2W2OP

Pcsk9-deltac d374y mutant bound to wt egf-a of ldlr
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
92
structure length
92
Chain Sequence
b'TATFHRCAKDPWRLPGTYVVVLKEETHLSQSERTARRLQAQAARRGYLTKILHVFHGLLPGFLVKMSGDLLELALKLPHVDYIEEDSSVFAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROPROTEIN CONVERTASE SUBTILISIN/KEXIN TYPE 9
publication title Structural and Biochemical Characterization of the Wild Type Pcsk9/Egf-Ab Complex and Natural Fh Mutants.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/receptor
total genus 21
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2008-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF05922 Inhibitor_I9 Peptidase inhibitor I9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 2w2oP01
3A3PB 3A3NB 2W2NP 2ZWPA 3P5BP 3VV2B 2Z58B 2W2MP 1SCJB 4OV6A 2E1PA 2Z57B 3H42A 4YN3B 1SPBP 3WIUA 3SQOP 3GCWP 3WHIA 3BPSP 3VHQA 2Z30B 2XTJP 2ZWOA 3CNQP 3BGOP 1V5IB 2PMWA 2W2QP 2QTWA 2Z56B 3GCXP 2Z2ZA 3A3OB 3T41A 2W2PP 2Z2YB 4NMXA 4K8RA 1ITPA 3CO0P 3WIVA 1R6VA 4JP8A 4NE9C 2W2OP 3AFGA 3QFHA
chains in the Genus database with same CATH superfamily
1I1GA 1K73T 1SUQB 2HHTA 3HSJA 1S6UA 3CT9A 2RMLA 5L9XA 5J1EB 1W7WA 3KJNB 5CCLA 5H9FK 1S57A 2MDAA 1N6QA 2M8DB 2HWTA 2ZOGA 4C8OA 5DDPC 3MAHA 3CCLS 5ETOA 1X60A 4DR7J 4TY9A 1SVDA 3Q2SC 4WP9A 2E7XA 4CQ1A 3ZZOA 2DNOA 2QA4G 3FQLA 4K4TA 3KUEA 4WIQA 4G3IA 1VRUA 2KL8A 1RWXB 2YNGA 1VQYA 2J0SD 4IFYB 5GADU 2KRBA 5E2QA 4QYZK 3RZAA 2WVBA 1KQGB 2GA7A 2OMLA 4Y65A 4RUHA 3HULA 4W90B 3IAS9 1AW0A 3KG4A 1YJ9S 2A18A 3DOMB 3PFEA 4PQUB 5T7LA 5L1IA 4DN0A 2MKYA 4Y2MA 3SV3A 2AZ1A 2V6AA 3R6LB 5DS7A 2VQEJ 2DHAA 3W61A 4QWDA 1DLOB 3AA9A 3SEOA 2ZM6F 3M6UA 2DRDA 4OI6A 3QWPA 1RHJB 5KT2A 1TZ0A 1YBAA 2C2NA 4EEYA 2NSCA 2ERRA 4WFYA 4WXWA 4NMLA 1S1VB 2C1EB 2MLZA 1OYDA 5T41A 2A6MA 1U1PA 3IG1A 1N36F 2M70A 3OR2A 3FFIB 2OGUA 4OFZA 4NLYA 2CJYB 4DQPA 3LOUA 4KKOA 4NCAA 1TUGB 1J27A 1MMNA 2B4OA 5DDRC 2ZUAA 3Q83A 1NAQA 5DQHA 2H5IB 3PYDA 2AQ4A 1X4BA 1HNXF 4UOFA 3PO4A 3CC7S 5HQLA 1HMVB 3M30A 4LR9A 1H2UX 2X1AA 4OX9F 2QA2A 1S0MA 4M8LA 3M6VA 4OZ1A 1T0TV 2BA9A 3RJMB 3CJKA 3PO5A 1X5TA 1ITPA 3EUNA 4F02A 1X7VA 4ECSA 2OAUA 5KFCA 2W1BA 2GO8A 3IO1A 3BGFA 4OV6A 2W7AA 2WOMA 5IM0B 3ENVA 3C14A 5IFMA 1ZTWA 5CA5A 2DNGA 3EZUA 2C2DA 4I4BA 2UUCJ 1RWKB 1GNKA 3QPIA 2P9GA 4NLGA 4CLLA 3I32A 3OJSA 1SL1A 2B7BB 4KB7A 5LL6d 4A4JA 4B9LA 1AYEA 5HP1A 4DN9A 1CQMA 5F3ZA 4P9SA 1V6HA 2AGQA 1TAQA 5CZVA 1A0OB 2Z2MA 2MQOA 1VQ4S 4B17A 4HH1A 2EEYA 4WZQA 2DGOA 4LSLB 1ZM2A 3CE8A 3W8PA 2ZH4A 3DI6B 1U45A 1LWXA 4CO1A 2CJ9A 2I9SA 3Q89A 3MD3A 1XIQA 2NZCA 1S1WB 4CDIA 3OTDA 3LTOA 5I3UB 3BSCA 1P8GA 2RE1A 2K1RA 4AE5A 3OXFA 3DLLQ 3B54A 2EPIA 4PYAA 5HI7A 2M0GB 1TTHB 2QFJA 5J1PA 1RWOB 2ZEJA 4FF3A 1F6TA 2MZTA 1SH2A 3LUYA 3IMQJ 1RJJA 3AFGA 1JIHA 2RDDA 4JI7J 2ZE2B 2HZAA 3OFHA 4KC5A 3ET6A 5DQGA 2VBYA 4OI2A 2DGVA 2V34A 3LO3A 3BPSP 3TX8A 3OLBA 3D67A 1G6BA 4CO3A 5A8RA 5HBMB 3DLKB 3R5BA 3ETOA 1SH0A 1T9WA 1T9UA 2J8AA 1NHUA 1HBMA 2AD9A 2G13A 1R89A 3LA0A 4WE1B 3KJVB 5GAEI 4MTPA 3H5YA 3AAWB 3BQ1A 4J9PA 4RKUC 2FJWA 1YVFA 3AOBA 2DPJA 4JI8J 3IWLA 1XQIA 4IKAA 2GMHA 3SDEB 1MU2B 2UVVA 3O44A 3NRBA 4X4NA 2GHPA 1QSSA 2MGZB 2YNFA 2R4FA 3IWXA 3DRRA 1X4FA 4Q8FA 5F9LA 1MNEA 2A1BA 4C8MA 1JLGA 2FZGB 4OLOA 2GHVC 1T3NA 2KXHA 2XMAA 4RBVA 2V68A 1NK8A 4KSEB 1UJ6A 4DWIA 2OSQA 1TKXB 4AYBD 4FZVA 4ID5B 1U0HA 3ILLA 2JVRA 3PIOQ 4J9OA 4R8UA 4RW9A 3OHAA 2ZKTA 2KFZA 1IBLF 1RT1A 2VG5A 1D09B 2G2YA 5HL7Q 2AYMA 3OQ2A 2VASA 2XG8A 2FD2A 2KZMA 4XPCA 3NCQA 2VFTA 2I5JB 4M5JA 2UVRA 4AQYJ 2WBMA 5JUMA 2KVIA 1NK6A 1S6QA 1XMQF 4NCGB 2ALYB 2YKOA 4P7VA 4OJ3A 1JLFA 3D5MA 5D0HA 2XMUA 2UUTA 3UR3C 3EGWB 2CZVC 3NOGA 3A8KA 1FRXA 3ZTOA 2APOA 1SJQA 1VS3A 2BANB 3D6HB 1LKZA 2FYXA 4DR4J 5FJ4A 3BQ2A 1Y5LB 4W98A 3FCHA 2B5JA 3GILA 4IH6A 3H2VE 1LXNA 2HVDA 3ILJA 5HMZA 2IM2A 5CYQB 3G8TA 2WSCC 1SC3B 3QZ8A 4IG0B 2QSWA 4DSIA 3J81j 1WHWA 3GP9A 3R27A 2X51A 2RD5C 2FZCB 3JQKA 3I0RA 1RA7A 3MMCA 2K06A 4V1Ak 1WEYA 1ZM3A 4GO5X 1MMLA 4WJBA 1UZDA 1C1CA 4M63A 3QT5A 4NEZA 1RTHA 1JLAA 1HPZB 2H4WB 2R8IA 1FKOB 3CJSA 1OS5A 2W4PA 4ZP8A 3BJYA 3KHLA 4I2QA 1YZ7A 1IBMF 1CC8A 1KN6A 4ZVFA 2LLZA 1HNIB 1F9EB 5I3QA 3PZPA 4DPWA 2MSTA 2BE9B 2DJWA 4M5DB 1GMUA 3L9ZA 2MZJA 4IYQA 1KS2A 1KKHA 3GJSB 3TVKA 2F5GA 2PSZA 3TUZC 3PIPQ 1Q95G 3IC1A 1F5BA 2FJDB 5AT1B 1EB0A 2DNRA 3NNAA 3PNIA 2Z2ZA 3TVYA 4RNMA 3R5CA 5E41A 5IQ6A 4DV2F 3FQKA 3CULA 1K44A 5JMNA 5KFWA 3QWUA 1U7LA 1HBNA 2WHOA 1CSJA 1OSDA 2AEJA 1LEOA 1KHWA 1HFEL 1XERA 3DLBA 2OH2A 2IJRA 3O1LA 1N0UA 2QT7A 3TAMB 1FESA 4LF7F 3C3LA 2P6TA 4H4OA 1VYAA 1TR0A 1FJCA 3N5FA 2WRMA 1CLFA 2OEJA 1VC5A 4LUBA 1YIJS 3H5SA 2X7IA 1UW4A 3ZZYA 4GRSA 1VHFA 1UVKA 1YQHA 4DU8A 3TX0A 4LQ9A 1Q5VA 3CDBA 3VGVA 2N4DA 2OFGX 2E1CA 1YJRA 2V8HA 3KKFA 1IQZA 1PBAA 3J7AN 3FBCA 1VRQC 4WKYA 4P6QA 4MK7A 4JYAF 1KVIA 1RP5A 1CBKA 3N4WA 1LXJA 3D0GE 3A12A 2D3UA 2F63A 2ZH5A 4LVOP 2MHEA 4LJMA 5DQIA 4PUOA 3CJ4A 1ZM9A 2VG7A 2I38A 4KBIA 3D6MB 5CYJA 2E5LJ 4DQQA 1NSKL 1X5PA 3OVBA 2YWWA 5HQMA 2E5JA 4HT7A 5GVQA 5BYQA 4ZJOA 3U1NA 4OHWA 3M8ZA 4Y00A 5A0YB 1YLXA 3AA8A 4NOHA 2ASYA 3GV8B 2COLA 2HVEA 2V2VA 5A6WA 4DCOB 2BRLA 5B0CA 4C97A 1T9YA 2YWGA 1M5VC 4ZHRA 5HATA 3CCTA 2NCKL 3IRXB 4DUZF 2QC3A 1WTFA 1WC0A 1S6OA 5CHCB 3BBCA 2XSJB 4OYIA 3GWCA 1FKPB 1LW2A 2CKWA 3QRPA 4OQJA 2HNZA 4O44A 1I5OB 1ZH5A 1JWWA 4X2BA 4EK2A 3IGNA 3ISZA 2MYFA 3BPDA 4C7QA 4YUDA 4QU6A 1PG5B 4F4AA 5HO4A 4MKVA 2ASJA 3M32A 4UUWA 2VQFJ 1J2VA 3K0JA 3CVKA 3D1HA 4FVMA 2LXIA 4ZCIA 2WONB 2PI5A 4CO0A 2LDYA 3MUTP 1H73A 1KOHA 1RXOB 5B7WA 2C42A 3LAMA 2XY5A 3KTQA 1IN0A 4F4ZA 1U24A 5CD4A 3MMAB 3X3UA 1CQNA 1JJ4A 1KWMA 2CG4A 1KVJA 1KONA 3ZC4A 1RTIB 3SYZA 4CT8A 3LAKA 3C16B 4ZK7M 2HFUA 5LJ3Y 1U4BA 1RCXB 2W7PA 1S9GB 3NP5A 2WB4A 3BYRA 2HHVA 3MM5A 3UD3P 4YR3A 3KLVA 2DGWA 3MCNA 1IVZA 1RBLA 1TVRB 2HG4A 1YX2A 3UFCX 2J9DA 1RHKB 1WSRA 2E44A 3TA0A 1U2RA 4ZLJA 1DFDA 1QY7A 2EVZA 4OHZA 4OYMA 2P2CB 1SC4B 4FXDA 2CQCA 1NXIA 2FHJD 1BMQB 4WIIA 3SQGB 1JJCB 3JTPA 3HHLA 5LM7E 3MCMA 2XQCA 2R8HA 3OL6A 4JI1J 2VODA 5LSOA 3M9OB 3MGJA 1VQMS 1KBRA 3FNNA 1HNZJ 2F8MA 1CULB 4ZVHA 2BJ1A 1VOMA 4NI2A 4USTA 2RUSA 3MCOA 1U1RA 4L72B 1GT8A 4YR0A 3NMAA 1R8BA 2VH7A 3MTJA 3MPVA 1FJGF 4P71A 4F0MA 2L3MA 2PC6A 5K9FA 1VFJA 2KFYA 1AUSL 4PPDA 1FDNA 2BKPA 4B3RF 4IG3B 1OQ6A 1RGVA 3RR7A 1Y5NB 1QVFR 4O4GB 2AJ4A 3EGNA 4ZIVA 3NXZA 2I2YA 1Q0NA 5IT4A 4PRFA 4DL4A 4JI0F 4L3KA 2YPZA 3P5TL 4CLWA 2OPPA 2R7QA 5HQ8A 3HVTB 2DR9A 4WU3A 3ZZZA 2CJAA 3UN5A 3DOLB 1UA1A 2FVSA 4EYIB 1DQAA 1HNVB 4AL6A 1T11A 2CJXB 1SC1B 2ASLA 2QRRA 1HR0J 1TK5A 3T3FA 4LF8F 4DR1J 2K8GA 3EDRB 1IBCB 4FYDA 3QRQA 2ZH9A 1MG7A 4DMZA 1YK9A 4QWAA 4DV4F 2FVPA 1R8PA 2D3ZA 3GFYA 4PCQA 1YRXA 3CMQA 4Q44A 4Q0BB 3KLEB 4BLGA 3D0HE 2ROEA 4DL0C 2DISA 2MZRA 1NHVA 1KLMB 4R5PA 4TNOA 2AW0A 2GMJA 5THWA 2VZ9A 2B4VA 3VZHA 1UZHA 1NPPA 2VQFF 3PW7A 2XULA 2DNLA 4TKTA 2KM8C 2VHGA 3VHQA 4IFYA 5AXLA 3NGUA 4FPRA 3GIJA 2B4PA 1RKJA 2N3OA 1O8BA 1ZTTA 3BR9A 5F9NA 3BEGB 2H51B 2E1RA 5CXTA 4DQIA 2Z58B 3MM8B 3KK2A 2GNKA 1Z2LA 1TV6B 1KFDA 1FJ7A 1F2GA 2HVZA 1S48A 3UCGA 2QSFA 5G0RB 2HMIB 2RDIA 3M8QA 2CA9A 4TY8A 4ED3A 1FK9B 2XO7A 1FFGB 3MHYA 4H4MA 4ZMMA 1C0UB 2EC2A 2VA2A 4LR7A 3GFHA 1CJUA 2V69A 3K59A 1VQNS 5D15A 2R2UA 1NKCA 5F8IA 4JI5F 4X65J 3EX7B 2BOAA 3FVYA 3TQ1A 2ZZMA 1UWBB 3VAMA 2FY8A 3DLGB 3BKTA 4TLQA 3QT8A 4QIFA 2JEFA 3JYTA 3AJ2A 3C6UB 1N5TA 1Z4UA 2HQCA 2ZDOA 3GQCA 1WDDA 1S4FA 1Q53A 4LIRA 2BR0A 3KOAA 3I4PA 3W9JA 4ZDNA 1J5EF 4Y2KA 4IH7A 3TZWA 5T14A 3QJJA 1OY9A 5U47A 1H72C 5MAOA 2BBEA 1C1BB 5SUHA 2WSFC 2DR5A 1N8RT 1FF2A 4ANCA 4H4KA 3W63A 4YN3B 4X4QA 1WACA 1E6VA 4DR3J 1S10A 3IR6B 1Y5IB 1IBKF 1KDNA 2AF6A 1RT7A 1MN9A 1RAGB 3HLUA 3M6XA 2RRAA 4QPXA 4KFBB 4OIXA 2JL9A 3R8YA 2DNHA 2D3O1 4DR2F 1QAIA 2F9JA 4J9UE 5J2PB 1IR0A 4MKBA 3WIVA 5D3GB 2LECA 2HRYA 1S1TB 2WK4A 1R6VA 1JLQA 4LRBA 4CWBA 3WZ0A 3I5AA 1SJ4P 1NZ8A 4DQSA 1SJFA 3PX0A 3CJ5A 3UN2A 5EWFA 2CPIA 2DO4A 4ZVOB 1CPZA 2NUUG 2QLBB 5CQGA 3EICA 1YI2S 3MAQA 3HSZA 3MPUB 4UQGA 1WKKA 1Y0HA 5HK4A 1F60B 4UW2A 3K7RA 4U96A 2MJNA 1VQ6S 3ZZTA 2DR7A 1HWLA 3K8VA 3HSDA 2LA4A 3SSRA 4ZPTR 3OTCA 5KT6A 2RF2A 4CRJA 2J5AA 2DY9A 3LGHA 3D6TB 2HHHF 1HA1A 3C46A 3M1VB 4PWWA 1JNRB 1JNZB 5I3UA 3E2EA 5H9EJ 1SI9A 2UU9J 3E01B 2W9BA 4DV0J 1PJ7A 2EFOA 4IOBA 2BKNA 4NZ0A 2O67A 3GV7B 2YH1A 1N34J 1RAJA 3E3XA 1B7YB 2LCWA 2JNJA 2PGCA 2NXUA 4XO0A 4C0HA 3TA2A 5HAOA 5L1JA 2ZE2A 4LF4J 3UWTA 3DM2B 2E7WA 4NLXA 4X4OA 3HHNB 4X64J 2F9DA 3L4BC 1APSA 2FGCA 4EZ9A 1TL1B 4ENOA 3CCES 1LWFA 2FY1A 3LF0A 1ZAWA 1OQ3A 4NWBA 4GVLA 4NZ6A 3EE3A 1P9YA 2NYIA 2HBRB 1U47A 3M2VB 4HL9A 2J7KA 3SSSA 2VDHA 1WELA 1WKLA 4CI0B 4QR2A 1NNDA 1FRKA 5E33A 4NLWA 2XBPA 1MU2A 3K8WA 5BR8J 2AU0A 2KHCA 4DV3J 3L7OA 2GX8A 2KT3A 2R2RA 2XZDB 1ZETA 4PG4A 4USMA 4WF9Q 4IQXA 2RHSB 5B0EA 1U8WA 2OPSA 3RGIA 2C3YA 4C8YA 2AYGA 4CIOA 5J2QB 3PJXA 1SL2A 1QTNB 4PPZA 3RB0A 1I6JA 3B4MA 3KWMA 2OP5A 3H2LA 3HK2A 1LFPA 4ZS6A 2FC9A 3NBPB 2YNHB 1VR6A 4DR6J 4ZOSA 3UN3A 5LMNJ 2HWIA 3GIRA 2LQ5A 3K5LA 3BZQA 2EG1A 2CQ0A 1HD1A 2BM0A 3VCDA 4K0KJ 1FNMA 1YWXA 3R2CJ 1WWHA 3K5PA 4USIA 1KQSR 1XMOJ 1NDPA 4AL5A 4YHHJ 1N52B 1L5UA 3DU5A 2IAJA 2DR6A 2XB2D 4B9UA 1JJHA 2XLJA 2Y1JA 1S77D 4F8RA 4NYZA 3QATA 4FBUA 4YEAA 5SZTA 2DR8A 3PRVA 2P6SA 3RRGA 4A8MP 2MZ1A 1N6QB 3VGTA 2UXDF 3CCQS 3CO9A 3T5LA 3D9BA 4BCAA 1XWLA 2AEMA 3EM1A 1JXEA 3QIDA 1VQOS 1S0NA 1JK9B 1HWIA 2DT9A 4BC9A 2BANA 5F41A 4DG1A 4HHHA 1RISA 1VK8A 4NE9C 2A10A 4USJC 1VRUB 2YNGB 3OXLA 2HQDA 2HZVA 3P8BB 3CNQP 1Y3KA 3A3OB 3H59A 2CPJA 4TQSA 4Y28C 2ATLA 4DR5F 2HFNA 3NKYA 5T7LB 2UVWA 1Y7PA 3MEKA 2XS7A 2PEBA 2RSQA 3CSKA 1RB0A 3UD5A 3SIPB 1N56A 4NXMF 2GGPA 4UY85 4M5KA 2BW7A 2V2KA 4DUYF 2P5VA 3PFOA 1RU2A 4ECRA 4Q43A 1ULRA 2CJQA 3KNAA 5HVGA 2QG9B 3PJ9A 1LOUA 3RUBL 3RRKA 3CW2C 2Z8QA 1FX4A 2WVDA 2RS2A 3PYEA 2OKQA 4HACA 3CCRS 4QR0A 5BYRA 3CJQA 5CCMA 3HJVA 2JLEA 4CLUA 3LANA 3HFKA 1FE0A 4PG7A 5AXKA 3D3BJ 3PW2A 4JI4J 4KKOB 3OBIA 4A8SA 3DC2A 3PEJA 2H65B 2LP4A 5IC4B 3AD9C 4CLTA 1VISA 2YXLA 5EX3A 4QYZJ 2AX0A 3M30B 3QGGA 2XYPB 3GIMA 4QJVA 3M8PA 2XNQA 3QT7A 1NSQA 1RT6A 2HNDB 5M2RA 2HQFA 3J7ZT 4LFBF 1NB2A 2ZD1A 2HGLA 2VPXB 3CJKB 4UF4A 1VCTA 2XM3A 3HM9A 2EBGA 5D6GA 2QIFA 1T9TA 2VC0A 2NPFA 1HYSB 4CO4A 2WOMB 3W9IA 5DZ7A 3Q8PB 4HDHA 2ZUGA 3BGUA 3MPYA 3FBFA 2SXLA 1XNRJ 3C14B 4LT6A 2ZC4A 4HI1A 4ZA1A 4BWMA 2DGTA 4PG5A 2ZNZA 1W25A 3PDNA 3E51A 5KT5A 5ETPA 3GCWP 5LSLA 1UWAA 5M2PA 3MURP 4JI3J 1IJEB 3V6JA 3A3PB 5HP1B 2KJVA 2HHUA 1BE4A 3MDFA 1VBKA 5HROA 4ED2A 3Q0AA 4C3LA 5I42A 2NQPA 3I5BA 2W9CA 2WTFA 3CCMS 4W4MA 1XMOF 3Q86A 1TKZA 4J9RA 1TFWA 2QGFB 5CD4H 3VGUA 4KGXB 5AXMA 4LF5J 4WK3A 4TLRA 1FX2A 1FTRA 6AT1B 2K1RB 3H2UB 1OWXA 2IRUA 2LA6A 2DGSA 2GJ2A 4I6WA 4JI2J 2CFXA 2E9ZA 1RSCA 1JMTA 1YZ6A 5ETVA 4ANEA 2DXDA 1QTMA 4XAKA 1RADB 3ET6B 2AV5A 4IO9Q 3AXMA 3PKYA 3QGHA 4ELTA 3KLGA 4F4XA 3CUNA 2R2TA 2PMWA 4Y0FA 5A8RB 2AJ0A 1IKYA 2O66A 4RBUA 3A3NB 2JSXA 4LR8A 2XI3A 4F3OA 1H6KX 3ULHA 2D9PA 2CQHA 1HBMB 4L73A 1JLBA 5KAKA 4ZPAA 3T1HJ 1LFWA 1PCAA 1IKVA 4I69A 3PXGa 4E8UA 4PG8A 3C2PA 4IQMA 2FHOB 4NLPA 1GMVA 4ERDA 1HBUA 2KN4A 3VWSA 2XZWA 5D0RA 2C3MA 4OZJA 2PI4A 2JEJA 3QBCA 4CT9A 3OUYB 2G9OA 3KNGA 3J7A1 1SKRA 1NZAA 4X66F 3CC2S 4DFMA 2YNFB 4NRTA 3TRGA 5BYSA 3DRRB 3NY0A 4FNIA 3W66A 4JI6J 3HFZB 3FDSA 2Y9HA 2OPQA 4YR2A 1JLGB 2DHSA 4N5SA 3MEDA 3MMAA 2QL7B 4NMXA 4J91A 2NUHA 4OJ1A 1WC1A 1UW9A 2GAGC 3GJTB 1VRTA 1EP4A 3EVOA 1NBEB 1C4CA 2YKQA 2EK6A 4P52A 4ZN1A 1WF1A 5EWGA 1U0HB 4F0KA 4EBCA 2KG1A 2HHPA 2NR0A 4R8UB 4RW9B 1S1UB 5KFGA 1RT1B 1JXLA 4JUZA 2FLOA 3T9ZA 2ZZTA 2GQ2A 2G1DA 2QL9B 2HIQA 4WCEQ 1X4GA 3QIPB 3NS7B 2CZ9A 3H4DA 1OY6A 1S6QB 4UQTA 1JLFB 4Y6IA 2J6TA 1Q8LA 4LQ3A 5KTQA 2C2RA 4C3MA 3KMQA 4HLBA 2KJWA 2OHDA 4ZVSB 1SL0A 4DV1F 2MY7A 1RABB 4ZP6A 1Y00A 4KRWA 3VAJA 2QLJB 4KV8A 2FGOA 3OXGA 3IP0A 2HFZA 2DH8A 2LVWA 4OZNA 5KG0A 1IJFB 3UD4P 4F67A 4A8QA 4EWTA 2RRBA 3H4BA 1DURA 3W3SA 4IG3A 2GO9A 1FA0A 4F2RA 4QWEA 4J37A 1FFWB 2DHXA 3LGMA 1NPKA 3I0RB 3MMCB 2QJ3A 4U6PA 3POTB 1S99A 4X4SA 2YTCA 3IR7B 2N4CA 3DCAA 1C1CB 3HVTA 2DH9A 1CEZA 1RTHB 2UXBJ 3DOLA 5D8HB 5E3RA 1T03A 3FMBA 1U09A 3KHRA 1S6PB 1R43A 4I2QB 7FD1A 4M94A 1TL7A 2Q3PA 2RUGA 2V2QA 4ECVA 1MW7A 4OX7A 2NLWA 1PJ6A 5K5MA 1YJUA 4FF4A 3DRPB 2EXUA 1HHSA 2GMLA 3GE9A 2MQLA 2VBZA 1T8EA 4EZ6A 1Y3JA 3R6GB 2DK2A 2V4RA 3K5NA 4ZCMA 3ADAC 1DTQA 1FXDA 2BJ8A 4X4PA 4DOZA 4I6YA 3J80U 1KLMA 3EVWA 4A8KA 2W25A 5A2QU 3P45B 3TAPA 3G6YA 1RAOA 4N41A 3QRRA 3TA1A 1QM9A 4EBEA 4MYUA 3W2VA 1SC6A 4YMEA 5LT5A 4M5LA 1EETA 3KHGA 1GTHA 2JFKA 4AUKA 2MSSA 2H5EA 1W2IA 2J7UA 1L3VA 4X4VA 4QR1A 3IXQA 4OL8A 3ONQA 5F8JA 1RTZA 4NXNJ 4RW8A 3G86A 4CZCA 1NMEB 3OJUA 1PIEA 1QUVA 1TV6A 4H4OB 2J9CA 1TQLA 5DETA 2KO1A 4KYZA 4B9SA 1N32J 5GAHI 3MUMP 3PCOB 4EYHB 1VQPS 3EGVA 3JXOA 4EGLA 2DO0A 1SJ1A 4HH0A 3LP0B 1REGX 3ZTSA 2ABYA 2H54B 4L74A 1BC6A 4RBTA 4ZP9A 4O0NA 4CYUA 2J0WA 3HKZD 1C0UA 3JSYA 4K7QA 1UTAA 1AT1B 2VFRA 2FTRA 3GFXA 3Q2TC 4OYAA 3ZNJ1 2CQ3A 4CH0S 3G87A 1QSLA 2KHDA 1OYEA 3M8SA 1EZZB 4ZPDA 2K7JA 2CQ2A 1QVGR 4L6V3 3RG6A 1RCOB 2GC8A 3OSPA 2DNZA 4ATNA 2HLUA 4PUOB 3FJ2A 2PN6A 1MWQA 2VG7B 2XHCA 5EHHA 1IXKA 1YJTA 1Q1KA 2YX4A 3FSXA 4KGVB 4KJIA 2OLWA 4UT4A 1D3WA 3LGNA 4I7FA 5EGYA 3A8EA 1U6FA 5K20B 2WZ1A 3MM6B 3HP6A 3PEHA 2VKRA 2I0XA 3THVA 2YNIA 3CXCR 2JRSA 1CJKB 5KG3A 4U8VA 2WAQD 4ZHRB 2QMXA 3RR8A 2W9AA 4TYBA 4P7TA 5HN0A 4DF8A 3VF0B 1SCJB 5AJ3J 1FT8A 4Z2XA 4B3SF 4JBCA 1I94J 1LW2B 2HNZB 4O44B 2O01C 2OD4A 3M2RA 4DV7F 1IWAA 3MR6A 3D7SB 4LF9J 1N33J 3V6HA 1RTJA 3CDWA 4WWSA 1N54B 2Q1LA 4DCJB 2J0XA 2QO3A 3BS9A 2YVSA 2MKCA 3M32B 3AOAA 3FEYB 5HLFA 3MEEA 4QZVB 5KT7A 3VZIA 4NA2A 4BS2A 1L3KA 1X4EA 2AGOA 5KG5A 5K8OA 3CD5A 2VG6A 4ES2A 2WVFA 1FHTA 2BJ7A 2L9WA 4A8OA 1RAFB 3J81U 3JB9k 4EMDA 3SXLA 4GMKA 3CJTA 4WK1A 2EFNA 4E98A 5DO2A 2IMWP 1VLOA 1PYSB 1X0PA 5CYMA 3MM5B 4LFAJ 4RU9A 1NHKL 3CGIA 4U95A 3J7YI 4M5NA 1UP1A 2PA3A 3H40A 3OHBA 3MUVP 2IBKA 2MQ8A 1NH8A 2YQ3A 4P2MA 2GAHC 1X5SA 3GYNA 2ROGA 4DV6F 3HHLB 3UCZP 3P49B 4DI6A 4DL7A 3QFWA 4IR9A 5AE1A 5B0GA 2VPYB 4B3MF 4GKKF 4N77A 4QIEA 4NI2B 1G3OA 1ZAXA 5IC6B 5J2NA 3ILOA 5DM7Q 3UR0A 1F3FA 2CAJA 4LFCF 3L3CA 3S6EA 4QOTA 2D74B 1VQ9S 3NL0A 2VKZG 3D28A 2B9WA 1RWVB 1C4AA 2EKNA 2CNLB 2J0QD 2AZ3A 4KPCA 1KD1T 1R6YA 5E3CA 3A8IA 1RWMB 4GKJF 1EKRA 4HTJA 2YH0A 2EKYA 2JFDA 4NL5A 3NAHA 1IM4A 2QE5A 2ZBIA 3MM7A 1RLCL 1SPBP 1OO0B 2RH3A 1HNWF 5DG7A 2UUAJ 1REVA 4LRAA 3DYAA 3TUJC 4AFFA 4B3TJ 1XNQF 3CJRA 2D41A 2OPPB 1D0EA 1VI7A 3JSBA 2VOPA 2PIIA 3IBFB 1NJIT 1XR7A 3PX4A 4ZJQA 2Z2LA 2IVYA 3MWBA 4JV5F 2CPYA 1PO6A 3IFEA 1M5PC 3RBZA 2HHWA 1PYTA 2UV8G 2JEGA 1J5OB 4U7UD 1LWCB 1ZOTA 4B3OB 4WU2A 4ZVEA 2L48A 4YB5A 2BQRA 2YNHA 4WP8A 5EUHA 2JEIA 4UOGA 1E6YA 1KOOA 4OHXA 4HHJA 2K3IA 4FVCA 2J9EA 3N01A 1AFJA 2P9CA 3PJWA 3Q8VA 5K8PA 4FYVB 4AXIA 4ILRA 2HKEA 3OV7A 2FIUA 1S72S 3DGPB 1X9SA 4TXSA 3GZ7A 4LRDA 3NWGA 2J6UA 3MR2A 4DX5A 2HVIA 1YJ7A 1ZA1B 4R5PB 3V6DA 2PE8A 4KHPF 4DXLA 4PEOA 4KE5A 2FJXA 2VIHA 3TJ8A 4DPTA 3OW2R 2ZBCA 4DV5F 2AP6A 2KTQA 1BQMA 2J9DE 3WQPA 5C42A 5C2GA 4RNHA 5LMUF 4ZVUB 2QFIA 2XMMA 2B6AA 3RBXA 5C25A 3HFVA 4FKYA 2FVRA 1HWJA 1R31A 4RL1A 2LQJA 3IA0A 1IR2A 1CJTA 3KK2B 2C3OA 4N8OA 1WG5A 3NGRA 2R8KA 2IC3A 2Y1RI 2BQUA 1NJYA 5F0WA 4GVBA 3M8QB 1N48A 2XCAA 1C0TA 2LQBA 4TY8B 2D69A 4IOAQ 2RJZA 1WHVA 4H4MB 4XDCA 3D68A 2XZTB 3R7SB 2W8KA 1CJUB 1V3ZA 5IS2A 2CVIA 2ZDPA 3T6JA 1VHIA 3OD2A 3GLJA 1GX5A 3BSAA 2V9WA 3IBWA 2AJ1A 4CTAA 1RACB 1F2HA 3JYTB 1PAUB 2P9EA 5B0FA 1FRHA 4NX9A 2ZH3A 3PM9A 2DY1A 1F1BB 4MH8A 4RLEA 3VV2B 3BDPA 1GH8A 1TKTA 2UXCJ 2CQBA 1U6ZA 3SFUA 2EC0A 1X5OA 2OFHX 3J7Z5 1R7IA 1RT3A 2RDJA 1DRZA 3H5XA 3Q24A 1JJ2R 2AYEA 2GIFA 4ZVRB 2EBEA 2HNDA 1U8SA 5DG8A 1R0BG 4YB7A 3L95X 4PXEA 5EWEA 1DARA 1K1QA 2KT2A 1E6VB 2IM1A 2DITA 6FDRA 5EX0A 1RT7B 1H38A 1FRIA 4AXJA 2NSBA 2IA0A 1SV5A 5A8KA 2QL5B 4ZVGA 3RB4A 2B56A 5FD1A 1HYSA 2ZVSA 3DNCA 4X62J 1FE4A 2MKSA 2MJUA 2MQPA 2RQKA 4MKAA 4ZITA 1JLQB 3NLCA 4MYTA 1TMJA 1RT2A 2UUBJ 3GG1A 1AZSB 1N5YA 4D3HA 5FIIA 3Q8RB 3B6BA 2B43A 5KOWA 3RAQA 5KFAA 3BQ0A 1V3SA 4QIWD 4USVA 5IT9U 2ZBRA 2RRNA 2ZZNA 4R25A 1D9FA 4AT1B 3EPGA 2CJKA 4DSLA 4RX6A 2BKOA 4P2SA 2XO6A 2B7CB 5IOLA 4RNFA 3T9NA 2HS4A 4L76A 8RUCA 1K47A 2ATCB 1UKUA 3CO0P 3CIZA 1KC8T 5IXUA 3JSMA 1SQEA 2RF2B 3MECA 1PJ5A 1UAWA 3ITHA 2AT1B 3CCUS 2ROPA 4Z37A 1ZBTA 1KSPA 1RA6A 2W9BB 1LK5A 2JZ5A 2F4VJ 1XEZA 4A8FA 4ETZA 3OR1A 3X1LB 3HMJG 3IM8A 4WFNQ 4B02A 4C11A 4DR7F 2HBYB 1TK0A 3F73A 1WF2A 1XR5A 2GQCA 4KH0B 3FRZA 2R42A 2RILA 2BACA 3PHEA 5D0EA 5GAGI 2VFVA 1RHRB 3W8GA 1G2EA 4JV1A 3SMZA 1R0AB 2ZJPQ 1NSPA 3QO9B 1LWFB 1G4CA 4QBUA 4FS1A 1S9FA 3SSQA 4NLTA 4BWJA 3HHEA 1UMJA 5IWAJ 3PR5B 2VJUA 2AJFE 3KG1A 4R0JA 2M8HA 1WOSA 3ENWA 2VQEF 1UJ5A 4QPTA 4PWUA 3O6QA 1XN9A 1RHUB 1M5HA 3HHDA 3HSGA 2HFVA 3OUYA 4Q8EA 4TVAB 1BHNA 1LV5A 3DOKA 1EQMA 2XSFA 2KVQE 2MKKA 3UDCA 2OPSB 3BBBA 2G4BA 2EW9A 3DU6A 2CRLA 5MLCV 1MN7A 1UFWA 3NGDA 1FDAA 4K4XA 2FUG9 1NKEA 2RQMA 3QZ7A 2WW8A 2UXCF 2BOPA 3W5YA 4N76A 3WX4A 3D66A 1Q7YT 3UDEA 2GJFA 4K50A 2NXCA 1I51B 1S1UA 1S97A 2E1PA 4TU9A 3D54A 2IDLA 2CQPA 1O0PA 3PG9A 2JJ4D 3NGTA 3MPDA 1VK3A 2HNYA 4YY3J 4B08A 5C5JA 4J9KA 9RUBA 5ITHA 4KTQA 3QIPA 2FJBB 2IAJB 5F0UA 1VC6A 4C8KA 1TL5A 2H5JB 4Y2IA 3HI9A 4RUAA 2M3DA 5A8WA 4S0MA 4RW6A 4GO7X 1U26A 4M5GA 1A9NB 2D3OR 2KRRA 3D0IE 3F44A 2UUCF 4J9LA 4F3QA 2HBQB 2NS1B 3UNGC 4IRCA 5D4PA 4DG1B 3WC2A 3FEZA 1U0SA 3D4JA 1D8ZA 4O3RA 4IO1A 2QA1A 4C48A 3GYXB 4YFUA 2MKJA 1L3TA 1HARA 3UVJA 3TZZA 2QYGA 4KIAA 2ZH2A 1FD2A 1OY8A 3BV8A 3GYGA 2WSEC 3AT1B 4X4TA 3CCSS 4LF6J 4G6VB 2Q6CA 3POTA 2GGPB 1NJWA 3VVUA 1T05A 1HIYA 3G71S 2W2OP 5LXYA 4Q45A 2ZJRQ 4DZ6A 3CCVS 3AODA 4A46A 1QE1A 4O3NA 2XMKA 2XYHB 1NK5A 3PRBA 2N7CA 1WOOA 1S6PA 1CJVA 1RAIB 1PC4A 1EJ7L 4A8XA 2BABA 1UPMB 2E1MC 2C3PA 3OT9A 4HACB 4JI7F 1GTEA 2NXJA 5H1SV 3DRPA 1SIWB 1BGXT 3AJ1A 2DB1A 2CADA 2ZBQA 2KB2A 2G0CA 3UW1A 4O4RA 1PC5A 1WG4A 2EI5A 2HS3A 3KMSA 2EWHA 2PMZD 4EFAC 3SZ2A 2MPUA 3M8PB 5D4NA 3FK4A 3PYFA 1RT6B 4OJHA 3PY8A 1SB6A 2ZD1B 3KLIA 4JI8F 1AXQA 1UFLA 2MMYA 1Q16B 1X8DA 1TELA 2ASDA 5DJBA 3G9CA 4Q2MA 3IRWP 1FTCA 3SQOP 2DCUB 2ZC3A 1IKXA 4M5HA 5LXRA 5IV4A 1WOPA 2YX7A 4O0IA 2J8SA 3K2YA 4V19J 1S5ZA 1K1SA 1P9QC 3QNWB 5JVGQ 1BQXA 1XK8A 2E66A 1QSYA 2RB7A 3Q8QB 1WI8A 4OI1A 3VTIA 4HR2A 1K9MT 2D1CA 3LPYA 1YDLA 3LP0A 3O2IA 3CPWR 4PXCA 3GONA 4DPOA 1B4SA 3F56A 1Y10A 1P6TA 4CLYA 5GADI 5HROB 3LQVA 4U9RA 5I42B 2EFQA 3HZGA 1SIZA 2W9CB 2QLFB 2XI2A 5HVHA 2HS0A 2RHQB 2V8GA 5K8MA 3TANA 1TKZB 5GAEU 4IRDA 3OTOJ 4DX7A 2W2MP 2LU2A 3WX8A 4AQYF 4OZ3A 3IWNC 1RYSA 3QLHA 3N6NA 2WCXA 2Y1LB 1PGZA 3RTVA 4C8NA 5H9EK 1QAYA 4HTIA 4DSFA 1NPRA 5HSPA 2ZKUA 1X9MA 5DDQC 5K14A 2W8LA 3CC4S 3GG0A 2X1FA 1HWUA 3MM6A 2V4JA 6FD1A 3MMJA 1SKUB 4H54A 3W65A 3VAKA 4DR4F 2YQ0A 3LH2S 1Q8IA 2XWXA 3TP2A 3KLGB 1CJKA 3AB2B 1RK8A 5EDWA 2FJEB 1PSDA 1DZ5A 1IKYB 2DGQA 3CF5Q 1K0TA 1QAXA 3MAAA 1KHVA 4CNYA 1HI1A 1JLBB 1S9EA 5B08A 1NU4A 5F8GA 3M4XA 1SKWA 4DHVA 1IKVB 1R27B 2MZSA 3DRSA 3MEGB 2W01A 1HBUB 7AT1B 1P27B 1WSVA 1Y4ZB 2DPIA 4P75A 4WTYA 2KZZA 2IMOA 5ETQA 1WKJA 3CJ8A 4F25A 3CWJA 1O5JA 2ZM6J 4OYWA 4DSEA 4P72A 3K58A 5IZHA 2FHJA 1DY3A 3L7PA 1WUUA 2OPQB 3BREA 3MEDB 5C24B 1OPZA 5KFBA 1T02A 1WD6A 4P2XA 1RTDA 2V67A 3GV5B 1VRTB 1EP4B 5B0DA 2E9RX 1R8HA 1N36J 3M9MB 2VA3A 4Z7CA 1QUPA 3QAUA 2KDOA 8ATCB 1PBUA 2HEKA 3PTWA 1F5CA 1TKDA 2F65A 1W26A 4ZN3A 1IKWA 2DTJA 1H3DA 1HNXJ 3E8OA 3FC9A 2HQ3A 2QN6B 4C4WA 1GXUA 5A76A 1YJWS 4ED4A 4OX9J 3H20A 2KU7A 2C2ZB 1GFWB 4O3PA 3WIUA 2XMWA 3AD7C 2PFFB 4K5RA 4OI3A 3Q8SB 1NDLA 4TN2A 3C66A 3AHPA 2A2DA 2V8DA 2XNRA 2DGXA 2KKHA 4DDFA 4ZCKA 3IR5B 4OJGA 2KYZA 4KV8B 3J80Y 4FF2A 2YQ1A 1C2PA 2AIRB 3IGVA 3M9NB 1Q82T 3DGVA 5A2QY 1NEEA 2HURA 1CVJA 3NAIA 4LSZB 3N79A 3CJ0A 1S7HA 5ETRA 4XTTA 2MEWA 3KK3A 2CDRB 3CB4A 4QWCA 1BD6A 3JAMU 4J90A 3BO2A 3M6WA 3R5AA 5KFJA 4HDGA 2R7WA 3TOQA 1NDCA 1ZPVA 3QAEA 2HQGA 1FCAA 1UVJA 1GMWD 2IHR1 3TW0A 4ECWA 1T03B 3LWMA 2E5LF 1J5OA 5KFTA 1LWCA 4B3OA 5B0AA 3NCRA 4RW4A 4O3QA 4AL7A 3JQMA 3TI0A 4CO2A 2GVZB 2JDJA 1TL7B 2W4DA 4ZVQB 1XBWA 1JLEA 4U7CA 2CG8A 2VONA 3CEDA 4M5IA 1DTTA 5KFEA 5KFRA 3N28A 3DLHA 2M4MA 2V8PA 5HMXA 2Z30B 1VLYA 3DGPA 4DPXA 3FSIA 2XLKA 4WPAA 1DTQB 2Z0GA 1NSAA 3MTKA 3LP1A 4DCPB 2QZ8A 3US5A 1KVKA 2N3LA 3FRYA 2J6SA 3LWLA 3QSYB 3W2VB 2YKNA 2KI2A 1QJHA 2Z57B 3MF5A 1EETB 3G6XA 2VUGA 2IRXA 2V5HG 4LBIA 1DQ9A 1B3TA 1U2CA 3IS9A 3JS9A 2D7SA 3FZ2A 1BQNA 2E5GA 4RW8B 1Q79A 3T1AA 2E29A 1FKAF 1RAAB 1U1MA 3JQJA 3P6YC 4YS2A 2IM0A 3T6BA 3EXYA 4FYWB 4D3GA 4L75A 2YWFA 1MMDA 3OL7A 1O51A 1N88A 3CMAS 2DBBA 4CYUB 4EU0A 3EDQB 3ZTQA 1VBXA 1TK8A 3QGIA 3R7NB 2LEBA 1KRPA 2N7YA 4Z7YA 3D2WA 1IBLJ 1YRTA 4NZ7A 5D78A 5KG4A 2JLGA 3RU0A 4ICLB 3DDNA 4JI1F 3J81Y 5KFQA 3OLAA 4PABA 1RWUA 2BJ9A 1HNZF 3H98A 1Q8BA 4OI4A 4RJVA 3OPKA 4UZBA 1XMQJ 2LEAA 1Q78A 2XC9A 4I7FB 2W4CA 3B78A 3FCWA 2CYYA 4ANDA 2DKOB 2IYIA 2RVJA 1L3SA 2XS2A 2YNIB 4RO0A 5ETTA 3KUGA 1V5VA 5J2MA 1T3OA 4IRKA 2H9ZA 2GIRA 4C6AA 4DZDA 4C8ZA 2FLPA 4DSKA 4URGA 2HYIB 2IPOB 4RNOA 4FP9A 3ZZPA 3ZTPA 2QX0A 4KR0B 1VQLS 3M2RB 5IQQA 3MR7A 2V4QA 3HVAA 1RE1B 1T95A 3BM7A 4O3SA 4QYRA 1AZSA 1RTJB 2XMJA 1RWPB 3SCIE 3H5UA 1NCLA 3BGRA 2R8GA 3KHHA 4A8YA 5HLFB 3MEEB 5KFSA 3W7BA 1HQUA 2R7TA 4WFAQ 1HR0F 2RU3A 2OELA 3PYGA 2VG6B 4DR1F 5HVFA 5HJXA 3P3DA 2G2ZA 2N82B 1IBMJ 3TJAA 2LQ9A 3SFGA 3BKUA 3SV4A 2OD6A 2YKAA 2PMHA 1YHQS 4ED6A 3A1YG 2Z56B 4U67Q 3ENQA 5CYMB 1EIYB 4WP3A 2XY6A 1BWVA 4RZRA 3PW5A 5KFLA 2IVFB 3D1OA 4NYOA 1KTQA 3UO0A 4MIWA 3RYLA 4F4YA 4RR5A 4I56A 4USUA 4HKQA 2J76E 3R1LA 3THPA 1Q7LB 1LQ9A 5ETSA 3OL8A 1L3UA 2B51A 1UETA 4FPIA 1UCNA 5DM6Q 3VAGA 2ALZA 2HK2A 1ACMB 3C15A 4KT0C 3B4DA 4CLKA 1R0AA 2OUGA 3QO9A 1U6BA 4DV2J 1OSCA 1N5VA 1CG2A 1QAJA 4U8YA 1YSJA 3AQPA 5J2NB 5FLXU 3MM9A 2DRBA 1S7IA 3DDIA 1FJEB 1O6XA 1NJZA 3AJDA 3SCLE 3P96A 4LF7J 3GPAA 2R2SA 2DNKA 4ECYA 3G4SS 1ROFA 3JTOA 3MOZA 4WFZA 1KQKA 3I0SA 1N0VC 3MM7B 4X65F 1REVB 4MT1A 5KFIA 3AB4B 3DYAB 1ZZFA 2NPIA 1HBOB 4K4SA 3T19A 2BE2A 2GV1A 2LXUA 2X3DA 2YKPA 2HAFA 1WC3A 4DU7A 1R3NA 4JYAJ 2KXNB 3CD7A 2DRAA 4RW7A 2LMIA 2W2NP 5LJ5Y 4ED7A 1RZMA 5KG2A 2RKIA 3I6PA 4LMZA 3CJ2A 2CZ4A 1MSWD 2JH3A 4QW8A 1WORA 4KGMA 4DL2A 1E6YB 1RWWB 2BMBA 1VJWA 3TEHB 1HL6A 4DR3F 4YB1P 4NLDA 4DLEA 2POKA 1ZZNA 4CNZA 1M5KC 4F04B 1EARA 2W7OA 9ATCB 1WG1A 5FDLA 2CVEA 4KQZA 5CH7B 4G1PA 4QQBA 1ZAVA 4DUZJ 4OLPA 3S1TA 1VBYA 4EI2A 2OTLS 4OX6A 5D4OA 1PYOB 1WF0A 3V6DB 3R1HA 3UDVA 1YG0A 5ADZA 1WC5A 4UZCA 1ZM4A 4DLGA 4ID8A 2HZCA 2F4FA 2YKMA 4TU8A 2GIQA 3C19A 2VDIA 4U7UK 2R9LA 4RNNA 1KEKA 2E7VA 1BQMB 5C42B 4UY8T 2MLXA 1S1XA 2BX6A 5GMKa 4DQRA 1WEXA 2B6AB 3OTBA 5C25B 1JX4A 4DL6A 1NDKA 3FCVA 5L8RC 5E7OB 3QFHA 2R7XA 1CJTB 2DNPA 1RBOB 2F8EX 4W92B 2QYCA 2DEJA 2IC3B 1VQ8S 3IN5A 4GVBB 4JOUA 2L9DA 2E5IA 3V4IA 3GMGA 3W5XA 5IT0A 1CC7A 2XLIA 2UU9F 2NZ4A 1U49A 1C0TB 4MIBA 4DV0F 2AJQA 2A0FB 2JC1A 2QMWA 1IWGA 2DXFA 3ZO7A 2IIHA 4ZVTB 3KK1B 1UVIA 5IT9Y 3V81A 1N34F 2XTJP 4NCBA 4K5SA 3M8RA 3PW0A 1TFYA 5H9FJ 2NXEA 3I56S 2IY5B 4NA3A 4WBFA 4FN5A 2CQDA 4CTAB 4LF4F 4QWBA 2PO4A 3G6ES 4X64F 2Z2YB 3R5GA 4BDPA 2A3JA 5ETLA 1VIXA 1KP6A 1SH3A 4YDDB 5E0OA 2MTLA 1TKTB 2H48B 4NEYA 4BBYA 1HI0P 5KFNA 1UL3A 1TP7A 4USWA 3KJFB 4IDKA 1RT3B 4Q2LA 1MWZA 2R7RA 3K17A 1RHMB 2ADCA 2OIHA 2JVOA 1FVQA 2PA8D 1R8AA 4O23A 2OMOA 1FRMA 1PILA 4UOHA 2Q6BA 2NXNA 3GU0A 4ILMA 1SV5B 5BR8F 5A8KB 1FJGJ 4OZ0A 4DV3F 1WC6A 1M1GA 3P4UB 2IVMA 4F4KA 5E3PA 4DL5A 4B3RJ 2ZITA 1LW0A 1TUVA 1MROB 4XK8C 4ECZA 4M1KA 5D77A 1RT2B 2LU1A 2OTJS 1N5YB 1K8AT 2FJAB 2M5YA 3ZXWA 1LNQA 4JI0J 2YPYA 2V50A 2ILZA 1CS4A 2OEMA 3Q8YA 2MQQA 3K57A 1DHMA 2XGPA 3N0VA 3A13A 3G6VA 2X1GA 1URNA 5KFZA 3EYZA 2PEHA 4DR6F 1VQSA 4HVZA 5E3AA 5LMNF 4CH7A 2KH9A 4G1QA 4CP5A 3BGOP 4WZMA 2XY7A 2EFVA 4K0KF 3S8SA 2HAIA 3JSMB 4ZVPB 3MECB 4YHHF 1X9WA 3U1LA 2HFSA 2R8JA 4LF8J 3ITHB 4LSNA 3C6TA 2CPHA 4KO0A 2IFXA 2MQNA 1D1UA 3MZIA 5KFMA 3IBCB 2K7KA 4FXVA 3CCJS 4DV4J 1S4EA 4N56A 4ZPBA 4IFVA 3F41A 3KG0A 3OR1B 1GK8A 3VALA 4C11B 4I2PA 2I1RA 1VBZA 3FBBA 2VICA 3BB5A 1F0XA 1FRLA 3AD8C 2F40A 3JSRA 1OMSA 1OPIA 2Q43A 4J5OA 4P2FA 3LP2A 1RT4A 1JQGA 2JC0A 1H7XA 2GCFA 3O5TB 2R7OA 2HPUA 4DF4A 1V5IB 1S12A 1RT5A 4WFXA 4JV0A 1U1KA 4PQAA 4I6AA 3MOJB 1UVNA 2C22A 1RKIA 3MR5A 3V4MA 2CDQA 2CPDA 3ZZUA 5KG7A 5M2UA 2CWKA 1VQ5S 3MEGA 2BXJA 1G7CB 2VF3A 4HEA9 3I82A 1JLCA 2IBOA 3M8WA 1QLNA 3UQSA 4A8WA 4C0BA 3T41A 2W2QP 3MMBA 2HSEB 3DOKB 4J9NA 2FLLA 1FFSB 3ICLA 3BO4A 2B3TB 1S0OA 2GVDA 2GQQA 4Y2CA 2WB1D 3DRXA 4C3KA 3VAHA 5C24A 2I8EA 1H74A 3GR0A 3R9LA 3KLFA 1Y11A 4JI5J 1HHTP 4PAAA 4JI4F 3SCJE 1MLAA 3N5BA 2VOOA 2OPRA 5F8LA 4DEZA 3KXDA 5A6PA 4CH1A 2Y0BB 3BF4A 3ZNUA 4B9NA 4OZ2A 4DSJA 4M5MA 3UE2A 2HRUA 2L41A 2EK1A 4F0HA 3GFZA 2XWYA 3GSDA 4I68A 2E1AA 1J5EJ 1TUWA 1KQFB 3O8WA 2HNYB 4G1IA 1ZPWX 2LEPA 2RAQA 4OX8A 5DGBA 3D6FB 4NASA 3NGKA 2IJNA 3WC0A 2MKHA 1G1XA 4LF1A 4R0EA 4EO6A 5CABA 3KYLA 1IBKJ 3S7RA 4K8RA 1K0VA 1XNRF 2UVUA 4FYXB 3DFEA 3G82A 5A8WB 3CD0A 4RW6B 3HHLD 4DR2J 1KTVA 4DFKA 2CWXA 3B8HA 3DMJA 3KLHA 2F1FA 1T7PA 1U25A 2M52A 4JI3F 1HW8A 2C3UA 3I96A 1X4HA 5L39A 4URQU 3K89A 3KFWX 4DPUA 2B0GA 2V0NA 5DZ6A 1PAEX 4K2XA 5RUBA 5F8MA 3UVJB 2BVZA 2BYCA 2P8IA 1XMBA 5DRKA 2QEXS 4PZVA 1V9OA 3TAQA 4WFBQ 1TL3A 5L9NA 4LF5F 2LKZA 3CMES 2EFPA 4KGKA 1T05B 3DLEA 3G8SA 2FPHX 1FDDA 2IYGA 4ED0A 1SUQA 5HMYA 4IOCQ 2KM8B 2HHHJ 1QE1B 1JXVA 1UA0A 4NYPA 1U1OA 1CJVB 4JI2F 1NH7A 1RBAA 5J1EA 4QIVA 3FBEA 3IM9A 2B9XA 2B8QA 1BLUA 2GVZA 3AXKA 3W62A 5KFHA 1RAEB 4XIUA 3RB6A 3B82A 1NLKL 4PR6A 2BV3A 3ISND 2ZH7A 1NJXA 3U27A 3PACA 1SBRA 2AKWB 1BXNA 3I9ZA 4IH5A 2C2KB 3UPFA 4MK8A 2F7VA 5I4MA 1AUDA 3T1HF 4J9QA 3Q22A 4WYWA 4P10A 2BDPA 5G4DA 1SJRA 3KLIB 3DOMA 2C2MB 5KFFA 4PQUA 3SCKE 3NEKA 1NRKA 1NUEA 5KFPA 4ITSA 3OL9A 5GMEA 3V5RA 2HGNA 2XYGB 3O3LA 1HW9A 1DLOA 5B09A 5CAAA 1H98A 1HHQA 3MI7X 4BHQA 2KG0A 1DBDA 3VAFA 3VVTA 1YTYA 2VPWB 3TQEA 1F5AA 1IKXB 4JI6F 3NS5A 5C2CA 1WI6A 1SQGA 1S1VA 3HJFA 1IQTA 4ECTA 3HVRA 1RAHB 5E5NA 3U1MA 3HT3A 1EX8A 3R3TA 3ILIA 3SI8A 1S79A 2L08A 3FFIA 2LYVA 3R97A 1BUXA 3M8YA 2GZOA 3RB3A 1H0HB 5KFVA 2AWZA 4KPYA 5ETMA 1U2FA 2MLYA 1HMVA 3TYTA 2FVQA 2BJDA 1M90T 1WEZA 1U1LA 4OHVA 2CUYA 3F0NA 1VIOA 3QLHB 4ICLA 5IV3A 2DHHA 5KFDA 2CPEA 7FDRA 2E9TA 3EWGA 1RUSA 2WVCA 2Q79A 2BM1A 2W24A 3OFFA 4ZLLA 1JKHB 3W60A 5K14B 3R7BB 4ZCLA 3PRDA 5IM0A 3MR3A 3KDOA 4CLFA 3RBEA 1D8YA 2BJEA 5KG1A 3H0PA 1UVMA 2V4JB 2UXDJ 1YJVA 4EO8A 2HW3A 3TARA 4AD6A 1X4AA 3BGLA 3KDNA 1S49A 3VAIA 3BR8A 4HYKA 3FMWA 3BO3A 2J7WA 2V2ZA 3NS6A 1H2VZ 1AFIA 3MAAB 4QIGA 1URRA 1UEVA 2ZH8A 1S9EB 1HQ2A 1FVSA 3ETMA 4FDFA 1S0VA 2BZ2A 4OHYA 2QTWA 2CPFA 3HX9A 1DQ8A 1KNZA 3DRSB 1EKSA 4DR5J 1WDTA 5DG9A 1GXTA 3QT6A 3HPOA 4LSLA 3UDLA 4RU2A 2Y3YA 4MAKA 2UXBF 2GFFA 3DI6A 2Y0SD 3BN7A 3HXMA 1I3OB 4NXMJ 3H7HB 1S1WA 4X84A 1SJ3P 1FEHA 2ZVIA 4DUYJ 3U02A 2B4UA 3QYYA 3HD2A 2ADBA 2QMUB 1Q8KA 4HI2A 2FC8A 3RAXA 2CIMA 3OVSA 4RUCA 1RTDB 3M2UB 2MZQA 4QU7A 1XC9A 3JAMY 1XR6A 4V19X 4OMFG 1D9DA 1H2TZ 1YRUA 2OSRA 2JX2A 4MMOA 1LWEB 4YB6A 1NK0A 4LRFA 2VFSA 4USKA 4WTOB 4ECQA 1GQEA 2C2EA 5HBMA 3DLKA 1UEKA 1M5SA 5DLFA 1ICEB 4J9SA 3V6KA 1IKWB 3ZFVA 4C98A 2QLWA 4C8LA 4KHMA 4WE1A 3KJVA 3V2UC 2HK3A 2O1PA 4LFBJ 3I9V9 3TNVA 2DCLA 3SBMA 4QW9A 3THTA 2PT0A 3TZYA 3SDEA 3ZZ0A 5JJBA 3MFHA 4UUXA 2O3DA 3RRHA 2MGZA 4PWDB 1FWKA 4F2SA 2ZNYA 4NXNF 1X4CA 3HO1A 2RQ4A 2M88A 1HQEB 5LSRA 3GCXP 3T5KA 1N32F 4LREA 4HHUA 3W2WB 2CNOB 4PXDA 1UJ4A 4MIAA 5B0BA 1TKXA 1X31C 3QMQA 3HHLC 4F26A 3KK3B 4I1TA 4ID5A 2G2OA 3T5JA 3TWZA 3QJPA 4I0WA 4MFBB 1DAXA 4J7CA 1HBOA 1R8CA 3UNYA 3QSIA 2I6WA 1FERA 2M2BA 2A6OA 2R7UA 1QD1A 2I5JA 4IUFA 3CDAA 4PXBA 4TQRA 3L7UA 3HCXA 4GC7A 4NCGA 4RW4B 1AB8A 4ALZA 1JLEB 4ED8A 2FDNA 3S01A 2LFVA 2JLFA 4F36A 4ILLA 2W2PP 2XHWA 2FHMA 3N9UC 2BRKA 5GAHU 2PFDA 1DTTB 1KR4A 1B70B 3U7JA 1UVLA 5AJ3F 3T1YJ 1I94F 4DL3A 5ETNA 3TUPA 4OYXA 3K5MA 2ILYA 2CXEA 5CYQA 4F50A 3BYPA 4UOCA 2CPZA 3EPIA 4IG0A 4LF9F 1N33F 3ISNC 3LP1B 3CDEA 4ES3A 1LK7A 4E2FB 1TL4A 4DBQA 3CIMA 1VGYA 4C2MA 1GAOA 3AOCA 4NPOA 1KLNA 4YDXA 2BQ3A 5JXSA 3GB0A 1UPPA 1YITS 2YKNB 1TAUA 5KFUA 3VR1A 1HPZA 4NLQA 5KG6A 1FKOA 3IS9B 3TZXA 2Q66A 4X66J 1BQNB 3GIKA 2CQIA 4CLSA 2A2CA 1NO8A 2XMTA 3CD6S 1S59A 3EJMA 1FWLA 2V63A 3H42A 3AQOA 4FF1A 1Z1ZA 3HZEA 2LXFA 3IG1B 1HNIA 5J1NA 4PKDB 3OR2B 2QV6A 4I64A 2U1AA 4NLSA 4M5DA 4LFAF 2IRYA 3IAM9 5L46A 4CCHA 1UFKA 4KY3A 2AGPA 4DUTA 3KK1A 4OZ5A 1EQ0A 4ED5A 2AX1A 5D0GA 4FYYB 3W5ZA 3A8JA 4NA1A 3M05A 1F3VA 5GMDA 4DPYA 4KH1B 3HDSA 4PYDA 2HVHA 2HLTA 4WKRA 4DS5A 2BW2A 2LDIA 1HKAA 2DIUA 4ELUA 1NM2A 1A6LA 2KFNA 1D9AA 4J9MA 2WBRA 1A7GE 4CLPA 3LALA 2QLXA 3M7VA 3I4HX 2HHSA 4OYOA 2IM3A 3TAMA 4NLUA 2K2PA 1P1LA 2V8VA 5ETKA 3GJRB 1SXLA 3HF5A 4RWXA 5DGAA 2C2OB 1RHQB 2DGUA 3CDUA 4DV1J 1IR1A 5J2MB 2RNEA 3EGZA 1QDUB 2RQCA 4LBPA 1ZYQA 3HKWA 4Y3CA 2ZHAA 1YBTA 2Z4PA 3DRYA 3J7YU 2QA4S 4FNHA 2AYBA 1HLWA 2UUAF 2DVIA 1X0FA 4B3TF 3W9HA 1MROA 2M9KA 4K4VA 4O3OA 1B64A 1FNOA 4LF2A 5FLXY 2AEFA 4H4KC 3GTYX 4NLRA 3R5JB 3BGRB 4N47A 1RDRA 2OI2A 2B9YA 2C28A 1HQUB 2UUWA 5LOQA 5AE2A 5L38A 4FBTA 3BH6B 4Y34A 4RWWA 4I67A 2VU5A 3KJQB 2HQIA 1Q5YA 3W1YC 5A0YA 2FJVA 4OYZA 3D3CJ 2VD3A 1BY9A 5I3PA 3LPEA 2VV5A 1H7WA 2M7SA 2G0IA 3T1YF 3IRXA 3HD1A 1VDHA 4Y2AA 5CZXA 4ETXA 5BXIA 4B9TA 3MFIA 1HI8A 2XSJA 3WDOA 2BEFA 1FKPA 2XGQA 2UZAA 2IDEA 3RW6A 1N5SA 2VL1A 3MPWA 4ECXA 2IJFA 1FNXH 4G65A 2ZBPA 3C15B 3BKFA 4JB8B 4OV1A 4FXWA 4WYLA 2L9NA 2RIJA 1VC0A 1WC4A 2AHOB 4TYAA 2WONA 1T9VA 1M1KT 4TU7A 3EXCX 3QJLA 2CQ1A 1AROP 4B9MA 3MM9B 4DX8H 3PHTA 5DDOC 4CM0A 2GW8A 5HANA 5E3QA 3EZ5A 1V3RA 2AJ2A 4RPFA 1RTIA 3C16A 5KT4A 1S76D 4KHRA 3H90A 2B8PA 1S9GA 3I0SB 2Y8WA 4DJBA 4K4ZA 1WHXA 2DYAA 4FKXA 4XDDA 1ZS6A 1FO1A 1TVRA 2DNYA 2VG5B 1FXRA 2XS5A 2AMCB 1FEEA 3GSIA 2BE2B 2H3EB 3FZBA 1P1TA 4GC6A 4P73A 1NKBA 4RW7B 5JVHQ 2PD1A 2DNQA 1YBUA 2OJ3A 3BSOA 3SQGA 4YOEA 2CPXA 1KFSA 3OFGA 5L1KA 2RKIB 1ZA2B 1BWEA 3UI3A 3W64A 1NK7A 4Q7AA 3PKMA 2YWEA 1CULA 2HWHA 3FSYA 2WW4A 4FS2A 2RS8A 2XCPA 3NOCA 4LIWA 1B99A 1X4DA 4YP3A 2BJ3A 4K4YA 2JOQA 5D4LA 2X1BA 4X4UA 4ELVA 1U02A 3ZZRA 1UEUA 5K8NA 3MCSA 2OO4A 5FDLB 4X62F 4ECUA 3BSNA 2R3VA 2B5JB 2VBXA 4F4WA 2ZJQQ 1M5OC 2DXEA 3H8YA 4Q5VA 2K3KA 4O4GA 4OYBA 3Q8UA 3VQSA 1U1QA 1PKUA 1TU0B 2BE7D 5AE3A 2UUBF 4B3SJ 1EAYC 4ZP7A 2VC1A 2HHXA 3FUYA 1GXLA 1HWKA 2LQ8A 4DS4A 4DV7J 3ZTRA 2YKMB 4M95A 1GX6A 2V94A 3EVMA 4WXOA 1JLAB 2ZH1A 1S1XB 3DN9A 5KFXA 3R5DA 2U2FA 1HNVA 4JV2A 2JWNA 2CQ4A 1RYRA 1B0VA 4ES1A 1JB0C 3V4IB 3N6MA 3TVZA 1U48A 4ZPCA 1OJ4A 2ZOMA 4LBHA 2F4VF 1VQ7S 4MJKA 4K4UA 4DFJA 4K4WA 2VJVA 3DKDA 3V81B 2ZFHA 1R0CB 5KFOA 3RW7A 4A47A 2ZH6A 4Q0BA 3I87A 4ZLNA 3CCWA 4C9DA 1B0TA 3D1QA 2MY8A 3KLEA 1XJWB 2EFGA 1FXLA 4NLVA 4QCLA 2WVEA 4BC7A 3NNCA 4YQWA 2JHEA 2DEIA 1W2BR 3A4TA 3PW4A 1RLDA 3BN4A 4LRCA 2KYXA 3NMRA 2YBVA 2DH7A 2ZWPA 2ZHOA 1F9HA 4DV6J 3KUHA 5EN1A 3QQCD 4HT5A 1HBNB 8AT1B 1F9FA 2HGMA 5IWAF 2ZOFA 3ELHA 1FRJA 4IDKB 1NB7A 4B3MJ 4GKKJ 2E5HA 4EUVA 3EMTA 3RAMA 3RBDA 4CM2A 3MM8A 1RQ0A 2FB0A 3TEGA 4LFCJ 4F7VA 3GR1A 2IA6A 4NLOA 4P74A 4URSA 5G0RA 2HMIA 2O5DA 1EHWA 1M0SA 4KGZB 4A48A 2MQMA 3H25A 3BBFA 1FK9A 5C7PA 2FQQB 4X4RA 3I31A 1LW0B 3OFEA 3G96A 3DLJA 4UTGA 4GKJJ 3FKBA 3I55S 4ZPVR 2XEXA 4E0DA 3R2DJ 1HNWJ 1DJ0A 1UWBA 2PDAA 2G0JA 5GAGU 3DLGA 1XNQJ 1B7FA 2GHWA 2ACYA 1M1HA 1CS4B 3DDKA 3C6UA 1YJNS 1IM6A 3N6LA 1Z2ZA 3PVXA 1VQKS 4MKYA 4JV5J 2D9OA 2RT3A 1MWYA 1Q4RA 4ED1A 1FDBA 4G1QB 4XPEA 3DXSX 3CJ3A 4YY3F 3G8QA 3AY0A 1WHYA 2DNMA 3WBZA 1C1BA 1NK9A 2DNNA 4NRUA 2X3GA 1Q86T 4LSNB 3DHXA 3C6TB 2ACMA 4KO0B 4OZLA 1NK4A 1OIAA 2FHKA 4OI0A 3JTNA 4USHA 2R7VA 4DFPA 5F8HA 2MHNA 5KT3A 2F8HA 4IFVB 4KFBA 3AH6A 1JKHA 2HIYA 5HJYA 2H4YB 5J2PA 2HFOA 4I2PB 1Y9OA 3NCPA 1VJQA 5D3GA 2YWKA 1S1TA 2MB0B 3TR5A 4ZJLA 2OEKA 3HVWA 3FEXB 4OYPA 2UP1A 3BDEA 3LP2B 1RT4B 2CNKB 4KHPJ 4ZPWR 4J9VA 3VQTA 4DX6A 2MXYA 2ZHBA 1WNEA 1RT5B 2DHGA 4DV5J 2KXFA 1U1NA 4N8NA 2CQGA 1T9XA 5F8NA 3UCUP 1WJ9A 2CJBA 1Q81T 5LMUJ 2CNNB 4KAIA 1IUJA 1RWNB 2BUNA 2EG2A 1TMMA 4LF6F 3DHWC 3OSNA 3T5HA 2DIVA 2YY3A 3G2XA 1JLCB 3OVAA 5BJRA 3WHIA 2KT5A 3L09A 3NG8A 3M1VA 3GIIA 3VGSA 1RU1A 1SQFA 1VMBA 3HHKA 3PX6A 3MMBB 5AXNA 5KFKA 3NWRA 2FLNA 3PV8A 3E01A 1AA1B 4JP8A 2NYHA 5KOXA 4F3MA 4CLZA 2GVDB 3Q23A 3EZOA 1T94A 3PR4A 1N4LA 3KLFB 3M2UA 3TUIC 2VBWA 2MKIA 2OPRB 3DM2A 2VB6A 4K59A 2GS8A 2HBZB 1LWEA 1TL1A 2V9KA 1SKSA 3I5CA 4PG6A 5L1LA 2GJIA 3P5BP 1FD8A 2Y8YA 3OTEA 2UV8A 3M2VA 2HRTA 2NREA 1GEHA 4LVNP 2HHQA 4ER8A 2VFUA 4MK9A 3MD1A 2Y1IA 4L3NA 4N7TA 3NNHA 1N5QA 2ZWOA 3CCZA 3DXBA 3K5OA 3G82B 4ZKAA 2F3JA 3BH7B 1B0PA 4PWDA 4EBDA 4CO5A 4ZIWA 1ELOA 2FVCA 3CTRA 1GMWA 4B9VA 1HQEA 3DMJB 3KLHB 2R7SA 3FGVA 1YKWA 3HT0A 3W2WA 2FZKB 2H1YA 1XTZA 3LW5C 4ZLPA 3TO8A 3TJ9A 1RI7A 5J2QA 2YWHA 2DD8S 1YGYA 3GJQB 2B9EA 4RUBA 4C0OC 2G1HA 4K2JA 5HMWA 5KFYA 3NGSA 3NBPA 1WTBA 4MFBA 3C8YA 3OTOF 1TL3B 1FWPA 2VPZB 4IR1A 5F3TA 1FI4A 1HD0A 2YX1A 2XMVA 3QGPA 3MXHP 2RU9A 3ENAA 5DLGA 3DLEB
chains in the Genus database with same CATH topology
3A3PB 3A3NB 2W2NP 2ZWPA 3P5BP 3VV2B 2Z58B 2W2MP 1SCJB 4OV6A 2E1PA 2Z57B 3H42A 4YN3B 1SPBP 3WIUA 3SQOP 3GCWP 3WHIA 3BPSP 3VHQA 2Z30B 2XTJP 2ZWOA 3CNQP 3BGOP 1V5IB 2PMWA 2W2QP 2QTWA 2Z56B 3GCXP 2Z2ZA 3A3OB 3T41A 2W2PP 2Z2YB 4NMXA 4K8RA 1ITPA 3CO0P 3WIVA 1R6VA 4JP8A 4NE9C 2W2OP 3AFGA 3QFHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A3P B;  3A3N B;  2W2N P;  2ZWP A;  3P5B P;  3VV2 B;  2Z58 B;  2W2M P;  1SCJ B;  4OV6 A;  2E1P A;  2Z57 B;  3H42 A;  4YN3 B;  1SPB P;  3WIU A;  3SQO P;  3GCW P;  3WHI A;  3BPS P;  3VHQ A;  2Z30 B;  2XTJ P;  2ZWO A;  3CNQ P;  3BGO P;  1V5I B;  2PMW A;  2W2Q P;  2QTW A;  2Z56 B;  3GCX P;  2Z2Z A;  3A3O B;  3T41 A;  2W2P P;  2Z2Y B;  4NMX A;  4K8R A;  1ITP A;  3CO0 P;  3WIV A;  1R6V A;  4JP8 A;  4NE9 C;  2W2O P;  3AFG A;  3QFH A; 
#chains in the Genus database with same CATH topology
 1I1G A;  1K73 T;  1SUQ B;  2HHT A;  3HSJ A;  1S6U A;  3CT9 A;  2RML A;  5L9X A;  5J1E B;  1W7W A;  3KJN B;  5CCL A;  5H9F K;  1S57 A;  2MDA A;  1N6Q A;  2M8D B;  2HWT A;  2ZOG A;  4C8O A;  5DDP C;  3MAH A;  3CCL S;  5ETO A;  1X60 A;  4DR7 J;  4TY9 A;  1SVD A;  3Q2S C;  4WP9 A;  2E7X A;  4CQ1 A;  3ZZO A;  2DNO A;  2QA4 G;  3FQL A;  4K4T A;  3KUE A;  4WIQ A;  4G3I A;  1VRU A;  2KL8 A;  1RWX B;  2YNG A;  1VQY A;  2J0S D;  4IFY B;  5GAD U;  2KRB A;  5E2Q A;  4QYZ K;  3RZA A;  2WVB A;  1KQG B;  2GA7 A;  2OML A;  4Y65 A;  4RUH A;  3HUL A;  4W90 B;  3IAS 9;  1AW0 A;  3KG4 A;  1YJ9 S;  2A18 A;  3DOM B;  3PFE A;  4PQU B;  5T7L A;  5L1I A;  4DN0 A;  2MKY A;  4Y2M A;  3SV3 A;  2AZ1 A;  2V6A A;  3R6L B;  5DS7 A;  2VQE J;  2DHA A;  3W61 A;  4QWD A;  1DLO B;  3AA9 A;  3SEO A;  2ZM6 F;  3M6U A;  2DRD A;  4OI6 A;  3QWP A;  1RHJ B;  5KT2 A;  1TZ0 A;  1YBA A;  2C2N A;  4EEY A;  2NSC A;  2ERR A;  4WFY A;  4WXW A;  4NML A;  1S1V B;  2C1E B;  2MLZ A;  1OYD A;  5T41 A;  2A6M A;  1U1P A;  3IG1 A;  1N36 F;  2M70 A;  3OR2 A;  3FFI B;  2OGU A;  4OFZ A;  4NLY A;  2CJY B;  4DQP A;  3LOU A;  4KKO A;  4NCA A;  1TUG B;  1J27 A;  1MMN A;  2B4O A;  5DDR C;  2ZUA A;  3Q83 A;  1NAQ A;  5DQH A;  2H5I B;  3PYD A;  2AQ4 A;  1X4B A;  1HNX F;  4UOF A;  3PO4 A;  3CC7 S;  5HQL A;  1HMV B;  3M30 A;  4LR9 A;  1H2U X;  2X1A A;  4OX9 F;  2QA2 A;  1S0M A;  4M8L A;  3M6V A;  4OZ1 A;  1T0T V;  2BA9 A;  3RJM B;  3CJK A;  3PO5 A;  1X5T A;  1ITP A;  3EUN A;  4F02 A;  1X7V A;  4ECS A;  2OAU A;  5KFC A;  2W1B A;  2GO8 A;  3IO1 A;  3BGF A;  4OV6 A;  2W7A A;  2WOM A;  5IM0 B;  3ENV A;  3C14 A;  5IFM A;  1ZTW A;  5CA5 A;  2DNG A;  3EZU A;  2C2D A;  4I4B A;  2UUC J;  1RWK B;  1GNK A;  3QPI A;  2P9G A;  4NLG A;  4CLL A;  3I32 A;  3OJS A;  1SL1 A;  2B7B B;  4KB7 A;  5LL6 d;  4A4J A;  4B9L A;  1AYE A;  5HP1 A;  4DN9 A;  1CQM A;  5F3Z A;  4P9S A;  1V6H A;  2AGQ A;  1TAQ A;  5CZV A;  1A0O B;  2Z2M A;  2MQO A;  1VQ4 S;  4B17 A;  4HH1 A;  2EEY A;  4WZQ A;  2DGO A;  4LSL B;  1ZM2 A;  3CE8 A;  3W8P A;  2ZH4 A;  3DI6 B;  1U45 A;  1LWX A;  4CO1 A;  2CJ9 A;  2I9S A;  3Q89 A;  3MD3 A;  1XIQ A;  2NZC A;  1S1W B;  4CDI A;  3OTD A;  3LTO A;  5I3U B;  3BSC A;  1P8G A;  2RE1 A;  2K1R A;  4AE5 A;  3OXF A;  3DLL Q;  3B54 A;  2EPI A;  4PYA A;  5HI7 A;  2M0G B;  1TTH B;  2QFJ A;  5J1P A;  1RWO B;  2ZEJ A;  4FF3 A;  1F6T A;  2MZT A;  1SH2 A;  3LUY A;  3IMQ J;  1RJJ A;  3AFG A;  1JIH A;  2RDD A;  4JI7 J;  2ZE2 B;  2HZA A;  3OFH A;  4KC5 A;  3ET6 A;  5DQG A;  2VBY A;  4OI2 A;  2DGV A;  2V34 A;  3LO3 A;  3BPS P;  3TX8 A;  3OLB A;  3D67 A;  1G6B A;  4CO3 A;  5A8R A;  5HBM B;  3DLK B;  3R5B A;  3ETO A;  1SH0 A;  1T9W A;  1T9U A;  2J8A A;  1NHU A;  1HBM A;  2AD9 A;  2G13 A;  1R89 A;  3LA0 A;  4WE1 B;  3KJV B;  5GAE I;  4MTP A;  3H5Y A;  3AAW B;  3BQ1 A;  4J9P A;  4RKU C;  2FJW A;  1YVF A;  3AOB A;  2DPJ A;  4JI8 J;  3IWL A;  1XQI A;  4IKA A;  2GMH A;  3SDE B;  1MU2 B;  2UVV A;  3O44 A;  3NRB A;  4X4N A;  2GHP A;  1QSS A;  2MGZ B;  2YNF A;  2R4F A;  3IWX A;  3DRR A;  1X4F A;  4Q8F A;  5F9L A;  1MNE A;  2A1B A;  4C8M A;  1JLG A;  2FZG B;  4OLO A;  2GHV C;  1T3N A;  2KXH A;  2XMA A;  4RBV A;  2V68 A;  1NK8 A;  4KSE B;  1UJ6 A;  4DWI A;  2OSQ A;  1TKX B;  4AYB D;  4FZV A;  4ID5 B;  1U0H A;  3ILL A;  2JVR A;  3PIO Q;  4J9O A;  4R8U A;  4RW9 A;  3OHA A;  2ZKT A;  2KFZ A;  1IBL F;  1RT1 A;  2VG5 A;  1D09 B;  2G2Y A;  5HL7 Q;  2AYM A;  3OQ2 A;  2VAS A;  2XG8 A;  2FD2 A;  2KZM A;  4XPC A;  3NCQ A;  2VFT A;  2I5J B;  4M5J A;  2UVR A;  4AQY J;  2WBM A;  5JUM A;  2KVI A;  1NK6 A;  1S6Q A;  1XMQ F;  4NCG B;  2ALY B;  2YKO A;  4P7V A;  4OJ3 A;  1JLF A;  3D5M A;  5D0H A;  2XMU A;  2UUT A;  3UR3 C;  3EGW B;  2CZV C;  3NOG A;  3A8K A;  1FRX A;  3ZTO A;  2APO A;  1SJQ A;  1VS3 A;  2BAN B;  3D6H B;  1LKZ A;  2FYX A;  4DR4 J;  5FJ4 A;  3BQ2 A;  1Y5L B;  4W98 A;  3FCH A;  2B5J A;  3GIL A;  4IH6 A;  3H2V E;  1LXN A;  2HVD A;  3ILJ A;  5HMZ A;  2IM2 A;  5CYQ B;  3G8T A;  2WSC C;  1SC3 B;  3QZ8 A;  4IG0 B;  2QSW A;  4DSI A;  3J81 j;  1WHW A;  3GP9 A;  3R27 A;  2X51 A;  2RD5 C;  2FZC B;  3JQK A;  3I0R A;  1RA7 A;  3MMC A;  2K06 A;  4V1A k;  1WEY A;  1ZM3 A;  4GO5 X;  1MML A;  4WJB A;  1UZD A;  1C1C A;  4M63 A;  3QT5 A;  4NEZ A;  1RTH A;  1JLA A;  1HPZ B;  2H4W B;  2R8I A;  1FKO B;  3CJS A;  1OS5 A;  2W4P A;  4ZP8 A;  3BJY A;  3KHL A;  4I2Q A;  1YZ7 A;  1IBM F;  1CC8 A;  1KN6 A;  4ZVF A;  2LLZ A;  1HNI B;  1F9E B;  5I3Q A;  3PZP A;  4DPW A;  2MST A;  2BE9 B;  2DJW A;  4M5D B;  1GMU A;  3L9Z A;  2MZJ A;  4IYQ A;  1KS2 A;  1KKH A;  3GJS B;  3TVK A;  2F5G A;  2PSZ A;  3TUZ C;  3PIP Q;  1Q95 G;  3IC1 A;  1F5B A;  2FJD B;  5AT1 B;  1EB0 A;  2DNR A;  3NNA A;  3PNI A;  2Z2Z A;  3TVY A;  4RNM A;  3R5C A;  5E41 A;  5IQ6 A;  4DV2 F;  3FQK A;  3CUL A;  1K44 A;  5JMN A;  5KFW A;  3QWU A;  1U7L A;  1HBN A;  2WHO A;  1CSJ A;  1OSD A;  2AEJ A;  1LEO A;  1KHW A;  1HFE L;  1XER A;  3DLB A;  2OH2 A;  2IJR A;  3O1L A;  1N0U A;  2QT7 A;  3TAM B;  1FES A;  4LF7 F;  3C3L A;  2P6T A;  4H4O A;  1VYA A;  1TR0 A;  1FJC A;  3N5F A;  2WRM A;  1CLF A;  2OEJ A;  1VC5 A;  4LUB A;  1YIJ S;  3H5S A;  2X7I A;  1UW4 A;  3ZZY A;  4GRS A;  1VHF A;  1UVK A;  1YQH A;  4DU8 A;  3TX0 A;  4LQ9 A;  1Q5V A;  3CDB A;  3VGV A;  2N4D A;  2OFG X;  2E1C A;  1YJR A;  2V8H A;  3KKF A;  1IQZ A;  1PBA A;  3J7A N;  3FBC A;  1VRQ C;  4WKY A;  4P6Q A;  4MK7 A;  4JYA F;  1KVI A;  1RP5 A;  1CBK A;  3N4W A;  1LXJ A;  3D0G E;  3A12 A;  2D3U A;  2F63 A;  2ZH5 A;  4LVO P;  2MHE A;  4LJM A;  5DQI A;  4PUO A;  3CJ4 A;  1ZM9 A;  2VG7 A;  2I38 A;  4KBI A;  3D6M B;  5CYJ A;  2E5L J;  4DQQ A;  1NSK L;  1X5P A;  3OVB A;  2YWW A;  5HQM A;  2E5J A;  4HT7 A;  5GVQ A;  5BYQ A;  4ZJO A;  3U1N A;  4OHW A;  3M8Z A;  4Y00 A;  5A0Y B;  1YLX A;  3AA8 A;  4NOH A;  2ASY A;  3GV8 B;  2COL A;  2HVE A;  2V2V A;  5A6W A;  4DCO B;  2BRL A;  5B0C A;  4C97 A;  1T9Y A;  2YWG A;  1M5V C;  4ZHR A;  5HAT A;  3CCT A;  2NCK L;  3IRX B;  4DUZ F;  2QC3 A;  1WTF A;  1WC0 A;  1S6O A;  5CHC B;  3BBC A;  2XSJ B;  4OYI A;  3GWC A;  1FKP B;  1LW2 A;  2CKW A;  3QRP A;  4OQJ A;  2HNZ A;  4O44 A;  1I5O B;  1ZH5 A;  1JWW A;  4X2B A;  4EK2 A;  3IGN A;  3ISZ A;  2MYF A;  3BPD A;  4C7Q A;  4YUD A;  4QU6 A;  1PG5 B;  4F4A A;  5HO4 A;  4MKV A;  2ASJ A;  3M32 A;  4UUW A;  2VQF J;  1J2V A;  3K0J A;  3CVK A;  3D1H A;  4FVM A;  2LXI A;  4ZCI A;  2WON B;  2PI5 A;  4CO0 A;  2LDY A;  3MUT P;  1H73 A;  1KOH A;  1RXO B;  5B7W A;  2C42 A;  3LAM A;  2XY5 A;  3KTQ A;  1IN0 A;  4F4Z A;  1U24 A;  5CD4 A;  3MMA B;  3X3U A;  1CQN A;  1JJ4 A;  1KWM A;  2CG4 A;  1KVJ A;  1KON A;  3ZC4 A;  1RTI B;  3SYZ A;  4CT8 A;  3LAK A;  3C16 B;  4ZK7 M;  2HFU A;  5LJ3 Y;  1U4B A;  1RCX B;  2W7P A;  1S9G B;  3NP5 A;  2WB4 A;  3BYR A;  2HHV A;  3MM5 A;  3UD3 P;  4YR3 A;  3KLV A;  2DGW A;  3MCN A;  1IVZ A;  1RBL A;  1TVR B;  2HG4 A;  1YX2 A;  3UFC X;  2J9D A;  1RHK B;  1WSR A;  2E44 A;  3TA0 A;  1U2R A;  4ZLJ A;  1DFD A;  1QY7 A;  2EVZ A;  4OHZ A;  4OYM A;  2P2C B;  1SC4 B;  4FXD A;  2CQC A;  1NXI A;  2FHJ D;  1BMQ B;  4WII A;  3SQG B;  1JJC B;  3JTP A;  3HHL A;  5LM7 E;  3MCM A;  2XQC A;  2R8H A;  3OL6 A;  4JI1 J;  2VOD A;  5LSO A;  3M9O B;  3MGJ A;  1VQM S;  1KBR A;  3FNN A;  1HNZ J;  2F8M A;  1CUL B;  4ZVH A;  2BJ1 A;  1VOM A;  4NI2 A;  4UST A;  2RUS A;  3MCO A;  1U1R A;  4L72 B;  1GT8 A;  4YR0 A;  3NMA A;  1R8B A;  2VH7 A;  3MTJ A;  3MPV A;  1FJG F;  4P71 A;  4F0M A;  2L3M A;  2PC6 A;  5K9F A;  1VFJ A;  2KFY A;  1AUS L;  4PPD A;  1FDN A;  2BKP A;  4B3R F;  4IG3 B;  1OQ6 A;  1RGV A;  3RR7 A;  1Y5N B;  1QVF R;  4O4G B;  2AJ4 A;  3EGN A;  4ZIV A;  3NXZ A;  2I2Y A;  1Q0N A;  5IT4 A;  4PRF A;  4DL4 A;  4JI0 F;  4L3K A;  2YPZ A;  3P5T L;  4CLW A;  2OPP A;  2R7Q A;  5HQ8 A;  3HVT B;  2DR9 A;  4WU3 A;  3ZZZ A;  2CJA A;  3UN5 A;  3DOL B;  1UA1 A;  2FVS A;  4EYI B;  1DQA A;  1HNV B;  4AL6 A;  1T11 A;  2CJX B;  1SC1 B;  2ASL A;  2QRR A;  1HR0 J;  1TK5 A;  3T3F A;  4LF8 F;  4DR1 J;  2K8G A;  3EDR B;  1IBC B;  4FYD A;  3QRQ A;  2ZH9 A;  1MG7 A;  4DMZ A;  1YK9 A;  4QWA A;  4DV4 F;  2FVP A;  1R8P A;  2D3Z A;  3GFY A;  4PCQ A;  1YRX A;  3CMQ A;  4Q44 A;  4Q0B B;  3KLE B;  4BLG A;  3D0H E;  2ROE A;  4DL0 C;  2DIS A;  2MZR A;  1NHV A;  1KLM B;  4R5P A;  4TNO A;  2AW0 A;  2GMJ A;  5THW A;  2VZ9 A;  2B4V A;  3VZH A;  1UZH A;  1NPP A;  2VQF F;  3PW7 A;  2XUL A;  2DNL A;  4TKT A;  2KM8 C;  2VHG A;  3VHQ A;  4IFY A;  5AXL A;  3NGU A;  4FPR A;  3GIJ A;  2B4P A;  1RKJ A;  2N3O A;  1O8B A;  1ZTT A;  3BR9 A;  5F9N A;  3BEG B;  2H51 B;  2E1R A;  5CXT A;  4DQI A;  2Z58 B;  3MM8 B;  3KK2 A;  2GNK A;  1Z2L A;  1TV6 B;  1KFD A;  1FJ7 A;  1F2G A;  2HVZ A;  1S48 A;  3UCG A;  2QSF A;  5G0R B;  2HMI B;  2RDI A;  3M8Q A;  2CA9 A;  4TY8 A;  4ED3 A;  1FK9 B;  2XO7 A;  1FFG B;  3MHY A;  4H4M A;  4ZMM A;  1C0U B;  2EC2 A;  2VA2 A;  4LR7 A;  3GFH A;  1CJU A;  2V69 A;  3K59 A;  1VQN S;  5D15 A;  2R2U A;  1NKC A;  5F8I A;  4JI5 F;  4X65 J;  3EX7 B;  2BOA A;  3FVY A;  3TQ1 A;  2ZZM A;  1UWB B;  3VAM A;  2FY8 A;  3DLG B;  3BKT A;  4TLQ A;  3QT8 A;  4QIF A;  2JEF A;  3JYT A;  3AJ2 A;  3C6U B;  1N5T A;  1Z4U A;  2HQC A;  2ZDO A;  3GQC A;  1WDD A;  1S4F A;  1Q53 A;  4LIR A;  2BR0 A;  3KOA A;  3I4P A;  3W9J A;  4ZDN A;  1J5E F;  4Y2K A;  4IH7 A;  3TZW A;  5T14 A;  3QJJ A;  1OY9 A;  5U47 A;  1H72 C;  5MAO A;  2BBE A;  1C1B B;  5SUH A;  2WSF C;  2DR5 A;  1N8R T;  1FF2 A;  4ANC A;  4H4K A;  3W63 A;  4YN3 B;  4X4Q A;  1WAC A;  1E6V A;  4DR3 J;  1S10 A;  3IR6 B;  1Y5I B;  1IBK F;  1KDN A;  2AF6 A;  1RT7 A;  1MN9 A;  1RAG B;  3HLU A;  3M6X A;  2RRA A;  4QPX A;  4KFB B;  4OIX A;  2JL9 A;  3R8Y A;  2DNH A;  2D3O 1;  4DR2 F;  1QAI A;  2F9J A;  4J9U E;  5J2P B;  1IR0 A;  4MKB A;  3WIV A;  5D3G B;  2LEC A;  2HRY A;  1S1T B;  2WK4 A;  1R6V A;  1JLQ A;  4LRB A;  4CWB A;  3WZ0 A;  3I5A A;  1SJ4 P;  1NZ8 A;  4DQS A;  1SJF A;  3PX0 A;  3CJ5 A;  3UN2 A;  5EWF A;  2CPI A;  2DO4 A;  4ZVO B;  1CPZ A;  2NUU G;  2QLB B;  5CQG A;  3EIC A;  1YI2 S;  3MAQ A;  3HSZ A;  3MPU B;  4UQG A;  1WKK A;  1Y0H A;  5HK4 A;  1F60 B;  4UW2 A;  3K7R A;  4U96 A;  2MJN A;  1VQ6 S;  3ZZT A;  2DR7 A;  1HWL A;  3K8V A;  3HSD A;  2LA4 A;  3SSR A;  4ZPT R;  3OTC A;  5KT6 A;  2RF2 A;  4CRJ A;  2J5A A;  2DY9 A;  3LGH A;  3D6T B;  2HHH F;  1HA1 A;  3C46 A;  3M1V B;  4PWW A;  1JNR B;  1JNZ B;  5I3U A;  3E2E A;  5H9E J;  1SI9 A;  2UU9 J;  3E01 B;  2W9B A;  4DV0 J;  1PJ7 A;  2EFO A;  4IOB A;  2BKN A;  4NZ0 A;  2O67 A;  3GV7 B;  2YH1 A;  1N34 J;  1RAJ A;  3E3X A;  1B7Y B;  2LCW A;  2JNJ A;  2PGC A;  2NXU A;  4XO0 A;  4C0H A;  3TA2 A;  5HAO A;  5L1J A;  2ZE2 A;  4LF4 J;  3UWT A;  3DM2 B;  2E7W A;  4NLX A;  4X4O A;  3HHN B;  4X64 J;  2F9D A;  3L4B C;  1APS A;  2FGC A;  4EZ9 A;  1TL1 B;  4ENO A;  3CCE S;  1LWF A;  2FY1 A;  3LF0 A;  1ZAW A;  1OQ3 A;  4NWB A;  4GVL A;  4NZ6 A;  3EE3 A;  1P9Y A;  2NYI A;  2HBR B;  1U47 A;  3M2V B;  4HL9 A;  2J7K A;  3SSS A;  2VDH A;  1WEL A;  1WKL A;  4CI0 B;  4QR2 A;  1NND A;  1FRK A;  5E33 A;  4NLW A;  2XBP A;  1MU2 A;  3K8W A;  5BR8 J;  2AU0 A;  2KHC A;  4DV3 J;  3L7O A;  2GX8 A;  2KT3 A;  2R2R A;  2XZD B;  1ZET A;  4PG4 A;  4USM A;  4WF9 Q;  4IQX A;  2RHS B;  5B0E A;  1U8W A;  2OPS A;  3RGI A;  2C3Y A;  4C8Y A;  2AYG A;  4CIO A;  5J2Q B;  3PJX A;  1SL2 A;  1QTN B;  4PPZ A;  3RB0 A;  1I6J A;  3B4M A;  3KWM A;  2OP5 A;  3H2L A;  3HK2 A;  1LFP A;  4ZS6 A;  2FC9 A;  3NBP B;  2YNH B;  1VR6 A;  4DR6 J;  4ZOS A;  3UN3 A;  5LMN J;  2HWI A;  3GIR A;  2LQ5 A;  3K5L A;  3BZQ A;  2EG1 A;  2CQ0 A;  1HD1 A;  2BM0 A;  3VCD A;  4K0K J;  1FNM A;  1YWX A;  3R2C J;  1WWH A;  3K5P A;  4USI A;  1KQS R;  1XMO J;  1NDP A;  4AL5 A;  4YHH J;  1N52 B;  1L5U A;  3DU5 A;  2IAJ A;  2DR6 A;  2XB2 D;  4B9U A;  1JJH A;  2XLJ A;  2Y1J A;  1S77 D;  4F8R A;  4NYZ A;  3QAT A;  4FBU A;  4YEA A;  5SZT A;  2DR8 A;  3PRV A;  2P6S A;  3RRG A;  4A8M P;  2MZ1 A;  1N6Q B;  3VGT A;  2UXD F;  3CCQ S;  3CO9 A;  3T5L A;  3D9B A;  4BCA A;  1XWL A;  2AEM A;  3EM1 A;  1JXE A;  3QID A;  1VQO S;  1S0N A;  1JK9 B;  1HWI A;  2DT9 A;  4BC9 A;  2BAN A;  5F41 A;  4DG1 A;  4HHH A;  1RIS A;  1VK8 A;  4NE9 C;  2A10 A;  4USJ C;  1VRU B;  2YNG B;  3OXL A;  2HQD A;  2HZV A;  3P8B B;  3CNQ P;  1Y3K A;  3A3O B;  3H59 A;  2CPJ A;  4TQS A;  4Y28 C;  2ATL A;  4DR5 F;  2HFN A;  3NKY A;  5T7L B;  2UVW A;  1Y7P A;  3MEK A;  2XS7 A;  2PEB A;  2RSQ A;  3CSK A;  1RB0 A;  3UD5 A;  3SIP B;  1N56 A;  4NXM F;  2GGP A;  4UY8 5;  4M5K A;  2BW7 A;  2V2K A;  4DUY F;  2P5V A;  3PFO A;  1RU2 A;  4ECR A;  4Q43 A;  1ULR A;  2CJQ A;  3KNA A;  5HVG A;  2QG9 B;  3PJ9 A;  1LOU A;  3RUB L;  3RRK A;  3CW2 C;  2Z8Q A;  1FX4 A;  2WVD A;  2RS2 A;  3PYE A;  2OKQ A;  4HAC A;  3CCR S;  4QR0 A;  5BYR A;  3CJQ A;  5CCM A;  3HJV A;  2JLE A;  4CLU A;  3LAN A;  3HFK A;  1FE0 A;  4PG7 A;  5AXK A;  3D3B J;  3PW2 A;  4JI4 J;  4KKO B;  3OBI A;  4A8S A;  3DC2 A;  3PEJ A;  2H65 B;  2LP4 A;  5IC4 B;  3AD9 C;  4CLT A;  1VIS A;  2YXL A;  5EX3 A;  4QYZ J;  2AX0 A;  3M30 B;  3QGG A;  2XYP B;  3GIM A;  4QJV A;  3M8P A;  2XNQ A;  3QT7 A;  1NSQ A;  1RT6 A;  2HND B;  5M2R A;  2HQF A;  3J7Z T;  4LFB F;  1NB2 A;  2ZD1 A;  2HGL A;  2VPX B;  3CJK B;  4UF4 A;  1VCT A;  2XM3 A;  3HM9 A;  2EBG A;  5D6G A;  2QIF A;  1T9T A;  2VC0 A;  2NPF A;  1HYS B;  4CO4 A;  2WOM B;  3W9I A;  5DZ7 A;  3Q8P B;  4HDH A;  2ZUG A;  3BGU A;  3MPY A;  3FBF A;  2SXL A;  1XNR J;  3C14 B;  4LT6 A;  2ZC4 A;  4HI1 A;  4ZA1 A;  4BWM A;  2DGT A;  4PG5 A;  2ZNZ A;  1W25 A;  3PDN A;  3E51 A;  5KT5 A;  5ETP A;  3GCW P;  5LSL A;  1UWA A;  5M2P A;  3MUR P;  4JI3 J;  1IJE B;  3V6J A;  3A3P B;  5HP1 B;  2KJV A;  2HHU A;  1BE4 A;  3MDF A;  1VBK A;  5HRO A;  4ED2 A;  3Q0A A;  4C3L A;  5I42 A;  2NQP A;  3I5B A;  2W9C A;  2WTF A;  3CCM S;  4W4M A;  1XMO F;  3Q86 A;  1TKZ A;  4J9R A;  1TFW A;  2QGF B;  5CD4 H;  3VGU A;  4KGX B;  5AXM A;  4LF5 J;  4WK3 A;  4TLR A;  1FX2 A;  1FTR A;  6AT1 B;  2K1R B;  3H2U B;  1OWX A;  2IRU A;  2LA6 A;  2DGS A;  2GJ2 A;  4I6W A;  4JI2 J;  2CFX A;  2E9Z A;  1RSC A;  1JMT A;  1YZ6 A;  5ETV A;  4ANE A;  2DXD A;  1QTM A;  4XAK A;  1RAD B;  3ET6 B;  2AV5 A;  4IO9 Q;  3AXM A;  3PKY A;  3QGH A;  4ELT A;  3KLG A;  4F4X A;  3CUN A;  2R2T A;  2PMW A;  4Y0F A;  5A8R B;  2AJ0 A;  1IKY A;  2O66 A;  4RBU A;  3A3N B;  2JSX A;  4LR8 A;  2XI3 A;  4F3O A;  1H6K X;  3ULH A;  2D9P A;  2CQH A;  1HBM B;  4L73 A;  1JLB A;  5KAK A;  4ZPA A;  3T1H J;  1LFW A;  1PCA A;  1IKV A;  4I69 A;  3PXG a;  4E8U A;  4PG8 A;  3C2P A;  4IQM A;  2FHO B;  4NLP A;  1GMV A;  4ERD A;  1HBU A;  2KN4 A;  3VWS A;  2XZW A;  5D0R A;  2C3M A;  4OZJ A;  2PI4 A;  2JEJ A;  3QBC A;  4CT9 A;  3OUY B;  2G9O A;  3KNG A;  3J7A 1;  1SKR A;  1NZA A;  4X66 F;  3CC2 S;  4DFM A;  2YNF B;  4NRT A;  3TRG A;  5BYS A;  3DRR B;  3NY0 A;  4FNI A;  3W66 A;  4JI6 J;  3HFZ B;  3FDS A;  2Y9H A;  2OPQ A;  4YR2 A;  1JLG B;  2DHS A;  4N5S A;  3MED A;  3MMA A;  2QL7 B;  4NMX A;  4J91 A;  2NUH A;  4OJ1 A;  1WC1 A;  1UW9 A;  2GAG C;  3GJT B;  1VRT A;  1EP4 A;  3EVO A;  1NBE B;  1C4C A;  2YKQ A;  2EK6 A;  4P52 A;  4ZN1 A;  1WF1 A;  5EWG A;  1U0H B;  4F0K A;  4EBC A;  2KG1 A;  2HHP A;  2NR0 A;  4R8U B;  4RW9 B;  1S1U B;  5KFG A;  1RT1 B;  1JXL A;  4JUZ A;  2FLO A;  3T9Z A;  2ZZT A;  2GQ2 A;  2G1D A;  2QL9 B;  2HIQ A;  4WCE Q;  1X4G A;  3QIP B;  3NS7 B;  2CZ9 A;  3H4D A;  1OY6 A;  1S6Q B;  4UQT A;  1JLF B;  4Y6I A;  2J6T A;  1Q8L A;  4LQ3 A;  5KTQ A;  2C2R A;  4C3M A;  3KMQ A;  4HLB A;  2KJW A;  2OHD A;  4ZVS B;  1SL0 A;  4DV1 F;  2MY7 A;  1RAB B;  4ZP6 A;  1Y00 A;  4KRW A;  3VAJ A;  2QLJ B;  4KV8 A;  2FGO A;  3OXG A;  3IP0 A;  2HFZ A;  2DH8 A;  2LVW A;  4OZN A;  5KG0 A;  1IJF B;  3UD4 P;  4F67 A;  4A8Q A;  4EWT A;  2RRB A;  3H4B A;  1DUR A;  3W3S A;  4IG3 A;  2GO9 A;  1FA0 A;  4F2R A;  4QWE A;  4J37 A;  1FFW B;  2DHX A;  3LGM A;  1NPK A;  3I0R B;  3MMC B;  2QJ3 A;  4U6P A;  3POT B;  1S99 A;  4X4S A;  2YTC A;  3IR7 B;  2N4C A;  3DCA A;  1C1C B;  3HVT A;  2DH9 A;  1CEZ A;  1RTH B;  2UXB J;  3DOL A;  5D8H B;  5E3R A;  1T03 A;  3FMB A;  1U09 A;  3KHR A;  1S6P B;  1R43 A;  4I2Q B;  7FD1 A;  4M94 A;  1TL7 A;  2Q3P A;  2RUG A;  2V2Q A;  4ECV A;  1MW7 A;  4OX7 A;  2NLW A;  1PJ6 A;  5K5M A;  1YJU A;  4FF4 A;  3DRP B;  2EXU A;  1HHS A;  2GML A;  3GE9 A;  2MQL A;  2VBZ A;  1T8E A;  4EZ6 A;  1Y3J A;  3R6G B;  2DK2 A;  2V4R A;  3K5N A;  4ZCM A;  3ADA C;  1DTQ A;  1FXD A;  2BJ8 A;  4X4P A;  4DOZ A;  4I6Y A;  3J80 U;  1KLM A;  3EVW A;  4A8K A;  2W25 A;  5A2Q U;  3P45 B;  3TAP A;  3G6Y A;  1RAO A;  4N41 A;  3QRR A;  3TA1 A;  1QM9 A;  4EBE A;  4MYU A;  3W2V A;  1SC6 A;  4YME A;  5LT5 A;  4M5L A;  1EET A;  3KHG A;  1GTH A;  2JFK A;  4AUK A;  2MSS A;  2H5E A;  1W2I A;  2J7U A;  1L3V A;  4X4V A;  4QR1 A;  3IXQ A;  4OL8 A;  3ONQ A;  5F8J A;  1RTZ A;  4NXN J;  4RW8 A;  3G86 A;  4CZC A;  1NME B;  3OJU A;  1PIE A;  1QUV A;  1TV6 A;  4H4O B;  2J9C A;  1TQL A;  5DET A;  2KO1 A;  4KYZ A;  4B9S A;  1N32 J;  5GAH I;  3MUM P;  3PCO B;  4EYH B;  1VQP S;  3EGV A;  3JXO A;  4EGL A;  2DO0 A;  1SJ1 A;  4HH0 A;  3LP0 B;  1REG X;  3ZTS A;  2ABY A;  2H54 B;  4L74 A;  1BC6 A;  4RBT A;  4ZP9 A;  4O0N A;  4CYU A;  2J0W A;  3HKZ D;  1C0U A;  3JSY A;  4K7Q A;  1UTA A;  1AT1 B;  2VFR A;  2FTR A;  3GFX A;  3Q2T C;  4OYA A;  3ZNJ 1;  2CQ3 A;  4CH0 S;  3G87 A;  1QSL A;  2KHD A;  1OYE A;  3M8S A;  1EZZ B;  4ZPD A;  2K7J A;  2CQ2 A;  1QVG R;  4L6V 3;  3RG6 A;  1RCO B;  2GC8 A;  3OSP A;  2DNZ A;  4ATN A;  2HLU A;  4PUO B;  3FJ2 A;  2PN6 A;  1MWQ A;  2VG7 B;  2XHC A;  5EHH A;  1IXK A;  1YJT A;  1Q1K A;  2YX4 A;  3FSX A;  4KGV B;  4KJI A;  2OLW A;  4UT4 A;  1D3W A;  3LGN A;  4I7F A;  5EGY A;  3A8E A;  1U6F A;  5K20 B;  2WZ1 A;  3MM6 B;  3HP6 A;  3PEH A;  2VKR A;  2I0X A;  3THV A;  2YNI A;  3CXC R;  2JRS A;  1CJK B;  5KG3 A;  4U8V A;  2WAQ D;  4ZHR B;  2QMX A;  3RR8 A;  2W9A A;  4TYB A;  4P7T A;  5HN0 A;  4DF8 A;  3VF0 B;  1SCJ B;  5AJ3 J;  1FT8 A;  4Z2X A;  4B3S F;  4JBC A;  1I94 J;  1LW2 B;  2HNZ B;  4O44 B;  2O01 C;  2OD4 A;  3M2R A;  4DV7 F;  1IWA A;  3MR6 A;  3D7S B;  4LF9 J;  1N33 J;  3V6H A;  1RTJ A;  3CDW A;  4WWS A;  1N54 B;  2Q1L A;  4DCJ B;  2J0X A;  2QO3 A;  3BS9 A;  2YVS A;  2MKC A;  3M32 B;  3AOA A;  3FEY B;  5HLF A;  3MEE A;  4QZV B;  5KT7 A;  3VZI A;  4NA2 A;  4BS2 A;  1L3K A;  1X4E A;  2AGO A;  5KG5 A;  5K8O A;  3CD5 A;  2VG6 A;  4ES2 A;  2WVF A;  1FHT A;  2BJ7 A;  2L9W A;  4A8O A;  1RAF B;  3J81 U;  3JB9 k;  4EMD A;  3SXL A;  4GMK A;  3CJT A;  4WK1 A;  2EFN A;  4E98 A;  5DO2 A;  2IMW P;  1VLO A;  1PYS B;  1X0P A;  5CYM A;  3MM5 B;  4LFA J;  4RU9 A;  1NHK L;  3CGI A;  4U95 A;  3J7Y I;  4M5N A;  1UP1 A;  2PA3 A;  3H40 A;  3OHB A;  3MUV P;  2IBK A;  2MQ8 A;  1NH8 A;  2YQ3 A;  4P2M A;  2GAH C;  1X5S A;  3GYN A;  2ROG A;  4DV6 F;  3HHL B;  3UCZ P;  3P49 B;  4DI6 A;  4DL7 A;  3QFW A;  4IR9 A;  5AE1 A;  5B0G A;  2VPY B;  4B3M F;  4GKK F;  4N77 A;  4QIE A;  4NI2 B;  1G3O A;  1ZAX A;  5IC6 B;  5J2N A;  3ILO A;  5DM7 Q;  3UR0 A;  1F3F A;  2CAJ A;  4LFC F;  3L3C A;  3S6E A;  4QOT A;  2D74 B;  1VQ9 S;  3NL0 A;  2VKZ G;  3D28 A;  2B9W A;  1RWV B;  1C4A A;  2EKN A;  2CNL B;  2J0Q D;  2AZ3 A;  4KPC A;  1KD1 T;  1R6Y A;  5E3C A;  3A8I A;  1RWM B;  4GKJ F;  1EKR A;  4HTJ A;  2YH0 A;  2EKY A;  2JFD A;  4NL5 A;  3NAH A;  1IM4 A;  2QE5 A;  2ZBI A;  3MM7 A;  1RLC L;  1SPB P;  1OO0 B;  2RH3 A;  1HNW F;  5DG7 A;  2UUA J;  1REV A;  4LRA A;  3DYA A;  3TUJ C;  4AFF A;  4B3T J;  1XNQ F;  3CJR A;  2D41 A;  2OPP B;  1D0E A;  1VI7 A;  3JSB A;  2VOP A;  2PII A;  3IBF B;  1NJI T;  1XR7 A;  3PX4 A;  4ZJQ A;  2Z2L A;  2IVY A;  3MWB A;  4JV5 F;  2CPY A;  1PO6 A;  3IFE A;  1M5P C;  3RBZ A;  2HHW A;  1PYT A;  2UV8 G;  2JEG A;  1J5O B;  4U7U D;  1LWC B;  1ZOT A;  4B3O B;  4WU2 A;  4ZVE A;  2L48 A;  4YB5 A;  2BQR A;  2YNH A;  4WP8 A;  5EUH A;  2JEI A;  4UOG A;  1E6Y A;  1KOO A;  4OHX A;  4HHJ A;  2K3I A;  4FVC A;  2J9E A;  3N01 A;  1AFJ A;  2P9C A;  3PJW A;  3Q8V A;  5K8P A;  4FYV B;  4AXI A;  4ILR A;  2HKE A;  3OV7 A;  2FIU A;  1S72 S;  3DGP B;  1X9S A;  4TXS A;  3GZ7 A;  4LRD A;  3NWG A;  2J6U A;  3MR2 A;  4DX5 A;  2HVI A;  1YJ7 A;  1ZA1 B;  4R5P B;  3V6D A;  2PE8 A;  4KHP F;  4DXL A;  4PEO A;  4KE5 A;  2FJX A;  2VIH A;  3TJ8 A;  4DPT A;  3OW2 R;  2ZBC A;  4DV5 F;  2AP6 A;  2KTQ A;  1BQM A;  2J9D E;  3WQP A;  5C42 A;  5C2G A;  4RNH A;  5LMU F;  4ZVU B;  2QFI A;  2XMM A;  2B6A A;  3RBX A;  5C25 A;  3HFV A;  4FKY A;  2FVR A;  1HWJ A;  1R31 A;  4RL1 A;  2LQJ A;  3IA0 A;  1IR2 A;  1CJT A;  3KK2 B;  2C3O A;  4N8O A;  1WG5 A;  3NGR A;  2R8K A;  2IC3 A;  2Y1R I;  2BQU A;  1NJY A;  5F0W A;  4GVB A;  3M8Q B;  1N48 A;  2XCA A;  1C0T A;  2LQB A;  4TY8 B;  2D69 A;  4IOA Q;  2RJZ A;  1WHV A;  4H4M B;  4XDC A;  3D68 A;  2XZT B;  3R7S B;  2W8K A;  1CJU B;  1V3Z A;  5IS2 A;  2CVI A;  2ZDP A;  3T6J A;  1VHI A;  3OD2 A;  3GLJ A;  1GX5 A;  3BSA A;  2V9W A;  3IBW A;  2AJ1 A;  4CTA A;  1RAC B;  1F2H A;  3JYT B;  1PAU B;  2P9E A;  5B0F A;  1FRH A;  4NX9 A;  2ZH3 A;  3PM9 A;  2DY1 A;  1F1B B;  4MH8 A;  4RLE A;  3VV2 B;  3BDP A;  1GH8 A;  1TKT A;  2UXC J;  2CQB A;  1U6Z A;  3SFU A;  2EC0 A;  1X5O A;  2OFH X;  3J7Z 5;  1R7I A;  1RT3 A;  2RDJ A;  1DRZ A;  3H5X A;  3Q24 A;  1JJ2 R;  2AYE A;  2GIF A;  4ZVR B;  2EBE A;  2HND A;  1U8S A;  5DG8 A;  1R0B G;  4YB7 A;  3L95 X;  4PXE A;  5EWE A;  1DAR A;  1K1Q A;  2KT2 A;  1E6V B;  2IM1 A;  2DIT A;  6FDR A;  5EX0 A;  1RT7 B;  1H38 A;  1FRI A;  4AXJ A;  2NSB A;  2IA0 A;  1SV5 A;  5A8K A;  2QL5 B;  4ZVG A;  3RB4 A;  2B56 A;  5FD1 A;  1HYS A;  2ZVS A;  3DNC A;  4X62 J;  1FE4 A;  2MKS A;  2MJU A;  2MQP A;  2RQK A;  4MKA A;  4ZIT A;  1JLQ B;  3NLC A;  4MYT A;  1TMJ A;  1RT2 A;  2UUB J;  3GG1 A;  1AZS B;  1N5Y A;  4D3H A;  5FII A;  3Q8R B;  3B6B A;  2B43 A;  5KOW A;  3RAQ A;  5KFA A;  3BQ0 A;  1V3S A;  4QIW D;  4USV A;  5IT9 U;  2ZBR A;  2RRN A;  2ZZN A;  4R25 A;  1D9F A;  4AT1 B;  3EPG A;  2CJK A;  4DSL A;  4RX6 A;  2BKO A;  4P2S A;  2XO6 A;  2B7C B;  5IOL A;  4RNF A;  3T9N A;  2HS4 A;  4L76 A;  8RUC A;  1K47 A;  2ATC B;  1UKU A;  3CO0 P;  3CIZ A;  1KC8 T;  5IXU A;  3JSM A;  1SQE A;  2RF2 B;  3MEC A;  1PJ5 A;  1UAW A;  3ITH A;  2AT1 B;  3CCU S;  2ROP A;  4Z37 A;  1ZBT A;  1KSP A;  1RA6 A;  2W9B B;  1LK5 A;  2JZ5 A;  2F4V J;  1XEZ A;  4A8F A;  4ETZ A;  3OR1 A;  3X1L B;  3HMJ G;  3IM8 A;  4WFN Q;  4B02 A;  4C11 A;  4DR7 F;  2HBY B;  1TK0 A;  3F73 A;  1WF2 A;  1XR5 A;  2GQC A;  4KH0 B;  3FRZ A;  2R42 A;  2RIL A;  2BAC A;  3PHE A;  5D0E A;  5GAG I;  2VFV A;  1RHR B;  3W8G A;  1G2E A;  4JV1 A;  3SMZ A;  1R0A B;  2ZJP Q;  1NSP A;  3QO9 B;  1LWF B;  1G4C A;  4QBU A;  4FS1 A;  1S9F A;  3SSQ A;  4NLT A;  4BWJ A;  3HHE A;  1UMJ A;  5IWA J;  3PR5 B;  2VJU A;  2AJF E;  3KG1 A;  4R0J A;  2M8H A;  1WOS A;  3ENW A;  2VQE F;  1UJ5 A;  4QPT A;  4PWU A;  3O6Q A;  1XN9 A;  1RHU B;  1M5H A;  3HHD A;  3HSG A;  2HFV A;  3OUY A;  4Q8E A;  4TVA B;  1BHN A;  1LV5 A;  3DOK A;  1EQM A;  2XSF A;  2KVQ E;  2MKK A;  3UDC A;  2OPS B;  3BBB A;  2G4B A;  2EW9 A;  3DU6 A;  2CRL A;  5MLC V;  1MN7 A;  1UFW A;  3NGD A;  1FDA A;  4K4X A;  2FUG 9;  1NKE A;  2RQM A;  3QZ7 A;  2WW8 A;  2UXC F;  2BOP A;  3W5Y A;  4N76 A;  3WX4 A;  3D66 A;  1Q7Y T;  3UDE A;  2GJF A;  4K50 A;  2NXC A;  1I51 B;  1S1U A;  1S97 A;  2E1P A;  4TU9 A;  3D54 A;  2IDL A;  2CQP A;  1O0P A;  3PG9 A;  2JJ4 D;  3NGT A;  3MPD A;  1VK3 A;  2HNY A;  4YY3 J;  4B08 A;  5C5J A;  4J9K A;  9RUB A;  5ITH A;  4KTQ A;  3QIP A;  2FJB B;  2IAJ B;  5F0U A;  1VC6 A;  4C8K A;  1TL5 A;  2H5J B;  4Y2I A;  3HI9 A;  4RUA A;  2M3D A;  5A8W A;  4S0M A;  4RW6 A;  4GO7 X;  1U26 A;  4M5G A;  1A9N B;  2D3O R;  2KRR A;  3D0I E;  3F44 A;  2UUC F;  4J9L A;  4F3Q A;  2HBQ B;  2NS1 B;  3UNG C;  4IRC A;  5D4P A;  4DG1 B;  3WC2 A;  3FEZ A;  1U0S A;  3D4J A;  1D8Z A;  4O3R A;  4IO1 A;  2QA1 A;  4C48 A;  3GYX B;  4YFU A;  2MKJ A;  1L3T A;  1HAR A;  3UVJ A;  3TZZ A;  2QYG A;  4KIA A;  2ZH2 A;  1FD2 A;  1OY8 A;  3BV8 A;  3GYG A;  2WSE C;  3AT1 B;  4X4T A;  3CCS S;  4LF6 J;  4G6V B;  2Q6C A;  3POT A;  2GGP B;  1NJW A;  3VVU A;  1T05 A;  1HIY A;  3G71 S;  2W2O P;  5LXY A;  4Q45 A;  2ZJR Q;  4DZ6 A;  3CCV S;  3AOD A;  4A46 A;  1QE1 A;  4O3N A;  2XMK A;  2XYH B;  1NK5 A;  3PRB A;  2N7C A;  1WOO A;  1S6P A;  1CJV A;  1RAI B;  1PC4 A;  1EJ7 L;  4A8X A;  2BAB A;  1UPM B;  2E1M C;  2C3P A;  3OT9 A;  4HAC B;  4JI7 F;  1GTE A;  2NXJ A;  5H1S V;  3DRP A;  1SIW B;  1BGX T;  3AJ1 A;  2DB1 A;  2CAD A;  2ZBQ A;  2KB2 A;  2G0C A;  3UW1 A;  4O4R A;  1PC5 A;  1WG4 A;  2EI5 A;  2HS3 A;  3KMS A;  2EWH A;  2PMZ D;  4EFA C;  3SZ2 A;  2MPU A;  3M8P B;  5D4N A;  3FK4 A;  3PYF A;  1RT6 B;  4OJH A;  3PY8 A;  1SB6 A;  2ZD1 B;  3KLI A;  4JI8 F;  1AXQ A;  1UFL A;  2MMY A;  1Q16 B;  1X8D A;  1TEL A;  2ASD A;  5DJB A;  3G9C A;  4Q2M A;  3IRW P;  1FTC A;  3SQO P;  2DCU B;  2ZC3 A;  1IKX A;  4M5H A;  5LXR A;  5IV4 A;  1WOP A;  2YX7 A;  4O0I A;  2J8S A;  3K2Y A;  4V19 J;  1S5Z A;  1K1S A;  1P9Q C;  3QNW B;  5JVG Q;  1BQX A;  1XK8 A;  2E66 A;  1QSY A;  2RB7 A;  3Q8Q B;  1WI8 A;  4OI1 A;  3VTI A;  4HR2 A;  1K9M T;  2D1C A;  3LPY A;  1YDL A;  3LP0 A;  3O2I A;  3CPW R;  4PXC A;  3GON A;  4DPO A;  1B4S A;  3F56 A;  1Y10 A;  1P6T A;  4CLY A;  5GAD I;  5HRO B;  3LQV A;  4U9R A;  5I42 B;  2EFQ A;  3HZG A;  1SIZ A;  2W9C B;  2QLF B;  2XI2 A;  5HVH A;  2HS0 A;  2RHQ B;  2V8G A;  5K8M A;  3TAN A;  1TKZ B;  5GAE U;  4IRD A;  3OTO J;  4DX7 A;  2W2M P;  2LU2 A;  3WX8 A;  4AQY F;  4OZ3 A;  3IWN C;  1RYS A;  3QLH A;  3N6N A;  2WCX A;  2Y1L B;  1PGZ A;  3RTV A;  4C8N A;  5H9E K;  1QAY A;  4HTI A;  4DSF A;  1NPR A;  5HSP A;  2ZKU A;  1X9M A;  5DDQ C;  5K14 A;  2W8L A;  3CC4 S;  3GG0 A;  2X1F A;  1HWU A;  3MM6 A;  2V4J A;  6FD1 A;  3MMJ A;  1SKU B;  4H54 A;  3W65 A;  3VAK A;  4DR4 F;  2YQ0 A;  3LH2 S;  1Q8I A;  2XWX A;  3TP2 A;  3KLG B;  1CJK A;  3AB2 B;  1RK8 A;  5EDW A;  2FJE B;  1PSD A;  1DZ5 A;  1IKY B;  2DGQ A;  3CF5 Q;  1K0T A;  1QAX A;  3MAA A;  1KHV A;  4CNY A;  1HI1 A;  1JLB B;  1S9E A;  5B08 A;  1NU4 A;  5F8G A;  3M4X A;  1SKW A;  4DHV A;  1IKV B;  1R27 B;  2MZS A;  3DRS A;  3MEG B;  2W01 A;  1HBU B;  7AT1 B;  1P27 B;  1WSV A;  1Y4Z B;  2DPI A;  4P75 A;  4WTY A;  2KZZ A;  2IMO A;  5ETQ A;  1WKJ A;  3CJ8 A;  4F25 A;  3CWJ A;  1O5J A;  2ZM6 J;  4OYW A;  4DSE A;  4P72 A;  3K58 A;  5IZH A;  2FHJ A;  1DY3 A;  3L7P A;  1WUU A;  2OPQ B;  3BRE A;  3MED B;  5C24 B;  1OPZ A;  5KFB A;  1T02 A;  1WD6 A;  4P2X A;  1RTD A;  2V67 A;  3GV5 B;  1VRT B;  1EP4 B;  5B0D A;  2E9R X;  1R8H A;  1N36 J;  3M9M B;  2VA3 A;  4Z7C A;  1QUP A;  3QAU A;  2KDO A;  8ATC B;  1PBU A;  2HEK A;  3PTW A;  1F5C A;  1TKD A;  2F65 A;  1W26 A;  4ZN3 A;  1IKW A;  2DTJ A;  1H3D A;  1HNX J;  3E8O A;  3FC9 A;  2HQ3 A;  2QN6 B;  4C4W A;  1GXU A;  5A76 A;  1YJW S;  4ED4 A;  4OX9 J;  3H20 A;  2KU7 A;  2C2Z B;  1GFW B;  4O3P A;  3WIU A;  2XMW A;  3AD7 C;  2PFF B;  4K5R A;  4OI3 A;  3Q8S B;  1NDL A;  4TN2 A;  3C66 A;  3AHP A;  2A2D A;  2V8D A;  2XNR A;  2DGX A;  2KKH A;  4DDF A;  4ZCK A;  3IR5 B;  4OJG A;  2KYZ A;  4KV8 B;  3J80 Y;  4FF2 A;  2YQ1 A;  1C2P A;  2AIR B;  3IGV A;  3M9N B;  1Q82 T;  3DGV A;  5A2Q Y;  1NEE A;  2HUR A;  1CVJ A;  3NAI A;  4LSZ B;  3N79 A;  3CJ0 A;  1S7H A;  5ETR A;  4XTT A;  2MEW A;  3KK3 A;  2CDR B;  3CB4 A;  4QWC A;  1BD6 A;  3JAM U;  4J90 A;  3BO2 A;  3M6W A;  3R5A A;  5KFJ A;  4HDG A;  2R7W A;  3TOQ A;  1NDC A;  1ZPV A;  3QAE A;  2HQG A;  1FCA A;  1UVJ A;  1GMW D;  2IHR 1;  3TW0 A;  4ECW A;  1T03 B;  3LWM A;  2E5L F;  1J5O A;  5KFT A;  1LWC A;  4B3O A;  5B0A A;  3NCR A;  4RW4 A;  4O3Q A;  4AL7 A;  3JQM A;  3TI0 A;  4CO2 A;  2GVZ B;  2JDJ A;  1TL7 B;  2W4D A;  4ZVQ B;  1XBW A;  1JLE A;  4U7C A;  2CG8 A;  2VON A;  3CED A;  4M5I A;  1DTT A;  5KFE A;  5KFR A;  3N28 A;  3DLH A;  2M4M A;  2V8P A;  5HMX A;  2Z30 B;  1VLY A;  3DGP A;  4DPX A;  3FSI A;  2XLK A;  4WPA A;  1DTQ B;  2Z0G A;  1NSA A;  3MTK A;  3LP1 A;  4DCP B;  2QZ8 A;  3US5 A;  1KVK A;  2N3L A;  3FRY A;  2J6S A;  3LWL A;  3QSY B;  3W2V B;  2YKN A;  2KI2 A;  1QJH A;  2Z57 B;  3MF5 A;  1EET B;  3G6X A;  2VUG A;  2IRX A;  2V5H G;  4LBI A;  1DQ9 A;  1B3T A;  1U2C A;  3IS9 A;  3JS9 A;  2D7S A;  3FZ2 A;  1BQN A;  2E5G A;  4RW8 B;  1Q79 A;  3T1A A;  2E29 A;  1FKA F;  1RAA B;  1U1M A;  3JQJ A;  3P6Y C;  4YS2 A;  2IM0 A;  3T6B A;  3EXY A;  4FYW B;  4D3G A;  4L75 A;  2YWF A;  1MMD A;  3OL7 A;  1O51 A;  1N88 A;  3CMA S;  2DBB A;  4CYU B;  4EU0 A;  3EDQ B;  3ZTQ A;  1VBX A;  1TK8 A;  3QGI A;  3R7N B;  2LEB A;  1KRP A;  2N7Y A;  4Z7Y A;  3D2W A;  1IBL J;  1YRT A;  4NZ7 A;  5D78 A;  5KG4 A;  2JLG A;  3RU0 A;  4ICL B;  3DDN A;  4JI1 F;  3J81 Y;  5KFQ A;  3OLA A;  4PAB A;  1RWU A;  2BJ9 A;  1HNZ F;  3H98 A;  1Q8B A;  4OI4 A;  4RJV A;  3OPK A;  4UZB A;  1XMQ J;  2LEA A;  1Q78 A;  2XC9 A;  4I7F B;  2W4C A;  3B78 A;  3FCW A;  2CYY A;  4AND A;  2DKO B;  2IYI A;  2RVJ A;  1L3S A;  2XS2 A;  2YNI B;  4RO0 A;  5ETT A;  3KUG A;  1V5V A;  5J2M A;  1T3O A;  4IRK A;  2H9Z A;  2GIR A;  4C6A A;  4DZD A;  4C8Z A;  2FLP A;  4DSK A;  4URG A;  2HYI B;  2IPO B;  4RNO A;  4FP9 A;  3ZZP A;  3ZTP A;  2QX0 A;  4KR0 B;  1VQL S;  3M2R B;  5IQQ A;  3MR7 A;  2V4Q A;  3HVA A;  1RE1 B;  1T95 A;  3BM7 A;  4O3S A;  4QYR A;  1AZS A;  1RTJ B;  2XMJ A;  1RWP B;  3SCI E;  3H5U A;  1NCL A;  3BGR A;  2R8G A;  3KHH A;  4A8Y A;  5HLF B;  3MEE B;  5KFS A;  3W7B A;  1HQU A;  2R7T A;  4WFA Q;  1HR0 F;  2RU3 A;  2OEL A;  3PYG A;  2VG6 B;  4DR1 F;  5HVF A;  5HJX A;  3P3D A;  2G2Z A;  2N82 B;  1IBM J;  3TJA A;  2LQ9 A;  3SFG A;  3BKU A;  3SV4 A;  2OD6 A;  2YKA A;  2PMH A;  1YHQ S;  4ED6 A;  3A1Y G;  2Z56 B;  4U67 Q;  3ENQ A;  5CYM B;  1EIY B;  4WP3 A;  2XY6 A;  1BWV A;  4RZR A;  3PW5 A;  5KFL A;  2IVF B;  3D1O A;  4NYO A;  1KTQ A;  3UO0 A;  4MIW A;  3RYL A;  4F4Y A;  4RR5 A;  4I56 A;  4USU A;  4HKQ A;  2J76 E;  3R1L A;  3THP A;  1Q7L B;  1LQ9 A;  5ETS A;  3OL8 A;  1L3U A;  2B51 A;  1UET A;  4FPI A;  1UCN A;  5DM6 Q;  3VAG A;  2ALZ A;  2HK2 A;  1ACM B;  3C15 A;  4KT0 C;  3B4D A;  4CLK A;  1R0A A;  2OUG A;  3QO9 A;  1U6B A;  4DV2 J;  1OSC A;  1N5V A;  1CG2 A;  1QAJ A;  4U8Y A;  1YSJ A;  3AQP A;  5J2N B;  5FLX U;  3MM9 A;  2DRB A;  1S7I A;  3DDI A;  1FJE B;  1O6X A;  1NJZ A;  3AJD A;  3SCL E;  3P96 A;  4LF7 J;  3GPA A;  2R2S A;  2DNK A;  4ECY A;  3G4S S;  1ROF A;  3JTO A;  3MOZ A;  4WFZ A;  1KQK A;  3I0S A;  1N0V C;  3MM7 B;  4X65 F;  1REV B;  4MT1 A;  5KFI A;  3AB4 B;  3DYA B;  1ZZF A;  2NPI A;  1HBO B;  4K4S A;  3T19 A;  2BE2 A;  2GV1 A;  2LXU A;  2X3D A;  2YKP A;  2HAF A;  1WC3 A;  4DU7 A;  1R3N A;  4JYA J;  2KXN B;  3CD7 A;  2DRA A;  4RW7 A;  2LMI A;  2W2N P;  5LJ5 Y;  4ED7 A;  1RZM A;  5KG2 A;  2RKI A;  3I6P A;  4LMZ A;  3CJ2 A;  2CZ4 A;  1MSW D;  2JH3 A;  4QW8 A;  1WOR A;  4KGM A;  4DL2 A;  1E6Y B;  1RWW B;  2BMB A;  1VJW A;  3TEH B;  1HL6 A;  4DR3 F;  4YB1 P;  4NLD A;  4DLE A;  2POK A;  1ZZN A;  4CNZ A;  1M5K C;  4F04 B;  1EAR A;  2W7O A;  9ATC B;  1WG1 A;  5FDL A;  2CVE A;  4KQZ A;  5CH7 B;  4G1P A;  4QQB A;  1ZAV A;  4DUZ J;  4OLP A;  3S1T A;  1VBY A;  4EI2 A;  2OTL S;  4OX6 A;  5D4O A;  1PYO B;  1WF0 A;  3V6D B;  3R1H A;  3UDV A;  1YG0 A;  5ADZ A;  1WC5 A;  4UZC A;  1ZM4 A;  4DLG A;  4ID8 A;  2HZC A;  2F4F A;  2YKM A;  4TU8 A;  2GIQ A;  3C19 A;  2VDI A;  4U7U K;  2R9L A;  4RNN A;  1KEK A;  2E7V A;  1BQM B;  5C42 B;  4UY8 T;  2MLX A;  1S1X A;  2BX6 A;  5GMK a;  4DQR A;  1WEX A;  2B6A B;  3OTB A;  5C25 B;  1JX4 A;  4DL6 A;  1NDK A;  3FCV A;  5L8R C;  5E7O B;  3QFH A;  2R7X A;  1CJT B;  2DNP A;  1RBO B;  2F8E X;  4W92 B;  2QYC A;  2DEJ A;  2IC3 B;  1VQ8 S;  3IN5 A;  4GVB B;  4JOU A;  2L9D A;  2E5I A;  3V4I A;  3GMG A;  3W5X A;  5IT0 A;  1CC7 A;  2XLI A;  2UU9 F;  2NZ4 A;  1U49 A;  1C0T B;  4MIB A;  4DV0 F;  2AJQ A;  2A0F B;  2JC1 A;  2QMW A;  1IWG A;  2DXF A;  3ZO7 A;  2IIH A;  4ZVT B;  3KK1 B;  1UVI A;  5IT9 Y;  3V81 A;  1N34 F;  2XTJ P;  4NCB A;  4K5S A;  3M8R A;  3PW0 A;  1TFY A;  5H9F J;  2NXE A;  3I56 S;  2IY5 B;  4NA3 A;  4WBF A;  4FN5 A;  2CQD A;  4CTA B;  4LF4 F;  4QWB A;  2PO4 A;  3G6E S;  4X64 F;  2Z2Y B;  3R5G A;  4BDP A;  2A3J A;  5ETL A;  1VIX A;  1KP6 A;  1SH3 A;  4YDD B;  5E0O A;  2MTL A;  1TKT B;  2H48 B;  4NEY A;  4BBY A;  1HI0 P;  5KFN A;  1UL3 A;  1TP7 A;  4USW A;  3KJF B;  4IDK A;  1RT3 B;  4Q2L A;  1MWZ A;  2R7R A;  3K17 A;  1RHM B;  2ADC A;  2OIH A;  2JVO A;  1FVQ A;  2PA8 D;  1R8A A;  4O23 A;  2OMO A;  1FRM A;  1PIL A;  4UOH A;  2Q6B A;  2NXN A;  3GU0 A;  4ILM A;  1SV5 B;  5BR8 F;  5A8K B;  1FJG J;  4OZ0 A;  4DV3 F;  1WC6 A;  1M1G A;  3P4U B;  2IVM A;  4F4K A;  5E3P A;  4DL5 A;  4B3R J;  2ZIT A;  1LW0 A;  1TUV A;  1MRO B;  4XK8 C;  4ECZ A;  4M1K A;  5D77 A;  1RT2 B;  2LU1 A;  2OTJ S;  1N5Y B;  1K8A T;  2FJA B;  2M5Y A;  3ZXW A;  1LNQ A;  4JI0 J;  2YPY A;  2V50 A;  2ILZ A;  1CS4 A;  2OEM A;  3Q8Y A;  2MQQ A;  3K57 A;  1DHM A;  2XGP A;  3N0V A;  3A13 A;  3G6V A;  2X1G A;  1URN A;  5KFZ A;  3EYZ A;  2PEH A;  4DR6 F;  1VQS A;  4HVZ A;  5E3A A;  5LMN F;  4CH7 A;  2KH9 A;  4G1Q A;  4CP5 A;  3BGO P;  4WZM A;  2XY7 A;  2EFV A;  4K0K F;  3S8S A;  2HAI A;  3JSM B;  4ZVP B;  3MEC B;  4YHH F;  1X9W A;  3U1L A;  2HFS A;  2R8J A;  4LF8 J;  3ITH B;  4LSN A;  3C6T A;  2CPH A;  4KO0 A;  2IFX A;  2MQN A;  1D1U A;  3MZI A;  5KFM A;  3IBC B;  2K7K A;  4FXV A;  3CCJ S;  4DV4 J;  1S4E A;  4N56 A;  4ZPB A;  4IFV A;  3F41 A;  3KG0 A;  3OR1 B;  1GK8 A;  3VAL A;  4C11 B;  4I2P A;  2I1R A;  1VBZ A;  3FBB A;  2VIC A;  3BB5 A;  1F0X A;  1FRL A;  3AD8 C;  2F40 A;  3JSR A;  1OMS A;  1OPI A;  2Q43 A;  4J5O A;  4P2F A;  3LP2 A;  1RT4 A;  1JQG A;  2JC0 A;  1H7X A;  2GCF A;  3O5T B;  2R7O A;  2HPU A;  4DF4 A;  1V5I B;  1S12 A;  1RT5 A;  4WFX A;  4JV0 A;  1U1K A;  4PQA A;  4I6A A;  3MOJ B;  1UVN A;  2C22 A;  1RKI A;  3MR5 A;  3V4M A;  2CDQ A;  2CPD A;  3ZZU A;  5KG7 A;  5M2U A;  2CWK A;  1VQ5 S;  3MEG A;  2BXJ A;  1G7C B;  2VF3 A;  4HEA 9;  3I82 A;  1JLC A;  2IBO A;  3M8W A;  1QLN A;  3UQS A;  4A8W A;  4C0B A;  3T41 A;  2W2Q P;  3MMB A;  2HSE B;  3DOK B;  4J9N A;  2FLL A;  1FFS B;  3ICL A;  3BO4 A;  2B3T B;  1S0O A;  2GVD A;  2GQQ A;  4Y2C A;  2WB1 D;  3DRX A;  4C3K A;  3VAH A;  5C24 A;  2I8E A;  1H74 A;  3GR0 A;  3R9L A;  3KLF A;  1Y11 A;  4JI5 J;  1HHT P;  4PAA A;  4JI4 F;  3SCJ E;  1MLA A;  3N5B A;  2VOO A;  2OPR A;  5F8L A;  4DEZ A;  3KXD A;  5A6P A;  4CH1 A;  2Y0B B;  3BF4 A;  3ZNU A;  4B9N A;  4OZ2 A;  4DSJ A;  4M5M A;  3UE2 A;  2HRU A;  2L41 A;  2EK1 A;  4F0H A;  3GFZ A;  2XWY A;  3GSD A;  4I68 A;  2E1A A;  1J5E J;  1TUW A;  1KQF B;  3O8W A;  2HNY B;  4G1I A;  1ZPW X;  2LEP A;  2RAQ A;  4OX8 A;  5DGB A;  3D6F B;  4NAS A;  3NGK A;  2IJN A;  3WC0 A;  2MKH A;  1G1X A;  4LF1 A;  4R0E A;  4EO6 A;  5CAB A;  3KYL A;  1IBK J;  3S7R A;  4K8R A;  1K0V A;  1XNR F;  2UVU A;  4FYX B;  3DFE A;  3G82 A;  5A8W B;  3CD0 A;  4RW6 B;  3HHL D;  4DR2 J;  1KTV A;  4DFK A;  2CWX A;  3B8H A;  3DMJ A;  3KLH A;  2F1F A;  1T7P A;  1U25 A;  2M52 A;  4JI3 F;  1HW8 A;  2C3U A;  3I96 A;  1X4H A;  5L39 A;  4URQ U;  3K89 A;  3KFW X;  4DPU A;  2B0G A;  2V0N A;  5DZ6 A;  1PAE X;  4K2X A;  5RUB A;  5F8M A;  3UVJ B;  2BVZ A;  2BYC A;  2P8I A;  1XMB A;  5DRK A;  2QEX S;  4PZV A;  1V9O A;  3TAQ A;  4WFB Q;  1TL3 A;  5L9N A;  4LF5 F;  2LKZ A;  3CME S;  2EFP A;  4KGK A;  1T05 B;  3DLE A;  3G8S A;  2FPH X;  1FDD A;  2IYG A;  4ED0 A;  1SUQ A;  5HMY A;  4IOC Q;  2KM8 B;  2HHH J;  1QE1 B;  1JXV A;  1UA0 A;  4NYP A;  1U1O A;  1CJV B;  4JI2 F;  1NH7 A;  1RBA A;  5J1E A;  4QIV A;  3FBE A;  3IM9 A;  2B9X A;  2B8Q A;  1BLU A;  2GVZ A;  3AXK A;  3W62 A;  5KFH A;  1RAE B;  4XIU A;  3RB6 A;  3B82 A;  1NLK L;  4PR6 A;  2BV3 A;  3ISN D;  2ZH7 A;  1NJX A;  3U27 A;  3PAC A;  1SBR A;  2AKW B;  1BXN A;  3I9Z A;  4IH5 A;  2C2K B;  3UPF A;  4MK8 A;  2F7V A;  5I4M A;  1AUD A;  3T1H F;  4J9Q A;  3Q22 A;  4WYW A;  4P10 A;  2BDP A;  5G4D A;  1SJR A;  3KLI B;  3DOM A;  2C2M B;  5KFF A;  4PQU A;  3SCK E;  3NEK A;  1NRK A;  1NUE A;  5KFP A;  4ITS A;  3OL9 A;  5GME A;  3V5R A;  2HGN A;  2XYG B;  3O3L A;  1HW9 A;  1DLO A;  5B09 A;  5CAA A;  1H98 A;  1HHQ A;  3MI7 X;  4BHQ A;  2KG0 A;  1DBD A;  3VAF A;  3VVT A;  1YTY A;  2VPW B;  3TQE A;  1F5A A;  1IKX B;  4JI6 F;  3NS5 A;  5C2C A;  1WI6 A;  1SQG A;  1S1V A;  3HJF A;  1IQT A;  4ECT A;  3HVR A;  1RAH B;  5E5N A;  3U1M A;  3HT3 A;  1EX8 A;  3R3T A;  3ILI A;  3SI8 A;  1S79 A;  2L08 A;  3FFI A;  2LYV A;  3R97 A;  1BUX A;  3M8Y A;  2GZO A;  3RB3 A;  1H0H B;  5KFV A;  2AWZ A;  4KPY A;  5ETM A;  1U2F A;  2MLY A;  1HMV A;  3TYT A;  2FVQ A;  2BJD A;  1M90 T;  1WEZ A;  1U1L A;  4OHV A;  2CUY A;  3F0N A;  1VIO A;  3QLH B;  4ICL A;  5IV3 A;  2DHH A;  5KFD A;  2CPE A;  7FDR A;  2E9T A;  3EWG A;  1RUS A;  2WVC A;  2Q79 A;  2BM1 A;  2W24 A;  3OFF A;  4ZLL A;  1JKH B;  3W60 A;  5K14 B;  3R7B B;  4ZCL A;  3PRD A;  5IM0 A;  3MR3 A;  3KDO A;  4CLF A;  3RBE A;  1D8Y A;  2BJE A;  5KG1 A;  3H0P A;  1UVM A;  2V4J B;  2UXD J;  1YJV A;  4EO8 A;  2HW3 A;  3TAR A;  4AD6 A;  1X4A A;  3BGL A;  3KDN A;  1S49 A;  3VAI A;  3BR8 A;  4HYK A;  3FMW A;  3BO3 A;  2J7W A;  2V2Z A;  3NS6 A;  1H2V Z;  1AFI A;  3MAA B;  4QIG A;  1URR A;  1UEV A;  2ZH8 A;  1S9E B;  1HQ2 A;  1FVS A;  3ETM A;  4FDF A;  1S0V A;  2BZ2 A;  4OHY A;  2QTW A;  2CPF A;  3HX9 A;  1DQ8 A;  1KNZ A;  3DRS B;  1EKS A;  4DR5 J;  1WDT A;  5DG9 A;  1GXT A;  3QT6 A;  3HPO A;  4LSL A;  3UDL A;  4RU2 A;  2Y3Y A;  4MAK A;  2UXB F;  2GFF A;  3DI6 A;  2Y0S D;  3BN7 A;  3HXM A;  1I3O B;  4NXM J;  3H7H B;  1S1W A;  4X84 A;  1SJ3 P;  1FEH A;  2ZVI A;  4DUY J;  3U02 A;  2B4U A;  3QYY A;  3HD2 A;  2ADB A;  2QMU B;  1Q8K A;  4HI2 A;  2FC8 A;  3RAX A;  2CIM A;  3OVS A;  4RUC A;  1RTD B;  3M2U B;  2MZQ A;  4QU7 A;  1XC9 A;  3JAM Y;  1XR6 A;  4V19 X;  4OMF G;  1D9D A;  1H2T Z;  1YRU A;  2OSR A;  2JX2 A;  4MMO A;  1LWE B;  4YB6 A;  1NK0 A;  4LRF A;  2VFS A;  4USK A;  4WTO B;  4ECQ A;  1GQE A;  2C2E A;  5HBM A;  3DLK A;  1UEK A;  1M5S A;  5DLF A;  1ICE B;  4J9S A;  3V6K A;  1IKW B;  3ZFV A;  4C98 A;  2QLW A;  4C8L A;  4KHM A;  4WE1 A;  3KJV A;  3V2U C;  2HK3 A;  2O1P A;  4LFB J;  3I9V 9;  3TNV A;  2DCL A;  3SBM A;  4QW9 A;  3THT A;  2PT0 A;  3TZY A;  3SDE A;  3ZZ0 A;  5JJB A;  3MFH A;  4UUX A;  2O3D A;  3RRH A;  2MGZ A;  4PWD B;  1FWK A;  4F2S A;  2ZNY A;  4NXN F;  1X4C A;  3HO1 A;  2RQ4 A;  2M88 A;  1HQE B;  5LSR A;  3GCX P;  3T5K A;  1N32 F;  4LRE A;  4HHU A;  3W2W B;  2CNO B;  4PXD A;  1UJ4 A;  4MIA A;  5B0B A;  1TKX A;  1X31 C;  3QMQ A;  3HHL C;  4F26 A;  3KK3 B;  4I1T A;  4ID5 A;  2G2O A;  3T5J A;  3TWZ A;  3QJP A;  4I0W A;  4MFB B;  1DAX A;  4J7C A;  1HBO A;  1R8C A;  3UNY A;  3QSI A;  2I6W A;  1FER A;  2M2B A;  2A6O A;  2R7U A;  1QD1 A;  2I5J A;  4IUF A;  3CDA A;  4PXB A;  4TQR A;  3L7U A;  3HCX A;  4GC7 A;  4NCG A;  4RW4 B;  1AB8 A;  4ALZ A;  1JLE B;  4ED8 A;  2FDN A;  3S01 A;  2LFV A;  2JLF A;  4F36 A;  4ILL A;  2W2P P;  2XHW A;  2FHM A;  3N9U C;  2BRK A;  5GAH U;  2PFD A;  1DTT B;  1KR4 A;  1B70 B;  3U7J A;  1UVL A;  5AJ3 F;  3T1Y J;  1I94 F;  4DL3 A;  5ETN A;  3TUP A;  4OYX A;  3K5M A;  2ILY A;  2CXE A;  5CYQ A;  4F50 A;  3BYP A;  4UOC A;  2CPZ A;  3EPI A;  4IG0 A;  4LF9 F;  1N33 F;  3ISN C;  3LP1 B;  3CDE A;  4ES3 A;  1LK7 A;  4E2F B;  1TL4 A;  4DBQ A;  3CIM A;  1VGY A;  4C2M A;  1GAO A;  3AOC A;  4NPO A;  1KLN A;  4YDX A;  2BQ3 A;  5JXS A;  3GB0 A;  1UPP A;  1YIT S;  2YKN B;  1TAU A;  5KFU A;  3VR1 A;  1HPZ A;  4NLQ A;  5KG6 A;  1FKO A;  3IS9 B;  3TZX A;  2Q66 A;  4X66 J;  1BQN B;  3GIK A;  2CQI A;  4CLS A;  2A2C A;  1NO8 A;  2XMT A;  3CD6 S;  1S59 A;  3EJM A;  1FWL A;  2V63 A;  3H42 A;  3AQO A;  4FF1 A;  1Z1Z A;  3HZE A;  2LXF A;  3IG1 B;  1HNI A;  5J1N A;  4PKD B;  3OR2 B;  2QV6 A;  4I64 A;  2U1A A;  4NLS A;  4M5D A;  4LFA F;  2IRY A;  3IAM 9;  5L46 A;  4CCH A;  1UFK A;  4KY3 A;  2AGP A;  4DUT A;  3KK1 A;  4OZ5 A;  1EQ0 A;  4ED5 A;  2AX1 A;  5D0G A;  4FYY B;  3W5Z A;  3A8J A;  4NA1 A;  3M05 A;  1F3V A;  5GMD A;  4DPY A;  4KH1 B;  3HDS A;  4PYD A;  2HVH A;  2HLT A;  4WKR A;  4DS5 A;  2BW2 A;  2LDI A;  1HKA A;  2DIU A;  4ELU A;  1NM2 A;  1A6L A;  2KFN A;  1D9A A;  4J9M A;  2WBR A;  1A7G E;  4CLP A;  3LAL A;  2QLX A;  3M7V A;  3I4H X;  2HHS A;  4OYO A;  2IM3 A;  3TAM A;  4NLU A;  2K2P A;  1P1L A;  2V8V A;  5ETK A;  3GJR B;  1SXL A;  3HF5 A;  4RWX A;  5DGA A;  2C2O B;  1RHQ B;  2DGU A;  3CDU A;  4DV1 J;  1IR1 A;  5J2M B;  2RNE A;  3EGZ A;  1QDU B;  2RQC A;  4LBP A;  1ZYQ A;  3HKW A;  4Y3C A;  2ZHA A;  1YBT A;  2Z4P A;  3DRY A;  3J7Y U;  2QA4 S;  4FNH A;  2AYB A;  1HLW A;  2UUA F;  2DVI A;  1X0F A;  4B3T F;  3W9H A;  1MRO A;  2M9K A;  4K4V A;  4O3O A;  1B64 A;  1FNO A;  4LF2 A;  5FLX Y;  2AEF A;  4H4K C;  3GTY X;  4NLR A;  3R5J B;  3BGR B;  4N47 A;  1RDR A;  2OI2 A;  2B9Y A;  2C28 A;  1HQU B;  2UUW A;  5LOQ A;  5AE2 A;  5L38 A;  4FBT A;  3BH6 B;  4Y34 A;  4RWW A;  4I67 A;  2VU5 A;  3KJQ B;  2HQI A;  1Q5Y A;  3W1Y C;  5A0Y A;  2FJV A;  4OYZ A;  3D3C J;  2VD3 A;  1BY9 A;  5I3P A;  3LPE A;  2VV5 A;  1H7W A;  2M7S A;  2G0I A;  3T1Y F;  3IRX A;  3HD1 A;  1VDH A;  4Y2A A;  5CZX A;  4ETX A;  5BXI A;  4B9T A;  3MFI A;  1HI8 A;  2XSJ A;  3WDO A;  2BEF A;  1FKP A;  2XGQ A;  2UZA A;  2IDE A;  3RW6 A;  1N5S A;  2VL1 A;  3MPW A;  4ECX A;  2IJF A;  1FNX H;  4G65 A;  2ZBP A;  3C15 B;  3BKF A;  4JB8 B;  4OV1 A;  4FXW A;  4WYL A;  2L9N A;  2RIJ A;  1VC0 A;  1WC4 A;  2AHO B;  4TYA A;  2WON A;  1T9V A;  1M1K T;  4TU7 A;  3EXC X;  3QJL A;  2CQ1 A;  1ARO P;  4B9M A;  3MM9 B;  4DX8 H;  3PHT A;  5DDO C;  4CM0 A;  2GW8 A;  5HAN A;  5E3Q A;  3EZ5 A;  1V3R A;  2AJ2 A;  4RPF A;  1RTI A;  3C16 A;  5KT4 A;  1S76 D;  4KHR A;  3H90 A;  2B8P A;  1S9G A;  3I0S B;  2Y8W A;  4DJB A;  4K4Z A;  1WHX A;  2DYA A;  4FKX A;  4XDD A;  1ZS6 A;  1FO1 A;  1TVR A;  2DNY A;  2VG5 B;  1FXR A;  2XS5 A;  2AMC B;  1FEE A;  3GSI A;  2BE2 B;  2H3E B;  3FZB A;  1P1T A;  4GC6 A;  4P73 A;  1NKB A;  4RW7 B;  5JVH Q;  2PD1 A;  2DNQ A;  1YBU A;  2OJ3 A;  3BSO A;  3SQG A;  4YOE A;  2CPX A;  1KFS A;  3OFG A;  5L1K A;  2RKI B;  1ZA2 B;  1BWE A;  3UI3 A;  3W64 A;  1NK7 A;  4Q7A A;  3PKM A;  2YWE A;  1CUL A;  2HWH A;  3FSY A;  2WW4 A;  4FS2 A;  2RS8 A;  2XCP A;  3NOC A;  4LIW A;  1B99 A;  1X4D A;  4YP3 A;  2BJ3 A;  4K4Y A;  2JOQ A;  5D4L A;  2X1B A;  4X4U A;  4ELV A;  1U02 A;  3ZZR A;  1UEU A;  5K8N A;  3MCS A;  2OO4 A;  5FDL B;  4X62 F;  4ECU A;  3BSN A;  2R3V A;  2B5J B;  2VBX A;  4F4W A;  2ZJQ Q;  1M5O C;  2DXE A;  3H8Y A;  4Q5V A;  2K3K A;  4O4G A;  4OYB A;  3Q8U A;  3VQS A;  1U1Q A;  1PKU A;  1TU0 B;  2BE7 D;  5AE3 A;  2UUB F;  4B3S J;  1EAY C;  4ZP7 A;  2VC1 A;  2HHX A;  3FUY A;  1GXL A;  1HWK A;  2LQ8 A;  4DS4 A;  4DV7 J;  3ZTR A;  2YKM B;  4M95 A;  1GX6 A;  2V94 A;  3EVM A;  4WXO A;  1JLA B;  2ZH1 A;  1S1X B;  3DN9 A;  5KFX A;  3R5D A;  2U2F A;  1HNV A;  4JV2 A;  2JWN A;  2CQ4 A;  1RYR A;  1B0V A;  4ES1 A;  1JB0 C;  3V4I B;  3N6M A;  3TVZ A;  1U48 A;  4ZPC A;  1OJ4 A;  2ZOM A;  4LBH A;  2F4V F;  1VQ7 S;  4MJK A;  4K4U A;  4DFJ A;  4K4W A;  2VJV A;  3DKD A;  3V81 B;  2ZFH A;  1R0C B;  5KFO A;  3RW7 A;  4A47 A;  2ZH6 A;  4Q0B A;  3I87 A;  4ZLN A;  3CCW A;  4C9D A;  1B0T A;  3D1Q A;  2MY8 A;  3KLE A;  1XJW B;  2EFG A;  1FXL A;  4NLV A;  4QCL A;  2WVE A;  4BC7 A;  3NNC A;  4YQW A;  2JHE A;  2DEI A;  1W2B R;  3A4T A;  3PW4 A;  1RLD A;  3BN4 A;  4LRC A;  2KYX A;  3NMR A;  2YBV A;  2DH7 A;  2ZWP A;  2ZHO A;  1F9H A;  4DV6 J;  3KUH A;  5EN1 A;  3QQC D;  4HT5 A;  1HBN B;  8AT1 B;  1F9F A;  2HGM A;  5IWA F;  2ZOF A;  3ELH A;  1FRJ A;  4IDK B;  1NB7 A;  4B3M J;  4GKK J;  2E5H A;  4EUV A;  3EMT A;  3RAM A;  3RBD A;  4CM2 A;  3MM8 A;  1RQ0 A;  2FB0 A;  3TEG A;  4LFC J;  4F7V A;  3GR1 A;  2IA6 A;  4NLO A;  4P74 A;  4URS A;  5G0R A;  2HMI A;  2O5D A;  1EHW A;  1M0S A;  4KGZ B;  4A48 A;  2MQM A;  3H25 A;  3BBF A;  1FK9 A;  5C7P A;  2FQQ B;  4X4R A;  3I31 A;  1LW0 B;  3OFE A;  3G96 A;  3DLJ A;  4UTG A;  4GKJ J;  3FKB A;  3I55 S;  4ZPV R;  2XEX A;  4E0D A;  3R2D J;  1HNW J;  1DJ0 A;  1UWB A;  2PDA A;  2G0J A;  5GAG U;  3DLG A;  1XNQ J;  1B7F A;  2GHW A;  2ACY A;  1M1H A;  1CS4 B;  3DDK A;  3C6U A;  1YJN S;  1IM6 A;  3N6L A;  1Z2Z A;  3PVX A;  1VQK S;  4MKY A;  4JV5 J;  2D9O A;  2RT3 A;  1MWY A;  1Q4R A;  4ED1 A;  1FDB A;  4G1Q B;  4XPE A;  3DXS X;  3CJ3 A;  4YY3 F;  3G8Q A;  3AY0 A;  1WHY A;  2DNM A;  3WBZ A;  1C1B A;  1NK9 A;  2DNN A;  4NRU A;  2X3G A;  1Q86 T;  4LSN B;  3DHX A;  3C6T B;  2ACM A;  4KO0 B;  4OZL A;  1NK4 A;  1OIA A;  2FHK A;  4OI0 A;  3JTN A;  4USH A;  2R7V A;  4DFP A;  5F8H A;  2MHN A;  5KT3 A;  2F8H A;  4IFV B;  4KFB A;  3AH6 A;  1JKH A;  2HIY A;  5HJY A;  2H4Y B;  5J2P A;  2HFO A;  4I2P B;  1Y9O A;  3NCP A;  1VJQ A;  5D3G A;  2YWK A;  1S1T A;  2MB0 B;  3TR5 A;  4ZJL A;  2OEK A;  3HVW A;  3FEX B;  4OYP A;  2UP1 A;  3BDE A;  3LP2 B;  1RT4 B;  2CNK B;  4KHP J;  4ZPW R;  4J9V A;  3VQT A;  4DX6 A;  2MXY A;  2ZHB A;  1WNE A;  1RT5 B;  2DHG A;  4DV5 J;  2KXF A;  1U1N A;  4N8N A;  2CQG A;  1T9X A;  5F8N A;  3UCU P;  1WJ9 A;  2CJB A;  1Q81 T;  5LMU J;  2CNN B;  4KAI A;  1IUJ A;  1RWN B;  2BUN A;  2EG2 A;  1TMM A;  4LF6 F;  3DHW C;  3OSN A;  3T5H A;  2DIV A;  2YY3 A;  3G2X A;  1JLC B;  3OVA A;  5BJR A;  3WHI A;  2KT5 A;  3L09 A;  3NG8 A;  3M1V A;  3GII A;  3VGS A;  1RU1 A;  1SQF A;  1VMB A;  3HHK A;  3PX6 A;  3MMB B;  5AXN A;  5KFK A;  3NWR A;  2FLN A;  3PV8 A;  3E01 A;  1AA1 B;  4JP8 A;  2NYH A;  5KOX A;  4F3M A;  4CLZ A;  2GVD B;  3Q23 A;  3EZO A;  1T94 A;  3PR4 A;  1N4L A;  3KLF B;  3M2U A;  3TUI C;  2VBW A;  2MKI A;  2OPR B;  3DM2 A;  2VB6 A;  4K59 A;  2GS8 A;  2HBZ B;  1LWE A;  1TL1 A;  2V9K A;  1SKS A;  3I5C A;  4PG6 A;  5L1L A;  2GJI A;  3P5B P;  1FD8 A;  2Y8Y A;  3OTE A;  2UV8 A;  3M2V A;  2HRT A;  2NRE A;  1GEH A;  4LVN P;  2HHQ A;  4ER8 A;  2VFU A;  4MK9 A;  3MD1 A;  2Y1I A;  4L3N A;  4N7T A;  3NNH A;  1N5Q A;  2ZWO A;  3CCZ A;  3DXB A;  3K5O A;  3G82 B;  4ZKA A;  2F3J A;  3BH7 B;  1B0P A;  4PWD A;  4EBD A;  4CO5 A;  4ZIW A;  1ELO A;  2FVC A;  3CTR A;  1GMW A;  4B9V A;  1HQE A;  3DMJ B;  3KLH B;  2R7S A;  3FGV A;  1YKW A;  3HT0 A;  3W2W A;  2FZK B;  2H1Y A;  1XTZ A;  3LW5 C;  4ZLP A;  3TO8 A;  3TJ9 A;  1RI7 A;  5J2Q A;  2YWH A;  2DD8 S;  1YGY A;  3GJQ B;  2B9E A;  4RUB A;  4C0O C;  2G1H A;  4K2J A;  5HMW A;  5KFY A;  3NGS A;  3NBP A;  1WTB A;  4MFB A;  3C8Y A;  3OTO F;  1TL3 B;  1FWP A;  2VPZ B;  4IR1 A;  5F3T A;  1FI4 A;  1HD0 A;  2YX1 A;  2XMV A;  3QGP A;  3MXH P;  2RU9 A;  3ENA A;  5DLG A;  3DLE B; 
#chains in the Genus database with same CATH homology
 3A3P B;  3A3N B;  2W2N P;  2ZWP A;  3P5B P;  3VV2 B;  2Z58 B;  2W2M P;  1SCJ B;  4OV6 A;  2E1P A;  2Z57 B;  3H42 A;  4YN3 B;  1SPB P;  3WIU A;  3SQO P;  3GCW P;  3WHI A;  3BPS P;  3VHQ A;  2Z30 B;  2XTJ P;  2ZWO A;  3CNQ P;  3BGO P;  1V5I B;  2PMW A;  2W2Q P;  2QTW A;  2Z56 B;  3GCX P;  2Z2Z A;  3A3O B;  3T41 A;  2W2P P;  2Z2Y B;  4NMX A;  4K8R A;  1ITP A;  3CO0 P;  3WIV A;  1R6V A;  4JP8 A;  4NE9 C;  2W2O P;  3AFG A;  3QFH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...