5AJ3F

Structure of the small subunit of the mammalian mitoribosome
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
123
structure length
123
Chain Sequence
PRYELALILKAMQRPETAAALKRTLEALMDRGAVVRNLENLGERMLPYKISAHNQRHSRGGYFLVDFYAPATTVESMMEHLSRDIDVIRPNIVKHPLTQEVKECEGIVPVPLEEKLYSTKKRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords MITORIBOSOMAL 12S RRNA
publication title Ribosome. The complete structure of the 55S mammalian mitochondrial ribosome.
pubmed doi rcsb
total genus 18
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2015-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5aj3F00
4JI6F 4B3TF 4DR3F 2UU9F 4DR5F 4JI5F 1VMBA 1CQMA 2VQFF 4JI1F 4DV0F 4DR6F 4LFAF 2ZM6F 1HNZF 2BXJA 3T1HF 2KJVA 3T1YF 1XMQF 4X64F 4DV5F 4DV2F 3R3TA 1G7CB 1N36F 1HNWF 4JI3F 1I94F 4OX9F 1CQNA 4JI0F 3ZZPA 1LOUA 1XNRF 4B3MF 1IBMF 1XNQF 1F60B 1HNXF 1QJHA 3OTOF 2BVZA 5AJ3F 2F4VF 1B64A 1J5EF 1IBLF 4DV3F 4DR1F 4NXMF 4GKJF 2UUAF 4DR4F 4DV7F 4GKKF 4DV1F 2B7CB 4DR7F 4B3SF 2UXDF 4LF4F 1FKAF 4AQYF 4JYAF 4YY3F 4JI8F 4DUYF 4JI7F 4DV6F 4NXNF 2KJWA 1FJGF 4JI2F 5BR8F 2YY3A 1GH8A 4X65F 4DUZF 1HR0F 4LFBF 4JV5F 4KHPF 1IBKF 1XMOF 4K0KF 1RISA 5LMNF 2UXCF 4DR2F 4B3RF 1G1XA 1N34F 2UUBF 5IWAF 2UUCF 4X66F 4LFCF 4YHHF 1N33F 4DV4F 1IJFB 2B7BB 4LF7F 4LF6F 5LMUF 2RJZA 4LF5F 2J5AA 2HHHF 2UXBF 4LF8F 4X62F 2VQEF 1N32F 1IJEB 4JI4F 2E5LF 4LF9F
chains in the Genus database with same CATH superfamily
4USWA 1ELOA 2U2FA 4O23A 4PWUA 3TAMA 4KFBA 1VBZA 3M9NB 2AHOB 3ETOA 5LL6d 2KZMA 2GMHA 3SSSA 2UUAJ 2EFNA 3NRBA 3MMAB 2QE5A 1NKCA 2JFDA 1PAEX 4DL5A 2AZ3A 2BJ8A 2C2EA 2D1CA 2H5IB 5FLXY 3PVXA 1B3TA 3U27A 1XK8A 2RILA 4NLRA 2W4DA 4F36A 3VAGA 3FBCA 1R8CA 2UUBJ 1AT1B 2L41A 4B9TA 4OFZA 4K59A 1FRJA 5DQGA 3V5RA 3PIOQ 4DX6A 3QZ7A 4OZJA 4L73A 1Q5VA 2ZHBA 3SQOP 1SV5B 3N5FA 1S6QA 5J2NB 1R0AA 4OHYA 2MLZA 4NCGA 1YJ7A 1NB2A 4P74A 5K8NA 4O3OA 1MWYA 1RAJA 2DHXA 1RHUB 2DNLA 1KFSA 2VQEJ 1S7IA 1CC7A 2XMUA 1Q8KA 2FHOB 3W2VA 9ATCB 2M52A 1T0TV 2MJNA 2CDRB 3MEKA 4H4KC 3NEKA 3OTEA 1IBMJ 2QMWA 3US5A 2N4DA 3CIMA 1WKLA 1NDLA 3AOAA 4U95A 4JI3F 2QLBB 3NGUA 2IM2A 4B9LA 2RHQB 4CWBA 1WC3A 4K4WA 5F3TA 2AJQA 3A3NB 2Y8WA 2QMXA 2RH3A 3NL0A 4O44B 2DGOA 1I51B 2WONB 4O3RA 2BQRA 1FE4A 2BE7D 3CIZA 4XDDA 1FKOB 1FFSB 3UDLA 1KQSR 5HK4A 2VFSA 2R2SA 2YNFA 4ZPWR 2FC8A 2DNHA 2IBKA 1YVFA 5J1PA 4M5MA 2VOOA 3AHPA 1N5QA 2NPFA 3KK1A 2Z2YB 3ITHB 5M2RA 1YWXA 3M8RA 4WXWA 2HAIA 2JLGA 1QSYA 2WCXA 1RWKB 2ROPA 3FSIA 3VQSA 1LW2B 1XR7A 4IFYA 1YITS 2XLIA 1ACMB 1DURA 4G1QB 3HFKA 4WU2A 2HHWA 2VL1A 3CCQS 4A47A 4PWDB 2M88A 2HWTA 4USUA 1WOPA 1NSKL 3TUJC 2BABA 3RR7A 4LF4F 2GIQA 4NLTA 2XULA 3GCXP 2O1PA 1RAFB 4TYAA 4DV6J 1BQNA 4J9KA 3CCZA 1SQFA 3T5LA 4IH6A 4TNOA 4ED7A 3TAQA 4K0KF 2X51A 4OLPA 2V2QA 2UVRA 3PW4A 4U67Q 1L3KA 2HW3A 1RAHB 2DO0A 4P10A 3DM2B 3G9CA 3QRPA 4ECYA 1YGYA 4DV5J 2IC3A 1PYSB 1BD6A 3UN2A 1VRUA 1FXRA 4ZLJA 1AFIA 2DNZA 2LFVA 2B4OA 4CLZA 2UV8A 4L3KA 4DV3J 3HVWA 1FD2A 3QT7A 2I1RA 4ZPBA 2V2VA 3L09A 7FD1A 1VK3A 2JZ5A 2OPSA 1Q82T 5K8PA 5L1KA 1JJ4A 2KKHA 3KLIB 1J5EF 2HWIA 2J0XA 3FRYA 2C2KB 1XMOJ 2J8AA 1VQ6S 4ZP9A 3FFIB 2AJ0A 1VIXA 1HHSA 4YUDA 2R7UA 1U48A 2DNOA 5J2MA 4OYWA 2J9EA 2DH9A 4I7FB 3D67A 3MECA 4MKAA 3LW5C 5E0OA 5A8WA 2P9GA 2CUYA 4YB6A 1X5PA 1WTFA 2MKYA 4LT6A 4KV8A 2C1EB 3FMBA 2KDOA 4I64A 3MPWA 3V4IA 1SJ4P 1PG5B 4ELVA 2RHSB 3IXQA 2ZC4A 1U8SA 4PKDB 4UW2A 2OPQB 4YEAA 1N6QA 1JJCB 3MCMA 3TR5A 3T9NA 5ETKA 2QA1A 4WFBQ 3L95X 2O5DA 3RBEA 2GCFA 1EZZB 4M5HA 3ADAC 5IM0B 1RJJA 3IP0A 2UXDJ 3RW7A 3ISZA 1S4FA 4MFBA 1VQ5S 4DSLA 2ZD1B 2ACMA 1U1PA 1UFLA 1CEZA 4ZCLA 1JLCB 2V68A 3HSDA 2QYGA 2G2YA 1CVJA 4WCEQ 4NCBA 1A0OB 2BM0A 4A46A 1RLDA 1IKWA 3CMES 3KK2A 2GIRA 1UJ6A 1TK5A 1G6BA 4DV0J 2DPIA 2BJDA 1KOOA 1SKSA 1N32F 3F73A 2ZNZA 3AD7C 1T11A 1EAYC 4C6AA 1ROFA 1OSCA 4HH1A 5B09A 1VQ9S 1HNWJ 3QAUA 4ED5A 3A1YG 1TAQA 5ADZA 3NMRA 1DRZA 4O4GB 4Q8EA 2C2NA 1FX4A 1X60A 2VUGA 3VVUA 2ZH1A 3KWMA 1YJTA 3ZXWA 4C3LA 1NSPA 1BMQB 2WHOA 3C66A 1KQFB 4XIUA 5IZHA 3O5TB 3BR8A 3OTOF 2YKNB 1FFWB 3CJ5A 1YZ6A 3R2DJ 4ILLA 4X84A 3H20A 2V0NA 2AGQA 4KHPJ 2VJUA 3NGSA 4KJIA 2D3ZA 4IQXA 5C25B 5IWAJ 4X4PA 2K1RB 5C5JA 4LF7J 2ERRA 1T03A 3WIUA 2D7SA 3R5JB 3HJFA 5FLXU 3M05A 3KLEB 4KO0B 1NSAA 4HACA 5DZ6A 2WVCA 2MJUA 5KFMA 5E7OB 1OY9A 3I82A 4RW7A 4PQAA 3NGRA 3JSMA 2AEFA 5LMUF 4WKRA 4IR1A 4Y28C 1TZ0A 2I8EA 2OKQA 4ILRA 4XPCA 2V94A 1Q79A 1ITPA 4PG7A 2CZ9A 5EGYA 4WF9Q 2YXLA 2JLFA 4H4OA 1Z1ZA 1U25A 3AD8C 2CPEA 2DVIA 3AJDA 1UEKA 1S9EB 1REVA 4KPCA 1T05B 5K8OA 2FGCA 4OZNA 2CQCA 4ZVEA 4USMA 2D41A 2J7WA 4J9QA 4ECXA 1WF0A 2QL5B 2WOMA 4M1KA 1SJFA 2QC3A 1D09B 1FKAF 4YY3F 3TQ1A 3I9V9 3CCVS 1ZTTA 1WC0A 2AV5A 1S1TB 2F8EX 4Q0BB 7AT1B 3NG8A 1J27A 2CXEA 3JB9k 1VQMS 1KWMA 3TZYA 2YWWA 3RR8A 1F1BB 2RQMA 3W9IA 1F0XA 4NL5A 2FTRA 2WVDA 1L5UA 3UNGC 3PX6A 2F8MA 4W4MA 4LREA 1RACB 4MYUA 3T1AA 5L46A 3L9ZA 2R4FA 3RZAA 5H9FJ 1ZM3A 1OMSA 2DXFA 2C2DA 1N5TA 1VC5A 3OSPA 3MMBB 2BE2B 3TP2A 1Y4ZB 3THPA 5H1SV 4DL6A 2RT3A 2AD9A 5LJ3Y 2R8IA 3TI0A 2BKNA 2ASDA 5KFDA 1MLAA 1S48A 2BANA 2BMBA 1HQEB 4RUCA 2VBXA 1LK5A 4B17A 1H38A 5AXLA 5F9LA 4GC6A 4U7UK 3DOLA 3U7JA 4MIWA 2Y1JA 3H90A 2C2ZB 3GMGA 5LSLA 2CJAA 1IXKA 1I5OB 3O6QA 1G3OA 2AX1A 3MDFA 2XB2D 3QGGA 1HBNA 4ECWA 5KFTA 2EPIA 4IDKB 2UUWA 3R5DA 3HVRA 2JVRA 3MM6B 5KOWA 3MURP 3R1LA 3KLFA 1UPPA 1VISA 4JI4F 2YQ1A 3BQ0A 3RB4A 1KONA 1CQMA 4J5OA 2EC2A 1OYEA 4U8YA 1HQUA 4YB5A 2VG5B 1VBXA 3N6LA 1CJUB 1J2VA 2RVJA 1LK7A 5KAKA 5ETOA 3BEGB 1F9EB 2BQ3A 1N0VC 1K1QA 2PEBA 2A0FB 1UFKA 1S1VA 1U45A 3R5BA 2OEJA 4A8FA 3Q8UA 2F7VA 5B7WA 1VRTA 2ZVSA 4NXMF 4KGKA 3KXDA 1PJ5A 3LPEA 2MEWA 2WRMA 2CQ3A 4PEOA 3GP9A 1WHYA 2J0SD 1RTIA 4TU9A 1NEEA 2HNZA 5KFRA 4C11B 4ZJOA 3SDEB 3A4TA 3JTNA 1WOOA 4RW4A 3V6JA 1UWAA 3EXCX 1N5YB 2CPYA 4ZVSB 1EP4B 4R8UB 2PEHA 1SIZA 2OEKA 4L74A 2ILYA 5AXKA 1KS2A 1X9WA 4M94A 3NCQA 1WI6A 2NXUA 2G9OA 3G71S 5CCLA 1GTHA 1RT7B 1IKXA 1LWEB 1B0PA 4IH5A 3S01A 1WHXA 1HYSB 2DHSA 5J2PA 1RK8A 5GADI 2RRBA 4JP8A 3CB4A 2ZUAA 4DR4F 3MPYA 3ILOA 4JI8F 1HARA 2CQIA 4OYAA 2B8QA 1NJYA 1HIYA 4V1Ak 4DG1A 2AGOA 5SUHA 3BH6B 2L9DA 1TUVA 4X4SA 2CG4A 2GMJA 2A2DA 4WP8A 5HQMA 1XWLA 3LUYA 2Y1RI 2V8PA 3WQPA 3MM8B 4CLLA 1SBRA 1DAXA 2P5VA 1Y11A 2BUNA 2J7KA 3MUMP 4J9VA 4ZVQB 3BR9A 1JJHA 2ZKTA 1JLQA 1MNEA 5GVQA 5K20B 3ZTQA 3RRKA 1MMDA 5HAOA 1NSQA 3TX0A 4DWIA 3ICLA 1TL7B 3D28A 4MJKA 1WF1A 3D2WA 3C15A 3FQKA 1R8PA 2H51B 4PZVA 2J76E 3DRYA 2CNLB 2RQCA 4P72A 2XZDB 4B3MF 3BM7A 4K50A 3OFGA 5C2GA 3PYEA 2BVZA 2IYIA 3TVZA 2Y1IA 3ZZYA 1NK0A 3MEEA 1QUVA 2GV1A 2CDQA 4DS4A 2XYGB 2DIUA 3R9LA 2QG9B 5H9EJ 3EDQB 4N8NA 2FJWA 2ADBA 4NLSA 3TVKA 4EU0A 1NK7A 4EK2A 2OFGX 4OQJA 3MAQA 1KTQA 2EVZA 3OXFA 3OL7A 2LXUA 4ALZA 1IBKF 3PIPQ 3N6MA 4J9OA 4EZ6A 4EO6A 8RUCA 4QYZK 1NNDA 5AT1B 2PMWA 2DEIA 1RWVB 1YRUA 3T5HA 3ISND 2MLXA 4ZK7M 3MM5B 2GQ2A 1SL1A 4U96A 2R42A 1BWVA 2MY7A 3WX4A 2FDNA 1OIAA 2KYXA 1LFWA 4C0HA 4C8LA 3SV3A 3V81B 4B9UA 4ZLPA 2UUAF 4JI2J 3OJUA 2Y1LB 4LSLA 2XCAA 1RZMA 2N3LA 4YHHJ 2CQ1A 3HFVA 1G2EA 4HLBA 2RB7A 4N8OA 3DLKB 4K4TA 1F5CA 2XWXA 1HMVA 3P6YC 1RISA 2KH9A 4OYIA 4C9DA 4FDFA 2UUBF 2QMUB 2DD8S 4QOTA 1JJ2R 1CS4A 4DX7A 2DGUA 4KHMA 2B7BB 4OLOA 4EGLA 5F9NA 1R0BG 3TUIC 1VOMA 2VH7A 4ZCMA 2I2YA 1WSRA 5RUBA 3FSXA 3OSNA 1RLCL 4NLQA 1FI4A 2HFUA 2IFXA 1RTHA 2HHPA 2O01C 3OT9A 4DF8A 1YBAA 3MI7X 1VQ4S 1UCNA 4KT0C 4IRKA 3AFGA 3NBPA 3LTOA 4YS2A 3U1MA 3DI6A 2J7UA 2GO9A 2HRYA 3QFWA 1RT6B 2FJEB 1HBOA 5KFHA 4WYWA 4PYAA 4PAAA 1LWFA 4JYAJ 1IBMF 3CC4S 2YX4A 2VG6A 2V2KA 3KJVA 2OIHA 5D0EA 4DS5A 1S1WA 3DNCA 4JV2A 1T94A 3MF5A 3PO5A 4QR1A 5KG6A 1T9XA 2Q3PA 3PFOA 1O0PA 1M5HA 2HQDA 1R27B 4JOUA 1T02A 3ZZ0A 3A12A 8ATCB 4X62J 1RWOB 1H2UX 4Y2CA 2IRXA 3MWBA 4P52A 2D74B 5IC6B 2W4CA 2HGLA 1VJWA 4KC5A 3IWNC 3LA0A 1FDDA 2AJ2A 2VG7B 2E9ZA 4HDHA 3E01A 4FKYA 2HNYA 4I2QB 5KFKA 3K2YA 2FIUA 3OHAA 4OZ5A 3H7HB 4DR6J 1DTTA 4CI0B 4FXVA 1PKUA 3MAHA 2CG8A 2OELA 2IVFB 1UVNA 2I38A 2BOAA 2QLFB 2VF3A 1Q78A 5CD4H 4F04B 1IQZA 2DR7A 3MEDB 1M5OC 2J0QD 2C42A 1VHFA 4DL4A 4CH1A 5T7LB 2HRUA 1FNOA 3QLHB 5KG3A 5GMKa 5HVFA 4J9UE 5IC4B 3Q89A 2BW7A 3CDEA 2XBPA 3KOAA 3Q0AA 3T5KA 2YKMB 2G0IA 4I69A 3HDSA 5CZXA 4M95A 2W9BB 2K3IA 3GIKA 3FBBA 1NJWA 3RBDA 1U24A 4IQMA 4M5JA 4O3QA 2X1FA 2GFFA 5DDPC 1IBLJ 1HWJA 4DV5F 4XK8C 4DSIA 3FK4A 3M8QB 4DV7J 2AEMA 4ZN3A 4URSA 1CQNA 4PXDA 5HVGA 3G8QA 4Y00A 4DV3F 5KFXA 3D9BA 3UR0A 3B6BA 2ATCB 4C3MA 2YQ0A 2KRRA 4X4UA 2DPJA 3QWPA 5HJYA 5KFUA 2HFVA 3EM1A 5B08A 2E5IA 2H48B 5EX0A 4Y0FA 3GV7B 4LF8J 1U0HB 1OQ6A 1VCTA 1U7LA 2XMVA 3IS9A 1QE1B 4JBCA 3I5AA 1XMOF 5KFSA 1R6YA 4ES3A 1U1QA 2NUHA 1B7FA 1IJFB 4MIAA 4KIAA 4ED3A 2RRAA 2V34A 3OR1B 3T1HJ 1D1UA 1FJEB 4ZLNA 2X1BA 2VBYA 2ZBIA 2WSEC 4Z7CA 1YBTA 1CJVA 2E66A 2LP4A 4URGA 3QGIA 1SKUB 4LMZA 3CCSS 4TY8B 2HBQB 4NRUA 2HNDB 3S7RA 3DRPA 3DLEA 3T6JA 5KG0A 2FZCB 2Y3YA 3MOZA 4R5PA 5CD4A 3VAMA 7FDRA 2V8VA 1T9UA 4DEZA 3BJYA 4ZJLA 4X4VA 4K4YA 2E1PA 3AODA 2QZ8A 5I3QA 1B4SA 4E0DA 2BKOA 4A8XA 2UXDF 2HLTA 1RSCA 3EUNA 2FD2A 3TZZA 4WFYA 3NLCA 5KFLA 5I3UA 2GVDB 1YG0A 3FEYB 1IWGA 4V19J 4FPIA 1WD6A 4NLGA 1SQEA 3C6TB 4FYWB 4CIOA 4CH7A 1TFWA 4F25A 2JH3A 3PM9A 2CNNB 3DFEA 2GAHC 5DZ7A 5DQIA 2DCLA 4A8QA 2HMIB 3KDOA 3G96A 2VU5A 1NK5A 2ZEJA 3HKWA 3Q8PB 1S12A 1KNZA 3OR2B 3PFEA 2HWHA 4OYOA 3FKBA 1NPRA 4DV0F 2H1YA 4YR0A 4CZCA 4F4AA 2PA8D 3W60A 1IWAA 4A8YA 3BB5A 1RCOB 3JAMY 2M70A 2H4WB 1HNWF 4Q7AA 4LUBA 1Q8BA 1LNQA 1HBMB 1RHMB 2C3PA 4C3KA 2DY1A 3IMQJ 3VGSA 2DXDA 5D0GA 3EICA 4RNNA 4KB7A 2HZVA 3S1TA 3DC2A 4CLTA 5CAAA 3G8TA 2ALZA 2ZOFA 3KJQB 2ASYA 2XEXA 1CJTA 3NWRA 1HWUA 3I0RB 4RUBA 5LSOA 4DPOA 2EWHA 2H4YB 2HQ3A 1S1UB 4KHPF 4JV5F 1JLFB 2W8KA 2OI2A 5IWAF 4LF7F 1WC6A 3BQ1A 1LXJA 4Q43A 2MKCA 3I5CA 1XR6A 3PJXA 4ED4A 2B9YA 5C24A 1RI7A 2ADCA 3T9ZA 4F26A 3UCUP 3HO1A 5I42B 1O8BA 2W9CB 1C1BB 3NNAA 3IG1B 1UP1A 2YKPA 1FESA 4PXEA 3R7NB 5K9FA 2OMLA 1FJGJ 2MMYA 4U9RA 3TA2A 4GKJJ 5HMYA 3LO3A 1L3UA 2R8HA 4IYQA 1Y5IB 2KG0A 1UEVA 5LM7E 2XMKA 3OW2R 2IJNA 2ZH5A 3GJQB 2IJRA 4KGVB 2OTLS 3KMQA 1WELA 3P96A 3P3DA 2NXJA 4B02A 4I6AA 1FEEA 1NDKA 5J2NA 1TQLA 3R27A 4DU7A 4GC7A 1F9HA 2RKIB 5A6WA 1HNIB 5F0WA 5D4OA 1OPIA 4Y2AA 5FJ4A 1UZDA 4PRFA 2FJAB 1P1TA 1SXLA 4M5KA 4DR1J 2PD1A 4XPEA 5KFQA 4IG3B 1RBOB 2NUUG 3L4BC 2Z30B 3CO9A 2HYIB 1Y5LB 5B0DA 2HIQA 4CLFA 1CULB 2DITA 2ASJA 5A0YA 2EEYA 3EZOA 2VKZG 2EBEA 4OYMA 3RYLA 1YKWA 1N33J 5C2CA 3M6VA 5L9XA 2MQOA 4LFBF 2LLZA 3PR4A 4WTYA 3DYAB 2R8KA 3I0SB 3RBXA 3VALA 3KHLA 2CADA 5HBMB 4BCAA 5EUHA 1U2CA 4FF2A 4X66F 2FUG9 1AW0A 5LT5A 2RDDA 2KXFA 4RBUA 2XMTA 1S0VA 4RW8A 4N47A 1X4EA 3PX0A 2O67A 2XSFA 1RP5A 1Z4UA 3D5MA 2BXJA 2HBZB 3BSAA 4Y2KA 1SKRA 3TJAA 4GVBB 2WTFA 2MKHA 2R7XA 2XSJB 3H5SA 1I94F 1UETA 4UY8T 3EXYA 2PMZD 4AQYJ 1LW2A 2DYAA 1KD1T 2V6AA 1NHVA 4G1QA 1SPBP 1RHKB 3AJ2A 1MSWD 1S6PB 2KT3A 4DV1F 1MN7A 5EN1A 5IFMA 4NA2A 2M7SA 3PCOB 1RWMB 5JVGQ 2JSXA 5E33A 1SQGA 1N56A 1BUXA 4N7TA 5L1JA 6FDRA 1R3NA 3TARA 5CYMB 4ZIWA 1FX2A 2Y0BB 2QA4S 4ZVGA 5DLFA 4LSZB 3L7PA 2I6WA 3K7RA 1UVLA 3PHEA 3Q83A 4G65A 4A8MP 1WG1A 3DM2A 4ES2A 5ETMA 3UE2A 4HT5A 1ZA1B 1VMBA 1SI9A 2VFTA 2F63A 1U02A 3HHLD 1IKYB 4ES1A 4OI0A 2KT2A 2VODA 2KTQA 3CCRS 3T1YF 3H0PA 2RAQA 1WG5A 1PAUB 1O6XA 2ZDPA 4ZVPB 3OVAA 4F3OA 4DSKA 1QSLA 3FRZA 3G87A 3IBCB 2H9ZA 1NJXA 4ENOA 4Q2LA 3KLIA 2BDPA 1NZAA 2F9DA 2X1GA 3M7VA 4NLVA 1RWPB 3CD5A 2AIRB 1S49A 1VC6A 4AD6A 1V3ZA 3FFIA 2VPZB 1H72C 3LH2S 4MK8A 2YX7A 4V19X 4DL0C 1E6YB 4FZVA 1H0HB 1NCLA 4I7FA 1AUSL 2AJ4A 1Y0HA 3HSGA 3UCGA 1S9GB 4ED8A 1TV6B 2IRUA 4UTGA 4DXLA 4DL7A 5CHCB 5B0CA 1WUUA 4O3NA 2EFQA 2ZH7A 1Q4RA 2HQFA 2DXEA 2OMOA 2EFPA 4USKA 4CLYA 1LEOA 1R0AB 2LQBA 4AE5A 2RMLA 5KFOA 1RT1B 5BJRA 3UD5A 1EHWA 3EGVA 3W9HA 3UI3A 4NZ7A 2LU2A 1FDNA 2OPQA 2AJ1A 3CW2C 3HD1A 3KLVA 3G4SS 5FIIA 3O3LA 1YRTA 3POTA 5LXRA 1XNQF 1VK8A 4MK7A 1XNRJ 1IR1A 2Q6CA 1X0FA 2YH0A 1Y3KA 1R31A 3VAHA 3BGUA 1EQMA 2IHR1 3SQGB 2MY8A 2WB1D 2DISA 2ZD1A 3W61A 2B56A 4MYTA 5AE2A 2HPUA 4CO4A 1JLCA 1TL3B 4OIXA 2HVZA 4CNYA 1JNRB 4I68A 1RAGB 2ZJPQ 1SJ1A 1ZOTA 4QIEA 4U7UD 3TUPA 1RE1B 1A6LA 4UOHA 4ZPTR 2QGFB 2OGUA 3IN5A 2NSBA 1R7IA 2B5JB 3D3CJ 1Y00A 2V2ZA 3C19A 1SIWB 3H5YA 2DT9A 4OMFG 4QU7A 4XDCA 3G8SA 4E98A 4GO7X 2ZVIA 3QGHA 1SC3B 2W4PA 2MGZB 5IT9Y 4C0BA 4O4GA 3MR5A 2AYMA 4DOZA 3C16B 4FS2A 4DI6A 2BEFA 4JI7J 4F2RA 4OZ1A 3BGFA 3X3UA 5AXNA 2G2ZA 2YKNA 3RRHA 3OL6A 1YBUA 3BYRA 4JV1A 4IFYB 2B8PA 1UW4A 4J91A 2LEAA 3K5OA 3W2WB 4OZ2A 5C25A 1ULRA 1SJQA 4JI2F 2BRLA 2K1RA 2V69A 3BQ2A 2DGQA 2MXYA 1U1KA 1UWBA 3H2UB 4EEYA 1IKVA 2RDJA 1KLMA 1WF2A 4NZ6A 1NPPA 3QFHA 3KLEA 4KO0A 4YHHF 2IDEA 2VONA 4LF6F 2D69A 4J7CA 1BQNB 3MPVA 1HI8A 1V3SA 4DHVA 4RJVA 1F9FA 1H2TZ 1IJEB 4ZOSA 3PACA 3FZ2A 1S79A 2DO4A 1NB7A 2RF2B 1Q8LA 5DS7A 2R2RA 1VQLS 4NMLA 8AT1B 3KHGA 3PX4A 2M3DA 3OVSA 3HCXA 2QRRA 5IQ6A 4GKKJ 1ZH5A 4TYBA 4NLPA 1RA7A 4J9NA 2HVIA 1L3VA 1VRQC 4PG6A 3RBZA 5C42B 3BSOA 3HM9A 4X65J 5DG8A 4CO3A 5SZTA 2PFDA 4NE9C 4JYAF 4WFXA 1I1GA 1JX4A 3L3CA 1Q5YA 1GEHA 3KMSA 3K8WA 2GQCA 3Q22A 2B6AB 3QIPA 2YNHB 5JUMA 1PIEA 1U1RA 4I56A 4Q0BA 2C3OA 3LGHA 4FF4A 2UU9J 3PKYA 4C98A 1VLOA 4FP9A 3KNAA 5ETQA 4OV1A 5KG7A 4IFVB 1X5SA 4WP9A 3IFEA 4X62F 5ETRA 1VBKA 2LEBA 2CQ4A 3GIMA 1TVRA 5B0AA 2NYIA 4ZVRB 4I6YA 4NWBA 3PY8A 1URNA 1B70B 1D3WA 3MMBA 2BE2A 3NY0A 3KLGB 4LR9A 3V4IB 3VHQA 2W24A 3M4XA 3TVYA 2LVWA 1KSPA 1X5TA 1RXOB 2CFXA 1NU4A 1JXLA 3OXGA 3EPIA 4LIWA 2Z58B 2IMWP 2H65B 3BKFA 3AH6A 1D9DA 4DR2J 3ZZZA 3CJKB 4NXNF 3LAKA 4DCOB 4M5DB 4QWCA 2KXHA 5KG4A 3KLHB 3MM6A 1SJ3P 4NYPA 1YLXA 3CJQA 2LECA 3ZC4A 4RX6A 1V5IB 3EPGA 2VPXB 5HQ8A 4B3TJ 1Q7YT 3FCWA 2IA0A 2YNGB 2C3YA 2LA4A 2VG5A 3R7SB 2CJBA 1CJUA 1PJ6A 1DTQB 2MZQA 3VR1A 5KFBA 4TLQA 3CSKA 3NS7B 3VAKA 1U6BA 1RTDA 3D68A 3PKMA 1VQYA 4ZP6A 1U1MA 5CYQB 3SZ2A 1IBLF 3VGTA 4RW6B 3DDIA 3D6HB 4DV7F 3KUGA 5D77A 3WIVA 2R2UA 5KT7A 4U7CA 3B82A 1K47A 3LP0B 2QA4G 1CJKB 5KG5A 3QRRA 2Z2ZA 3ONQA 2F65A 3NS5A 5E2QA 3AAWB 1FERA 2EFOA 2L9NA 3FCHA 4P73A 4ANEA 1VYAA 3K5LA 1ZZFA 1TP7A 2NZCA 4LF8F 1EP4A 2CJ9A 2B51A 4R8UA 4WKYA 4M5NA 3K8VA 4I1TA 2J9DE 2P6SA 1FHTA 4HDGA 2IAJA 2QYCA 3T1HF 5K8MA 4LBHA 2ZE2B 4L75A 3M8ZA 4NOHA 1LWEA 3MR6A 1IVZA 2DNNA 3V6HA 4Z2XA 5ETNA 5EWFA 1HYSA 1GMVA 2MZRA 2WB4A 2ROEA 3AB2B 3RAXA 3TNVA 4I4BA 2B0GA 1S77D 2KG1A 1GX5A 2CJQA 1TELA 4MT1A 4ILMA 3VV2B 1NXIA 3ILLA 2AX0A 3CJ2A 3QATA 2L9WA 1JLAA 2W9AA 3EGWB 2YWEA 2G1DA 2YY3A 3W64A 3GFHA 1BC6A 4WYLA 4FYYB 1YJUA 2RD5C 3K17A 3AXKA 4H4MB 4ZHRB 3KK3B 4BDPA 2WAQD 4DQQA 3KNGA 4BLGA 3LPYA 4HTIA 1RAOA 3HSJA 1FRIA 5LSRA 4OYPA 4NEZA 2EK1A 2ABYA 5EWGA 2FVRA 1VJQA 1CC8A 2VFRA 4TQSA 2ZC3A 5HROB 1N5VA 4ZCIA 1TKXA 1SC6A 3GV8B 3MPDA 3JQJA 2VD3A 3DRSB 1TL7A 1RBAA 1ZM2A 3R1HA 1GXLA 2IMOA 2CWXA 4CT8A 2OJ3A 4LQ3A 4OX8A 3MFIA 5CCMA 2V9WA 1OS5A 1KHVA 3ZZRA 2NSCA 1D9AA 2JC0A 2PIIA 2VB6A 2QTWA 2EW9A 4DCPB 1KEKA 4B3RJ 2VFVA 3EGNA 1S6OA 1HWIA 2OD6A 4A8KA 1H98A 5A8KB 2UXBJ 2XQCA 3CWJA 3GR0A 3ZO7A 3ZNJ1 2QL7B 4HH0A 3AB4B 3RTVA 3TUZC 4ED6A 2O3DA 1C1CB 4UUXA 1XERA 3GLJA 3HHDA 2EI5A 5KFIA 4BWJA 3AA8A 1HBNB 4E2FB 5KFJA 2MQLA 2KZZA 4QWAA 4KKOA 4LF9F 3PDNA 1CSJA 3HHNB 3K5MA 2FJXA 3UN5A 4UUWA 1NUEA 2JFKA 3SBMA 1JB0C 2MZJA 2APOA 2DB1A 3ILJA 1HNZF 4IRCA 5K14B 2DR9A 4RZRA 1FNXH 1H6KX 1W2BR 2UUTA 3LF0A 4B08A 1B0VA 1IN0A 3DGPB 4ECZA 1HPZB 3B4DA 4CTAB 3I31A 4P2SA 2F9JA 4DFMA 1NJZA 1UMJA 3LALA 3CDUA 1FKPB 4IUFA 2JDJA 3K89A 5KTQA 1B0TA 2EC0A 2AP6A 1K9MT 1VRTB 4BS2A 5DGBA 1FJGF 1UJ5A 1K0TA 3GIIA 2HHHJ 2F5GA 5EX3A 2NLWA 2POKA 2ZBCA 2FPHX 4QWBA 3JTPA 1JIHA 1KQKA 3CT9A 4PQUA 4DR3J 3MM7A 3JQKA 4QR2A 3NCPA 1H3DA 1C0TA 3M2VB 1C4CA 1UTAA 1FRKA 3C14B 2H54B 2KJVA 2WSCC 4UQGA 3BPSP 4ICLB 5MLCV 1P8GA 4FPRA 3M1VB 4CLUA 2CRLA 1DLOB 2DNMA 2E1AA 5FDLB 2Q79A 4B3OB 1IKXB 4RW9B 2OD4A 1WI8A 4KGXB 2GS8A 4DR1F 1WWHA 1Y10A 1EIYB 4LR7A 4ZLLA 3J80Y 4QYZJ 2FVSA 4ZCKA 3VGUA 3ZTRA 1SUQA 4YB7A 1S0MA 2GGPB 2Y0SD 3HX9A 3DLGA 3ISNC 2CQ0A 2GVZB 4PG4A 4LF5J 2AGPA 1YIJS 2QSFA 3BBCA 2E5LJ 2VDHA 3K58A 4C7QA 2ZH2A 4YR3A 4KR0B 1IR2A 2HQGA 2BZ2A 1N33F 4DR5J 3UD4P 3LGNA 1RQ0A 1RAEB 2VG7A 2HG4A 3IAM9 4DV2J 3SFGA 4EMDA 4I2QA 2GO8A 2VC0A 3GJTB 1WC5A 5HP1A 3DXSX 4N56A 1UAWA 1DQ9A 4DSFA 4MAKA 1V6HA 2D9PA 4JUZA 1JLQB 1RU1A 2R9LA 4Y6IA 4CDIA 2DRAA 2DHHA 1S7HA 4QJVA 4JV0A 5E3AA 5J2QA 5HANA 4USJC 3F0NA 4AFFA 4DUZJ 1XC9A 1K8AT 1XR5A 4F4KA 4OHZA 1N52B 4AQYF 4C4WA 3W7BA 1RWNB 1VQ8S 2RU3A 3CMQA 5K5MA 4C48A 3ETMA 5C7PA 5T7LA 1MW7A 1VLYA 1AROP 1MMNA 2JNJA 2V8HA 3T6BA 5GAHI 2DNQA 3FJ2A 4UF4A 2B4PA 1ZBTA 1RTJB 4ERDA 3N79A 3HVTA 3Q2SC 2VA2A 1N32J 4FXWA 2R8JA 2XO6A 5D78A 2W8LA 3Q8VA 2ZH3A 4ZPAA 2J6SA 1T3OA 3Q24A 2ZJRQ 1R43A 5A2QY 2WVFA 4C2MA 1QY7A 5E3PA 2PI5A 2LMIA 3DDNA 3AQOA 3UQSA 2M8DB 3C2PA 4CNZA 2YX1A 4NPOA 3ET6B 1F60B 4YN3B 1HBUB 1JXEA 3UVJA 2Z4PA 1U47A 1ZAVA 2ZDOA 1F3FA 1ZYQA 5L8RC 3M30A 1N34J 2BJEA 2HIYA 6AT1B 4AT1B 4WZQA 2E7WA 3VAFA 3KKFA 4F4WA 3UW1A 2DK2A 3GONA 3CCWA 1YI2S 2MYFA 5B0EA 2QFJA 1U0HA 1FDBA 3TJ8A 1QE1A 2A10A 1HA1A 2A6OA 3TW0A 5CH7B 1GMWD 3MHYA 1HMVB 1ZZNA 3PW7A 4ZVFA 4DL2A 3OR1A 4BBYA 5D4NA 2RIJA 3KTQA 1Q8IA 1FEHA 1CS4B 4DPWA 3PYDA 4PABA 1RT2A 1X4DA 2HVDA 3BPDA 4X4OA 4DZ6A 3R8YA 4TY8A 1EKRA 2HNDA 1RHQB 2ZITA 1YQHA 3NP5A 4USTA 1MWZA 1G4CA 4OJ3A 5E3CA 4NLDA 4X2BA 4X4NA 2KN4A 4C8ZA 4EYHB 1IM4A 2QT7A 5BR8J 3PG9A 2WSFC 4ECRA 1RUSA 3DHXA 4TU8A 3QZ8A 2VG6B 1TL1B 2OPRB 3KJVB 3BN7A 1NK8A 2HK2A 1HW9A 2X7IA 4I6WA 3C6TA 3CNQP 4QU6A 2OP5A 4NLOA 4O3SA 1I3OB 3PRBA 4YDXA 1JNZB 2GJFA 1SVDA 2VQFJ 2HFNA 4QWDA 4RU9A 2HMIA 2X3DA 2B4VA 3VQTA 3OR2A 1BHNA 1KLNA 3DLLQ 3HZEA 1LW0B 2RSQA 2AJFE 1F5BA 1PBAA 2B3TB 1YJ9S 3B8HA 2ZFHA 3M6UA 4MK9A 1YJRA 1NKEA 3NCRA 4AYBD 2F4VJ 5E3QA 1WKJA 1T9VA 3G6XA 1VC0A 3A8JA 4EUVA 3QIDA 5KFGA 4TQRA 3CMAS 1HBMA 3EE3A 3CJTA 3NGKA 1RU2A 5KT2A 3CJ0A 4URQU 1WEXA 2MQQA 5KFFA 4NLXA 4JI7F 4P2MA 5KFZA 4DV4J 4QWEA 4B9NA 3HHEA 2JRSA 4EWTA 4UZBA 1Y9OA 5DJBA 4FBTA 2B4UA 3I0RA 1RDRA 1REGX 3RB0A 5F8LA 1JLFA 4DU8A 3P5BP 1VBYA 5DETA 3N28A 3HVAA 1WEZA 3NGDA 3CTRA 3SEOA 4N41A 4JI4J 1U1NA 1Q86T 3TEHB 4OX9J 1HW8A 3HHLB 1ZM4A 2K2PA 1E6VB 2XCPA 3D6MB 2XYHB 1W25A 4PWWA 1LKZA 2C2OB 3QJJA 3NGTA 3V6KA 2W01A 5J1EA 2CNOB 2HEKA 4G1IA 3CJ4A 4GMKA 5T14A 3V6DA 2Q66A 3CGIA 4Q8FA 3EVOA 3RAQA 1TMMA 1XJWB 1Q7LB 3IG1A 3BGLA 3JSYA 1EETA 4WTOB 2OFHX 3M9OB 4GKKF 1RCXB 2OEMA 2HRTA 2L3MA 2ZUGA 5KT5A 1RWWB 4M5GA 2VV5A 3IAS9 4UY85 4BWMA 2MKJA 3M8YA 4X65F 3M9MB 2O66A 1NHKL 3TZXA 5LJ5Y 2PT0A 3RB6A 4PCQA 3PW0A 3QBCA 3W9JA 4ED0A 3A8EA 3RGIA 3HD2A 2G4BA 1OY6A 2RKIA 4CO5A 4DPYA 2E1RA 4RNFA 4OHWA 2UU9F 2RQ4A 3PV8A 3CJ3A 4KYZA 2XMMA 2YVSA 1QLNA 3I9ZA 2CAJA 4O4RA 5KFEA 5KT6A 2XC9A 4OX7A 4ZP8A 2YNIB 3W65A 1X4FA 3D6TB 1GFWB 1JKHB 4FNIA 5E5NA 2XI2A 2KB2A 2CZ4A 4WIIA 3BSCA 4CLSA 2LDIA 1URRA 2Z57B 4IG3A 4RNHA 3DRPB 2DY9A 4CO1A 4F0HA 2QLXA 2XLKA 3HULA 2BJ1A 5BYRA 4DR4J 1PC5A 3FSYA 4NASA 4U6PA 2DGVA 4ER8A 4WJBA 1WTBA 4CRJA 4OHVA 3W8GA 3RU0A 2DGTA 3CC7S 5HLFB 1OSDA 1TU0B 4DR2F 1S5ZA 4F4XA 3ZNUA 3CO0P 4JI5J 4WZMA 5I3UB 1JLBA 1KQGB 2W7OA 2IRYA 1YSJA 4CYUA 9RUBA 3CF5Q 2AF6A 1CG2A 2KT5A 2XTJP 1A7GE 4ZVUB 3GJRB 4OZLA 3HT3A 2E9TA 2XY7A 1BGXT 2N7YA 3CD6S 1EQ0A 2W2OP 2OH2A 3SXLA 2J0WA 3AD9C 1F2HA 3QSIA 3MAAB 2XNRA 1JLEA 2XSJA 3HP6A 4C97A 1OWXA 1QJHA 5IXUA 3GILA 1IUJA 1AA1B 3J81j 2ZH6A 3QGPA 1PSDA 1GXUA 2YQ3A 2QLJB 1CBKA 1SKWA 4WE1B 2AKWB 1TK8A 1P6TA 4C0OC 2XS2A 1XQIA 4FYXB 5HMZA 1MU2B 2CQGA 2B9XA 3JSRA 4ZN1A 2MQ8A 4DLEA 2WZ1A 2MHNA 3W63A 1P9QC 3CXCR 3N0VA 1OPZA 2ACYA 4X4QA 2RUGA 2MZ1A 2C22A 2XG8A 2ZH4A 4USHA 2WVEA 1V5VA 3IO1A 4A8SA 5IS2A 4FXDA 4DX5A 6FD1A 2FVQA 1IKYA 2HS3A 3UCZP 1PBUA 1FVQA 2HLUA 3AA9A 4LSNA 1VHIA 3K59A 3CCES 1KRPA 3CJRA 5C24B 3V4MA 3I87A 3J7YU 2XHWA 5IOLA 3M2RB 1NZ8A 3G6ES 2AYBA 2P9CA 4DJBA 4DN9A 4DR7F 4PR6A 2QJ3A 1FTRA 4EBEA 2RS8A 5DO2A 2H5EA 2I5JB 1KOHA 4Y2IA 4QPTA 3KG1A 5KG2A 4WU3A 4Z37A 2XS7A 1E6YA 2ZNYA 1RYSA 2VPYB 1WSVA 3DKDA 2AMCB 2RJZA 3D0HE 1S9GA 1TV6A 2EFVA 1L3SA 2X3GA 1LWCB 2YPYA 3QYYA 3TA1A 2Z2MA 3J7AN 4WFNQ 3K5NA 3DOMB 4DLGA 4L72B 3WDOA 1RT1A 1HNXJ 4QQBA 4RU2A 2HFOA 2F1FA 2MZTA 5GADU 5BYQA 1FFGB 3PXGa 3M32B 1KVKA 4C8YA 3Q23A 3HKZD 2PDAA 3J7ZT 4I2PB 4ZJQA 3TJ9A 2FHJA 2FLOA 1FNMA 2KFNA 1VQOS 2MDAA 3I32A 2BBEA 3ZZOA 3CD0A 3SQGA 3WBZA 2BKPA 2HHTA 3L7OA 1FXLA 3HLUA 1HNVB 4MKVA 3EGZA 1X0PA 2NREA 3CDBA 1TL3A 5A0YB 3WZ0A 3HHLC 3VVTA 1J5OB 2NCKL 1QVGR 1UL3A 2WBRA 4B3RF 2YTCA 3DMJB 5DM7Q 1RGVA 1U4BA 1F6TA 1U0SA 1FE0A 2ZBRA 2M2BA 3GTYX 2DTJA 2B5JA 2UXBF 3PJWA 2VQEF 2XMAA 4F2SA 4HVZA 5A8RB 4YB1P 4F0MA 2F4FA 3T3FA 2GHWA 2HK3A 3LP1B 4RW8B 2MGZA 2NR0A 3I4PA 3FBFA 4R25A 4LRAA 4LBPA 3R97A 3C16A 3ZZPA 4K4UA 2I9SA 2QX0A 1TL4A 2AU0A 3KJFB 2NXNA 3UWTA 1BQMB 2M9KA 5G0RB 4D3HA 2FYXA 5HN0A 2AZ1A 3GWCA 1MROB 3EMTA 2VICA 1TL5A 5ETPA 5HSPA 1RT3A 3BH7B 3NAIA 1KHWA 3W2WA 2OPPA 3MGJA 1F5AA 4N5SA 2DRBA 2IY5B 3CD7A 2IVYA 1YTYA 5HI7A 2RS2A 4RBTA 4C8NA 1G1XA 2CQHA 2OO4A 2FJVA 1OJ4A 3NOGA 5HVHA 3CCUS 2D3O1 2CA9A 2V67A 2ATLA 2HHHF 3QJPA 3UNYA 4XAKA 4OJHA 1XMQJ 2UZAA 3AY0A 2RU9A 3W66A 3G6VA 2AEJA 4DR3F 2BR0A 5EDWA 1YJWS 4B9SA 4JI0J 3NWGA 2RF2A 1RA6A 2X1AA 2YPZA 4PPZA 1RT4A 3OVBA 4DBQA 3I96A 4H4KA 1SH3A 1SB6A 3RUBL 1EARA 3NS6A 3D0IE 3BREA 2HVEA 4NI2A 3KJNB 4P71A 1DY3A 2IM1A 3O2IA 5C42A 2NQPA 1QAIA 2FVPA 2QV6A 3MOJB 1OQ3A 2W7AA 1SJRA 1NKBA 4ZKAA 3ENVA 2LDYA 4DV6F 4ECTA 5GAGU 1CLFA 2B6AA 4C8MA 3W5ZA 4PUOA 2YNHA 1HL6A 5F8MA 3QRQA 1N54B 2EKNA 4LF5F 2HAFA 4I67A 3I56S 4IFVA 2E5LF 1FT8A 3GB0A 1VS3A 3BSNA 1WC4A 4J9PA 4IG0B 4DR5F 3GR1A 4ZMMA 5CABA 1AZSB 3WHIA 4DQRA 4DQPA 3VF0B 5GMEA 3MD3A 5DM6Q 3PYGA 4K8RA 4DV2F 3R3TA 4WFZA 3KLGA 2N7CA 1JLGB 1PJ7A 2VKRA 4HHJA 3D3BJ 3SMZA 3PEHA 1FWKA 4K4ZA 4DQSA 1M1HA 3OL9A 3P5TL 3QT6A 2UXCJ 1P1LA 3I5BA 3POTB 1FJCA 2R3VA 4OI3A 4TXSA 5HL7Q 2QFIA 1XTZA 5HMXA 4OJ1A 3CJKA 3KUHA 4DUZF 1N88A 2LCWA 1FWPA 2G2OA 3N4WA 4M5DA 1QDUB 3MCOA 2DRDA 3H40A 2A6MA 3DXBA 3KLHA 2SXLA 1DHMA 3CVKA 2WW4A 1FO1A 3IGVA 2AWZA 1FA0A 3HPOA 3E3XA 1K73T 5L1LA 2CQ2A 3E2EA 2GJ2A 4FF3A 4QIFA 1PYOB 2FY1A 3M8WA 2V4QA 5KFWA 3HF5A 2ZHOA 3SV4A 2KM8B 2E9RX 4PYDA 2YNGA 4RR5A 3BZQA 3HI9A 2LKZA 2DCUB 3C46A 3TOQA 4UOGA 2UV8G 4YR2A 1DTQA 4RWXA 1AXQA 2PE8A 4ATNA 3BO2A 3MCSA 3KFWX 4AUKA 2G1HA 3D1HA 5CYQA 1TKTB 3BGRA 4RW6A 4LIRA 4ECSA 2FLNA 3OTBA 1K44A 1JXVA 1TKZB 1NK6A 2DHAA 2V4JB 5GAEU 3D7SB 2R7TA 3LP0A 4HL9A 5DLGA 5JVHQ 2PI4A 1CJKA 5F8HA 3LQVA 5DDRC 3IBFB 2JHEA 4JB8B 4KE5A 1S59A 2UVVA 3G86A 2HHXA 3JTOA 4JV5J 2LQ5A 1N34F 3V2UC 4J9LA 4YFUA 2IYGA 2HURA 4J37A 4XO0A 3HK2A 2J5AA 2W2NP 1I6JA 3UDCA 1UWBB 3KHRA 3QT5A 1IKVB 2DNRA 1KLMB 1S1XA 4RNMA 3OV7A 1H73A 3RB3A 1RT5A 3OPKA 1N5SA 3UPFA 3BO4A 4LRFA 3IWXA 1KBRA 3PW5A 5AJ3J 2Y8YA 1U49A 3DU6A 3DRRA 4F50A 3CDWA 3RW6A 4HYKA 3Q8RB 4ZITA 3T5JA 2ZBPA 3L7UA 2ZE2A 3RG6A 3MEGA 3GCWP 1LOUA 4J9RA 3OUYA 4DX8H 4NLYA 4F3MA 1AUDA 3SI8A 5KFVA 1NJIT 1RWXB 1B64A 4G1PA 3S8SA 1RBLA 2E7VA 1M5SA 3ENQA 1Z2LA 2V4RA 2R7SA 4J9SA 1UVMA 3G82A 5JXSA 1WHVA 3WC0A 5BR8F 3OHBA 1T8EA 3K5PA 1Y5NB 5IV3A 3LWLA 5F8IA 4DN0A 3M2UB 5HATA 4LJMA 3R7BB 3MM9B 4NRTA 2R7WA 4TKTA 1Q1KA 3CDAA 4Q45A 4JI1J 4OYZA 3QIPB 4H4MA 4ZHRA 2P6TA 5A6PA 2BW2A 3KK3A 5D3GB 2HSEB 3QO9B 5ETTA 3MFHA 1N36J 3MMAA 3UD3P 2VQFF 2QL9B 2FGOA 1IM6A 2LQ9A 2KI2A 3HT0A 2B43A 5HROA 4K2JA 1RHJB 1TVRB 5DG7A 3TAPA 1NDCA 4G3IA 2Q43A 3DRSA 4M5IA 4EBCA 2F4VF 1SL2A 4F02A 3W1YC 2V8DA 3Q86A 3AQPA 2DNKA 5A76A 4CLKA 1NMEB 3CPWR 1BLUA 5LMNJ 1WHWA 1SV5A 2GHVC 2A18A 3SCIE 4LR8A 2FHJD 3OL8A 2MKIA 2XYPB 3BF4A 3RRGA 5A8KA 4LFBJ 3E8OA 3T19A 4NA1A 5KG1A 4ZPVR 4P75A 4DV4F 4X66J 1D9FA 2D3OR 2HHVA 4UOFA 1C1CA 4LRDA 1EX8A 4ZDNA 1FK9B 1OO0B 1RB0A 4DSEA 4ZVTB 1YJVA 4K4SA 3T41A 2HVHA 3U1NA 5K14A 1FD8A 1C0UB 1X31C 2MQMA 3N5BA 2MHEA 4OX9F 3KHHA 1NHUA 1I94J 2ZOGA 3BBFA 4O44A 3DGPA 2VA3A 1S0NA 1HPZA 4N77A 4CTAA 2WONA 2WBMA 5HQLA 2HGMA 3GG0A 1FKPA 3PEJA 3JYTB 1FKOA 1ICEB 4DV1J 1RTDB 4P9SA 2KVQE 1TAUA 2EFGA 4RL1A 1TUWA 2YKQA 5DG9A 3CCTA 3E51A 1HQ2A 2GIFA 4JI6J 4KQZA 4CM0A 2R8GA 3J7YI 4G6VB 4MIBA 2KRBA 4P2FA 4ETXA 2E5GA 3ITHA 3R5AA 1Q95G 4NX9A 1NK9A 3DOKB 3C6UB 3MMCB 3M2VA 1KTVA 4K7QA 3PHTA 2GNKA 2J8SA 3IM9A 3IRXB 1ZAWA 2QA2A 3C14A 3R6GB 3GJSB 2EBGA 3T1YJ 3MCNA 4L3NA 3M8PB 1YX2A 4PWDA 4ICLA 3M1VA 2IAJB 1DLOA 1Y7PA 5FDLA 4IOAQ 4DUYJ 1NDPA 1SC4B 2A3JA 4S0MA 4B3OA 4RW9A 2KFZA 4F0KA 4ZVHA 1N48A 3PRVA 4OV6A 1N0UA 1TR0A 3KDNA 1UZHA 2QN6B 2J9CA 2GGPA 1Q16B 3SSQA 3BKTA 4J90A 4DFPA 3P49B 5LXYA 3GIJA 2GVZA 3CCMS 4ID5B 2KM8C 2C28A 2VHGA 5KFNA 3O44A 2AT1B 3QPIA 4NMXA 3LP2B 3B78A 4NZ0A 1FWLA 4Y34A 3FBEA 1JLAB 2MKKA 3FMWA 4LFAJ 2PC6A 1M1GA 2YWFA 2RNEA 3TAMB 4KFBB 2E7XA 3BN4A 3TQEA 4JI5F 3TA0A 1ZS6A 2NXEA 4F67A 1WKKA 4ECVA 1S76D 4YP3A 3TRGA 2XO7A 3ENAA 2CPIA 4NYOA 2JC1A 3D4JA 1GT8A 4RNOA 4OZ3A 3KUEA 4LF2A 4W92B 3MR2A 1XNQJ 2CPJA 1M90T 1TKXB 2BJ9A 3ZZTA 4NCAA 1BXNA 1QUPA 3KG4A 2WW8A 1IQTA 2UVWA 3QMQA 3AOBA 3MR7A 5F41A 5F8JA 2H5JB 2LXIA 1T9YA 3TANA 2BQUA 2ZZTA 2Y9HA 3FUYA 2K06A 1X9SA 2JEJA 4FVMA 2BE9B 1ZM9A 1UVIA 1S6QB 4HR2A 4YDDB 2JWNA 4NCGB 4EFAC 5IV4A 4IRDA 4WXOA 2EXUA 2K8GA 5M2UA 1RTJA 2XY6A 1S99A 4KTQA 2QLWA 4ELUA 5F0UA 1KP6A 3D1OA 3W2VB 3A8KA 5IM0A 2ZJQQ 1XIQA 4KKOB 2CQBA 2CPHA 4PXBA 1WORA 3W62A 1WDDA 3GIRA 1NK4A 3JAMU 3P45B 4PG8A 1OY8A 3MTKA 1VQ7S 2VOPA 5F8GA 3H25A 1B99A 4J9MA 2NS1B 3ET6A 2FJBB 1H7WA 1HBUA 3VZHA 1HR0J 1MMLA 4HTJA 1PCAA 2FLPA 4WFAQ 3TEGA 1PO6A 3PTWA 3DRXA 4P6QA 2VFUA 3H2VE 1RTZA 2L08A 3M8SA 2MPUA 3EDRB 2FJDB 3UDEA 1U6FA 4WPAA 2CVIA 5CQGA 4Y65A 1T9TA 2ZKUA 4RWWA 2CQPA 2QIFA 3I6PA 1X4HA 4OHXA 3PW2A 3UR3C 3KG0A 4TVAB 2YNFB 4FF1A 2XWYA 2BACA 1O5JA 4LF6J 2ZM6J 3ILIA 1WEYA 3VCDA 3W8PA 3DN9A 1YJNS 3IM8A 2FHMA 2YWGA 3S6EA 2YWHA 2DKOB 1VQSA 4PQUB 4OYBA 3KK1B 3MM7B 1R8AA 4P2XA 5B0FA 1ZAXA 3HXMA 5GAGI 4TN2A 2KL8A 2CJKA 1C0TB 1D8ZA 2PO4A 4CLWA 2FHKA 2YKOA 1O51A 2AW0A 1CPZA 4LF1A 1HNXF 5F3ZA 1APSA 2HGNA 2GX8A 2MTLA 2MZSA 1X4CA 4PPDA 3GU0A 3AOCA 1LQ9A 1V9OA 3MTJA 2UUCJ 1S9FA 4LQ9A 3F44A 1TL1A 5AXMA 1U09A 2OPRA 4DSJA 1TUGB 3M6WA 3P4UB 2BOPA 1SUQB 5KT3A 1OYDA 3DLGB 1GTEA 5FD1A 2YH1A 3UN3A 5ETVA 2V63A 2IC3B 4X64J 1S9EA 2JEGA 1T05A 1VRUB 2JOQA 3J7A1 4A48A 4F4ZA 4DPUA 2CPXA 2CQDA 2M5YA 4KGMA 1LW0A 4NA3A 1DJ0A 4WK3A 4XTTA 4O0IA 2OPSB 2DEJA 4B3SJ 1VR6A 5HP1B 4E8UA 5L1IA 3CEDA 1UPMB 1QSSA 2OSRA 5G4DA 1AYEA 2DGSA 2IPOB 1S1TA 4ANDA 2IBOA 1M5KC 1MG7A 4DPTA 3SCLE 4EZ9A 5DDQC 4MKBA 2RE1A 1UVJA 1KDNA 1WG4A 2P9EA 1U2RA 2EG1A 5J2MB 3G2XA 5J2QB 1RKJA 2P2CB 4NXNJ 3FC9A 2VZ9A 4WWSA 3MECB 3G6YA 5A8WB 2ASLA 4GVLA 1X5OA 3ULHA 1XMBA 1M5VC 5CXTA 4H54A 2NPIA 1R0CB 4KV8B 3QSYB 4KPYA 2E29A 5GAEI 3A3PB 4F3QA 4X4TA 4DL3A 4OJGA 3HVTB 1HQEA 2MB0B 3IA0A 4DR6F 4AL6A 5GMDA 2PSZA 3HHLA 2RRNA 1N6QB 1DZ5A 1E6VA 2GMLA 1XMQF 4USVA 4FNHA 4Y3CA 2HBRB 2GW8A 2FB0A 1QTMA 1AB8A 1FTCA 3J81Y 3BGOP 4JI0F 2BX6A 1FDAA 5KFYA 4MFBB 5BYSA 1TK0A 2VJVA 5D4PA 1UKUA 4F4YA 3OFFA 3JQMA 3MD1A 4IDKA 2DIVA 2HFSA 3WC2A 1NRKA 2NZ4A 2BJ3A 4CO2A 3NOCA 2JX2A 4LFCJ 3UVJB 5D6GA 4FN5A 1C4AA 1NAQA 2N3OA 1VGYA 1IKWB 3KK2B 2EKYA 2MQNA 3M30B 1H74A 3GFYA 5E3RA 1W26A 2J9DA 2GAGC 4UQTA 1JWWA 1WOSA 3D0GE 2KHCA 4Q44A 1WJ9A 2CJYB 2LA6A 2N82B 5CA5A 1DFDA 3OBIA 1RAAB 4IOCQ 3A8IA 3VWSA 4TLRA 2CVEA 3O8WA 3JS9A 3DLJA 2V8GA 2JEIA 2IA6A 2E44A 4AXIA 3HSZA 1EKSA 2MSSA 2YNIA 2VBWA 1HI0P 1RT2B 1JKHA 1GNKA 4CO0A 4EO8A 1TFYA 1QVFR 4DFJA 5H9FK 1S4EA 4ECQA 3H59A 2HHUA 1UEUA 3GZ7A 1Y3JA 4C11A 3ZTPA 1HKAA 3SDEA 5THWA 3DCAA 2W2QP 1KN6A 1KC8T 5EWEA 3EVMA 1N5YA 1T03B 4AL5A 3THVA 1IBCB 4HACB 4IH7A 3MR3A 5HLFA 3HJVA 2UXCF 4Q5VA 4RW7B 3GPAA 3JSMB 1X9MA 2XNQA 3OLAA 2K7KA 2ZH9A 1RT7A 1K0VA 4W98A 4ZP7A 2KVIA 1PC4A 4H4OB 4L76A 4ZPDA 3OXLA 1FRHA 4Z7YA 4DUTA 3DHWC 1T7PA 2DGWA 4W90B 5BXIA 2BA9A 1REVB 2Q6BA 2Z0GA 1NO8A 5U47A 3OQ2A 2LEPA 5DDOC 2HZCA 2C2RA 4L6V3 2FZGB 3MAAA 3O1LA 5CYJA 4CP5A 1HFEL 1RABB 3UFCX 2OTJS 2WOMB 3HZGA 2FZKB 2FY8A 3W3SA 3EWGA 4ZS6A 2HFZA 3LGMA 4M8LA 1DARA 3BDPA 4WE1A 3MM8A 3F41A 1YRXA 1DQAA 2XI3A 4ID8A 4ETZA 3J7Z5 2Z2LA 4ZVOB 4AL7A 4RUAA 2XGPA 2QEXS 4K2XA 4UZCA 2A1BA 2XM3A 4P7VA 1MU2A 4BHQA 2J6UA 3ZZUA 4RKUC 2IM0A 2C3UA 3FZBA 3HFZB 4WIQA 2CIMA 3U02A 2HHQA 3OLBA 3Q8SB 2R2TA 2B9EA 1D8YA 4CM2A 4LF9J 1X8DA 4C8KA 3IC1A 3CJSA 4JI3J 4I0WA 1U6ZA 2KXNB 2KU7A 5HMWA 4EBDA 4DDFA 1DBDA 1YDLA 5IT9U 1S57A 3SCKE 2VIHA 5D4LA 3VAIA 3PO4A 1HNZJ 3PZPA 2BANB 5B0BA 2YWKA 5L39A 5I4MA 3FNNA 4LRCA 1U8WA 3FEZA 3VGVA 4LVNP 2GJIA 3OTDA 4UT4A 1FJ7A 3AJ1A 2DHGA 1WDTA 3DOLB 4OI4A 2DH8A 3MUTP 5AJ3F 2ZH8A 2K3KA 2XMWA 5J1EB 2F3JA 3CC2S 2E5HA 2VPWB 3V6DB 3M2RA 1UW9A 4KHRA 1GX6A 2C3MA 2VBZA 2LQ8A 3H4BA 2ZWPA 2IDLA 3FVYA 3DGVA 4RUHA 2K7JA 3AXMA 3WX8A 1EETB 2R7QA 2I5JA 1FRXA 5J1NA 2WVBA 5B0GA 2IVMA 3KLFB 2V9KA 3OFHA 2KFYA 1HHQA 3MM5A 3ENWA 2E1CA 4OI1A 3A3OB 1LWCA 5HO4A 2M4MA 3QJLA 1JK9B 1HQUB 2GZOA 5D0RA 4KRWA 4HT7A 4JI1F 4TY9A 1KVIA 3DOMA 4N76A 1GQEA 1H7XA 2UVUA 3V81A 1NPKA 4KBIA 4KAIA 4M5LA 2ZOMA 1HWLA 1S1VB 2IJFA 2VASA 1N36F 3C3LA 4EYIB 3RAMA 4Y2MA 4NEYA 3M32A 3QAEA 4LF4J 3I55S 4I2PA 1NM2A 4USIA 2LYVA 2Z8QA 1ZETA 3IR6B 3IGNA 4GKJF 1EJ7L 2V5HG 3SCJE 3DLKA 2NXCA 3NNCA 1BE4A 1V3RA 4K0KJ 1RTIB 1IR0A 2HNZB 1HNVA 5AE1A 3X1LB 4RW4B 1VDHA 3OD2A 1GH8A 1KVJA 3MZIA 1J5OA 1VIOA 5LMNF 4QIVA 5IQQA 3IBWA 1QTNB 2HHSA 2XHCA 3CCJS 3TX8A 4RLEA 3DMJA 4DCJB 1T3NA 1A9NB 5H9EK 1RHRB 4AXJA 4ZA1A 2HQCA 3SSRA 4QPXA 2GHPA 3EYZA 1HWKA 1AFJA 5A8RA 2LQJA 4YQWA 1JLBB 2DNGA 1RT6A 3LANA 2PFFB 2G13A 2DR8A 4CYUB 1X4AA 2XY5A 3LP1A 1UFWA 1J5EJ 2E5JA 4CQ1A 3CJ8A 2R7RA 1HI1A 1WACA 2J6TA 2DNPA 2DR5A 5J2PB 2VDIA 3GE9A 1F2GA 1N4LA 1P27B 2U1AA 2G0CA 4D3GA 4QYRA 3MUVP 3K57A 4K4XA 5IT4A 1BQMA 1JLEB 4CCHA 4WP3A 4FBUA 2Z56B 5G0RA 2GQQA 3B4MA 4OZ0A 3J81U 3IR5B 4DG1B 1MROA 4HI2A 2KYZA 2IIHA 1R89A 5JJBA 2WK4A 1DQ8A 3D66A 4OI6A 4MH8A 1HHTP 3UDVA 1NH7A 1GXTA 5T41A 2DNYA 3TYTA 4WBFA 3QQCD 3N01A 3NXZA 1ZTWA 3BYPA 4IR9A 2V50A 3FDSA 4JI6F 4ANCA 1WC1A 3HMJG 2M8HA 3GYGA 5KT4A 2OLWA 4QCLA 4QIGA 3ZTSA 4R0JA 1GAOA 1VQPS 2HQIA 3VTIA 4ELTA 3C15B 1G7CB 3EVWA 3FCVA 4A8OA 4EI2A 3BV8A 3D1QA 3MEDA 3BKUA 4QW8A 3THTA 1HD0A 3MEEB 2ZBQA 5KFAA 2MLYA 4LSNB 1S97A 3QLHA 4DMZA 4X4RA 1QAJA 3TO8A 2IM3A 4DUYF 2D3UA 1SH2A 1RADB 2YKMA 5CZVA 2W1BA 1TKDA 4YMEA 3NAHA 4FYDA 1QAXA 4K5RA 3GYNA 1B7YB 2W9BA 3EZ5A 1H2VZ 2YBVA 5L9NA 4DQIA 3N9UC 3K0JA 3EJMA 4ECUA 2ZZNA 4LBIA 4QR0A 1U1LA 1UVKA 2MSTA 4B9VA 1YK9A 3M8QA 4K4VA 3DU5A 4IG0A 4IO1A 3D54A 4LFAF 1AZSA 3JSBA 3OTOJ 3EX7B 3H8YA 2H3EB 3MPUB 1GMUA 2BV3A 4R0EA 3C8YA 4Q2MA 2NYHA 1M1KT 1D0EA 1KR4A 2CZVC 3PRDA 1JLGA 1U1OA 1TMJA 3H5UA 2ALYB 3R5GA 2YKAA 4LSLB 1FVSA 3QNWB 2AYGA 4UOCA 3GQCA 1YHQS 4NLUA 4IKAA 2LU1A 4GRSA 2UP1A 5L38A 3BBBA 2JJ4D 3B54A 1VFJA 1QD1A 5LMUJ 2P8IA 4MKYA 2N4CA 4BC7A 1P9YA 5HJXA 2F40A 3Q8YA 1KKHA 1ZA2B 2KO1A 1GK8A 1X7VA 1PGZA 3GG1A 1S10A 1ZPWX 2RUSA 1RTHB 4ITSA 2A2CA 2HKEA 3BS9A 2Q1LA 1M0SA 4RBVA 2RDIA 1C2PA 4KGZB 3NBPB 1RKIA 3TZWA 3DI6B 4A8WA 1MWQA 3BDEA 1HBOB 2ZZMA 2W2PP 4GO5X 1LWFB 1NH8A 4TU7A 1XNRF 4ED1A 4YY3J 3NKYA 1Q53A 1S0OA 2E1MC 2GVDA 3H98A 2FQQB 1UJ4A 3IWLA 4OI2A 1S1WB 1F3VA 1Z2ZA 1T95A 2M0GB 2CPZA 4HHUA 1TKTA 3GFZA 3MXHP 2ROGA 5E41A 5GAHU 2OUGA 1TKZA 3FQLA 3KYLA 4DF4A 1LXNA 1XEZA 2V4JA 1R8BA 3UO0A 4ED2A 1HR0F 2CPDA 1Q0NA 3EZUA 2JL9A 4QW9A 3D6FB 1RT3B 2W2MP 3OFEA 3GFXA 3E01B 3PNIA 2OPPB 3SYZA 2HNYB 1S72S 1VQNS 2BJ7A 3N6NA 1X4GA 3CULA 1DTTB 3W5YA 3OJSA 2ZM6F 2XS5A 3PYFA 4DPXA 3ELHA 1SL0A 2CPFA 5DRKA 4NLWA 5KOXA 3P8BB 3VZIA 4LRBA 4A4JA 4ZIVA 3TWZA 3H42A 3NMAA 3GSDA 3R6LB 3H2LA 4HEA9 3R2CJ 1RT4B 3AT1B 5ITHA 2ILZA 4B9MA 1S1UA 2XZTB 2R7VA 4C8OA 1FRMA 2KJWA 4NI2B 3LOUA 1RYRA 1YZ7A 2DGXA 1UA1A 2PMHA 3LWMA 3M6XA 3M2UA 1EB0A 2UUCF 5M2PA 3R5CA 2VC1A 1VI7A 3MM9A 3QT8A 3Q2TC 2BM1A 3SFUA 4PUOB 3FEXB 1SC1B 1T9WA 1L3TA 5D3GA 2HZAA 3CE8A 2LXFA 2BYCA 2B9WA 3H4DA 1XBWA 3QO9A 2I0XA 3W5XA 1BY9A 2JEFA 5I42A 4MTPA 2PA3A 2AYEA 2W9CA 2COLA 3ZTOA 1C1BA 4OX6A 2MKSA 1PYTA 5D8HB 1TTHB 1FCAA 3RJMB 4X64F 2FLLA 2CWKA 4NXMJ 3SIPB 1RAIB 2XGQA 3IRWP 2D9OA 5KFPA 3Q8QB 3QWUA 2W25A 1S6UA 3H5XA 2JVOA 5MAOA 3GV5B 4DZDA 3J80U 1VQKS 4B3SF 4P7TA 2L48A 3DLBA 1R8HA 4PG5A 1FRLA 5D0HA 3DLHA 3IS9B 2F8HA 1HNIA 2HS4A 1LFPA 1JMTA 2KHDA 3FGVA 4K5SA 2HS0A 4KH1B 3JXOA 1HLWA 4HHHA 4KY3A 3OTCA 4O3PA 1UA0A 5LOQA 3CUNA 1FK9A 4WK1A 2MQPA 1CJVB 1BQXA 1ZPVA 3HHKA 4FVCA 4KH0B 2CYYA 4QZVB 3PR5B 5ETLA 3DLEB 2OHDA 2PN6A 1Q81T 1CULA 1QAYA 4R5PB 2DR6A 2GA7A 5D15A 4F8RA 1C0UA 4DFKA 4ZPCA 3I4HX 3VAJA 3LAMA 1JQGA 4JI8J 2DBBA 1U26A 1QM9A 5DGAA 2OSQA 3PJ9A 3ZFVA 4HKQA 1M5PC 4OL8A 3A13A 5IT0A 3DYAA 3I0SA 3CCLS 5HBMA 3JYTA 4RPFA 2ZHAA 4CT9A 1SH0A 3BGRB 1W7WA 1BWEA 1W2IA 4HI1A 5EHHA 1SCJB 4LFCF 1LWXA 1FF2A 3MMJA 3NNHA 3DDKA 2C2MB 2FVCA 2FC9A 4QBUA 2XMJA 3GSIA 1GMWA 1XN9A 2EK6A 2ZWOA 4GVBA 4B3TF 3F56A 2CNKB 3DOKA 3C6UA 4BC9A 4CLPA 3MMCA 2XZWA 2CKWA 1PILA 4B3MJ 4RO0A 5A2QU 1WNEA 1S1XB 3IRXA 4FYVB 4F7VA 3U1LA 5AE3A 2PGCA 1RT5B 1NLKL 2AQ4A 4O0NA 1N8RT 1S6PA 3M8PA 1RWUA 4NYZA 2BRKA 5JMNA 4YOEA 4OYXA 3DRRB 4U8VA 2RQKA 4MMOA 2CJXB 2R7OA 4PXCA 2JLEA 3MEGB 5I3PA 2B7CB 4QIWD 1IBKJ 1K1SA 2QO3A 2W7PA 5F8NA 5ETSA 2DJWA 3OUYB 1CJTB 4DR7J 1R6VA 1HD1A 4CH0S 2QSWA 2G0JA 5CYMA 1X4BA 3BO3A 5KFCA 2OAUA 1FXDA 1KFDA 2EG2A 4FKXA 4IO9Q 4FS1A 1NBEB 4LVOP 4ID5A 4M63A 2HBYB 2GC8A 3GYXB 3G82B 5DQHA 3LP2A 2DH7A 4IOBA 2XLJA 4KSEB 1U2FA 1MN9A 3IR7B 1LV5A
chains in the Genus database with same CATH topology
3PFEA 1Q8IA 1ELOA 1FEHA 2U2FA 2HWHA 4O23A 4PWUA 3TAMA 4KFBA 1VBZA 4DV0F 3M9NB 1RT2A 1X4DA 5IM0A 2ZJQQ 4YR0A 4CZCA 3ETOA 2PA8D 4A8YA 5LL6d 4X4OA 4KKOB 3BB5A 2KZMA 2CQBA 4TY8A 2CPHA 4PXBA 2HNDA 2GMHA 1NK4A 3SSSA 3JAMY 2EFNA 3NRBA 2M70A 2ZITA 1YQHA 3MMAB 1HNWF 4PG8A 2QE5A 4Q7AA 1NKCA 3MTKA 2JFDA 4LUBA 1VQ7S 2VOPA 4DL5A 1Q8BA 5F8GA 3NP5A 1HBMB 1MWZA 2C3PA 3H25A 4OJ3A 5E3CA 4C3KA 4NLDA 4X2BA 4J9MA 2NS1B 4X4NA 2KN4A 4C8ZA 2C2EA 2D1CA 4EYHB 1IM4A 2FJBB 1H7WA 4RNNA 1HBUA 5FLXY 4KB7A 2QT7A 3VZHA 3S1TA 3DC2A 1MMLA 2WSFC 3PVXA 4HTJA 3G8TA 2FLPA 4WFAQ 4ECRA 1PO6A 2ALZA 3DHXA 2ZOFA 3DRXA 4P6QA 2VFUA 3H2VE 3U27A 1XK8A 2RILA 2L08A 4NLRA 4TU8A 3M8SA 2W4DA 2MPUA 3VAGA 3QZ8A 2ASYA 2XEXA 1R8CA 2FJDB 2VG6B 1TL1B 2L41A 1U6FA 4B9TA 4OFZA 4K59A 1FRJA 1HWUA 2CVIA 2OPRB 5DQGA 5CQGA 4Y65A 3KJVB 3I0RB 3V5RA 5LSOA 3PIOQ 3BN7A 4DPOA 3QZ7A 2ZKUA 2EWHA 4RWWA 1NK8A 1HW9A 4OZJA 2CQPA 2HQ3A 4I6WA 1S1UB 2QIFA 3C6TA 3I6PA 4KHPF 4JV5F 4QU6A 2OP5A 2ZHBA 1JLFB 1X4HA 4NLOA 4O3SA 2W8KA 3PRBA 1SV5B 4OHXA 4YDXA 3PW2A 1JNZB 3N5FA 1S6QA 3KG0A 5J2NB 3UR3C 5IWAF 1R0AA 4OHYA 2YNFB 4NCGA 4FF1A 2XWYA 5K8NA 4LF7F 2HFNA 4QWDA 2BACA 4RU9A 2HMIA 1O5JA 4O3OA 1WEYA 1MWYA 3VCDA 3BQ1A 1RAJA 3DN9A 1LXJA 2DHXA 1YJNS 4Q43A 2DNLA 2FHMA 1KFSA 2YWGA 3S6EA 2YWHA 1CC7A 2XMUA 2B4VA 1VQSA 2MKCA 4PQUB 3VQTA 3KK1B 3OR2A 3MM7B 2FHOB 1R8AA 3W2VA 1KLNA 3I5CA 5B0FA 3DLLQ 1XR6A 2M52A 1ZAXA 3HXMA 3HZEA 3PJXA 2MJNA 5GAGI 1LW0B 3MEKA 4TN2A 2RSQA 2AJFE 1F5BA 2B9YA 4H4KC 2B3TB 3OTEA 1YJ9S 3B8HA 2QMWA 2ZFHA 3US5A 3M6UA 2N4DA 3CIMA 4MK9A 2CJKA 1YJRA 5C24A 1NKEA 3NCRA 1RI7A 4AYBD 2ADCA 1C0TB 3T9ZA 5E3QA 1D8ZA 2PO4A 4F26A 4JI3F 3G6XA 1VC0A 3UCUP 4EUVA 3HO1A 3QIDA 5I42B 2FHKA 2YKOA 5KFGA 1O51A 1O8BA 2W9CB 2AW0A 1CPZA 1C1BB 2IM2A 3NNAA 3IG1B 4TQRA 1UP1A 5F3ZA 1HBMA 2YKPA 1FESA 3CMAS 4PXEA 1HNXF 4B9LA 3NGKA 1APSA 5K9FA 5F3TA 2HGNA 4K4WA 2GX8A 2OMLA 2AJQA 2MMYA 5KT2A 3W2VB 3CJ0A 2MZSA 4U9RA 2QMXA 3TA2A 2RH3A 1X4CA 5HMYA 4PPDA 4URQU 1WEXA 3LO3A 1L3UA 3NL0A 2R8HA 4IYQA 1Y5IB 4O44B 2MQQA 1LQ9A 5KFFA 1V9OA 4NLXA 2KG0A 2DGOA 4JI7F 3MTJA 1UEVA 5KFZA 2WONB 1S9FA 4O3RA 4QWEA 4B9NA 2XMKA 3HHEA 4LQ9A 3F44A 2JRSA 4EWTA 3OW2R 2IJNA 1TL1A 5AXMA 1Y9OA 2BQRA 5DJBA 2ZH5A 4FBTA 1U09A 1FE4A 2OPRA 4DSJA 3M6WA 2B4UA 3CIZA 3I0RA 1RDRA 4XDDA 2BOPA 3KMQA 1SUQB 2OTLS 1FKOB 1WELA 5KT3A 3P96A 3P3DA 3DLGB 3RB0A 4B02A 1GTEA 3UDLA 5FD1A 5F8LA 4I6AA 1JLFA 1FEEA 2YH1A 1KQSR 2VFSA 5J2NA 1TQLA 2R2SA 5DETA 1VBYA 3R27A 2YNFA 4GC7A 3N28A 2RKIB 5A6WA 3HVAA 1HNIB 1WEZA 3NGDA 4ZPWR 3CTRA 2FC8A 3SEOA 2IC3B 2DNHA 2IBKA 1YVFA 4N41A 5J1PA 1S9EA 2JEGA 2VOOA 1T05A 1U1NA 1VRUB 2JOQA 1Q86T 3J7A1 4A48A 3AHPA 1N5QA 4F4ZA 2NPFA 5F0WA 2CPXA 3KK1A 5D4OA 1OPIA 2CQDA 1HW8A 3HHLB 2M5YA 1ZM4A 2K2PA 4Y2AA 5FJ4A 3ITHB 4PRFA 1E6VB 4KGMA 5M2RA 2XCPA 1LW0A 2FJAB 4NA3A 1W25A 1P1TA 1SXLA 1LKZA 1YWXA 3M8RA 4WXWA 3QJJA 1DJ0A 2HAIA 2JLGA 4WK3A 1QSYA 2PD1A 4XPEA 5KFQA 2WCXA 3V6KA 5J1EA 2ROPA 3FSIA 4G1IA 4O0IA 3CJ4A 2OPSB 4GMKA 5T14A 4IG3B 3V6DA 2Q66A 3VQSA 3CGIA 4Q8FA 1LW2B 1XR7A 4E8UA 5L1IA 2NUUG 5HP1B 4IFYA 3CEDA 1YITS 3CO9A 2HYIB 2XLIA 3RAQA 1DURA 1Y5LB 4G1QB 1QSSA 3HFKA 2OSRA 5B0DA 2HIQA 5G4DA 1Q7LB 3IG1A 2DITA 4WU2A 3BGLA 2ASJA 5A0YA 2DGSA 2HHWA 3JSYA 1S1TA 1EETA 2VL1A 3CCQS 2VKZG 4A47A 2EBEA 2IBOA 4PWDB 2M88A 2HWTA 2OFHX 1M5KC 3M9OB 4GKKF 3SCLE 4EZ9A 5DDQC 3TUJC 2L3MA 3RYLA 2ZUGA 2BABA 4MKBA 2RE1A 3RR7A 4LF4F 5KT5A 1UVJA 2GIQA 1WG4A 2VV5A 2P9EA 4NLTA 3IAS9 2XULA 1U2RA 2EG1A 2O1PA 5J2MB 5J2QB 3M6VA 4TYAA 1RKJA 5L9XA 4UY85 4BWMA 1BQNA 2MKJA 2MQOA 4X65F 2VZ9A 4LFBF 4J9KA 3CCZA 3MECB 3M9MB 2O66A 3G6YA 2LLZA 3PR4A 3T5LA 4IH6A 4TNOA 4WTYA 3DYAB 2R8KA 3I0SB 5A8WB 3VALA 4ED7A 3TAQA 3KHLA 4K0KF 5LJ5Y 2X51A 5HBMB 2ASLA 2PT0A 4BCAA 5EUHA 1X5OA 4FF2A 4OLPA 4X66F 2FUG9 3ULHA 3RB6A 2UVRA 4PCQA 1XMBA 3PW0A 1M5VC 1AW0A 5LT5A 5CXTA 4H54A 2NPIA 2KXFA 4KV8B 4RBUA 3PW4A 4ED0A 2XMTA 4U67Q 1L3KA 1S0VA 4RW8A 3A8EA 2HW3A 4N47A 2G4BA 2DO0A 1X4EA 3DM2B 3PX0A 3G9CA 2O67A 2RKIA 4CO5A 4ECYA 1YGYA 2E1RA 2XSFA 4RNFA 1RP5A 2IC3A 2E29A 4KPYA 1Z4UA 4OHWA 2UU9F 1BD6A 5GAEI 2RQ4A 4F3QA 4X4TA 3PV8A 3CJ3A 1VRUA 4DL3A 1FXRA 4OJGA 1AFIA 2DNZA 2XMMA 1HQEA 2YVSA 3HVTB 3IA0A 2MB0B 1QLNA 4AL6A 4DR6F 2B4OA 3D5MA 2PSZA 3I9ZA 3HHLA 2RRNA 4O4RA 2BXJA 1N6QB 1DZ5A 3BSAA 5KFEA 5KT6A 1E6VA 2GMLA 2UV8A 2XC9A 1XMQF 4OX7A 4Y2KA 1SKRA 4ZP8A 4FNHA 4Y3CA 2YNIB 3HVWA 2GW8A 2WTFA 1FD2A 2MKHA 2FB0A 1X4FA 4FNIA 1JKHB 1QTMA 5E5NA 2R7XA 2XI2A 2XSJB 2I1RA 3H5SA 4ZPBA 1I94F 1FTCA 3J81Y 3L09A 7FD1A 2KB2A 1UETA 4JI0F 4UY8T 2CZ4A 4WIIA 3BSCA 1VK3A 3EXYA 2PMZD 2JZ5A 2LDIA 1FDAA 2OPSA 4MFBB 1URRA 4IG3A 5KFYA 1Q82T 5K8PA 5L1KA 5BYSA 1TK0A 1JJ4A 1LW2A 4RNHA 2KKHA 5D4PA 1KD1T 1UKUA 4F4YA 3KLIB 3DRPB 1NHVA 3OFFA 4G1QA 4CO1A 1J5EF 2QLXA 2XLKA 2HWIA 3AJ2A 3MD1A 4IDKA 5BYRA 2DIVA 2J0XA 3FRYA 1MSWD 1S6PB 2KT3A 4DV1F 5EN1A 3WC2A 1NRKA 2J8AA 5IFMA 2NZ4A 4NA2A 4CO2A 1PC5A 1VQ6S 4ZP9A 2M7SA 3FSYA 3FFIB 2AJ0A 1VIXA 1HHSA 2JX2A 4YUDA 2R7UA 5D6GA 4U6PA 2DGVA 5JVGQ 4FN5A 1U48A 1C4AA 4WJBA 1WTBA 2JSXA 1NAQA 2DNOA 2N3OA 5J2MA 4OHVA 1VGYA 5E33A 3RU0A 2DGTA 3CC7S 1IKWB 2J9EA 1N56A 2DH9A 5HLFB 4I7FB 3KK2B 2EKYA 5L1JA 2MQNA 3MECA 4MKAA 3LW5C 3M30B 1OSDA 5E0OA 3GFYA 5A8WA 6FDRA 4DR2F 4F4XA 2P9GA 1R3NA 4YB6A 5E3RA 2J9DA 3TARA 4UQTA 1JWWA 5CYMB 4WZMA 5I3UB 1JLBA 1KQGB 2W7OA 2QA4S 4ZVGA 2IRYA 5DLFA 1X5PA 3D0GE 1YSJA 2KHCA 3L7PA 4Q44A 1WTFA 3K7RA 1UVLA 3CF5Q 2AF6A 3PHEA 2LA6A 4LT6A 4KV8A 1CG2A 2KT5A 2N82B 3FMBA 4A8MP 1A7GE 2KDOA 4I64A 1WG1A 3DM2A 5CA5A 4ES2A 1DFDA 3OBIA 4OZLA 3MPWA 3V4IA 1SJ4P 3HT3A 4IOCQ 3UE2A 4ELVA 2E9TA 4HT5A 3IXQA 2ZC4A 1VMBA 1SI9A 1BGXT 2N7YA 2VFTA 2XY7A 3VWSA 3CD6S 4TLRA 2OH2A 3SXLA 2CVEA 3HHLD 3O8WA 2J0WA 1IKYB 4ES1A 1U8SA 4OI0A 4PKDB 4UW2A 2KT2A 2VODA 2OPQB 2KTQA 3CCRS 3DLJA 3T1YF 2V8GA 2JEIA 4YEAA 1N6QA 2IA6A 3TR5A 2E44A 4AXIA 3T9NA 4WFBQ 2QA1A 3L95X 2O5DA 1WG5A 3RBEA 2ZDPA 2GCFA 2MSSA 2XNRA 2YNIA 3OVAA 2VBWA 1JLEA 1HI0P 1RT2B 5IM0B 1JKHA 4F3OA 1RJJA 2XSJA 3HP6A 4DSKA 4C97A 1GNKA 1QSLA 1OWXA 4CO0A 3RW7A 4EO8A 3ISZA 1TFYA 1QJHA 1QVFR 4DFJA 1S4FA 5IXUA 3GILA 3FRZA 4MFBA 4ECQA 1IUJA 3H59A 1VQ5S 4DSLA 2HHUA 2H9ZA 2ZH6A 1UEUA 3GZ7A 2ZD1B 1NJXA 1U1PA 3QGPA 1UFLA 3KLIA 4Q2LA 1Y3JA 1PSDA 4C11A 1GXUA 1CEZA 3SDEA 2YQ3A 5THWA 2BDPA 3DCAA 4ZCLA 1JLCB 1SKWA 1NZAA 2F9DA 2X1GA 4NLVA 1KN6A 3CD5A 4WE1B 1KC8T 5EWEA 1N5YA 1T03B 1S49A 1VC6A 1CVJA 4AL5A 1V3ZA 4WCEQ 3THVA 4NCBA 1TK8A 1P6TA 3FFIA 2VPZB 4C0OC 2BM0A 3LH2S 4MK8A 2YX7A 4V19X 2XS2A 4A46A 5HMZA 4DL0C 1E6YB 4FZVA 1MU2B 1H0HB 2CQGA 1IKWA 2B9XA 4IH7A 3JSRA 3MR3A 5HLFA 4I7FA 3CMES 3KK2A 2GIRA 2UXCF 2AJ4A 4Q5VA 4DLEA 1Y0HA 4RW7B 3JSMB 1X9MA 3UCGA 1UJ6A 1TK5A 2XNQA 1G6BA 3OLAA 1S9GB 2MHNA 1TV6B 4ED8A 2IRUA 4DL7A 2DPIA 5CHCB 1P9QC 5B0CA 2BJDA 4O3NA 1KOOA 3CXCR 2EFQA 2K7KA 2ZH7A 3N0VA 1SKSA 1N32F 3F73A 1OPZA 2ACYA 2ZNZA 4X4QA 1RT7A 2ZH9A 1K0VA 1Q4RA 2RUGA 4ZP7A 2KVIA 2OMOA 1ROFA 2EFPA 1PC4A 4H4OB 2MZ1A 2C22A 1OSCA 4HH1A 2XG8A 4ZPDA 4USHA 2ZH4A 3OXLA 1R0AB 5B09A 1VQ9S 1FRHA 3QAUA 4ED5A 2LQBA 3A1YG 4AE5A 1TAQA 3IO1A 5ADZA 2RMLA 5KFOA 1RT1B 3DHWC 5IS2A 4A8SA 1DRZA 3NMRA 5BJRA 1T7PA 4O4GB 4Q8EA 4FXDA 2DGWA 4W90B 2VUGA 2ZH1A 2BA9A 1REVB 6FD1A 3KWMA 1YJTA 4C3LA 2Q6BA 2FVQA 2Z0GA 1IKYA 1NO8A 2HS3A 5U47A 3UI3A 3OQ2A 2LEPA 4NZ7A 3UCZP 2LU2A 1FDNA 1FVQA 2HLUA 2AJ1A 2OPQA 2WHOA 5DDOC 2HZCA 3C66A 3AA9A 4LSNA 2C2RA 4L6V3 3K59A 3O1LA 5CYJA 3KLVA 3CCES 1KQFB 3G4SS 1HFEL 4XIUA 5IZHA 5FIIA 1KRPA 3O5TB 3O3LA 1YRTA 3POTA 5LXRA 3BR8A 1XNQF 1VK8A 4MK7A 5C24B 3V4MA 3OTOF 3UFCX 2Q6CA 2YKNB 1X0FA 2OTJS 2WOMB 2YH0A 3I87A 1Y3KA 3J7YU 3HZGA 1R31A 2XHWA 3VAHA 3BGUA 2IHR1 3W3SA 3CJ5A 3M2RB 4ILLA 3SQGB 2MY8A 2WB1D 3G6ES 4X84A 3H20A 2V0NA 2DISA 2ZD1A 2AYBA 2P9CA 4DJBA 2AGQA 2B56A 4ZS6A 4MYTA 4DN9A 5AE2A 4KJIA 4DR7F 2HPUA 2HFZA 4PR6A 2D3ZA 3LGMA 4M8LA 4CO4A 1JLCA 1FTRA 1DARA 1TL3B 4IQXA 3BDPA 5C25B 4X4PA 4EBEA 4OIXA 4WE1A 2HVZA 2RS8A 3MM8A 3F41A 2K1RB 5DO2A 4CNYA 1YRXA 2H5EA 5C5JA 1JNRB 2I5JB 4I68A 1DQAA 2ERRA 1T03A 1KOHA 2XI3A 4ID8A