2WOMB

Crystal structure of uk-453061 bound to hiv-1 reverse transcriptase (k103n).
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
427
structure length
412
Chain Sequence
SPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title Lersivirine, a nonnucleoside reverse transcriptase inhibitor with activity against drug-resistant human immunodeficiency virus type 1.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 109
structure length 412
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 2womB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2womB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2womB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2womB03
4ZVEA 2RKIB 5J1EA 5CYQA 3H5YA 4ED2A 1HPZB 2HAIA 2AGPA 1DLOB 2WOMA 1RT6A 4EBEA 1S1XB 3M8QB 3KOAA 4HYKA 3DRPA 2W9AA 4JV1A 2W9CA 1XR5A 1S4FA 3CJ3A 4DEZA 4ED3A 2DPJA 2CJQA 1S9EA 1HQEA 4R5PB 2B43A 5KG5A 4RW8A 1YVFA 3GIIA 3DYAB 4I2PA 3EZUA 4EEYA 3JSMA 5DQGA 3KLEB 4KKOB 2OPRA 2IA6A 4F4ZA 4IRDA 5KFOA 4IDKA 2WONB 3BR9A 3KMQA 1RT3B 2FVQA 4H4MB 1D0EA 2XCAA 4I2QB 3QLHB 1LWFA 1LW0A 4QW9A 3GQCA 3HVWA 2WK4A 4IR1A 1FK9A 4U6PA 1TQLA 3HVAA 2UVVA 2E9TA 4K4WA 5C25A 1RYRA 4Q45A 2YKNB 5FDLB 1JLCB 1IKWA 1RTDB 4Q0BA 2UUWA 4ECZA 3MR5A 3SFGA 4DL3A 3DM2A 4NLOA 1VRTB 2W7OA 4IG3A 1NNDA 4RW4A 4ED1A 1NHUA 3FFIA 1HYSA 3NAHA 3MEEA 3NKYA 4LQ9A 1JKHB 5J2MA 3UR0A 3QIPB 4IFVB 3KK1B 3HHKA 4YQWA 4J9PA 1S9GB 2GIRA 3DRSB 3I0SB 5HBMA 4XO0A 1RT7B 1IKYA 4M94A 3Q8QB 3LP0A 3MFHA 1S9FA 3T5JA 1BQNA 3NL0A 3QO9A 1XR7A 3KLVA 3LP1B 5I42B 1HMVA 1TL3B 2BE2A 5HROB 3MR6A 1T05B 4WFYA 4WE1B 5DG9A 4J9RA 4EYHB 3DRRB 4EYIB 4MFBB 4U7CA 5KT4A 1TKXB 4O3QA 4KO0B 1IKVB 5J2QA 3HVTA 2VG7B 4KHMA 1SUQB 4MKBA 4FBTA 3NBPB 4PWDB 3CJ0A 4DG1A 4EO8A 3KK2B 2VA2A 4URGA 3IGVA 3OL7A 3G6XA 2WHOA 3KK3B 4KV8B 1N6QB 2QV6A 3E01B 4ZVFA 1S1UB 3M9OB 4LSLA 1SV5B 4ECTA 4ZHRA 3KHHA 4URQU 1MU2A 1C1CB 1JLBA 1EETB 3GYNA 3EPGA 1JLQB 3PHEA 4TY8B 3MEDA 2FLPA 1S6QB 3LALA 1C0UB 1DTTB 4F4XA 3V6HA 4GC7A 4RW6A 4WXOA 3PW5A 1RTJA 5J2PB 5KFEA 1RT5B 1LWEA 3MECA 2WCXA 5F8IA 4KAIA 5KFAA 4H4OA 2UUTA 4DL6A 3KLHA 1GX6A 2FJVA 4ZP7A 1HNIA 2OPQB 4XPEA 2HNYA 1JIHA 2OPSA 3H2LA 3ICLA 4NLXA 3GIJA 1HPZA 2IM3A 3BQ1A 1TKTB 2IMWP 1DLOA 4RNNA 2IAJB 2JLEA 2RF2A 3M8QA 4O44B 2D3ZA 2ZE2B 1S97A 2XGPA 2ILZA 2IM2A 3PW0A 4O3RA 3KLGA 4NCGB 2BANB 4RNHA 4WYWA 1N5YA 4TYBA 1JLGB 4J9NA 5I3UB 3V6JA 1UWBB 3RAXA 3IG1B 4HKQA 2AX0A 4WZMA 2I5JA 2BRKA 4B3OB 5C42A 1SH0A 5KFGA 5KFWA 3MR2A 2R8IA 2YKMB 5CYMB 4ZPDA 1NHVA 3TAMB 4ECRA 2AQ4A 2WONA 4YP3A 3T5HA 5KFIA 5F9LA 4DL2A 5D3GB 1RT3A 4H4MA 4KSEB 3C6TA 3RAQA 3LP2B 4J9LA 3SFUA 1C1BA 1LW2A 2YNHA 4I2QA 3CO9A 3ITHA 4NLQA 2XC9A 2YNIB 3IRXA 3KLIA 1SH2A 2CKWA 4ZP6A 4R0EA 3DMJB 1JXLA 2YNGB 3PJXA 3N6LA 1TKZB 2YKNA 3DDKA 5KFYA 1JLEA 5KFBA 5FDLA 1JLCA 3C6UA 1RTDA 1T94A 4ZVHA 2OPPB 4TXSA 5F8GA 4ED8A 1JLFB 4LSNA 3BSCA 4NYZA 1RT2A 5HP1B 2XI2A 1D1UA 3M9NB 1MMLA 4TN2A 1FKOB 5DGAA 3KHGA 3V4IB 5HLFB 2ATLA 5J2NB 1JKHA 4NLSA 4RW9A 2AGQA 3H4BA 1EP4B 3GIKA 5KT7A 3RB6A 3Q8RB 4K50A 5KG2A 2R8GA 2W9BB 5KFXA 4G1QB 3DRSA 3I0SA 2XGQA 1RT7A 3CDUA 4MK7A 1BQMB 5F8HA 3BSOA 4R8UB 3OL8A 3IS9A 5I42A 4ZPAA 4O3NA 3OL9A 4K4SA 3H5UA 5HROA 2IC3A 2VG6B 1T05A 4WE1A 2W8KA 4TLRA 4Y2CA 4YR3A 3DRRA 1R0AA 1TV6B 4MH8A 5KFZA 2D7SA 4KO0A 4QPXA 3DOKB 2J6TA 2HNDB 4O3PA 1N4LA 3NBPA 4YR0A 3FDSA 3FQKA 5KFQA 1RTIA 2WTFA 3KK2A 1ZTWA 3GV7B 4I7FA 3T1AA 1ZETA 3H5XA 4IG0A 3D5MA 3KK3A 4ZP9A 4ID5B 4KV8A 3PR4A 1N6QA 3E01A 4RUCA 4K4YA 1S1UA 1S6PA 3G6YA 1S1VB 1SV5A 1HNVA 2UVUA 4NLTA 1RT1B 1C2PA 2AWZA 4WZQA 2XWYA 1EETA 4K4TA 3JYTA 4TY8A 1S10A 3KLFA 4TQRA 1C0UA 1DTTA 2FLLA 2QE5A 3MR3A 1HQUA 5J2PA 2FVPA 1RT5A 3RB3A 3M8PA 4EBDA 1C0TB 5DG7A 4EBCA 4Y34A 3DLEA 3CVKA 3BQ0A 5K14A 4KFBB 2BQ3A 5F9NA 3OSPA 4FS2A 4PQUA 1TKTA 4OL8A 3BREA 1FKPB 4ZVGA 5F8LA 3E51A 4EO6A 4ECXA 3H59A 2ZE2A 4WXWA 1VRUB 2AU0A 2FVRA 4NCGA 2BANA 4ECSA 3I0RA 1RA7A 4Q8EA 2B6AB 5I3UA 4J9OA 4TY9A 3KNAA 3IG1A 5KFRA 4F4WA 1S0OA 3V6KA 1RT6B 1IM4A 4ECWA 4B3OA 4ICLA 3V81B 3OHAA 2FJWA 5CYMA 3DI6A 2R8JA 4DL5A 3KJVB 4Y3CA 1HQEB 4QWBA 5D3GA 3ISND 1TL1B 5KG3A 3T5LA 4X2BA 2B5JA 4ECUA 2E9ZA 3V6DB 2C2DA 3BGRB 4Q8FA 1KLMA 3CJ4A 3MEGA 3OHBA 5KFJA 5L1JA 1T03A 1QAIA 4QWCA 2OPRB 3DMJA 3G86A 4MIAA 1S1TB 1TKZA 4RW7A 4IDKB 3HKWA 3QGGA 2V9WA 3DLKB 4F50A 2OPPA 5KG6A 4MK8A 3KHLA 1JLFA 3PVXA 5HP1A 3G6VA 2RKIA 1FKOA 1LW0B 3PR5B 4JV0A 5HLFA 3MF5A 4NLDA 1FK9B 3MFIA 1W25A 3RB4A 2HMIB 1KHWA 1EP4A 1S1XA 4URSA 1CSJA 2W9BA 2JC0A 3QGHA 4G1QA 4J9KA 3PW4A 4Q0BB 4WFXA 2JEJA 1S1WB 1GX5A 4R5PA 4RW4B 4R8UA 5KT5A 3FFIB 2FVCA 3IGNA 3MEEB 2BQRA 4DL7A 3DYAA 4RU9A 2YNFB 5J2MB 3LAMA 2JEIA 2DPIA 3KLEA 4KKOA 1TP7A 4K4VA 4K4ZA 3FQLA 5KFMA 1IKYB 3DOLB 4ECYA 5KG4A 3N6NA 1BQNB 2HNZB 3QO9B 2GIQA 1TVRB 3N6MA 3IN5A 2FLNA 1HMVB 5KG1A 2IJFA 3QLHA 3OLBA 5KFHA 1S0MA 3PJWA 5KFDA 2J6SA 4M95A 3CJ5A 4ID5A 5EDWA 5KT3A 4GC6A 3CDEA 4XPCA 3H4DA 3HVTB 5DLGA 4FS1A 4KHRA 1RT1A 2AX1A 1VRTA 4DG1B 1S48A 4IH5A 3GIMA 3M9MB 4K4UA 5C5JA 4WYLA 3QIPA 4IFVA 5C24B 3KK1A 2O5DA 3D28A 5JXSA 4LSLB 4ZPBA 4FBUA 4O3OA 1S9GA 5L9XA 1MU2B 5KFCA 3BJYA 1JLBB 2FJXA 3MTKA 5EWEA 5DLFA 2OH2A 1JLAB 1RDRA 2JEGA 3MEDB 2EC0A 2ZD1B 3LP1A 3RB0A 2IBKA 1FKPA 1TL3A 3OLAA 4RW6B 1LWCB 3H5SA 4DL4A 3KHRA 1LWEB 2BRLA 1VRUA 4QWAA 1REVB 2ILYA 4NLRA 4MFBA 2W7PA 1KHVA 5KG7A 2ASJA 1TKXA 4J9QA 4NLYA 1IKVA 1HNIB 2B6AA 2HNYB 5L1LA 2OPSB 3NMAA 3OL6A 2VG7A 1JX4A 1SUQA 5KT6A 4PWDA 2C28A 1HARA 2RF2B 1J5OB 3V81A 4IFYB 1RYSA 4ED6A 5KFVA 3TQ1A 3QYYA 3KJVA 1QUVA 4RUAA 1IKXB 3KLGB 5KFUA 3H98A 1N5YB 2R2UA 1TL1A 3VQSA 2ZKUA 3V6DA 1I6JA 4G3IA 2I5JB 1C1CA 3BGRA 3BSNA 2WB4A 5T14A 3QZ7A 4QW8A 5KFKA 4IQXA 4J9MA 1JLQA 4LQ3A 5C42B 3SI8A 1Z4UA 5L1KA 4RZRA 1S6QA 3DLGB 3NGDA 1S1TA 4O4GB 4KE5A 1QE1B 1SH3A 3DLKA 2UVWA 2E9RX 5EUHA 1RA6A 2D3UA 3C6TB 5F8MA 5KG0A 1C1BB 1LW2B 2YNHB 2JEFA 3ITHB 4NRUA 2OPQA 4YMEA 3BSAA 4RNMA 3IRXB 3KLIB 2R2RA 2HMIA 3H40A 2IM1A 5KFSA 2R8KA 1RTHB 2HWIA 4K4XA 2IAJA 4O44A 4PUOB 3UDLA 1JLEB 5EWGA 3PW7A 3C6UB 1RT4B 2JC1A 2XCPA 1S1WA 2VG5B 4LSNB 1DTQB 3FSIA 1RT2B 3UQSA 5DG8A 2V4RA 4ED0A 3LANA 5J1EB 1N56A 5CYQB 1JLGA 1UWBA 3QIDA 3UPFA 5KFNA 2ASLA 4RW9B 3TVKA 2YNFA 2WOMB 2IM0A 4MKAA 2ASDA 4TQSA 3CJ2A 3DRPB 2C22A 4KB7A 2YKMA 2W9CB 4RNOA 4RNFA 4YR2A 3I5AA 3DOLA 3TAMA 5KT2A 1S9EB 2HWHA 2HNZA 5KFPA 1TVRA 3IS9B 4RW8B 3LP2A 2IC3B 4I2PB 4ED7A 2BQUA 1S0NA 2YNIA 3JSMB 2AGOA 1R0AB 1S49A 2W8LA 3QZ8A 2YNGA 4NLPA 2R2TA 4QWDA 4O3SA 1XR6A 1RTIB 5DGBA 2UVRA 1LWFB 4NRTA 4I7FB 3V4IA 3PW2A 4IG0B 4ZMMA 5J2NA 3GV8B 3RBEA 4IR9A 1WNEA 5C25B 5C24A 2XI3A 1S6PB 1ZTTA 4WFZA 5KFLA 1HNVB 1IKWB 3CDWA 3DM2B 1BQMA 3JYTB 1JLAA 4IG3B 4JV2A 3T19A 2ZD1A 3KLFB 5EWFA 1HYSB 4IRCA 3ISNC 2RDJA 2VG6A 1LWCA 1HQUB 4IOBA 2V4QA 2D41A 3CWJA 4NLWA 3M8PB 1TV6A 1REVA 2FVSA 3Q8SB 3DLEB 5L1IA 5HBMB 3T5KA 5K14B 4IH7A 3DOKA 3OSNA 3BQ2A 3LP0B 2F8EX 3Q8PB 1K1QA 2R2SA 2HNDA 4PQUB 3I5CA 2BE2B 1J5OA 2IJNA 2J6UA 3PZPA 2C2RA 4IFYA 5DQHA 1U09A 2BR0A 5F8NA 1IKXA 4QWEA 4F4YA 3I0RB 3FRZA 4IH6A 2VA3A 3I5BA 5J2QB 4J9SA 4ECQA 1S1VA 4O4RA 2C2EA 3EPIA 4MK9A 4NZ0A 1QAJA 4ZP8A 2V0NA 4ICLB 4Y2AA 4Q43A 4IRKA 5KFFA 3DI6B 3DLGA 4MIBA 4NLGA 4O4GA 4NLVA 1QE1A 5KFTA 2I1RA 1T3NA 4TYAA 4ZHRB 2B5JB 1C0TA 3RBDA 3GV5B 4Q44A 1KLMB 3NAIA 3MEGB 4KFBA 3QGIA 3CIZA 2GC8A 1T03B 1K1SA 2RDIA 4JUZA 2R8HA 3GILA 1OS5A 4NLUA 4ZPCA 5JUMA 1N48A 1RTHA 3LAKA 4RW7B 4PUOA 4H54A 5DQIA 4IKAA 1RAJA 1RTJB 2ALZA 2WRMA 1RT4A 4ECVA 3MECB 5F8JA 3KMSA 4KBIA 2VG5A 4H4OB 1DTQA 3KLHB
chains in the Genus database with same CATH superfamily
3EJMA 1MWYA 1U1PA 3KOAA 1WEZA 2MLYA 2XYPB 2DCUB 3NRBA 4YEAA 1RWVB 5EN1A 2ZM6J 1PGZA 2MY7A 1D0EA 1L3VA 3PYEA 1LWFA 4MT1A 2C3YA 4P10A 3US5A 2EW9A 2UXBJ 4ZVRB 3D4JA 4DL3A 2A6OA 3JB9k 1T02A 3NAHA 4LQ9A 1SQEA 1VQ4S 3HHKA 4J9PA 1S7HA 1IKYA 4M94A 3LP0A 2GA7A 4Z2XA 1A9NB 4MFBB 1WACA 1FERA 4LF4F 3KK2B 2DR8A 4URGA 2E7XA 2BJ9A 4X4NA 3C16A 5L38A 2V8GA 1JLQB 1WF2A 4OZ1A 1U47A 3PW5A 1B70B 2XMKA 3KJFB 4N7TA 5KFEA 3LH2S 3MAAB 1AZSB 1RAOA 3MM6A 3M1VB 3SDEA 1HNIA 2OPQB 1VQSA 1S97A 4FYXB 5B0GA 4HT5A 2ZBCA 3KLGA 1FVQA 1P8GA 2AJ4A 5CZVA 4WZMA 2HZCA 1X9WA 1VK3A 1PYSB 3MR2A 2C3MA 3A13A 3UFCX 4S0MA 5GAHI 2CNLB 4KSEB 1KWMA 2VQFJ 2OHDA 3KLIA 1DFDA 1NK6A 5DGAA 3KHGA 3FSYA 3OVSA 1YX2A 2E5LF 3GCXP 4USIA 3DRSA 2B3TB 4FNIA 5F8HA 4LF5J 4G1IA 3OL8A 3TEGA 3FC9A 1Q79A 3VGUA 4GKKF 4FYWB 4KO0A 4WKYA 4B9TA 3FDSA 1ZETA 4I7FA 4DX5A 1C2PA 2RQKA 2CQCA 2JLFA 2XYGB 2UU9J 3G96A 5DG7A 2KRBA 4EBCA 2RILA 3H7HB 3NOCA 1X4EA 5F9NA 1Y5NB 5LXRA 3SBMA 3O1LA 2BV3A 4A8XA 2IVMA 2XQCA 1Q78A 3NLCA 3KJVB 1A7GE 4I64A 2FGCA 1JJHA 2MKCA 2B5JA 2FHOB 4X4SA 4C9DA 1KLMA 5D0EA 4A4JA 2ZBPA 4FYVB 3Q22A 3G6VA 1FKOA 2W7AA 4I6YA 1HI8A 4N47A 2W9BA 3ZZOA 4WFXA 5CH7B 3RTVA 2FB0A 2XZWA 3MEEB 4C8OA 1TP7A 1GMWA 5LJ3Y 1S0MA 1Y11A 4C8MA 4WJBA 1CJUA 2NXUA 4GC6A 3GFXA 3OT9A 2FC8A 2Y1LB 2AX1A 3CT9A 1EQMA 4JYAF 3QIPA 2O5DA 3M30A 5CAAA 2E1PA 3KJQB 5HMZA 2J0WA 4RW6B 1YJVA 2BW2A 3LGMA 4HVZA 4ZPVR 2G9OA 5KT6A 1UPMB 2LVWA 3ZTRA 3EE3A 1IBCB 1MMDA 2QLFB 2Q6CA 1K0TA 1UCNA 1PILA 5LMNJ 1SH3A 4PXBA 5I3PA 1SVDA 1RAEB 2QT7A 4NCBA 3BSAA 4DV3J 1LFWA 2VU5A 2WZ1A 4K4XA 2KVIA 3D1HA 4C98A 3HI9A 5B09A 1N56A 2E5GA 5G0RB 2RIJA 4RNOA 2QLJB 2W4DA 1N5SA 5KT2A 2U1AA 1S9EB 3WX8A 2KO1A 2HNZA 2EFGA 2QLXA 4M5LA 3VAGA 4KC5A 4B3MJ 1R0AB 2GV1A 1FRLA 4HHHA 3D68A 3R5CA 3OVAA 2XI3A 2A3JA 1S6UA 1AFIA 2QG9B 3DHWC 4X64F 2VG6A 1HQUB 1I5OB 2FVSA 4J9UE 2CQ4A 2VFSA 1YKWA 3CJQA 4QWEA 1QVFR 3I0RB 1EIYB 1Q8IA 3EPIA 2QZ8A 4CNZA 2D9OA 1T03B 3MECB 3KMSA 1DTQA 3D6HB 2LQ8A 2MDAA 1DLOB 4DXLA 2VBXA 4YUDA 2DEJA 2XY6A 2CJQA 2YVSA 5J1PA 5F0WA 3DYAB 1RGVA 2SXLA 2OPRA 4CLYA 4IDKA 3BKUA 1BGXT 4F3OA 2YWKA 1LW0A 4JI0J 4P2SA 2CZ4A 4I6AA 2P6TA 1RWPB 1O0PA 3ENAA 4DUYF 1TL7A 1S9FA 2C3UA 3NMRA 3K5NA 2RHSB 1NJWA 1N34F 3DC2A 1P27B 1HW9A 2VG7B 2FHJD 3NBPB 2L41A 1JXEA 4P2FA 3EX7B 4URQU 1MU2A 2XLIA 4QU7A 1JLBA 2YWGA 3MOJB 3UDEA 4WCEQ 3LALA 5THWA 1L3UA 1I3OB 5KFAA 2IVFB 4Y00A 2IMWP 3VAFA 6FD1A 3O8WA 2GGPB 4DSEA 4ZIVA 2PD1A 3WIVA 2N4CA 3JSBA 2RHQB 2DNMA 2ZJQQ 3TAMB 5F9LA 1UKUA 3HPOA 1F6TA 4PXDA 3IBWA 4ZN1A 3MCSA 3NCQA 2MEWA 3UD3P 1EARA 1FDDA 5CD4A 1OMSA 2Y8WA 2GNKA 2X1AA 3CDUA 1UJ5A 2OUGA 3ULHA 3OL9A 1KDNA 3NS5A 4L74A 1RK8A 4LF8J 3U7JA 3NCPA 4DDFA 1RT1B 2R7VA 5A2QY 2HHSA 2ACMA 1HWLA 5DETA 4RX6A 3UVJA 3HFZB 3K8WA 2VOPA 1NLKL 3B4DA 5EX0A 2E44A 5K8OA 4GO5X 4RO0A 3X3UA 2ZH3A 4Q8EA 1S0OA 3LQVA 3V6KA 3UCGA 1HWUA 3R97A 1O6XA 3FSXA 2HQDA 2F9JA 4OYAA 2DNZA 2ADCA 3LUYA 4FF2A 4C4WA 3M2RB 2ZNYA 1FHTA 3G82A 3PM9A 2HHHF 3ZTOA 3ZC4A 4RUHA 3RBXA 1DY3A 1ZZFA 4RWXA 3JXOA 3M05A 4R8UA 2I0XA 4WTOB 3MGJA 3NNAA 2XS5A 1O5JA 1D8YA 3AAWB 1RQ0A 2K3IA 5D0GA 3W9IA 4ELVA 2YX1A 3OTOF 2J0SD 5ETNA 4K4UA 3KK1A 1YRTA 4DR6F 1C4AA 1LWEB 3CDBA 1VRUA 3R6LB 2XMWA 2MGZB 4J9QA 4BDPA 3PYDA 2VASA 2C28A 3U1NA 4X66F 5FD1A 3QATA 2RUGA 2W2NP 3CDAA 2VOOA 2OEMA 1S1TA 2UVWA 3H42A 4JI2J 3MWBA 2HMIA 2DO0A 2KKHA 2IAJA 4CI0B 3PW7A 2QGFB 1YI2S 2EBEA 2WOMB 3MOZA 3FZ2A 1SQFA 4TU8A 5FLXY 3S6EA 2BQUA 1S0NA 4FZVA 3TWZA 2YQ0A 5DGBA 3PW2A 3FUYA 1ZTTA 1FEHA 1XMQJ 2DNYA 2I9SA 2N82B 1MWQA 3UR3C 3Q86A 1X5PA 2CJYB 1TV6A 4N41A 1FRKA 4IH7A 4XDDA 4F3QA 2IJNA 4IFYA 2ROPA 1QSYA 1MW7A 2HURA 3DFEA 2I6WA 1GTEA 1GAOA 3BO3A 4Y2AA 3MMAB 3UN3A 4TYAA 3POTA 2E66A 2DGQA 1OO0B 3QGIA 1VQOS 1TFYA 3HLUA 4JUZA 4JI4F 1RAJA 3QNWB 1HIYA 2AJFE 5HAOA 2RNEA 2RKIB 4OV6A 4OX9F 3KKFA 2QL9B 4EBEA 2ATCB 1FA0A 3R6GB 4DLGA 2B9EA 4ZLPA 2E5JA 1AB8A 4X4VA 2AIRB 5M2UA 2XEXA 4KKOB 3BBBA 2LQ9A 4AT1B 5A76A 1RT3B 4H4MB 3QLHB 2F65A 5IV4A 4X62J 4CLUA 3HVAA 3WHIA 4K4WA 1Q16B 3OPKA 2KFZA 3GTYX 5HVGA 3DGPB 5GAEU 2V2KA 4UOHA 1NDPA 4RBTA 4FVMA 2W01A 2DRAA 3SEOA 5ETQA 2F4FA 5J2QA 2NPFA 3MUTP 4M1KA 4PWDB 1N33J 2YKQA 4ECTA 2M2BA 2H9ZA 1Y5IB 1R7IA 2HGLA 2AD9A 2O3DA 2UUTA 3R5DA 4ZCIA 3PXGa 3SQGB 2RVJA 1TK5A 1NKCA 1FCAA 2XMJA 2D3ZA 2JFDA 1K9MT 2MQLA 2CAJA 3CC4S 4DCPB 1TMJA 3HD2A 4PWUA 5KFGA 4DFPA 2BKOA 1TUWA 4Z7CA 3SFUA 1FJCA 2EKYA 4JOUA 1J2VA 4CT9A 2BXJA 1RTDA 2V8DA 3KG4A 3BSCA 1VJQA 1D1UA 2VKZG 2EK1A 3RB6A 4LBHA 2VJVA 1YJUA 3D6TB 4F67A 3PHTA 1D9AA 5ADZA 1YG0A 3G6ES 3DRRA 1RBAA 4WP9A 1UL3A 1MSWD 4YR0A 3GV7B 1TUGB 4OYXA 2MPUA 2DH8A 4N56A 4Q5VA 1T9VA 1S6PA 1Q95G 1HNVA 2K06A 4DSIA 1EETA 2C3PA 4M5IA 5EGYA 4TQRA 3BGLA 4LF1A 2FLLA 2QE5A 5J2PA 5HQMA 3AOCA 4DWIA 1UAWA 3ADAC 5E7OB 1S5ZA 1OWXA 4OL8A 5C7PA 1NEEA 1GXLA 4LBPA 2UXCF 3KNAA 1RT6B 2H5IB 2HW3A 1NXIA 5BYRA 1GXUA 3ISND 3OFFA 1HL6A 4KGMA 4J91A 4BC9A 3MEGA 2V9KA 3N5FA 4ERDA 2UUCF 3S1TA 4F50A 1KKHA 5KG6A 1TK8A 5HP1A 4ZVTB 3LA0A 1D3WA 4R5PA 4KY3A 2GZOA 3IGNA 3ET6B 1PSDA 2CNOB 3FQLA 2CJAA 2JX2A 2GIQA 3G87A 1RUSA 3CCQS 2W25A 5DDOC 3CJ5A 1OQ6A 2ZHOA 2CNNB 1LKZA 1SKRA 2V50A 2IYGA 4ID8A 5GAHU 5JXSA 4IFVA 2ZDOA 2C3OA 4RKUC 1RI7A 3GG0A 5DLFA 3RZAA 1R3NA 2EC0A 1B3TA 4DL0C 3GONA 3TO8A 2HNYB 4OI3A 1ZZNA 3MM5B 1A0OB 4UQTA 4RUAA 1SL1A 2DXDA 2R2UA 1N32F 2MZQA 3WZ0A 4QW8A 4PKDB 3SI8A 5L1KA 2B8PA 2AYGA 2E9RX 5K9FA 5EUHA 3P5TL 1C1BB 2YNHB 2JEFA 4TU7A 3JSYA 1U2FA 2XO6A 5KFSA 2MTLA 2JC1A 4LSNB 5GMEA 2J7UA 3QIDA 5H1SV 2AZ3A 2YX7A 3KFWX 4TU9A 2OIHA 1RU1A 5HJYA 1CBKA 2Q6BA 2EG1A 1F3VA 2YNIA 2J5AA 3A1YG 1HBMB 3KJNB 1KFDA 4OI4A 3IC1A 1DBDA 5C24A 3C8YA 4DR2J 2V8PA 4K0KF 4DV7J 4DPXA 3T19A 3KLFB 1LWCA 1UW9A 3M8PB 1YIJS 5K14B 3DOKA 1KFSA 4C8YA 1XERA 3I5CA 2BE2B 2X1BA 1SC6A 3HJFA 2YWWA 4F36A 3W61A 4F4YA 1X4CA 2QJ3A 5IV3A 2DJWA 4O4RA 3KTQA 3CC2S 5B08A 2EKNA 2C1EB 2WB1D 4YB7A 3RBDA 4DV4F 2PGCA 2K1RB 2Z2YB 4P74A 2K3KA 2YKAA 3O3LA 2HQFA 3M6VA 4OI1A 4ED2A 2OTLS 4CRJA 2QSFA 2OTJS 2P2CB 1HNWF 1RCXB 2DPJA 5LMUJ 3B8HA 4G1PA 1N5QA 2MLXA 1T8EA 3VVUA 3VAIA 2HAFA 2DT9A 3UI3A 3R9LA 4H4KA 2E9TA 4Q45A 3EVOA 2YKNB 2QX0A 5FDLB 3SFGA 2R7XA 2HS4A 3PFEA 2IIHA 4GRSA 4LRAA 5A8RB 3SSQA 1V3RA 2ERRA 1B4SA 2M0GB 4WE1B 1Q82T 3ZFVA 4PG6A 4USUA 2DNNA 2ZBQA 1AROP 2H5EA 2DNQA 4KT0C 3IGVA 4Q7AA 5IWAJ 2PEBA 4ZHRA 1F5CA 1C1CB 3VVTA 3J7YU 4IOCQ 3P45B 4ATNA 4LFCF 4LR8A 2VODA 4ALZA 3PX4A 4KAIA 2HFOA 2HK2A 1TKTB 3I87A 2BBEA 1CEZA 3MMBA 3W8PA 1GT8A 4IYQA 1AW0A 2BJEA 2ZC3A 4ZPDA 4N8OA 3EZOA 2FJAB 2WONA 1VRQC 3C6TA 5GAGI 2O01C 3OD2A 3KYLA 3DMJB 2Z30B 2MKJA 1T94A 4DV1F 2Y8YA 1FFGB 4M8LA 5HLFB 1WC5A 1EP4B 3GIKA 5KT7A 1NJIT 2Z2ZA 2RSQA 2HVDA 4U9RA 2EFOA 4TKTA 2NYHA 3D3BJ 5I42A 4LFAJ 4DUZF 5LSRA 4HHJA 2IRYA 1E6YA 3FRYA 1TK0A 1F0XA 2VZ9A 4USVA 1RBLA 4NLTA 2OD4A 1PG5B 3ILJA 3OFGA 1KBRA 1RWKB 5LJ5Y 3CCTA 1F2GA 3OSPA 3CPWR 2J8SA 2ZE2A 4M5HA 3CJKA 4WXWA 2ZZTA 2AU0A 4JV5F 1FO1A 1TUVA 2RUSA 1VQ7S 1IM4A 5CYMA 1KP6A 3CCLS 1XQIA 5A8WA 2C2DA 4Q8FA 4OYWA 1L3KA 2XSJB 1QAIA 4R0JA 4NLDA 3IM8A 1FK9B 3VGVA 3V2UC 3SIPB 2IA0A 3LAMA 2HQCA 1YJRA 1VBXA 1Q5YA 2HYIB 2R7WA 1X9MA 2FLNA 1R8AA 1RXOB 3OLBA 5KFHA 3PJWA 4M95A 1CPZA 4QR1A 1YBUA 2A0FB 2O67A 3HVTB 5DLGA 2B7CB 1U1LA 1CVJA 3W2VA 4IH5A 1X4DA 4NI2A 3DDNA 4DZ6A 1Q53A 3LP1A 2W4CA 1DQ8A 1X4GA 2JVRA 3NCRA 2DNRA 4YS2A 3ZNUA 3M2UA 4NX9A 3C14A 1VLYA 4LR9A 3SMZA 4J9MA 2WSFC 1S6QA 2NUHA 5C2CA 2UXDF 4L73A 4NRUA 1ULRA 1BE4A 2HGNA 1JLEB 2E5IA 4USHA 1BY9A 1FRMA 5DG8A 1H6KX 1KS2A 3GWCA 5GADI 1NB7A 2FPHX 4JI8F 2RQMA 3DRPB 2W9CB 3AY0A 1VBZA 3OFEA 2GJIA 4NZ7A 4F04B 4OZ2A 3JSMB 1VR6A 4QWDA 1FRHA 1FD8A 2KH9A 4C0OC 3C66A 4B3SF 1UPPA 3CE8A 3TJAA 1FNOA 2LEAA 3CWJA 4CLWA 4DQIA 1REVA 2W1BA 2UUAJ 3NS6A 1P9QC 4KJIA 2E1MC 2DB1A 4AL6A 4E8UA 2QYCA 4ICLB 3SCJE 3HHLB 4O4GA 3OTBA 3THPA 1OYEA 2CFXA 4Q44A 3NAIA 1Q1KA 3VZHA 4RW7B 4ECVA 3K5OA 1Z2ZA 2F8HA 5K20B 5MLCV 2VDIA 5KOXA 1XK8A 3PNIA 2QA4S 3IBFB 4LBIA 4HYKA 2VD3A 2DCLA 1FI4A 3CJ3A 4ED3A 3PX6A 2BE7D 1LXJA 3HHEA 1YVFA 3GIIA 4AD6A 4I2PA 3OQ2A 2DVIA 5ETMA 4CLKA 4F4ZA 2Y0BB 4C8NA 1WHWA 1H7WA 2L48A 3PEHA 3GQCA 2DGOA 1FTRA 4ECZA 3MR5A 3DM2A 3LWMA 2Q43A 3DOMA 1Q86T 1NNDA 4LIRA 3FFIA 4GVBA 1VGYA 2YQ1A 4LFBF 2GIRA 2HVZA 3A8IA 1CC7A 2WVCA 4G6VB 1T05B 1MROB 5K8NA 3W5YA 3LWLA 5D4OA 3IO1A 4BBYA 3HK2A 9RUBA 2HFZA 3CJRA 3PKYA 2HFNA 1SKSA 4C8KA 3I9V9 4QZVB 3TUZC 4YB6A 4DV5F 3FVYA 4CYUB 3UD4P 2ZH7A 2R7TA 3KLHA 4X65F 4B3TF 2GVZA 3PW0A 4ZJQA 1WC3A 3IFEA 3IG1B 4MAKA 2I5JA 3WBZA 1C4CA 5L39A 4B3OB 3KUEA 2F63A 2AKWB 3RAQA 4HACB 2CKWA 1WG1A 1R8HA 5BYQA 1TKZB 3PIOQ 3UN5A 2BW7A 5F8GA 3PRBA 3OR2A 4TN2A 3AHPA 2ATLA 1IBMF 2AGQA 1E6VB 5BR8F 4DPWA 3D9BA 4K7QA 4HL9A 2GQQA 4F26A 4U7UK 3CCZA 5D78A 1DARA 1ZAXA 2GIFA 4KH1B 5ETSA 3IR7B 1N4LA 1CQMA 3DRXA 4ILRA 1NSAA 2WVBA 3EDQB 1BXNA 2PMWA 3E01A 3G6YA 1Q7LB 5HVFA 1HBOA 2IFXA 4NMLA 4KTQA 3DXSX 3ZXWA 2FVPA 3N9UC 5HSPA 1OYDA 4KFBB 4OHXA 4OHVA 2ZKTA 4FS2A 2G4BA 1G6BA 1T3OA 2OSRA 2V2VA 1RZMA 2VF3A 4B02A 3BKFA 4ECWA 2B56A 3THVA 4Z37A 3G71S 5AE1A 1U8SA 4KHPJ 1RWXB 5KFJA 1SIWB 3G86A 4MIAA 3SSSA 1YWXA 2VFUA 3K8VA 2Z0GA 1RCOB 3EUNA 2KM8B 1U7LA 1IUJA 4WWSA 1UFWA 3OUYA 3T1HJ 2H5JB 2R42A 5U47A 4G1QA 4BWJA 1NCLA 2ACYA 1RADB 1VC0A 5KT5A 2KU7A 2LQJA 1Y00A 3HO1A 1NO8A 2CUYA 5KG1A 4ZLNA 3R8YA 1PYOB 5KAKA 4A46A 1HBNB 2MJUA 1WUUA 2CG4A 1FEEA 3RJMB 4O3OA 2VB6A 2B4VA 1JLAB 1WOPA 3W9JA 3N0VA 4A8MP 5A0YB 2Z8QA 4Y2IA 4MFBA 1ZAVA 3H8YA 2B6AA 2RQCA 1MN9A 1W2IA 4JI1F 3V81A 1TL1A 5CD4H 1MLAA 3QZ7A 4IQXA 1JLQA 5C42B 2DGTA 1AZSA 2OPQA 1JJCB 2GAGC 5GMDA 1RTHB 3MHYA 5EWGA 1NUEA 4CLPA 4B9MA 3EGVA 4OZ0A 1XJWB 3HX9A 3TVKA 1YJ9S 1LNQA 2XS7A 4RNFA 2V2ZA 2HWHA 1RWWB 5KFPA 3IS9B 2FIUA 1H3DA 2AGOA 2F4VJ 2DD8S 1IM6A 5AE3A 1H0HB 3I96A 2CZ9A 3OJUA 4L76A 2UVRA 1LWFB 5E33A 4OLOA 2B7BB 3DLHA 4DFJA 4P71A 3JYTB 3B82A 3GU0A 3FJ2A 2RDJA 3UO0A 3T1YF 5ETRA 3BDEA 2I38A 5L1IA 3OSNA 3LP0B 4PQUB 2GVDB 5K8MA 4NZ6A 1KD1T 3N4WA 3OTDA 4MK9A 4DR3F 2MZRA 1EQ0A 3BGFA 4V19X 2KZZA 1GEHA 1T3NA 2VPXB 4X4RA 4DHVA 3C16B 3J7Z5 1OS5A 4NLUA 1FDAA 3FBBA 4KBIA 4EYHB 4USWA 5LOQA 2V69A 1HLWA 1S1XB 2W9AA 4WU3A 4DV2J 3HHLC 4JI3F 3ENWA 2MKIA 3BDPA 4NE9C 1FFSB 3AA8A 4ZCMA 1OY9A 5BJRA 2RT3A 3TUPA 2AJQA 1JB0C 3GJTB 2KT3A 2QFIA 2G1DA 1OSDA 4JI5F 1IKWA 4NLOA 2W7OA 1WOOA 1IR1A 1FVSA 4EUVA 2ZH8A 3MEEA 4ZOSA 1S9GB 3DRSB 5HBMA 3HCXA 1TKDA 5IT9U 3QMQA 2DIVA 3KDOA 4J9RA 3HDSA 4KO0B 4L72B 2C2OB 3HF5A 3FNNA 3OL7A 5J1NA 2KXNB 3ZZRA 3GCWP 4N5SA 4KIAA 4ZVFA 3M9OB 2VPZB 1SC1B 3PHEA 2Y9HA 1G2EA 4RL1A 4RW6A 3K5MA 3AH6A 4DL6A 4N77A 3ICLA 2YWFA 4PPZA 4CM0A 1EB0A 3ZZTA 4AL5A 1Z1ZA 3MMCB 3SZ2A 3RBZA 1Y10A 3L7OA 1HD1A 3AQOA 3HSJA 1VISA 2IDLA 1SJ1A 4I2QA 2BMBA 3QJJA 1UFLA 3DLBA 4NYPA 1BQXA 3S8SA 2DHGA 2KXHA 5KFBA 4W90B 1L3SA 3A4TA 3Q83A 1FKOB 2MYFA 4OX6A 1VQ5S 1SIZA 2AEMA 1RHQB 4I1TA 2QA2A 2CPZA 2W9BB 3I0SA 1FNMA 4ZPAA 3PTWA 5L8RC 1R0AA 1GMVA 1URRA 1EKSA 2FHJA 1Y9OA 1WHYA 2W2QP 5IFMA 2Z4PA 5C2GA 4RUCA 1U0HB 3IMQJ 2KJVA 4KRWA 1NJYA 4P7VA 1DTTA 1HQUA 3J81U 2MB0B 1R6VA 3BBCA 3I82A 1C0TB 5F41A 4Y34A 4DPUA 5M2PA 4FXDA 4EO6A 3BN4A 1HI1A 4IO1A 4NCGA 2FTRA 3I0RA 1WJ9A 4J9OA 5CA5A 4PG7A 3QBCA 1HQEB 1FWLA 5FIIA 2R7RA 1IXKA 4NWBA 2DK2A 3CJ4A 3QSYB 1T03A 4QWCA 3W5XA 2DY9A 4PXEA 2GX8A 4LF9F 3HVRA 3QGHA 2XMUA 4Q0BB 1TL4A 3W7BA 3QFWA 3DYAA 2PE8A 2RS2A 1HI0P 4LF7F 1Q8BA 4K4ZA 2HNZB 3QO9B 5CZXA 2MHEA 5KT3A 2MQMA 3ZZYA 4ZVOB 4LRFA 1WDTA 2KVQE 3MCNA 3BM7A 3PG9A 3W66A 5GAGU 2FJXA 2OH2A 2JEGA 1IQTA 1XMOJ 3CD7A 4PG4A 4PYAA 1M5SA 1QTMA 2VG7A 3OXLA 4MTPA 2BM1A 3TQ1A 3P49B 1PAUB 3HULA 3KXDA 1BWEA 1RACB 4DSLA 1LW2B 4UY85 2DITA 5IQ6A 1N36J 1T11A 5IM0A 3UDLA 2GGPA 1TAQA 3WC0A 1DTQB 3QT5A 2PC6A 4QIFA 3I5AA 3TAMA 2FY1A 1FJGJ 1TVRA 1VQ9S 4XAKA 3J80U 3DCAA 2PSZA 1HNZJ 4P75A 2HLTA 2P6SA 1KC8T 1H2VZ 4IG0B 2K7KA 2Z2MA 2BDPA 4LRBA 3FZBA 1S72S 2JLGA 2EFVA 1WEXA 3ISNC 4ES1A 2PA8D 4K8RA 1TL7B 3IA0A 3T6JA 2ZFHA 2G2ZA 1F9FA 3NXZA 2C2RA 4IUFA 1YITS 4A8YA 3N5BA 1UP1A 4QIVA 2YXLA 3MMJA 2XHCA 3GV5B 1OIAA 1NK5A 4M63A 2V6AA 5ITHA 4DSJA 4DQRA 2R7QA 1LXNA 3LF0A 5ETTA 2LQBA 3MAQA 1RTZA 2VJUA 1ITPA 1NPKA 3DLJA 4A8SA 1FT8A 5DQGA 1X4FA 3MXHP 1Y0HA 5A8KA 4FXVA 2FVQA 1WI6A 1Q4RA 3M2RA 4ANDA 3HVWA 2WK4A 2RE1A 2VPWB 5K5MA 5A6PA 1VRTB 5HQ8A 4ED1A 3WX4A 4YQWA 1RSCA 1RAHB 2D3OR 1OQ3A 2HHQA 1S76D 2B9YA 1TZ0A 2U2FA 3T41A 3KUHA 4Y28C 3LGNA 3R3TA 1XNQF 1U45A 1R31A 2VA2A 2W2MP 1U6BA 3MPDA 4U67Q 2VQEJ 2A6MA 3HM9A 2H4YB 4USJC 4KH0B 4WXOA 4F0MA 1LWEA 2LXIA 2MXYA 2OEJA 4NLXA 2E7WA 3AJDA 4FF4A 1YQHA 8AT1B 4X4OA 4FVCA 2UZAA 4C48A 3QJLA 1T0TV 1VQLS 1K44A 3SQOP 4NXNF 5DM6Q 1ZPVA 4C97A 1RWMB 3Q8UA 3K59A 1HFEL 2DR5A 4TXSA 4ZVUB 3CCRS 4CO5A 3V4IB 3G82B 2GO8A 1JNRB 8RUCA 3NGKA 3D6FB 2AJ0A 4R8UB 4K4SA 3CB4A 2UUBF 1U1QA 1LQ9A 1I94J 2HNDB 2QIFA 2ZHAA 2OO4A 3M32A 3V4MA 1ZTWA 4NXMJ 1N6QA 2J9DE 1SV5A 2UVUA 1VQ8S 2AWZA 4TY8A 1J5EF 3MR7A 3MR3A 1Q5VA 4CH0S 5HO4A 1Q8KA 3W2WA 1U0SA 3MURP 1VRUB 2FJDB 2MY8A 3M8YA 2JFKA 1U6FA 2CXEA 2QN6B 3MM7A 4MYUA 1S1TB 3ILOA 3KHLA 4B9NA 2RKIA 2RH3A 3BZQA 4JI6J 2HMIB 1IBKF 2JC0A 3PW4A 2JDJA 4PYDA 1SL2A 1GX5A 1BHNA 1F60B 2BQRA 3D0IE 3E3XA 2HHPA 3NOGA 4KKOA 2Y1RI 1CULA 2IMOA 1NRKA 2O66A 1MG7A 3N6NA 4PQAA 1HMVB 2XYHB 7FD1A 5I4MA 3QLHA 5KFDA 3NNCA 3TUIC 3NGRA 1UA1A 1S48A 3GIMA 2YWEA 3DGPA 4AQYF 1OPZA 2PT0A 4N8NA 2XMMA 1DJ0A 3MEDB 3OLAA 5AJ3F 3R2CJ 5FJ4A 3KHRA 3QWPA 4I56A 1U6ZA 1HHQA 4F7VA 1QY7A 3QSIA 4PWDA 1X5SA 1DQAA 2YH1A 4IFYB 4OJHA 2ZH9A 1QUVA 1XNRF 1FWKA 3FCHA 4ZJLA 2HFUA 1WSVA 2CVEA 2IVYA 3DLKA 5ETOA 1RA6A 3POTB 5GVQA 1YK9A 3FSIA 3LO3A 3D2WA 4LSZB 4OZ5A 2F5GA 4YB5A 3LTOA 5ETVA 1YHQS 3DU6A 4DV0J 1TFWA 1KTVA 2ZDPA 1HW8A 4LR7A 4ANCA 2MKHA 2MZTA 1TELA 3QQCD 2GHVC 4B9SA 3HSGA 4DPOA 2LU1A 1M1GA 3HSZA 4JV2A 2JH3A 3HT3A 5E3QA 5HL7Q 4UY8T 2HQ3A 2DHXA 3DLEB 3FEYB 4HH0A 4DV6J 4CTAA 2E7VA 3CTRA 3VAMA 4UOCA 3QAUA 5J2QB 2HIYA 1B64A 3U27A 4DR5J 5DDRC 2ZH2A 1TMMA 1K1SA 1QM9A 2R8HA 2HQIA 4PUOA 3TAPA 1SI9A 2VG5A 4QR0A 2JZ5A 3H5YA 1NK0A 1RT6A 2L9WA 5HN0A 2B43A 3O44A 4W92B 1QD1A 2DNOA 3T9ZA 1W2BR 4F25A 1XTZA 2GFFA 1RTDB 3BGUA 3NGUA 1M5OC 3M4XA 4IG3A 1HYSA 4QYZK 1HNXF 4LF4J 3BKTA 4C2MA 3KLVA 4WP8A 1VQNS 3DRRB 4CO0A 4KGVB 3HHNB 3NS7B 1SUQB 3B6BA 4JI7F 1XEZA 2DKOB 1EETB 3IM9A 3SV3A 4AUKA 4GC7A 5J2PB 5SUHA 2EEYA 1S79A 2N3LA 2HNYA 3IXQA 5G4DA 4LF6F 1WHXA 4PG5A 2D3O1 4YY3F 4WYWA 1JLGB 2PFDA 2PMHA 3MUVP 2BJ8A 2A10A 4YP3A 4F0KA 4DF4A 5CABA 4F4KA 1C1BA 2YNHA 3MPVA 4HH1A 3F73A 1SH2A 2E5LJ 3DDKA 4ZVHA 4LSNA 3GR0A 5HP1B 2HHTA 3MD3A 2DBBA 5J2NB 4GKKJ 1HBUB 2BOPA 1ZM4A 5HROA 3LPYA 5E5NA 3E8OA 2OFHX 2KG0A 1HBMA 3DXBA 4M5DB 3NY0A 3FQKA 4DPTA 3D5MA 2Z57B 4LT6A 1HWJA 4U95A 1S1UA 1TTHB 3OTEA 2J0XA 3KLFA 2POKA 2QL5B 3M8PA 5K14A 3SCIE 5LM7E 4ZVGA 4I69A 1AUDA 2HBYB 2E29A 1VHIA 3MZIA 2ZBRA 2HZVA 3OHAA 5D3GA 5DZ6A 2K1RA 2WSCC 2HGMA 5D0RA 4CDIA 2Q3PA 3J7YI 3BS9A 2V34A 2VBWA 3LW5C 3PR5B 3MFIA 3PYGA 2CIMA 1PC5A 3ZTPA 3IP0A 2NPIA 2HSEB 4RW4B 4AFFA 2ZH5A 5LSOA 4M5KA 5KFMA 1KLNA 4F02A 4JYAJ 4A48A 3KWMA 1ELOA 2FY8A 5EDWA 1WD6A 3CDEA 1U4BA 3JTNA 4DG1B 3SV4A 2ADBA 3CSKA 2D69A 4RUBA 4AXIA 5C24B 4LSLB 2P9EA 4HDGA 5A8RA 4TNOA 1PKUA 2JOQA 4ES2A 3MTKA 3PACA 3JQKA 2NSCA 1FKPA 3A8KA 3TQEA 1LWCB 4DL4A 2CNKB 4ZDNA 4BWMA 2CDRB 3RAMA 2GQCA 2BJ7A 2BM0A 4WU2A 2G13A 4G3IA 3BGRA 1C1CA 3OV7A 3IWLA 1OSCA 3PCOB 4WFAQ 4KE5A 3UD5A 4QPTA 1U1NA 1F5BA 5KG0A 2VBZA 3ITHB 3EYZA 1AYEA 1Y3JA 2ROGA 2ASDA 2C22A 3DOLA 1QSLA 4DR1F 1ZH5A 3B4MA 1NJXA 3FBFA 3MD1A 1XR6A 1RTIB 4X64J 4CH1A 5LL6d 1FXRA 4WFZA 1HWIA 2CDQA 2XWXA 1U49A 1NZAA 1SXLA 3BQ2A 4YDDB 2R2SA 1J5OA 1KEKA 4ECQA 1RAGB 1IBLF 4ZP8A 5B0BA 2CQIA 3QRQA 5MAOA 4ZHRB 1N5TA 3DU5A 1H2TZ 4DSKA 3MM9B 5F8JA 1WORA 3RUBL 2YQ3A 5J1EA 3FBEA 2QLWA 2DNGA 4CLLA 1HR0F 3GJSB 3MMBB 2ZH6A 4JBCA 1NPPA 4QU6A 3EZUA 2V94A 4ANEA 2XSJA 2IA6A 5LXYA 1IWGA 2WONB 3MAHA 4WIQA 3OFHA 3FK4A 1FK9A 4J5OA 3MUMP 1TQLA 3GSIA 4DUYJ 3EWGA 1RYRA 1T9TA 2IBOA 1NKEA 2UV8A 1N34J 4OZJA 3CCES 3BYRA 3D1OA 4CLTA 1U02A 5I42B 3M8SA 2V8HA 4DCOB 2VICA 3AFGA 1TKXB 4ELUA 3HVTA 4KHMA 5EX3A 2KYZA 3UWTA 5IZHA 1KQSR 2LDYA 3TOQA 3A8JA 4F4XA 2FZGB 2KZMA 2WCXA 4R25A 2W2OP 4ED5A 4XPEA 1HPZA 2NZ4A 3BQ1A 2AYBA 3CO0P 2JLEA 2ZE2B 2XGPA 3CCSS 2IM2A 4J9NA 3UN2A 4DR7F 4CO2A 2KN4A 5KFWA 5CYMB 2XMTA 1VQ6S 4ECRA 1UJ6A 3KDNA 5A8WB 2XSFA 4PPDA 1G7CB 1JXLA 3N6LA 1JLEA 1HHSA 4UOGA 2WAQD 4CZCA 4EMDA 1D9DA 1JKHA 2GJ2A 3U1LA 5F0UA 4A8OA 4PCQA 2V4JA 5KG2A 4OX7A 4MIWA 2LA6A 2XGQA 4MK7A 1BQMB 3H5UA 1LOUA 4QPXA 3IWNC 2CRLA 2DEIA 5ETPA 4ZN3A 4F3MA 1X60A 1S57A 3KK3A 4C11A 1NHKL 4U8VA 1FE4A 1Q0NA 5HMWA 4WZQA 3NEKA 4GKJF 4YHHF 4NI2B 1NJZA 2HBZB 1RT5A 3BQ0A 2R7SA 4DR4F 2HPUA 3MEKA 5F8LA 1SB6A 3W5ZA 2PDAA 1RWUA 5I3UA 4B9VA 3HHDA 2IPOB 2XLKA 4ICLA 2CQ0A 3M2UB 2R3VA 3C14B 2XY7A 2XS2A 2E9ZA 2HHHJ 1NU4A 3ILLA 1VS3A 2J7WA 4RW7A 5DO2A 1UEUA 4HDHA 1NH7A 3DRYA 4NEZA 2NYIA 4J9KA 3MI7X 2LA4A 1VIOA 4BS2A 5J2MB 2X3DA 2KFNA 2Q79A 2HLUA 2J7KA 4ECYA 4C0HA 4QCLA 3IN5A 3OTOJ 4WPAA 4ID5A 4KYZA 4DR6J 4HEA9 4O23A 4X4TA 1FESA 1ZA1B 4OZNA 5T41A 4LRDA 5C5JA 4Y2MA 1RHUB 1YBTA 3OW2R 3D28A 4B3RF 2RS8A 3BJYA 4X66J 4GO7X 3W63A 2Q66A 2LYVA 1MROA 1REVB 2ILYA 1EZZB 2ASJA 5L1LA 2YKOA 4KPCA 2XMVA 4MYTA 3DLLQ 4A47A 1VQPS 4UT4A 2GHPA 1UZHA 4C0BA 1M90T 1ZBTA 4O4GB 2H1YA 3R7NB 4CYUA 2GHWA 2D3UA 1WG5A 1NSKL 4DCJB 2AJ1A 4K2JA 2CPIA 3H20A 1S1WA 1RT2B 1ROFA 3Q23A 3OXFA 2DRBA 3VTIA 3UPFA 5KFNA 4RW9B 4NA1A 2YNFA 1FXLA 4KB7A 1PC4A 7AT1B 1XN9A 3A3NB 4I2PB 4ED7A 4HACA 2AYMA 2R9LA 1VYAA 2UV8G 4CQ1A 2G0JA 5DS7A 2HEKA 2CQ3A 2IRUA 3DM2B 3DOMB 4FP9A 2D41A 3W64A 1QJHA 1U2CA 2I8EA 4CLZA 2F8EX 1GH8A 1QSSA 2X1FA 4UTGA 4H4KC 1IKXA 3W1YC 1T7PA 1FRXA 4P7TA 4JI4J 4IRKA 3DI6B 3DLGA 4NLVA 2XM3A 1NK9A 1WTBA 1D8ZA 4OX9J 4KFBA 4DN9A 3CIZA 2RDIA 5DQIA 1SC3B 2ALZA 1RT4A 3KLHB 4F4AA 5CYQA 3GFZA 1T9XA 2ZVSA 2BKPA 1S4EA 2GVZB 3D7SB 4ZLLA 2ZITA 2CYYA 1CS4B 1R43A 3KLEB 1FX2A 2XCAA 1NAQA 1NSQA 5E3RA 3AXMA 1K73T 5C25A 1FJ7A 2UUWA 2ZM6F 2HKEA 2PN6A 2OLWA 4PG8A 3HFVA 2UXBF 4XO0A 3Q8QB 4PABA 2HG4A 2BX6A 5B0CA 3CCWA 3P4UB 2AW0A 3NG8A 4QYZJ 3OJSA 3CJ0A 4ES3A 1WF0A 2WHOA 3FEXB 3E01B 3FGVA 2YPZA 1RE1B 4ZITA 4OX8A 2J8AA 3BN7A 4LMZA 2JRSA 4CT8A 2CZVC 1GX6A 1AT1B 2KXFA 4DJBA 2ZOGA 3D3CJ 4RNNA 1U48A 4O3RA 4TYBA 2DR9A 1UWBB 3PJ9A 2B4PA 4DS5A 5C42A 2CPFA 1U8WA 2ZOMA 2JNJA 4ER8A 3L3CA 2E5HA 2CJKA 4J9LA 1YBAA 4ZPWR 2F8MA 2QA1A 2DHSA 1F5AA 4QIGA 5D77A 2HS3A 3S7RA 1NK8A 2F40A 1UTAA 2VQFF 3OUYB 2PO4A 3PYFA 5KFXA 4G1QB 3CJTA 5AXMA 1EAYC 3PFOA 3IS9A 4QQBA 4ZIWA 4O3PA 2BACA 4LF5F 3T1AA 1LK5A 4KV8A 1S1VB 4V19J 3JYTA 3AODA 3RRHA 4NEYA 1V5VA 2UXCJ 3J7AN 3TJ9A 5DDQC 4PQUA 2L3MA 2GVDA 3M6XA 4ECXA 3LPEA 4ECSA 2BANA 2J76E 4DX8H 2UU9F 2B6AB 1HQ2A 2M4MA 3TARA 1BLUA 5DRKA 3V81B 2UUCJ 6FDRA 3EM1A 4QWBA 1TL1B 4X2BA 2GJFA 3OHBA 3WQPA 3AT1B 3HP6A 4HLBA 4AXJA 1NZ8A 3EVWA 2OPPA 1JLFA 1SQGA 2CPEA 2IY5B 4OI6A 1S1XA 4URSA 2VDHA 2ZUGA 3M2VA 1SKUB 1U25A 2HVIA 2DPIA 3DNCA 1Y3KA 3AA9A 5D4LA 4OI2A 1BQNB 1XMBA 4YB1P 2IJFA 3GZ7A 1ZYQA 2DGXA 3F0NA 4F8RA 3K58A 5T7LB 3RRKA 1SJRA 3CD0A 4B08A 4WYLA 4X4UA 5IT9Y 4ZPBA 1S9GA 4FXWA 2LXUA 1N32J 2W7PA 2QA4G 4XTTA 1S7IA 1SBRA 3B54A 1M1HA 3CNQP 3QYYA 2DR7A 3LOUA 3IRWP 3VHQA 1N5YB 5EHHA 4M5JA 3VQSA 3W62A 1R0CB 3KNGA 3V6DA 1I6JA 3KG1A 4ZVQB 1OJ4A 5E3PA 4OV1A 5KFKA 4LQ3A 2ROEA 3NGDA 1PO6A 5H9EK 3RRGA 2RQ4A 3IRXB 3H40A 2R8KA 3L7PA 2VIHA 1WF1A 3C6UB 4E0DA 5LMNF 2CQHA 1K47A 4C3KA 3QGPA 3MMCA 2GW8A 3GE9A 4DV3F 3CJ2A 4ETZA 3M8ZA 1Z2LA 1P9YA 1UA0A 2PEHA 2YWHA 1WWHA 3SXLA 4CH7A 5ETKA 2A2DA 2W8LA 2M70A 3QZ8A 4K0KJ 1VQYA 2DRDA 3H25A 3CD6S 4O3SA 4EZ6A 1WTFA 4B3MF 1WNEA 1VFJA 2EBGA 1IKWB 2BKNA 1PYTA 1DHMA 2ZD1A 4AL7A 2V4QA 1JJ2R 1NK7A 2N3OA 5HBMB 3CUNA 4USMA 2WVDA 3HKZD 2J6UA 1FE0A 4JB8B 2JSXA 4DV4J 2BJ1A 4N76A 3I9ZA 1U0HA 4NZ0A 3J81Y 2V0NA 4I68A 4MIBA 1QE1A 1C0TA 2LDIA 4ELTA 1UVKA 8ATCB 3NGSA 5JUMA 3I56S 1HNWJ 2Z2LA 2M7SA 2ZOFA 4OZ3A 3KUGA 3M7VA 2K2PA 1HQEA 1NK4A 2DXEA 1KVJA 1RAAB 4RW8A 2CQPA 2LCWA 3QPIA 4QYRA 4GVLA 4I2QB 3IAM9 3D6MB 4ZCKA 2Y1IA 4Q0BA 1UWAA 4ZKAA 1NB2A 1V9OA 3PY8A 2MHNA 4OJ1A 4NYOA 2GS8A 4JI0F 1RAFB 3I0SB 3QO9A 1TL3B 1NM2A 2KT5A 4WFYA 1YJ7A 5KT4A 3MPYA 4O3QA 1IKVB 4MKVA 4LFCJ 5SZTA 3K57A 3R7SB 5L9NA 3R5BA 3GYXB 4Y2KA 2FLPA 1VQKS 1DTTB 2KHDA 3MTJA 1RTJA 1NDLA 5AXNA 4H4OA 2BE9B 3M8QA 5IT4A 2DR6A 5HMXA 2OMOA 4DPYA 3C15B 4WIIA 1WHVA 1EKRA 1KSPA 3PRVA 4DUTA 4NCGB 1CLFA 2R7OA 4WBFA 3G8SA 3TR5A 2L9DA 2YKMB 4DV1J 1O51A 2H48B 4ZS6A 3LP2B 2ALYB 1LW2A 3CO9A 1KVKA 4DN0A 4PAAA 4OHZA 1JLCA 4FDFA 2XI2A 3D66A 4DUZJ 2LP4A 1RT7A 1H2UX 3J80Y 3MM8A 3K7RA 2HQGA 1FF2A 2H3EB 4D3GA 2D7SA 4HT7A 4FKXA 4B9LA 1ZA2B 1FDNA 4PZVA 2WTFA 1LEOA 3BEGB 4IG0A 4CNYA 2WBRA 1RLCL 1XIQA 5A6WA 2X7IA 1KOHA 1C0UA 3HFKA 2DIUA 4LF8F 4JV5J 1MMNA 3BH6B 3R5GA 4ZLJA 2OGUA 1NDKA 1CJKB 2ZWPA 1IJEB 5F3TA 2WVEA 3FEZA 7FDRA 4NPOA 4CLFA 2VBYA 4DL5A 1N0VC 1X4HA 3EZ5A 5KTQA 3AD8C 4OYBA 1M0SA 2V9WA 1KTQA 1T9UA 2R4FA 4MK8A 1N5VA 3R5AA 4JV0A 3WIUA 2WBMA 1KHWA 5IM0B 5HANA 2XB2D 1VOMA 2QL7B 2LEBA 1IN0A 1S12A 2JEIA 3CJ8A 2RJZA 3BPDA 1V3SA 4M5NA 1TVRB 2DXFA 3F41A 3VAJA 3H4DA 4PR6A 1VRTA 2YKPA 1R6YA 3I4HX 1QLNA 1SJQA 1H74A 4FBUA 2P9GA 5HQLA 1VIXA 1FX4A 4CCHA 1OPIA 1JXVA 1RP5A 4WP3A 1HWKA 2OPSB 5E3AA 2ZJRQ 2RF2B 2RB7A 2F1FA 2FGOA 3VV2B 5LT5A 3ETMA 4ED6A 2UXDJ 3AB4B 5KFUA 2Q1LA 3Q8YA 3B78A 1Z4UA 1YLXA 2GO9A 1U1OA 1KN6A 3VCDA 3THTA 1RB0A 1GQEA 2DGSA 4RNMA 3TJ8A 4JI8J 1UVIA 1S0VA 5AXLA 1NSPA 2FZCB 3OR1B 2ZBIA 3AOBA 1D09B 2ASLA 4FF3A 4ZCLA 1QVGR 4TQSA 4JI2F 1VCTA 2DO4A 3ZZUA 1T95A 4CWBA 2IC3B 4B3SJ 3VAKA 5A8KB 3I55S 2CQ1A 2HIQA 3V4IA 4ZMMA 5CCMA 3GV8B 4UZCA 3TUJC 1CJVA 5EWFA 1IR2A 4IOBA 4NLWA 3J7A1 3TRGA 1XMQF 4JP8A 3TZZA 2Y1JA 2HNDA 5F8NA 3PKMA 1CJTB 1TU0B 2VA3A 4J9SA 4E98A 3UCUP 2Y0SD 4B17A 2CJBA 3P96A 4ZA1A 5E0OA 2J9EA 4EU0A 4CIOA 3HHLD 1ZM3A 1CG2A 2AF6A 1X8DA 2OELA 3TW0A 5E2QA 3GLJA 5JVGQ 1R8CA 4OYOA 4JV1A 2CPDA 1S4FA 2DGUA 3H90A 3KMQA 2JJ4D 1KNZA 4IR1A 4U6PA 4LFBJ 4EI2A 2KTQA 2P5VA 1NHUA 2BEFA 4X4QA 4P9SA 5CQGA 4X62F 2RU3A 4P2XA 1HMVA 2DGVA 1SJ3P 2ASYA 3NWGA 4DV5J 4FBTA 1B0VA 3M32B 2M5YA 1DZ5A 3C3LA 3JAMU 3ISZA 4ZK7M 2XULA 1N6QB 1QTNB 1SV5B 4X65J 4B3TJ 3KHHA 2MZ1A 3GYNA 5D0HA 4TY8B 4HTIA 3MEDA 1FRIA 2HK3A 1N33F 5F8IA 1GTHA 2IM3A 3W2WB 4O44B 3QJPA 2NCKL 3HSDA 2C42A 4RNHA 4EWTA 2BABA 3HZEA 4ILMA 1NHVA 2CJXB 3T5HA 2AQ4A 1IBMJ 5BR8J 3MM7B 3Q2SC 4AE5A 4R0EA 2YNGB 1OY8A 2V8VA 4NYZA 1GFWB 3EXYA 2MQPA 3QT7A 2MKYA 3Q8RB 2R8GA 2N4DA 4NCAA 2XMAA 4O3NA 1NH8A 2UP1A 4YR3A 3L7UA 2QLBB 4RWWA 1CULB 2L08A 2VFTA 4I4BA 1WC4A 2V5HG 1WC6A 2KG1A 4QR2A 2FZKB 3KK2A 5RUBA 2L9NA 4DQSA 2ZH4A 2EG2A 2HVEA 2RRBA 1Q8LA 2LKZA 3MAAA 3DLEA 2ZEJA 3CVKA 3M1VA 4L6V3 4FNHA 2AMCB 1KOOA 5IC4B 1F3FA 1CQNA 5KFRA 3BGOP 1B0TA 3CC7S 2FJWA 4GMKA 1IWAA 1XWLA 4Y3CA 3T5LA 3RW6A 3I32A 2HRTA 1REGX 2BOAA 4M5MA 4NA2A 3DLKB 3NGTA 1H38A 3H2UB 4PXCA 2GQ2A 1B7YB 1W25A 3TVYA 1CSJA 4MKYA 2FVCA 4DI6A 1RWNB 9ATCB 1IKYB 4ENOA 2RMLA 2N7YA 5HI7A 3RR8A 2VPYB 2XNRA 2H54B 1ZOTA 3BYPA 2LQ5A 4KHRA 3MCMA 2V2QA 3QWUA 1FWPA 3UDVA 4LVNP 2A18A 2IHR1 4JI1J 1HD0A 4MMOA 2NZCA 1VJWA 2BRLA 4DOZA 4NLRA 1XC9A 3MM6B 2YX4A 3SDEB 1HNIB 1VHFA 4CTAB 4C6AA 3BBFA 1SUQA 3ONQA 1YZ7A 3HMJG 3KJVA 3ZO7A 3KLGB 1F2HA 2WB4A 1M1KT 4RZRA 3JS9A 3TP2A 1U1KA 3ELHA 5B0EA 1X5OA 4OFZA 4YMEA 3KLIB 2H4WB 2IM1A 4PUOB 2AV5A 3X1LB 2XCPA 2VG5B 4A8QA 2G0IA 1JLGA 2QMXA 2KDOA 4C3MA 5H9EJ 1SCJB 5HJXA 1WEYA 2ZH1A 2QMUB 1UFKA 4HHUA 3GMGA 4NLPA 4WFNQ 2NXNA 2K8GA 4I7FB 4QIEA 2EFNA 3T1YJ 4HTJA 5J2NA 3RBEA 2CG8A 1HBUA 2VC0A 4IG3B 4OHWA 4O0NA 1HYSB 1LFPA 2VL1A 3CCUS 3Q89A 5IQQA 4DR2F 4DR3J 3EGWB 4DV7F 4M5DA 5IC6B 1X5TA 2M52A 2QTWA 1X4BA 2MQ8A 4C8ZA 3BPSP 5AE2A 3CF5Q 5KFTA 2KL8A 2NXEA 3BR8A 2B5JB 4P6QA 5E3CA 1KLMB 4NOHA 1CC8A 1N48A 3JSRA 4JI3J 2JL9A 3C46A 3F56A 4KQZA 2BJ3A 3A3PB 2HAIA 5G0RA 2AGPA 3GIRA 1XR5A 1S9EA 2B9WA 4JI5J 2WW8A 2FD2A 2B8QA 2F3JA 3PIPQ 1V5IB 1N0UA 2EFPA 5K8PA 2D9PA 4IQMA 2XHWA 3Q2TC 3W8GA 1CJUB 5LMUF 2AZ1A 3EGZA 2A1BA 1FKAF 1LWXA 2B4OA 2MQOA 4RW4A 3PV8A 3QIPB 5D4NA 3VR1A 3M30B 5B0DA 3N79A 5HROB 2DNPA 3MR6A 2QC3A 5DG9A 1S59A 4EYIB 4U7CA 1RKIA 2CWKA 1X0FA 2DY1A 4DG1A 3G6XA 3AOAA 2QV6A 1S1UB 4LSLA 3LGHA 3VGTA 2QSWA 2FJEB 3MECA 2BYCA 2LEPA 2CQDA 5IWAF 3GIJA 1DLOA 2F9DA 3D54A 2DGWA 3HD1A 3JTPA 5H9FK 4UUWA 4QOTA 2M8HA 2PI5A 1F1BB 1SH0A 5DZ7A 1YJNS 4USTA 3GPAA 4UW2A 3GFHA 5KFIA 5D3GB 4HI1A 3CMES 3FCWA 4OJGA 3ITHA 2XC9A 3O5TB 4ZP6A 2VV5A 2HHWA 1VC5A 3G9CA 3G2XA 2FHMA 2XZTB 1MMLA 2NR0A 1UMJA 3H4BA 2PI4A 3TZYA 3P6YC 2VG6B 2LMIA 1APSA 1GMWD 3OVBA 2GAHC 3NBPA 1RTIA 4CLSA 3G4SS 4LFAF 3A8EA 4OZLA 3QFHA 4DFMA 1WKKA 4WK1A 2OJ3A 3BF4A 4PEOA 1YSJA 1SC4B 4NASA 1K0VA 2DH7A 1VK8A 5D8HB 1FKPB 3E51A 3WDOA 1ZM2A 4TY9A 2WVFA 3K89A 4C3LA 4QJVA 5KG3A 4LF9J 3BGRB 1U2RA 5L1JA 2OPRB 4IDKB 3MM9A 2IRXA 2NQPA 2CPJA 3PVXA 3GR1A 3RYLA 4DFKA 1LW0B 4DF8A 3CGIA 2HS0A 4LF7J 3NNHA 1RABB 1R0BG 4UUXA 3TX8A 5B0AA 1MNEA 1NMEB 3FKBA 3CCVS 2DNKA 4DMZA 1PAEX 4KGXB 2M88A 3VALA 3DOLB 4ETXA 5KG4A 2KRRA 1UZDA 1WOSA 4WKRA 3EVMA 4USKA 1H72C 3R5JB 1RT1A 2EXUA 3ILIA 1L3TA 3N28A 3AD9C 3M9MB 3CCMS 1VDHA 4EGLA 1MU2B 3OTCA 1JLBB 3W60A 4XDCA 2IBKA 1BWVA 5IOLA 4QWAA 5LSLA 1TKXA 4WK3A 1J5OB 2VKRA 4LJMA 3EXCX 3BSNA 2B51A 3PO5A 3L09A 4OYPA 5F8MA 2WSEC 2HFVA 2R2RA 2PA3A 2QFJA 3L9ZA 2V4RA 4ED0A 5J1EB 2IM0A 3P5BP 1KR4A 1SPBP 1ZAWA 4IO9Q 3M8RA 2MZJA 4ITSA 4DSFA 1VMBA 1X9SA 4P2MA 2VC1A 2YY3A 5AT1B 4NRTA 1PCAA 2LXFA 2HBRB 4IR9A 2AT1B 3M6UA 3O2IA 3TNVA 2H65B 3CDWA 1BQMA 2RU9A 4FN5A 3R27A 4IRCA 5A2QU 2J9DA 2GMLA 1EHWA 1YGYA 2MGZA 3Q8SB 3T5KA 3UVJB 3Q8PB 4I67A 5HATA 4DBQA 4IOAQ 3SCKE 2KYXA 1QAJA 4K2XA 4YFUA 2UUAF 4OQJA 1G1XA 3GILA 1WSRA 3LAKA 4H54A 1M5KC 4IKAA 1HHTP 4P72A 5ETLA 3H5XA 5D15A 4M5GA 2MKKA 3P8BB 4DX7A 1HPZB 5I3QA 2WOMA 4G65A 4RR5A 2CA9A 2KT2A 3SCLE 1PIEA 2D74B 4DU7A 5JJBA 5KFOA 3BR9A 3R7BB 3D0GE 3RU0A 4U96A 1KQFB 4F2RA 4QW9A 2UVVA 3NP5A 1XBWA 3E2EA 4BHQA 3UCZP 4LRCA 5JMNA 3QRRA 1JKHB 1TL5A 4OYIA 1YDLA 5J2MA 3UR0A 3KK1B 2V4JB 4OYZA 1XNQJ 3MFHA 2VH7A 3NL0A 1H73A 1F9HA 1ICEB 2VUGA 2I2YA 4ZVSB 2C2MB 4Y0FA 3MMAA 1X31C 3KK3B 4C11B 1S77D 4UF4A 1K8AT 3RR7A 4FKYA 3A12A 1N52B 2M8DB 1RT5B 1OY6A 1LV5A 2FLOA 1ZS6A 1JIHA 3S01A 1FTCA 3UE2A 2ZWOA 2ZJPQ 2IAJB 2CJ9A 4NXNJ 4FPRA 4J9VA 1Y5LB 5I3UB 2OMLA 3RG6A 3UNYA 4A8KA 1PJ5A 1KQKA 2W4PA 1RT3A 4H4MA 4RLEA 4NLQA 1YRUA 2CPXA 1T9YA 2J0QD 2MSTA 5FLXU 1SJFA 1WKJA 3H0PA 5CXTA 1IVZA 1RT2A 2UUBJ 2CPHA 3VZIA 4RW9A 2LFVA 1X4AA 1S99A 2VFVA 3D1QA 1UVLA 2V68A 3AD7C 3W9HA 2G0CA 3DKDA 2AP6A 4I6WA 3QT8A 4Y2CA 2N7CA 1TV6B 4MH8A 1T9WA 1BUXA 5KFZA 2E1AA 1PJ7A 2VFRA 4F0HA 1VI7A 2KJWA 2XZDB 1J5EJ 4K50A 5DDPC 3Q8VA 4XK8C 2OI2A 4ID5B 3PR4A 4K4YA 2EC2A 1AUSL 2XWYA 4K4TA 4PRFA 1G3OA 1JNZB 1S10A 1GK8A 4WTYA 3GG1A 3FCVA 3SQGA 1URNA 2R7UA 4ED4A 1PBAA 3H59A 4TLQA 1YJTA 1RA7A 2DHHA 5B7WA 3DI6A 3BV8A 1KVIA 2EWHA 1RHJB 3TEHB 4DLEA 1V3ZA 5IT0A 2DHAA 1FNXH 1IBKJ 3R1HA 3VQTA 5D4PA 2CPYA 1N88A 1HKAA 3MF5A 4KHPF 4L3NA 2JEJA 3BH7B 1S1WB 2BUNA 1X0PA 1TAUA 1A6LA 4RU2A 5DJBA 4RU9A 2YNFB 1CS4A 3T1HF 3KLEA 4K4VA 2JWNA 3N6MA 2HVHA 1M5HA 4AQYJ 2EK6A 2DH9A 2XLJA 4FS1A 3UDCA 1S6OA 5AJ3J 1UVMA 1D9FA 4FPIA 4AYBD 2OAUA 2EI5A 3HJVA 1QAXA 5GMKa 1UJ4A 5KFCA 1F9EB 3IAS9 3RB0A 2H51B 4WFBQ 2APOA 4HI2A 1JK9B 3VGSA 1XNRJ 3UW1A 1KHVA 2BJDA 2DISA 3CXCR 1TR0A 1HARA 2V67A 1RYSA 5KFVA 1IKXB 2GMJA 3N01A 2RDDA 1BMQB 5T14A 2E1CA 3MDFA 1BC6A 3DLGB 3UNGC 4LUBA 2G2YA 3M6WA 3U02A 2J9CA 1LK7A 1RT4B 5HK4A 2KHCA 3UQSA 3LANA 5CYQB 1DURA 2MSSA 1UWBA 2MQQA 3ET6A 4MKAA 4YR2A 5HVHA 2AYEA 3J81j 2K7JA 4FF1A 1WC0A 2MKSA 1H98A 1I1GA 3R1LA 2FHKA 4Y65A 4C7QA 5C25B 1G4CA 1S6PB 5KFLA 1HNVB 2XO7A 2F4VF 1L5UA 2HHXA 1U24A 3CD5A 2HFSA 3MM5A 1O8BA 4L75A 5BXIA 5DQHA 1U09A 2FJBB 4IH6A 1S1VA 2RD5C 3BB5A 5F3ZA 4LIWA 2DNHA 2I1RA 4CO1A 1DAXA 5B0FA 3CCJS 3MEGB 2CVIA 4ZPCA 2YPYA 2HRUA 3DHXA 3RW7A 5D6GA 3QAEA 3CJSA 1U1RA 3ZTSA 1YJWS 4A8FA 2MMYA 1AFJA 4R5PB 5KG5A 3BO2A 4EEYA 4KPYA 4IRDA 4RBUA 4DV2F 1HNXJ 3GSDA 1RHMB 2DYAA 2G2OA 1BD6A 1R8PA 4IFVB 1QAYA 3TA2A 1VQMS 3TZWA 1BQNA 1XR7A 4V1Ak 4JI7J 2BE2A 2GMHA 5IXUA 3I4PA 4MKBA 4BC7A 5T7LA 2CQGA 2QEXS 1FFWB 4ZJOA 2IJRA 4KV8B 4DU8A 2LLZA 3VWSA 2MJNA 4LF6J 1Q81T 4P52A 2XG8A 4RBVA 4ZVPB 3DDIA 4YY3J 2NSBA 3EGNA 4OJ3A 4J90A 3ZZZA 4C8LA 3AB2B 2ILZA 3HXMA 2BANB 2B4UA 1N5YA 5BYSA 3RAXA 2CQ2A 2AX0A 1FDBA 3QRPA 3WC2A 3W3SA 1U1MA 2R8IA 3AQPA 2OEKA 2NLWA 1Y4ZB 3T9NA 4OI0A 2M9KA 2YNIB 5H9FJ 3IRXA 2YKNA 5FDLA 4RJVA 3T3FA 3C6UA 3GB0A 2OPPB 3GYGA 4ED8A 1JLFB 4F2SA 3M9NB 3ZZ0A 3FMWA 3EDRB 2VHGA 3JQMA 3CULA 3M2VB 4CM2A 5KOWA 1SJ4P 2GCFA 4KGKA 1B7FA 2FUG9 4WE1A 4I0WA 4UZBA 3ETOA 3DOKB 4W4MA 2J6TA 3AJ2A 2HWTA 4FYYB 4ZP9A 1GXTA 2A2CA 2YBVA 2NREA 1NPRA 4X84A 2RAQA 1R27B 1IR0A 4DZDA 4ILLA 3RB3A 4EBDA 3GJQB 2BQ3A 3EMTA 1TKTA 2G1HA 3IR5B 2FVRA 2RRNA 2NS1B 3BO4A 4OIXA 1PBUA 2EPIA 1N8RT 1ZPWX 3NWRA 3ENVA 3U1MA 1FRJA 2E1RA 2W2PP 3V6DB 1X7VA 2FC9A 3DMJA 1VLOA 2O1PA 3QGGA 4K5RA 4XIUA 2NUUG 4YN3B 3ENQA 1RJJA 4U7UD 5HLFA 3CMAS 3RB4A 2QRRA 5HMYA 1EP4A 1WDDA 3AXKA 2MQNA 3SYZA 2YH0A 2DTJA 4NMXA 4DL7A 1P6TA 2YTCA 1AA1B 3K2YA 2BVZA 2OFGX 3G8TA 2ZVIA 3GFYA 4L3KA 2P8IA 3PX0A 3OBIA 1B0PA 2ZZMA 2V63A 5L9XA 1FXDA 3K0JA 3D0HE 3M8WA 2ZD1B 1TL3A 4EZ9A 1W26A 3PO4A 2XY5A 3TA0A 1IKVA 2X3GA 3OL6A 1JX4A 3SSRA 2HHVA 1XMOF 4W98A 2F7VA 1W7WA 2P9CA 2XNQA 4DS4A 2ZKUA 3PRDA 1Q7YT 2CQBA 3CW2C 4BLGA 3TAQA 1QE1B 1UW4A 1SL0A 3C6TB 2PIIA 2W24A 1WI8A 2HWIA 1ACMB 2ZZNA 4DR1J 3C15A 3K5PA 3EICA 1KQGB 1RHKB 4QIWD 4P73A 1N36F 2YKMA 3W65A 2D1CA 5CCLA 1H7XA 1ZM9A 4RW8B 3LP2A 1Y7PA 5CHCB 2AHOB 1JMTA 4UQGA 4X4PA 1E6YB 2OSQA 1FJGF 2OKQA 1DRZA 1HNZF 2OD6A 4DQPA 2HHUA 3FMBA 4Q2LA 3DN9A 4Z7YA 2PFFB 1RHRB 1IBLJ 3A3OB 4BCAA 5JVHQ 3PZPA 3CJKB 2KM8C 2DNLA 4OYMA 1QDUB 3I5BA 1HA1A 2C2EA 2B0GA 4NLGA 3ZTQA 5L46A 3TANA 2GC8A 3TA1A 1HR0J 2BZ2A 3K5LA 1CJKA 1RTJB 3H2VE 4H4OB 3L4BC 4E2FB 1UEKA 4ZVEA 3P3DA 3M8QB 1KRPA 3HZGA 3DRPA 1RBOB 4CO4A 2W9CA 3HT0A 4DEZA 1UEVA 4Y6IA 1FJEB 1IQZA 1KONA 3JSMA 3CEDA 5M2RA 2C2ZB 4J7CA 4J37A 1NDCA 3KG0A 1UVJA 3GP9A 3O6QA 3C19A 1JLCB 4OLPA 3Q0AA 3W2VB 4OHYA 1JJ4A 2CADA 3NKYA 1UVNA 2VONA 1QUPA 1RT7B 2KFYA 3T5JA 2FYXA 3LP1B 3MM8B 2PMZD 2B9XA 4EFAC 2QO3A 3OXGA 2ZHBA 1B99A 4D3HA 4NL5A 3AJ1A 2QYGA 4EO8A 3TI0A 3HHLA 4LREA 2MLZA 3I31A 3IBCB 4K5SA 3T6BA 1GNKA 2FQQB 2CWXA 3EPGA 1DQ9A 1S6QB 1C0UB 1JQGA 3V6HA 3TX0A 3F44A 2VQEF 3QT6A 4DR7J 2FJVA 4ZP7A 1I51B 2OPSA 3H2LA 4YOEA 1R8BA 1VBYA 2NXJA 2RF2A 1RAIB 1U26A 3L95X 3V6JA 4HKQA 4U8YA 1RWOB 2BRKA 4TVAB 3JTOA 4OMFG 4DL2A 1FD2A 4RPFA 3PJXA 3MPUB 5KFYA 4O0IA 3OR1A 4MJKA 4NLSA 2JVOA 1WKLA 4DX6A 3CMQA 3BSOA 2IC3A 1T05A 2W8KA 2EFQA 2FDNA 2ZC4A 4TLRA 3MPWA 3JQJA 4FYDA 4GKJJ 4YHHJ 2COLA 5KFQA 3RGIA 1RU2A 3DGVA 2KI2A 2OP5A 4KGZB 3C2PA 2Z58B 4DR4J 3I6PA 1I94F 1RKJA 1WELA 1SKWA 4NXMF 3V5RA 2RRAA 4Q2MA 3J7ZT 3BREA 4WF9Q 1P1TA 2LECA 2EVZA 1J27A 1MWZA 1CJTA 3R2DJ 1NKBA 5GADU 3IG1A 2ABYA 3TYTA 4F4WA 4B3OA 1N54B 2R8JA 3CIMA 3PEJA 1GMUA 2MZSA 4ECUA 1EX8A 3TVZA 3MCOA 1TKZA 3HKWA 2ZUAA 2LU2A 1YTYA 1E6VA 1VC6A 2HZAA 3FFIB 1PJ6A 4GVBB 4JI6F 3K17A 5CYJA 2NXCA 1AXQA 2XBPA 2AEFA 3FBCA 2J6SA 4B3RJ 4XPCA 4UOFA 4EK2A 1YZ6A 1RISA 2XTJP 4QBUA 1RLDA 4ZPTR 1CJVB 5EWEA 4B9UA 1RDRA 1YRXA 4K59A 4PWWA 3H5SA 2BA9A 2Y3YA 2KB2A 2WW4A 5KG7A 4NLYA 3NMAA 2X51A 1IJFB 2ZNZA 3JAMY 2JHEA 1MN7A 1R89A 3PDNA 3H98A 2M3DA 4KR0B 2HRYA 2I5JB 2AJ2A 4CP5A 2IYIA 4NA3A 3IR6B 3ZZPA 5GAEI 5DM7Q 3IWXA 4O44A 2IDEA 1JWWA 4YDXA 3OR2B 3VF0B 1NBEB 2QMWA 6AT1B 3Q24A 3D67A 4A8WA 1S49A 1UETA 2YNGA 2C2KB 2R2TA 1M5PC 4DV0F 1HBNA 2Z56B 4LF2A 1HBOB 1JLAA 2HBQB 3TZXA 2X1GA 4DQQA 5AXKA 5A0YA 1M5VC 1VBKA 3GJRB 1K1QA 4CO3A 2BR0A 3FRZA 4DV6F 5IS2A 4LVOP 4Q43A 5KFFA 3VAHA 3ZNJ1 1V6HA 4HR2A 1WG4A 1WC1A 5E41A 1P1LA 1RTHA 2C2NA 2WRMA 1EJ7L 3G8QA 2AEJA 4DR5F
chains in the Genus database with same CATH topology
5J1EA 5KOXA 1MWYA 2QLWA 2HAIA 1U1PA 1XK8A 3PNIA 5G0RA 2AGPA 2QA4S 3KOAA 1WEZA 2DNGA 4HYKA 1HR0F 2VD3A 2DCLA 3MMBB 2ZH6A 1XR5A 4JBCA 2DCUB 3CJ3A 4ED3A 3PX6A 1S9EA 1LXJA 3NRBA 2B9WA 3HHEA 4YEAA 1YVFA 2WW8A 3GIIA 4QU6A 4I2PA 3EZUA 3OQ2A 2V94A 2DVIA 2FD2A 2XSJA 5EN1A 2IA6A 4F4ZA 5LXYA 2F3JA 3PIPQ 4C8NA 1N0UA 1PGZA 2WONB 3MAHA 2EFPA 2MY7A 1D0EA 2D9PA 1WHWA 5K8PA 1H7WA 2L48A 3OFHA 1L3VA 3PEHA 1LWFA 4IQMA 3GQCA 2C3YA 1FK9A 2XHWA 4J5OA 1TQLA 3US5A 3MUMP 3Q2TC 2DGOA 5LMUF 2EW9A 1RYRA 3EGZA 1FTRA 4ECZA 2A1BA 1FKAF 3MR5A 4DL3A 3DM2A 3LWMA 2B4OA 3JB9k 2IBOA 1T02A 2Q43A 3DOMA 1NNDA 2UV8A 4RW4A 4LIRA 2MQOA 1NKEA 1Q86T 3FFIA 3NAHA 4LQ9A 1SQEA 3PV8A 1VGYA 3QIPB 3HHKA 4OZJA 1VQ4S 5D4NA 3VR1A 3CCES 4LFBF 4J9PA 2GIRA 1S7HA 3M30B 1IKYA 4M94A 3D1OA 2HVZA 3LP0A 5B0DA 1CC7A 5I42B 3N79A 4G6VB 2GA7A 3M8SA 5HROB 2V8HA 2DNPA 3MR6A 1T05B 5DG9A 1MROB 4Z2XA 5K8NA 1A9NB 4EYIB 4MFBB 1WACA 4U7CA 3LWLA 1RKIA 1TKXB 4ELUA 5D4OA 1FERA 3HVTA 4LF4F 3IO1A 4KHMA 1X0FA 5EX3A 2KYZA 4BBYA 4DG1A 3HK2A 3KK2B 3UWTA 4URGA 3G6XA 2DR8A 2E7XA 5IZHA 2QV6A 2HFZA 1S1UB 4LSLA 3PKYA 2HFNA 1KQSR 4X4NA 2LDYA 3TOQA 1SKSA 4C8KA 5L38A 3I9V9 2V8GA 1JLQB 1WF2A 4QZVB 3TUZC 4YB6A 4DV5F 4OZ1A 3FVYA 4F4XA 1U47A 3PW5A 2QSWA 2KZMA 2XMKA 2FJEB 5KFEA 2WCXA 3MECA 2BYCA 3LH2S 4R25A 2ZH7A 3UD4P 2LEPA 2R7TA 2CQDA 3KLHA 4ED5A 3MM6A 3M1VB 3SDEA 5IWAF 1HNIA 2OPQB 4XPEA 4X65F 3GIJA 4B3TF 1VQSA 1HPZA 2NZ4A 3BQ1A 2AYBA 1DLOA 2F9DA 3D54A 2JLEA 2DGWA 1S97A 2ZE2B 2XGPA 3CCSS 2IM2A 3JTPA 5B0GA 3PW0A 4HT5A 4UUWA 2ZBCA 3KLGA 1FVQA 3IFEA 1P8GA 2AJ4A 4J9NA 3IG1B 4MAKA 5CZVA 4WZMA 4DR7F 4QOTA 2HZCA 2I5JA 2M8HA 3WBZA 1C4CA 1X9WA 5L39A 2PI5A 1VK3A 4CO2A 4B3OB 1SH0A 2KN4A 3MR2A 5KFWA 1YJNS 5CYMB 2XMTA 4UW2A 1VQ6S 4ECRA 3GFHA 2C3MA 3UFCX 5KFIA 5GAHI 1UJ6A 5D3GB 4HI1A 3CMES 4KSEB 5A8WB 3RAQA 2XSFA 4OJGA 3ITHA 2XC9A 3O5TB 4PPDA 1G7CB 3KLIA