2W2OP

Pcsk9-deltac d374y mutant bound to wt egf-a of ldlr
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
92
structure length
92
Chain Sequence
TATFHRCAKDPWRLPGTYVVVLKEETHLSQSERTARRLQAQAARRGYLTKILHVFHGLLPGFLVKMSGDLLELALKLPHVDYIEEDSSVFAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROPROTEIN CONVERTASE SUBTILISIN/KEXIN TYPE 9
publication title Structural and Biochemical Characterization of the Wild Type Pcsk9/Egf-Ab Complex and Natural Fh Mutants.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/receptor
total genus 21
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2008-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF05922 Inhibitor_I9 Peptidase inhibitor I9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 2w2oP01
2E1PA 3GCXP 2Z58B 4JP8A 1V5IB 2W2MP 2ZWOA 2W2NP 3CNQP 2ZWPA 2W2OP 4OV6A 1SPBP 3GCWP 3WIVA 3P5BP 1ITPA 2Z2ZA 3H42A 3SQOP 2W2QP 2Z56B 1R6VA 2PMWA 2W2PP 3BGOP 2Z57B 4K8RA 3VHQA 2QTWA 3AFGA 2XTJP 3CO0P 4NMXA 3WIUA 3WHIA 3VV2B 2Z30B 3A3PB 4YN3B 1SCJB 3A3OB 3QFHA 2Z2YB 3A3NB 3BPSP 4NE9C 3T41A
chains in the Genus database with same CATH superfamily
3HHLB 4J9VA 2CKWA 4CLSA 2CYYA 4P73A 1R8AA 1YJRA 3FRZA 4CLWA 1NHKL 2BA9A 5CXTA 5KG3A 4B9UA 1MN9A 4YB5A 4DL2A 5F8JA 1N36J 2IAJA 3SYZA 1RHQB 3PYFA 3MD3A 3VWSA 4RNOA 5ETOA 5KT4A 1IVZA 4X4TA 4A46A 5DS7A 1RT7A 3DLGA 1SKWA 2HQDA 2DRAA 1R31A 4E8UA 4E98A 1X4CA 8ATCB 4WKRA 5B0AA 3Q24A 2B9YA 3ZZYA 3KHHA 2IDEA 3DLBA 4F0MA 4F4AA 1U0HB 3FC9A 1QVGR 1VRQC 3NLCA 5CCLA 4DFMA 3CO9A 4E2FB 2DHHA 4OLPA 4H4MA 4LF5F 1UFLA 2GHWA 1PG5B 1KQGB 2XLJA 3L9ZA 1Q95G 4XAKA 4EGLA 5GAGI 4YDDB 3HHDA 2FJDB 3MM5B 2HNYA 1IWAA 2DPJA 1KONA 4UF4A 1OMSA 2RIJA 4LSNA 3S7RA 1YTYA 3KLEA 3M8PB 2BJ7A 2LEBA 4ED0A 2R7TA 3CW2C 2RDDA 4LSLA 4J90A 2V8VA 1M1HA 5GAGU 2V4RA 4C8MA 4YHHF 1R8BA 4JBCA 5KAKA 2CRLA 4P7TA 1N56A 5HP1B 1HL6A 1HNVB 2DR8A 2WONB 1GMWA 1RB0A 2WTFA 2Y1LB 3QIPB 2ZNYA 2VC0A 2W01A 3D7SB 3R5AA 1QUVA 1NUEA 1VQ6S 4QBUA 2J9DA 1TUGB 2LDIA 3ZC4A 1WELA 4OI3A 1VBXA 1YG0A 1T03A 2FYXA 1BLUA 3K57A 1UPPA 5HJXA 3Q0AA 4GC6A 2R2SA 4LF7F 2MGZB 2JOQA 1QDUB 3X1LB 1S1VB 5ETNA 3V4IB 5K8OA 1AZSA 3O6QA 4QIGA 3W5XA 4I68A 4I2PA 3W9IA 5I3PA 3E51A 1UVKA 1YX2A 4BWJA 2DNNA 1WC1A 4F4YA 1EQMA 4ICLB 2QA1A 2HWIA 4F3OA 2V63A 3TZYA 5FJ4A 3DXSX 2ILZA 2VZ9A 1RYSA 1FEEA 1XR7A 1HHQA 4ZK7M 1NSKL 4HH0A 2V9WA 4I0WA 4WP8A 3V5RA 2HIYA 5H1SV 3PRBA 1DQ8A 3AJDA 4XK8C 5KFGA 2FJWA 3HVAA 3VAFA 2B56A 1HNIB 3W64A 3NGKA 2IM3A 1WOOA 4LVNP 1DAXA 4K2XA 2XS2A 5EDWA 3EZOA 2NUUG 2OPQB 4YR3A 3L7OA 2J6SA 4ZPWR 1S1WA 3RAQA 4NL5A 1EP4A 3UNYA 1DLOA 3ICLA 4Q43A 1B3TA 3AD8C 3MFIA 4LF8F 2XS5A 3R1LA 3VAHA 2CNOB 3H4BA 2DYAA 4A8MP 1VQLS 2HWTA 4FVMA 3OHBA 1F2GA 2AJ2A 3DGPA 1GFWB 3HFVA 3IR6B 1NKCA 2I2YA 1RT6B 4DFPA 1FRLA 1J5OA 2QG9B 3GV8B 2KRRA 2MKIA 3OTBA 3UQSA 3HVTB 3C15B 2GIQA 3MI7X 2CZVC 3L09A 3W7BA 3AA9A 2BANA 5I4MA 3M2RA 4R5PB 3T9NA 4K50A 5JXSA 2HHVA 4RBUA 1K1QA 4KB7A 1HKAA 2NXUA 1DTQB 5E7OB 3KK3A 3HI9A 2BJ9A 1D9DA 2BABA 1X9WA 1RT5B 3OSPA 4FXVA 4GVBA 3QMQA 1PKUA 1NMEB 2P8IA 2MEWA 1OY6A 4X66F 4CP5A 5A2QY 4Q7AA 5CZXA 4IH5A 4PRFA 2QLBB 3GONA 2LFVA 3T41A 2DHXA 1ROFA 5IM0A 3CIZA 2RD5C 4M5DA 3HT3A 2IY5B 2B51A 1FKPA 4CO1A 2HHXA 1SUQA 2DJWA 3U02A 1HI0P 3MTKA 1EB0A 2J7KA 4IH6A 4A47A 2BKPA 4NYPA 3E01B 4ED4A 4ZVPB 3DYAA 4QYZK 3H5UA 3HSDA 5KFZA 4KH1B 3HHLC 3DC2A 4L6V3 4N7TA 4WKYA 1FXLA 3PM9A 1RWNB 4NCGA 4ID5A 1OSCA 3I96A 2MZTA 4P2XA 4RW4B 2MY7A 3M2VB 3GPAA 1JLBB 3GFYA 2X3GA 2VU5A 1ACMB 2FTRA 3TX8A 3TVKA 4N8OA 5L1LA 2RQKA 4EBDA 1OY9A 4DV1F 2XMWA 2GMHA 1VCTA 4NLRA 4J9SA 1FXRA 2PI4A 3PW2A 2KT2A 1G3OA 3KG4A 1C1CB 3RU0A 4WP9A 2E29A 3IS9A 3IM9A 3J80U 1S49A 1EJ7L 1X4EA 2UVUA 1O5JA 2ZM6J 5CABA 4I67A 4JI5J 2YKOA 1U1MA 1TV6A 1S4FA 3S6EA 4I7FB 2F4VJ 3I9ZA 1YBTA 4M5HA 4ECRA 4ELVA 3OL6A 4PEOA 1WF1A 2DPIA 4ANDA 1U6ZA 1Y0HA 2VOPA 4PQUB 2E7VA 3PJ9A 4WCEQ 4TU9A 1RBLA 4KHPJ 1X7VA 4YP3A 1JLAA 1IKXA 2NXCA 3F44A 4OX7A 3R3TA 2OI2A 2XM3A 3FBBA 2KVIA 2XNQA 3N01A 4KFBA 2FLLA 1KLMA 3Q86A 1T7PA 4PG5A 3H8YA 4AFFA 3JXOA 2RF2A 4K4SA 3ELHA 2MTLA 5K8NA 2HIQA 3QGIA 3UVJA 2UV8G 2HHWA 2UZAA 4ZHRA 2KG0A 2YWEA 4DV7J 2N4DA 5K8PA 3M05A 1TMMA 1SPBP 1IKVA 4M5GA 2CAJA 2O66A 4V1Ak 2B8PA 2OGUA 4RW6A 4WE1A 2NQPA 4E0DA 4DR1F 1JKHA 2R7RA 3IGNA 3EVOA 2I5JB 3LQVA 1K8AT 4O4GB 2ZE2B 5B0GA 3GMGA 2HHHJ 1ZM2A 3R6LB 1UAWA 1SL0A 3GSIA 3IMQJ 3CCZA 1U1PA 3NBPB 1Z4UA 3H98A 2Q1LA 3PRVA 5HJYA 1VQ9S 5IWAJ 2A18A 1IBKF 4NEZA 5IV3A 4DZ6A 1S9GA 4X4NA 1M0SA 1TL4A 2DBBA 2ZOGA 3PDNA 2MZ1A 4DR7F 1TKXB 3MPUB 2CVEA 1JLQA 3G8TA 4WTYA 4DMZA 3Q8PB 1H6KX 3NP5A 4EBCA 1RACB 2KTQA 1PCAA 2Y1JA 1BQNA 2FD2A 3VV2B 1Y5IB 3HVWA 2RKIA 2BR0A 2AT1B 3PEJA 1VLYA 2QLJB 3TJ9A 5CYMB 2Y3YA 5KFOA 1YGYA 1V6HA 4DFKA 1HR0J 3NGRA 2QN6B 4HI1A 3T19A 2IMWP 5CZVA 2M8DB 4S0MA 2ZWPA 4WFYA 2MKSA 1FJEB 4CYUA 1WC3A 4MK8A 3DRRB 4DV5F 5IOLA 2D7SA 2BACA 2M5YA 4OHYA 4ES3A 1EARA 4QWBA 3P8BB 3SQGB 2RHSB 3MAAB 1L3UA 2W2PP 5D4PA 3THPA 3TQ1A 3HZEA 4J9MA 3D3BJ 2E5LF 3T1YF 2UUAJ 3M8QB 3CC7S 3GWCA 3W9JA 3TI0A 3OFFA 5AXLA 3BZQA 4NZ0A 4LFAJ 2VF3A 3IRWP 1UWBA 4ZLJA 5G0RB 2XG8A 2JRSA 3V2UC 2AWZA 3BBBA 4A8SA 3EXCX 3EVWA 3L7PA 1RAEB 1EETA 3VVUA 5IZHA 2CIMA 4I2QA 4B3OB 1S59A 3MCSA 1N5YA 1H98A 1RHUB 3GILA 3R7NB 2JL9A 5CYQA 1CULA 3MPDA 2VPYB 1TK8A 3MFHA 1VC5A 2IYIA 4RUBA 2R7UA 3EMTA 4KO0B 3NS5A 4GKKF 4Y2MA 5AXKA 2QL5B 4NLQA 2VA3A 1LW0B 4DN0A 1TMJA 3BGRA 1UA0A 1C0TA 1C4AA 1NM2A 1G6BA 1U47A 1R0BG 4DF8A 1AFIA 2V69A 1HHSA 1S6OA 3THTA 3B54A 3AQOA 2J7WA 1AB8A 4G1PA 5H9EJ 2CQPA 4IO9Q 2FIUA 4QR2A 1NSQA 1RA7A 3A8IA 2XZWA 2PA8D 1PAUB 3W2VB 4F2SA 1GMWD 5A8RA 4Y34A 1NSPA 4RW8A 2VA2A 3IG1B 2W7OA 5D0EA 4ZITA 1KVKA 2HVHA 4TQRA 5KFNA 3OR1B 4B3SJ 1UCNA 2CDRB 2LQBA 1RHJB 2X1GA 1BWVA 2K7JA 3NXZA 2DO4A 1WG5A 3KLHA 2JFKA 1TZ0A 3HULA 2LQ9A 5F8IA 1WC0A 2R8KA 3G87A 2KHDA 2IIHA 3D1QA 5D3GB 2WVBA 2IM1A 1Q1KA 1ZOTA 9ATCB 1VQ7S 1M5OC 4U7UD 2XLKA 3FGVA 1S97A 3RAMA 3DM2A 2D9OA 3IBFB 2MB0B 5J2PB 3OTCA 4ZOSA 4MJKA 1XWLA 4EYHB 3KG1A 2B4UA 2J5AA 1HMVB 4CTAA 3D54A 4DPYA 4CO0A 4MIAA 1N5TA 1KEKA 3C46A 1IBMJ 2ZH3A 1JIHA 1YJVA 1Z2ZA 3CMAS 5K14A 3JQJA 3OQ2A 4BC9A 1WORA 2AEMA 2PMZD 4YUDA 3KJVB 1CVJA 1N0VC 1ZA2B 3WIUA 2LXUA 1F9HA 3C6TA 4KH0B 3BN7A 1JJ2R 1F0XA 1W7WA 1TU0B 1TL3A 3OL9A 1NDCA 2DR7A 2GV1A 3M6UA 1B64A 4DSFA 2PO4A 4D3GA 1SJ3P 4QQBA 3OBIA 1NK9A 1LWXA 1O8BA 1X31C 1H7XA 1WEYA 5GAEU 3D3CJ 2AZ1A 3K5MA 5F8NA 1RTDA 2YVSA 2ROEA 3FFIA 2DITA 2GA7A 4RU2A 1UJ4A 2HVZA 1VOMA 4LUBA 3NNCA 3W66A 2MPUA 1NZAA 4KGMA 2XO7A 4YQWA 4HL9A 1FA0A 4IRKA 1VQSA 5A8WA 1ZS6A 2HMIB 2R2RA 1H2TZ 1M5HA 3TQEA 3CJRA 5I3UB 1WG4A 4JI3F 2YXLA 4WFZA 2JC0A 3OVAA 5DG9A 2CPFA 5HI7A 4L76A 3EUNA 1TFYA 3IR7B 1GTHA 4F0HA 3DLLQ 3M2UB 3TEGA 1M5SA 4O3OA 1IJEB 1T0TV 2VBZA 2AF6A 5CQGA 1WACA 4TQSA 1AW0A 4ED7A 2C2NA 3P5TL 3TO8A 3MPYA 3OSNA 2KM8B 3MAHA 1BHNA 2BMBA 3QSYB 2CQGA 1XMBA 2MHNA 2Y1RI 4RW9A 2DIUA 2DXFA 2UXBF 4C8NA 1TK0A 3VGTA 1DQ9A 3CCJS 1LWCB 2BE2B 1KS2A 4ANEA 4O44A 1XMQJ 3GV7B 2VFVA 3OTDA 2GO9A 3FUYA 3NKYA 1X60A 3H25A 7FD1A 1S1TB 4KGZB 4PG7A 1RWUA 4B3RF 2V50A 3Q2SC 2J6UA 1SH2A 3SCKE 3LPYA 2VG5A 3PY8A 2GIFA 4OZ2A 3RUBL 3MEEB 2U2FA 3M6WA 4J9NA 4A4JA 4LBIA 5J2NB 4LF5J 5LL6d 4P2MA 3QRRA 2ZD1A 1PJ7A 2R2TA 4YY3F 1S12A 4RUHA 1PJ5A 4A8KA 2XSFA 1HPZB 2E9TA 1CLFA 3OV7A 4LJMA 4OIXA 2FZKB 4WK3A 4OZ0A 1IWGA 2CQDA 1RP5A 3CJSA 1J2VA 3TJAA 5AXNA 2YKAA 5FDLB 4LFCF 4XO0A 3NG8A 2V2KA 1E6VA 5D8HB 4KBIA 5J2MB 1P1LA 2BJEA 3AD7C 1RTHB 1TAUA 1E6YB 4YHHJ 3U1LA 3W5ZA 5KG0A 4FYDA 2LQ5A 2K1RB 2G1DA 1EKRA 3HSZA 2DEJA 2UVVA 4F8RA 2DNLA 4Z7YA 4EMDA 1NJWA 2UUTA 5BYQA 1LFPA 3HF5A 1ZAVA 2NZ4A 2ZVIA 3ULHA 2OD6A 4DSLA 4FYXB 5DDRC 1TKDA 2CPHA 3JQKA 1UEUA 2GHPA 3TP2A 2P2CB 4PAAA 1YJWS 2HHQA 1O0PA 3SDEA 4QW9A 2VH7A 1SQEA 2IPOB 4LIWA 4KKOA 1G4CA 5G4DA 4RU9A 1QE1A 5HBMB 4TY8B 2AYMA 5E41A 1QJHA 1X4FA 2AMCB 5SZTA 4HLBA 1F9EB 2YNFB 3BKFA 2QMWA 2CADA 3NCPA 2C2ZB 1KHVA 1IJFB 3KK1B 3D6HB 3POTA 4ZP7A 3PW5A 4DXLA 2HHSA 1YRTA 1XMOJ 2VQFJ 2MDAA 4K59A 4ZCIA 4WXWA 3LAKA 2OTJS 4DSIA 3M1VB 2WAQD 4NI2A 4Y65A 1ZPVA 2VPWB 2OPSA 5SUHA 2UUCJ 3PHTA 3R8YA 3T9ZA 1TL1B 3UN2A 4RLEA 1T3NA 2EBGA 4QIVA 4WJBA 4ZJQA 1T9XA 2VG7B 3AHPA 3NAHA 2HNDB 1HNXF 5FD1A 3R5JB 3BN4A 4M8LA 2CPXA 3M4XA 4IFVB 4LF8J 2HFNA 4PG6A 1HHTP 3IAM9 4ED2A 3RTVA 2KZMA 2QYGA 2W9CB 4Q2LA 3QJPA 1SQFA 4JI0F 3Q83A 5D4LA 2F8MA 4CO5A 3GCXP 3K0JA 2YQ0A 1U02A 3N5BA 2G2ZA 4IG0B 3B82A 2JEGA 2CZ4A 3PO5A 3PX4A 5DDQC 4DF4A 5ETLA 2VICA 2Z30B 4P7VA 3TWZA 4EO6A 1XR6A 4CO4A 1SIZA 4IDKA 4IYQA 3HXMA 2NR0A 2W25A 2FDNA 2EFQA 2CQ3A 2QSFA 3JAMY 1HYSA 1RI7A 3J7YI 2ZBPA 4NXNF 1J5EF 2MY8A 3KHGA 2V4JA 1K9MT 1TUWA 2UXDF 4LF1A 1KLNA 2K8GA 4NA3A 3CDBA 3N6MA 5IT0A 3TANA 3FDSA 1FTCA 2HGLA 1TK5A 1N36F 3QZ8A 3RRKA 3N28A 4DX5A 5HMXA 3QPIA 4H4OA 1NDPA 5KFHA 2YX1A 5IT9Y 1SC1B 2Z4PA 5LJ5Y 4X66J 2KFYA 1HIYA 4L3KA 3N0VA 1S77D 1I3OB 2ABYA 5KFVA 3KHLA 2JC1A 3MM7B 3HKZD 3R7BB 5J1EA 1N8RT 4XPEA 4CLKA 5KFQA 1RLCL 2VFSA 1HBOA 1Y7PA 2EG2A 1NBEB 2FHOB 2CVIA 4DG1B 2V67A 5CH7B 5C24B 2B6AB 5LXYA 4P2SA 2O1PA 3JYTA 5H9EK 4DV0F 2XBPA 1FRMA 2KVQE 1C1BA 2APOA 3GTYX 4C8ZA 1RE1B 1Y5NB 1S9EA 4IRCA 1ZBTA 2KM8C 2ZH4A 3BYPA 3UDLA 3CCMS 4QWEA 3MXHP 2JEJA 3IAS9 3SFGA 3TUZC 2DTJA 3MM8B 3OFGA 1S6QB 2XY7A 1VBZA 2X7IA 3ZZUA 1S79A 1V3SA 4LREA 1XR5A 5CD4A 4K4XA 5B0FA 1T9TA 3FRYA 2AGQA 1FVSA 1LW2A 2MQQA 2LXFA 1N5VA 4MYUA 4A8QA 5LOQA 2OPRB 2QYCA 3NMAA 1D3WA 2FHKA 4KIAA 1WEZA 5KG5A 2IHR1 3UDEA 1RT7B 3D2WA 2HRTA 2W2QP 4USTA 2A6MA 1VBKA 3CCQS 3C16A 2MQLA 3HSJA 2KFZA 4ZLLA 3HSGA 3MCNA 2E44A 1KFSA 2W9BA 1DJ0A 1YJ7A 2P6TA 3SFUA 1MW7A 3ET6B 3GV5B 4GRSA 1MN7A 3KG0A 1CQMA 1KC8T 5AXMA 2KYXA 1N34J 4K4UA 3NNAA 3SCIE 2MQNA 2X1FA 3BM7A 4BDPA 4CCHA 2A10A 3R97A 3SQOP 4G1QA 2ZNZA 1FE0A 3E3XA 4QW8A 3PV8A 1H73A 3GR1A 4PZVA 3NGDA 4KY3A 3B4DA 3KLEB 4JV2A 3QO9A 2J6TA 4OZLA 2P5VA 1T9WA 2AU0A 4ED3A 3DOKA 1OS5A 1ZH5A 5DZ7A 3KLGB 2VG6A 3NCRA 2GAHC 1VQ4S 2W8KA 3O3LA 1I51B 2BYCA 4DR1J 4B02A 4ZJOA 3GSDA 3W2WA 2VPXB 1N54B 4ZVTB 4YEAA 2AJQA 2BVZA 1KN6A 4WXOA 1RT2B 3CJ0A 1FFGB 1HBMA 4J5OA 4ID8A 1S1UB 3FQKA 3CD7A 4DUTA 2LEPA 4QCLA 1FRKA 4PWWA 3OW2R 3SBMA 2XMMA 4ZN3A 4U8VA 3O5TB 1C4CA 1IBKJ 1FVQA 4PUOB 1AZSB 1RU2A 4DX8H 2DR5A 5T14A 1IM4A 3T1HJ 1JLGA 4I2PB 4LRCA 5LSOA 3NGTA 4PWDA 4J9RA 4P72A 3H20A 4ECTA 1DURA 4DR7J 3CPWR 3AH6A 3UCGA 1DTTA 1HNZF 3BREA 1JQGA 1YJUA 2ZITA 4NX9A 3ISND 2VDHA 1Q0NA 1FDNA 3W63A 3TNVA 4OYBA 3ILOA 4LRAA 4IUFA 3L4BC 2E1CA 2AHOB 4AQYF 5KFYA 1D8YA 3RG6A 1S6PA 5LMUF 3BDPA 5EUHA 1XC9A 2PEBA 3ZFVA 3QBCA 1UFKA 2VFTA 3QLHB 3TARA 3MMBA 5KT5A 3GZ7A 3J7Z5 5DETA 2F8EX 5C42B 5A8KA 1VISA 4JB8B 1U1QA 4IOAQ 3HT0A 4DV5J 2RH3A 1SJ4P 2XSJA 4MH8A 2KJWA 2HNZB 3DGPB 2EFGA 2WK4A 2LDYA 1C0UA 2LQJA 3PYGA 4PXCA 2AKWB 4O3SA 3ILLA 1XNRJ 1J5OB 1QAIA 3AJ2A 2E5LJ 3T1YJ 3W5YA 3TYTA 2ZKUA 3OL7A 5H9FK 3GLJA 3BQ1A 3PX0A 5DM6Q 2R8IA 2UXCF 5KFXA 3BGUA 1JLFA 1XERA 4NCBA 4DCPB 1CS4A 1R0AA 3M2RB 3GJTB 3MUVP 5KOXA 5D0HA 2VBWA 1X4BA 2HURA 4UY85 3TAPA 1HNWF 2GJFA 2MXYA 3KUGA 3PEHA 3KK3B 1PBAA 2EK1A 1LXNA 2F3JA 5DGBA 4GVBB 3NL0A 2E1MC 4B9LA 1RT3B 5ETVA 1FFSB 3IN5A 1FO1A 4GKKJ 2WSCC 3NOCA 4JI5F 3DMJA 5C5JA 1ZTWA 2DY1A 2MHEA 1FWPA 3OR2A 4RUCA 1F6TA 3ZZTA 4ELUA 4OMFG 1KQFB 3V81A 4QYRA 4L3NA 3LO3A 2CG8A 1UFWA 1UW9A 4M5DB 1QAYA 3ZZRA 4N77A 5M2UA 3D5MA 1FKPB 3TUIC 4M63A 1VGYA 2HS4A 4LIRA 1K73T 1RAHB 4ZPBA 5IS2A 4HHUA 3WIVA 4URQU 1TTHB 2ZH7A 4X65F 1HQEA 3MECA 4GO7X 1SVDA 3CB4A 4URGA 3H59A 2KXFA 4KHRA 1U8WA 4QR0A 2L9DA 1X9MA 1B99A 1N33F 4MFBA 3J7A1 1YBUA 1T8EA 3UD5A 4NCGB 3I5CA 4ZVEA 4ID5B 3UN3A 3THVA 3FEZA 2X1AA 4MIWA 3I87A 1VBYA 4OX9J 3DKDA 4K2JA 2DGXA 3MAQA 2J9DE 2LU1A 1RABB 1FKAF 4DPWA 1GXUA 1U0HA 1GX5A 5HLFA 1GMUA 3CJ8A 4RJVA 3GCWP 1CJUA 2DNKA 1U1LA 2UP1A 2GJIA 5ETMA 5MLCV 3IS9B 4L75A 2BV3A 4FKYA 3VQSA 1VRTA 3D0HE 4URSA 3DFEA 3MM5A 3Q8YA 1TV6B 1S48A 1FE4A 2CQ4A 3MEKA 3P96A 3WZ0A 3VCDA 2DEIA 5IWAF 1GX6A 3M8PA 1YJ9S 1RAOA 4FPRA 1A9NB 2VHGA 2V8DA 2C2EA 1KDNA 1R0CB 2FLPA 3ISZA 3QGHA 2FJAB 3A3OB 1S72S 4F50A 2YX4A 4HACB 1ULRA 3L3CA 1UTAA 1JLAB 1MWQA 1IKXB 3EZUA 2H51B 2BQ3A 5C25A 1FJGF 2DNOA 2W2OP 4JYAF 1L3TA 5KFBA 4N47A 3AJ1A 4ERDA 1RAFB 2V2QA 2RDJA 3DI6B 4N8NA 1RYRA 4DQSA 1SC6A 2RF2B 2Y9HA 2CWKA 5EN1A 3BGLA 4EYIB 3UVJB 2NREA 4LF6F 4DPXA 2JDJA 2WVCA 1TVRA 1Q8BA 3U7JA 6FD1A 3V6JA 4WP3A 4JI3J 2W4CA 2CPJA 4CM0A 3SIPB 1JKHB 1FRJA 4AT1B 4UOGA 3W9HA 1P1TA 1VIOA 1PSDA 2ZH2A 4KGVB 4WFXA 1HWJA 4KGKA 4EI2A 1RHMB 5B09A 2FGCA 1H38A 2VDIA 5EX0A 3AB2B 2MLYA 5B08A 4C0BA 5E2QA 3I6PA 2UUAF 2C3UA 1WD6A 3CULA 1D9FA 2G0CA 2XMVA 1HNIA 2Y8WA 3MM9A 4GO5X 4G6VB 1U09A 1ZM3A 1KOHA 2OPQA 4EBEA 1T94A 3NNHA 5E3AA 1H0HB 2UXBJ 2UVRA 3GFZA 1R7IA 1BY9A 1RADB 1X0PA 2VASA 3ITHA 4DV2F 1IQTA 2HVEA 2B9EA 4DUYF 2DB1A 5KFLA 2KFNA 4ZVUB 4H4KA 2V94A 4I6WA 1R6YA 2J0QD 2ZBQA 4B3RJ 2FLOA 1NJZA 4G65A 2L48A 3ZTQA 1BQNB 1QAXA 2MZSA 3VAJA 2W2NP 4C3LA 2N7YA 2E9ZA 5LSRA 3HVTA 1LK7A 2JZ5A 3PFEA 1YDLA 4O0IA 1PBUA 1F9FA 1JMTA 1B7FA 3FCHA 2P9GA 4OZ1A 4YY3J 4R5PA 1Y4ZB 2FUG9 5BJRA 2BJDA 3AA8A 2HZAA 3DLHA 2B4OA 5KT3A 4ZCKA 4QYZJ 1KVJA 4CYUB 1DTQA 4NLVA 2XY5A 4X4UA 4DX6A 3GJQB 4LFCJ 1S0MA 4F36A 1GNKA 4NYZA 2XCPA 3VAIA 3F41A 3UW1A 3GYXB 4ELTA 2I8EA 1Y9OA 1UMJA 1U48A 1WTBA 3W61A 1FDBA 2QC3A 2EFPA 2DGOA 4O0NA 2WSEC 1L3SA 1X5OA 4OHXA 3LUYA 2DGUA 2PMHA 1UWBB 3H7HB 1RAIB 3K17A 1DRZA 2JVOA 2R3VA 2E5JA 4DL0C 2HPUA 3TAQA 2Z0GA 3CDAA 3M30A 3CJKA 2B7CB 1VYAA 2MQPA 3G71S 3BSOA 1TFWA 2R7WA 2JLGA 3PIOQ 2CJ9A 1RKJA 3BDEA 2WBRA 5KFCA 1NK0A 2ACYA 5GMEA 1FF2A 2I6WA 3K8VA 4C8LA 1TR0A 3DU5A 4WU2A 4FPIA 5THWA 2RB7A 4ALZA 4W92B 1UETA 4HTJA 1C0TB 3GJRB 1KWMA 2VQEF 3QT5A 4RW4A 3ETOA 1JJ4A 1VRUB 1HQ2A 3HD1A 1K1SA 2BKNA 2B5JB 3OJSA 3RRGA 4A8FA 3A8JA 4C6AA 2ILYA 1WNEA 1YI2S 3JSYA 4ILMA 3GYNA 2IM0A 2ERRA 3D6TB 4AXJA 3NCQA 3N9UC 4J7CA 1C1CA 1HWLA 2JSXA 3IGVA 1R8CA 3J81j 3MURP 5A8RB 2HLTA 4RW8B 4Y2KA 4FYVB 4P6QA 1UEKA 4I7FA 1RK8A 4DR5F 1BC6A 4OYIA 1HNXJ 3KLHB 1BMQB 3BBFA 2FPHX 2NSBA 2B4VA 2WHOA 3M8SA 4PQUA 3HHNB 3DM2B 4U95A 3WC0A 1P27B 3BSAA 5FLXU 1Y3JA 2C2DA 5IT4A 3QIDA 1HI8A 2IJNA 1RISA 1FKOB 1RAJA 5HN0A 4CTAB 4ECVA 1NU4A 3D0IE 4M1KA 2ZJRQ 1TQLA 2DK2A 2CNKB 4KPCA 3AOAA 3H40A 1J5EJ 3QGGA 2QL7B 3PCOB 2UXDJ 5T7LB 2JX2A 2YNHB 1HBUB 3I5BA 4PPZA 5GMKa 4DCOB 4FKXA 1P6TA 1KNZA 3A3PB 5A6PA 5B0EA 3C6TB 1CJKA 3I4PA 2J7UA 5HANA 4DCJB 2K3KA 2GZOA 1TL3B 3EM1A 4OZ5A 3ILIA 1XMQF 3US5A 3VAGA 3WC2A 3BV8A 1SI9A 4JUZA 1A0OB 2I5JA 2IMOA 1IN0A 3SSQA 1BD6A 5AT1B 1ZPWX 2RSQA 1XBWA 3FMBA 1T3OA 3LP2B 4Q0BB 2ZE2A 1WHYA 2FJVA 4PWUA 2RUSA 2ZH1A 5E5NA 1RUSA 3O1LA 3FFIB 1QAJA 2YY3A 5A2QU 2RNEA 4Y2AA 3UFCX 5KTQA 2RS2A 4F4XA 4JI6F 1SJQA 4OYPA 2KU7A 1R43A 3RB3A 4DV0J 3IA0A 2A3JA 5L1IA 1OQ6A 1WDDA 1LOUA 2FB0A 1HQUB 2XMTA 1QTMA 1YLXA 1DY3A 2BKOA 3K8WA 1CJTB 1T05A 3LWMA 5E33A 1B0PA 4N76A 3V6DA 3O44A 1XJWB 3I0RB 4ANCA 1VS3A 4C3KA 3P49B 2VV5A 3GIIA 2Q6CA 2VODA 2C22A 5CAAA 2A2DA 1YRUA 2DO0A 4KT0C 4IO1A 2YPZA 4RWWA 1K44A 5ADZA 4C98A 1JWWA 2RUGA 4X62J 4RBVA 3B8HA 2F9DA 1G2EA 3AD9C 2MSSA 2GVZB 4P10A 5J2QA 1YJNS 2PT0A 4OV6A 5KFIA 4DPOA 3SZ2A 2AJ4A 4YR0A 4ZVGA 4OI1A 4DR3F 4CQ1A 3BQ0A 5F8HA 1YK9A 2QIFA 4X4SA 2OAUA 3SQGA 3MAAA 1OPIA 2VG5B 1P9QC 4MK7A 4YS2A 4OZJA 1I5OB 4ZMMA 5AJ3F 3Q8QB 2CJKA 3RW6A 5MAOA 1T9UA 2RU3A 4Y00A 1C2PA 2X3DA 2O3DA 3SXLA 5K5MA 4ZPVR 4QWDA 1BUXA 3ZTPA 1XMOF 5BYSA 2YH0A 2VQFF 1ZETA 4B3OA 2Z58B 3GU0A 4WIQA 1H3DA 2LU2A 3QYYA 1FNXH 3KK2A 1V5VA 4F02A 2U1AA 1RA6A 3MCMA 2DR6A 2Q66A 3M9OB 3FBEA 3DLEA 2UUCF 1RAAB 2M2BA 1FFWB 3PYDA 3A4TA 5GVQA 2MSTA 3CUNA 1LWEA 5CD4H 1LW0A 1ICEB 1N88A 1S0OA 4PXBA 2Z2MA 1H74A 3JSBA 1ZA1B 2OP5A 4GKJJ 1N6QA 2KJVA 3HLUA 2MKHA 5CYJA 3P3DA 4ECSA 4U9RA 4TU7A 2W8LA 2D41A 4DQIA 3D6MB 1N5QA 2OPPB 2WCXA 4RO0A 1NK8A 1EKSA 2IC3B 2C1EB 3W2VA 2Z2LA 4GC7A 2QLXA 2J0WA 2H4WB 3SEOA 2F8HA 4P52A 3IG1A 4O3PA 4CNZA 2I1RA 1IBLJ 1BQMA 4UOCA 1IR1A 5KFJA 2IVFB 1HNZJ 5HQ8A 2B9WA 3PTWA 4PABA 1VIXA 3HHKA 4B17A 1T02A 4I64A 3BO2A 6FDRA 3POTB 1FI4A 2ZH8A 1EHWA 3EPGA 3K5LA 5J2PA 3UD4P 3FVYA 4L74A 3HD2A 4LF9J 2XC9A 1WUUA 2XZDB 4Q45A 3DGVA 4AQYJ 4NI2B 4EZ6A 1PJ6A 5GAHI 5LMUJ 3CXCR 1MWZA 1CC8A 4OYOA 2VJUA 2MMYA 2B9XA 4FS2A 1DQAA 2IA6A 2DXEA 1CQNA 1B4SA 3LPEA 2K3IA 2NXJA 1WI8A 5GAHU 4OZNA 4C9DA 3HCXA 4OJ1A 3RW7A 3PW7A 4X4OA 4YB1P 3MD1A 3FKBA 2C42A 2FHMA 2KI2A 2EWHA 3W60A 3CO0P 1XTZA 4WU3A 1RKIA 3DRPA 2GGPA 4ES2A 5KFPA 4OYZA 4V19J 5BYRA 4QIWD 4B9MA 2YWGA 2LVWA 4IDKB 2NYHA 4K4WA 1F1BB 2WW8A 3RR7A 3H90A 2MJUA 5KFEA 4JI7F 2UXCJ 3TUJC 2QMUB 5D15A 1CJVA 3RAXA 1LFWA 2QEXS 4C8KA 2V4JB 5T41A 4DPUA 1HNWJ 1RLDA 5A76A 3QGPA 3VVTA 3KOAA 3ZNJ1 1SJRA 1KQKA 4UQGA 2DNGA 4KGXB 2H5EA 1UVIA 1H2UX 1X4AA 2CUYA 4EEYA 5M2PA 1UWAA 4H4OB 3ISNC 2ZBIA 1CG2A 4DR2F 3CJ3A 4IR1A 4W98A 2ZFHA 4LR9A 2QTWA 3ZXWA 1N0UA 2ZEJA 3TA2A 1G1XA 1WKKA 2IM2A 3M2UA 3MMAB 4ECQA 3CJ2A 5J1EB 1AXQA 3MMCA 1YITS 2HBRB 3KLIB 3RB6A 3RBEA 5F8LA 3IWNC 5LM7E 2B3TB 2XTJP 2H65B 2HHPA 4ZP8A 5HVFA 1KR4A 2XULA 2GJ2A 4X65J 1U0SA 4LF4F 4HT7A 3JYTB 2O67A 1H7WA 1N34F 2NLWA 1SV5B 1Q5VA 3OVSA 1UVLA 1S9EB 1N33J 4DWIA 3OXFA 1LWCA 4PXDA 5HQLA 4OYXA 1YKWA 2FVSA 4CIOA 4Q8EA 4HDGA 4DZDA 1U4BA 2E9RX 4ILLA 2NXEA 3R1HA 3C6UB 5F9LA 5IQQA 1IR0A 3PO4A 1GH8A 5DG7A 1GTEA 1NH7A 7FDRA 4JV5F 1O51A 1LW2B 3OXLA 3PX6A 5D78A 2XY6A 4FF3A 4KV8B 3QQCD 4DUZF 1JXEA 5J2NA 3V6KA 2E1PA 2B8QA 3EGNA 1RBOB 1M5PC 2ZH6A 3M32A 3VHQA 4UOFA 2RQMA 1G7CB 2F9JA 2DNPA 3LA0A 2VKZG 3NS7B 3DRSA 4DR4F 5M2RA 2ZDOA 2Y0SD 2OFGX 1HWIA 1FRIA 4OX8A 2C3MA 3UCZP 3IRXB 3C16B 1RTHA 4B9NA 3GG1A 1E6YA 3T1HF 2OH2A 2QGFB 4DI6A 2OEKA 4LFBF 2M9KA 4JI2F 2W9BB 1HLWA 2ASYA 1RTZA 1RCOB 3C14B 2QO3A 5CCMA 1FJGJ 4JYAJ 3KTQA 3CC2S 3KWMA 1HD1A 3DDIA 2IRYA 4ZN1A 2UV8A 3R5DA 2F7VA 1BWEA 3VAMA 3A8EA 3HMJG 3TRGA 4DL6A 5L39A 1XN9A 1RTJA 1F5CA 4G1QB 4WFNQ 1XNQJ 3UO0A 5KG7A 1RDRA 2VC1A 3G8SA 4MIBA 3QO9B 5E0OA 3D4JA 2LA6A 1N5SA 2H5JB 5U47A 3NGUA 3KLFA 5I42B 4LF6J 1X5PA 5HBMA 3UE2A 4TY8A 1MU2A 1F3VA 2EPIA 4U7UK 3T5HA 2QE5A 1UJ6A 2LEAA 4H54A 3FSYA 2GHVC 4ZCMA 3MM6B 4ZVSB 4JI8F 3KK1A 4YN3B 5ETPA 1GAOA 2OHDA 5DQGA 2HQIA 2HK3A 3JSMA 1HBMB 2DD8S 2GCFA 1VLOA 2KRBA 4DS4A 1XNRF 4CLTA 1SH3A 2PSZA 4ZLNA 3VF0B 2B43A 2PFFB 2KKHA 4BS2A 1QSSA 3QJJA 4LQ9A 3AB4B 2XS7A 3M1VA 3KJNB 2LECA 2W2MP 1UW4A 2A1BA 5IV4A 1LNQA 1TKZA 3PKMA 3RBZA 1EZZB 1Q8IA 1TL1A 2OEMA 1JLGB 2H54B 3MF5A 1S76D 2DNMA 4PWDB 4J9QA 2VBYA 1H72C 2CNNB 2C3PA 4DV2J 3PFOA 1VQ8S 4RKUC 4DUYJ 5HVHA 2CQHA 4RX6A 2EVZA 1IBCB 1F60B 3SMZA 2W9CA 4NOHA 3DNCA 2HAFA 3T1AA 2R8GA 3SCLE 4OLOA 1WEXA 1U2FA 3Q22A 2YTCA 3R5GA 2GO8A 2BRKA 1F3FA 3DXBA 4A8OA 4IG0A 2YNIB 4F25A 2DNYA 1S6PB 3UR3C 1S9FA 4C11A 5A0YB 5HSPA 5HO4A 2JJ4D 5LMNJ 1HD0A 3KFWX 4HHHA 1T11A 8RUCA 2XEXA 2RDIA 1WDTA 4R8UB 3CJ5A 4L73A 2EKNA 3BBCA 1NHVA 3IP0A 3C3LA 5IC4B 4KQZA 2XSJB 2F65A 4JI1F 4I6YA 3TVZA 4DBQA 3EGZA 2D3OR 5LT5A 2HQCA 2HLUA 5K8MA 1Z2LA 1PILA 2ZWOA 2GVDB 3ZNUA 3HHEA 2J76E 5L1KA 2CQBA 4OX9F 3MM7A 2P9EA 2C28A 2DGVA 1J27A 4JI4F 1CS4B 3I0SB 1WC4A 1WJ9A 1WKJA 4C0HA 2ADBA 3ZZOA 1NAQA 3GR0A 2EC2A 2WB1D 1M1GA 5C24A 2B6AA 1K0TA 1RZMA 2LMIA 4C97A 2HK2A 4CLYA 2ZHOA 1RWOB 3PIPQ 4ZCLA 2KDOA 4LR7A 1REVB 2UUWA 3DMJB 5K9FA 3G6XA 1XIQA 3H2UB 5IC6B 3MHYA 1SL1A 3JTNA 5BXIA 3HDSA 4K0KF 2VQEJ 3V81B 3DOMB 1S6QA 3W8GA 2HGMA 2KG1A 4B9SA 3D9BA 3DDNA 2SXLA 3OTEA 1Q8KA 1YJTA 2N82B 1NK4A 4NCAA 2MZRA 1NDLA 4DQQA 3E2EA 5IFMA 1IKWB 2VONA 5FIIA 1UL3A 5KT7A 2XMJA 3HKWA 1HQEB 3MECB 2IDLA 4XDCA 2J9EA 2OPRA 3M7VA 3ENVA 3MTJA 2HHTA 2GFFA 2OMLA 2G1HA 2I9SA 4ECXA 2O5DA 4EO8A 5JUMA 3OUYA 3K58A 4MFBB 4F67A 2EK6A 1VMBA 1QY7A 3NS6A 2V9KA 2FVPA 4WK1A 2KT3A 5KFTA 4JOUA 4DR5J 1FHTA 2HS0A 3VZHA 3J7ZT 2YWKA 2H1YA 2CQ2A 4USMA 2XHCA 3V4MA 3KUEA 3CJQA 3VAKA 3PW0A 4ED8A 1FRHA 3J81Y 2BM1A 1CPZA 4ED1A 1ZTTA 1RWWB 2HS3A 4HH1A 3RRHA 2Z8QA 2KZZA 3GIMA 5HLFB 1S1XB 2KB2A 3ET6A 1CJUB 2MZJA 4X4PA 3M8RA 2FY1A 3UR0A 4MT1A 4UUXA 1I94F 4ENOA 1KTQA 2HBZB 2IRXA 3DCAA 4IOBA 1VRTB 2BE9B 1NH8A 4RPFA 2GMJA 3DRXA 4K7QA 2CPIA 4N56A 2H9ZA 3R9LA 3AOBA 1BXNA 5KG4A 4UY8T 2XYGB 2RT3A 4IG3B 5DDPC 1W2IA 3MEDA 3I56S 4LRBA 3WX8A 2ZBRA 1KSPA 3EYZA 4MYTA 4PPDA 2GQCA 3JAMU 3KLGA 4HTIA 2PE8A 1Q81T 2WB4A 1N32F 3PKYA 4F3QA 5C25B 2AIRB 2UVWA 4LF2A 5KFFA 3QJLA 4K4TA 4UUWA 2CQ0A 1RU1A 1JJCB 3EXYA 4HI2A 3BQ2A 1RT2A 2ALYB 2M3DA 2YKMA 1FERA 3ADAC 2OLWA 4G1IA 3I5AA 2D9PA 4TVAB 5IT9U 1CC7A 1S1UA 4C8YA 2FY8A 1Q86T 4X2BA 3BGOP 2OIHA 5ETSA 3CCLS 4X4QA 4JI6J 1U1KA 2YQ1A 1FNOA 2RHQB 1WI6A 4PUOA 3G82A 4AUKA 1TELA 1PO6A 3H5XA 1TVRB 3R6GB 4LSZB 2DT9A 3MR6A 3OXGA 2QA4S 3JS9A 1RT4A 2HBQB 3H2VE 1UVMA 1AFJA 2AV5A 5I3QA 3LGMA 4ECZA 2DY9A 2G2YA 1SXLA 2MJNA 4DV3F 2R8JA 2EFOA 3RBDA 2H5IB 3RB4A 4K8RA 4MKAA 2HQ3A 4LQ3A 2GMLA 2BDPA 2AP6A 4HYKA 4CNYA 1R3NA 5H9FJ 4LMZA 4WZMA 3T5KA 5RUBA 2J0SD 3NMRA 2HZVA 2KYZA 2ZBCA 2LCWA 3D6FB 4IRDA 3MM9B 1H2VZ 2IVYA 3FMWA 1OO0B 1MROB 1VQOS 2YX7A 5FLXY 5EWEA 3Q8RB 2XCAA 2W9AA 1LKZA 3QLHA 2EXUA 4DSEA 1UA1A 2NXNA 2QMXA 3ITHB 5C42A 2BQRA 2E1RA 1UVJA 2ZOFA 2C2MB 1A6LA 1B7YB 3K59A 4QWAA 3TAMB 4RW7B 3S01A 4DR3J 1JB0C 5IQ6A 4ZPCA 2HNZA 3B6BA 1RT1B 4TLRA 4CLPA 3AXMA 1R8PA 2BOAA 1NPKA 2YH1A 3LANA 4USVA 2OELA 5F8GA 3B78A 1XEZA 4PG8A 4ITSA 2Z2ZA 2HRUA 3GYGA 3I55S 1KTVA 4RZRA 1IM6A 3D28A 5AJ3J 2W4DA 1Q82T 1QLNA 2DH7A 3QNWB 1BGXT 3Q89A 1MMNA 5AE3A 3G2XA 3TA0A 4IFYB 4PYAA 2OMOA 3AFGA 1D9AA 2RU9A 1Q4RA 3F56A 4KYZA 5F3TA 1TKTA 4Z7CA 4ZVFA 4NEYA 4I1TA 5KFMA 3LP0A 1QM9A 1RT3A 2BOPA 1LQ9A 1NPRA 1RCXB 3MEGA 3QAUA 4OHVA 5HK4A 1EIYB 4NLDA 1WOPA 3QFWA 2QZ8A 1KRPA 1S4EA 3DHXA 3T6BA 4FBTA 3FZBA 4CM2A 3NWGA 2DNRA 5AE1A 4MTPA 3Q2TC 1ZZFA 3SCJE 3VGVA 3HJFA 2D69A 2D74B 3HM9A 2WVDA 3FQLA 1UPMB 3ENAA 5F41A 3KHRA 1PGZA 1RHRB 4KAIA 3LP1A 4USJC 2ASLA 1L3VA 1JLCA 3OVBA 2MZQA 3PVXA 4USUA 3K2YA 3QZ7A 3M30B 3CJKB 1U25A 1RXOB 3C2PA 3DOLA 4C2MA 2MQMA 1IUJA 1FWKA 3BPDA 3MCOA 1JXLA 3GP9A 1RTIB 4FZVA 4EU0A 5JVGQ 1S5ZA 5KT2A 3FCWA 2PA3A 4ETXA 4LBHA 2DIVA 2HQFA 2V0NA 4K5RA 3KJQB 3M8ZA 5ETRA 2BJ8A 4NA2A 1NO8A 3VGUA 3J7YU 3LH2S 2POKA 1YSJA 2XGPA 3QWUA 3CEDA 3GQCA 3CCSS 3PNIA 4I56A 4LR8A 4CLFA 4DL7A 4B3TF 5B7WA 4M94A 2K06A 1GT8A 3BSCA 2HW3A 3CGIA 2W1BA 1LWFA 1JLEA 3LWLA 4USWA 2B7BB 1NNDA 5KG1A 2FZGB 1X4GA 4UZBA 3ZZ0A 1U45A 1TP7A 1KBRA 3LF0A 3CIMA 4Y6IA 3CJ4A 3TW0A 4OV1A 3TA1A 1VQKS 2YNGB 4AL5A 2PEHA 2CPYA 3CCES 1OYDA 2R7SA 2YKNB 1NB2A 1X0FA 1R6VA 2J9CA 4C0OC 1MSWD 1HBNA 1A7GE 4HACA 3QWPA 2RILA 1Q7LB 5ETKA 4DU7A 4OYAA 1PIEA 3AOCA 1IR2A 2GS8A 1JJHA 5HROB 3EVMA 4DL5A 3FCVA 2HFSA 2XWYA 4BC7A 1HWUA 2CZ9A 4CH1A 4JI7J 3DI6A 2BQUA 4ED6A 4QIFA 3CMES 2CQCA 3CNQP 2CPZA 4NA1A 3RJMB 3SV3A 4EWTA 1X5TA 4CO3A 1IKYA 2JEIA 3MGJA 3WBZA 4ATNA 2IAJB 4X62F 4TYBA 2H3EB 1AA1B 1CJKB 4GMKA 4PG4A 1X4DA 3GIKA 3EWGA 1EQ0A 2VIHA 2V2VA 4DR2J 2FC8A 1S10A 4MK9A 3ZO7A 4DQRA 2AGOA 2P9CA 4DR6F 1RBAA 3DLGB 1RSCA 2PI5A 3OFEA 1YIJS 5J1PA 4AYBD 1QSYA 4AD6A 4O3QA 4GVLA 1S0NA 4EFAC 4UW2A 4DOZA 4X4RA 1REGX 4ZJLA 2G4BA 4P74A 2Z57B 4H4MB 4LF4J 1YQHA 1N4LA 2K2PA 1V3ZA 5HMZA 3NGSA 3QAEA 4CT9A 1FK9A 3FNNA 2UUBJ 2ZZTA 1TL7A 2R42A 2HNYB 2KL8A 4DV4J 2AJFE 3G86A 2YKQA 1V3RA 1Q7YT 2N4CA 4Z37A 4XDDA 4LSNB 3PHEA 3K5NA 4LSLB 1T05B 3R2DJ 2CA9A 2WW4A 3V6DB 3UPFA 2R7QA 2BW2A 2ZDPA 1WF2A 4JV5J 3RYLA 3G6VA 2Z2YB 3TZZA 5HQMA 1YHQS 1GMVA 4DUZJ 1VQ5S 4GKJF 4H4KC 2E5IA 5L38A 2HFZA 1X8DA 4TY9A 4F26A 1B70B 1S7IA 3WX4A 2ACMA 2WOMA 1T03B 5J2QB 2M7SA 3EDRB 3EGVA 1SBRA 3N4WA 4DR4J 2V34A 2V5HG 1U8SA 4RWXA 2AD9A 1ZAXA 1UEVA 3G9CA 4DL3A 2DR9A 3BYRA 1IBLF 2CJYB 4LFBJ 3AY0A 1RGVA 4JI2J 2M0GB 1X4HA 4C8OA 5E3CA 2UU9F 5LJ3Y 2B4PA 4R0JA 3CDUA 4QJVA 3D0GE 3EDQB 3JB9k 4OJHA 3BR8A 1JK9B 4DN9A 4DPTA 2FC9A 2F5GA 4F2RA 4WYWA 3J80Y 1X5SA 4L72B 2CWXA 3PG9A 4C3MA 3D67A 4HDHA 1UJ5A 1X9SA 3BGFA 2HFUA 3UWTA 4LF9F 4TN2A 3BJYA 5B0DA 3ETMA 1I1GA 3KK2B 1HFEL 2RMLA 5C2GA 5L9NA 5D0RA 2XLIA 3TZWA 1Z1ZA 3DLEB 3IO1A 4ETZA 2KO1A 1UKUA 5D6GA 2PC6A 1FDDA 1ITPA 4DFJA 1S1WB 5L46A 1LWEB 1EP4B 1DLOB 2N3LA 4PKDB 4NLTA 3K5OA 1FNMA 4NLGA 1VRUA 4DQPA 2CJXB 1Q5YA 1N6QB 4JI8J 2B5JA 3LGNA 3Q8VA 3FJ2A 3UI3A 4UTGA 1B0VA 2MKKA 4OI2A 1I6JA 4A48A 3SSRA 4CI0B 2RRNA 4OZ3A 2HSEB 4OYWA 2WRMA 2BX6A 3CT9A 4F04B 1RWKB 3T6JA 3OFHA 2IBOA 2OTLS 4WPAA 4UQTA 2BANB 3MZIA 4USIA 4OHZA 5C2CA 2HG4A 1BQMB 1WHXA 3DLKA 4ZVRB 3BH6B 4R0EA 2QT7A 3VZIA 1B0TA 1IXKA 3MR2A 2DISA 5GADI 2NS1B 3TVYA 1OPZA 3M6XA 2CQIA 3H2LA 2GQ2A 2Z56B 2ASDA 1GXLA 4FF4A 5A6WA 2L9WA 4LVOP 3FBFA 3PZPA 4KSEB 4Q2MA 4USKA 3PXGa 1M5KC 1MG7A 3ZTSA 2PFDA 5L9XA 2C2OB 1FKOA 5GADU 3R5CA 1U1NA 5DG8A 4TU8A 2AJ0A 5IM0B 2VKRA 1FT8A 5BR8J 1Y10A 1U26A 1T9VA 1HW8A 4DV6F 1MMLA 1SUQB 3HHLA 3U1MA 3HX9A 2V6AA 3HJVA 1SH0A 5T7LA 7AT1B 1SJFA 1KP6A 3QT6A 2AEFA 2YNHA 1HBUA 1FWLA 2WSFC 3DYAB 1FESA 1NK5A 1WWHA 1EAYC 4JI1J 2AYGA 2EKYA 4YB6A 3KNAA 5GAEI 2EBEA 3CDEA 3U1NA 1D0EA 2XYHB 1FD8A 1GEHA 1SQGA 8AT1B 1Q16B 3MR5A 2HHUA 3DRPB 2GGPB 4XIUA 2QSWA 1RWXB 3LP2A 4Q0BA 2QA4G 4F4KA 2A2CA 4M5JA 4P75A 4MMOA 2XI3A 2DNZA 4P9SA 1VK8A 1CJVB 4NRUA 4JI4J 2ZOMA 5HL7Q 1KFDA 3KNGA 3MPWA 4FVCA 2IRUA 4YMEA 3I9V9 4CRJA 2L9NA 1WC6A 4CH7A 5DLFA 5B0CA 2EFNA 2XQCA 3IBWA 3BH7B 3BKUA 1SCJB 4CWBA 3GIRA 4FYWB 2AX0A 2D3ZA 3IC1A 3JSRA 4K4ZA 2ATCB 2DGWA 4XTTA 5D77A 1HQUA 1FJCA 3BO4A 2IYGA 1CBKA 3OT9A 4K0KJ 1CJTA 1SIWB 3QT8A 4FBUA 3GFXA 1ELOA 3I0RA 4M5IA 3MMCB 2MLXA 3W65A 3ZTRA 5EHHA 5HP1A 4KRWA 4OI6A 2IA0A 1HNVA 2WONA 2VL1A 3VQTA 4W4MA 3R7SB 2RE1A 5KFUA 4ES1A 3G6ES 3QIPA 3KMSA 4NXMF 4NASA 2PD1A 2HWHA 2A0FB 2RAQA 2HKEA 2RRAA 2XMAA 2GAGC 3HK2A 3CWJA 4KFBB 1KLMB 2LLZA 1T9YA 2GVZA 1QUPA 1NK7A 2HYIB 1XNQF 2MGZA 4NZ7A 4A8WA 4HT5A 1S1VA 4FDFA 4ZHRB 4F7VA 4YR2A 3MOZA 2O01C 3V4IA 4YDXA 4ZP6A 2IVMA 4NRTA 3TZXA 5K20B 4X64F 2MLZA 3CCRS 1WOSA 3G8QA 3L7UA 5KG6A 1IKVB 4BCAA 1QSLA 4RW6B 4WE1B 4J9UE 1WSRA 4ICLA 2E7WA 1YWXA 3EZ5A 4W90B 1KOOA 1NZ8A 4ZP9A 3A1YG 3CE8A 4USHA 2MKYA 2V8PA 1I94J 1NSAA 2G9OA 5EWGA 2Q6BA 1L5UA 3M32B 2MKJA 3C8YA 4I69A 3AT1B 4Q5VA 3ZZZA 2IJRA 1WG1A 3W8PA 5F9NA 2OSRA 3DRSB 4QU6A 4C48A 2W7AA 1RQ0A 1CEZA 2PMWA 2ZKTA 4QOTA 3H5YA 3PACA 4Q44A 1S9GB 2AJ1A 2PDAA 3T5JA 3AQPA 1FRXA 2XWXA 1VQMS 2N7CA 4NLYA 3L95X 2BBEA 3FBCA 3SI8A 2HEKA 2XZTB 2CJQA 4YOEA 2XO6A 4JV1A 3MUTP 2LKZA 1N32J 4DS5A 1JLQB 1K47A 3J7AN 3C66A 4O23A 3A12A 1M1KT 1UZHA 2AGPA 2IJFA 1NB7A 1RTJB 2NCKL 4ILRA 1Q53A 1RT6A 3OTOF 4DU8A 4K4VA 2OPPA 4LF7J 2CFXA 2RKIB 4UOHA 2IC3A 4YB7A 3BKTA 1KQSR 3G96A 4WZQA 4IQXA 1MMDA 3EPIA 2C3YA 4LRDA 3KLFB 1NLKL 3C15A 5LMNF 3WDOA 1IQZA 1TL5A 1MU2B 1RHKB 2AX1A 1HA1A 1N48A 3PRDA 2K7KA 4EK2A 2QFJA 3LW5C 2R7OA 2ADCA 1CSJA 3GB0A 1BE4A 4DV3J 2RQ4A 4QR1A 1RT5A 1S99A 4MKBA 4P71A 1D8ZA 1JXVA 3JSMB 2XI2A 2ZJPQ 2ALZA 2YKPA 3FZ2A 4B3MF 3ENWA 3LGHA 4ECUA 1R89A 2QFIA 3WHIA 2JNJA 2NPIA 4EUVA 2FVQA 1UVNA 2FJXA 2KT5A 1YZ7A 3K5PA 1TKZB 3MWBA 5DQHA 4QPTA 4KPYA 4CLLA 4N41A 4AL7A 2G2OA 1EETB 4IKAA 3HP6A 2AYEA 1SKUB 2GNKA 2DCLA 2ZZNA 3UDVA 1VQYA 4I2QB 2VD3A 1F5BA 1N5YB 3DLJA 3E01A 4DHVA 3X3UA 2OJ3A 2QX0A 3BR9A 5CYQB 4I6AA 1CULB 1FX4A 3PJWA 2YBVA 2BJ1A 1VJQA 2RS8A 1KD1T 1LXJA 3O2IA 1PAEX 2FVRA 1FCAA 2V68A 3TR5A 3HFZB 3MPVA 3IM8A 5DDOC 4BLGA 4NLUA 2AQ4A 3BGRB 4LBPA 5DLGA 3OD2A 4UT4A 3M2VA 1NXIA 3R2CJ 1JLBA 4C11B 3FEXB 3NWRA 4J9PA 5B0BA 3A13A 2W4PA 2DNHA 2Q3PA 5L8RC 3W62A 3DU6A 2IFXA 3BO3A 1WSVA 2VFRA 2N3OA 4RNMA 1PC5A 2YQ3A 5ITHA 3CCVS 2ZC3A 1WKLA 3FK4A 2OO4A 5KFWA 3CCUS 2L41A 2G13A 1SJ1A 1D1UA 1KKHA 2OD4A 1WTFA 5CA5A 3TJ8A 2XNRA 2I0XA 5D0GA 2HQGA 3DDKA 4ZDNA 2DHGA 4WWSA 2HZCA 1ZYQA 1SC4B 3F73A 3B4MA 5EGYA 3A3NB 3MMAA 3D1HA 2QL9B 2G0JA 3R27A 3KLIA 1DZ5A 2F63A 4FP9A 4Y0FA 3PR4A 3S1TA 5AE2A 1UP1A 3M8WA 2FGOA 1VR6A 1NCLA 3LTOA 1PC4A 2XMUA 1WF0A 1P8GA 5JJBA 1GXTA 2XYPB 3PW4A 1SV5A 2CPDA 4HEA9 2Y1IA 2I38A 4KE5A 4OL8A 2DCUB 1SKSA 2VFUA 3WQPA 3RB0A 3OHAA 5K14B 2FHJA 3QFHA 2J8SA 1U1OA 3FSIA 1FXDA 4DEZA 3K7RA 1OY8A 3MR7A 3CD6S 4F3MA 5JMNA 2RQCA 3OL8A 2LP4A 2M88A 2L3MA 2FQQB 3AODA 3C6UA 1U7LA 2J0XA 3RBXA 4CH0S 1NJXA 1EX8A 2ZZMA 4NWBA 5F0WA 3T5LA 3UN5A 4CLZA 4KC5A 1NJIT 2W24A 4RBTA 4DV1J 4B3TJ 3OJUA 4DSJA 3N6LA 4KV8A 2BM0A 4PXEA 4KTQA 5DJBA 3U27A 3ENQA 4O4GA 5CHCB 4RNNA 1VDHA 4WIIA 4NLOA 3OUYB 1RTDB 4Y2IA 1OSDA 1GQEA 4J91A 3ZZPA 4FF2A 3P45B 3NBPA 1TUVA 1PYOB 1DHMA 4DLGA 2NPFA 1OJ4A 1U2RA 2D1CA 3NOGA 5A8WB 2R8HA 3IRXA 1VJWA 2EC0A 2R7VA 3M8YA 3IWXA 2JVRA 5C7PA 5D4OA 3TOQA 2GX8A 1RWVB 4RNFA 1F5AA 1TKXA 4O4RA 3JQMA 3C14A 4ZS6A 3BS9A 5KFSA 5E3RA 3MMJA 4OI4A 4LRFA 1VC0A 4NE9C 2D3UA 2GW8A 1U24A 3TX0A 4CDIA 2RVJA 4ECWA 4O3RA 2FZCB 3OLAA 3VTIA 4CT8A 4BWMA 3MEDB 4MKVA 4QU7A 5CYMA 1AUSL 9RUBA 5I42A 1BQXA 2DH9A 3IBCB 2HBYB 4RW9B 2E1AA 5F3ZA 4ZIVA 3RR8A 1NKEA 5E3QA 1AYEA 2M8HA 4O44B 3F0NA 3QRQA 2MQ8A 2FLNA 3MM6A 3DRRA 3HHLD 4DR6J 4BBYA 1U6FA 1T95A 2HAIA 2CXEA 2YKMB 3LALA 1HWKA 4U7CA 3CCTA 4OFZA 1Y3KA 3P5BP 4ECYA 1Y11A 3M8QA 2ZHBA 1HI1A 3MDFA 1Q79A 3CCWA 2AYBA 3G82B 1ZAWA 3EJMA 4C7QA 1KVIA 2QLWA 5G0RA 2ZD1B 3AXKA 4CZCA 5IXUA 6AT1B 2KN4A 3A8KA 1NEEA 1RT4B 4B9TA 1M5VC 5HMWA 2ATLA 1WHVA 3CVKA 4FN5A 2ROGA 3BF4A 4J37A 2XB2D 5F8MA 2ZUAA 4ZVHA 2W7PA 3N79A 3H0PA 1E6VB 1FDAA 4KO0A 5LSLA 3KDNA 4FXDA 1QD1A 5HMYA 3V6HA 5DGAA 3Q23A 3CC4S 2YNIA 2CG4A 2E5GA 3G4SS 3OLBA 3T3FA 1AROP 1JNRB 1FJ7A 5ETTA 5A0YA 2ZJQQ 4PR6A 2DGSA 5KFDA 5J1NA 4F0KA 1Q8LA 2VJVA 1JNZB 1SC3B 3UNGC 4XPCA 2JLFA 2CQ1A 2CDQA 5EX3A 4R8UA 1D09B 4Y3CA 1LV5A 3P6YC 4O3NA 3CF5Q 4ZPDA 2VOOA 2EFVA 4BHQA 3H42A 3FSXA 3SDEB 4ZVQB 4KKOB 2WVEA 4TXSA 1QE1B 2ZC4A 2EG1A 3OR1A 1N52B 4D3HA 3GIJA 2FJBB 2HFOA 3VR1A 2GVDA 2A6OA 5F0UA 5DO2A 2UU9J 4V19X 1F2HA 3N6NA 2JHEA 1URRA 3Q8UA 1SL2A 3UD3P 4G3IA 2NZCA 5D3GA 4CLUA 4M5KA 4X4VA 3I32A 3DN9A 1GK8A 4OJ3A 3I0SA 4HKQA 3ONQA 4WFBQ 2VBXA 2H4YB 2BEFA 2ZHAA 2JH3A 5KFRA 5JVHQ 3OPKA 1HMVA 2HVDA 2LYVA 2Q43A 1TKTB 4UZCA 4HHJA 2PGCA 3LP0B 2YWHA 2JEFA 2DGQA 4AXIA 2AW0A 2OPSB 2ZM6F 4QZVB 5EWFA 3ZTOA 4HVZA 1REVA 3MEGB 1WC5A 2F4VF 3M9NB 4MAKA 4PQAA 4NYOA 3KJVA 3VGSA 3KDOA 3DOMA 4J9KA 5HVGA 2B0GA 3NRBA 1S0VA 1XQIA 4U8YA 2KH9A 1AUDA 1U49A 4NLXA 4NLSA 3HVRA 1IKWA 3LP1B 3KJFB 4KHPF 1JLCB 3AAWB 3NEKA 2CJBA 3K89A 4U6PA 3GFHA 4K4YA 4U67Q 2GQQA 3DOLB 4WYLA 4P2FA 4AL6A 4ZPTR 2OEJA 4J9LA 3MUMP 3H4DA 2BUNA 2H48B 4M5MA 1MLAA 4F4ZA 1RWPB 2RRBA 2WBMA 1HYSB 4ZVOB 2GIRA 4CO2A 4U96A 3CD0A 2LXIA 1ZM4A 2YWFA 2DHSA 1TAQA 4EZ9A 3HO1A 2AEJA 1VHFA 4DV7F 2V4QA 2HMIA 3SSSA 2EI5A 2CPEA 3IR5B 3ILJA 5DRKA 4AE5A 4IH7A 4NZ6A 4PYDA 5I3UA 1JX4A 3FEYB 2OSQA 3UCUP 3GJSB 2C2KB 1S1XA 1DARA 1XK8A 5LXRA 2E7XA 2DXDA 4ZA1A 3GG0A 3D1OA 2PIIA 1LWFB 3SV4A 5KOWA 1JLEB 2HHHF 4TLQA 4DV6J 4ED5A 2NUHA 2V2ZA 1HBOB 4M5NA 1SB6A 3EX7B 2MYFA 2HVIA 4IG3A 5DM7Q 2R7XA 4K5SA 3N5FA 1C1BB 2NSCA 1RWMB 3BSNA 3HZGA 1S57A 3Q8SB 3KUHA 3JTPA 2F4FA 2UUBF 4RUAA 1M90T 1DFDA 2PN6A 1WHWA 4DV4F 1HBNB 2Y0BB 2AZ3A 2BE2A 2DNQA 4NMLA 3GE9A 4ER8A 1U1RA 1MNEA 3CTRA 4B08A 1S1TA 1FTRA 1HARA 3D66A 3M9MB 1DBDA 2FJEB 4FNIA 2QRRA 2JFDA 2NYIA 4OHWA 3DHWC 3KXDA 2KXHA 3TEHB 3MEEA 1IKYB 3M6VA 3E8OA 4DL4A 2DH8A 3UDCA 1W25A 3QATA 5KFKA 1V5IB 1MWYA 2DVIA 5HAOA 4DX7A 3EE3A 1HR0F 4B9VA 4M95A 1HPZA 4M5LA 2R4FA 1VFJA 4Y28C 1O6XA 4TKTA 1LEOA 2QA2A 3QSIA 3HFKA 1LK5A 1YZ6A 2E5HA 3KMQA 2DHAA 3CMQA 2Y8YA 3JTOA 5FDLA 5ETQA 2M4MA 4OI0A 1L3KA 2QJ3A 5J2MA 3D68A 1FEHA 4Q8FA 2V8GA 2EEYA 2BRLA 1UZDA 4Z2XA 4NLPA 2XGQA 3CJTA 1R8HA 3I4HX 1NPPA 2QV6A 1RAGB 4TYAA 4Y2CA 2K1RA 4I4BA 4NLWA 3VALA 4LT6A 4NXMJ 5L1JA 2GC8A 5KG2A 2ZH9A 4LFAF 4IOCQ 2FVCA 4DSKA 1MROA 4OQJA 4QIEA 1FK9B 2ASJA 3LAMA 3BB5A 1TL7B 1VQNS 2JWNA 2ZVSA 1VC6A 1SKRA 2DGTA 3BPSP 2M52A 2M70A 3I31A 3TAMA 4RW7A 2F40A 2J8AA 4R25A 3TUPA 1RT1A 2ZUGA 4X64J 1Y5LB 1P9YA 3DOKB 5DZ6A 3RGIA 3CDWA 2VG6B 2COLA 3KLVA 1R27B 4JP8A 2Q79A 2YNFA 4FYYB 1NKBA 2FHJD 1PYTA 1FD2A 3W2WB 3KKFA 1VHIA 4KJIA 2LQ8A 2CJAA 3J81U 2LA4A 2WOMB 3H5SA 1VK3A 3P4UB 4IFYA 1NDKA 4DJBA 1OWXA 3IWLA 2C2RA 1FX2A 3MR3A 4JV0A 1APSA 3MOJB 3CD5A 2C3OA 2BJ3A 3PYEA 2L08A 4N5SA 2YPYA 3PR5B 2RJZA 2BW7A 1PYSB 2DKOB 4YFUA 4B3SF 2DRBA 2VG7A 1YBAA 2HNDA 4TNOA 1RJJA 2F1FA 1ZM9A 1DTTB 3R5BA 5D4NA 4IFVA 1NK6A 2R9LA 1ZZNA 4NPOA 3LOUA 2BXJA 4OYMA 2X1BA 4DLEA 4WF9Q 1OIAA 1QVFR 3OTOJ 3IFEA 1Q78A 1S7HA 2KHCA 4F4WA 1KHWA 4WFAQ 5HATA 5BR8F 4ZKAA 2QLFB 1RTIA 1U6BA 1IBMF 3NY0A 2MKCA 3RZAA 4IR9A 4FNHA 4KHMA 2OUGA 4RNHA 2ROPA 3MMBB 1W2BR 4NMXA 1OQ3A 2X51A 4ZLPA 4RL1A 2BE7D 5A8KB 2R2UA 1W26A 3C19A 1U2CA 2EW9A 2XHWA 5GMDA 1YRXA 5E3PA 3QRPA 4QWCA 3S8SA 1NHUA 2OKQA 3KYLA 1S6UA 2MQOA 4A8YA 2HGNA 3BEGB 1C0UB 4FS1A 4B3MJ 3EGWB 2VB6A 2HFVA 2HRYA 4OJGA 4HR2A 4KR0B 1AT1B 1NJYA 1OYEA 1K0VA 2VUGA 1NRKA 1URNA 1JLFB 2KXNB 1R0AB 4MKYA 4ZIWA 4IQMA 2V8HA 3DLKB 3W3SA 2CNLB 2WZ1A 2P6SA 2VPZB 2ZH5A 4DG1A 3CSKA 1HW9A 2BZ2A 2YWWA 3HPOA 4FXWA 4X84A 3I82A 2JLEA 2YNGA 1QTNB 4DDFA 3NAIA 1VI7A 3IXQA 4QPXA 2XMKA 4JI0J 1Y00A 2YKNA 3O8WA 1VQPS 5KFAA 4C4WA 1YVFA 3EICA 4FF1A 5DQIA 5KT6A 4PCQA 3PJXA 3OR2B 4WBFA 4ZPAA 4OX6A 5HROA 3QT7A 1V9OA 2DRDA 2E66A 3MM8A 2G0IA 4A8XA 3G6YA 4WTOB 4J9OA 3DRYA 3W1YC 2D3O1 4RR5A 2IBKA 2OFHX 2WVFA 4NXNJ
chains in the Genus database with same CATH topology
2E1PA 3GCXP 2Z58B 4JP8A 1V5IB 2W2MP 2ZWOA 2W2NP 3CNQP 2ZWPA 2W2OP 4OV6A 1SPBP 3GCWP 3WIVA 3P5BP 1ITPA 2Z2ZA 3H42A 3SQOP 2W2QP 2Z56B 1R6VA 2PMWA 2W2PP 3BGOP 2Z57B 4K8RA 3VHQA 2QTWA 3AFGA 2XTJP 3CO0P 4NMXA 3WIUA 3WHIA 3VV2B 2Z30B 3A3PB 4YN3B 1SCJB 3A3OB 3QFHA 2Z2YB 3A3NB 3BPSP 4NE9C 3T41A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E1P A;  3GCX P;  2Z58 B;  4JP8 A;  1V5I B;  2W2M P;  2ZWO A;  2W2N P;  3CNQ P;  2ZWP A;  2W2O P;  4OV6 A;  1SPB P;  3GCW P;  3WIV A;  3P5B P;  1ITP A;  2Z2Z A;  3H42 A;  3SQO P;  2W2Q P;  2Z56 B;  1R6V A;  2PMW A;  2W2P P;  3BGO P;  2Z57 B;  4K8R A;  3VHQ A;  2QTW A;  3AFG A;  2XTJ P;  3CO0 P;  4NMX A;  3WIU A;  3WHI A;  3VV2 B;  2Z30 B;  3A3P B;  4YN3 B;  1SCJ B;  3A3O B;  3QFH A;  2Z2Y B;  3A3N B;  3BPS P;  4NE9 C;  3T41 A; 
#chains in the Genus database with same CATH topology
 3HHL B;  4J9V A;  2CKW A;  4CLS A;  2CYY A;  4P73 A;  1R8A A;  1YJR A;  3FRZ A;  4CLW A;  1NHK L;  2BA9 A;  5CXT A;  5KG3 A;  4B9U A;  1MN9 A;  4YB5 A;  4DL2 A;  5F8J A;  1N36 J;  2IAJ A;  3SYZ A;  1RHQ B;  3PYF A;  3MD3 A;  3VWS A;  4RNO A;  5ETO A;  5KT4 A;  1IVZ A;  4X4T A;  4A46 A;  5DS7 A;  1RT7 A;  3DLG A;  1SKW A;  2HQD A;  2DRA A;  1R31 A;  4E8U A;  4E98 A;  1X4C A;  8ATC B;  4WKR A;  5B0A A;  3Q24 A;  2B9Y A;  3ZZY A;  3KHH A;  2IDE A;  3DLB A;  4F0M A;  4F4A A;  1U0H B;  3FC9 A;  1QVG R;  1VRQ C;  3NLC A;  5CCL A;  4DFM A;  3CO9 A;  4E2F B;  2DHH A;  4OLP A;  4H4M A;  4LF5 F;  1UFL A;  2GHW A;  1PG5 B;  1KQG B;  2XLJ A;  3L9Z A;  1Q95 G;  4XAK A;  4EGL A;  5GAG I;  4YDD B;  3HHD A;  2FJD B;  3MM5 B;  2HNY A;  1IWA A;  2DPJ A;  1KON A;  4UF4 A;  1OMS A;  2RIJ A;  4LSN A;  3S7R A;  1YTY A;  3KLE A;  3M8P B;  2BJ7 A;  2LEB A;  4ED0 A;  2R7T A;  3CW2 C;  2RDD A;  4LSL A;  4J90 A;  2V8V A;  1M1H A;  5GAG U;  2V4R A;  4C8M A;  4YHH F;  1R8B A;  4JBC A;  5KAK A;  2CRL A;  4P7T A;  1N56 A;  5HP1 B;  1HL6 A;  1HNV B;  2DR8 A;  2WON B;  1GMW A;  1RB0 A;  2WTF A;  2Y1L B;  3QIP B;  2ZNY A;  2VC0 A;  2W01 A;  3D7S B;  3R5A A;  1QUV A;  1NUE A;  1VQ6 S;  4QBU A;  2J9D A;  1TUG B;  2LDI A;  3ZC4 A;  1WEL A;  4OI3 A;  1VBX A;  1YG0 A;  1T03 A;  2FYX A;  1BLU A;  3K57 A;  1UPP A;  5HJX A;  3Q0A A;  4GC6 A;  2R2S A;  4LF7 F;  2MGZ B;  2JOQ A;  1QDU B;  3X1L B;  1S1V B;  5ETN A;  3V4I B;  5K8O A;  1AZS A;  3O6Q A;  4QIG A;  3W5X A;  4I68 A;  4I2P A;  3W9I A;  5I3P A;  3E51 A;  1UVK A;  1YX2 A;  4BWJ A;  2DNN A;  1WC1 A;  4F4Y A;  1EQM A;  4ICL B;  2QA1 A;  2HWI A;  4F3O A;  2V63 A;  3TZY A;  5FJ4 A;  3DXS X;  2ILZ A;  2VZ9 A;  1RYS A;  1FEE A;  1XR7 A;  1HHQ A;  4ZK7 M;  1NSK L;  4HH0 A;  2V9W A;  4I0W A;  4WP8 A;  3V5R A;  2HIY A;  5H1S V;  3PRB A;  1DQ8 A;  3AJD A;  4XK8 C;  5KFG A;  2FJW A;  3HVA A;  3VAF A;  2B56 A;  1HNI B;  3W64 A;  3NGK A;  2IM3 A;  1WOO A;  4LVN P;  1DAX A;  4K2X A;  2XS2 A;  5EDW A;  3EZO A;  2NUU G;  2OPQ B;  4YR3 A;  3L7O A;  2J6S A;  4ZPW R;  1S1W A;  3RAQ A;  4NL5 A;  1EP4 A;  3UNY A;  1DLO A;  3ICL A;  4Q43 A;  1B3T A;  3AD8 C;  3MFI A;  4LF8 F;  2XS5 A;  3R1L A;  3VAH A;  2CNO B;  3H4B A;  2DYA A;  4A8M P;  1VQL S;  2HWT A;  4FVM A;  3OHB A;  1F2G A;  2AJ2 A;  3DGP A;  1GFW B;  3HFV A;  3IR6 B;  1NKC A;  2I2Y A;  1RT6 B;  4DFP A;  1FRL A;  1J5O A;  2QG9 B;  3GV8 B;  2KRR A;  2MKI A;  3OTB A;  3UQS A;  3HVT B;  3C15 B;  2GIQ A;  3MI7 X;  2CZV C;  3L09 A;  3W7B A;  3AA9 A;  2BAN A;  5I4M A;  3M2R A;  4R5P B;  3T9N A;  4K50 A;  5JXS A;  2HHV A;  4RBU A;  1K1Q A;  4KB7 A;  1HKA A;  2NXU A;  1DTQ B;  5E7O B;  3KK3 A;  3HI9 A;  2BJ9 A;  1D9D A;  2BAB A;  1X9W A;  1RT5 B;  3OSP A;  4FXV A;  4GVB A;  3QMQ A;  1PKU A;  1NME B;  2P8I A;  2MEW A;  1OY6 A;  4X66 F;  4CP5 A;  5A2Q Y;  4Q7A A;  5CZX A;  4IH5 A;  4PRF A;  2QLB B;  3GON A;  2LFV A;  3T41 A;  2DHX A;  1ROF A;  5IM0 A;  3CIZ A;  2RD5 C;  4M5D A;  3HT3 A;  2IY5 B;  2B51 A;  1FKP A;  4CO1 A;  2HHX A;  1SUQ A;  2DJW A;  3U02 A;  1HI0 P;  3MTK A;  1EB0 A;  2J7K A;  4IH6 A;  4A47 A;  2BKP A;  4NYP A;  3E01 B;  4ED4 A;  4ZVP B;  3DYA A;  4QYZ K;  3H5U A;  3HSD A;  5KFZ A;  4KH1 B;  3HHL C;  3DC2 A;  4L6V 3;  4N7T A;  4WKY A;  1FXL A;  3PM9 A;  1RWN B;  4NCG A;  4ID5 A;  1OSC A;  3I96 A;  2MZT A;  4P2X A;  4RW4 B;  2MY7 A;  3M2V B;  3GPA A;  1JLB B;  3GFY A;  2X3G A;  2VU5 A;  1ACM B;  2FTR A;  3TX8 A;  3TVK A;  4N8O A;  5L1L A;  2RQK A;  4EBD A;  1OY9 A;  4DV1 F;  2XMW A;  2GMH A;  1VCT A;  4NLR A;  4J9S A;  1FXR A;  2PI4 A;  3PW2 A;  2KT2 A;  1G3O A;  3KG4 A;  1C1C B;  3RU0 A;  4WP9 A;  2E29 A;  3IS9 A;  3IM9 A;  3J80 U;  1S49 A;  1EJ7 L;  1X4E A;  2UVU A;  1O5J A;  2ZM6 J;  5CAB A;  4I67 A;  4JI5 J;  2YKO A;  1U1M A;  1TV6 A;  1S4F A;  3S6E A;  4I7F B;  2F4V J;  3I9Z A;  1YBT A;  4M5H A;  4ECR A;  4ELV A;  3OL6 A;  4PEO A;  1WF1 A;  2DPI A;  4AND A;  1U6Z A;  1Y0H A;  2VOP A;  4PQU B;  2E7V A;  3PJ9 A;  4WCE Q;  4TU9 A;  1RBL A;  4KHP J;  1X7V A;  4YP3 A;  1JLA A;  1IKX A;  2NXC A;  3F44 A;  4OX7 A;  3R3T A;  2OI2 A;  2XM3 A;  3FBB A;  2KVI A;  2XNQ A;  3N01 A;  4KFB A;  2FLL A;  1KLM A;  3Q86 A;  1T7P A;  4PG5 A;  3H8Y A;  4AFF A;  3JXO A;  2RF2 A;  4K4S A;  3ELH A;  2MTL A;  5K8N A;  2HIQ A;  3QGI A;  3UVJ A;  2UV8 G;  2HHW A;  2UZA A;  4ZHR A;  2KG0 A;  2YWE A;  4DV7 J;  2N4D A;  5K8P A;  3M05 A;  1TMM A;  1SPB P;  1IKV A;  4M5G A;  2CAJ A;  2O66 A;  4V1A k;  2B8P A;  2OGU A;  4RW6 A;  4WE1 A;  2NQP A;  4E0D A;  4DR1 F;  1JKH A;  2R7R A;  3IGN A;  3EVO A;  2I5J B;  3LQV A;  1K8A T;  4O4G B;  2ZE2 B;  5B0G A;  3GMG A;  2HHH J;  1ZM2 A;  3R6L B;  1UAW A;  1SL0 A;  3GSI A;  3IMQ J;  3CCZ A;  1U1P A;  3NBP B;  1Z4U A;  3H98 A;  2Q1L A;  3PRV A;  5HJY A;  1VQ9 S;  5IWA J;  2A18 A;  1IBK F;  4NEZ A;  5IV3 A;  4DZ6 A;  1S9G A;  4X4N A;  1M0S A;  1TL4 A;  2DBB A;  2ZOG A;  3PDN A;  2MZ1 A;  4DR7 F;  1TKX B;  3MPU B;  2CVE A;  1JLQ A;  3G8T A;  4WTY A;  4DMZ A;  3Q8P B;  1H6K X;  3NP5 A;  4EBC A;  1RAC B;  2KTQ A;  1PCA A;  2Y1J A;  1BQN A;  2FD2 A;  3VV2 B;  1Y5I B;  3HVW A;  2RKI A;  2BR0 A;  2AT1 B;  3PEJ A;  1VLY A;  2QLJ B;  3TJ9 A;  5CYM B;  2Y3Y A;  5KFO A;  1YGY A;  1V6H A;  4DFK A;  1HR0 J;  3NGR A;  2QN6 B;  4HI1 A;  3T19 A;  2IMW P;  5CZV A;  2M8D B;  4S0M A;  2ZWP A;  4WFY A;  2MKS A;  1FJE B;  4CYU A;  1WC3 A;  4MK8 A;  3DRR B;  4DV5 F;  5IOL A;  2D7S A;  2BAC A;  2M5Y A;  4OHY A;  4ES3 A;  1EAR A;  4QWB A;  3P8B B;  3SQG B;  2RHS B;  3MAA B;  1L3U A;  2W2P P;  5D4P A;  3THP A;  3TQ1 A;  3HZE A;  4J9M A;  3D3B J;  2E5L F;  3T1Y F;  2UUA J;  3M8Q B;  3CC7 S;  3GWC A;  3W9J A;  3TI0 A;  3OFF A;  5AXL A;  3BZQ A;  4NZ0 A;  4LFA J;  2VF3 A;  3IRW P;  1UWB A;  4ZLJ A;  5G0R B;  2XG8 A;  2JRS A;  3V2U C;  2AWZ A;  3BBB A;  4A8S A;  3EXC X;  3EVW A;  3L7P A;  1RAE B;  1EET A;  3VVU A;  5IZH A;  2CIM A;  4I2Q A;  4B3O B;  1S59 A;  3MCS A;  1N5Y A;  1H98 A;  1RHU B;  3GIL A;  3R7N B;  2JL9 A;  5CYQ A;  1CUL A;  3MPD A;  2VPY B;  1TK8 A;  3MFH A;  1VC5 A;  2IYI A;  4RUB A;  2R7U A;  3EMT A;  4KO0 B;  3NS5 A;  4GKK F;  4Y2M A;  5AXK A;  2QL5 B;  4NLQ A;  2VA3 A;  1LW0 B;  4DN0 A;  1TMJ A;  3BGR A;  1UA0 A;  1C0T A;  1C4A A;  1NM2 A;  1G6B A;  1U47 A;  1R0B G;  4DF8 A;  1AFI A;  2V69 A;  1HHS A;  1S6O A;  3THT A;  3B54 A;  3AQO A;  2J7W A;  1AB8 A;  4G1P A;  5H9E J;  2CQP A;  4IO9 Q;  2FIU A;  4QR2 A;  1NSQ A;  1RA7 A;  3A8I A;  2XZW A;  2PA8 D;  1PAU B;  3W2V B;  4F2S A;  1GMW D;  5A8R A;  4Y34 A;  1NSP A;  4RW8 A;  2VA2 A;  3IG1 B;  2W7O A;  5D0E A;  4ZIT A;  1KVK A;  2HVH A;  4TQR A;  5KFN A;  3OR1 B;  4B3S J;  1UCN A;  2CDR B;  2LQB A;  1RHJ B;  2X1G A;  1BWV A;  2K7J A;  3NXZ A;  2DO4 A;  1WG5 A;  3KLH A;  2JFK A;  1TZ0 A;  3HUL A;  2LQ9 A;  5F8I A;  1WC0 A;  2R8K A;  3G87 A;  2KHD A;  2IIH A;  3D1Q A;  5D3G B;  2WVB A;  2IM1 A;  1Q1K A;  1ZOT A;  9ATC B;  1VQ7 S;  1M5O C;  4U7U D;  2XLK A;  3FGV A;  1S97 A;  3RAM A;  3DM2 A;  2D9O A;  3IBF B;  2MB0 B;  5J2P B;  3OTC A;  4ZOS A;  4MJK A;  1XWL A;  4EYH B;  3KG1 A;  2B4U A;  2J5A A;  1HMV B;  4CTA A;  3D54 A;  4DPY A;  4CO0 A;  4MIA A;  1N5T A;  1KEK A;  3C46 A;  1IBM J;  2ZH3 A;  1JIH A;  1YJV A;  1Z2Z A;  3CMA S;  5K14 A;  3JQJ A;  3OQ2 A;  4BC9 A;  1WOR A;  2AEM A;  2PMZ D;  4YUD A;  3KJV B;  1CVJ A;  1N0V C;  1ZA2 B;  3WIU A;  2LXU A;  1F9H A;  3C6T A;  4KH0 B;  3BN7 A;  1JJ2 R;  1F0X A;  1W7W A;  1TU0 B;  1TL3 A;  3OL9 A;  1NDC A;  2DR7 A;  2GV1 A;  3M6U A;  1B64 A;  4DSF A;  2PO4 A;  4D3G A;  1SJ3 P;  4QQB A;  3OBI A;  1NK9 A;  1LWX A;  1O8B A;  1X31 C;  1H7X A;  1WEY A;  5GAE U;  3D3C J;  2AZ1 A;  3K5M A;  5F8N A;  1RTD A;  2YVS A;  2ROE A;  3FFI A;  2DIT A;  2GA7 A;  4RU2 A;  1UJ4 A;  2HVZ A;  1VOM A;  4LUB A;  3NNC A;  3W66 A;  2MPU A;  1NZA A;  4KGM A;  2XO7 A;  4YQW A;  4HL9 A;  1FA0 A;  4IRK A;  1VQS A;  5A8W A;  1ZS6 A;  2HMI B;  2R2R A;  1H2T Z;  1M5H A;  3TQE A;  3CJR A;  5I3U B;  1WG4 A;  4JI3 F;  2YXL A;  4WFZ A;  2JC0 A;  3OVA A;  5DG9 A;  2CPF A;  5HI7 A;  4L76 A;  3EUN A;  1TFY A;  3IR7 B;  1GTH A;  4F0H A;  3DLL Q;  3M2U B;  3TEG A;  1M5S A;  4O3O A;  1IJE B;  1T0T V;  2VBZ A;  2AF6 A;  5CQG A;  1WAC A;  4TQS A;  1AW0 A;  4ED7 A;  2C2N A;  3P5T L;  3TO8 A;  3MPY A;  3OSN A;  2KM8 B;  3MAH A;  1BHN A;  2BMB A;  3QSY B;  2CQG A;  1XMB A;  2MHN A;  2Y1R I;  4RW9 A;  2DIU A;  2DXF A;  2UXB F;  4C8N A;  1TK0 A;  3VGT A;  1DQ9 A;  3CCJ S;  1LWC B;  2BE2 B;  1KS2 A;  4ANE A;  4O44 A;  1XMQ J;  3GV7 B;  2VFV A;  3OTD A;  2GO9 A;  3FUY A;  3NKY A;  1X60 A;  3H25 A;  7FD1 A;  1S1T B;  4KGZ B;  4PG7 A;  1RWU A;  4B3R F;  2V50 A;  3Q2S C;  2J6U A;  1SH2 A;  3SCK E;  3LPY A;  2VG5 A;  3PY8 A;  2GIF A;  4OZ2 A;  3RUB L;  3MEE B;  2U2F A;  3M6W A;  4J9N A;  4A4J A;  4LBI A;  5J2N B;  4LF5 J;  5LL6 d;  4P2M A;  3QRR A;  2ZD1 A;  1PJ7 A;  2R2T A;  4YY3 F;  1S12 A;  4RUH A;  1PJ5 A;  4A8K A;  2XSF A;  1HPZ B;  2E9T A;  1CLF A;  3OV7 A;  4LJM A;  4OIX A;  2FZK B;  4WK3 A;  4OZ0 A;  1IWG A;  2CQD A;  1RP5 A;  3CJS A;  1J2V A;  3TJA A;  5AXN A;  2YKA A;  5FDL B;  4LFC F;  4XO0 A;  3NG8 A;  2V2K A;  1E6V A;  5D8H B;  4KBI A;  5J2M B;  1P1L A;  2BJE A;  3AD7 C;  1RTH B;  1TAU A;  1E6Y B;  4YHH J;  3U1L A;  3W5Z A;  5KG0 A;  4FYD A;  2LQ5 A;  2K1R B;  2G1D A;  1EKR A;  3HSZ A;  2DEJ A;  2UVV A;  4F8R A;  2DNL A;  4Z7Y A;  4EMD A;  1NJW A;  2UUT A;  5BYQ A;  1LFP A;  3HF5 A;  1ZAV A;  2NZ4 A;  2ZVI A;  3ULH A;  2OD6 A;  4DSL A;  4FYX B;  5DDR C;  1TKD A;  2CPH A;  3JQK A;  1UEU A;  2GHP A;  3TP2 A;  2P2C B;  4PAA A;  1YJW S;  2HHQ A;  1O0P A;  3SDE A;  4QW9 A;  2VH7 A;  1SQE A;  2IPO B;  4LIW A;  4KKO A;  1G4C A;  5G4D A;  4RU9 A;  1QE1 A;  5HBM B;  4TY8 B;  2AYM A;  5E41 A;  1QJH A;  1X4F A;  2AMC B;  5SZT A;  4HLB A;  1F9E B;  2YNF B;  3BKF A;  2QMW A;  2CAD A;  3NCP A;  2C2Z B;  1KHV A;  1IJF B;  3KK1 B;  3D6H B;  3POT A;  4ZP7 A;  3PW5 A;  4DXL A;  2HHS A;  1YRT A;  1XMO J;  2VQF J;  2MDA A;  4K59 A;  4ZCI A;  4WXW A;  3LAK A;  2OTJ S;  4DSI A;  3M1V B;  2WAQ D;  4NI2 A;  4Y65 A;  1ZPV A;  2VPW B;  2OPS A;  5SUH A;  2UUC J;  3PHT A;  3R8Y A;  3T9Z A;  1TL1 B;  3UN2 A;  4RLE A;  1T3N A;  2EBG A;  4QIV A;  4WJB A;  4ZJQ A;  1T9X A;  2VG7 B;  3AHP A;  3NAH A;  2HND B;  1HNX F;  5FD1 A;  3R5J B;  3BN4 A;  4M8L A;  2CPX A;  3M4X A;  4IFV B;  4LF8 J;  2HFN A;  4PG6 A;  1HHT P;  3IAM 9;  4ED2 A;  3RTV A;  2KZM A;  2QYG A;  2W9C B;  4Q2L A;  3QJP A;  1SQF A;  4JI0 F;  3Q83 A;  5D4L A;  2F8M A;  4CO5 A;  3GCX P;  3K0J A;  2YQ0 A;  1U02 A;  3N5B A;  2G2Z A;  4IG0 B;  3B82 A;  2JEG A;  2CZ4 A;  3PO5 A;  3PX4 A;  5DDQ C;  4DF4 A;  5ETL A;  2VIC A;  2Z30 B;  4P7V A;  3TWZ A;  4EO6 A;  1XR6 A;  4CO4 A;  1SIZ A;  4IDK A;  4IYQ A;  3HXM A;  2NR0 A;  2W25 A;  2FDN A;  2EFQ A;  2CQ3 A;  2QSF A;  3JAM Y;  1HYS A;  1RI7 A;  3J7Y I;  2ZBP A;  4NXN F;  1J5E F;  2MY8 A;  3KHG A;  2V4J A;  1K9M T;  1TUW A;  2UXD F;  4LF1 A;  1KLN A;  2K8G A;  4NA3 A;  3CDB A;  3N6M A;  5IT0 A;  3TAN A;  3FDS A;  1FTC A;  2HGL A;  1TK5 A;  1N36 F;  3QZ8 A;  3RRK A;  3N28 A;  4DX5 A;  5HMX A;  3QPI A;  4H4O A;  1NDP A;  5KFH A;  2YX1 A;  5IT9 Y;  1SC1 B;  2Z4P A;  5LJ5 Y;  4X66 J;  2KFY A;  1HIY A;  4L3K A;  3N0V A;  1S77 D;  1I3O B;  2ABY A;  5KFV A;  3KHL A;  2JC1 A;  3MM7 B;  3HKZ D;  3R7B B;  5J1E A;  1N8R T;  4XPE A;  4CLK A;  5KFQ A;  1RLC L;  2VFS A;  1HBO A;  1Y7P A;  2EG2 A;  1NBE B;  2FHO B;  2CVI A;  4DG1 B;  2V67 A;  5CH7 B;  5C24 B;  2B6A B;  5LXY A;  4P2S A;  2O1P A;  3JYT A;  5H9E K;  4DV0 F;  2XBP A;  1FRM A;  2KVQ E;  1C1B A;  2APO A;  3GTY X;  4C8Z A;  1RE1 B;  1Y5N B;  1S9E A;  4IRC A;  1ZBT A;  2KM8 C;  2ZH4 A;  3BYP A;  3UDL A;  3CCM S;  4QWE A;  3MXH P;  2JEJ A;  3IAS 9;  3SFG A;  3TUZ C;  2DTJ A;  3MM8 B;  3OFG A;  1S6Q B;  2XY7 A;  1VBZ A;  2X7I A;  3ZZU A;  1S79 A;  1V3S A;  4LRE A;  1XR5 A;  5CD4 A;  4K4X A;  5B0F A;  1T9T A;  3FRY A;  2AGQ A;  1FVS A;  1LW2 A;  2MQQ A;  2LXF A;  1N5V A;  4MYU A;  4A8Q A;  5LOQ A;  2OPR B;  2QYC A;  3NMA A;  1D3W A;  2FHK A;  4KIA A;  1WEZ A;  5KG5 A;  2IHR 1;  3UDE A;  1RT7 B;  3D2W A;  2HRT A;  2W2Q P;  4UST A;  2A6M A;  1VBK A;  3CCQ S;  3C16 A;  2MQL A;  3HSJ A;  2KFZ A;  4ZLL A;  3HSG A;  3MCN A;  2E44 A;  1KFS A;  2W9B A;  1DJ0 A;  1YJ7 A;  2P6T A;  3SFU A;  1MW7 A;  3ET6 B;  3GV5 B;  4GRS A;  1MN7 A;  3KG0 A;  1CQM A;  1KC8 T;  5AXM A;  2KYX A;  1N34 J;  4K4U A;  3NNA A;  3SCI E;  2MQN A;  2X1F A;  3BM7 A;  4BDP A;  4CCH A;  2A10 A;  3R97 A;  3SQO P;  4G1Q A;  2ZNZ A;  1FE0 A;  3E3X A;  4QW8 A;  3PV8 A;  1H73 A;  3GR1 A;  4PZV A;  3NGD A;  4KY3 A;  3B4D A;  3KLE B;  4JV2 A;  3QO9 A;  2J6T A;  4OZL A;  2P5V A;  1T9W A;  2AU0 A;  4ED3 A;  3DOK A;  1OS5 A;  1ZH5 A;  5DZ7 A;  3KLG B;  2VG6 A;  3NCR A;  2GAH C;  1VQ4 S;  2W8K A;  3O3L A;  1I51 B;  2BYC A;  4DR1 J;  4B02 A;  4ZJO A;  3GSD A;  3W2W A;  2VPX B;  1N54 B;  4ZVT B;  4YEA A;  2AJQ A;  2BVZ A;  1KN6 A;  4WXO A;  1RT2 B;  3CJ0 A;  1FFG B;  1HBM A;  4J5O A;  4ID8 A;  1S1U B;  3FQK A;  3CD7 A;  4DUT A;  2LEP A;  4QCL A;  1FRK A;  4PWW A;  3OW2 R;  3SBM A;  2XMM A;  4ZN3 A;  4U8V A;  3O5T B;  1C4C A;  1IBK J;  1FVQ A;  4PUO B;  1AZS B;  1RU2 A;  4DX8 H;  2DR5 A;  5T14 A;  1IM4 A;  3T1H J;  1JLG A;  4I2P B;  4LRC A;  5LSO A;  3NGT A;  4PWD A;  4J9R A;  4P72 A;  3H20 A;  4ECT A;  1DUR A;  4DR7 J;  3CPW R;  3AH6 A;  3UCG A;  1DTT A;  1HNZ F;  3BRE A;  1JQG A;  1YJU A;  2ZIT A;  4NX9 A;  3ISN D;  2VDH A;  1Q0N A;  1FDN A;  3W63 A;  3TNV A;  4OYB A;  3ILO A;  4LRA A;  4IUF A;  3L4B C;  2E1C A;  2AHO B;  4AQY F;  5KFY A;  1D8Y A;  3RG6 A;  1S6P A;  5LMU F;  3BDP A;  5EUH A;  1XC9 A;  2PEB A;  3ZFV A;  3QBC A;  1UFK A;  2VFT A;  3QLH B;  3TAR A;  3MMB A;  5KT5 A;  3GZ7 A;  3J7Z 5;  5DET A;  2F8E X;  5C42 B;  5A8K A;  1VIS A;  4JB8 B;  1U1Q A;  4IOA Q;  3HT0 A;  4DV5 J;  2RH3 A;  1SJ4 P;  2XSJ A;  4MH8 A;  2KJW A;  2HNZ B;  3DGP B;  2EFG A;  2WK4 A;  2LDY A;  1C0U A;  2LQJ A;  3PYG A;  4PXC A;  2AKW B;  4O3S A;  3ILL A;  1XNR J;  1J5O B;  1QAI A;  3AJ2 A;  2E5L J;  3T1Y J;  3W5Y A;  3TYT A;  2ZKU A;  3OL7 A;  5H9F K;  3GLJ A;  3BQ1 A;  3PX0 A;  5DM6 Q;  2R8I A;  2UXC F;  5KFX A;  3BGU A;  1JLF A;  1XER A;  4NCB A;  4DCP B;  1CS4 A;  1R0A A;  3M2R B;  3GJT B;  3MUV P;  5KOX A;  5D0H A;  2VBW A;  1X4B A;  2HUR A;  4UY8 5;  3TAP A;  1HNW F;  2GJF A;  2MXY A;  3KUG A;  3PEH A;  3KK3 B;  1PBA A;  2EK1 A;  1LXN A;  2F3J A;  5DGB A;  4GVB B;  3NL0 A;  2E1M C;  4B9L A;  1RT3 B;  5ETV A;  1FFS B;  3IN5 A;  1FO1 A;  4GKK J;  2WSC C;  3NOC A;  4JI5 F;  3DMJ A;  5C5J A;  1ZTW A;  2DY1 A;  2MHE A;  1FWP A;  3OR2 A;  4RUC A;  1F6T A;  3ZZT A;  4ELU A;  4OMF G;  1KQF B;  3V81 A;  4QYR A;  4L3N A;  3LO3 A;  2CG8 A;  1UFW A;  1UW9 A;  4M5D B;  1QAY A;  3ZZR A;  4N77 A;  5M2U A;  3D5M A;  1FKP B;  3TUI C;  4M63 A;  1VGY A;  2HS4 A;  4LIR A;  1K73 T;  1RAH B;  4ZPB A;  5IS2 A;  4HHU A;  3WIV A;  4URQ U;  1TTH B;  2ZH7 A;  4X65 F;  1HQE A;  3MEC A;  4GO7 X;  1SVD A;  3CB4 A;  4URG A;  3H59 A;  2KXF A;  4KHR A;  1U8W A;  4QR0 A;  2L9D A;  1X9M A;  1B99 A;  1N33 F;  4MFB A;  3J7A 1;  1YBU A;  1T8E A;  3UD5 A;  4NCG B;  3I5C A;  4ZVE A;  4ID5 B;  3UN3 A;  3THV A;  3FEZ A;  2X1A A;  4MIW A;  3I87 A;  1VBY A;  4OX9 J;  3DKD A;  4K2J A;  2DGX A;  3MAQ A;  2J9D E;  2LU1 A;  1RAB B;  1FKA F;  4DPW A;  1GXU A;  1U0H A;  1GX5 A;  5HLF A;  1GMU A;  3CJ8 A;  4RJV A;  3GCW P;  1CJU A;  2DNK A;  1U1L A;  2UP1 A;  2GJI A;  5ETM A;  5MLC V;  3IS9 B;  4L75 A;  2BV3 A;  4FKY A;  3VQS A;  1VRT A;  3D0H E;  4URS A;  3DFE A;  3MM5 A;  3Q8Y A;  1TV6 B;  1S48 A;  1FE4 A;  2CQ4 A;  3MEK A;  3P96 A;  3WZ0 A;  3VCD A;  2DEI A;  5IWA F;  1GX6 A;  3M8P A;  1YJ9 S;  1RAO A;  4FPR A;  1A9N B;  2VHG A;  2V8D A;  2C2E A;  1KDN A;  1R0C B;  2FLP A;  3ISZ A;  3QGH A;  2FJA B;  3A3O B;  1S72 S;  4F50 A;  2YX4 A;  4HAC B;  1ULR A;  3L3C A;  1UTA A;  1JLA B;  1MWQ A;  1IKX B;  3EZU A;  2H51 B;  2BQ3 A;  5C25 A;  1FJG F;  2DNO A;  2W2O P;  4JYA F;  1L3T A;  5KFB A;  4N47 A;  3AJ1 A;  4ERD A;  1RAF B;  2V2Q A;  2RDJ A;  3DI6 B;  4N8N A;  1RYR A;  4DQS A;  1SC6 A;  2RF2 B;  2Y9H A;  2CWK A;  5EN1 A;  3BGL A;  4EYI B;  3UVJ B;  2NRE A;  4LF6 F;  4DPX A;  2JDJ A;  2WVC A;  1TVR A;  1Q8B A;  3U7J A;  6FD1 A;  3V6J A;  4WP3 A;  4JI3 J;  2W4C A;  2CPJ A;  4CM0 A;  3SIP B;  1JKH B;  1FRJ A;  4AT1 B;  4UOG A;  3W9H A;  1P1T A;  1VIO A;  1PSD A;  2ZH2 A;  4KGV B;  4WFX A;  1HWJ A;  4KGK A;  4EI2 A;  1RHM B;  5B09 A;  2FGC A;  1H38 A;  2VDI A;  5EX0 A;  3AB2 B;  2MLY A;  5B08 A;  4C0B A;  5E2Q A;  3I6P A;  2UUA F;  2C3U A;  1WD6 A;  3CUL A;  1D9F A;  2G0C A;  2XMV A;  1HNI A;  2Y8W A;  3MM9 A;  4GO5 X;  4G6V B;  1U09 A;  1ZM3 A;  1KOH A;  2OPQ A;  4EBE A;  1T94 A;  3NNH A;  5E3A A;  1H0H B;  2UXB J;  2UVR A;  3GFZ A;  1R7I A;  1BY9 A;  1RAD B;  1X0P A;  2VAS A;  3ITH A;  4DV2 F;  1IQT A;  2HVE A;  2B9E A;  4DUY F;  2DB1 A;  5KFL A;  2KFN A;  4ZVU B;  4H4K A;  2V94 A;  4I6W A;  1R6Y A;  2J0Q D;  2ZBQ A;  4B3R J;  2FLO A;  1NJZ A;  4G65 A;  2L48 A;  3ZTQ A;  1BQN B;  1QAX A;  2MZS A;  3VAJ A;  2W2N P;  4C3L A;  2N7Y A;  2E9Z A;  5LSR A;  3HVT A;  1LK7 A;  2JZ5 A;  3PFE A;  1YDL A;  4O0I A;  1PBU A;  1F9F A;  1JMT A;  1B7F A;  3FCH A;  2P9G A;  4OZ1 A;  4YY3 J;  4R5P A;  1Y4Z B;  2FUG 9;  5BJR A;  2BJD A;  3AA8 A;  2HZA A;  3DLH A;  2B4O A;  5KT3 A;  4ZCK A;  4QYZ J;  1KVJ A;  4CYU B;  1DTQ A;  4NLV A;  2XY5 A;  4X4U A;  4DX6 A;  3GJQ B;  4LFC J;  1S0M A;  4F36 A;  1GNK A;  4NYZ A;  2XCP A;  3VAI A;  3F41 A;  3UW1 A;  3GYX B;  4ELT A;  2I8E A;  1Y9O A;  1UMJ A;  1U48 A;  1WTB A;  3W61 A;  1FDB A;  2QC3 A;  2EFP A;  2DGO A;  4O0N A;  2WSE C;  1L3S A;  1X5O A;  4OHX A;  3LUY A;  2DGU A;  2PMH A;  1UWB B;  3H7H B;  1RAI B;  3K17 A;  1DRZ A;  2JVO A;  2R3V A;  2E5J A;  4DL0 C;  2HPU A;  3TAQ A;  2Z0G A;  3CDA A;  3M30 A;  3CJK A;  2B7C B;  1VYA A;  2MQP A;  3G71 S;  3BSO A;  1TFW A;  2R7W A;  2JLG A;  3PIO Q;  2CJ9 A;  1RKJ A;  3BDE A;  2WBR A;  5KFC A;  1NK0 A;  2ACY A;  5GME A;  1FF2 A;  2I6W A;  3K8V A;  4C8L A;  1TR0 A;  3DU5 A;  4WU2 A;  4FPI A;  5THW A;  2RB7 A;  4ALZ A;  4W92 B;  1UET A;  4HTJ A;  1C0T B;  3GJR B;  1KWM A;  2VQE F;  3QT5 A;  4RW4 A;  3ETO A;  1JJ4 A;  1VRU B;  1HQ2 A;  3HD1 A;  1K1S A;  2BKN A;  2B5J B;  3OJS A;  3RRG A;  4A8F A;  3A8J A;  4C6A A;  2ILY A;  1WNE A;  1YI2 S;  3JSY A;  4ILM A;  3GYN A;  2IM0 A;  2ERR A;  3D6T B;  4AXJ A;  3NCQ A;  3N9U C;  4J7C A;  1C1C A;  1HWL A;  2JSX A;  3IGV A;  1R8C A;  3J81 j;  3MUR P;  5A8R B;  2HLT A;  4RW8 B;  4Y2K A;  4FYV B;  4P6Q A;  1UEK A;  4I7F A;  1RK8 A;  4DR5 F;  1BC6 A;  4OYI A;  1HNX J;  3KLH B;  1BMQ B;  3BBF A;  2FPH X;  2NSB A;  2B4V A;  2WHO A;  3M8S A;  4PQU A;  3HHN B;  3DM2 B;  4U95 A;  3WC0 A;  1P27 B;  3BSA A;  5FLX U;  1Y3J A;  2C2D A;  5IT4 A;  3QID A;  1HI8 A;  2IJN A;  1RIS A;  1FKO B;  1RAJ A;  5HN0 A;  4CTA B;  4ECV A;  1NU4 A;  3D0I E;  4M1K A;  2ZJR Q;  1TQL A;  2DK2 A;  2CNK B;  4KPC A;  3AOA A;  3H40 A;  1J5E J;  3QGG A;  2QL7 B;  3PCO B;  2UXD J;  5T7L B;  2JX2 A;  2YNH B;  1HBU B;  3I5B A;  4PPZ A;  5GMK a;  4DCO B;  4FKX A;  1P6T A;  1KNZ A;  3A3P B;  5A6P A;  5B0E A;  3C6T B;  1CJK A;  3I4P A;  2J7U A;  5HAN A;  4DCJ B;  2K3K A;  2GZO A;  1TL3 B;  3EM1 A;  4OZ5 A;  3ILI A;  1XMQ F;  3US5 A;  3VAG A;  3WC2 A;  3BV8 A;  1SI9 A;  4JUZ A;  1A0O B;  2I5J A;  2IMO A;  1IN0 A;  3SSQ A;  1BD6 A;  5AT1 B;  1ZPW X;  2RSQ A;  1XBW A;  3FMB A;  1T3O A;  3LP2 B;  4Q0B B;  2ZE2 A;  1WHY A;  2FJV A;  4PWU A;  2RUS A;  2ZH1 A;  5E5N A;  1RUS A;  3O1L A;  3FFI B;  1QAJ A;  2YY3 A;  5A2Q U;  2RNE A;  4Y2A A;  3UFC X;  5KTQ A;  2RS2 A;  4F4X A;  4JI6 F;  1SJQ A;  4OYP A;  2KU7 A;  1R43 A;  3RB3 A;  4DV0 J;  3IA0 A;  2A3J A;  5L1I A;  1OQ6 A;  1WDD A;  1LOU A;  2FB0 A;  1HQU B;  2XMT A;  1QTM A;  1YLX A;  1DY3 A;  2BKO A;  3K8W A;  1CJT B;  1T05 A;  3LWM A;  5E33 A;  1B0P A;  4N76 A;  3V6D A;  3O44 A;  1XJW B;  3I0R B;  4ANC A;  1VS3 A;  4C3K A;  3P49 B;  2VV5 A;  3GII A;  2Q6C A;  2VOD A;  2C22 A;  5CAA A;  2A2D A;  1YRU A;  2DO0 A;  4KT0 C;  4IO1 A;  2YPZ A;  4RWW A;  1K44 A;  5ADZ A;  4C98 A;  1JWW A;  2RUG A;  4X62 J;  4RBV A;  3B8H A;  2F9D A;  1G2E A;  3AD9 C;  2MSS A;  2GVZ B;  4P10 A;  5J2Q A;  1YJN S;  2PT0 A;  4OV6 A;  5KFI A;  4DPO A;  3SZ2 A;  2AJ4 A;  4YR0 A;  4ZVG A;  4OI1 A;  4DR3 F;  4CQ1 A;  3BQ0 A;  5F8H A;  1YK9 A;  2QIF A;  4X4S A;  2OAU A;  3SQG A;  3MAA A;  1OPI A;  2VG5 B;  1P9Q C;  4MK7 A;  4YS2 A;  4OZJ A;  1I5O B;  4ZMM A;  5AJ3 F;  3Q8Q B;  2CJK A;  3RW6 A;  5MAO A;  1T9U A;  2RU3 A;  4Y00 A;  1C2P A;  2X3D A;  2O3D A;  3SXL A;  5K5M A;  4ZPV R;  4QWD A;  1BUX A;  3ZTP A;  1XMO F;  5BYS A;  2YH0 A;  2VQF F;  1ZET A;  4B3O A;  2Z58 B;  3GU0 A;  4WIQ A;  1H3D A;  2LU2 A;  3QYY A;  1FNX H;  3KK2 A;  1V5V A;  4F02 A;  2U1A A;  1RA6 A;  3MCM A;  2DR6 A;  2Q66 A;  3M9O B;  3FBE A;  3DLE A;  2UUC F;  1RAA B;  2M2B A;  1FFW B;  3PYD A;  3A4T A;  5GVQ A;  2MST A;  3CUN A;  1LWE A;  5CD4 H;  1LW0 A;  1ICE B;  1N88 A;  1S0O A;  4PXB A;  2Z2M A;  1H74 A;  3JSB A;  1ZA1 B;  2OP5 A;  4GKJ J;  1N6Q A;  2KJV A;  3HLU A;  2MKH A;  5CYJ A;  3P3D A;  4ECS A;  4U9R A;  4TU7 A;  2W8L A;  2D41 A;  4DQI A;  3D6M B;  1N5Q A;  2OPP B;  2WCX A;  4RO0 A;  1NK8 A;  1EKS A;  2IC3 B;  2C1E B;  3W2V A;  2Z2L A;  4GC7 A;  2QLX A;  2J0W A;  2H4W B;  3SEO A;  2F8H A;  4P52 A;  3IG1 A;  4O3P A;  4CNZ A;  2I1R A;  1IBL J;  1BQM A;  4UOC A;  1IR1 A;  5KFJ A;  2IVF B;  1HNZ J;  5HQ8 A;  2B9W A;  3PTW A;  4PAB A;  1VIX A;  3HHK A;  4B17 A;  1T02 A;  4I64 A;  3BO2 A;  6FDR A;  3POT B;  1FI4 A;  2ZH8 A;  1EHW A;  3EPG A;  3K5L A;  5J2P A;  3UD4 P;  3FVY A;  4L74 A;  3HD2 A;  4LF9 J;  2XC9 A;  1WUU A;  2XZD B;  4Q45 A;  3DGV A;  4AQY J;  4NI2 B;  4EZ6 A;  1PJ6 A;  5GAH I;  5LMU J;  3CXC R;  1MWZ A;  1CC8 A;  4OYO A;  2VJU A;  2MMY A;  2B9X A;  4FS2 A;  1DQA A;  2IA6 A;  2DXE A;  1CQN A;  1B4S A;  3LPE A;  2K3I A;  2NXJ A;  1WI8 A;  5GAH U;  4OZN A;  4C9D A;  3HCX A;  4OJ1 A;  3RW7 A;  3PW7 A;  4X4O A;  4YB1 P;  3MD1 A;  3FKB A;  2C42 A;  2FHM A;  2KI2 A;  2EWH A;  3W60 A;  3CO0 P;  1XTZ A;  4WU3 A;  1RKI A;  3DRP A;  2GGP A;  4ES2 A;  5KFP A;  4OYZ A;  4V19 J;  5BYR A;  4QIW D;  4B9M A;  2YWG A;  2LVW A;  4IDK B;  2NYH A;  4K4W A;  1F1B B;  2WW8 A;  3RR7 A;  3H90 A;  2MJU A;  5KFE A;  4JI7 F;  2UXC J;  3TUJ C;  2QMU B;  5D15 A;  1CJV A;  3RAX A;  1LFW A;  2QEX S;  4C8K A;  2V4J B;  5T41 A;  4DPU A;  1HNW J;  1RLD A;  5A76 A;  3QGP A;  3VVT A;  3KOA A;  3ZNJ 1;  1SJR A;  1KQK A;  4UQG A;  2DNG A;  4KGX B;  2H5E A;  1UVI A;  1H2U X;  1X4A A;  2CUY A;  4EEY A;  5M2P A;  1UWA A;  4H4O B;  3ISN C;  2ZBI A;  1CG2 A;  4DR2 F;  3CJ3 A;  4IR1 A;  4W98 A;  2ZFH A;  4LR9 A;  2QTW A;  3ZXW A;  1N0U A;  2ZEJ A;  3TA2 A;  1G1X A;  1WKK A;  2IM2 A;  3M2U A;  3MMA B;  4ECQ A;  3CJ2 A;  5J1E B;  1AXQ A;  3MMC A;  1YIT S;  2HBR B;  3KLI B;  3RB6 A;  3RBE A;  5F8L A;  3IWN C;  5LM7 E;  2B3T B;  2XTJ P;  2H65 B;  2HHP A;  4ZP8 A;  5HVF A;  1KR4 A;  2XUL A;  2GJ2 A;  4X65 J;  1U0S A;  4LF4 F;  4HT7 A;  3JYT B;  2O67 A;  1H7W A;  1N34 F;  2NLW A;  1SV5 B;  1Q5V A;  3OVS A;  1UVL A;  1S9E B;  1N33 J;  4DWI A;  3OXF A;  1LWC A;  4PXD A;  5HQL A;  4OYX A;  1YKW A;  2FVS A;  4CIO A;  4Q8E A;  4HDG A;  4DZD A;  1U4B A;  2E9R X;  4ILL A;  2NXE A;  3R1H A;  3C6U B;  5F9L A;  5IQQ A;  1IR0 A;  3PO4 A;  1GH8 A;  5DG7 A;  1GTE A;  1NH7 A;  7FDR A;  4JV5 F;  1O51 A;  1LW2 B;  3OXL A;  3PX6 A;  5D78 A;  2XY6 A;  4FF3 A;  4KV8 B;  3QQC D;  4DUZ F;  1JXE A;  5J2N A;  3V6K A;  2E1P A;  2B8Q A;  3EGN A;  1RBO B;  1M5P C;  2ZH6 A;  3M32 A;  3VHQ A;  4UOF A;  2RQM A;  1G7C B;  2F9J A;  2DNP A;  3LA0 A;  2VKZ G;  3NS7 B;  3DRS A;  4DR4 F;  5M2R A;  2ZDO A;  2Y0S D;  2OFG X;  1HWI A;  1FRI A;  4OX8 A;  2C3M A;  3UCZ P;  3IRX B;  3C16 B;  1RTH A;  4B9N A;  3GG1 A;  1E6Y A;  3T1H F;  2OH2 A;  2QGF B;  4DI6 A;  2OEK A;  4LFB F;  2M9K A;  4JI2 F;  2W9B B;  1HLW A;  2ASY A;  1RTZ A;  1RCO B;  3C14 B;  2QO3 A;  5CCM A;  1FJG J;  4JYA J;  3KTQ A;  3CC2 S;  3KWM A;  1HD1 A;  3DDI A;  2IRY A;  4ZN1 A;  2UV8 A;  3R5D A;  2F7V A;  1BWE A;  3VAM A;  3A8E A;  3HMJ G;  3TRG A;  4DL6 A;  5L39 A;  1XN9 A;  1RTJ A;  1F5C A;  4G1Q B;  4WFN Q;  1XNQ J;  3UO0 A;  5KG7 A;  1RDR A;  2VC1 A;  3G8S A;  4MIB A;  3QO9 B;  5E0O A;  3D4J A;  2LA6 A;  1N5S A;  2H5J B;  5U47 A;  3NGU A;  3KLF A;  5I42 B;  4LF6 J;  1X5P A;  5HBM A;  3UE2 A;  4TY8 A;  1MU2 A;  1F3V A;  2EPI A;  4U7U K;  3T5H A;  2QE5 A;  1UJ6 A;  2LEA A;  4H54 A;  3FSY A;  2GHV C;  4ZCM A;  3MM6 B;  4ZVS B;  4JI8 F;  3KK1 A;  4YN3 B;  5ETP A;  1GAO A;  2OHD A;  5DQG A;  2HQI A;  2HK3 A;  3JSM A;  1HBM B;  2DD8 S;  2GCF A;  1VLO A;  2KRB A;  4DS4 A;  1XNR F;  4CLT A;  1SH3 A;  2PSZ A;  4ZLN A;  3VF0 B;  2B43 A;  2PFF B;  2KKH A;  4BS2 A;  1QSS A;  3QJJ A;  4LQ9 A;  3AB4 B;  2XS7 A;  3M1V A;  3KJN B;  2LEC A;  2W2M P;  1UW4 A;  2A1B A;  5IV4 A;  1LNQ A;  1TKZ A;  3PKM A;  3RBZ A;  1EZZ B;  1Q8I A;  1TL1 A;  2OEM A;  1JLG B;  2H54 B;  3MF5 A;  1S76 D;  2DNM A;  4PWD B;  4J9Q A;  2VBY A;  1H72 C;  2CNN B;  2C3P A;  4DV2 J;  3PFO A;  1VQ8 S;  4RKU C;  4DUY J;  5HVH A;  2CQH A;  4RX6 A;  2EVZ A;  1IBC B;  1F60 B;  3SMZ A;  2W9C A;  4NOH A;  3DNC A;  2HAF A;  3T1A A;  2R8G A;  3SCL E;  4OLO A;  1WEX A;  1U2F A;  3Q22 A;  2YTC A;  3R5G A;  2GO8 A;  2BRK A;  1F3F A;  3DXB A;  4A8O A;  4IG0 A;  2YNI B;  4F25 A;  2DNY A;  1S6P B;  3UR3 C;  1S9F A;  4C11 A;  5A0Y B;  5HSP A;  5HO4 A;  2JJ4 D;  5LMN J;  1HD0 A;  3KFW X;  4HHH A;  1T11 A;  8RUC A;  2XEX A;  2RDI A;  1WDT A;  4R8U B;  3CJ5 A;  4L73 A;  2EKN A;  3BBC A;  1NHV A;  3IP0 A;  3C3L A;  5IC4 B;  4KQZ A;  2XSJ B;  2F65 A;  4JI1 F;  4I6Y A;  3TVZ A;  4DBQ A;  3EGZ A;  2D3O R;  5LT5 A;  2HQC A;  2HLU A;  5K8M A;  1Z2L A;  1PIL A;  2ZWO A;  2GVD B;  3ZNU A;  3HHE A;  2J76 E;  5L1K A;  2CQB A;  4OX9 F;  3MM7 A;  2P9E A;  2C28 A;  2DGV A;  1J27 A;  4JI4 F;  1CS4 B;  3I0S B;  1WC4 A;  1WJ9 A;  1WKJ A;  4C0H A;  2ADB A;  3ZZO A;  1NAQ A;  3GR0 A;  2EC2 A;  2WB1 D;  1M1G A;  5C24 A;  2B6A A;  1K0T A;  1RZM A;  2LMI A;  4C97 A;  2HK2 A;  4CLY A;  2ZHO A;  1RWO B;  3PIP Q;  4ZCL A;  2KDO A;  4LR7 A;  1REV B;  2UUW A;  3DMJ B;  5K9F A;  3G6X A;  1XIQ A;  3H2U B;  5IC6 B;  3MHY A;  1SL1 A;  3JTN A;  5BXI A;  3HDS A;  4K0K F;  2VQE J;  3V81 B;  3DOM B;  1S6Q A;  3W8G A;  2HGM A;  2KG1 A;  4B9S A;  3D9B A;  3DDN A;  2SXL A;  3OTE A;  1Q8K A;  1YJT A;  2N82 B;  1NK4 A;  4NCA A;  2MZR A;  1NDL A;  4DQQ A;  3E2E A;  5IFM A;  1IKW B;  2VON A;  5FII A;  1UL3 A;  5KT7 A;  2XMJ A;  3HKW A;  1HQE B;  3MEC B;  2IDL A;  4XDC A;  2J9E A;  2OPR A;  3M7V A;  3ENV A;  3MTJ A;  2HHT A;  2GFF A;  2OML A;  2G1H A;  2I9S A;  4ECX A;  2O5D A;  4EO8 A;  5JUM A;  3OUY A;  3K58 A;  4MFB B;  4F67 A;  2EK6 A;  1VMB A;  1QY7 A;  3NS6 A;  2V9K A;  2FVP A;  4WK1 A;  2KT3 A;  5KFT A;  4JOU A;  4DR5 J;  1FHT A;  2HS0 A;  3VZH A;  3J7Z T;  2YWK A;  2H1Y A;  2CQ2 A;  4USM A;  2XHC A;  3V4M A;  3KUE A;  3CJQ A;  3VAK A;  3PW0 A;  4ED8 A;  1FRH A;  3J81 Y;  2BM1 A;  1CPZ A;  4ED1 A;  1ZTT A;  1RWW B;  2HS3 A;  4HH1 A;  3RRH A;  2Z8Q A;  2KZZ A;  3GIM A;  5HLF B;  1S1X B;  2KB2 A;  3ET6 A;  1CJU B;  2MZJ A;  4X4P A;  3M8R A;  2FY1 A;  3UR0 A;  4MT1 A;  4UUX A;  1I94 F;  4ENO A;  1KTQ A;  2HBZ B;  2IRX A;  3DCA A;  4IOB A;  1VRT B;  2BE9 B;  1NH8 A;  4RPF A;  2GMJ A;  3DRX A;  4K7Q A;  2CPI A;  4N56 A;  2H9Z A;  3R9L A;  3AOB A;  1BXN A;  5KG4 A;  4UY8 T;  2XYG B;  2RT3 A;  4IG3 B;  5DDP C;  1W2I A;  3MED A;  3I56 S;  4LRB A;  3WX8 A;  2ZBR A;  1KSP A;  3EYZ A;  4MYT A;  4PPD A;  2GQC A;  3JAM U;  3KLG A;  4HTI A;  2PE8 A;  1Q81 T;  2WB4 A;  1N32 F;  3PKY A;  4F3Q A;  5C25 B;  2AIR B;  2UVW A;  4LF2 A;  5KFF A;  3QJL A;  4K4T A;  4UUW A;  2CQ0 A;  1RU1 A;  1JJC B;  3EXY A;  4HI2 A;  3BQ2 A;  1RT2 A;  2ALY B;  2M3D A;  2YKM A;  1FER A;  3ADA C;  2OLW A;  4G1I A;  3I5A A;  2D9P A;  4TVA B;  5IT9 U;  1CC7 A;  1S1U A;  4C8Y A;  2FY8 A;  1Q86 T;  4X2B A;  3BGO P;  2OIH A;  5ETS A;  3CCL S;  4X4Q A;  4JI6 J;  1U1K A;  2YQ1 A;  1FNO A;  2RHQ B;  1WI6 A;  4PUO A;  3G82 A;  4AUK A;  1TEL A;  1PO6 A;  3H5X A;  1TVR B;  3R6G B;  4LSZ B;  2DT9 A;  3MR6 A;  3OXG A;  2QA4 S;  3JS9 A;  1RT4 A;  2HBQ B;  3H2V E;  1UVM A;  1AFJ A;  2AV5 A;  5I3Q A;  3LGM A;  4ECZ A;  2DY9 A;  2G2Y A;  1SXL A;  2MJN A;  4DV3 F;  2R8J A;  2EFO A;  3RBD A;  2H5I B;  3RB4 A;  4K8R A;  4MKA A;  2HQ3 A;  4LQ3 A;  2GML A;  2BDP A;  2AP6 A;  4HYK A;  4CNY A;  1R3N A;  5H9F J;  4LMZ A;  4WZM A;  3T5K A;  5RUB A;  2J0S D;  3NMR A;  2HZV A;  2KYZ A;  2ZBC A;  2LCW A;  3D6F B;  4IRD A;  3MM9 B;  1H2V Z;  2IVY A;  3FMW A;  1OO0 B;  1MRO B;  1VQO S;  2YX7 A;  5FLX Y;  5EWE A;  3Q8R B;  2XCA A;  2W9A A;  1LKZ A;  3QLH A;  2EXU A;  4DSE A;  1UA1 A;  2NXN A;  2QMX A;  3ITH B;  5C42 A;  2BQR A;  2E1R A;  1UVJ A;  2ZOF A;  2C2M B;  1A6L A;  1B7Y B;  3K59 A;  4QWA A;  3TAM B;  4RW7 B;  3S01 A;  4DR3 J;  1JB0 C;  5IQ6 A;  4ZPC A;  2HNZ A;  3B6B A;  1RT1 B;  4TLR A;  4CLP A;  3AXM A;  1R8P A;  2BOA A;  1NPK A;  2YH1 A;  3LAN A;  4USV A;  2OEL A;  5F8G A;  3B78 A;  1XEZ A;  4PG8 A;  4ITS A;  2Z2Z A;  2HRU A;  3GYG A;  3I55 S;  1KTV A;  4RZR A;  1IM6 A;  3D28 A;  5AJ3 J;  2W4D A;  1Q82 T;  1QLN A;  2DH7 A;  3QNW B;  1BGX T;  3Q89 A;  1MMN A;  5AE3 A;  3G2X A;  3TA0 A;  4IFY B;  4PYA A;  2OMO A;  3AFG A;  1D9A A;  2RU9 A;  1Q4R A;  3F56 A;  4KYZ A;  5F3T A;  1TKT A;  4Z7C A;  4ZVF A;  4NEY A;  4I1T A;  5KFM A;  3LP0 A;  1QM9 A;  1RT3 A;  2BOP A;  1LQ9 A;  1NPR A;  1RCX B;  3MEG A;  3QAU A;  4OHV A;  5HK4 A;  1EIY B;  4NLD A;  1WOP A;  3QFW A;  2QZ8 A;  1KRP A;  1S4E A;  3DHX A;  3T6B A;  4FBT A;  3FZB A;  4CM2 A;  3NWG A;  2DNR A;  5AE1 A;  4MTP A;  3Q2T C;  1ZZF A;  3SCJ E;  3VGV A;  3HJF A;  2D69 A;  2D74 B;  3HM9 A;  2WVD A;  3FQL A;  1UPM B;  3ENA A;  5F41 A;  3KHR A;  1PGZ A;  1RHR B;  4KAI A;  3LP1 A;  4USJ C;  2ASL A;  1L3V A;  1JLC A;  3OVB A;  2MZQ A;  3PVX A;  4USU A;  3K2Y A;  3QZ7 A;  3M30 B;  3CJK B;  1U25 A;  1RXO B;  3C2P A;  3DOL A;  4C2M A;  2MQM A;  1IUJ A;  1FWK A;  3BPD A;  3MCO A;  1JXL A;  3GP9 A;  1RTI B;  4FZV A;  4EU0 A;  5JVG Q;  1S5Z A;  5KT2 A;  3FCW A;  2PA3 A;  4ETX A;  4LBH A;  2DIV A;  2HQF A;  2V0N A;  4K5R A;  3KJQ B;  3M8Z A;  5ETR A;  2BJ8 A;  4NA2 A;  1NO8 A;  3VGU A;  3J7Y U;  3LH2 S;  2POK A;  1YSJ A;  2XGP A;  3QWU A;  3CED A;  3GQC A;  3CCS S;  3PNI A;  4I56 A;  4LR8 A;  4CLF A;  4DL7 A;  4B3T F;  5B7W A;  4M94 A;  2K06 A;  1GT8 A;  3BSC A;  2HW3 A;  3CGI A;  2W1B A;  1LWF A;  1JLE A;  3LWL A;  4USW A;  2B7B B;  1NND A;  5KG1 A;  2FZG B;  1X4G A;  4UZB A;  3ZZ0 A;  1U45 A;  1TP7 A;  1KBR A;  3LF0 A;  3CIM A;  4Y6I A;  3CJ4 A;  3TW0 A;  4OV1 A;  3TA1 A;  1VQK S;  2YNG B;  4AL5 A;  2PEH A;  2CPY A;  3CCE S;  1OYD A;  2R7S A;  2YKN B;  1NB2 A;  1X0F A;  1R6V A;  2J9C A;  4C0O C;  1MSW D;  1HBN A;  1A7G E;  4HAC A;  3QWP A;  2RIL A;  1Q7L B;  5ETK A;  4DU7 A;  4OYA A;  1PIE A;  3AOC A;  1IR2 A;  2GS8 A;  1JJH A;  5HRO B;  3EVM A;  4DL5 A;  3FCV A;  2HFS A;  2XWY A;  4BC7 A;  1HWU A;  2CZ9 A;  4CH1 A;  4JI7 J;  3DI6 A;  2BQU A;  4ED6 A;  4QIF A;  3CME S;  2CQC A;  3CNQ P;  2CPZ A;  4NA1 A;  3RJM B;  3SV3 A;  4EWT A;  1X5T A;  4CO3 A;  1IKY A;  2JEI A;  3MGJ A;  3WBZ A;  4ATN A;  2IAJ B;  4X62 F;  4TYB A;  2H3E B;  1AA1 B;  1CJK B;  4GMK A;  4PG4 A;  1X4D A;  3GIK A;  3EWG A;  1EQ0 A;  2VIH A;  2V2V A;  4DR2 J;  2FC8 A;  1S10 A;  4MK9 A;  3ZO7 A;  4DQR A;  2AGO A;  2P9C A;  4DR6 F;  1RBA A;  3DLG B;  1RSC A;  2PI5 A;  3OFE A;  1YIJ S;  5J1P A;  4AYB D;  1QSY A;  4AD6 A;  4O3Q A;  4GVL A;  1S0N A;  4EFA C;  4UW2 A;  4DOZ A;  4X4R A;  1REG X;  4ZJL A;  2G4B A;  4P74 A;  2Z57 B;  4H4M B;  4LF4 J;  1YQH A;  1N4L A;  2K2P A;  1V3Z A;  5HMZ A;  3NGS A;  3QAE A;  4CT9 A;  1FK9 A;  3FNN A;  2UUB J;  2ZZT A;  1TL7 A;  2R42 A;  2HNY B;  2KL8 A;  4DV4 J;  2AJF E;  3G86 A;  2YKQ A;  1V3R A;  1Q7Y T;  2N4C A;  4Z37 A;  4XDD A;  4LSN B;  3PHE A;  3K5N A;  4LSL B;  1T05 B;  3R2D J;  2CA9 A;  2WW4 A;  3V6D B;  3UPF A;  2R7Q A;  2BW2 A;  2ZDP A;  1WF2 A;  4JV5 J;  3RYL A;  3G6V A;  2Z2Y B;  3TZZ A;  5HQM A;  1YHQ S;  1GMV A;  4DUZ J;  1VQ5 S;  4GKJ F;  4H4K C;  2E5I A;  5L38 A;  2HFZ A;  1X8D A;  4TY9 A;  4F26 A;  1B70 B;  1S7I A;  3WX4 A;  2ACM A;  2WOM A;  1T03 B;  5J2Q B;  2M7S A;  3EDR B;  3EGV A;  1SBR A;  3N4W A;  4DR4 J;  2V34 A;  2V5H G;  1U8S A;  4RWX A;  2AD9 A;  1ZAX A;  1UEV A;  3G9C A;  4DL3 A;  2DR9 A;  3BYR A;  1IBL F;  2CJY B;  4LFB J;  3AY0 A;  1RGV A;  4JI2 J;  2M0G B;  1X4H A;  4C8O A;  5E3C A;  2UU9 F;  5LJ3 Y;  2B4P A;  4R0J A;  3CDU A;  4QJV A;  3D0G E;  3EDQ B;  3JB9 k;  4OJH A;  3BR8 A;  1JK9 B;  4DN9 A;  4DPT A;  2FC9 A;  2F5G A;  4F2R A;  4WYW A;  3J80 Y;  1X5S A;  4L72 B;  2CWX A;  3PG9 A;  4C3M A;  3D67 A;  4HDH A;  1UJ5 A;  1X9S A;  3BGF A;  2HFU A;  3UWT A;  4LF9 F;  4TN2 A;  3BJY A;  5B0D A;  3ETM A;  1I1G A;  3KK2 B;  1HFE L;  2RML A;  5C2G A;  5L9N A;  5D0R A;  2XLI A;  3TZW A;  1Z1Z A;  3DLE B;  3IO1 A;  4ETZ A;  2KO1 A;  1UKU A;  5D6G A;  2PC6 A;  1FDD A;  1ITP A;  4DFJ A;  1S1W B;  5L46 A;  1LWE B;  1EP4 B;  1DLO B;  2N3L A;  4PKD B;  4NLT A;  3K5O A;  1FNM A;  4NLG A;  1VRU A;  4DQP A;  2CJX B;  1Q5Y A;  1N6Q B;  4JI8 J;  2B5J A;  3LGN A;  3Q8V A;  3FJ2 A;  3UI3 A;  4UTG A;  1B0V A;  2MKK A;  4OI2 A;  1I6J A;  4A48 A;  3SSR A;  4CI0 B;  2RRN A;  4OZ3 A;  2HSE B;  4OYW A;  2WRM A;  2BX6 A;  3CT9 A;  4F04 B;  1RWK B;  3T6J A;  3OFH A;  2IBO A;  2OTL S;  4WPA A;  4UQT A;  2BAN B;  3MZI A;  4USI A;  4OHZ A;  5C2C A;  2HG4 A;  1BQM B;  1WHX A;  3DLK A;  4ZVR B;  3BH6 B;  4R0E A;  2QT7 A;  3VZI A;  1B0T A;  1IXK A;  3MR2 A;  2DIS A;  5GAD I;  2NS1 B;  3TVY A;  1OPZ A;  3M6X A;  2CQI A;  3H2L A;  2GQ2 A;  2Z56 B;  2ASD A;  1GXL A;  4FF4 A;  5A6W A;  2L9W A;  4LVO P;  3FBF A;  3PZP A;  4KSE B;  4Q2M A;  4USK A;  3PXG a;  1M5K C;  1MG7 A;  3ZTS A;  2PFD A;  5L9X A;  2C2O B;  1FKO A;  5GAD U;  3R5C A;  1U1N A;  5DG8 A;  4TU8 A;  2AJ0 A;  5IM0 B;  2VKR A;  1FT8 A;  5BR8 J;  1Y10 A;  1U26 A;  1T9V A;  1HW8 A;  4DV6 F;  1MML A;  1SUQ B;  3HHL A;  3U1M A;  3HX9 A;  2V6A A;  3HJV A;  1SH0 A;  5T7L A;  7AT1 B;  1SJF A;  1KP6 A;  3QT6 A;  2AEF A;  2YNH A;  1HBU A;  1FWL A;  2WSF C;  3DYA B;  1FES A;  1NK5 A;  1WWH A;  1EAY C;  4JI1 J;  2AYG A;  2EKY A;  4YB6 A;  3KNA A;  5GAE I;  2EBE A;  3CDE A;  3U1N A;  1D0E A;  2XYH B;  1FD8 A;  1GEH A;  1SQG A;  8AT1 B;  1Q16 B;  3MR5 A;  2HHU A;  3DRP B;  2GGP B;  4XIU A;  2QSW A;  1RWX B;  3LP2 A;  4Q0B A;  2QA4 G;  4F4K A;  2A2C A;  4M5J A;  4P75 A;  4MMO A;  2XI3 A;  2DNZ A;  4P9S A;  1VK8 A;  1CJV B;  4NRU A;  4JI4 J;  2ZOM A;  5HL7 Q;  1KFD A;  3KNG A;  3MPW A;  4FVC A;  2IRU A;  4YME A;  3I9V 9;  4CRJ A;  2L9N A;  1WC6 A;  4CH7 A;  5DLF A;  5B0C A;  2EFN A;  2XQC A;  3IBW A;  3BH7 B;  3BKU A;  1SCJ B;  4CWB A;  3GIR A;  4FYW B;  2AX0 A;  2D3Z A;  3IC1 A;  3JSR A;  4K4Z A;  2ATC B;  2DGW A;  4XTT A;  5D77 A;  1HQU A;  1FJC A;  3BO4 A;  2IYG A;  1CBK A;  3OT9 A;  4K0K J;  1CJT A;  1SIW B;  3QT8 A;  4FBU A;  3GFX A;  1ELO A;  3I0R A;  4M5I A;  3MMC B;  2MLX A;  3W65 A;  3ZTR A;  5EHH A;  5HP1 A;  4KRW A;  4OI6 A;  2IA0 A;  1HNV A;  2WON A;  2VL1 A;  3VQT A;  4W4M A;  3R7S B;  2RE1 A;  5KFU A;  4ES1 A;  3G6E S;  3QIP A;  3KMS A;  4NXM F;  4NAS A;  2PD1 A;  2HWH A;  2A0F B;  2RAQ A;  2HKE A;  2RRA A;  2XMA A;  2GAG C;  3HK2 A;  3CWJ A;  4KFB B;  1KLM B;  2LLZ A;  1T9Y A;  2GVZ A;  1QUP A;  1NK7 A;  2HYI B;  1XNQ F;  2MGZ A;  4NZ7 A;  4A8W A;  4HT5 A;  1S1V A;  4FDF A;  4ZHR B;  4F7V A;  4YR2 A;  3MOZ A;  2O01 C;  3V4I A;  4YDX A;  4ZP6 A;  2IVM A;  4NRT A;  3TZX A;  5K20 B;  4X64 F;  2MLZ A;  3CCR S;  1WOS A;  3G8Q A;  3L7U A;  5KG6 A;  1IKV B;  4BCA A;  1QSL A;  4RW6 B;  4WE1 B;  4J9U E;  1WSR A;  4ICL A;  2E7W A;  1YWX A;  3EZ5 A;  4W90 B;  1KOO A;  1NZ8 A;  4ZP9 A;  3A1Y G;  3CE8 A;  4USH A;  2MKY A;  2V8P A;  1I94 J;  1NSA A;  2G9O A;  5EWG A;  2Q6B A;  1L5U A;  3M32 B;  2MKJ A;  3C8Y A;  4I69 A;  3AT1 B;  4Q5V A;  3ZZZ A;  2IJR A;  1WG1 A;  3W8P A;  5F9N A;  2OSR A;  3DRS B;  4QU6 A;  4C48 A;  2W7A A;  1RQ0 A;  1CEZ A;  2PMW A;  2ZKT A;  4QOT A;  3H5Y A;  3PAC A;  4Q44 A;  1S9G B;  2AJ1 A;  2PDA A;  3T5J A;  3AQP A;  1FRX A;  2XWX A;  1VQM S;  2N7C A;  4NLY A;  3L95 X;  2BBE A;  3FBC A;  3SI8 A;  2HEK A;  2XZT B;  2CJQ A;  4YOE A;  2XO6 A;  4JV1 A;  3MUT P;  2LKZ A;  1N32 J;  4DS5 A;  1JLQ B;  1K47 A;  3J7A N;  3C66 A;  4O23 A;  3A12 A;  1M1K T;  1UZH A;  2AGP A;  2IJF A;  1NB7 A;  1RTJ B;  2NCK L;  4ILR A;  1Q53 A;  1RT6 A;  3OTO F;  4DU8 A;  4K4V A;  2OPP A;  4LF7 J;  2CFX A;  2RKI B;  4UOH A;  2IC3 A;  4YB7 A;  3BKT A;  1KQS R;  3G96 A;  4WZQ A;  4IQX A;  1MMD A;  3EPI A;  2C3Y A;  4LRD A;  3KLF B;  1NLK L;  3C15 A;  5LMN F;  3WDO A;  1IQZ A;  1TL5 A;  1MU2 B;  1RHK B;  2AX1 A;  1HA1 A;  1N48 A;  3PRD A;  2K7K A;  4EK2 A;  2QFJ A;  3LW5 C;  2R7O A;  2ADC A;  1CSJ A;  3GB0 A;  1BE4 A;  4DV3 J;  2RQ4 A;  4QR1 A;  1RT5 A;  1S99 A;  4MKB A;  4P71 A;  1D8Z A;  1JXV A;  3JSM B;  2XI2 A;  2ZJP Q;  2ALZ A;  2YKP A;  3FZ2 A;  4B3M F;  3ENW A;  3LGH A;  4ECU A;  1R89 A;  2QFI A;  3WHI A;  2JNJ A;  2NPI A;  4EUV A;  2FVQ A;  1UVN A;  2FJX A;  2KT5 A;  1YZ7 A;  3K5P A;  1TKZ B;  3MWB A;  5DQH A;  4QPT A;  4KPY A;  4CLL A;  4N41 A;  4AL7 A;  2G2O A;  1EET B;  4IKA A;  3HP6 A;  2AYE A;  1SKU B;  2GNK A;  2DCL A;  2ZZN A;  3UDV A;  1VQY A;  4I2Q B;  2VD3 A;  1F5B A;  1N5Y B;  3DLJ A;  3E01 A;  4DHV A;  3X3U A;  2OJ3 A;  2QX0 A;  3BR9 A;  5CYQ B;  4I6A A;  1CUL B;  1FX4 A;  3PJW A;  2YBV A;  2BJ1 A;  1VJQ A;  2RS8 A;  1KD1 T;  1LXJ A;  3O2I A;  1PAE X;  2FVR A;  1FCA A;  2V68 A;  3TR5 A;  3HFZ B;  3MPV A;  3IM8 A;  5DDO C;  4BLG A;  4NLU A;  2AQ4 A;  3BGR B;  4LBP A;  5DLG A;  3OD2 A;  4UT4 A;  3M2V A;  1NXI A;  3R2C J;  1JLB A;  4C11 B;  3FEX B;  3NWR A;  4J9P A;  5B0B A;  3A13 A;  2W4P A;  2DNH A;  2Q3P A;  5L8R C;  3W62 A;  3DU6 A;  2IFX A;  3BO3 A;  1WSV A;  2VFR A;  2N3O A;  4RNM A;  1PC5 A;  2YQ3 A;  5ITH A;  3CCV S;  2ZC3 A;  1WKL A;  3FK4 A;  2OO4 A;  5KFW A;  3CCU S;  2L41 A;  2G13 A;  1SJ1 A;  1D1U A;  1KKH A;  2OD4 A;  1WTF A;  5CA5 A;  3TJ8 A;  2XNR A;  2I0X A;  5D0G A;  2HQG A;  3DDK A;  4ZDN A;  2DHG A;  4WWS A;  2HZC A;  1ZYQ A;  1SC4 B;  3F73 A;  3B4M A;  5EGY A;  3A3N B;  3MMA A;  3D1H A;  2QL9 B;  2G0J A;  3R27 A;  3KLI A;  1DZ5 A;  2F63 A;  4FP9 A;  4Y0F A;  3PR4 A;  3S1T A;  5AE2 A;  1UP1 A;  3M8W A;  2FGO A;  1VR6 A;  1NCL A;  3LTO A;  1PC4 A;  2XMU A;  1WF0 A;  1P8G A;  5JJB A;  1GXT A;  2XYP B;  3PW4 A;  1SV5 A;  2CPD A;  4HEA 9;  2Y1I A;  2I38 A;  4KE5 A;  4OL8 A;  2DCU B;  1SKS A;  2VFU A;  3WQP A;  3RB0 A;  3OHA A;  5K14 B;  2FHJ A;  3QFH A;  2J8S A;  1U1O A;  3FSI A;  1FXD A;  4DEZ A;  3K7R A;  1OY8 A;  3MR7 A;  3CD6 S;  4F3M A;  5JMN A;  2RQC A;  3OL8 A;  2LP4 A;  2M88 A;  2L3M A;  2FQQ B;  3AOD A;  3C6U A;  1U7L A;  2J0X A;  3RBX A;  4CH0 S;  1NJX A;  1EX8 A;  2ZZM A;  4NWB A;  5F0W A;  3T5L A;  3UN5 A;  4CLZ A;  4KC5 A;  1NJI T;  2W24 A;  4RBT A;  4DV1 J;  4B3T J;  3OJU A;  4DSJ A;  3N6L A;  4KV8 A;  2BM0 A;  4PXE A;  4KTQ A;  5DJB A;  3U27 A;  3ENQ A;  4O4G A;  5CHC B;  4RNN A;  1VDH A;  4WII A;  4NLO A;  3OUY B;  1RTD B;  4Y2I A;  1OSD A;  1GQE A;  4J91 A;  3ZZP A;  4FF2 A;  3P45 B;  3NBP A;  1TUV A;  1PYO B;  1DHM A;  4DLG A;  2NPF A;  1OJ4 A;  1U2R A;  2D1C A;  3NOG A;  5A8W B;  2R8H A;  3IRX A;  1VJW A;  2EC0 A;  2R7V A;  3M8Y A;  3IWX A;  2JVR A;  5C7P A;  5D4O A;  3TOQ A;  2GX8 A;  1RWV B;  4RNF A;  1F5A A;  1TKX A;  4O4R A;  3JQM A;  3C14 A;  4ZS6 A;  3BS9 A;  5KFS A;  5E3R A;  3MMJ A;  4OI4 A;  4LRF A;  1VC0 A;  4NE9 C;  2D3U A;  2GW8 A;  1U24 A;  3TX0 A;  4CDI A;  2RVJ A;  4ECW A;  4O3R A;  2FZC B;  3OLA A;  3VTI A;  4CT8 A;  4BWM A;  3MED B;  4MKV A;  4QU7 A;  5CYM A;  1AUS L;  9RUB A;  5I42 A;  1BQX A;  2DH9 A;  3IBC B;  2HBY B;  4RW9 B;  2E1A A;  5F3Z A;  4ZIV A;  3RR8 A;  1NKE A;  5E3Q A;  1AYE A;  2M8H A;  4O44 B;  3F0N A;  3QRQ A;  2MQ8 A;  2FLN A;  3MM6 A;  3DRR A;  3HHL D;  4DR6 J;  4BBY A;  1U6F A;  1T95 A;  2HAI A;  2CXE A;  2YKM B;  3LAL A;  1HWK A;  4U7C A;  3CCT A;  4OFZ A;  1Y3K A;  3P5B P;  4ECY A;  1Y11 A;  3M8Q A;  2ZHB A;  1HI1 A;  3MDF A;  1Q79 A;  3CCW A;  2AYB A;  3G82 B;  1ZAW A;  3EJM A;  4C7Q A;  1KVI A;  2QLW A;  5G0R A;  2ZD1 B;  3AXK A;  4CZC A;  5IXU A;  6AT1 B;  2KN4 A;  3A8K A;  1NEE A;  1RT4 B;  4B9T A;  1M5V C;  5HMW A;  2ATL A;  1WHV A;  3CVK A;  4FN5 A;  2ROG A;  3BF4 A;  4J37 A;  2XB2 D;  5F8M A;  2ZUA A;  4ZVH A;  2W7P A;  3N79 A;  3H0P A;  1E6V B;  1FDA A;  4KO0 A;  5LSL A;  3KDN A;  4FXD A;  1QD1 A;  5HMY A;  3V6H A;  5DGA A;  3Q23 A;  3CC4 S;  2YNI A;  2CG4 A;  2E5G A;  3G4S S;  3OLB A;  3T3F A;  1ARO P;  1JNR B;  1FJ7 A;  5ETT A;  5A0Y A;  2ZJQ Q;  4PR6 A;  2DGS A;  5KFD A;  5J1N A;  4F0K A;  1Q8L A;  2VJV A;  1JNZ B;  1SC3 B;  3UNG C;  4XPC A;  2JLF A;  2CQ1 A;  2CDQ A;  5EX3 A;  4R8U A;  1D09 B;  4Y3C A;  1LV5 A;  3P6Y C;  4O3N A;  3CF5 Q;  4ZPD A;  2VOO A;  2EFV A;  4BHQ A;  3H42 A;  3FSX A;  3SDE B;  4ZVQ B;  4KKO B;  2WVE A;  4TXS A;  1QE1 B;  2ZC4 A;  2EG1 A;  3OR1 A;  1N52 B;  4D3H A;  3GIJ A;  2FJB B;  2HFO A;  3VR1 A;  2GVD A;  2A6O A;  5F0U A;  5DO2 A;  2UU9 J;  4V19 X;  1F2H A;  3N6N A;  2JHE A;  1URR A;  3Q8U A;  1SL2 A;  3UD3 P;  4G3I A;  2NZC A;  5D3G A;  4CLU A;  4M5K A;  4X4V A;  3I32 A;  3DN9 A;  1GK8 A;  4OJ3 A;  3I0S A;  4HKQ A;  3ONQ A;  4WFB Q;  2VBX A;  2H4Y B;  2BEF A;  2ZHA A;  2JH3 A;  5KFR A;  5JVH Q;  3OPK A;  1HMV A;  2HVD A;  2LYV A;  2Q43 A;  1TKT B;  4UZC A;  4HHJ A;  2PGC A;  3LP0 B;  2YWH A;  2JEF A;  2DGQ A;  4AXI A;  2AW0 A;  2OPS B;  2ZM6 F;  4QZV B;  5EWF A;  3ZTO A;  4HVZ A;  1REV A;  3MEG B;  1WC5 A;  2F4V F;  3M9N B;  4MAK A;  4PQA A;  4NYO A;  3KJV A;  3VGS A;  3KDO A;  3DOM A;  4J9K A;  5HVG A;  2B0G A;  3NRB A;  1S0V A;  1XQI A;  4U8Y A;  2KH9 A;  1AUD A;  1U49 A;  4NLX A;  4NLS A;  3HVR A;  1IKW A;  3LP1 B;  3KJF B;  4KHP F;  1JLC B;  3AAW B;  3NEK A;  2CJB A;  3K89 A;  4U6P A;  3GFH A;  4K4Y A;  4U67 Q;  2GQQ A;  3DOL B;  4WYL A;  4P2F A;  4AL6 A;  4ZPT R;  2OEJ A;  4J9L A;  3MUM P;  3H4D A;  2BUN A;  2H48 B;  4M5M A;  1MLA A;  4F4Z A;  1RWP B;  2RRB A;  2WBM A;  1HYS B;  4ZVO B;  2GIR A;  4CO2 A;  4U96 A;  3CD0 A;  2LXI A;  1ZM4 A;  2YWF A;  2DHS A;  1TAQ A;  4EZ9 A;  3HO1 A;  2AEJ A;  1VHF A;  4DV7 F;  2V4Q A;  2HMI A;  3SSS A;  2EI5 A;  2CPE A;  3IR5 B;  3ILJ A;  5DRK A;  4AE5 A;  4IH7 A;  4NZ6 A;  4PYD A;  5I3U A;  1JX4 A;  3FEY B;  2OSQ A;  3UCU P;  3GJS B;  2C2K B;  1S1X A;  1DAR A;  1XK8 A;  5LXR A;  2E7X A;  2DXD A;  4ZA1 A;  3GG0 A;  3D1O A;  2PII A;  1LWF B;  3SV4 A;  5KOW A;  1JLE B;  2HHH F;  4TLQ A;  4DV6 J;  4ED5 A;  2NUH A;  2V2Z A;  1HBO B;  4M5N A;  1SB6 A;  3EX7 B;  2MYF A;  2HVI A;  4IG3 A;  5DM7 Q;  2R7X A;  4K5S A;  3N5F A;  1C1B B;  2NSC A;  1RWM B;  3BSN A;  3HZG A;  1S57 A;  3Q8S B;  3KUH A;  3JTP A;  2F4F A;  2UUB F;  4RUA A;  1M90 T;  1DFD A;  2PN6 A;  1WHW A;  4DV4 F;  1HBN B;  2Y0B B;  2AZ3 A;  2BE2 A;  2DNQ A;  4NML A;  3GE9 A;  4ER8 A;  1U1R A;  1MNE A;  3CTR A;  4B08 A;  1S1T A;  1FTR A;  1HAR A;  3D66 A;  3M9M B;  1DBD A;  2FJE B;  4FNI A;  2QRR A;  2JFD A;  2NYI A;  4OHW A;  3DHW C;  3KXD A;  2KXH A;  3TEH B;  3MEE A;  1IKY B;  3M6V A;  3E8O A;  4DL4 A;  2DH8 A;  3UDC A;  1W25 A;  3QAT A;  5KFK A;  1V5I B;  1MWY A;  2DVI A;  5HAO A;  4DX7 A;  3EE3 A;  1HR0 F;  4B9V A;  4M95 A;  1HPZ A;  4M5L A;  2R4F A;  1VFJ A;  4Y28 C;  1O6X A;  4TKT A;  1LEO A;  2QA2 A;  3QSI A;  3HFK A;  1LK5 A;  1YZ6 A;  2E5H A;  3KMQ A;  2DHA A;  3CMQ A;  2Y8Y A;  3JTO A;  5FDL A;  5ETQ A;  2M4M A;  4OI0 A;  1L3K A;  2QJ3 A;  5J2M A;  3D68 A;  1FEH A;  4Q8F A;  2V8G A;  2EEY A;  2BRL A;  1UZD A;  4Z2X A;  4NLP A;  2XGQ A;  3CJT A;  1R8H A;  3I4H X;  1NPP A;  2QV6 A;  1RAG B;  4TYA A;  4Y2C A;  2K1R A;  4I4B A;  4NLW A;  3VAL A;  4LT6 A;  4NXM J;  5L1J A;  2GC8 A;  5KG2 A;  2ZH9 A;  4LFA F;  4IOC Q;  2FVC A;  4DSK A;  1MRO A;  4OQJ A;  4QIE A;  1FK9 B;  2ASJ A;  3LAM A;  3BB5 A;  1TL7 B;  1VQN S;  2JWN A;  2ZVS A;  1VC6 A;  1SKR A;  2DGT A;  3BPS P;  2M52 A;  2M70 A;  3I31 A;  3TAM A;  4RW7 A;  2F40 A;  2J8A A;  4R25 A;  3TUP A;  1RT1 A;  2ZUG A;  4X64 J;  1Y5L B;  1P9Y A;  3DOK B;  5DZ6 A;  3RGI A;  3CDW A;  2VG6 B;  2COL A;  3KLV A;  1R27 B;  4JP8 A;  2Q79 A;  2YNF A;  4FYY B;  1NKB A;  2FHJ D;  1PYT A;  1FD2 A;  3W2W B;  3KKF A;  1VHI A;  4KJI A;  2LQ8 A;  2CJA A;  3J81 U;  2LA4 A;  2WOM B;  3H5S A;  1VK3 A;  3P4U B;  4IFY A;  1NDK A;  4DJB A;  1OWX A;  3IWL A;  2C2R A;  1FX2 A;  3MR3 A;  4JV0 A;  1APS A;  3MOJ B;  3CD5 A;  2C3O A;  2BJ3 A;  3PYE A;  2L08 A;  4N5S A;  2YPY A;  3PR5 B;  2RJZ A;  2BW7 A;  1PYS B;  2DKO B;  4YFU A;  4B3S F;  2DRB A;  2VG7 A;  1YBA A;  2HND A;  4TNO A;  1RJJ A;  2F1F A;  1ZM9 A;  1DTT B;  3R5B A;  5D4N A;  4IFV A;  1NK6 A;  2R9L A;  1ZZN A;  4NPO A;  3LOU A;  2BXJ A;  4OYM A;  2X1B A;  4DLE A;  4WF9 Q;  1OIA A;  1QVF R;  3OTO J;  3IFE A;  1Q78 A;  1S7H A;  2KHC A;  4F4W A;  1KHW A;  4WFA Q;  5HAT A;  5BR8 F;  4ZKA A;  2QLF B;  1RTI A;  1U6B A;  1IBM F;  3NY0 A;  2MKC A;  3RZA A;  4IR9 A;  4FNH A;  4KHM A;  2OUG A;  4RNH A;  2ROP A;  3MMB B;  1W2B R;  4NMX A;  1OQ3 A;  2X51 A;  4ZLP A;  4RL1 A;  2BE7 D;  5A8K B;  2R2U A;  1W26 A;  3C19 A;  1U2C A;  2EW9 A;  2XHW A;  5GMD A;  1YRX A;  5E3P A;  3QRP A;  4QWC A;  3S8S A;  1NHU A;  2OKQ A;  3KYL A;  1S6U A;  2MQO A;  4A8Y A;  2HGN A;  3BEG B;  1C0U B;  4FS1 A;  4B3M J;  3EGW B;  2VB6 A;  2HFV A;  2HRY A;  4OJG A;  4HR2 A;  4KR0 B;  1AT1 B;  1NJY A;  1OYE A;  1K0V A;  2VUG A;  1NRK A;  1URN A;  1JLF B;  2KXN B;  1R0A B;  4MKY A;  4ZIW A;  4IQM A;  2V8H A;  3DLK B;  3W3S A;  2CNL B;  2WZ1 A;  2P6S A;  2VPZ B;  2ZH5 A;  4DG1 A;  3CSK A;  1HW9 A;  2BZ2 A;  2YWW A;  3HPO A;  4FXW A;  4X84 A;  3I82 A;  2JLE A;  2YNG A;  1QTN B;  4DDF A;  3NAI A;  1VI7 A;  3IXQ A;  4QPX A;  2XMK A;  4JI0 J;  1Y00 A;  2YKN A;  3O8W A;  1VQP S;  5KFA A;  4C4W A;  1YVF A;  3EIC A;  4FF1 A;  5DQI A;  5KT6 A;  4PCQ A;  3PJX A;  3OR2 B;  4WBF A;  4ZPA A;  4OX6 A;  5HRO A;  3QT7 A;  1V9O A;  2DRD A;  2E66 A;  3MM8 A;  2G0I A;  4A8X A;  3G6Y A;  4WTO B;  4J9O A;  3DRY A;  3W1Y C;  2D3O 1;  4RR5 A;  2IBK A;  2OFH X;  2WVF A;  4NXN J; 
#chains in the Genus database with same CATH homology
 2E1P A;  3GCX P;  2Z58 B;  4JP8 A;  1V5I B;  2W2M P;  2ZWO A;  2W2N P;  3CNQ P;  2ZWP A;  2W2O P;  4OV6 A;  1SPB P;  3GCW P;  3WIV A;  3P5B P;  1ITP A;  2Z2Z A;  3H42 A;  3SQO P;  2W2Q P;  2Z56 B;  1R6V A;  2PMW A;  2W2P P;  3BGO P;  2Z57 B;  4K8R A;  3VHQ A;  2QTW A;  3AFG A;  2XTJ P;  3CO0 P;  4NMX A;  3WIU A;  3WHI A;  3VV2 B;  2Z30 B;  3A3P B;  4YN3 B;  1SCJ B;  3A3O B;  3QFH A;  2Z2Y B;  3A3N B;  3BPS P;  4NE9 C;  3T41 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...