2IDEA

Crystal structure of the molybdenum cofactor biosynthesis protein c (ttha1789) from thermus theromophilus hb8
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
148
structure length
148
Chain Sequence
DGRPRMVDVTEKPETFRTATAEAFVELTEEALSALEKGGVGKGDPLVVAQLAGILAAKKTADLIPLCHPLPLTGVEVRVELLKAEKRVRIEATVKTKAETGVEMEAMTACAVAALTVYDMLKAASKGLVISQVRLLHKAGGKSGEWRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Molybdenum cofactor biosynthesis protein C
publication title Crystal Structure of the molybdenum cofactor biosynthesis protein C (TTHA1789) from Thermus Theromophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Biosynthetic protein
total genus 39
structure length 148
sequence length 148
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2006-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01967 MoaC MoaC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.640 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Molybdopterin cofactor biosynthesis C (MoaC) domain 2ideA00
2IDEA 4PYDA 3JQJA 4FDFA 2EEYA 3JQMA 2IIHA 3JQKA 2OHDA 4PYAA 1EKRA 2EKNA 1EKSA
chains in the Genus database with same CATH superfamily
3U1MA 1LK7A 3CC2S 4LF8J 4J9MA 2BZ2A 1TK5A 1PKUA 3OFHA 1HIYA 2B51A 2W9CA 2XO7A 2O01C 5IT4A 2AKWB 4ZVOB 2CQBA 1KWMA 4WFZA 1S12A 2G2OA 3PYDA 2UXCJ 1KHWA 2MPUA 3DC2A 2RILA 3EM1A 3TAMA 4JBCA 2LXIA 1UWBB 3DDIA 3MHYA 3IBCB 4K0KJ 1KKHA 4RNFA 2BW7A 1N5SA 5D0HA 2YKAA 1T9TA 1VS3A 2G13A 4KHPJ 5AXKA 1WI8A 2WVDA 1NM2A 3UWTA 1Y10A 2DEIA 2CQ2A 3R9LA 1KNZA 4PQUA 2KT5A 4J7CA 4M5DA 3QSYB 1FESA 1WG5A 1NSPA 1U1OA 3VAIA 1TR0A 4U7UD 2GQCA 2ZFHA 3V6KA 4C8KA 4C11A 4M5HA 4IQXA 1RHRB 4URSA 3W3SA 5CZVA 3SQOP 3WIVA 4CLFA 3MOZA 5KFVA 2QLFB 1RCXB 3M8YA 4OFZA 3AB2B 3BO2A 1L3VA 1QAYA 1WSRA 3W66A 5D4OA 2RRAA 1RISA 2W4PA 1NEEA 4P6QA 2GVZA 4J9NA 5H9EK 2W2PP 4OZNA 4G3IA 3N6NA 2AX1A 3VAHA 3MUVP 1Q82T 1VJWA 2Y1RI 3GZ7A 4C7QA 4PYDA 3P6YC 2YNFB 3J7AN 2CJXB 3Q23A 2DISA 2NYIA 4LRDA 5GAGI 1U0HA 1IM4A 3MEGA 1RKIA 3RTVA 1M5SA 4USTA 1UJ4A 3R5CA 2RVJA 5C24B 4NOHA 4DU7A 5I42B 1B99A 1U2CA 4DPXA 2A2CA 2E9ZA 3GILA 3AH6A 1XNRJ 2QLJB 4N56A 2HQDA 3V6JA 1U2RA 3QRQA 1VHIA 2P8IA 4IFYA 2H1YA 2LEBA 2QTWA 3TUPA 3D4JA 4KY3A 3RB3A 1RT3B 2RAQA 3PIPQ 4RW7B 3HHKA 4ZPVR 3GP9A 3OFFA 4C9DA 3EVMA 4AL5A 4U7UK 2E1MC 4QW9A 3HHDA 3BN7A 2JC1A 1TMJA 2YWKA 3Q86A 3WC0A 3W5YA 4WE1A 2CYYA 1OIAA 2GHWA 3SMZA 1SJQA 2JFDA 4NEYA 4ZLPA 4DR6F 3KOAA 2IHR1 1WC0A 3QLHA 1A7GE 3LP2A 3B4MA 4OX6A 1UP1A 3PACA 2X1AA 2Y0SD 1HARA 4IOCQ 1R8HA 1RT7B 3MEDB 1YJRA 4ZJQA 3AD8C 1N5VA 2FUG9 4P7VA 2MKKA 2C2MB 4FS1A 2VH7A 4FBTA 5LSOA 4K2JA 3CDUA 2XZWA 4K4UA 3V6HA 1JLFB 2W4CA 2EK6A 4ZP7A 2L48A 3HSGA 3ITHB 3H25A 1YBAA 5CAAA 5U47A 2Q66A 1LV5A 1J5OB 5KG1A 3HZEA 3BDEA 4LF4F 5DQIA 1A9NB 5J1EB 3FQKA 3UCGA 4DX5A 4UUXA 3IWLA 4ZVTB 2V4JB 4W90B 3OLAA 1E6YB 2KZZA 1S10A 2MJNA 2V8VA 2P6SA 3CSKA 1H38A 2AMCB 2EG1A 2MKHA 1TVRB 3DLKB 1UJ5A 3PTWA 2XMVA 5JVHQ 4B9SA 1HPZA 4ZPTR 5F8JA 3K8WA 5AT1B 4ZPAA 4DQRA 2MYFA 2IM0A 5CABA 5H9FK 5A8RA 5GADU 3MR2A 1N5YA 5CA5A 3NCRA 3H4BA 4IO9Q 1RB0A 2GC8A 1R89A 3W64A 2ADCA 4DXLA 1FK9A 3PR5B 1VQ8S 2FZCB 3HHNB 3FCHA 5IT0A 2QC3A 3HVWA 2ZITA 1IXKA 4ED8A 3LWLA 1JLBA 5KG3A 5KFZA 4OX9J 3M8QB 1FX2A 3MPDA 2IA6A 2J76E 4LBHA 5D15A 1XJWB 4NCGA 4AUKA 2X3GA 4RUHA 2ZM6J 2YPYA 3KLFA 2GX8A 4ED2A 5RUBA 1UKUA 4YB6A 3DXSX 3WIUA 3OR1A 2MGZA 1HBNB 2B7BB 2IY5B 4P74A 2PFFB 5LMUJ 4TQRA 3KLIB 4ED0A 2CPIA 4M1KA 4DUYF 3RRKA 4DUTA 3FJ2A 3C15B 3PFEA 3IA0A 5EX0A 4A8FA 1F9HA 3AOBA 1N88A 4RW8A 3CXCR 1H7WA 3HHLC 1FWLA 4CO2A 2M88A 1FVQA 5BYRA 2JEJA 4O3RA 1RT4A 3M8ZA 1KBRA 3R5AA 2K7KA 4URQU 2DVIA 4NZ0A 1S1UB 1LWCB 1UVNA 3KHLA 4YB1P 2FHMA 3JTNA 2KVIA 1ZOTA 2HWHA 2DY1A 2C3MA 4FKXA 2COLA 4LF8F 2A1BA 1JX4A 3BO4A 5BJRA 1RAGB 1GMUA 3DNCA 1ZA1B 2MKSA 1H74A 2V94A 2CPZA 2VG7B 5E41A 1S5ZA 4PG8A 4ETZA 4OZJA 1SV5A 4IG3B 1PC5A 3FZBA 4A8MP 2UXCF 4HACA 3PKYA 4FXWA 2WHOA 4QZVB 2IAJA 3QGHA 2ZHBA 4K0KF 2DB1A 1OPZA 1U25A 1X4HA 3V2UC 1EAYC 4KHPF 1NPRA 4TYBA 2PA3A 1D9AA 2QE5A 1D09B 1JLGA 3CCSS 5K14A 2VDHA 4Y2KA 1L3KA 3NKYA 2ALZA 4JI6J 5HQ8A 5L9NA 3LH2S 1BE4A 2UUBJ 4ZPCA 4XIUA 1HNXF 4ENOA 1RWOB 4ZIWA 4WFAQ 1K8AT 3ZTSA 2R8IA 3AA9A 3TVYA 3LGMA 2F4VJ 1RHKB 5F9NA 3OL8A 2ABYA 2Q6CA 4H4OB 4Y65A 3CD5A 1PSDA 1WWHA 4ECWA 3KLHA 3OFEA 1QE1A 4FPIA 1WOOA 1NO8A 2HNYA 1UZDA 5CH7B 4OL8A 4K50A 2MJUA 1UW9A 4KGMA 5JJBA 1EP4A 2L3MA 4KB7A 4TQSA 4MIWA 3OL9A 3SCJE 4JB8B 2DGQA 4DV4J 2YWEA 1HL6A 1XMQF 4PZVA 3H0PA 4WYWA 1SC6A 2XQCA 3NNCA 2X3DA 2UUTA 1XNRF 4NLVA 3EZOA 1VQPS 4K4SA 1NH7A 4WKRA 3BSAA 3IXQA 4LVOP 5F8NA 5DDOC 3VF0B 3MMBB 4CT9A 2MQNA 2H54B 4CIOA 4TY8A 2ZE2B 2RJZA 2Z2MA 1TKZA 2IVYA 2VG5A 2YWHA 3HD2A 1HI0P 3DOLB 1DLOB 1RSCA 3PDNA 1UWAA 4DPTA 1FE0A 3DN9A 4O3SA 2ZH7A 3C2PA 7AT1B 1YWXA 4Y2MA 2CDRB 3D6HB 2Z30B 4LSZB 3PX0A 1KQFB 4PR6A 5D4NA 5K8NA 2E7VA 5J1NA 1S57A 4KFBA 2DHHA 3DOKB 1RYSA 3ZFVA 2BYCA 2CQ3A 3DRRA 2V0NA 2KT3A 4CH0S 1X7VA 1X4CA 1SH0A 2EFPA 3V81B 5D3GA 4J9OA 1TAUA 1RU2A 3QNWB 2HHSA 2DR5A 1CJTB 3MF5A 5L46A 4FS2A 1RADB 5HMWA 1PBUA 3W8PA 2P5VA 5KT6A 2VQEJ 3NBPA 2WBRA 4V19X 4OJ1A 3IS9B 3MM9A 4K4WA 1KSPA 4ZA1A 4KPYA 1BWVA 2ALYB 3CDBA 4NLTA 4ILMA 2YKMB 2M52A 1KDNA 2IIHA 2LA6A 1LXJA 2E66A 3CVKA 4NL5A 2Z4PA 3I9V9 1X4AA 4CLLA 3T5KA 2DK2A 3SIPB 5EX3A 3KK2B 2GVDB 2UVWA 3HVTB 1BUXA 1C0UB 1H0HB 4AT1B 1S1WA 2JNJA 2X51A 2ZUGA 3E8OA 1ZPWX 2XSJB 2OPRA 5M2PA 3DRSB 2IBKA 1WHWA 4X2BA 2F9DA 2NUUG 3ZTRA 1SUQB 4I6AA 4EFAC 5KT2A 2XLIA 3IN5A 3C16A 1HBMB 3OV7A 3EGZA 2VBXA 2BEFA 3C14A 4ZLJA 2R3VA 1JK9B 1WDDA 2IJFA 1SB6A 2OTJS 4DR2J 2MMYA 1YJ9S 2KJWA 3G96A 1KHVA 2LVWA 5KFNA 4E0DA 2DNHA 3OBIA 2F7VA 2KTQA 3DGPA 4RBUA 2ZJRQ 2B6AB 3NS5A 2ZM6F 3CB4A 2CADA 1OSCA 3WC2A 1WG1A 4DSKA 2MSTA 4K4XA 5ETMA 1B7YB 1RTHA 3KYLA 1VQNS 5LMUF 4IRCA 2J9EA 2VOOA 3CJQA 4ECVA 1JLQA 1Y3JA 1UFWA 2OELA 3KMQA 1UTAA 3FBBA 1RUSA 1AFIA 2VU5A 4ZVPB 1PC4A 3AODA 4ECZA 4YP3A 3RR7A 1TV6B 2VBYA 1FEEA 2V9KA 5D78A 4NZ7A 1HQ2A 2IBOA 3ZZYA 2CZ4A 2GNKA 2Q43A 3BGFA 3S8SA 1VQOS 2YNHA 1GMWA 2NYHA 1FD8A 1S4EA 4LSLA 5LXYA 2OH2A 2FD2A 3AA8A 1U1QA 4DR4J 2XZDB 2OP5A 1SL0A 4KC5A 2Z57B 3RW6A 1VOMA 4M5LA 2YQ3A 2FPHX 1AB8A 3D6FB 3M8RA 5KFMA 4CLZA 1U48A 1FERA 3L9ZA 4CTAA 2V2KA 1FRXA 3KWMA 4PEOA 2RKIA 3R97A 4F4WA 5KTQA 2NQPA 3QATA 2QL9B 2LEAA 3FCWA 2XY6A 3FBEA 3BO3A 5DZ6A 2BDPA 3R7SB 2FVPA 2MY7A 4QR0A 3POTB 1QVFR 4Z2XA 3GPAA 5JXSA 2HHHJ 1OYDA 4JI6F 2D1CA 2CJBA 3NWGA 1DTQA 5HJXA 1G7CB 5CYQA 5LSRA 2UUBF 4TLRA 1EKRA 2CPJA 1HI8A 3B82A 2NPFA 1T9YA 1R27B 2ZBPA 1P6TA 2E9RX 2GJFA 3SSRA 4JV0A 3O44A 3MPWA 2VB6A 2F4VF 5LM7E 2PC6A 5IM0B 4FF3A 5E3PA 3R5GA 4MKAA 1FWKA 5K8MA 2AEMA 1NJWA 2ILZA 3M1VB 4DV1J 2QT7A 3UR3C 1YJTA 3E3XA 3QZ7A 2YX1A 5ADZA 2CNKB 3BQ0A 2VC0A 4KV8A 3KLGB 3MFHA 2WZ1A 2FHKA 2MZSA 1QAXA 2V6AA 1YITS 4I7FB 3C3LA 1TKDA 2CRLA 2YNGA 1AA1B 4CQ1A 2F4FA 1EHWA 2AJ4A 1C2PA 2BW2A 4ICLB 5HLFA 4ANEA 3HHEA 1C4AA 2XMTA 2YKNB 4P2SA 3QSIA 2ZUAA 4Q44A 4DV4F 1R31A 3BREA 2B5JA 3QIPB 1Q7LB 1IN0A 3K5PA 3CC7S 1KFDA 3MAAB 5LMNF 4O4RA 5L1LA 1FX4A 3ENAA 2CQ1A 4NLQA 3L4BC 3SYZA 4GO5X 4I68A 2VZ9A 1Q8BA 4WFNQ 4OZLA 1RAJA 3TJ8A 3EX7B 3KLVA 1RJJA 2YNIA 1BWEA 1NSAA 4LRCA 3QGGA 1U1PA 2RSQA 1N34J 5HI7A 1FHTA 5FDLA 1K1SA 2BACA 2MY8A 3OR2B 1HQEA 4A8QA 4DEZA 1WC4A 4OV6A 3BSNA 4A8WA 1FRLA 4FKYA 2RF2B 1QUPA 2ZD1A 4PAAA 3ZC4A 2VPWB 4PPZA 4WYLA 3RAQA 3EUNA 4I2QA 3J81Y 2C2KB 3DRYA 3VGVA 4DX6A 5B0BA 2WONA 4FVMA 2UZAA 2KHCA 2DHSA 3DLEB 3AHPA 3NL0A 2LQ8A 1CQNA 1TL3A 4RNNA 2XULA 2VQEF 5A6PA 2EKYA 2Q1LA 1BQNB 2MXYA 3VALA 4OLPA 1KOHA 2D9OA 1B64A 2DYAA 1U09A 1HR0J 4KGKA 3PW4A 3M30A 2BJDA 3O6QA 1N5QA 3SCKE 2L08A 3EXYA 3ZZ0A 4E98A 3R6LB 1S1XA 2VQFJ 2GMJA 1RHQB 4NRTA 1JLAA 4DBQA 5DZ7A 3FGVA 4JP8A 4A8SA 3DHXA 4O4GB 2B43A 4ZKAA 2HRTA 2ZH9A 2G1HA 1SC3B 5HBMA 5GADI 2OEJA 1RU1A 2K1RA 4B3OB 4JV1A 2EW9A 4DSIA 1S1VB 3ISND 2YWGA 2VV5A 3BZQA 1Q8LA 2FVRA 2RE1A 3T1AA 4HH0A 4J9KA 4NA1A 1LW2B 3M8PA 1KS2A 4EWTA 1OWXA 2C42A 2B4PA 3A8KA 4X4SA 3PYEA 5ETKA 3GIKA 3TVZA 4OYZA 4QPXA 1G6BA 4GO7X 4DR2F 4KTQA 5J2QA 4FYDA 3ETMA 2XMJA 1SL2A 3GG1A 4X84A 1X9WA 2HHVA 1QAIA 3DYAB 3DHWC 2ZH5A 3EMTA 2I2YA 2HVZA 1OO0B 2FTRA 4LBIA 3AY0A 2OO4A 3ILIA 3T1HJ 3MM7B 2N4CA 1HI1A 2FQQB 1WD6A 1KOOA 3X1LB 3D1HA 5HK4A 2OTLS 2ZBCA 2AYEA 1PILA 1H72C 2FGOA 2IMOA 4CH1A 2OMLA 2NR0A 3SDEB 3M4XA 2D74B 1N52B 3V4MA 2OUGA 5J2NB 1HKAA 4NI2B 4KJIA 1YJVA 1AYEA 1IBMJ 4DWIA 3DRPA 2CPEA 4WXWA 4AL6A 4CT8A 3MPUB 4LF1A 1XWLA 3QWPA 4LIWA 5DM6Q 1CLFA 5DQGA 3AXKA 2IA0A 2CJAA 4NLUA 2DIVA 3MM6A 5KFKA 3H2VE 3ZZRA 3H40A 3EPGA 4UOFA 2KXFA 5GMEA 4YFUA 3G9CA 3GFYA 1FXLA 4K5RA 2BE2B 4DR4F 3G6ES 1DJ0A 3LAKA 3EDQB 1PYTA 4QWBA 4HH1A 5ETLA 3DKDA 1UWBA 2MZTA 2CZVC 4JI3J 4CI0B 2JX2A 5EHHA 3CUNA 3W5ZA 4CM2A 5ETPA 1NAQA 4LFCJ 5IOLA 3W61A 2LQJA 1CEZA 2AYGA 1Y00A 3T6BA 3TUIC 2QLWA 3NCPA 5FD1A 4DU8A 5ITHA 2VUGA 1MMNA 1GAOA 4GC7A 3PFOA 1YLXA 4FYVB 5DRKA 2XEXA 2FHJA 4NLYA 3W2VB 2D3UA 4Y2AA 1RT1B 4XDCA 2JHEA 1RAHB 2GHPA 2HRYA 1SPBP 4KT0C 3V4IA 1W7WA 1YRTA 5CYJA 5B09A 2CQHA 2VD3A 3KLEB 1M5PC 4L6V3 2I0XA 2ZHOA 1I3OB 3ZZZA 1VR6A 3HLUA 3L09A 4LREA 2XMKA 6AT1B 2WSCC 5E7OB 1NUEA 1UW4A 1FJ7A 3U1NA 4ED7A 1Q1KA 2UVVA 4OIXA 2YNFA 1VLOA 3B78A 3PJXA 5CYMB 2VJUA 4ID8A 4CO3A 3J80Y 3GJRB 3VVTA 4A8XA 2MLZA 2CPFA 4B9NA 5I42A 1WELA 1FKAF 1RWUA 4UTGA 2V63A 1N56A 4OI2A 4DHVA 3L95X 2KXNB 4QIGA 4KO0B 4F4AA 4F2RA 3HZGA 2J7UA 4QYZK 4ZN3A 2DCLA 1RT3A 3TZZA 2XG8A 3M32A 1TL1B 2PD1A 3QJJA 3GMGA 3O8WA 3VGSA 3U7JA 4RW7A 1WJ9A 2HGLA 3OJSA 5E5NA 2OJ3A 5GAHU 2W2QP 3HVAA 1N34F 2ZC4A 5KFGA 2V2VA 1ZM3A 3PKMA 1S0MA 3PYFA 2FY8A 3A3PB 1B7FA 1AZSB 2DXFA 2XS7A 4MK9A 4USUA 3BKFA 3KJVB 4MFBB 4UQTA 1YBTA 4A47A 2DPJA 2K3IA 1Y3KA 2WBMA 1S4FA 1L3SA 1X8DA 1WEYA 4AXJA 2KXHA 3MEDA 3AOCA 4NRUA 3KHRA 1RABB 3GIMA 1JLFA 2WAQD 4PRFA 3AT1B 3DLLQ 3ITHA 1RAOA 2W8KA 5HQMA 1J5OA 3GIIA 2QL7B 2AQ4A 1CS4B 5J1EA 1RP5A 3HD1A 1NDPA 2V4JA 3DGVA 1HR0F 1OQ3A 3FEZA 3DXBA 2KFNA 3R3TA 1E6YA 5J2PB 1GK8A 4FNIA 5AE2A 2ZNYA 1JB0C 4AFFA 5IWAJ 1TVRA 3DLKA 3GLJA 3UN3A 1HBOA 2N7CA 3EYZA 3CC4S 3ET6B 2VQFF 5D77A 2KRRA 2XMMA 2DNLA 1WOPA 5KFDA 2ZWOA 1FA0A 3G87A 1QSLA 3HSZA 4ZCKA 3R1LA 2Y0BB 2B8PA 2JVRA 2OD4A 3FCVA 2KVQE 1T05B 1H3DA 4DV2J 2J0WA 3R1HA 5B7WA 2G0CA 1M5HA 3MUMP 3ONQA 1HFEL 1WF0A 3M8QA 3CJ8A 2M5YA 5EWEA 2WVBA 4F04B 2NZCA 1VBXA 4AQYJ 4TXSA 1SJ3P 2XO6A 4JI7J 2WOMB 3ISNC 4PYAA 3W2WB 2VPZB 4DLGA 4R8UB 4B9UA 1FRKA 4DV6F 1TK0A 1HBNA 1S99A 2GW8A 4F3QA 4USHA 5KT7A 2F8EX 4CH7A 1HW8A 3T1HF 3KLIA 3IRXB 1Y5NB 1Y0HA 1SIWB 3C15A 5JVGQ 1IJFB 1QUVA 1NJYA 1DBDA 1U47A 5IFMA 4USVA 2C3UA 4B3SJ 3VZHA 3BH7B 4YR2A 1F9EB 1SJRA 2JOQA 2JJ4D 3UNGC 3EICA 2DT9A 3MPVA 1S1UA 2POKA 3NG8A 1W25A 4G1IA 2VKZG 1IBMF 5C7PA 2GMHA 5IC6B 2PMHA 1RTIB 4AYBD 2KHDA 2ZOMA 1FRMA 2QFJA 1D1UA 3FBCA 3C46A 1SXLA 1TELA 2ZHAA 1TP7A 2OKQA 2I5JB 2VG7A 1VQYA 2CNLB 4ZP9A 1YRXA 1YVFA 4FVCA 1WSVA 2D9PA 3MM5B 4IOAQ 1BXNA 3B54A 2VODA 4TU7A 3VQTA 4TYAA 1RI7A 3Q8UA 1XR7A 4JI3F 5GAEI 4OJGA 2M8HA 4NXNJ 3IBWA 5IT9U 2HIYA 3OSPA 4LFCF 4DL4A 1R8CA 1X4EA 3VTIA 2HRUA 4LR9A 3G6YA 3MGJA 2QA4S 4NLSA 1V3RA 2XCAA 2JWNA 4XPEA 1VIXA 3EZ5A 1APSA 3QJPA 3DU6A 2AGQA 1FXRA 5F8IA 2ZNZA 1J5EF 1HHTP 1PJ5A 2HQFA 2WRMA 2VFUA 5KFTA 2QZ8A 1WTFA 1RGVA 3A12A 1RTJA 4FPRA 4PUOB 2WK4A 1S1TB 4RNMA 1F5BA 4TLQA 3BEGB 3O5TB 3I4HX 3CO0P 2I38A 2ZH6A 4I4BA 3MCMA 1C1BB 1KN6A 4DQPA 2VF3A 1YKWA 1HYSB 3KHGA 2DD8S 4EMDA 3CIZA 4OYWA 1XERA 4Y28C 2JL9A 2RH3A 3KK3B 2FGCA 2C1EB 3W62A 1IKWB 2UUWA 2LU2A 2DR9A 1YRUA 2CJ9A 1ZYQA 4EBEA 1T02A 3HF5A 3L7PA 1V6HA 1FDNA 2DGWA 4M8LA 2B3TB 3GR1A 2OSRA 1N33J 2DPIA 4JV5J 2HAIA 5E3AA 3R2CJ 4FXVA 3CCMS 3CJ0A 2XY5A 1VC0A 3QYYA 1XTZA 3G86A 3MXHP 3HHLB 4ZP8A 3A3NB 5LXRA 4EGLA 2E1PA 3MMBA 3SSQA 1R43A 1KVKA 3MCOA 3WBZA 2F9JA 4IH6A 2ZE2A 2R7SA 1RHUB 4DCJB 4BBYA 1HNVB 2CG8A 4OYOA 3KUGA 4DDFA 4ZVUB 3BR9A 3DOLA 2HK3A 4QBUA 2C28A 1DLOA 3BKTA 1HHSA 4U8YA 3CCRS 4F50A 1VQLS 5KFYA 3CCVS 3N5BA 1RHJB 5C42B 4QWCA 2W8LA 1U1LA 3GJTB 3DM2B 5MLCV 2UP1A 2MKIA 3NS6A 1RBAA 1FJEB 1S6QB 3DOKA 4RW6B 4DV3J 5D4LA 2ZH3A 3OPKA 3QT8A 3LQVA 4ZVFA 4LMZA 1S9GA 2DNOA 1YIJS 1YZ7A 4DV0J 4DR7J 3F0NA 2CAJA 3LWMA 5D0GA 4DJBA 4O0IA 2OSQA 4IDKA 3IS9A 4J5OA 2VFTA 1CG2A 1Q0NA 2B4VA 2YKMA 3MMCB 3CDWA 3OW2R 4UOHA 1ITPA 1GFWB 2EFOA 5EWGA 1VCTA 3I0SB 3IFEA 4HLBA 2QL5B 3KK2A 2XYGB 2ZZMA 4Y00A 3M2UB 3HVTA 5IWAF 2QRRA 2YH0A 3KDNA 1C0UA 4J9UE 3B6BA 3I6PA 2RDIA 2PMZD 3PRDA 4HL9A 3DRSA 1U7LA 1S6UA 1D8YA 2CDQA 1WHYA 1DRZA 3UFCX 3OL7A 4BS2A 4YR0A 3CD0A 3HDSA 3MTKA 3CJ4A 3KG1A 4ZPBA 1SUQA 3R7NB 1VMBA 3R5BA 1HNZJ 2DXDA 2X7IA 4B17A 3H5XA 4A4JA 2J0QD 3JTPA 5KT3A 4BWJA 4CO0A 3LP0B 4WIQA 3LPEA 4C4WA 1XBWA 1ROFA 3TR5A 1JJHA 5F8HA 1MN7A 4OHWA 2CJKA 5D6GA 4CNZA 1GX6A 2RHQB 1JLEB 3ILOA 2KKHA 2IM3A 4ITSA 4OZ1A 4NYZA 4JI7F 2B6AA 4RKUC 1JLCB 1MROA 4DG1B 3IG1B 3BB5A 4PCQA 3NNAA 3GU0A 4TNOA 2W9AA 4MK8A 3KG4A 4V19J 2QMUB 5K9FA 2E1RA 2EVZA 3HFVA 2QEXS 4HKQA 3D0HE 3OVSA 4BC9A 2B7CB 1VQSA 1TAQA 4Q7AA 4B3SF 3M6VA 5ETRA 4UOGA 4IG0B 1Y7PA 3V5RA 2PEHA 2GGPB 2VG6B 1NK8A 1FXDA 4WIIA 2F63A 1J2VA 3H42A 3U27A 3U1LA 3MEKA 2FY1A 3LALA 2XYHB 2HS4A 3JQMA 3C6TB 2W2OP 4N7TA 2LU1A 5T7LB 2IDEA 2DJWA 4YQWA 3CJ5A 4WU3A 1S77D 5FLXU 2FZKB 2ZVSA 4LRBA 1UA1A 2AWZA 3MECB 2DNKA 2HIQA 2RQ4A 5F0WA 2Y9HA 3HSDA 4PQUB 4ED3A 1GQEA 3BGOP 1ZAXA 4C8LA 4R25A 3T1YJ 5K8OA 2AJ0A 3RU0A 4NX9A 3ZO7A 4NXNF 3T5HA 3NP5A 1H98A 3TQ1A 2G0IA 4C11B 1FVSA 4OHVA 3MDFA 3POTA 4HEA9 2H5JB 2HHTA 4C0OC 3TW0A 4X65J 4UQGA 2MLXA 3I32A 1IR2A 1YJUA 4DFJA 5HP1A 2MKCA 3TYTA 2RDDA 4RBTA 2HBRB 3Q83A 4L72B 4M5MA 3AD9C 1F3FA 1KVJA 2HHWA 2ZDOA 5IM0A 1KQKA 5LSLA 2Y8WA 2HQGA 1G1XA 1X9MA 1IQZA 3M1VA 4ZPDA 1P9YA 2BR0A 4FF4A 1K1QA 3KLGA 2HS0A 3R2DJ 2FC9A 4Q45A 1BHNA 1ZA2B 2Q79A 2V68A 1ZTTA 4H4KC 1F9FA 3P3DA 2IRYA 4TU9A 1YQHA 2WB4A 1FT8A 4LF4J 4YS2A 3CD6S 2R2TA 4S0MA 5DGBA 2B9WA 2RMLA 4ICLA 2YKNA 4Z7YA 1S0VA 4LBPA 1KTVA 3ILJA 4DF4A 3N5FA 4CRJA 2QMXA 2M3DA 4ZVRB 2R2UA 1N33F 4QIVA 5KFJA 4JV5F 5KFWA 1K73T 4DV5F 4OZ0A 4D3GA 1B3TA 3CJTA 3QIPA 4DL5A 1CPZA 3MAAA 2K2PA 5ETNA 1WF2A 1UEVA 4YEAA 3UDVA 2JEGA 2MSSA 1K47A 3D1QA 1NJZA 3G2XA 4YR3A 2W24A 1IKXB 2J7WA 1LWXA 1T11A 3CO9A 5GAHI 3OR2A 2V8DA 1TQLA 4B02A 3CD7A 5IXUA 1F5AA 1OYEA 4ED1A 2HGMA 2RF2A 3CDAA 3I82A 1CJVB 1X60A 4B3TJ 3H59A 1P9QC 3CCQS 1AUSL 4OYAA 1JWWA 4ELUA 3VGUA 3M8WA 2H51B 3QJLA 1S6OA 3SSSA 4DV3F 3KJNB 4WU2A 3RW7A 3DLEA 3PYGA 5FIIA 4UY8T 3QZ8A 3S6EA 1VQ4S 4QIWD 2QX0A 2XI2A 4UY85 5B0FA 3HI9A 3RB6A 3W9IA 2NREA 4MK7A 1LK5A 1UAWA 4DR7F 4ZVHA 3F44A 1NK0A 2FLLA 4F36A 3FKBA 1BQNA 1N0VC 1ZS6A 2JZ5A 4AD6A 4PWDB 4QYRA 4QJVA 5B0AA 1HPZB 2V2QA 3NGUA 2X1FA 2DTJA 4J9VA 3BKUA 4JOUA 4ZOSA 1I94J 1SC1B 2MKJA 4U8VA 5A8RB 3PW2A 4M5KA 2E5IA 4MYTA 1NDCA 1F6TA 1ZM9A 4ECTA 4ES3A 4O4GA 1X4GA 1FK9B 2EFQA 2OFHX 1REVB 1NKEA 4I67A 4X4NA 1RAAB 2XI3A 1NHVA 5EN1A 2W7PA 3HSJA 1JLBB 3P49B 4PXCA 1S1VA 3ENVA 1H7XA 3F56A 1X4FA 2A6MA 1HNZF 6FD1A 2N3LA 3TI0A 3OQ2A 2C2OB 3G6XA 4DS5A 1LW2A 3Q8YA 1VBZA 2IFXA 1JXEA 5BR8J 3BPSP 2PN6A 3OR1B 4NLOA 3CNQP 4PXEA 3US5A 4B9MA 2F40A 1FRJA 1U24A 2Y1LB 2A18A 5D0RA 4N77A 3DYAA 2NPIA 3R6GB 1HNXJ 2W7OA 1DURA 4GMKA 3MM7A 1KFSA 1NJIT 2V9WA 2ZDPA 4DR5F 3N01A 1GX5A 4O3QA 3GWCA 2R8HA 3H90A 1UEKA 2DHAA 3SDEA 2E5GA 2MLYA 4R5PB 2ASJA 2WCXA 3VZIA 5J2NA 3KXDA 4OJHA 1VDHA 4NI2A 4ECXA 3FRZA 4BWMA 1X0FA 2E29A 3RB0A 2ADBA 4DFPA 1Q78A 4P71A 1VBKA 4LQ3A 3GYGA 1BQXA 3GJQB 3L7OA 1NPPA 3PO4A 5A2QU 5C5JA 1NRKA 4HACB 1GEHA 5KFCA 4TVAB 2IAJB 3A3OB 2LECA 2DR8A 4Y0FA 4DR1J 3PV8A 2EFNA 4AXIA 1XMQJ 2X1GA 2IJRA 1KLNA 1RWVB 4H4KA 1JLGB 3EPIA 4ZCIA 2G1DA 8AT1B 4DQSA 2FJVA 1MWQA 5GMKa 4E2FB 1UCNA 2O67A 5KT4A 5DQHA 2WB1D 2QG9B 1JXVA 2OPPB 4WFYA 3T1YF 1OMSA 4H54A 3OUYB 2KT2A 3ADAC 3D1OA 1SIZA 1IQTA 4QU7A 3MCSA 2BBEA 2P6TA 4K4YA 4KYZA 3M6XA 5MAOA 4X65F 1EQ0A 3SCIE 3MAHA 1P1TA 3W2VA 5I3UB 1WEXA 2VDIA 3UI3A 4U6PA 3ENWA 1OY6A 1X4DA 3ETOA 3KLEA 3C6UB 2BXJA 4K7QA 1IKYB 1NU4A 1FF2A 3W5XA 2CIMA 4W92B 1EP4B 1YSJA 3I0RB 3M9OB 3OFGA 4K4VA 4X64J 3O2IA 1REGX 5G0RB 5CYMA 1VC6A 1VI7A 2E9TA 4LT6A 1G2EA 3EE3A 2Z0GA 5LOQA 1CJKB 2OGUA 3M8SA 2M9KA 4HI2A 2R8KA 2PT0A 2GMLA 2DNMA 2FJDB 4M5GA 3WHIA 3DDKA 3O1LA 4WTOB 1YJWS 4KSEB 5A0YB 3IGNA 3CGIA 3TX0A 3C66A 3I96A 1NHUA 1W2BR 4DZ6A 4F2SA 4KO0A 2VPYB 2EC0A 1U6FA 3QAEA 3QT7A 2JH3A 2IDLA 2IC3B 1TL1A 4USIA 2KZMA 3GFXA 1GNKA 2BJEA 1VLYA 2AD9A 2W01A 3JAMY 3DLJA 4ZHRB 4KFBB 1C0TB 4ECYA 4ELVA 3EJMA 2MTLA 1AZSA 3NGDA 3K59A 2KO1A 5ETSA 3IR5B 2IMWP 3MAQA 2ASDA 3J7ZT 3MD1A 2HBYB 5B0EA 5DDRC 2AEJA 5D3GB 3KJVA 4MFBA 1R8BA 4B3TF 2KI2A 3J7Z5 2U2FA 2UV8G 3NLCA 1EZZB 1MMLA 2VA2A 1ZM4A 2LEPA 3NBPB 1H6KX 4DUZF 3NMRA 4OX7A 3IBFB 1DARA 3KK1B 4I6WA 3QRPA 2YKQA 4JI4J 1NB7A 1KTQA 1T0TV 2PI5A 1CBKA 4LRAA 1SBRA 4RBVA 5C2GA 2QA4G 3GYXB 2VA3A 1TKTA 2OPSB 4ERDA 3BV8A 2QIFA 1FCAA 1CS4A 2F3JA 3KDOA 2W1BA 2CNNB 1QAJA 4LJMA 1QDUB 4RW9B 3CCLS 1S1WB 2HVIA 3E01B 1I94F 3G71S 5B0GA 1I6JA 1IBLJ 2AJ2A 1WC5A 2ROEA 3FSYA 1YZ6A 1Q86T 3ET6A 3RB4A 2BOAA 1IKVB 4LF7J 5M2UA 3LP1B 4NMXA 2R9LA 3CWJA 3NGRA 3PNIA 3C14B 4DL6A 2J9DA 4Y2CA 1MW7A 1Y4ZB 5L1IA 5HROB 1YBUA 1T05A 2DNNA 2YKOA 5B0DA 2FB0A 1XR5A 4YUDA 4ZCLA 2C3YA 4DQQA 5KAKA 4YMEA 3OVAA 2YWWA 1SQFA 2XZTB 3A1YG 2GQ2A 3D3CJ 4ED4A 2Y3YA 3FEYB 4ZJOA 1ACMB 4MMOA 3EXCX 1VQ7S 3I9ZA 1NLKL 5BR8F 2HK2A 5A8KB 2VC1A 2DRDA 1ZZFA 3R7BB 1R0AB 2WOMA 4MJKA 1NK9A 3WZ0A 1NNDA 3TOQA 3IC1A 4QR1A 3RRGA 3W2WA 4WP3A 2UUCJ 1S76D 3JSMB 4C6AA 4R8UA 4C3MA 1JLQB 1KP6A 3EWGA 1UVKA 2DEJA 1RCOB 1O5JA 1M5OC 4C8OA 2F5GA 3IRXA 4EBDA 4OI1A 2OPQB 2CQ0A 4DL0C 4NMLA 2GCFA 5THWA 3EGVA 1MMDA 3D3BJ 1WKKA 2EKNA 1SH2A 2KYZA 2V67A 1D9FA 2HNDB 2DNGA 1D9DA 2YNHB 3JXOA 3SV3A 4WBFA 1XR6A 2WVCA 4DN0A 1UZHA 5L1JA 1K9MT 3EDRB 3P5BP 4ATNA 3IR6B 2ZBIA 3Q8VA 2ROGA 1SJ4P 1T7PA 3HKZD 3DDNA 3MFIA 1U8SA 2KYXA 4G6VB 3GG0A 1RWWB 3FEXB 4EO8A 2JEFA 4DF8A 3GFHA 4N5SA 4IFVA 4DR1F 4NYPA 1B0TA 3NEKA 2OEKA 2K8GA 3MM5A 4ECUA 1RT6A 2LMIA 3K17A 2L9WA 3IRWP 4EEYA 5LMNJ 4IKAA 2YTCA 4CLUA 2R7VA 2HVEA 2DO0A 1DTQB 3GTYX 1YDLA 1N6QB 5CYQB 2AGOA 2AHOB 4A8KA 4U96A 1X4BA 3P4UB 5HANA 2XWYA 5IC4B 1SKRA 2NSBA 1UVIA 3HPOA 5I3PA 4HYKA 5M2RA 1HBUB 2F8HA 5D8HB 1M5KC 1HWIA 1S97A 4KV8B 4J9SA 5JMNA 2G0JA 4PUOA 3W7BA 1S48A 1N0UA 2HQ3A 3NAHA 3T9NA 2AF6A 4ZMMA 2ROPA 4HTIA 1C1BA 2VASA 2YNGB 3SZ2A 3A13A 3H4DA 1EETB 5J2MB 1HYSA 3TAPA 4WP8A 3TZXA 4X64F 1N4LA 4NLGA 2VFSA 1B0VA 2XBPA 3KK3A 3NWRA 2EXUA 2NS1B 4D3HA 2B5JB 3EVWA 3RZAA 3SXLA 2O5DA 3UO0A 3D2WA 1M1GA 4KGZB 2C22A 3H2UB 5KFLA 3ZXWA 2LQBA 4WKYA 2DGUA 4ZK7M 1X5TA 5KFPA 1Q5YA 3HHLA 5HO4A 1C1CB 1TL7A 4B3RJ 2MEWA 3KHHA 3PRBA 1URRA 3THVA 2V5HG 4KGVB 3G82B 4OYIA 1M0SA 3UNYA 4DSJA 5T41A 2C2NA 2KH9A 4WZQA 2QLBB 1IWAA 1VJQA 1IR1A 3TP2A 5EUHA 2MZ1A 1CJUA 5DJBA 4NLPA 2ACMA 2NXNA 4I2QB 4F25A 3N6LA 3VQSA 1U4BA 1HA1A 4IYQA 1UA0A 3JYTB 3FNNA 1Y5LB 3PEHA 5AE1A 4N47A 1WI6A 3QWUA 5C42A 3KTQA 1FJCA 3DM2A 1XN9A 4UW2A 1S6QA 1RT2A 3HULA 3TARA 3T3FA 4GVLA 2M0GB 1U45A 3H5SA 4RUBA 4RW6A 4HTJA 2XCPA 3FMBA 3K5OA 3P45B 3J81j 2EWHA 4XPCA 1MU2A 4QOTA 3M05A 3UVJA 3GQCA 2PE8A 4GKJF 3NS7B 2YXLA 1Q8IA 3HMJG 2MQ8A 1UL3A 4JI4F 2NUHA 4UF4A 5GVQA 4LQ9A 2VPXB 2LLZA 1TK8A 4B9LA 1RKJA 4IRKA 2IM2A 2L9NA 2FZGB 1J27A 1MSWD 1IBCB 4M63A 3MMCA 4FYXB 2HGNA 3ULHA 4LVNP 2HHUA 2JLEA 2FJXA 3I0SA 5HBMB 3NXZA 2AJ1A 2PEBA 3WX8A 4X62F 1UMJA 3ISZA 1IBLF 3H20A 1P8GA 2SXLA 1RWNB 3FRYA 3DOMB 1BQMB 3HFZB 4HT7A 3S7RA 3BGLA 3TEGA 2H48B 4DPOA 1DFDA 4LF7F 3D66A 3K5NA 3I5CA 2DGOA 1ZH5A 4EYIB 2MZQA 4F26A 2XMWA 3WQPA 1QJHA 4G65A 5KFSA 3IWNC 3CF5Q 1FDBA 3CMQA 1TZ0A 2XM3A 4W4MA 1I51B 5T14A 4KE5A 3GIRA 2MHEA 2Z2ZA 4YHHJ 1U6ZA 2HZAA 3RR8A 3LP0A 3MZIA 2D3ZA 3RBDA 5GAEU 5DS7A 4ANDA 1OS5A 1RT5B 4WWSA 1JLEA 3CCES 2I1RA 2ATCB 1ZZNA 4M95A 4CLSA 1EARA 2KL8A 3KFWX 3H98A 4ANCA 4DG1A 5A8WB 2Y1JA 3IG1A 2UUCF 5ETOA 3C19A 4JV2A 3MD3A 3TO8A 4ES1A 2CXEA 4Y34A 3CCWA 3NOGA 2M4MA 2ATLA 1FDAA 3JTOA 2R7TA 1PYOB 1HNIB 1P1LA 4Q8EA 3QO9B 3TX8A 3RUBL 1FFWB 3BJYA 2BE9B 3OSNA 1QTMA 5HJYA 2ZWPA 4J37A 5L8RC 4K5SA 4GRSA 4KH0B 4NA3A 5H9FJ 3MM6B 4IG0A 2XWXA 3AD7C 1MWZA 2V2ZA 2GGPA 2VG6A 1S59A 1S7HA 4OYPA 2RT3A 5LT5A 3MCNA 2GS8A 1RDRA 2R42A 1MNEA 2VONA 1VRUB 1CSJA 1A6LA 1O6XA 1F3VA 3H7HB 3TZYA 3C6TA 2RD5C 4L3NA 4CCHA 1H73A 3LA0A 5T7LA 1HMVA 4USWA 3MOJB 3B4DA 2DHGA 2QSWA 2P9EA 2DBBA 3BS9A 4X4OA 4WZMA 3QFWA 3MECA 3J7YI 3LGHA 4OX8A 4ILRA 3UE2A 2XY7A 3QT6A 5IZHA 2EBEA 2BQUA 5L39A 1Z2ZA 3I56S 3G8QA 1K0VA 2BM1A 4YDXA 5E3QA 2UXBJ 3ENQA 1GMWD 4L73A 2LDYA 2C2DA 3K7RA 2R8GA 1AW0A 3SQGB 2BANA 4FXDA 1WEZA 1FD2A 3LANA 2WVFA 3V4IB 1UVMA 2XB2D 2IPOB 3FBFA 5SUHA 2HFOA 4E8UA 5DLGA 1VRQC 1IWGA 1T94A 3HT0A 5AE3A 5KFOA 4YB5A 1H2VZ 5C25B 4OZ2A 2OAUA 1F5CA 3PXGa 3ZNJ1 2J6UA 3KG0A 4FBUA 2ZBRA 1LW0B 1FKOB 2KG1A 2J7KA 3Q0AA 4J9PA 3AB4B 1NZ8A 4BHQA 1T9UA 4B08A 2FJAB 1DQ8A 5CHCB 1S79A 2HLUA 3R5DA 5AXNA 4CNYA 1XC9A 3UN2A 3BBBA 5IV3A 3F41A 1AXQA 4LSNB 4PQAA 4L3KA 5HVGA 3HT3A 3VAJA 1I5OB 3NGSA 3M32B 2DGSA 5LL6d 3LTOA 3RBEA 3OTEA 3MM8B 3DRXA 5DG8A 2ZH4A 4OI3A 4B3RF 3RJMB 3L3CA 4NCBA 5BYSA 4O44B 3M9MB 1IKXA 1S49A 4M5IA 3RAMA 3W9HA 4JI0F 3DLHA 2B4UA 4FP9A 3GCWP 2ZKTA 1P27B 1T3NA 5H1SV 5BYQA 5IQQA 2BJ3A 4DPYA 3TQEA 5HATA 1XNQJ 4RWWA 4Q0BB 1TU0B 3SCLE 2RS2A 1CJVA 1MN9A 5D0EA 4NYOA 5E2QA 3IGVA 4XO0A 2YX7A 1N32J 2UU9J 1OQ6A 3KNGA 5F8GA 2NLWA 2FVQA 2HQCA 1U1NA 2E1CA 4LF9J 3DI6B 4DV6J 3MEEB 1WF1A 4HR2A 3TANA 3UD5A 3CTRA 2B9EA 3FSIA 2G2ZA 4F0MA 1PJ6A 3PW5A 6FDRA 4IOBA 4ER8A 1PGZA 2ZH1A 5L1KA 3PM9A 1SKUB 1FEHA 3BF4A 4PWDA 1HBOB 1JKHB 2R7XA 4N41A 4NLDA 1K0TA 2W7AA 3ZZOA 1Z1ZA 4J90A 3VVUA 4PG7A 5KG5A 5L38A 2IYGA 4HI1A 1Q95G 9ATCB 2H65B 4CM0A 1RWKB 5AJ3J 4P9SA 4CO5A 2PO4A 4C8ZA 1WC1A 4L74A 1AROP 3JSRA 1M1HA 3CCJS 1REVA 4RPFA 3LW5C 3IO1A 2YKPA 3HJVA 8ATCB 4RNOA 3OHAA 3CMAS 2CJYB 4RW4B 1NCLA 2DO4A 1SVDA 2RHSB 4ETXA 2ZOFA 3HCXA 2ZBQA 3JSBA 4N76A 3VWSA 1X9SA 3AJ2A 4QPTA 4YHHF 4CLPA 4U95A 3BGRB 3TRGA 3JS9A 2HYIB 1RTZA 2HFUA 1E6VB 4EUVA 1ZETA 1L3TA 3DMJB 3OTDA 2JC0A 1VRTB 2EEYA 2R7UA 4KHRA 4CYUB 2VL1A 1S9EB 3W8GA 1U1RA 2J9CA 2XC9A 1Z4UA 3V6DB 3VR1A 3JQJA 3NGTA 3RG6A 1RTDB 1EIYB 4DFMA 3DLBA 2LQ5A 8RUCA 1J5EJ 3Q8SB 1HWKA 4YOEA 4MKYA 4JUZA 3R5JB 5DG7A 1WHVA 1JJ4A 5F8LA 4QWDA 2K7JA 1IM6A 1NDKA 3MTJA 2GQQA 2J5AA 4P2FA 3VAFA 4R5PA 5KOWA 4LF2A 4B9VA 2VJVA 3GV7B 2HHQA 3MMAB 1CC8A 3M9NB 4QU6A 1X5SA 4O23A 3MR6A 2GHVC 4CO1A 1RE1B 1TUWA 1UVLA 1WKLA 2IJNA 3A8EA 2CNOB 4XDDA 3EVOA 4ZVQB 1VYAA 3T19A 4I64A 2HVHA 2YWFA 2K06A 1LQ9A 5C24A 4ECRA 1SKWA 1PJ7A 3GIJA 4J9LA 2DGXA 2ZZTA 3NY0A 3GJSB 4DV7J 4ZIVA 1VK3A 3IAM9 3RBZA 2KDOA 2BUNA 3AFGA 4LF5J 1ZBTA 2OPPA 2LP4A 4DQIA 2AU0A 4WFBQ 4PWUA 3OUYA 4BDPA 5HSPA 2DGVA 1HWUA 3M2VB 3AJ1A 1CULB 2YH1A 1RLCL 1NSQA 3L7UA 2UXBF 2DNPA 3J81U 4QQBA 4CLKA 3LO3A 5K8PA 5HAOA 4URGA 1YI2S 1HQUB 1RTJB 5KFEA 2BKNA 5B08A 1HD1A 2J0XA 5I3UA 3VAGA 3ZTPA 1V9OA 4ZCMA 2EFVA 1VK8A 4O3NA 2BA9A 3THTA 2KM8B 1FKPB 3NCQA 3C6UA 2JFKA 1IKYA 1F2HA 3QIDA 2H5EA 1SI9A 4ZITA 3BBFA 3I0RA 2OIHA 1LOUA 2R7QA 1RT7A 1NHKL 4WXOA 2G9OA 1VIOA 4NXMJ 2FHJD 3M2RB 2GA7A 2V8GA 3AOAA 5G0RA 1V5IB 4P73A 5E3CA 2WSFC 4ZLLA 5KOXA 3CT9A 2AEFA 3G4SS 3G8SA 3N6MA 4NWBA 1CJKA 3TVKA 1Q81T 3EZUA 4H4MB 2AZ1A 4P7TA 2ZZNA 3D5MA 3IMQJ 4KKOB 2CWKA 1HWJA 3BYRA 4C3KA 1KD1T 2FLOA 5A0YA 1FTRA 1LEOA 2V34A 2CQ4A 2RU3A 5ETQA 2L9DA 2PDAA 2AIRB 3H5YA 3GONA 2E1AA 1WNEA 1S72S 2EI5A 4JI5J 1G4CA 2PGCA 2F8MA 4DN9A 1R6YA 2V50A 1BMQB 1IBKJ 4QW8A 2WTFA 1Q8KA 3QGPA 1F2GA 2A6OA 2IC3A 1W2IA 2WSEC 2JRSA 4DSLA 3MWBA 5KT5A 1LWFB 1S6PB 1VHFA 3LUYA 4JYAJ 5EDWA 4R0EA 2I8EA 2W2NP 5AXLA 1TKXB 3GSIA 2B56A 4ZHRA 4YN3B 1C0TA 1NZAA 4I69A 4DZDA 4LRFA 1XNQF 3QPIA 4TKTA 4GC6A 1ELOA 4QWAA 2FJBB 3CDEA 1S9GB 2BKPA 3ZTOA 2MQMA 2JLGA 4X4QA 1N32F 2UU9F 1UEUA 2GJ2A 4MKVA 1WTBA 1LXNA 1JNZB 2J8SA 5K5MA 2CUYA 1JXLA 3KK1A 4LF9F 4NLRA 4IDKB 1U8WA 4EYHB 2VFRA 2FDNA 3IM9A 5KFRA 5HMZA 4EZ6A 2AJQA 5B0CA 3GFZA 3BGUA 2HMIB 1YG0A 2J9DE 3IAS9 1NK6A 3BSCA 2MHNA 4G1QB 2YX4A 2OPSA 3OHBA 3GYNA 1ZAVA 5SZTA 4OI6A 2X1BA 3KUEA 3P8BB 4RW9A 1LWCA 3GV5B 4U7CA 4EU0A 3E01A 2IM1A 2PFDA 2D3OR 2EC2A 3THPA 4ZVEA 1WACA 1N54B 5AJ3F 4G1PA 1IKVA 1SL1A 4HHUA 3TNVA 3LP1A 2HQIA 1KVIA 4JI1J 2D3O1 2XMUA 2NXJA 5KFUA 5HROA 4IG3A 5K20B 4M94A 4OX9F 3M7VA 4PXDA 5LJ3Y 2JSXA 2HKEA 1NPKA 1VQMS 3CJKB 2F65A 4XTTA 2AV5A 3I5AA 1MROB 3OTBA 3TWZA 2KB2A 2EK1A 2BRKA 3PRVA 1H2TZ 4F7VA 5A8KA 1FO1A 3FQLA 4U67Q 1R0AA 4PG5A 5ETTA 2XLKA 3JSMA 2M2BA 3Q8PB 4KPCA 4RUCA 4ELTA 1HNWJ 2K3KA 3BR8A 3K5MA 1YTYA 4EBCA 3S1TA 4ZDNA 2OPQA 5KFAA 4X4TA 3FC9A 3RYLA 2EFGA 2V8PA 2R2RA 3PG9A 2BMBA 4H4OA 3J80U 2ERRA 4O0NA 1K44A 4GVBB 3JQKA 2PIIA 2H5IB 1QTNB 1KLMB 2HNDA 2VKRA 1CVJA 4K4ZA 2AJFE 4OV1A 5KFQA 3TEHB 4FF1A 3TA1A 1T03B 1VFJA 4RZRA 3M6WA 2AP6A 3TAQA 4ID5B 1MWYA 1BD6A 2C2RA 3G8TA 4YB7A 1RAEB 3CJ3A 7FD1A 4CDIA 2GJIA 1PIEA 2KU7A 1EQMA 3PHTA 4LR7A 4DV5J 1DQ9A 2YPZA 4YY3J 2RU9A 4DV7F 3PO5A 5J1PA 4LF5F 2DNQA 2RS8A 1N6QA 2MQQA 2HHPA 1PAUB 5HP1B 3FFIB 2B4OA 3D0GE 1IR0A 3MI7X 3GSDA 2ZEJA 2B9XA 2AYMA 1U6BA 1F0XA 2HURA 1XQIA 4K8RA 1JQGA 1HBUA 1DTTB 4UZBA 1WKJA 1XK8A 1B4SA 2B0GA 2W9BB 1RWPB 2RUSA 1KQGB 2ASLA 1U02A 4PKDB 1RWXB 4IH5A 3Q8QB 2R7OA 4FNHA 2AT1B 3BBCA 2VBZA 2ZC3A 2DGTA 3GB0A 2IVMA 2Y1IA 3PR4A 2HZCA 5DG9A 2BABA 4USJC 2KG0A 2ZH8A 3T6JA 4ECSA 2DCUB 3CCTA 4UOCA 4OHXA 3TA0A 3V81A 4FZVA 1EETA 5J2MA 1R0BG 1AUDA 4LUBA 2V69A 4NXMF 2UUAJ 1CJTA 2BJ7A 2FHOB 4ZP6A 3HXMA 1Q7YT 2U1AA 3CE8A 4JI2J 1MLAA 3I4PA 5BXIA 2ZH2A 5F0UA 2CFXA 4A48A 4N8OA 3BPDA 4C0HA 4CZCA 3D6TB 3PJ9A 2G2YA 1RA7A 2IRXA 3QRRA 2KRBA 4RJVA 3I87A 4ECQA 1FDDA 4ZVSB 3PEJA 1C1CA 2GVDA 2KN4A 2HWTA 4RO0A 1NB2A 4JI5F 1UJ6A 3UDEA 1C4CA 4KAIA 1IBKF 4LF6J 2HZVA 3G82A 3CPWR 1N36J 2UVRA 4ZPWR 3UDLA 2XSJA 5HVFA 1V3ZA 3P5TL 1NK7A 4F3OA 2GAHC 3IP0A 2RQCA 5DETA 4JYAF 3D7SB 1HBMA 2LYVA 2HNZB 4OHZA 5A76A 1KR4A 1DZ5A 1JIHA 3JYTA 4I2PB 1T8EA 3DLGB 1NXIA 2YVSA 4F4XA 3D6MB 2XGQA 1LWEB 3N28A 5KG7A 2GV1A 3HO1A 3BDPA 4MKBA 1U1KA 1FJGJ 4AE5A 4ZS6A 2GZOA 2DH9A 4BC7A 1LNQA 2Z2YB 2VBWA 2FLNA 1GH8A 4X66J 3OTCA 4DR5J 3DCAA 3AQPA 2LXUA 2BRLA 3O3LA 1T9XA 1TFWA 3D28A 2RRNA 4Q5VA 2WW8A 3PJWA 1URNA 4CWBA 4QYZJ 1FTCA 1F60B 5F3TA 2N3OA 1D3WA 1FFGB 2W9CB 3UD4P 4DS4A 4RLEA 4C0BA 2V4QA 3KJQB 4RNHA 4NEZA 1VISA 4MH8A 4Z37A 3LPYA 3KNAA 1TV6A 4IRDA 2BJ9A 3R8YA 4OZ5A 1EKSA 3DOMA 1BQMA 3T41A 2VHGA 3TAMB 1TFYA 2HFVA 2BQRA 2CZ9A 3SV4A 3CCZA 3QQCD 2HEKA 3D68A 4JI1F 4W98A 4C97A 4MIBA 1RHMB 2CWXA 1V5VA 1PO6A 2YY3A 2I6WA 4F4KA 3PCOB 2E5HA 5F3ZA 3JB9k 4CLYA 1R8PA 3VGTA 1GTEA 1CQMA 3C8YA 4M5DB 1JJCB 2MZJA 4M5NA 3ELHA 5AXMA 2DNYA 4NPOA 1ULRA 1X0PA 3W9JA 2AYBA 2BX6A 1R3NA 4R0JA 1RT5A 1UFKA 3EGWB 3N9UC 5HVHA 4OHYA 2NXEA 4NLXA 1QSYA 2CPYA 3AJDA 3T5LA 5CXTA 5KFIA 5A8WA 3R27A 1GXLA 4BLGA 3G6VA 2ZVIA 1WOSA 2Z2LA 2GVZB 1HNWF 3VCDA 1HNIA 3QO9A 3OTOJ 4P52A 2CG4A 2V4RA 5F41A 4QIFA 5DLFA 2WW4A 3IR7B 2NXCA 2EPIA 4F0HA 4NA2A 4TN2A 1ZTWA 1D0EA 2D41A 2QO3A 2MQOA 3HVRA 3KMSA 2ZOGA 4Q2LA 1UPMB 1U0HB 2LCWA 2HFSA 1FNOA 3MEGB 5KG0A 3QT5A 4OYXA 3HP6A 2NXUA 3E51A 2IYIA 4I7FA 2V8HA 4KBIA 1VRUA 7FDRA 2E44A 2AGPA 3H2LA 1EB0A 5KFFA 3VHQA 3Q2TC 1EX8A 3SI8A 5DDPC 3T5JA 4UT4A 1R0CB 4IFYB 4WK3A 1Z2LA 2FJWA 2FVCA 2UXDJ 5E0OA 4RWXA 1XMOJ 3HFKA 4FYYB 3S01A 4YY3F 2QN6B 2CVEA 1YGYA 4PG4A 2HHHF 4EO6A 4WFXA 4BCAA 3VAKA 3ICLA 1UVJA 1R8AA 2DY9A 3B8HA 1DY3A 2HFNA 3X3UA 4P2XA 4WE1B 1OSDA 4RU9A 4FN5A 5HL7Q 5IT9Y 2FIUA 3SQGA 1GXUA 3GR0A 5CCMA 1Q4RA 1GTHA 3IWXA 3TZWA 1KRPA 3QLHB 2E5JA 4ZJLA 4F8RA 3LP2B 1ZAWA 5HMYA 2F1FA 3PW7A 1S0NA 3K58A 5IQ6A 4MTPA 4DOZA 4DV1F 1AFJA 1N5TA 3BSOA 4J9QA 2DRBA 3SFGA 4HHHA 2OEMA 2A3JA 4ALZA 1A0OB 2CQIA 5C25A 1SKSA 4P10A 2Y8YA 4DUZJ 1LW0A 2HW3A 1FKOA 2MKYA 4X4UA 3BH6B 5CZXA 5HQLA 2HLTA 3JSYA 1WUUA 2UUAF 2DNRA 1W26A 2DHXA 1NKBA 2CPDA 1RK8A 4JI2F 2I9SA 3NGKA 1WG4A 3GE9A 1XIQA 3D0IE 2E5LJ 3PIOQ 3MMJA 4LSNA 4P2MA 1UETA 4C98A 1SJ1A 1KC8T 2GAGC 1RA6A 4IR1A 4F3MA 1NK5A 2Q3PA 1D8ZA 2RB7A 4TU8A 2DIUA 4V1Ak 3MM8A 5I4MA 1N5YB 4LFAJ 1IJEB 3DFEA 2H3EB 4USMA 2N7YA 4L75A 1Q16B 4XK8C 1YJ7A 4KGXB 1Y11A 4USKA 4LF6F 5JUMA 4O44A 2A10A 1N36F 2OMOA 4O3PA 4QR2A 3E2EA 2OFGX 4PG6A 1XEZA 4B3OA 3AXMA 2KM8C 1FRHA 1YHQS 3T9ZA 4EI2A 1M90T 4ZLNA 1VC5A 4NCGB 1M1KT 2CKWA 4Q0BA 4C8MA 3PX6A 4OQJA 3KLFB 1LKZA 4DR3J 1X5PA 1CC7A 2GIQA 3PVXA 2IVFB 1Q79A 2MGZB 1F1BB 5KG2A 4X4VA 2UVUA 3TUZC 4LR8A 1FRIA 5DO2A 2J0SD 3H5UA 2P9CA 1FJGF 1DHMA 3UCZP 2RNEA 3DI6A 1XMBA 3K89A 3MEEA 1TKTB 4RW8B 2H9ZA 4Q43A 3CCUS 4X66F 4A46A 4WJBA 3P96A 2BE7D 3LF0A 3VV2B 1Y9OA 5E3RA 1RT4B 2DH7A 2XSFA 2ZJQQ 3UPFA 1WC3A 2OD6A 4QWEA 2QV6A 2B9YA 5DM7Q 4OI4A 3CW2C 1AT1B 2DR6A 3M6UA 2FYXA 2HWIA 3J7A1 1JKHA 4PABA 2MQPA 1Q5VA 2W4DA 2HG4A 4DL7A 1T95A 4PWWA 4F4YA 4LFBJ 1U26A 3ZNUA 2JDJA 4QCLA 2DH8A 1RAFB 1HD0A 4HHJA 1SV5B 2Z8QA 4CP5A 4B3MJ 3SEOA 3MR3A 1V3SA 5ETVA 2LDIA 2MQLA 4LIRA 1UFLA 4HT5A 3QMQA 2J8AA 4F0KA 1BLUA 1FI4A 4RW4A 2BE2A 2XNQA 1QY7A 3MR5A 3J7YU 3FZ2A 1NMEB 1OY9A 5K14B 3QBCA 4ILLA 2H4WB 1Y5IB 3W60A 4Q8FA 3BGRA 2HBQB 1E6VA 1DQAA 3DMJA 2N4DA 1VRTA 2QMWA 2LXFA 4CYUA 4Y2IA 1S9EA 4DLEA 2DR7A 4C3LA 3OLBA 2Z58B 3V6DA 2QLXA 2LKZA 4A8OA 1N8RT 1RTDA 2HVDA 3I31A 2FLPA 3KLHB 3OXFA 1QE1B 3CULA 4FDFA 3N0VA 1RT1A 1SCJB 2HNYB 2YBVA 3OTOF 2PI4A 2R2SA 2R7WA 2BOPA 4HVZA 5LJ5Y 2CQDA 3PX4A 3N79A 4DMZA 3KJFB 3OD2A 2MZRA 2E7XA 3HJFA 4U9RA 3TUJC 5HMXA 5GAGU 1FNMA 3MMAA 1VBYA 4WK1A 2QYGA 1X31C 2QA2A 2CQCA 4IFVB 4K2XA 4K4TA 1S9FA 2BJ8A 4OYBA 3D54A 1RT6B 1PAEX 3UR0A 4KH1B 5F8MA 1JMTA 2CPHA 1YJNS 5C2CA 4ED5A 4KHMA 2GIFA 1ZM2A 3SFUA 2L41A 2P2CB 3RGIA 2DXEA 4GKKJ 2M8DB 5DDQC 3TA2A 2UXDF 4K59A 5EGYA 4J9RA 4TY8B 1YK9A 5FLXY 1TKZB 2VG5B 1XMOF 4KRWA 2KFZA 3FUYA 5DGAA 4X4PA 1IUJA 4WP9A 1SC4B 3K0JA 4WF9Q 2RRBA 2C3OA 1RAIB 2RUGA 2EG2A 3M2VA 2CVIA 4DSFA 1CULA 2XNRA 4MT1A 4DL2A 1GXTA 2GO8A 2W2MP 2HFZA 2GIRA 2DNZA 1NKCA 5CCLA 1HQUA 3DRRB 2AW0A 3U02A 4IQMA 3UCUP 3FMWA 3D67A 2BKOA 4FF2A 1FKPA 3OXLA 2ACYA 1GMVA 2OHDA 4HDHA 3PY8A 3LGNA 1IVZA 1RBOB 1TUGB 3FSXA 4DX8H 1RZMA 4CLWA 2GFFA 4RL1A 3BN4A 1GT8A 4OYMA 4I1TA 4GKJJ 3MM9B 3M2RA 4AL7A 2LQ9A 3EGNA 4QIEA 3I5BA 2VIHA 3FK4A 2ASYA 1FNXH 1JNRB 1OJ4A 4MAKA 4NE9C 1RLDA 1KONA 3CMES 4H4MA 4J91A 2E5LF 2R4FA 3HKWA 4KKOA 1TL7B 3QGIA 2OLWA 1SJFA 1BC6A 4UZCA 2IRUA 5L9XA 5J2PA 4OZ3A 2OPRB 2RIJA 4X62J 4FYWB 2XLJA 4DPWA 5IV4A 1CJUB 3BM7A 1RQ0A 4LFAF 2CQGA 3C16B 4C2MA 1LFWA 3PHEA 3W63A 4Q2MA 3Q24A 3RAXA 1LWFA 1S6PA 3WX4A 5GMDA 5G4DA 3Q8RB 1TKXA 4NLWA 1H2UX 1NSKL 1DAXA 1RT2B 2QA1A 3OVBA 2KFYA 2XGPA 3MR7A 3FDSA 2QFIA 3DGPB 2VOPA 4DR3F 3IM8A 1VGYA 1MU2B 2BJ1A 3UVJB 1O0PA 1FE4A 2N82B 1U0SA 2AX0A 1RTHB 1RBLA 4NZ6A 4JI8J 1WHXA 5F9LA 3UDCA 2HBZB 4IH7A 4IR9A 3HX9A 1TTHB 5HN0A 5IS2A 2LA4A 4DPUA 4B9TA 3KKFA 3SBMA 2AZ3A 3ZZPA 2B8QA 4NASA 4DFKA 2JLFA 2HMIA 4WTYA 3QFHA 4O3OA 1TL5A 4G1QA 3OXGA 1B70B 4ED6A 5KFBA 3NNHA 1NDLA 1FWPA 2LFVA 3BQ1A 1SQEA 2ZJPQ 5FJ4A 1FFSB 4LSLB 4LFBF 1WORA 1RTIA 1RXOB 1U49A 2H4YB 1T9VA 2XMAA 3D9BA 1QVGR 3A8IA 1O8BA 4B3MF 2C2EA 4WCEQ 1X5OA 2JVOA 4L76A 1HLWA 1VQ5S 4DV2F 3K8VA 5D4PA 4CTAB 3Q2SC 2Z56B 1N48A 2I5JA 3BYPA 2RKIB 1BGXT 3HM9A 2EBGA 1ICEB 1QLNA 1I1GA 3CIMA 3ZTQA 4F02A 2YQ1A 4AQYF 3CJKA 2ILYA 4M5JA 5CQGA 2A2DA 5CD4A 3OL6A 2VICA 2CPXA 2HAFA 1NBEB 1M5VC 5A6WA 4I6YA 1NJXA 4IUFA 3BQ2A 2RQKA 2O66A 3UN5A 1B0PA 4RR5A 5I3QA 3RRHA 4I56A 3TJAA 3FVYA 4TY9A 2QSFA 4CLTA 1MG7A 2XS5A 2BQ3A 1WC6A 1PCAA 2J6TA 2M70A 1OPIA 2HS3A 3UW1A 2J6SA 4C48A 4I0WA 1T3OA 4OI0A 1KQSR 2D69A 3ILLA 2BVZA 2M7SA 1PG5B 4NCAA 2APOA 2Q6BA 1S1TA 1EJ7L 4GVBA 2NCKL 4N8NA 5E33A 3I55S 4PPDA 3MURP 1KLMA 2XHWA 3KUHA 3OT9A 4UUWA 3VAMA 5KG6A 2WVEA 4P72A 1HMVB 2RDJA 1T03A 5HLFB 3NMAA 2O1PA 4A8YA 1SQGA 2KJVA 2XYPB 1IKWA 2QYCA 4ID5A 4RUAA 2HHXA 4OMFG 2O3DA 5A2QY 4ES2A 2QGFB 2MB0B 2NSCA 4MIAA 4WPAA 3LOUA 3WDOA 4GKKF 3JAMU 4ZN1A 4DCPB 1QD1A 4YDDB 2FJEB 2YNIB 4OJ3A 2BANB 3MPYA 3W65A 5CD4H 5FDLB 3DU5A 1HHQA 2VFVA 1HQEB 3NRBA 4ZVGA 2PSZA 3FFIA 3NAIA 3UD3P 1RWMB 3PW0A 2C3PA 2E7WA 4JI0J 1NK4A 4DR6J 1HNVA 2ZD1B 2BM0A 5H9EJ 2DRAA 2FVSA 1PBAA 1R6VA 3A8JA 1L5UA 1DTTA 5KG4A 2W9BA 3RBXA 1L3UA 2PMWA 3K2YA 1S7IA 4KIAA 2WONB 1O51A 4F4ZA 3QAUA 3H8YA 2YQ0A 1NH8A 2XS2A 3UQSA 1BY9A 1JJ2R 3Q89A 1U1MA 3AAWB 1TL3B 1HW9A 4RX6A 4XAKA 1LFPA 4OLOA 1OY8A 3PZPA 4DCOB 9RUBA 2UV8A 1U2FA 1VQKS 1VQ9S 2HPUA 2CJQA 1TL4A 4P75A 5EWFA 3M30B 1ZPVA 2XTJP 1UPPA 1WDTA 2XHCA 3K57A 3MUTP 2JEIA 2DITA 2G4BA 3HK2A 1S1XB 2MDAA 1RACB 1JLAB 2OI2A 4EZ9A 3CEDA 1G3OA 4DL3A 2K1RB 1S0OA 3M2UA 4Z7CA 1QM9A 3OJUA 4C8NA 4DSEA 1QSSA 1HWLA 1KEKA 2HSEB 3M8PB 2PA8D 3GV8B 4MYUA 4X4RA 2A0FB 5KFHA 5KFXA 3F73A 4KR0B 2P9GA 3K5LA 2W25A 3GCXP 5J2QB 2HNZA 3W1YC 3HHLD 3Q22A 1PYSB 4I2PA 1R7IA 3A4TA 2ZKUA 2R7RA 1SH3A 3DLGA 1RYRA 3CJSA 3AQOA 4Y6IA 4CO4A 1LWEA 1TUVA 2RQMA 1YX2A 2CQPA 4DUYJ 2DKOB 3CJRA 4DX7A 1VQ6S 2D7SA 4JI8F 1JLCA 3TJ9A 4RU2A 2CA9A 1Q53A 4Y3CA 4DV0F 3N4WA 3ZZUA 4EK2A 4C8YA 2QJ3A 2BV3A 4HDGA 2FC8A 3LAMA 4F67A 2R8JA 4KQZA 4DI6A 2NZ4A 4IO1A 2GO9A 3NOCA 1T9WA 3CJ2A 3ZZTA 3DRPB 4PXBA 2C2ZB 1TMMA
chains in the Genus database with same CATH topology
2IDEA 4PYDA 3JQJA 4FDFA 2EEYA 3JQMA 2IIHA 3JQKA 2OHDA 4PYAA 1EKRA 2EKNA 1EKSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IDE A;  4PYD A;  3JQJ A;  4FDF A;  2EEY A;  3JQM A;  2IIH A;  3JQK A;  2OHD A;  4PYA A;  1EKR A;  2EKN A;  1EKS A; 
#chains in the Genus database with same CATH topology
 3U1M A;  1LK7 A;  3CC2 S;  4LF8 J;  4J9M A;  2BZ2 A;  1TK5 A;  1PKU A;  3OFH A;  1HIY A;  2B51 A;  2W9C A;  2XO7 A;  2O01 C;  5IT4 A;  2AKW B;  4ZVO B;  2CQB A;  1KWM A;  4WFZ A;  1S12 A;  2G2O A;  3PYD A;  2UXC J;  1KHW A;  2MPU A;  3DC2 A;  2RIL A;  3EM1 A;  3TAM A;  4JBC A;  2LXI A;  1UWB B;  3DDI A;  3MHY A;  3IBC B;  4K0K J;  1KKH A;  4RNF A;  2BW7 A;  1N5S A;  5D0H A;  2YKA A;  1T9T A;  1VS3 A;  2G13 A;  4KHP J;  5AXK A;  1WI8 A;  2WVD A;  1NM2 A;  3UWT A;  1Y10 A;  2DEI A;  2CQ2 A;  3R9L A;  1KNZ A;  4PQU A;  2KT5 A;  4J7C A;  4M5D A;  3QSY B;  1FES A;  1WG5 A;  1NSP A;  1U1O A;  3VAI A;  1TR0 A;  4U7U D;  2GQC A;  2ZFH A;  3V6K A;  4C8K A;  4C11 A;  4M5H A;  4IQX A;  1RHR B;  4URS A;  3W3S A;  5CZV A;  3SQO P;  3WIV A;  4CLF A;  3MOZ A;  5KFV A;  2QLF B;  1RCX B;  3M8Y A;  4OFZ A;  3AB2 B;  3BO2 A;  1L3V A;  1QAY A;  1WSR A;  3W66 A;  5D4O A;  2RRA A;  1RIS A;  2W4P A;  1NEE A;  4P6Q A;  2GVZ A;  4J9N A;  5H9E K;  2W2P P;  4OZN A;  4G3I A;  3N6N A;  2AX1 A;  3VAH A;  3MUV P;  1Q82 T;  1VJW A;  2Y1R I;  3GZ7 A;  4C7Q A;  4PYD A;  3P6Y C;  2YNF B;  3J7A N;  2CJX B;  3Q23 A;  2DIS A;  2NYI A;  4LRD A;  5GAG I;  1U0H A;  1IM4 A;  3MEG A;  1RKI A;  3RTV A;  1M5S A;  4UST A;  1UJ4 A;  3R5C A;  2RVJ A;  5C24 B;  4NOH A;  4DU7 A;  5I42 B;  1B99 A;  1U2C A;  4DPX A;  2A2C A;  2E9Z A;  3GIL A;  3AH6 A;  1XNR J;  2QLJ B;  4N56 A;  2HQD A;  3V6J A;  1U2R A;  3QRQ A;  1VHI A;  2P8I A;  4IFY A;  2H1Y A;  2LEB A;  2QTW A;  3TUP A;  3D4J A;  4KY3 A;  3RB3 A;  1RT3 B;  2RAQ A;  3PIP Q;  4RW7 B;  3HHK A;  4ZPV R;  3GP9 A;  3OFF A;  4C9D A;  3EVM A;  4AL5 A;  4U7U K;  2E1M C;  4QW9 A;  3HHD A;  3BN7 A;  2JC1 A;  1TMJ A;  2YWK A;  3Q86 A;  3WC0 A;  3W5Y A;  4WE1 A;  2CYY A;  1OIA A;  2GHW A;  3SMZ A;  1SJQ A;  2JFD A;  4NEY A;  4ZLP A;  4DR6 F;  3KOA A;  2IHR 1;  1WC0 A;  3QLH A;  1A7G E;  3LP2 A;  3B4M A;  4OX6 A;  1UP1 A;  3PAC A;  2X1A A;  2Y0S D;  1HAR A;  4IOC Q;  1R8H A;  1RT7 B;  3MED B;  1YJR A;  4ZJQ A;  3AD8 C;  1N5V A;  2FUG 9;  4P7V A;  2MKK A;  2C2M B;  4FS1 A;  2VH7 A;  4FBT A;  5LSO A;  4K2J A;  3CDU A;  2XZW A;  4K4U A;  3V6H A;  1JLF B;  2W4C A;  2EK6 A;  4ZP7 A;  2L48 A;  3HSG A;  3ITH B;  3H25 A;  1YBA A;  5CAA A;  5U47 A;  2Q66 A;  1LV5 A;  1J5O B;  5KG1 A;  3HZE A;  3BDE A;  4LF4 F;  5DQI A;  1A9N B;  5J1E B;  3FQK A;  3UCG A;  4DX5 A;  4UUX A;  3IWL A;  4ZVT B;  2V4J B;  4W90 B;  3OLA A;  1E6Y B;  2KZZ A;  1S10 A;  2MJN A;  2V8V A;  2P6S A;  3CSK A;  1H38 A;  2AMC B;  2EG1 A;  2MKH A;  1TVR B;  3DLK B;  1UJ5 A;  3PTW A;  2XMV A;  5JVH Q;  4B9S A;  1HPZ A;  4ZPT R;  5F8J A;  3K8W A;  5AT1 B;  4ZPA A;  4DQR A;  2MYF A;  2IM0 A;  5CAB A;  5H9F K;  5A8R A;  5GAD U;  3MR2 A;  1N5Y A;  5CA5 A;  3NCR A;  3H4B A;  4IO9 Q;  1RB0 A;  2GC8 A;  1R89 A;  3W64 A;  2ADC A;  4DXL A;  1FK9 A;  3PR5 B;  1VQ8 S;  2FZC B;  3HHN B;  3FCH A;  5IT0 A;  2QC3 A;  3HVW A;  2ZIT A;  1IXK A;  4ED8 A;  3LWL A;  1JLB A;  5KG3 A;  5KFZ A;  4OX9 J;  3M8Q B;  1FX2 A;  3MPD A;  2IA6 A;  2J76 E;  4LBH A;  5D15 A;  1XJW B;  4NCG A;  4AUK A;  2X3G A;  4RUH A;  2ZM6 J;  2YPY A;  3KLF A;  2GX8 A;  4ED2 A;  5RUB A;  1UKU A;  4YB6 A;  3DXS X;  3WIU A;  3OR1 A;  2MGZ A;  1HBN B;  2B7B B;  2IY5 B;  4P74 A;  2PFF B;  5LMU J;  4TQR A;  3KLI B;  4ED0 A;  2CPI A;  4M1K A;  4DUY F;  3RRK A;  4DUT A;  3FJ2 A;  3C15 B;  3PFE A;  3IA0 A;  5EX0 A;  4A8F A;  1F9H A;  3AOB A;  1N88 A;  4RW8 A;  3CXC R;  1H7W A;  3HHL C;  1FWL A;  4CO2 A;  2M88 A;  1FVQ A;  5BYR A;  2JEJ A;  4O3R A;  1RT4 A;  3M8Z A;  1KBR A;  3R5A A;  2K7K A;  4URQ U;  2DVI A;  4NZ0 A;  1S1U B;  1LWC B;  1UVN A;  3KHL A;  4YB1 P;  2FHM A;  3JTN A;  2KVI A;  1ZOT A;  2HWH A;  2DY1 A;  2C3M A;  4FKX A;  2COL A;  4LF8 F;  2A1B A;  1JX4 A;  3BO4 A;  5BJR A;  1RAG B;  1GMU A;  3DNC A;  1ZA1 B;  2MKS A;  1H74 A;  2V94 A;  2CPZ A;  2VG7 B;  5E41 A;  1S5Z A;  4PG8 A;  4ETZ A;  4OZJ A;  1SV5 A;  4IG3 B;  1PC5 A;  3FZB A;  4A8M P;  2UXC F;  4HAC A;  3PKY A;  4FXW A;  2WHO A;  4QZV B;  2IAJ A;  3QGH A;  2ZHB A;  4K0K F;  2DB1 A;  1OPZ A;  1U25 A;  1X4H A;  3V2U C;  1EAY C;  4KHP F;  1NPR A;  4TYB A;  2PA3 A;  1D9A A;  2QE5 A;  1D09 B;  1JLG A;  3CCS S;  5K14 A;  2VDH A;  4Y2K A;  1L3K A;  3NKY A;  2ALZ A;  4JI6 J;  5HQ8 A;  5L9N A;  3LH2 S;  1BE4 A;  2UUB J;  4ZPC A;  4XIU A;  1HNX F;  4ENO A;  1RWO B;  4ZIW A;  4WFA Q;  1K8A T;  3ZTS A;  2R8I A;  3AA9 A;  3TVY A;  3LGM A;  2F4V J;  1RHK B;  5F9N A;  3OL8 A;  2ABY A;  2Q6C A;  4H4O B;  4Y65 A;  3CD5 A;  1PSD A;  1WWH A;  4ECW A;  3KLH A;  3OFE A;  1QE1 A;  4FPI A;  1WOO A;  1NO8 A;  2HNY A;  1UZD A;  5CH7 B;  4OL8 A;  4K50 A;  2MJU A;  1UW9 A;  4KGM A;  5JJB A;  1EP4 A;  2L3M A;  4KB7 A;  4TQS A;  4MIW A;  3OL9 A;  3SCJ E;  4JB8 B;  2DGQ A;  4DV4 J;  2YWE A;  1HL6 A;  1XMQ F;  4PZV A;  3H0P A;  4WYW A;  1SC6 A;  2XQC A;  3NNC A;  2X3D A;  2UUT A;  1XNR F;  4NLV A;  3EZO A;  1VQP S;  4K4S A;  1NH7 A;  4WKR A;  3BSA A;  3IXQ A;  4LVO P;  5F8N A;  5DDO C;  3VF0 B;  3MMB B;  4CT9 A;  2MQN A;  2H54 B;  4CIO A;  4TY8 A;  2ZE2 B;  2RJZ A;  2Z2M A;  1TKZ A;  2IVY A;  2VG5 A;  2YWH A;  3HD2 A;  1HI0 P;  3DOL B;  1DLO B;  1RSC A;  3PDN A;  1UWA A;  4DPT A;  1FE0 A;  3DN9 A;  4O3S A;  2ZH7 A;  3C2P A;  7AT1 B;  1YWX A;  4Y2M A;  2CDR B;  3D6H B;  2Z30 B;  4LSZ B;  3PX0 A;  1KQF B;  4PR6 A;  5D4N A;  5K8N A;  2E7V A;  5J1N A;  1S57 A;  4KFB A;  2DHH A;  3DOK B;  1RYS A;  3ZFV A;  2BYC A;  2CQ3 A;  3DRR A;  2V0N A;  2KT3 A;  4CH0 S;  1X7V A;  1X4C A;  1SH0 A;  2EFP A;  3V81 B;  5D3G A;  4J9O A;  1TAU A;  1RU2 A;  3QNW B;  2HHS A;  2DR5 A;  1CJT B;  3MF5 A;  5L46 A;  4FS2 A;  1RAD B;  5HMW A;  1PBU A;  3W8P A;  2P5V A;  5KT6 A;  2VQE J;  3NBP A;  2WBR A;  4V19 X;  4OJ1 A;  3IS9 B;  3MM9 A;  4K4W A;  1KSP A;  4ZA1 A;  4KPY A;  1BWV A;  2ALY B;  3CDB A;  4NLT A;  4ILM A;  2YKM B;  2M52 A;  1KDN A;  2IIH A;  2LA6 A;  1LXJ A;  2E66 A;  3CVK A;  4NL5 A;  2Z4P A;  3I9V 9;  1X4A A;  4CLL A;  3T5K A;  2DK2 A;  3SIP B;  5EX3 A;  3KK2 B;  2GVD B;  2UVW A;  3HVT B;  1BUX A;  1C0U B;  1H0H B;  4AT1 B;  1S1W A;  2JNJ A;  2X51 A;  2ZUG A;  3E8O A;  1ZPW X;  2XSJ B;  2OPR A;  5M2P A;  3DRS B;  2IBK A;  1WHW A;  4X2B A;  2F9D A;  2NUU G;  3ZTR A;  1SUQ B;  4I6A A;  4EFA C;  5KT2 A;  2XLI A;  3IN5 A;  3C16 A;  1HBM B;  3OV7 A;  3EGZ A;  2VBX A;  2BEF A;  3C14 A;  4ZLJ A;  2R3V A;  1JK9 B;  1WDD A;  2IJF A;  1SB6 A;  2OTJ S;  4DR2 J;  2MMY A;  1YJ9 S;  2KJW A;  3G96 A;  1KHV A;  2LVW A;  5KFN A;  4E0D A;  2DNH A;  3OBI A;  2F7V A;  2KTQ A;  3DGP A;  4RBU A;  2ZJR Q;  2B6A B;  3NS5 A;  2ZM6 F;  3CB4 A;  2CAD A;  1OSC A;  3WC2 A;  1WG1 A;  4DSK A;  2MST A;  4K4X A;  5ETM A;  1B7Y B;  1RTH A;  3KYL A;  1VQN S;  5LMU F;  4IRC A;  2J9E A;  2VOO A;  3CJQ A;  4ECV A;  1JLQ A;  1Y3J A;  1UFW A;  2OEL A;  3KMQ A;  1UTA A;  3FBB A;  1RUS A;  1AFI A;  2VU5 A;  4ZVP B;  1PC4 A;  3AOD A;  4ECZ A;  4YP3 A;  3RR7 A;  1TV6 B;  2VBY A;  1FEE A;  2V9K A;  5D78 A;  4NZ7 A;  1HQ2 A;  2IBO A;  3ZZY A;  2CZ4 A;  2GNK A;  2Q43 A;  3BGF A;  3S8S A;  1VQO S;  2YNH A;  1GMW A;  2NYH A;  1FD8 A;  1S4E A;  4LSL A;  5LXY A;  2OH2 A;  2FD2 A;  3AA8 A;  1U1Q A;  4DR4 J;  2XZD B;  2OP5 A;  1SL0 A;  4KC5 A;  2Z57 B;  3RW6 A;  1VOM A;  4M5L A;  2YQ3 A;  2FPH X;  1AB8 A;  3D6F B;  3M8R A;  5KFM A;  4CLZ A;  1U48 A;  1FER A;  3L9Z A;  4CTA A;  2V2K A;  1FRX A;  3KWM A;  4PEO A;  2RKI A;  3R97 A;  4F4W A;  5KTQ A;  2NQP A;  3QAT A;  2QL9 B;  2LEA A;  3FCW A;  2XY6 A;  3FBE A;  3BO3 A;  5DZ6 A;  2BDP A;  3R7S B;  2FVP A;  2MY7 A;  4QR0 A;  3POT B;  1QVF R;  4Z2X A;  3GPA A;  5JXS A;  2HHH J;  1OYD A;  4JI6 F;  2D1C A;  2CJB A;  3NWG A;  1DTQ A;  5HJX A;  1G7C B;  5CYQ A;  5LSR A;  2UUB F;  4TLR A;  1EKR A;  2CPJ A;  1HI8 A;  3B82 A;  2NPF A;  1T9Y A;  1R27 B;  2ZBP A;  1P6T A;  2E9R X;  2GJF A;  3SSR A;  4JV0 A;  3O44 A;  3MPW A;  2VB6 A;  2F4V F;  5LM7 E;  2PC6 A;  5IM0 B;  4FF3 A;  5E3P A;  3R5G A;  4MKA A;  1FWK A;  5K8M A;  2AEM A;  1NJW A;  2ILZ A;  3M1V B;  4DV1 J;  2QT7 A;  3UR3 C;  1YJT A;  3E3X A;  3QZ7 A;  2YX1 A;  5ADZ A;  2CNK B;  3BQ0 A;  2VC0 A;  4KV8 A;  3KLG B;  3MFH A;  2WZ1 A;  2FHK A;  2MZS A;  1QAX A;  2V6A A;  1YIT S;  4I7F B;  3C3L A;  1TKD A;  2CRL A;  2YNG A;  1AA1 B;  4CQ1 A;  2F4F A;  1EHW A;  2AJ4 A;  1C2P A;  2BW2 A;  4ICL B;  5HLF A;  4ANE A;  3HHE A;  1C4A A;  2XMT A;  2YKN B;  4P2S A;  3QSI A;  2ZUA A;  4Q44 A;  4DV4 F;  1R31 A;  3BRE A;  2B5J A;  3QIP B;  1Q7L B;  1IN0 A;  3K5P A;  3CC7 S;  1KFD A;  3MAA B;  5LMN F;  4O4R A;  5L1L A;  1FX4 A;  3ENA A;  2CQ1 A;  4NLQ A;  3L4B C;  3SYZ A;  4GO5 X;  4I68 A;  2VZ9 A;  1Q8B A;  4WFN Q;  4OZL A;  1RAJ A;  3TJ8 A;  3EX7 B;  3KLV A;  1RJJ A;  2YNI A;  1BWE A;  1NSA A;  4LRC A;  3QGG A;  1U1P A;  2RSQ A;  1N34 J;  5HI7 A;  1FHT A;  5FDL A;  1K1S A;  2BAC A;  2MY8 A;  3OR2 B;  1HQE A;  4A8Q A;  4DEZ A;  1WC4 A;  4OV6 A;  3BSN A;  4A8W A;  1FRL A;  4FKY A;  2RF2 B;  1QUP A;  2ZD1 A;  4PAA A;  3ZC4 A;  2VPW B;  4PPZ A;  4WYL A;  3RAQ A;  3EUN A;  4I2Q A;  3J81 Y;  2C2K B;  3DRY A;  3VGV A;  4DX6 A;  5B0B A;  2WON A;  4FVM A;  2UZA A;  2KHC A;  2DHS A;  3DLE B;  3AHP A;  3NL0 A;  2LQ8 A;  1CQN A;  1TL3 A;  4RNN A;  2XUL A;  2VQE F;  5A6P A;  2EKY A;  2Q1L A;  1BQN B;  2MXY A;  3VAL A;  4OLP A;  1KOH A;  2D9O A;  1B64 A;  2DYA A;  1U09 A;  1HR0 J;  4KGK A;  3PW4 A;  3M30 A;  2BJD A;  3O6Q A;  1N5Q A;  3SCK E;  2L08 A;  3EXY A;  3ZZ0 A;  4E98 A;  3R6L B;  1S1X A;  2VQF J;  2GMJ A;  1RHQ B;  4NRT A;  1JLA A;  4DBQ A;  5DZ7 A;  3FGV A;  4JP8 A;  4A8S A;  3DHX A;  4O4G B;  2B43 A;  4ZKA A;  2HRT A;  2ZH9 A;  2G1H A;  1SC3 B;  5HBM A;  5GAD I;  2OEJ A;  1RU1 A;  2K1R A;  4B3O B;  4JV1 A;  2EW9 A;  4DSI A;  1S1V B;  3ISN D;  2YWG A;  2VV5 A;  3BZQ A;  1Q8L A;  2FVR A;  2RE1 A;  3T1A A;  4HH0 A;  4J9K A;  4NA1 A;  1LW2 B;  3M8P A;  1KS2 A;  4EWT A;  1OWX A;  2C42 A;  2B4P A;  3A8K A;  4X4S A;  3PYE A;  5ETK A;  3GIK A;  3TVZ A;  4OYZ A;  4QPX A;  1G6B A;  4GO7 X;  4DR2 F;  4KTQ A;  5J2Q A;  4FYD A;  3ETM A;  2XMJ A;  1SL2 A;  3GG1 A;  4X84 A;  1X9W A;  2HHV A;  1QAI A;  3DYA B;  3DHW C;  2ZH5 A;  3EMT A;  2I2Y A;  2HVZ A;  1OO0 B;  2FTR A;  4LBI A;  3AY0 A;  2OO4 A;  3ILI A;  3T1H J;  3MM7 B;  2N4C A;  1HI1 A;  2FQQ B;  1WD6 A;  1KOO A;  3X1L B;  3D1H A;  5HK4 A;  2OTL S;  2ZBC A;  2AYE A;  1PIL A;  1H72 C;  2FGO A;  2IMO A;  4CH1 A;  2OML A;  2NR0 A;  3SDE B;  3M4X A;  2D74 B;  1N52 B;  3V4M A;  2OUG A;  5J2N B;  1HKA A;  4NI2 B;  4KJI A;  1YJV A;  1AYE A;  1IBM J;  4DWI A;  3DRP A;  2CPE A;  4WXW A;  4AL6 A;  4CT8 A;  3MPU B;  4LF1 A;  1XWL A;  3QWP A;  4LIW A;  5DM6 Q;  1CLF A;  5DQG A;  3AXK A;  2IA0 A;  2CJA A;  4NLU A;  2DIV A;  3MM6 A;  5KFK A;  3H2V E;  3ZZR A;  3H40 A;  3EPG A;  4UOF A;  2KXF A;  5GME A;  4YFU A;  3G9C A;  3GFY A;  1FXL A;  4K5R A;  2BE2 B;  4DR4 F;  3G6E S;  1DJ0 A;  3LAK A;  3EDQ B;  1PYT A;  4QWB A;  4HH1 A;  5ETL A;  3DKD A;  1UWB A;  2MZT A;  2CZV C;  4JI3 J;  4CI0 B;  2JX2 A;  5EHH A;  3CUN A;  3W5Z A;  4CM2 A;  5ETP A;  1NAQ A;  4LFC J;  5IOL A;  3W61 A;  2LQJ A;  1CEZ A;  2AYG A;  1Y00 A;  3T6B A;  3TUI C;  2QLW A;  3NCP A;  5FD1 A;  4DU8 A;  5ITH A;  2VUG A;  1MMN A;  1GAO A;  4GC7 A;  3PFO A;  1YLX A;  4FYV B;  5DRK A;  2XEX A;  2FHJ A;  4NLY A;  3W2V B;  2D3U A;  4Y2A A;  1RT1 B;  4XDC A;  2JHE A;  1RAH B;  2GHP A;  2HRY A;  1SPB P;  4KT0 C;  3V4I A;  1W7W A;  1YRT A;  5CYJ A;  5B09 A;  2CQH A;  2VD3 A;  3KLE B;  1M5P C;  4L6V 3;  2I0X A;  2ZHO A;  1I3O B;  3ZZZ A;  1VR6 A;  3HLU A;  3L09 A;  4LRE A;  2XMK A;  6AT1 B;  2WSC C;  5E7O B;  1NUE A;  1UW4 A;  1FJ7 A;  3U1N A;  4ED7 A;  1Q1K A;  2UVV A;  4OIX A;  2YNF A;  1VLO A;  3B78 A;  3PJX A;  5CYM B;  2VJU A;  4ID8 A;  4CO3 A;  3J80 Y;  3GJR B;  3VVT A;  4A8X A;  2MLZ A;  2CPF A;  4B9N A;  5I42 A;  1WEL A;  1FKA F;  1RWU A;  4UTG A;  2V63 A;  1N56 A;  4OI2 A;  4DHV A;  3L95 X;  2KXN B;  4QIG A;  4KO0 B;  4F4A A;  4F2R A;  3HZG A;  2J7U A;  4QYZ K;  4ZN3 A;  2DCL A;  1RT3 A;  3TZZ A;  2XG8 A;  3M32 A;  1TL1 B;  2PD1 A;  3QJJ A;  3GMG A;  3O8W A;  3VGS A;  3U7J A;  4RW7 A;  1WJ9 A;  2HGL A;  3OJS A;  5E5N A;  2OJ3 A;  5GAH U;  2W2Q P;  3HVA A;  1N34 F;  2ZC4 A;  5KFG A;  2V2V A;  1ZM3 A;  3PKM A;  1S0M A;  3PYF A;  2FY8 A;  3A3P B;  1B7F A;  1AZS B;  2DXF A;  2XS7 A;  4MK9 A;  4USU A;  3BKF A;  3KJV B;  4MFB B;  4UQT A;  1YBT A;  4A47 A;  2DPJ A;  2K3I A;  1Y3K A;  2WBM A;  1S4F A;  1L3S A;  1X8D A;  1WEY A;  4AXJ A;  2KXH A;  3MED A;  3AOC A;  4NRU A;  3KHR A;  1RAB B;  3GIM A;  1JLF A;  2WAQ D;  4PRF A;  3AT1 B;  3DLL Q;  3ITH A;  1RAO A;  2W8K A;  5HQM A;  1J5O A;  3GII A;  2QL7 B;  2AQ4 A;  1CS4 B;  5J1E A;  1RP5 A;  3HD1 A;  1NDP A;  2V4J A;  3DGV A;  1HR0 F;  1OQ3 A;  3FEZ A;  3DXB A;  2KFN A;  3R3T A;  1E6Y A;  5J2P B;  1GK8 A;  4FNI A;  5AE2 A;  2ZNY A;  1JB0 C;  4AFF A;  5IWA J;  1TVR A;  3DLK A;  3GLJ A;  3UN3 A;  1HBO A;  2N7C A;  3EYZ A;  3CC4 S;  3ET6 B;  2VQF F;  5D77 A;  2KRR A;  2XMM A;  2DNL A;  1WOP A;  5KFD A;  2ZWO A;  1FA0 A;  3G87 A;  1QSL A;  3HSZ A;  4ZCK A;  3R1L A;  2Y0B B;  2B8P A;  2JVR A;  2OD4 A;  3FCV A;  2KVQ E;  1T05 B;  1H3D A;  4DV2 J;  2J0W A;  3R1H A;  5B7W A;  2G0C A;  1M5H A;  3MUM P;  3ONQ A;  1HFE L;  1WF0 A;  3M8Q A;  3CJ8 A;  2M5Y A;  5EWE A;  2WVB A;  4F04 B;  2NZC A;  1VBX A;  4AQY J;  4TXS A;  1SJ3 P;  2XO6 A;  4JI7 J;  2WOM B;  3ISN C;  4PYA A;  3W2W B;  2VPZ B;  4DLG A;  4R8U B;  4B9U A;  1FRK A;  4DV6 F;  1TK0 A;  1HBN A;  1S99 A;  2GW8 A;  4F3Q A;  4USH A;  5KT7 A;  2F8E X;  4CH7 A;  1HW8 A;  3T1H F;  3KLI A;  3IRX B;  1Y5N B;  1Y0H A;  1SIW B;  3C15 A;  5JVG Q;  1IJF B;  1QUV A;  1NJY A;  1DBD A;  1U47 A;  5IFM A;  4USV A;  2C3U A;  4B3S J;  3VZH A;  3BH7 B;  4YR2 A;  1F9E B;  1SJR A;  2JOQ A;  2JJ4 D;  3UNG C;  3EIC A;  2DT9 A;  3MPV A;  1S1U A;  2POK A;  3NG8 A;  1W25 A;  4G1I A;  2VKZ G;  1IBM F;  5C7P A;  2GMH A;  5IC6 B;  2PMH A;  1RTI B;  4AYB D;  2KHD A;  2ZOM A;  1FRM A;  2QFJ A;  1D1U A;  3FBC A;  3C46 A;  1SXL A;  1TEL A;  2ZHA A;  1TP7 A;  2OKQ A;  2I5J B;  2VG7 A;  1VQY A;  2CNL B;  4ZP9 A;  1YRX A;  1YVF A;  4FVC A;  1WSV A;  2D9P A;  3MM5 B;  4IOA Q;  1BXN A;  3B54 A;  2VOD A;  4TU7 A;  3VQT A;  4TYA A;  1RI7 A;  3Q8U A;  1XR7 A;  4JI3 F;  5GAE I;  4OJG A;  2M8H A;  4NXN J;  3IBW A;  5IT9 U;  2HIY A;  3OSP A;  4LFC F;  4DL4 A;  1R8C A;  1X4E A;  3VTI A;  2HRU A;  4LR9 A;  3G6Y A;  3MGJ A;  2QA4 S;  4NLS A;  1V3R A;  2XCA A;  2JWN A;  4XPE A;  1VIX A;  3EZ5 A;  1APS A;  3QJP A;  3DU6 A;  2AGQ A;  1FXR A;  5F8I A;  2ZNZ A;  1J5E F;  1HHT P;  1PJ5 A;  2HQF A;  2WRM A;  2VFU A;  5KFT A;  2QZ8 A;  1WTF A;  1RGV A;  3A12 A;  1RTJ A;  4FPR A;  4PUO B;  2WK4 A;  1S1T B;  4RNM A;  1F5B A;  4TLQ A;  3BEG B;  3O5T B;  3I4H X;  3CO0 P;  2I38 A;  2ZH6 A;  4I4B A;  3MCM A;  1C1B B;  1KN6 A;  4DQP A;  2VF3 A;  1YKW A;  1HYS B;  3KHG A;  2DD8 S;  4EMD A;  3CIZ A;  4OYW A;  1XER A;  4Y28 C;  2JL9 A;  2RH3 A;  3KK3 B;  2FGC A;  2C1E B;  3W62 A;  1IKW B;  2UUW A;  2LU2 A;  2DR9 A;  1YRU A;  2CJ9 A;  1ZYQ A;  4EBE A;  1T02 A;  3HF5 A;  3L7P A;  1V6H A;  1FDN A;  2DGW A;  4M8L A;  2B3T B;  3GR1 A;  2OSR A;  1N33 J;  2DPI A;  4JV5 J;  2HAI A;  5E3A A;  3R2C J;  4FXV A;  3CCM S;  3CJ0 A;  2XY5 A;  1VC0 A;  3QYY A;  1XTZ A;  3G86 A;  3MXH P;  3HHL B;  4ZP8 A;  3A3N B;  5LXR A;  4EGL A;  2E1P A;  3MMB A;  3SSQ A;  1R43 A;  1KVK A;  3MCO A;  3WBZ A;  2F9J A;  4IH6 A;  2ZE2 A;  2R7S A;  1RHU B;  4DCJ B;  4BBY A;  1HNV B;  2CG8 A;  4OYO A;  3KUG A;  4DDF A;  4ZVU B;  3BR9 A;  3DOL A;  2HK3 A;  4QBU A;  2C28 A;  1DLO A;  3BKT A;  1HHS A;  4U8Y A;  3CCR S;  4F50 A;  1VQL S;  5KFY A;  3CCV S;  3N5B A;  1RHJ B;  5C42 B;  4QWC A;  2W8L A;  1U1L A;  3GJT B;  3DM2 B;  5MLC V;  2UP1 A;  2MKI A;  3NS6 A;  1RBA A;  1FJE B;  1S6Q B;  3DOK A;  4RW6 B;  4DV3 J;  5D4L A;  2ZH3 A;  3OPK A;  3QT8 A;  3LQV A;  4ZVF A;  4LMZ A;  1S9G A;  2DNO A;  1YIJ S;  1YZ7 A;  4DV0 J;  4DR7 J;  3F0N A;  2CAJ A;  3LWM A;  5D0G A;  4DJB A;  4O0I A;  2OSQ A;  4IDK A;  3IS9 A;  4J5O A;  2VFT A;  1CG2 A;  1Q0N A;  2B4V A;  2YKM A;  3MMC B;  3CDW A;  3OW2 R;  4UOH A;  1ITP A;  1GFW B;  2EFO A;  5EWG A;  1VCT A;  3I0S B;  3IFE A;  4HLB A;  2QL5 B;  3KK2 A;  2XYG B;  2ZZM A;  4Y00 A;  3M2U B;  3HVT A;  5IWA F;  2QRR A;  2YH0 A;  3KDN A;  1C0U A;  4J9U E;  3B6B A;  3I6P A;  2RDI A;  2PMZ D;  3PRD A;  4HL9 A;  3DRS A;  1U7L A;  1S6U A;  1D8Y A;  2CDQ A;  1WHY A;  1DRZ A;  3UFC X;  3OL7 A;  4BS2 A;  4YR0 A;  3CD0 A;  3HDS A;  3MTK A;  3CJ4 A;  3KG1 A;  4ZPB A;  1SUQ A;  3R7N B;  1VMB A;  3R5B A;  1HNZ J;  2DXD A;  2X7I A;  4B17 A;  3H5X A;  4A4J A;  2J0Q D;  3JTP A;  5KT3 A;  4BWJ A;  4CO0 A;  3LP0 B;  4WIQ A;  3LPE A;  4C4W A;  1XBW A;  1ROF A;  3TR5 A;  1JJH A;  5F8H A;  1MN7 A;  4OHW A;  2CJK A;  5D6G A;  4CNZ A;  1GX6 A;  2RHQ B;  1JLE B;  3ILO A;  2KKH A;  2IM3 A;  4ITS A;  4OZ1 A;  4NYZ A;  4JI7 F;  2B6A A;  4RKU C;  1JLC B;  1MRO A;  4DG1 B;  3IG1 B;  3BB5 A;  4PCQ A;  3NNA A;  3GU0 A;  4TNO A;  2W9A A;  4MK8 A;  3KG4 A;  4V19 J;  2QMU B;  5K9F A;  2E1R A;  2EVZ A;  3HFV A;  2QEX S;  4HKQ A;  3D0H E;  3OVS A;  4BC9 A;  2B7C B;  1VQS A;  1TAQ A;  4Q7A A;  4B3S F;  3M6V A;  5ETR A;  4UOG A;  4IG0 B;  1Y7P A;  3V5R A;  2PEH A;  2GGP B;  2VG6 B;  1NK8 A;  1FXD A;  4WII A;  2F63 A;  1J2V A;  3H42 A;  3U27 A;  3U1L A;  3MEK A;  2FY1 A;  3LAL A;  2XYH B;  2HS4 A;  3JQM A;  3C6T B;  2W2O P;  4N7T A;  2LU1 A;  5T7L B;  2IDE A;  2DJW A;  4YQW A;  3CJ5 A;  4WU3 A;  1S77 D;  5FLX U;  2FZK B;  2ZVS A;  4LRB A;  1UA1 A;  2AWZ A;  3MEC B;  2DNK A;  2HIQ A;  2RQ4 A;  5F0W A;  2Y9H A;  3HSD A;  4PQU B;  4ED3 A;  1GQE A;  3BGO P;  1ZAX A;  4C8L A;  4R25 A;  3T1Y J;  5K8O A;  2AJ0 A;  3RU0 A;  4NX9 A;  3ZO7 A;  4NXN F;  3T5H A;  3NP5 A;  1H98 A;  3TQ1 A;  2G0I A;  4C11 B;  1FVS A;  4OHV A;  3MDF A;  3POT A;  4HEA 9;  2H5J B;  2HHT A;  4C0O C;  3TW0 A;  4X65 J;  4UQG A;  2MLX A;  3I32 A;  1IR2 A;  1YJU A;  4DFJ A;  5HP1 A;  2MKC A;  3TYT A;  2RDD A;  4RBT A;  2HBR B;  3Q83 A;  4L72 B;  4M5M A;  3AD9 C;  1F3F A;  1KVJ A;  2HHW A;  2ZDO A;  5IM0 A;  1KQK A;  5LSL A;  2Y8W A;  2HQG A;  1G1X A;  1X9M A;  1IQZ A;  3M1V A;  4ZPD A;  1P9Y A;  2BR0 A;  4FF4 A;  1K1Q A;  3KLG A;  2HS0 A;  3R2D J;  2FC9 A;  4Q45 A;  1BHN A;  1ZA2 B;  2Q79 A;  2V68 A;  1ZTT A;  4H4K C;  1F9F A;  3P3D A;  2IRY A;  4TU9 A;  1YQH A;  2WB4 A;  1FT8 A;  4LF4 J;  4YS2 A;  3CD6 S;  2R2T A;  4S0M A;  5DGB A;  2B9W A;  2RML A;  4ICL A;  2YKN A;  4Z7Y A;  1S0V A;  4LBP A;  1KTV A;  3ILJ A;  4DF4 A;  3N5F A;  4CRJ A;  2QMX A;  2M3D A;  4ZVR B;  2R2U A;  1N33 F;  4QIV A;  5KFJ A;  4JV5 F;  5KFW A;  1K73 T;  4DV5 F;  4OZ0 A;  4D3G A;  1B3T A;  3CJT A;  3QIP A;  4DL5 A;  1CPZ A;  3MAA A;  2K2P A;  5ETN A;  1WF2 A;  1UEV A;  4YEA A;  3UDV A;  2JEG A;  2MSS A;  1K47 A;  3D1Q A;  1NJZ A;  3G2X A;  4YR3 A;  2W24 A;  1IKX B;  2J7W A;  1LWX A;  1T11 A;  3CO9 A;  5GAH I;  3OR2 A;  2V8D A;  1TQL A;  4B02 A;  3CD7 A;  5IXU A;  1F5A A;  1OYE A;  4ED1 A;  2HGM A;  2RF2 A;  3CDA A;  3I82 A;  1CJV B;  1X60 A;  4B3T J;  3H59 A;  1P9Q C;  3CCQ S;  1AUS L;  4OYA A;  1JWW A;  4ELU A;  3VGU A;  3M8W A;  2H51 B;  3QJL A;  1S6O A;  3SSS A;  4DV3 F;  3KJN B;  4WU2 A;  3RW7 A;  3DLE A;  3PYG A;  5FII A;  4UY8 T;  3QZ8 A;  3S6E A;  1VQ4 S;  4QIW D;  2QX0 A;  2XI2 A;  4UY8 5;  5B0F A;  3HI9 A;  3RB6 A;  3W9I A;  2NRE A;  4MK7 A;  1LK5 A;  1UAW A;  4DR7 F;  4ZVH A;  3F44 A;  1NK0 A;  2FLL A;  4F36 A;  3FKB A;  1BQN A;  1N0V C;  1ZS6 A;  2JZ5 A;  4AD6 A;  4PWD B;  4QYR A;  4QJV A;  5B0A A;  1HPZ B;  2V2Q A;  3NGU A;  2X1F A;  2DTJ A;  4J9V A;  3BKU A;  4JOU A;  4ZOS A;  1I94 J;  1SC1 B;  2MKJ A;  4U8V A;  5A8R B;  3PW2 A;  4M5K A;  2E5I A;  4MYT A;  1NDC A;  1F6T A;  1ZM9 A;  4ECT A;  4ES3 A;  4O4G A;  1X4G A;  1FK9 B;  2EFQ A;  2OFH X;  1REV B;  1NKE A;  4I67 A;  4X4N A;  1RAA B;  2XI3 A;  1NHV A;  5EN1 A;  2W7P A;  3HSJ A;  1JLB B;  3P49 B;  4PXC A;  1S1V A;  3ENV A;  1H7X A;  3F56 A;  1X4F A;  2A6M A;  1HNZ F;  6FD1 A;  2N3L A;  3TI0 A;  3OQ2 A;  2C2O B;  3G6X A;  4DS5 A;  1LW2 A;  3Q8Y A;  1VBZ A;  2IFX A;  1JXE A;  5BR8 J;  3BPS P;  2PN6 A;  3OR1 B;  4NLO A;  3CNQ P;  4PXE A;  3US5 A;  4B9M A;  2F40 A;  1FRJ A;  1U24 A;  2Y1L B;  2A18 A;  5D0R A;  4N77 A;  3DYA A;  2NPI A;  3R6G B;  1HNX J;  2W7O A;  1DUR A;  4GMK A;  3MM7 A;  1KFS A;  1NJI T;  2V9W A;  2ZDP A;  4DR5 F;  3N01 A;  1GX5 A;  4O3Q A;  3GWC A;  2R8H A;  3H90 A;  1UEK A;  2DHA A;  3SDE A;  2E5G A;  2MLY A;  4R5P B;  2ASJ A;  2WCX A;  3VZI A;  5J2N A;  3KXD A;  4OJH A;  1VDH A;  4NI2 A;  4ECX A;  3FRZ A;  4BWM A;  1X0F A;  2E29 A;  3RB0 A;  2ADB A;  4DFP A;  1Q78 A;  4P71 A;  1VBK A;  4LQ3 A;  3GYG A;  1BQX A;  3GJQ B;  3L7O A;  1NPP A;  3PO4 A;  5A2Q U;  5C5J A;  1NRK A;  4HAC B;  1GEH A;  5KFC A;  4TVA B;  2IAJ B;  3A3O B;  2LEC A;  2DR8 A;  4Y0F A;  4DR1 J;  3PV8 A;  2EFN A;  4AXI A;  1XMQ J;  2X1G A;  2IJR A;  1KLN A;  1RWV B;  4H4K A;  1JLG B;  3EPI A;  4ZCI A;  2G1D A;  8AT1 B;  4DQS A;  2FJV A;  1MWQ A;  5GMK a;  4E2F B;  1UCN A;  2O67 A;  5KT4 A;  5DQH A;  2WB1 D;  2QG9 B;  1JXV A;  2OPP B;  4WFY A;  3T1Y F;  1OMS A;  4H54 A;  3OUY B;  2KT2 A;  3ADA C;  3D1O A;  1SIZ A;  1IQT A;  4QU7 A;  3MCS A;  2BBE A;  2P6T A;  4K4Y A;  4KYZ A;  3M6X A;  5MAO A;  4X65 F;  1EQ0 A;  3SCI E;  3MAH A;  1P1T A;  3W2V A;  5I3U B;  1WEX A;  2VDI A;  3UI3 A;  4U6P A;  3ENW A;  1OY6 A;  1X4D A;  3ETO A;  3KLE A;  3C6U B;  2BXJ A;  4K7Q A;  1IKY B;  1NU4 A;  1FF2 A;  3W5X A;  2CIM A;  4W92 B;  1EP4 B;  1YSJ A;  3I0R B;  3M9O B;  3OFG A;  4K4V A;  4X64 J;  3O2I A;  1REG X;  5G0R B;  5CYM A;  1VC6 A;  1VI7 A;  2E9T A;  4LT6 A;  1G2E A;  3EE3 A;  2Z0G A;  5LOQ A;  1CJK B;  2OGU A;  3M8S A;  2M9K A;  4HI2 A;  2R8K A;  2PT0 A;  2GML A;  2DNM A;  2FJD B;  4M5G A;  3WHI A;  3DDK A;  3O1L A;  4WTO B;  1YJW S;  4KSE B;  5A0Y B;  3IGN A;  3CGI A;  3TX0 A;  3C66 A;  3I96 A;  1NHU A;  1W2B R;  4DZ6 A;  4F2S A;  4KO0 A;  2VPY B;  2EC0 A;  1U6F A;  3QAE A;  3QT7 A;  2JH3 A;  2IDL A;  2IC3 B;  1TL1 A;  4USI A;  2KZM A;  3GFX A;  1GNK A;  2BJE A;  1VLY A;  2AD9 A;  2W01 A;  3JAM Y;  3DLJ A;  4ZHR B;  4KFB B;  1C0T B;  4ECY A;  4ELV A;  3EJM A;  2MTL A;  1AZS A;  3NGD A;  3K59 A;  2KO1 A;  5ETS A;  3IR5 B;  2IMW P;  3MAQ A;  2ASD A;  3J7Z T;  3MD1 A;  2HBY B;  5B0E A;  5DDR C;  2AEJ A;  5D3G B;  3KJV A;  4MFB A;  1R8B A;  4B3T F;  2KI2 A;  3J7Z 5;  2U2F A;  2UV8 G;  3NLC A;  1EZZ B;  1MML A;  2VA2 A;  1ZM4 A;  2LEP A;  3NBP B;  1H6K X;  4DUZ F;  3NMR A;  4OX7 A;  3IBF B;  1DAR A;  3KK1 B;  4I6W A;  3QRP A;  2YKQ A;  4JI4 J;  1NB7 A;  1KTQ A;  1T0T V;  2PI5 A;  1CBK A;  4LRA A;  1SBR A;  4RBV A;  5C2G A;  2QA4 G;  3GYX B;  2VA3 A;  1TKT A;  2OPS B;  4ERD A;  3BV8 A;  2QIF A;  1FCA A;  1CS4 A;  2F3J A;  3KDO A;  2W1B A;  2CNN B;  1QAJ A;  4LJM A;  1QDU B;  4RW9 B;  3CCL S;  1S1W B;  2HVI A;  3E01 B;  1I94 F;  3G71 S;  5B0G A;  1I6J A;  1IBL J;  2AJ2 A;  1WC5 A;  2ROE A;  3FSY A;  1YZ6 A;  1Q86 T;  3ET6 A;  3RB4 A;  2BOA A;  1IKV B;  4LF7 J;  5M2U A;  3LP1 B;  4NMX A;  2R9L A;  3CWJ A;  3NGR A;  3PNI A;  3C14 B;  4DL6 A;  2J9D A;  4Y2C A;  1MW7 A;  1Y4Z B;  5L1I A;  5HRO B;  1YBU A;  1T05 A;  2DNN A;  2YKO A;  5B0D A;  2FB0 A;  1XR5 A;  4YUD A;  4ZCL A;  2C3Y A;  4DQQ A;  5KAK A;  4YME A;  3OVA A;  2YWW A;  1SQF A;  2XZT B;  3A1Y G;  2GQ2 A;  3D3C J;  4ED4 A;  2Y3Y A;  3FEY B;  4ZJO A;  1ACM B;  4MMO A;  3EXC X;  1VQ7 S;  3I9Z A;  1NLK L;  5BR8 F;  2HK2 A;  5A8K B;  2VC1 A;  2DRD A;  1ZZF A;  3R7B B;  1R0A B;  2WOM A;  4MJK A;  1NK9 A;  3WZ0 A;  1NND A;  3TOQ A;  3IC1 A;  4QR1 A;  3RRG A;  3W2W A;  4WP3 A;  2UUC J;  1S76 D;  3JSM B;  4C6A A;  4R8U A;  4C3M A;  1JLQ B;  1KP6 A;  3EWG A;  1UVK A;  2DEJ A;  1RCO B;  1O5J A;  1M5O C;  4C8O A;  2F5G A;  3IRX A;  4EBD A;  4OI1 A;  2OPQ B;  2CQ0 A;  4DL0 C;  4NML A;  2GCF A;  5THW A;  3EGV A;  1MMD A;  3D3B J;  1WKK A;  2EKN A;  1SH2 A;  2KYZ A;  2V67 A;  1D9F A;  2HND B;  2DNG A;  1D9D A;  2YNH B;  3JXO A;  3SV3 A;  4WBF A;  1XR6 A;  2WVC A;  4DN0 A;  1UZH A;  5L1J A;  1K9M T;  3EDR B;  3P5B P;  4ATN A;  3IR6 B;  2ZBI A;  3Q8V A;  2ROG A;  1SJ4 P;  1T7P A;  3HKZ D;  3DDN A;  3MFI A;  1U8S A;  2KYX A;  4G6V B;  3GG0 A;  1RWW B;  3FEX B;  4EO8 A;  2JEF A;  4DF8 A;  3GFH A;  4N5S A;  4IFV A;  4DR1 F;  4NYP A;  1B0T A;  3NEK A;  2OEK A;  2K8G A;  3MM5 A;  4ECU A;  1RT6 A;  2LMI A;  3K17 A;  2L9W A;  3IRW P;  4EEY A;  5LMN J;  4IKA A;  2YTC A;  4CLU A;  2R7V A;  2HVE A;  2DO0 A;  1DTQ B;  3GTY X;  1YDL A;  1N6Q B;  5CYQ B;  2AGO A;  2AHO B;  4A8K A;  4U96 A;  1X4B A;  3P4U B;  5HAN A;  2XWY A;  5IC4 B;  1SKR A;  2NSB A;  1UVI A;  3HPO A;  5I3P A;  4HYK A;  5M2R A;  1HBU B;  2F8H A;  5D8H B;  1M5K C;  1HWI A;  1S97 A;  4KV8 B;  4J9S A;  5JMN A;  2G0J A;  4PUO A;  3W7B A;  1S48 A;  1N0U A;  2HQ3 A;  3NAH A;  3T9N A;  2AF6 A;  4ZMM A;  2ROP A;  4HTI A;  1C1B A;  2VAS A;  2YNG B;  3SZ2 A;  3A13 A;  3H4D A;  1EET B;  5J2M B;  1HYS A;  3TAP A;  4WP8 A;  3TZX A;  4X64 F;  1N4L A;  4NLG A;  2VFS A;  1B0V A;  2XBP A;  3KK3 A;  3NWR A;  2EXU A;  2NS1 B;  4D3H A;  2B5J B;  3EVW A;  3RZA A;  3SXL A;  2O5D A;  3UO0 A;  3D2W A;  1M1G A;  4KGZ B;  2C22 A;  3H2U B;  5KFL A;  3ZXW A;  2LQB A;  4WKY A;  2DGU A;  4ZK7 M;  1X5T A;  5KFP A;  1Q5Y A;  3HHL A;  5HO4 A;  1C1C B;  1TL7 A;  4B3R J;  2MEW A;  3KHH A;  3PRB A;  1URR A;  3THV A;  2V5H G;  4KGV B;  3G82 B;  4OYI A;  1M0S A;  3UNY A;  4DSJ A;  5T41 A;  2C2N A;  2KH9 A;  4WZQ A;  2QLB B;  1IWA A;  1VJQ A;  1IR1 A;  3TP2 A;  5EUH A;  2MZ1 A;  1CJU A;  5DJB A;  4NLP A;  2ACM A;  2NXN A;  4I2Q B;  4F25 A;  3N6L A;  3VQS A;  1U4B A;  1HA1 A;  4IYQ A;  1UA0 A;  3JYT B;  3FNN A;  1Y5L B;  3PEH A;  5AE1 A;  4N47 A;  1WI6 A;  3QWU A;  5C42 A;  3KTQ A;  1FJC A;  3DM2 A;  1XN9 A;  4UW2 A;  1S6Q A;  1RT2 A;  3HUL A;  3TAR A;  3T3F A;  4GVL A;  2M0G B;  1U45 A;  3H5S A;  4RUB A;  4RW6 A;  4HTJ A;  2XCP A;  3FMB A;  3K5O A;  3P45 B;  3J81 j;  2EWH A;  4XPC A;  1MU2 A;  4QOT A;  3M05 A;  3UVJ A;  3GQC A;  2PE8 A;  4GKJ F;  3NS7 B;  2YXL A;  1Q8I A;  3HMJ G;  2MQ8 A;  1UL3 A;  4JI4 F;  2NUH A;  4UF4 A;  5GVQ A;  4LQ9 A;  2VPX B;  2LLZ A;  1TK8 A;  4B9L A;  1RKJ A;  4IRK A;  2IM2 A;  2L9N A;  2FZG B;  1J27 A;  1MSW D;  1IBC B;  4M63 A;  3MMC A;  4FYX B;  2HGN A;  3ULH A;  4LVN P;  2HHU A;  2JLE A;  2FJX A;  3I0S A;  5HBM B;  3NXZ A;  2AJ1 A;  2PEB A;  3WX8 A;  4X62 F;  1UMJ A;  3ISZ A;  1IBL F;  3H20 A;  1P8G A;  2SXL A;  1RWN B;  3FRY A;  3DOM B;  1BQM B;  3HFZ B;  4HT7 A;  3S7R A;  3BGL A;  3TEG A;  2H48 B;  4DPO A;  1DFD A;  4LF7 F;  3D66 A;  3K5N A;  3I5C A;  2DGO A;  1ZH5 A;  4EYI B;  2MZQ A;  4F26 A;  2XMW A;  3WQP A;  1QJH A;  4G65 A;  5KFS A;  3IWN C;  3CF5 Q;  1FDB A;  3CMQ A;  1TZ0 A;  2XM3 A;  4W4M A;  1I51 B;  5T14 A;  4KE5 A;  3GIR A;  2MHE A;  2Z2Z A;  4YHH J;  1U6Z A;  2HZA A;  3RR8 A;  3LP0 A;  3MZI A;  2D3Z A;  3RBD A;  5GAE U;  5DS7 A;  4AND A;  1OS5 A;  1RT5 B;  4WWS A;  1JLE A;  3CCE S;  2I1R A;  2ATC B;  1ZZN A;  4M95 A;  4CLS A;  1EAR A;  2KL8 A;  3KFW X;  3H98 A;  4ANC A;  4DG1 A;  5A8W B;  2Y1J A;  3IG1 A;  2UUC F;  5ETO A;  3C19 A;  4JV2 A;  3MD3 A;  3TO8 A;  4ES1 A;  2CXE A;  4Y34 A;  3CCW A;  3NOG A;  2M4M A;  2ATL A;  1FDA A;  3JTO A;  2R7T A;  1PYO B;  1HNI B;  1P1L A;  4Q8E A;  3QO9 B;  3TX8 A;  3RUB L;  1FFW B;  3BJY A;  2BE9 B;  3OSN A;  1QTM A;  5HJY A;  2ZWP A;  4J37 A;  5L8R C;  4K5S A;  4GRS A;  4KH0 B;  4NA3 A;  5H9F J;  3MM6 B;  4IG0 A;  2XWX A;  3AD7 C;  1MWZ A;  2V2Z A;  2GGP A;  2VG6 A;  1S59 A;  1S7H A;  4OYP A;  2RT3 A;  5LT5 A;  3MCN A;  2GS8 A;  1RDR A;  2R42 A;  1MNE A;  2VON A;  1VRU B;  1CSJ A;  1A6L A;  1O6X A;  1F3V A;  3H7H B;  3TZY A;  3C6T A;  2RD5 C;  4L3N A;  4CCH A;  1H73 A;  3LA0 A;  5T7L A;  1HMV A;  4USW A;  3MOJ B;  3B4D A;  2DHG A;  2QSW A;  2P9E A;  2DBB A;  3BS9 A;  4X4O A;  4WZM A;  3QFW A;  3MEC A;  3J7Y I;  3LGH A;  4OX8 A;  4ILR A;  3UE2 A;  2XY7 A;  3QT6 A;  5IZH A;  2EBE A;  2BQU A;  5L39 A;  1Z2Z A;  3I56 S;  3G8Q A;  1K0V A;  2BM1 A;  4YDX A;  5E3Q A;  2UXB J;  3ENQ A;  1GMW D;  4L73 A;  2LDY A;  2C2D A;  3K7R A;  2R8G A;  1AW0 A;  3SQG B;  2BAN A;  4FXD A;  1WEZ A;  1FD2 A;  3LAN A;  2WVF A;  3V4I B;  1UVM A;  2XB2 D;  2IPO B;  3FBF A;  5SUH A;  2HFO A;  4E8U A;  5DLG A;  1VRQ C;  1IWG A;  1T94 A;  3HT0 A;  5AE3 A;  5KFO A;  4YB5 A;  1H2V Z;  5C25 B;  4OZ2 A;  2OAU A;  1F5C A;  3PXG a;  3ZNJ 1;  2J6U A;  3KG0 A;  4FBU A;  2ZBR A;  1LW0 B;  1FKO B;  2KG1 A;  2J7K A;  3Q0A A;  4J9P A;  3AB4 B;  1NZ8 A;  4BHQ A;  1T9U A;  4B08 A;  2FJA B;  1DQ8 A;  5CHC B;  1S79 A;  2HLU A;  3R5D A;  5AXN A;  4CNY A;  1XC9 A;  3UN2 A;  3BBB A;  5IV3 A;  3F41 A;  1AXQ A;  4LSN B;  4PQA A;  4L3K A;  5HVG A;  3HT3 A;  3VAJ A;  1I5O B;  3NGS A;  3M32 B;  2DGS A;  5LL6 d;  3LTO A;  3RBE A;  3OTE A;  3MM8 B;  3DRX A;  5DG8 A;  2ZH4 A;  4OI3 A;  4B3R F;  3RJM B;  3L3C A;  4NCB A;  5BYS A;  4O44 B;  3M9M B;  1IKX A;  1S49 A;  4M5I A;  3RAM A;  3W9H A;  4JI0 F;  3DLH A;  2B4U A;  4FP9 A;  3GCW P;  2ZKT A;  1P27 B;  1T3N A;  5H1S V;  5BYQ A;  5IQQ A;  2BJ3 A;  4DPY A;  3TQE A;  5HAT A;  1XNQ J;  4RWW A;  4Q0B B;  1TU0 B;  3SCL E;  2RS2 A;  1CJV A;  1MN9 A;  5D0E A;  4NYO A;  5E2Q A;  3IGV A;  4XO0 A;  2YX7 A;  1N32 J;  2UU9 J;  1OQ6 A;  3KNG A;  5F8G A;  2NLW A;  2FVQ A;  2HQC A;  1U1N A;  2E1C A;  4LF9 J;  3DI6 B;  4DV6 J;  3MEE B;  1WF1 A;  4HR2 A;  3TAN A;  3UD5 A;  3CTR A;  2B9E A;  3FSI A;  2G2Z A;  4F0M A;  1PJ6 A;  3PW5 A;  6FDR A;  4IOB A;  4ER8 A;  1PGZ A;  2ZH1 A;  5L1K A;  3PM9 A;  1SKU B;  1FEH A;  3BF4 A;  4PWD A;  1HBO B;  1JKH B;  2R7X A;  4N41 A;  4NLD A;  1K0T A;  2W7A A;  3ZZO A;  1Z1Z A;  4J90 A;  3VVU A;  4PG7 A;  5KG5 A;  5L38 A;  2IYG A;  4HI1 A;  1Q95 G;  9ATC B;  2H65 B;  4CM0 A;  1RWK B;  5AJ3 J;  4P9S A;  4CO5 A;  2PO4 A;  4C8Z A;  1WC1 A;  4L74 A;  1ARO P;  3JSR A;  1M1H A;  3CCJ S;  1REV A;  4RPF A;  3LW5 C;  3IO1 A;  2YKP A;  3HJV A;  8ATC B;  4RNO A;  3OHA A;  3CMA S;  2CJY B;  4RW4 B;  1NCL A;  2DO4 A;  1SVD A;  2RHS B;  4ETX A;  2ZOF A;  3HCX A;  2ZBQ A;  3JSB A;  4N76 A;  3VWS A;  1X9S A;  3AJ2 A;  4QPT A;  4YHH F;  4CLP A;  4U95 A;  3BGR B;  3TRG A;  3JS9 A;  2HYI B;  1RTZ A;  2HFU A;  1E6V B;  4EUV A;  1ZET A;  1L3T A;  3DMJ B;  3OTD A;  2JC0 A;  1VRT B;  2EEY A;  2R7U A;  4KHR A;  4CYU B;  2VL1 A;  1S9E B;  3W8G A;  1U1R A;  2J9C A;  2XC9 A;  1Z4U A;  3V6D B;  3VR1 A;  3JQJ A;  3NGT A;  3RG6 A;  1RTD B;  1EIY B;  4DFM A;  3DLB A;  2LQ5 A;  8RUC A;  1J5E J;  3Q8S B;  1HWK A;  4YOE A;  4MKY A;  4JUZ A;  3R5J B;  5DG7 A;  1WHV A;  1JJ4 A;  5F8L A;  4QWD A;  2K7J A;  1IM6 A;  1NDK A;  3MTJ A;  2GQQ A;  2J5A A;  4P2F A;  3VAF A;  4R5P A;  5KOW A;  4LF2 A;  4B9V A;  2VJV A;  3GV7 B;  2HHQ A;  3MMA B;  1CC8 A;  3M9N B;  4QU6 A;  1X5S A;  4O23 A;  3MR6 A;  2GHV C;  4CO1 A;  1RE1 B;  1TUW A;  1UVL A;  1WKL A;  2IJN A;  3A8E A;  2CNO B;  4XDD A;  3EVO A;  4ZVQ B;  1VYA A;  3T19 A;  4I64 A;  2HVH A;  2YWF A;  2K06 A;  1LQ9 A;  5C24 A;  4ECR A;  1SKW A;  1PJ7 A;  3GIJ A;  4J9L A;  2DGX A;  2ZZT A;  3NY0 A;  3GJS B;  4DV7 J;  4ZIV A;  1VK3 A;  3IAM 9;  3RBZ A;  2KDO A;  2BUN A;  3AFG A;  4LF5 J;  1ZBT A;  2OPP A;  2LP4 A;  4DQI A;  2AU0 A;  4WFB Q;  4PWU A;  3OUY A;  4BDP A;  5HSP A;  2DGV A;  1HWU A;  3M2V B;  3AJ1 A;  1CUL B;  2YH1 A;  1RLC L;  1NSQ A;  3L7U A;  2UXB F;  2DNP A;  3J81 U;  4QQB A;  4CLK A;  3LO3 A;  5K8P A;  5HAO A;  4URG A;  1YI2 S;  1HQU B;  1RTJ B;  5KFE A;  2BKN A;  5B08 A;  1HD1 A;  2J0X A;  5I3U A;  3VAG A;  3ZTP A;  1V9O A;  4ZCM A;  2EFV A;  1VK8 A;  4O3N A;  2BA9 A;  3THT A;  2KM8 B;  1FKP B;  3NCQ A;  3C6U A;  2JFK A;  1IKY A;  1F2H A;  3QID A;  2H5E A;  1SI9 A;  4ZIT A;  3BBF A;  3I0R A;  2OIH A;  1LOU A;  2R7Q A;  1RT7 A;  1NHK L;  4WXO A;  2G9O A;  1VIO A;  4NXM J;  2FHJ D;  3M2R B;  2GA7 A;  2V8G A;  3AOA A;  5G0R A;  1V5I B;  4P73 A;  5E3C A;  2WSF C;  4ZLL A;  5KOX A;  3CT9 A;  2AEF A;  3G4S S;  3G8S A;  3N6M A;  4NWB A;  1CJK A;  3TVK A;  1Q81 T;  3EZU A;  4H4M B;  2AZ1 A;  4P7T A;  2ZZN A;  3D5M A;  3IMQ J;  4KKO B;  2CWK A;  1HWJ A;  3BYR A;  4C3K A;  1KD1 T;  2FLO A;  5A0Y A;  1FTR A;  1LEO A;  2V34 A;  2CQ4 A;  2RU3 A;  5ETQ A;  2L9D A;  2PDA A;  2AIR B;  3H5Y A;  3GON A;  2E1A A;  1WNE A;  1S72 S;  2EI5 A;  4JI5 J;  1G4C A;  2PGC A;  2F8M A;  4DN9 A;  1R6Y A;  2V50 A;  1BMQ B;  1IBK J;  4QW8 A;  2WTF A;  1Q8K A;  3QGP A;  1F2G A;  2A6O A;  2IC3 A;  1W2I A;  2WSE C;  2JRS A;  4DSL A;  3MWB A;  5KT5 A;  1LWF B;  1S6P B;  1VHF A;  3LUY A;  4JYA J;  5EDW A;  4R0E A;  2I8E A;  2W2N P;  5AXL A;  1TKX B;  3GSI A;  2B56 A;  4ZHR A;  4YN3 B;  1C0T A;  1NZA A;  4I69 A;  4DZD A;  4LRF A;  1XNQ F;  3QPI A;  4TKT A;  4GC6 A;  1ELO A;  4QWA A;  2FJB B;  3CDE A;  1S9G B;  2BKP A;  3ZTO A;  2MQM A;  2JLG A;  4X4Q A;  1N32 F;  2UU9 F;  1UEU A;  2GJ2 A;  4MKV A;  1WTB A;  1LXN A;  1JNZ B;  2J8S A;  5K5M A;  2CUY A;  1JXL A;  3KK1 A;  4LF9 F;  4NLR A;  4IDK B;  1U8W A;  4EYH B;  2VFR A;  2FDN A;  3IM9 A;  5KFR A;  5HMZ A;  4EZ6 A;  2AJQ A;  5B0C A;  3GFZ A;  3BGU A;  2HMI B;  1YG0 A;  2J9D E;  3IAS 9;  1NK6 A;  3BSC A;  2MHN A;  4G1Q B;  2YX4 A;  2OPS A;  3OHB A;  3GYN A;  1ZAV A;  5SZT A;  4OI6 A;  2X1B A;  3KUE A;  3P8B B;  4RW9 A;  1LWC A;  3GV5 B;  4U7C A;  4EU0 A;  3E01 A;  2IM1 A;  2PFD A;  2D3O R;  2EC2 A;  3THP A;  4ZVE A;  1WAC A;  1N54 B;  5AJ3 F;  4G1P A;  1IKV A;  1SL1 A;  4HHU A;  3TNV A;  3LP1 A;  2HQI A;  1KVI A;  4JI1 J;  2D3O 1;  2XMU A;  2NXJ A;  5KFU A;  5HRO A;  4IG3 A;  5K20 B;  4M94 A;  4OX9 F;  3M7V A;  4PXD A;  5LJ3 Y;  2JSX A;  2HKE A;  1NPK A;  1VQM S;  3CJK B;  2F65 A;  4XTT A;  2AV5 A;  3I5A A;  1MRO B;  3OTB A;  3TWZ A;  2KB2 A;  2EK1 A;  2BRK A;  3PRV A;  1H2T Z;  4F7V A;  5A8K A;  1FO1 A;  3FQL A;  4U67 Q;  1R0A A;  4PG5 A;  5ETT A;  2XLK A;  3JSM A;  2M2B A;  3Q8P B;  4KPC A;  4RUC A;  4ELT A;  1HNW J;  2K3K A;  3BR8 A;  3K5M A;  1YTY A;  4EBC A;  3S1T A;  4ZDN A;  2OPQ A;  5KFA A;  4X4T A;  3FC9 A;  3RYL A;  2EFG A;  2V8P A;  2R2R A;  3PG9 A;  2BMB A;  4H4O A;  3J80 U;  2ERR A;  4O0N A;  1K44 A;  4GVB B;  3JQK A;  2PII A;  2H5I B;  1QTN B;  1KLM B;  2HND A;  2VKR A;  1CVJ A;  4K4Z A;  2AJF E;  4OV1 A;  5KFQ A;  3TEH B;  4FF1 A;  3TA1 A;  1T03 B;  1VFJ A;  4RZR A;  3M6W A;  2AP6 A;  3TAQ A;  4ID5 B;  1MWY A;  1BD6 A;  2C2R A;  3G8T A;  4YB7 A;  1RAE B;  3CJ3 A;  7FD1 A;  4CDI A;  2GJI A;  1PIE A;  2KU7 A;  1EQM A;  3PHT A;  4LR7 A;  4DV5 J;  1DQ9 A;  2YPZ A;  4YY3 J;  2RU9 A;  4DV7 F;  3PO5 A;  5J1P A;  4LF5 F;  2DNQ A;  2RS8 A;  1N6Q A;  2MQQ A;  2HHP A;  1PAU B;  5HP1 B;  3FFI B;  2B4O A;  3D0G E;  1IR0 A;  3MI7 X;  3GSD A;  2ZEJ A;  2B9X A;  2AYM A;  1U6B A;  1F0X A;  2HUR A;  1XQI A;  4K8R A;  1JQG A;  1HBU A;  1DTT B;  4UZB A;  1WKJ A;  1XK8 A;  1B4S A;  2B0G A;  2W9B B;  1RWP B;  2RUS A;  1KQG B;  2ASL A;  1U02 A;  4PKD B;  1RWX B;  4IH5 A;  3Q8Q B;  2R7O A;  4FNH A;  2AT1 B;  3BBC A;  2VBZ A;  2ZC3 A;  2DGT A;  3GB0 A;  2IVM A;  2Y1I A;  3PR4 A;  2HZC A;  5DG9 A;  2BAB A;  4USJ C;  2KG0 A;  2ZH8 A;  3T6J A;  4ECS A;  2DCU B;  3CCT A;  4UOC A;  4OHX A;  3TA0 A;  3V81 A;  4FZV A;  1EET A;  5J2M A;  1R0B G;  1AUD A;  4LUB A;  2V69 A;  4NXM F;  2UUA J;  1CJT A;  2BJ7 A;  2FHO B;  4ZP6 A;  3HXM A;  1Q7Y T;  2U1A A;  3CE8 A;  4JI2 J;  1MLA A;  3I4P A;  5BXI A;  2ZH2 A;  5F0U A;  2CFX A;  4A48 A;  4N8O A;  3BPD A;  4C0H A;  4CZC A;  3D6T B;  3PJ9 A;  2G2Y A;  1RA7 A;  2IRX A;  3QRR A;  2KRB A;  4RJV A;  3I87 A;  4ECQ A;  1FDD A;  4ZVS B;  3PEJ A;  1C1C A;  2GVD A;  2KN4 A;  2HWT A;  4RO0 A;  1NB2 A;  4JI5 F;  1UJ6 A;  3UDE A;  1C4C A;  4KAI A;  1IBK F;  4LF6 J;  2HZV A;  3G82 A;  3CPW R;  1N36 J;  2UVR A;  4ZPW R;  3UDL A;  2XSJ A;  5HVF A;  1V3Z A;  3P5T L;  1NK7 A;  4F3O A;  2GAH C;  3IP0 A;  2RQC A;  5DET A;  4JYA F;  3D7S B;  1HBM A;  2LYV A;  2HNZ B;  4OHZ A;  5A76 A;  1KR4 A;  1DZ5 A;  1JIH A;  3JYT A;  4I2P B;  1T8E A;  3DLG B;  1NXI A;  2YVS A;  4F4X A;  3D6M B;  2XGQ A;  1LWE B;  3N28 A;  5KG7 A;  2GV1 A;  3HO1 A;  3BDP A;  4MKB A;  1U1K A;  1FJG J;  4AE5 A;  4ZS6 A;  2GZO A;  2DH9 A;  4BC7 A;  1LNQ A;  2Z2Y B;  2VBW A;  2FLN A;  1GH8 A;  4X66 J;  3OTC A;  4DR5 J;  3DCA A;  3AQP A;  2LXU A;  2BRL A;  3O3L A;  1T9X A;  1TFW A;  3D28 A;  2RRN A;  4Q5V A;  2WW8 A;  3PJW A;  1URN A;  4CWB A;  4QYZ J;  1FTC A;  1F60 B;  5F3T A;  2N3O A;  1D3W A;  1FFG B;  2W9C B;  3UD4 P;  4DS4 A;  4RLE A;  4C0B A;  2V4Q A;  3KJQ B;  4RNH A;  4NEZ A;  1VIS A;  4MH8 A;  4Z37 A;  3LPY A;  3KNA A;  1TV6 A;  4IRD A;  2BJ9 A;  3R8Y A;  4OZ5 A;  1EKS A;  3DOM A;  1BQM A;  3T41 A;  2VHG A;  3TAM B;  1TFY A;  2HFV A;  2BQR A;  2CZ9 A;  3SV4 A;  3CCZ A;  3QQC D;  2HEK A;  3D68 A;  4JI1 F;  4W98 A;  4C97 A;  4MIB A;  1RHM B;  2CWX A;  1V5V A;  1PO6 A;  2YY3 A;  2I6W A;  4F4K A;  3PCO B;  2E5H A;  5F3Z A;  3JB9 k;  4CLY A;  1R8P A;  3VGT A;  1GTE A;  1CQM A;  3C8Y A;  4M5D B;  1JJC B;  2MZJ A;  4M5N A;  3ELH A;  5AXM A;  2DNY A;  4NPO A;  1ULR A;  1X0P A;  3W9J A;  2AYB A;  2BX6 A;  1R3N A;  4R0J A;  1RT5 A;  1UFK A;  3EGW B;  3N9U C;  5HVH A;  4OHY A;  2NXE A;  4NLX A;  1QSY A;  2CPY A;  3AJD A;  3T5L A;  5CXT A;  5KFI A;  5A8W A;  3R27 A;  1GXL A;  4BLG A;  3G6V A;  2ZVI A;  1WOS A;  2Z2L A;  2GVZ B;  1HNW F;  3VCD A;  1HNI A;  3QO9 A;  3OTO J;  4P52 A;  2CG4 A;  2V4R A;  5F41 A;  4QIF A;  5DLF A;  2WW4 A;  3IR7 B;  2NXC A;  2EPI A;  4F0H A;  4NA2 A;  4TN2 A;  1ZTW A;  1D0E A;  2D41 A;  2QO3 A;  2MQO A;  3HVR A;  3KMS A;  2ZOG A;  4Q2L A;  1UPM B;  1U0H B;  2LCW A;  2HFS A;  1FNO A;  3MEG B;  5KG0 A;  3QT5 A;  4OYX A;  3HP6 A;  2NXU A;  3E51 A;  2IYI A;  4I7F A;  2V8H A;  4KBI A;  1VRU A;  7FDR A;  2E44 A;  2AGP A;  3H2L A;  1EB0 A;  5KFF A;  3VHQ A;  3Q2T C;  1EX8 A;  3SI8 A;  5DDP C;  3T5J A;  4UT4 A;  1R0C B;  4IFY B;  4WK3 A;  1Z2L A;  2FJW A;  2FVC A;  2UXD J;  5E0O A;  4RWX A;  1XMO J;  3HFK A;  4FYY B;  3S01 A;  4YY3 F;  2QN6 B;  2CVE A;  1YGY A;  4PG4 A;  2HHH F;  4EO6 A;  4WFX A;  4BCA A;  3VAK A;  3ICL A;  1UVJ A;  1R8A A;  2DY9 A;  3B8H A;  1DY3 A;  2HFN A;  3X3U A;  4P2X A;  4WE1 B;  1OSD A;  4RU9 A;  4FN5 A;  5HL7 Q;  5IT9 Y;  2FIU A;  3SQG A;  1GXU A;  3GR0 A;  5CCM A;  1Q4R A;  1GTH A;  3IWX A;  3TZW A;  1KRP A;  3QLH B;  2E5J A;  4ZJL A;  4F8R A;  3LP2 B;  1ZAW A;  5HMY A;  2F1F A;  3PW7 A;  1S0N A;  3K58 A;  5IQ6 A;  4MTP A;  4DOZ A;  4DV1 F;  1AFJ A;  1N5T A;  3BSO A;  4J9Q A;  2DRB A;  3SFG A;  4HHH A;  2OEM A;  2A3J A;  4ALZ A;  1A0O B;  2CQI A;  5C25 A;  1SKS A;  4P10 A;  2Y8Y A;  4DUZ J;  1LW0 A;  2HW3 A;  1FKO A;  2MKY A;  4X4U A;  3BH6 B;  5CZX A;  5HQL A;  2HLT A;  3JSY A;  1WUU A;  2UUA F;  2DNR A;  1W26 A;  2DHX A;  1NKB A;  2CPD A;  1RK8 A;  4JI2 F;  2I9S A;  3NGK A;  1WG4 A;  3GE9 A;  1XIQ A;  3D0I E;  2E5L J;  3PIO Q;  3MMJ A;  4LSN A;  4P2M A;  1UET A;  4C98 A;  1SJ1 A;  1KC8 T;  2GAG C;  1RA6 A;  4IR1 A;  4F3M A;  1NK5 A;  2Q3P A;  1D8Z A;  2RB7 A;  4TU8 A;  2DIU A;  4V1A k;  3MM8 A;  5I4M A;  1N5Y B;  4LFA J;  1IJE B;  3DFE A;  2H3E B;  4USM A;  2N7Y A;  4L75 A;  1Q16 B;  4XK8 C;  1YJ7 A;  4KGX B;  1Y11 A;  4USK A;  4LF6 F;  5JUM A;  4O44 A;  2A10 A;  1N36 F;  2OMO A;  4O3P A;  4QR2 A;  3E2E A;  2OFG X;  4PG6 A;  1XEZ A;  4B3O A;  3AXM A;  2KM8 C;  1FRH A;  1YHQ S;  3T9Z A;  4EI2 A;  1M90 T;  4ZLN A;  1VC5 A;  4NCG B;  1M1K T;  2CKW A;  4Q0B A;  4C8M A;  3PX6 A;  4OQJ A;  3KLF B;  1LKZ A;  4DR3 J;  1X5P A;  1CC7 A;  2GIQ A;  3PVX A;  2IVF B;  1Q79 A;  2MGZ B;  1F1B B;  5KG2 A;  4X4V A;  2UVU A;  3TUZ C;  4LR8 A;  1FRI A;  5DO2 A;  2J0S D;  3H5U A;  2P9C A;  1FJG F;  1DHM A;  3UCZ P;  2RNE A;  3DI6 A;  1XMB A;  3K89 A;  3MEE A;  1TKT B;  4RW8 B;  2H9Z A;  4Q43 A;  3CCU S;  4X66 F;  4A46 A;  4WJB A;  3P96 A;  2BE7 D;  3LF0 A;  3VV2 B;  1Y9O A;  5E3R A;  1RT4 B;  2DH7 A;  2XSF A;  2ZJQ Q;  3UPF A;  1WC3 A;  2OD6 A;  4QWE A;  2QV6 A;  2B9Y A;  5DM7 Q;  4OI4 A;  3CW2 C;  1AT1 B;  2DR6 A;  3M6U A;  2FYX A;  2HWI A;  3J7A 1;  1JKH A;  4PAB A;  2MQP A;  1Q5V A;  2W4D A;  2HG4 A;  4DL7 A;  1T95 A;  4PWW A;  4F4Y A;  4LFB J;  1U26 A;  3ZNU A;  2JDJ A;  4QCL A;  2DH8 A;  1RAF B;  1HD0 A;  4HHJ A;  1SV5 B;  2Z8Q A;  4CP5 A;  4B3M J;  3SEO A;  3MR3 A;  1V3S A;  5ETV A;  2LDI A;  2MQL A;  4LIR A;  1UFL A;  4HT5 A;  3QMQ A;  2J8A A;  4F0K A;  1BLU A;  1FI4 A;  4RW4 A;  2BE2 A;  2XNQ A;  1QY7 A;  3MR5 A;  3J7Y U;  3FZ2 A;  1NME B;  1OY9 A;  5K14 B;  3QBC A;  4ILL A;  2H4W B;  1Y5I B;  3W60 A;  4Q8F A;  3BGR A;  2HBQ B;  1E6V A;  1DQA A;  3DMJ A;  2N4D A;  1VRT A;  2QMW A;  2LXF A;  4CYU A;  4Y2I A;  1S9E A;  4DLE A;  2DR7 A;  4C3L A;  3OLB A;  2Z58 B;  3V6D A;  2QLX A;  2LKZ A;  4A8O A;  1N8R T;  1RTD A;  2HVD A;  3I31 A;  2FLP A;  3KLH B;  3OXF A;  1QE1 B;  3CUL A;  4FDF A;  3N0V A;  1RT1 A;  1SCJ B;  2HNY B;  2YBV A;  3OTO F;  2PI4 A;  2R2S A;  2R7W A;  2BOP A;  4HVZ A;  5LJ5 Y;  2CQD A;  3PX4 A;  3N79 A;  4DMZ A;  3KJF B;  3OD2 A;  2MZR A;  2E7X A;  3HJF A;  4U9R A;  3TUJ C;  5HMX A;  5GAG U;  1FNM A;  3MMA A;  1VBY A;  4WK1 A;  2QYG A;  1X31 C;  2QA2 A;  2CQC A;  4IFV B;  4K2X A;  4K4T A;  1S9F A;  2BJ8 A;  4OYB A;  3D54 A;  1RT6 B;  1PAE X;  3UR0 A;  4KH1 B;  5F8M A;  1JMT A;  2CPH A;  1YJN S;  5C2C A;  4ED5 A;  4KHM A;  2GIF A;  1ZM2 A;  3SFU A;  2L41 A;  2P2C B;  3RGI A;  2DXE A;  4GKK J;  2M8D B;  5DDQ C;  3TA2 A;  2UXD F;  4K59 A;  5EGY A;  4J9R A;  4TY8 B;  1YK9 A;  5FLX Y;  1TKZ B;  2VG5 B;  1XMO F;  4KRW A;  2KFZ A;  3FUY A;  5DGA A;  4X4P A;  1IUJ A;  4WP9 A;  1SC4 B;  3K0J A;  4WF9 Q;  2RRB A;  2C3O A;  1RAI B;  2RUG A;  2EG2 A;  3M2V A;  2CVI A;  4DSF A;  1CUL A;  2XNR A;  4MT1 A;  4DL2 A;  1GXT A;  2GO8 A;  2W2M P;  2HFZ A;  2GIR A;  2DNZ A;  1NKC A;  5CCL A;  1HQU A;  3DRR B;  2AW0 A;  3U02 A;  4IQM A;  3UCU P;  3FMW A;  3D67 A;  2BKO A;  4FF2 A;  1FKP A;  3OXL A;  2ACY A;  1GMV A;  2OHD A;  4HDH A;  3PY8 A;  3LGN A;  1IVZ A;  1RBO B;  1TUG B;  3FSX A;  4DX8 H;  1RZM A;  4CLW A;  2GFF A;  4RL1 A;  3BN4 A;  1GT8 A;  4OYM A;  4I1T A;  4GKJ J;  3MM9 B;  3M2R A;  4AL7 A;  2LQ9 A;  3EGN A;  4QIE A;  3I5B A;  2VIH A;  3FK4 A;  2ASY A;  1FNX H;  1JNR B;  1OJ4 A;  4MAK A;  4NE9 C;  1RLD A;  1KON A;  3CME S;  4H4M A;  4J91 A;  2E5L F;  2R4F A;  3HKW A;  4KKO A;  1TL7 B;  3QGI A;  2OLW A;  1SJF A;  1BC6 A;  4UZC A;  2IRU A;  5L9X A;  5J2P A;  4OZ3 A;  2OPR B;  2RIJ A;  4X62 J;  4FYW B;  2XLJ A;  4DPW A;  5IV4 A;  1CJU B;  3BM7 A;  1RQ0 A;  4LFA F;  2CQG A;  3C16 B;  4C2M A;  1LFW A;  3PHE A;  3W63 A;  4Q2M A;  3Q24 A;  3RAX A;  1LWF A;  1S6P A;  3WX4 A;  5GMD A;  5G4D A;  3Q8R B;  1TKX A;  4NLW A;  1H2U X;  1NSK L;  1DAX A;  1RT2 B;  2QA1 A;  3OVB A;  2KFY A;  2XGP A;  3MR7 A;  3FDS A;  2QFI A;  3DGP B;  2VOP A;  4DR3 F;  3IM8 A;  1VGY A;  1MU2 B;  2BJ1 A;  3UVJ B;  1O0P A;  1FE4 A;  2N82 B;  1U0S A;  2AX0 A;  1RTH B;  1RBL A;  4NZ6 A;  4JI8 J;  1WHX A;  5F9L A;  3UDC A;  2HBZ B;  4IH7 A;  4IR9 A;  3HX9 A;  1TTH B;  5HN0 A;  5IS2 A;  2LA4 A;  4DPU A;  4B9T A;  3KKF A;  3SBM A;  2AZ3 A;  3ZZP A;  2B8Q A;  4NAS A;  4DFK A;  2JLF A;  2HMI A;  4WTY A;  3QFH A;  4O3O A;  1TL5 A;  4G1Q A;  3OXG A;  1B70 B;  4ED6 A;  5KFB A;  3NNH A;  1NDL A;  1FWP A;  2LFV A;  3BQ1 A;  1SQE A;  2ZJP Q;  5FJ4 A;  1FFS B;  4LSL B;  4LFB F;  1WOR A;  1RTI A;  1RXO B;  1U49 A;  2H4Y B;  1T9V A;  2XMA A;  3D9B A;  1QVG R;  3A8I A;  1O8B A;  4B3M F;  2C2E A;  4WCE Q;  1X5O A;  2JVO A;  4L76 A;  1HLW A;  1VQ5 S;  4DV2 F;  3K8V A;  5D4P A;  4CTA B;  3Q2S C;  2Z56 B;  1N48 A;  2I5J A;  3BYP A;  2RKI B;  1BGX T;  3HM9 A;  2EBG A;  1ICE B;  1QLN A;  1I1G A;  3CIM A;  3ZTQ A;  4F02 A;  2YQ1 A;  4AQY F;  3CJK A;  2ILY A;  4M5J A;  5CQG A;  2A2D A;  5CD4 A;  3OL6 A;  2VIC A;  2CPX A;  2HAF A;  1NBE B;  1M5V C;  5A6W A;  4I6Y A;  1NJX A;  4IUF A;  3BQ2 A;  2RQK A;  2O66 A;  3UN5 A;  1B0P A;  4RR5 A;  5I3Q A;  3RRH A;  4I56 A;  3TJA A;  3FVY A;  4TY9 A;  2QSF A;  4CLT A;  1MG7 A;  2XS5 A;  2BQ3 A;  1WC6 A;  1PCA A;  2J6T A;  2M70 A;  1OPI A;  2HS3 A;  3UW1 A;  2J6S A;  4C48 A;  4I0W A;  1T3O A;  4OI0 A;  1KQS R;  2D69 A;  3ILL A;  2BVZ A;  2M7S A;  1PG5 B;  4NCA A;  2APO A;  2Q6B A;  1S1T A;  1EJ7 L;  4GVB A;  2NCK L;  4N8N A;  5E33 A;  3I55 S;  4PPD A;  3MUR P;  1KLM A;  2XHW A;  3KUH A;  3OT9 A;  4UUW A;  3VAM A;  5KG6 A;  2WVE A;  4P72 A;  1HMV B;  2RDJ A;  1T03 A;  5HLF B;  3NMA A;  2O1P A;  4A8Y A;  1SQG A;  2KJV A;  2XYP B;  1IKW A;  2QYC A;  4ID5 A;  4RUA A;  2HHX A;  4OMF G;  2O3D A;  5A2Q Y;  4ES2 A;  2QGF B;  2MB0 B;  2NSC A;  4MIA A;  4WPA A;  3LOU A;  3WDO A;  4GKK F;  3JAM U;  4ZN1 A;  4DCP B;  1QD1 A;  4YDD B;  2FJE B;  2YNI B;  4OJ3 A;  2BAN B;  3MPY A;  3W65 A;  5CD4 H;  5FDL B;  3DU5 A;  1HHQ A;  2VFV A;  1HQE B;  3NRB A;  4ZVG A;  2PSZ A;  3FFI A;  3NAI A;  3UD3 P;  1RWM B;  3PW0 A;  2C3P A;  2E7W A;  4JI0 J;  1NK4 A;  4DR6 J;  1HNV A;  2ZD1 B;  2BM0 A;  5H9E J;  2DRA A;  2FVS A;  1PBA A;  1R6V A;  3A8J A;  1L5U A;  1DTT A;  5KG4 A;  2W9B A;  3RBX A;  1L3U A;  2PMW A;  3K2Y A;  1S7I A;  4KIA A;  2WON B;  1O51 A;  4F4Z A;  3QAU A;  3H8Y A;  2YQ0 A;  1NH8 A;  2XS2 A;  3UQS A;  1BY9 A;  1JJ2 R;  3Q89 A;  1U1M A;  3AAW B;  1TL3 B;  1HW9 A;  4RX6 A;  4XAK A;  1LFP A;  4OLO A;  1OY8 A;  3PZP A;  4DCO B;  9RUB A;  2UV8 A;  1U2F A;  1VQK S;  1VQ9 S;  2HPU A;  2CJQ A;  1TL4 A;  4P75 A;  5EWF A;  3M30 B;  1ZPV A;  2XTJ P;  1UPP A;  1WDT A;  2XHC A;  3K57 A;  3MUT P;  2JEI A;  2DIT A;  2G4B A;  3HK2 A;  1S1X B;  2MDA A;  1RAC B;  1JLA B;  2OI2 A;  4EZ9 A;  3CED A;  1G3O A;  4DL3 A;  2K1R B;  1S0O A;  3M2U A;  4Z7C A;  1QM9 A;  3OJU A;  4C8N A;  4DSE A;  1QSS A;  1HWL A;  1KEK A;  2HSE B;  3M8P B;  2PA8 D;  3GV8 B;  4MYU A;  4X4R A;  2A0F B;  5KFH A;  5KFX A;  3F73 A;  4KR0 B;  2P9G A;  3K5L A;  2W25 A;  3GCX P;  5J2Q B;  2HNZ A;  3W1Y C;  3HHL D;  3Q22 A;  1PYS B;  4I2P A;  1R7I A;  3A4T A;  2ZKU A;  2R7R A;  1SH3 A;  3DLG A;  1RYR A;  3CJS A;  3AQO A;  4Y6I A;  4CO4 A;  1LWE A;  1TUV A;  2RQM A;  1YX2 A;  2CQP A;  4DUY J;  2DKO B;  3CJR A;  4DX7 A;  1VQ6 S;  2D7S A;  4JI8 F;  1JLC A;  3TJ9 A;  4RU2 A;  2CA9 A;  1Q53 A;  4Y3C A;  4DV0 F;  3N4W A;  3ZZU A;  4EK2 A;  4C8Y A;  2QJ3 A;  2BV3 A;  4HDG A;  2FC8 A;  3LAM A;  4F67 A;  2R8J A;  4KQZ A;  4DI6 A;  2NZ4 A;  4IO1 A;  2GO9 A;  3NOC A;  1T9W A;  3CJ2 A;  3ZZT A;  3DRP B;  4PXB A;  2C2Z B;  1TMM A; 
#chains in the Genus database with same CATH homology
 2IDE A;  4PYD A;  3JQJ A;  4FDF A;  2EEY A;  3JQM A;  2IIH A;  3JQK A;  2OHD A;  4PYA A;  1EKR A;  2EKN A;  1EKS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...