2IDEA

Crystal structure of the molybdenum cofactor biosynthesis protein c (ttha1789) from thermus theromophilus hb8
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
148
structure length
148
Chain Sequence
DGRPRMVDVTEKPETFRTATAEAFVELTEEALSALEKGGVGKGDPLVVAQLAGILAAKKTADLIPLCHPLPLTGVEVRVELLKAEKRVRIEATVKTKAETGVEMEAMTACAVAALTVYDMLKAASKGLVISQVRLLHKAGGKSGEWRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biosynthetic protein
molecule keywords Molybdenum cofactor biosynthesis protein C
publication title Crystal Structure of the molybdenum cofactor biosynthesis protein C (TTHA1789) from Thermus Theromophilus HB8
rcsb
source organism Thermus thermophilus
total genus 39
structure length 148
sequence length 148
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2006-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01967 MoaC MoaC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.640 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Molybdopterin cofactor biosynthesis C (MoaC) domain 2ideA00
3JQMA 4PYAA 1EKRA 2EKNA 4PYDA 2OHDA 4FDFA 2IIHA 3JQJA 3JQKA 2IDEA 2EEYA 1EKSA
chains in the Genus database with same CATH superfamily
2R8GA 1S4EA 3A3PB 1NAQA 1R8BA 4LF4F 1NSQA 5IC4B 5IZHA 4I2QB 1XQIA 2GGPA 3RR7A 3EGZA 4Y2KA 4UY85 1Z1ZA 3LO3A 1SI9A 2GMHA 4LFCF 4EMDA 2Z4PA 4V19J 3MTKA 5E7OB 1PJ6A 1U02A 1RWMB 3GZ7A 2ZVIA 4ZPBA 5I3UA 3TAMB 5HQ8A 4KO0A 3UCUP 4ECSA 4WFZA 1RKJA 4F4ZA 1U6BA 1U8SA 2GO8A 1KLMA 2FVPA 1NKCA 4Q44A 3LALA 1AFIA 2CDQA 1FVQA 3R9LA 2VC0A 4B3TF 2Y9HA 3OTDA 1QTMA 1SJ1A 2MSSA 4J9NA 3CMAS 2GAGC 3A13A 2W24A 1V3RA 2IBOA 5DJBA 2EKYA 1P6TA 4OYZA 2KHCA 4CDIA 4NYZA 3R5JB 5A2QU 3GLJA 4Z7YA 2VASA 3V81B 4NZ0A 5ETRA 3LH2S 4PR6A 1NCLA 3NS7B 4G1QA 2ZBRA 4TLRA 1T9TA 3ZTSA 5E41A 2CDRB 5F8JA 4TYAA 1VYAA 1ZM3A 2B6AA 5KTQA 1RGVA 2KFNA 4DQSA 2Y1LB 1TL5A 4LF4J 1SIWB 2KJVA 3TP2A 2ZKTA 2DVIA 3H90A 3UWTA 2FD2A 2XS5A 2K06A 4EZ6A 4KYZA 4OV6A 4IFVA 1UWAA 1J5OA 4LFCJ 4R0JA 3CIMA 2IY5B 5G4DA 3DDNA 3HZEA 3CJKA 1X4DA 5K5MA 2JFKA 4RBTA 2A18A 2GIFA 4RNMA 3IWXA 2XC9A 1CJVA 3K58A 2BMBA 1N5YB 1P1LA 2KM8B 1IN0A 1HYSB 3HM9A 1S7HA 2KJWA 2XI3A 3E3XA 2CADA 3NS5A 2BOPA 3CC7S 2AZ1A 4B3TJ 3HJVA 1XBWA 5F0UA 5CYQB 2AYBA 1FDAA 5C5JA 3K2YA 2PMHA 3ADAC 1S48A 1SUQA 1C4AA 3FCHA 1VJQA 1X0FA 2D3UA 1PC5A 3CB4A 3FCWA 1H2TZ 2QX0A 2B51A 7FDRA 1RWUA 3H20A 2P5VA 2ZH4A 1YKWA 2V8HA 2KT2A 4OX9F 3V4IA 2GQQA 4J90A 1KDNA 3D1QA 1I3OB 2OD4A 2C3UA 3C2PA 3NAHA 3SIPB 2HHQA 2HWHA 1D09B 3JS9A 5IT9Y 1REVA 2DEIA 1B0TA 2CJKA 2V8GA 4UUXA 3KK2A 3VAKA 2DNRA 3CCVS 3JAMY 2LXIA 5HJYA 3BS9A 5KFLA 5A8RB 3FCVA 1M1KT 4WP3A 3TARA 2ROGA 3TVZA 2M7SA 3D6FB 4J9UE 4KGMA 4KAIA 2XBPA 3GV5B 3BBFA 3MECB 4P9SA 1FF2A 5T14A 3I0SB 4DN9A 2ASYA 1FD2A 1N33F 2OELA 1A0OB 3POTA 1JB0C 1X5SA 3MMAA 2J9DE 2HQGA 3SV3A 2OUGA 5L1LA 5ETLA 4NCAA 2HBYB 5L39A 1FRJA 3RYLA 1FDBA 1HL6A 3AHPA 2VG6B 2FHJD 3N9UC 2LLZA 2ZOMA 1RT1B 4GVBB 4DV0F 4C7QA 3GWCA 5GADU 2B43A 2V8PA 4DR2F 3QATA 5GMDA 2OSQA 4NLDA 2OIHA 3HHEA 5D15A 4OX9J 1ZAVA 1FWKA 1TL4A 4UQGA 3OJSA 3CJQA 4CNYA 2P9CA 5IC6B 2U1AA 4C8OA 5KFEA 1RI7A 2AYMA 3C6TB 2GMJA 3OR2B 3OUYA 1H7XA 2RNEA 4KV8B 3V6JA 4FF1A 3ENVA 1IXKA 1XMOF 1JJHA 1N5QA 4PG8A 5D4NA 1HI1A 4ZITA 2C2KB 3M2UB 1KSPA 3R8YA 3V6HA 2Q1LA 3CMQA 5K8OA 1RT2B 5GAGU 2BJ7A 1EETA 1VDHA 2UP1A 3MPWA 5EX0A 4QR0A 4I2PA 1WKLA 1N33J 1N48A 1FEEA 2RB7A 3KYLA 2OMLA 1Q0NA 4CCHA 1HQ2A 1FTRA 3A1YG 1N5VA 1YLXA 3OT9A 1ELOA 4URQU 4DR6J 1VQ7S 1CJTA 2NUUG 4DV0J 3FRYA 1GMUA 4YR0A 2XY5A 3EX7B 5GADI 4DR2J 3AD7C 2XB2D 4WIIA 5KG5A 4JI0F 2PT0A 4DL4A 2DH9A 2BANB 2IC3A 2HYIB 2QA4G 1PJ5A 2IRUA 3W1YC 3GONA 1M5HA 3CCJS 4DL5A 4ZVUB 2RHSB 8RUCA 4X4NA 1LWCB 1K44A 2IVYA 4XIUA 1M90T 4A8MP 3OFGA 4HHUA 1JXVA 3FSXA 1XMOJ 3UN3A 4J37A 1TMMA 3OPKA 3M8SA 1S1XB 3M6XA 1CJUA 3NBPA 2AIRB 3R7BB 3T5HA 3OJUA 4RNFA 2LU1A 5GAGI 4DF4A 3GYGA 2ZOGA 1VS3A 1YRXA 2RDJA 3GIRA 2VDIA 1RJJA 2OPQA 1HQEB 4H4KA 5H9EK 1UFKA 3OL8A 4NXNJ 1T05B 4ZVGA 3H2VE 1W7WA 2AV5A 2MLXA 4J91A 1NK9A 5I42B 2PA3A 3C16B 3BF4A 4WJBA 3P5BP 4ED7A 5ETKA 4RX6A 4DV5F 3SSSA 3T1YF 2QJ3A 1TUVA 2JLGA 1VQ6S 4RNNA 4NASA 4IG3A 5IT9U 4DV2J 4ETXA 1UVIA 2RKIA 1NHUA 2FYXA 4NLWA 1RABB 3JAMU 4JI0J 1U0SA 4CIOA 5DLFA 1ZA1B 1VQKS 3VTIA 5DM7Q 2HVIA 4LSNA 5C2CA 1VRUA 3I5BA 4F0KA 4IUFA 2V68A 1FJGJ 1C0TA 1WOOA 3LW5C 2PIIA 1YG0A 3BR9A 2RIJA 3CJRA 3HSZA 3J7AN 2GIRA 4U7CA 4LRCA 1Y5IB 2OPRA 3ZZYA 2EKNA 3ISND 2XSJB 2RMLA 1BQXA 2D3ZA 3DRPB 3SSQA 3RBEA 4D3GA 3ZFVA 4EYHB 3QT7A 3L9ZA 5DM6Q 2WONA 3AJ2A 1ZM2A 1N8RT 2UXDF 3QLHB 2VG5B 3MOZA 4OZ2A 3DLGB 3KJNB 2XEXA 2AKWB 4CLPA 2E5LF 6FDRA 4ZK7M 1WNEA 1S1TA 4TU7A 3H98A 1D9FA 3NWRA 4DV5J 3T1YJ 2KXHA 3WHIA 2BJDA 1LW2A 2KYXA 2O1PA 1FRIA 3BSOA 3A8EA 3EWGA 1PYTA 4LF8F 1NMEB 1HWUA 5HBMB 2R7TA 5KFMA 3GJQB 5KFTA 2XMMA 3AJDA 1JLCB 5LOQA 2MLYA 1RA6A 1WTBA 4DR1F 4ZS6A 4YB5A 2F7VA 1UZHA 3I0RB 4B02A 1LFWA 1RDRA 3L7PA 2E5JA 3PJXA 2D9OA 3MR7A 2BZ2A 2Y8WA 4FBTA 1S0MA 5KT4A 1H0HB 1MU2B 2DITA 3NP5A 2JFDA 2P2CB 3CIZA 3MM5A 2HHPA 2IA6A 4QYZJ 4X4QA 4N77A 3W7BA 2LDYA 5HP1B 4DXLA 3CSKA 1D0EA 1RT4A 1WG5A 2ZHAA 1JLFA 3AODA 3FFIB 2B3TB 3CD5A 2A6OA 2PGCA 2XZWA 4B9UA 4RW6A 1YJUA 2W4DA 4O44B 2UXDJ 3UNYA 5IXUA 3KNGA 3CDBA 2ZZMA 4F0HA 2XWYA 2QA4S 2E5LJ 3RBXA 2HFUA 2ZNYA 2BJ8A 2IM2A 3D3BJ 1MWZA 4F4AA 1J5EF 3BGFA 1VC0A 2LXUA 1HW8A 2YKMA 1HPZA 1WJ9A 4A4JA 3OVBA 5KOXA 4P7VA 4R8UB 3K57A 2J5AA 1VHIA 2DRAA 2DCLA 3TEHB 3MMJA 3SFUA 1RWNB 2XS2A 1OPIA 3I56S 5L38A 4E2FB 4DR1J 1K0TA 3CGIA 3TAPA 1OIAA 1K1QA 4YOEA 1TKTA 2WTFA 2MXYA 1NJXA 4QU7A 5J2MB 5ETTA 1IKVA 4EU0A 2R3VA 4O3QA 2KRRA 4RR5A 2R7QA 4D3HA 5FJ4A 4A8YA 1XNRF 1HBNB 1N0VC 4PUOA 2FC8A 3HPOA 3C6UB 1TL7B 3I31A 2JEFA 1FDDA 5A6PA 1E6VB 4L3KA 3CC2S 3QAEA 3LGNA 2N4DA 3TUIC 4PYAA 2ZJRQ 4MIAA 1ZOTA 3Q8YA 4FKXA 3CCUS 1EKSA 2XZTB 3TZXA 2VHGA 2FLOA 2LEAA 2BQ3A 1D3WA 3V5RA 2ZH6A 2VPYB 4IQXA 2KZMA 4QOTA 1J5EJ 4O4RA 2J6SA 1UVMA 5F8GA 1QUPA 5E2QA 3DLJA 1F2HA 3VALA 3DXSX 4EK2A 4USIA 2M8HA 3HI9A 4J7CA 2J0QD 2RDIA 1KN6A 1S0VA 3SDEB 5BJRA 3IWNC 4GRSA 1S6UA 4OZ5A 2GAHC 3ENWA 1PGZA 5KFYA 1K0VA 3H4BA 5LM7E 4LVNP 2CQCA 2W8LA 2ZEJA 4O0NA 3D54A 2I9SA 1BGXT 1G6BA 3V2UC 1B64A 3BKFA 3THTA 2C2EA 1D8YA 4DQQA 1DBDA 4F8RA 4GMKA 2HK3A 1XNRJ 3C8YA 1VQ5S 2EC2A 4LRDA 4TLQA 3FKBA 2DR8A 2M2BA 3PEJA 4L74A 2DR9A 1WHWA 1TFWA 1HNZF 2DJWA 2PDAA 2KXNB 3MMCB 4KB7A 2KKHA 1O5JA 5K14B 2CQ4A 2K7JA 1VCTA 1U24A 1LFPA 4JV2A 2W1BA 2NQPA 3BQ2A 2X51A 1WC5A 1T9XA 5F8NA 2J7UA 2RQ4A 3CD7A 3HFZB 4RWXA 3W9JA 3Q89A 3NMRA 4U9RA 2V9KA 2BACA 1N5YA 1FKPB 4FYDA 4UOFA 2BBEA 1FXRA 3R7SB 4QIVA 1HYSA 3ZZOA 3CCTA 4IFYB 3BBBA 3G6YA 4NCGB 5CYQA 2HRUA 1CG2A 1KOHA 2C2RA 4DS5A 2GA7A 1V3SA 2AX1A 4BS2A 3K89A 4A47A 3CCMS 3MM7A 3RAQA 3VVTA 2N4CA 2Z8QA 2M3DA 1BWVA 1RT3B 3GTYX 3PW0A 4ZJLA 2YTCA 1SCJB 4RW8B 3RB3A 4LF6F 2GO9A 3MM9B 4MKBA 4L6V3 4WPAA 3SFGA 2WB4A 3BBCA 2FY1A 1HNZJ 1V6HA 3J7YU 2VBXA 2H5IB 5CAAA 4ES1A 5C25B 4KH0B 1UA1A 3KK1B 1HKAA 2IPOB 1ZETA 1SKRA 1S6OA 2DNQA 4EEYA 5A8RA 2MZJA 4M5HA 4KHRA 2NUHA 3QFHA 1KQGB 1TUGB 4EBDA 2MQLA 3T41A 2CJXB 4DWIA 5LT5A 3DYAB 2B4VA 1VBYA 4L3NA 3FQKA 4JUZA 3MMBB 4FXDA 1CEZA 3BGUA 3MECA 4OIXA 3O3LA 3HHLC 1E6YB 3I0SA 4GC6A 4OV1A 1C1BB 3G6VA 3AB4B 2GJFA 5T7LB 2JLEA 2ZZTA 2FZGB 4V1Ak 1DJ0A 1CS4B 4N8OA 2HFSA 3EUNA 2W4CA 3HF5A 3U02A 3G86A 4NYOA 4ED6A 1FO1A 1BQNA 1RTIB 3MTJA 3GIJA 2VG6A 2IVFB 3PO5A 1RT1A 4UTGA 4GVBA 3M9MB 1FE4A 3HFKA 3JTPA 2N82B 4R0EA 1LOUA 2E29A 5HVFA 1UFLA 1R0CB 3DDKA 4MKAA 1IWAA 4U95A 3BSAA 4USVA 4M5DB 5FDLB 3CXCR 4LF6J 4OHXA 1IBMF 4XTTA 2GW8A 2V4JA 3CWJA 4BC7A 1CJKB 3J7YI 1QM9A 5E3AA 4DQRA 3C6TA 4AFFA 4AT1B 4ENOA 1OSDA 2YQ3A 3OR2A 2B9EA 5F3TA 2BUNA 4KV8A 5L46A 1RCOB 4ELUA 3T1HF 1S0OA 1X0PA 1GMVA 4ECZA 3U7JA 1PJ7A 2FVRA 3TW0A 1F6TA 2F4VF 3X1LB 1BY9A 4WTOB 3HZGA 4DFJA 2UV8G 1ZBTA 2ZC3A 3M2UA 3EXCX 1NJWA 1OYEA 2PI4A 3G2XA 3NGKA 2HNDB 3N6NA 5HK4A 3DGPB 3ILIA 3CO9A 1A9NB 1RT2A 1W2BR 5KG1A 4PQAA 3LOUA 2W25A 4AXJA 3KG4A 2Y1RI 4TU8A 3PHTA 2G1HA 3HK2A 3SSRA 4I7FB 4QZVB 4DG1B 4O0IA 2DXFA 4QJVA 3QJPA 4ZA1A 1YJTA 3OVAA 1S5ZA 3IS9B 2FLNA 2EFVA 3D2WA 4G65A 5BYQA 4AXIA 2C1EB 4X4VA 3G8SA 4ZP9A 2P9GA 3EM1A 2HQCA 1CPZA 3EXYA 3HD1A 4DL3A 2XS7A 2FC9A 5HO4A 3KLFA 2KYZA 3Q22A 4F0MA 3UD5A 4ATNA 3W65A 2BANA 4QR2A 4KHPF 4HLBA 1IBMJ 2UVVA 4O3OA 2MZ1A 3KDOA 3H5UA 4EO6A 3LGHA 3PR4A 1U1NA 3NL0A 4NLGA 1LWCA 1NSAA 1F5CA 4URSA 3BEGB 3R2CJ 3T1HJ 5DO2A 4KTQA 1R8PA 2GC8A 2HQ3A 1IUJA 2F4VJ 1IJEB 1IM4A 1M1GA 2CPJA 4C8NA 2WRMA 2VONA 2MSTA 5D0EA 3DU5A 3ICLA 4UW2A 1Z4UA 2DGQA 4WIQA 3QSIA 2OD6A 2DNZA 4ZVOB 3DOMB 2W2MP 4C6AA 2K3KA 3K5MA 1F3FA 1IBLF 3D6MB 4JI7F 2EK1A 2CQ3A 1QLNA 1Y5NB 5I42A 5JVGQ 3C16A 1B70B 4XO0A 1SB6A 3KHGA 3CDUA 2AJ4A 2GMLA 3MFHA 3CJSA 3MPDA 2XGQA 3F56A 1VFJA 2IDLA 2Y1JA 3E51A 3NS6A 1OY6A 3NNAA 2AU0A 3BV8A 2EI5A 1P9YA 4NLQA 1EB0A 2DRBA 2FHMA 3GYXB 4HT7A 4ECUA 2YWEA 5GMKa 5EHHA 3Q8UA 2QN6B 3SQGB 2XULA 4CLTA 2DHAA 1SV5B 1RWXB 4OYIA 4C8MA 4JI8F 4KHPJ 2MZRA 1XJWB 3FQLA 4TXSA 4DSJA 4DPYA 2XLIA 1X60A 3FSIA 1NK0A 4K4ZA 2E1AA 1LXJA 4ILLA 1GQEA 5A8WB 2J6UA 5CXTA 3FGVA 4GVLA 1IR1A 2W7AA 4LR7A 4YHHF 3K59A 5KFKA 4BC9A 1UAWA 1S97A 2V63A 1RISA 4M5MA 4EFAC 1KTVA 3IR6B 5B0FA 1M5SA 2XSJA 3RRKA 3DRPA 3QIDA 1I5OB 2MZQA 1DZ5A 3QRQA 4UZBA 2AJQA 2HBQB 1WWHA 3T1AA 2OLWA 5AJ3F 1LNQA 3V4MA 2WOMB 1IBLJ 2DNHA 2HHSA 4JI7J 1FNOA 1Q8KA 3QLHA 4HYKA 2W2OP 2VG5A 3U1LA 2N3OA 1L3KA 2BW7A 4IR1A 3DRXA 2KTQA 2OFGX 2UUWA 1NDPA 1YJNS 4W4MA 1VGYA 4ZLNA 3MM6B 2HQIA 5KFSA 4TNOA 2V4RA 1HD1A 1HMVB 3IXQA 1RLDA 3G6ES 2YWHA 2Y8YA 5HBMA 3FBCA 1FJCA 4TKTA 2J9CA 2LKZA 1F2GA 4DZDA 1JLCA 2L9DA 4JI8J 3EPGA 1RHKB 2MEWA 3K5OA 3I0RA 4ILMA 4CLWA 2N7YA 2DPIA 1Q86T 1P27B 3QRPA 2HFVA 3BN7A 1MU2A 1RSCA 1B4SA 3JSBA 5A76A 4MYUA 1JNZB 2WVBA 4DV3F 5E3PA 3OXLA 4YHHJ 5K20B 5CYMB 2AWZA 4OHVA 5HP1A 2ZNZA 3EDRB 3GCWP 3R5GA 2Y1IA 4B3OB 1OSCA 3EZOA 1IVZA 2OPSB 4Y3CA 4Y2IA 4DX8H 1SQGA 3Q8VA 4ERDA 3S6EA 2DIUA 2RH3A 2HS3A 3RR8A 2AW0A 3FFIA 4PCQA 2EEYA 3CJ3A 3JYTB 4O44A 1VOMA 4OI4A 3DKDA 1LWFA 3THPA 3FEZA 2ACMA 2R8IA 1GXTA 3R97A 2BR0A 2L41A 3RZAA 2DNNA 4IOCQ 1ZM4A 3PZPA 4ZKAA 4FVMA 3M8QB 1R31A 4TYBA 4K7QA 3GIIA 3DLBA 1X4BA 4P7TA 3W60A 1WELA 2E9RX 4R8UA 2A10A 2FZKB 2WW4A 2EFGA 1VQLS 2OEMA 4ETZA 3OL9A 3DLHA 1G4CA 2ALYB 1GK8A 3BPDA 4RW9B 8AT1B 3E01B 1RE1B 2KFYA 4I1TA 4K2JA 1VLOA 1P9QC 2XMJA 5J2MA 1J2VA 1VR6A 2COLA 3TEGA 2HS4A 5HLFB 3KHHA 4IYQA 2XLKA 2H1YA 2ZHBA 3CMES 4DV3J 2CQGA 3IC1A 1HBNA 4NLRA 1U26A 5KFHA 3PY8A 4Q2LA 2EFOA 1X9MA 3C6UA 1TL7A 4ZPAA 4J9QA 2DYAA 3ZNJ1 1RACB 3QPIA 3G87A 4BCAA 2GIQA 4J9RA 4JV0A 2ZZNA 1GAOA 1XN9A 5HSPA 3J81Y 3OVSA 5A6WA 1NSPA 4U7UK 3NOGA 4NLOA 1WKKA 4NOHA 5BXIA 1X5PA 1SUQB 2CG8A 1T3NA 3BR8A 4QYZK 4ZOSA 4OI2A 5KFBA 2DRDA 3BGRA 3ZZ0A 2FJBB 3P6YC 4ZCIA 5KG0A 2CQ0A 1WHYA 2MKIA 4K4WA 1S1VB 1ICEB 2HWTA 2I0XA 2JNJA 3QZ8A 3U1NA 4N76A 1S7IA 1GXLA 3A3OB 3HKZD 1KTQA 2BVZA 2FHKA 3Q2SC 2EG1A 2FJXA 4N8NA 2AD9A 1REVB 2WZ1A 3PKMA 1N56A 1WC3A 2CJBA 3HX9A 3PYFA 2MYFA 1UVNA 4PXCA 3U1MA 1JJ2R 2E9ZA 1O6XA 3GV7B 3UCGA 3E2EA 4UF4A 2GNKA 2YNFB 4ZIVA 4OFZA 4HH1A 3UDVA 2LEBA 4RUAA 2IFXA 3GJTB 3I4HX 3QT5A 1CLFA 3M6VA 2MZTA 2J0XA 2BM1A 3KUHA 3CD0A 1N32F 1MN7A 3AD8C 2M88A 5CYJA 2ZITA 3MMCA 5K14A 2VDHA 3B4MA 3POTB 4KQZA 5DG8A 1NH8A 1S1UB 3MMAB 5KOWA 1LEOA 3A8IA 2HKEA 2VFVA 5B0GA 5GAEU 2KG1A 1V5VA 3BDEA 2A3JA 5H9FK 2WSCC 1RYRA 4DQIA 3IN5A 1OQ3A 1G1XA 3VCDA 5LJ3Y 4USWA 5FLXY 4K5SA 1HNVB 2WAQD 4DL7A 1FKPA 1RZMA 2YWWA 4EBEA 1RA7A 3QWUA 3TUZC 1QVGR 1I51B 4IFYA 2RSQA 4Y00A 3W9IA 2ZWPA 4QBUA 1SQFA 4EI2A 4X65F 5IOLA 3FK4A 4NCGA 2VZ9A 3M6UA 3MD1A 2R2RA 3O2IA 4X66F 3J80Y 2FHJA 2NXEA 1RHUB 3MEEB 3DC2A 2M4MA 4J9PA 3BM7A 3B4DA 1RAHB 4XAKA 1TL1B 4QWCA 4A8FA 1VISA 5B08A 2HHWA 4EWTA 1NK6A 1CC7A 2HZAA 1V9OA 3TZZA 2ASLA 5D0HA 4MTPA 2V2KA 1RT3A 4OJ3A 5HL7Q 4RW8A 3D28A 2A2CA 1S72S 3O6QA 2GHVC 3MM9A 4IDKB 2DNGA 3PHEA 4WWSA 1N32J 4I2PB 3R3TA 3T19A 5C25A 4WFYA 5HMXA 2V8VA 2WBMA 4OI6A 3ZNUA 1FERA 1SKSA 1JIHA 5GAHI 2Y0SD 4B9SA 3N28A 3QAUA 5GAEI 1M5OC 3ZZUA 1HQUB 3OD2A 4CH1A 5JVHQ 2CXEA 1Y11A 1R8HA 3DYAA 4FNIA 1T94A 2YBVA 3MMBA 3F0NA 2CNLB 2KT5A 1C1CB 1E6YA 4C3LA 3CTRA 2RU3A 1C1BA 3OXFA 4DV7F 5T7LA 2HLTA 4FF3A 2IC3B 4X65J 2WSEC 1HBUA 4GO5X 2UXCF 2JZ5A 2X1AA 1V5IB 1N36F 4ZPDA 3A3NB 3A12A 4X66J 2BQRA 1Q8BA 2H4YB 4YMEA 3MUTP 1RTIA 2DO0A 4FBUA 2DGTA 3HSGA 3N01A 1FRLA 3VZIA 2LXFA 3F41A 3J81U 4K4YA 4M5DA 5FDLA 1PO6A 4AE5A 2YX7A 2LQBA 1B7YB 9ATCB 4WZQA 7AT1B 2XYGB 3Q24A 5THWA 2MKSA 1CJKA 2MQMA 4C0BA 1HLWA 2WB1D 1T9UA 3P45B 1ZH5A 4I0WA 3MR2A 1TELA 2MJUA 3CE8A 3V6DB 4XDCA 2IA0A 1NZAA 4NLTA 3Q23A 1IWGA 1WHXA 3MEDB 2VF3A 4QQBA 2HGNA 3RRHA 2HNDA 2BOAA 5DGBA 2H51B 3DGPA 2CG4A 4KH1B 3OTCA 4UT4A 2FGOA 1TMJA 1W26A 4BLGA 1WHVA 1ULRA 3HSJA 4ZVTB 1RT6B 2JC0A 2ZBPA 3FC9A 1BC6A 4DV7J 4KE5A 1REGX 2RQMA 4CO3A 4I7FA 1T9WA 3C46A 3HJFA 2UXCJ 1SKUB 3L7OA 1VQ8S 4DG1A 1N36J 1GTHA 4DR7F 2ZHOA 5EX3A 1FRMA 3IGVA 5J1PA 2DXDA 2CPDA 4C3MA 5DZ6A 3GSDA 4WXOA 4F4YA 2RQKA 5IM0B 4M5KA 2PN6A 4M1KA 2C3YA 1OY8A 2OSRA 3BDPA 3OTBA 1I1GA 2QMWA 2DR7A 5HANA 4YB1P 5FLXU 1CQMA 1Q7YT 3QZ7A 2IIHA 2RRNA 1H73A 2QO3A 4R25A 2XNRA 4UUWA 4FDFA 2Y3YA 1S6QB 5DDRC 4YDXA 3KJFB 3MM8B 1TKZB 3W9HA 3HP6A 4CLSA 2VODA 4IH7A 3DOMA 4TY8B 2OTJS 4Y65A 1URRA 2DH8A 1YQHA 4O23A 5CCMA 3ZTQA 3CW2C 4U67Q 3JQMA 1X7VA 3M8YA 2D3OR 1D9DA 4MH8A 1HBOA 4KR0B 4P6QA 3LF0A 4P2XA 3M32A 4P2MA 2B7BB 4DR7J 1OQ6A 1RU2A 1URNA 4YN3B 1DQAA 3W8GA 2ERRA 4J9SA 1NEEA 3G4SS 4JYAF 3N6MA 4X4SA 3BGLA 3RG6A 2VJVA 2F4FA 4M5IA 4JI6F 3CPWR 4PXEA 1EQMA 2R7VA 4PZVA 4F50A 3SQGA 1SV5A 1YWXA 3PYDA 4AL5A 1AW0A 4OHZA 2OI2A 3SCJE 1HHQA 1FRKA 3JSMB 1XR7A 2MQNA 3R27A 1CVJA 4LF5F 2WBRA 2VIHA 3I6PA 2V2QA 2HVZA 3BZQA 1KP6A 3QGHA 4PEOA 3OHBA 2VOPA 2DNOA 4WYWA 3IBFB 1SJRA 5HATA 5A8WA 1TK5A 1M5PC 2C2DA 2VBYA 1G3OA 3LGMA 3RUBL 1YZ6A 2UZAA 4PAAA 2R7XA 4DEZA 2VOOA 1S49A 1NHVA 2A0FB 1KHWA 2YKMB 1WDDA 1SPBP 5I3QA 2H5EA 1HHTP 3I5AA 4LF7F 3PX0A 2QL9B 3QYYA 2C2OB 2WOMA 1QY7A 4OI3A 1RAOA 3LP1A 1R27B 5B0BA 2MDAA 5HVGA 2AZ3A 1QAYA 4DLEA 1PYSB 4G6VB 3TX8A 4GC7A 2GFFA 2AGPA 1M0SA 4Q8EA 2FJAB 3LAKA 3KOAA 5LMUF 2HIYA 3D7SB 2BX6A 2A1BA 4JYAJ 1RTJB 3DDIA 4JI2F 3R5DA 1HMVA 4WKYA 3VWSA 1PG5B 3KLHB 1JNRB 5A0YB 2QLWA 4RL1A 4F4KA 3GYNA 4DFMA 4HT5A 3RW7A 3HHLD 1JLEB 4B9VA 1FJEB 4BWMA 1Q7LB 3AJ1A 4LF5J 2E1RA 2X1GA 1TTHB 4QCLA 3GMGA 1WORA 2ALZA 4FXVA 1RHRB 2APOA 3ENAA 1AUSL 2G13A 4KC5A 4F04B 5L9XA 4YB6A 3BGOP 3Q83A 1D9AA 4LRBA 5CYMA 1FT8A 2Z58B 5CD4A 4A8KA 1U45A 4B3OA 1DAXA 2B56A 2AYGA 3TR5A 1NPPA 2OPSA 4KGXB 4A8XA 3EVWA 3QMQA 2J8AA 2F9DA 5CCLA 4LF7J 5I4MA 4CNZA 3M1VB 4U8VA 5KT5A 3JYTA 4I6AA 4DPWA 1FA0A 4JI5F 1R3NA 2XQCA 1S1WB 2DNPA 4C4WA 3PW5A 2G2ZA 2XSFA 3DRSB 2XNQA 1C0UB 2PE8A 3G71S 3M8PB 3GIMA 2MMYA 3CVKA 5E0OA 4K50A 1LXNA 4WXWA 3MEGB 5LMUJ 4XPCA 3M8QA 2VQFF 2H48B 4WZMA 1SKWA 3O44A 1NKEA 2WK4A 4JI2J 1NRKA 3IR7B 1RWOB 2HAFA 2LYVA 5DG9A 2MKCA 1UA0A 4DSKA 2B4UA 2Q79A 5B0DA 4NXMF 3K5NA 2EFNA 2R9LA 4ZLPA 4RW9A 3E01A 3W5ZA 2FIUA 3PKYA 3O8WA 1KD1T 4CWBA 2BRKA 4X4UA 4F4WA 4O3SA 1U4BA 4YUDA 3BKTA 3NKYA 1GFWB 1X4CA 4NI2A 2B9YA 1MG7A 2X3GA 1RBAA 1AUDA 4G1IA 4FYVB 5HLFA 4I6YA 5B09A 4CO2A 2POKA 4NMLA 4RUCA 1RBOB 3DMJB 4ED0A 3OSPA 1Q5YA 5IT0A 3K5LA 1X4GA 2L3MA 2ZDPA 3RGIA 5LMNF 4X64F 2YXLA 2KG0A 3S1TA 5KFNA 4F25A 1MMDA 2XYPB 1C4CA 1VJWA 3CDAA 1LWEA 2H4WB 3OXGA 1Q82T 1IR2A 1UEKA 2JWNA 2W2PP 4PWUA 1UVJA 4KPCA 4LMZA 7FD1A 2M70A 4JI5J 2DISA 2ZD1B 1PBUA 2PA8D 3CCWA 2RF2A 3ELHA 5KFZA 2GZOA 3FNNA 4MAKA 1JJCB 4CZCA 2VD3A 3MM7B 1U7LA 4AL6A 2VQFJ 4PG6A 1S1VA 3ILLA 3EPIA 3A4TA 1ZPVA 2I38A 1RQ0A 4LF2A 3LP2B 2E66A 4CT8A 4E0DA 3ZXWA 2LQJA 1QSSA 3GV8B 1EX8A 4NXMJ 1HD0A 3C14B 3GR1A 4OJGA 4USJC 4OLPA 2YNHA 4K4TA 4I6WA 4ECRA 1BQMB 2F8EX 3R1HA 3D4JA 3WX8A 3DNCA 5D77A 3KG0A 2B8QA 5CQGA 5L8RC 2HVEA 4DMZA 4OX6A 2PC6A 5FIIA 4BDPA 2MQQA 1IKXB 4PKDB 2YNFA 1MSWD 4LR9A 2AX0A 1SL0A 5DQGA 4WTYA 5LMNJ 4X64J 4QW9A 2IM0A 2CYYA 2RHQB 2XMWA 2NPFA 2DGVA 1AT1B 5LL6d 3M05A 2P6TA 4ZP7A 1G7CB 2BXJA 4NRTA 4LVOP 1SQEA 4H4MA 5HQLA 1F9FA 1C2PA 2O01C 2VJUA 1S1UA 5IV3A 1VRQC 1SXLA 3MXHP 2NCKL 2EG2A 3KK3B 3LPEA 1EAYC 1UW9A 5CABA 1LK5A 4KBIA 2V2VA 2DEJA 4JV1A 1PILA 1OPZA 1BQNB 2OEKA 4DCJB 2NSBA 3OTOF 4U8YA 1HNVA 3FBBA 4IOBA 2MKYA 3DCAA 2EW9A 1WC1A 1MWQA 3LTOA 1JLAA 2GQ2A 3MUVP 1SL1A 2F63A 1UWBB 5KFWA 1FWLA 4Z37A 1RTDA 1FTCA 1AA1B 3GQCA 2C3MA 2V4JB 4PWWA 4F36A 2PSZA 3OTEA 4CO1A 3WC0A 3MEEA 4ZN1A 3RRGA 4WE1B 2D74B 2MLZA 1TL1A 5A8KB 4MT1A 1Q16B 2R7SA 1FKOB 5LSRA 3QO9A 3NMAA 3GU0A 4C98A 1L3UA 2ZDOA 3UNGC 4NLVA 3ULHA 1QUVA 1WOPA 2QE5A 4DPXA 3GFHA 3AT1B 1NDLA 2RQCA 4Z7CA 2WCXA 4ZCKA 4J9MA 4IDKA 3BYRA 2R2UA 1S9FA 4DQPA 4L72B 5C24B 2AT1B 1WEYA 3HCXA 2FPHX 1TV6B 3ZO7A 5HMWA 4I4BA 3US5A 1DTTB 4OMFG 1IBKF 1VLYA 3O5TB 3L3CA 1ZS6A 2UV8A 4DL6A 2LU2A 4IOAQ 4NE9C 2JRSA 2R8JA 4K4XA 1WF0A 3D6HB 5ADZA 2W2QP 4PXBA 2XLJA 4HH0A 2IJFA 1YJVA 1HQUA 4CP5A 3OTOJ 2HW3A 5H9EJ 2XGPA 2DO4A 3GG1A 1DLOB 1GT8A 1T11A 3GG0A 5IWAF 3ITHB 1TL3B 1C1CA 3M30B 3B6BA 2JC1A 4CM2A 2J76E 4EO8A 3T6BA 1RP5A 3KLFB 4P73A 2O3DA 2QZ8A 2RDDA 4DUYF 4YQWA 2HPUA 1PKUA 4M5GA 3S8SA 4LF1A 5J1EB 2F8MA 4GKKF 1TU0B 3G96A 3ZTOA 4B3SF 3K8VA 2YWGA 4MMOA 1XWLA 2UUTA 4FF2A 2VPZB 3IM9A 1TAUA 4G1PA 4MKVA 4Q8FA 4QPTA 3R6GB 2DNYA 3RBDA 3N0VA 1QE1B 4USUA 3TANA 3OL7A 2I2YA 5D3GA 1X5OA 2MHNA 4RW7B 3KG1A 2NXUA 3JB9k 3IRXB 4CI0B 4OZ1A 1K8AT 4ANCA 5ITHA 3KLGB 1RHJB 2WHOA 2P8IA 4K5RA 1IBKJ 2BE9B 3AOCA 2VA3A 2V50A 3ZZTA 2D1CA 3MDFA 4RW4B 3V6DA 1SH3A 5HMYA 1N6QB 2HFNA 2W9BB 3MEDA 2XMTA 1IJFB 1BUXA 2NYIA 4KRWA 4DX7A 2L48A 1R8AA 5KT3A 5IWAJ 2ABYA 1A6LA 1GEHA 2GX8A 1HWIA 2JEJA 2X3DA 1VMBA 4ZHRB 1RT6A 4NLYA 4QIGA 1PBAA 4DUYJ 4U7UD 1WEXA 1ZTTA 1EHWA 1DFDA 3DRRB 4FN5A 2KB2A 4X84A 3CCLS 1Q1KA 5K8NA 3ONQA 1H6KX 4GKKJ 3PRBA 2MPUA 4B3SJ 2UXBF 3OFEA 5SZTA 3N79A 2NS1B 4QIEA 2AJ1A 2OAUA 2K3IA 2YKPA 4DSFA 1LQ9A 3ZZRA 3D67A 5IM0A 4Z2XA 2ZKUA 2G1DA 3IBWA 4WU3A 3H5YA 3WIVA 1YIJS 4RNHA 4ZPCA 1UJ5A 4DBQA 2A6MA 3I5CA 1NB2A 1Q8LA 4Y2AA 2C3PA 3H7HB 4DV1F 2BKPA 1Y5LB 3DM2B 4ZCLA 3JTOA 3W2VA 3PX4A 4QWAA 3AA8A 3PM9A 2ROEA 1YJ7A 2HWIA 4Q0BA 3FJ2A 1KONA 2NREA 2HNZA 3K5PA 4UQTA 4W98A 5HMZA 2G0JA 2BRLA 4OX8A 4P2SA 3R7NB 3EICA 4XPEA 1FJ7A 3H59A 3MEKA 1S6QA 2IJRA 3MM8A 4WFBQ 4ZPTR 1TKZA 2B5JB 2LVWA 3AA9A 1UPPA 3VAJA 1W2IA 4TY8A 3I4PA 2Q66A 2NSCA 1R89A 2YQ1A 4HACA 4GKJF 4TN2A 3QGPA 1LW0A 3CCSS 2QLXA 5HJXA 2RD5C 3T9NA 1RAAB 2UXBJ 4DSLA 3IR5B 1W25A 1OO0B 3MGJA 1SJFA 3WIUA 3CCRS 3HHNB 2E7XA 2MGZB 2CNOB 4N7TA 4Q5VA 2L9NA 2XY7A 1Q78A 3HHLB 3NNHA 4DR4F 4A8OA 1UJ4A 4C2MA 2V5HG 2V9WA 3I9V9 4ZN3A 5K8MA 3OL6A 2ZJQQ 2MY7A 1UKUA 1OS5A 4A8SA 3BPSP 4HR2A 2NPIA 1HNIB 1RCXB 4DL0C 3JSMA 3AY0A 2B8PA 2VA2A 4CLLA 2GCFA 3QT8A 1SIZA 4DV1J 4OI1A 2KN4A 5D4OA 2IMOA 1WACA 4LSZB 5KFCA 4DX5A 1Q53A 2JX2A 3GFYA 3MPYA 3N5BA 1VBZA 3ET6B 3MAAB 4LIRA 1LWFB 3MD3A 4B9LA 1UEVA 3DN9A 4IO9Q 2M5YA 1VQMS 1U1MA 1LKZA 1VQYA 3BQ1A 2CPIA 3LP0B 2YWFA 1RAFB 2FTRA 5J2QB 2UVRA 3CULA 4L75A 3CDEA 4RKUC 4DN0A 1YBUA 2G9OA 1QDUB 2AEFA 4ILRA 1DTQB 4LF8J 1KOOA 1VQ9S 3QRRA 2K2PA 4CYUB 3DI6B 3VV2B 2ZBQA 2H5JB 4GKJJ 1BHNA 4K4SA 2OP5A 2WVCA 4WFNQ 3FZBA 2YPYA 3SEOA 1NJIT 4LT6A 3UQSA 4RBUA 3H2LA 2QRRA 5DDOC 2L9WA 1FVSA 4ECTA 1N0UA 2XYHB 5L9NA 1RTJA 2BKNA 2DY9A 1U48A 3TOQA 1MW7A 1MMNA 3KLHA 4DR4J 5A0YA 2XZDB 2X1FA 2DGUA 3MFIA 5F8IA 2OHDA 2DR5A 2E1CA 3HVRA 2C2MB 3KUGA 4HI2A 1U1QA 2CNNB 1Y10A 2YNIA 3MCOA 1WD6A 1FXDA 1JLEA 1TKDA 1NNDA 4ER8A 2V4QA 4KSEB 1RT7A 1SH2A 4RUHA 2VG7A 2Y0BB 1WSRA 1JLQB 2FZCB 1WI6A 4FVCA 1KFSA 5AXKA 1HWJA 3GJSB 3PIOQ 2BV3A 4HTIA 4R5PB 2HVHA 4LRFA 1WG4A 2QV6A 3MR5A 3VHQA 2ZUGA 4F67A 3BGRB 4F26A 3UVJB 2W7PA 3TUPA 4M95A 4OQJA 5F3ZA 3BKUA 2CJQA 3GPAA 3C15B 1TK0A 2UU9F 1XMQF 6FD1A 4PRFA 3QFWA 3M1VA 2MQPA 4DL2A 3CO0P 3C3LA 4NA1A 5IQQA 4C9DA 1GTEA 2VUGA 3D68A 1S1WA 5E33A 4NLXA 2RRBA 3OLBA 3DRSA 2FVCA 3QNWB 2NZCA 1C0UA 2CQPA 2AGQA 2KRBA 3M8PA 4FPIA 3KLEB 4NEZA 3MEGA 4ZPWR 2XY6A 5FD1A 2I5JB 4Y2MA 1ZM9A 1NB7A 2V8DA 4IR9A 1F9HA 4YR2A 1T02A 2AGOA 4Y0FA 4WFAQ 1XMBA 5CZVA 2ZE2B 1HNXF 1Y4ZB 1UMJA 2EK6A 4WFXA 4IKAA 2UVWA 4LBIA 2QT7A 4E98A 2OTLS 2Z30B 1UVKA 1N5TA 5DRKA 1FFGB 1VQPS 1ZAWA 2KVQE 3IAS9 4YEAA 3C19A 3LA0A 5SUHA 5KFRA 4RLEA 2QEXS 2Z0GA 5GVQA 2C42A 2AMCB 4X62F 2IHR1 3DMJA 4YR3A 1AFJA 3LQVA 3SZ2A 3CD6S 3H5XA 2R8KA 3H8YA 5BYSA 4H4KC 5KFAA 3PVXA 4BWJA 2UU9J 1XMQJ 1TZ0A 3MI7X 2E5IA 1KQFB 2HLUA 3W8PA 4X4OA 3PDNA 1UJ6A 1YJ9S 4FPRA 4CLFA 1XR6A 3AQOA 2P6SA 4OYXA 3RB6A 3G6XA 3W3SA 2ZD1A 4DUZF 2N7CA 1ZAXA 2CQDA 3N6LA 3QT6A 3CJ2A 2IRYA 4ED8A 1RBLA 3H40A 4C8ZA 2HEKA 1RAGB 3PW4A 4HHHA 4ZVEA 3TA2A 2BE7D 2ZVSA 4QW8A 3EZ5A 3LP2A 1KS2A 1U1OA 2FJWA 4PG4A 3D1HA 3M7VA 2V69A 2KT3A 1UL3A 1HNXJ 1BWEA 3C14A 4H4OB 1H38A 1BQMA 2ZFHA 1X5TA 1O0PA 3R5CA 3UDLA 2MKHA 1H2VZ 3QJJA 1IKXA 3VQSA 3GB0A 2WVDA 5IFMA 4DPTA 4X62J 2YX1A 3CF5Q 1JLGB 1L5UA 2GV1A 1IR0A 4WYLA 2MB0B 4BBYA 2KFZA 2HGMA 1IBCB 2HVDA 2DHHA 4UOGA 3VGSA 2K8GA 2HAIA 4HI1A 3T3FA 2FB0A 4PQUB 3TJ8A 3IO1A 2VB6A 2MQ8A 1HBUB 2J9EA 4RO0A 1NPRA 1WC0A 2FLLA 3P8BB 5DQIA 3KK3A 4OJHA 5HI7A 4DUZJ 3TRGA 4B9TA 3GP9A 2EVZA 2AYEA 3BO2A 3IRWP 3ETOA 4LIWA 2ZBIA 2GVZB 1TK8A 2MKKA 3LWMA 3KNAA 3NGDA 2B9WA 1IKYB 3P4UB 1I94F 4CRJA 2NZ4A 2ZH9A 1UWBA 3MCMA 5D0RA 3L4BC 1S0NA 2ASJA 2DD8S 2H54B 4O3RA 2QFIA 5KFPA 4DX6A 5J2NA 3UR3C 1XC9A 1FX4A 4WE1A 2QLFB 5A8KA 2CQIA 1FKOA 5F41A 1AYEA 1BLUA 2EXUA 3A8KA 2M52A 1VC6A 4OHWA 4ICLB 1SVDA 3OR1B 1HA1A 3DHXA 3CJ4A 4J5OA 1FHTA 2RILA 3BJYA 5DETA 3VAFA 2CRLA 1SBRA 4RBVA 1T8EA 5C7PA 1UW4A 2OPPB 5ETSA 5C24A 4RU9A 3TZYA 3TA1A 1SJ4P 1TV6A 1B7FA 4CH7A 2DNLA 3JTNA 1DTTA 3PNIA 3QIPB 1ACMB 1U1RA 1JLBB 4DR6F 3IFEA 3HXMA 2ZH7A 2LP4A 1XTZA 5MAOA 3QWPA 1T95A 4MJKA 1HNWF 1APSA 4Q2MA 2PI5A 3TI0A 1T9VA 4CO0A 4N5SA 3QJLA 3L95X 3MPUB 3W5YA 4P74A 4TVAB 1SH0A 2CJAA 1DLOA 4FZVA 3ITHA 4F7VA 1TL3A 3FDSA 2Z2MA 3M30A 3SBMA 1RTZA 1I94J 2VFSA 2JL9A 1F60B 1FRXA 3G9CA 1U1PA 4DUTA 1LK7A 4ZVSB 4YY3F 3NGRA 1OJ4A 2E5HA 5J1EA 4UZCA 1RAJA 4CT9A 4C48A 4TQSA 4KHMA 3TWZA 3X3UA 1MROB 4TU9A 1HIYA 2A2DA 1VQSA 2LFVA 1QE1A 3VVUA 4NXNF 4CLYA 4J9VA 3EVMA 2C3OA 1ZZNA 2ROPA 3KJVB 4LRAA 1Y00A 3TJ9A 3UDEA 4RW7A 2J7KA 4RPFA 1VQ4S 4FS2A 1UP1A 4WP9A 1YTYA 3L7UA 3IRXA 4JI4F 1BXNA 3KLGA 3FEYB 3QGIA 2DCUB 4TQRA 5AE2A 1WC6A 2G2OA 3GR0A 2W8KA 2YKNB 3UN2A 3HSDA 4ZVPB 2XWXA 2DGOA 2HRYA 4RW4A 4DI6A 4DV2F 4JBCA 1HNWJ 1JJ4A 1HBOB 5C2GA 2CPFA 1N6QA 2W9BA 3M32B 3KXDA 4HEA9 4HVZA 2QLBB 2CPYA 1FK9A 3DGVA 1U0HB 2HHVA 2MTLA 1U8WA 4WBFA 2KL8A 3UPFA 1FI4A 4ZJOA 3HHDA 1FJGF 4ZHRA 2XMUA 5JJBA 3M4XA 4DCPB 4MFBB 2HGLA 2BABA 2QG9B 4YY3J 1AZSA 4K2XA 4X2BA 4USTA 3DRRA 1X4AA 1CULA 4DV4F 1B0PA 2F40A 2LDIA 4EBCA 1T3OA 1OYDA 4AQYF 2YVSA 2KU7A 1NO8A 2GJ2A 3FMBA 2YQ0A 3R5AA 1MLAA 5ETOA 3DRYA 1FE0A 1KQSR 2CKWA 4OX7A 6AT1B 3AAWB 3K8WA 1RHQB 2FVSA 3N5FA 5JMNA 2VBZA 4CH0S 2RRAA 2FJDB 3DOLB 3IGNA 3DLKB 1RT5A 5KG3A 2HMIB 2HRTA 3CJTA 3WBZA 1RTHB 4JI4J 3U27A 2Q43A 1HHSA 4WKRA 1FEHA 3Q2TC 1GMWA 4C8KA 2J9DA 3DM2A 3VGTA 4DFPA 1WC4A 3NAIA 1YJRA 3LP1B 1NK7A 3AOAA 1U6ZA 1Q81T 2U2FA 3IMQJ 5HAOA 1M5VC 4B17A 2E5GA 2ZH5A 4DJBA 1D1UA 4Q7AA 2V6AA 1RU1A 2YWKA 4DPOA 2MQOA 5K9FA 3THVA 2CQBA 2DHSA 1JWWA 3OBIA 1CBKA 2RS2A 3DOKB 1SC4B 1HWKA 5D4PA 2KM8C 4OZ3A 2R7OA 4NEYA 4QR1A 3CCZA 3T5LA 3HKWA 2B5JA 1AB8A 1GXUA 3P96A 2JLFA 4ZJQA 2KXFA 5F9NA 3GFZA 2XI2A 4FF4A 3NRBA 3MZIA 1WG1A 4DV4J 3KLIB 2KO1A 2ASDA 1X4FA 2W9CB 4ECVA 1F3VA 1X31C 1H72C 4AQYJ 2V34A 3H0PA 1KHVA 5LJ5Y 3P3DA 5EWGA 5KG2A 3GFXA 1WDTA 2MGZA 4X4TA 4WU2A 4DV6F 4ANDA 3JQJA 3P49B 1XEZA 3HHLA 3MURP 3DU6A 4QWDA 3ZZZA 4C97A 4C11A 4NL5A 3KUEA 3AD9C 3TUJC 2P9EA 5DDQC 3MOJB 1HNIA 3SCLE 3AXKA 1L3SA 5AJ3J 4WK1A 3GE9A 2QGFB 4IRCA 4CLKA 1KEKA 1Q5VA 2G2YA 4FYWB 2M9KA 3ET6A 3MAAA 2QTWA 5G0RB 2LQ8A 4O4GB 1RAIB 2JDJA 5AXMA 4ZPVR 5F0WA 1Z2ZA 1SC6A 3QBCA 3UN5A 3NGTA 2BJ9A 3LP0A 1U25A 3EVOA 5JUMA 5J2QA 2CQ2A 1F5AA 1BE4A 1DTQA 2O5DA 1H98A 4Y2CA 1UZDA 2DNKA 4CYUA 3DI6A 2CZ4A 4HDGA 2FJVA 1K73T 1FDNA 2JSXA 4P75A 2AJ0A 3W2WA 2EFQA 3OW2R 5HN0A 4OJ1A 3T9ZA 1VRTA 4ZIWA 4OI0A 3PX6A 4LFBF 3CJ8A 4OZJA 3G8QA 2DBBA 3IAM9 4PG5A 4AL7A 4NI2B 1S9EB 4DSEA 4Q45A 2VBWA 2F1FA 2VL1A 4DV6J 4XK8C 3IG1B 2LECA 3KJQB 2W2NP 4L73A 4NRUA 5C42B 2VKRA 4NYPA 3RJMB 3LWLA 1UCNA 2RUSA 4MYTA 4HTJA 1LWEB 5GMEA 1VK8A 3UD3P 2G0IA 1GX5A 1KKHA 4JP8A 4EYIB 1TP7A 2VPXB 2HBRB 1UPMB 5EWEA 1JLQA 2HIQA 5MLCV 4W92B 2QC3A 3M9NB 2RF2B 3VZHA 3TQ1A 1YI2S 2B9XA 2WSFC 2KH9A 4Y28C 4R5PA 2AJFE 1EP4B 3UVJA 1FXLA 3BN4A 3I32A 4ES2A 4CLZA 3C15A 3R2DJ 3CCES 2CQHA 5HQMA 2D69A 4YB7A 3EDQB 4DSIA 1YVFA 4DFKA 3LANA 4M5NA 4K59A 2R7RA 5KG6A 5H9FJ 4FS1A 2HHTA 2ACYA 4P71A 1TKXA 2YNHB 1NUEA 2CA9A 1XR5A 3ISZA 4ITSA 3KTQA 4LFBJ 5CZXA 4ZP6A 4B9MA 3ILOA 3WZ0A 3KLEA 3GSIA 4KGVB 3H4DA 3P5TL 4PPDA 3W63A 2I5JA 5F8HA 2VC1A 2VFRA 4Y6IA 1HW9A 4ZDNA 2LQ5A 2ATLA 3NGSA 1OY9A 1J27A 3B82A 2D7SA 4I2QA 1NJZA 1S6PB 2ZE2A 5AE1A 3W66A 3PR5B 1NU4A 2QLJB 1QAJA 4KFBB 3OLAA 4H4MB 3PV8A 2R2SA 3CJ5A 2HHHF 2VV5A 4C3KA 3TZWA 1B3TA 3M6WA 4PYDA 3KFWX 3TAMA 2J8SA 3GJRB 1VIXA 2XCPA 3HVWA 1RADB 2PMWA 5E3CA 4M8LA 3QQCD 1R0BG 4I56A 3TO8A 4C0HA 2LCWA 3EZUA 1HWLA 2R2TA 3IBCB 3MWBA 1U2RA 2VPWB 1JLAB 1MN9A 1WI8A 1TUWA 4FKYA 4KGZB 2R42A 2FHOB 2IVMA 1RTDB 3AB2B 1Q95G 1F1BB 1NZ8A 4HDHA 3D3CJ 1NDCA 2VQEF 1CC8A 3V81A 3RAMA 1WTFA 2JEGA 1QD1A 4J9KA 2OO4A 5DS7A 4DS4A 2R7WA 3PW7A 2ILYA 3QO9B 2J0WA 2YPZA 5EUHA 2RAQA 5CA5A 1YSJA 2CWKA 3K0JA 2I8EA 2BA9A 4EZ9A 2DT9A 4USHA 2CJYB 4IG0B 3PXGa 3M2RB 1N34F 5KT7A 4H4OA 4QU6A 3HD2A 4I67A 3UW1A 2V2ZA 4UOHA 1S79A 3HULA 5F8LA 2CPHA 2HHHJ 4NZ6A 3AFGA 4QIFA 1VBKA 2W7OA 5EWFA 4QWEA 5D78A 4LBPA 1VBXA 5IS2A 2BQUA 5M2UA 1FD8A 1T7PA 4NZ7A 4DOZA 1R8CA 1SC3B 1JLGA 2YNGB 1KQKA 2NYHA 3FEXB 3Q0AA 2EFPA 4K4UA 3TYTA 4LSLB 3M9OB 3J7A1 3MAHA 2RJZA 1IKWB 5D0GA 4PQUA 3WC2A 4IRKA 3BB5A 3CJ0A 1FKAF 3E8OA 1VI7A 3HMJG 3I87A 3SCIE 2VQEJ 2XTJP 4DF8A 3TQEA 4C8LA 1F5BA 2GHPA 1XIQA 2BE2B 4W90B 4B08A 2GVZA 1FCAA 2X1BA 4L76A 2CJ9A 2J0SD 1R6YA 1IKYA 3AXMA 1WF2A 5D3GB 2VH7A 5AE3A 4DU7A 3VR1A 1QTNB 5HVHA 1Y7PA 3RU0A 2D3O1 2IAJB 2PFFB 2XHWA 4KT0C 1N34J 5LSLA 4MIBA 1NHKL 4FYYB 1S59A 1QJHA 1Q4RA 3S01A 2XMKA 1P1TA 1UETA 4JV5F 2I1RA 1Q8IA 3RAXA 1YBTA 1VC5A 2BKOA 2XO7A 3FSYA 1ROFA 4NX9A 3J81j 2ZH8A 4MK9A 4YS2A 1DRZA 1PAUB 3R6LB 2NXNA 4ICLA 3J7ZT 3OR1A 2C28A 4U6PA 4OYMA 5ETPA 2CAJA 2RS8A 3HVAA 2DGWA 1S9GB 1YDLA 2OPPA 4RJVA 2DHGA 2EBEA 4AUKA 4PPZA 4ID5B 3QIPA 1X4EA 1JLBA 3SI8A 1O8BA 4OYBA 2HBZB 1HBMB 4ECYA 4ZVFA 2XHCA 2DH7A 2KVIA 1U47A 1NK4A 3BQ0A 3OQ2A 3Q8SB 2X7IA 1EQ0A 2FUG9 5H1SV 1UTAA 5L1KA 4F4XA 4ED1A 1X9WA 3BYPA 3VGUA 4YFUA 2ZOFA 3UO0A 3NCQA 5KAKA 1SJQA 3Q8QB 4LFAF 4ED4A 4H54A 1LV5A 2FLPA 3FMWA 4OZ0A 2OJ3A 1WUUA 3EYZA 3OFFA 5IT4A 1NJYA 5J2PB 3W2VB 1NH7A 1MROA 2ZJPQ 4ZMMA 3Q8RB 4Q0BB 4JV5J 4AD6A 1KNZA 3G8TA 2V94A 2E1PA 2Z56B 3M8ZA 2HNZB 1ZYQA 3PIPQ 4JOUA 1S99A 3VAHA 3H25A 1YX2A 3KJVA 2IYIA 2DK2A 2HNYB 2J7WA 4KY3A 5CD4H 2FJEB 5KG4A 3AQPA 3TAQA 2GHWA 4QWBA 3J80U 3DFEA 1QSYA 4B3MF 5ETNA 1H7WA 2F8HA 2RU9A 4O3NA 1FX2A 2C2ZB 1EIYB 2GS8A 5KT2A 2YKNA 4HACB 1N54B 2OEJA 2PMZD 4CTAB 1LW0B 5B0AA 5HROB 1L3TA 4QIWD 1B99A 3I82A 2YX4A 2CIMA 3CEDA 3HDSA 2IJNA 1U0HA 3HVTB 5KFGA 4LQ3A 2BDPA 1GH8A 1R6VA 3PEHA 4U96A 1DURA 4N56A 4HKQA 1TVRB 4V19X 4LFAJ 1T9YA 2BYCA 4IQMA 1ZTWA 4MFBA 2GVDB 1FESA 2DGXA 2HK2A 4RZRA 4OHYA 2K1RB 3HT3A 2YY3A 2AEMA 3OFHA 1XNQF 1S1XA 2QIFA 2FQQB 2Z57B 2OMOA 2E44A 3ETMA 3ZZPA 1GMWD 3DLEB 2QSWA 3W62A 2YH0A 4P72A 1S10A 1RUSA 1HQEA 1IQTA 2NXCA 1N88A 1RWVB 2JEIA 5KFVA 1MMLA 1K1SA 4DZ6A 4ED2A 1FRHA 1T05A 3EJMA 2IMWP 2IM1A 3BH7B 2JH3A 2DY1A 5ETVA 3HHKA 3HFVA 3DOLA 3UI3A 3DLKA 2H9ZA 2HMIA 2E7WA 4KGKA 4UY8T 1RTHA 4Q43A 4B3MJ 2AP6A 2E9TA 1BMQB 3PACA 1FNMA 3TVKA 3KHLA 3DHWC 4F3MA 2I6WA 1TAQA 1RHMB 2OGUA 4N47A 2QYCA 1EJ7L 4TY9A 2IBKA 2CVIA 2V0NA 1YHQS 1T03B 3NCRA 2Z2LA 3GILA 4NA3A 3DOKA 1V3ZA 3SQOP 2CQ1A 3CCQS 5IV4A 2H65B 3EMTA 2M8DB 4JI6J 4KKOB 4RUBA 3G82B 2HQFA 3NEKA 2HQDA 5RUBA 2YNIB 3KKFA 2MHEA 3IM8A 3BSCA 2B0GA 1NDKA 2IDEA 4LBHA 1RT7B 4WP8A 1XNQJ 3KLIA 3R5BA 3HO1A 2VG7B 2QL5B 1VHFA 2ZH2A 2QA2A 2W9CA 2RT3A 3NLCA 4EUVA 2OH2A 1HI8A 5T41A 3M2VB 5KFOA 4FP9A 4LJMA 4X4PA 1R0AB 2ZH3A 2FY8A 2CPEA 3C66A 1PYOB 5KFIA 3DLGA 5KFDA 3ZTRA 3AOBA 2DB1A 2CVEA 4I64A 2MJNA 1JKHB 3CUNA 3T5KA 4RU2A 1U6FA 2DIVA 4NLPA 2NLWA 1KLNA 1DHMA 4GO7X 4HL9A 4PWDB 1QAXA 2QL7B 4ZVHA 3D1OA 4YDDB 5F9LA 5G0RA 4O4GA 4OLOA 2W01A 1G2EA 1WSVA 1NPKA 1JXEA 5D6GA 1YZ7A 4KJIA 5IQ6A 4KIAA 1NLKL 3Q8PB 5I3PA 4ALZA 4C0OC 1JQGA 4OL8A 5L1JA 2CPXA 3WQPA 2GGPB 5KFFA 2HG4A 1HR0F 2RVJA 3FBEA 2FGCA 4ZLLA 1OMSA 3ENQA 1WEZA 3R1LA 1N4LA 4ID8A 2DNMA 1S12A 3NG8A 3H42A 2VKZG 5I3UB 3GIKA 2O67A 4KO0B 2KI2A 1IQZA 1RLCL 1R43A 4F3OA 2ILZA 1S9EA 1ZA2B 1Y3KA 2VU5A 3CDWA 1K47A 4DPUA 3W61A 3SYZA 2CWXA 4LREA 2G4BA 3IG1A 1KLMB 3WDOA 3PRVA 3OV7A 1KVIA 2E1MC 2N3LA 3VGVA 3AH6A 2BM0A 3RB4A 2VICA 5C42A 3W64A 5EDWA 2AHOB 2IYGA 2YH1A 3B54A 1YITS 2DKOB 1U2CA 5EN1A 2RUGA 3H5SA 1U2FA 3FBFA 5CHCB 1RXOB 1EKRA 3BO4A 3M8WA 2UUAF 5DDPC 2W4PA 3PRDA 2EC0A 4FNHA 1EP4A 4G1QB 5KFUA 2KZZA 1U09A 1HI0P 1NBEB 2MZSA 3BH6B 1FFWB 8ATCB 2B6AB 2ATCB 1CQNA 4NPOA 1CSJA 1L3VA 2CUYA 1YJWS 3OHAA 4IRDA 1FNXH 1HR0J 3TVYA 1YBAA 1NK5A 1RWPB 4NMXA 2LEPA 4IFVB 2PD1A 1J5OB 2EPIA 4MIWA 4FXWA 4DCOB 3CJKB 3T6JA 4FYXB 1M5KC 1WOSA 1FFSB 4OYWA 2VFUA 1CJVB 1KVJA 1U49A 1AROP 3N4WA 1E6VA 2DXEA 1JXLA 3NWGA 4I68A 5D4LA 5KG7A 4DLGA 1N52B 4ES3A 2WVFA 4DDFA 1HFEL 1WKJA 3B8HA 1S6PA 3IP0A 3EGWB 1ITPA 2H3EB 3KMQA 4DR5F 2YKAA 3ZC4A 1H2UX 4CO5A 4KFBA 5J1NA 1AXQA 2DGSA 2J6TA 2R4FA 2EWHA 1RWKB 4NLSA 4F02A 2VFTA 4J9OA 3TX0A 2HS0A 2WVEA 1KRPA 4F2SA 1YGYA 3EGNA 5E3RA 2B4OA 3ISNC 1RAEB 1U1KA 2UUAJ 3FUYA 1KR4A 2ZC4A 3KDNA 3V4IB 4S0MA 3IWLA 2SXLA 2F65A 1PCAA 3PG9A 1TQLA 2D41A 2NXJA 3SDEA 4P10A 3PO4A 1VQNS 1VQOS 4USMA 3KK2B 5KFXA 4ZVQB 3NNCA 2KDOA 2IRXA 2B4PA 4ED5A 2QMXA 1XK8A 4B3RF 3O1LA 3KHRA 1B0VA 1H74A 1VK3A 5J2NB 4X4RA 3RB0A 3I55S 4ANEA 3PYEA 2DR6A 2ZWOA 4MK8A 5DG7A 3D9BA 1S76D 1JMTA 2R7UA 2UVUA 1DQ8A 2JVOA 3H2UB 4JI1F 5GAHU 3CNQP 1QVFR 2JJ4D 4I69A 4A46A 4ECXA 4IG0A 2FVQA 5D8HB 4RWWA 5ETMA 3OSNA 3M2RA 3S7RA 5LXYA 4DR5J 1OWXA 3RBZA 2QFJA 1F0XA 3LUYA 3F73A 1YK9A 2ZUAA 1NSKL 4JB8B 4K0KF 4OZLA 2JOQA 4O3PA 2Z2ZA 2YNGA 4J9LA 3KWMA 2XG8A 1KFDA 4ZVRB 4MKYA 4LSLA 3MR6A 2BEFA 2GQCA 2D9PA 3ZTPA 2G0CA 3OUYB 3VAGA 2L08A 5B0CA 1IKWA 5KFQA 4A48A 2QSFA 4OYAA 4B3RJ 1K9MT 4NA2A 3B78A 4UOCA 3RTVA 2HHUA 2NR0A 3A8JA 2BE2A 2XCAA 4XDDA 1EETB 1SJ3P 3CT9A 1NKBA 3MF5A 1DY3A 4KPYA 5B7WA 4QYRA 2PEBA 2BJ3A 2HFOA 3KK1A 1PAEX 3QGGA 3M8RA 4QPXA 4JI1J 4F2RA 3JQKA 2IAJA 1ZZFA 5AXNA 4DR3F 4IH5A 3RW6A 3MCSA 2KHDA 3HLUA 3SCKE 1U1LA 2XO6A 3GCXP 3K17A 2FDNA 1CJTB 5JXSA 3KLVA 2UUCF 5BYRA 4ZLJA 3PTWA 5ETQA 4M63A 3DLLQ 4K0KJ 4PABA 3PFOA 3PJWA 1P8GA 2JHEA 1LWXA 5KT6A 1FK9B 4OYPA 1RWWB 3VF0B 1CS4A 1RYSA 1YRTA 1S9GA 3DXBA 4CO4A 3JXOA 3SV4A 2LQ9A 2QA1A 2HURA 4ID5A 1X4HA 2Q6CA 2ADBA 4PG7A 1AZSB 1RK8A 9RUBA 2DPJA 2M0GB 1CULB 1HBMA 3PYGA 3D0IE 3FZ2A 1PC4A 1CJUB 3NBPB 2AQ4A 3QSYB 4A8WA 4M5LA 2EBGA 1ZPWX 5DGAA 2C22A 2Q6BA 3UDCA 4P52A 2F5GA 1DARA 2OPQB 2PEHA 2HFZA 1UVLA 3D6TB 1RT5B 3TA0A 4Y34A 1FWPA 1T0TV 4RNOA 3EGVA 2CZ9A 2XMVA 5L1IA 4DR3J 2OKQA 1D8ZA 5K8PA 1X9SA 1QSLA 5J2PA 1TFYA 3D0HE 1XERA 4AYBD 4IG3B 2UUCJ 2RKIB 5AT1B 3V6KA 4NLUA 1TR0A 1KVKA 3UD4P 2HNYA 3UFCX 4ED3A 1SC1B 2YKOA 3VAIA 2CNKB 4LSNB 5DLGA 1GX6A 1VRUB 3HT0A 3I9ZA 4M5JA 1MWYA 4NWBA 2OFHX 3PFEA 1C0TB 2XM3A 2B7CB 1KC8T 4OZNA 4ZP8A 1MNEA 1RB0A 3IS9A 2W9AA 4DU8A 1KWMA 4CQ1A 4K4VA 1UFWA 2PO4A 4CTAA 3NXZA 3ILJA 4K8RA 2R8HA 2HSEB 4LQ9A 5HROA 2OPRB 2HZVA 3PW2A 3TNVA 3VAMA 2AF6A 5LSOA 1KBRA 2MY8A 2JVRA 1Y0HA 2ADCA 2UUBF 3F44A 5LXRA 2AJ2A 3HVTA 1Y9OA 4N41A 3UE2A 3JSRA 1EARA 5A2QY 4B9NA 4USKA 3L09A 2WONB 3J7Z5 1TVRA 4C11B 5CH7B 1Z2LA 4EGLA 1QAIA 4BHQA 2GVDA 5E5NA 1YRUA 4ELVA 4LF9F 3MCNA 2K1RA 3JSYA 2PFDA 3UCZP 1JX4A 1S1TB 5DZ7A 2ZBCA 3K7RA 2AEJA 2ZM6F 2Z2YB 3MHYA 3MR3A 1LW2B 1A7GE 4WK3A 3DLEA 1N5SA 4A8QA 2O66A 2Q3PA 2CFXA 1NK8A 2MKJA 4OYOA 4PXDA 4MK7A 3W5XA 2LA4A 2ZH1A 5DQHA 3BSNA 2QMUB 1SL2A 3D66A 5U47A 2LMIA 1Q79A 3D0GE 4YP3A 3CC4S 1Y3JA 4JI3F 5AXLA 1I6JA 2HZCA 3MPVA 4WCEQ 5BR8F 3IA0A 4ZCMA 3W2WB 4CM0A 3NY0A 1PSDA 5B0EA 4M94A 4IH6A 1VRTB 4IO1A 1R7IA 4P2FA 3MM5B 3UR0A 1PIEA 1BD6A 2BJEA 4WF9Q 1UEUA 1JK9B 4ELTA 1WF1A 2F3JA 4F3QA 2UUBJ 5F8MA 1T03A 4E8UA 1RT4B 2BJ1A 3LAMA 2CZVC 1JLFB 3BREA 1VIOA 4NCBA 2DHXA 3BO3A 1O51A 3NCPA 1DQ9A 2WW8A 3D5MA 3I96A 4RW6B 4KKOA 2DTJA 4LR8A 3G82A 2IM3A 4C8YA 1F9EB 5M2RA 4G3IA 3PCOB 4DHVA 5E3QA 4LUBA 4LF9J 4URGA 3NOCA 1X8DA 1S57A 3TJAA 5KFJA 1HPZB 3SXLA 2ZM6J 4ECWA 4CLUA 3NGUA 2XMAA 4HHJA 3VQTA 3M2VA 3KMSA 4ECQA 2E7VA 5M2PA 1HARA 3EE3A 1IM6A 2LA6A 2HHXA 1R0AA 3T5JA 1EZZB 3PJ9A 2CPZA 5EGYA 1GNKA 1H3DA 1S4FA 3FVYA 2RE1A 1TKTB 1M1HA 4JI3J 1JKHA 1NXIA 1IKVB 3FRZA 5BR8J 3WX4A 1S77D 3MM6A 2BW2A 4PWDA 1TKXB 2YKQA 2K7KA 4PUOB 3MUMP 3Q86A 3SMZA 1NM2A 2C2NA 2QYGA 2V67A 3LPYA 3MAQA 2GJIA 2F9JA 1RKIA
chains in the Genus database with same CATH topology
3JQMA 4PYAA 1EKRA 2EKNA 4PYDA 2OHDA 4FDFA 2IIHA 3JQJA 3JQKA 2IDEA 2EEYA 1EKSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JQM A;  4PYA A;  1EKR A;  2EKN A;  4PYD A;  2OHD A;  4FDF A;  2IIH A;  3JQJ A;  3JQK A;  2IDE A;  2EEY A;  1EKS A; 
#chains in the Genus database with same CATH topology
 2R8G A;  1S4E A;  3A3P B;  1NAQ A;  1R8B A;  4LF4 F;  1NSQ A;  5IC4 B;  5IZH A;  4I2Q B;  1XQI A;  2GGP A;  3RR7 A;  3EGZ A;  4Y2K A;  4UY8 5;  1Z1Z A;  3LO3 A;  1SI9 A;  2GMH A;  4LFC F;  4EMD A;  2Z4P A;  4V19 J;  3MTK A;  5E7O B;  1PJ6 A;  1U02 A;  1RWM B;  3GZ7 A;  2ZVI A;  4ZPB A;  5I3U A;  3TAM B;  5HQ8 A;  4KO0 A;  3UCU P;  4ECS A;  4WFZ A;  1RKJ A;  4F4Z A;  1U6B A;  1U8S A;  2GO8 A;  1KLM A;  2FVP A;  1NKC A;  4Q44 A;  3LAL A;  1AFI A;  2CDQ A;  1FVQ A;  3R9L A;  2VC0 A;  4B3T F;  2Y9H A;  3OTD A;  1QTM A;  1SJ1 A;  2MSS A;  4J9N A;  3CMA S;  2GAG C;  3A13 A;  2W24 A;  1V3R A;  2IBO A;  5DJB A;  2EKY A;  1P6T A;  4OYZ A;  2KHC A;  4CDI A;  4NYZ A;  3R5J B;  5A2Q U;  3GLJ A;  4Z7Y A;  2VAS A;  3V81 B;  4NZ0 A;  5ETR A;  3LH2 S;  4PR6 A;  1NCL A;  3NS7 B;  4G1Q A;  2ZBR A;  4TLR A;  1T9T A;  3ZTS A;  5E41 A;  2CDR B;  5F8J A;  4TYA A;  1VYA A;  1ZM3 A;  2B6A A;  5KTQ A;  1RGV A;  2KFN A;  4DQS A;  2Y1L B;  1TL5 A;  4LF4 J;  1SIW B;  2KJV A;  3TP2 A;  2ZKT A;  2DVI A;  3H90 A;  3UWT A;  2FD2 A;  2XS5 A;  2K06 A;  4EZ6 A;  4KYZ A;  4OV6 A;  4IFV A;  1UWA A;  1J5O A;  4LFC J;  4R0J A;  3CIM A;  2IY5 B;  5G4D A;  3DDN A;  3HZE A;  3CJK A;  1X4D A;  5K5M A;  2JFK A;  4RBT A;  2A18 A;  2GIF A;  4RNM A;  3IWX A;  2XC9 A;  1CJV A;  3K58 A;  2BMB A;  1N5Y B;  1P1L A;  2KM8 B;  1IN0 A;  1HYS B;  3HM9 A;  1S7H A;  2KJW A;  2XI3 A;  3E3X A;  2CAD A;  3NS5 A;  2BOP A;  3CC7 S;  2AZ1 A;  4B3T J;  3HJV A;  1XBW A;  5F0U A;  5CYQ B;  2AYB A;  1FDA A;  5C5J A;  3K2Y A;  2PMH A;  3ADA C;  1S48 A;  1SUQ A;  1C4A A;  3FCH A;  1VJQ A;  1X0F A;  2D3U A;  1PC5 A;  3CB4 A;  3FCW A;  1H2T Z;  2QX0 A;  2B51 A;  7FDR A;  1RWU A;  3H20 A;  2P5V A;  2ZH4 A;  1YKW A;  2V8H A;  2KT2 A;  4OX9 F;  3V4I A;  2GQQ A;  4J90 A;  1KDN A;  3D1Q A;  1I3O B;  2OD4 A;  2C3U A;  3C2P A;  3NAH A;  3SIP B;  2HHQ A;  2HWH A;  1D09 B;  3JS9 A;  5IT9 Y;  1REV A;  2DEI A;  1B0T A;  2CJK A;  2V8G A;  4UUX A;  3KK2 A;  3VAK A;  2DNR A;  3CCV S;  3JAM Y;  2LXI A;  5HJY A;  3BS9 A;  5KFL A;  5A8R B;  3FCV A;  1M1K T;  4WP3 A;  3TAR A;  2ROG A;  3TVZ A;  2M7S A;  3D6F B;  4J9U E;  4KGM A;  4KAI A;  2XBP A;  3GV5 B;  3BBF A;  3MEC B;  4P9S A;  1FF2 A;  5T14 A;  3I0S B;  4DN9 A;  2ASY A;  1FD2 A;  1N33 F;  2OEL A;  1A0O B;  3POT A;  1JB0 C;  1X5S A;  3MMA A;  2J9D E;  2HQG A;  3SV3 A;  2OUG A;  5L1L A;  5ETL A;  4NCA A;  2HBY B;  5L39 A;  1FRJ A;  3RYL A;  1FDB A;  1HL6 A;  3AHP A;  2VG6 B;  2FHJ D;  3N9U C;  2LLZ A;  2ZOM A;  1RT1 B;  4GVB B;  4DV0 F;  4C7Q A;  3GWC A;  5GAD U;  2B43 A;  2V8P A;  4DR2 F;  3QAT A;  5GMD A;  2OSQ A;  4NLD A;  2OIH A;  3HHE A;  5D15 A;  4OX9 J;  1ZAV A;  1FWK A;  1TL4 A;  4UQG A;  3OJS A;  3CJQ A;  4CNY A;  2P9C A;  5IC6 B;  2U1A A;  4C8O A;  5KFE A;  1RI7 A;  2AYM A;  3C6T B;  2GMJ A;  3OR2 B;  3OUY A;  1H7X A;  2RNE A;  4KV8 B;  3V6J A;  4FF1 A;  3ENV A;  1IXK A;  1XMO F;  1JJH A;  1N5Q A;  4PG8 A;  5D4N A;  1HI1 A;  4ZIT A;  2C2K B;  3M2U B;  1KSP A;  3R8Y A;  3V6H A;  2Q1L A;  3CMQ A;  5K8O A;  1RT2 B;  5GAG U;  2BJ7 A;  1EET A;  1VDH A;  2UP1 A;  3MPW A;  5EX0 A;  4QR0 A;  4I2P A;  1WKL A;  1N33 J;  1N48 A;  1FEE A;  2RB7 A;  3KYL A;  2OML A;  1Q0N A;  4CCH A;  1HQ2 A;  1FTR A;  3A1Y G;  1N5V A;  1YLX A;  3OT9 A;  1ELO A;  4URQ U;  4DR6 J;  1VQ7 S;  1CJT A;  2NUU G;  4DV0 J;  3FRY A;  1GMU A;  4YR0 A;  2XY5 A;  3EX7 B;  5GAD I;  4DR2 J;  3AD7 C;  2XB2 D;  4WII A;  5KG5 A;  4JI0 F;  2PT0 A;  4DL4 A;  2DH9 A;  2BAN B;  2IC3 A;  2HYI B;  2QA4 G;  1PJ5 A;  2IRU A;  3W1Y C;  3GON A;  1M5H A;  3CCJ S;  4DL5 A;  4ZVU B;  2RHS B;  8RUC A;  4X4N A;  1LWC B;  1K44 A;  2IVY A;  4XIU A;  1M90 T;  4A8M P;  3OFG A;  4HHU A;  1JXV A;  3FSX A;  1XMO J;  3UN3 A;  4J37 A;  1TMM A;  3OPK A;  3M8S A;  1S1X B;  3M6X A;  1CJU A;  3NBP A;  2AIR B;  3R7B B;  3T5H A;  3OJU A;  4RNF A;  2LU1 A;  5GAG I;  4DF4 A;  3GYG A;  2ZOG A;  1VS3 A;  1YRX A;  2RDJ A;  3GIR A;  2VDI A;  1RJJ A;  2OPQ A;  1HQE B;  4H4K A;  5H9E K;  1UFK A;  3OL8 A;  4NXN J;  1T05 B;  4ZVG A;  3H2V E;  1W7W A;  2AV5 A;  2MLX A;  4J91 A;  1NK9 A;  5I42 B;  2PA3 A;  3C16 B;  3BF4 A;  4WJB A;  3P5B P;  4ED7 A;  5ETK A;  4RX6 A;  4DV5 F;  3SSS A;  3T1Y F;  2QJ3 A;  1TUV A;  2JLG A;  1VQ6 S;  4RNN A;  4NAS A;  4IG3 A;  5IT9 U;  4DV2 J;  4ETX A;  1UVI A;  2RKI A;  1NHU A;  2FYX A;  4NLW A;  1RAB B;  3JAM U;  4JI0 J;  1U0S A;  4CIO A;  5DLF A;  1ZA1 B;  1VQK S;  3VTI A;  5DM7 Q;  2HVI A;  4LSN A;  5C2C A;  1VRU A;  3I5B A;  4F0K A;  4IUF A;  2V68 A;  1FJG J;  1C0T A;  1WOO A;  3LW5 C;  2PII A;  1YG0 A;  3BR9 A;  2RIJ A;  3CJR A;  3HSZ A;  3J7A N;  2GIR A;  4U7C A;  4LRC A;  1Y5I B;  2OPR A;  3ZZY A;  2EKN A;  3ISN D;  2XSJ B;  2RML A;  1BQX A;  2D3Z A;  3DRP B;  3SSQ A;  3RBE A;  4D3G A;  3ZFV A;  4EYH B;  3QT7 A;  3L9Z A;  5DM6 Q;  2WON A;  3AJ2 A;  1ZM2 A;  1N8R T;  2UXD F;  3QLH B;  2VG5 B;  3MOZ A;  4OZ2 A;  3DLG B;  3KJN B;  2XEX A;  2AKW B;  4CLP A;  2E5L F;  6FDR A;  4ZK7 M;  1WNE A;  1S1T A;  4TU7 A;  3H98 A;  1D9F A;  3NWR A;  4DV5 J;  3T1Y J;  2KXH A;  3WHI A;  2BJD A;  1LW2 A;  2KYX A;  2O1P A;  1FRI A;  3BSO A;  3A8E A;  3EWG A;  1PYT A;  4LF8 F;  1NME B;  1HWU A;  5HBM B;  2R7T A;  5KFM A;  3GJQ B;  5KFT A;  2XMM A;  3AJD A;  1JLC B;  5LOQ A;  2MLY A;  1RA6 A;  1WTB A;  4DR1 F;  4ZS6 A;  4YB5 A;  2F7V A;  1UZH A;  3I0R B;  4B02 A;  1LFW A;  1RDR A;  3L7P A;  2E5J A;  3PJX A;  2D9O A;  3MR7 A;  2BZ2 A;  2Y8W A;  4FBT A;  1S0M A;  5KT4 A;  1H0H B;  1MU2 B;  2DIT A;  3NP5 A;  2JFD A;  2P2C B;  3CIZ A;  3MM5 A;  2HHP A;  2IA6 A;  4QYZ J;  4X4Q A;  4N77 A;  3W7B A;  2LDY A;  5HP1 B;  4DXL A;  3CSK A;  1D0E A;  1RT4 A;  1WG5 A;  2ZHA A;  1JLF A;  3AOD A;  3FFI B;  2B3T B;  3CD5 A;  2A6O A;  2PGC A;  2XZW A;  4B9U A;  4RW6 A;  1YJU A;  2W4D A;  4O44 B;  2UXD J;  3UNY A;  5IXU A;  3KNG A;  3CDB A;  2ZZM A;  4F0H A;  2XWY A;  2QA4 S;  2E5L J;  3RBX A;  2HFU A;  2ZNY A;  2BJ8 A;  2IM2 A;  3D3B J;  1MWZ A;  4F4A A;  1J5E F;  3BGF A;  1VC0 A;  2LXU A;  1HW8 A;  2YKM A;  1HPZ A;  1WJ9 A;  4A4J A;  3OVB A;  5KOX A;  4P7V A;  4R8U B;  3K57 A;  2J5A A;  1VHI A;  2DRA A;  2DCL A;  3TEH B;  3MMJ A;  3SFU A;  1RWN B;  2XS2 A;  1OPI A;  3I56 S;  5L38 A;  4E2F B;  4DR1 J;  1K0T A;  3CGI A;  3TAP A;  1OIA A;  1K1Q A;  4YOE A;  1TKT A;  2WTF A;  2MXY A;  1NJX A;  4QU7 A;  5J2M B;  5ETT A;  1IKV A;  4EU0 A;  2R3V A;  4O3Q A;  2KRR A;  4RR5 A;  2R7Q A;  4D3H A;  5FJ4 A;  4A8Y A;  1XNR F;  1HBN B;  1N0V C;  4PUO A;  2FC8 A;  3HPO A;  3C6U B;  1TL7 B;  3I31 A;  2JEF A;  1FDD A;  5A6P A;  1E6V B;  4L3K A;  3CC2 S;  3QAE A;  3LGN A;  2N4D A;  3TUI C;  4PYA A;  2ZJR Q;  4MIA A;  1ZOT A;  3Q8Y A;  4FKX A;  3CCU S;  1EKS A;  2XZT B;  3TZX A;  2VHG A;  2FLO A;  2LEA A;  2BQ3 A;  1D3W A;  3V5R A;  2ZH6 A;  2VPY B;  4IQX A;  2KZM A;  4QOT A;  1J5E J;  4O4R A;  2J6S A;  1UVM A;  5F8G A;  1QUP A;  5E2Q A;  3DLJ A;  1F2H A;  3VAL A;  3DXS X;  4EK2 A;  4USI A;  2M8H A;  3HI9 A;  4J7C A;  2J0Q D;  2RDI A;  1KN6 A;  1S0V A;  3SDE B;  5BJR A;  3IWN C;  4GRS A;  1S6U A;  4OZ5 A;  2GAH C;  3ENW A;  1PGZ A;  5KFY A;  1K0V A;  3H4B A;  5LM7 E;  4LVN P;  2CQC A;  2W8L A;  2ZEJ A;  4O0N A;  3D54 A;  2I9S A;  1BGX T;  1G6B A;  3V2U C;  1B64 A;  3BKF A;  3THT A;  2C2E A;  1D8Y A;  4DQQ A;  1DBD A;  4F8R A;  4GMK A;  2HK3 A;  1XNR J;  3C8Y A;  1VQ5 S;  2EC2 A;  4LRD A;  4TLQ A;  3FKB A;  2DR8 A;  2M2B A;  3PEJ A;  4L74 A;  2DR9 A;  1WHW A;  1TFW A;  1HNZ F;  2DJW A;  2PDA A;  2KXN B;  3MMC B;  4KB7 A;  2KKH A;  1O5J A;  5K14 B;  2CQ4 A;  2K7J A;  1VCT A;  1U24 A;  1LFP A;  4JV2 A;  2W1B A;  2NQP A;  3BQ2 A;  2X51 A;  1WC5 A;  1T9X A;  5F8N A;  2J7U A;  2RQ4 A;  3CD7 A;  3HFZ B;  4RWX A;  3W9J A;  3Q89 A;  3NMR A;  4U9R A;  2V9K A;  2BAC A;  1N5Y A;  1FKP B;  4FYD A;  4UOF A;  2BBE A;  1FXR A;  3R7S B;  4QIV A;  1HYS A;  3ZZO A;  3CCT A;  4IFY B;  3BBB A;  3G6Y A;  4NCG B;  5CYQ A;  2HRU A;  1CG2 A;  1KOH A;  2C2R A;  4DS5 A;  2GA7 A;  1V3S A;  2AX1 A;  4BS2 A;  3K89 A;  4A47 A;  3CCM S;  3MM7 A;  3RAQ A;  3VVT A;  2N4C A;  2Z8Q A;  2M3D A;  1BWV A;  1RT3 B;  3GTY X;  3PW0 A;  4ZJL A;  2YTC A;  1SCJ B;  4RW8 B;  3RB3 A;  4LF6 F;  2GO9 A;  3MM9 B;  4MKB A;  4L6V 3;  4WPA A;  3SFG A;  2WB4 A;  3BBC A;  2FY1 A;  1HNZ J;  1V6H A;  3J7Y U;  2VBX A;  2H5I B;  5CAA A;  4ES1 A;  5C25 B;  4KH0 B;  1UA1 A;  3KK1 B;  1HKA A;  2IPO B;  1ZET A;  1SKR A;  1S6O A;  2DNQ A;  4EEY A;  5A8R A;  2MZJ A;  4M5H A;  4KHR A;  2NUH A;  3QFH A;  1KQG B;  1TUG B;  4EBD A;  2MQL A;  3T41 A;  2CJX B;  4DWI A;  5LT5 A;  3DYA B;  2B4V A;  1VBY A;  4L3N A;  3FQK A;  4JUZ A;  3MMB B;  4FXD A;  1CEZ A;  3BGU A;  3MEC A;  4OIX A;  3O3L A;  3HHL C;  1E6Y B;  3I0S A;  4GC6 A;  4OV1 A;  1C1B B;  3G6V A;  3AB4 B;  2GJF A;  5T7L B;  2JLE A;  2ZZT A;  2FZG B;  4V1A k;  1DJ0 A;  1CS4 B;  4N8O A;  2HFS A;  3EUN A;  2W4C A;  3HF5 A;  3U02 A;  3G86 A;  4NYO A;  4ED6 A;  1FO1 A;  1BQN A;  1RTI B;  3MTJ A;  3GIJ A;  2VG6 A;  2IVF B;  3PO5 A;  1RT1 A;  4UTG A;  4GVB A;  3M9M B;  1FE4 A;  3HFK A;  3JTP A;  2N82 B;  4R0E A;  1LOU A;  2E29 A;  5HVF A;  1UFL A;  1R0C B;  3DDK A;  4MKA A;  1IWA A;  4U95 A;  3BSA A;  4USV A;  4M5D B;  5FDL B;  3CXC R;  4LF6 J;  4OHX A;  1IBM F;  4XTT A;  2GW8 A;  2V4J A;  3CWJ A;  4BC7 A;  1CJK B;  3J7Y I;  1QM9 A;  5E3A A;  4DQR A;  3C6T A;  4AFF A;  4AT1 B;  4ENO A;  1OSD A;  2YQ3 A;  3OR2 A;  2B9E A;  5F3T A;  2BUN A;  4KV8 A;  5L46 A;  1RCO B;  4ELU A;  3T1H F;  1S0O A;  1X0P A;  1GMV A;  4ECZ A;  3U7J A;  1PJ7 A;  2FVR A;  3TW0 A;  1F6T A;  2F4V F;  3X1L B;  1BY9 A;  4WTO B;  3HZG A;  4DFJ A;  2UV8 G;  1ZBT A;  2ZC3 A;  3M2U A;  3EXC X;  1NJW A;  1OYE A;  2PI4 A;  3G2X A;  3NGK A;  2HND B;  3N6N A;  5HK4 A;  3DGP B;  3ILI A;  3CO9 A;  1A9N B;  1RT2 A;  1W2B R;  5KG1 A;  4PQA A;  3LOU A;  2W25 A;  4AXJ A;  3KG4 A;  2Y1R I;  4TU8 A;  3PHT A;  2G1H A;  3HK2 A;  3SSR A;  4I7F B;  4QZV B;  4DG1 B;  4O0I A;  2DXF A;  4QJV A;  3QJP A;  4ZA1 A;  1YJT A;  3OVA A;  1S5Z A;  3IS9 B;  2FLN A;  2EFV A;  3D2W A;  4G65 A;  5BYQ A;  4AXI A;  2C1E B;  4X4V A;  3G8S A;  4ZP9 A;  2P9G A;  3EM1 A;  2HQC A;  1CPZ A;  3EXY A;  3HD1 A;  4DL3 A;  2XS7 A;  2FC9 A;  5HO4 A;  3KLF A;  2KYZ A;  3Q22 A;  4F0M A;  3UD5 A;  4ATN A;  3W65 A;  2BAN A;  4QR2 A;  4KHP F;  4HLB A;  1IBM J;  2UVV A;  4O3O A;  2MZ1 A;  3KDO A;  3H5U A;  4EO6 A;  3LGH A;  3PR4 A;  1U1N A;  3NL0 A;  4NLG A;  1LWC A;  1NSA A;  1F5C A;  4URS A;  3BEG B;  3R2C J;  3T1H J;  5DO2 A;  4KTQ A;  1R8P A;  2GC8 A;  2HQ3 A;  1IUJ A;  2F4V J;  1IJE B;  1IM4 A;  1M1G A;  2CPJ A;  4C8N A;  2WRM A;  2VON A;  2MST A;  5D0E A;  3DU5 A;  3ICL A;  4UW2 A;  1Z4U A;  2DGQ A;  4WIQ A;  3QSI A;  2OD6 A;  2DNZ A;  4ZVO B;  3DOM B;  2W2M P;  4C6A A;  2K3K A;  3K5M A;  1F3F A;  1IBL F;  3D6M B;  4JI7 F;  2EK1 A;  2CQ3 A;  1QLN A;  1Y5N B;  5I42 A;  5JVG Q;  3C16 A;  1B70 B;  4XO0 A;  1SB6 A;  3KHG A;  3CDU A;  2AJ4 A;  2GML A;  3MFH A;  3CJS A;  3MPD A;  2XGQ A;  3F56 A;  1VFJ A;  2IDL A;  2Y1J A;  3E51 A;  3NS6 A;  1OY6 A;  3NNA A;  2AU0 A;  3BV8 A;  2EI5 A;  1P9Y A;  4NLQ A;  1EB0 A;  2DRB A;  2FHM A;  3GYX B;  4HT7 A;  4ECU A;  2YWE A;  5GMK a;  5EHH A;  3Q8U A;  2QN6 B;  3SQG B;  2XUL A;  4CLT A;  2DHA A;  1SV5 B;  1RWX B;  4OYI A;  4C8M A;  4JI8 F;  4KHP J;  2MZR A;  1XJW B;  3FQL A;  4TXS A;  4DSJ A;  4DPY A;  2XLI A;  1X60 A;  3FSI A;  1NK0 A;  4K4Z A;  2E1A A;  1LXJ A;  4ILL A;  1GQE A;  5A8W B;  2J6U A;  5CXT A;  3FGV A;  4GVL A;  1IR1 A;  2W7A A;  4LR7 A;  4YHH F;  3K59 A;  5KFK A;  4BC9 A;  1UAW A;  1S97 A;  2V63 A;  1RIS A;  4M5M A;  4EFA C;  1KTV A;  3IR6 B;  5B0F A;  1M5S A;  2XSJ A;  3RRK A;  3DRP A;  3QID A;  1I5O B;  2MZQ A;  1DZ5 A;  3QRQ A;  4UZB A;  2AJQ A;  2HBQ B;  1WWH A;  3T1A A;  2OLW A;  5AJ3 F;  1LNQ A;  3V4M A;  2WOM B;  1IBL J;  2DNH A;  2HHS A;  4JI7 J;  1FNO A;  1Q8K A;  3QLH A;  4HYK A;  2W2O P;  2VG5 A;  3U1L A;  2N3O A;  1L3K A;  2BW7 A;  4IR1 A;  3DRX A;  2KTQ A;  2OFG X;  2UUW A;  1NDP A;  1YJN S;  4W4M A;  1VGY A;  4ZLN A;  3MM6 B;  2HQI A;  5KFS A;  4TNO A;  2V4R A;  1HD1 A;  1HMV B;  3IXQ A;  1RLD A;  3G6E S;  2YWH A;  2Y8Y A;  5HBM A;  3FBC A;  1FJC A;  4TKT A;  2J9C A;  2LKZ A;  1F2G A;  4DZD A;  1JLC A;  2L9D A;  4JI8 J;  3EPG A;  1RHK B;  2MEW A;  3K5O A;  3I0R A;  4ILM A;  4CLW A;  2N7Y A;  2DPI A;  1Q86 T;  1P27 B;  3QRP A;  2HFV A;  3BN7 A;  1MU2 A;  1RSC A;  1B4S A;  3JSB A;  5A76 A;  4MYU A;  1JNZ B;  2WVB A;  4DV3 F;  5E3P A;  3OXL A;  4YHH J;  5K20 B;  5CYM B;  2AWZ A;  4OHV A;  5HP1 A;  2ZNZ A;  3EDR B;  3GCW P;  3R5G A;  2Y1I A;  4B3O B;  1OSC A;  3EZO A;  1IVZ A;  2OPS B;  4Y3C A;  4Y2I A;  4DX8 H;  1SQG A;  3Q8V A;  4ERD A;  3S6E A;  2DIU A;  2RH3 A;  2HS3 A;  3RR8 A;  2AW0 A;  3FFI A;  4PCQ A;  2EEY A;  3CJ3 A;  3JYT B;  4O44 A;  1VOM A;  4OI4 A;  3DKD A;  1LWF A;  3THP A;  3FEZ A;  2ACM A;  2R8I A;  1GXT A;  3R97 A;  2BR0 A;  2L41 A;  3RZA A;  2DNN A;  4IOC Q;  1ZM4 A;  3PZP A;  4ZKA A;  4FVM A;  3M8Q B;  1R31 A;  4TYB A;  4K7Q A;  3GII A;  3DLB A;  1X4B A;  4P7T A;  3W60 A;  1WEL A;  2E9R X;  4R8U A;  2A10 A;  2FZK B;  2WW4 A;  2EFG A;  1VQL S;  2OEM A;  4ETZ A;  3OL9 A;  3DLH A;  1G4C A;  2ALY B;  1GK8 A;  3BPD A;  4RW9 B;  8AT1 B;  3E01 B;  1RE1 B;  2KFY A;  4I1T A;  4K2J A;  1VLO A;  1P9Q C;  2XMJ A;  5J2M A;  1J2V A;  1VR6 A;  2COL A;  3TEG A;  2HS4 A;  5HLF B;  3KHH A;  4IYQ A;  2XLK A;  2H1Y A;  2ZHB A;  3CME S;  4DV3 J;  2CQG A;  3IC1 A;  1HBN A;  4NLR A;  1U26 A;  5KFH A;  3PY8 A;  4Q2L A;  2EFO A;  1X9M A;  3C6U A;  1TL7 A;  4ZPA A;  4J9Q A;  2DYA A;  3ZNJ 1;  1RAC B;  3QPI A;  3G87 A;  4BCA A;  2GIQ A;  4J9R A;  4JV0 A;  2ZZN A;  1GAO A;  1XN9 A;  5HSP A;  3J81 Y;  3OVS A;  5A6W A;  1NSP A;  4U7U K;  3NOG A;  4NLO A;  1WKK A;  4NOH A;  5BXI A;  1X5P A;  1SUQ B;  2CG8 A;  1T3N A;  3BR8 A;  4QYZ K;  4ZOS A;  4OI2 A;  5KFB A;  2DRD A;  3BGR A;  3ZZ0 A;  2FJB B;  3P6Y C;  4ZCI A;  5KG0 A;  2CQ0 A;  1WHY A;  2MKI A;  4K4W A;  1S1V B;  1ICE B;  2HWT A;  2I0X A;  2JNJ A;  3QZ8 A;  3U1N A;  4N76 A;  1S7I A;  1GXL A;  3A3O B;  3HKZ D;  1KTQ A;  2BVZ A;  2FHK A;  3Q2S C;  2EG1 A;  2FJX A;  4N8N A;  2AD9 A;  1REV B;  2WZ1 A;  3PKM A;  1N56 A;  1WC3 A;  2CJB A;  3HX9 A;  3PYF A;  2MYF A;  1UVN A;  4PXC A;  3U1M A;  1JJ2 R;  2E9Z A;  1O6X A;  3GV7 B;  3UCG A;  3E2E A;  4UF4 A;  2GNK A;  2YNF B;  4ZIV A;  4OFZ A;  4HH1 A;  3UDV A;  2LEB A;  4RUA A;  2IFX A;  3GJT B;  3I4H X;  3QT5 A;  1CLF A;  3M6V A;  2MZT A;  2J0X A;  2BM1 A;  3KUH A;  3CD0 A;  1N32 F;  1MN7 A;  3AD8 C;  2M88 A;  5CYJ A;  2ZIT A;  3MMC A;  5K14 A;  2VDH A;  3B4M A;  3POT B;  4KQZ A;  5DG8 A;  1NH8 A;  1S1U B;  3MMA B;  5KOW A;  1LEO A;  3A8I A;  2HKE A;  2VFV A;  5B0G A;  5GAE U;  2KG1 A;  1V5V A;  3BDE A;  2A3J A;  5H9F K;  2WSC C;  1RYR A;  4DQI A;  3IN5 A;  1OQ3 A;  1G1X A;  3VCD A;  5LJ3 Y;  4USW A;  5FLX Y;  4K5S A;  1HNV B;  2WAQ D;  4DL7 A;  1FKP A;  1RZM A;  2YWW A;  4EBE A;  1RA7 A;  3QWU A;  3TUZ C;  1QVG R;  1I51 B;  4IFY A;  2RSQ A;  4Y00 A;  3W9I A;  2ZWP A;  4QBU A;  1SQF A;  4EI2 A;  4X65 F;  5IOL A;  3FK4 A;  4NCG A;  2VZ9 A;  3M6U A;  3MD1 A;  2R2R A;  3O2I A;  4X66 F;  3J80 Y;  2FHJ A;  2NXE A;  1RHU B;  3MEE B;  3DC2 A;  2M4M A;  4J9P A;  3BM7 A;  3B4D A;  1RAH B;  4XAK A;  1TL1 B;  4QWC A;  4A8F A;  1VIS A;  5B08 A;  2HHW A;  4EWT A;  1NK6 A;  1CC7 A;  2HZA A;  1V9O A;  3TZZ A;  2ASL A;  5D0H A;  4MTP A;  2V2K A;  1RT3 A;  4OJ3 A;  5HL7 Q;  4RW8 A;  3D28 A;  2A2C A;  1S72 S;  3O6Q A;  2GHV C;  3MM9 A;  4IDK B;  2DNG A;  3PHE A;  4WWS A;  1N32 J;  4I2P B;  3R3T A;  3T19 A;  5C25 A;  4WFY A;  5HMX A;  2V8V A;  2WBM A;  4OI6 A;  3ZNU A;  1FER A;  1SKS A;  1JIH A;  5GAH I;  2Y0S D;  4B9S A;  3N28 A;  3QAU A;  5GAE I;  1M5O C;  3ZZU A;  1HQU B;  3OD2 A;  4CH1 A;  5JVH Q;  2CXE A;  1Y11 A;  1R8H A;  3DYA A;  4FNI A;  1T94 A;  2YBV A;  3MMB A;  3F0N A;  2CNL B;  2KT5 A;  1C1C B;  1E6Y A;  4C3L A;  3CTR A;  2RU3 A;  1C1B A;  3OXF A;  4DV7 F;  5T7L A;  2HLT A;  4FF3 A;  2IC3 B;  4X65 J;  2WSE C;  1HBU A;  4GO5 X;  2UXC F;  2JZ5 A;  2X1A A;  1V5I B;  1N36 F;  4ZPD A;  3A3N B;  3A12 A;  4X66 J;  2BQR A;  1Q8B A;  2H4Y B;  4YME A;  3MUT P;  1RTI A;  2DO0 A;  4FBU A;  2DGT A;  3HSG A;  3N01 A;  1FRL A;  3VZI A;  2LXF A;  3F41 A;  3J81 U;  4K4Y A;  4M5D A;  5FDL A;  1PO6 A;  4AE5 A;  2YX7 A;  2LQB A;  1B7Y B;  9ATC B;  4WZQ A;  7AT1 B;  2XYG B;  3Q24 A;  5THW A;  2MKS A;  1CJK A;  2MQM A;  4C0B A;  1HLW A;  2WB1 D;  1T9U A;  3P45 B;  1ZH5 A;  4I0W A;  3MR2 A;  1TEL A;  2MJU A;  3CE8 A;  3V6D B;  4XDC A;  2IA0 A;  1NZA A;  4NLT A;  3Q23 A;  1IWG A;  1WHX A;  3MED B;  2VF3 A;  4QQB A;  2HGN A;  3RRH A;  2HND A;  2BOA A;  5DGB A;  2H51 B;  3DGP A;  2CG4 A;  4KH1 B;  3OTC A;  4UT4 A;  2FGO A;  1TMJ A;  1W26 A;  4BLG A;  1WHV A;  1ULR A;  3HSJ A;  4ZVT B;  1RT6 B;  2JC0 A;  2ZBP A;  3FC9 A;  1BC6 A;  4DV7 J;  4KE5 A;  1REG X;  2RQM A;  4CO3 A;  4I7F A;  1T9W A;  3C46 A;  3HJF A;  2UXC J;  1SKU B;  3L7O A;  1VQ8 S;  4DG1 A;  1N36 J;  1GTH A;  4DR7 F;  2ZHO A;  5EX3 A;  1FRM A;  3IGV A;  5J1P A;  2DXD A;  2CPD A;  4C3M A;  5DZ6 A;  3GSD A;  4WXO A;  4F4Y A;  2RQK A;  5IM0 B;  4M5K A;  2PN6 A;  4M1K A;  2C3Y A;  1OY8 A;  2OSR A;  3BDP A;  3OTB A;  1I1G A;  2QMW A;  2DR7 A;  5HAN A;  4YB1 P;  5FLX U;  1CQM A;  1Q7Y T;  3QZ7 A;  2IIH A;  2RRN A;  1H73 A;  2QO3 A;  4R25 A;  2XNR A;  4UUW A;  4FDF A;  2Y3Y A;  1S6Q B;  5DDR C;  4YDX A;  3KJF B;  3MM8 B;  1TKZ B;  3W9H A;  3HP6 A;  4CLS A;  2VOD A;  4IH7 A;  3DOM A;  4TY8 B;  2OTJ S;  4Y65 A;  1URR A;  2DH8 A;  1YQH A;  4O23 A;  5CCM A;  3ZTQ A;  3CW2 C;  4U67 Q;  3JQM A;  1X7V A;  3M8Y A;  2D3O R;  1D9D A;  4MH8 A;  1HBO A;  4KR0 B;  4P6Q A;  3LF0 A;  4P2X A;  3M32 A;  4P2M A;  2B7B B;  4DR7 J;  1OQ6 A;  1RU2 A;  1URN A;  4YN3 B;  1DQA A;  3W8G A;  2ERR A;  4J9S A;  1NEE A;  3G4S S;  4JYA F;  3N6M A;  4X4S A;  3BGL A;  3RG6 A;  2VJV A;  2F4F A;  4M5I A;  4JI6 F;  3CPW R;  4PXE A;  1EQM A;  2R7V A;  4PZV A;  4F50 A;  3SQG A;  1SV5 A;  1YWX A;  3PYD A;  4AL5 A;  1AW0 A;  4OHZ A;  2OI2 A;  3SCJ E;  1HHQ A;  1FRK A;  3JSM B;  1XR7 A;  2MQN A;  3R27 A;  1CVJ A;  4LF5 F;  2WBR A;  2VIH A;  3I6P A;  2V2Q A;  2HVZ A;  3BZQ A;  1KP6 A;  3QGH A;  4PEO A;  3OHB A;  2VOP A;  2DNO A;  4WYW A;  3IBF B;  1SJR A;  5HAT A;  5A8W A;  1TK5 A;  1M5P C;  2C2D A;  2VBY A;  1G3O A;  3LGM A;  3RUB L;  1YZ6 A;  2UZA A;  4PAA A;  2R7X A;  4DEZ A;  2VOO A;  1S49 A;  1NHV A;  2A0F B;  1KHW A;  2YKM B;  1WDD A;  1SPB P;  5I3Q A;  2H5E A;  1HHT P;  3I5A A;  4LF7 F;  3PX0 A;  2QL9 B;  3QYY A;  2C2O B;  2WOM A;  1QY7 A;  4OI3 A;  1RAO A;  3LP1 A;  1R27 B;  5B0B A;  2MDA A;  5HVG A;  2AZ3 A;  1QAY A;  4DLE A;  1PYS B;  4G6V B;  3TX8 A;  4GC7 A;  2GFF A;  2AGP A;  1M0S A;  4Q8E A;  2FJA B;  3LAK A;  3KOA A;  5LMU F;  2HIY A;  3D7S B;  2BX6 A;  2A1B A;  4JYA J;  1RTJ B;  3DDI A;  4JI2 F;  3R5D A;  1HMV A;  4WKY A;  3VWS A;  1PG5 B;  3KLH B;  1JNR B;  5A0Y B;  2QLW A;  4RL1 A;  4F4K A;  3GYN A;  4DFM A;  4HT5 A;  3RW7 A;  3HHL D;  1JLE B;  4B9V A;  1FJE B;  4BWM A;  1Q7L B;  3AJ1 A;  4LF5 J;  2E1R A;  2X1G A;  1TTH B;  4QCL A;  3GMG A;  1WOR A;  2ALZ A;  4FXV A;  1RHR B;  2APO A;  3ENA A;  1AUS L;  2G13 A;  4KC5 A;  4F04 B;  5L9X A;  4YB6 A;  3BGO P;  3Q83 A;  1D9A A;  4LRB A;  5CYM A;  1FT8 A;  2Z58 B;  5CD4 A;  4A8K A;  1U45 A;  4B3O A;  1DAX A;  2B56 A;  2AYG A;  3TR5 A;  1NPP A;  2OPS A;  4KGX B;  4A8X A;  3EVW A;  3QMQ A;  2J8A A;  2F9D A;  5CCL A;  4LF7 J;  5I4M A;  4CNZ A;  3M1V B;  4U8V A;  5KT5 A;  3JYT A;  4I6A A;  4DPW A;  1FA0 A;  4JI5 F;  1R3N A;  2XQC A;  1S1W B;  2DNP A;  4C4W A;  3PW5 A;  2G2Z A;  2XSF A;  3DRS B;  2XNQ A;  1C0U B;  2PE8 A;  3G71 S;  3M8P B;  3GIM A;  2MMY A;  3CVK A;  5E0O A;  4K50 A;  1LXN A;  4WXW A;  3MEG B;  5LMU J;  4XPC A;  3M8Q A;  2VQF F;  2H48 B;  4WZM A;  1SKW A;  3O44 A;  1NKE A;  2WK4 A;  4JI2 J;  1NRK A;  3IR7 B;  1RWO B;  2HAF A;  2LYV A;  5DG9 A;  2MKC A;  1UA0 A;  4DSK A;  2B4U A;  2Q79 A;  5B0D A;  4NXM F;  3K5N A;  2EFN A;  2R9L A;  4ZLP A;  4RW9 A;  3E01 A;  3W5Z A;  2FIU A;  3PKY A;  3O8W A;  1KD1 T;  4CWB A;  2BRK A;  4X4U A;  4F4W A;  4O3S A;  1U4B A;  4YUD A;  3BKT A;  3NKY A;  1GFW B;  1X4C A;  4NI2 A;  2B9Y A;  1MG7 A;  2X3G A;  1RBA A;  1AUD A;  4G1I A;  4FYV B;  5HLF A;  4I6Y A;  5B09 A;  4CO2 A;  2POK A;  4NML A;  4RUC A;  1RBO B;  3DMJ B;  4ED0 A;  3OSP A;  1Q5Y A;  5IT0 A;  3K5L A;  1X4G A;  2L3M A;  2ZDP A;  3RGI A;  5LMN F;  4X64 F;  2YXL A;  2KG0 A;  3S1T A;  5KFN A;  4F25 A;  1MMD A;  2XYP B;  1C4C A;  1VJW A;  3CDA A;  1LWE A;  2H4W B;  3OXG A;  1Q82 T;  1IR2 A;  1UEK A;  2JWN A;  2W2P P;  4PWU A;  1UVJ A;  4KPC A;  4LMZ A;  7FD1 A;  2M70 A;  4JI5 J;  2DIS A;  2ZD1 B;  1PBU A;  2PA8 D;  3CCW A;  2RF2 A;  3ELH A;  5KFZ A;  2GZO A;  3FNN A;  4MAK A;  1JJC B;  4CZC A;  2VD3 A;  3MM7 B;  1U7L A;  4AL6 A;  2VQF J;  4PG6 A;  1S1V A;  3ILL A;  3EPI A;  3A4T A;  1ZPV A;  2I38 A;  1RQ0 A;  4LF2 A;  3LP2 B;  2E66 A;  4CT8 A;  4E0D A;  3ZXW A;  2LQJ A;  1QSS A;  3GV8 B;  1EX8 A;  4NXM J;  1HD0 A;  3C14 B;  3GR1 A;  4OJG A;  4USJ C;  4OLP A;  2YNH A;  4K4T A;  4I6W A;  4ECR A;  1BQM B;  2F8E X;  3R1H A;  3D4J A;  3WX8 A;  3DNC A;  5D77 A;  3KG0 A;  2B8Q A;  5CQG A;  5L8R C;  2HVE A;  4DMZ A;  4OX6 A;  2PC6 A;  5FII A;  4BDP A;  2MQQ A;  1IKX B;  4PKD B;  2YNF A;  1MSW D;  4LR9 A;  2AX0 A;  1SL0 A;  5DQG A;  4WTY A;  5LMN J;  4X64 J;  4QW9 A;  2IM0 A;  2CYY A;  2RHQ B;  2XMW A;  2NPF A;  2DGV A;  1AT1 B;  5LL6 d;  3M05 A;  2P6T A;  4ZP7 A;  1G7C B;  2BXJ A;  4NRT A;  4LVO P;  1SQE A;  4H4M A;  5HQL A;  1F9F A;  1C2P A;  2O01 C;  2VJU A;  1S1U A;  5IV3 A;  1VRQ C;  1SXL A;  3MXH P;  2NCK L;  2EG2 A;  3KK3 B;  3LPE A;  1EAY C;  1UW9 A;  5CAB A;  1LK5 A;  4KBI A;  2V2V A;  2DEJ A;  4JV1 A;  1PIL A;  1OPZ A;  1BQN B;  2OEK A;  4DCJ B;  2NSB A;  3OTO F;  4U8Y A;  1HNV A;  3FBB A;  4IOB A;  2MKY A;  3DCA A;  2EW9 A;  1WC1 A;  1MWQ A;  3LTO A;  1JLA A;  2GQ2 A;  3MUV P;  1SL1 A;  2F63 A;  1UWB B;  5KFW A;  1FWL A;  4Z37 A;  1RTD A;  1FTC A;  1AA1 B;  3GQC A;  2C3M A;  2V4J B;  4PWW A;  4F36 A;  2PSZ A;  3OTE A;  4CO1 A;  3WC0 A;  3MEE A;  4ZN1 A;  3RRG A;  4WE1 B;  2D74 B;  2MLZ A;  1TL1 A;  5A8K B;  4MT1 A;  1Q16 B;  2R7S A;  1FKO B;  5LSR A;  3QO9 A;  3NMA A;  3GU0 A;  4C98 A;  1L3U A;  2ZDO A;  3UNG C;  4NLV A;  3ULH A;  1QUV A;  1WOP A;  2QE5 A;  4DPX A;  3GFH A;  3AT1 B;  1NDL A;  2RQC A;  4Z7C A;  2WCX A;  4ZCK A;  4J9M A;  4IDK A;  3BYR A;  2R2U A;  1S9F A;  4DQP A;  4L72 B;  5C24 B;  2AT1 B;  1WEY A;  3HCX A;  2FPH X;  1TV6 B;  3ZO7 A;  5HMW A;  4I4B A;  3US5 A;  1DTT B;  4OMF G;  1IBK F;  1VLY A;  3O5T B;  3L3C A;  1ZS6 A;  2UV8 A;  4DL6 A;  2LU2 A;  4IOA Q;  4NE9 C;  2JRS A;  2R8J A;  4K4X A;  1WF0 A;  3D6H B;  5ADZ A;  2W2Q P;  4PXB A;  2XLJ A;  4HH0 A;  2IJF A;  1YJV A;  1HQU A;  4CP5 A;  3OTO J;  2HW3 A;  5H9E J;  2XGP A;  2DO4 A;  3GG1 A;  1DLO B;  1GT8 A;  1T11 A;  3GG0 A;  5IWA F;  3ITH B;  1TL3 B;  1C1C A;  3M30 B;  3B6B A;  2JC1 A;  4CM2 A;  2J76 E;  4EO8 A;  3T6B A;  1RP5 A;  3KLF B;  4P73 A;  2O3D A;  2QZ8 A;  2RDD A;  4DUY F;  4YQW A;  2HPU A;  1PKU A;  4M5G A;  3S8S A;  4LF1 A;  5J1E B;  2F8M A;  4GKK F;  1TU0 B;  3G96 A;  3ZTO A;  4B3S F;  3K8V A;  2YWG A;  4MMO A;  1XWL A;  2UUT A;  4FF2 A;  2VPZ B;  3IM9 A;  1TAU A;  4G1P A;  4MKV A;  4Q8F A;  4QPT A;  3R6G B;  2DNY A;  3RBD A;  3N0V A;  1QE1 B;  4USU A;  3TAN A;  3OL7 A;  2I2Y A;  5D3G A;  1X5O A;  2MHN A;  4RW7 B;  3KG1 A;  2NXU A;  3JB9 k;  3IRX B;  4CI0 B;  4OZ1 A;  1K8A T;  4ANC A;  5ITH A;  3KLG B;  1RHJ B;  2WHO A;  2P8I A;  4K5R A;  1IBK J;  2BE9 B;  3AOC A;  2VA3 A;  2V50 A;  3ZZT A;  2D1C A;  3MDF A;  4RW4 B;  3V6D A;  1SH3 A;  5HMY A;  1N6Q B;  2HFN A;  2W9B B;  3MED A;  2XMT A;  1IJF B;  1BUX A;  2NYI A;  4KRW A;  4DX7 A;  2L48 A;  1R8A A;  5KT3 A;  5IWA J;  2ABY A;  1A6L A;  1GEH A;  2GX8 A;  1HWI A;  2JEJ A;  2X3D A;  1VMB A;  4ZHR B;  1RT6 A;  4NLY A;  4QIG A;  1PBA A;  4DUY J;  4U7U D;  1WEX A;  1ZTT A;  1EHW A;  1DFD A;  3DRR B;  4FN5 A;  2KB2 A;  4X84 A;  3CCL S;  1Q1K A;  5K8N A;  3ONQ A;  1H6K X;  4GKK J;  3PRB A;  2MPU A;  4B3S J;  2UXB F;  3OFE A;  5SZT A;  3N79 A;  2NS1 B;  4QIE A;  2AJ1 A;  2OAU A;  2K3I A;  2YKP A;  4DSF A;  1LQ9 A;  3ZZR A;  3D67 A;  5IM0 A;  4Z2X A;  2ZKU A;  2G1D A;  3IBW A;  4WU3 A;  3H5Y A;  3WIV A;  1YIJ S;  4RNH A;  4ZPC A;  1UJ5 A;  4DBQ A;  2A6M A;  3I5C A;  1NB2 A;  1Q8L A;  4Y2A A;  2C3P A;  3H7H B;  4DV1 F;  2BKP A;  1Y5L B;  3DM2 B;  4ZCL A;  3JTO A;  3W2V A;  3PX4 A;  4QWA A;  3AA8 A;  3PM9 A;  2ROE A;  1YJ7 A;  2HWI A;  4Q0B A;  3FJ2 A;  1KON A;  2NRE A;  2HNZ A;  3K5P A;  4UQT A;  4W98 A;  5HMZ A;  2G0J A;  2BRL A;  4OX8 A;  4P2S A;  3R7N B;  3EIC A;  4XPE A;  1FJ7 A;  3H59 A;  3MEK A;  1S6Q A;  2IJR A;  3MM8 A;  4WFB Q;  4ZPT R;  1TKZ A;  2B5J B;  2LVW A;  3AA9 A;  1UPP A;  3VAJ A;  1W2I A;  4TY8 A;  3I4P A;  2Q66 A;  2NSC A;  1R89 A;  2YQ1 A;  4HAC A;  4GKJ F;  4TN2 A;  3QGP A;  1LW0 A;  3CCS S;  2QLX A;  5HJX A;  2RD5 C;  3T9N A;  1RAA B;  2UXB J;  4DSL A;  3IR5 B;  1W25 A;  1OO0 B;  3MGJ A;  1SJF A;  3WIU A;  3CCR S;  3HHN B;  2E7X A;  2MGZ B;  2CNO B;  4N7T A;  4Q5V A;  2L9N A;  2XY7 A;  1Q78 A;  3HHL B;  3NNH A;  4DR4 F;  4A8O A;  1UJ4 A;  4C2M A;  2V5H G;  2V9W A;  3I9V 9;  4ZN3 A;  5K8M A;  3OL6 A;  2ZJQ Q;  2MY7 A;  1UKU A;  1OS5 A;  4A8S A;  3BPS P;  4HR2 A;  2NPI A;  1HNI B;  1RCX B;  4DL0 C;  3JSM A;  3AY0 A;  2B8P A;  2VA2 A;  4CLL A;  2GCF A;  3QT8 A;  1SIZ A;  4DV1 J;  4OI1 A;  2KN4 A;  5D4O A;  2IMO A;  1WAC A;  4LSZ B;  5KFC A;  4DX5 A;  1Q53 A;  2JX2 A;  3GFY A;  3MPY A;  3N5B A;  1VBZ A;  3ET6 B;  3MAA B;  4LIR A;  1LWF B;  3MD3 A;  4B9L A;  1UEV A;  3DN9 A;  4IO9 Q;  2M5Y A;  1VQM S;  1U1M A;  1LKZ A;  1VQY A;  3BQ1 A;  2CPI A;  3LP0 B;  2YWF A;  1RAF B;  2FTR A;  5J2Q B;  2UVR A;  3CUL A;  4L75 A;  3CDE A;  4RKU C;  4DN0 A;  1YBU A;  2G9O A;  1QDU B;  2AEF A;  4ILR A;  1DTQ B;  4LF8 J;  1KOO A;  1VQ9 S;  3QRR A;  2K2P A;  4CYU B;  3DI6 B;  3VV2 B;  2ZBQ A;  2H5J B;  4GKJ J;  1BHN A;  4K4S A;  2OP5 A;  2WVC A;  4WFN Q;  3FZB A;  2YPY A;  3SEO A;  1NJI T;  4LT6 A;  3UQS A;  4RBU A;  3H2L A;  2QRR A;  5DDO C;  2L9W A;  1FVS A;  4ECT A;  1N0U A;  2XYH B;  5L9N A;  1RTJ A;  2BKN A;  2DY9 A;  1U48 A;  3TOQ A;  1MW7 A;  1MMN A;  3KLH A;  4DR4 J;  5A0Y A;  2XZD B;  2X1F A;  2DGU A;  3MFI A;  5F8I A;  2OHD A;  2DR5 A;  2E1C A;  3HVR A;  2C2M B;  3KUG A;  4HI2 A;  1U1Q A;  2CNN B;  1Y10 A;  2YNI A;  3MCO A;  1WD6 A;  1FXD A;  1JLE A;  1TKD A;  1NND A;  4ER8 A;  2V4Q A;  4KSE B;  1RT7 A;  1SH2 A;  4RUH A;  2VG7 A;  2Y0B B;  1WSR A;  1JLQ B;  2FZC B;  1WI6 A;  4FVC A;  1KFS A;  5AXK A;  1HWJ A;  3GJS B;  3PIO Q;  2BV3 A;  4HTI A;  4R5P B;  2HVH A;  4LRF A;  1WG4 A;  2QV6 A;  3MR5 A;  3VHQ A;  2ZUG A;  4F67 A;  3BGR B;  4F26 A;  3UVJ B;  2W7P A;  3TUP A;  4M95 A;  4OQJ A;  5F3Z A;  3BKU A;  2CJQ A;  3GPA A;  3C15 B;  1TK0 A;  2UU9 F;  1XMQ F;  6FD1 A;  4PRF A;  3QFW A;  3M1V A;  2MQP A;  4DL2 A;  3CO0 P;  3C3L A;  4NA1 A;  5IQQ A;  4C9D A;  1GTE A;  2VUG A;  3D68 A;  1S1W A;  5E33 A;  4NLX A;  2RRB A;  3OLB A;  3DRS A;  2FVC A;  3QNW B;  2NZC A;  1C0U A;  2CQP A;  2AGQ A;  2KRB A;  3M8P A;  4FPI A;  3KLE B;  4NEZ A;  3MEG A;  4ZPW R;  2XY6 A;  5FD1 A;  2I5J B;  4Y2M A;  1ZM9 A;  1NB7 A;  2V8D A;  4IR9 A;  1F9H A;  4YR2 A;  1T02 A;  2AGO A;  4Y0F A;  4WFA Q;  1XMB A;  5CZV A;  2ZE2 B;  1HNX F;  1Y4Z B;  1UMJ A;  2EK6 A;  4WFX A;  4IKA A;  2UVW A;  4LBI A;  2QT7 A;  4E98 A;  2OTL S;  2Z30 B;  1UVK A;  1N5T A;  5DRK A;  1FFG B;  1VQP S;  1ZAW A;  2KVQ E;  3IAS 9;  4YEA A;  3C19 A;  3LA0 A;  5SUH A;  5KFR A;  4RLE A;  2QEX S;  2Z0G A;  5GVQ A;  2C42 A;  2AMC B;  4X62 F;  2IHR 1;  3DMJ A;  4YR3 A;  1AFJ A;  3LQV A;  3SZ2 A;  3CD6 S;  3H5X A;  2R8K A;  3H8Y A;  5BYS A;  4H4K C;  5KFA A;  3PVX A;  4BWJ A;  2UU9 J;  1XMQ J;  1TZ0 A;  3MI7 X;  2E5I A;  1KQF B;  2HLU A;  3W8P A;  4X4O A;  3PDN A;  1UJ6 A;  1YJ9 S;  4FPR A;  4CLF A;  1XR6 A;  3AQO A;  2P6S A;  4OYX A;  3RB6 A;  3G6X A;  3W3S A;  2ZD1 A;  4DUZ F;  2N7C A;  1ZAX A;  2CQD A;  3N6L A;  3QT6 A;  3CJ2 A;  2IRY A;  4ED8 A;  1RBL A;  3H40 A;  4C8Z A;  2HEK A;  1RAG B;  3PW4 A;  4HHH A;  4ZVE A;  3TA2 A;  2BE7 D;  2ZVS A;  4QW8 A;  3EZ5 A;  3LP2 A;  1KS2 A;  1U1O A;  2FJW A;  4PG4 A;  3D1H A;  3M7V A;  2V69 A;  2KT3 A;  1UL3 A;  1HNX J;  1BWE A;  3C14 A;  4H4O B;  1H38 A;  1BQM A;  2ZFH A;  1X5T A;  1O0P A;  3R5C A;  3UDL A;  2MKH A;  1H2V Z;  3QJJ A;  1IKX A;  3VQS A;  3GB0 A;  2WVD A;  5IFM A;  4DPT A;  4X62 J;  2YX1 A;  3CF5 Q;  1JLG B;  1L5U A;  2GV1 A;  1IR0 A;  4WYL A;  2MB0 B;  4BBY A;  2KFZ A;  2HGM A;  1IBC B;  2HVD A;  2DHH A;  4UOG A;  3VGS A;  2K8G A;  2HAI A;  4HI1 A;  3T3F A;  2FB0 A;  4PQU B;  3TJ8 A;  3IO1 A;  2VB6 A;  2MQ8 A;  1HBU B;  2J9E A;  4RO0 A;  1NPR A;  1WC0 A;  2FLL A;  3P8B B;  5DQI A;  3KK3 A;  4OJH A;  5HI7 A;  4DUZ J;  3TRG A;  4B9T A;  3GP9 A;  2EVZ A;  2AYE A;  3BO2 A;  3IRW P;  3ETO A;  4LIW A;  2ZBI A;  2GVZ B;  1TK8 A;  2MKK A;  3LWM A;  3KNA A;  3NGD A;  2B9W A;  1IKY B;  3P4U B;  1I94 F;  4CRJ A;  2NZ4 A;  2ZH9 A;  1UWB A;  3MCM A;  5D0R A;  3L4B C;  1S0N A;  2ASJ A;  2DD8 S;  2H54 B;  4O3R A;  2QFI A;  5KFP A;  4DX6 A;  5J2N A;  3UR3 C;  1XC9 A;  1FX4 A;  4WE1 A;  2QLF B;  5A8K A;  2CQI A;  1FKO A;  5F41 A;  1AYE A;  1BLU A;  2EXU A;  3A8K A;  2M52 A;  1VC6 A;  4OHW A;  4ICL B;  1SVD A;  3OR1 B;  1HA1 A;  3DHX A;  3CJ4 A;  4J5O A;  1FHT A;  2RIL A;  3BJY A;  5DET A;  3VAF A;  2CRL A;  1SBR A;  4RBV A;  1T8E A;  5C7P A;  1UW4 A;  2OPP B;  5ETS A;  5C24 A;  4RU9 A;  3TZY A;  3TA1 A;  1SJ4 P;  1TV6 A;  1B7F A;  4CH7 A;  2DNL A;  3JTN A;  1DTT A;  3PNI A;  3QIP B;  1ACM B;  1U1R A;  1JLB B;  4DR6 F;  3IFE A;  3HXM A;  2ZH7 A;  2LP4 A;  1XTZ A;  5MAO A;  3QWP A;  1T95 A;  4MJK A;  1HNW F;  1APS A;  4Q2M A;  2PI5 A;  3TI0 A;  1T9V A;  4CO0 A;  4N5S A;  3QJL A;  3L95 X;  3MPU B;  3W5Y A;  4P74 A;  4TVA B;  1SH0 A;  2CJA A;  1DLO A;  4FZV A;  3ITH A;  4F7V A;  1TL3 A;  3FDS A;  2Z2M A;  3M30 A;  3SBM A;  1RTZ A;  1I94 J;  2VFS A;  2JL9 A;  1F60 B;  1FRX A;  3G9C A;  1U1P A;  4DUT A;  1LK7 A;  4ZVS B;  4YY3 F;  3NGR A;  1OJ4 A;  2E5H A;  5J1E A;  4UZC A;  1RAJ A;  4CT9 A;  4C48 A;  4TQS A;  4KHM A;  3TWZ A;  3X3U A;  1MRO B;  4TU9 A;  1HIY A;  2A2D A;  1VQS A;  2LFV A;  1QE1 A;  3VVU A;  4NXN F;  4CLY A;  4J9V A;  3EVM A;  2C3O A;  1ZZN A;  2ROP A;  3KJV B;  4LRA A;  1Y00 A;  3TJ9 A;  3UDE A;  4RW7 A;  2J7K A;  4RPF A;  1VQ4 S;  4FS2 A;  1UP1 A;  4WP9 A;  1YTY A;  3L7U A;  3IRX A;  4JI4 F;  1BXN A;  3KLG A;  3FEY B;  3QGI A;  2DCU B;  4TQR A;  5AE2 A;  1WC6 A;  2G2O A;  3GR0 A;  2W8K A;  2YKN B;  3UN2 A;  3HSD A;  4ZVP B;  2XWX A;  2DGO A;  2HRY A;  4RW4 A;  4DI6 A;  4DV2 F;  4JBC A;  1HNW J;  1JJ4 A;  1HBO B;  5C2G A;  2CPF A;  1N6Q A;  2W9B A;  3M32 B;  3KXD A;  4HEA 9;  4HVZ A;  2QLB B;  2CPY A;  1FK9 A;  3DGV A;  1U0H B;  2HHV A;  2MTL A;  1U8W A;  4WBF A;  2KL8 A;  3UPF A;  1FI4 A;  4ZJO A;  3HHD A;  1FJG F;  4ZHR A;  2XMU A;  5JJB A;  3M4X A;  4DCP B;  4MFB B;  2HGL A;  2BAB A;  2QG9 B;  4YY3 J;  1AZS A;  4K2X A;  4X2B A;  4UST A;  3DRR A;  1X4A A;  1CUL A;  4DV4 F;  1B0P A;  2F40 A;  2LDI A;  4EBC A;  1T3O A;  1OYD A;  4AQY F;  2YVS A;  2KU7 A;  1NO8 A;  2GJ2 A;  3FMB A;  2YQ0 A;  3R5A A;  1MLA A;  5ETO A;  3DRY A;  1FE0 A;  1KQS R;  2CKW A;  4OX7 A;  6AT1 B;  3AAW B;  3K8W A;  1RHQ B;  2FVS A;  3N5F A;  5JMN A;  2VBZ A;  4CH0 S;  2RRA A;  2FJD B;  3DOL B;  3IGN A;  3DLK B;  1RT5 A;  5KG3 A;  2HMI B;  2HRT A;  3CJT A;  3WBZ A;  1RTH B;  4JI4 J;  3U27 A;  2Q43 A;  1HHS A;  4WKR A;  1FEH A;  3Q2T C;  1GMW A;  4C8K A;  2J9D A;  3DM2 A;  3VGT A;  4DFP A;  1WC4 A;  3NAI A;  1YJR A;  3LP1 B;  1NK7 A;  3AOA A;  1U6Z A;  1Q81 T;  2U2F A;  3IMQ J;  5HAO A;  1M5V C;  4B17 A;  2E5G A;  2ZH5 A;  4DJB A;  1D1U A;  4Q7A A;  2V6A A;  1RU1 A;  2YWK A;  4DPO A;  2MQO A;  5K9F A;  3THV A;  2CQB A;  2DHS A;  1JWW A;  3OBI A;  1CBK A;  2RS2 A;  3DOK B;  1SC4 B;  1HWK A;  5D4P A;  2KM8 C;  4OZ3 A;  2R7O A;  4NEY A;  4QR1 A;  3CCZ A;  3T5L A;  3HKW A;  2B5J A;  1AB8 A;  1GXU A;  3P96 A;  2JLF A;  4ZJQ A;  2KXF A;  5F9N A;  3GFZ A;  2XI2 A;  4FF4 A;  3NRB A;  3MZI A;  1WG1 A;  4DV4 J;  3KLI B;  2KO1 A;  2ASD A;  1X4F A;  2W9C B;  4ECV A;  1F3V A;  1X31 C;  1H72 C;  4AQY J;  2V34 A;  3H0P A;  1KHV A;  5LJ5 Y;  3P3D A;  5EWG A;  5KG2 A;  3GFX A;  1WDT A;  2MGZ A;  4X4T A;  4WU2 A;  4DV6 F;  4AND A;  3JQJ A;  3P49 B;  1XEZ A;  3HHL A;  3MUR P;  3DU6 A;  4QWD A;  3ZZZ A;  4C97 A;  4C11 A;  4NL5 A;  3KUE A;  3AD9 C;  3TUJ C;  2P9E A;  5DDQ C;  3MOJ B;  1HNI A;  3SCL E;  3AXK A;  1L3S A;  5AJ3 J;  4WK1 A;  3GE9 A;  2QGF B;  4IRC A;  4CLK A;  1KEK A;  1Q5V A;  2G2Y A;  4FYW B;  2M9K A;  3ET6 A;  3MAA A;  2QTW A;  5G0R B;  2LQ8 A;  4O4G B;  1RAI B;  2JDJ A;  5AXM A;  4ZPV R;  5F0W A;  1Z2Z A;  1SC6 A;  3QBC A;  3UN5 A;  3NGT A;  2BJ9 A;  3LP0 A;  1U25 A;  3EVO A;  5JUM A;  5J2Q A;  2CQ2 A;  1F5A A;  1BE4 A;  1DTQ A;  2O5D A;  1H98 A;  4Y2C A;  1UZD A;  2DNK A;  4CYU A;  3DI6 A;  2CZ4 A;  4HDG A;  2FJV A;  1K73 T;  1FDN A;  2JSX A;  4P75 A;  2AJ0 A;  3W2W A;  2EFQ A;  3OW2 R;  5HN0 A;  4OJ1 A;  3T9Z A;  1VRT A;  4ZIW A;  4OI0 A;  3PX6 A;  4LFB F;  3CJ8 A;  4OZJ A;  3G8Q A;  2DBB A;  3IAM 9;  4PG5 A;  4AL7 A;  4NI2 B;  1S9E B;  4DSE A;  4Q45 A;  2VBW A;  2F1F A;  2VL1 A;  4DV6 J;  4XK8 C;  3IG1 B;  2LEC A;  3KJQ B;  2W2N P;  4L73 A;  4NRU A;  5C42 B;  2VKR A;  4NYP A;  3RJM B;  3LWL A;  1UCN A;  2RUS A;  4MYT A;  4HTJ A;  1LWE B;  5GME A;  1VK8 A;  3UD3 P;  2G0I A;  1GX5 A;  1KKH A;  4JP8 A;  4EYI B;  1TP7 A;  2VPX B;  2HBR B;  1UPM B;  5EWE A;  1JLQ A;  2HIQ A;  5MLC V;  4W92 B;  2QC3 A;  3M9N B;  2RF2 B;  3VZH A;  3TQ1 A;  1YI2 S;  2B9X A;  2WSF C;  2KH9 A;  4Y28 C;  4R5P A;  2AJF E;  1EP4 B;  3UVJ A;  1FXL A;  3BN4 A;  3I32 A;  4ES2 A;  4CLZ A;  3C15 A;  3R2D J;  3CCE S;  2CQH A;  5HQM A;  2D69 A;  4YB7 A;  3EDQ B;  4DSI A;  1YVF A;  4DFK A;  3LAN A;  4M5N A;  4K59 A;  2R7R A;  5KG6 A;  5H9F J;  4FS1 A;  2HHT A;  2ACY A;  4P71 A;  1TKX A;  2YNH B;  1NUE A;  2CA9 A;  1XR5 A;  3ISZ A;  4ITS A;  3KTQ A;  4LFB J;  5CZX A;  4ZP6 A;  4B9M A;  3ILO A;  3WZ0 A;  3KLE A;  3GSI A;  4KGV B;  3H4D A;  3P5T L;  4PPD A;  3W63 A;  2I5J A;  5F8H A;  2VC1 A;  2VFR A;  4Y6I A;  1HW9 A;  4ZDN A;  2LQ5 A;  2ATL A;  3NGS A;  1OY9 A;  1J27 A;  3B82 A;  2D7S A;  4I2Q A;  1NJZ A;  1S6P B;  2ZE2 A;  5AE1 A;  3W66 A;  3PR5 B;  1NU4 A;  2QLJ B;  1QAJ A;  4KFB B;  3OLA A;  4H4M B;  3PV8 A;  2R2S A;  3CJ5 A;  2HHH F;  2VV5 A;  4C3K A;  3TZW A;  1B3T A;  3M6W A;  4PYD A;  3KFW X;  3TAM A;  2J8S A;  3GJR B;  1VIX A;  2XCP A;  3HVW A;  1RAD B;  2PMW A;  5E3C A;  4M8L A;  3QQC D;  1R0B G;  4I56 A;  3TO8 A;  4C0H A;  2LCW A;  3EZU A;  1HWL A;  2R2T A;  3IBC B;  3MWB A;  1U2R A;  2VPW B;  1JLA B;  1MN9 A;  1WI8 A;  1TUW A;  4FKY A;  4KGZ B;  2R42 A;  2FHO B;  2IVM A;  1RTD B;  3AB2 B;  1Q95 G;  1F1B B;  1NZ8 A;  4HDH A;  3D3C J;  1NDC A;  2VQE F;  1CC8 A;  3V81 A;  3RAM A;  1WTF A;  2JEG A;  1QD1 A;  4J9K A;  2OO4 A;  5DS7 A;  4DS4 A;  2R7W A;  3PW7 A;  2ILY A;  3QO9 B;  2J0W A;  2YPZ A;  5EUH A;  2RAQ A;  5CA5 A;  1YSJ A;  2CWK A;  3K0J A;  2I8E A;  2BA9 A;  4EZ9 A;  2DT9 A;  4USH A;  2CJY B;  4IG0 B;  3PXG a;  3M2R B;  1N34 F;  5KT7 A;  4H4O A;  4QU6 A;  3HD2 A;  4I67 A;  3UW1 A;  2V2Z A;  4UOH A;  1S79 A;  3HUL A;  5F8L A;  2CPH A;  2HHH J;  4NZ6 A;  3AFG A;  4QIF A;  1VBK A;  2W7O A;  5EWF A;  4QWE A;  5D78 A;  4LBP A;  1VBX A;  5IS2 A;  2BQU A;  5M2U A;  1FD8 A;  1T7P A;  4NZ7 A;  4DOZ A;  1R8C A;  1SC3 B;  1JLG A;  2YNG B;  1KQK A;  2NYH A;  3FEX B;  3Q0A A;  2EFP A;  4K4U A;  3TYT A;  4LSL B;  3M9O B;  3J7A 1;  3MAH A;  2RJZ A;  1IKW B;  5D0G A;  4PQU A;  3WC2 A;  4IRK A;  3BB5 A;  3CJ0 A;  1FKA F;  3E8O A;  1VI7 A;  3HMJ G;  3I87 A;  3SCI E;  2VQE J;  2XTJ P;  4DF8 A;  3TQE A;  4C8L A;  1F5B A;  2GHP A;  1XIQ A;  2BE2 B;  4W90 B;  4B08 A;  2GVZ A;  1FCA A;  2X1B A;  4L76 A;  2CJ9 A;  2J0S D;  1R6Y A;  1IKY A;  3AXM A;  1WF2 A;  5D3G B;  2VH7 A;  5AE3 A;  4DU7 A;  3VR1 A;  1QTN B;  5HVH A;  1Y7P A;  3RU0 A;  2D3O 1;  2IAJ B;  2PFF B;  2XHW A;  4KT0 C;  1N34 J;  5LSL A;  4MIB A;  1NHK L;  4FYY B;  1S59 A;  1QJH A;  1Q4R A;  3S01 A;  2XMK A;  1P1T A;  1UET A;  4JV5 F;  2I1R A;  1Q8I A;  3RAX A;  1YBT A;  1VC5 A;  2BKO A;  2XO7 A;  3FSY A;  1ROF A;  4NX9 A;  3J81 j;  2ZH8 A;  4MK9 A;  4YS2 A;  1DRZ A;  1PAU B;  3R6L B;  2NXN A;  4ICL A;  3J7Z T;  3OR1 A;  2C28 A;  4U6P A;  4OYM A;  5ETP A;  2CAJ A;  2RS8 A;  3HVA A;  2DGW A;  1S9G B;  1YDL A;  2OPP A;  4RJV A;  2DHG A;  2EBE A;  4AUK A;  4PPZ A;  4ID5 B;  3QIP A;  1X4E A;  1JLB A;  3SI8 A;  1O8B A;  4OYB A;  2HBZ B;  1HBM B;  4ECY A;  4ZVF A;  2XHC A;  2DH7 A;  2KVI A;  1U47 A;  1NK4 A;  3BQ0 A;  3OQ2 A;  3Q8S B;  2X7I A;  1EQ0 A;  2FUG 9;  5H1S V;  1UTA A;  5L1K A;  4F4X A;  4ED1 A;  1X9W A;  3BYP A;  3VGU A;  4YFU A;  2ZOF A;  3UO0 A;  3NCQ A;  5KAK A;  1SJQ A;  3Q8Q B;  4LFA F;  4ED4 A;  4H54 A;  1LV5 A;  2FLP A;  3FMW A;  4OZ0 A;  2OJ3 A;  1WUU A;  3EYZ A;  3OFF A;  5IT4 A;  1NJY A;  5J2P B;  3W2V B;  1NH7 A;  1MRO A;  2ZJP Q;  4ZMM A;  3Q8R B;  4Q0B B;  4JV5 J;  4AD6 A;  1KNZ A;  3G8T A;  2V94 A;  2E1P A;  2Z56 B;  3M8Z A;  2HNZ B;  1ZYQ A;  3PIP Q;  4JOU A;  1S99 A;  3VAH A;  3H25 A;  1YX2 A;  3KJV A;  2IYI A;  2DK2 A;  2HNY B;  2J7W A;  4KY3 A;  5CD4 H;  2FJE B;  5KG4 A;  3AQP A;  3TAQ A;  2GHW A;  4QWB A;  3J80 U;  3DFE A;  1QSY A;  4B3M F;  5ETN A;  1H7W A;  2F8H A;  2RU9 A;  4O3N A;  1FX2 A;  2C2Z B;  1EIY B;  2GS8 A;  5KT2 A;  2YKN A;  4HAC B;  1N54 B;  2OEJ A;  2PMZ D;  4CTA B;  1LW0 B;  5B0A A;  5HRO B;  1L3T A;  4QIW D;  1B99 A;  3I82 A;  2YX4 A;  2CIM A;  3CED A;  3HDS A;  2IJN A;  1U0H A;  3HVT B;  5KFG A;  4LQ3 A;  2BDP A;  1GH8 A;  1R6V A;  3PEH A;  4U96 A;  1DUR A;  4N56 A;  4HKQ A;  1TVR B;  4V19 X;  4LFA J;  1T9Y A;  2BYC A;  4IQM A;  1ZTW A;  4MFB A;  2GVD B;  1FES A;  2DGX A;  2HK2 A;  4RZR A;  4OHY A;  2K1R B;  3HT3 A;  2YY3 A;  2AEM A;  3OFH A;  1XNQ F;  1S1X A;  2QIF A;  2FQQ B;  2Z57 B;  2OMO A;  2E44 A;  3ETM A;  3ZZP A;  1GMW D;  3DLE B;  2QSW A;  3W62 A;  2YH0 A;  4P72 A;  1S10 A;  1RUS A;  1HQE A;  1IQT A;  2NXC A;  1N88 A;  1RWV B;  2JEI A;  5KFV A;  1MML A;  1K1S A;  4DZ6 A;  4ED2 A;  1FRH A;  1T05 A;  3EJM A;  2IMW P;  2IM1 A;  3BH7 B;  2JH3 A;  2DY1 A;  5ETV A;  3HHK A;  3HFV A;  3DOL A;  3UI3 A;  3DLK A;  2H9Z A;  2HMI A;  2E7W A;  4KGK A;  4UY8 T;  1RTH A;  4Q43 A;  4B3M J;  2AP6 A;  2E9T A;  1BMQ B;  3PAC A;  1FNM A;  3TVK A;  3KHL A;  3DHW C;  4F3M A;  2I6W A;  1TAQ A;  1RHM B;  2OGU A;  4N47 A;  2QYC A;  1EJ7 L;  4TY9 A;  2IBK A;  2CVI A;  2V0N A;  1YHQ S;  1T03 B;  3NCR A;  2Z2L A;  3GIL A;  4NA3 A;  3DOK A;  1V3Z A;  3SQO P;  2CQ1 A;  3CCQ S;  5IV4 A;  2H65 B;  3EMT A;  2M8D B;  4JI6 J;  4KKO B;  4RUB A;  3G82 B;  2HQF A;  3NEK A;  2HQD A;  5RUB A;  2YNI B;  3KKF A;  2MHE A;  3IM8 A;  3BSC A;  2B0G A;  1NDK A;  2IDE A;  4LBH A;  1RT7 B;  4WP8 A;  1XNQ J;  3KLI A;  3R5B A;  3HO1 A;  2VG7 B;  2QL5 B;  1VHF A;  2ZH2 A;  2QA2 A;  2W9C A;  2RT3 A;  3NLC A;  4EUV A;  2OH2 A;  1HI8 A;  5T41 A;  3M2V B;  5KFO A;  4FP9 A;  4LJM A;  4X4P A;  1R0A B;  2ZH3 A;  2FY8 A;  2CPE A;  3C66 A;  1PYO B;  5KFI A;  3DLG A;  5KFD A;  3ZTR A;  3AOB A;  2DB1 A;  2CVE A;  4I64 A;  2MJN A;  1JKH B;  3CUN A;  3T5K A;  4RU2 A;  1U6F A;  2DIV A;  4NLP A;  2NLW A;  1KLN A;  1DHM A;  4GO7 X;  4HL9 A;  4PWD B;  1QAX A;  2QL7 B;  4ZVH A;  3D1O A;  4YDD B;  5F9L A;  5G0R A;  4O4G A;  4OLO A;  2W01 A;  1G2E A;  1WSV A;  1NPK A;  1JXE A;  5D6G A;  1YZ7 A;  4KJI A;  5IQ6 A;  4KIA A;  1NLK L;  3Q8P B;  5I3P A;  4ALZ A;  4C0O C;  1JQG A;  4OL8 A;  5L1J A;  2CPX A;  3WQP A;  2GGP B;  5KFF A;  2HG4 A;  1HR0 F;  2RVJ A;  3FBE A;  2FGC A;  4ZLL A;  1OMS A;  3ENQ A;  1WEZ A;  3R1L A;  1N4L A;  4ID8 A;  2DNM A;  1S12 A;  3NG8 A;  3H42 A;  2VKZ G;  5I3U B;  3GIK A;  2O67 A;  4KO0 B;  2KI2 A;  1IQZ A;  1RLC L;  1R43 A;  4F3O A;  2ILZ A;  1S9E A;  1ZA2 B;  1Y3K A;  2VU5 A;  3CDW A;  1K47 A;  4DPU A;  3W61 A;  3SYZ A;  2CWX A;  4LRE A;  2G4B A;  3IG1 A;  1KLM B;  3WDO A;  3PRV A;  3OV7 A;  1KVI A;  2E1M C;  2N3L A;  3VGV A;  3AH6 A;  2BM0 A;  3RB4 A;  2VIC A;  5C42 A;  3W64 A;  5EDW A;  2AHO B;  2IYG A;  2YH1 A;  3B54 A;  1YIT S;  2DKO B;  1U2C A;  5EN1 A;  2RUG A;  3H5S A;  1U2F A;  3FBF A;  5CHC B;  1RXO B;  1EKR A;  3BO4 A;  3M8W A;  2UUA F;  5DDP C;  2W4P A;  3PRD A;  2EC0 A;  4FNH A;  1EP4 A;  4G1Q B;  5KFU A;  2KZZ A;  1U09 A;  1HI0 P;  1NBE B;  2MZS A;  3BH6 B;  1FFW B;  8ATC B;  2B6A B;  2ATC B;  1CQN A;  4NPO A;  1CSJ A;  1L3V A;  2CUY A;  1YJW S;  3OHA A;  4IRD A;  1FNX H;  1HR0 J;  3TVY A;  1YBA A;  1NK5 A;  1RWP B;  4NMX A;  2LEP A;  4IFV B;  2PD1 A;  1J5O B;  2EPI A;  4MIW A;  4FXW A;  4DCO B;  3CJK B;  3T6J A;  4FYX B;  1M5K C;  1WOS A;  1FFS B;  4OYW A;  2VFU A;  1CJV B;  1KVJ A;  1U49 A;  1ARO P;  3N4W A;  1E6V A;  2DXE A;  1JXL A;  3NWG A;  4I68 A;  5D4L A;  5KG7 A;  4DLG A;  1N52 B;  4ES3 A;  2WVF A;  4DDF A;  1HFE L;  1WKJ A;  3B8H A;  1S6P A;  3IP0 A;  3EGW B;  1ITP A;  2H3E B;  3KMQ A;  4DR5 F;  2YKA A;  3ZC4 A;  1H2U X;  4CO5 A;  4KFB A;  5J1N A;  1AXQ A;  2DGS A;  2J6T A;  2R4F A;  2EWH A;  1RWK B;  4NLS A;  4F02 A;  2VFT A;  4J9O A;  3TX0 A;  2HS0 A;  2WVE A;  1KRP A;  4F2S A;  1YGY A;  3EGN A;  5E3R A;  2B4O A;  3ISN C;  1RAE B;  1U1K A;  2UUA J;  3FUY A;  1KR4 A;  2ZC4 A;  3KDN A;  3V4I B;  4S0M A;  3IWL A;  2SXL A;  2F65 A;  1PCA A;  3PG9 A;  1TQL A;  2D41 A;  2NXJ A;  3SDE A;  4P10 A;  3PO4 A;  1VQN S;  1VQO S;  4USM A;  3KK2 B;  5KFX A;  4ZVQ B;  3NNC A;  2KDO A;  2IRX A;  2B4P A;  4ED5 A;  2QMX A;  1XK8 A;  4B3R F;  3O1L A;  3KHR A;  1B0V A;  1H74 A;  1VK3 A;  5J2N B;  4X4R A;  3RB0 A;  3I55 S;  4ANE A;  3PYE A;  2DR6 A;  2ZWO A;  4MK8 A;  5DG7 A;  3D9B A;  1S76 D;  1JMT A;  2R7U A;  2UVU A;  1DQ8 A;  2JVO A;  3H2U B;  4JI1 F;  5GAH U;  3CNQ P;  1QVF R;  2JJ4 D;  4I69 A;  4A46 A;  4ECX A;  4IG0 A;  2FVQ A;  5D8H B;  4RWW A;  5ETM A;  3OSN A;  3M2R A;  3S7R A;  5LXY A;  4DR5 J;  1OWX A;  3RBZ A;  2QFJ A;  1F0X A;  3LUY A;  3F73 A;  1YK9 A;  2ZUA A;  1NSK L;  4JB8 B;  4K0K F;  4OZL A;  2JOQ A;  4O3P A;  2Z2Z A;  2YNG A;  4J9L A;  3KWM A;  2XG8 A;  1KFD A;  4ZVR B;  4MKY A;  4LSL A;  3MR6 A;  2BEF A;  2GQC A;  2D9P A;  3ZTP A;  2G0C A;  3OUY B;  3VAG A;  2L08 A;  5B0C A;  1IKW A;  5KFQ A;  4A48 A;  2QSF A;  4OYA A;  4B3R J;  1K9M T;  4NA2 A;  3B78 A;  4UOC A;  3RTV A;  2HHU A;  2NR0 A;  3A8J A;  2BE2 A;  2XCA A;  4XDD A;  1EET B;  1SJ3 P;  3CT9 A;  1NKB A;  3MF5 A;  1DY3 A;  4KPY A;  5B7W A;  4QYR A;  2PEB A;  2BJ3 A;  2HFO A;  3KK1 A;  1PAE X;  3QGG A;  3M8R A;  4QPX A;  4JI1 J;  4F2R A;  3JQK A;  2IAJ A;  1ZZF A;  5AXN A;  4DR3 F;  4IH5 A;  3RW6 A;  3MCS A;  2KHD A;  3HLU A;  3SCK E;  1U1L A;  2XO6 A;  3GCX P;  3K17 A;  2FDN A;  1CJT B;  5JXS A;  3KLV A;  2UUC F;  5BYR A;  4ZLJ A;  3PTW A;  5ETQ A;  4M63 A;  3DLL Q;  4K0K J;  4PAB A;  3PFO A;  3PJW A;  1P8G A;  2JHE A;  1LWX A;  5KT6 A;  1FK9 B;  4OYP A;  1RWW B;  3VF0 B;  1CS4 A;  1RYS A;  1YRT A;  1S9G A;  3DXB A;  4CO4 A;  3JXO A;  3SV4 A;  2LQ9 A;  2QA1 A;  2HUR A;  4ID5 A;  1X4H A;  2Q6C A;  2ADB A;  4PG7 A;  1AZS B;  1RK8 A;  9RUB A;  2DPJ A;  2M0G B;  1CUL B;  1HBM A;  3PYG A;  3D0I E;  3FZ2 A;  1PC4 A;  1CJU B;  3NBP B;  2AQ4 A;  3QSY B;  4A8W A;  4M5L A;  2EBG A;  1ZPW X;  5DGA A;  2C22 A;  2Q6B A;  3UDC A;  4P52 A;  2F5G A;  1DAR A;  2OPQ B;  2PEH A;  2HFZ A;  1UVL A;  3D6T B;  1RT5 B;  3TA0 A;  4Y34 A;  1FWP A;  1T0T V;  4RNO A;  3EGV A;  2CZ9 A;  2XMV A;  5L1I A;  4DR3 J;  2OKQ A;  1D8Z A;  5K8P A;  1X9S A;  1QSL A;  5J2P A;  1TFY A;  3D0H E;  1XER A;  4AYB D;  4IG3 B;  2UUC J;  2RKI B;  5AT1 B;  3V6K A;  4NLU A;  1TR0 A;  1KVK A;  3UD4 P;  2HNY A;  3UFC X;  4ED3 A;  1SC1 B;  2YKO A;  3VAI A;  2CNK B;  4LSN B;  5DLG A;  1GX6 A;  1VRU B;  3HT0 A;  3I9Z A;  4M5J A;  1MWY A;  4NWB A;  2OFH X;  3PFE A;  1C0T B;  2XM3 A;  2B7C B;  1KC8 T;  4OZN A;  4ZP8 A;  1MNE A;  1RB0 A;  3IS9 A;  2W9A A;  4DU8 A;  1KWM A;  4CQ1 A;  4K4V A;  1UFW A;  2PO4 A;  4CTA A;  3NXZ A;  3ILJ A;  4K8R A;  2R8H A;  2HSE B;  4LQ9 A;  5HRO A;  2OPR B;  2HZV A;  3PW2 A;  3TNV A;  3VAM A;  2AF6 A;  5LSO A;  1KBR A;  2MY8 A;  2JVR A;  1Y0H A;  2ADC A;  2UUB F;  3F44 A;  5LXR A;  2AJ2 A;  3HVT A;  1Y9O A;  4N41 A;  3UE2 A;  3JSR A;  1EAR A;  5A2Q Y;  4B9N A;  4USK A;  3L09 A;  2WON B;  3J7Z 5;  1TVR A;  4C11 B;  5CH7 B;  1Z2L A;  4EGL A;  1QAI A;  4BHQ A;  2GVD A;  5E5N A;  1YRU A;  4ELV A;  4LF9 F;  3MCN A;  2K1R A;  3JSY A;  2PFD A;  3UCZ P;  1JX4 A;  1S1T B;  5DZ7 A;  2ZBC A;  3K7R A;  2AEJ A;  2ZM6 F;  2Z2Y B;  3MHY A;  3MR3 A;  1LW2 B;  1A7G E;  4WK3 A;  3DLE A;  1N5S A;  4A8Q A;  2O66 A;  2Q3P A;  2CFX A;  1NK8 A;  2MKJ A;  4OYO A;  4PXD A;  4MK7 A;  3W5X A;  2LA4 A;  2ZH1 A;  5DQH A;  3BSN A;  2QMU B;  1SL2 A;  3D66 A;  5U47 A;  2LMI A;  1Q79 A;  3D0G E;  4YP3 A;  3CC4 S;  1Y3J A;  4JI3 F;  5AXL A;  1I6J A;  2HZC A;  3MPV A;  4WCE Q;  5BR8 F;  3IA0 A;  4ZCM A;  3W2W B;  4CM0 A;  3NY0 A;  1PSD A;  5B0E A;  4M94 A;  4IH6 A;  1VRT B;  4IO1 A;  1R7I A;  4P2F A;  3MM5 B;  3UR0 A;  1PIE A;  1BD6 A;  2BJE A;  4WF9 Q;  1UEU A;  1JK9 B;  4ELT A;  1WF1 A;  2F3J A;  4F3Q A;  2UUB J;  5F8M A;  1T03 A;  4E8U A;  1RT4 B;  2BJ1 A;  3LAM A;  2CZV C;  1JLF B;  3BRE A;  1VIO A;  4NCB A;  2DHX A;  3BO3 A;  1O51 A;  3NCP A;  1DQ9 A;  2WW8 A;  3D5M A;  3I96 A;  4RW6 B;  4KKO A;  2DTJ A;  4LR8 A;  3G82 A;  2IM3 A;  4C8Y A;  1F9E B;  5M2R A;  4G3I A;  3PCO B;  4DHV A;  5E3Q A;  4LUB A;  4LF9 J;  4URG A;  3NOC A;  1X8D A;  1S57 A;  3TJA A;  5KFJ A;  1HPZ B;  3SXL A;  2ZM6 J;  4ECW A;  4CLU A;  3NGU A;  2XMA A;  4HHJ A;  3VQT A;  3M2V A;  3KMS A;  4ECQ A;  2E7V A;  5M2P A;  1HAR A;  3EE3 A;  1IM6 A;  2LA6 A;  2HHX A;  1R0A A;  3T5J A;  1EZZ B;  3PJ9 A;  2CPZ A;  5EGY A;  1GNK A;  1H3D A;  1S4F A;  3FVY A;  2RE1 A;  1TKT B;  1M1H A;  4JI3 J;  1JKH A;  1NXI A;  1IKV B;  3FRZ A;  5BR8 J;  3WX4 A;  1S77 D;  3MM6 A;  2BW2 A;  4PWD A;  1TKX B;  2YKQ A;  2K7K A;  4PUO B;  3MUM P;  3Q86 A;  3SMZ A;  1NM2 A;  2C2N A;  2QYG A;  2V67 A;  3LPY A;  3MAQ A;  2GJI A;  2F9J A;  1RKI A; 
#chains in the Genus database with same CATH homology
 3JQM A;  4PYA A;  1EKR A;  2EKN A;  4PYD A;  2OHD A;  4FDF A;  2IIH A;  3JQJ A;  3JQK A;  2IDE A;  2EEY A;  1EKS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...