2W2OP

Pcsk9-deltac d374y mutant bound to wt egf-a of ldlr
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
92
structure length
92
Chain Sequence
TATFHRCAKDPWRLPGTYVVVLKEETHLSQSERTARRLQAQAARRGYLTKILHVFHGLLPGFLVKMSGDLLELALKLPHVDYIEEDSSVFAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROPROTEIN CONVERTASE SUBTILISIN/KEXIN TYPE 9
publication title Structural and Biochemical Characterization of the Wild Type Pcsk9/Egf-Ab Complex and Natural Fh Mutants.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/receptor
total genus 21
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2008-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF05922 Inhibitor_I9 Peptidase inhibitor I9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 2w2oP01
2W2NP 1R6VA 4NE9C 3A3OB 3GCXP 4YN3B 2Z30B 3VV2B 3QFHA 3WIUA 3CO0P 2ZWOA 2W2PP 2W2OP 3CNQP 1ITPA 4JP8A 3T41A 3AFGA 1SCJB 2ZWPA 2Z57B 3WIVA 3GCWP 2Z2ZA 2E1PA 3VHQA 2W2MP 4NMXA 3BPSP 2QTWA 3H42A 2Z56B 2PMWA 3A3NB 4OV6A 3WHIA 2W2QP 3A3PB 2Z2YB 3P5BP 1V5IB 4K8RA 1SPBP 3BGOP 3SQOP 2XTJP 2Z58B
chains in the Genus database with same CATH superfamily
2MGZB 2DGVA 1JK9B 3R5BA 2XG8A 3SFUA 3ENVA 1M0SA 3H2VE 2H1YA 4J9QA 2H4WB 4P2FA 1J5OA 4NMXA 1REVA 1IBMF 4YB7A 3VAGA 2A6MA 1WJ9A 4USIA 1AZSA 3ELHA 2NXEA 1C0UA 2OPSB 2HNYA 5IT9Y 3LP0B 5L9NA 3O44A 1P1TA 1SC1B 5DRKA 1CBKA 3M2RA 2E44A 4NX9A 2FD2A 1SQFA 4NYOA 4DSFA 3KHGA 4OYOA 2YKMA 2OPRA 3CJ3A 2GW8A 4ZOSA 3QAUA 1D9AA 4DFKA 2UXDJ 1TV6A 2ZDOA 2CNKB 1X9MA 4M5KA 4YEAA 2W01A 1HNWJ 4Z37A 2B5JA 2IVFB 3ILOA 5H1SV 1C2PA 3Q8SB 3C6UA 3H8YA 1RHMB 1V3RA 2CPZA 4M5DA 1VDHA 5GAHI 2Z4PA 3H25A 2IDEA 1FA0A 2R7VA 2KT3A 2QIFA 4QIFA 4IUFA 3QT8A 2XMAA 1APSA 2VFRA 1BE4A 2BANA 4ZMMA 2DRDA 1PYOB 2X1AA 1RT5A 2QMWA 1RLCL 1DHMA 2PGCA 5ETQA 4B9UA 3WBZA 8RUCA 3HVAA 2BKOA 4MK9A 2B9WA 3GFZA 2MJUA 1CVJA 1J27A 1FJ7A 3HLUA 4QYRA 3BSOA 2EKNA 4DS4A 3E01A 1FFGB 1F2GA 2C42A 2LYVA 4DPTA 2LDYA 1N34F 1WSRA 3QGGA 3BQ0A 1N36J 3T5JA 4ED4A 4YQWA 2V8PA 2CQ2A 5RUBA 4NXNJ 2NPFA 2GJ2A 1YI2S 3DRPA 1VISA 1VC0A 4LVNP 1YHQS 2H65B 3A3NB 1SL1A 4TYAA 2NUUG 3BH7B 1O6XA 4J9KA 4NRTA 2KJWA 5IQQA 1NKEA 3EPGA 3U02A 3KHRA 5CYQB 2AGOA 5FJ4A 1V5VA 2WSEC 2J6UA 3R5GA 2B4PA 3OXFA 4J7CA 1NK6A 2VQEJ 1YZ7A 2PE8A 4A4JA 3L9ZA 4LRDA 1OSCA 5HLFA 5DDPC 1SC3B 3W1YC 1TKZB 4NEYA 3VF0B 2L3MA 1RU1A 2ZKTA 3ZNUA 1D0EA 2W8KA 1NU4A 2H5EA 4FKXA 2CQ0A 5IV4A 3ZZUA 1C0TA 3IRWP 2FJXA 2BJ7A 5LMNF 1H2VZ 1RGVA 3DI6A 4ELUA 2CPIA 4OI4A 3D1QA 4DR4J 2E5GA 2ZH9A 4H4MB 2E5JA 4L74A 3W5ZA 2E5IA 3JAMU 2KG0A 4ZPCA 3N5BA 4R8UA 1E6YB 2HNDB 5L38A 3JYTA 2WB1D 3Q24A 3PW2A 3L7UA 2GO9A 3EVOA 2IA0A 5D78A 4RLEA 1AUDA 3S7RA 3TO8A 3ENAA 4GKJF 5D0HA 1UW4A 2BX6A 2DNKA 2HHXA 2X3DA 4PEOA 4OZJA 4ZPVR 1TZ0A 4LF4F 2MQLA 4F0HA 3GG1A 2CYYA 2AYEA 2MLXA 2LP4A 3CSKA 3M2VB 5DDOC 2CAJA 1Y0HA 4D3HA 1RA6A 5EWGA 4X64J 1NBEB 2IM1A 2V0NA 4YB6A 3QAEA 3D3CJ 1VQ5S 2IMWP 4ZCLA 1KHVA 4N47A 4F2SA 4ATNA 1R0AA 2QYGA 3RRHA 3G82B 1UP1A 4C9DA 2B8PA 1N5VA 4ZIWA 2H51B 3UO0A 3MR7A 4X2BA 3JTNA 1R8AA 3SCIE 4AL5A 1FTCA 4V1Ak 3OD2A 2B4UA 2WK4A 4NI2A 4PXDA 4YB5A 4K4XA 3Q22A 2HPUA 3SBMA 4KY3A 1B0VA 3KLFB 3UWTA 2YQ1A 5IS2A 3HVTA 3GFXA 2DGOA 1EB0A 3WDOA 1BC6A 4ZVEA 4N8NA 2XYGB 2I0XA 1Y5NB 2KVQE 3GSIA 3NBPB 3KJVA 2WW4A 4DV7F 3TA2A 5IC4B 3TA0A 2DO0A 2XLJA 3HF5A 1SPBP 4NLOA 1SVDA 3IXQA 3PIOQ 4M95A 1HNZJ 1JMTA 5GAEI 3DGPB 1RHKB 3NMRA 2ZHAA 3KMSA 2F63A 2Q3PA 4NASA 1U1KA 4CYUB 2AZ1A 2RRBA 4ZP8A 4UY85 3VAJA 1RAEB 4I2QA 1K47A 4DCPB 1HWUA 3AOCA 3SZ2A 3P96A 7FDRA 1UEUA 3R97A 2V4RA 1TELA 5BYRA 3IO1A 4JI5J 1NK5A 1C1CB 1D8ZA 5KG1A 1ZTWA 1QVFR 3AJDA 2CQHA 2RVJA 3UCUP 2R2TA 4ZPWR 1K8AT 4Y34A 2V68A 1MNEA 4ES3A 4F3OA 1FJGJ 2CUYA 4ANCA 3V6JA 4H4KC 4V19X 3MGJA 2RRNA 2GFFA 3MMBA 3M6UA 3TWZA 1T3OA 1Y00A 1TU0B 2EFOA 2MQQA 2XYPB 4ZP6A 4IG3A 3E3XA 2M88A 4RJVA 1KQKA 1XNRF 3I87A 4F2RA 4OYBA 2DHSA 1S7IA 2DYAA 2FIUA 3MF5A 2XTJP 4Y3CA 5DLFA 2Z2MA 3I56S 2VOOA 1HNIB 4JOUA 2W2PP 2IYIA 4F4XA 5CYJA 3BS9A 4BLGA 3CD7A 3CWJA 3SCJE 1WF2A 3NGRA 3DMJA 1NPKA 2L48A 3CO9A 4CLPA 3MM7A 4ED3A 4IH5A 3A4TA 5MLCV 1NSQA 5KAKA 2RU3A 5GADI 5GAEU 3NKYA 1RE1B 2PA8D 1FKOA 2I5JA 1VQ9S 2QLWA 1UL3A 3M05A 1VRUB 4O4GB 1HHSA 1WOSA 2VIHA 2XZTB 1FDBA 1JXLA 1JJ2R 5D0GA 2WOMA 2A6OA 2ZOMA 3MTJA 3R1HA 2DNHA 4DR6F 2X1BA 1UAWA 1LW0B 3CO0P 1YTYA 5KT5A 3IA0A 2I2YA 2XM3A 3J81Y 1F1BB 2ZJPQ 2E9RX 2HHPA 3MAQA 1WC1A 1WTFA 5K5MA 3C14B 3HFVA 3R1LA 1AFJA 4CDIA 1SC4B 3ZZZA 2VJUA 2RDDA 4F8RA 1OSDA 3T3FA 3OLAA 3G87A 1RT2A 1YBTA 5LSOA 2P8IA 3OL6A 3PR5B 3NNAA 1XTZA 2HQ3A 2DHHA 4PCQA 2QJ3A 4DUZJ 3D0GE 1OPIA 3MCSA 3MEDA 3KK3B 4FVCA 1QLNA 4DUYF 2JHEA 3G9CA 3BV8A 4WZMA 3V81B 5D0EA 3KHLA 5JJBA 2W24A 4OX9J 4C11A 4RWXA 4ENOA 2RIJA 3VWSA 3D6FB 3POTA 2ZITA 1OPZA 5A6WA 3RJMB 3V2UC 4EK2A 4LREA 4DPWA 3BYRA 2D3O1 5ETTA 5IOLA 3G71S 1R6YA 3TVZA 3I5AA 1MLAA 2OPQA 1FXRA 1RAJA 1DURA 1WC6A 4M5GA 2KZZA 4A48A 3E51A 2HGMA 4F25A 4RL1A 1T95A 3TRGA 4X66F 1KEKA 1WKLA 1NJWA 2KN4A 2PFFB 4K7QA 2FZKB 4S0MA 3BSCA 1N0UA 2KYXA 3ONQA 4OL8A 3DHWC 4B3TF 2WTFA 3FEXB 4OZNA 4ZVOB 1OYEA 2UUTA 1T11A 4CH1A 5G0RA 2NZ4A 5KG5A 1IM4A 4PQUA 2W7AA 2KL8A 3QFWA 2F65A 4F50A 2M8HA 1DLOB 1BQMB 2V69A 4U7UK 1VBKA 4KKOA 2JVOA 1ZTTA 1YWXA 3TUPA 2KXNB 1YJVA 3C6TA 1YBUA 1RTHB 3J7YI 2ZEJA 1BY9A 2HAIA 2KFYA 2OTJS 4KC5A 1KQSR 4AXIA 2GS8A 5E5NA 5B7WA 5F3TA 4O3PA 4JI7F 4NLSA 4BWMA 1GFWB 3IP0A 3UVJB 1FI4A 4KT0C 4YY3J 1LWXA 1IBKF 4KGVB 2KT2A 3VHQA 4NLWA 4DFMA 1WEZA 2IYGA 1MSWD 1FK9B 1FE4A 4U6PA 2HFUA 1NRKA 2M0GB 1RT1A 4PR6A 2JRSA 1PIEA 4LT6A 5HP1B 1N4LA 4O44B 3EGVA 2OPSA 1G7CB 3DGVA 1RHRB 3M2UA 3BO2A 4WU2A 3N28A 4DEZA 2MKIA 4LSLA 2UUBF 1BMQB 4M5IA 5B09A 3NG8A 2RF2B 4P2XA 2HQFA 1U2FA 4R0JA 2OSQA 2B7CB 2BABA 5CD4A 1B64A 1SUQA 3CIZA 1B3TA 1R3NA 4B9MA 3HSDA 3KJQB 3PNIA 1HQ2A 4ICLB 1QSYA 2GNKA 3CCVS 4NCAA 2WW8A 4I7FA 4XO0A 3J7Z5 3TQ1A 5IV3A 5KFWA 4B3RF 3KUEA 5FLXY 3OTDA 2GQCA 3TOQA 3F56A 4JI1J 4TLRA 3FBBA 3SIPB 4J37A 2J6TA 3EXCX 3LUYA 4WFYA 1FRMA 2VG6A 1NK8A 5KOXA 5HQ8A 5BXIA 1DZ5A 5KT6A 1YG0A 4KFBB 4OIXA 2W4DA 1EZZB 2YWFA 4V19J 3QFHA 4Q2LA 3K0JA 2HVZA 1WSVA 3KK1A 3OXGA 3MZIA 3P45B 4A8QA 1KC8T 2RMLA 2NYHA 1HQEA 4PWWA 4YHHJ 4LBHA 3DLLQ 4Y65A 2JC1A 2EVZA 4DWIA 4O0NA 4O3QA 3OW2R 1WI6A 3JQJA 4DLEA 2EBEA 3A12A 1NZAA 3T6JA 3SV4A 2DHGA 3I55S 2ADBA 3FFIA 2UU9J 3T9NA 2E5LF 2J7KA 1CJKB 2VDHA 3HHLD 3B4MA 4DR2F 1N52B 2ADCA 1HKAA 2LQ5A 1U1NA 4U7UD 3KNAA 1RTZA 3I31A 1T9TA 5C25A 2IJFA 3IRXA 4U96A 2AX0A 3TJ9A 1VQ4S 3W9JA 1RU2A 1SJFA 3M8QA 4RUBA 5C42B 1ZM4A 1U26A 3VCDA 2ZBQA 2ZUGA 2FVRA 2MSTA 1WEXA 1WOOA 1KDNA 3TR5A 3DM2B 4FPIA 2H5JB 5J1EA 3TAPA 3BB5A 3DDKA 1RWOB 2WVEA 2JLGA 5F8NA 2B4VA 1Z1ZA 2XMUA 2VFVA 2LMIA 3AAWB 3MEEA 4K4WA 2X3GA 2XSJB 1LNQA 2V63A 4JI2J 4EYHB 4AL7A 1X5SA 3FJ2A 3E8OA 1EKSA 1UWBB 4NLRA 2HK3A 2R2RA 4DR7J 2DPIA 4KRWA 1GX6A 4ILRA 1K44A 3K5OA 3T1AA 4BBYA 2YKOA 5IT4A 4FZVA 4L3KA 3TAMB 3KDNA 2DHXA 5HROA 3HK2A 1NK7A 5EDWA 4E2FB 3BBFA 3MAAA 1VQKS 4U8VA 3SDEB 4LFBF 3EX7B 4ILLA 2V4JB 4WE1B 2VFSA 4JI0F 1RTIA 4ZVGA 2HQDA 1Y3KA 3SSQA 1VI7A 2EI5A 2F8HA 2W9CB 2FUG9 1ZPWX 9RUBA 3CTRA 3P5BP 5LXRA 4PXBA 3NP5A 4LRBA 1T03A 2FYXA 1W7WA 4FF2A 4PABA 2BE2A 3C16A 1FVSA 2CPJA 2D9PA 4IQMA 4LFCJ 4RW8A 2WBMA 1PGZA 3HHEA 3S6EA 3O8WA 7AT1B 3B54A 2AJQA 3HFZB 4KV8A 2DXEA 2QE5A 2E7VA 2U1AA 2HNZB 3FMBA 4YDDB 1FF2A 2BBEA 4ZITA 3UNGC 4TVAB 2E1MC 1QY7A 1YK9A 2YH0A 5IM0A 1IKVA 2HS0A 1RYRA 1XEZA 4K59A 1BQNB 3U7JA 4DR5F 2MKKA 3HD1A 1FWLA 5K8PA 1R8CA 1S1TA 1VMBA 1IWAA 1RISA 4GKKF 4OJ3A 3QO9B 5A2QY 1SQEA 2FY1A 4HT7A 2JH3A 2PN6A 4RUCA 4ECYA 4O0IA 1KNZA 4FXDA 3UDLA 3EVWA 2IDLA 1ZOTA 4Z7YA 3CMAS 2R8GA 3EM1A 3EWGA 2EEYA 1K0TA 2J8SA 3I0SB 1UEKA 4IFVB 2UUCJ 3GR1A 4R5PB 5DJBA 2XI3A 1LWEA 2KRBA 3FMWA 4FS2A 4HHUA 1NCLA 3UE2A 3PG9A 5A0YA 2IA6A 4AL6A 3LGHA 4OI0A 2XMMA 3D6MB 3T19A 5HMWA 2JLEA 1AW0A 4NCBA 2CPDA 3MTKA 4ECQA 4WFXA 3NNCA 2CG8A 1NB2A 2RB7A 5KFFA 1PSDA 2V8GA 1GEHA 4PPZA 4JV5F 1NDPA 4IFYA 3CMES 4NLYA 1DRZA 4USJC 2EC0A 1AA1B 4GRSA 3LWLA 1CPZA 2ZM6F 4IQXA 2VA3A 2F8EX 2RH3A 3VALA 4WFZA 4F04B 1KVJA 2Y1JA 4HHJA 1UPMB 2CWKA 2DNGA 1N0VC 2PC6A 5DETA 2RU9A 4HACB 1HW9A 3MUTP 3SSRA 2XZDB 1NK9A 4NRUA 4R25A 2MZ1A 4A8XA 1VQ7S 1WG4A 2VQFF 1CLFA 1N33J 1IKWA 3NEKA 2OTLS 2XC9A 3I4PA 1NPRA 4LF7J 4C0BA 2R2SA 2R7SA 3THPA 2C2NA 4F67A 3FCHA 4PUOB 1FVQA 1QE1B 3J7A1 1S6PB 3RU0A 3LTOA 3A3OB 2BXJA 1RTDB 3QSIA 4OZLA 3HHNB 5H9FK 1FNMA 4FKYA 1PBUA 3NOGA 1ZZNA 4TYBA 4NA2A 4JV2A 4J90A 1S1XB 2FVSA 3ZZRA 4MKBA 3NGDA 4TY8A 2FVQA 4FXWA 4DR4F 4OI1A 2Q6CA 3PVXA 2OMOA 3RRGA 1UVMA 2UVUA 1BWVA 2HS4A 2QC3A 4O4GA 4LF9J 4WKYA 5IFMA 1MN9A 1HR0J 2JNJA 1YIJS 3R5CA 4LF8J 1WUUA 4KPCA 3FZBA 2KI2A 4DQQA 3VAMA 2HEKA 1PJ7A 4M5NA 1FRXA 1FHTA 4ED2A 2IBKA 4CLKA 5HVGA 1L3SA 3BDPA 2CJYB 3PYDA 2XBPA 2XMTA 5A8RA 4DQRA 4JI3J 4LF2A 3M32B 3O6QA 2WSFC 2DH9A 3F0NA 5C7PA 2BJ3A 3MEKA 1NJYA 1UCNA 2PMZD 4MTPA 1H98A 4X64F 2VHGA 3S01A 4FF1A 4DPUA 1HD0A 2AX1A 2ALZA 3BDEA 2NXCA 3NGUA 3GE9A 1S1UB 1S1WA 2RRAA 1B99A 1RAGB 5KFTA 3AT1B 1FE0A 2G2ZA 2IM2A 2YQ0A 3AOAA 5HI7A 4AFFA 2F1FA 2KYZA 2YNHB 1VRTB 1R27B 2GZOA 2OEKA 4PYDA 4ETZA 2NYIA 2YWHA 2R7TA 2D1CA 4CLUA 3ZTQA 3NCPA 2BA9A 5F8GA 4LJMA 1VQOS 1NHKL 3MEGA 2JFKA 3G6YA 2YX1A 2AD9A 2E9ZA 1QTMA 2FZCB 5KOWA 1RTJB 5J2QB 1HNXF 1YJWS 1OWXA 1H0HB 2BR0A 2Y1LB 5HO4A 2KG1A 3OT9A 4BHQA 3LA0A 3EE3A 1TKTB 3QQCD 5T14A 3GMGA 4B9TA 1JIHA 2CZVC 3KG4A 4M5LA 1NH8A 4HYKA 4E0DA 1RT4B 3BYPA 1UVLA 2ZD1B 1VLYA 2YKNA 2VBXA 3CW2C 1J5EJ 5KTQA 4P2MA 2ZWPA 1JLGA 2AT1B 1NXIA 1N5YB 1AFIA 1U7LA 1XERA 2VDIA 1KSPA 2W7PA 5AE1A 4X4RA 4ECSA 2OFHX 1ZM9A 4USVA 4ZPTR 4DV0J 1XR6A 4FDFA 2HQCA 3US5A 2OI2A 4IDKA 3I5CA 2E9TA 4DG1A 4YR3A 1WF0A 2QX0A 1B0PA 4I69A 1FTRA 3D6HB 3QIDA 5H9EK 4USUA 2CIMA 3G8QA 1FO1A 1TMMA 4A8OA 1NJIT 2VASA 1N5QA 1LQ9A 3JSBA 3KK2B 2W2NP 2E1AA 2J0XA 3H98A 2BRLA 2X1GA 1QVGR 4CRJA 1JLFB 3LP1B 2F9JA 2YNFB 3K7RA 1LW2A 1UEVA 2ZE2B 3BQ1A 2AGPA 4EWTA 3Q83A 1DTTA 2CRLA 3S1TA 4HL9A 4MKYA 1HWIA 2RF2A 5KG0A 5BYQA 5HATA 3U1NA 2M3DA 4ILMA 5D4LA 1VK3A 3GV7B 4JYAF 4Z2XA 1CJUA 5SZTA 1VQ6S 2MZTA 3H42A 2WVDA 2K2PA 2XNRA 4OHXA 5A6PA 4DOZA 2YNIA 2DNMA 2EG2A 3MMCA 2XS5A 1JLQB 1RT6B 1RT3B 3ILIA 1MROB 3H4BA 1F5BA 4K4YA 2K8GA 2FVPA 2GV1A 3ZTOA 5I42B 5KFEA 1UFWA 4KFBA 2R4FA 2RS8A 1HBMA 4F3QA 2CKWA 4I68A 2KH9A 1T0TV 2F7VA 3ZC4A 5F8HA 1RABB 4DL6A 2FDNA 4EUVA 2L08A 2EFQA 3SEOA 2DY9A 1GXLA 2XHWA 4CM2A 2FHOB 2HAFA 4KGKA 3QRQA 5IWAF 2ZC4A 1S9EB 1PKUA 3KHHA 4KJIA 1RYSA 3GFHA 1WC4A 3AH6A 1U1LA 4NLQA 3FQLA 3W2VA 2A3JA 4DX8H 2YH1A 3DOMA 3P5TL 2R8IA 2D9OA 1OS5A 4GVBA 1JLAB 1X4GA 3MM8B 3LP2A 4OX9F 3NWGA 4USKA 3OL7A 3PHTA 3H59A 3BKTA 3R5JB 3K5MA 3KKFA 3UCZP 1SJRA 3QZ8A 3Q2SC 1L3UA 1N32J 4JI4F 1I1GA 4G65A 1QD1A 3HZGA 2MQOA 1HFEL 5IT9U 3W7BA 4IR1A 2V6AA 1WF1A 4Y2KA 1HBOA 4HHHA 1EQMA 3MR6A 1IKYB 3A8KA 1Q5VA 3UN5A 3QYYA 4LMZA 2IM0A 4GMKA 2NREA 4KGMA 4ZIVA 1LOUA 2LA6A 1TUWA 2O5DA 2DITA 1U1MA 4G1QB 5IQ6A 4WFBQ 2OGUA 4CLSA 2UXCJ 2O67A 4ZN3A 1U49A 3FKBA 2FHJA 4F02A 3JTOA 3EUNA 4DR3J 4ID5B 5DM7Q 2WAQD 1S49A 3A8JA 3MPDA 1RADB 4DV4F 1JKHA 3QLHA 4EYIB 4AYBD 2UUAJ 4ITSA 2MZSA 4Y6IA 5DZ6A 2MLZA 2EXUA 3CCLS 3VAFA 2J9EA 5FIIA 4ECXA 5K14B 3C15A 2N3OA 4WCEQ 1R8PA 2V8HA 3DRSB 5B0EA 3QSYB 2DHAA 2W9BA 2DR9A 2UUWA 6AT1B 2DR5A 7FD1A 1VFJA 2CJBA 2VPZB 2CNOB 4OV6A 3KYLA 1H72C 4URQU 3BO3A 2J9DE 2CQIA 2AF6A 1N48A 5HMYA 4XDDA 1NB7A 1IBCB 2HS3A 3PHEA 4JI6J 2O01C 1TL1A 1SI9A 2UXBF 2J8AA 2HHTA 4B9SA 3DRRA 2DT9A 2CQBA 1HNVB 2HBQB 3KJNB 1KQGB 1TTHB 2OUGA 2CDRB 2HNZA 4GC6A 1IM6A 5J1NA 4WWSA 2X1FA 2BKPA 3CJKB 3OLBA 2E1RA 2BE9B 1TL7B 3Q8YA 1EETA 3KXDA 5KT4A 1JLCA 3PJXA 1QAXA 4QR2A 4UTGA 2N7CA 1Y3JA 4KHMA 5I3QA 3NS7B 3NOCA 2I8EA 4WKRA 4LSZB 1G6BA 1C4CA 1Y11A 4IYQA 1HL6A 3PACA 2FJWA 2VODA 3WZ0A 2C2OB 2K7JA 2Z0GA 4PG7A 2DR8A 1Y10A 1U2RA 2HHHJ 4QIEA 2E1CA 3BGRB 4DV1F 2D3ZA 2RHSB 3CD6S 3LPEA 4TLQA 1NM2A 1Q8BA 2LVWA 3B4DA 4WYWA 3TNVA 1F9HA 4MFBA 2A10A 2IRUA 5AXMA 1YITS 1QSSA 2MPUA 4KR0B 5ETSA 4K2JA 5LMUF 1A6LA 1Y7PA 4EU0A 1F60B 3JXOA 2K1RB 2W7OA 5DDQC 4I2PB 3HMJG 4CTAB 1Z2LA 3RBEA 2HWHA 4OJGA 4ES1A 2WVCA 1PYSB 1HYSB 3OR1A 1NJXA 2SXLA 1Q1KA 3K17A 1ROFA 1SV5B 1X9SA 4UOHA 2B8QA 1A9NB 4MK7A 3CJQA 3FCVA 3HZEA 2P6SA 1CJVA 4NZ6A 2J9DA 2JC0A 3CC2S 3UD3P 3BPSP 1VC6A 3LW5C 4QYZJ 3K8WA 1OO0B 3V6DA 1U45A 1RWNB 3L95X 2R7XA 1OJ4A 1WKKA 2R3VA 3TX0A 2ZNYA 4DSJA 4A46A 2PI5A 2IVMA 2IVYA 5ETLA 4EBEA 1TAUA 1MWZA 2B6AA 2C2EA 4PWDA 3VVTA 1HI8A 3SSSA 4LSNB 2EFNA 2DK2A 1EX8A 4DQPA 2RKIB 3I9V9 4DS5A 5KG4A 1IR0A 2ERRA 2DIUA 2EPIA 3R27A 2IJNA 5ETKA 3R3TA 3CJSA 2ZJQQ 3OUYA 2M70A 4UQTA 2NS1B 5ETRA 3CCTA 4JI2F 2HURA 3AB2B 3C19A 1BXNA 1Q82T 3R2CJ 1UVIA 2FJDB 1Q7LB 3EGZA 2ROGA 5CYMB 3EVMA 2FB0A 4NOHA 4XAKA 1U6FA 3K5LA 3GIRA 2HVDA 2P2CB 2VUGA 1HD1A 3DYAA 4RO0A 3SQGA 2RQMA 3OTEA 1RKIA 2H4YB 3KLGB 4Q2MA 4DR1F 4H4OA 1X0FA 3CE8A 2DNRA 2BQUA 2FLNA 3JQKA 3RB6A 3ET6A 2AJ2A 2IPOB 3M32A 3T1HF 1JLEB 4ZKAA 4B3MJ 4ZJLA 4ECRA 3HXMA 2GGPA 2K7KA 3DOKB 1TKXA 3PO5A 1FXDA 1N6QB 5KFJA 1SH0A 3FZ2A 2AKWB 2VG7B 2XMJA 1X5PA 2AP6A 2XWXA 2HFVA 5J2MB 1H7XA 1Y9OA 3KTQA 3R7SB 3F44A 2HHVA 2XGQA 2WVBA 3HI9A 3VV2B 4ZS6A 2B56A 5CCLA 1LWFA 4IO9Q 2LKZA 1U1PA 3PYEA 1VHFA 1U6ZA 2Z56B 2ZBPA 4ZVPB 4C2MA 4DBQA 2G2OA 2BW7A 3V5RA 4QIVA 1EHWA 1UPPA 5C5JA 5ETOA 5CA5A 4C8KA 2ILYA 1SKRA 2DGUA 2PT0A 4GC7A 1C1BB 2VG5B 1SIWB 1X31C 4MT1A 1IBMJ 3R6LB 1FRLA 2IMOA 4RNOA 4HKQA 5C24B 3FRYA 2VZ9A 3UQSA 3ZO7A 3RUBL 4G3IA 3AD9C 5KFYA 3MECB 3RAQA 3DLHA 3D67A 4X65F 1UW9A 2KTQA 1U47A 4MIAA 3MAHA 3FNNA 4DN9A 3KLHB 3PFEA 4QU7A 4RUAA 1PILA 2XGPA 1VQMS 1QAYA 3JB9k 2G4BA 3FBFA 4CZCA 3DLEB 4B3OB 3ZTSA 1RT7B 5E3QA 1Q7YT 4OZ5A 3D1HA 2GJFA 2ZD1A 2ZH1A 4WP9A 4P7TA 1K9MT 3SV3A 1SIZA 1HMVA 1WACA 2GMLA 2B0GA 4FYDA 3TANA 2R7WA 1R0BG 3ZZYA 2IAJA 4FNIA 2VBZA 3FSXA 2VBYA 4OHYA 3TQEA 4RW6B 4WU3A 3D0HE 4W98A 2HVEA 3J81U 5KFZA 3D6TB 4NZ7A 2XY7A 3KWMA 4RW7A 5GAGU 4MH8A 3C66A 5EUHA 2I1RA 3I0RA 4RW9A 4J9LA 5FD1A 1ZA2B 4P9SA 4DUTA 2NR0A 5L39A 3TARA 4QIGA 1L3KA 1ZAWA 2CDQA 4DL0C 1NK4A 4J5OA 1JXVA 3DLGA 3BGOP 1B0TA 4CLTA 3LGMA 3D3BJ 1LK7A 4KB7A 4RZRA 4ZPBA 4AD6A 2QMUB 4ZLPA 2AIRB 3DXBA 5F0UA 3NCRA 1N34J 5E3PA 4I6YA 4DU7A 2L9NA 4NMLA 4O3NA 1N33F 4IO1A 1EQ0A 4Y2AA 2IRYA 1HWLA 3OV7A 4H54A 3FQKA 2ATCB 3H0PA 1B7YB 2QA4G 2VPWB 2QLBB 2QSFA 2B9YA 4OYZA 2XMKA 1DY3A 4ZLJA 3W66A 3BREA 4NWBA 1F9EB 2GHPA 1S4FA 4RU9A 3IMQJ 4LFAJ 1D9DA 1K0VA 2PFDA 4A8FA 4IOAQ 2DXFA 4WIQA 4AT1B 3EZOA 1KVIA 1HBUB 1KWMA 3QJJA 5A8WA 2FVCA 3I82A 2BQRA 4DQSA 2POKA 3CDUA 1ZAVA 4C3MA 2IIHA 1ZPVA 1EJ7L 4DV3F 4LBIA 4AE5A 3MMAB 4EO8A 4TU8A 4QPXA 1CSJA 3T1YF 2ZC3A 4R0EA 2HMIA 2YKPA 2J0WA 1S9GB 5LMNJ 4DL3A 2DKOB 3IGNA 2ZBCA 3CD5A 2YY3A 4JI3F 3MM6A 1K73T 3CNQP 2QA2A 2GVZB 4MKVA 4Q8FA 2IC3A 4UUXA 3M6WA 1LXNA 1UVKA 4RW4B 4GKJJ 4NCGB 1KR4A 2XEXA 3LALA 1Q81T 3BEGB 4HEA9 4YR2A 1M5VC 3JSMB 3DDIA 3RTVA 3MWBA 4Q7AA 1EKRA 1WDDA 2DNZA 4LF4J 1XR5A 3GU0A 1TVRB 5CQGA 3N01A 2E5HA 4ZHRB 3ADAC 3QIPB 4C8LA 2HZAA 5KFRA 3AQOA 4NYPA 2M9KA 5KFDA 1LEOA 4ED5A 4UUWA 5HK4A 2YTCA 3RAXA 1J5OB 1REVB 2ZHOA 1S1VA 5HAOA 3VVUA 3W61A 3X3UA 1XMBA 1I94F 1AZSB 1C0UB 2YKQA 2HNYB 2C2RA 2J9CA 3OTCA 3QGIA 1IVZA 3DKDA 3M9NB 4DV6F 3PX4A 4FPRA 3AD8C 2G1HA 3MD1A 3M2RB 2WONA 2MY7A 4XPCA 1DTQA 3GONA 3PFOA 1IWGA 3CCRS 3HD2A 3Q8UA 5LOQA 2ZH7A 4IRKA 1Q8KA 2XS2A 2AEFA 1L3VA 3HHLB 5FLXU 2V9WA 1TV6B 1FRKA 2GVDA 2B5JB 2R7RA 1KLMA 1WHVA 5HBMA 3U27A 1WC3A 3M1VA 3C6UB 5GAHU 2GHVC 4HTIA 3K57A 1N88A 4XK8C 1G1XA 1F5CA 3PIPQ 4M5DB 2MKCA 2HSEB 3MR3A 1U0HA 2CWXA 3LWMA 3JSRA 1GNKA 2LQ8A 3BQ2A 1IR2A 4ZPDA 2F4VJ 3ENWA 1JWWA 3HP6A 3BM7A 4GO5X 1WHXA 5DG7A 1N5SA 4WIIA 2BANB 5DG9A 1XIQA 2JDJA 2NCKL 1U02A 1RT5B 4MIBA 2HQIA 4AQYJ 3H2LA 5H9FJ 3FC9A 2GA7A 2AYGA 5AXLA 3E01B 4G6VB 5KFUA 1GT8A 2Z2LA 2QZ8A 1RJJA 1T05A 4C8YA 1OY9A 1PJ6A 2Z58B 1R6VA 1Q0NA 5HL7Q 3C2PA 1VQPS 5DZ7A 2VB6A 3DRXA 1RP5A 2RE1A 2WZ1A 3DRPB 1O8BA 2AJ4A 2CJXB 2ZJRQ 1TL7A 4IOBA 5D6GA 2FHJD 5U47A 1N54B 1SQGA 4OMFG 5L1IA 1S99A 2GIQA 1WKJA 1MG7A 5EWFA 4ID8A 2BJDA 4IRDA 4U8YA 2DY1A 5GMDA 2YNGA 3KUHA 3FRZA 2Y9HA 3GPAA 2XO6A 2FQQB 2RDJA 3GJQB 1JLBA 2CQ1A 3ETMA 3MCMA 3R7NB 1KBRA 3PYGA 2EFVA 5HLFB 1HBNB 2OPPA 3CJ4A 1NUEA 3V4MA 2C22A 3OBIA 5KG7A 4IH7A 1YZ6A 1HQUA 3IG1A 3V4IB 5M2UA 1N56A 1URNA 5K8MA 3WC0A 3UW1A 1H2UX 4YUDA 2M5YA 4TY9A 5HMZA 3K59A 1O0PA 1CC8A 2K1RA 2LQBA 5E41A 1OY6A 4W92B 3DI6B 4X4NA 3SQOP 4CNZA 3R7BB 1RHUB 3CJ0A 3M8PA 4R8UB 3JYTB 3LO3A 2HBZB 3BO4A 4LF5J 2MXYA 4OZ2A 1HPZA 3LAMA 5HVFA 1VJQA 1MU2A 1PG5B 3RW6A 1OQ6A 1VBXA 2OJ3A 2ACYA 4JUZA 4CP5A 5KG6A 3TA1A 4DR6J 4RU2A 3NS5A 4CO2A 4KBIA 4K4VA 2ZH2A 1LWCA 4ZVSB 3MI7X 4FF3A 3UN3A 1JX4A 3PW5A 4TU9A 4X84A 3HHDA 2BJEA 3QGHA 4Q8EA 1EIYB 1VJWA 2JSXA 1ZBTA 2PMWA 2HHWA 1XWLA 3IN5A 2OSRA 1REGX 3D66A 1A7GE 4M8LA 4F0MA 2VL1A 1PBAA 4QWEA 2AHOB 4DV2F 3HJFA 1CS4A 2KVIA 3E2EA 1R0AB 2KHCA 2MKYA 1JJHA 3NGTA 2IJRA 3EZ5A 1FJEB 1VOMA 1LK5A 2HYIB 1LKZA 1TQLA 2EC2A 5LSLA 4TNOA 2UXCF 2CQDA 4WK1A 1CULB 4NI2B 4CO3A 3KLEA 5A2QU 2HVHA 3ZNJ1 3EXYA 4DZDA 3CVKA 1XJWB 5H9EJ 2L9WA 3HVTB 4X66J 1FFWB 3EMTA 1V6HA 4O23A 4C8MA 5BR8F 3CCES 2FJVA 2F9DA 2ABYA 2B51A 3KJVB 2UUAF 1I51B 4ZVUB 2N4DA 3PEHA 5D3GA 1S59A 4I6AA 3CCWA 4ZVHA 4CLFA 1SB6A 2XLIA 4PWUA 1RWMB 4DL7A 2ATLA 2IM3A 3CJ5A 3J80Y 4J9UE 1ACMB 2RQ4A 3KLGA 4KHPJ 3GIMA 1S5ZA 1ZS6A 3MM5A 4LF1A 2DRBA 3BGFA 1GMWD 1Q16B 2BMBA 1WWHA 3DOLA 4TU7A 4I2QB 2HQGA 4DPYA 2VG7A 3G6VA 2D7SA 2QLXA 4JI6F 4CM0A 5GMEA 3MPUB 5J2MA 3M30B 2B9XA 2HFNA 3HSGA 3A8EA 3MPVA 4CT8A 1TFYA 1GXTA 2MMYA 4PG6A 5EHHA 2KHDA 5AXKA 2OO4A 5ITHA 1KD1T 4DHVA 2M52A 3LQVA 1M1GA 4OQJA 5HSPA 4I67A 3ZXWA 2FHMA 2C3YA 1R0CB 5J2NB 5KFVA 2JWNA 3CCMS 4LF6F 1DARA 4ZVFA 4PG8A 4JV0A 3WQPA 2HBRB 3Q8QB 3MMBB 1S6QA 3NS6A 1UJ4A 3TUJC 2JEFA 2QEXS 4H4KA 4IG3B 4IG0A 4FN5A 1NH7A 5L1LA 2ZH5A 4CLLA 2G0JA 1S7HA 3DLJA 1NAQA 3Q8RB 4KO0A 1FEEA 1XNQF 5AT1B 4OX8A 1UVJA 2DGQA 4QWBA 4KH0B 3CDEA 2UUBJ 3N9UC 3CMQA 1Y5LB 3W62A 1K1SA 1U4BA 1S48A 1NPPA 1E6VA 1HARA 1XMQF 5A8KA 1D8YA 1U8SA 3DLEA 5DGBA 3PRDA 4QWDA 5GADU 3BF4A 3MM7B 4TKTA 3TJ8A 2O3DA 4JP8A 1FDAA 3AOBA 4QYZK 1U48A 4GVLA 3H40A 1RAAB 2CADA 3HX9A 1FKOB 1MMDA 2I5JB 2MDAA 4K5RA 1X9WA 1ZA1B 4OLOA 3HKZD 4ED7A 3P4UB 3OXLA 3TI0A 2WOMB 4ZJOA 4OHVA 2GO8A 2Q43A 4XIUA 2CZ9A 5LM7E 4M5HA 4N76A 2LEBA 4HI2A 2R2UA 4ZN1A 3OSPA 1Q79A 1UJ5A 5AXNA 1RT2B 2LA4A 5T7LA 4DX6A 3UD5A 4L73A 2J5AA 2WVFA 3CPWR 1S0MA 2HG4A 2X51A 4NLPA 3MEDB 1X0PA 1GXUA 2M7SA 5G4DA 2QMXA 4UOFA 1CJTA 4QOTA 2MGZA 3VGVA 3NCQA 1XR7A 3IM9A 2AWZA 1DQ8A 2N4CA 4C11B 3MR5A 1U2CA 1X5TA 4KGZB 2C3OA 2E5LJ 1VYAA 5E3RA 3IAS9 1UWAA 1HHTP 4PPDA 2OLWA 3OTOF 1S57A 3VAKA 3EDQB 3LP0A 4RPFA 4C0OC 5F3ZA 2C3UA 3IWLA 1ICEB 3W64A 2OPQB 4X4UA 2B9EA 1T9XA 3HHLC 2C2KB 1SJQA 4F4WA 3EZUA 4A8MP 4JB8B 2C2MB 1WC0A 2CQGA 3WC2A 4NZ0A 5L1JA 2V50A 2Y1RI 2D3OR 4DX7A 1RA7A 3O2IA 4F4KA 4PRFA 5F8IA 3EGWB 4FBTA 5LXYA 3DLKB 3OHBA 3PZPA 2FLPA 4OJHA 4EO6A 5AE3A 1ZM3A 1RBLA 5I3PA 3D7SB 3BSNA 4PQUB 3J7YU 3HM9A 1IBLF 1FFSB 4O4RA 1OYDA 2RUGA 4KKOB 2E1PA 5GVQA 4B3MF 4QR1A 6FD1A 1HWJA 3C6TB 5EGYA 2RQCA 3AA8A 2YPZA 1JNZB 2OD6A 4K5SA 2EG1A 2EWHA 3DC2A 2JEIA 1HLWA 3AB4B 5ETNA 4BCAA 4I1TA 1S0OA 4KIAA 3TZWA 4JI0J 4K4SA 3R2DJ 1RACB 2MEWA 3HKWA 1KRPA 2DISA 1NHVA 1GTEA 3PO4A 2LQ9A 4C6AA 1H3DA 2UVRA 3H5YA 4FYXB 4M5MA 3LAKA 4HI1A 1VBZA 4DQIA 2HRYA 4K50A 1SKWA 4OFZA 1RT1B 2VBWA 1X4EA 2GMJA 4RNFA 5C2GA 4Y00A 8ATCB 3HT0A 1HA1A 4YB1P 3U1LA 2YVSA 2MTLA 5CYQA 3WX8A 5ETMA 3M2UB 4LSLB 2J7UA 4B3SJ 1WHYA 1SKUB 4JI8J 1DJ0A 2G13A 2KJVA 3K8VA 4F0KA 2YKAA 2CVEA 3O1LA 2PDAA 2QYCA 3G8SA 2R8KA 1SUQB 3HHLA 1GMUA 3CT9A 4FP9A 1VIOA 1TKZA 4C48A 5EX0A 3FBCA 3VGUA 4DR5J 4OJ1A 3VAHA 4I7FB 4Q44A 2JX2A 4GKKJ 2XZWA 2YBVA 1FRIA 3IS9B 2GCFA 4MIWA 3RBDA 5AJ3F 3CGIA 3VZHA 5KFSA 1HIYA 2V4QA 2G0IA 3IBWA 1ITPA 2VG6B 4H4MA 1RWUA 2CJKA 1E6YA 2HNDA 2QRRA 2H5IB 4C7QA 1KOHA 2GHWA 3K5NA 3X1LB 4HDHA 2MQNA 2JOQA 5HJXA 2ZWOA 3KK1B 4WZQA 3QT6A 3F73A 1G4CA 1FDDA 5D4OA 4CO5A 1OQ3A 3B6BA 4DX5A 1U24A 2DH7A 1HQEB 1FKAF 3RBZA 4UZBA 4TQSA 5T41A 2ACMA 5DO2A 3VQTA 2DGXA 1NHUA 2CJ9A 1FD2A 4JV5J 3M2VA 5KT3A 4MK8A 3FVYA 5F41A 2DH8A 5HQMA 1RKJA 3MPYA 3Q8PB 3FFIB 2V2VA 2ZM6J 2MKHA 3MMJA 3H5XA 4CWBA 3OFGA 4CLYA 3I9ZA 2APOA 3M6XA 2UP1A 1F9FA 2LLZA 2YX7A 4USTA 3M7VA 5C25B 3IRXB 1M5OC 2VJVA 3G82A 3TVYA 2EFGA 3M8QB 5E33A 1N5TA 1YJTA 4LFAF 4KHRA 4U95A 3M6VA 1IQZA 4FYYB 2LQJA 4Q43A 3W8PA 2AEJA 1AB8A 3M4XA 1YBAA 3PKMA 2HIQA 5I3UB 1UVNA 2VQFJ 4BS2A 4YFUA 1X4DA 3GB0A 3CJRA 3PEJA 4ZCIA 3M8SA 5J1EB 1HBNA 2UXDF 4O3RA 4WXWA 3KLFA 4LVOP 1RUSA 1P8GA 1RBAA 1XMOJ 1HNWF 3ILLA 1DQAA 3IAM9 3V4IA 3LPYA 1YRXA 2C2DA 3LGNA 1N8RT 3G4SS 1P6TA 2WB4A 3AXKA 2DEIA 1RAHB 3CCZA 3RB4A 2MYFA 2FGCA 5JVHQ 1FD8A 3NBPA 3OJSA 3MEEB 4NL5A 5BJRA 3W3SA 2D74B 2AYBA 3QNWB 1DQ9A 4UY8T 1WEYA 2GQ2A 2CPEA 3IC1A 4USWA 5IT0A 4P74A 1KN6A 4ZJQA 2D3UA 1FNXH 2W2MP 1ZH5A 3HCXA 1QTNB 3C8YA 3DGPA 4K0KJ 4CH7A 3S8SA 5HROB 4CYUA 2ZKUA 3QZ7A 3OVAA 1OMSA 3MAAB 5JVGQ 2CQ3A 1RI7A 2KRRA 3M8YA 4B9VA 3AQPA 4WF9Q 1UA1A 2NXNA 4LR7A 1VR6A 3AJ2A 3UR0A 2ZDPA 3GSDA 1RTIB 2YWGA 4EZ9A 3GCXP 3K5PA 2XS7A 2IHR1 2VPYB 5L9XA 1BD6A 2EKYA 2CFXA 1V3SA 3CD0A 1Q8LA 1C1CA 2GQQA 2BDPA 1N36F 1T03B 2Q79A 4OYXA 2K3IA 4DU8A 2BE2B 2PIIA 2Q1LA 4I0WA 4NXNF 1H7WA 3C16B 9ATCB 1UETA 3FSIA 2DXDA 2A18A 4WFNQ 4RW8B 2W25A 3RBXA 3NAIA 2QSWA 3EDRB 3W5XA 1EP4B 1FWPA 1UFKA 4KV8B 1RAIB 2HWTA 3GFYA 5IXUA 2VQEF 2Y1IA 3OJUA 3PRBA 3V6HA 3MCNA 1T9YA 3TJAA 3A13A 2HZCA 2LDIA 1YQHA 4CT9A 4ELTA 1D3WA 1T8EA 1L3TA 1CULA 1HNIA 1ZAXA 3SI8A 1XBWA 5DS7A 3TW0A 4RUHA 5IM0B 4NLGA 1IKVB 3M9OB 3KNGA 4QWCA 3WHIA 3AY0A 2NXJA 2HGNA 3NGKA 4P6QA 4UOCA 3W9HA 4DL4A 3IWNC 1S1TB 3DN9A 3RR7A 1Z4UA 1HNXJ 2XQCA 1S76D 1TL3B 2AYMA 3CB4A 4FNHA 3TZZA 1GTHA 4BDPA 1U0SA 4LR8A 1KONA 1YGYA 2F4VF 1ZZFA 1SCJB 2VKZG 1VRUA 1RQ0A 1U09A 4FYVB 1LWEB 1YRUA 1T7PA 4CQ1A 4N77A 1DFDA 3L7OA 4B08A 1LW0A 3MURP 3MOZA 4M63A 2FPHX 4AQYF 5EWEA 4LRCA 5A0YB 2HLUA 3BBCA 3Q2TC 1FKPB 2ZH6A 1F6TA 3ZZTA 4K4UA 3C14A 2E29A 1IJEB 3ENQA 3EPIA 3RB3A 4M94A 3M30A 1D9FA 1WG5A 1UA0A 1BGXT 1JJ4A 2DNQA 4ZLLA 3FGVA 4IFYB 3RR8A 1PCAA 3KOAA 1T9UA 4NA3A 3KK3A 3LH2S 4X4SA 3BSAA 5CZVA 5IC6B 5J2NA 4DL2A 2KZMA 3V81A 2XB2D 1JJCB 6FDRA 3N79A 2P9GA 1RLDA 2HWIA 1TL5A 1F2HA 2KFNA 1S4EA 4GO7X 4WP3A 2Q66A 3MUMP 2QO3A 4ECWA 2FJEB 1PC4A 1WC5A 2RUSA 1Q4RA 4E98A 1PAUB 2DPJA 1DAXA 1M5HA 4ZVQB 4DF8A 5D0RA 2GJIA 3H2UB 4F4YA 1WHWA 1AROP 2DCUB 1IKWB 4J9OA 5SUHA 5DM6Q 3DDNA 1LXJA 5IZHA 3I4HX 4RKUC 4NA1A 3KJFB 2KM8B 2PI4A 4MJKA 1HW8A 4P10A 4A47A 5B0AA 4JYAJ 4X4OA 2CA9A 4RNNA 1SH3A 3PW4A 4DV5J 3J81j 4TY8B 3VQSA 2DO4A 2FLLA 3HSZA 2NQPA 3BGUA 3R5DA 4EEYA 2YWWA 2UVWA 4LF5F 1HNZF 2G1DA 2E66A 4EZ6A 4PXCA 1KHWA 1DLOA 1BQMA 4X4TA 1YJUA 3JS9A 4USMA 3BH6B 1QJHA 4CIOA 1RTHA 3W65A 3CDWA 2RT3A 5E7OB 3RB0A 3CEDA 1I5OB 2CG4A 1NKBA 3DCAA 5A8RB 3CJ2A 2BE7D 1W2BR 5M2PA 5KG3A 5IWAJ 4EFAC 2ZBIA 2W2OP 4JI5F 1KKHA 1XC9A 3F41A 3PX6A 3UVJA 5B0BA 2HFSA 3QBCA 2R8JA 2DJWA 4PG4A 3A3PB 2DCLA 4DPOA 4EBCA 4B02A 1FJGF 1WELA 4OZ1A 3GILA 4Y28C 3GJRB 2R7UA 4HVZA 2ZOFA 2CPHA 2Y0SD 2QA1A 1Q53A 1WG1A 1HWKA 2NXUA 3O5TB 1VCTA 3OFEA 2NUHA 1FK9A 1S1WB 2F8MA 3L09A 3UDCA 2J0QD 2HFZA 2LXFA 4LR9A 2OMLA 5HP1A 4O44A 3BN4A 4JI4J 2MHEA 3H4DA 1S77D 3SCKE 2VU5A 4DFJA 2XLKA 1M90T 3J7ZT 2C2ZB 2OH2A 3TVKA 5DDRC 1MMLA 5KFOA 3MEGB 5E3CA 2CNLB 2FGOA 3THVA 2DEJA 3MFHA 4PYAA 4A8SA 5DGAA 3QRPA 4C8NA 1GMVA 1CEZA 2C28A 2NPIA 4IR9A 4NLVA 2ZNZA 3DLKA 1RDRA 4ICLA 2NLWA 3OL8A 1T02A 5LJ3Y 2LCWA 2BACA 4NXMJ 4CH0S 2W4CA 4P73A 4KHPF 2BEFA 4L72B 3BR8A 1YLXA 1QAJA 2DD8S 4IKAA 4TQRA 2OHDA 4J9NA 3GCWP 4DPXA 3A1YG 4QIWD 2YKNB 5JXSA 3P6YC 1W26A 5E0OA 3MCOA 1G2EA 2I9SA 4WTYA 3GIJA 3G6ES 4DV4J 5DQHA 1PC5A 3HO1A 1JLGB 2M4MA 2F5GA 2KKHA 2H3EB 2HLTA 2XNQA 5JUMA 1P27B 3N4WA 3HSJA 5K9FA 1IN0A 4ZCKA 2AGQA 3V6KA 3T41A 2AZ3A 4IDKB 1TUVA 4DUZF 2YPYA 2FLOA 4NLTA 2V8VA 4DG1B 1X4BA 4L75A 2UZAA 2B3TB 4QWAA 1U8WA 3WX4A 4I4BA 4QR0A 2F3JA 3ZFVA 3NNHA 2YWKA 1YDLA 1RWXB 2CXEA 3LOUA 2MB0B 3I32A 3TZYA 1S6OA 1R31A 2UXBJ 1CJKA 2BQ3A 3IR7B 1M5PC 4C98A 4Q0BB 1HI1A 1NDCA 1KFSA 5I4MA 4LIWA 2CQCA 1BQXA 1LW2B 5KFIA 2V2KA 3H7HB 1NSPA 1Y4ZB 2MQPA 2RJZA 4WFAQ 3CULA 4DN0A 1DTTB 2OP5A 5C42A 1M1HA 2VF3A 4J9MA 4OX6A 2P9EA 4OI6A 2BJ1A 4ZK7M 4DZ6A 2BOPA 2J7WA 3H90A 4P71A 5L46A 3OFFA 1F0XA 4LQ3A 3DM2A 2XSFA 1NSAA 1S0NA 2ZHBA 4KGXB 2FC9A 1SJ3P 1CJUB 3UPFA 1QAIA 2F40A 1TP7A 2DBBA 5F0WA 4ECZA 4K2XA 4Q5VA 4OYWA 4DI6A 4HR2A 2MHNA 4DV1J 2XSJA 2YNIB 3IS9A 2Z30B 2XCAA 3MMCB 1MN7A 1W25A 3CDBA 1W2IA 3C46A 4ZDNA 3HJVA 3TZXA 1IJFB 1UWBA 5THWA 1SL2A 1YKWA 5KFAA 2W1BA 3PRVA 1HBMB 5LMUJ 1D09B 3OSNA 1M1KT 1RZMA 3TAMA 3GYGA 4ECTA 3ZZ0A 4OZ3A 1RHJB 5J1PA 1F3FA 3JAMY 3TUIC 3R8YA 5CD4H 1F5AA 3VGSA 3SDEA 4N41A 3GWCA 2KDOA 4Y2IA 2V4JA 2MZRA 4YY3F 4WE1A 2AU0A 2JZ5A 2RAQA 4F3MA 5LJ5Y 2W9CA 1WD6A 2PA3A 3W2VB 3THTA 3DOMB 2RHQB 5E3AA 4GVBB 1OIAA 2HHQA 4ED0A 3LP2B 5E2QA 5HANA 3RG6A 4FXVA 3M8ZA 1TAQA 1FERA 4XTTA 1YSJA 5D15A 4DFPA 1WDTA 1NJZA 3GTYX 2HVIA 4YN3B 2BJ8A 3BKFA 5D8HB 1NDLA 4J9VA 4NLDA 1WI8A 3PY8A 2KFZA 1SJ4P 2PO4A 2IRXA 3DFEA 1Q78A 1QUVA 2B4OA 3Q23A 1HBOB 3D5MA 3CUNA 2EK6A 3B82A 1B4SA 1BHNA 4Y2CA 2KXHA 4OYIA 4C3KA 3OR2B 1RBOB 5I3UA 4WXOA 2DRAA 2LU2A 3SFGA 4J9RA 4OYAA 1BQNA 4N56A 3RRKA 1IUJA 1IR1A 2QTWA 5KFNA 1O51A 1TMJA 1YJRA 2BW2A 2CNNB 2L9DA 3ZZOA 3BKUA 3QO9A 4JI1F 1NLKL 4MYTA 4ER8A 3G8TA 2UV8G 5F8MA 4QU6A 2GAHC 2CJQA 2RD5C 1X4CA 2NSBA 2QV6A 4I64A 1JKHB 3I0SA 2FC8A 4KPYA 3QLHB 1SH2A 3ISZA 4IFVA 1GX5A 4R5PA 3DXSX 2HHUA 2DVIA 3O3LA 2UV8A 4OHZA 1MW7A 4PAAA 4ZP7A 2E7XA 3HHKA 1FJCA 2QFJA 2KB2A 3GIKA 3EGNA 3C15B 4DR1J 3IR6B 1B7FA 3ETOA 5B0DA 4YHHF 3T5KA 5JMNA 3W9IA 2W9BB 4XDCA 4G1IA 1YX2A 3QWUA 5B0CA 1RWKB 3T1HJ 1RCXB 2AJ1A 4C97A 2FJBB 5CH7B 3OVBA 4MMOA 2HBYB 3CXCR 3W2WB 5ETVA 4ZVTB 1R89A 2UU9F 1RAFB 2BUNA 2R42A 1TL1B 3Q0AA 3FEYB 3DRRB 4FS1A 2LEPA 2VA2A 3GYXB 3QMQA 4HTJA 1YVFA 4HDGA 4W4MA 2V2ZA 3SXLA 1EP4A 1FDNA 3K89A 5DG8A 1UFLA 2OEJA 4HACA 2ZOGA 4B3SF 1J2VA 4JI8F 4OYMA 2LXIA 2ROEA 2GC8A 3PYFA 3TX8A 4NLUA 2KM8C 2VICA 3SYZA 1O5JA 1EETB 2EK1A 4AXJA 4ED8A 5B0GA 1JLCB 2DTJA 3ITHB 1VBYA 4ALZA 1IQTA 4PUOA 1QE1A 1S6PA 5CABA 2V8DA 1RTDA 4ETXA 2XMVA 2AMCB 3KLIB 4Z7CA 4YDXA 4X65J 3LF0A 5KFCA 1TL3A 1S1XA 3W63A 2KO1A 3AD7C 3M8WA 2V34A 2UVVA 2JEGA 1PAEX 1UZHA 1P9QC 4MFBB 3KLVA 2GIRA 4DR7F 3NGSA 2HGLA 2K3KA 2DNLA 3L7PA 4X62J 1JQGA 4O3SA 1H73A 4FBUA 2MY8A 3K58A 3ZZPA 4JBCA 2IY5B 3D4JA 4CCHA 1JNRB 2VV5A 3GG0A 3Q86A 4OI2A 1T9VA 4HT5A 4CI0B 1M5SA 1GK8A 1S79A 1PJ5A 3CJ8A 3DU5A 2AJ0A 3NY0A 1FKPA 4DJBA 4D3GA 2DGWA 1BWEA 3D2WA 3IFEA 3VTIA 3KG0A 1FRJA 3OR1B 4OX7A 3PX0A 4Y2MA 2X7IA 4Q45A 3CCQS 1U1QA 3B8HA 2Y8WA 2O1PA 3AODA 2A0FB 3CF5Q 5L8RC 2ALYB 1X4FA 4FYWB 1CJVB 3GLJA 4QW9A 3NRBA 4UT4A 2A2DA 3ISNC 2ILZA 3DU6A 3FBEA 1S10A 4FVMA 3OL9A 1X5OA 3FEZA 3BR9A 3V6DB 2HZVA 4LFCF 1BUXA 4FF4A 1UKUA 1S1UA 1KS2A 3I6PA 3RAMA 2J0SD 3UFCX 5KG2A 3MM9B 4DSKA 1YRTA 3AHPA 2YNHA 2XMWA 1VRTA 2ZBRA 2ASYA 2B6AB 5HN0A 2MJNA 2FY8A 1X8DA 3U1MA 4CO0A 3SMZA 4PWDB 3P8BB 4U67Q 3DNCA 3MR2A 5BYSA 3P3DA 4DSIA 1SJ1A 2KT5A 3N6LA 2Z8QA 3KMQA 1EAYC 3RZAA 1M5KC 1XMOF 3CC4S 3NLCA 3QJPA 5F9NA 1VS3A 2J6SA 3OUYB 1RTJA 1S97A 3K2YA 5J2QA 2VFUA 5HVHA 3M9MB 3Q8VA 1TKTA 4UF4A 2JLFA 1FT8A 1WNEA 3LANA 1H74A 2DNYA 3J80U 3VR1A 4F36A 1U1OA 2AW0A 2HRTA 2UUCF 1RT4A 2IBOA 4NEZA 3CCSS 5CCMA 4K0KF 1HI0P 3MHYA 2V94A 4DV3J 4CO4A 3DYAB 3PTWA 3SQGB 3T1YJ 1VQ8S 3CIMA 2Z2ZA 2ZH8A 2COLA 1VQSA 1N5YA 4H4OB 3Q89A 5HQLA 4EBDA 5KFBA 2GIFA 1WTBA 2DGSA 3ET6B 3ISND 3UNYA 2VOPA 1T9WA 1KFDA 1KOOA 3QRRA 2GGPB 2CJAA 2W2QP 1TKXB 1ZETA 2R7OA 1H2TZ 2EW9A 2D69A 1R7IA 2JEJA 4TXSA 1BLUA 2LECA 3UD4P 4RR5A 2QL5B 2N82B 5D4NA 2ZVSA 1ZM2A 3GP9A 4UZCA 2OD4A 2HK2A 3KK2A 1LWFB 3JTPA 3RYLA 2GX8A 1TKDA 2H48B 2C3PA 1JLFA 3KDOA 3LP1A 2M2BA 2YNFA 2QL7B 2ZE2A 1R8HA 3N0VA 3OPKA 4ZLNA 4YMEA 1VGYA 4LF7F 4YOEA 1I94J 3OTBA 1SKSA 1V3ZA 2DB1A 4MKAA 1NMEB 3B78A 4KTQA 2BOAA 4DV6J 3HT3A 3N6MA 2QL9B 3QATA 1AXQA 1UTAA 1VHIA 1H6KX 2E7WA 2MZJA 1KVKA 3BJYA 2PSZA 3R9LA 1JLQA 4LF9F 1RT6A 4RBVA 1RT3A 4ANEA 2ZZMA 1MROA 5K8OA 4BC7A 1X4HA 1I6JA 2ZZTA 1HMVB 1HR0F 4LF8F 3W60A 5DQGA 5I42A 1PYTA 5FDLB 4ELVA 2IAJB 4ED1A 4ANDA 1NZ8A 4P2SA 2PEBA 2AEMA 1IKXB 4C8OA 2G9OA 2JVRA 2YXLA 4RW7B 3M8RA 5J2PB 1S9EA 2QFIA 1FX2A 5K8NA 1S9FA 2BKNA 3JSYA 2A1BA 1KLNA 3T5HA 3I0RB 3OHAA 4RW9B 4U7CA 4K4ZA 4QPTA 4CNYA 4WTOB 3PR4A 1R43A 5CHCB 2O66A 4P72A 3KFWX 2OFGX 4BWJA 1RCOB 4TN2A 1JLAA 3MM8A 4ZPAA 2A2CA 3DLGB 2J76E 2CQPA 3T9ZA 4ZCMA 8AT1B 5F9LA 4ERDA 1XK8A 3NL0A 1RHQB 4E8UA 4LUBA 3R6GB 4C0HA 3TAQA 2H54B 2KXFA 1R8BA 1XQIA 3AFGA 4Q0BA 5KFLA 1HHQA 2XYHB 3RGIA 2MKSA 4DSEA 3TYTA 1V5IB 3GIIA 2FZGB 3HPOA 3QJLA 3AA9A 3T5LA 4C4WA 3H5SA 2CPXA 4QQBA 4PG5A 4B17A 3MFIA 1RWWB 1IKYA 2EFPA 3GR0A 4OHWA 1SL0A 1KTQA 2RDIA 3BN7A 1YJ7A 4B9NA 2QT7A 2QG9B 3WIUA 5C2CA 2CPFA 1FCAA 4DMZA 3AJ1A 1AT1B 2JJ4D 2HFOA 3D68A 2P6TA 4G1QA 2ZFHA 3VZIA 2YKMB 4DV5F 4ED6A 2OPRB 5F8JA 1MWQA 1AUSL 4CO1A 4IOCQ 4PXEA 5A8WB 1UZDA 3GV5B 2CZ4A 2XY5A 3G86A 4YP3A 1KP6A 4ID5A 4B9LA 2MQMA 1J5EF 4WYLA 3HDSA 4RBTA 1SXLA 1Q5YA 2B43A 4DV7J 2HMIB 3QT7A 1S12A 1CC7A 2WCXA 1P9YA 1CG2A 3WIVA 4ECUA 2WSCC 2RQKA 4DV0F 2VC0A 4KQZA 3MM6B 1Q95G 4N5SA 1P1LA 3TP2A 5K14A 1GAOA 2IC3B 2Y0BB 2BRKA 5L1KA 3JQMA 4J9PA 3DRSA 4XPEA 2XY6A 5CAAA 3BZQA 2G0CA 4QBUA 2HHSA 3H20A 2VONA 4X4QA 4ES2A 1AYEA 2ASJA 1TK8A 1WOPA 4L3NA 3SCLE 2XULA 2CVIA 2HKEA 4PZVA 3J7AN 4HH0A 3KUGA 2BVZA 3GZ7A 3QPIA 4U9RA 4YS2A 4M1KA 1HNVA 1FWKA 3ZTRA 4MAKA 2GAGC 1Q8IA 2RS2A 4M5JA 2V2QA 2DNPA 4QZVB 3G96A 2RILA 1ULRA 1S1VB 4G1PA 1NKCA 2QN6B 2XCPA 4J91A 3CJKA 3OR2A 1VQLS 4WK3A 3UI3A 4DV2J 2MQ8A 2N7YA 2Y8YA 1RK8A 2HRUA 3H5UA 3ZTPA 1C4AA 2KU7A 1TK5A 1QM9A 3IBFB 2WONB 1XNRJ 5LT5A 1DTQB 5B0FA 3VGTA 3MDFA 2BM0A 4NXMF 4F4AA 3ULHA 1QSLA 3BGRA 4NYZA 4A8WA 1K1QA 4F4ZA 1FRHA 2GVDB 1Z2ZA 4RBUA 1KLMB 2V9KA 5HBMB 4USHA 5BR8J 5KT7A 2ASDA 2OELA 3NWRA 1TR0A 3M1VB 1C0TB 4DF4A 4URGA 2MLYA 5KFHA 3W5YA 5KFKA 2FHKA 1V9OA 3DHXA 4KSEB 2OAUA 2DR6A 3BGLA 2H9ZA 2F4FA 4J9SA 2VC1A 4I2PA 1U0HB 4CTAA 1TUGB 5KFPA 1U6BA 3MOJB 2YQ3A 3FSYA 2JL9A 3MPWA 1HYSA 1NEEA 4CLWA 4LRFA 1G3OA 1SV5A 2VFTA 1QUPA 2MSSA 3FUYA 3GJSB 2DR7A 3HVWA 4RNMA 2D41A 3W2WA 4L6V3 1X4AA 5CZXA 4HLBA 2QLJB 2DNOA 3PKYA 5KFMA 4A8YA 2XWYA 1PO6A 4OV1A 1N32F 2P5VA 1T05B 3N5FA 2BYCA 5D77A 2DGTA 4DCOB 2OKQA 1D1UA 4QCLA 3HFKA 5LSRA 3OVSA 4DUYJ 2K06A 4LF6J 3UCGA 3MXHP 5EN1A 3BBBA 2WHOA 4LSNA 3ITHA 2CQ4A 3PXGa 1ZYQA 2VH7A 4PKDB 4KE5A 2CPYA 4URSA 2QA4S 2RKIA 3CCUS 4C3LA 2XHCA 2YNGB 3W8GA 2LXUA 4KYZA 2R9LA 3PJ9A 4NLXA 3KLIA 1JLBB 1FX4A 3A8IA 1XNQJ 1L5UA 4P75A 2OPPB 1RXOB 5F8LA 4F26A 4OZ0A 4WBFA 5DQIA 4C8ZA 1FNOA 2QGFB 1XMQJ 3IGVA 4DR3F 3CDAA 4AUKA 1HQUB 3KG1A 3IG1B 1RSCA 1S72S 2DIVA 2PD1A 4LBPA 2W4PA 4DLGA 2HW3A 3IM8A 5CYMA 1LV5A 1JB0C 4I6WA 1VQYA 2BJ9A 4B3TJ 4K4TA 5B08A 2EBGA 4L76A 1T94A 5HMXA 2YWEA 3ICLA 4P52A 4I56A 2XI2A 4ECVA 3M8PB 3RW7A 2AJFE 4EGLA 4DSLA 2GMHA 2NSCA 3CCJS 1HPZB 2L41A 5A76A 1VRQC 1Y5IB 1MU2B 3ILJA 3FDSA 1JLEA 3PV8A 1F3VA 4DDFA 2MZQA 1CQNA 3DOKA 1B70B 2I38A 1GH8A 1N6QA 2OEMA 1I3OB 1TL4A 4KAIA 3PW7A 3DLBA 1LWCB 2WBRA 4JI7J 3T6BA 4A8KA 3I5BA 1DBDA 3D1OA 1IBKJ 5MAOA 2Z57B 4RWWA 1GMWA 5AE2A 2Z2YB 3MM9A 5HJYA 1RWPB 1A0OB 2VKRA 4X4VA 5GMKa 3L4BC 1CS4B 1C1BA 4ZP9A 2VG5A 2C3MA 3HULA 3BPDA 1NDKA 2ASLA 3AXMA 1EARA 2YX4A 4EMDA 3OTOJ 2QLFB 2PEHA 3CC7S 3OFHA 2LEAA 2ZH3A 2AV5A 5C24A 2ZZNA 4KH1B 3TUZC 2JFDA 2FJAB 3D54A 2ZUAA 3MECA 4NPOA 2HHHF 4DL5A 3N6NA 4K8RA 1QDUB 4OI3A 4QJVA 4BC9A 3KLHA 2G2YA 3KLEB 3UN2A 1SC6A 4Y0FA 3VAIA 3EJMA 1VIXA 1CQMA 2V5HG 2B7BB 1UJ6A 4B3OA 1RT7A 4JV1A 4WJBA 3DMJB 3G6XA 4LIRA 4ZA1A 3C3LA 2ROPA 5D3GB 4CLZA 3PJWA 1TK0A 1JXEA 1VK8A 5CXTA 2Y3YA 4B3RJ 4RW6A 1LFWA 1OY8A 2BM1A 2BV3A 1KQFB 2LFVA 2U2FA 3IBCB 1IBLJ 4PQAA 3MM5B 2MKJA 4OYPA 5DLGA 3PDNA 1URRA 1MMNA 3HVRA 1H38A 3G2XA 4UQGA 2RSQA 3NAHA 1XN9A 2IFXA 5GAGI 5D4PA 3DOLB 3I96A 4MYUA 2DNNA 4WPAA 3GYNA 4QW8A 1NSKL 3NMAA 4OLPA 2WRMA 2OIHA 2BZ2A 4UOGA 3UR3C 2W9AA 4NE9C 4O3OA 3IWXA 3D9BA 5ADZA 1VC5A 4F7VA 5KFQA 1T3NA 4WP8A 3TEGA 4LQ9A 3D28A 1U25A 1FESA 5KT2A 1YJ9S 2XO7A 5K20B 1NK0A 1RB0A 2Q6BA 4N7TA 2NZCA 2W8LA 1S6QB 3IR5B 3NXZA 2V67A 4IH6A 3UDEA 4RNHA 1S0VA 1NO8A 3MD3A 4IG0B 3POTB 3L3CA 2PMHA 1X60A 3GJTB 3FK4A 3UDVA 4DR2J 1U1RA 2LU1A 3QWPA 1IXKA 2VD3A 4KO0B 3EYZA 1VQNS 1NNDA 5KFGA 4X4PA 3D0IE 4EI2A 3P49B 1E6VB 5A8KB 1HBUA 1MWYA 1Q86T 4DCJB 1GQEA 2FTRA 3GV8B 1KTVA 4W90B 4X62F 3GQCA 3OQ2A 3EICA 1RWVB 4IRCA 1RAOA 2VPXB 1UMJA 3MMAA 2M8DB 2R8HA 5FDLA 1TFWA 1S9GA 5G0RB 3R5AA 1YJNS 3QT5A 1LFPA 5KFXA 5AJ3J 4LRAA 4UW2A 1IKXA 5ETPA 5EX3A 5J2PA 2GVZA 1X7VA 3TEHB 2C1EB 4RX6A 4P7VA 1S6UA 1WORA 3PM9A 3QGPA 5M2RA 1FXLA 2R7QA 2I6WA 1FEHA 4HH1A 2P9CA 2ZH4A 3PW0A 4RW4A 4ZVRB 1SBRA 4NCGA 4LFBJ 2HIYA 3DRYA 5T7LB 3JSMA 2N3LA 3MUVP 4N8OA 3PCOB 5LL6d 1TVRA 3FCWA 2AQ4A 4ZHRA 4YR0A 3QIPA 4DXLA 1ELOA 3CJTA 2RNEA 1VLOA 2ZVIA 1CJTB
chains in the Genus database with same CATH topology
2W2NP 1R6VA 4NE9C 3A3OB 3GCXP 4YN3B 2Z30B 3VV2B 3QFHA 3WIUA 3CO0P 2ZWOA 2W2PP 2W2OP 3CNQP 1ITPA 4JP8A 3T41A 3AFGA 1SCJB 2ZWPA 2Z57B 3WIVA 3GCWP 2Z2ZA 2E1PA 3VHQA 2W2MP 4NMXA 3BPSP 2QTWA 3H42A 2Z56B 2PMWA 3A3NB 4OV6A 3WHIA 2W2QP 3A3PB 2Z2YB 3P5BP 1V5IB 4K8RA 1SPBP 3BGOP 3SQOP 2XTJP 2Z58B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W2N P;  1R6V A;  4NE9 C;  3A3O B;  3GCX P;  4YN3 B;  2Z30 B;  3VV2 B;  3QFH A;  3WIU A;  3CO0 P;  2ZWO A;  2W2P P;  2W2O P;  3CNQ P;  1ITP A;  4JP8 A;  3T41 A;  3AFG A;  1SCJ B;  2ZWP A;  2Z57 B;  3WIV A;  3GCW P;  2Z2Z A;  2E1P A;  3VHQ A;  2W2M P;  4NMX A;  3BPS P;  2QTW A;  3H42 A;  2Z56 B;  2PMW A;  3A3N B;  4OV6 A;  3WHI A;  2W2Q P;  3A3P B;  2Z2Y B;  3P5B P;  1V5I B;  4K8R A;  1SPB P;  3BGO P;  3SQO P;  2XTJ P;  2Z58 B; 
#chains in the Genus database with same CATH topology
 2MGZ B;  2DGV A;  1JK9 B;  3R5B A;  2XG8 A;  3SFU A;  3ENV A;  1M0S A;  3H2V E;  2H1Y A;  4J9Q A;  2H4W B;  4P2F A;  1J5O A;  4NMX A;  1REV A;  1IBM F;  4YB7 A;  3VAG A;  2A6M A;  1WJ9 A;  4USI A;  1AZS A;  3ELH A;  2NXE A;  1C0U A;  2OPS B;  2HNY A;  5IT9 Y;  3LP0 B;  5L9N A;  3O44 A;  1P1T A;  1SC1 B;  5DRK A;  1CBK A;  3M2R A;  2E44 A;  4NX9 A;  2FD2 A;  1SQF A;  4NYO A;  4DSF A;  3KHG A;  4OYO A;  2YKM A;  2OPR A;  3CJ3 A;  2GW8 A;  4ZOS A;  3QAU A;  1D9A A;  4DFK A;  2UXD J;  1TV6 A;  2ZDO A;  2CNK B;  1X9M A;  4M5K A;  4YEA A;  2W01 A;  1HNW J;  4Z37 A;  2B5J A;  2IVF B;  3ILO A;  5H1S V;  1C2P A;  3Q8S B;  3C6U A;  3H8Y A;  1RHM B;  1V3R A;  2CPZ A;  4M5D A;  1VDH A;  5GAH I;  2Z4P A;  3H25 A;  2IDE A;  1FA0 A;  2R7V A;  2KT3 A;  2QIF A;  4QIF A;  4IUF A;  3QT8 A;  2XMA A;  1APS A;  2VFR A;  1BE4 A;  2BAN A;  4ZMM A;  2DRD A;  1PYO B;  2X1A A;  1RT5 A;  2QMW A;  1RLC L;  1DHM A;  2PGC A;  5ETQ A;  4B9U A;  3WBZ A;  8RUC A;  3HVA A;  2BKO A;  4MK9 A;  2B9W A;  3GFZ A;  2MJU A;  1CVJ A;  1J27 A;  1FJ7 A;  3HLU A;  4QYR A;  3BSO A;  2EKN A;  4DS4 A;  3E01 A;  1FFG B;  1F2G A;  2C42 A;  2LYV A;  4DPT A;  2LDY A;  1N34 F;  1WSR A;  3QGG A;  3BQ0 A;  1N36 J;  3T5J A;  4ED4 A;  4YQW A;  2V8P A;  2CQ2 A;  5RUB A;  4NXN J;  2NPF A;  2GJ2 A;  1YI2 S;  3DRP A;  1VIS A;  1VC0 A;  4LVN P;  1YHQ S;  2H65 B;  3A3N B;  1SL1 A;  4TYA A;  2NUU G;  3BH7 B;  1O6X A;  4J9K A;  4NRT A;  2KJW A;  5IQQ A;  1NKE A;  3EPG A;  3U02 A;  3KHR A;  5CYQ B;  2AGO A;  5FJ4 A;  1V5V A;  2WSE C;  2J6U A;  3R5G A;  2B4P A;  3OXF A;  4J7C A;  1NK6 A;  2VQE J;  1YZ7 A;  2PE8 A;  4A4J A;  3L9Z A;  4LRD A;  1OSC A;  5HLF A;  5DDP C;  1SC3 B;  3W1Y C;  1TKZ B;  4NEY A;  3VF0 B;  2L3M A;  1RU1 A;  2ZKT A;  3ZNU A;  1D0E A;  2W8K A;  1NU4 A;  2H5E A;  4FKX A;  2CQ0 A;  5IV4 A;  3ZZU A;  1C0T A;  3IRW P;  2FJX A;  2BJ7 A;  5LMN F;  1H2V Z;  1RGV A;  3DI6 A;  4ELU A;  2CPI A;  4OI4 A;  3D1Q A;  4DR4 J;  2E5G A;  2ZH9 A;  4H4M B;  2E5J A;  4L74 A;  3W5Z A;  2E5I A;  3JAM U;  2KG0 A;  4ZPC A;  3N5B A;  4R8U A;  1E6Y B;  2HND B;  5L38 A;  3JYT A;  2WB1 D;  3Q24 A;  3PW2 A;  3L7U A;  2GO9 A;  3EVO A;  2IA0 A;  5D78 A;  4RLE A;  1AUD A;  3S7R A;  3TO8 A;  3ENA A;  4GKJ F;  5D0H A;  1UW4 A;  2BX6 A;  2DNK A;  2HHX A;  2X3D A;  4PEO A;  4OZJ A;  4ZPV R;  1TZ0 A;  4LF4 F;  2MQL A;  4F0H A;  3GG1 A;  2CYY A;  2AYE A;  2MLX A;  2LP4 A;  3CSK A;  3M2V B;  5DDO C;  2CAJ A;  1Y0H A;  4D3H A;  1RA6 A;  5EWG A;  4X64 J;  1NBE B;  2IM1 A;  2V0N A;  4YB6 A;  3QAE A;  3D3C J;  1VQ5 S;  2IMW P;  4ZCL A;  1KHV A;  4N47 A;  4F2S A;  4ATN A;  1R0A A;  2QYG A;  3RRH A;  3G82 B;  1UP1 A;  4C9D A;  2B8P A;  1N5V A;  4ZIW A;  2H51 B;  3UO0 A;  3MR7 A;  4X2B A;  3JTN A;  1R8A A;  3SCI E;  4AL5 A;  1FTC A;  4V1A k;  3OD2 A;  2B4U A;  2WK4 A;  4NI2 A;  4PXD A;  4YB5 A;  4K4X A;  3Q22 A;  2HPU A;  3SBM A;  4KY3 A;  1B0V A;  3KLF B;  3UWT A;  2YQ1 A;  5IS2 A;  3HVT A;  3GFX A;  2DGO A;  1EB0 A;  3WDO A;  1BC6 A;  4ZVE A;  4N8N A;  2XYG B;  2I0X A;  1Y5N B;  2KVQ E;  3GSI A;  3NBP B;  3KJV A;  2WW4 A;  4DV7 F;  3TA2 A;  5IC4 B;  3TA0 A;  2DO0 A;  2XLJ A;  3HF5 A;  1SPB P;  4NLO A;  1SVD A;  3IXQ A;  3PIO Q;  4M95 A;  1HNZ J;  1JMT A;  5GAE I;  3DGP B;  1RHK B;  3NMR A;  2ZHA A;  3KMS A;  2F63 A;  2Q3P A;  4NAS A;  1U1K A;  4CYU B;  2AZ1 A;  2RRB A;  4ZP8 A;  4UY8 5;  3VAJ A;  1RAE B;  4I2Q A;  1K47 A;  4DCP B;  1HWU A;  3AOC A;  3SZ2 A;  3P96 A;  7FDR A;  1UEU A;  3R97 A;  2V4R A;  1TEL A;  5BYR A;  3IO1 A;  4JI5 J;  1NK5 A;  1C1C B;  1D8Z A;  5KG1 A;  1ZTW A;  1QVF R;  3AJD A;  2CQH A;  2RVJ A;  3UCU P;  2R2T A;  4ZPW R;  1K8A T;  4Y34 A;  2V68 A;  1MNE A;  4ES3 A;  4F3O A;  1FJG J;  2CUY A;  4ANC A;  3V6J A;  4H4K C;  4V19 X;  3MGJ A;  2RRN A;  2GFF A;  3MMB A;  3M6U A;  3TWZ A;  1T3O A;  1Y00 A;  1TU0 B;  2EFO A;  2MQQ A;  2XYP B;  4ZP6 A;  4IG3 A;  3E3X A;  2M88 A;  4RJV A;  1KQK A;  1XNR F;  3I87 A;  4F2R A;  4OYB A;  2DHS A;  1S7I A;  2DYA A;  2FIU A;  3MF5 A;  2XTJ P;  4Y3C A;  5DLF A;  2Z2M A;  3I56 S;  2VOO A;  1HNI B;  4JOU A;  2W2P P;  2IYI A;  4F4X A;  5CYJ A;  3BS9 A;  4BLG A;  3CD7 A;  3CWJ A;  3SCJ E;  1WF2 A;  3NGR A;  3DMJ A;  1NPK A;  2L48 A;  3CO9 A;  4CLP A;  3MM7 A;  4ED3 A;  4IH5 A;  3A4T A;  5MLC V;  1NSQ A;  5KAK A;  2RU3 A;  5GAD I;  5GAE U;  3NKY A;  1RE1 B;  2PA8 D;  1FKO A;  2I5J A;  1VQ9 S;  2QLW A;  1UL3 A;  3M05 A;  1VRU B;  4O4G B;  1HHS A;  1WOS A;  2VIH A;  2XZT B;  1FDB A;  1JXL A;  1JJ2 R;  5D0G A;  2WOM A;  2A6O A;  2ZOM A;  3MTJ A;  3R1H A;  2DNH A;  4DR6 F;  2X1B A;  1UAW A;  1LW0 B;  3CO0 P;  1YTY A;  5KT5 A;  3IA0 A;  2I2Y A;  2XM3 A;  3J81 Y;  1F1B B;  2ZJP Q;  2E9R X;  2HHP A;  3MAQ A;  1WC1 A;  1WTF A;  5K5M A;  3C14 B;  3HFV A;  3R1L A;  1AFJ A;  4CDI A;  1SC4 B;  3ZZZ A;  2VJU A;  2RDD A;  4F8R A;  1OSD A;  3T3F A;  3OLA A;  3G87 A;  1RT2 A;  1YBT A;  5LSO A;  2P8I A;  3OL6 A;  3PR5 B;  3NNA A;  1XTZ A;  2HQ3 A;  2DHH A;  4PCQ A;  2QJ3 A;  4DUZ J;  3D0G E;  1OPI A;  3MCS A;  3MED A;  3KK3 B;  4FVC A;  1QLN A;  4DUY F;  2JHE A;  3G9C A;  3BV8 A;  4WZM A;  3V81 B;  5D0E A;  3KHL A;  5JJB A;  2W24 A;  4OX9 J;  4C11 A;  4RWX A;  4ENO A;  2RIJ A;  3VWS A;  3D6F B;  3POT A;  2ZIT A;  1OPZ A;  5A6W A;  3RJM B;  3V2U C;  4EK2 A;  4LRE A;  4DPW A;  3BYR A;  2D3O 1;  5ETT A;  5IOL A;  3G71 S;  1R6Y A;  3TVZ A;  3I5A A;  1MLA A;  2OPQ A;  1FXR A;  1RAJ A;  1DUR A;  1WC6 A;  4M5G A;  2KZZ A;  4A48 A;  3E51 A;  2HGM A;  4F25 A;  4RL1 A;  1T95 A;  3TRG A;  4X66 F;  1KEK A;  1WKL A;  1NJW A;  2KN4 A;  2PFF B;  4K7Q A;  2FZK B;  4S0M A;  3BSC A;  1N0U A;  2KYX A;  3ONQ A;  4OL8 A;  3DHW C;  4B3T F;  2WTF A;  3FEX B;  4OZN A;  4ZVO B;  1OYE A;  2UUT A;  1T11 A;  4CH1 A;  5G0R A;  2NZ4 A;  5KG5 A;  1IM4 A;  4PQU A;  2W7A A;  2KL8 A;  3QFW A;  2F65 A;  4F50 A;  2M8H A;  1DLO B;  1BQM B;  2V69 A;  4U7U K;  1VBK A;  4KKO A;  2JVO A;  1ZTT A;  1YWX A;  3TUP A;  2KXN B;  1YJV A;  3C6T A;  1YBU A;  1RTH B;  3J7Y I;  2ZEJ A;  1BY9 A;  2HAI A;  2KFY A;  2OTJ S;  4KC5 A;  1KQS R;  4AXI A;  2GS8 A;  5E5N A;  5B7W A;  5F3T A;  4O3P A;  4JI7 F;  4NLS A;  4BWM A;  1GFW B;  3IP0 A;  3UVJ B;  1FI4 A;  4KT0 C;  4YY3 J;  1LWX A;  1IBK F;  4KGV B;  2KT2 A;  3VHQ A;  4NLW A;  4DFM A;  1WEZ A;  2IYG A;  1MSW D;  1FK9 B;  1FE4 A;  4U6P A;  2HFU A;  1NRK A;  2M0G B;  1RT1 A;  4PR6 A;  2JRS A;  1PIE A;  4LT6 A;  5HP1 B;  1N4L A;  4O44 B;  3EGV A;  2OPS A;  1G7C B;  3DGV A;  1RHR B;  3M2U A;  3BO2 A;  4WU2 A;  3N28 A;  4DEZ A;  2MKI A;  4LSL A;  2UUB F;  1BMQ B;  4M5I A;  5B09 A;  3NG8 A;  2RF2 B;  4P2X A;  2HQF A;  1U2F A;  4R0J A;  2OSQ A;  2B7C B;  2BAB A;  5CD4 A;  1B64 A;  1SUQ A;  3CIZ A;  1B3T A;  1R3N A;  4B9M A;  3HSD A;  3KJQ B;  3PNI A;  1HQ2 A;  4ICL B;  1QSY A;  2GNK A;  3CCV S;  4NCA A;  2WW8 A;  4I7F A;  4XO0 A;  3J7Z 5;  3TQ1 A;  5IV3 A;  5KFW A;  4B3R F;  3KUE A;  5FLX Y;  3OTD A;  2GQC A;  3TOQ A;  3F56 A;  4JI1 J;  4TLR A;  3FBB A;  3SIP B;  4J37 A;  2J6T A;  3EXC X;  3LUY A;  4WFY A;  1FRM A;  2VG6 A;  1NK8 A;  5KOX A;  5HQ8 A;  5BXI A;  1DZ5 A;  5KT6 A;  1YG0 A;  4KFB B;  4OIX A;  2W4D A;  1EZZ B;  2YWF A;  4V19 J;  3QFH A;  4Q2L A;  3K0J A;  2HVZ A;  1WSV A;  3KK1 A;  3OXG A;  3MZI A;  3P45 B;  4A8Q A;  1KC8 T;  2RML A;  2NYH A;  1HQE A;  4PWW A;  4YHH J;  4LBH A;  3DLL Q;  4Y65 A;  2JC1 A;  2EVZ A;  4DWI A;  4O0N A;  4O3Q A;  3OW2 R;  1WI6 A;  3JQJ A;  4DLE A;  2EBE A;  3A12 A;  1NZA A;  3T6J A;  3SV4 A;  2DHG A;  3I55 S;  2ADB A;  3FFI A;  2UU9 J;  3T9N A;  2E5L F;  2J7K A;  1CJK B;  2VDH A;  3HHL D;  3B4M A;  4DR2 F;  1N52 B;  2ADC A;  1HKA A;  2LQ5 A;  1U1N A;  4U7U D;  3KNA A;  1RTZ A;  3I31 A;  1T9T A;  5C25 A;  2IJF A;  3IRX A;  4U96 A;  2AX0 A;  3TJ9 A;  1VQ4 S;  3W9J A;  1RU2 A;  1SJF A;  3M8Q A;  4RUB A;  5C42 B;  1ZM4 A;  1U26 A;  3VCD A;  2ZBQ A;  2ZUG A;  2FVR A;  2MST A;  1WEX A;  1WOO A;  1KDN A;  3TR5 A;  3DM2 B;  4FPI A;  2H5J B;  5J1E A;  3TAP A;  3BB5 A;  3DDK A;  1RWO B;  2WVE A;  2JLG A;  5F8N A;  2B4V A;  1Z1Z A;  2XMU A;  2VFV A;  2LMI A;  3AAW B;  3MEE A;  4K4W A;  2X3G A;  2XSJ B;  1LNQ A;  2V63 A;  4JI2 J;  4EYH B;  4AL7 A;  1X5S A;  3FJ2 A;  3E8O A;  1EKS A;  1UWB B;  4NLR A;  2HK3 A;  2R2R A;  4DR7 J;  2DPI A;  4KRW A;  1GX6 A;  4ILR A;  1K44 A;  3K5O A;  3T1A A;  4BBY A;  2YKO A;  5IT4 A;  4FZV A;  4L3K A;  3TAM B;  3KDN A;  2DHX A;  5HRO A;  3HK2 A;  1NK7 A;  5EDW A;  4E2F B;  3BBF A;  3MAA A;  1VQK S;  4U8V A;  3SDE B;  4LFB F;  3EX7 B;  4ILL A;  2V4J B;  4WE1 B;  2VFS A;  4JI0 F;  1RTI A;  4ZVG A;  2HQD A;  1Y3K A;  3SSQ A;  1VI7 A;  2EI5 A;  2F8H A;  2W9C B;  2FUG 9;  1ZPW X;  9RUB A;  3CTR A;  3P5B P;  5LXR A;  4PXB A;  3NP5 A;  4LRB A;  1T03 A;  2FYX A;  1W7W A;  4FF2 A;  4PAB A;  2BE2 A;  3C16 A;  1FVS A;  2CPJ A;  2D9P A;  4IQM A;  4LFC J;  4RW8 A;  2WBM A;  1PGZ A;  3HHE A;  3S6E A;  3O8W A;  7AT1 B;  3B54 A;  2AJQ A;  3HFZ B;  4KV8 A;  2DXE A;  2QE5 A;  2E7V A;  2U1A A;  2HNZ B;  3FMB A;  4YDD B;  1FF2 A;  2BBE A;  4ZIT A;  3UNG C;  4TVA B;  2E1M C;  1QY7 A;  1YK9 A;  2YH0 A;  5IM0 A;  1IKV A;  2HS0 A;  1RYR A;  1XEZ A;  4K59 A;  1BQN B;  3U7J A;  4DR5 F;  2MKK A;  3HD1 A;  1FWL A;  5K8P A;  1R8C A;  1S1T A;  1VMB A;  1IWA A;  1RIS A;  4GKK F;  4OJ3 A;  3QO9 B;  5A2Q Y;  1SQE A;  2FY1 A;  4HT7 A;  2JH3 A;  2PN6 A;  4RUC A;  4ECY A;  4O0I A;  1KNZ A;  4FXD A;  3UDL A;  3EVW A;  2IDL A;  1ZOT A;  4Z7Y A;  3CMA S;  2R8G A;  3EM1 A;  3EWG A;  2EEY A;  1K0T A;  2J8S A;  3I0S B;  1UEK A;  4IFV B;  2UUC J;  3GR1 A;  4R5P B;  5DJB A;  2XI3 A;  1LWE A;  2KRB A;  3FMW A;  4FS2 A;  4HHU A;  1NCL A;  3UE2 A;  3PG9 A;  5A0Y A;  2IA6 A;  4AL6 A;  3LGH A;  4OI0 A;  2XMM A;  3D6M B;  3T19 A;  5HMW A;  2JLE A;  1AW0 A;  4NCB A;  2CPD A;  3MTK A;  4ECQ A;  4WFX A;  3NNC A;  2CG8 A;  1NB2 A;  2RB7 A;  5KFF A;  1PSD A;  2V8G A;  1GEH A;  4PPZ A;  4JV5 F;  1NDP A;  4IFY A;  3CME S;  4NLY A;  1DRZ A;  4USJ C;  2EC0 A;  1AA1 B;  4GRS A;  3LWL A;  1CPZ A;  2ZM6 F;  4IQX A;  2VA3 A;  2F8E X;  2RH3 A;  3VAL A;  4WFZ A;  4F04 B;  1KVJ A;  2Y1J A;  4HHJ A;  1UPM B;  2CWK A;  2DNG A;  1N0V C;  2PC6 A;  5DET A;  2RU9 A;  4HAC B;  1HW9 A;  3MUT P;  3SSR A;  2XZD B;  1NK9 A;  4NRU A;  4R25 A;  2MZ1 A;  4A8X A;  1VQ7 S;  1WG4 A;  2VQF F;  1CLF A;  1N33 J;  1IKW A;  3NEK A;  2OTL S;  2XC9 A;  3I4P A;  1NPR A;  4LF7 J;  4C0B A;  2R2S A;  2R7S A;  3THP A;  2C2N A;  4F67 A;  3FCH A;  4PUO B;  1FVQ A;  1QE1 B;  3J7A 1;  1S6P B;  3RU0 A;  3LTO A;  3A3O B;  2BXJ A;  1RTD B;  3QSI A;  4OZL A;  3HHN B;  5H9F K;  1FNM A;  4FKY A;  1PBU A;  3NOG A;  1ZZN A;  4TYB A;  4NA2 A;  4JV2 A;  4J90 A;  1S1X B;  2FVS A;  3ZZR A;  4MKB A;  3NGD A;  4TY8 A;  2FVQ A;  4FXW A;  4DR4 F;  4OI1 A;  2Q6C A;  3PVX A;  2OMO A;  3RRG A;  1UVM A;  2UVU A;  1BWV A;  2HS4 A;  2QC3 A;  4O4G A;  4LF9 J;  4WKY A;  5IFM A;  1MN9 A;  1HR0 J;  2JNJ A;  1YIJ S;  3R5C A;  4LF8 J;  1WUU A;  4KPC A;  3FZB A;  2KI2 A;  4DQQ A;  3VAM A;  2HEK A;  1PJ7 A;  4M5N A;  1FRX A;  1FHT A;  4ED2 A;  2IBK A;  4CLK A;  5HVG A;  1L3S A;  3BDP A;  2CJY B;  3PYD A;  2XBP A;  2XMT A;  5A8R A;  4DQR A;  4JI3 J;  4LF2 A;  3M32 B;  3O6Q A;  2WSF C;  2DH9 A;  3F0N A;  5C7P A;  2BJ3 A;  3MEK A;  1NJY A;  1UCN A;  2PMZ D;  4MTP A;  1H98 A;  4X64 F;  2VHG A;  3S01 A;  4FF1 A;  4DPU A;  1HD0 A;  2AX1 A;  2ALZ A;  3BDE A;  2NXC A;  3NGU A;  3GE9 A;  1S1U B;  1S1W A;  2RRA A;  1B99 A;  1RAG B;  5KFT A;  3AT1 B;  1FE0 A;  2G2Z A;  2IM2 A;  2YQ0 A;  3AOA A;  5HI7 A;  4AFF A;  2F1F A;  2KYZ A;  2YNH B;  1VRT B;  1R27 B;  2GZO A;  2OEK A;  4PYD A;  4ETZ A;  2NYI A;  2YWH A;  2R7T A;  2D1C A;  4CLU A;  3ZTQ A;  3NCP A;  2BA9 A;  5F8G A;  4LJM A;  1VQO S;  1NHK L;  3MEG A;  2JFK A;  3G6Y A;  2YX1 A;  2AD9 A;  2E9Z A;  1QTM A;  2FZC B;  5KOW A;  1RTJ B;  5J2Q B;  1HNX F;  1YJW S;  1OWX A;  1H0H B;  2BR0 A;  2Y1L B;  5HO4 A;  2KG1 A;  3OT9 A;  4BHQ A;  3LA0 A;  3EE3 A;  1TKT B;  3QQC D;  5T14 A;  3GMG A;  4B9T A;  1JIH A;  2CZV C;  3KG4 A;  4M5L A;  1NH8 A;  4HYK A;  4E0D A;  1RT4 B;  3BYP A;  1UVL A;  2ZD1 B;  1VLY A;  2YKN A;  2VBX A;  3CW2 C;  1J5E J;  5KTQ A;  4P2M A;  2ZWP A;  1JLG A;  2AT1 B;  1NXI A;  1N5Y B;  1AFI A;  1U7L A;  1XER A;  2VDI A;  1KSP A;  2W7P A;  5AE1 A;  4X4R A;  4ECS A;  2OFH X;  1ZM9 A;  4USV A;  4ZPT R;  4DV0 J;  1XR6 A;  4FDF A;  2HQC A;  3US5 A;  2OI2 A;  4IDK A;  3I5C A;  2E9T A;  4DG1 A;  4YR3 A;  1WF0 A;  2QX0 A;  1B0P A;  4I69 A;  1FTR A;  3D6H B;  3QID A;  5H9E K;  4USU A;  2CIM A;  3G8Q A;  1FO1 A;  1TMM A;  4A8O A;  1NJI T;  2VAS A;  1N5Q A;  1LQ9 A;  3JSB A;  3KK2 B;  2W2N P;  2E1A A;  2J0X A;  3H98 A;  2BRL A;  2X1G A;  1QVG R;  4CRJ A;  1JLF B;  3LP1 B;  2F9J A;  2YNF B;  3K7R A;  1LW2 A;  1UEV A;  2ZE2 B;  3BQ1 A;  2AGP A;  4EWT A;  3Q83 A;  1DTT A;  2CRL A;  3S1T A;  4HL9 A;  4MKY A;  1HWI A;  2RF2 A;  5KG0 A;  5BYQ A;  5HAT A;  3U1N A;  2M3D A;  4ILM A;  5D4L A;  1VK3 A;  3GV7 B;  4JYA F;  4Z2X A;  1CJU A;  5SZT A;  1VQ6 S;  2MZT A;  3H42 A;  2WVD A;  2K2P A;  2XNR A;  4OHX A;  5A6P A;  4DOZ A;  2YNI A;  2DNM A;  2EG2 A;  3MMC A;  2XS5 A;  1JLQ B;  1RT6 B;  1RT3 B;  3ILI A;  1MRO B;  3H4B A;  1F5B A;  4K4Y A;  2K8G A;  2FVP A;  2GV1 A;  3ZTO A;  5I42 B;  5KFE A;  1UFW A;  4KFB A;  2R4F A;  2RS8 A;  1HBM A;  4F3Q A;  2CKW A;  4I68 A;  2KH9 A;  1T0T V;  2F7V A;  3ZC4 A;  5F8H A;  1RAB B;  4DL6 A;  2FDN A;  4EUV A;  2L08 A;  2EFQ A;  3SEO A;  2DY9 A;  1GXL A;  2XHW A;  4CM2 A;  2FHO B;  2HAF A;  4KGK A;  3QRQ A;  5IWA F;  2ZC4 A;  1S9E B;  1PKU A;  3KHH A;  4KJI A;  1RYS A;  3GFH A;  1WC4 A;  3AH6 A;  1U1L A;  4NLQ A;  3FQL A;  3W2V A;  2A3J A;  4DX8 H;  2YH1 A;  3DOM A;  3P5T L;  2R8I A;  2D9O A;  1OS5 A;  4GVB A;  1JLA B;  1X4G A;  3MM8 B;  3LP2 A;  4OX9 F;  3NWG A;  4USK A;  3OL7 A;  3PHT A;  3H59 A;  3BKT A;  3R5J B;  3K5M A;  3KKF A;  3UCZ P;  1SJR A;  3QZ8 A;  3Q2S C;  1L3U A;  1N32 J;  4JI4 F;  1I1G A;  4G65 A;  1QD1 A;  3HZG A;  2MQO A;  1HFE L;  5IT9 U;  3W7B A;  4IR1 A;  2V6A A;  1WF1 A;  4Y2K A;  1HBO A;  4HHH A;  1EQM A;  3MR6 A;  1IKY B;  3A8K A;  1Q5V A;  3UN5 A;  3QYY A;  4LMZ A;  2IM0 A;  4GMK A;  2NRE A;  4KGM A;  4ZIV A;  1LOU A;  2LA6 A;  1TUW A;  2O5D A;  2DIT A;  1U1M A;  4G1Q B;  5IQ6 A;  4WFB Q;  2OGU A;  4CLS A;  2UXC J;  2O67 A;  4ZN3 A;  1U49 A;  3FKB A;  2FHJ A;  4F02 A;  3JTO A;  3EUN A;  4DR3 J;  4ID5 B;  5DM7 Q;  2WAQ D;  1S49 A;  3A8J A;  3MPD A;  1RAD B;  4DV4 F;  1JKH A;  3QLH A;  4EYI B;  4AYB D;  2UUA J;  4ITS A;  2MZS A;  4Y6I A;  5DZ6 A;  2MLZ A;  2EXU A;  3CCL S;  3VAF A;  2J9E A;  5FII A;  4ECX A;  5K14 B;  3C15 A;  2N3O A;  4WCE Q;  1R8P A;  2V8H A;  3DRS B;  5B0E A;  3QSY B;  2DHA A;  2W9B A;  2DR9 A;  2UUW A;  6AT1 B;  2DR5 A;  7FD1 A;  1VFJ A;  2CJB A;  2VPZ B;  2CNO B;  4OV6 A;  3KYL A;  1H72 C;  4URQ U;  3BO3 A;  2J9D E;  2CQI A;  2AF6 A;  1N48 A;  5HMY A;  4XDD A;  1NB7 A;  1IBC B;  2HS3 A;  3PHE A;  4JI6 J;  2O01 C;  1TL1 A;  1SI9 A;  2UXB F;  2J8A A;  2HHT A;  4B9S A;  3DRR A;  2DT9 A;  2CQB A;  1HNV B;  2HBQ B;  3KJN B;  1KQG B;  1TTH B;  2OUG A;  2CDR B;  2HNZ A;  4GC6 A;  1IM6 A;  5J1N A;  4WWS A;  2X1F A;  2BKP A;  3CJK B;  3OLB A;  2E1R A;  2BE9 B;  1TL7 B;  3Q8Y A;  1EET A;  3KXD A;  5KT4 A;  1JLC A;  3PJX A;  1QAX A;  4QR2 A;  4UTG A;  2N7C A;  1Y3J A;  4KHM A;  5I3Q A;  3NS7 B;  3NOC A;  2I8E A;  4WKR A;  4LSZ B;  1G6B A;  1C4C A;  1Y11 A;  4IYQ A;  1HL6 A;  3PAC A;  2FJW A;  2VOD A;  3WZ0 A;  2C2O B;  2K7J A;  2Z0G A;  4PG7 A;  2DR8 A;  1Y10 A;  1U2R A;  2HHH J;  4QIE A;  2E1C A;  3BGR B;  4DV1 F;  2D3Z A;  2RHS B;  3CD6 S;  3LPE A;  4TLQ A;  1NM2 A;  1Q8B A;  2LVW A;  3B4D A;  4WYW A;  3TNV A;  1F9H A;  4MFB A;  2A10 A;  2IRU A;  5AXM A;  1YIT S;  1QSS A;  2MPU A;  4KR0 B;  5ETS A;  4K2J A;  5LMU F;  1A6L A;  1Y7P A;  4EU0 A;  1F60 B;  3JXO A;  2K1R B;  2W7O A;  5DDQ C;  4I2P B;  3HMJ G;  4CTA B;  1Z2L A;  3RBE A;  2HWH A;  4OJG A;  4ES1 A;  2WVC A;  1PYS B;  1HYS B;  3OR1 A;  1NJX A;  2SXL A;  1Q1K A;  3K17 A;  1ROF A;  1SV5 B;  1X9S A;  4UOH A;  2B8Q A;  1A9N B;  4MK7 A;  3CJQ A;  3FCV A;  3HZE A;  2P6S A;  1CJV A;  4NZ6 A;  2J9D A;  2JC0 A;  3CC2 S;  3UD3 P;  3BPS P;  1VC6 A;  3LW5 C;  4QYZ J;  3K8W A;  1OO0 B;  3V6D A;  1U45 A;  1RWN B;  3L95 X;  2R7X A;  1OJ4 A;  1WKK A;  2R3V A;  3TX0 A;  2ZNY A;  4DSJ A;  4A46 A;  2PI5 A;  2IVM A;  2IVY A;  5ETL A;  4EBE A;  1TAU A;  1MWZ A;  2B6A A;  2C2E A;  4PWD A;  3VVT A;  1HI8 A;  3SSS A;  4LSN B;  2EFN A;  2DK2 A;  1EX8 A;  4DQP A;  2RKI B;  3I9V 9;  4DS5 A;  5KG4 A;  1IR0 A;  2ERR A;  2DIU A;  2EPI A;  3R27 A;  2IJN A;  5ETK A;  3R3T A;  3CJS A;  2ZJQ Q;  3OUY A;  2M70 A;  4UQT A;  2NS1 B;  5ETR A;  3CCT A;  4JI2 F;  2HUR A;  3AB2 B;  3C19 A;  1BXN A;  1Q82 T;  3R2C J;  1UVI A;  2FJD B;  1Q7L B;  3EGZ A;  2ROG A;  5CYM B;  3EVM A;  2FB0 A;  4NOH A;  4XAK A;  1U6F A;  3K5L A;  3GIR A;  2HVD A;  2P2C B;  2VUG A;  1HD1 A;  3DYA A;  4RO0 A;  3SQG A;  2RQM A;  3OTE A;  1RKI A;  2H4Y B;  3KLG B;  4Q2M A;  4DR1 F;  4H4O A;  1X0F A;  3CE8 A;  2DNR A;  2BQU A;  2FLN A;  3JQK A;  3RB6 A;  3ET6 A;  2AJ2 A;  2IPO B;  3M32 A;  3T1H F;  1JLE B;  4ZKA A;  4B3M J;  4ZJL A;  4ECR A;  3HXM A;  2GGP A;  2K7K A;  3DOK B;  1TKX A;  3PO5 A;  1FXD A;  1N6Q B;  5KFJ A;  1SH0 A;  3FZ2 A;  2AKW B;  2VG7 B;  2XMJ A;  1X5P A;  2AP6 A;  2XWX A;  2HFV A;  5J2M B;  1H7X A;  1Y9O A;  3KTQ A;  3R7S B;  3F44 A;  2HHV A;  2XGQ A;  2WVB A;  3HI9 A;  3VV2 B;  4ZS6 A;  2B56 A;  5CCL A;  1LWF A;  4IO9 Q;  2LKZ A;  1U1P A;  3PYE A;  1VHF A;  1U6Z A;  2Z56 B;  2ZBP A;  4ZVP B;  4C2M A;  4DBQ A;  2G2O A;  2BW7 A;  3V5R A;  4QIV A;  1EHW A;  1UPP A;  5C5J A;  5ETO A;  5CA5 A;  4C8K A;  2ILY A;  1SKR A;  2DGU A;  2PT0 A;  4GC7 A;  1C1B B;  2VG5 B;  1SIW B;  1X31 C;  4MT1 A;  1IBM J;  3R6L B;  1FRL A;  2IMO A;  4RNO A;  4HKQ A;  5C24 B;  3FRY A;  2VZ9 A;  3UQS A;  3ZO7 A;  3RUB L;  4G3I A;  3AD9 C;  5KFY A;  3MEC B;  3RAQ A;  3DLH A;  3D67 A;  4X65 F;  1UW9 A;  2KTQ A;  1U47 A;  4MIA A;  3MAH A;  3FNN A;  4DN9 A;  3KLH B;  3PFE A;  4QU7 A;  4RUA A;  1PIL A;  2XGP A;  1VQM S;  1QAY A;  3JB9 k;  2G4B A;  3FBF A;  4CZC A;  3DLE B;  4B3O B;  3ZTS A;  1RT7 B;  5E3Q A;  1Q7Y T;  4OZ5 A;  3D1H A;  2GJF A;  2ZD1 A;  2ZH1 A;  4WP9 A;  4P7T A;  1K9M T;  3SV3 A;  1SIZ A;  1HMV A;  1WAC A;  2GML A;  2B0G A;  4FYD A;  3TAN A;  2R7W A;  1R0B G;  3ZZY A;  2IAJ A;  4FNI A;  2VBZ A;  3FSX A;  2VBY A;  4OHY A;  3TQE A;  4RW6 B;  4WU3 A;  3D0H E;  4W98 A;  2HVE A;  3J81 U;  5KFZ A;  3D6T B;  4NZ7 A;  2XY7 A;  3KWM A;  4RW7 A;  5GAG U;  4MH8 A;  3C66 A;  5EUH A;  2I1R A;  3I0R A;  4RW9 A;  4J9L A;  5FD1 A;  1ZA2 B;  4P9S A;  4DUT A;  2NR0 A;  5L39 A;  3TAR A;  4QIG A;  1L3K A;  1ZAW A;  2CDQ A;  4DL0 C;  1NK4 A;  4J5O A;  1JXV A;  3DLG A;  3BGO P;  1B0T A;  4CLT A;  3LGM A;  3D3B J;  1LK7 A;  4KB7 A;  4RZR A;  4ZPB A;  4AD6 A;  2QMU B;  4ZLP A;  2AIR B;  3DXB A;  5F0U A;  3NCR A;  1N34 J;  5E3P A;  4I6Y A;  4DU7 A;  2L9N A;  4NML A;  4O3N A;  1N33 F;  4IO1 A;  1EQ0 A;  4Y2A A;  2IRY A;  1HWL A;  3OV7 A;  4H54 A;  3FQK A;  2ATC B;  3H0P A;  1B7Y B;  2QA4 G;  2VPW B;  2QLB B;  2QSF A;  2B9Y A;  4OYZ A;  2XMK A;  1DY3 A;  4ZLJ A;  3W66 A;  3BRE A;  4NWB A;  1F9E B;  2GHP A;  1S4F A;  4RU9 A;  3IMQ J;  4LFA J;  1D9D A;  1K0V A;  2PFD A;  4A8F A;  4IOA Q;  2DXF A;  4WIQ A;  4AT1 B;  3EZO A;  1KVI A;  1HBU B;  1KWM A;  3QJJ A;  5A8W A;  2FVC A;  3I82 A;  2BQR A;  4DQS A;  2POK A;  3CDU A;  1ZAV A;  4C3M A;  2IIH A;  1ZPV A;  1EJ7 L;  4DV3 F;  4LBI A;  4AE5 A;  3MMA B;  4EO8 A;  4TU8 A;  4QPX A;  1CSJ A;  3T1Y F;  2ZC3 A;  4R0E A;  2HMI A;  2YKP A;  2J0W A;  1S9G B;  5LMN J;  4DL3 A;  2DKO B;  3IGN A;  2ZBC A;  3CD5 A;  2YY3 A;  4JI3 F;  3MM6 A;  1K73 T;  3CNQ P;  2QA2 A;  2GVZ B;  4MKV A;  4Q8F A;  2IC3 A;  4UUX A;  3M6W A;  1LXN A;  1UVK A;  4RW4 B;  4GKJ J;  4NCG B;  1KR4 A;  2XEX A;  3LAL A;  1Q81 T;  3BEG B;  4HEA 9;  4YR2 A;  1M5V C;  3JSM B;  3DDI A;  3RTV A;  3MWB A;  4Q7A A;  1EKR A;  1WDD A;  2DNZ A;  4LF4 J;  1XR5 A;  3GU0 A;  1TVR B;  5CQG A;  3N01 A;  2E5H A;  4ZHR B;  3ADA C;  3QIP B;  4C8L A;  2HZA A;  5KFR A;  3AQO A;  4NYP A;  2M9K A;  5KFD A;  1LEO A;  4ED5 A;  4UUW A;  5HK4 A;  2YTC A;  3RAX A;  1J5O B;  1REV B;  2ZHO A;  1S1V A;  5HAO A;  3VVU A;  3W61 A;  3X3U A;  1XMB A;  1I94 F;  1AZS B;  1C0U B;  2YKQ A;  2HNY B;  2C2R A;  2J9C A;  3OTC A;  3QGI A;  1IVZ A;  3DKD A;  3M9N B;  4DV6 F;  3PX4 A;  4FPR A;  3AD8 C;  2G1H A;  3MD1 A;  3M2R B;  2WON A;  2MY7 A;  4XPC A;  1DTQ A;  3GON A;  3PFO A;  1IWG A;  3CCR S;  3HD2 A;  3Q8U A;  5LOQ A;  2ZH7 A;  4IRK A;  1Q8K A;  2XS2 A;  2AEF A;  1L3V A;  3HHL B;  5FLX U;  2V9W A;  1TV6 B;  1FRK A;  2GVD A;  2B5J B;  2R7R A;  1KLM A;  1WHV A;  5HBM A;  3U27 A;  1WC3 A;  3M1V A;  3C6U B;  5GAH U;  2GHV C;  4HTI A;  3K57 A;  1N88 A;  4XK8 C;  1G1X A;  1F5C A;  3PIP Q;  4M5D B;  2MKC A;  2HSE B;  3MR3 A;  1U0H A;  2CWX A;  3LWM A;  3JSR A;  1GNK A;  2LQ8 A;  3BQ2 A;  1IR2 A;  4ZPD A;  2F4V J;  3ENW A;  1JWW A;  3HP6 A;  3BM7 A;  4GO5 X;  1WHX A;  5DG7 A;  1N5S A;  4WII A;  2BAN B;  5DG9 A;  1XIQ A;  2JDJ A;  2NCK L;  1U02 A;  1RT5 B;  4MIB A;  2HQI A;  4AQY J;  3H2L A;  5H9F J;  3FC9 A;  2GA7 A;  2AYG A;  5AXL A;  3E01 B;  4G6V B;  5KFU A;  1GT8 A;  2Z2L A;  2QZ8 A;  1RJJ A;  1T05 A;  4C8Y A;  1OY9 A;  1PJ6 A;  2Z58 B;  1R6V A;  1Q0N A;  5HL7 Q;  3C2P A;  1VQP S;  5DZ7 A;  2VB6 A;  3DRX A;  1RP5 A;  2RE1 A;  2WZ1 A;  3DRP B;  1O8B A;  2AJ4 A;  2CJX B;  2ZJR Q;  1TL7 A;  4IOB A;  5D6G A;  2FHJ D;  5U47 A;  1N54 B;  1SQG A;  4OMF G;  5L1I A;  1S99 A;  2GIQ A;  1WKJ A;  1MG7 A;  5EWF A;  4ID8 A;  2BJD A;  4IRD A;  4U8Y A;  2DY1 A;  5GMD A;  2YNG A;  3KUH A;  3FRZ A;  2Y9H A;  3GPA A;  2XO6 A;  2FQQ B;  2RDJ A;  3GJQ B;  1JLB A;  2CQ1 A;  3ETM A;  3MCM A;  3R7N B;  1KBR A;  3PYG A;  2EFV A;  5HLF B;  1HBN B;  2OPP A;  3CJ4 A;  1NUE A;  3V4M A;  2C22 A;  3OBI A;  5KG7 A;  4IH7 A;  1YZ6 A;  1HQU A;  3IG1 A;  3V4I B;  5M2U A;  1N56 A;  1URN A;  5K8M A;  3WC0 A;  3UW1 A;  1H2U X;  4YUD A;  2M5Y A;  4TY9 A;  5HMZ A;  3K59 A;  1O0P A;  1CC8 A;  2K1R A;  2LQB A;  5E41 A;  1OY6 A;  4W92 B;  3DI6 B;  4X4N A;  3SQO P;  4CNZ A;  3R7B B;  1RHU B;  3CJ0 A;  3M8P A;  4R8U B;  3JYT B;  3LO3 A;  2HBZ B;  3BO4 A;  4LF5 J;  2MXY A;  4OZ2 A;  1HPZ A;  3LAM A;  5HVF A;  1VJQ A;  1MU2 A;  1PG5 B;  3RW6 A;  1OQ6 A;  1VBX A;  2OJ3 A;  2ACY A;  4JUZ A;  4CP5 A;  5KG6 A;  3TA1 A;  4DR6 J;  4RU2 A;  3NS5 A;  4CO2 A;  4KBI A;  4K4V A;  2ZH2 A;  1LWC A;  4ZVS B;  3MI7 X;  4FF3 A;  3UN3 A;  1JX4 A;  3PW5 A;  4TU9 A;  4X84 A;  3HHD A;  2BJE A;  3QGH A;  4Q8E A;  1EIY B;  1VJW A;  2JSX A;  1ZBT A;  2PMW A;  2HHW A;  1XWL A;  3IN5 A;  2OSR A;  1REG X;  3D66 A;  1A7G E;  4M8L A;  4F0M A;  2VL1 A;  1PBA A;  4QWE A;  2AHO B;  4DV2 F;  3HJF A;  1CS4 A;  2KVI A;  3E2E A;  1R0A B;  2KHC A;  2MKY A;  1JJH A;  3NGT A;  2IJR A;  3EZ5 A;  1FJE B;  1VOM A;  1LK5 A;  2HYI B;  1LKZ A;  1TQL A;  2EC2 A;  5LSL A;  4TNO A;  2UXC F;  2CQD A;  4WK1 A;  1CUL B;  4NI2 B;  4CO3 A;  3KLE A;  5A2Q U;  2HVH A;  3ZNJ 1;  3EXY A;  4DZD A;  3CVK A;  1XJW B;  5H9E J;  2L9W A;  3HVT B;  4X66 J;  1FFW B;  3EMT A;  1V6H A;  4O23 A;  4C8M A;  5BR8 F;  3CCE S;  2FJV A;  2F9D A;  2ABY A;  2B51 A;  3KJV B;  2UUA F;  1I51 B;  4ZVU B;  2N4D A;  3PEH A;  5D3G A;  1S59 A;  4I6A A;  3CCW A;  4ZVH A;  4CLF A;  1SB6 A;  2XLI A;  4PWU A;  1RWM B;  4DL7 A;  2ATL A;  2IM3 A;  3CJ5 A;  3J80 Y;  4J9U E;  1ACM B;  2RQ4 A;  3KLG A;  4KHP J;  3GIM A;  1S5Z A;  1ZS6 A;  3MM5 A;  4LF1 A;  2DRB A;  3BGF A;  1GMW D;  1Q16 B;  2BMB A;  1WWH A;  3DOL A;  4TU7 A;  4I2Q B;  2HQG A;  4DPY A;  2VG7 A;  3G6V A;  2D7S A;  2QLX A;  4JI6 F;  4CM0 A;  5GME A;  3MPU B;  5J2M A;  3M30 B;  2B9X A;  2HFN A;  3HSG A;  3A8E A;  3MPV A;  4CT8 A;  1TFY A;  1GXT A;  2MMY A;  4PG6 A;  5EHH A;  2KHD A;  5AXK A;  2OO4 A;  5ITH A;  1KD1 T;  4DHV A;  2M52 A;  3LQV A;  1M1G A;  4OQJ A;  5HSP A;  4I67 A;  3ZXW A;  2FHM A;  2C3Y A;  1R0C B;  5J2N B;  5KFV A;  2JWN A;  3CCM S;  4LF6 F;  1DAR A;  4ZVF A;  4PG8 A;  4JV0 A;  3WQP A;  2HBR B;  3Q8Q B;  3MMB B;  1S6Q A;  3NS6 A;  1UJ4 A;  3TUJ C;  2JEF A;  2QEX S;  4H4K A;  4IG3 B;  4IG0 A;  4FN5 A;  1NH7 A;  5L1L A;  2ZH5 A;  4CLL A;  2G0J A;  1S7H A;  3DLJ A;  1NAQ A;  3Q8R B;  4KO0 A;  1FEE A;  1XNQ F;  5AT1 B;  4OX8 A;  1UVJ A;  2DGQ A;  4QWB A;  4KH0 B;  3CDE A;  2UUB J;  3N9U C;  3CMQ A;  1Y5L B;  3W62 A;  1K1S A;  1U4B A;  1S48 A;  1NPP A;  1E6V A;  1HAR A;  1XMQ F;  5A8K A;  1D8Y A;  1U8S A;  3DLE A;  5DGB A;  3PRD A;  4QWD A;  5GAD U;  3BF4 A;  3MM7 B;  4TKT A;  3TJ8 A;  2O3D A;  4JP8 A;  1FDA A;  3AOB A;  4QYZ K;  1U48 A;  4GVL A;  3H40 A;  1RAA B;  2CAD A;  3HX9 A;  1FKO B;  1MMD A;  2I5J B;  2MDA A;  4K5R A;  1X9W A;  1ZA1 B;  4OLO A;  3HKZ D;  4ED7 A;  3P4U B;  3OXL A;  3TI0 A;  2WOM B;  4ZJO A;  4OHV A;  2GO8 A;  2Q43 A;  4XIU A;  2CZ9 A;  5LM7 E;  4M5H A;  4N76 A;  2LEB A;  4HI2 A;  2R2U A;  4ZN1 A;  3OSP A;  1Q79 A;  1UJ5 A;  5AXN A;  1RT2 B;  2LA4 A;  5T7L A;  4DX6 A;  3UD5 A;  4L73 A;  2J5A A;  2WVF A;  3CPW R;  1S0M A;  2HG4 A;  2X51 A;  4NLP A;  3MED B;  1X0P A;  1GXU A;  2M7S A;  5G4D A;  2QMX A;  4UOF A;  1CJT A;  4QOT A;  2MGZ A;  3VGV A;  3NCQ A;  1XR7 A;  3IM9 A;  2AWZ A;  1DQ8 A;  2N4C A;  4C11 B;  3MR5 A;  1U2C A;  1X5T A;  4KGZ B;  2C3O A;  2E5L J;  1VYA A;  5E3R A;  3IAS 9;  1UWA A;  1HHT P;  4PPD A;  2OLW A;  3OTO F;  1S57 A;  3VAK A;  3EDQ B;  3LP0 A;  4RPF A;  4C0O C;  5F3Z A;  2C3U A;  3IWL A;  1ICE B;  3W64 A;  2OPQ B;  4X4U A;  2B9E A;  1T9X A;  3HHL C;  2C2K B;  1SJQ A;  4F4W A;  3EZU A;  4A8M P;  4JB8 B;  2C2M B;  1WC0 A;  2CQG A;  3WC2 A;  4NZ0 A;  5L1J A;  2V50 A;  2Y1R I;  2D3O R;  4DX7 A;  1RA7 A;  3O2I A;  4F4K A;  4PRF A;  5F8I A;  3EGW B;  4FBT A;  5LXY A;  3DLK B;  3OHB A;  3PZP A;  2FLP A;  4OJH A;  4EO6 A;  5AE3 A;  1ZM3 A;  1RBL A;  5I3P A;  3D7S B;  3BSN A;  4PQU B;  3J7Y U;  3HM9 A;  1IBL F;  1FFS B;  4O4R A;  1OYD A;  2RUG A;  4KKO B;  2E1P A;  5GVQ A;  4B3M F;  4QR1 A;  6FD1 A;  1HWJ A;  3C6T B;  5EGY A;  2RQC A;  3AA8 A;  2YPZ A;  1JNZ B;  2OD6 A;  4K5S A;  2EG1 A;  2EWH A;  3DC2 A;  2JEI A;  1HLW A;  3AB4 B;  5ETN A;  4BCA A;  4I1T A;  1S0O A;  4KIA A;  3TZW A;  4JI0 J;  4K4S A;  3R2D J;  1RAC B;  2MEW A;  3HKW A;  1KRP A;  2DIS A;  1NHV A;  1GTE A;  3PO4 A;  2LQ9 A;  4C6A A;  1H3D A;  2UVR A;  3H5Y A;  4FYX B;  4M5M A;  3LAK A;  4HI1 A;  1VBZ A;  4DQI A;  2HRY A;  4K50 A;  1SKW A;  4OFZ A;  1RT1 B;  2VBW A;  1X4E A;  2GMJ A;  4RNF A;  5C2G A;  4Y00 A;  8ATC B;  3HT0 A;  1HA1 A;  4YB1 P;  3U1L A;  2YVS A;  2MTL A;  5CYQ A;  3WX8 A;  5ETM A;  3M2U B;  4LSL B;  2J7U A;  4B3S J;  1WHY A;  1SKU B;  4JI8 J;  1DJ0 A;  2G13 A;  2KJV A;  3K8V A;  4F0K A;  2YKA A;  2CVE A;  3O1L A;  2PDA A;  2QYC A;  3G8S A;  2R8K A;  1SUQ B;  3HHL A;  1GMU A;  3CT9 A;  4FP9 A;  1VIO A;  1TKZ A;  4C48 A;  5EX0 A;  3FBC A;  3VGU A;  4DR5 J;  4OJ1 A;  3VAH A;  4I7F B;  4Q44 A;  2JX2 A;  4GKK J;  2XZW A;  2YBV A;  1FRI A;  3IS9 B;  2GCF A;  4MIW A;  3RBD A;  5AJ3 F;  3CGI A;  3VZH A;  5KFS A;  1HIY A;  2V4Q A;  2G0I A;  3IBW A;  1ITP A;  2VG6 B;  4H4M A;  1RWU A;  2CJK A;  1E6Y A;  2HND A;  2QRR A;  2H5I B;  4C7Q A;  1KOH A;  2GHW A;  3K5N A;  3X1L B;  4HDH A;  2MQN A;  2JOQ A;  5HJX A;  2ZWO A;  3KK1 B;  4WZQ A;  3QT6 A;  3F73 A;  1G4C A;  1FDD A;  5D4O A;  4CO5 A;  1OQ3 A;  3B6B A;  4DX5 A;  1U24 A;  2DH7 A;  1HQE B;  1FKA F;  3RBZ A;  4UZB A;  4TQS A;  5T41 A;  2ACM A;  5DO2 A;  3VQT A;  2DGX A;  1NHU A;  2CJ9 A;  1FD2 A;  4JV5 J;  3M2V A;  5KT3 A;  4MK8 A;  3FVY A;  5F41 A;  2DH8 A;  5HQM A;  1RKJ A;  3MPY A;  3Q8P B;  3FFI B;  2V2V A;  2ZM6 J;  2MKH A;  3MMJ A;  3H5X A;  4CWB A;  3OFG A;  4CLY A;  3I9Z A;  2APO A;  3M6X A;  2UP1 A;  1F9F A;  2LLZ A;  2YX7 A;  4UST A;  3M7V A;  5C25 B;  3IRX B;  1M5O C;  2VJV A;  3G82 A;  3TVY A;  2EFG A;  3M8Q B;  5E33 A;  1N5T A;  1YJT A;  4LFA F;  4KHR A;  4U95 A;  3M6V A;  1IQZ A;  4FYY B;  2LQJ A;  4Q43 A;  3W8P A;  2AEJ A;  1AB8 A;  3M4X A;  1YBA A;  3PKM A;  2HIQ A;  5I3U B;  1UVN A;  2VQF J;  4BS2 A;  4YFU A;  1X4D A;  3GB0 A;  3CJR A;  3PEJ A;  4ZCI A;  3M8S A;  5J1E B;  1HBN A;  2UXD F;  4O3R A;  4WXW A;  3KLF A;  4LVO P;  1RUS A;  1P8G A;  1RBA A;  1XMO J;  1HNW F;  3ILL A;  1DQA A;  3IAM 9;  3V4I A;  3LPY A;  1YRX A;  2C2D A;  3LGN A;  1N8R T;  3G4S S;  1P6T A;  2WB4 A;  3AXK A;  2DEI A;  1RAH B;  3CCZ A;  3RB4 A;  2MYF A;  2FGC A;  5JVH Q;  1FD8 A;  3NBP A;  3OJS A;  3MEE B;  4NL5 A;  5BJR A;  3W3S A;  2D74 B;  2AYB A;  3QNW B;  1DQ9 A;  4UY8 T;  1WEY A;  2GQ2 A;  2CPE A;  3IC1 A;  4USW A;  5IT0 A;  4P74 A;  1KN6 A;  4ZJQ A;  2D3U A;  1FNX H;  2W2M P;  1ZH5 A;  3HCX A;  1QTN B;  3C8Y A;  3DGP A;  4K0K J;  4CH7 A;  3S8S A;  5HRO B;  4CYU A;  2ZKU A;  3QZ7 A;  3OVA A;  1OMS A;  3MAA B;  5JVG Q;  2CQ3 A;  1RI7 A;  2KRR A;  3M8Y A;  4B9V A;  3AQP A;  4WF9 Q;  1UA1 A;  2NXN A;  4LR7 A;  1VR6 A;  3AJ2 A;  3UR0 A;  2ZDP A;  3GSD A;  1RTI B;  2YWG A;  4EZ9 A;  3GCX P;  3K5P A;  2XS7 A;  2IHR 1;  2VPY B;  5L9X A;  1BD6 A;  2EKY A;  2CFX A;  1V3S A;  3CD0 A;  1Q8L A;  1C1C A;  2GQQ A;  2BDP A;  1N36 F;  1T03 B;  2Q79 A;  4OYX A;  2K3I A;  4DU8 A;  2BE2 B;  2PII A;  2Q1L A;  4I0W A;  4NXN F;  1H7W A;  3C16 B;  9ATC B;  1UET A;  3FSI A;  2DXD A;  2A18 A;  4WFN Q;  4RW8 B;  2W25 A;  3RBX A;  3NAI A;  2QSW A;  3EDR B;  3W5X A;  1EP4 B;  1FWP A;  1UFK A;  4KV8 B;  1RAI B;  2HWT A;  3GFY A;  5IXU A;  2VQE F;  2Y1I A;  3OJU A;  3PRB A;  3V6H A;  3MCN A;  1T9Y A;  3TJA A;  3A13 A;  2HZC A;  2LDI A;  1YQH A;  4CT9 A;  4ELT A;  1D3W A;  1T8E A;  1L3T A;  1CUL A;  1HNI A;  1ZAX A;  3SI8 A;  1XBW A;  5DS7 A;  3TW0 A;  4RUH A;  5IM0 B;  4NLG A;  1IKV B;  3M9O B;  3KNG A;  4QWC A;  3WHI A;  3AY0 A;  2NXJ A;  2HGN A;  3NGK A;  4P6Q A;  4UOC A;  3W9H A;  4DL4 A;  3IWN C;  1S1T B;  3DN9 A;  3RR7 A;  1Z4U A;  1HNX J;  2XQC A;  1S76 D;  1TL3 B;  2AYM A;  3CB4 A;  4FNH A;  3TZZ A;  1GTH A;  4BDP A;  1U0S A;  4LR8 A;  1KON A;  1YGY A;  2F4V F;  1ZZF A;  1SCJ B;  2VKZ G;  1VRU A;  1RQ0 A;  1U09 A;  4FYV B;  1LWE B;  1YRU A;  1T7P A;  4CQ1 A;  4N77 A;  1DFD A;  3L7O A;  4B08 A;  1LW0 A;  3MUR P;  3MOZ A;  4M63 A;  2FPH X;  4AQY F;  5EWE A;  4LRC A;  5A0Y B;  2HLU A;  3BBC A;  3Q2T C;  1FKP B;  2ZH6 A;  1F6T A;  3ZZT A;  4K4U A;  3C14 A;  2E29 A;  1IJE B;  3ENQ A;  3EPI A;  3RB3 A;  4M94 A;  3M30 A;  1D9F A;  1WG5 A;  1UA0 A;  1BGX T;  1JJ4 A;  2DNQ A;  4ZLL A;  3FGV A;  4IFY B;  3RR8 A;  1PCA A;  3KOA A;  1T9U A;  4NA3 A;  3KK3 A;  3LH2 S;  4X4S A;  3BSA A;  5CZV A;  5IC6 B;  5J2N A;  4DL2 A;  2KZM A;  3V81 A;  2XB2 D;  1JJC B;  6FDR A;  3N79 A;  2P9G A;  1RLD A;  2HWI A;  1TL5 A;  1F2H A;  2KFN A;  1S4E A;  4GO7 X;  4WP3 A;  2Q66 A;  3MUM P;  2QO3 A;  4ECW A;  2FJE B;  1PC4 A;  1WC5 A;  2RUS A;  1Q4R A;  4E98 A;  1PAU B;  2DPJ A;  1DAX A;  1M5H A;  4ZVQ B;  4DF8 A;  5D0R A;  2GJI A;  3H2U B;  4F4Y A;  1WHW A;  1ARO P;  2DCU B;  1IKW B;  4J9O A;  5SUH A;  5DM6 Q;  3DDN A;  1LXJ A;  5IZH A;  3I4H X;  4RKU C;  4NA1 A;  3KJF B;  2KM8 B;  2PI4 A;  4MJK A;  1HW8 A;  4P10 A;  4A47 A;  5B0A A;  4JYA J;  4X4O A;  2CA9 A;  4RNN A;  1SH3 A;  3PW4 A;  4DV5 J;  3J81 j;  4TY8 B;  3VQS A;  2DO4 A;  2FLL A;  3HSZ A;  2NQP A;  3BGU A;  3R5D A;  4EEY A;  2YWW A;  2UVW A;  4LF5 F;  1HNZ F;  2G1D A;  2E66 A;  4EZ6 A;  4PXC A;  1KHW A;  1DLO A;  1BQM A;  4X4T A;  1YJU A;  3JS9 A;  4USM A;  3BH6 B;  1QJH A;  4CIO A;  1RTH A;  3W65 A;  3CDW A;  2RT3 A;  5E7O B;  3RB0 A;  3CED A;  1I5O B;  2CG4 A;  1NKB A;  3DCA A;  5A8R B;  3CJ2 A;  2BE7 D;  1W2B R;  5M2P A;  5KG3 A;  5IWA J;  4EFA C;  2ZBI A;  2W2O P;  4JI5 F;  1KKH A;  1XC9 A;  3F41 A;  3PX6 A;  3UVJ A;  5B0B A;  2HFS A;  3QBC A;  2R8J A;  2DJW A;  4PG4 A;  3A3P B;  2DCL A;  4DPO A;  4EBC A;  4B02 A;  1FJG F;  1WEL A;  4OZ1 A;  3GIL A;  4Y28 C;  3GJR B;  2R7U A;  4HVZ A;  2ZOF A;  2CPH A;  2Y0S D;  2QA1 A;  1Q53 A;  1WG1 A;  1HWK A;  2NXU A;  3O5T B;  1VCT A;  3OFE A;  2NUH A;  1FK9 A;  1S1W B;  2F8M A;  3L09 A;  3UDC A;  2J0Q D;  2HFZ A;  2LXF A;  4LR9 A;  2OML A;  5HP1 A;  4O44 A;  3BN4 A;  4JI4 J;  2MHE A;  3H4D A;  1S77 D;  3SCK E;  2VU5 A;  4DFJ A;  2XLK A;  1M90 T;  3J7Z T;  2C2Z B;  2OH2 A;  3TVK A;  5DDR C;  1MML A;  5KFO A;  3MEG B;  5E3C A;  2CNL B;  2FGO A;  3THV A;  2DEJ A;  3MFH A;  4PYA A;  4A8S A;  5DGA A;  3QRP A;  4C8N A;  1GMV A;  1CEZ A;  2C28 A;  2NPI A;  4IR9 A;  4NLV A;  2ZNZ A;  3DLK A;  1RDR A;  4ICL A;  2NLW A;  3OL8 A;  1T02 A;  5LJ3 Y;  2LCW A;  2BAC A;  4NXM J;  4CH0 S;  2W4C A;  4P73 A;  4KHP F;  2BEF A;  4L72 B;  3BR8 A;  1YLX A;  1QAJ A;  2DD8 S;  4IKA A;  4TQR A;  2OHD A;  4J9N A;  3GCW P;  4DPX A;  3A1Y G;  4QIW D;  2YKN B;  5JXS A;  3P6Y C;  1W26 A;  5E0O A;  3MCO A;  1G2E A;  2I9S A;  4WTY A;  3GIJ A;  3G6E S;  4DV4 J;  5DQH A;  1PC5 A;  3HO1 A;  1JLG B;  2M4M A;  2F5G A;  2KKH A;  2H3E B;  2HLT A;  2XNQ A;  5JUM A;  1P27 B;  3N4W A;  3HSJ A;  5K9F A;  1IN0 A;  4ZCK A;  2AGQ A;  3V6K A;  3T41 A;  2AZ3 A;  4IDK B;  1TUV A;  4DUZ F;  2YPY A;  2FLO A;  4NLT A;  2V8V A;  4DG1 B;  1X4B A;  4L75 A;  2UZA A;  2B3T B;  4QWA A;  1U8W A;  3WX4 A;  4I4B A;  4QR0 A;  2F3J A;  3ZFV A;  3NNH A;  2YWK A;  1YDL A;  1RWX B;  2CXE A;  3LOU A;  2MB0 B;  3I32 A;  3TZY A;  1S6O A;  1R31 A;  2UXB J;  1CJK A;  2BQ3 A;  3IR7 B;  1M5P C;  4C98 A;  4Q0B B;  1HI1 A;  1NDC A;  1KFS A;  5I4M A;  4LIW A;  2CQC A;  1BQX A;  1LW2 B;  5KFI A;  2V2K A;  3H7H B;  1NSP A;  1Y4Z B;  2MQP A;  2RJZ A;  4WFA Q;  3CUL A;  4DN0 A;  1DTT B;  2OP5 A;  5C42 A;  1M1H A;  2VF3 A;  4J9M A;  4OX6 A;  2P9E A;  4OI6 A;  2BJ1 A;  4ZK7 M;  4DZ6 A;  2BOP A;  2J7W A;  3H90 A;  4P71 A;  5L46 A;  3OFF A;  1F0X A;  4LQ3 A;  3DM2 A;  2XSF A;  1NSA A;  1S0N A;  2ZHB A;  4KGX B;  2FC9 A;  1SJ3 P;  1CJU B;  3UPF A;  1QAI A;  2F40 A;  1TP7 A;  2DBB A;  5F0W A;  4ECZ A;  4K2X A;  4Q5V A;  4OYW A;  4DI6 A;  4HR2 A;  2MHN A;  4DV1 J;  2XSJ A;  2YNI B;  3IS9 A;  2Z30 B;  2XCA A;  3MMC B;  1MN7 A;  1W25 A;  3CDB A;  1W2I A;  3C46 A;  4ZDN A;  3HJV A;  3TZX A;  1IJF B;  1UWB A;  5THW A;  1SL2 A;  1YKW A;  5KFA A;  2W1B A;  3PRV A;  1HBM B;  5LMU J;  1D09 B;  3OSN A;  1M1K T;  1RZM A;  3TAM A;  3GYG A;  4ECT A;  3ZZ0 A;  4OZ3 A;  1RHJ B;  5J1P A;  1F3F A;  3JAM Y;  3TUI C;  3R8Y A;  5CD4 H;  1F5A A;  3VGS A;  3SDE A;  4N41 A;  3GWC A;  2KDO A;  4Y2I A;  2V4J A;  2MZR A;  4YY3 F;  4WE1 A;  2AU0 A;  2JZ5 A;  2RAQ A;  4F3M A;  5LJ5 Y;  2W9C A;  1WD6 A;  2PA3 A;  3W2V B;  3THT A;  3DOM B;  2RHQ B;  5E3A A;  4GVB B;  1OIA A;  2HHQ A;  4ED0 A;  3LP2 B;  5E2Q A;  5HAN A;  3RG6 A;  4FXV A;  3M8Z A;  1TAQ A;  1FER A;  4XTT A;  1YSJ A;  5D15 A;  4DFP A;  1WDT A;  1NJZ A;  3GTY X;  2HVI A;  4YN3 B;  2BJ8 A;  3BKF A;  5D8H B;  1NDL A;  4J9V A;  4NLD A;  1WI8 A;  3PY8 A;  2KFZ A;  1SJ4 P;  2PO4 A;  2IRX A;  3DFE A;  1Q78 A;  1QUV A;  2B4O A;  3Q23 A;  1HBO B;  3D5M A;  3CUN A;  2EK6 A;  3B82 A;  1B4S A;  1BHN A;  4Y2C A;  2KXH A;  4OYI A;  4C3K A;  3OR2 B;  1RBO B;  5I3U A;  4WXO A;  2DRA A;  2LU2 A;  3SFG A;  4J9R A;  4OYA A;  1BQN A;  4N56 A;  3RRK A;  1IUJ A;  1IR1 A;  2QTW A;  5KFN A;  1O51 A;  1TMJ A;  1YJR A;  2BW2 A;  2CNN B;  2L9D A;  3ZZO A;  3BKU A;  3QO9 A;  4JI1 F;  1NLK L;  4MYT A;  4ER8 A;  3G8T A;  2UV8 G;  5F8M A;  4QU6 A;  2GAH C;  2CJQ A;  2RD5 C;  1X4C A;  2NSB A;  2QV6 A;  4I64 A;  1JKH B;  3I0S A;  2FC8 A;  4KPY A;  3QLH B;  1SH2 A;  3ISZ A;  4IFV A;  1GX5 A;  4R5P A;  3DXS X;  2HHU A;  2DVI A;  3O3L A;  2UV8 A;  4OHZ A;  1MW7 A;  4PAA A;  4ZP7 A;  2E7X A;  3HHK A;  1FJC A;  2QFJ A;  2KB2 A;  3GIK A;  3EGN A;  3C15 B;  4DR1 J;  3IR6 B;  1B7F A;  3ETO A;  5B0D A;  4YHH F;  3T5K A;  5JMN A;  3W9I A;  2W9B B;  4XDC A;  4G1I A;  1YX2 A;  3QWU A;  5B0C A;  1RWK B;  3T1H J;  1RCX B;  2AJ1 A;  4C97 A;  2FJB B;  5CH7 B;  3OVB A;  4MMO A;  2HBY B;  3CXC R;  3W2W B;  5ETV A;  4ZVT B;  1R89 A;  2UU9 F;  1RAF B;  2BUN A;  2R42 A;  1TL1 B;  3Q0A A;  3FEY B;  3DRR B;  4FS1 A;  2LEP A;  2VA2 A;  3GYX B;  3QMQ A;  4HTJ A;  1YVF A;  4HDG A;  4W4M A;  2V2Z A;  3SXL A;  1EP4 A;  1FDN A;  3K89 A;  5DG8 A;  1UFL A;  2OEJ A;  4HAC A;  2ZOG A;  4B3S F;  1J2V A;  4JI8 F;  4OYM A;  2LXI A;  2ROE A;  2GC8 A;  3PYF A;  3TX8 A;  4NLU A;  2KM8 C;  2VIC A;  3SYZ A;  1O5J A;  1EET B;  2EK1 A;  4AXJ A;  4ED8 A;  5B0G A;  1JLC B;  2DTJ A;  3ITH B;  1VBY A;  4ALZ A;  1IQT A;  4PUO A;  1QE1 A;  1S6P A;  5CAB A;  2V8D A;  1RTD A;  4ETX A;  2XMV A;  2AMC B;  3KLI B;  4Z7C A;  4YDX A;  4X65 J;  3LF0 A;  5KFC A;  1TL3 A;  1S1X A;  3W63 A;  2KO1 A;  3AD7 C;  3M8W A;  2V34 A;  2UVV A;  2JEG A;  1PAE X;  1UZH A;  1P9Q C;  4MFB B;  3KLV A;  2GIR A;  4DR7 F;  3NGS A;  2HGL A;  2K3K A;  2DNL A;  3L7P A;  4X62 J;  1JQG A;  4O3S A;  1H73 A;  4FBU A;  2MY8 A;  3K58 A;  3ZZP A;  4JBC A;  2IY5 B;  3D4J A;  4CCH A;  1JNR B;  2VV5 A;  3GG0 A;  3Q86 A;  4OI2 A;  1T9V A;  4HT5 A;  4CI0 B;  1M5S A;  1GK8 A;  1S79 A;  1PJ5 A;  3CJ8 A;  3DU5 A;  2AJ0 A;  3NY0 A;  1FKP A;  4DJB A;  4D3G A;  2DGW A;  1BWE A;  3D2W A;  3IFE A;  3VTI A;  3KG0 A;  1FRJ A;  3OR1 B;  4OX7 A;  3PX0 A;  4Y2M A;  2X7I A;  4Q45 A;  3CCQ S;  1U1Q A;  3B8H A;  2Y8W A;  2O1P A;  3AOD A;  2A0F B;  3CF5 Q;  5L8R C;  2ALY B;  1X4F A;  4FYW B;  1CJV B;  3GLJ A;  4QW9 A;  3NRB A;  4UT4 A;  2A2D A;  3ISN C;  2ILZ A;  3DU6 A;  3FBE A;  1S10 A;  4FVM A;  3OL9 A;  1X5O A;  3FEZ A;  3BR9 A;  3V6D B;  2HZV A;  4LFC F;  1BUX A;  4FF4 A;  1UKU A;  1S1U A;  1KS2 A;  3I6P A;  3RAM A;  2J0S D;  3UFC X;  5KG2 A;  3MM9 B;  4DSK A;  1YRT A;  3AHP A;  2YNH A;  2XMW A;  1VRT A;  2ZBR A;  2ASY A;  2B6A B;  5HN0 A;  2MJN A;  2FY8 A;  1X8D A;  3U1M A;  4CO0 A;  3SMZ A;  4PWD B;  3P8B B;  4U67 Q;  3DNC A;  3MR2 A;  5BYS A;  3P3D A;  4DSI A;  1SJ1 A;  2KT5 A;  3N6L A;  2Z8Q A;  3KMQ A;  1EAY C;  3RZA A;  1M5K C;  1XMO F;  3CC4 S;  3NLC A;  3QJP A;  5F9N A;  1VS3 A;  2J6S A;  3OUY B;  1RTJ A;  1S97 A;  3K2Y A;  5J2Q A;  2VFU A;  5HVH A;  3M9M B;  3Q8V A;  1TKT A;  4UF4 A;  2JLF A;  1FT8 A;  1WNE A;  3LAN A;  1H74 A;  2DNY A;  3J80 U;  3VR1 A;  4F36 A;  1U1O A;  2AW0 A;  2HRT A;  2UUC F;  1RT4 A;  2IBO A;  4NEZ A;  3CCS S;  5CCM A;  4K0K F;  1HI0 P;  3MHY A;  2V94 A;  4DV3 J;  4CO4 A;  3DYA B;  3PTW A;  3SQG B;  3T1Y J;  1VQ8 S;  3CIM A;  2Z2Z A;  2ZH8 A;  2COL A;  1VQS A;  1N5Y A;  4H4O B;  3Q89 A;  5HQL A;  4EBD A;  5KFB A;  2GIF A;  1WTB A;  2DGS A;  3ET6 B;  3ISN D;  3UNY A;  2VOP A;  1T9W A;  1KFD A;  1KOO A;  3QRR A;  2GGP B;  2CJA A;  2W2Q P;  1TKX B;  1ZET A;  2R7O A;  1H2T Z;  2EW9 A;  2D69 A;  1R7I A;  2JEJ A;  4TXS A;  1BLU A;  2LEC A;  3UD4 P;  4RR5 A;  2QL5 B;  2N82 B;  5D4N A;  2ZVS A;  1ZM2 A;  3GP9 A;  4UZC A;  2OD4 A;  2HK2 A;  3KK2 A;  1LWF B;  3JTP A;  3RYL A;  2GX8 A;  1TKD A;  2H48 B;  2C3P A;  1JLF A;  3KDO A;  3LP1 A;  2M2B A;  2YNF A;  2QL7 B;  2ZE2 A;  1R8H A;  3N0V A;  3OPK A;  4ZLN A;  4YME A;  1VGY A;  4LF7 F;  4YOE A;  1I94 J;  3OTB A;  1SKS A;  1V3Z A;  2DB1 A;  4MKA A;  1NME B;  3B78 A;  4KTQ A;  2BOA A;  4DV6 J;  3HT3 A;  3N6M A;  2QL9 B;  3QAT A;  1AXQ A;  1UTA A;  1VHI A;  1H6K X;  2E7W A;  2MZJ A;  1KVK A;  3BJY A;  2PSZ A;  3R9L A;  1JLQ A;  4LF9 F;  1RT6 A;  4RBV A;  1RT3 A;  4ANE A;  2ZZM A;  1MRO A;  5K8O A;  4BC7 A;  1X4H A;  1I6J A;  2ZZT A;  1HMV B;  1HR0 F;  4LF8 F;  3W60 A;  5DQG A;  5I42 A;  1PYT A;  5FDL B;  4ELV A;  2IAJ B;  4ED1 A;  4AND A;  1NZ8 A;  4P2S A;  2PEB A;  2AEM A;  1IKX B;  4C8O A;  2G9O A;  2JVR A;  2YXL A;  4RW7 B;  3M8R A;  5J2P B;  1S9E A;  2QFI A;  1FX2 A;  5K8N A;  1S9F A;  2BKN A;  3JSY A;  2A1B A;  1KLN A;  3T5H A;  3I0R B;  3OHA A;  4RW9 B;  4U7C A;  4K4Z A;  4QPT A;  4CNY A;  4WTO B;  3PR4 A;  1R43 A;  5CHC B;  2O66 A;  4P72 A;  3KFW X;  2OFG X;  4BWJ A;  1RCO B;  4TN2 A;  1JLA A;  3MM8 A;  4ZPA A;  2A2C A;  3DLG B;  2J76 E;  2CQP A;  3T9Z A;  4ZCM A;  8AT1 B;  5F9L A;  4ERD A;  1XK8 A;  3NL0 A;  1RHQ B;  4E8U A;  4LUB A;  3R6G B;  4C0H A;  3TAQ A;  2H54 B;  2KXF A;  1R8B A;  1XQI A;  3AFG A;  4Q0B A;  5KFL A;  1HHQ A;  2XYH B;  3RGI A;  2MKS A;  4DSE A;  3TYT A;  1V5I B;  3GII A;  2FZG B;  3HPO A;  3QJL A;  3AA9 A;  3T5L A;  4C4W A;  3H5S A;  2CPX A;  4QQB A;  4PG5 A;  4B17 A;  3MFI A;  1RWW B;  1IKY A;  2EFP A;  3GR0 A;  4OHW A;  1SL0 A;  1KTQ A;  2RDI A;  3BN7 A;  1YJ7 A;  4B9N A;  2QT7 A;  2QG9 B;  3WIU A;  5C2C A;  2CPF A;  1FCA A;  4DMZ A;  3AJ1 A;  1AT1 B;  2JJ4 D;  2HFO A;  3D68 A;  2P6T A;  4G1Q A;  2ZFH A;  3VZI A;  2YKM B;  4DV5 F;  4ED6 A;  2OPR B;  5F8J A;  1MWQ A;  1AUS L;  4CO1 A;  4IOC Q;  4PXE A;  5A8W B;  1UZD A;  3GV5 B;  2CZ4 A;  2XY5 A;  3G86 A;  4YP3 A;  1KP6 A;  4ID5 A;  4B9L A;  2MQM A;  1J5E F;  4WYL A;  3HDS A;  4RBT A;  1SXL A;  1Q5Y A;  2B43 A;  4DV7 J;  2HMI B;  3QT7 A;  1S12 A;  1CC7 A;  2WCX A;  1P9Y A;  1CG2 A;  3WIV A;  4ECU A;  2WSC C;  2RQK A;  4DV0 F;  2VC0 A;  4KQZ A;  3MM6 B;  1Q95 G;  4N5S A;  1P1L A;  3TP2 A;  5K14 A;  1GAO A;  2IC3 B;  2Y0B B;  2BRK A;  5L1K A;  3JQM A;  4J9P A;  3DRS A;  4XPE A;  2XY6 A;  5CAA A;  3BZQ A;  2G0C A;  4QBU A;  2HHS A;  3H20 A;  2VON A;  4X4Q A;  4ES2 A;  1AYE A;  2ASJ A;  1TK8 A;  1WOP A;  4L3N A;  3SCL E;  2XUL A;  2CVI A;  2HKE A;  4PZV A;  3J7A N;  4HH0 A;  3KUG A;  2BVZ A;  3GZ7 A;  3QPI A;  4U9R A;  4YS2 A;  4M1K A;  1HNV A;  1FWK A;  3ZTR A;  4MAK A;  2GAG C;  1Q8I A;  2RS2 A;  4M5J A;  2V2Q A;  2DNP A;  4QZV B;  3G96 A;  2RIL A;  1ULR A;  1S1V B;  4G1P A;  1NKC A;  2QN6 B;  2XCP A;  4J91 A;  3CJK A;  3OR2 A;  1VQL S;  4WK3 A;  3UI3 A;  4DV2 J;  2MQ8 A;  2N7Y A;  2Y8Y A;  1RK8 A;  2HRU A;  3H5U A;  3ZTP A;  1C4A A;  2KU7 A;  1TK5 A;  1QM9 A;  3IBF B;  2WON B;  1XNR J;  5LT5 A;  1DTQ B;  5B0F A;  3VGT A;  3MDF A;  2BM0 A;  4NXM F;  4F4A A;  3ULH A;  1QSL A;  3BGR A;  4NYZ A;  4A8W A;  1K1Q A;  4F4Z A;  1FRH A;  2GVD B;  1Z2Z A;  4RBU A;  1KLM B;  2V9K A;  5HBM B;  4USH A;  5BR8 J;  5KT7 A;  2ASD A;  2OEL A;  3NWR A;  1TR0 A;  3M1V B;  1C0T B;  4DF4 A;  4URG A;  2MLY A;  5KFH A;  3W5Y A;  5KFK A;  2FHK A;  1V9O A;  3DHX A;  4KSE B;  2OAU A;  2DR6 A;  3BGL A;  2H9Z A;  2F4F A;  4J9S A;  2VC1 A;  4I2P A;  1U0H B;  4CTA A;  1TUG B;  5KFP A;  1U6B A;  3MOJ B;  2YQ3 A;  3FSY A;  2JL9 A;  3MPW A;  1HYS A;  1NEE A;  4CLW A;  4LRF A;  1G3O A;  1SV5 A;  2VFT A;  1QUP A;  2MSS A;  3FUY A;  3GJS B;  2DR7 A;  3HVW A;  4RNM A;  2D41 A;  3W2W A;  4L6V 3;  1X4A A;  5CZX A;  4HLB A;  2QLJ B;  2DNO A;  3PKY A;  5KFM A;  4A8Y A;  2XWY A;  1PO6 A;  4OV1 A;  1N32 F;  2P5V A;  1T05 B;  3N5F A;  2BYC A;  5D77 A;  2DGT A;  4DCO B;  2OKQ A;  1D1U A;  4QCL A;  3HFK A;  5LSR A;  3OVS A;  4DUY J;  2K06 A;  4LF6 J;  3UCG A;  3MXH P;  5EN1 A;  3BBB A;  2WHO A;  4LSN A;  3ITH A;  2CQ4 A;  3PXG a;  1ZYQ A;  2VH7 A;  4PKD B;  4KE5 A;  2CPY A;  4URS A;  2QA4 S;  2RKI A;  3CCU S;  4C3L A;  2XHC A;  2YNG B;  3W8G A;  2LXU A;  4KYZ A;  2R9L A;  3PJ9 A;  4NLX A;  3KLI A;  1JLB B;  1FX4 A;  3A8I A;  1XNQ J;  1L5U A;  4P75 A;  2OPP B;  1RXO B;  5F8L A;  4F26 A;  4OZ0 A;  4WBF A;  5DQI A;  4C8Z A;  1FNO A;  2QGF B;  1XMQ J;  3IGV A;  4DR3 F;  3CDA A;  4AUK A;  1HQU B;  3KG1 A;  3IG1 B;  1RSC A;  1S72 S;  2DIV A;  2PD1 A;  4LBP A;  2W4P A;  4DLG A;  2HW3 A;  3IM8 A;  5CYM A;  1LV5 A;  1JB0 C;  4I6W A;  1VQY A;  2BJ9 A;  4B3T J;  4K4T A;  5B08 A;  2EBG A;  4L76 A;  1T94 A;  5HMX A;  2YWE A;  3ICL A;  4P52 A;  4I56 A;  2XI2 A;  4ECV A;  3M8P B;  3RW7 A;  2AJF E;  4EGL A;  4DSL A;  2GMH A;  2NSC A;  3CCJ S;  1HPZ B;  2L41 A;  5A76 A;  1VRQ C;  1Y5I B;  1MU2 B;  3ILJ A;  3FDS A;  1JLE A;  3PV8 A;  1F3V A;  4DDF A;  2MZQ A;  1CQN A;  3DOK A;  1B70 B;  2I38 A;  1GH8 A;  1N6Q A;  2OEM A;  1I3O B;  1TL4 A;  4KAI A;  3PW7 A;  3DLB A;  1LWC B;  2WBR A;  4JI7 J;  3T6B A;  4A8K A;  3I5B A;  1DBD A;  3D1O A;  1IBK J;  5MAO A;  2Z57 B;  4RWW A;  1GMW A;  5AE2 A;  2Z2Y B;  3MM9 A;  5HJY A;  1RWP B;  1A0O B;  2VKR A;  4X4V A;  5GMK a;  3L4B C;  1CS4 B;  1C1B A;  4ZP9 A;  2VG5 A;  2C3M A;  3HUL A;  3BPD A;  1NDK A;  2ASL A;  3AXM A;  1EAR A;  2YX4 A;  4EMD A;  3OTO J;  2QLF B;  2PEH A;  3CC7 S;  3OFH A;  2LEA A;  2ZH3 A;  2AV5 A;  5C24 A;  2ZZN A;  4KH1 B;  3TUZ C;  2JFD A;  2FJA B;  3D54 A;  2ZUA A;  3MEC A;  4NPO A;  2HHH F;  4DL5 A;  3N6N A;  4K8R A;  1QDU B;  4OI3 A;  4QJV A;  4BC9 A;  3KLH A;  2G2Y A;  3KLE B;  3UN2 A;  1SC6 A;  4Y0F A;  3VAI A;  3EJM A;  1VIX A;  1CQM A;  2V5H G;  2B7B B;  1UJ6 A;  4B3O A;  1RT7 A;  4JV1 A;  4WJB A;  3DMJ B;  3G6X A;  4LIR A;  4ZA1 A;  3C3L A;  2ROP A;  5D3G B;  4CLZ A;  3PJW A;  1TK0 A;  1JXE A;  1VK8 A;  5CXT A;  2Y3Y A;  4B3R J;  4RW6 A;  1LFW A;  1OY8 A;  2BM1 A;  2BV3 A;  1KQF B;  2LFV A;  2U2F A;  3IBC B;  1IBL J;  4PQA A;  3MM5 B;  2MKJ A;  4OYP A;  5DLG A;  3PDN A;  1URR A;  1MMN A;  3HVR A;  1H38 A;  3G2X A;  4UQG A;  2RSQ A;  3NAH A;  1XN9 A;  2IFX A;  5GAG I;  5D4P A;  3DOL B;  3I96 A;  4MYU A;  2DNN A;  4WPA A;  3GYN A;  4QW8 A;  1NSK L;  3NMA A;  4OLP A;  2WRM A;  2OIH A;  2BZ2 A;  4UOG A;  3UR3 C;  2W9A A;  4NE9 C;  4O3O A;  3IWX A;  3D9B A;  5ADZ A;  1VC5 A;  4F7V A;  5KFQ A;  1T3N A;  4WP8 A;  3TEG A;  4LQ9 A;  3D28 A;  1U25 A;  1FES A;  5KT2 A;  1YJ9 S;  2XO7 A;  5K20 B;  1NK0 A;  1RB0 A;  2Q6B A;  4N7T A;  2NZC A;  2W8L A;  1S6Q B;  3IR5 B;  3NXZ A;  2V67 A;  4IH6 A;  3UDE A;  4RNH A;  1S0V A;  1NO8 A;  3MD3 A;  4IG0 B;  3POT B;  3L3C A;  2PMH A;  1X60 A;  3GJT B;  3FK4 A;  3UDV A;  4DR2 J;  1U1R A;  2LU1 A;  3QWP A;  1IXK A;  2VD3 A;  4KO0 B;  3EYZ A;  1VQN S;  1NND A;  5KFG A;  4X4P A;  3D0I E;  4EI2 A;  3P49 B;  1E6V B;  5A8K B;  1HBU A;  1MWY A;  1Q86 T;  4DCJ B;  1GQE A;  2FTR A;  3GV8 B;  1KTV A;  4W90 B;  4X62 F;  3GQC A;  3OQ2 A;  3EIC A;  1RWV B;  4IRC A;  1RAO A;  2VPX B;  1UMJ A;  3MMA A;  2M8D B;  2R8H A;  5FDL A;  1TFW A;  1S9G A;  5G0R B;  3R5A A;  1YJN S;  3QT5 A;  1LFP A;  5KFX A;  5AJ3 J;  4LRA A;  4UW2 A;  1IKX A;  5ETP A;  5EX3 A;  5J2P A;  2GVZ A;  1X7V A;  3TEH B;  2C1E B;  4RX6 A;  4P7V A;  1S6U A;  1WOR A;  3PM9 A;  3QGP A;  5M2R A;  1FXL A;  2R7Q A;  2I6W A;  1FEH A;  4HH1 A;  2P9C A;  2ZH4 A;  3PW0 A;  4RW4 A;  4ZVR B;  1SBR A;  4NCG A;  4LFB J;  2HIY A;  3DRY A;  5T7L B;  3JSM A;  2N3L A;  3MUV P;  4N8O A;  3PCO B;  5LL6 d;  1TVR A;  3FCW A;  2AQ4 A;  4ZHR A;  4YR0 A;  3QIP A;  4DXL A;  1ELO A;  3CJT A;  2RNE A;  1VLO A;  2ZVI A;  1CJT B; 
#chains in the Genus database with same CATH homology
 2W2N P;  1R6V A;  4NE9 C;  3A3O B;  3GCX P;  4YN3 B;  2Z30 B;  3VV2 B;  3QFH A;  3WIU A;  3CO0 P;  2ZWO A;  2W2P P;  2W2O P;  3CNQ P;  1ITP A;  4JP8 A;  3T41 A;  3AFG A;  1SCJ B;  2ZWP A;  2Z57 B;  3WIV A;  3GCW P;  2Z2Z A;  2E1P A;  3VHQ A;  2W2M P;  4NMX A;  3BPS P;  2QTW A;  3H42 A;  2Z56 B;  2PMW A;  3A3N B;  4OV6 A;  3WHI A;  2W2Q P;  3A3P B;  2Z2Y B;  3P5B P;  1V5I B;  4K8R A;  1SPB P;  3BGO P;  3SQO P;  2XTJ P;  2Z58 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...