2WOMB

Crystal structure of uk-453061 bound to hiv-1 reverse transcriptase (k103n).
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
427
structure length
412
Chain Sequence
SPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title Lersivirine, a nonnucleoside reverse transcriptase inhibitor with activity against drug-resistant human immunodeficiency virus type 1.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 109
structure length 412
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2womB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2womB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2womB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2womB03
2XCPA 4EYIB 4IFVA 3MEDB 4ZVHA 5CYMB 2FLNA 4O44A 1S1UB 4ZP7A 1SH0A 3BQ2A 3OL8A 3GILA 4F4YA 4F4ZA 1S1TB 1VRUB 5KG2A 5L1IA 3TQ1A 1IKWA 4B3OA 3M9MB 3CJ2A 5KT7A 1JLFB 3IG1A 1XR6A 3ICLA 3CJ3A 2BQ3A 5L1JA 1LW0A 4YR2A 4KV8A 3QO9A 1FKPA 3DI6A 3DLKA 4TY8A 3MR6A 5C25B 3JSMB 3GV8B 1SV5A 4X2BA 2IAJB 5KFGA 2HNYB 1S6PB 2WCXA 1HPZA 2RKIB 1I6JA 4Y34A 5EUHA 4TQSA 2XGQA 4EBEA 4FBUA 3M8QB 3NKYA 4J9OA 5KG5A 1HMVA 1RDRA 1S1VA 3I5AA 2AQ4A 5KFQA 2BQRA 1UWBA 1C2PA 3E51A 3QLHB 4Q8EA 1RT3A 3LP1B 3HHKA 2GC8A 4LSLA 4RW4B 1JXLA 1C1CB 4URSA 1RA6A 1LWFA 4KHRA 4NLRA 4K4YA 4MFBB 2CKWA 3GIMA 2C2DA 2W9CB 3FRZA 2ZD1A 4IQXA 3H5UA 3MEDA 3DM2B 5CYMA 5KFEA 3SI8A 1J5OA 2WONB 2DPIA 4IRKA 2XCAA 5J2MB 4WFXA 2XI3A 4ZP9A 4O3OA 5J1EB 4QWDA 3MFHA 4ECXA 3T5JA 4I7FA 2OPSB 2R8IA 4ECQA 3NMAA 5F8JA 1CSJA 1JLFA 5C42B 2FVPA 3V6JA 5CYQA 2IJNA 5F8GA 2XI2A 1S49A 3MR2A 3MR3A 4ZPCA 3KHGA 2V4RA 2UVRA 1JX4A 3I0RB 5C25A 3JSMA 2UVVA 4MIBA 2O5DA 4WYWA 3G6VA 1S6PA 4O4RA 5KFLA 2RKIA 1RT1B 2JEGA 2IBKA 3M8QA 1SH2A 5KT6A 1JKHA 4RNMA 2WOMB 3MEEB 4FS1A 4ED1A 1RYSA 3OL6A 4K4XA 5F9NA 4KB7A 5KFKA 3QLHA 2FJXA 3LP1A 2YNGB 1C0TB 2RDIA 5DQHA 4RW4A 3KMSA 4TXSA 3HKWA 1C1CA 1EP4A 1N56A 4JUZA 4MFBA 1EETA 5EWEA 3M9NB 2W9BA 1S10A 4IG0A 2E9RX 4FBTA 5KFAA 2HMIB 3NGDA 3DM2A 4Q8FA 1DTQB 2WONA 2VA3A 5J2MA 4EO8A 4MIAA 2B5JB 4DL3A 2FLPA 2FJWA 1HNIB 4URQU 3KMQA 5K14B 4QWCA 5JUMA 2W8KA 2OPSA 5KFWA 1TVRA 3KK2B 4I2PB 2ILZA 3HVTB 5C42A 5KFVA 4ECSA 2IA6A 2JEFA 4LQ9A 2YKMB 5HROB 5F8MA 1RT6B 3I0RA 3CIZA 4H4OA 4WXOA 5DQGA 3KOAA 4NLQA 5KG6A 2XWYA 4O3QA 4HKQA 5F8HA 4DL5A 4IR1A 3MF5A 3OSPA 5DG7A 4XPCA 3V81B 1JLCB 1KHVA 1SH3A 4YQWA 3D5MA 2WOMA 3C6UB 3I0SB 3JYTB 2IJFA 1N4LA 5D3GB 5KFUA 3V4IB 2D41A 4ZVEA 2BANB 1C0TA 4WE1B 3BGRB 4IDKA 4O3NA 3PR5B 1NHVA 5J2PA 4G1QB 2YNIA 5J2QA 5I42A 1BQNB 4ECUA 1S1WB 2B5JA 1K1QA 1IKVB 1R0AA 4TLRA 2WB4A 3GQCA 1DTTB 4IG3B 3BSCA 3BSAA 2VG5B 3KK2A 5KFMA 4I2PA 3HVTA 3CWJA 1REVB 2YNHA 2YKMA 4RUCA 5HROA 1YVFA 4WYLA 4ZPBA 5KT5A 4H4MA 5KT4A 1RT6A 4IH5A 3LP2A 4KFBB 4NLYA 2R8GA 5KG3A 4GC6A 1SUQA 3GIIA 1IKYB 1JLGB 5KG4A 4GC7A 2WK4A 1KLMB 1RT4A 3DOKB 1JLCA 3KLIA 3C6UA 3I0SA 3JYTA 3DYAB 3FQKA 3PVXA 2CJQA 3V4IA 3DLGA 2BANA 4WE1A 2YKNB 3I5CA 4NRUA 3CDUA 4M94A 3PW5A 4U6PA 4WXWA 1D1UA 2JC1A 4PUOB 2OPRB 1QE1B 3QIPB 1S48A 4ZPDA 2WHOA 3ISND 4G1QA 4NCGB 1LW2B 3DRPB 2GIQA 1KHWA 4J9NA 3VQSA 3QGHA 1S1WA 1IKVA 2HWIA 1S0NA 1S6QB 4RNFA 4ECYA 1DTTA 4IG3A 5DLFA 2VG5A 4DG1A 5C24B 1JLQB 4PWDA 4KE5A 5KFXA 3Q8PB 4O4GB 3G86A 3E01B 1REVA 3LALA 4Y3CA 3FSIA 4RNOA 4YR3A 1MMLA 4Q43A 3M8PB 4MK7A 4ECVA 1U09A 4MK8A 2ILYA 5F8NA 3KLVA 3KHHA 2OPQB 4IH6A 3MTKA 5KFFA 3RB0A 4RW7B 1IKYA 1LWEB 2BRKA 1RT2A 2DPJA 4K4TA 5DG8A 4R8UB 2HNDA 2B43A 3DOKA 1KLMA 2VG7B 4EO6A 4DL4A 4K4VA 4YR0A 3DYAA 3SFGA 4Y2AA 4RUAA 3OL7A 1S1UA 4ZVGA 2QV6A 3OHAA 2C2EA 3MR5A 2YKNA 3RB4A 1S1TA 1VRUA 5HLFB 3GYNA 4MK9A 2OPPB 4J9PA 3OHBA 3PW7A 2BR0A 1JIHA 4RW8B 3H4DA 2OPRA 3QIPA 2R2SA 1NHUA 3CDWA 2V9WA 4ID5B 1JLEB 4IRDA 2W7OA 1LW2A 3DRPA 4J9LA 1S97A 5KFCA 3H5XA 5EDWA 2IAJA 2IM0A 4KKOB 2HNYA 3BR9A 1S6QA 1TL3B 2R2RA 3GIJA 4KO0B 4O3SA 3DRSB 4O4GA 3E01A 5KT3A 1S9EB 3NL0A 1IKXB 4NRTA 4QWBA 3M8PA 2VG6B 3KLHB 4ECTA 3PW4A 5KFIA 1TKTB 4IOBA 2OPQA 1DLOB 2BQUA 4FS2A 4RW7A 1LWEA 3H5SA 4URGA 4ECRA 3CO9A 2AGOA 3EZUA 2W9CA 4R8UA 1FKOB 1Z4UA 1T94A 5DQIA 1RA7A 5F8LA 4IH7A 1TV6B 1RT7B 3Q8SB 2FVSA 3IRXB 3FDSA 2IMWP 5I3UB 1TKXB 5J1EA 3N6LA 3N6MA 5HLFA 3V6DB 4NZ0A 2IC3B 2OPPA 3PHEA 4EYHB 4LQ3A 3ITHB 1QAIA 4NYZA 5KG1A 4ED8A 2JLEA 5DG9A 4EEYA 3CJ5A 1JLEA 3T5HA 5DGAA 4IRCA 3FQLA 5F8IA 4DL2A 2J6TA 3UPFA 2HNZB 3KJVB 4J9KA 4XO0A 3FFIB 3RAQA 1TL3A 1T05B 3QYYA 1RT1A 4IKAA 3PW2A 3RB3A 3UDLA 3MEEA 3MECB 1IKXA 1ZETA 4OL8A 2VG6A 3LANA 3NAHA 1RTJB 2YNGA 5HP1B 4KSEB 2R8KA 1JLAB 3KLGB 1N5YB 1TKTA 5C5JA 4ZMMA 4LSNB 1DLOA 1NNDA 5J2NB 3RBDA 2ZE2B 3D28A 4MKBA 2FVRA 2WRMA 3OLAA 3I5BA 1FKOA 1S9FA 2EC0A 2HMIA 5F9LA 3IS9B 1DTQA 4YMEA 3T5LA 5DLGA 1RT7A 4J9MA 3PW0A 1HNIA 3IRXA 5K14A 5I3UA 1TKXA 3PJXA 4TYAA 2I5JB 2BRLA 2IC3A 4IFVB 2C28A 4ZVFA 3M9OB 4K4UA 4WZMA 4O44B 3OSNA 4JV0A 5KFOA 3HVWA 1ZTTA 4H54A 4WFZA 2HNZA 3KJVA 2F8EX 3N6NA 3FFIA 4Q44A 2RF2B 1RTDB 4B3OB 2IM2A 1VRTB 3DMJB 3IG1B 1T05A 3IGVA 4ECWA 3CVKA 1LW0B 2BE2B 4KV8B 3V81A 1T03B 3KK1B 3CDEA 2D7SA 3IGNA 3QIDA 4TY8B 4ZPAA 4U7CA 1HNVB 4ECZA 4NLXA 5D3GA 3TVKA 2W7PA 1RTJA 1K1SA 1TQLA 4RNNA 1JLAA 3BGRA 3KLGA 1N5YA 5FDLB 4LSNA 3QZ8A 3V6HA 3KLFB 5KG0A 2J6UA 3UQSA 1TL1B 5EWGA 3OL9A 4ED2A 3H5YA 2B6AB 4EBDA 2C2RA 1RT3B 3SFUA 1HQUB 2GIRA 3G6XA 1BQNA 3BJYA 4I2QB 1LWFB 4TY9A 3KNAA 2I5JA 4M95A 2ZD1B 3BSOA 1RTHB 1GX5A 4KHMA 1J5OB 4QW8A 4JV1A 4NLSA 2ATLA 5L1KA 3QZ7A 4Q0BB 3PJWA 4TQRA 4KFBA 3LP0B 4I7FB 3T19A 2QE5A 2XC9A 2RF2A 1RTDA 1VRTA 5KFRA 3DMJA 1JLGA 4PQUB 3EPIA 4QW9A 5CYQB 5T14A 3BQ0A 1RAJA 2BE2A 1T03A 4MKAA 1TP7A 3KK1A 3HVAA 4DL7A 5KFZA 2OH2A 1RTIB 2IM3A 1HNVA 2AWZA 3BSNA 2JEJA 1HYSB 3PR4A 4NLOA 5FDLA 4WFYA 1JKHB 3KHRA 3KLFA 1QAJA 4R5PB 1TL1A 3LAKA 4PUOA 4O3RA 5KFYA 2FJVA 2R2UA 1QE1A 1TKZB 2AGPA 2B6AA 3PZPA 4NCGA 5KFDA 4K4WA 1HQUA 3KLEB 4ZP6A 2IM1A 3DOLB 1EP4B 4I2QA 1S0OA 2W9BB 1EETB 4IG0B 5EWFA 1WNEA 5JXSA 5KT2A 5C24A 1JLQA 2R2TA 1RTHA 2FVCA 4EBCA 4ED6A 2C22A 4JV2A 2UUWA 3GV5B 3Q8RB 1ZTWA 4RNHA 2HWHA 2UUTA 1HQEB 4Q0BA 4KBIA 5KFSA 2W8LA 3LP0A 1TVRB 4RW9B 3H98A 2HAIA 4RU9A 2JEIA 1JLBB 4PQUA 3TAMB 4ED3A 4O3PA 3KHLA 4ED0A 2XGPA 2E9TA 2VG7A 4R0EA 4TYBA 4ICLB 1RTIA 4H4OB 4F50A 1S1XB 5KFPA 1HYSA 2V4QA 1IM4A 1S4FA 1C0UB 2ASLA 1FK9B 3UR0A 4R5PA 3DRRB 3CJ0A 3CJ4A 4RW8A 3KK3B 1TKZA 5KG7A 4NLVA 1GX6A 5KFBA 4QWEA 1S0MA 4ID5A 3QGGA 3T5KA 3KLEA 1BQMB 4NLWA 5KFNA 4MH8A 3DOLA 4IDKB 3RAXA 4KKOA 2AX1A 5HBMB 4KO0A 4ZHRB 5J2PB 3H2LA 5I42B 2YNIB 5J2QB 3H4BA 1RYRA 4IR9A 3DRSA 3H59A 4DEZA 1S9EA 4J9RA 1HARA 2V0NA 1R0AB 3KLHA 1HQEA 2AX0A 4KAIA 3H40A 1N6QB 2VA2A 3C6TB 3BREA 4YP3A 4NLGA 4RW9A 4J9QA 2WTFA 1JLBA 3NAIA 3TAMA 4K4SA 3DLEB 2YNHB 2YNFB 4K50A 3V6KA 4NLUA 2E9ZA 3NBPB 4H4MB 2D3ZA 4IFYB 4ICLA 3LP2B 1LWCB 4ZP8A 2R8JA 1RT5B 1TV6A 1S9GB 3MEGB 4HYKA 1MU2B 1C1BB 1S1XA 1SUQB 5KFJA 2W9AA 4G3IA 1C0UA 4RW6B 2FVQA 4NLTA 4Q45A 1FK9A 3V6DA 1RT4B 3GIKA 3RB6A 2AGQA 3IN5A 4F4XA 3DRRA 3KLIB 5L9XA 4QPXA 3ITHA 4F4WA 3KK3A 3GV7B 5L1LA 2ALZA 4TN2A 3QGIA 2ASJA 3DLGB 1T3NA 2FLLA 2R8HA 1QUVA 2J6SA 4K4ZA 1BQMA 1IKWB 3OLBA 5HBMA 4ZHRA 4QWAA 1XR7A 4ED7A 3QO9B 1FKPB 3DI6B 3DLKB 3ISNC 1XR5A 1W25A 3DDKA 3MECA 1SV5B 3G6YA 2RDJA 3MFIA 3BQ1A 2UVWA 4NLDA 4WZQA 1HPZB 1N6QA 5HP1A 3C6TA 2I1RA 5KFTA 4RZRA 4DG1B 4PWDB 4NLPA 1HMVB 3T1AA 1D0EA 4Y2CA 4DL6A 1S1VB 3EPGA 5J2NA 2ZE2A 3DLEA 2YNFA 1UWBB 1N48A 1OS5A 4XPEA 2UVUA 5DGBA 3NBPA 4LSLB 2AU0A 3IS9A 4IFYA 2D3UA 1LWCA 1RT5A 3MEGA 1S9GA 4J9SA 3Q8QB 1MU2A 1C1BA 3RBEA 3LAMA 2ZKUA 4RW6A 1RT2B 2ASDA 5KFHA 2HNDB 2JC0A
chains in the Genus database with same CATH superfamily
3TWZA 1IM6A 2BBEA 3MPWA 4NEZA 3TR5A 4OI3A 2FY1A 1QJHA 2ZDPA 1SB6A 4ETXA 4UZBA 3OUYB 4B3SF 2IAJB 4FYXB 4FBUA 1PC5A 3M8QB 1HMVA 4OX8A 1K47A 2PMWA 4YHHF 3RBXA 3LGNA 3CDAA 1N52B 1X7VA 5ETTA 1SL1A 1RKIA 1Z1ZA 3OW2R 1SJ4P 1UFLA 5HL7Q 5CYQA 2IJNA 3SYZA 1R27B 2JEGA 3M8QA 4ED1A 2LA6A 4EZ6A 3ETOA 2GHWA 3IP0A 2OSRA 3KMQA 2ZH6A 4LBHA 3B54A 4WK3A 1EX8A 3W5XA 1ZPVA 1RT6B 3PCOB 1M5HA 4DZDA 2CJXB 1N4LA 1NJXA 4DV5F 4E8UA 1RBOB 1R3NA 3PKMA 2M0GB 1KP6A 1NHVA 2E1RA 1RHUB 1U1MA 4DF4A 4USTA 3PO4A 2XYPB 1VC5A 3HFVA 2YNHA 1RT6A 1RAFB 1RHRB 4WTOB 3KJQB 2WK4A 1V3ZA 2QA2A 2CJQA 4LFBJ 3ZTPA 2L3MA 1FRHA 5H9EJ 4UQGA 4ELVA 1R8AA 1QE1B 5L46A 1FFGB 2BJDA 4ZLJA 2X1FA 1I1GA 1Y11A 4ECYA 2K3KA 3Q8PB 3TP2A 2OEKA 4FF4A 1KOOA 1Y5LB 1HI8A 1QM9A 4WP9A 3RB0A 2KHCA 3E8OA 3W2WB 2DH8A 2QLJB 3O8WA 4ZDNA 1IWAA 5HLFB 2R2SA 1VJQA 3W65A 5GMEA 1KQGB 1AUDA 3AJ2A 5EDWA 1WHVA 3BR9A 4C8KA 3JTPA 2OJ3A 3J80U 1F5AA 3R1LA 2DNQA 2HK2A 2XMVA 3OXGA 4LREA 2HHUA 2QO3A 4PWUA 3VAMA 3W2WA 5F8LA 2PMZD 2KHDA 5HLFA 3BPDA 4EYHB 2A10A 1WF2A 1QAIA 3KNGA 5A8KB 3Q23A 2VIHA 3UPFA 1O0PA 1WD6A 1QAXA 1BXNA 2CFXA 5ETQA 3TEHB 1IBCB 2DR5A 3NCRA 1VISA 1WC5A 1DTQA 4NZ6A 2AJFE 3FCHA 3W9JA 1WWHA 1XMOJ 1FJEB 1QUPA 3IGVA 3CVKA 3LW5C 2W4DA 4F2SA 1T9UA 3H90A 3BGRA 3QZ8A 1H3DA 1KVKA 2I6WA 2CYYA 3SFUA 2JSXA 2PFFB 1V5VA 1R0BG 2CPIA 1TUGB 4M5HA 5E41A 2ATLA 3BBFA 5L1KA 3C46A 1D9FA 3FZBA 3FKBA 2HFUA 4NCAA 2BV3A 5KFRA 4CLUA 2Y1IA 2R7QA 3FCVA 5ITHA 1SJ3P 3OR1B 4IG0B 4LRCA 3PRDA 2RVJA 5KFSA 3BKUA 4RW9B 4ERDA 6AT1B 4USUA 4L6V3 1U1RA 3PRVA 4DR5J 1EZZB 4F3OA 2QZ8A 3OR1A 3KK3B 4DFKA 1XBWA 3GLJA 4ZCMA 4M5KA 3H4BA 1URRA 2XHWA 2GJIA 1S6OA 3HZGA 3Q22A 1U4BA 4RW9A 4B3SJ 4USVA 2G2OA 2YX4A 5ETKA 1MU2B 3CC7S 4YHHJ 4NLTA 1NKBA 3W7BA 2IMOA 1PIEA 4F4WA 4JI0F 4C48A 4L3KA 3KK3A 2ASJA 4QYRA 4FNHA 2QEXS 1D09B 3HO1A 3ULHA 4ED7A 3BQ1A 3QAEA 1N33F 4RZRA 4IQMA 3KG4A 4LMZA 4KR0B 3QBCA 1Q78A 2W7AA 3Q8QB 1MU2A 4DN0A 2C3UA 2LQ8A 5CYMB 2VQEF 1SH0A 1S4EA 4USIA 3NP5A 5IQ6A 2YKPA 1F60B 2YH0A 5EUHA 5KG5A 3ZO7A 1SC3B 1UKUA 1FF2A 4D3GA 3KUGA 2XY5A 4DV5J 3DM2B 5CYMA 4Y2MA 2L41A 4O3OA 5EHHA 3Q8UA 5HJXA 5AE1A 4P10A 1VIOA 2QA4S 3E3XA 3UD5A 1VQ6S 4FVMA 1C0TB 2XM3A 4TXSA 5B0DA 3CMAS 1S10A 2NPFA 3DM2A 4S0MA 3B4MA 3NGTA 4DL0C 5KFVA 3CIZA 3M6UA 2ZH1A 4XPCA 4YN3B 4YQWA 1KOHA 2CNOB 5KFUA 1C0TA 4WE1B 4G1QB 2B7BB 2BJ7A 3GTYX 4B3MF 4U7UK 1KLMB 1H2VZ 1XNRF 4NXNF 3W62A 4WE1A 1M0SA 4KJIA 3MAAB 3EX7B 4WXWA 4G1QA 1X4DA 5AT1B 5DLFA 2AJ1A 3NRBA 1JLQB 1SKUB 4PG6A 3FC9A 4Y3CA 2VD3A 1WG5A 1U47A 1U1QA 2R7VA 2E5JA 4EO6A 1KLMA 4QIWD 4F4KA 2DHGA 2ZHOA 4PG8A 3MAAA 2V2VA 3D67A 4MK9A 1JIHA 1HWUA 4DSEA 2XSJB 3K5OA 4IRDA 4KKOB 3GYXB 3GIJA 2EFNA 1RACB 1VQKS 3RUBL 3PIOQ 2QA1A 2HFSA 1TKTB 3CT9A 4M5NA 1TK0A 2NSCA 3SCKE 1Y4ZB 1YI2S 2WW8A 2R4FA 1TKXB 5LT5A 4BLGA 1NK0A 3QRQA 4H4KC 2LXUA 3DHWC 3EGZA 5C5JA 1TKTA 1WC0A 2ZE2B 2WRMA 5DM6Q 1JNRB 1WEXA 2B4OA 1FNXH 2VC0A 1TKXA 4KGXB 3A1YG 4ZVFA 4YY3F 2IM2A 4X66F 3CCLS 4JI1F 3D6MB 3JSYA 1MN7A 5LSLA 3V4MA 2J6UA 4ED2A 1IR0A 4YB5A 4HTIA 2E1PA 4LBPA 3DKDA 3JB9k 5CABA 3BB5A 3OTCA 5KAKA 4ILLA 3K8WA 4QOTA 4KFBA 3LO3A 1OSCA 3LWLA 2FPHX 2R7WA 2AF6A 1RHMB 2GQCA 5KFYA 3MMCB 2DNPA 3PYFA 4JI0J 4LRFA 3QAUA 2UUTA 2BA9A 4PR6A 4KBIA 4AQYF 3TJAA 2N3LA 3WBZA 2X3DA 4OZJA 1HWLA 2VG7A 4B9MA 1JQGA 2I38A 1S4FA 4FKYA 4ZIVA 4LVOP 4M1KA 2VQEJ 6FDRA 5HBMB 5GAHI 3OFGA 1HARA 1UVLA 4RUHA 4FYWB 3M30A 4W92B 4M5LA 1X4HA 4DV1F 3V6KA 5DDOC 2P5VA 1PBAA 2CQIA 3G96A 2Y0SD 4J5OA 2W9AA 3TANA 5L1LA 2R8HA 3HSGA 5H1SV 3K5MA 5HBMA 3OBIA 1B0TA 3THVA 2DNGA 4QR1A 3BS9A 4A8YA 2QMXA 2CWXA 9RUBA 2Z2LA 2HIQA 2J76E 2ZBRA 2VKRA 3QMQA 4ZVHA 4AXJA 1BQXA 2MMYA 3BQ2A 2DIUA 2HQIA 2MKCA 5IC4B 2YQ1A 2HPUA 3ICLA 3HP6A 3VAGA 4KV8A 4TY8A 2EWHA 2E9TA 4EBEA 2BQRA 3KYLA 3OTDA 2CKWA 2CUYA 1D8ZA 3IRWP 1PJ6A 4KH1B 2GNKA 4F8RA 4LR7A 3V6JA 3UNYA 2AEFA 5GAEI 1VBYA 4X4QA 3UE2A 4EWTA 1CEZA 3H0PA 5CCLA 4B3MJ 2HURA 3DLHA 1XNRJ 4X62F 1RWPB 2ZWPA 1N34F 4BS2A 1HD1A 1KD1T 1D3WA 5IWAF 2CZ9A 2EKNA 2R7RA 2QLFB 4QPTA 1FNOA 1TVRA 4FPIA 4HKQA 3I55S 3VGUA 3ENAA 2HK3A 1OIAA 3C6UB 5KOXA 4WKRA 4HHJA 1M5VC 3R27A 5J2QA 4CH0S 2VBZA 1IKVB 1NAQA 2G0JA 3EVOA 2E5LF 4BHQA 3MMAB 1QDUB 1YRTA 2KVQE 5KT4A 1Q8LA 2Z30B 4HEA9 4C8MA 3G8SA 2YX1A 2Q79A 3C6UA 2HBZB 3X1LB 4OYWA 3ZTOA 2B4VA 3EZOA 3CDUA 1MWZA 1TMJA 1FRIA 3ISND 4NCGB 2CQDA 4F36A 4J9NA 1IKVA 3UI3A 2VBWA 2QA4G 2OFGX 3VR1A 2QC3A 4EMDA 2YKAA 1N5VA 1I5OB 3W5YA 1TL7B 3VAFA 2RUGA 3JSRA 1N0UA 1NB2A 3VZIA 1Z2LA 4ZVSB 1PBUA 3BGFA 3MUMP 2CJYB 2HW3A 4F3QA 3PTWA 2JH3A 2OFHX 2HAFA 3DLJA 2V8DA 5D0GA 4CO4A 4YY3J 4YEAA 2VICA 2LA4A 4JI6F 3OVSA 5LSRA 4NRTA 2VJUA 4JI1J 2JJ4D 3J7Z5 1TL7A 3CO9A 2W01A 5E3RA 2UXBF 5I3UB 2H4WB 3RG6A 3VAIA 5DDRC 1FTRA 2G0CA 5E3CA 4EEYA 3FQLA 4WP8A 2YKOA 3UDLA 4DQQA 1VQNS 2IIHA 2GQQA 1RK8A 4M5IA 3CCES 5DLGA 2DGVA 1HNIA 5I3UA 3AXKA 2EFQA 4AL6A 1IQZA 1UVJA 3EXYA 2FZKB 2F3JA 5HQLA 1TFYA 4AQYJ 1ICEB 2MKSA 3K58A 1TQLA 2QG9B 9ATCB 3KLFB 2VB6A 3H5YA 2NXEA 1AFIA 4QYZK 1BQNA 4TY9A 3QRRA 2CJBA 3RAMA 1TU0B 4ZKAA 3LP0B 4I7FB 4DS5A 2J9DA 2OH2A 2Z8QA 3TVYA 2YKQA 4DS4A 4DV1J 2CRLA 3A12A 3SCLE 2JX2A 3WX4A 3ZZTA 3KLFA 4R5PB 4W4MA 3R5CA 3BKTA 3NLCA 3PZPA 2Q6BA 2W9BB 2VFUA 2CJAA 3Q8RB 1FNMA 1R8CA 4P73A 3M05A 3LP0A 2HAIA 1A9NB 1SPBP 1WDTA 1P27B 1CJTB 1KWMA 4H4OB 4A8WA 2R7SA 3VGVA 3UO0A 4R5PA 1Y10A 1R31A 2MZSA 1U0HB 3J7YI 1TUVA 3CCWA 1NLKL 4O23A 4DEZA 3EJMA 2CDRB 4P2SA 3NNCA 3K59A 2YNFB 3W8GA 1CJTA 4HLBA 4TLQA 2GO9A 4P74A 3MZIA 1WC1A 1T3NA 2J6SA 4A8MP 3JS9A 3CCRS 1VQPS 1NMEB 5F3ZA 1HWKA 2VPXB 4NLDA 2Z2ZA 2KFNA 4CLLA 1Q81T 2YNFA 1UWBB 1OS5A 1FRKA 1MMNA 3ILJA 4OI1A 1FRJA 4J9SA 1G1XA 4UT4A 4IFVA 4X62J 1N34J 3GU0A 1EAYC 5IWAJ 5KG2A 3M8RA 1JLFB 1VLYA 2ZOFA 2HEKA 3CJ3A 4P72A 4WK1A 2IHR1 5BXIA 1S6PB 4X4OA 5K8NA 2XLIA 1N36F 1UWBA 4CTAB 1RT3A 3U1NA 2VFTA 4RW4B 1RUSA 3BKFA 2BVZA 1H0HB 2OPSB 2KYXA 1JLFA 5DDPC 1GNKA 1S49A 2RMLA 3KHGA 2V4RA 2E5LJ 4KPCA 1S6PA 1LQ9A 4FS1A 4WFNQ 4OZ5A 4CTAA 2FJXA 5DQHA 4RW4A 1MLAA 4B3TF 3PXGa 1UWAA 5BJRA 3CC2S 3J7AN 4KT0C 2OPSA 1OPZA 5KFWA 2ILZA 4DUZF 2FHJD 1UVKA 1NUEA 2KB2A 5KG6A 4G6VB 4P71A 1SH3A 5D4LA 3JYTB 2IFXA 1HW9A 4NL5A 4NXMF 1TFWA 4IDKA 4WFAQ 4CLZA 1FRMA 3M8ZA 1DTTB 2ZVSA 2JNJA 3B8HA 2FUG9 2HHTA 1FESA 4JI6J 3IM8A 4NLYA 2V6AA 1U49A 2OI2A 1OYDA 1S99A 3G8QA 1U2FA 4QIGA 1RT4A 3JYTA 3TA2A 3D6FB 2DNNA 4BBYA 3SCJE 1F5CA 3MCNA 5G0RA 2NXUA 2UXBJ 1L3VA 1LW2B 5GADU 1S6QB 1DTTA 1X60A 2PE8A 5DJBA 1Q7LB 3FSIA 5HQMA 4FN5A 4ECVA 4CNZA 1B7FA 4CLPA 1DBDA 5A76A 1R7IA 1RBLA 4GMKA 4PWWA 4R8UB 2B43A 4GVLA 3OHAA 1TL4A 4U8VA 1RCOB 2WZ1A 2OPPB 1XWLA 4KYZA 3BGLA 4N56A 4ZITA 1YZ6A 1LW2A 3QWPA 5E2QA 3RU0A 1S6QA 3UFCX 4C8OA 3HKZD 4HH0A 2HBQB 3EGNA 5IC6B 3MPVA 3IMQJ 3PW4A 1UZHA 2IDEA 4R8UA 1FKOB 2BE7D 2RHSB 1RA7A 1D9DA 5C7PA 3FDSA 4BCAA 3N6LA 1VQ8S 2OPPA 2M9KA 3R2DJ 3T5HA 3CC4S 1BY9A 3MR7A 3QYYA 3AA8A 1DQAA 1FKOA 1HBUB 2E5HA 3A3OB 4J9MA 2HRUA 1U1PA 1RAAB 2F9JA 3K0JA 3N0VA 1IJFB 3HVWA 2CG8A 1PYOB 1RTDB 1YIJS 4OI0A 4GKKF 3FNNA 1SJQA 2KFYA 4U67Q 1LWFB 4RWXA 4IYQA 1RTHB 1HBMB 1ZOTA 1UA0A 3KG1A 1NK5A 4DZ6A 1RTDA 3TUIC 1W7WA 4QIVA 2V2ZA 1UJ5A 1KBRA 2R2UA 4I6YA 2VFSA 2CPHA 3KLEB 1KVJA 1F0XA 2UU9F 3CNQP 3CCVS 1RTHA 1LXNA 2BOAA 3DGPB 1HBMA 4OHZA 1BHNA 1YX2A 4I0WA 2NUHA 4C8YA 5M2RA 2W2QP 2L08A 1Q0NA 5ETSA 2V8HA 3D4JA 1YBTA 3KLEA 4NLWA 5IFMA 2J7WA 4MH8A 1BD6A 5E5NA 2KI2A 4KO0A 5J2PB 1T9XA 2IVFB 3DGPA 4KRWA 4GVBB 3MDFA 4YP3A 4NLGA 2AYGA 4B9UA 3NAIA 3D6HB 3SCIE 2D3ZA 4EK2A 3MEGB 3BDEA 3GE9A 1N36J 4RW6B 1LXJA 3IN5A 5CZXA 2P8IA 3W9HA 4K4ZA 1KQSR 2N7CA 1GK8A 3QO9B 3ISNC 4GVBA 1HPZB 2QLXA 4P75A 2BJ8A 1N48A 3MEGA 3RBEA 2LXIA 4RW6A 4WZMA 4DUTA 3NGUA 5KFHA 4B3TJ 2OUGA 1Y5NB 3UD4P 5AXLA 5E33A 5G4DA 1B3TA 2CAJA 5L1JA 5AE2A 3QO9A 4V1Ak 2QTWA 1HPZA 1REGX 4X65J 3LP1B 1RWVB 3PV8A 5LXYA 4IQXA 1FDBA 4BC9A 2NQPA 1J5OA 3ZC4A 4WFXA 1RAOA 3KUHA 1HW8A 1OY8A 2F9DA 5F8GA 2YVSA 1FJ7A 4DMZA 3G6VA 3MUTP 4RWWA 3MEEB 2ROGA 4KB7A 5M2UA 3LP1A 3DDIA 2N82B 4JUZA 3M9NB 5IT0A 2QSFA 2PEHA 1IR1A 5L38A 2A6MA 3MI7X 4EO8A 2FJWA 4URQU 3P8BB 3PG9A 1NDLA 1IBMJ 3D0HE 3HVTB 3UNGC 4U96A 3KOAA 5DQGA 3NS7B 3Q24A 5F8HA 3OSPA 5E0OA 3U02A 5D3GB 2DHHA 4ER8A 4FXDA 5IM0B 1VMBA 1VQ5S 2KXNB 2ZH8A 4TLRA 2IVYA 1Y0HA 2ZBIA 2LQBA 1Q7YT 3HVTA 3MD3A 4BC7A 2JDJA 1YVFA 2IVMA 1CJKA 4H4MA 3C66A 1FX2A 1WACA 3VCDA 3DLGA 3HI9A 2EBGA 2CPEA 2BM1A 3G4SS 5BYRA 4RNFA 2NSBA 3OVAA 5KFXA 4KE5A 2YWGA 1R8HA 1QSLA 7FDRA 2DNLA 4ES1A 1R0CB 2DPJA 1M1HA 1B64A 1FERA 1J5EJ 1S1TA 5LMUF 2HLTA 1AA1B 4P7VA 1UEVA 3MXHP 1TL3B 3NY0A 2LECA 2UUAJ 4HHUA 3NNHA 3M8WA 4GKKJ 2VG6B 1TL5A 3TZXA 1ZM3A 3AT1B 4LF8F 2AGOA 3TZZA 1WKLA 4HT7A 3V6DB 2ZHBA 4ED8A 2LQJA 3KKFA 5BR8F 2O1PA 4YOEA 4E0DA 4FKXA 1TL3A 1MROA 4A48A 1ZETA 1ZZNA 2VG6A 2R8KA 3E2EA 3FSYA 4MKBA 4E98A 3LPEA 1M5OC 3IS9B 2DYAA 3PW0A 4TYAA 3S6EA 2UU9J 4TKTA 1FCAA 1X4FA 3MPDA 4DV3F 3C19A 4IO9Q 4DX5A 2RDDA 2KO1A 4JYAF 5K20B 4EU0A 2DNYA 3V6HA 2UP1A 2OEMA 1RWNB 2FHKA 3BJYA 1ROFA 1GMWD 3I9V9 4OI4A 4TQRA 1NEEA 1CPZA 1WOSA 2KTQA 5HO4A 2AWZA 4A47A 2F4FA 2KXFA 3U27A 1OY9A 4DLGA 3M2RA 1SL2A 4Q5VA 3C16B 2IM1A 2AEMA 4WBFA 4EBCA 3I82A 4Y6IA 3OTBA 3BV8A 1HQEB 5B0CA 4RPFA 4QU7A 3R8YA 3EGVA 4O3PA 1WI6A 2MKKA 1X0PA 4RW8A 1EKSA 3C16A 2V2KA 4KHPF 1RHJB 3G2XA 5SUHA 3DRSA 3DFEA 1VQ9S 2FTRA 1HQEA 3L95X 3C6TB 1JK9B 1RWWB 3HD2A 1DQ9A 3SZ2A 3M2UB 4PPDA 3MAHA 1L3UA 1NCLA 3B78A 3IFEA 2HVDA 3ITHA 1H6KX 3RZAA 2FGOA 2A0FB 2W4CA 2ZH4A 2B9EA 1FKPB 1UJ6A 3MECA 5HP1A 3C6TA 2E7WA 1UEKA 3RR7A 4DG1B 1D0EA 1S1VB 2ZOMA 3FVYA 4F0HA 4F4AA 1E6YB 4RL1A 3M2UA 5MAOA 2EFOA 4UUXA 2P6SA 2HNDB 2XCPA 1KQFB 4AFFA 2FLNA 2IRUA 1YSJA 1CBKA 3M9MB 3T1YF 5HMWA 1YJ9S 2Z0GA 1LW0A 1U25A 1FKPA 4X4RA 3GJTB 2WW4A 1A6LA 2HNYB 4CLWA 3HLUA 1S1VA 1E6YA 4Q8EA 3DU5A 2NZCA 4KHRA 2K7KA 2Q6CA 1FHTA 1SC4B 1PCAA 4WIIA 4ECXA 3T5JA 1TKDA 3NMAA 1HA1A 4DV7F 3MR2A 1PYTA 2QFJA 1JX4A 1NM2A 4KGKA 5IQQA 4WKYA 2DO4A 2M7SA 4DOZA 1RYSA 2MZ1A 2RDIA 5LJ3Y 4X4TA 1EP4A 2YPZA 4DCOB 2BJEA 1HHQA 2VA3A 2ATCB 2D1CA 4WJBA 5H9FK 3PX4A 4O3QA 5A8WA 1YJRA 3OTOF 1KHVA 4Y0FA 3CMES 2BANB 2AJQA 1PJ5A 4Z2XA 3ZFVA 1WTBA 3EYZA 5LMUJ 2V94A 2EG2A 4DSFA 3CWJA 2AHOB 4J90A 3UDEA 3AJDA 4ZPBA 4CO0A 3KTQA 5HMYA 2LEAA 2EPIA 2BANA 1U24A 2C3PA 4M94A 1Z2ZA 1FEHA 1SBRA 4PUOB 4KY3A 1T02A 4HTJA 4PPZA 3PFOA 5BR8J 5C24B 3A13A 3FEYB 3IWXA 2HS0A 1WHXA 1M90T 3DNCA 1RT2A 4WWSA 2Z4PA 3VF0B 3QPIA 1H72C 4ES2A 3PW7A 4J9PA 1BUXA 1X4CA 4ZVOB 3GG0A 3P45B 2GJ2A 2XHCA 3Q8VA 4ID5B 3LWMA 2IM0A 5E3AA 2A6OA 1IWGA 3N5BA 1S9EB 1SC1B 4LF6F 4QWBA 1RE1B 4QJVA 4WU3A 4ECTA 2CADA 4CH1A 3I32A 2W9CA 1TUWA 3K5NA 4ZCIA 3BN4A 4OHWA 3N6MA 2IC3B 1UW4A 2MGZB 4V19X 2H51B 2F40A 1T0TV 1RT1A 2HHHF 1TK8A 3POTA 4CO5A 3NAHA 2HZVA 4LSNB 5J2NB 1IJEB 2ROPA 3G87A 1NBEB 4L3NA 2A2DA 3SIPB 3A8KA 2IC3A 1A0OB 1CULB 3TVZA 1O6XA 3PO5A 4O44B 5KFOA 4WFZA 3I4HX 4N76A 2HVIA 4B3OB 1OY6A 3O5TB 3KK1B 4OYOA 1WKKA 3HMJG 1N32F 4RNNA 4LSNA 1T3OA 2MZJA 2B6AB 5D0EA 3L7OA 4KC5A 4RO0A 3G6XA 4K7QA 4RX6A 5I4MA 3BSOA 1CULA 3CXCR 4DV4F 1GX5A 1NJZA 4KHPJ 2HBRB 4C6AA 3CJKB 8RUCA 1Q79A 1VK8A 4ILMA 4X4UA 3KK1A 5I3PA 2KYZA 3FK4A 4NLOA 5HK4A 4A8OA 2IBOA 2IY5B 2V67A 3T6JA 2HQDA 2B6AA 3HHNB 1EQMA 1FE4A 4JV2A 3VAJA 2J0QD 3CJKA 3CD6S 5A6WA 1YG0A 3TJ9A 3P6YC 4NLVA 2YWKA 2KN4A 3K8VA 2YNIB 2UXDF 3H59A 1KN6A 4J9RA 3T1YJ 2MPUA 4DCJB 2BW2A 4DV0F 2AX0A 3CJRA 3AY0A 1G7CB 4CT9A 2P6TA 4I64A 4ZP8A 1WHWA 1FDAA 1S7HA 2DRDA 5KOWA 4V19J 2DNZA 4LBIA 3QGIA 5AXNA 2GGPB 4J9VA 5DM7Q 1HL6A 1APSA 3C3LA 2XBPA 2G2YA 4C3MA 1W25A 3T9ZA 4DV7J 2AMCB 3C15B 2PSZA 1AT1B 4XDCA 3EPGA 3IXQA 1M5KC 4XPEA 2XZDB 2UVUA 2D9PA 1FD2A 1Q95G 1WEZA 3QNWB 3CO0P 3HF5A 2GGPA 3GILA 4DPUA 2DJWA 1SQFA 3NEKA 4XTTA 3GJRB 4MKVA 4P7TA 2WCXA 2MKIA 1NH8A 2IYGA 3C15A 2KVIA 3G82B 4DR7F 5KFQA 2ZHAA 1SKSA 1VQSA 3OTOJ 2YTCA 4C2MA 3GIMA 3GCXP 2ALYB 4M8LA 1YITS 2E1AA 4FXVA 2FB0A 4A8SA 4ZIWA 3MR3A 4CO3A 3GZ7A 4O4RA 1RTZA 2YNGB 4Q7AA 5ETNA 1N56A 4DUYF 3LGMA 3HHLD 3DOMB 2EK6A 2FLPA 5K14B 5JUMA 1RADB 1WOOA 4ECSA 4NYOA 2W2MP 2C2MB 2G1HA 3AD7C 3D54A 1KC8T 2ZH3A 3V81B 3AAWB 2PN6A 2D41A 5EGYA 3EMTA 2JLFA 2LEPA 3DOMA 1QSSA 4ALZA 3G8TA 2NREA 1X4EA 3BSAA 2VG5B 4B9LA 1TAUA 3Q89A 2BMBA 3HK2A 4NI2B 2QL7B 3GP9A 2W2PP 1EIYB 1YK9A 2Y3YA 3GIIA 1Q82T 4LF6J 4DWIA 1J2VA 1WDDA 2Z58B 3ZZOA 4P2FA 4DQRA 3G9CA 2QYCA 1HBOA 3HXMA 2RRAA 1KFSA 2I9SA 3I4PA 3W66A 2MZTA 2GIQA 1FE0A 3SQOP 2VG5A 1FJGF 3ETMA 3PEJA 3LALA 4NI2A 1MMLA 2HHHJ 3CD7A 2SXLA 2P9GA 4U95A 3SV4A 3EE3A 4UUWA 3ZZUA 4YR0A 1ZM4A 4ZVGA 3MR5A 3MD1A 3CUNA 2OLWA 2GS8A 3HVRA 5FLXY 4EFAC 2NYIA 3TEGA 1Y5IB 1ZZFA 1IKXB 3KLHB 3CB4A 4I1TA 2DGQA 4IOBA 1N32J 2XWXA 1NSKL 1TV6B 1NXIA 4DSKA 5J1EA 2DXEA 3F44A 1H2UX 2N4CA 3Q2SC 5KG1A 2MKYA 3KJVB 4U7UD 4JI2F 2XY6A 5D4NA 2CA9A 1IKXA 3US5A 4L75A 4ED4A 4DSJA 1LWXA 3D28A 1S79A 2BRLA 2B9XA 5A2QU 3M9OB 2RQCA 4WF9Q 2BZ2A 1DJ0A 4Z37A 4DLEA 3KJVA 1H73A 1WC3A 4C7QA 4Y28C 2D7SA 4NLXA 4KPYA 1C4CA 3NCPA 4Q2MA 1CS4B 5HQ8A 1OJ4A 3KNAA 2ZZMA 4JV1A 1ZS6A 1T9YA 2UXDJ 2V8GA 4DV0J 5CYQB 4MMOA 3LOUA 2XMUA 5CAAA 3MURP 4CLFA 3W63A 4JI8F 2FJVA 1KTVA 2IDLA 1CS4A 4K4WA 4MAKA 1IXKA 1D9AA 2FQQB 1WNEA 2FVCA 2C22A 2WVBA 2LU2A 4Y65A 3K7RA 4RU9A 1R43A 1JLBB 2BKNA 3GFXA 4NMXA 4JI5J 1S59A 2V4QA 3S01A 3HHDA 5RUBA 1BQMB 4I4BA 2HFVA 4BWMA 1JJ4A 1CVJA 4FXWA 2LP4A 3H40A 2LEBA 1JLBA 2YNHB 1RWMB 4DXLA 2DH9A 3C2PA 2XG8A 4DR7J 2MTLA 4YDXA 1QUVA 4YFUA 1BQMA 1NB7A 1HWJA 3TUJC 1VIXA 2HS3A 4N8OA 2VKZG 2OIHA 2WAQD 3P4UB 2LMIA 2EG1A 2UUBF 2J0XA 2BEFA 3LAMA 1VC6A 2ASDA 4WXOA 4X64F 1M1GA 1VQOS 1NU4A 1MSWD 5A0YB 7FD1A 4HL9A 2BQ3A 4TVAB 3CSKA 2F63A 4Y34A 1RDRA 3E51A 2HFZA 1JXLA 4NLRA 4MFBB 2YWWA 3X3UA 4ZP9A 3MFHA 5HN0A 5A0YA 3BH6B 1R6VA 2XEXA 5GAHU 2HSEB 4DPTA 4LF5F 3WX8A 4CI0B 4OZ1A 3I0RB 3JXOA 4J91A 2KJVA 1SVDA 1I3OB 1HWIA 2BDPA 4RNMA 2ZM6F 1HI0P 1QTMA 1B4SA 3IM9A 4MFBA 1PSDA 2GVDB 4DR6F 5KFAA 1DTQB 1U1KA 5F3TA 1CLFA 3MGJA 1FJGJ 5F8MA 3MM7B 3I0RA 2K1RB 4L72B 3F0NA 4A8XA 5DG7A 3GONA 3BGRB 1NZAA 2GVDA 3MHYA 5CQGA 1R0AA 1SJ1A 2ZC4A 3BSCA 3HD1A 4N7TA 4DR4F 5DZ7A 5KFMA 1UPPA 2HZCA 3MM7A 2K1RA 4DU8A 2FZGB 1KLNA 3W9IA 1S5ZA 2B51A 1VCTA 4F25A 5ETLA 1ZA2B 3I5CA 1X9WA 1S48A 3MM5A 2ZJPQ 2CQ1A 1UVNA 1S0NA 3TNVA 5GAEU 4RNOA 2Q66A 2X1BA 3MCSA 4A8FA 1U09A 1KS2A 1Q8IA 5KFFA 2RNEA 2FY8A 4RW7B 1LWEB 3OFFA 2YXLA 2B56A 3ENQA 2YWEA 1U7LA 1UVMA 3NS5A 2M5YA 3AD8C 3EZ5A 3RB4A 1VRUA 3WZ0A 2W7OA 4J9LA 2HFNA 3H5XA 2AEJA 3L9ZA 3TQEA 2ZWOA 2ADCA 4RW7A 1LWEA 3EZUA 4F0KA 5DQIA 1RI7A 2PO4A 3AQPA 1SL0A 2IMWP 4RJVA 4C8LA 3IR5B 2L9DA 2PIIA 4WU2A 2J7UA 4C3LA 4F0MA 4K2XA 3TJ8A 3LANA 3I9ZA 4CLKA 1JWWA 4ZMMA 3PIPQ 1V6HA 2WBMA 4CIOA 1S9FA 4YMEA 4N5SA 4JI8J 2N3OA 2FYXA 3O44A 3VAKA 2C28A 3CF5Q 2NCKL 2XO7A 2EVZA 2M52A 3N6NA 1JXVA 2HIYA 2HYIB 1X5SA 4UY8T 3A3NB 1F9EB 4OMFG 1QTNB 1HIYA 3MAQA 5B0FA 1HQUB 1H7WA 4HACA 2EXUA 2D74B 5B0EA 3DCAA 1UEUA 3PHTA 3FBBA 2RIJA 1JLGA 1VYAA 3ZZZA 2CQCA 3TZYA 2BJ3A 3A3PB 3VQTA 3OPKA 1Q53A 5KFDA 1HQUA 1WI8A 4CLSA 3DOLB 3BYPA 4ID8A 1QVFR 5B0GA 4ZVPB 5EWFA 3ONQA 1R8BA 3HHLC 4XIUA 4ED3A 2XNRA 2C3YA 4QYZJ 3KHLA 2Y1RI 2RU3A 4C0OC 5BYSA 4R0EA 2KG0A 4F50A 4B3RF 2UUBJ 1NJYA 3UR0A 3H8YA 3CJ0A 5KG7A 2VPYB 5KFNA 2RRNA 4X64J 4ELTA 3DOLA 3RAXA 3CJSA 4I67A 4DQPA 1P9YA 5A6PA 3UVJB 3T6BA 1HNXF 4NMLA 3QRPA 4P2MA 4DV6F 1FT8A 1GXTA 2O66A 4P6QA 2I2YA 5D8HB 3NGRA 2V34A 3NBPB 1NK7A 5B0AA 4L73A 4HYKA 1S9GB 2XNQA 4QPXA 4TN2A 1ZYQA 2W25A 1F5BA 2WVFA 4ES3A 3D3CJ 4KTQA 4N41A 3UVJA 3DI6B 3G6YA 4WZQA 4LF5J 5KFTA 1C4AA 3F73A 1T9WA 2CPJA 2ACYA 1SCJB 5D77A 3NBPA 2HWTA 4C98A 2AYMA 1MNEA 2ZM6J 1S9GA 3ZNUA 4AL5A 2OTJS 5E7OB 2M3DA 1EKRA 1FA0A 3OL8A 4DR6J 1SQEA 3O3LA 3DI6A 3RW6A 1VOMA 3JSMB 3GSDA 1T11A 4F3MA 5FLXU 4ZLLA 3ZTQA 1IVZA 4C3KA 1E6VA 2ZD1A 3VZHA 5KFEA 2FIUA 3GJQB 4ECQA 2C3MA 1LKZA 3J7YU 3JSMA 5THWA 4CQ1A 4D3HA 4M5GA 4ZCLA 1VQMS 1NH7A 2VDIA 3KMSA 1UETA 1EETA 3ZXWA 1Y3JA 2U1AA 1KEKA 4ZPVR 3W2VA 2OP5A 4L76A 2CZ4A 3MOZA 1U2RA 2IA6A 4FNIA 2EFGA 5HROB 1HHTP 3DLLQ 3IAM9 2R7TA 4CYUA 1EJ7L 1JLCB 2XYGB 3BBCA 3D5MA 3HT0A 1YBUA 3MPUB 5GAGI 4LF7F 4WP3A 1S76D 1FVSA 2YX7A 4GO7X 1OYEA 4ED5A 4ECUA 1S1WB 4OV1A 3NNAA 4OJ1A 1U0SA 3R97A 5HROA 4WYLA 2MB0B 2FHJA 4KFBB 2R8GA 1SUQA 1WG1A 4GC7A 2NR0A 3DOKB 1JLCA 3M6VA 3TZWA 2Y8WA 2Q43A 4U6PA 2XO6A 2WHOA 4ENOA 1S1WA 2DHXA 5D78A 5HVGA 1JMTA 3RJMB 3SEOA 3M8PB 4MK7A 1DURA 3F41A 5DG8A 3DOKA 2VG7B 3BDPA 1S1UA 2C2EA 4AL7A 3I31A 2ZBPA 3H20A 1VS3A 4ZPWR 1RLCL 5AXMA 1GT8A 1IR2A 2YQ3A 1KDNA 2OELA 3VAHA 3M8PA 4ZCKA 3B6BA 1UA1A 5LMNF 3M30B 5JVGQ 3H5SA 1N33J 3NCQA 2BX6A 2NYHA 4MYUA 2FVSA 2LDYA 1HR0F 1Q8KA 2HHVA 1SIZA 4RLEA 2ABYA 3W8PA 2J6TA 3OR2B 5AJ3F 2W2OP 2PGCA 2RJZA 3PW2A 3MM9B 3RB3A 1JJCB 5D0RA 1BE4A 1KRPA 3K5PA 3CCMS 4DJBA 2M4MA 3V5RA 2COLA 2X1GA 2EC0A 1WEYA 2HMIA 2V2QA 3CGIA 1U1NA 3PJXA 4N77A 3OR2A 4KIAA 2GFFA 1N8RT 3MM9A 2BE2B 4KV8B 4TY8B 1U02A 3KUEA 3UQSA 2NUUG 1X8DA 5F41A 4B3RJ 2EC2A 1B0VA 4M95A 4PXCA 3JAMY 2QMWA 2GMJA 2E5GA 3A4TA 1M5SA 2XC9A 2V9KA 4UOFA 2CQ2A 4DV6J 5KTQA 2BE2A 2IM3A 1LV5A 3HJVA 2DGOA 2DGUA 2DEIA 5B09A 2ACMA 1CJVB 2R3VA 1YRXA 3AB2B 3DLBA 2LYVA 1MWYA 2R2TA 1CG2A 2BOPA 2HWHA 3O6QA 2W8LA 1DAXA 1TVRB 2JEIA 2KDOA 4ED0A 2ERRA 2RT3A 2OD6A 4LRBA 1N5TA 2B8QA 4XK8C 1YLXA 5IV3A 5KFBA 1CJVA 4ZN3A 1HHSA 4NXNJ 2MYFA 3H2LA 2YWFA 1X9MA 5J2QB 2H54B 1SIWB 4FYVB 2KT3A 3EGWB 5EX0A 2DO0A 3EXCX 1TAQA 2HHXA 3LTOA 5B0BA 4QR0A 2HVZA 2RQ4A 4TU8A 2I0XA 1X4BA 5LXRA 4Q45A 3GIKA 4LT6A 2D3OR 3Q83A 3CCQS 4B02A 2KRRA 4PCQA 1XR7A 2VFRA 3DLKB 5DS7A 4HHHA 3ZZPA 1NO8A 3T1AA 3PACA 1VBXA 3ET6A 2GHVC 2X3GA 3SBMA 3B82A 3NXZA 2ZKUA 2B4UA 3UR3C 1X0FA 5JJBA 4FP9A 3AJ1A 1HBNB 2CVIA 2APOA 2H9ZA 2LQ9A 1Q4RA 1ELOA 4PXBA 4LF4F 3IG1A 3DLKA 4LRDA 3DXSX 1I6JA 5I3QA 2XGQA 2DY9A 3THPA 3I5AA 1YDLA 1XMOF 4HVZA 2AIRB 2C2DA 2CQHA 2IYIA 1HBNA 3C8YA 4RR5A 2PT0A 2DB1A 2ZKTA 4NA1A 1BLUA 4CP5A 2UVRA 4JB8B 4X4PA 2XMTA 2B3TB 2WSFC 5LL6d 2MLYA 2PMHA 1JKHA 1GQEA 2LDIA 3BYRA 4X66J 4KH0B 3LUYA 2G2ZA 3PY8A 2D9OA 4KGMA 1GTEA 2BJ1A 2CVEA 1SKWA 2MKHA 1K44A 4MIAA 1HNIB 3ELHA 1KTQA 2CNNB 4DF8A 2CPXA 2QX0A 4LQ9A 3BZQA 2BW7A 2Z2YB 4CCHA 3L7UA 1T95A 2MDAA 2UZAA 4FF3A 5ETOA 3HSJA 3D66A 1UVIA 5I42A 2VQFF 4YB7A 2J0WA 1BQNB 2KL8A 2QLWA 4YDDB 3M32B 1FWKA 4RUCA 4AE5A 1JJ2R 4NA3A 3LP2A 3KG0A 4GKJF 3ENVA 1VLOA 2Y8YA 3KLIA 1NRKA 5LMNJ 2CJKA 3QT7A 3TYTA 1WC4A 2V8VA 2ZOGA 3D9BA 4ZVUB 3QIPB 3IR7B 1HR0J 3AOCA 1FFSB 3JSBA 4PWDA 2FHMA 3IBCB 5AJ3J 3NMRA 3M32A 1UAWA 4MK8A 5CH7B 4JOUA 1RZMA 3SFGA 5EN1A 4KGZB 2N7YA 1V9OA 5LSOA 3QIPA 3BEGB 3AHPA 1JLEB 3R6LB 3OUYA 2IAJA 2CQ3A 5HATA 4QBUA 3ILOA 3UCUP 2LU1A 2HQGA 4Y2IA 4IRCA 5DGAA 1JLEA 4IKAA 4OQJA 2PDAA 1EB0A 2X51A 3TAQA 3KLGB 3W1YC 5DRKA 3D0GE 2B0GA 2HHPA 5F9LA 1B99A 4ZK7M 1YJUA 1L3TA 4IFVB 1XK8A 3I6PA 4JV0A 1ZTTA 2WBRA 4OZLA 1U6BA 4YB6A 3IGNA 3QIDA 1ZH5A 1RB0A 3KLGA 2ZNZA 5EWGA 4HDGA 2EFVA 4EBDA 1RT3B 3DU6A 1AXQA 4EI2A 3HM9A 3OQ2A 3KWMA 2GMLA 2EK1A 3T41A 1KQKA 4PKDB 2NXCA 2DD8S 4USKA 2MQNA 2JZ5A 3CMQA 1U48A 4MKYA 2M88A 4QW9A 5T14A 4DBQA 1RTIB 2MHNA 4O3RA 2KG1A 1QE1A 2F1FA 3I87A 1S0OA 2ZH5A 4DFPA 2FC8A 3GSIA 2UUWA 1GMWA 3ILIA 3D3BJ 3FJ2A 1DARA 1DFDA 3AB4B 4OJ3A 4JI7F 2OAUA 3VVUA 4PG4A 2MHEA 3VVTA 2WB1D 1RTIA 5KFPA 1T7PA 1FRXA 1WOPA 1FEEA 4K5SA 1T9VA 4QWEA 1GX6A 4OHXA 3N79A 4U8YA 2J8AA 1RWUA 4IDKB 3FBCA 2V0NA 4LF4J 3JTNA 2VA2A 1EHWA 1N6QB 2M2BA 3MTJA 2DNKA 3BO2A 2K3IA 5AE3A 3N5FA 4NPOA 1TK5A 3WQPA 2E44A 2E9ZA 2R8JA 3FSXA 2BACA 1RT4B 3HT3A 3QJJA 5A8KA 2FJAB 1WC6A 5G0RB 1BGXT 2AJ0A 4OHVA 3DDNA 1CC8A 4LF2A 1S57A 1N6QA 2I1RA 1WELA 4NLPA 1HNWF 4OIXA 2WVDA 2FZCB 1FDNA 4I69A 3TUZC 2AU0A 2ZBCA 5B08A 2DY1A 1OMSA 2O67A 3OFHA 5IV4A 4UTGA 4N8NA 2JC0A 2DGSA 2HS4A 5J1NA 1ZAVA 1FJCA 1J27A 1XNQF 4ANCA 4F4YA 1NPRA 3RGIA 1XR6A 1UJ4A 3WC2A 4YR2A 4ZJQA 1AB8A 1OO0B 4TU9A 5LOQA 2RKIB 2ZZNA 4TQSA 4B17A 2R42A 4W90B 2KKHA 3QLHB 2AJ4A 2GHPA 3HHKA 1AYEA 3O1LA 1C1CB 1UL3A 3PFEA 1RAGB 2XTJP 1YRUA 1O5JA 2B7CB 2XI3A 4B9TA 2VQFJ 2XS2A 2R8IA 4NE9C 1F6TA 4DFJA 2YWHA 3TW0A 3BPSP 3R5GA 2UVVA 2O5DA 2RKIA 5KT6A 4GKJJ 4K4XA 3QLHA 4DX7A 1F3FA 2LCWA 1T8EA 1C1CA 4G65A 4OX9F 4Z7YA 5IXUA 2ZH9A 4IG0A 4FBTA 3CEDA 2I8EA 3NGDA 2F65A 3GCWP 1GTHA 2RB7A 3IO1A 4CLYA 2BE9B 3TO8A 2CPZA 5FIIA 2K8GA 1S77D 4ZVEA 2YBVA 2CNLB 4MJKA 4FDFA 2H65B 2DH7A 2B9WA 1WG4A 5CXTA 2VF3A 3FEXB 2XQCA 2HGLA 5KT5A 3M8YA 5IS2A 2MZRA 3JAMU 4ANEA 3KJFB 2HG4A 5KG4A 1KNZA 4ZS6A 2R9LA 5H9FJ 4K5RA 2OHDA 2LFVA 1JJHA 3BM7A 3E01B 4YR3A 2KRBA 4MIWA 3V2UC 2MZQA 5F8NA 2OPQB 4DPXA 3HZEA 2BRKA 1S7IA 2H5JB 4OLOA 3TX8A 4NASA 4RUAA 2DGWA 4LRAA 2WVCA 4CO1A 4C8ZA 2CQPA 1S12A 2ZJQQ 2V9WA 3BGUA 2VBYA 4ZOSA 1YKWA 4KO0B 4ZN1A 3DRYA 3ZZ0A 3E01A 3NL0A 4ZVTB 2ROEA 3H25A 4UZCA 3ZZYA 2OPQA 2L9NA 4LF9F 3GB0A 3THTA 3D1OA 4NYZA 5ADZA 1U6FA 4QIFA 3CJ5A 3FEZA 1F2GA 4M5JA 3FFIB 4NEYA 2HZAA 4LR8A 4MTPA 3DHXA 1Y7PA 4CNYA 1RTJB 1RHQB 4G1PA 4KSEB 4DPYA 1GMUA 1JLAB 5T7LB 2O01C 2CNKB 1RLDA 2AZ3A 2MKJA 4Q44A 3FFIA 2CZVC 1VRTB 1N88A 2CWKA 3CJTA 1T03B 2AD9A 4JI7J 2G13A 4PAAA 3WIVA 5CHCB 1VQ7S 1RTJA 1JLAA 2NZ4A 5T7LA 3R3TA 1TL1B 2ZZTA 3OL9A 2HQ3A 2JL9A 4ETZA 3IC1A 2DTJA 3GR0A 1J5OB 1G4CA 2DCLA 1BMQB 1TTHB 1TR0A 1F9HA 1VRTA 4ATNA 3DGVA 3S1TA 1T03A 4DL7A 3G6ES 4DUZJ 2OEJA 2JEJA 4PRFA 1MWQA 1TL1A 1QLNA 1AZSB 4TNOA 2XS5A 1H7XA 2GA7A 1U2CA 4NXMJ 3AOAA 5IT9Y 3J7ZT 1JLQA 2MQ8A 1VI7A 3MWBA 4PABA 1SJFA 4C8NA 2RQKA 4PQAA 1DY3A 3L7PA 1HNWJ 1VBZA 1R8PA 3PM9A 1VDHA 2FDNA 1GAOA 4K8RA 3ILLA 3DRRB 1ITPA 1AZSA 1Q8BA 2XSJA 3QGGA 4DDFA 1RQ0A 2ZNYA 4KKOA 2AX1A 4OX7A 4ZHRB 3W61A 1XNQJ 4DU7A 1NKEA 1MN9A 3BREA 1PYSB 2DXFA 3CW2C 3BO3A 5DZ6A 1CJKB 4H4MB 1YTYA 3MM8B 1GXLA 1NPKA 2AGQA 4F4XA 3DRRA 2QN6B 4DQSA 3MMJA 2DVIA 2ALZA 3DLGB 2ZVIA 3HX9A 2PFDA 4ZHRA 3FZ2A 1O8BA 3IWNC 1F2HA 2P2CB 2ZE2A 1R89A 4I6WA 2B4PA 3R7BB 2XY7A 1WF0A 3MUVP 1UCNA 3MM8A 2A3JA 1EARA 5HAOA 1FTCA 4OX9J 4JI4F 1S1TB 4DPOA 2RE1A 4QR2A 3BN7A 2KU7A 1ZM9A 1HI1A 2P9EA 4X2BA 4XDDA 5KFGA 2FGCA 3CE8A 3J81Y 2VHGA 1RSCA 4DV2F 1ZAXA 1FI4A 5K8MA 1VRQC 1QD1A 1WF1A 1U8SA 2DIVA 3IR6B 3QFWA 4Q2LA 1RA6A 1F3VA 2MEWA 4URSA 3ZTSA 4B9NA 2FLOA 2WSEC 3IA0A 2WONB 4IRKA 3AXMA 2NS1B 3M4XA 1CSJA 4NZ7A 4ZPCA 1XEZA 1MROB 3HHEA 3BBBA 3CIMA 1XMBA 3MMCA 2FHOB 5F9NA 1Q1KA 1VGYA 1LK7A 3QQCD 3HHLB 2WONA 2B5JB 2W8KA 3KK2B 1L3KA 5H9EK 1GEHA 3ZZRA 1YJTA 1FXLA 1P1LA 4RBTA 2VBXA 1RGVA 1VJWA 2KJWA 3PX6A 1HLWA 1XQIA 4O3NA 3PR5B 1AFJA 3HHLA 4DQIA 2AZ1A 2B5JA 2VASA 4K0KF 3GQCA 2V63A 2DR8A 3KK2A 2DK2A 2K06A 1PC4A 5KG3A 2AKWB 2QSWA 4PXDA 1H38A 2DHAA 3PVXA 4LF9J 3TARA 3PW5A 2Y0BB 2DR7A 4IOCQ 3M2RB 4OI2A 4F26A 5K8PA 1UMJA 2VONA 1CJUB 3EDQB 2FJDB 2JVRA 2XMKA 1X5PA 3TA1A 1RAIB 2HQFA 4DL4A 4Y2AA 3HFKA 1Q86T 2QV6A 3GYNA 4U9RA 4LSZB 1FKAF 1NSPA 2NXNA 2R7UA 4RW8B 3H4DA 3CDWA 2AW0A 2MSTA 4P9SA 5KFCA 1PAUB 1CJUA 4OYAA 3CTRA 1PKUA 2JWNA 3DRSB 4PG5A 1H74A 2H48B 2ZEJA 1NSAA 4NA2A 2QL5B 1T94A 1VQ4S 4OLPA 3UN2A 1KFDA 3PHEA 3W3SA 3ITHB 3UDCA 2EBEA 3U1MA 4J9KA 4UOGA 2KFZA 4I68A 3MECB 1EQ0A 5HP1B 3W60A 4F67A 1I94F 1TZ0A 1NNDA 1ZA1B 3W64A 4ZA1A 3R9LA 1RWKB 2VPWB 2J8SA 3RYLA 8AT1B 3PX0A 2F8EX 3AFGA 4ECWA 1LW0B 2KT5A 4U7CA 4WTYA 3DRXA 1HFEL 3CD0A 1S0VA 2CPDA 2H5EA 3TRGA 2GIRA 2BJ9A 3CCUS 6FD1A 2QIFA 3S8SA 3MMAA 4NLSA 1UFWA 4HT5A 2RH3A 3EPIA 4OYZA 3NG8A 4B9SA 1KVIA 2RSQA 3PR4A 1F1BB 3KHRA 4NCGA 1DQ8A 5FD1A 4ZVRB 1EP4B 3RBZA 4IUFA 3GV5B 4RNHA 3N9UC 2NLWA 2J9CA 5IOLA 1VQLS 1N0VC 4ICLB 3WDOA 2C2KB 4NOHA 5A8WB 1C0UB 2FJBB 5IT4A 2E7XA 3K57A 1VQYA 4HR2A 2AP6A 3CJ4A 1NK9A 1S0MA 5CD4A 1NDKA 1M5PC 2UUCF 3LGHA 2ASYA 2F8MA 4FF2A 4JI4J 4C0BA 2G4BA 5HJYA 4K50A 3MCMA 4DV2J 4ICLA 1LWCB 4X84A 1RT5B 5GVQA 2D3O1 4AT1B 1C0UA 4UOHA 4RU2A 2GO8A 2Y1JA 2MLXA 2M70A 2JVOA 4AUKA 1IKWB 4E2FB 4DPWA 4QIEA 3U1LA 1PO6A 2L9WA 3SSRA 3IAS9 3WHIA 1O51A 3DXBA 1IUJA 4PEOA 5J1PA 1LWCA 2H5IB 1RT5A 4KGVB 1JNZB 1RT2B 2PD1A 4NWBA 4LIWA 4LF8J 2EFPA 3GFZA 4ZP7A 1RP5A 5L1IA 1IKWA 3CJ2A 1WKJA 2G0IA 3UDVA 3QWUA 2HGNA 4J9OA 3LF0A 3C14B 5ETPA 4P52A 5HSPA 1P8GA 1VHIA 4K4YA 2W9CB 2DHSA 3R5AA 1SKRA 1FXDA 3ZTRA 3CPWR 1B7YB 1LFPA 4OZ3A 2M8DB 1U45A 4I7FA 1OSDA 5F8JA 3QT5A 5HVFA 5C42B 4K0KJ 2XI2A 2OO4A 5KFLA 1RT1B 4DV3J 1R6YA 3C14A 3POTB 3M1VB 5KFKA 4ILRA 4BWJA 4ELUA 4LJMA 4JYAJ 2VL1A 2W9BA 5D6GA 4JP8A 4DL3A 3R2CJ 4DFMA 4QWCA 1RKJA 2OMLA 2JEFA 5C42A 3VV2B 2YKMB 4CH7A 3GJSB 4H4OA 3UCGA 4NLQA 2XWYA 4IR1A 5U47A 2POKA 3I0SB 1G3OA 2Q1LA 2QFIA 1DZ5A 3M1VA 3V4IB 1KKHA 2LXFA 2VV5A 4CLTA 1U0HA 2LKZA 1K1QA 2WB4A 5B7WA 4IG3B 3MOJB 2QYGA 2YKMA 1OPIA 2QJ3A 3TOQA 3BGOP 5A8RB 2HRYA 4GC6A 4LF1A 3WIUA 1PILA 2B9YA 4OYMA 3I0SA 3DYAB 1I51B 3FQKA 4K59A 3EICA 3QJPA 4J7CA 3V4IA 2IRXA 4NRUA 2H4YB 3CCZA 2OPRB 2V50A 2E7VA 2GV1A 2RD5C 3DRPB 4A4JA 1KHWA 2HHWA 4IG3A 3P5BP 5L39A 1WSRA 4O4GB 5IT9U 4Y2KA 2KM8B 3HCXA 5A8RA 2A1BA 3U7JA 1I94J 1URNA 3DYAA 2DNMA 2CJ9A 1LNQA 2GW8A 3A8IA 3OHBA 2OPRA 2Z57B 1NK4A 3L09A 3DRPA 1ULRA 2ZITA 3DC2A 1V3RA 1HNZF 2R2RA 4OZ0A 4O3SA 4O4GA 1FRLA 5KT3A 5D4PA 4IO1A 1K0VA 3UW1A 2GAHC 4O0IA 4FF1A 3D68A 1Z4UA 3PJ9A 1NHKL 3IRXB 4FPRA 2IPOB 4KQZA 4MT1A 2P9CA 4OJGA 2ZJRQ 4DL2A 3MM6B 2R7OA 4G1IA 2H3EB 3K2YA 4X65F 1U1LA 1N5YB 2FD2A 1NK8A 2HRTA 3RBDA 1RHKB 4OZ2A 3NGSA 3P49B 4X4VA 3IRXA 1IBKF 2DEJA 3LPYA 3TUPA 2BABA 1UW9A 1VR6A 2K2PA 2K7JA 4ZPTR 3MM6A 1NDCA 1VBKA 3OVBA 5L9NA 2LLZA 1NDPA 4WIQA 4ZPAA 5CZVA 1HNVB 4DR3F 1HKAA 1K1SA 3SDEB 1N5YA 3D1HA 4USWA 3J81U 3D7SB 3TX0A 3MMBB 1X4AA 1IBMF 1XIQA 2C3OA 3T9NA 2DXDA 2UUCJ 4QW8A 3RR8A 4Q0BB 1RABB 1P9QC 3T19A 4YS2A 3P3DA 3H42A 5KFZA 1FX4A 1HNVA 2VZ9A 3SDEA 2YPYA 2CPYA 1QAJA 3AOBA 4LFCF 3MMBA 1RISA 3WC0A 2GVZB 4Q0BA 3PEHA 3H98A 1G6BA 4QCLA 5MLCV 4OYIA 3L4BC 4FYYB 1A7GE 2EW9A 1XC9A 3QATA 1WORA 1YZ7A 1SXLA 3NOCA 4OYXA 5GMKa 5D15A 3UCZP 2MLZA 1RYRA 4USMA 2GCFA 5AXKA 2GVZA 4KAIA 5DETA 4J9QA 4ZJOA 2MQPA 3DLEB 4TU7A 2OTLS 2DRAA 3CCSS 2U2FA 2CQ4A 1J5EF 4IFYB 3CCJS 2ZUGA 3LQVA 4M5DB 3RW7A 2OGUA 3JQMA 2EI5A 3SSSA 1HBOB 4ITSA 2UUAF 2IA0A 1Y9OA 3VGSA 3VGTA 4CM2A 4WCEQ 1YJVA 2UVWA 2RDJA 1NKCA 1WJ9A 2WSCC 5E3PA 2C42A 3SQGB 4DL6A 3OXLA 3DLEA 4F7VA 1HBUA 4LSLB 4IFYA 3AODA 2YQ0A 1W26A 4M5DA 3R6GB 2FJEB 1MG7A 4F4ZA 1ACMB 1D8YA 4WFBQ 2DBBA 5C2GA 4MYTA 3SSQA 3SQGA 4DHVA 4LSLA 7AT1B 3CD5A 3EVWA 1LWFA 4OYPA 1K73T 2XLKA 4JI3F 3BR8A 3SI8A 5ETVA 2XCAA 1FD8A 3UN3A 5J1EB 4QWDA 2IRYA 3UWTA 1RU1A 2GMHA 1RCXB 2GJFA 3RTVA 2J9EA 3ISZA 2WOMB 2C2ZB 3QFHA 2F5GA 3HKWA 2EEYA 4C11B 2CQGA 4Q8FA 5DDQC 4YB1P 2HGMA 2MQQA 3DN9A 1K8AT 1GH8A 3TA0A 2VU5A 4DV4J 3CJ8A 2RQMA 2XSFA 2WOMA 1PGZA 3FUYA 4DX6A 5J2PA 4J9UE 2DR9A 4C11A 1K0TA 2DISA 1SJRA 5HMZA 2VC1A 1HNZJ 2Z56B 1G2EA 4IH5A 2R7XA 2JFDA 3R1HA 4L74A 2NPIA 8ATCB 5IZHA 5SZTA 3IBWA 2PI4A 2E1CA 2HBYB 3BO4A 4RBVA 1OWXA 1X31C 1Q16B 4FZVA 4ZPDA 5HVHA 1QY7A 4OJHA 1B70B 3VQSA 3H7HB 1TELA 1GFWB 3FBEA 3SXLA 4Q43A 3A8JA 2JLGA 1H98A 2ILYA 3KLVA 4IH6A 1MW7A 3MEKA 2HFOA 4N47A 4I56A 4QU6A 3Q2TC 3FRYA 1IBKJ 1FDDA 3G71S 3KDNA 1ZPWX 3OJUA 2IJRA 3JQJA 4DR3J 4PZVA 3GMGA 1YWXA 4DCPB 3QT6A 5GAGU 2VJVA 4LQ3A 4LIRA 5F8IA 1RJJA 3AA9A 5ETRA 3RAQA 1T05B 3P5TL 3ADAC 3MEEA 1HD0A 1ZBTA 2KT2A 2FVRA 4F02A 3I5BA 4NX9A 2W1BA 4OX6A 2CPFA 1W2BR 3PYDA 2DNOA 2I5JB 4LFCJ 3HJFA 4DR1F 3D6TB 4H54A 3N01A 2RF2B 3DMJB 1T05A 4ECZA 4OFZA 5D3GA 2W7PA 1PAEX 5FDLB 1VFJA 3AH6A 5IM0A 2QRRA 1LK5A 5E3QA 2I5JA 1K9MT 4I6AA 2M8HA 4DUYJ 4PYAA 3D0IE 3N28A 2RF2A 3DMJA 3GG1A 2MQOA 1RAJA 3O2IA 4MKAA 3T1HF 3HDSA 2CQ0A 3BSNA 1HYSB 3TAPA 1Y00A 5FDLA 4WFYA 4M5MA 3LAKA 3GR1A 1TKZB 2XULA 2PI5A 2J5AA 3Q0AA 2AJ2A 5JXSA 1S72S 3TAMB 2XGPA 4C0HA 1QAYA 4TYBA 1TMMA 1HYSA 4LUBA 2E66A 3TI0A 1TKZA 1RXOB 3T5KA 1GMVA 2ZBQA 1YHQS 1P6TA 1KR4A 4IR9A 4Z7CA 5D0HA 5HANA 3R5DA 1R0AB 1FFWB 4K4SA 3TAMA 4F2RA 1YQHA 1IQTA 3CULA 5KFJA 2X7IA 2FVQA 1M1KT 2CQBA 1XMQF 3V6DA 3RB6A 5CCMA 3RRHA 4LFAF 4JI3J 3OTEA 3N4WA 2KZZA 2ZUAA 1CQMA 4QWAA 1RWXB 3MM5B 2XS7A 2JHEA 1XR5A 1SV5B 2QT7A 3FMBA 3AQOA 1AUSL 3VHQA 5BYQA 4B9VA 2VDHA 5DGBA 3IS9A 4EYIB 2W24A 2XLJA 1VRUB 5GMDA 3SV3A 2AV5A 5KT7A 1S6UA 2VOPA 3MR6A 4LR9A 5C25B 1SV5A 1FO1A 5K8OA 3VTIA 4A8KA 2B8PA 3HSDA 4B08A 1RWOB 3RRGA 3NKYA 1NSQA 4NCBA 4QQBA 4M63A 2ZH7A 2AQ4A 5ETMA 1NK6A 4JI2J 2F4VF 2BYCA 2AYEA 1PG5B 3FRZA 4P2XA 2E5IA 3H5UA 2LQ5A 1NPPA 1RAHB 1V5IB 5GADI 2GX8A 2DNHA 5C25A 1N5QA 3OD2A 2IBKA 1SH2A 1BWEA 1LFWA 3K89A 2KZMA 3QSYB 2MQMA 4JV5F 2MY8A 4UOCA 4K2JA 3GFHA 3R5JB 2GZOA 2FC9A 2IJFA 2RS2A 2CG4A 1XERA 1YBAA 2MXYA 2V4JB 2RILA 4HACB 1IBLF 1AW0A 4X4SA 1UTAA 5F0UA 3PYGA 4IOAQ 4OI6A 5A2QY 1IKYB 1JLGB 3UN5A 2YKNB 2XMJA 4H4KA 2DGXA 2JC1A 2V4JA 4HI1A 2YH1A 4QZVB 2MQLA 1BWVA 2RHQB 5K9FA 2HWIA 2O3DA 3JTOA 4DG1A 2HVHA 3NWGA 2GAGC 1LOUA 4DSLA 3W5ZA 3PRBA 1IKYA 3A8EA 2G9OA 2HNDA 4ZVQB 4K4VA 4ZLPA 5LJ5Y 2YKNA 4OZNA 4DR2F 2H1YA 3M2VB 4RUBA 4DR1J 1S97A 4PXEA 4CT8A 3J7A1 2HNYA 3EM1A 1XTZA 5KFIA 4YUDA 2C1EB 4URGA 2Y9HA 3R7NB 3M6XA 1B0PA 3Q8SB 3EVMA 4NZ0A 4JBCA 2JLEA 3M2VA 2HNZB 4XO0A 2E29A 2XYHB 2WVEA 3GWCA 4FVCA 1UPMB 3T1HJ 4C9DA 3M6WA 3CDBA 3S7RA 3T5LA 4DN9A 2PA8D 1WSVA 1IN0A 4K4UA 2Q3PA 3QT8A 3OSNA 1CQNA 4DSIA 1RU2A 2YY3A 4X4NA 2HNZA 4A8QA 3GYGA 2MJNA 2X1AA 2RRBA 3OV7A 2QMUB 3TVKA 1YJWS 5KG0A 2C2RA 1UP1A 3IWLA 1E6VB 2DITA 2ZD1B 4KHMA 4O0NA 1DRZA 3UD3P 5T41A 4PQUB 1N5SA 1AROP 3BQ0A 2E1MC 3EWGA 1SQGA 3NS6A 4PG7A 4PUOA 1X9SA 2C2NA 2DGTA 1WTFA 4XAKA 3M8SA 1XMQJ 2HHQA 3R5BA 3I96A 4LFAJ 4LVNP 4F04B 1EETB 2CXEA 1RAEB 5KT2A 5C24A 4OYBA 1U26A 1ZTWA 2PC6A 4CZCA 2HKEA 4DX8H 3W2VB 2BM0A 4PQUA 2VH7A 4DR4J 2HLUA 1QVGR 3NOGA 3D1QA 3NWRA 1N54B 1IM4A 2ASLA 4CM0A 4CYUB 3BF4A 4ID5A 2XB2D 1U8WA 5CD4H 5CYJA 3H2UB 3J80Y 1S9EA 2VFVA 2ZC3A 2BKOA 2DCUB 4OV6A 3B4DA 5HI7A 3K5LA 4NLUA 4HH1A 2V5HG 3KDOA 1C1BB 1SUQB 2F4VJ 4G3IA 5C2CA 3H2VE 2MGZA 3GV7B 3ZNJ1 3OLBA 1XJWB 1HQ2A 3DDKA 1GXUA 3PKYA 1JB0C 4NYPA 4Y2CA 5J2NA 1MMDA 1DHMA 2HHSA 1T9TA 2D3UA 1C1BA 4CO2A 1JXEA 2MJUA 2VUGA 3MEDB 4O44A 1S1UB 5LM7E 2UXCF 3TQ1A 4B3OA 4JV5J 5FJ4A 2V69A 3J81j 2DNRA 3GV8B 2V68A 1SC6A 1KONA 3FCWA 1C2PA 3FGVA 2GC8A 3HSZA 3R7SB 3MEDA 1VC0A 2DPIA 2G1DA 5J2MB 5L8RC 1QSYA 4HDHA 2L48A 1IBLJ 2FVPA 1U6ZA 3P96A 4AD6A 4MIBA 4WYWA 3IBFB 3QGPA 1VK3A 1KSPA 1YJ7A 3OL6A 4EUVA 3CJQA 1NJWA 2OD4A 5EWEA 2E9RX 1FWPA 2HMIB 3D2WA 5J2MA 4GO5X 2QGFB 2W2NP 5D4OA 1X5TA 3GIRA 4I2PB 1XN9A 3Q86A 2BUNA 2V8PA 1WHYA 4DL5A 3MF5A 1YGYA 1UZDA 2XZWA 2BXJA 1FWLA 2YNIA 1VHFA 4DR2J 5JVHQ 1NZ8A 3QJLA 3SMZA 4I2PA 3T3FA 1REVB 4JI5F 3EUNA 2A2CA 5CA5A 1OQ6A 3LH2S 4CWBA 3VALA 2D69A 2OMOA 1D1UA 4UY85 5K5MA 1NJIT 3QGHA 1CC7A 1FXRA 3G86A 1REVA 1ZAWA 4ZLNA 1X4GA 2DRBA 1HNXJ 1RBAA 4UQTA 3KHHA 3MTKA 4K4TA 5JMNA 3QSIA 2EKYA 5EX3A 3OL7A 1F9FA 1H2TZ 2BR0A 1U1OA 1NHUA 4CRJA 3HPOA 3OT9A 4AYBD 2HQCA 3LA0A 2OSQA 2QLBB 3G82A 4GRSA 4DI6A 4J37A 1X5OA 1BC6A 2BQUA 1DLOB 4PYDA 4FS2A 3RRKA 4ECRA 2XZTB 4LFBF 2VPZB 1Q5VA 4IH7A 3Q8YA 1RT7B 2XMAA 3FBFA 2J0SD 2VOOA 1P1TA 5HMXA 4AXIA 5DG9A 4C4WA 4R0JA 2DT9A 3PDNA 3GFYA 4OL8A 4WPAA 3M7VA 2YNGA 4CDIA 2F7VA 2RUSA 2Z2MA 1DLOA 3ET6B 3OLAA 4ANDA 4OHYA 2NXJA 3FMWA 2MSSA 3EDRB 3MPYA 2ZDOA 3JQKA 1RT7A 1ZM2A 5K14A 2N4DA 3KXDA 3OXFA 1WUUA 1YJNS 3GPAA 2W4PA 2RS8A 1V3SA 2CIMA 2AYBA 3IG1B 3KJNB 3V81A 3CDEA 1SI9A 5DO2A 1FVQA 2KH9A 2CDQA 4W98A 4BDPA 2C2OB 4USHA 2HVEA 4UF4A 2XMMA 4EZ9A 4R25A 2KM8C 3MCOA 4I2QB 2ZFHA 2JRSA 4USJC 3VWSA 2OKQA 3AD9C 3OJSA 2UV8A 4Y00A 3PNIA 3QZ7A 2PA3A 4HI2A 3PJWA 2QE5A 2ADBA 1TP7A 3HVAA 5M2PA 2PEBA 3L3CA 2RAQA 1JKHB 3PYEA 2AGPA 1OQ3A 2JFKA 4ZP6A 4C97A 4I2QA 5F0WA 1UFKA 4LF7J 3HFZB 4ED6A 4UW2A 2MY7A 2AT1B 1S1XB 1Q5YA 2UV8G 1W2IA 1FK9B 4FYDA 4RBUA 3HULA 2Y1LB 2JOQA 1L3SA 2KXHA 1Y3KA 2ZH2A 2UXCJ 5I42B 3BH7B 2VODA 2XMWA 2RU9A 3KLHA 4ZJLA 2J9DE 1PJ7A 2WTFA 2QL9B 2J7KA 3LP2B 1TV6A 4EGLA 1S1XA 1LEOA 1FK9A 3KLIB 5L9XA 3KFWX 2GQ2A 3ENWA 2FLLA 2A18A 2LVWA 3K17A 4A46A 2DR6A 2GIFA 3F56A 3MFIA 4RKUC 1L5UA 4PWDB 1HMVB 3OFEA 2BKPA 4DR5F 2F8HA 3I56S 2DKOB 3CCTA 3NGKA
chains in the Genus database with same CATH topology
4LIWA 2OTJS 3MPWA 2BBEA 5E7OB 2EFPA 2M3DA 3GFZA 3TR5A 1Y5NB 1FA0A 4ZP7A 3UD4P 3OL8A 1SQEA 3O3LA 5E33A 5AXLA 4OI3A 5G4DA 1RP5A 2FY1A 5L1IA 1QJHA 1IKWA 3CJ2A 2ZDPA 5L1JA 5AE2A 1SB6A 4ETXA 3QWUA 3QO9A 3DI6A 3RW6A 1VOMA 3JSMB 3OUYB 4B3SF 2IAJB 3GSDA 4F3MA 1HPZA 4FBUA 1PC5A 2HGNA 3M8QB 4J9OA 1HMVA 3LF0A 4OX8A 3LP1B 4YHHF 3LGNA 3CDAA 4C3KA 1P8GA 3PV8A 4K4YA 1N52B 1E6VA 1X7VA 1SL1A 2W9CB 2ZD1A 2DHSA 1RKIA 3R5AA 1FDBA 3VZHA 5LXYA 1FXDA 1SKRA 5KFEA 2FIUA 4BC9A 1J5OA 1Z1ZA 2NQPA 3ZC4A 4WFXA 3CPWR 1LFPA 3OW2R 1SJ4P 1UFLA 2M8DB 1U45A 4I7FA 1OSDA 4ECQA 5F8JA 2C3MA 1HW8A 1LKZA 5C42B 3J7YU 5HL7Q 5CYQA 2F9DA 2IJNA 2XI2A 5F8GA 2OO4A 3SYZA 2YVSA 1FJ7A 3JSMA 4DMZA 3G6VA 5THWA 3MUTP 4CQ1A 5KFLA 4D3HA 1RT1B 1R27B 2JEGA 3M8QA 1R6YA 4ZCLA 1VQMS 3POTB 4RWWA 3MEEB 4ED1A 2LA6A 2ROGA 1NH7A 3M1VB 4KB7A 5KFKA 4ILRA 5M2UA 3LP1A 4BWJA 4ELUA 4LJMA 3KMSA 2N82B 4EZ6A 1UETA 4JUZA 2VL1A 1EETA 3M9NB 2W9BA 5IT0A 2QSFA 2PEHA 5L38A 3ETOA 2GHWA 5D6GA 1Y3JA 3MI7X 4EO8A 2OSRA 2U1AA 1KEKA 4DL3A 4ZPVR 3W2VA 2FJWA 2OP5A 4URQU 3KMQA 2ZH6A 4DFMA 4QWCA 2CZ4A 3D0HE 1U2RA 3MOZA 1RKJA 2OMLA 4WK3A 2IA6A 2JEFA 3HVTB 5C42A 3UNGC 1ZPVA 4FNIA 2YKMB 2EFGA 5HROB 4CH7A 1HHTP 1RT6B 3KOAA 4H4OA 5DQGA 3UCGA 4NLQA 1M5HA 3Q24A 2XWYA 5F8HA 3DLLQ 3IAM9 4IR1A 2R7TA 5U47A 3OSPA 2POKA 5E0OA 1JLCB 3D5MA 3I0SB 1G3OA 2Q1LA 3U02A 1DZ5A 1N4LA 5D3GB 3M1VA 1NJXA 3V4IB 5GAGI 4DV5F 2LXFA 4E8UA 4LF7F 2VV5A 1R3NA 4FXDA 3PKMA 2M0GB 1S76D 5IM0B 1NHVA 1VMBA 1VQ5S 1FVSA 2E1RA 2YX7A 4GO7X 2KXNB 2ZH8A 1U1MA 4ED5A 4DF4A 2LKZA 3PO4A 4ECUA 1S1WB 1K1QA 4OV1A 4TLRA 2WB4A 3NNAA 5B7WA 4IG3B 3MOJB 4OJ1A 2IVYA 1Y0HA 2ZBIA 2LQBA 1Q7YT 3HVTA 1VC5A 3MD3A 4BC7A 2YNHA 2JDJA 2YKMA 1OPIA 5HROA 1YVFA 4WYLA 2MB0B 2IVMA 3TOQA 4H4MA 1RT6A 5A8RB 2FHJA 4KFBB 2HRYA 2R8GA 4GC6A 1SUQA 1WG1A 1PILA 4GC7A 3C66A 2NR0A 2WK4A 3DOKB 1V3ZA 1JLCA 2B9YA 3M6VA 3I0SA