 3V81B 4X66F 3QMQA 2DGTA 2Q3PA 1RT3B 3HDSA 3MM5A 5HMXA 2ROGA 4NYOA 3PIPQ 4BC7A 1E6YB 3TUZC 1NKBA 5G4DA 3V6JA 2KKHA 1SV5A 1CSJA 3FEYB 1TKZA 2R2TA 2MQOA 3RRHA 5JJBA 2BV3A 4E0DA 5IQQA 2UU9F 1JX4A 5IT4A 2ZH2A 1SH2A 5EWFA 3M2RB 5LJ3Y 2LU1A 2XSJA 3JSMA 2BQUA 4F2RA 2R9LA 1VQOS 4AL6A 3DRRB 2BQ3A 4TY8A 2J7WA 4ZP8A 4ZKAA 2MZ1A 2XCPA 3H2LA 4OZNA 4RW7B 2Q43A 2DNQA 1TAUA 4AL5A 3FFIB 3F56A 4GMKA 3FQLA 3RBEA 4JI2F 1X9SA 3GV7B 3DRXA 2OP5A 4C0HA 3G8SA 3GB0A 3DLBA 4OHVA 3H2UB 2MMYA 1LW2B 3FGVA 3CCZA 3LANA 3JTNA 2J6TA 3OVSA 3DLGB 2GQCA 4U7CA 4CT9A 3V6KA 3CDBA 5KFTA 2X1FA 3K5OA 2Q1LA 2LA6A 3MD3A 3I4HX 2D7SA 2DNGA 5KTQA 2GJIA 5J2NA 1S10A 4C8KA 2GJ2A 1H7WA 2DHAA 3G6ES 4BWJA 3BB5A 4DFJA 3NRBA 1ZBTA 2ZH1A 2MZRA 3QYYA 2MZTA 2M4MA 2ASYA 3MPYA 4JI0F 3UR0A 1S77D 1KR4A 4TU7A 3CF5Q 4FF2A 3I0SB 5CD4H 2J0QD 1U1PA 1LW0B 3HFKA 5DDPC 4C8YA 4MKYA 2R7RA 3NCRA 4IH6A 3THVA 2CJAA 3VWSA 4OLPA 3Q23A 2I8EA 1VK3A 2AP6A 2LU2A 4PXBA 3U1MA 4MKBA 3FMBA 1KQSR 2OAUA 2I2YA 2BJDA 4K5RA 5AE1A 4PUOB 4RZRA 3GYXB 4IOAQ 3LAKA 2V9WA 1IKYB 2CYYA 3I32A 2OO4A 3DNCA 1S97A 1SIWB 1SB6A 2DJWA 1O8BA 1G7CB 1WHWA 2AJ4A 2EG2A 5SUHA 4H54A 2EW9A 2YX1A 2RS2A 2J7KA 2G1DA 2HFOA 3S1TA 3U02A 2DHSA 4J9SA 4N76A 3PEHA 1EP4B 2QA4S 1U6FA 5JVGQ 3BGRB 1T8EA 1X0FA 5DDRC 1RYSA 4PG8A 1HQUA 2GHWA 3RB6A 2OMOA 3KK2B 2RB7A 1FRHA 2B6AB 2LDIA 4J9RA 1FHTA 1ZPVA 4YUDA 3K8VA 1BQNB 1C1BB 1S6QB 2C3PA 4P6QA 2GHVC 2YKQA 5D3GB 4MK7A 1SJFA 4CT8A 3H40A 4WKRA 3SDEA 2DTJA 2CPHA 1KRPA 2DISA 2FHOB 3PNIA 4DLGA 2OD6A 4NA1A 2AX0A 4H4MA 4ECZA 4ED1A 3CULA 4H4KA 2Q6CA 1HARA 2ZBCA 2AGOA 1KVJA 3CJ3A 4DUZF 1E6VB 4D3GA 3ENWA 3ZZYA 4C8ZA 2GMHA 1N6QA 1QAJA 3BQ0A 4FYDA 2VBWA 3TW0A 2J6SA 1H2VZ 1H0HB 3M4XA 3DM2A 1SKWA 4N47A 3R1HA 1NJIT 2RQKA 4IG3A 5KG1A 2B9WA 3UR3C 4I56A 1J5OB 2JEFA 1U45A 2DT9A 3HM9A 4O23A 1GXUA 2FHJD 3DLLQ 3ZZTA 4DV0F 2J8AA 1N56A 2F40A 2PGCA 4QW9A 1TK5A 2B43A 1ZOTA 2APOA 1NNDA 2IJFA 2HQIA 5IFMA 4I1TA 2YH1A 4F4KA 1VQ9S 1S1VB 4G1PA 3ZZPA 1R43A 4ED8A 2RQCA 2GA7A 4A8WA 2QT7A 2RT3A 4FF4A 1GTEA 3OFEA 1NRKA 4Q45A 2FIUA 2VG6B 3US5A 1GQEA 3A8EA 4MIBA 2ZHBA 3RBDA 1JXLA 1ULRA 2HLTA 4JV1A 5HL7Q 1LOUA 4CCHA 2MKKA 4ZHRA 2NUHA 3KLGA 3HVRA 4YOEA 4LVOP 2YNFA 5KFRA 5KOXA 4MFBB 5E7OB 5KG0A 4LF5F 1TFYA 5DQGA 2UXBF 2PMZD 2EFGA 4RW9A 2ZJRQ 5IQ6A 5JXSA 2VPWB 3PEJA 4HTIA 1P9QC 5KFUA 1NK6A 2W9BB 4X84A 4M94A 3OSNA 3G71S 3DRPA 5J2QB 1GAOA 3JYTA 2YNIA 2M8DB 2MGZB 2CPFA 2CZVC 2WAQD 1AFIA 1FE4A 1I6JA 4RKUC 1UW4A 2F1FA 5IXUA 3CXCR 3BSOA 5KAKA 4KFBB 3QIPA 5LSLA 1TK0A 1A9NB 1QE1B 3K5LA 5KFYA 2ZM6F 4I2PB 3PO4A 4JI4F 4ILRA 3B4MA 1ZM4A 2R7WA 1T05A 3K58A 4QR2A 3OQ2A 2AW0A 2BACA 4NCGB 4MAKA 1N33F 3GR0A 3IWNC 3U27A 1N88A 2OJ3A 4OI4A 1YIJS 4V19J 2HLUA 5L39A 5DQHA 2VFVA 3W2WB 3SZ2A 4TQSA 1YVFA 1U2RA 1CLFA 2O1PA 4E8UA 3T3FA 1FRLA 1RT2B 5FLXY 2D1CA 1S49A 3TYTA 3O1LA 1VJWA 1OQ3A 1M5OC 2ATLA 1DQ9A 2KM8C 2DB1A 2HNDA 4I7FA 4EWTA 4RWXA 3FNNA 1DJ0A 1IKVB 3N5FA 1Z2ZA 2DBBA 2BM0A 4DR3F 4KGMA 2LEPA 3UI3A 2NS1B 1OIAA 3BSAA 1S1WA 1DQ8A 3QGHA 1ZPWX 2M5YA 2W9CA 3RB4A 4KV8A 2Y1JA 3HVAA 3VAFA 3M9OB 1J5EF 5M2UA 3M8RA 4GKJF 2FGCA 2JOQA 3SSRA 4IO1A 3CCSS 2J0WA 4ED2A 4TXSA 3KYLA 5C25B 1KC8T 5K8NA 3HHLB 1HL6A 5DM7Q 5C5JA 1T03B 4KE5A 2C22A 3ZZ0A 3NNHA 4C8OA 2EFNA 3MZIA 2J0SD 4NCBA 2K1RB 1AXQA 3WC0A 4J9PA 2LCWA 4DL3A 5D77A 5B0GA 1REVB 5AXKA 3VAHA 1Y7PA 4IRCA 1SJ3P 2HNYA 2YKMA 4QBUA 2HZCA 1RT7A 5GAEI 3SFUA 1FDBA 5E5NA 4U6PA 2W4DA 4C11A 1U09A 5ITHA 4R8UA 4DN9A 4IFVB 5K14A 1U8SA 2BDPA 3VQTA 3ULHA 4EBDA 4DQRA 3IBWA 3PFEA 5I3UB 3M6VA 6FD1A 1TP7A 3MURP 1IBKF 5IM0A 2ZDPA 2F7VA 2HHPA 2CVIA 1YITS 4A8FA 1NHUA 3MR2A 2DH7A 3AH6A 5HP1B 4HI2A 4ATNA 1KLMB 4ZCKA 3R5BA 4TLQA 4J9NA 4TY9A 3AQOA 1RT1B 3IN5A 2MSTA 3KLIB 1X4AA 2LQ5A 2ZOMA 3UW1A 3MMBB 3DLEA 3MM6A 4ZCMA 3PJXA 3T5KA 1UVLA 2XI3A 4KO0A 3E51A 3JSBA 2ZOGA 3CGIA 1KOHA 5KFIA 5KG5A 2B5JB 2XBPA 2W7PA 2H5EA 4LIWA 3FDSA 2HWHA 2PDAA 4F3OA 1M5SA 2RRNA 2YKAA 3MHYA 3PO5A 1HWIA 3NNAA 3IRXB 1CC7A 4G1QA 2FLNA 1M5PC 2EBGA 2VD3A 3I0RB 4NXMF 1S1XB 2IC3A 2VBZA 4XPEA 4F4WA 2FD2A 1X0PA 1ZAWA 5KFKA 1OPZA 1HMVA 1UA1A 1DFDA 3M1VB 4Z2XA 1Y9OA 2ZD1B 2QFJA 2JC1A 3OW2R 1NH8A 4WYLA 3K5NA 4X4VA 3MM7B 2ADCA 1JLCB 2DGQA 3MR3A 1HHTP 5CXTA 3C3LA 2HRUA 2A18A 3H5SA 4X4UA 3PFOA 2FPHX 1IJFB 2HMIA 2AJFE 2DGOA 4ZP7A 4O3PA 3V4IA 5F0WA 4WCEQ 4LT6A 1T95A 2HWTA 2CKWA 1APSA 2QSWA 1VK8A 1WI6A 3MD1A 1QAXA 5KFZA 3L09A 2HAIA 3KK3B 3QGIA 3CCWA 2ZH9A 4ZOSA 1FDAA 3T1AA 3KK1A 5BJRA 2YKOA 2OPRA 4DSEA 3L7PA 3CCQS 4FVCA 4I2QA 1L3UA 3CWJA 1XMBA 3HVTB 2IRYA 4ELTA 1HA1A 2BANA 1SJ4P 3DRSA 4O3SA 1R8PA 4IRDA 4B9NA 1Q1KA 5FDLA 5GADI 3CMES 1RTJB 3MEGB 3KFWX 2XHWA 2DO0A 3CJ4A 4ID8A 4J9LA 1NJZA 2V94A 2ZFHA 1FK9B 1KQKA 2FHKA 5J1EB 2L41A 2V9KA 4JUZA 2VQFF 1N5TA 4KBIA 2CG4A 4TN2A 2YWHA 4K4SA 1LFPA 4DQPA 2RVJA 2NUUG 2K2PA 3Q2SC 2XZWA 4EBCA 4PXCA 2E1AA 2VG7A 2C28A 2RF2A 2YNGB 2M7SA 4LSNA 4EUVA 1R3NA 3F41A 1SJQA 4NLTA 3QO9B 4QW8A 1WHVA 2CJ9A 4DG1B 1MW7A 5CYMB 3VAGA 4IFYB 3TVKA 3K5PA 5HLFB 4CNZA 5KFQA 4C4WA 4ETZA 1L3VA 1PC4A 2MJUA 3NBPB 1PO6A 3Q0AA 2DPIA 4DSFA 4Y00A 2JEGA 4ELVA 2DNHA 2VG5A 4ECVA 3K59A 2RRAA 5L1KA 1U1LA 4RNHA 4RWWA 4J9KA 2L9DA 1HWUA 2IAJB 3EZUA 4YB7A 2QA2A 3ZFVA 1IQZA 3CT9A 1Y3KA 2IM2A 3SMZA 2R7TA 5F8MA 4A4JA 3SCIE 4RW6A 4PWUA 1IKWB 2DD8S 2HW3A 4DR4F 1S6PB 4OLOA 2Q66A 1F5CA 3I9V9 5L38A 2EK6A 5E33A 5KT6A 1FNXH 4DSIA 3MOJB 1PC5A 2V4JA 3BQ1A 3GSDA 2E66A 3GG1A 4EZ6A 3SXLA 2BE2B 2MZSA 2D41A 1TUVA 2NXUA 2IHR1 2DNLA 2Q6BA 3TARA 3DXBA 1RTDA 4ILMA 2C3OA 2AV5A 3SCKE 1JKHB 2R2RA 1V6HA 4CO3A 2QEXS 1DBDA 5E3PA 4KIAA 3UQSA 2CQCA 4IO9Q 2XMTA 4ECWA 1FRXA 2VPZB 3UWTA 1FDNA 1FE0A 3ZZUA 1RA6A 1VGYA 1HBUA 1NZAA 4ED5A 4DR6F 2ZH7A