2WOMB

Crystal structure of uk-453061 bound to hiv-1 reverse transcriptase (k103n).
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
427
structure length
412
Chain Sequence
SPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Lersivirine, a nonnucleoside reverse transcriptase inhibitor with activity against drug-resistant human immunodeficiency virus type 1.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
total genus 109
structure length 412
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2womB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2womB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2womB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2womB03
5CYQB 3EZUA 1UWBB 5KFCA 4QWCA 3KK1B 2FLLA 4Q43A 1MU2A 1LWCA 3G86A 1SH2A 4ED0A 5J1EA 1IKWB 2D41A 3SFGA 4NLPA 4IG3A 3QO9B 5KG6A 4RW8A 4Y3CA 2HMIA 1RTDA 4ZVFA 3GYNA 3V4IA 3M9MB 3CJ0A 2BANB 2RF2A 1KHVA 1U09A 3KLHA 3H5SA 2D3UA 3ICLA 2UUTA 3NKYA 3OL6A 4NLUA 3RAQA 4GC6A 4J9SA 5KFHA 4IFYA 4Q44A 2YNIB 3OSNA 2EC0A 4F4WA 5KG3A 1REVB 3MEGA 1HQUB 4MK9A 1S1WA 5KFXA 5EWGA 2DPIA 4DL2A 1T03A 4KSEB 1FK9A 4KV8A 2WHOA 3MEDA 3CDWA 4NYZA 1KLMA 2VG5A 2JC0A 1N6QA 1C0TA 1HNIB 3KK3A 3DRPB 5KG4A 4MK8A 1HNVB 3HVTA 2E9ZA 3FRZA 3KLEB 3IG1B 1TL1B 5JXSA 3VQSA 4O4GB 1C1BB 2IJNA 3H2LA 4KHRA 2UVUA 3V6KA 1DLOB 2YKNB 2HMIB 3DDKA 4I7FA 1IKXA 4O4GA 5F8JA 4RW8B 5L1JA 4KFBB 2QE5A 4YMEA 4GC7A 5KFVA 5KG7A 5DLFA 3V6DB 1BQNB 3BQ0A 5KFMA 4ZP9A 2V0NA 1JLEA 4Y34A 4Y2CA 4O3OA 1JLCA 3CJ4A 3GQCA 4IOBA 4NLRA 4QW8A 1GX6A 2XWYA 2R8IA 3FFIA 2F8EX 3H4BA 4XPEA 5F8NA 2JLEA 1RYSA 3IRXA 4H4OA 2HNZB 2B6AA 2RKIB 1DTTA 1IKVA 1LWFA 2HNDB 4DG1A 3KJVA 2WRMA 4NLXA 4ECWA 4ED7A 5L1KA 1N56A 1RT5A 1RT4B 4U7CA 4OL8A 1N6QB 4NLSA 2ATLA 1S0MA 4ICLA 4QWDA 3PW7A 1HARA 1JLGA 2CKWA 4QWBA 3KNAA 4ED3A 2W9CA 4J9NA 4TXSA 1CSJA 1SV5A 4JUZA 1TKZB 1S1VB 5KFRA 1HYSA 4FS2A 2BQ3A 3KMSA 1N48A 3LALA 4WYLA 3QZ7A 4MFBB 3V81A 4IFYB 2R8KA 3V81B 4URGA 5DGBA 3NBPB 4WXWA 2IA6A 2UVWA 3N6MA 3ISNC 1HQEB 2BR0A 5C24A 1HPZB 5HBMA 1KHWA 1C1CB 3TQ1A 3KLFA 3DRSA 4ED2A 3BGRB 3DI6A 3E01B 5F8MA 3C6TA 2UVRA 2XGQA 1RT5B 1TQLA 5KFSA 5DGAA 4TLRA 4TYAA 1RT1B 4ECYA 3I0SB 2R2SA 4WE1B 5KT2A 2ILYA 4ZMMA 1HMVA 1VRUB 3D5MA 4QW9A 3GILA 3I0SA 4K4YA 2WONA 4EYIB 2AGOA 2ZE2A 1S1VA 3MR2A 1NHUA 1S0NA 1C2PA 4K4XA 3LAMA 2YNHA 4KHMA 2AGQA 4I2PA 1S1TB 1TKTA 4NLVA 3Q8PB 3GV7B 5EWEA 1ZETA 1HYSB 4Q8EA 2YNFA 4B3OB 4WYWA 1BQNA 5F9LA 3MEEA 1XR7A 2WB4A 2IC3A 5D3GB 3M8QA 4EBCA 4RW6B 2V9WA 3KLFB 2R8HA 5HP1B 5J2NA 4URSA 3FDSA 4J9RA 2HNZA 1EETA 4M94A 1HQEA 3DLGA 1RT4A 3TVKA 2AX0A 1LWEB 4R0EA 1S1XA 2OPRA 4MH8A 4R8UA 4RUCA 4ZPCA 4DG1B 4O4RA 1QUVA 5F9NA 4J9KA 1S97A 1C0TB 4LSLB 2JEFA 2FVRA 4ECQA 2ASLA 1FK9B 2FVPA 2OPQA 1SUQA 3LP2B 5KFQA 5L1IA 4KKOA 1SV5B 3KHHA 4G3IA 4IQXA 4I2QA 4KB7A 4F4XA 4KFBA 4RW7B 4O3NA 1JLGB 2XC9A 3KLIB 3GIMA 3BSNA 2FVQA 3KLGA 3MECA 2JC1A 4RNFA 4IH7A 1RTIB 3T5JA 1C1BA 3IGVA 3G6YA 3KLHB 3CDUA 3KHGA 4M95A 1Z4UA 3MFHA 1IKXB 3H98A 3NGDA 5DQHA 1RTJA 4RNHA 3TAMB 1S6PA 5K14B 4RW4A 2FVSA 5CYMA 4KV8B 1TV6B 5KFZA 3DYAA 3SFUA 1I6JA 3QLHA 4EO8A 4MIBA 4TY9A 5DQIA 4LSLA 5DG9A 4U6PA 3CJ3A 4NLGA 3MR5A 1REVA 1HMVB 1VRUA 3MR6A 3I5AA 4WE1A 4ECZA 2FLNA 4I7FB 5FDLB 3CWJA 1N4LA 1QAIA 3LP1A 1OS5A 4YR0A 3DOLA 4KBIA 3CVKA 2IM0A 2AQ4A 3KLEA 4PWDB 5KFEA 4R5PA 1RT7A 4XPCA 1IKWA 3DRPA 1S4FA 1S10A 3KK2A 4TN2A 2IM2A 5HP1A 4J9OA 1EP4B 1C0UB 3QO9A 4I2PB 5KFOA 3M8QB 1RTHA 2ZD1A 2I1RA 4ECRA 4FBTA 4O3SA 2YNFB 4B3OA 1FKPB 4WZQA 3DMJA 4ZHRB 3M8PB 3JYTA 5C5JA 1S9FA 1TKTB 2ASJA 5C42A 2YNIA 4NLOA 1XR5A 2BRKA 1JLFB 3OHBA 4URQU 1D0EA 2C2EA 3KLVA 3IN5A 2D7SA 5T14A 3C6TB 5KFDA 3SI8A 4K4VA 3C6UA 3RBDA 3IS9A 3QIDA 1NNDA 4H54A 5JUMA 4ZPAA 5KFUA 2W9CB 4TQSA 1XR6A 1LW2A 1TVRB 2W7PA 3RBEA 3IS9B 2R8GA 3UQSA 3HKWA 3KK2B 1LWCB 1S9GA 5KFWA 3RAXA 5I42B 3RB3A 1JKHA 3H40A 2FJVA 3KK1A 3BREA 4WXOA 1S1TA 4PWDA 2OPPA 3G6VA 3H5YA 3KHRA 4K4WA 3NL0A 2BQRA 2IAJA 3QZ8A 5KFAA 3Q8SB 1S48A 4EYHB 4NCGA 3CO9A 3MTKA 4IH5A 2UVVA 1MMLA 4Y2AA 1TKXA 2YKMA 4LQ3A 1QE1A 5KFYA 2B5JA 3JYTB 1IKYA 2CJQA 2WOMA 4IRCA 4Q0BA 1TL3A 3M9OB 4PQUA 1T05B 5K14A 3DRSB 1J5OA 5KFIA 3DM2A 4IRDA 2HNDA 3KJVB 2B43A 3LP1B 3OL7A 4K4TA 4NZ0A 2B6AB 2VG7B 5FDLA 2QV6A 3IRXB 4H4OB 3D28A 4NLYA 2W9AA 3IG1A 4DL4A 4IFVA 2HAIA 4TY8B 3QGHA 3BQ1A 4F50A 3IGNA 3MEDB 2C2DA 3KLIA 1DTQA 1JLQA 1S9EB 5HROA 1W25A 4LQ9A 4QWAA 3Q8QB 4DL7A 5KT5A 1FKPA 4ZVEA 3BQ2A 3V6DA 2ZD1B 2J6SA 4IKAA 4RW9A 2W9BA 1DTQB 1EP4A 1JLQB 5KFPA 3KOAA 3TAMA 1JLEB 4NRUA 5CYMB 4O3PA 5I3UA 3E51A 4K50A 5KFFA 3NMAA 3PHEA 2YNGB 3OLAA 1JIHA 4J9LA 2BRLA 3PR4A 1WNEA 4LSNB 4IDKB 1S6PB 4MIAA 1S1UA 3MR3A 4ECVA 1DTTB 5KFNA 4O44B 4IDKA 4LSNA 3DM2B 1J5OB 1R0AA 4QPXA 4IG0A 5L1LA 4Q0BB 3LANA 4KAIA 4RU9A 1KLMB 3T5KA 4ID5A 3GIIA 1S0OA 4DL3A 5HLFA 4RZRA 2OPQB 4ZPDA 4RW7A 4FS1A 1T03B 4ED6A 4I2QB 3RB6A 5F8LA 4ID5B 4O3QA 1FKOA 3LP2A 2GIQA 5HROB 4NCGB 4WFZA 2ALZA 1S6QA 5KG0A 5DQGA 5KFGA 1RTJB 2IAJB 1DLOA 2YKNA 5KT4A 5J2NB 1K1QA 4G1QA 2YNGA 2O5DA 2JEJA 3OHAA 4YR3A 1RTIA 1EETB 3GV5B 4WZMA 3T1AA 2FVCA 2HWHA 3BSCA 5F8IA 4ED8A 1T3NA 2WK4A 1QE1B 2C28A 1T05A 2IC3B 5KFLA 1T94A 2HNYA 3PR5B 1C1CA 4XO0A 1TKXB 5J2QB 1S1WB 5C25B 3UPFA 4F4YA 2FLPA 3PVXA 3H5UA 2W8LA 1SUQB 1RAJA 2IBKA 3QIPA 2IM3A 1K1SA 3CIZA 1RT3A 4PUOB 1RYRA 1YVFA 1RA7A 4NLDA 4X2BA 3I5CA 3PZPA 4DL5A 1RT3B 4PUOA 5KFJA 3PJXA 4WFXA 4IRKA 2IM1A 1BQMB 5KT6A 1RT2A 3CDEA 1S9GB 2VG7A 1LW0A 3H5XA 3PJWA 4JV0A 4IR9A 2OPPB 4ZP8A 3T5LA 1C0UA 4IG3B 3BR9A 2GIRA 3GV8B 3H59A 5J1EB 4MK7A 4NRTA 1GX5A 3QGIA 4NLQA 5EUHA 2I5JA 2OH2A 1RT7B 2J6UA 1IM4A 4G1QB 3LAKA 2YNHB 3PW5A 1JLFA 3QYYA 1JXLA 1JLAB 5C24B 5DLGA 2VG6B 3MFIA 4Q8FA 3NBPA 1JLBA 4TYBA 3BJYA 3JSMB 2VG6A 1S49A 5C25A 3HVAA 4MKBA 3LP0A 4ZP6A 2HNYB 3QLHB 5C42B 2C22A 3QIPB 5HLFB 2DPJA 1TV6A 2WCXA 5KG5A 5I42A 4ICLB 3M9NB 3BGRA 3DI6B 4QWEA 2AWZA 2ZKUA 4J9MA 3V6JA 3I0RB 3ITHB 4R5PB 3I5BA 4RNNA 2XGPA 4J9QA 4O3RA 5EWFA 4JV1A 3DOLB 4TQRA 3V6HA 4JV2A 4IR1A 1S6QB 4EBEA 2D3ZA 3OLBA 4ZP7A 5J2PA 2R2TA 4NLWA 2C2RA 5KG1A 3MECB 1RT6B 3DLKA 4ZVGA 2FJXA 2BE2B 2VA3A 4HKQA 3M8PA 4YQWA 3DMJB 4ZHRA 1N5YA 2R2UA 5KG2A 5KFTA 3FFIB 4ECSA 5J2QA 1N5YB 4K4ZA 3MEGB 4RW4B 3GIJA 3DYAB 1NHVA 5KFBA 3N6NA 4FBUA 2BQUA 4O44A 3NAIA 2ASDA 1ZTTA 3EPIA 2OPSB 2J6TA 4TY8A 4IG0B 3DLEB 3FSIA 1S1XB 2OPRB 3DRRB 4IFVB 2R2RA 1R0AB 4ECXA 3DLEA 1D1UA 3NAHA 5KT7A 3PW2A 2OPSA 1IKVB 1LWFB 1HNIA 3KK3B 2XCPA 2RKIA 4K4UA 2AU0A 2XI3A 2VG5B 3BSAA 3QGGA 5F8GA 2W8KA 3KLGB 1TL1A 3DRRA 1HNVA 3HVTB 3CJ5A 3I0RA 3ITHA 3OSPA 1FKOB 4KKOB 1JX4A 1MU2B 4ZPBA 1S9EA 3EPGA 1RT6A 3DLKB 5CYQA 2R8JA 4RW9B 2W9BB 1JLCB 3ISND 2YKMB 4K4SA 2WONB 5KT3A 5J2PB 4RUAA 1JLBB 2BE2A 1RA6A 2GC8A 3GIKA 2RDJA 2FJWA 1JLAA 1S1UB 1TP7A 2JEIA 3FQLA 4MKAA 1LWEA 4R8UB 2E9RX 2RF2B 5D3GA 4EEYA 3DLGB 4PQUB 4EO6A 1TL3B 5I3UB 3PW0A 4ED1A 3G6XA 1VRTA 2WOMB 3E01A 1QAJA 4IH6A 1IKYB 4Q45A 3KMQA 2IJFA 4YR2A 1LW2B 1TVRA 1SH3A 4F4ZA 2ILZA 3RB4A 2AX1A 3C6UB 3LP0B 1LW0B 5KFKA 3DOKA 2V4QA 4EBDA 1HQUA 4ZVHA 2HWIA 2JEGA 2VA2A 3HHKA 3MF5A 1BQMA 5L9XA 1UWBA 4NLTA 2UUWA 4H4MB 3H4DA 3HVWA 3CJ2A 2IMWP 3RB0A 3OL9A 2ZE2B 2E9TA 1RT1A 4MFBA 2XI2A 4H4MA 2W7OA 2V4RA 2BANA 4WFYA 1JKHB 3V4IB 3OL8A 3FQKA 4DEZA 3BSOA 1RTDB 1TKZA 4ECTA 1RTHB 3T19A 4HYKA 5J2MB 1RDRA 4RW6A 4J9PA 2I5JB 3MEEB 3UR0A 1VRTB 4ECUA 1HPZA 5HBMB 5F8HA 2WTFA 5DG8A 3PW4A 2AGPA 2B5JB 5EDWA 5J2MA 3KHLA 3UDLA 4YP3A 4KE5A 4RNMA 4KO0B 3JSMA 1RT2B 3Q8RB 3T5HA 3N6LA 1ZTWA 4KO0A 2RDIA 2XCAA 3DOKB 4DL6A 1SH0A 4RNOA 5DG7A
chains in the Genus database with same CATH superfamily
5CYQB 1UWBB 2AEFA 1MMNA 3KK1B 4Q2LA 2FLLA 4DR7F 1ZPVA 1LWCA 3G86A 3CDAA 4Q5VA 4FNHA 4L3NA 5LM7E 1YJVA 1N52B 1PYTA 2D41A 3D3CJ 3SFGA 3QO9B 3U27A 2JLGA 1VQNS 2K2PA 2MZSA 4Y0FA 5B0AA 2I38A 4WWSA 1JJ4A 2H3EB 3M9MB 1N34F 3CJ0A 3H5SA 2UXCJ 2G1HA 3KLHA 2F7VA 2D3UA 3AJ1A 3CJKA 2D3OR 3NKYA 2IDEA 4BWJA 1RBOB 3IP0A 1GT8A 3UR3C 4J9SA 1D8ZA 3HD2A 4DF8A 2AT1B 3OFGA 4ZCKA 1VJWA 4P72A 2EC0A 1TAUA 1NMEB 3NWRA 1BWEA 3VCDA 5DDQC 1CJUB 4X4NA 2DY9A 3BM7A 1NKEA 2OFGX 4OJGA 3CD5A 1TR0A 3JS9A 2CYYA 3MMCB 3POTA 3ENQA 3J7AN 1FF2A 3MMBA 4NMLA 3T9NA 1MROA 3BBBA 5HQMA 2YPYA 1FK9A 4NYZA 5EN1A 2VG5A 2E1MC 2JC0A 4L75A 1RJJA 3QATA 3M30B 2DH9A 1OY6A 3DRPB 5KG4A 4YFUA 1KVKA 5LMUJ 1HNVB 4LBIA 3O44A 3EZOA 4O4GB 1KKHA 1NKCA 2LFVA 1YBUA 1HA1A 4NL5A 3B4MA 2LA6A 4WIQA 1LWXA 4YUDA 1X31C 3TP2A 1HNXF 3C46A 5KG7A 5DLFA 3NNHA 3V6DB 1M0SA 1HD0A 5KFMA 2M7SA 1AYEA 1JLCA 2GCFA 2M70A 4OJ3A 4PG6A 1MN9A 1DQAA 2VFSA 3RJMB 2N3LA 3GQCA 2M9KA 4NLRA 2CVIA 2CPFA 2MSTA 3EICA 1ZM3A 1NJZA 4KH0B 3UCGA 2WW4A 3IRXA 3OVAA 2HNZB 1Y5NB 1QUPA 3PKYA 2RKIB 1IWGA 1DTTA 3RZAA 1IKVA 3KJVA 4DG1A 3QNWB 3PXGa 4ECWA 1SKSA 1G2EA 4NXNF 1PCAA 2OD4A 2QSFA 2R7SA 2HIQA 3MPYA 4U8VA 1YKWA 4NLSA 2ATLA 2EFNA 3FBCA 1T7PA 4MTPA 2KI2A 3BO4A 1Q8LA 3KNAA 1B3TA 5D6GA 4CLUA 2W9CA 2LEPA 3P96A 4JUZA 3THTA 2MXYA 4J9NA 1TKZB 3E8OA 1S1VB 4P73A 4RUHA 1IBLF 1HYSA 2HHPA 2MKKA 3M6UA 2NQPA 4ZPVR 5MLCV 4FS2A 3NS7B 1L3VA 2GO9A 3LALA 1SB6A 3TW0A 1XNRF 2Q6CA 2RQMA 4B17A 2R8KA 1NSQA 3PX4A 2KKHA 2MZTA 2KT5A 3CD6S 5B09A 3GWCA 1HKAA 1U2RA 4LF8J 3CCTA 8RUCA 4P2SA 1EHWA 1TKDA 2YH1A 1XERA 1YJ7A 3F56A 1I94J 1C1CB 4CO2A 3TQ1A 4C11A 2LKZA 4P74A 3LOUA 5E3AA 2VKRA 5AXKA 3DRSA 5ETPA 2KVQE 3RU0A 2RQKA 2XLKA 3SSQA 4KT0C 4BCAA 3B8HA 4FF2A 3E01B 3SQGB 3A12A 1SPBP 2XGQA 4WF9Q 1YX2A 2QIFA 2J7UA 3B54A 3J81Y 3QFWA 2B9WA 3GJSB 4TLRA 3TWZA 5ETNA 4DCOB 4ECYA 4ES2A 3GZ7A 2EK6A 4KGXB 2AJQA 2R2SA 2LEBA 1BC6A 4OI3A 4DV6F 1WWHA 1FE0A 4EYIB 4LF1A 1S1VA 2W1BA 3GPAA 3GSDA 3I82A 3R6LB 4F0KA 1HLWA 4X4QA 2X3DA 2XM3A 2ZM6F 5DM7Q 2MZRA 5E0OA 2G9OA 4B3MF 3Q8PB 1FJCA 1Q7LB 4EWTA 4B3OB 1BQNA 3VGSA 2EFVA 1XR7A 4EI2A 1KOHA 3B4DA 3OV7A 4EBCA 4DN9A 1NK4A 2V9WA 2R8HA 1NPKA 1U24A 1UEKA 4PCQA 5FLXY 4QBUA 4B3RF 2G2OA 4J9RA 2MLXA 3CCUS 1EETA 4M94A 5CQGA 1NDCA 1P9YA 3DLGA 3NCRA 1WDTA 4J5OA 4R8UA 4MH8A 2GAHC 1FEHA 1T9YA 4O4RA 3UDCA 1RBAA 5CCLA 1IJFB 2C1EB 2QLJB 3N5FA 2U2FA 3LP2B 3IBFB 5KFQA 2E1RA 1NRKA 1WC3A 4KKOA 2W4CA 5L1IA 3WIUA 2HVIA 4MIWA 2DYAA 4IQXA 4WFBQ 3W8PA 1JLGB 3BGUA 1TMJA 2YWWA 3KLGA 2OMOA 2LMIA 4KY3A 1N34J 2VOOA 2HHSA 2VASA 1RTIB 2YKAA 3T5JA 1XC9A 1R43A 4F3QA 2GJ2A 2VBWA 5ADZA 3G8SA 3KLHB 3W8GA 3CDUA 3DXBA 3MFHA 8ATCB 5LJ5Y 4Y28C 2KT3A 2J7WA 1Z1ZA 1RTJA 1VBKA 2LQ5A 5RUBA 2YWEA 3GG0A 3HDSA 2CJXB 4I6YA 5SUHA 2KZZA 3GIRA 1E6YB 1RSCA 2FIUA 5DDOC 2FVSA 3C15B 1RLCL 4C4WA 4FF4A 2RVJA 1K0VA 5ETLA 4CO0A 4HTJA 2G0CA 4DHVA 3MM7A 1VK3A 1S57A 4EO8A 4NLGA 4U6PA 4U7UD 2DKOB 3CJ3A 3MR5A 2F65A 3CJQA 5I3PA 2DD8S 1HMVB 2JSXA 3NRBA 3MR6A 2HFVA 3C14A 5L39A 3HPOA 4ECZA 2DR8A 1AB8A 2FLNA 2DGUA 3CCZA 3GONA 3J7Z5 2APOA 4YR0A 2XQCA 3D2WA 4AXIA 3BBCA 3KLEA 2AZ1A 5KFEA 4XPCA 2CNKB 1IKWA 1UKUA 1TK0A 1RAHB 1S10A 3V4MA 4PG4A 1CJTA 4NA3A 3N79A 4FXWA 1RU1A 1TELA 2LXFA 4QIGA 2X1AA 3HSJA 2CJYB 3MPWA 2CNLB 4FBTA 4USUA 2HBRB 3G9CA 2PC6A 2Y8YA 3DMJA 4ZHRB 3M8PB 2V34A 3CCSS 2HVDA 5K8PA 4ELVA 2OTJS 1LK7A 1YITS 1TAQA 2ZOGA 4P6QA 1M1GA 2ZZMA 2ZUGA 4MMOA 1XNRJ 2MDAA 1RAIB 2FLOA 1D0EA 3D1HA 4F2SA 3KLVA 1ICEB 3IN5A 4DX6A 2Y1LB 1X4BA 2K7KA 5KFDA 1U26A 2E7XA 2KDOA 1HNZJ 1NNDA 4DV0J 2U1AA 3R3TA 5CYJA 4BDPA 2X1BA 2P9GA 3RBEA 3IS9B 2R8GA 2NPFA 2PD1A 3AH6A 3KK2B 3PNIA 4MJKA 3D0IE 4JI7J 4AFFA 3H40A 4WXOA 2LDIA 1S1TA 3VVTA 1G7CB 2CQ0A 2OP5A 2R7OA 1UPMB 3ELHA 2VODA 1XEZA 2BKPA 4ZCMA 1VGYA 2XS2A 2VC0A 2XMUA 1R3NA 2GQ2A 7FD1A 2BUNA 4XK8C 2F8MA 4HDGA 2BV3A 4Y2AA 4CLZA 3TA1A 1UW9A 4CNYA 2IYGA 1IJEB 3MM5B 5F0UA 1UAWA 2HWTA 3B78A 4GO7X 4USMA 2BDPA 4DSJA 3PKMA 1FX2A 1IKYA 2XMTA 4USVA 4F26A 4PYAA 2DCUB 2EBGA 4Q0BA 1X4FA 1TL3A 3NS5A 2XMVA 1YG0A 4QR1A 2B9YA 1CPZA 3HK2A 5KFIA 3DM2A 2PDAA 2LXIA 1R6YA 1FRXA 5B7WA 2B6AB 1OSDA 2AEMA 1XNQJ 3IG1A 4DL4A 4IFVA 3QJPA 1QSSA 1Y7PA 4A4JA 4TY8B 4AL7A 4CP5A 1CVJA 2E66A 4ZVRB 1FNMA 2DRDA 3VALA 5IM0A 2VPWB 1BXNA 4HACA 4AYBD 3CCQS 4DQSA 1S9EB 1FD8A 4LQ9A 4NYOA 4GVBB 2DCLA 4C98A 3DDIA 3TA0A 4ID8A 4C0BA 4DU7A 4E8UA 2D9OA 4M63A 5CA5A 2Z58B 2YY3A 4IKAA 5K8MA 2J6SA 1F5BA 4NCAA 1UVLA 1DTQB 3NGSA 3DGPB 2DHXA 4DF4A 1H0HB 1YDLA 2BEFA 3ZTOA 2CXEA 2VQFJ 5KFFA 3DRYA 3PHEA 4ZJLA 3UWTA 3NMAA 3OLAA 4J9LA 1SC6A 2P8IA 5KTQA 3PR4A 1WNEA 1ZM9A 2DNZA 1S1UA 3MR3A 1NK5A 2LP4A 4LF6F 3LUYA 3TO8A 1OYEA 4NOHA 4LSNA 4CLSA 1X0FA 1UMJA 2ZH3A 2MB0B 4FF1A 1R0AA 3MMBB 5E3QA 5AJ3J 5L1LA 4P10A 3KDNA 2Q3PA 5D4PA 3TJ8A 2A10A 1W2IA 4DUYF 2HFSA 3BYRA 1Z2ZA 2XSJB 1GH8A 4N47A 3QT5A 3BDEA 5CH7B 4FS1A 3R2DJ 3RRKA 1M5VC 1HWIA 1CQNA 1U2CA 1PC4A 2ZWPA 2CPYA 3HHLD 3O8WA 2OLWA 2RHQB 4NCGB 4WFZA 2R7WA 1Y3KA 4PG5A 4MYTA 5K20B 2VOPA 4EK2A 1RTJB 2PO4A 1DLOA 5GAEI 5KT4A 3IRWP 4AQYF 1K1QA 3T1HJ 1FFSB 2AJ1A 2O5DA 5BYRA 2R7XA 3OHAA 4YR3A 1EETB 3MAAB 2KXFA 1NDPA 2OO4A 2VPXB 4OX8A 2HWHA 3BSCA 1T3NA 3ETOA 3PO5A 1AFJA 5KFLA 2HNYA 5J2QB 4C3KA 5GADI 2C42A 3N01A 4LFAJ 3PVXA 1CJUA 2M3DA 3R27A 4B3SF 3A8KA 4DV7F 3QIPA 3P3DA 2IM3A 5F0WA 4PUOB 4DV1F 1VMBA 2XMMA 2YVSA 1ZAXA 2D1CA 2HZVA 2CADA 3HZEA 3PZPA 2VJUA 1RT3B 4ZVSB 5KFJA 3H42A 4WFXA 3I31A 2IM1A 1NK8A 2KZMA 2L3MA 3CDEA 3CTRA 1EKRA 2HHHF 3PEJA 1CJKB 3CNQP 2FHOB 2OPPB 3JSBA 3PJWA 4NI2A 5CD4A 2B4UA 2RDDA 3H59A 4Y65A 3LGNA 1JQGA 3AQOA 2IRUA 2H54B 2ROEA 4X64J 4EZ6A 4J90A 4CDIA 4IUFA 2I5JA 4ANEA 1RT7B 4ZVTB 4CO3A 2VC1A 4QR2A 4OI4A 1S4EA 4Z37A 2YNHB 1RB0A 3PW5A 3QYYA 1SVDA 1JLAB 4ZVUB 5HJXA 2NXNA 2SXLA 3TX0A 2HQCA 5DLGA 4B9MA 3M4XA 2Z2LA 3NBPA 3AJ2A 4HT7A 1WD6A 3OXFA 1S49A 4WFNQ 3U02A 4YHHF 3QLHB 2HQGA 4DR5F 4OX9J 2H4WB 3W3SA 3QIPB 2IRXA 3NY0A 1TV6A 2LECA 3IR5B 2ZJPQ 1ZZFA 2BE7D 4F02A 1MSWD 4JV5J 3SCJE 4QWEA 2ZKUA 2CJ9A 4J9MA 2OELA 1U1MA 3UD5A 3T5LA 2CZVC 4N7TA 1GXLA 4PXDA 4JV5F 4CI0B 3BGOP 4WP8A 1VBZA 3DOLB 2UU9F 3V6HA 3ZTRA 4ZLNA 3NOCA 2KJVA 3TARA 4DV1J 3CMQA 2V8VA 2E5GA 3TEGA 3FZ2A 1B4SA 2J0QD 2OHDA 5J2PA 4NLWA 3PX0A 5KG1A 1X4HA 3I4PA 2DRBA 1RWVB 2Z56B 2F8HA 4USTA 1RT6B 3CO0P 2DISA 4LRAA 3PRBA 4DLGA 2R2UA 2XEXA 4ECSA 1ZS6A 1RWUA 2BM1A 3G87A 3MEGB 4P2FA 4B9TA 5ETSA 3DYAB 1NHVA 2B7CB 3SEOA 4W90B 2V63A 3UO0A 3R5JB 5LSOA 3I96A 2GIFA 2HYIB 2IVYA 1U1OA 4OMFG 3FGVA 3DLEB 4YDXA 2UUBF 2L08A 4IFVB 1I3OB 4KHPF 3DLEA 2N4CA 1WC1A 5KT7A 1U1NA 1HNIA 3KK3B 3QGGA 1RWWB 2MZJA 2EKYA 5F8GA 5HO4A 2BM0A 2R9LA 3OVBA 2B9EA 3HVTB 3HI9A 5IXUA 3ITHA 4J7CA 1EARA 2DNPA 3CJTA 2FTRA 4KKOB 2BABA 4FNIA 4OX9F 4LF7F 4USHA 4X66J 3RYLA 3BKUA 4P7TA 2H4YB 3NP5A 2W9BB 4A8SA 2R8JA 1SCJB 1Q7YT 4ED5A 1AFIA 2FJBB 3IWXA 3G96A 1FE4A 4M5MA 4ZVOB 5CXTA 3PIOQ 1JLBB 3VAHA 3VHQA 2FJWA 4MYUA 3NWGA 2V8DA 4R8UB 1TK8A 2DNOA 1FRLA 2E9RX 3QRQA 1PKUA 4PQUB 2V8PA 3RAMA 4ILMA 1WHVA 4DPYA 3G6XA 2IMOA 2XY7A 3HHNB 4IH6A 4PPZA 4QIWD 3KMQA 4YB7A 4P75A 5LSRA 4F4ZA 2E1PA 4C11B 4B9VA 2CWXA 2V2VA 4K2XA 3POTB 2QA4S 1LW0B 2XYHB 4EBDA 1HQUA 3MF5A 4NASA 1BQMA 2FJDB 3GFXA 3MWBA 5L9XA 4KGZB 4G6VB 5A8WA 3CJ2A 2AEJA 5DZ6A 2IMWP 3MOZA 5F3TA 2WVEA 3OL9A 2BACA 1Q5VA 4MFBA 4H4MA 2DXFA 1Q95G 3OR2A 2V4RA 3ZZZA 1AA1B 5ETVA 1K73T 1WC0A 2J8AA 4DR4J 2E1CA 1JKHB 4DX5A 4C8MA 1RTDB 1TKZA 2MKYA 4ECTA 3M8YA 3T19A 4XIUA 4HYKA 2VONA 5HSPA 2B4PA 4RW6A 3R7BB 1DFDA 1N5TA 1NB2A 2I5JB 3MEEB 1X7VA 2AJFE 3M1VB 1VRTB 1WHXA 1HPZA 4ECUA 2WSCC 2WTFA 2HVHA 3SV3A 3UCUP 1S7IA 2XNQA 3IBCB 2C2MB 2DK2A 4YP3A 1LOUA 4KE5A 2DHGA 1UFWA 1CJVB 3MI7X 1SJ1A 4JI8F 3T5HA 4KYZA 1VQYA 2MQMA 3C14B 3K2YA 5IOLA 3UVJB 1ACMB 3A3OB 4KO0A 1CULB 1HBNB 5HAOA 4DL6A 1UETA 1GQEA 2HQ3A 4UW2A 2PN6A 3VGTA 1GMWA 4PWUA 1T9XA 1HNZF 2J9EA 1MU2A 1P9QC 1WOPA 2VL1A 4OYPA 3SBMA 1SH2A 2XNRA 3PDNA 5GMDA 4DV0F 2FC9A 4IG3A 4NLPA 2Q1LA 2R7RA 4C0HA 4I56A 4B3SJ 2ASYA 2HMIA 1RTDA 5JMNA 2X3GA 4ZVFA 1LV5A 4UQTA 5AE2A 4JI3F 3VF0B 2BANB 1U4BA 4UY85 1P1LA 3GSIA 4HVZA 1RZMA 1T9WA 1YK9A 2J9DE 3BGFA 4FYVB 3RAQA 5HQ8A 2GVZA 2YNIB 4IOCQ 1FTRA 1MROB 4F4WA 4OIXA 2CIMA 3MEGA 4MK9A 2P6SA 5EWGA 3WIVA 3H25A 1V9OA 4DL2A 4I64A 2Y9HA 1T03A 1R89A 3KFWX 2DO4A 4E0DA 5GMKa 3MEDA 4LVOP 1ZA1B 4OYZA 3K57A 1N6QA 2AIRB 4G1IA 4MK8A 3M6XA 3BS9A 1DBDA 2CPZA 1U0HA 4UTGA 2IJNA 4AD6A 4OHXA 2DR5A 2OKQA 3ZZYA 3NCPA 2YKNB 2UVUA 4LF4F 2D9PA 3L4BC 4GRSA 3DDKA 1IKXA 4H4KC 1M5HA 3PYFA 4C6AA 5L1JA 4YMEA 4GC7A 2CZ9A 5KFVA 2QA4G 3PYGA 3K0JA 2HW3A 2FHJA 3BQ0A 4N41A 1FJ7A 5LMNJ 2FGCA 2DNKA 4A8MP 3PTWA 4QW8A 2V69A 3TRGA 2Y1JA 4F25A 3MM5A 2R8IA 4USIA 4P2XA 2XBPA 2EPIA 2M5YA 2GVZB 5A8RA 1IR2A 4CTAA 2ZBIA 1YJNS 4RWWA 4XPEA 4M5JA 3CJSA 1XMBA 4ZIVA 3MZIA 2CQCA 1SC4B 2ZC3A 4W4MA 2B6AA 2QJ3A 5DJBA 2KM8B 3CGIA 3QGPA 1LWFA 2HNDB 1VHFA 3LQVA 2WRMA 4NLXA 1EZZB 5CZXA 2E44A 3Q0AA 5L1KA 4ED7A 3M6WA 1RT4B 2HS3A 2JOQA 3BEGB 4OL8A 3CCWA 4DSFA 2FJAB 3M30A 1N6QB 5DRKA 3KG0A 4NZ7A 5DDPC 4OZLA 3PW7A 1HARA 3QBCA 2CKWA 4QYRA 1VQMS 1XWLA 2CPDA 4I4BA 1N5VA 5L46A 1CSJA 4YEAA 1Q5YA 2PSZA 3LWMA 5DO2A 2BJ8A 4GVBA 2DNQA 2Z57B 3H0PA 3KMSA 1LFPA 2DGOA 4Y00A 4MFBB 4IFYB 1WI6A 2XYGB 3Q8VA 4HI2A 4JI3J 1VJQA 4DSLA 1JJCB 3CJKB 4GKJJ 5DGBA 4WXWA 2DT9A 2IA6A 1RQ0A 2GX8A 4GKJF 5C24A 5HBMA 3W2WA 3SQGA 2P5VA 2Z2MA 1KHWA 3M6VA 3W61A 3EYZA 2QRRA 3AFGA 3HSGA 4LFAF 1WC5A 4NZ6A 3EDQB 1VC5A 1VISA 3DI6A 3SXLA 3C6TA 2G1DA 3HLUA 3Q89A 4NYPA 5B0EA 5KFSA 1TL7A 2KYXA 4OLPA 1EB0A 1GXTA 3G4SS 2DGWA 2NS1B 1XQIA 3HP6A 1XTZA 1H98A 2JL9A 4M5NA 2D3O1 1NJXA 1T02A 2DHAA 1VRUB 3D5MA 4FPRA 3I0SA 3HMJG 1GNKA 2AGOA 2P9EA 1C2PA 2H48B 2RUSA 1YJWS 4ETZA 1YBAA 4I2PA 1RABB 5J1NA 1S1TB 1TKTA 4NLVA 1NZ8A 3CC2S 1FJEB 7FDRA 1HQ2A 1RKIA 3M1VA 1TMMA 3M8RA 2HGLA 1OPIA 3K5MA 2KFNA 3CC7S 1NEEA 2IC3A 3KLFB 1T95A 4BC9A 2DGQA 2DBBA 2IA0A 4ZLLA 4GO5X 5DS7A 4RBVA 1U1KA 2K3KA 2VKZG 1FEEA 4K8RA 4I6WA 2OPRA 4RUCA 2B51A 2NCKL 1HWKA 3M05A 4DG1B 3PFOA 1KQKA 3GJTB 1C0TB 3HFZB 4CTAB 5E41A 1U6FA 1V3RA 4ECQA 2QO3A 3TVZA 2Y0SD 2FVPA 2L48A 2X1GA 1IR1A 4X4TA 1SUQA 3MUMP 2HBQB 5C2CA 2Q66A 3KNGA 5CD4H 1SV5B 2MLYA 3KHHA 3GCWP 3D7SB 1WTBA 1F60B 4G3IA 4F4XA 5A2QY 2XMKA 4KFBA 3GIMA 2UUAF 2VUGA 5U47A 3KLIB 2M52A 2C2NA 3S8SA 1N33J 3MECA 4ELTA 3QT7A 1RK8A 4LIRA 4RNFA 3AT1B 4LF5F 2C3YA 4E98A 1DQ8A 3G6YA 4I0WA 1U1LA 4LF5J 1F6TA 4M95A 1Y9OA 1RAGB 1IKXB 2B9XA 5IQ6A 5DQHA 3NGDA 4RNHA 2IDLA 3HT3A 3TAMB 2DNYA 3M2RB 1XMQJ 2RMLA 1X60A 2XG8A 5K14B 3DHXA 1AXQA 3QSIA 3HHLB 3D4JA 2WBMA 1T0TV 5AJ3F 3AOCA 3MURP 2BBEA 4NA1A 3MUVP 2UXBJ 1SKWA 1DHMA 1I6JA 3HVRA 5DQIA 1F2HA 3EVMA 2UUCJ 2AHOB 5DG9A 5KOWA 3MM8A 3G8TA 2UXBF 2HZCA 4PXBA 1IXKA 2IY5B 3TOQA 1SJ3P 2FY8A 3I5AA 1VC6A 2ZWOA 1YRUA 2K1RA 1FDNA 2I9SA 3P8BB 4L3KA 5GAGU 1LQ9A 3LP1A 1OS5A 1RWNB 4KBIA 3T41A 1NJYA 4JI2J 4V19J 2G4BA 4R5PA 3EUNA 3DRPA 4CH0S 2CJBA 4DCJB 4TN2A 1KLNA 1VYAA 3EE3A 1VQ7S 2IM2A 2QA1A 5HP1A 5KFOA 3PFEA 3M8QB 5JJBA 1CJKA 4K2JA 4PXEA 4OX7A 3PY8A 2B4OA 4B3OA 2JHEA 3M2VA 5LOQA 2E5LF 2R7UA 1V5IB 1NPPA 3JYTA 3O3LA 4X4SA 1S9FA 1TKTB 2A2DA 1V5VA 2XZTB 3AD9C 2V2KA 2VV5A 2ZHAA 2JEGA 2BRKA 2NSBA 4WK1A 4NXNJ 1X4EA 3M8WA 4I68A 3WHIA 2QSWA 4HDHA 4TKTA 4DBQA 1R31A 5LSLA 2F3JA 4B9SA 2D7SA 3ZTQA 4QYZJ 3SI8A 2OMLA 2IVMA 3QIDA 1UVMA 3NCQA 2W2OP 1UCNA 2V67A 3IR7B 2GAGC 1TVRB 5HVGA 1RU2A 1D9DA 4DV4J 3HKWA 3ILJA 3RAXA 3MUTP 1R8HA 4J9UE 1NH8A 1YHQS 3HHEA 1FRIA 3AODA 2M2BA 3OR2B 4OI2A 4DDFA 3H5YA 1NKBA 3GLJA 3QZ8A 1FCAA 1X5PA 1S48A 2OI2A 2MZ1A 4NCGA 2JFKA 3CO9A 2RUGA 4CM2A 3AY0A 4GVLA 3RRHA 3WC2A 1XMOJ 1Q1KA 2KU7A 3NGKA 4DFJA 1MMLA 1TTHB 3FNNA 3M2VB 4M5IA 1X4CA 2HQIA 1UW4A 4LQ3A 1KQFB 3W63A 2GHPA 5KFYA 2M4MA 2LU1A 4BLGA 4DPXA 2CJQA 1U1QA 1WEZA 2H5IB 3K59A 2XB2D 1QY7A 4PQUA 2KN4A 3PV8A 1QAYA 1NZAA 5K14A 4ES1A 3K5OA 1J5OA 5M2UA 3PYDA 3NOGA 2ZNZA 2B43A 3OL7A 1HI1A 4NZ0A 2VG7B 1Q53A 3D28A 3IRXB 2CPEA 1QD1A 3B6BA 4NLYA 1PILA 2W9AA 2KM8C 3VAFA 4BWMA 2HAIA 3J81U 5GMEA 2A6OA 2W24A 5B0DA 1BE4A 2QLBB 3MM8B 1XNQF 2JJ4D 3LPEA 1B0PA 5AE1A 1PO6A 1ZH5A 2C2DA 3R7SB 1J5EJ 1DTQA 5HROA 4ZJOA 1S6OA 4DL7A 1AW0A 1F3FA 5KT5A 1X9SA 1FKPA 1WF1A 2HK2A 4ZVEA 4QR0A 3W9HA 2DTJA 3D67A 1RWMB 4RW9A 2CQBA 3SQOP 2AP6A 1SL2A 1IM6A 1FNXH 1U1PA 4DR6J 4A8WA 3QT8A 2UXCF 3LO3A 5A8KA 3WX8A 1S76D 3AXMA 4QU7A 2GVDA 1N88A 2VFRA 5D4LA 3TUJC 1JIHA 2D74B 4IDKB 2JZ5A 2QC3A 1Q8KA 3DFEA 4MIAA 1DTTB 4O44B 1JXEA 4IQMA 1ZBTA 3D54A 5A2QU 5GVQA 2VHGA 1VBXA 3DM2B 1J5OB 1NBEB 3R8YA 4IG0A 2KG1A 2KYZA 1OY8A 1SJQA 4DPOA 3WC0A 1WDDA 5IT0A 2ZH2A 3EVOA 4KAIA 5CCMA 5BR8F 2W25A 4RU9A 1YJ9S 3ILLA 4DL3A 3CCRS 3BPDA 2OPQB 4ZPDA 3UFCX 4I2QB 1UPPA 3TJAA 5F8LA 4ID5B 5LMUF 1S12A 3NXZA 3QAUA 3RB6A 1LKZA 3LP2A 1Y4ZB 2GIQA 3CEDA 3PYEA 3KUHA 2QN6B 4CWBA 4OJ1A 5K8OA 5IM0B 1S6QA 5KG0A 1PSDA 5KFGA 3FBEA 4Q7AA 4XTTA 1UJ4A 2A6MA 5L9NA 4B9NA 3W7BA 1VQ6S 2CG4A 3FEZA 2YNGA 4JI2F 3JQMA 4U95A 1RTIA 2COLA 1KTQA 2B7BB 1SQFA 4PQAA 1YI2S 4LFBF 4CLTA 3OTCA 4ED8A 4HI1A 1HNWF 2R7TA 4MKVA 3W65A 2ACMA 1T94A 4P7VA 2MKIA 3UPFA 5C25B 1WC6A 2NPIA 2HLTA 2ZEJA 4I1TA 4IYQA 2V4QA 2FLPA 2V4JB 1SUQB 2M0GB 2W8LA 1N36J 4LF9F 4I6AA 1HBUA 3CIZA 4WJBA 1YVFA 1RA7A 3LA0A 3TUZC 3LWLA 4CLWA 3I5CA 3UNYA 1YJTA 1KP6A 2F4FA 2YWHA 3OFHA 3QQCD 2HG4A 3PG9A 2VZ9A 2N7CA 1VI7A 1CJVA 5IT9U 5L38A 2VG7A 1LW0A 1WG4A 3UDVA 4OV6A 3ZNUA 2GIRA 5DDRC 3IM9A 2YBVA 4KIAA 4MK7A 2A18A 4LIWA 1GX5A 3QGIA 2HHTA 5EUHA 3HULA 1HI0P 4LR7A 1L3SA 4OYIA 5H9EJ 3BKFA 1HR0F 3QAEA 2BJ7A 1A0OB 1U2FA 2XZDB 2GQQA 1XK8A 3MM9B 2HVEA 4P2MA 3R7NB 4A8FA 5IT9Y 4X4VA 5C24B 3W2WB 2VG6B 3FCVA 5IWAJ 2DR9A 4PYDA 4WTOB 1WORA 1UEUA 2IRYA 2J0WA 2RQ4A 2W2QP 2BVZA 3V2UC 4YHHJ 3A3NB 5C25A 1Y5IB 1WHWA 1CC8A 3EDRB 4MKBA 1M5OC 2HNYB 1VIOA 2JRSA 3ILOA 4EU0A 1MNEA 1YIJS 5HLFB 2BW2A 4E2FB 5B0CA 4X62J 5KG5A 5I42A 4ICLB 2A0FB 1N0UA 2AYEA 4YY3J 1SKUB 1HHSA 5E2QA 3BGRA 5HJYA 4USWA 3I5BA 2ZH4A 4R5PB 5AXLA 4KTQA 2CJKA 4O3RA 3AXKA 1P27B 4U9RA 5EWFA 3P6YC 4GKKJ 1H7WA 4JV1A 3OTDA 3GFYA 3O5TB 2ZZTA 4ZITA 1TK5A 3KUGA 1B64A 1FNOA 4R0JA 2CQ2A 1T11A 2D3ZA 4DSKA 3JSRA 4CO5A 4P52A 5HL7Q 4B3MJ 2F40A 4FP9A 3DGPA 3DLKA 3CF5Q 5B0FA 2FJXA 2JFDA 3UN3A 1HBOA 4HKQA 2HFNA 1YRXA 1N5YA 2QL7B 5EX0A 3EGVA 4K4ZA 1N5YB 3H20A 5BJRA 2KJWA 4DV2F 4HR2A 3GIJA 3MM7B 3QRRA 5E5NA 2A3JA 3NS6A 3IAM9 2LEAA 2ZZNA 2YH0A 4HH0A 2OGUA 2J76E 3DXSX 3CCLS 1G4CA 2ASDA 1ZTTA 2OJ3A 1OPZA 2OPSB 4JI0J 1N5QA 1R0AB 2OPRB 2V2QA 1XBWA 2E1AA 2ZKTA 1CS4B 2EFQA 2KO1A 1IKVB 2NXJA 5IWAF 3KDOA 3MR7A 2XCPA 4K4UA 1Y00A 2XI3A 3BSAA 2W8KA 1RKJA 1KR4A 3KLGB 4WIIA 3OSPA 2B4VA 1NHKL 3RG6A 1FKOB 1IQZA 2O1PA 2RRNA 4OYOA 5D0GA 1JX4A 2K7JA 2WW8A 5FIIA 3K5PA 1CEZA 1X4DA 2ZOFA 4HL9A 5CYQA 4C8NA 1UVNA 1U47A 4K4SA 1S6UA 4ELUA 2WONB 2ZHOA 5J2PB 3T6JA 3L9ZA 4OZNA 4ATNA 5KT3A 1RA6A 2GC8A 3S6EA 3UD4P 2DNMA 1KRPA 1GFWB 1FFWB 1KNZA 1XJWB 1JLAA 1R27B 2K8GA 2YQ3A 2QEXS 4LMZA 3HJVA 3FKBA 2GV1A 4OQJA 3I87A 3M8ZA 2XZWA 2HGNA 4CT9A 4EEYA 5D3GA 3OJUA 3DLGB 4JI6F 2BJ1A 1F1BB 4KR0B 2WOMB 3E01A 2Z2ZA 3D6MB 1IKYB 4F36A 3EMTA 3QMQA 3QPIA 4OYAA 2EKNA 1D09B 4CYUA 5HMZA 2ILZA 2DIUA 3C6UB 3UW1A 2MKJA 3ILIA 3CD7A 3ZXWA 1WELA 2HWIA 2VA2A 3BZQA 3SYZA 1MMDA 2VBZA 3BV8A 2UUWA 4CNZA 3H4DA 4LRDA 2YWFA 2E9TA 1KQGB 2CG8A 2W7OA 2EFPA 4DR3J 3CIMA 2NYHA 4DUTA 2BANA 4KGMA 2VQEJ 3V4IB 3DC2A 3FQKA 4DEZA 3BSOA 1NK7A 4HTIA 4RKUC 1M1KT 1FXLA 1RDRA 1VFJA 3U1MA 2DNNA 3P5TL 3CT9A 4QIEA 5T41A 4DXLA 3UR0A 1W26A 4GKKF 1LXJA 2BE9B 3K7RA 1O6XA 2B5JB 3MGJA 5EDWA 4X64F 2R4FA 5J2MA 2RU3A 1RGVA 2JX2A 3KKFA 2F9DA 2B0GA 4RNMA 1H38A 3Q8RB 2N82B 2FPHX 2IIHA 4HHHA 5D78A 1ZTWA 2RDIA 2RS8A 3CE8A 4JI1J 2AF6A 2DNHA 4C8YA 4RNOA 5DG7A 4Q2MA 1H74A 1QM9A 3EGNA 4R25A 4DMZA 1FD2A 3OUYB 4QWCA 2ADBA 4DQIA 2XSJA 4RL1A 2BJ3A 5J1EA 1IKWB 2O3DA 1FRHA 1NM2A 2BMBA 2VFUA 2Z8QA 1ZOTA 5KG6A 4RW8A 3AB2B 1KBRA 2AMCB 3Q22A 2UV8G 5T7LA 2O67A 4L72B 2JVOA 4D3GA 2AW0A 3GYNA 4TU8A 1ELOA 2RF2A 1KHVA 1U09A 1WOOA 2CZ4A 2HEKA 3JSYA 4HHJA 4X65J 2I2YA 1FDBA 3OL6A 4GC6A 5KFHA 1B99A 4EZ9A 3IO1A 4YY3F 4DUYJ 2QYCA 3N9UC 1REVB 5KG3A 4RBTA 3U7JA 3QJLA 4LF2A 3CJ8A 1FFGB 1S1WA 4K59A 2PMHA 3I9V9 5KFXA 3PRDA 4YOEA 1OYDA 1NU4A 4ILLA 5B0BA 1U6BA 1X4GA 1IBMJ 4PRFA 2PT0A 2YX1A 1U8SA 2IYIA 3CDWA 2GS8A 2ADCA 4UZCA 1C0TA 2PFFB 3MOJB 3M2UB 3HVTA 1GAOA 3IFEA 4DCPB 3KLEB 4NWBA 1TL1B 2NXUA 5JXSA 2XYPB 1C1BB 1JMTA 4KHRA 2MQPA 1DLOB 4HT5A 4AQYJ 3MXHP 3GG1A 1KVIA 4O4GA 3ET6A 2HAFA 1P1TA 4KFBB 5K8NA 1R0BG 2WBRA 2WVDA 1URRA 2ZVIA 5SZTA 2ZH5A 4DR5J 1HNWJ 4ZP9A 4Y34A 2UZAA 4Y2CA 2MGZB 2DH7A 4UUWA 4JI7F 1OO0B 1Y0HA 3JTPA 3MPUB 3OD2A 3NLCA 4C8LA 3FFIA 3I56S 4NPOA 1T9VA 3H4BA 5IV4A 1VK8A 2AYGA 1KVJA 1CG2A 3DLJA 4M1KA 1WEXA 1CLFA 1RYSA 4H4OA 3UE2A 4OZ3A 4DR3F 2E7WA 3P4UB 2AYBA 2W01A 2HS4A 1QJHA 3T6BA 4ZA1A 1RT5A 1F9HA 3I4HX 2WVBA 4JOUA 3C19A 3GJQB 2VH7A 4KGVB 5BYQA 4ZKAA 2IBOA 3TAPA 4QWDA 1S0MA 3NNAA 1N32F 2HHWA 1GMUA 3D66A 4EUVA 5BR8J 1RHJB 2PI4A 1D9FA 1SV5A 2YTCA 3VAIA 5D4OA 5KFRA 2RT3A 2YKOA 4DZDA 2BQ3A 4NCBA 1JXVA 1N48A 3WQPA 3NGTA 3QZ7A 1URNA 1VRQC 4K7QA 2AKWB 2HBZB 2DEJA 1NSAA 2MQ8A 2XHCA 3OXGA 3P45B 3NBPB 2MKHA 2MQLA 3N6MA 3CDBA 3T3FA 2CQPA 3EX7B 1HQEB 3IWLA 3KG4A 1HPZB 3E3XA 3C3LA 2ALYB 2WVCA 3VZIA 1NXIA 4LRCA 4F3MA 2Y8WA 1L3KA 1B0VA 1APSA 2Z4PA 2NZCA 1SXLA 2GFFA 3Q83A 2RU9A 2Y1RI 2QZ8A 3VV2B 3I55S 1DAXA 1RCOB 1KOOA 1X5SA 4TYAA 3SMZA 4FYWB 3UNGC 1KTVA 1K47A 1EIYB 4OI1A 1VLOA 2IJRA 5ETKA 1NK0A 2B56A 2VDIA 3OTEA 1WKKA 2ILYA 2L9WA 3GFZA 1HMVA 4CO1A 3GILA 1BQXA 4N77A 4K4YA 2WONA 2ZE2A 1NHUA 1S0NA 5H9EK 2AYMA 3LAMA 2YNHA 5A8WB 2AGQA 5DGAA 3HD1A 1PC5A 3IBWA 4GMKA 4KGKA 4IOAQ 5EWEA 1QTNB 1ZETA 2KB2A 4Q8EA 4TLQA 2YNFA 4WYWA 5F9LA 4L76A 4USKA 3VTIA 1GEHA 5D3GB 3M8QA 2JVRA 2YQ1A 4X84A 3BH6B 5J2NA 2KXHA 2MHEA 2ZBQA 3CSKA 4ERDA 5LXYA 2UUBJ 2ZH1A 2EBEA 2R7VA 2KG0A 5GAEU 1YRTA 3OR1A 1NO8A 2X51A 2HFZA 3MCSA 2P9CA 4R0EA 1S1XA 2AZ3A 2MHNA 3F73A 4ZN1A 1U1RA 4OHWA 1QUVA 2LVWA 5F9NA 3FCHA 4A8KA 1S97A 4LSLB 1TFYA 2GW8A 2BOAA 2FVRA 2OFHX 1UWAA 3JTOA 2ASLA 1FK9B 3MHYA 5JVGQ 4PWWA 3PACA 1S7HA 2C2OB 3IXQA 2DNLA 2OD6A 2MJNA 1PYSB 3TA2A 3KG1A 1M5KC 3D6TB 4F4AA 1X4AA 4YS2A 5F41A 5DM6Q 2XC9A 1N56A 3G82A 4IO1A 4HACB 4CM0A 3BSNA 3I32A 3J81j 3RTVA 1DURA 1C1BA 1P8GA 2W2NP 4OHZA 2Q43A 4C3MA 4QU6A 3K8VA 5D15A 1JNRB 2I8EA 5J1PA 4X4OA 1S6PA 3LGMA 5HVFA 2V94A 4ZVQB 4UY8T 3TI0A 2KXNB 1NH7A 1H2VZ 2FZCB 2HQFA 4ES3A 3ENAA 5A8KB 3SV4A 1R7IA 1IBMF 4KV8B 4DFPA 1N54B 1UA1A 2M88A 3NG8A 4JI5F 5KFZA 3W1YC 3SFUA 2UV8A 3QLHA 3MPDA 2W4DA 2BZ2A 4OYWA 4QQBA 4TY9A 4WTYA 4LSLA 4B3TJ 1Y10A 1NPRA 1JB0C 5BYSA 4LF4J 1VOMA 9ATCB 2ROGA 5A0YA 4RJVA 3D9BA 4WE1A 3SCIE 1S77D 2VQFF 4I7FB 3CB4A 1LEOA 3CWJA 2QLXA 1N4LA 4LBHA 2KRRA 4DU8A 4Z7CA 3DOLA 1I5OB 3T1YJ 3CVKA 1KFDA 1RACB 2IM0A 1FA0A 4PWDB 6FDRA 2AQ4A 2C3MA 4JI4J 1S0VA 2BX6A 2C3UA 4RLEA 3KK2A 3GP9A 4M5DA 4Z7YA 1EP4B 1C0UB 4J9OA 4I2PB 4DS5A 2HHHJ 2LQ8A 2BYCA 5HMWA 4WPAA 1TU0B 2I1RA 4ECRA 4O3SA 1KONA 4C8OA 3RBZA 3HXMA 2UU9J 1KSPA 6FD1A 4WKRA 3SDEB 5C42A 2ASJA 1YZ7A 4ENOA 2O01C 2Q79A 1H73A 1MW7A 5IZHA 2WZ1A 1O8BA 4N76A 3I6PA 3LPYA 2CQIA 2C2EA 1K8AT 2G2YA 3ENVA 2Z2YB 3AOBA 5THWA 5T14A 2KTQA 2C3OA 1YSJA 3C6UA 1S5ZA 3IS9A 4H54A 4PABA 2OUGA 4ZN3A 1PAUB 1TL7B 2MJUA 4ZPAA 4CT8A 4ZK7M 4WCEQ 1LW2A 2VD3A 3W9IA 3M7VA 4OX6A 4NE9C 4UOHA 2W7PA 2VFVA 3S01A 3UQSA 2XHWA 2HQDA 3TYTA 1S9GA 3PM9A 1MWQA 5I42B 3RB3A 1JKHA 4KQZA 1WOSA 1R8CA 2UUCF 2J8SA 4PWDA 1YGYA 4OV1A 3FEYB 4NI2B 3G6VA 2ZH7A 4K4WA 2ZDOA 1TFWA 2IAJA 1RXOB 4CQ1A 3PO4A 1ZM2A 4OI6A 3M8SA 4IH5A 2KFYA 3VAJA 3MAHA 2N7YA 2XLJA 4DR2J 3D3BJ 4PPDA 2CQDA 2PEHA 4JI4F 1TKXA 1RISA 2HLUA 1GMWD 3A4TA 3TZZA 1SJ4P 2H51B 1IBKJ 4DSIA 4HH1A 4N5SA 1QE1A 4MKYA 2H9ZA 2B5JA 3JYTB 2CRLA 3R5BA 4KC5A 2WOMA 4ITSA 3TZXA 1SBRA 3MAAA 2AJ0A 4C0OC 1UJ5A 3M9OB 2CA9A 1HW8A 1H6KX 2IFXA 5HMYA 3DRSB 3H2UB 4LR8A 3TJ9A 4CYUB 4MAKA 1IBLJ 1F5AA 2DHHA 2PA3A 4DWIA 3KJVB 2B8QA 4IRDA 1UTAA 3DNCA 1LNQA 2QV6A 5FDLA 5G0RB 1G6BA 1HI8A 2CWKA 4ZPWR 1AZSA 2E5JA 4S0MA 3BQ1A 3AD8C 5AT1B 2IPOB 1VC0A 3CULA 5KOXA 3KLIA 1VR6A 1D9AA 1Y5LB 2ACYA 4QWAA 1DZ5A 4WP3A 2ZC4A 2W2PP 2WSFC 5HVHA 3BQ2A 4UUXA 2FDNA 2ZD1B 2F63A 4WK3A 4Y2KA 2YX7A 5ETOA 3ZZTA 3J7YU 2W9BA 1JLQB 1VQ4S 1RE1B 2BKNA 4CLFA 4WFAQ 3KOAA 1JLEB 5AXNA 5CYMB 2CFXA 4PKDB 2E7VA 4LJMA 3BPSP 5I3UA 4X4PA 2FY1A 2FGOA 4K50A 3JXOA 4N56A 2BRLA 1Q82T 3TUIC 4LSNB 1ZPWX 1S6PB 1X5TA 1FRKA 2ZOMA 4WU2A 4X4RA 4ECVA 1B7YB 2GNKA 2EVZA 5D0EA 3VAMA 5B08A 2QLFB 3DLLQ 4CH7A 1S0OA 1UJ6A 2X1FA 3GIIA 4DR7J 3J80U 5HLFA 3QWPA 4RZRA 3OUYA 3K5LA 3VAKA 5G4DA 1WKLA 2YX4A 1S79A 1BMQB 4J91A 1NLKL 2O66A 5HROB 3FC9A 3HFVA 4O0IA 4XDDA 1UZDA 3ZZOA 1HWLA 3ET6B 3MAQA 2ALZA 1VQPS 2F4VJ 1PJ7A 5DQGA 3FVYA 3L7UA 2E29A 5C7PA 4CIOA 3X1LB 2V9KA 1JJHA 5J2NB 4Y2IA 2EG1A 2Z0GA 2ZH9A 4O0NA 4P71A 3W62A 3GV5B 2EC2A 2WVFA 3F0NA 5EGYA 3J7A1 3ZZUA 4RR5A 4IO9Q 3UI3A 1A9NB 1VQ5S 1QAXA 2WK4A 2C28A 1T05A 2DITA 2IC3B 2G2ZA 3CJRA 4UOCA 5CZVA 4F7VA 3H2VE 4U67Q 1TKXB 1U48A 1S1WB 1VQ9S 2HZAA 4JB8B 4NEZA 4A8OA 3R1HA 4LT6A 1RAJA 1IN0A 2AJ4A 3DCAA 4X2BA 1RT3A 1RYRA 2BKOA 3GYXB 4B02A 2ZH8A 2QYGA 2KFZA 1GK8A 1HBNA 2HRYA 2XMJA 2QTWA 4PUOA 4F0HA 2H5EA 1I1GA 1BWVA 2NLWA 3LH2S 4C7QA 4C48A 4TU9A 2KH9A 2XMWA 3HO1A 5L8RC 4NEYA 4ZPTR 4OLOA 4JV0A 4ZP8A 2DNRA 4CCHA 1C0UA 4IG3B 2CQ4A 3BR9A 4P9SA 2XO6A 2ZM6J 4B3TF 1B7FA 3SSRA 1UFLA 1CJTB 4NRTA 3ZC4A 3L7OA 1NDKA 2GGPB 1SJRA 3C16A 3MPVA 4W98A 2EG2A 2OH2A 2MMYA 2Y0BB 4QJVA 3F41A 4DV4F 3LAKA 3HFKA 4F4KA 1JLFA 1FI4A 4ZCLA 1JXLA 4C8KA 2LQBA 2QA2A 1BGXT 2KHCA 4C3LA 1O5JA 3CMAS 3MFIA 4JYAF 1EQ0A 4LRFA 4TYBA 1JLBA 1TUVA 4QZVB 4UF4A 4DJBA 4Q8FA 4J9VA 4JP8A 4CLKA 4DUZJ 4ZP6A 2EXUA 2MKCA 4CRJA 4UOGA 2C22A 3GCXP 1HBUB 1A6LA 1GMVA 2MQNA 5LXRA 3HF5A 4TU7A 2ZUAA 4YB5A 1RAOA 3RW7A 3DRXA 3M9NB 2YWGA 1SJFA 4FYDA 2KL8A 3FJ2A 3I0RB 4J9QA 1KD1T 1EJ7L 2ZBPA 3CW2C 4YDDB 1HIYA 2VJVA 5IS2A 3R2CJ 4DPWA 4Y6IA 2FZGB 4JV2A 4KPYA 4DQQA 3J7ZT 2K1RB 1V3ZA 3MD1A 1S6QB 3THPA 2MQOA 4PEOA 4DR1F 4FVCA 2VBYA 1RHKB 1UEVA 1OY9A 5M2PA 2VFTA 1E6VB 2R2TA 2DNGA 3EGWB 3CCES 4DV6J 3ETMA 4N8OA 3SDEA 4ZVGA 3DHWC 2VA3A 2BE2B 3A8EA 4DV2J 3DMJB 4ZHRA 1OWXA 7AT1B 5IFMA 1NAQA 5KG2A 5KFTA 4FXVA 2I6WA 2ZITA 2RAQA 4RW4B 2FYXA 2GZOA 1IR0A 1MG7A 3GTYX 4UT4A 1VQOS 3KJNB 3FEXB 5ETQA 4FBUA 2BQUA 4O44A 1Q16B 3HM9A 3EPIA 3UD3P 3VZHA 4C97A 2HK3A 3NL0A 2DGVA 1S1XB 4ECXA 3PX6A 3VGUA 4FKXA 3PW2A 1LWFB 2VBXA 2AU0A 2VG5B 2CQ1A 3E2EA 2DGSA 2QX0A 3Q24A 2QLWA 5FD1A 3X3UA 3DRRA 2DHSA 3HX9A 1HNVA 3CJ5A 1QVFR 2K06A 2OEJA 2VPZB 4M8LA 3S1TA 1T3OA 1WJ9A 3KJFB 2NR0A 4DR6F 5HMXA 4ZPBA 1S9EA 2CNNB 3EPGA 1RT6A 3CUNA 1VHIA 3H7HB 4LF9J 1HD1A 1YQHA 3ISZA 3HHLA 1WSRA 5JVHQ 4ER8A 4F8RA 3W2VA 2ZDPA 4NXMJ 3BYPA 3QSYB 4CO4A 1AT1B 1T9TA 3JB9k 1S1UB 3PHTA 2D69A 1TP7A 2BXJA 3FQLA 3MTJA 5HANA 4DOZA 4LFCF 3NGRA 3FZBA 2JEIA 1Q0NA 1IQTA 3PW0A 1VCTA 3OR1B 1TL3B 3A3PB 5G0RA 3ZZ0A 2CNOB 1VRTA 3IR6B 4BC7A 4EO6A 2OIHA 3IC1A 4JI5J 3VWSA 2QL9B 4Q45A 2IJFA 1TVRA 1SH3A 4FVMA 2HRUA 2R7QA 1S99A 4B08A 3RB4A 2J5AA 2HHQA 4LSZB 5KFKA 3DOKA 2CPJA 3FCWA 1IUJA 3SCKE 1BUXA 2IVFB 1H2TZ 3HHKA 4FKYA 1VS3A 3TANA 4PZVA 2MYFA 3KXDA 1PJ6A 4H4MB 3BKTA 3HVWA 5HK4A 2DR7A 2UXDF 3RB0A 1NCLA 2XWXA 1SKRA 2Q6BA 2XI2A 2YWKA 1OMSA 1SQGA 2FHKA 3EZ5A 3GJRB 4AT1B 3BN7A 3CCVS 1H7XA 4F67A 3OL8A 1WEYA 1QSYA 2IHR1 1SI9A 3JTNA 5LT5A 4M5HA 2JNJA 4XDCA 2FC8A 4LR9A 3DDNA 3W64A 1B70B 5J2MB 1KS2A 2F5GA 4J9PA 4LF7J 2E5LJ 1L5UA 1Q78A 3Q2TC 3AD7C 3MCOA 3H90A 3Q2SC 3AA9A 3WDOA 1Q4RA 5F8HA 3OTOF 3K89A 5DG8A 5MAOA 2AGPA 4FZVA 1FVQA 4CLYA 5ETRA 3KHLA 3KYLA 3UDLA 1U02A 4AXJA 4F3OA 4KO0B 1UZHA 3K58A 1RT2B 1Y3JA 5A0YB 3N6LA 2VF3A 1RHUB 1X9MA 2PMZD 3GR0A 2BJDA 2ZBRA 1Y11A 3DOKB 5CHCB 1J5EF 1XIQA 2OTLS 2PMWA 4DS4A 4OHYA 4JI1F 1I51B 3EZUA 5KFCA 2HS0A 5LMNF 1VLYA 4Q43A 3QWUA 4I67A 2FHJD 4ED0A 4ETXA 2PA8D 4C8ZA 1VQKS 2M8HA 3M32A 5I3QA 4Y3CA 2HHVA 4U96A 5DETA 2NYIA 3RW6A 1R8PA 3V4IA 2ZJQQ 3IAS9 4H4KA 1WHYA 2OAUA 3ICLA 2UUTA 2R42A 4NLUA 1H3DA 2CQHA 4OZ0A 4IFYA 4Q44A 2LCWA 2VQEF 3OSNA 4JYAJ 1OIAA 3EGZA 1HQUB 2C2KB 5A8RB 2VPYB 1WF0A 1N33F 2KRBA 4KSEB 4KV8A 2WHOA 2V6AA 1KLMA 1TUGB 4RO0A 3GU0A 3OPKA 2ERRA 1N8RT 1HR0J 1HNIB 3KK3A 2JH3A 2QMXA 2RD5C 3A8IA 2LU2A 3AB4B 4KH1B 1UA0A 3FRZA 3IG1B 3VQSA 4IRCA 3H2LA 4DFKA 2V5HG 3V6KA 4ZDNA 3VQTA 4AE5A 2HMIB 3A8JA 3GFHA 5HQLA 3JAMU 4I7FA 3LTOA 1KQSR 3D6FB 3C2PA 3R5CA 3TQEA 4RW8B 2HFUA 2KT2A 2P2CB 2QE5A 1ZZNA 1D8YA 5F8JA 4ZLJA 1BQNB 1U0SA 2NREA 1VIXA 2HHXA 2V0NA 1JLEA 3NNCA 1ITPA 4O3OA 2XTJP 2YQ0A 3CJ4A 4CH1A 1M5SA 1FESA 2J9CA 4G65A 1GX6A 2XWYA 4IOBA 1T9UA 4LUBA 2DEIA 4QIVA 1RAAB 2F8EX 4UZBA 3G6ES 1HBOB 2NXCA 3UVJA 5K5MA 4LFCJ 1HBMB 2JLEA 2Y3YA 3PRVA 5F8NA 4A8XA 2FZKB 3THVA 1K0TA 4DV7J 2CDQA 3L7PA 3OW2R 1W7WA 1N5SA 4U7CA 4K5RA 4NX9A 1FJGF 2J9DA 4U7UK 4W92B 4ICLA 1CQMA 4FN5A 2V68A 3F44A 1JLGA 1FRJA 1FJGJ 4QWBA 4ED3A 2G0JA 1MN7A 4TXSA 3KWMA 2NZ4A 3BBFA 1OJ4A 4ZS6A 2CPHA 1F0XA 2GHWA 3O1LA 2XS7A 4AUKA 1QLNA 3SCLE 2LQJA 2RH3A 2CPIA 3QRPA 2GQCA 4WYLA 4KPCA 2RILA 2VDHA 3V81A 3D1OA 2PEBA 2MTLA 2RSQA 4OFZA 3CPWR 3V81B 2DXEA 3GMGA 4URGA 1NK6A 1PBAA 3OFEA 4WKYA 5E3CA 4JI6J 2UVWA 2UXDJ 1I94F 3JQJA 1S72S 1DRZA 3ISNC 1M1HA 2DY1A 5M2RA 1Q79A 2G0IA 1XN9A 2XMAA 2BR0A 1QVGR 4LF8F 4RBUA 1NK9A 4DR2F 2B8PA 3DLHA 3KLFA 1PBUA 4J37A 4ED2A 1H2UX 3C66A 4B9LA 2DXDA 3BGRB 2NSCA 5IC6B 5F8MA 2Y1IA 2YKQA 4QPTA 2UVRA 1RT5B 1TQLA 4YN3B 1HW9A 3W66A 2GMLA 4DPUA 3AQPA 1RT1B 5E7OB 3RRGA 2L41A 4X4UA 4X65F 2W4PA 3I0SB 2DVIA 4NXMF 2VB6A 1RTZA 4WE1B 5KT2A 3OJSA 4ZMMA 4QW9A 3OT9A 1NSKL 2H65B 3MR2A 1AUDA 1RI7A 2FJEB 1FWLA 2X7IA 3AOAA 3FUYA 3MM9A 4KHMA 4K4XA 1FWPA 3GV7B 1DARA 3K17A 5GAHI 2GHVC 1HYSB 2GGPA 3C16B 3NMRA 5AE3A 3W60A 5HN0A 3MEEA 1WSVA 4ZIWA 1E6YA 2F1FA 2PGCA 2WB4A 4QOTA 4RW6B 2DO0A 3RUBL 5H1SV 3SZ2A 5HP1B 1QTMA 4YB1P 1RWKB 4DV3F 4JI8J 4URSA 3FDSA 4RWXA 2HNZA 4KHPJ 4FF3A 1HQEA 4O23A 3V5RA 4EFAC 1RT4A 1CS4A 4TVAB 2AX0A 1LWEB 3TVKA 1SIWB 2AV5A 4ZPCA 4DFMA 1PIEA 4J9KA 3MMAA 1ZAWA 1JK9B 3D1QA 1U25A 2JEFA 4FPIA 3D6HB 3BO3A 3TUPA 3NEKA 3Q8YA 3HSZA 4PR6A 2K3IA 2OPQA 2VU5A 1NSPA 3MDFA 3MM6A 3PIPQ 5E3PA 4BHQA 1ZYQA 2HPUA 1N0VC 3AHPA 4OZ5A 4WU3A 2MY8A 3AA8A 3BB5A 4I2QA 4KB7A 4RW7B 4O3NA 1J27A 4M5DB 3EJMA 2FVQA 2JC1A 4LVNP 2YXLA 3Q8UA 2ZH6A 1YBTA 4IH7A 3A13A 2PFDA 3IGVA 1L3UA 2BOPA 2FD2A 2RE1A 3KHGA 1Z4UA 2GMHA 2I0XA 2HBYB 3H98A 3M2RA 3CCJS 1SQEA 1RAFB 3R5DA 3G2XA 4ZVPB 4KRWA 4QYZK 1MLAA 1D3WA 4RW4A 2DIVA 2GVDB 1CC7A 3MMCA 5IT4A 3HJFA 3O6QA 5CYMA 1AROP 1AUSL 1WC4A 5D0RA 1TV6B 4WP9A 4KJIA 4HHUA 4FYXB 3DYAA 2N4DA 3CC4S 1Q8IA 1X8DA 1FDAA 3HHDA 4MIBA 3KUEA 2GMJA 2MPUA 4LREA 2GA7A 4ILRA 1OSCA 1REVA 1FTCA 1VRUA 3MM6B 2LQ9A 1ZM4A 4RX6A 2MQQA 2DRAA 5FDLB 1PAEX 1K44A 4OZ2A 1QAIA 3UN2A 2JDJA 3M32B 4NMXA 1U0HB 2PE8A 1NJWA 1RT7A 2QG9B 5FLXU 1S4FA 3ULHA 1U45A 1YWXA 4UOFA 2W7AA 3IWNC 1KDNA 3QO9A 1FRMA 2EW9A 4G1PA 3OVSA 3FSXA 2QFJA 3UCZP 1FDDA 5LJ3Y 1RTHA 2ZD1A 1J2VA 1Q86T 4JBCA 2YNFB 4WZQA 1FKPB 2HFOA 4AL5A 4YB6A 5C5JA 1X0PA 3P5BP 1O51A 1IWAA 2A1BA 2YNIA 4NLOA 3RR8A 3W5XA 2WAQD 1XR5A 5H9FK 2MKSA 2LYVA 1JLFB 3WZ0A 1KEKA 3OHBA 2XY6A 4URQU 2MY7A 2V4JA 1HHQA 2MZQA 2YPZA 1L3TA 3C6TB 2EWHA 1OQ3A 1UP1A 2H1YA 3SIPB 4DN0A 4K4VA 2N3OA 3RBDA 5JUMA 2W9CB 3DGVA 4ZLPA 5KFUA 1BLUA 4TQSA 1XR6A 1NJIT 5E3RA 2HGMA 1F9EB 2QGFB 1LWCB 3S7RA 5KFWA 2DPIA 4K0KF 2FJVA 1X5OA 3KK1A 1F5CA 1ZAVA 2QFIA 3BREA 3LW5C 3K5NA 2OPPA 1VBYA 1QSLA 3TEHB 3N0VA 1WACA 1YJRA 2CQ3A 3D0HE 3W5ZA 3KHRA 2BQRA 3LGHA 4RU2A 5KFAA 4DR4F 2LA4A 3Q8SB 1KN6A 3VAGA 4EYHB 3R6GB 3MTKA 3FBBA 4DUZF 2HIYA 2LXUA 5CAAA 3T1YF 1VQ8S 2UVVA 1DY3A 1FXDA 3VR1A 2YKMA 3T9ZA 1XMOF 1RP5A 3WBZA 4ANCA 3N28A 3ZFVA 2MGZA 1SL0A 2YKPA 1C4AA 1RWOB 1LK5A 1U49A 2B3TB 1PGZA 1T05B 4ED4A 2Z30B 2RS2A 5A6PA 2HNDA 4K4TA 3LP1B 3IA0A 3R5GA 9RUBA 4DR1J 3BDPA 3ZO7A 4H4OB 4DLEA 1WTFA 4PAAA 1DJ0A 3QGHA 2DGTA 3BO2A 1VQLS 3T1HF 6AT1B 3ZTSA 4F50A 3L09A 3IGNA 3MEDB 3RBXA 1BHNA 1HNXJ 1RHQB 3G82B 4F2RA 4QCLA 1JLQA 3O2IA 4DV5F 1W25A 3AAWB 4OYXA 1U8WA 3DU5A 3R97A 3Q8QB 4B9UA 1FO1A 2XSFA 4OYMA 3V6DA 1CBKA 4OHVA 1ULRA 2HRTA 3HZGA 4A48A 2DB1A 4M5LA 1EP4A 3KTQA 4OI0A 4K0KJ 3PEHA 4HEA9 3DKDA 2ZNYA 5KFPA 3TAMA 4NRUA 2AD9A 3R5AA 1G1XA 2V8GA 4ZCIA 4O3PA 4DZ6A 3E51A 1EX8A 1RADB 2DJWA 2YNGB 2A2CA 3IMQJ 4I69A 4CLPA 3MD3A 3EXCX 2FUG9 3G8QA 4DX8H 3CD0A 5KFNA 2JLFA 2WB1D 4FYYB 1RHRB 1A7GE 3TZYA 4IDKA 1F3VA 1JNZB 1RHMB 4OZJA 3HT0A 5ETMA 3VVUA 4A47A 3RR7A 4DQPA 4QPXA 1BD6A 4LF6J 1UFKA 4Q0BB 3HCXA 4D3HA 3LANA 2UUAJ 3DN9A 1KLMB 3OBIA 4ID5A 3T5KA 1Q81T 2GJFA 2CQGA 3ZNJ1 1PG5B 3CMES 2ZVSA 4RW7A 3TX8A 1T03B 2ROPA 5HI7A 4BBYA 5EHHA 3MMJA 4ED6A 1KFSA 1N32J 1RAEB 4A46A 1QDUB 4RUBA 4O3QA 1FKOA 3TZWA 2ZHBA 1NUEA 2E5IA 3QT6A 4L73A 3OXLA 4C2MA 3ADAC 1ZA2B 3R9LA 2IAJB 2YKNA 1SL1A 2LDYA 2OSQA 1U7LA 3A1YG 3UN5A 5F3ZA 5IV3A 2VICA 1FT8A 1UVIA 4G1QA 1SC3B 2JEJA 3QJJA 4EMDA 2JWNA 2L9NA 3HKZD 1H72C 1Z2LA 4NA2A 1UVKA 2FHMA 2ATCB 3BF4A 4WZMA 3T1AA 2FVCA 3D68A 5F8IA 3FRYA 3UDEA 5GAHU 1K9MT 1IBCB 1QE1B 1R8BA 4AL6A 2EK1A 3PR5B 1C1CA 4XO0A 2GJIA 1V6HA 1GXUA 4F4YA 1N36F 1R6VA 1KC8T 2POKA 3H5UA 2CPXA 3BN4A 3ZZRA 2IBKA 3H8YA 1K1SA 3DU6A 2OEKA 4L74A 4NLDA 1S59A 4PG8A 2QMUB 1RBLA 4OYBA 4Y2MA 3US5A 3TVYA 1WI8A 4DL5A 2J0SD 4IRKA 3PJXA 3MCNA 3DLBA 4UQGA 1RWPB 3JQKA 4Z2XA 1BQMB 5KT6A 1RT2A 2HSEB 1S9GB 2EEYA 3H5XA 2HURA 3OTBA 4OJHA 1TUWA 4IR9A 2F9JA 4ANDA 1HL6A 1LXNA 2AJ2A 2RHSB 1HWUA 3ENWA 3ONQA 4CLLA 3RGIA 3GV8B 5J1EB 4A8YA 5H9FJ 2OSRA 3TNVA 2WSEC 4NLQA 2XO7A 2EFGA 3JAMY 1TL4A 1NB7A 2RRAA 2J6UA 1IM4A 3MEKA 4G1QB 2NXEA 3WX4A 3KJQB 2V50A 4JI0F 4CZCA 2XY5A 4DSEA 4LRBA 3Q86A 2QT7A 4L6V3 1WG5A 2RB7A 3HSDA 3W2VB 2M8DB 1RUSA 4HLBA 3J7YI 1WUUA 2HVZA 3JSMB 1G3OA 2VG6A 3W9JA 3BJYA 4WBFA 3HVAA 3NGUA 3LP0A 3PCOB 1VDHA 3EXYA 4X62F 5GADU 2J7KA 4DQRA 5C42B 1YLXA 5A76A 2DPJA 2WCXA 2RQCA 4X66F 2C2ZB 1LFWA 2UP1A 2CVEA 1KWMA 1R8AA 3DI6B 3BGLA 5E33A 2AWZA 5KAKA 2VIHA 1HFEL 3ITHB 4RNNA 3V6JA 2HKEA 2XGPA 3PJ9A 1V3SA 3DOMB 4PXCA 4BS2A 2NUUG 4TQRA 1P6TA 3QFHA 5BXIA 2MSSA 1IBKF 4IR1A 4V19X 4EBEA 3W5YA 3OLBA 4ZP7A 2BJEA 4DL0C 4A8QA 2C2RA 2W2MP 4M5KA 3MECB 4XAKA 1TL5A 3CXCR 5ITHA 3Q23A 4U8YA 2CDRB 3M8PA 2RJZA 3C8YA 3VGVA 4OZ1A 4DX7A 3N5BA 1MWYA 3GB0A 4YQWA 3FFIB 3C15A 5J2QA 4RPFA 3SSSA 1DQ9A 2ZFHA 4ZJQA 5KFBA 2RNEA 3N4WA 3N6NA 5D4NA 1C4CA 2DH8A 3NAIA 2XLIA 5LL6d 2QMWA 3ZTPA 5D77A 2R3VA 3MMAB 5HATA 1REGX 4TY8A 4IG0B 3FSIA 1HWJA 2J6TA 3DRRB 2R2RA 4K5SA 2BA9A 1D1UA 1GTEA 1MWZA 2FQQB 3EM1A 2OPSA 3FSYA 3NAHA 3U1LA 2RKIA 3FMBA 4DV5J 1FKAF 2EFOA 2BJ9A 2P6TA 1TL1A 3FMWA 5EX3A 3DOMA 3FBFA 1VQSA 3TAQA 3GYGA 4LFBJ 3M2UA 3I0RA 4USJC 1WG1A 2PI5A 2L9DA 2GO8A 3I9ZA 2C3PA 1MU2B 4MT1A 1JWWA 2MLZA 3OQ2A 1M90T 3DLKB 3U1NA 4RW9B 4FDFA 1JLCB 3ISND 1EQMA 1PYOB 2YKMB 5CABA 2G13A 3AJDA 3K8WA 1E6VA 1BY9A 4RUAA 1RLDA 2BE2A 5AXMA 3GIKA 1FVSA 3IM8A 1YZ6A 3EVWA 2RDJA 1UVJA 2DR6A 2RIJA 1ROFA 2OEMA 4ALZA 1FX4A 2H5JB 5T7LB 4C9DA 4LBPA 4MKAA 1LWEA 3OFFA 2RF2B 4DI6A 3L95X 5I3UB 5B0GA 4ED1A 1X9WA 1QAJA 1FHTA 1FXRA 1UL3A 4N8NA 1F2GA 3LF0A 4YR2A 1LW2B 4FXDA 1F9FA 1WF2A 3D0GE 1IVZA 2AX1A 4F0MA 2MEWA 3LP0B 4QIFA 2ZBCA 5GAGI 2E9ZA 1CULA 4ZVHA 1NDLA 2V2ZA 4F04B 4DV3J 1FWKA 1U6ZA 3GE9A 5K9FA 3J80Y 1UWBA 3L3CA 4NLTA 1T8EA 4EGLA 3P49B 1B0TA 2V8HA 3B82A 5IQQA 1YJUA 5C2GA 3G71S 2ZE2B 3HHLC 1AZSB 1RT1A 1Q8BA 4TNOA 3ZZPA 2ZJRQ 4WFYA 1SC1B 4M5GA 2CUYA 2KVIA 4ZOSA 8AT1B 5I4MA 1JJ2R 2J0XA 2QL5B 1RTHB 1EKSA 2E5HA 2RRBA 5ETTA 3MCMA 2LLZA 1RCXB 1TZ0A 1R0CB 2CAJA 3OTOJ 3R1LA 2PIIA 3BR8A 4DPTA 5IC4B 2DGXA 2NUHA 5D0HA 5HBMB 2EI5A 3PW4A 4V1Ak 2ABYA 1O0PA 1M5PC 1GTHA 2XULA 5FJ4A 2CJAA 4PG7A 1WKJA 1SIZA 2XS5A 3TR5A 1W2BR 1EAYC 2HHUA 3EWGA 2F4VF 2KHDA 3JSMA 1OQ6A 3FK4A 4B3RJ 1HBMA 1YTYA 1RWXB 2BW7A 5DZ7A 1PJ5A 3GR1A 2XCAA 3CCMS 1XMQF 1HHTP 2FB0A 1SH0A 5A6WA 3BH7B 5D8HB 1FERA
chains in the Genus database with same CATH topology
5CYQB 1UWBB 1MMNA 3KK1B 4Q2LA 2FLLA 4DR7F 1ZPVA 1LWCA 3G86A 3CDAA 4Q5VA 4FNHA 4L3NA 1YJVA 1N52B 2D41A 3SFGA 3U27A 1VQNS 3QO9B 2JLGA 2K2PA 2MZSA 4Y0FA 5B0AA 2I38A 1JJ4A 3M9MB 1N34F 3CJ0A 3H5SA 3KLHA 2F7VA 2D3UA 3AJ1A 3CJKA 2D3OR 3NKYA 4BWJA 4J9SA 1GT8A 3UR3C 1D8ZA 4DF8A 4ZCKA 3OFGA 1VJWA 2EC0A 1TAUA 1BWEA 3VCDA 5DDQC 4X4NA 3BM7A 1NKEA 2OFGX 4OJGA 3CD5A 1TR0A 3POTA 2CYYA 3MMCB 3ENQA 1FF2A 3MMBA 4NMLA 3T9NA 1MROA 4NYZA 1FK9A 5EN1A 2VG5A 2E1MC 2JC0A 4YFUA 1RJJA 3M30B 2DH9A 3DRPB 5KG4A 1HNVB 3O44A 4O4GB 1NKCA 1HA1A 4NL5A 3B4MA 2LA6A 4YUDA 1HNXF 3TP2A 3C46A 5KG7A 5DLFA 3NNHA 3V6DB 1M0SA 1HD0A 5KFMA 2M7SA 1JLCA 2GCFA 2M70A 4OJ3A 4PG6A 3QJLA 1DQAA 2VFSA 3GQCA 2N3LA 2M9KA 4NLRA 2CVIA 2CPFA 2MSTA 1ZM3A 1NJZA 3UCGA 3IRXA 3OVAA 2HNZB 1Y5NB 1QUPA 3PKYA 2RKIB 1DTTA 3RZAA 1IKVA 3KJVA 4DG1A 3PXGa 4ECWA 1SKSA 1G2EA 4NXNF 2QSFA 2OD4A 2R7SA 2HIQA 3MPYA 4NLSA 2ATLA 2EFNA 1T7PA 4MTPA 2KI2A 3BO4A 1Q8LA 3KNAA 5D6GA 2W9CA 4J9NA 2LEPA 3P96A 4JUZA 3THTA 2MXYA 1TKZB 3E8OA 1S1VB 1IBLF 4RUHA 1HYSA 2HHPA 2MKKA 3M6UA 2NQPA 4ZPVR 5MLCV 4FS2A 1L3VA 2GO9A 3LALA 1SB6A 3TW0A 1XNRF 2Q6CA 2RQMA 4B17A 2R8KA 3PX4A 2KKHA 2MZTA 2KT5A 3CD6S 5B09A 3GWCA 1U2RA 3CCTA 4P2SA 1TKDA 2YH1A 1XERA 3F56A 1C1CB 4CO2A 3TQ1A 4C11A 2LKZA 3LOUA 5E3AA 2VKRA 5AXKA 3DRSA 3RU0A 2XLKA 2RQKA 3SSQA 4KT0C 4BCAA 3B8HA 4FF2A 3E01B 3SQGB 2XGQA 4WF9Q 2QIFA 2J7UA 3J81Y 5DGAA 4TLRA 2B9WA 4ECYA 4ES2A 3GZ7A 2EK6A 2AJQA 2R2SA 2LEBA 1BC6A 4OI3A 4DV6F 1WWHA 1FE0A 4EYIB 1S1VA 3GSDA 3I82A 4JYAF 4X4QA 2ZM6F 5DM7Q 2MZRA 5E0OA 2G9OA 4B3MF 3Q8PB 1FJCA 1Q7LB 4EWTA 4B3OB 1BQNA 2EFVA 1XR7A 1NK4A 1KOHA 3B4DA 3OV7A 4EBCA 4DN9A 2V9WA 2R8HA 1U24A 4PCQA 5FLXY 4QBUA 4B3RF 4J9RA 3CCUS 1EETA 4M94A 5CQGA 3DLGA 3NCRA 4J5OA 4R8UA 4MH8A 1FEHA 3UDCA 4O4RA 5CCLA 1IJFB 3N5FA 2U2FA 3LP2B 5KFQA 5L1IA 2E1RA 1NRKA 4KKOA 2W4CA 2HVIA 4MIWA 4IQXA 4WFBQ