2W2OP

Pcsk9-deltac d374y mutant bound to wt egf-a of ldlr
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
92
structure length
92
Chain Sequence
TATFHRCAKDPWRLPGTYVVVLKEETHLSQSERTARRLQAQAARRGYLTKILHVFHGLLPGFLVKMSGDLLELALKLPHVDYIEEDSSVFAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/receptor
molecule keywords PROPROTEIN CONVERTASE SUBTILISIN/KEXIN TYPE 9
publication title Structural and Biochemical Characterization of the Wild Type Pcsk9/Egf-Ab Complex and Natural Fh Mutants.
pubmed doi rcsb
source organism Homo sapiens
total genus 21
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2008-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF05922 Inhibitor_I9 Peptidase inhibitor I9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 2w2oP01
3A3NB 1V5IB 4K8RA 2XTJP 3A3OB 3BGOP 4NMXA 4NE9C 1SPBP 2W2QP 3VHQA 2PMWA 3H42A 3SQOP 3GCXP 3BPSP 4YN3B 4JP8A 2QTWA 3WIUA 3T41A 3WIVA 2ZWPA 2W2PP 2Z30B 1R6VA 3QFHA 1ITPA 2Z2ZA 2Z57B 3VV2B 2E1PA 3CNQP 3AFGA 3GCWP 3P5BP 2W2OP 3WHIA 2Z56B 2W2NP 3A3PB 2Z2YB 4OV6A 2W2MP 2Z58B 3CO0P 1SCJB 2ZWOA
chains in the Genus database with same CATH superfamily
4FPRA 1S0MA 2M70A 3GFZA 3NNCA 3TJAA 2WSFC 2M88A 3T1HF 2E5GA 1VLOA 2L48A 3CE8A 1G6BA 2GV1A 4ECYA 4BBYA 1JXVA 3BSNA 1F5BA 2GAGC 2J9CA 3BS9A 5L38A 1KFSA 2DGQA 2XMVA 3G87A 4ZIWA 1RAAB 4WFNQ 1XR5A 1XMOJ 4WU3A 1IBCB 2KB2A 2AWZA 2C2OB 2RS2A 2E5HA 2OGUA 1BQMA 3KLIA 2JLFA 4F04B 4J7CA 3HSGA 3BKTA 1S6OA 2PD1A 3KLIB 4JI2J 2ERRA 2DEJA 2VU5A 1ZTTA 3GCWP 1BUXA 2YKPA 1NK0A 4FVMA 3VALA 4WKYA 4DSFA 5J2PB 4IG3B 2XMJA 2JH3A 4U96A 2GJIA 3C6UA 2LEPA 2UUWA 2M9KA 3RBZA 3OSNA 2DR6A 1QAXA 2X1GA 2A2CA 4QWAA 4ZVTB 4DUTA 4DZDA 2RUSA 3HT0A 2ZNZA 1BE4A 2GMHA 4C6AA 1D8ZA 1EKSA 3IAS9 4URGA 1SC3B 4O0NA 5L8RC 2CUYA 1FFSB 2WZ1A 3VHQA 1SJ1A 3K8WA 4C9DA 3FSIA 2DTJA 1BQNA 4RBUA 2OEJA 4NWBA 2P6SA 5ETNA 2WK4A 2K8GA 1X60A 4L75A 5B0GA 5G4DA 4DX6A 2P2CB 2EG2A 4H54A 4DL0C 3HHLC 5C25B 4U8YA 3H5SA 4NZ7A 4ZCKA 4UW2A 4WP8A 1S1VB 1VQMS 1TL1A 1UEVA 4RW7B 3BBFA 4DPYA 4I2QA 1LK5A 2ZC3A 4LVOP 4Y65A 4MYTA 1NDLA 3G6XA 4NLRA 2XYHB 1KP6A 4H4KA 4I2QB 1RT2B 2OD6A 3NGSA 5I3PA 1FDNA 2CJBA 4X4NA 3GSDA 4MKAA 1I3OB 2VICA 2CWKA 4B3TJ 4F4ZA 3TVKA 5HMXA 3D3CJ 4Q2LA 1CQNA 1BD6A 3W60A 2J9DA 3CULA 1VFJA 3Q23A 4ZLJA 1IBKJ 3VV2B 3OVSA 1RTZA 2OHDA 2A6MA 4OX9F 1F9HA 5DDPC 4IO9Q 1FERA 5KT7A 3CO9A 4DUYF 2ZH7A 1F9FA 4F8RA 4PQUB 3C15B 3AT1B 3Q8SB 4FYWB 1Y00A 5D4LA 5DGAA 3JTNA 4C8NA 4S0MA 3THPA 3ETOA 1IWGA 5FJ4A 2Q3PA 4LRDA 4ITSA 4I1TA 4HHJA 3I56S 2ZZMA 1PC5A 3D6HB 4OZ3A 2MQOA 2C2RA 2QSFA 2DRBA 1NPRA 2FGOA 1EB0A 2PA3A 3CW2C 4KGMA 1HBOB 4C7QA 1Q53A 2VG7B 3KHLA 4DV0F 3TA2A 2A6OA 3IFEA 1RE1B 1GTHA 3J81U 1J5EF 1K0TA 1PILA 1CJKA 1TKZB 1NSAA 2FY8A 5FLXY 4R5PB 3K89A 4NEYA 1R8HA 2B43A 4CO5A 3CTRA 2KDOA 2WVDA 5HL7Q 3ONQA 1H72C 5E3PA 1YRTA 5F3ZA 4EO8A 2HBZB 1CLFA 1GMUA 1WACA 1WF0A 2IYGA 2W1BA 4E8UA 1UJ6A 4LSLA 3EYZA 1IKXA 4K4XA 4CLTA 2OEMA 4LSLB 2A18A 4ZP7A 2ZHOA 2J8SA 2FVSA 1YI2S 1NZAA 3MEDB 2J8AA 1LW2A 1OY8A 2GVDA 3HCXA 1FWPA 4NLYA 2HHSA 5ETTA 2BEFA 2YH1A 4DR1J 4DQRA 2ADCA 2B51A 1LWXA 5HMYA 1QAYA 5KG0A 5LM7E 3IWXA 4RU9A 4P2SA 2G13A 1NHUA 4RX6A 2IM1A 4D3HA 2XI3A 2FLOA 4DOZA 4PZVA 1JXLA 1SKUB 3MXHP 4TNOA 5J2QA 3J81Y 3Q8PB 1NLKL 5D0HA 4C3KA 3BV8A 4O3PA 4CO2A 4B3RF 5DETA 2NCKL 5J2QB 3PG9A 4EYHB 2GJFA 2FTRA 1S97A 3R5CA 4KH1B 1P9QC 1UKUA 3KK3A 3MM7B 2BMBA 2ZJRQ 2N4CA 1RA6A 5HANA 2KZZA 1NDCA 3AOAA 1Q4RA 2BKNA 1C4CA 1JB0C 3QWPA 1PGZA 4ETXA 3KLFA 4CRJA 4NRTA 3MPYA 1SQFA 1P1TA 4X4QA 2BJDA 1RACB 3MPVA 4C8ZA 3NAHA 2ZH2A 3W64A 2MKIA 5DLFA 2W24A 3NGKA 4OZ2A 2FDNA 1V9OA 3FKBA 1MG7A 2FJDB 4QYZJ 3CCRS 4KKOB 4WTOB 4USUA 4ZDNA 4EBDA 3BGOP 4ER8A 1DURA 1VIXA 5KFPA 4FPIA 3ENWA 1TVRA 3NS7B 3V4IB 1HNVA 5CQGA 3UR0A 4Q8FA 1HNVB 2CG8A 4IH5A 2RE1A 1UCNA 4JI6F 4IRDA 2H3EB 2GA7A 4UZCA 5FDLB 5F8IA 1XWLA 4FS2A 3H98A 1GNKA 2HZAA 2IMWP 3S7RA 1HA1A 4P2MA 1T02A 4IH6A 2ZOGA 5LOQA 2VBXA 3R1HA 2HNZB 3U1LA 3M2VA 3DKDA 4WFBQ 2BE2A 1YJ7A 4CLUA 4K4TA 2CPFA 2M3DA 2J6UA 2BE2B 2GIQA 2FLNA 2UVWA 4UOCA 2RU9A 2DNKA 4URSA 5KFLA 2K1RA 3GYGA 1YRUA 3GJRB 3UDCA 1IR2A 3FEZA 2ASYA 5KFRA 4NXNF 4ELUA 4LBHA 4P71A 1GK8A 2HAIA 4JV5J 1DRZA 3QATA 1JIHA 3K8VA 4WXOA 1WTFA 3J7Z5 4PUOA 1N6QB 4PEOA 3DOLB 1YJVA 3MEEA 4DSKA 3PEHA 2M8DB 4PUOB 2RMLA 1DFDA 3ENAA 9RUBA 1NDPA 1TKTA 2V2VA 5ADZA 4NI2B 4ZVGA 2PN6A 4F36A 4JB8B 2O01C 4NLQA 3GTYX 3V81B 2J0SD 4HI1A 3VQTA 2MKJA 3G71S 2KI2A 3RU0A 2E7WA 4Q5VA 1N5TA 1FNMA 1REGX 1RKJA 1H73A 4MH8A 2QA4G 2LQJA 2LP4A 3ZNUA 5A8KB 4PG4A 3DU5A 2NR0A 2I0XA 2ZWOA 1WF1A 1VBZA 4ZCIA 2EFQA 1T9TA 4PPDA 4ED4A 4XDDA 3OHBA 2Z30B 4GVBB 2D9OA 3AY0A 1NRKA 4PXDA 1PJ7A 4LUBA 2K7JA 4DV2J 4E0DA 1HARA 3JXOA 3O3LA 4OQJA 1C1BA 2MQMA 1UZHA 3DXBA 5G0RA 1J27A 3QLHA 1C1BB 5AE2A 2J5AA 2HKEA 3QLHB 4ZP9A 1X4DA 3H25A 2J7KA 4I6WA 1O6XA 3TP2A 4OI2A 2AF6A 2NUUG 4KGZB 4ZLPA 1P1LA 1RT4A 3G96A 3DLEB 4ES3A 5LJ5Y 2R7VA 1FRHA 3VCDA 1RT4B 4WYLA 4C98A 2Z2MA 4LSZB 3LO3A 1XEZA 5KFKA 1JJ4A 3Q2TC 3SSRA 3ZFVA 2YNFB 2L9DA 3OR1A 2QMUB 2XZDB 1FE4A 3OR1B 2KL8A 3KK2A 2CNKB 1UVNA 2XC9A 4X62J 3KK2B 2PI4A 4OYPA 2YKMA 5E2QA 3DOMB 5IT9U 1Y4ZB 4LJMA 2JL9A 2BE9B 1Q95G 3BGFA 1OJ4A 2V67A 4K50A 3OTOJ 5KOWA 2PC6A 3OL8A 8RUCA 3WZ0A 3B78A 2NXUA 2CG4A 2FZKB 3DXSX 2PI5A 5K14A 3K0JA 2IDLA 2YVSA 4NEZA 2CQCA 3KKFA 2BW2A 5K14B 2Y8WA 4M5KA 4TYAA 3LWLA 4PR6A 2KXFA 1YBUA 4OHYA 1TZ0A 2PMWA 2EKNA 4RNFA 2QGFB 4U9RA 3VAFA 4LRCA 1SC4B 3CVKA 4CH7A 2CNLB 3BGUA 1TELA 4CLLA 1BY9A 3R7BB 4ATNA 3M9NB 4OZ1A 4DQPA 2V34A 3NCPA 5C5JA 3KUGA 3MM6A 1JNZB 2AKWB 3HI9A 1HWIA 4G1QA 4PYDA 2W9AA 3W65A 2C28A 3TQEA 5I42A 4DDFA 3BF4A 3IS9B 4UOGA 4P10A 4P9SA 4DV7J 4FXVA 2XCPA 1VI7A 1LK7A 3POTB 2B3TB 2MEWA 3UVJB 4KPYA 3NRBA 4AUKA 2OPPB 5EWEA 2BABA 5K20B 4CDIA 1QSLA 4MKYA 1OPIA 5IT9Y 2CZ9A 2V6AA 3S1TA 3SCLE 3TZWA 4I4BA 3QT6A 2MSSA 2ZBCA 1TL7A 6FD1A 3MR3A 1TL7B 4PCQA 2WTFA 3DGPB 4KC5A 2IDEA 4FF2A 2VQFJ 2HYIB 4WWSA 3PZPA 2F65A 3OSPA 1VBXA 4RWXA 3HVTB 5D77A 4NLOA 3M6VA 2YWHA 3O5TB 4LFCF 4RPFA 1RTJB 3H2UB 5DJBA 4FYXB 3W5ZA 2C2EA 2YWEA 3TAQA 1KTQA 1MROA 1U2CA 4N8NA 5D15A 4Y2CA 4QU6A 1C0UB 3G4SS 4DSIA 4HI2A 2F1FA 1RDRA 2GHVC 2V5HG 1FRXA 4IKAA 3IP0A 3V6KA 2CDRB 5F0WA 2CJXB 3C8YA 4DV6J 1HNIA 4P7VA 2P8IA 1URRA 1HNIB 1S7IA 2PSZA 1NB2A 3BSCA 4P2XA 1LXJA 4MFBB 3D5MA 1SKSA 1LXNA 2PFFB 2VA3A 3PW5A 5M2UA 2C3PA 2CPYA 2AJ1A 3PO5A 2VFRA 2C42A 3OJSA 1RB0A 2QL7B 2R7QA 3A8EA 3CIZA 1N32F 4DLGA 1U1OA 3GWCA 1X4GA 4Z2XA 2D3OR 2Z4PA 4F0KA 5B0CA 3QIDA 2IIHA 3BB5A 1OWXA 2KYXA 2MZTA 2N4DA 4C97A 3OLAA 5IWAJ 2FVCA 4I6YA 1EIYB 4QZVB 2QO3A 2MJUA 2XS5A 3QFWA 2UUCF 4F67A 3PVXA 1Q7YT 1HBMA 3FBEA 5CABA 4XO0A 2HVZA 3QO9A 4DR4J 3PTWA 2BW7A 1HBMB 1TUWA 1SVDA 4TKTA 2MJNA 4K0KF 3QO9B 1Y5LB 1IQZA 1O5JA 4K2XA 1ZS6A 4MK9A 3G6YA 1HW9A 1Y3KA 4B02A 3I55S 1NH8A 2KVIA 4I6AA 2QC3A 4JP8A 3UD3P 4YUDA 2CQBA 2OPSA 4WIQA 5KG4A 1K0VA 4M5JA 5LJ3Y 2UXDJ 2YWKA 3KLEB 5H9FJ 3DMJA 3C19A 1F5AA 2DVIA 3W2WB 3C46A 2QEXS 5LL6d 4ZA1A 4KGVB 5CZVA 2R8HA 3MFHA 2N7YA 4C8OA 1U1QA 4YDXA 4YMEA 2VPXB 5A6WA 5IV3A 3IA0A 3D66A 3K7RA 3FMBA 1WKLA 5EX3A 4WE1A 3R3TA 1H0HB 2AJ2A 1IKYB 4P2FA 3PX4A 1GAOA 1RLDA 2AEMA 2ROEA 3KDOA 5GAGI 3N6LA 4EK2A 3HSZA 2AX0A 3A1YG 3GV8B 3PXGa 1KFDA 3MMCA 1JLEA 3RBDA 3QBCA 1RUSA 2CKWA 1RHQB 5DG8A 1VR6A 4LRBA 1AB8A 3I32A 3G6VA 3F73A 3D6FB 3HHEA 3M8YA 5HROB 3CCSS 2RHSB 1U1KA 2M5YA 1JLFA 4DG1B 3GV5B 1JNRB 3W2VB 3BPDA 3KLGA 3MAQA 1N0VC 1SJ4P 3NG8A 1JLFB 1X5PA 3AD7C 5D0GA 4DS4A 4E2FB 2LECA 4CLWA 1T3OA 2B5JA 4J9QA 2M2BA 2QMWA 1RT7B 1MN7A 2DNZA 3PM9A 1BWEA 1VQ4S 2B5JB 1S1WB 3AAWB 4MJKA 2AYBA 3OR2B 4IRCA 1N54B 1S99A 1TAUA 2ZKTA 2E1RA 1FVQA 1LV5A 2WBMA 3CDBA 1N33F 3CJ0A 1I94F 4OX6A 4K4WA 2W7PA 3CMES 3G8TA 2M4MA 3TANA 3BDEA 4JI1F 1RT6B 5EWGA 5IC4B 4JV0A 2COLA 3VVTA 2JEIA 1FI4A 1UVIA 3D0HE 4RO0A 5LSOA 1XMQF 1HWLA 2C2NA 5AXNA 5I3UB 1G4CA 2BX6A 2IRXA 4NLDA 3B4DA 3EUNA 2MHNA 3D4JA 1SIZA 2HFOA 3UCGA 1KLMB 3OW2R 4EMDA 3IBCB 5K8NA 1CS4A 1OY6A 1TMJA 4I0WA 3J7A1 2J0XA 3B4MA 4P74A 1CS4B 2I38A 1H3DA 4PWWA 1H98A 4HDHA 4LF5J 3EICA 3OVBA 4YHHF 1XNRF 3JSBA 4NA2A 5DG9A 1J2VA 1FKOA 2P9CA 2DGSA 1VQLS 5H1SV 1SH2A 3WX4A 1H74A 4DL7A 5E3AA 5A2QY 4O3RA 3LP2A 4HH1A 4LF1A 3O8WA 3DLBA 3A3NB 2DH7A 3TVZA 2L08A 3ZZPA 3TVYA 3O6QA 3JSMA 3N5FA 3PYEA 3EZUA 5DM6Q 3AHPA 5CYMA 3HO1A 3B6BA 2D1CA 2IM3A 2NXCA 4G65A 2RNEA 3TQ1A 1TK5A 3FSXA 1P8GA 3HT3A 4JI8F 3ZO7A 4OYMA 2VASA 4C8KA 2VC0A 2U1AA 2Q6BA 2C3UA 3NAIA 4KO0A 4LF6F 2V69A 1Z4UA 1D9AA 2HMIA 1R6VA 4KO0B 2XM3A 4RW8A 2AP6A 2M7SA 2HMIB 3K5NA 2XSFA 2MHEA 2ZHBA 4USTA 1Y3JA 3CUNA 4LMZA 3AOCA 2E5LF 3PEJA 1NNDA 1VRUB 3SYZA 1XNQF 3VAJA 3N6NA 2C22A 2MDAA 2B0GA 4ZPCA 3C16B 4TLRA 3M05A 2DKOB 5CA5A 1HYSA 2LFVA 2CQ3A 4PG8A 4F4AA 3ZTPA 4M94A 3ILJA 4YFUA 3HMJG 1L5UA 3T5HA 3NY0A 2PMHA 5E3QA 2WRMA 1HBUB 1SL0A 4DR7F 3CGIA 3FBFA 2XSJB 3ITHB 2VFUA 5T7LB 3LP1A 5HBMA 2AMCB 3LP0B 1MN9A 1H38A 4CO0A 5HBMB 3M8PA 1FFWB 3DN9A 5KFOA 1GQEA 2ZWPA 1JKHA 3W7BA 3M8PB 4QYRA 2AW0A 5IT0A 4B9NA 3M8QA 3DFEA 2AD9A 1FK9A 2R4FA 3OUYB 5AJ3F 2ILYA 1UA1A 3E01B 3FC9A 2GO8A 2AGQA 4LF8J 4RJVA 4YQWA 3K57A 4K5RA 3KJNB 4IFVB 1RQ0A 3BKUA 2DGWA 1ZETA 4PRFA 3R6LB 1RT1A 3W9HA 2RH3A 4RW9B 3ET6A 5MLCV 4J9OA 1VIOA 2BXJA 5SUHA 5DQGA 4AQYJ 4DXLA 2HFUA 5AXMA 4Q45A 5HVFA 2CJAA 4CIOA 4GRSA 3T41A 3M8RA 2CQ4A 2LVWA 3BO3A 4A8MP 4ERDA 2JC0A 1R8CA 5HP1A 1RAEB 4HL9A 4NLSA 1ZTWA 3K58A 4HDGA 3EPGA 2DR8A 5HP1B 2HWHA 3L4BC 1FTCA 3EE3A 4ANDA 3QIPA 1HR0J 2A3JA 2DNQA 3EZ5A 3VZHA 3FFIB 2EKYA 4CLYA 3M6WA 2CVIA 5J2NA 3OD2A 2L9NA 2YQ1A 1GXTA 1RWKB 2CQIA 1RXOB 4ZPAA 3NBPB 4QR1A 4HHUA 4U67Q 4PWDA 2CQDA 4LSNA 1YVFA 2HRUA 2PGCA 4N5SA 3TR5A 1T9WA 4DV5F 4FF3A 3MTKA 3IG1B 1SIWB 2RQKA 1JX4A 3DI6A 4OIXA 1KQKA 2RF2B 2IJRA 4B9TA 2AYGA 4IOCQ 2GFFA 2V63A 2VL1A 3QJPA 3LF0A 2QZ8A 4LF4J 1LFWA 1I5OB 1IKWA 3WC2A 1WNEA 3SV4A 2J7WA 1N5VA 3I82A 2NS1B 2XZTB 2X51A 1XBWA 2NPIA 2QLXA 4RBTA 4X64F 2DR5A 2OPRB 1RWVB 3A3OB 4GKJJ 1VQPS 3GQCA 1NJXA 4OHWA 5KOXA 3D1OA 2QLFB 2C2MB 2OKQA 1NPKA 1IJEB 2HVHA 2GC8A 3CWJA 5HJXA 2EFVA 1PYTA 5BYSA 4TQSA 1KQSR 2PIIA 4C0HA 4DSLA 3MM5B 5DO2A 2W9BB 4O0IA 2W4CA 1FD2A 1MMDA 2UU9J 3R5BA 1IKVA 1N48A 2KU7A 1K8AT 3D6MB 3P4UB 2XMUA 2ALYB 5GAGU 2XHCA 4F4KA 2FPHX 1N5YA 2CZVC 3FBCA 3AD9C 2F4FA 1N5YB 2LMIA 2E66A 5L1IA 3ZZYA 2HK2A 3M30A 2KJWA 2BQRA 1UA0A 1KKHA 3KWMA 2J9EA 3D0GE 1RWPB 2Y3YA 2LQ9A 1ZM3A 3CDUA 4AE5A 3KG0A 1V3SA 1B0PA 3G9CA 3M4XA 3N79A 1YKWA 3WC0A 4QCLA 2OAUA 3UDLA 1XC9A 1RLCL 1S5ZA 4J90A 4Y3CA 1NM2A 3NGRA 2CPIA 3MAAA 3OFHA 2B9XA 4K7QA 3MAAB 2XLKA 2BJ3A 4U7CA 2LU1A 5EN1A 1S4EA 1N5QA 3TARA 4DFJA 1XR7A 4M8LA 1D0EA 4NXMF 2ZH1A 1CJVB 4JI7F 2HHWA 1IQTA 1SQGA 2BKPA 1T03B 4ES2A 5BXIA 1LW0A 4M5GA 1SH3A 2RQ4A 5LMUF 1HKAA 1EETA 2DNLA 4TLQA 4QWEA 1S0VA 4J91A 1EETB 3K2YA 5F8LA 4C11B 4NZ0A 3T5JA 4WFXA 1M1HA 1KC8T 3CMAS 1WHVA 2X3GA 3R2DJ 1X4CA 4A8FA 1RTIB 3KNGA 1B3TA 1EARA 4UF4A 1VYAA 2HVIA 2NXNA 4DPXA 1UVJA 2HHHJ 1RZMA 3TYTA 1TUGB 3OQ2A 2ZC4A 4H4KC 2UZAA 3CPWR 1FHTA 2HFSA 5LMNJ 4IQXA 3TAMA 4ALZA 3B82A 1SC6A 2D3UA 3TAMB 1AFJA 2BZ2A 1CC7A 4ZKAA 5A6PA 1MW7A 2YNIA 4JI4J 4HH0A 4BCAA 4RNOA 4GKKJ 1KDNA 4J9SA 2GCFA 1RTHB 4J9NA 4X66J 2YWWA 5HLFB 3IRXB 1JLAA 5HJYA 4DUZF 2ZH9A 1HPZA 4YR2A 1HQ2A 1HPZB 3OL9A 2K2PA 1IBLJ 1SV5A 1NJYA 2KYZA 2M52A 4J9LA 2B4VA 1JMTA 3RYLA 4IO1A 2OD4A 1VRTA 1Z2LA 7AT1B 2UUAF 4ZP8A 1FKPB 2MLYA 1S1XA 4DQSA 3A4TA 4OYBA 1KHVA 2YQ0A 1HI8A 4CT9A 1TL4A 2DBBA 4P7TA 1AROP 3HULA 1IN0A 4O44A 4JYAJ 4UT4A 3WQPA 4URQU 5D6GA 4O44B 2LA6A 3MEGB 1L3KA 2NUHA 2Z56B 4LR9A 1QD1A 2V2KA 4NYZA 4P52A 1U0SA 4HTIA 3CCWA 4LR7A 1EQMA 5E7OB 4WK1A 1Y5IB 4IH7A 4A48A 1BXNA 3US5A 3SDEA 4EEYA 3CO0P 1GFWB 2UV8A 2KFNA 3ZZUA 4EUVA 2JOQA 4NCBA 3T5KA 2Z2ZA 2VOOA 4E98A 3JQMA 1OQ6A 2R2UA 2ROPA 2YWFA 3BH7B 5KFHA 2H1YA 2XEXA 2DHXA 3HHLB 5H9EK 4BHQA 4HT7A 4ZVFA 3V5RA 3VGVA 3DRPA 2G1HA 1KR4A 2IYIA 2HS0A 2F8MA 1A6LA 2C2DA 3KUHA 3CJKB 3TA0A 1N34F 2CYYA 1FO1A 4AFFA 3PJWA 1YG0A 4UTGA 2CNNB 4QOTA 5FD1A 2VFSA 5KFSA 2HURA 3Q89A 4DF4A 2H54B 2VODA 1KEKA 5DDQC 1S6PB 2DGTA 4JI3F 1RT5A 3OFGA 1E6VA 3GFHA 2UXBF 2FVQA 2UUTA 4ECTA 4O4RA 4L3NA 3M2RB 2KT2A 2PA8D 4R0EA 1G7CB 2HHUA 2BJ9A 2CNOB 3SCJE 3E8OA 2H9ZA 1YK9A 4LRFA 5GAEI 5KG7A 1RJJA 1FDBA 4IOAQ 4DR2J 1UVLA 3T1YJ 3JQKA 3KOAA 1RAHB 1Q78A 3MCSA 4FP9A 3VVUA 3MMJA 1R8AA 3MECB 2HQIA 3L7PA 2RUGA 3A13A 3QGPA 3K59A 3A12A 2CQ2A 1HMVB 2UVVA 1WKKA 1X4HA 3RB6A 5F0UA 2RILA 3RBEA 5U47A 2WOMA 3VQSA 4KHPF 1WDDA 3CDAA 3KHHA 2MLXA 2WOMB 1S6QB 4OMFG 2X3DA 3T9ZA 4TXSA 4OX8A 2PFDA 5LSLA 1U02A 2QMXA 3BGRB 3D54A 4LQ3A 3Q8RB 1OIAA 1IBMF 4ID8A 3VAIA 4DR5J 3W62A 2W2OP 1M5SA 1WG4A 3CC4S 5A8WA 1V5IB 3HZEA 2Q66A 4CYUA 3M1VB 3AB2B 1U4BA 2W9CA 4DQQA 5B09A 4CH1A 2XS2A 5KT5A 5GAHI 1P27B 2FY1A 4P72A 5A0YA 4DUZJ 2KN4A 2DHAA 3OFEA 2ZDPA 4ED0A 2Q79A 5A0YB 4FNIA 3LANA 3A8KA 1HBNA 1T9XA 2KG0A 4FXDA 3KJVB 5DM7Q 1UZDA 3MM8A 3Q0AA 2V2ZA 2IVFB 2VG6A 3JTPA 3DLLQ 1FRKA 4B3MJ 5J1EA 4V19X 2QFJA 2WAQD 2F8EX 2EFGA 3IBFB 1NJIT 4DR3J 2ZFHA 3OJUA 4B3SJ 3TUPA 4YR0A 1FXLA 3TO8A 3ISND 3DOKB 5KFQA 1KLNA 1ACMB 4A8WA 3MMAB 4HR2A 1FXDA 3PFEA 1R8BA 4CO3A 1QVFR 1FA0A 4KY3A 1HNXJ 3UR3C 4NMXA 2RB7A 4IRKA 2CJ9A 3RAQA 5DS7A 2I1RA 2KXHA 2Y9HA 1U2FA 3PYFA 2W2PP 1UVMA 3I0RA 1WF2A 4OV6A 5DLGA 3IAM9 4H4OA 4Z7YA 1ZAXA 3HXMA 2HBQB 1R8PA 1Q8LA 2V68A 1D9DA 4EU0A 3KG4A 5GMEA 2HQFA 1AZSB 1VQ8S 3ZTSA 3UN2A 3MUMP 2DGOA 2A10A 4CCHA 1BWVA 2OTJS 1EAYC 1YZ7A 4QR0A 2V4JA 2DGUA 4LFAF 2YKQA 2WONA 1TV6B 1S77D 1AW0A 3KJFB 1HIYA 5ETPA 1S9EB 3OV7A 4X2BA 3C6TA 2LLZA 3KHRA 3CNQP 2MY7A 2EK6A 1LWEA 3VR1A 3U02A 1FWKA 4IG0A 4DSEA 1MWYA 1LWEB 2YX7A 2HHTA 1HD0A 5KFYA 5IM0A 4UZBA 1NXIA 3IM8A 2EI5A 5IM0B 4CLFA 4HKQA 4RUHA 4F25A 4NRUA 4EZ9A 2U2FA 4OZLA 1WC5A 5F9NA 1GX6A 3CT9A 4BC9A 2MGZA 3LWMA 4DCJB 4ZIVA 2WVEA 2DHGA 2MGZB 2G2YA 3TUZC 2CQGA 4KAIA 2B6AA 2R8IA 2SXLA 2KG1A 1C0TA 2B6AB 2QJ3A 4G1IA 4WU2A 2PEBA 3HZGA 2MMYA 1FT8A 4O3OA 4R8UB 4AL7A 3HK2A 3ADAC 4D3GA 5BR8F 2DNHA 3K17A 5F3TA 3WBZA 4EBEA 2VQEJ 3SZ2A 1RT3A 2OP5A 4X4PA 4QIGA 3FNNA 1RAFB 4WF9Q 3EVWA 5HO4A 3JSYA 2XGQA 1HI1A 5L1KA 2G0CA 3OL7A 2ZJQQ 4ED8A 1RWUA 3D1HA 1N36F 1H2VZ 4WZMA 1FRMA 2BRLA 2W2NP 4ZVPB 2Z2LA 3SFUA 1JLBA 3M2UA 4J5OA 3MD1A 2J7UA 1CBKA 1DLOB 4PG7A 2FD2A 3M2UB 2DNPA 4ED3A 5B0AA 2HBYB 1MU2B 2ZVSA 4ZHRB 2VA2A 1KS2A 4ZPVR 4FZVA 1WI8A 2EVZA 3K5MA 1SC1B 3DLHA 3Q8VA 5ETLA 3PX6A 1DY3A 4EYIB 2EBEA 3PRVA 1QAJA 5EWFA 4W90B 1HWJA 4CI0B 2UUBJ 5JUMA 2L3MA 2LEAA 4DX7A 2YX4A 1ELOA 1DJ0A 4DCPB 4GO5X 4L76A 2HLUA 1FXRA 4X4OA 3P6YC 3TX0A 1KSPA 4NA3A 1S6UA 3H4BA 4GMKA 5KT3A 1H2UX 2ZHAA 3OBIA 4F0MA 5L1LA 2GW8A 4BWMA 2WB4A 2YNHB 1EP4B 3T5LA 1P6TA 4Y00A 4YB6A 3PHEA 4ZPBA 2QSWA 2XO7A 4A8QA 1HQEA 2VG5B 1HQEB 3BO2A 2YWGA 1NKBA 5J2PA 4IG3A 2I5JA 4F26A 2VPZB 1UL3A 1QE1B 2OUGA 2I5JB 2HHXA 1CSJA 4QIVA 2Y1IA 5LT5A 4DV4F 1IXKA 5KFUA 4ZPTR 3KHGA 4CTAB 1JLQB 4ZVUB 2YTCA 4XIUA 4UUXA 3EX7B 3IN5A 3DC2A 1YTYA 1JLGB 4JV2A 3K5PA 1FJCA 4Z7CA 3AQPA 4WCEQ 1XERA 1NSPA 5I4MA 3MTJA 3NGUA 5C25A 3MD3A 1UP1A 2DXEA 3M8ZA 2R7WA 1S1VA 3OFFA 3CJRA 1S0NA 5JVHQ 2DGVA 4RW7A 3CJQA 3WDOA 4BS2A 3O44A 2HGMA 1DBDA 1RT2A 2CJQA 5KFXA 3BBBA 2IRYA 3AH6A 4DX5A 3DM2B 2Y1LB 3W61A 3SCKE 4O3SA 5E0OA 1OSCA 3VAKA 2DO0A 2IVMA 2XMWA 3OL6A 2EFNA 5HQLA 2XMMA 2XNRA 1A7GE 4OHVA 4KGXB 2MXYA 4RLEA 1YX2A 2ROGA 3AB4B 3CCVS 3NLCA 4EGLA 2DISA 2NQPA 3GR1A 2DIVA 3LALA 1REVA 1VLYA 4PQUA 3C15A 4ECZA 2ATCB 2BJ1A 2ZE2A 1REVB 2IFXA 3CJTA 4OYAA 2WVFA 1K73T 5J1NA 2ZE2B 4A4JA 4DV3J 2W4PA 3X3UA 4NOHA 3JYTB 3FUYA 5C24A 1B64A 1UTAA 4WTYA 5KT2A 2JFKA 1U1LA 5C24B 1CJUB 3W5XA 1Q8KA 3DU6A 1T9YA 1HNZF 5DRKA 1NSKL 5ETMA 3EPIA 4IYQA 1U24A 3W8PA 3H2LA 5C42B 1HBOA 4B08A 2ZM6F 4CH0S 5KFGA 1NZ8A 5KFTA 2VG7A 2KJVA 1S48A 3OTBA 4BDPA 1BMQB 3MFIA 4QIWD 2CWXA 1T94A 3Q8YA 1TKZA 1E6YA 1UJ5A 2IA0A 4DX8H 2QG9B 5KFEA 1E6YB 4JI5F 4R5PA 4OLOA 4NLWA 4LVNP 3ZZTA 3IMQJ 2MB0B 1N0UA 3PCOB 1R3NA 2KVQE 1U45A 3EGNA 5KT4A 3KLVA 4NYOA 4DPUA 4KV8B 4FBUA 4ES1A 5SZTA 4TYBA 3KK1B 3UDEA 2BKOA 4DPOA 3HVWA 3H2VE 1XMBA 1S9GB 2MKSA 3GIKA 1CULB 3MEDA 5HI7A 2N7CA 4M95A 3T1HJ 1KVIA 3W5YA 4K4YA 3PR4A 1RWNB 1T9VA 1FWLA 3CCJS 4MTPA 3CB4A 1WEYA 4ZK7M 1BQXA 1FFGB 2K3KA 4PKDB 3FCHA 1UETA 1CVJA 3SSSA 2ZBPA 5KG6A 1NAQA 2PE8A 2H51B 4L73A 1U8WA 1DQ9A 2DGXA 5EGYA 3CF5Q 1T0TV 3MM7A 3H40A 2IPOB 4NLUA 3M8WA 2B56A 1TFWA 2BOPA 3IXQA 2R7UA 3HVRA 2HRTA 2G4BA 4P75A 2QRRA 4RBVA 2FHOB 2BA9A 4ZPDA 1RCXB 2RQMA 3H4DA 1SKRA 1BGXT 3L7OA 1GTEA 4TU8A 4X65F 2BDPA 2CPXA 1AYEA 2MSTA 4RUBA 5L1JA 3P5BP 4DV1F 4ZVOB 1NK9A 1IVZA 3BO4A 4LFBF 4CO4A 2ASLA 1S79A 1HNWF 5MAOA 1S72S 2DNYA 3HLUA 2G9OA 3R9LA 2DY1A 1RGVA 4KKOA 3VAGA 5AT1B 2QA4S 1X4FA 2MQ8A 4M1KA 2W8LA 2NYIA 3UD4P 3V4IA 3FQKA 2D3ZA 3DRRA 2CDQA 2XG8A 1YLXA 3NKYA 2XWYA 4JI0F 4TU7A 3DRRB 2AEFA 3T6JA 1UJ4A 1WUUA 4YB1P 1TMMA 1EKRA 5FDLA 1WC6A 3BPSP 4W92B 4A8SA 5HVGA 1B7YB 3DNCA 3EGVA 1OS5A 2B7CB 3MWBA 2Z58B 1F2GA 2HNZA 3J81j 3ZTOA 2QL5B 1C1CB 2LDIA 1UFKA 2ZD1B 5E3CA 4ED6A 4OX9J 3QRRA 2R8KA 4C0BA 3M7VA 2IAJB 4MIAA 2KO1A 5KG1A 2G2ZA 3RGIA 2R7RA 1M90T 1WG1A 3I31A 4DUYJ 4LIRA 3N0VA 1M5PC 4F3OA 1FVSA 4DJBA 1YJNS 1IM6A 2W01A 2V8VA 4LF9F 3NNHA 2DR9A 4B3OB 1UAWA 4F3MA 4QW9A 2Y0BB 2OI2A 3EVOA 3RUBL 5LXYA 1S1TB 1N6QA 3RJMB 3DOLA 1TU0B 2YPZA 4DR6F 2PEHA 1ZBTA 4J9PA 1RYRA 4NI2A 1FRLA 4Q8EA 1TP7A 2HG4A 2OFGX 3FMWA 3PW4A 3V81A 1FDAA 2AYMA 2EPIA 2RAQA 1FRIA 1K1QA 3R1LA 5D3GB 2MZSA 4KTQA 4DV0J 2DNOA 3C14A 2V8PA 4CLKA 2F63A 4NL5A 4DMZA 4ZVRB 1M5KC 1BC6A 3VAHA 3AD8C 4G1PA 3C14B 1XJWB 1J5EJ 5A8KA 5IT4A 1RBLA 3RRGA 2UXCF 3CJ2A 3J80U 3KFWX 3QRPA 4CLSA 2V9KA 2JVRA 2ZEJA 2PMZD 1WC1A 2E1AA 2JC1A 4GVBA 4Z37A 1V3ZA 3KYLA 3CIMA 3QJJA 3PJ9A 1W2IA 3CDWA 2F5GA 2YNGB 2HNYB 3BR9A 2KZMA 2CRLA 2R8JA 2C3YA 1OYEA 2J6SA 2E1CA 3SFGA 3AJ1A 3G82A 2ZITA 2RD5C 1HI0P 2HHVA 3G82B 3UO0A 2W4DA 3FDSA 3O2IA 2NSCA 2HIYA 1U0HA 3MGJA 3IR5B 3DLEA 4ZOSA 2RQCA 4QWBA 2HIQA 1U0HB 2BUNA 3HKWA 1SCJB 3DDKA 1R0AB 3MUTP 3I9V9 4BWJA 4U6PA 4DPTA 3PJXA 1OO0B 3P96A 2LU2A 2YNFA 1VQ9S 1OMSA 1VCTA 1B0TA 2B8PA 4B3RJ 4F7VA 1XMOF 4ANCA 1UFWA 2JEGA 3J80Y 1NO8A 3KLHB 5A8RB 2LDYA 3IR6B 2EEYA 3RR7A 4JI2F 2AU0A 5J2MB 2CQPA 2FJVA 3DOMA 1ZH5A 1HHQA 3ZNJ1 4KFBB 1DZ5A 4Y2MA 4G6VB 1ZYQA 1A0OB 1JJCB 2RDIA 3W9IA 3GG0A 4ECQA 5GMKa 5IS2A 5F8MA 4USHA 2CADA 3LPEA 2G0JA 3I5BA 1S1UB 5E33A 1LWCB 1SJRA 2XQCA 1K9MT 2JWNA 3TAPA 2VFTA 3FBBA 2YKOA 2XGPA 5F8HA 3CCQS 4JI6J 4AXIA 4XDCA 1UMJA 3IS9A 3THVA 4RW6B 2X1FA 2XYPB 3POTA 2XMTA 2HNDB 4FN5A 3I87A 3UVJA 2VOPA 2C1EB 5THWA 2CA9A 3ETMA 3P3DA 4IQMA 2XCAA 3NOGA 2OPPA 4B3TF 2FC8A 1UPPA 5CCLA 3ZXWA 4UQTA 2ZNYA 2ATLA 1IBKF 3OHAA 5CAAA 3QJLA 1QY7A 5E3RA 1T3NA 5HN0A 3R8YA 5B0BA 3DGPA 5IXUA 3DLGB 4DS5A 2BVZA 2F7VA 3G8SA 3FCWA 1IJFB 2V8DA 4NXNJ 3H59A 2J9DE 2BANB 3MURP 4AL5A 2D74B 2BM1A 2GVZB 5CH7B 3C66A 3HVTA 3IC1A 2FZCB 4B9LA 1RTJA 2K3IA 4OYXA 2NREA 4KBIA 2GAHC 5D4PA 4YB5A 2EBGA 3R6GB 1XN9A 3AJDA 3FJ2A 3BSOA 1C0UA 4Y6IA 3AJ2A 4MYUA 3M32A 3TJ8A 2F8HA 2GGPB 1PAUB 5KFJA 5B0FA 4Y2KA 3M32B 1B70B 2DPJA 2E5IA 5HSPA 2AV5A 3FCVA 4C8MA 3V6DB 3IGNA 2HWTA 3HFVA 4NASA 1FJGF 3D1QA 5A76A 3CD6S 1FDDA 1W26A 1AFIA 1FESA 4MFBA 2JDJA 5F8GA 4DWIA 3H5XA 3C3LA 1MMLA 2AZ1A 5ITHA 4Q2MA 4L3KA 5IFMA 3DLKA 4CT8A 4IR1A 3TJ9A 3DLKB 2D3O1 3SQOP 1FX4A 3NGDA 2E7XA 2YH0A 4ID5A 2BRKA 1KN6A 1OYDA 2R2TA 3N6MA 2LYVA 4ID5B 2K06A 2BOAA 3W8GA 5D8HB 5KT6A 3VF0B 4Q0BA 1ZA2B 3TEGA 1BLUA 2QA2A 4FKYA 2MKHA 2H5JB 2RSQA 1HQUA 4Q0BB 2B9WA 5KFFA 2F4VF 2OSQA 2JNJA 1B4SA 4DR1F 2APOA 9ATCB 1HQUB 2FLLA 4NLPA 3Q83A 3HKZD 1RWMB 1VS3A 3HM9A 4RNHA 1B0VA 3BQ2A 3DRXA 1QTNB 4DN9A 1JWWA 1N52B 3F41A 4U95A 1NU4A 3RB0A 4R25A 3MOZA 2ZBQA 1R31A 1VC6A 4ZN3A 1BQMB 5LXRA 3KLEA 3ILIA 1PKUA 3AFGA 2VV5A 3W2WA 3M9MB 5B0EA 3GIJA 2R7SA 1JJHA 3C6UB 4ZLLA 4KHRA 3UN3A 3PW7A 3EXCX 1KVJA 4ENOA 4N41A 2Q43A 1U25A 2OTLS 1X5TA 3Q86A 2FJWA 4O3NA 1PG5B 1IKYA 4A8XA 4ZVSB 1YWXA 2P9EA 2FJBB 5IV4A 2KKHA 5I3QA 1MWZA 1BQNB 2KTQA 3DGVA 3M9OB 4F2RA 1VQYA 3R5DA 2HGNA 1WORA 3G86A 4A8YA 2DJWA 1APSA 3NCRA 4OI4A 4K5SA 3UE2A 3EWGA 3AODA 1URNA 5HROA 1TL1B 3PY8A 1Y10A 1T9UA 3U27A 1H7WA 4DG1A 2PT0A 3W2VA 4J37A 3N01A 2NXJA 3GJSB 3PDNA 2RDJA 4KR0B 1NJZA 3HX9A 5FLXU 2ABYA 4OX7A 4CNYA 4Y34A 4HACA 1RT7A 1RKIA 1S1WA 2F9JA 5T41A 4B17A 4HACB 4NCAA 3OR2A 3UW1A 4ZMMA 1S12A 4F4WA 3E2EA 3U1MA 1UVKA 3D68A 4EWTA 5JXSA 5H9EJ 3CJ5A 1HHSA 2OJ3A 3EGZA 2G0IA 4MT1A 3P49B 3A3PB 1Y5NB 1SL2A 3HJVA 3I4HX 1RT6A 4TU9A 4C48A 1KQFB 3EMTA 4JV5F 2ZVIA 3UNYA 2DNNA 3ILOA 4LBIA 4LFCJ 2DK2A 5I3UA 1EQ0A 1RI7A 3RG6A 4ETZA 4HYKA 5CYQA 1U49A 4OI3A 3QQCD 2FGCA 5CYQB 1KLMA 3HHLD 2WSCC 1L3SA 2VKZG 1KONA 1MSWD 4DCOB 2ZJPQ 1WC4A 5HMZA 3RZAA 1JXEA 2N3LA 1CJTA 2GQQA 6AT1B 1FJGJ 4O23A 1Y0HA 3GR0A 2VC1A 3MDFA 1CJTB 1CJKB 1DQ8A 4LR8A 3MM9A 3NWRA 3VWSA 3PR5B 1AA1B 3TNVA 3MM9B 2Z57B 3CD0A 2XLIA 1N32J 2QFIA 5ETQA 1HHTP 2VBZA 4YR3A 4BLGA 3CJ8A 1WDTA 3ENVA 4DV2F 2JVOA 2Q6CA 1FNXH 2IC3A 4KIAA 4HT5A 4Y2AA 3A8IA 4JOUA 1IKXB 2IC3B 2GMLA 1V6HA 2V94A 4OJ3A 3Q2SC 2DH9A 2AGOA 3VAMA 2HFNA 1G3OA 4OZNA 1DTQA 2UUCJ 1PIEA 1LW2B 2LKZA 2F4VJ 2QA1A 2GVDB 4N47A 2BJ7A 1DTQB 1ZA1B 1WELA 3TW0A 3UQSA 1XK8A 1FEHA 1XTZA 2ADBA 1IUJA 4K0KJ 3PACA 1VRUA 2R3VA 1X0PA 3J7ZT 1X5SA 1FTRA 3OT9A 2CJKA 5K8OA 2MZJA 2HQDA 1JLCA 4X4UA 4KGKA 3GJTB 3C16A 3O1LA 4QBUA 1JLCB 2FVPA 4FF1A 2CQ0A 1WSRA 2OH2A 2KM8B 4LRAA 3TZXA 3L3CA 4CQ1A 3PRDA 1F9EB 4FNHA 1RHRB 1T7PA 4Y2IA 5L39A 1N4LA 2XI2A 4N7TA 2OPQA 3KK3B 4DQIA 3FEXB 4X62F 3X1LB 2OPQB 1X9MA 4ICLA 1HBUA 4USKA 2XSJA 3ITHA 4IUFA 5T7LA 2VB6A 3DHWC 4ICLB 1WI6A 2OMOA 2H4WB 4OHZA 1YJUA 4EBCA 3LP0A 3KLFB 4NX9A 3L7UA 4ZVHA 1SJFA 3ZC4A 2W7OA 4P6QA 3P5TL 3EM1A 1I1GA 1Q8IA 3KMQA 3OTOF 2BJEA 2KRBA 1N8RT 3VTIA 2FJXA 1SKWA 5CHCB 2IY5B 2HK3A 3L95X 4ECUA 1RHKB 1D09B 3DYAA 3OUYA 3OTCA 2K7KA 1VQ5S 1QUPA 3E01A 4B9MA 1QJHA 2LEBA 3DYAB 1UWBA 3FRZA 5L9NA 4WFAQ 3WIUA 3I9ZA 3QWUA 5ETOA 1UWBB 3T6BA 4IFVA 2XMAA 3BQ0A 1TVRB 1U7LA 2HHPA 4I56A 2ZH4A 4DFPA 4RW9A 3TEHB 1GH8A 4DBQA 1Y11A 1Q86T 5F8NA 1XQIA 4Y0FA 3JTOA 2CFXA 4DV7F 1M0SA 2HAFA 3ELHA 7FD1A 3BEGB 5M2RA 2ASJA 2QX0A 4ELVA 3HPOA 4GC6A 3AOBA 4TVAB 4MKBA 4ED2A 2P6TA 2F9DA 3M2VB 3D28A 2GNKA 3FFIA 1T8EA 1C4AA 3BBCA 3NMAA 1Z2ZA 1N33J 5IZHA 2ZZNA 1I94J 3Q22A 2K1RB 1RADB 4WIIA 3NBPA 3ZZZA 3SSQA 3BGLA 3RRKA 2VQFF 3DCAA 4NLXA 2NPFA 4IR9A 4JI1J 1R0CB 4XPEA 3SI8A 1D1UA 3CJ3A 4KQZA 3IG1A 1TAQA 2DYAA 5AE1A 3UFCX 1I51B 2FZGB 1XMQJ 1RAJA 2FVRA 2RF2A 4YEAA 4F50A 2KRRA 1QTMA 2Z8QA 3MEEB 2R9LA 2KHCA 2RIJA 1WOOA 2R2RA 1R27B 4PAAA 3FRYA 1MLAA 1LWFA 2DHSA 2NZ4A 4OYIA 1TKTB 1DARA 3D9BA 3PV8A 1UWAA 4U7UK 1LWFB 1UEUA 4Q43A 2JRSA 3QGIA 1WHYA 2NSBA 2R8GA 3JQJA 1R0BG 1RHMB 4I68A 2XBPA 1VHFA 2JSXA 4DF8A 3GZ7A 1NH7A 4PQAA 2ZH5A 2XY6A 2OPRA 3QFHA 3I5AA 4YHHJ 1XNRJ 5EUHA 3OXLA 3CCMS 4OV1A 2IBOA 5KG5A 4GO7X 4DV6F 2ACMA 1X8DA 2BBEA 2D9PA 2KFYA 1U26A 5CD4A 3GP9A 2EC2A 4UOHA 4ECSA 4IFYA 1HWUA 4C3LA 3MM5A 2W9BA 3GE9A 4CM0A 3RW7A 4IFYB 1SH0A 1S10A 4F02A 3N5BA 4I64A 3D6TB 2GQ2A 2HVEA 1ZM2A 2WW4A 1YJWS 1VJQA 3OTEA 4JI8J 4ZCMA 5G0RB 1UW4A 2FHKA 5GADI 4LF6J 1X0FA 3AXMA 2RJZA 1RHUB 5IWAF 4ECXA 2JJ4D 4WPAA 1VGYA 4HLBA 2HBRB 5CYJA 1RWWB 1D3WA 2ZOMA 3R97A 3HP6A 1MMNA 3SEOA 2VONA 1PYSB 1IR1A 1SPBP 1Q1KA 3B54A 1K44A 2O67A 3BKFA 2B8QA 2E5LJ 4DR4F 2BJ8A 1XNQJ 3LGNA 4FBTA 5D4NA 2JLGA 3N28A 1CG2A 3CCUS 2FJEB 1TUVA 2IVYA 4RUCA 1U2RA 2CXEA 4KHMA 3ZTQA 5C2CA 3EDQB 5KFZA 2DRDA 1G2EA 1DAXA 2CJYB 1KBRA 5K8PA 1A9NB 3CMQA 2UXDF 2YXLA 1JK9B 2VBYA 3VZIA 3R5JB 4DR7J 1XIQA 2CZ4A 1ZAWA 2YKMB 3K5OA 1EJ7L 1CJVA 3N9UC 4OYWA 1WSVA 2ZKUA 1Q16B 2RKIA 1M5HA 2HHQA 2HZVA 2J6TA 1T03A 2QIFA 3QT7A 2RKIB 1PBAA 4JV1A 1S59A 2GIRA 1ZM4A 2M8HA 2NLWA 3OVAA 1XR6A 3NEKA 4AD6A 2F40A 1NHVA 5AJ3J 1F3FA 3F56A 5KFBA 1WOSA 4C11A 2R42A 2QTWA 2O1PA 4GVLA 3QPIA 4KT0C 2AJFE 4V1Ak 2XY7A 1WOPA 4AYBD 1RTIA 2OFHX 5ETRA 4DHVA 3R7NB 1SB6A 2HSEB 4ELTA 2E1MC 4KYZA 3MM6B 4EI2A 1M5VC 3HFKA 1B99A 2C2ZB 4G1QB 2RT3A 1QSYA 4J9MA 2E9ZA 5I42B 1VJWA 1F60B 3GYNA 3D3BJ 3P45B 3EXYA 1VQNS 3PRBA 3S01A 1KNZA 1KVKA 2Y1RI 4C8YA 1FNOA 1LOUA 2DCLA 2CAJA 4ZITA 2BM0A 1RTHA 4MMOA 1NUEA 1V5VA 1R6YA 5HLFA 3IRXA 1GXUA 3MPWA 2P9GA 1NEEA 3MCMA 1Q0NA 4K4SA 3PW2A 1YJTA 1HLWA 4MIBA 2CPDA 3UN5A 1VQ7S 3HF5A 3PYDA 1SBRA 3OTDA 2HWIA 2Q1LA 3T19A 5K8MA 4RL1A 2GS8A 3RBXA 1C2PA 4DV5J 2DNRA 1FRJA 4HTJA 1FKPA 1ICEB 4OFZA 3FGVA 2E29A 1FF2A 2HS3A 3QAUA 2VDHA 1V3RA 4LF2A 1M1KT 2DRAA 2A1BA 1Q5VA 1YZ6A 1RAIB 4YB7A 2LQ5A 1NK6A 2H65B 3JSRA 4J9UE 2P5VA 1MROB 4PYAA 3LPYA 3MEGA 3QAEA 4G3IA 1U6BA 4X64J 1O51A 4DL2A 1X9SA 1VHIA 1SUQA 3LOUA 4LF5F 2V8GA 3QZ8A 1F6TA 3OXGA 1SUQB 1PO6A 4NLGA 2I6WA 1LQ9A 3GV7B 4CWBA 4NMLA 3SV3A 3NCQA 3MOJB 2D69A 2EWHA 3TWZA 4B9UA 4DSJA 2KH9A 4NE9C 3ILLA 3RW6A 3BM7A 5JMNA 2AGPA 2X1AA 2AYEA 3GMGA 3MR6A 2WW8A 3HD2A 3HHLA 2VUGA 2J76E 2VKRA 4ECVA 3HVAA 3H42A 1WWHA 4JUZA 1WJ9A 1IM4A 3S6EA 2UVUA 3CC7S 3CJKA 4AL6A 4N56A 3FEYB 7FDRA 2BQ3A 4DL5A 3R5AA 4KB7A 1FEEA 3DHXA 1N5SA 1U1NA 1H6KX 3IM9A 3H8YA 2FHJD 1KTVA 1S6PA 3MR5A 1VQSA 2FLPA 3RAXA 4ED5A 1PAEX 1TKDA 3GB0A 1HW8A 1HD1A 4KH0B 3TRGA 2RRAA 3M2RA 3W1YC 1J5OA 1Q81T 1T95A 2OPSB 3SCIE 1J5OB 1SL1A 4OYOA 3DMJB 4NXMJ 2DR7A 3H7HB 2B4OA 3M6UA 3PFOA 4JI7J 4M5MA 1Q79A 3UCUP 1CPZA 1TK8A 1RP5A 1U6ZA 3GLJA 4HEA9 1NK8A 1BHNA 4DLEA 1GMWD 3NWGA 2C3OA 4L74A 3MECA 5LMUJ 4CO1A 4WE1B 2HRYA 4USIA 2A0FB 5B0DA 1HMVA 4KPCA 4WFYA 4Q7AA 3H20A 5ETKA 1T05A 2D41A 4YS2A 4LREA 1T05B 2H5IB 3ISNC 3CCZA 4LF8F 2ACYA 3ZZRA 1RWOB 3A8JA 3MMCB 1JLEB 3UNGC 1S6QA 2DITA 1M5OC 1I6JA 2WVCA 3V6JA 3BDPA 4TY9A 4K4VA 1RCOB 5CZXA 3BGRA 3TZZA 2KFZA 4AQYF 3KLGB 2OEKA 2MZQA 2ZDOA 2VPYB 3ENQA 2L41A 1H7XA 1OPZA 2V4RA 2DD8S 3M1VA 1W7WA 5KFVA 1Z1ZA 2UV8G 5A2QU 1JJ2R 3VGTA 2MZ1A 1GEHA 1RBAA 2G2OA 2HQGA 2RRNA 2XWXA 2V4QA 2W8KA 2MKYA 2VJUA 1HR0F 3RRHA 3HD1A 4FXWA 4C2MA 1F1BB 5GADU 4N77A 4ZJOA 2AJ0A 1WC3A 5C2GA 4USWA 1AXQA 3B8HA 2MQNA 2OO4A 3F0NA 3KJVA 2QYGA 2HPUA 3UPFA 4K4ZA 3D7SB 1NCLA 3U7JA 1NDKA 1YBTA 4KE5A 4LQ9A 4ANEA 2UUAJ 3GU0A 1QAIA 3IGVA 2AZ3A 3NOCA 3TX8A 2V0NA 4QYZK 2M0GB 3DOKA 4DN0A 4XAKA 4AT1B 2MYFA 4HVZA 3MMAA 4LF4F 5BYRA 2R2SA 2Y1JA 1VBYA 3I4PA 3GCXP 1VQKS 1QUVA 4MK7A 2MY8A 2HQCA 2EK1A 1KRPA 3BREA 4C4WA 2HVDA 3MR2A 2WB1D 3GJQB 4GKJF 4OI0A 1TK0A 4IOBA 1X4EA 3NP5A 1FKOB 1S49A 5DG7A 6FDRA 2XYGB 1S76D 4MKVA 1VC5A 3AA9A 3LGMA 4OJHA 3LP2B 4DPWA 3PHTA 2ALZA 1U1MA 4NPOA 3M8SA 5KFNA 1AZSA 3EDRB 2UU9F 2GX8A 1AUSL 2XLJA 3JSMB 3N4WA 3MMBA 4ILRA 5CYMB 3RR8A 2NXEA 1ZZFA 3MMBB 1H2TZ 3UWTA 2DXFA 4YN3B 4M5DA 3AQOA 3RB4A 1TQLA 2DY9A 4M5DB 4NCGA 2H5EA 4F4YA 3Q8UA 1TV6A 2C3MA 3OXFA 2I8EA 2DPIA 4ZLNA 4WBFA 2GQCA 4NCGB 1N34J 4FS1A 1S9EA 4I69A 3FSYA 4RW8B 2B4PA 1PCAA 5DDRC 2VZ9A 2FQQB 2POKA 1WG5A 2WCXA 3H5UA 4CLZA 2IM0A 3NGTA 2GHWA 4WK3A 2IMOA 3BN7A 3MUVP 5AE3A 4RNMA 3TOQA 1W2BR 2LA4A 2VJVA 4F2SA 4K8RA 2XTJP 2DT9A 2KXNB 4JI3J 3CDEA 5F8JA 2UXBJ 2VFVA 2ZH6A 2DB1A 5FIIA 5JVGQ 3ZZOA 1Y9OA 4A47A 4M5NA 1KWMA 1YSJA 2O3DA 1HYSB 4BC7A 2OIHA 1WC0A 2IRUA 3ISZA 4M5HA 2RS8A 1NJWA 1DQAA 1W25A 2NYHA 3LP1B 1O8BA 1YITS 5D0RA 4KSEB 2IM2A 4NZ6A 1VK3A 4R8UA 2F3JA 2NZCA 4YDDB 3EZOA 1JKHB 4UOFA 2B9YA 1VQ6S 1VK8A 5DQHA 3ZZ0A 4M63A 3M8QB 1HFEL 1FK9B 2DNGA 1GMVA 5HMWA 2Y0SD 3NL0A 1RTDA 5CXTA 2A2DA 3V2UC 1X4AA 4UY8T 4KHPJ 1RTDB 3RAMA 4RNNA 2MKKA 1RT1B 4FYVB 4PPZA 4J9KA 3ET6B 3DDIA 3T3FA 2HHHF 1DLOA 5HATA 3DDNA 1X9WA 1MU2A 1IBMJ 2B4UA 4ZVEA 2ZUAA 1WTBA 2FHMA 4ZHRA 4B9SA 3LH2S 2QLWA 3W9JA 3ULHA 5LMNF 1NPPA 2XMKA 3IR7B 1NB7A 4KJIA 4FDFA 2MQPA 1UFLA 1NKCA 1S9FA 3KDNA 3LW5C 3QMQA 2O66A 4JI4F 5E5NA 3TUIC 2EFPA 4X4SA 3DRYA 4F3QA 4GKKF 3QT5A 3QIPB 1QM9A 4X66F 1RISA 4QWDA 4ZP6A 5J2NB 3EJMA 2HS4A 4ED7A 3FZBA 2OMLA 2AJ4A 2ZZTA 1AUDA 4J9RA 3GIRA 1LKZA 3CD7A 2JLEA 2C2KB 1F3VA 1KOOA 4WJBA 4PWDB 1IBLF 3HSDA 4PG5A 2IBKA 4LSNB 3W63A 3PIOQ 3NXZA 1U8SA 2YNHA 4ILMA 1EP4A 3HSJA 3DI6B 2VBWA 2E44A 1UPMB 3HFZB 2YKAA 2VG5A 2AQ4A 3CEDA 4OZ5A 1UW9A 2ZBIA 4JYAF 1OSDA 1L3VA 1IKWB 1QE1A 2IA6A 3IWNC 4NLTA 3QYYA 4FYDA 3KTQA 2X1BA 2FYXA 4FVCA 3TUJC 4RZRA 4TN2A 2HGLA 1FE0A 3E3XA 1JQGA 3S8SA 4CTAA 1JLQA 4F4XA 1WKJA 5GAEU 1AT1B 3H90A 3PW0A 1Y7PA 3ICLA 1JLGA 2DCUB 5B7WA 3SMZA 5KAKA 2B9EA 1NK5A 2EXUA 4QU7A 4UUWA 1IKVB 3HHNB 4N76A 1PBUA 5HQ8A 1SJ3P 4DI6A 3NS6A 2WVBA 3EGWB 4UY85 2FIUA 4LFAJ 3CD5A 2MKCA 2LQ8A 1NBEB 2N82B 1EHWA 3DM2A 3KXDA 4DU8A 3UD5A 3BJYA 1D9FA 4QPXA 5KFDA 3M30B 2GJ2A 5IQQA 1D8YA 3BR8A 2UP1A 5DQIA 3MHYA 3EVMA 1T11A 2W7AA 1KOHA 5ETVA 3L9ZA 2IJNA 4A8OA 2BR0A 3GILA 1U47A 1U48A 1GT8A 3THTA 2OELA 2J0WA 4J9VA 2E9RX 1LEOA 2W25A 2Z2YB 3NS5A 3SQGA 2AT1B 4DL6A 4L72B 5CCMA 3SQGB 5GAHU 2D7SA 3JS9A 3JYTA 4DFKA 4QR2A 2DH8A 5IQ6A 3CXCR 5BJRA 1CJUA 3G6ES 1Q7LB 3J7YI 2E7VA 4IDKA 1SQEA 2YPYA 4EFAC 4UQGA 3IBWA 4IDKB 2QYCA 4RWWA 4XK8C 2JZ5A 4QIEA 2KT5A 4DR2F 4GC7A 3T1YF 3MI7X 4ZS6A 5C42A 1G1XA 5F41A 2ZOFA 3FVYA 5BR8J 2FHJA 1LW0B 4CZCA 2EC0A 2XZWA 4RUAA 1ZM9A 3H0PA 3ZTRA 1VRQC 2JHEA 2WSEC 4I2PA 4K4UA 1YDLA 1N36J 1RABB 5J1PA 1RA7A 2GZOA 2VHGA 2WBRA 4ZVQB 3H5YA 4I2PB 2AX1A 2W2MP 4DZ6A 2HFZA 4QPTA 5F9LA 3W66A 4KV8A 3CSKA 4V19J 2R7TA 4WYWA 3P8BB 1RAGB 5AXLA 4X4RA 1NHKL 1PSDA 4DR5F 3KK1A 1GMWA 1Q5YA 2V9WA 4USMA 5CD4H 2QLJB 1S9GA 4M5IA 1CEZA 3PKMA 1R89A 1CULA 4M5LA 4OZ0A 2DO4A 3PKYA 2YNIB 1ITPA 2VDIA 3HDSA 1L3UA 3M6XA 4DU7A 3PNIA 2H4YB 3D2WA 3RB3A 4I7FA 4CLPA 5H9FK 1CQMA 4DL3A 4L6V3 1JLAB 4I7FB 1S0OA 5GVQA 5ETSA 3J7AN 3SXLA 1S4FA 2BE7D 8ATCB 3GSIA 1X7VA 2ZUGA 1QDUB 1SV5B 2AHOB 3GPAA 1VRTB 1GX5A 4FKXA 4B3MF 1QLNA 1FX2A 2LXFA 5HAOA 4X84A 3KJQB 1S1XB 2Z0GA 4DR3F 4MK8A 4B3SF 2YQ3A 3IWLA 4YP3A 1LNQA 1P9YA 4LF7F 4USJC 1N56A 2G1DA 3TA1A 2RRBA 3RTVA 2JEJA 2RVJA 5C7PA 4WZQA 1HNXF 1X5OA 3CJ4A 2XO6A 4DV4J 4CNZA 4RU2A 2CPZA 3MCNA 1YBAA 3D0IE 2GO9A 3L09A 3MCOA 2RU3A 1UEKA 3WHIA 3FK4A 4QIFA 3LGHA 2FJAB 3LAMA 4OL8A 2HLTA 4YOEA 1QVGR 3SDEB 1RYSA 4OI6A 5AXKA 2JX2A 2E1PA 1B7FA 2YBVA 1YRXA 3TI0A 4EO6A 1MWQA 5KFWA 2ASDA 3TZYA 1WD6A 1QSSA 3CCES 1NMEB 3D67A 1NK7A 3QZ7A 4ZJQA 4H4MA 1TR0A 3KG1A 2JEFA 1FJEB 3R2CJ 3DRPB 4H4MB 2VIHA 2QE5A 2RDDA 4U7UD 4MIWA 1PC4A 1VOMA 2V2QA 3MR7A 2ZH8A 4EZ6A 4W98A 2HW3A 5KFIA 1C1CA 3MF5A 1NKEA 2XHWA 1MNEA 3HJFA 2ZD1A 1CC8A 4YY3F 4FYYB 3I96A 1YJRA 4XTTA 1HWKA 3LQVA 2KM8C 3BQ1A 1O0PA 2IAJA 1TFYA 3MPDA 4ZN1A 4KRWA 2XY5A 1RT5B 4O4GA 1RU2A 2VD3A 1E6VB 5RUBA 3LTOA 2E9TA 4P73A 4O4GB 5DZ6A 1TL5A 2B7BB 3GIIA 4B3OA 2MQLA 1Q8BA 3BYPA 3IO1A 1TTHB 3BSAA 4HHHA 1S1TA 2FUG9 3BH6B 1U6FA 1TKXA 3I0SA 1R43A 1IWAA 1HNZJ 1YGYA 3I0SB 1TKXB 3UCZP 2V8HA 3JB9k 3QSYB 2ZM6J 5EHHA 1X31C 5D3GA 1SI9A 2UVRA 3KMSA 1VBKA 2MTLA 2XB2D 4QW8A 3FQLA 3WX8A 3CCLS 4C0OC 4XPCA 2VQEF 1PJ5A 3DLJA 2AIRB 2MZRA 2I9SA 1ZZNA 5K9FA 2KHDA 2L9WA 4JI5J 1WEZA 2Y8YA 4N8OA 4TQRA 4O3QA 1U1RA 5IC6B 4Y28C 2PO4A 5LSRA 2GMJA 2R7XA 3CJSA 3VGSA 3PX0A 1R7IA 3NNAA 2CVEA 4Q44A 4LT6A 4JBCA 3BYRA 2YNGA 3MPUB 2HNYA 4OLPA 2VH7A 3KUEA 3HHKA 4PXCA 4DL4A 3F44A 5KFAA 4X4TA 1FCAA 2XS7A 3GFYA 1OY9A 4WKRA 2I2YA 1F0XA 3C2PA 5A8WB 3WIVA 2DXDA 5L9XA 4CYUB 3HHDA 1ROFA 2YX1A 2J0QD 2W9CB 3OPKA 5EX0A 4OJGA 2EFOA 3T1AA 4ECRA 2UUBF 2MQQA 5EDWA 3Q8QB 3QGGA 4RKUC 4RW4A 1F2HA 4W4MA 3VGUA 3UI3A 4RW4B 1R0AA 3PO4A 5HVHA 1HBNB 3QGHA 4WFZA 4ECWA 1K47A 2CQ1A 4OYZA 4AXJA 3MM8B 1Q82T 4C3MA 2VG6B 4DEZA 2V50A 3KNAA 3R27A 2MPUA 1ZAVA 3FZ2A 1FJ7A 1WEXA 5J1EB 1K1SA 4I67A 3KLHA 5M2PA 1LFPA 1YIJS 1RWXB 4ED1A 5A8RA 4PG6A 4LF7J 2WHOA 5KFMA 1VC0A 2BACA 5J2MA 3R7SB 2E5JA 5D4OA 4QJVA 4KFBA 4ZJLA 1YHQS 5KG2A 2CPHA 2ZH3A 3Q24A 3IRWP 4CP5A 1FKAF 1F5CA 3G2XA 3NMRA 4X65J 3GG1A 4DV1J 2OLWA 1L3TA 3LAKA 5T14A 4LFBJ 5KTQA 4NYPA 3J7YU 1HNWJ 2IJFA 2CPEA 1SXLA 1N88A 4PXBA 2QN6B 3I0RB 4F0HA 3PYGA 2YKNA 3W3SA 4H4OB 2X7IA 1NSQA 1S1UA 4CM2A 1LWCA 1TL3A 2JFDA 3GONA 2YKNB 1RK8A 3AA8A 1TL3B 1FD8A 1SJQA 4OJ1A 2QV6A 1U09A 2EG1A 3CCTA 4X4VA 3GIMA 2W2QP 4QWCA 3QRQA 4JI0J 3E51A 2PDAA 2HFVA 4RR5A 3GFXA 1NK4A 3BZQA 2AJQA 4TY8A 1VMBA 5E41A 1ZOTA 5D78A 2LXUA 3MZIA 3BN4A 1VISA 4TY8B 3SBMA 1KHWA 5HK4A 1RBOB 4RW6A 1PYOB 2GIFA 2V4JB 2LXIA 2HNDA 2BYCA 2EW9A 3V6HA 2WONB 4LBPA 2H48B 2LQBA 3I6PA 4OI1A 5DDOC 2HEKA 2YY3A 1RSCA 4A8KA 3LUYA 3C6TB 4NLVA 4PABA 4WXWA 4OZJA 2FB0A 4USVA 8AT1B 2ILZA 4YY3J 3GYXB 3PIPQ 3U1NA 2DNMA 4IG0B 4DFMA 2DHHA 1IR0A 4PXEA 1VQOS 2XNQA 1ZPVA 4LIWA 1EX8A 4FF4A 3SIPB 5BYQA 3G8QA 4ZCLA 1WHXA 3DLGA 2BV3A 3R5GA 2HZCA 3QT8A 1DTTA 5HQMA 1RAOA 2BANA 1U1PA 1M1GA 4K2JA 4LF9J 2FC9A 1ULRA 2GHPA 1DTTB 4WP3A 4A46A 5D0EA 3K5LA 1GXLA 4DV3F 3JAMU 1VDHA 2GVZA 4ILLA 3T9NA 1KQGB 1S57A 1HL6A 2O5DA 4DR6J 3OLBA 1X4BA 5B08A 1OQ3A 2BQUA 4K59A 3V4MA 3CC2S 3QSIA 2HQ3A 2LCWA 3I5CA 1S7HA 2CIMA 1C0TB 2CPJA 2QL9B 2IHR1 2XULA 5K5MA 3QNWB 4R0JA 1WHWA 2QT7A 1RU1A 1YJ9S 5DZ7A 2GGPA 2VF3A 1DHMA 1PJ6A 1RT3B 4QQBA 3V6DA 2UXCJ 2DEIA 5L46A 3MEKA 4MAKA 1KD1T 4NA1A 1YQHA 1EZZB 3AXKA 2MLZA 2RHQB 2ZBRA 2VPWB 4OHXA 3LA0A 5GMDA 4C8LA 1JLBB 5DGBA 5KG3A 1RHJB 5KFCA 2CQHA 2OSRA 3UDVA 4ZPWR 1ZPWX 5JJBA 4U8VA 4WP9A 5IOLA 3JAMY 3DRSA 4PWUA 3DRSB 2DIUA 2N3OA 2QLBB 2R7OA 2KT3A 3MAHA 4B9VA 2AEJA
chains in the Genus database with same CATH topology
3A3NB 1V5IB 4K8RA 2XTJP 3A3OB 3BGOP 4NMXA 4NE9C 1SPBP 2W2QP 3VHQA 2PMWA 3H42A 3SQOP 3GCXP 3BPSP 4YN3B 4JP8A 2QTWA 3WIUA 3T41A 3WIVA 2ZWPA 2W2PP 2Z30B 1R6VA 3QFHA 1ITPA 2Z2ZA 2Z57B 3VV2B 2E1PA 3CNQP 3AFGA 3GCWP 3P5BP 2W2OP 3WHIA 2Z56B 2W2NP 3A3PB 2Z2YB 4OV6A 2W2MP 2Z58B 3CO0P 1SCJB 2ZWOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A3N B;  1V5I B;  4K8R A;  2XTJ P;  3A3O B;  3BGO P;  4NMX A;  4NE9 C;  1SPB P;  2W2Q P;  3VHQ A;  2PMW A;  3H42 A;  3SQO P;  3GCX P;  3BPS P;  4YN3 B;  4JP8 A;  2QTW A;  3WIU A;  3T41 A;  3WIV A;  2ZWP A;  2W2P P;  2Z30 B;  1R6V A;  3QFH A;  1ITP A;  2Z2Z A;  2Z57 B;  3VV2 B;  2E1P A;  3CNQ P;  3AFG A;  3GCW P;  3P5B P;  2W2O P;  3WHI A;  2Z56 B;  2W2N P;  3A3P B;  2Z2Y B;  4OV6 A;  2W2M P;  2Z58 B;  3CO0 P;  1SCJ B;  2ZWO A; 
#chains in the Genus database with same CATH topology
 4FPR A;  1S0M A;  2M70 A;  3GFZ A;  3NNC A;  3TJA A;  2WSF C;  2M88 A;  3T1H F;  2E5G A;  1VLO A;  2L48 A;  3CE8 A;  1G6B A;  2GV1 A;  4ECY A;  4BBY A;  1JXV A;  3BSN A;  1F5B A;  2GAG C;  2J9C A;  3BS9 A;  5L38 A;  1KFS A;  2DGQ A;  2XMV A;  3G87 A;  4ZIW A;  1RAA B;  4WFN Q;  1XR5 A;  1XMO J;  4WU3 A;  1IBC B;  2KB2 A;  2AWZ A;  2C2O B;  2RS2 A;  2E5H A;  2OGU A;  1BQM A;  3KLI A;  2JLF A;  4F04 B;  4J7C A;  3HSG A;  3BKT A;  1S6O A;  2PD1 A;  3KLI B;  4JI2 J;  2ERR A;  2DEJ A;  2VU5 A;  1ZTT A;  3GCW P;  1BUX A;  2YKP A;  1NK0 A;  4FVM A;  3VAL A;  4WKY A;  4DSF A;  5J2P B;  4IG3 B;  2XMJ A;  2JH3 A;  4U96 A;  2GJI A;  3C6U A;  2LEP A;  2UUW A;  2M9K A;  3RBZ A;  3OSN A;  2DR6 A;  1QAX A;  2X1G A;  2A2C A;  4QWA A;  4ZVT B;  4DUT A;  4DZD A;  2RUS A;  3HT0 A;  2ZNZ A;  1BE4 A;  2GMH A;  4C6A A;  1D8Z A;  1EKS A;  3IAS 9;  4URG A;  1SC3 B;  4O0N A;  5L8R C;  2CUY A;  1FFS B;  2WZ1 A;  3VHQ A;  1SJ1 A;  3K8W A;  4C9D A;  3FSI A;  2DTJ A;  1BQN A;  4RBU A;  2OEJ A;  4NWB A;  2P6S A;  5ETN A;  2WK4 A;  2K8G A;  1X60 A;  4L75 A;  5B0G A;  5G4D A;  4DX6 A;  2P2C B;  2EG2 A;  4H54 A;  4DL0 C;  3HHL C;  5C25 B;  4U8Y A;  3H5S A;  4NZ7 A;  4ZCK A;  4UW2 A;  4WP8 A;  1S1V B;  1VQM S;  1TL1 A;  1UEV A;  4RW7 B;  3BBF A;  4DPY A;  4I2Q A;  1LK5 A;  2ZC3 A;  4LVO P;  4Y65 A;  4MYT A;  1NDL A;  3G6X A;  4NLR A;  2XYH B;  1KP6 A;  4H4K A;  4I2Q B;  1RT2 B;  2OD6 A;  3NGS A;  5I3P A;  1FDN A;  2CJB A;  4X4N A;  3GSD A;  4MKA A;  1I3O B;  2VIC A;  2CWK A;  4B3T J;  4F4Z A;  3TVK A;  5HMX A;  3D3C J;  4Q2L A;  1CQN A;  1BD6 A;  3W60 A;  2J9D A;  3CUL A;  1VFJ A;  3Q23 A;  4ZLJ A;  1IBK J;  3VV2 B;  3OVS A;  1RTZ A;  2OHD A;  2A6M A;  4OX9 F;  1F9H A;  5DDP C;  4IO9 Q;  1FER A;  5KT7 A;  3CO9 A;  4DUY F;  2ZH7 A;  1F9F A;  4F8R A;  4PQU B;  3C15 B;  3AT1 B;  3Q8S B;  4FYW B;  1Y00 A;  5D4L A;  5DGA A;  3JTN A;  4C8N A;  4S0M A;  3THP A;  3ETO A;  1IWG A;  5FJ4 A;  2Q3P A;  4LRD A;  4ITS A;  4I1T A;  4HHJ A;  3I56 S;  2ZZM A;  1PC5 A;  3D6H B;  4OZ3 A;  2MQO A;  2C2R A;  2QSF A;  2DRB A;  1NPR A;  2FGO A;  1EB0 A;  2PA3 A;  3CW2 C;  4KGM A;  1HBO B;  4C7Q A;  1Q53 A;  2VG7 B;  3KHL A;  4DV0 F;  3TA2 A;  2A6O A;  3IFE A;  1RE1 B;  1GTH A;  3J81 U;  1J5E F;  1K0T A;  1PIL A;  1CJK A;  1TKZ B;  1NSA A;  2FY8 A;  5FLX Y;  4R5P B;  3K89 A;  4NEY A;  1R8H A;  2B43 A;  4CO5 A;  3CTR A;  2KDO A;  2WVD A;  5HL7 Q;  3ONQ A;  1H72 C;  5E3P A;  1YRT A;  5F3Z A;  4EO8 A;  2HBZ B;  1CLF A;  1GMU A;  1WAC A;  1WF0 A;  2IYG A;  2W1B A;  4E8U A;  1UJ6 A;  4LSL A;  3EYZ A;  1IKX A;  4K4X A;  4CLT A;  2OEM A;  4LSL B;  2A18 A;  4ZP7 A;  2ZHO A;  2J8S A;  2FVS A;  1YI2 S;  1NZA A;  3MED B;  2J8A A;  1LW2 A;  1OY8 A;  2GVD A;  3HCX A;  1FWP A;  4NLY A;  2HHS A;  5ETT A;  2BEF A;  2YH1 A;  4DR1 J;  4DQR A;  2ADC A;  2B51 A;  1LWX A;  5HMY A;  1QAY A;  5KG0 A;  5LM7 E;  3IWX A;  4RU9 A;  4P2S A;  2G13 A;  1NHU A;  4RX6 A;  2IM1 A;  4D3H A;  2XI3 A;  2FLO A;  4DOZ A;  4PZV A;  1JXL A;  1SKU B;  3MXH P;  4TNO A;  5J2Q A;  3J81 Y;  3Q8P B;  1NLK L;  5D0H A;  4C3K A;  3BV8 A;  4O3P A;  4CO2 A;  4B3R F;  5DET A;  2NCK L;  5J2Q B;  3PG9 A;  4EYH B;  2GJF A;  2FTR A;  1S97 A;  3R5C A;  4KH1 B;  1P9Q C;  1UKU A;  3KK3 A;  3MM7 B;  2BMB A;  2ZJR Q;  2N4C A;  1RA6 A;  5HAN A;  2KZZ A;  1NDC A;  3AOA A;  1Q4R A;  2BKN A;  1C4C A;  1JB0 C;  3QWP A;  1PGZ A;  4ETX A;  3KLF A;  4CRJ A;  4NRT A;  3MPY A;  1SQF A;  1P1T A;  4X4Q A;  2BJD A;  1RAC B;  3MPV A;  4C8Z A;  3NAH A;  2ZH2 A;  3W64 A;  2MKI A;  5DLF A;  2W24 A;  3NGK A;  4OZ2 A;  2FDN A;  1V9O A;  3FKB A;  1MG7 A;  2FJD B;  4QYZ J;  3CCR S;  4KKO B;  4WTO B;  4USU A;  4ZDN A;  4EBD A;  3BGO P;  4ER8 A;  1DUR A;  1VIX A;  5KFP A;  4FPI A;  3ENW A;  1TVR A;  3NS7 B;  3V4I B;  1HNV A;  5CQG A;  3UR0 A;  4Q8F A;  1HNV B;  2CG8 A;  4IH5 A;  2RE1 A;  1UCN A;  4JI6 F;  4IRD A;  2H3E B;  2GA7 A;  4UZC A;  5FDL B;  5F8I A;  1XWL A;  4FS2 A;  3H98 A;  1GNK A;  2HZA A;  2IMW P;  3S7R A;  1HA1 A;  4P2M A;  1T02 A;  4IH6 A;  2ZOG A;  5LOQ A;  2VBX A;  3R1H A;  2HNZ B;  3U1L A;  3M2V A;  3DKD A;  4WFB Q;  2BE2 A;  1YJ7 A;  4CLU A;  4K4T A;  2CPF A;  2M3D A;  2J6U A;  2BE2 B;  2GIQ A;  2FLN A;  2UVW A;  4UOC A;  2RU9 A;  2DNK A;  4URS A;  5KFL A;  2K1R A;  3GYG A;  1YRU A;  3GJR B;  3UDC A;  1IR2 A;  3FEZ A;  2ASY A;  5KFR A;  4NXN F;  4ELU A;  4LBH A;  4P71 A;  1GK8 A;  2HAI A;  4JV5 J;  1DRZ A;  3QAT A;  1JIH A;  3K8V A;  4WXO A;  1WTF A;  3J7Z 5;  4PUO A;  1N6Q B;  4PEO A;  3DOL B;  1YJV A;  3MEE A;  4DSK A;  3PEH A;  2M8D B;  4PUO B;  2RML A;  1DFD A;  3ENA A;  9RUB A;  1NDP A;  1TKT A;  2V2V A;  5ADZ A;  4NI2 B;  4ZVG A;  2PN6 A;  4F36 A;  4JB8 B;  2O01 C;  4NLQ A;  3GTY X;  3V81 B;  2J0S D;  4HI1 A;  3VQT A;  2MKJ A;  3G71 S;  2KI2 A;  3RU0 A;  2E7W A;  4Q5V A;  1N5T A;  1FNM A;  1REG X;  1RKJ A;  1H73 A;  4MH8 A;  2QA4 G;  2LQJ A;  2LP4 A;  3ZNU A;  5A8K B;  4PG4 A;  3DU5 A;  2NR0 A;  2I0X A;  2ZWO A;  1WF1 A;  1VBZ A;  4ZCI A;  2EFQ A;  1T9T A;  4PPD A;  4ED4 A;  4XDD A;  3OHB A;  2Z30 B;  4GVB B;  2D9O A;  3AY0 A;  1NRK A;  4PXD A;  1PJ7 A;  4LUB A;  2K7J A;  4DV2 J;  4E0D A;  1HAR A;  3JXO A;  3O3L A;  4OQJ A;  1C1B A;  2MQM A;  1UZH A;  3DXB A;  5G0R A;  1J27 A;  3QLH A;  1C1B B;  5AE2 A;  2J5A A;  2HKE A;  3QLH B;  4ZP9 A;  1X4D A;  3H25 A;  2J7K A;  4I6W A;  1O6X A;  3TP2 A;  4OI2 A;  2AF6 A;  2NUU G;  4KGZ B;  4ZLP A;  1P1L A;  1RT4 A;  3G96 A;  3DLE B;  4ES3 A;  5LJ5 Y;  2R7V A;  1FRH A;  3VCD A;  1RT4 B;  4WYL A;  4C98 A;  2Z2M A;  4LSZ B;  3LO3 A;  1XEZ A;  5KFK A;  1JJ4 A;  3Q2T C;  3SSR A;  3ZFV A;  2YNF B;  2L9D A;  3OR1 A;  2QMU B;  2XZD B;  1FE4 A;  3OR1 B;  2KL8 A;  3KK2 A;  2CNK B;  1UVN A;  2XC9 A;  4X62 J;  3KK2 B;  2PI4 A;  4OYP A;  2YKM A;  5E2Q A;  3DOM B;  5IT9 U;  1Y4Z B;  4LJM A;  2JL9 A;  2BE9 B;  1Q95 G;  3BGF A;  1OJ4 A;  2V67 A;  4K50 A;  3OTO J;  5KOW A;  2PC6 A;  3OL8 A;  8RUC A;  3WZ0 A;  3B78 A;  2NXU A;  2CG4 A;  2FZK B;  3DXS X;  2PI5 A;  5K14 A;  3K0J A;  2IDL A;  2YVS A;  4NEZ A;  2CQC A;  3KKF A;  2BW2 A;  5K14 B;  2Y8W A;  4M5K A;  4TYA A;  3LWL A;  4PR6 A;  2KXF A;  1YBU A;  4OHY A;  1TZ0 A;  2PMW A;  2EKN A;  4RNF A;  2QGF B;  4U9R A;  3VAF A;  4LRC A;  1SC4 B;  3CVK A;  4CH7 A;  2CNL B;  3BGU A;  1TEL A;  4CLL A;  1BY9 A;  3R7B B;  4ATN A;  3M9N B;  4OZ1 A;  4DQP A;  2V34 A;  3NCP A;  5C5J A;  3KUG A;  3MM6 A;  1JNZ B;  2AKW B;  3HI9 A;  1HWI A;  4G1Q A;  4PYD A;  2W9A A;  3W65 A;  2C28 A;  3TQE A;  5I42 A;  4DDF A;  3BF4 A;  3IS9 B;  4UOG A;  4P10 A;  4P9S A;  4DV7 J;  4FXV A;  2XCP A;  1VI7 A;  1LK7 A;  3POT B;  2B3T B;  2MEW A;  3UVJ B;  4KPY A;  3NRB A;  4AUK A;  2OPP B;  5EWE A;  2BAB A;  5K20 B;  4CDI A;  1QSL A;  4MKY A;  1OPI A;  5IT9 Y;  2CZ9 A;  2V6A A;  3S1T A;  3SCL E;  3TZW A;  4I4B A;  3QT6 A;  2MSS A;  2ZBC A;  1TL7 A;  6FD1 A;  3MR3 A;  1TL7 B;  4PCQ A;  2WTF A;  3DGP B;  4KC5 A;  2IDE A;  4FF2 A;  2VQF J;  2HYI B;  4WWS A;  3PZP A;  2F65 A;  3OSP A;  1VBX A;  4RWX A;  3HVT B;  5D77 A;  4NLO A;  3M6V A;  2YWH A;  3O5T B;  4LFC F;  4RPF A;  1RTJ B;  3H2U B;  5DJB A;  4FYX B;  3W5Z A;  2C2E A;  2YWE A;  3TAQ A;  1KTQ A;  1MRO A;  1U2C A;  4N8N A;  5D15 A;  4Y2C A;  4QU6 A;  1C0U B;  3G4S S;  4DSI A;  4HI2 A;  2F1F A;  1RDR A;  2GHV C;  2V5H G;  1FRX A;  4IKA A;  3IP0 A;  3V6K A;  2CDR B;  5F0W A;  2CJX B;  3C8Y A;  4DV6 J;  1HNI A;  4P7V A;  2P8I A;  1URR A;  1HNI B;  1S7I A;  2PSZ A;  1NB2 A;  3BSC A;  4P2X A;  1LXJ A;  4MFB B;  3D5M A;  1SKS A;  1LXN A;  2PFF B;  2VA3 A;  3PW5 A;  5M2U A;  2C3P A;  2CPY A;  2AJ1 A;  3PO5 A;  2VFR A;  2C42 A;  3OJS A;  1RB0 A;  2QL7 B;  2R7Q A;  3A8E A;  3CIZ A;  1N32 F;  4DLG A;  1U1O A;  3GWC A;  1X4G A;  4Z2X A;  2D3O R;  2Z4P A;  4F0K A;  5B0C A;  3QID A;  2IIH A;  3BB5 A;  1OWX A;  2KYX A;  2MZT A;  2N4D A;  4C97 A;  3OLA A;  5IWA J;  2FVC A;  4I6Y A;  1EIY B;  4QZV B;  2QO3 A;  2MJU A;  2XS5 A;  3QFW A;  2UUC F;  4F67 A;  3PVX A;  1Q7Y T;  1HBM A;  3FBE A;  5CAB A;  4XO0 A;  2HVZ A;  3QO9 A;  4DR4 J;  3PTW A;  2BW7 A;  1HBM B;  1TUW A;  1SVD A;  4TKT A;  2MJN A;  4K0K F;  3QO9 B;  1Y5L B;  1IQZ A;  1O5J A;  4K2X A;  1ZS6 A;  4MK9 A;  3G6Y A;  1HW9 A;  1Y3K A;  4B02 A;  3I55 S;  1NH8 A;  2KVI A;  4I6A A;  2QC3 A;  4JP8 A;  3UD3 P;  4YUD A;  2CQB A;  2OPS A;  4WIQ A;  5KG4 A;  1K0V A;  4M5J A;  5LJ3 Y;  2UXD J;  2YWK A;  3KLE B;  5H9F J;  3DMJ A;  3C19 A;  1F5A A;  2DVI A;  3W2W B;  3C46 A;  2QEX S;  5LL6 d;  4ZA1 A;  4KGV B;  5CZV A;  2R8H A;  3MFH A;  2N7Y A;  4C8O A;  1U1Q A;  4YDX A;  4YME A;  2VPX B;  5A6W A;  5IV3 A;  3IA0 A;  3D66 A;  3K7R A;  3FMB A;  1WKL A;  5EX3 A;  4WE1 A;  3R3T A;  1H0H B;  2AJ2 A;  1IKY B;  4P2F A;  3PX4 A;  1GAO A;  1RLD A;  2AEM A;  2ROE A;  3KDO A;  5GAG I;  3N6L A;  4EK2 A;  3HSZ A;  2AX0 A;  3A1Y G;  3GV8 B;  3PXG a;  1KFD A;  3MMC A;  1JLE A;  3RBD A;  3QBC A;  1RUS A;  2CKW A;  1RHQ B;  5DG8 A;  1VR6 A;  4LRB A;  1AB8 A;  3I32 A;  3G6V A;  3F73 A;  3D6F B;  3HHE A;  3M8Y A;  5HRO B;  3CCS S;  2RHS B;  1U1K A;  2M5Y A;  1JLF A;  4DG1 B;  3GV5 B;  1JNR B;  3W2V B;  3BPD A;  3KLG A;  3MAQ A;  1N0V C;  1SJ4 P;  3NG8 A;  1JLF B;  1X5P A;  3AD7 C;  5D0G A;  4DS4 A;  4E2F B;  2LEC A;  4CLW A;  1T3O A;  2B5J A;  4J9Q A;  2M2B A;  2QMW A;  1RT7 B;  1MN7 A;  2DNZ A;  3PM9 A;  1BWE A;  1VQ4 S;  2B5J B;  1S1W B;  3AAW B;  4MJK A;  2AYB A;  3OR2 B;  4IRC A;  1N54 B;  1S99 A;  1TAU A;  2ZKT A;  2E1R A;  1FVQ A;  1LV5 A;  2WBM A;  3CDB A;  1N33 F;  3CJ0 A;  1I94 F;  4OX6 A;  4K4W A;  2W7P A;  3CME S;  3G8T A;  2M4M A;  3TAN A;  3BDE A;  4JI1 F;  1RT6 B;  5EWG A;  5IC4 B;  4JV0 A;  2COL A;  3VVT A;  2JEI A;  1FI4 A;  1UVI A;  3D0H E;  4RO0 A;  5LSO A;  1XMQ F;  1HWL A;  2C2N A;  5AXN A;  5I3U B;  1G4C A;  2BX6 A;  2IRX A;  4NLD A;  3B4D A;  3EUN A;  2MHN A;  3D4J A;  1SIZ A;  2HFO A;  3UCG A;  1KLM B;  3OW2 R;  4EMD A;  3IBC B;  5K8N A;  1CS4 A;  1OY6 A;  1TMJ A;  4I0W A;  3J7A 1;  2J0X A;  3B4M A;  4P74 A;  1CS4 B;  2I38 A;  1H3D A;  4PWW A;  1H98 A;  4HDH A;  4LF5 J;  3EIC A;  3OVB A;  4YHH F;  1XNR F;  3JSB A;  4NA2 A;  5DG9 A;  1J2V A;  1FKO A;  2P9C A;  2DGS A;  1VQL S;  5H1S V;  1SH2 A;  3WX4 A;  1H74 A;  4DL7 A;  5E3A A;  5A2Q Y;  4O3R A;  3LP2 A;  4HH1 A;  4LF1 A;  3O8W A;  3DLB A;  3A3N B;  2DH7 A;  3TVZ A;  2L08 A;  3ZZP A;  3TVY A;  3O6Q A;  3JSM A;  3N5F A;  3PYE A;  3EZU A;  5DM6 Q;  3AHP A;  5CYM A;  3HO1 A;  3B6B A;  2D1C A;  2IM3 A;  2NXC A;  4G65 A;  2RNE A;  3TQ1 A;  1TK5 A;  3FSX A;  1P8G A;  3HT3 A;  4JI8 F;  3ZO7 A;  4OYM A;  2VAS A;  4C8K A;  2VC0 A;  2U1A A;  2Q6B A;  2C3U A;  3NAI A;  4KO0 A;  4LF6 F;  2V69 A;  1Z4U A;  1D9A A;  2HMI A;  1R6V A;  4KO0 B;  2XM3 A;  4RW8 A;  2AP6 A;  2M7S A;  2HMI B;  3K5N A;  2XSF A;  2MHE A;  2ZHB A;  4UST A;  1Y3J A;  3CUN A;  4LMZ A;  3AOC A;  2E5L F;  3PEJ A;  1NND A;  1VRU B;  3SYZ A;  1XNQ F;  3VAJ A;  3N6N A;  2C22 A;  2MDA A;  2B0G A;  4ZPC A;  3C16 B;  4TLR A;  3M05 A;  2DKO B;  5CA5 A;  1HYS A;  2LFV A;  2CQ3 A;  4PG8 A;  4F4A A;  3ZTP A;  4M94 A;  3ILJ A;  4YFU A;  3HMJ G;  1L5U A;  3T5H A;  3NY0 A;  2PMH A;  5E3Q A;  2WRM A;  1HBU B;  1SL0 A;  4DR7 F;  3CGI A;  3FBF A;  2XSJ B;  3ITH B;  2VFU A;  5T7L B;  3LP1 A;  5HBM A;  2AMC B;  3LP0 B;  1MN9 A;  1H38 A;  4CO0 A;  5HBM B;  3M8P A;  1FFW B;  3DN9 A;  5KFO A;  1GQE A;  2ZWP A;  1JKH A;  3W7B A;  3M8P B;  4QYR A;  2AW0 A;  5IT0 A;  4B9N A;  3M8Q A;  3DFE A;  2AD9 A;  1FK9 A;  2R4F A;  3OUY B;  5AJ3 F;  2ILY A;  1UA1 A;  3E01 B;  3FC9 A;  2GO8 A;  2AGQ A;  4LF8 J;  4RJV A;  4YQW A;  3K57 A;  4K5R A;  3KJN B;  4IFV B;  1RQ0 A;  3BKU A;  2DGW A;  1ZET A;  4PRF A;  3R6L B;  1RT1 A;  3W9H A;  2RH3 A;  4RW9 B;  3ET6 A;  5MLC V;  4J9O A;  1VIO A;  2BXJ A;  5SUH A;  5DQG A;  4AQY J;  4DXL A;  2HFU A;  5AXM A;  4Q45 A;  5HVF A;  2CJA A;  4CIO A;  4GRS A;  3T41 A;  3M8R A;  2CQ4 A;  2LVW A;  3BO3 A;  4A8M P;  4ERD A;  2JC0 A;  1R8C A;  5HP1 A;  1RAE B;  4HL9 A;  4NLS A;  1ZTW A;  3K58 A;  4HDG A;  3EPG A;  2DR8 A;  5HP1 B;  2HWH A;  3L4B C;  1FTC A;  3EE3 A;  4AND A;  3QIP A;  1HR0 J;  2A3J A;  2DNQ A;  3EZ5 A;  3VZH A;  3FFI B;  2EKY A;  4CLY A;  3M6W A;  2CVI A;  5J2N A;  3OD2 A;  2L9N A;  2YQ1 A;  1GXT A;  1RWK B;  2CQI A;  1RXO B;  4ZPA A;  3NBP B;  4QR1 A;  4HHU A;  4U67 Q;  4PWD A;  2CQD A;  4LSN A;  1YVF A;  2HRU A;  2PGC A;  4N5S A;  3TR5 A;  1T9W A;  4DV5 F;  4FF3 A;  3MTK A;  3IG1 B;  1SIW B;  2RQK A;  1JX4 A;  3DI6 A;  4OIX A;  1KQK A;  2RF2 B;  2IJR A;  4B9T A;  2AYG A;  4IOC Q;  2GFF A;  2V63 A;  2VL1 A;  3QJP A;  3LF0 A;  2QZ8 A;  4LF4 J;  1LFW A;  1I5O B;  1IKW A;  3WC2 A;  1WNE A;  3SV4 A;  2J7W A;  1N5V A;  3I82 A;  2NS1 B;  2XZT B;  2X51 A;  1XBW A;  2NPI A;  2QLX A;  4RBT A;  4X64 F;  2DR5 A;  2OPR B;  1RWV B;  3A3O B;  4GKJ J;  1VQP S;  3GQC A;  1NJX A;  4OHW A;  5KOX A;  3D1O A;  2QLF B;  2C2M B;  2OKQ A;  1NPK A;  1IJE B;  2HVH A;  2GC8 A;  3CWJ A;  5HJX A;  2EFV A;  1PYT A;  5BYS A;  4TQS A;  1KQS R;  2PII A;  4C0H A;  4DSL A;  3MM5 B;  5DO2 A;  2W9B B;  4O0I A;  2W4C A;  1FD2 A;  1MMD A;  2UU9 J;  3R5B A;  1IKV A;  1N48 A;  2KU7 A;  1K8A T;  3D6M B;  3P4U B;  2XMU A;  2ALY B;  5GAG U;  2XHC A;  4F4K A;  2FPH X;  1N5Y A;  2CZV C;  3FBC A;  3AD9 C;  2F4F A;  1N5Y B;  2LMI A;  2E66 A;  5L1I A;  3ZZY A;  2HK2 A;  3M30 A;  2KJW A;  2BQR A;  1UA0 A;  1KKH A;  3KWM A;  2J9E A;  3D0G E;  1RWP B;  2Y3Y A;  2LQ9 A;  1ZM3 A;  3CDU A;  4AE5 A;  3KG0 A;  1V3S A;  1B0P A;  3G9C A;  3M4X A;  3N79 A;  1YKW A;  3WC0 A;  4QCL A;  2OAU A;  3UDL A;  1XC9 A;  1RLC L;  1S5Z A;  4J90 A;  4Y3C A;  1NM2 A;  3NGR A;  2CPI A;  3MAA A;  3OFH A;  2B9X A;  4K7Q A;  3MAA B;  2XLK A;  2BJ3 A;  4U7C A;  2LU1 A;  5EN1 A;  1S4E A;  1N5Q A;  3TAR A;  4DFJ A;  1XR7 A;  4M8L A;  1D0E A;  4NXM F;  2ZH1 A;  1CJV B;  4JI7 F;  2HHW A;  1IQT A;  1SQG A;  2BKP A;  1T03 B;  4ES2 A;  5BXI A;  1LW0 A;  4M5G A;  1SH3 A;  2RQ4 A;  5LMU F;  1HKA A;  1EET A;  2DNL A;  4TLQ A;  4QWE A;  1S0V A;  4J91 A;  1EET B;  3K2Y A;  5F8L A;  4C11 B;  4NZ0 A;  3T5J A;  4WFX A;  1M1H A;  1KC8 T;  3CMA S;  1WHV A;  2X3G A;  3R2D J;  1X4C A;  4A8F A;  1RTI B;  3KNG A;  1B3T A;  1EAR A;  4UF4 A;  1VYA A;  2HVI A;  2NXN A;  4DPX A;  1UVJ A;  2HHH J;  1RZM A;  3TYT A;  1TUG B;  3OQ2 A;  2ZC4 A;  4H4K C;  2UZA A;  3CPW R;  1FHT A;  2HFS A;  5LMN J;  4IQX A;  3TAM A;  4ALZ A;  3B82 A;  1SC6 A;  2D3U A;  3TAM B;  1AFJ A;  2BZ2 A;  1CC7 A;  4ZKA A;  5A6P A;  1MW7 A;  2YNI A;  4JI4 J;  4HH0 A;  4BCA A;  4RNO A;  4GKK J;  1KDN A;  4J9S A;  2GCF A;  1RTH B;  4J9N A;  4X66 J;  2YWW A;  5HLF B;  3IRX B;  1JLA A;  5HJY A;  4DUZ F;  2ZH9 A;  1HPZ A;  4YR2 A;  1HQ2 A;  1HPZ B;  3OL9 A;  2K2P A;  1IBL J;  1SV5 A;  1NJY A;  2KYZ A;  2M52 A;  4J9L A;  2B4V A;  1JMT A;  3RYL A;  4IO1 A;  2OD4 A;  1VRT A;  1Z2L A;  7AT1 B;  2UUA F;  4ZP8 A;  1FKP B;  2MLY A;  1S1X A;  4DQS A;  3A4T A;  4OYB A;  1KHV A;  2YQ0 A;  1HI8 A;  4CT9 A;  1TL4 A;  2DBB A;  4P7T A;  1ARO P;  3HUL A;  1IN0 A;  4O44 A;  4JYA J;  4UT4 A;  3WQP A;  4URQ U;  5D6G A;  4O44 B;  2LA6 A;  3MEG B;  1L3K A;  2NUH A;  2Z56 B;  4LR9 A;  1QD1 A;  2V2K A;  4NYZ A;  4P52 A;  1U0S A;  4HTI A;  3CCW A;  4LR7 A;  1EQM A;  5E7O B;  4WK1 A;  1Y5I B;  4IH7 A;  4A48 A;  1BXN A;  3US5 A;  3SDE A;  4EEY A;  3CO0 P;  1GFW B;  2UV8 A;  2KFN A;  3ZZU A;  4EUV A;  2JOQ A;  4NCB A;  3T5K A;  2Z2Z A;  2VOO A;  4E98 A;  3JQM A;  1OQ6 A;  2R2U A;  2ROP A;  2YWF A;  3BH7 B;  5KFH A;  2H1Y A;  2XEX A;  2DHX A;  3HHL B;  5H9E K;  4BHQ A;  4HT7 A;  4ZVF A;  3V5R A;  3VGV A;  3DRP A;  2G1H A;  1KR4 A;  2IYI A;  2HS0 A;  2F8M A;  1A6L A;  2C2D A;  3KUH A;  3CJK B;  3TA0 A;  1N34 F;  2CYY A;  1FO1 A;  4AFF A;  3PJW A;  1YG0 A;  4UTG A;  2CNN B;  4QOT A;  5FD1 A;  2VFS A;  5KFS A;  2HUR A;  3Q89 A;  4DF4 A;  2H54 B;  2VOD A;  1KEK A;  5DDQ C;  1S6P B;  2DGT A;  4JI3 F;  1RT5 A;  3OFG A;  1E6V A;  3GFH A;  2UXB F;  2FVQ A;  2UUT A;  4ECT A;  4O4R A;  4L3N A;  3M2R B;  2KT2 A;  2PA8 D;  4R0E A;  1G7C B;  2HHU A;  2BJ9 A;  2CNO B;  3SCJ E;  3E8O A;  2H9Z A;  1YK9 A;  4LRF A;  5GAE I;  5KG7 A;  1RJJ A;  1FDB A;  4IOA Q;  4DR2 J;  1UVL A;  3T1Y J;  3JQK A;  3KOA A;  1RAH B;  1Q78 A;  3MCS A;  4FP9 A;  3VVU A;  3MMJ A;  1R8A A;  3MEC B;  2HQI A;  3L7P A;  2RUG A;  3A13 A;  3QGP A;  3K59 A;  3A12 A;  2CQ2 A;  1HMV B;  2UVV A;  1WKK A;  1X4H A;  3RB6 A;  5F0U A;  2RIL A;  3RBE A;  5U47 A;  2WOM A;  3VQS A;  4KHP F;  1WDD A;  3CDA A;  3KHH A;  2MLX A;  2WOM B;  1S6Q B;  4OMF G;  2X3D A;  3T9Z A;  4TXS A;  4OX8 A;  2PFD A;  5LSL A;  1U02 A;  2QMX A;  3BGR B;  3D54 A;  4LQ3 A;  3Q8R B;  1OIA A;  1IBM F;  4ID8 A;  3VAI A;  4DR5 J;  3W62 A;  2W2O P;  1M5S A;  1WG4 A;  3CC4 S;  5A8W A;  1V5I B;  3HZE A;  2Q66 A;  4CYU A;  3M1V B;  3AB2 B;  1U4B A;  2W9C A;  4DQQ A;  5B09 A;  4CH1 A;  2XS2 A;  5KT5 A;  5GAH I;  1P27 B;  2FY1 A;  4P72 A;  5A0Y A;  4DUZ J;  2KN4 A;  2DHA A;  3OFE A;  2ZDP A;  4ED0 A;  2Q79 A;  5A0Y B;  4FNI A;  3LAN A;  3A8K A;  1HBN A;  1T9X A;  2KG0 A;  4FXD A;  3KJV B;  5DM7 Q;  1UZD A;  3MM8 A;  3Q0A A;  2V2Z A;  2IVF B;  2VG6 A;  3JTP A;  3DLL Q;  1FRK A;  4B3M J;  5J1E A;  4V19 X;  2QFJ A;  2WAQ D;  2F8E X;  2EFG A;  3IBF B;  1NJI T;  4DR3 J;  2ZFH A;  3OJU A;  4B3S J;  3TUP A;  4YR0 A;  1FXL A;  3TO8 A;  3ISN D;  3DOK B;  5KFQ A;  1KLN A;  1ACM B;  4A8W A;  3MMA B;  4HR2 A;  1FXD A;  3PFE A;  1R8B A;  4CO3 A;  1QVF R;  1FA0 A;  4KY3 A;  1HNX J;  3UR3 C;  4NMX A;  2RB7 A;  4IRK A;  2CJ9 A;  3RAQ A;  5DS7 A;  2I1R A;  2KXH A;  2Y9H A;  1U2F A;  3PYF A;  2W2P P;  1UVM A;  3I0R A;  1WF2 A;  4OV6 A;  5DLG A;  3IAM 9;  4H4O A;  4Z7Y A;  1ZAX A;  3HXM A;  2HBQ B;  1R8P A;  1Q8L A;  2V68 A;  1D9D A;  4EU0 A;  3KG4 A;  5GME A;  2HQF A;  1AZS B;  1VQ8 S;  3ZTS A;  3UN2 A;  3MUM P;  2DGO A;  2A10 A;  4CCH A;  1BWV A;  2OTJ S;  1EAY C;  1YZ7 A;  4QR0 A;  2V4J A;  2DGU A;  4LFA F;  2YKQ A;  2WON A;  1TV6 B;  1S77 D;  1AW0 A;  3KJF B;  1HIY A;  5ETP A;  1S9E B;  3OV7 A;  4X2B A;  3C6T A;  2LLZ A;  3KHR A;  3CNQ P;  2MY7 A;  2EK6 A;  1LWE A;  3VR1 A;  3U02 A;  1FWK A;  4IG0 A;  4DSE A;  1MWY A;  1LWE B;  2YX7 A;  2HHT A;  1HD0 A;  5KFY A;  5IM0 A;  4UZB A;  1NXI A;  3IM8 A;  2EI5 A;  5IM0 B;  4CLF A;  4HKQ A;  4RUH A;  4F25 A;  4NRU A;  4EZ9 A;  2U2F A;  4OZL A;  1WC5 A;  5F9N A;  1GX6 A;  3CT9 A;  4BC9 A;  2MGZ A;  3LWM A;  4DCJ B;  4ZIV A;  2WVE A;  2DHG A;  2MGZ B;  2G2Y A;  3TUZ C;  2CQG A;  4KAI A;  2B6A A;  2R8I A;  2SXL A;  2KG1 A;  1C0T A;  2B6A B;  2QJ3 A;  4G1I A;  4WU2 A;  2PEB A;  3HZG A;  2MMY A;  1FT8 A;  4O3O A;  4R8U B;  4AL7 A;  3HK2 A;  3ADA C;  4D3G A;  5BR8 F;  2DNH A;  3K17 A;  5F3T A;  3WBZ A;  4EBE A;  2VQE J;  3SZ2 A;  1RT3 A;  2OP5 A;  4X4P A;  4QIG A;  3FNN A;  1RAF B;  4WF9 Q;  3EVW A;  5HO4 A;  3JSY A;  2XGQ A;  1HI1 A;  5L1K A;  2G0C A;  3OL7 A;  2ZJQ Q;  4ED8 A;  1RWU A;  3D1H A;  1N36 F;  1H2V Z;  4WZM A;  1FRM A;  2BRL A;  2W2N P;  4ZVP B;  2Z2L A;  3SFU A;  1JLB A;  3M2U A;  4J5O A;  3MD1 A;  2J7U A;  1CBK A;  1DLO B;  4PG7 A;  2FD2 A;  3M2U B;  2DNP A;  4ED3 A;  5B0A A;  2HBY B;  1MU2 B;  2ZVS A;  4ZHR B;  2VA2 A;  1KS2 A;  4ZPV R;  4FZV A;  1WI8 A;  2EVZ A;  3K5M A;  1SC1 B;  3DLH A;  3Q8V A;  5ETL A;  3PX6 A;  1DY3 A;  4EYI B;  2EBE A;  3PRV A;  1QAJ A;  5EWF A;  4W90 B;  1HWJ A;  4CI0 B;  2UUB J;  5JUM A;  2L3M A;  2LEA A;  4DX7 A;  2YX4 A;  1ELO A;  1DJ0 A;  4DCP B;  4GO5 X;  4L76 A;  2HLU A;  1FXR A;  4X4O A;  3P6Y C;  3TX0 A;  1KSP A;  4NA3 A;  1S6U A;  3H4B A;  4GMK A;  5KT3 A;  1H2U X;  2ZHA A;  3OBI A;  4F0M A;  5L1L A;  2GW8 A;  4BWM A;  2WB4 A;  2YNH B;  1EP4 B;  3T5L A;  1P6T A;  4Y00 A;  4YB6 A;  3PHE A;  4ZPB A;  2QSW A;  2XO7 A;  4A8Q A;  1HQE A;  2VG5 B;  1HQE B;  3BO2 A;  2YWG A;  1NKB A;  5J2P A;  4IG3 A;  2I5J A;  4F26 A;  2VPZ B;  1UL3 A;  1QE1 B;  2OUG A;  2I5J B;  2HHX A;  1CSJ A;  4QIV A;  2Y1I A;  5LT5 A;  4DV4 F;  1IXK A;  5KFU A;  4ZPT R;  3KHG A;  4CTA B;  1JLQ B;  4ZVU B;  2YTC A;  4XIU A;  4UUX A;  3EX7 B;  3IN5 A;  3DC2 A;  1YTY A;  1JLG B;  4JV2 A;  3K5P A;  1FJC A;  4Z7C A;  3AQP A;  4WCE Q;  1XER A;  1NSP A;  5I4M A;  3MTJ A;  3NGU A;  5C25 A;  3MD3 A;  1UP1 A;  2DXE A;  3M8Z A;  2R7W A;  1S1V A;  3OFF A;  3CJR A;  1S0N A;  5JVH Q;  2DGV A;  4RW7 A;  3CJQ A;  3WDO A;  4BS2 A;  3O44 A;  2HGM A;  1DBD A;  1RT2 A;  2CJQ A;  5KFX A;  3BBB A;  2IRY A;  3AH6 A;  4DX5 A;  3DM2 B;  2Y1L B;  3W61 A;  3SCK E;  4O3S A;  5E0O A;  1OSC A;  3VAK A;  2DO0 A;  2IVM A;  2XMW A;  3OL6 A;  2EFN A;  5HQL A;  2XMM A;  2XNR A;  1A7G E;  4OHV A;  4KGX B;  2MXY A;  4RLE A;  1YX2 A;  2ROG A;  3AB4 B;  3CCV S;  3NLC A;  4EGL A;  2DIS A;  2NQP A;  3GR1 A;  2DIV A;  3LAL A;  1REV A;  1VLY A;  4PQU A;  3C15 A;  4ECZ A;  2ATC B;  2BJ1 A;  2ZE2 A;  1REV B;  2IFX A;  3CJT A;  4OYA A;  2WVF A;  1K73 T;  5J1N A;  2ZE2 B;  4A4J A;  4DV3 J;  2W4P A;  3X3U A;  4NOH A;  3JYT B;  3FUY A;  5C24 A;  1B64 A;  1UTA A;  4WTY A;  5KT2 A;  2JFK A;  1U1L A;  5C24 B;  1CJU B;  3W5X A;  1Q8K A;  3DU6 A;  1T9Y A;  1HNZ F;  5DRK A;  1NSK L;  5ETM A;  3EPI A;  4IYQ A;  1U24 A;  3W8P A;  3H2L A;  5C42 B;  1HBO A;  4B08 A;  2ZM6 F;  4CH0 S;  5KFG A;  1NZ8 A;  5KFT A;  2VG7 A;  2KJV A;  1S48 A;  3OTB A;  4BDP A;  1BMQ B;  3MFI A;  4QIW D;  2CWX A;  1T94 A;  3Q8Y A;  1TKZ A;  1E6Y A;  1UJ5 A;  2IA0 A;  4DX8 H;  2QG9 B;  5KFE A;  1E6Y B;  4JI5 F;  4R5P A;  4OLO A;  4NLW A;  4LVN P;  3ZZT A;  3IMQ J;  2MB0 B;  1N0U A;  3PCO B;  1R3N A;  2KVQ E;  1U45 A;  3EGN A;  5KT4 A;  3KLV A;  4NYO A;  4DPU A;  4KV8 B;  4FBU A;  4ES1 A;  5SZT A;  4TYB A;  3KK1 B;  3UDE A;  2BKO A;  4DPO A;  3HVW A;  3H2V E;  1XMB A;  1S9G B;  2MKS A;  3GIK A;  1CUL B;  3MED A;  5HI7 A;  2N7C A;  4M95 A;  3T1H J;  1KVI A;  3W5Y A;  4K4Y A;  3PR4 A;  1RWN B;  1T9V A;  1FWL A;  3CCJ S;  4MTP A;  3CB4 A;  1WEY A;  4ZK7 M;  1BQX A;  1FFG B;  2K3K A;  4PKD B;  3FCH A;  1UET A;  1CVJ A;  3SSS A;  2ZBP A;  5KG6 A;  1NAQ A;  2PE8 A;  2H51 B;  4L73 A;  1U8W A;  1DQ9 A;  2DGX A;  5EGY A;  3CF5 Q;  1T0T V;  3MM7 A;  3H40 A;  2IPO B;  4NLU A;  3M8W A;  2B56 A;  1TFW A;  2BOP A;  3IXQ A;  2R7U A;  3HVR A;  2HRT A;  2G4B A;  4P75 A;  2QRR A;  4RBV A;  2FHO B;  2BA9 A;  4ZPD A;  1RCX B;  2RQM A;  3H4D A;  1SKR A;  1BGX T;  3L7O A;  1GTE A;  4TU8 A;  4X65 F;  2BDP A;  2CPX A;  1AYE A;  2MST A;  4RUB A;  5L1J A;  3P5B P;  4DV1 F;  4ZVO B;  1NK9 A;  1IVZ A;  3BO4 A;  4LFB F;  4CO4 A;  2ASL A;  1S79 A;  1HNW F;  5MAO A;  1S72 S;  2DNY A;  3HLU A;  2G9O A;  3R9L A;  2DY1 A;  1RGV A;  4KKO A;  3VAG A;  5AT1 B;  2QA4 S;  1X4F A;  2MQ8 A;  4M1K A;  2W8L A;  2NYI A;  3UD4 P;  3V4I A;  3FQK A;  2D3Z A;  3DRR A;  2CDQ A;  2XG8 A;  1YLX A;  3NKY A;  2XWY A;  4JI0 F;  4TU7 A;  3DRR B;  2AEF A;  3T6J A;  1UJ4 A;  1WUU A;  4YB1 P;  1TMM A;  1EKR A;  5FDL A;  1WC6 A;  3BPS P;  4W92 B;  4A8S A;  5HVG A;  1B7Y B;  3DNC A;  3EGV A;  1OS5 A;  2B7C B;  3MWB A;  2Z58 B;  1F2G A;  2HNZ A;  3J81 j;  3ZTO A;  2QL5 B;  1C1C B;  2LDI A;  1UFK A;  2ZD1 B;  5E3C A;  4ED6 A;  4OX9 J;  3QRR A;  2R8K A;  4C0B A;  3M7V A;  2IAJ B;  4MIA A;  2KO1 A;  5KG1 A;  2G2Z A;  3RGI A;  2R7R A;  1M90 T;  1WG1 A;  3I31 A;  4DUY J;  4LIR A;  3N0V A;  1M5P C;  4F3O A;  1FVS A;  4DJB A;  1YJN S;  1IM6 A;  2W01 A;  2V8V A;  4LF9 F;  3NNH A;  2DR9 A;  4B3O B;  1UAW A;  4F3M A;  4QW9 A;  2Y0B B;  2OI2 A;  3EVO A;  3RUB L;  5LXY A;  1S1T B;  1N6Q A;  3RJM B;  3DOL A;  1TU0 B;  2YPZ A;  4DR6 F;  2PEH A;  1ZBT A;  4J9P A;  1RYR A;  4NI2 A;  1FRL A;  4Q8E A;  1TP7 A;  2HG4 A;  2OFG X;  3FMW A;  3PW4 A;  3V81 A;  1FDA A;  2AYM A;  2EPI A;  2RAQ A;  1FRI A;  1K1Q A;  3R1L A;  5D3G B;  2MZS A;  4KTQ A;  4DV0 J;  2DNO A;  3C14 A;  2V8P A;  4CLK A;  2F63 A;  4NL5 A;  4DMZ A;  4ZVR B;  1M5K C;  1BC6 A;  3VAH A;  3AD8 C;  4G1P A;  3C14 B;  1XJW B;  1J5E J;  5A8K A;  5IT4 A;  1RBL A;  3RRG A;  2UXC F;  3CJ2 A;  3J80 U;  3KFW X;  3QRP A;  4CLS A;  2V9K A;  2JVR A;  2ZEJ A;  2PMZ D;  1WC1 A;  2E1A A;  2JC1 A;  4GVB A;  4Z37 A;  1V3Z A;  3KYL A;  3CIM A;  3QJJ A;  3PJ9 A;  1W2I A;  3CDW A;  2F5G A;  2YNG B;  2HNY B;  3BR9 A;  2KZM A;  2CRL A;  2R8J A;  2C3Y A;  1OYE A;  2J6S A;  2E1C A;  3SFG A;  3AJ1 A;  3G82 A;  2ZIT A;  2RD5 C;  1HI0 P;  2HHV A;  3G82 B;  3UO0 A;  2W4D A;  3FDS A;  3O2I A;  2NSC A;  2HIY A;  1U0H A;  3MGJ A;  3IR5 B;  3DLE A;  4ZOS A;  2RQC A;  4QWB A;  2HIQ A;  1U0H B;  2BUN A;  3HKW A;  1SCJ B;  3DDK A;  1R0A B;  3MUT P;  3I9V 9;  4BWJ A;  4U6P A;  4DPT A;  3PJX A;  1OO0 B;  3P96 A;  2LU2 A;  2YNF A;  1VQ9 S;  1OMS A;  1VCT A;  1B0T A;  2B8P A;  4B3R J;  4F7V A;  1XMO F;  4ANC A;  1UFW A;  2JEG A;  3J80 Y;  1NO8 A;  3KLH B;  5A8R B;  2LDY A;  3IR6 B;  2EEY A;  3RR7 A;  4JI2 F;  2AU0 A;  5J2M B;  2CQP A;  2FJV A;  3DOM A;  1ZH5 A;  1HHQ A;  3ZNJ 1;  4KFB B;  1DZ5 A;  4Y2M A;  4G6V B;  1ZYQ A;  1A0O B;  1JJC B;  2RDI A;  3W9I A;  3GG0 A;  4ECQ A;  5GMK a;  5IS2 A;  5F8M A;  4USH A;  2CAD A;  3LPE A;  2G0J A;  3I5B A;  1S1U B;  5E33 A;  1LWC B;  1SJR A;  2XQC A;  1K9M T;  2JWN A;  3TAP A;  2VFT A;  3FBB A;  2YKO A;  2XGP A;  5F8H A;  3CCQ S;  4JI6 J;  4AXI A;  4XDC A;  1UMJ A;  3IS9 A;  3THV A;  4RW6 B;  2X1F A;  2XYP B;  3POT A;  2XMT A;  2HND B;  4FN5 A;  3I87 A;  3UVJ A;  2VOP A;  2C1E B;  5THW A;  2CA9 A;  3ETM A;  3P3D A;  4IQM A;  2XCA A;  3NOG A;  2OPP A;  4B3T F;  2FC8 A;  1UPP A;  5CCL A;  3ZXW A;  4UQT A;  2ZNY A;  2ATL A;  1IBK F;  3OHA A;  5CAA A;  3QJL A;  1QY7 A;  5E3R A;  1T3N A;  5HN0 A;  3R8Y A;  5B0B A;  3DGP A;  5IXU A;  3DLG B;  4DS5 A;  2BVZ A;  2F7V A;  3G8S A;  3FCW A;  1IJF B;  2V8D A;  4NXN J;  3H59 A;  2J9D E;  2BAN B;  3MUR P;  4AL5 A;  2D74 B;  2BM1 A;  2GVZ B;  5CH7 B;  3C66 A;  3HVT A;  3IC1 A;  2FZC B;  4B9L A;  1RTJ A;  2K3I A;  4OYX A;  2NRE A;  4KBI A;  2GAH C;  5D4P A;  4YB5 A;  2EBG A;  3R6G B;  1XN9 A;  3AJD A;  3FJ2 A;  3BSO A;  1C0U A;  4Y6I A;  3AJ2 A;  4MYU A;  3M32 A;  3TJ8 A;  2F8H A;  2GGP B;  1PAU B;  5KFJ A;  5B0F A;  4Y2K A;  3M32 B;  1B70 B;  2DPJ A;  2E5I A;  5HSP A;  2AV5 A;  3FCV A;  4C8M A;  3V6D B;  3IGN A;  2HWT A;  3HFV A;  4NAS A;  1FJG F;  3D1Q A;  5A76 A;  3CD6 S;  1FDD A;  1W26 A;  1AFI A;  1FES A;  4MFB A;  2JDJ A;  5F8G A;  4DWI A;  3H5X A;  3C3L A;  1MML A;  2AZ1 A;  5ITH A;  4Q2M A;  4L3K A;  5IFM A;  3DLK A;  4CT8 A;  4IR1 A;  3TJ9 A;  3DLK B;  2D3O 1;  3SQO P;  1FX4 A;  3NGD A;  2E7X A;  2YH0 A;  4ID5 A;  2BRK A;  1KN6 A;  1OYD A;  2R2T A;  3N6M A;  2LYV A;  4ID5 B;  2K06 A;  2BOA A;  3W8G A;  5D8H B;  5KT6 A;  3VF0 B;  4Q0B A;  1ZA2 B;  3TEG A;  1BLU A;  2QA2 A;  4FKY A;  2MKH A;  2H5J B;  2RSQ A;  1HQU A;  4Q0B B;  2B9W A;  5KFF A;  2F4V F;  2OSQ A;  2JNJ A;  1B4S A;  4DR1 F;  2APO A;  9ATC B;  1HQU B;  2FLL A;  4NLP A;  3Q83 A;  3HKZ D;  1RWM B;  1VS3 A;  3HM9 A;  4RNH A;  1B0V A;  3BQ2 A;  3DRX A;  1QTN B;  4DN9 A;  1JWW A;  1N52 B;  3F41 A;  4U95 A;  1NU4 A;  3RB0 A;  4R25 A;  3MOZ A;  2ZBQ A;  1R31 A;  1VC6 A;  4ZN3 A;  1BQM B;  5LXR A;  3KLE A;  3ILI A;  1PKU A;  3AFG A;  2VV5 A;  3W2W A;  3M9M B;  5B0E A;  3GIJ A;  2R7S A;  1JJH A;  3C6U B;  4ZLL A;  4KHR A;  3UN3 A;  3PW7 A;  3EXC X;  1KVJ A;  4ENO A;  4N41 A;  2Q43 A;  1U25 A;  2OTL S;  1X5T A;  3Q86 A;  2FJW A;  4O3N A;  1PG5 B;  1IKY A;  4A8X A;  4ZVS B;  1YWX A;  2P9E A;  2FJB B;  5IV4 A;  2KKH A;  5I3Q A;  1MWZ A;  1BQN B;  2KTQ A;  3DGV A;  3M9O B;  4F2R A;  1VQY A;  3R5D A;  2HGN A;  1WOR A;  3G86 A;  4A8Y A;  2DJW A;  1APS A;  3NCR A;  4OI4 A;  4K5S A;  3UE2 A;  3EWG A;  3AOD A;  1URN A;  5HRO A;  1TL1 B;  3PY8 A;  1Y10 A;  1T9U A;  3U27 A;  1H7W A;  4DG1 A;  2PT0 A;  3W2V A;  4J37 A;  3N01 A;  2NXJ A;  3GJS B;  3PDN A;  2RDJ A;  4KR0 B;  1NJZ A;  3HX9 A;  5FLX U;  2ABY A;  4OX7 A;  4CNY A;  4Y34 A;  4HAC A;  1RT7 A;  1RKI A;  1S1W A;  2F9J A;  5T41 A;  4B17 A;  4HAC B;  4NCA A;  3OR2 A;  3UW1 A;  4ZMM A;  1S12 A;  4F4W A;  3E2E A;  3U1M A;  1UVK A;  3D68 A;  4EWT A;  5JXS A;  5H9E J;  3CJ5 A;  1HHS A;  2OJ3 A;  3EGZ A;  2G0I A;  4MT1 A;  3P49 B;  3A3P B;  1Y5N B;  1SL2 A;  3HJV A;  3I4H X;  1RT6 A;  4TU9 A;  4C48 A;  1KQF B;  3EMT A;  4JV5 F;  2ZVI A;  3UNY A;  2DNN A;  3ILO A;  4LBI A;  4LFC J;  2DK2 A;  5I3U A;  1EQ0 A;  1RI7 A;  3RG6 A;  4ETZ A;  4HYK A;  5CYQ A;  1U49 A;  4OI3 A;  3QQC D;  2FGC A;  5CYQ B;  1KLM A;  3HHL D;  2WSC C;  1L3S A;  2VKZ G;  1KON A;  1MSW D;  4DCO B;  2ZJP Q;  1WC4 A;  5HMZ A;  3RZA A;  1JXE A;  2N3L A;  1CJT A;  2GQQ A;  6AT1 B;  1FJG J;  4O23 A;  1Y0H A;  3GR0 A;  2VC1 A;  3MDF A;  1CJT B;  1CJK B;  1DQ8 A;  4LR8 A;  3MM9 A;  3NWR A;  3VWS A;  3PR5 B;  1AA1 B;  3TNV A;  3MM9 B;  2Z57 B;  3CD0 A;  2XLI A;  1N32 J;  2QFI A;  5ETQ A;  1HHT P;  2VBZ A;  4YR3 A;  4BLG A;  3CJ8 A;  1WDT A;  3ENV A;  4DV2 F;  2JVO A;  2Q6C A;  1FNX H;  2IC3 A;  4KIA A;  4HT5 A;  4Y2A A;  3A8I A;  4JOU A;  1IKX B;  2IC3 B;  2GML A;  1V6H A;  2V94 A;  4OJ3 A;  3Q2S C;  2DH9 A;  2AGO A;  3VAM A;  2HFN A;  1G3O A;  4OZN A;  1DTQ A;  2UUC J;  1PIE A;  1LW2 B;  2LKZ A;  2F4V J;  2QA1 A;  2GVD B;  4N47 A;  2BJ7 A;  1DTQ B;  1ZA1 B;  1WEL A;  3TW0 A;  3UQS A;  1XK8 A;  1FEH A;  1XTZ A;  2ADB A;  1IUJ A;  4K0K J;  3PAC A;  1VRU A;  2R3V A;  1X0P A;  3J7Z T;  1X5S A;  1FTR A;  3OT9 A;  2CJK A;  5K8O A;  2MZJ A;  2HQD A;  1JLC A;  4X4U A;  4KGK A;  3GJT B;  3C16 A;  3O1L A;  4QBU A;  1JLC B;  2FVP A;  4FF1 A;  2CQ0 A;  1WSR A;  2OH2 A;  2KM8 B;  4LRA A;  3TZX A;  3L3C A;  4CQ1 A;  3PRD A;  1F9E B;  4FNH A;  1RHR B;  1T7P A;  4Y2I A;  5L39 A;  1N4L A;  2XI2 A;  4N7T A;  2OPQ A;  3KK3 B;  4DQI A;  3FEX B;  4X62 F;  3X1L B;  2OPQ B;  1X9M A;  4ICL A;  1HBU A;  4USK A;  2XSJ A;  3ITH A;  4IUF A;  5T7L A;  2VB6 A;  3DHW C;  4ICL B;  1WI6 A;  2OMO A;  2H4W B;  4OHZ A;  1YJU A;  4EBC A;  3LP0 A;  3KLF B;  4NX9 A;  3L7U A;  4ZVH A;  1SJF A;  3ZC4 A;  2W7O A;  4P6Q A;  3P5T L;  3EM1 A;  1I1G A;  1Q8I A;  3KMQ A;  3OTO F;  2BJE A;  2KRB A;  1N8R T;  3VTI A;  2FJX A;  1SKW A;  5CHC B;  2IY5 B;  2HK3 A;  3L95 X;  4ECU A;  1RHK B;  1D09 B;  3DYA A;  3OUY A;  3OTC A;  2K7K A;  1VQ5 S;  1QUP A;  3E01 A;  4B9M A;  1QJH A;  2LEB A;  3DYA B;  1UWB A;  3FRZ A;  5L9N A;  4WFA Q;  3WIU A;  3I9Z A;  3QWU A;  5ETO A;  1UWB B;  3T6B A;  4IFV A;  2XMA A;  3BQ0 A;  1TVR B;  1U7L A;  2HHP A;  4I56 A;  2ZH4 A;  4DFP A;  4RW9 A;  3TEH B;  1GH8 A;  4DBQ A;  1Y11 A;  1Q86 T;  5F8N A;  1XQI A;  4Y0F A;  3JTO A;  2CFX A;  4DV7 F;  1M0S A;  2HAF A;  3ELH A;  7FD1 A;  3BEG B;  5M2R A;  2ASJ A;  2QX0 A;  4ELV A;  3HPO A;  4GC6 A;  3AOB A;  4TVA B;  4MKB A;  4ED2 A;  2P6T A;  2F9D A;  3M2V B;  3D28 A;  2GNK A;  3FFI A;  1T8E A;  1C4A A;  3BBC A;  3NMA A;  1Z2Z A;  1N33 J;  5IZH A;  2ZZN A;  1I94 J;  3Q22 A;  2K1R B;  1RAD B;  4WII A;  3NBP A;  3ZZZ A;  3SSQ A;  3BGL A;  3RRK A;  2VQF F;  3DCA A;  4NLX A;  2NPF A;  4IR9 A;  4JI1 J;  1R0C B;  4XPE A;  3SI8 A;  1D1U A;  3CJ3 A;  4KQZ A;  3IG1 A;  1TAQ A;  2DYA A;  5AE1 A;  3UFC X;  1I51 B;  2FZG B;  1XMQ J;  1RAJ A;  2FVR A;  2RF2 A;  4YEA A;  4F50 A;  2KRR A;  1QTM A;  2Z8Q A;  3MEE B;  2R9L A;  2KHC A;  2RIJ A;  1WOO A;  2R2R A;  1R27 B;  4PAA A;  3FRY A;  1MLA A;  1LWF A;  2DHS A;  2NZ4 A;  4OYI A;  1TKT B;  1DAR A;  3D9B A;  3PV8 A;  1UWA A;  4U7U K;  1LWF B;  1UEU A;  4Q43 A;  2JRS A;  3QGI A;  1WHY A;  2NSB A;  2R8G A;  3JQJ A;  1R0B G;  1RHM B;  4I68 A;  2XBP A;  1VHF A;  2JSX A;  4DF8 A;  3GZ7 A;  1NH7 A;  4PQA A;  2ZH5 A;  2XY6 A;  2OPR A;  3QFH A;  3I5A A;  4YHH J;  1XNR J;  5EUH A;  3OXL A;  3CCM S;  4OV1 A;  2IBO A;  5KG5 A;  4GO7 X;  4DV6 F;  2ACM A;  1X8D A;  2BBE A;  2D9P A;  2KFY A;  1U26 A;  5CD4 A;  3GP9 A;  2EC2 A;  4UOH A;  4ECS A;  4IFY A;  1HWU A;  4C3L A;  3MM5 A;  2W9B A;  3GE9 A;  4CM0 A;  3RW7 A;  4IFY B;  1SH0 A;  1S10 A;  4F02 A;  3N5B A;  4I64 A;  3D6T B;  2GQ2 A;  2HVE A;  1ZM2 A;  2WW4 A;  1YJW S;  1VJQ A;  3OTE A;  4JI8 J;  4ZCM A;  5G0R B;  1UW4 A;  2FHK A;  5GAD I;  4LF6 J;  1X0F A;  3AXM A;  2RJZ A;  1RHU B;  5IWA F;  4ECX A;  2JJ4 D;  4WPA A;  1VGY A;  4HLB A;  2HBR B;  5CYJ A;  1RWW B;  1D3W A;  2ZOM A;  3R97 A;  3HP6 A;  1MMN A;  3SEO A;  2VON A;  1PYS B;  1IR1 A;  1SPB P;  1Q1K A;  3B54 A;  1K44 A;  2O67 A;  3BKF A;  2B8Q A;  2E5L J;  4DR4 F;  2BJ8 A;  1XNQ J;  3LGN A;  4FBT A;  5D4N A;  2JLG A;  3N28 A;  1CG2 A;  3CCU S;  2FJE B;  1TUV A;  2IVY A;  4RUC A;  1U2R A;  2CXE A;  4KHM A;  3ZTQ A;  5C2C A;  3EDQ B;  5KFZ A;  2DRD A;  1G2E A;  1DAX A;  2CJY B;  1KBR A;  5K8P A;  1A9N B;  3CMQ A;  2UXD F;  2YXL A;  1JK9 B;  2VBY A;  3VZI A;  3R5J B;  4DR7 J;  1XIQ A;  2CZ4 A;  1ZAW A;  2YKM B;  3K5O A;  1EJ7 L;  1CJV A;  3N9U C;  4OYW A;  1WSV A;  2ZKU A;  1Q16 B;  2RKI A;  1M5H A;  2HHQ A;  2HZV A;  2J6T A;  1T03 A;  2QIF A;  3QT7 A;  2RKI B;  1PBA A;  4JV1 A;  1S59 A;  2GIR A;  1ZM4 A;  2M8H A;  2NLW A;  3OVA A;  1XR6 A;  3NEK A;  4AD6 A;  2F40 A;  1NHV A;  5AJ3 J;  1F3F A;  3F56 A;  5KFB A;  1WOS A;  4C11 A;  2R42 A;  2QTW A;  2O1P A;  4GVL A;  3QPI A;  4KT0 C;  2AJF E;  4V1A k;  2XY7 A;  1WOP A;  4AYB D;  1RTI A;  2OFH X;  5ETR A;  4DHV A;  3R7N B;  1SB6 A;  2HSE B;  4ELT A;  2E1M C;  4KYZ A;  3MM6 B;  4EI2 A;  1M5V C;  3HFK A;  1B99 A;  2C2Z B;  4G1Q B;  2RT3 A;  1QSY A;  4J9M A;  2E9Z A;  5I42 B;  1VJW A;  1F60 B;  3GYN A;  3D3B J;  3P45 B;  3EXY A;  1VQN S;  3PRB A;  3S01 A;  1KNZ A;  1KVK A;  2Y1R I;  4C8Y A;  1FNO A;  1LOU A;  2DCL A;  2CAJ A;  4ZIT A;  2BM0 A;  1RTH A;  4MMO A;  1NUE A;  1V5V A;  1R6Y A;  5HLF A;  3IRX A;  1GXU A;  3MPW A;  2P9G A;  1NEE A;  3MCM A;  1Q0N A;  4K4S A;  3PW2 A;  1YJT A;  1HLW A;  4MIB A;  2CPD A;  3UN5 A;  1VQ7 S;  3HF5 A;  3PYD A;  1SBR A;  3OTD A;  2HWI A;  2Q1L A;  3T19 A;  5K8M A;  4RL1 A;  2GS8 A;  3RBX A;  1C2P A;  4DV5 J;  2DNR A;  1FRJ A;  4HTJ A;  1FKP A;  1ICE B;  4OFZ A;  3FGV A;  2E29 A;  1FF2 A;  2HS3 A;  3QAU A;  2VDH A;  1V3R A;  4LF2 A;  1M1K T;  2DRA A;  2A1B A;  1Q5V A;  1YZ6 A;  1RAI B;  4YB7 A;  2LQ5 A;  1NK6 A;  2H65 B;  3JSR A;  4J9U E;  2P5V A;  1MRO B;  4PYA A;  3LPY A;  3MEG A;  3QAE A;  4G3I A;  1U6B A;  4X64 J;  1O51 A;  4DL2 A;  1X9S A;  1VHI A;  1SUQ A;  3LOU A;  4LF5 F;  2V8G A;  3QZ8 A;  1F6T A;  3OXG A;  1SUQ B;  1PO6 A;  4NLG A;  2I6W A;  1LQ9 A;  3GV7 B;  4CWB A;  4NML A;  3SV3 A;  3NCQ A;  3MOJ B;  2D69 A;  2EWH A;  3TWZ A;  4B9U A;  4DSJ A;  2KH9 A;  4NE9 C;  3ILL A;  3RW6 A;  3BM7 A;  5JMN A;  2AGP A;  2X1A A;  2AYE A;  3GMG A;  3MR6 A;  2WW8 A;  3HD2 A;  3HHL A;  2VUG A;  2J76 E;  2VKR A;  4ECV A;  3HVA A;  3H42 A;  1WWH A;  4JUZ A;  1WJ9 A;  1IM4 A;  3S6E A;  2UVU A;  3CC7 S;  3CJK A;  4AL6 A;  4N56 A;  3FEY B;  7FDR A;  2BQ3 A;  4DL5 A;  3R5A A;  4KB7 A;  1FEE A;  3DHX A;  1N5S A;  1U1N A;  1H6K X;  3IM9 A;  3H8Y A;  2FHJ D;  1KTV A;  1S6P A;  3MR5 A;  1VQS A;  2FLP A;  3RAX A;  4ED5 A;  1PAE X;  1TKD A;  3GB0 A;  1HW8 A;  1HD1 A;  4KH0 B;  3TRG A;  2RRA A;  3M2R A;  3W1Y C;  1J5O A;  1Q81 T;  1T95 A;  2OPS B;  3SCI E;  1J5O B;  1SL1 A;  4OYO A;  3DMJ B;  4NXM J;  2DR7 A;  3H7H B;  2B4O A;  3M6U A;  3PFO A;  4JI7 J;  4M5M A;  1Q79 A;  3UCU P;  1CPZ A;  1TK8 A;  1RP5 A;  1U6Z A;  3GLJ A;  4HEA 9;  1NK8 A;  1BHN A;  4DLE A;  1GMW D;  3NWG A;  2C3O A;  4L74 A;  3MEC A;  5LMU J;  4CO1 A;  4WE1 B;  2HRY A;  4USI A;  2A0F B;  5B0D A;  1HMV A;  4KPC A;  4WFY A;  4Q7A A;  3H20 A;  5ETK A;  1T05 A;  2D41 A;  4YS2 A;  4LRE A;  1T05 B;  2H5I B;  3ISN C;  3CCZ A;  4LF8 F;  2ACY A;  3ZZR A;  1RWO B;  3A8J A;  3MMC B;  1JLE B;  3UNG C;  1S6Q A;  2DIT A;  1M5O C;  1I6J A;  2WVC A;  3V6J A;  3BDP A;  4TY9 A;  4K4V A;  1RCO B;  5CZX A;  3BGR A;  3TZZ A;  2KFZ A;  4AQY F;  3KLG B;  2OEK A;  2MZQ A;  2ZDO A;  2VPY B;  3ENQ A;  2L41 A;  1H7X A;  1OPZ A;  2V4R A;  2DD8 S;  3M1V A;  1W7W A;  5KFV A;  1Z1Z A;  2UV8 G;  5A2Q U;  1JJ2 R;  3VGT A;  2MZ1 A;  1GEH A;  1RBA A;  2G2O A;  2HQG A;  2RRN A;  2XWX A;  2V4Q A;  2W8K A;  2MKY A;  2VJU A;  1HR0 F;  3RRH A;  3HD1 A;  4FXW A;  4C2M A;  1F1B B;  5GAD U;  4N77 A;  4ZJO A;  2AJ0 A;  1WC3 A;  5C2G A;  4USW A;  1AXQ A;  3B8H A;  2MQN A;  2OO4 A;  3F0N A;  3KJV A;  2QYG A;  2HPU A;  3UPF A;  4K4Z A;  3D7S B;  1NCL A;  3U7J A;  1NDK A;  1YBT A;  4KE5 A;  4LQ9 A;  4ANE A;  2UUA J;  3GU0 A;  1QAI A;  3IGV A;  2AZ3 A;  3NOC A;  3TX8 A;  2V0N A;  4QYZ K;  2M0G B;  3DOK A;  4DN0 A;  4XAK A;  4AT1 B;  2MYF A;  4HVZ A;  3MMA A;  4LF4 F;  5BYR A;  2R2S A;  2Y1J A;  1VBY A;  3I4P A;  3GCX P;  1VQK S;  1QUV A;  4MK7 A;  2MY8 A;  2HQC A;  2EK1 A;  1KRP A;  3BRE A;  4C4W A;  2HVD A;  3MR2 A;  2WB1 D;  3GJQ B;  4GKJ F;  4OI0 A;  1TK0 A;  4IOB A;  1X4E A;  3NP5 A;  1FKO B;  1S49 A;  5DG7 A;  6FDR A;  2XYG B;  1S76 D;  4MKV A;  1VC5 A;  3AA9 A;  3LGM A;  4OJH A;  3LP2 B;  4DPW A;  3PHT A;  2ALZ A;  1U1M A;  4NPO A;  3M8S A;  5KFN A;  1AZS A;  3EDR B;  2UU9 F;  2GX8 A;  1AUS L;  2XLJ A;  3JSM B;  3N4W A;  3MMB A;  4ILR A;  5CYM B;  3RR8 A;  2NXE A;  1ZZF A;  3MMB B;  1H2T Z;  3UWT A;  2DXF A;  4YN3 B;  4M5D A;  3AQO A;  3RB4 A;  1TQL A;  2DY9 A;  4M5D B;  4NCG A;  2H5E A;  4F4Y A;  3Q8U A;  1TV6 A;  2C3M A;  3OXF A;  2I8E A;  2DPI A;  4ZLN A;  4WBF A;  2GQC A;  4NCG B;  1N34 J;  4FS1 A;  1S9E A;  4I69 A;  3FSY A;  4RW8 B;  2B4P A;  1PCA A;  5DDR C;  2VZ9 A;  2FQQ B;  2POK A;  1WG5 A;  2WCX A;  3H5U A;  4CLZ A;  2IM0 A;  3NGT A;  2GHW A;  4WK3 A;  2IMO A;  3BN7 A;  3MUV P;  5AE3 A;  4RNM A;  3TOQ A;  1W2B R;  2LA4 A;  2VJV A;  4F2S A;  4K8R A;  2XTJ P;  2DT9 A;  2KXN B;  4JI3 J;  3CDE A;  5F8J A;  2UXB J;  2VFV A;  2ZH6 A;  2DB1 A;  5FII A;  5JVG Q;  3ZZO A;  1Y9O A;  4A47 A;  4M5N A;  1KWM A;  1YSJ A;  2O3D A;  1HYS B;  4BC7 A;  2OIH A;  1WC0 A;  2IRU A;  3ISZ A;  4M5H A;  2RS8 A;  1NJW A;  1DQA A;  1W25 A;  2NYH A;  3LP1 B;  1O8B A;  1YIT S;  5D0R A;  4KSE B;  2IM2 A;  4NZ6 A;  1VK3 A;  4R8U A;  2F3J A;  2NZC A;  4YDD B;  3EZO A;  1JKH B;  4UOF A;  2B9Y A;  1VQ6 S;  1VK8 A;  5DQH A;  3ZZ0 A;  4M63 A;  3M8Q B;  1HFE L;  1FK9 B;  2DNG A;  1GMV A;  5HMW A;  2Y0S D;  3NL0 A;  1RTD A;  5CXT A;  2A2D A;  3V2U C;  1X4A A;  4UY8 T;  4KHP J;  1RTD B;  3RAM A;  4RNN A;  2MKK A;  1RT1 B;  4FYV B;  4PPZ A;  4J9K A;  3ET6 B;  3DDI A;  3T3F A;  2HHH F;  1DLO A;  5HAT A;  3DDN A;  1X9W A;  1MU2 A;  1IBM J;  2B4U A;  4ZVE A;  2ZUA A;  1WTB A;  2FHM A;  4ZHR A;  4B9S A;  3LH2 S;  2QLW A;  3W9J A;  3ULH A;  5LMN F;  1NPP A;  2XMK A;  3IR7 B;  1NB7 A;  4KJI A;  4FDF A;  2MQP A;  1UFL A;  1NKC A;  1S9F A;  3KDN A;  3LW5 C;  3QMQ A;  2O66 A;  4JI4 F;  5E5N A;  3TUI C;  2EFP A;  4X4S A;  3DRY A;  4F3Q A;  4GKK F;  3QT5 A;  3QIP B;  1QM9 A;  4X66 F;  1RIS A;  4QWD A;  4ZP6 A;  5J2N B;  3EJM A;  2HS4 A;  4ED7 A;  3FZB A;  2OML A;  2AJ4 A;  2ZZT A;  1AUD A;  4J9R A;  3GIR A;  1LKZ A;  3CD7 A;  2JLE A;  2C2K B;  1F3V A;  1KOO A;  4WJB A;  4PWD B;  1IBL F;  3HSD A;  4PG5 A;  2IBK A;  4LSN B;  3W63 A;  3PIO Q;  3NXZ A;  1U8S A;  2YNH A;  4ILM A;  1EP4 A;  3HSJ A;  3DI6 B;  2VBW A;  2E44 A;  1UPM B;  3HFZ B;  2YKA A;  2VG5 A;  2AQ4 A;  3CED A;  4OZ5 A;  1UW9 A;  2ZBI A;  4JYA F;  1OSD A;  1L3V A;  1IKW B;  1QE1 A;  2IA6 A;  3IWN C;  4NLT A;  3QYY A;  4FYD A;  3KTQ A;  2X1B A;  2FYX A;  4FVC A;  3TUJ C;  4RZR A;  4TN2 A;  2HGL A;  1FE0 A;  3E3X A;  1JQG A;  3S8S A;  4CTA A;  1JLQ A;  4F4X A;  1WKJ A;  5GAE U;  1AT1 B;  3H90 A;  3PW0 A;  1Y7P A;  3ICL A;  1JLG A;  2DCU B;  5B7W A;  3SMZ A;  5KAK A;  2B9E A;  1NK5 A;  2EXU A;  4QU7 A;  4UUW A;  1IKV B;  3HHN B;  4N76 A;  1PBU A;  5HQ8 A;  1SJ3 P;  4DI6 A;  3NS6 A;  2WVB A;  3EGW B;  4UY8 5;  2FIU A;  4LFA J;  3CD5 A;  2MKC A;  2LQ8 A;  1NBE B;  2N82 B;  1EHW A;  3DM2 A;  3KXD A;  4DU8 A;  3UD5 A;  3BJY A;  1D9F A;  4QPX A;  5KFD A;  3M30 B;  2GJ2 A;  5IQQ A;  1D8Y A;  3BR8 A;  2UP1 A;  5DQI A;  3MHY A;  3EVM A;  1T11 A;  2W7A A;  1KOH A;  5ETV A;  3L9Z A;  2IJN A;  4A8O A;  2BR0 A;  3GIL A;  1U47 A;  1U48 A;  1GT8 A;  3THT A;  2OEL A;  2J0W A;  4J9V A;  2E9R X;  1LEO A;  2W25 A;  2Z2Y B;  3NS5 A;  3SQG A;  2AT1 B;  4DL6 A;  4L72 B;  5CCM A;  3SQG B;  5GAH U;  2D7S A;  3JS9 A;  3JYT A;  4DFK A;  4QR2 A;  2DH8 A;  5IQ6 A;  3CXC R;  5BJR A;  1CJU A;  3G6E S;  1Q7L B;  3J7Y I;  2E7V A;  4IDK A;  1SQE A;  2YPY A;  4EFA C;  4UQG A;  3IBW A;  4IDK B;  2QYC A;  4RWW A;  4XK8 C;  2JZ5 A;  4QIE A;  2KT5 A;  4DR2 F;  4GC7 A;  3T1Y F;  3MI7 X;  4ZS6 A;  5C42 A;  1G1X A;  5F41 A;  2ZOF A;  3FVY A;  5BR8 J;  2FHJ A;  1LW0 B;  4CZC A;  2EC0 A;  2XZW A;  4RUA A;  1ZM9 A;  3H0P A;  3ZTR A;  1VRQ C;  2JHE A;  2WSE C;  4I2P A;  4K4U A;  1YDL A;  1N36 J;  1RAB B;  5J1P A;  1RA7 A;  2GZO A;  2VHG A;  2WBR A;  4ZVQ B;  3H5Y A;  4I2P B;  2AX1 A;  2W2M P;  4DZ6 A;  2HFZ A;  4QPT A;  5F9L A;  3W66 A;  4KV8 A;  3CSK A;  4V19 J;  2R7T A;  4WYW A;  3P8B B;  1RAG B;  5AXL A;  4X4R A;  1NHK L;  1PSD A;  4DR5 F;  3KK1 A;  1GMW A;  1Q5Y A;  2V9W A;  4USM A;  5CD4 H;  2QLJ B;  1S9G A;  4M5I A;  1CEZ A;  3PKM A;  1R89 A;  1CUL A;  4M5L A;  4OZ0 A;  2DO4 A;  3PKY A;  2YNI B;  1ITP A;  2VDI A;  3HDS A;  1L3U A;  3M6X A;  4DU7 A;  3PNI A;  2H4Y B;  3D2W A;  3RB3 A;  4I7F A;  4CLP A;  5H9F K;  1CQM A;  4DL3 A;  4L6V 3;  1JLA B;  4I7F B;  1S0O A;  5GVQ A;  5ETS A;  3J7A N;  3SXL A;  1S4F A;  2BE7 D;  8ATC B;  3GSI A;  1X7V A;  2ZUG A;  1QDU B;  1SV5 B;  2AHO B;  3GPA A;  1VRT B;  1GX5 A;  4FKX A;  4B3M F;  1QLN A;  1FX2 A;  2LXF A;  5HAO A;  4X84 A;  3KJQ B;  1S1X B;  2Z0G A;  4DR3 F;  4MK8 A;  4B3S F;  2YQ3 A;  3IWL A;  4YP3 A;  1LNQ A;  1P9Y A;  4LF7 F;  4USJ C;  1N56 A;  2G1D A;  3TA1 A;  2RRB A;  3RTV A;  2JEJ A;  2RVJ A;  5C7P A;  4WZQ A;  1HNX F;  1X5O A;  3CJ4 A;  2XO6 A;  4DV4 J;  4CNZ A;  4RU2 A;  2CPZ A;  3MCN A;  1YBA A;  3D0I E;  2GO9 A;  3L09 A;  3MCO A;  2RU3 A;  1UEK A;  3WHI A;  3FK4 A;  4QIF A;  3LGH A;  2FJA B;  3LAM A;  4OL8 A;  2HLT A;  4YOE A;  1QVG R;  3SDE B;  1RYS A;  4OI6 A;  5AXK A;  2JX2 A;  2E1P A;  1B7F A;  2YBV A;  1YRX A;  3TI0 A;  4EO6 A;  1MWQ A;  5KFW A;  2ASD A;  3TZY A;  1WD6 A;  1QSS A;  3CCE S;  1NME B;  3D67 A;  1NK7 A;  3QZ7 A;  4ZJQ A;  4H4M A;  1TR0 A;  3KG1 A;  2JEF A;  1FJE B;  3R2C J;  3DRP B;  4H4M B;  2VIH A;  2QE5 A;  2RDD A;  4U7U D;  4MIW A;  1PC4 A;  1VOM A;  2V2Q A;  3MR7 A;  2ZH8 A;  4EZ6 A;  4W98 A;  2HW3 A;  5KFI A;  1C1C A;  3MF5 A;  1NKE A;  2XHW A;  1MNE A;  3HJF A;  2ZD1 A;  1CC8 A;  4YY3 F;  4FYY B;  3I96 A;  1YJR A;  4XTT A;  1HWK A;  3LQV A;  2KM8 C;  3BQ1 A;  1O0P A;  2IAJ A;  1TFY A;  3MPD A;  4ZN1 A;  4KRW A;  2XY5 A;  1RT5 B;  4O4G A;  1RU2 A;  2VD3 A;  1E6V B;  5RUB A;  3LTO A;  2E9T A;  4P73 A;  4O4G B;  5DZ6 A;  1TL5 A;  2B7B B;  3GII A;  4B3O A;  2MQL A;  1Q8B A;  3BYP A;  3IO1 A;  1TTH B;  3BSA A;  4HHH A;  1S1T A;  2FUG 9;  3BH6 B;  1U6F A;  1TKX A;  3I0S A;  1R43 A;  1IWA A;  1HNZ J;  1YGY A;  3I0S B;  1TKX B;  3UCZ P;  2V8H A;  3JB9 k;  3QSY B;  2ZM6 J;  5EHH A;  1X31 C;  5D3G A;  1SI9 A;  2UVR A;  3KMS A;  1VBK A;  2MTL A;  2XB2 D;  4QW8 A;  3FQL A;  3WX8 A;  3CCL S;  4C0O C;  4XPC A;  2VQE F;  1PJ5 A;  3DLJ A;  2AIR B;  2MZR A;  2I9S A;  1ZZN A;  5K9F A;  2KHD A;  2L9W A;  4JI5 J;  1WEZ A;  2Y8Y A;  4N8O A;  4TQR A;  4O3Q A;  1U1R A;  5IC6 B;  4Y28 C;  2PO4 A;  5LSR A;  2GMJ A;  2R7X A;  3CJS A;  3VGS A;  3PX0 A;  1R7I A;  3NNA A;  2CVE A;  4Q44 A;  4LT6 A;  4JBC A;  3BYR A;  2YNG A;  3MPU B;  2HNY A;  4OLP A;  2VH7 A;  3KUE A;  3HHK A;  4PXC A;  4DL4 A;  3F44 A;  5KFA A;  4X4T A;  1FCA A;  2XS7 A;  3GFY A;  1OY9 A;  4WKR A;  2I2Y A;  1F0X A;  3C2P A;  5A8W B;  3WIV A;  2DXD A;  5L9X A;  4CYU B;  3HHD A;  1ROF A;  2YX1 A;  2J0Q D;  2W9C B;  3OPK A;  5EX0 A;  4OJG A;  2EFO A;  3T1A A;  4ECR A;  2UUB F;  2MQQ A;  5EDW A;  3Q8Q B;  3QGG A;  4RKU C;  4RW4 A;  1F2H A;  4W4M A;  3VGU A;  3UI3 A;  4RW4 B;  1R0A A;  3PO4 A;  5HVH A;  1HBN B;  3QGH A;  4WFZ A;  4ECW A;  1K47 A;  2CQ1 A;  4OYZ A;  4AXJ A;  3MM8 B;  1Q82 T;  4C3M A;  2VG6 B;  4DEZ A;  2V50 A;  3KNA A;  3R27 A;  2MPU A;  1ZAV A;  3FZ2 A;  1FJ7 A;  1WEX A;  5J1E B;  1K1S A;  4I67 A;  3KLH A;  5M2P A;  1LFP A;  1YIJ S;  1RWX B;  4ED1 A;  5A8R A;  4PG6 A;  4LF7 J;  2WHO A;  5KFM A;  1VC0 A;  2BAC A;  5J2M A;  3R7S B;  2E5J A;  5D4O A;  4QJV A;  4KFB A;  4ZJL A;  1YHQ S;  5KG2 A;  2CPH A;  2ZH3 A;  3Q24 A;  3IRW P;  4CP5 A;  1FKA F;  1F5C A;  3G2X A;  3NMR A;  4X65 J;  3GG1 A;  4DV1 J;  2OLW A;  1L3T A;  3LAK A;  5T14 A;  4LFB J;  5KTQ A;  4NYP A;  3J7Y U;  1HNW J;  2IJF A;  2CPE A;  1SXL A;  1N88 A;  4PXB A;  2QN6 B;  3I0R B;  4F0H A;  3PYG A;  2YKN A;  3W3S A;  4H4O B;  2X7I A;  1NSQ A;  1S1U A;  4CM2 A;  1LWC A;  1TL3 A;  2JFD A;  3GON A;  2YKN B;  1RK8 A;  3AA8 A;  1TL3 B;  1FD8 A;  1SJQ A;  4OJ1 A;  2QV6 A;  1U09 A;  2EG1 A;  3CCT A;  4X4V A;  3GIM A;  2W2Q P;  4QWC A;  3QRQ A;  4JI0 J;  3E51 A;  2PDA A;  2HFV A;  4RR5 A;  3GFX A;  1NK4 A;  3BZQ A;  2AJQ A;  4TY8 A;  1VMB A;  5E41 A;  1ZOT A;  5D78 A;  2LXU A;  3MZI A;  3BN4 A;  1VIS A;  4TY8 B;  3SBM A;  1KHW A;  5HK4 A;  1RBO B;  4RW6 A;  1PYO B;  2GIF A;  2V4J B;  2LXI A;  2HND A;  2BYC A;  2EW9 A;  3V6H A;  2WON B;  4LBP A;  2H48 B;  2LQB A;  3I6P A;  4OI1 A;  5DDO C;  2HEK A;  2YY3 A;  1RSC A;  4A8K A;  3LUY A;  3C6T B;  4NLV A;  4PAB A;  4WXW A;  4OZJ A;  2FB0 A;  4USV A;  8AT1 B;  2ILZ A;  4YY3 J;  3GYX B;  3PIP Q;  3U1N A;  2DNM A;  4IG0 B;  4DFM A;  2DHH A;  1IR0 A;  4PXE A;  1VQO S;  2XNQ A;  1ZPV A;  4LIW A;  1EX8 A;  4FF4 A;  3SIP B;  5BYQ A;  3G8Q A;  4ZCL A;  1WHX A;  3DLG A;  2BV3 A;  3R5G A;  2HZC A;  3QT8 A;  1DTT A;  5HQM A;  1RAO A;  2BAN A;  1U1P A;  1M1G A;  4K2J A;  4LF9 J;  2FC9 A;  1ULR A;  2GHP A;  1DTT B;  4WP3 A;  4A46 A;  5D0E A;  3K5L A;  1GXL A;  4DV3 F;  3JAM U;  1VDH A;  2GVZ A;  4ILL A;  3T9N A;  1KQG B;  1S57 A;  1HL6 A;  2O5D A;  4DR6 J;  3OLB A;  1X4B A;  5B08 A;  1OQ3 A;  2BQU A;  4K59 A;  3V4M A;  3CC2 S;  3QSI A;  2HQ3 A;  2LCW A;  3I5C A;  1S7H A;  2CIM A;  1C0T B;  2CPJ A;  2QL9 B;  2IHR 1;  2XUL A;  5K5M A;  3QNW B;  4R0J A;  1WHW A;  2QT7 A;  1RU1 A;  1YJ9 S;  5DZ7 A;  2GGP A;  2VF3 A;  1DHM A;  1PJ6 A;  1RT3 B;  4QQB A;  3V6D A;  2UXC J;  2DEI A;  5L46 A;  3MEK A;  4MAK A;  1KD1 T;  4NA1 A;  1YQH A;  1EZZ B;  3AXK A;  2MLZ A;  2RHQ B;  2ZBR A;  2VPW B;  4OHX A;  3LA0 A;  5GMD A;  4C8L A;  1JLB B;  5DGB A;  5KG3 A;  1RHJ B;  5KFC A;  2CQH A;  2OSR A;  3UDV A;  4ZPW R;  1ZPW X;  5JJB A;  4U8V A;  4WP9 A;  5IOL A;  3JAM Y;  3DRS A;  4PWU A;  3DRS B;  2DIU A;  2N3O A;  2QLB B;  2R7O A;  2KT3 A;  3MAH A;  4B9V A;  2AEJ A; 
#chains in the Genus database with same CATH homology
 3A3N B;  1V5I B;  4K8R A;  2XTJ P;  3A3O B;  3BGO P;  4NMX A;  4NE9 C;  1SPB P;  2W2Q P;  3VHQ A;  2PMW A;  3H42 A;  3SQO P;  3GCX P;  3BPS P;  4YN3 B;  4JP8 A;  2QTW A;  3WIU A;  3T41 A;  3WIV A;  2ZWP A;  2W2P P;  2Z30 B;  1R6V A;  3QFH A;  1ITP A;  2Z2Z A;  2Z57 B;  3VV2 B;  2E1P A;  3CNQ P;  3AFG A;  3GCW P;  3P5B P;  2W2O P;  3WHI A;  2Z56 B;  2W2N P;  3A3P B;  2Z2Y B;  4OV6 A;  2W2M P;  2Z58 B;  3CO0 P;  1SCJ B;  2ZWO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...