4QIVA

Crystal structure of hexameric microcomparment shell protein from aeromonas hydrophila
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
86
structure length
86
Chain Sequence
DALGLIETKGLVACIEAADAMCKAANVELIGYENVGSGLVTAMVKGDVGAVKAAVDSGVESAQRIGEVVTSLVIARPHNDISKIVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Bacterial microcompartments family protein
publication title Crystal structure of a hexameric microcomparment protein from Aeromonas hydrophila
rcsb
source organism Aeromonas hydrophila subsp. hydrophila
total genus 23
structure length 86
sequence length 86
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00936 BMC BMC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1710 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4qivA00
3DNCA 3I96A 3NGKA 3N79A 4QIFA 3SSQA 5DJBA 4RBUA 4QIGA 3MPWA 4P2SA 4RBTA 4P7VA 4RBVA 3I6PA 2G13A 4OX7A 3CIMA 3DN9A 5L38A 3NWGA 4P7TA 3BN4A 2A1BA 3IA0A 4QIVA 2A10A 3MPYA 4OLPA 3PACA 2A18A 4OLOA 4PPDA 3SSRA 2EWHA 4AXIA 3H8YA 3CGIA 3SSSA 3VCDA 4DDFA 4QIEA 4AXJA 4OX8A 4LIWA 4OX6A
chains in the Genus database with same CATH superfamily
5L9XA 2R8GA 2FJBB 4P73A 2DNHA 3E2EA 4RUBA 5DZ7A 4PEOA 1F9HA 3OHAA 1D09B 1GX5A 2MKHA 2MZRA 1EHWA 2YNFA 5D4PA 1V3RA 2D3UA 1IWAA 1DJ0A 3V81B 4DPUA 3GJQB 2HZAA 2A3JA 3JQMA 2RMLA 4M5NA 1WWHA 3RU0A 4CLKA 1GXLA 4TU8A 3M1VB 2K06A 2ZJPQ 2HNDA 2AYEA 3CJSA 2ZVIA 3UW1A 4ZN1A 3MR7A 3VAJA 1G6BA 2ZH4A 2IVFB 1FKPA 2VG5B 3DOKA 3NS7B 3RBXA 5EGYA 5KG5A 4ZVEA 3MAAA 2DT9A 3M2RA 3S8SA 2CKWA 3D5MA 2GS8A 4ZVFA 3C16A 2YKQA 1Q8BA 4OI4A 2RF2B 4PG6A 2RNEA 4ZVPB 4LMZA 2VIHA 3A1YG 3SIPB 3A8EA 2GMJA 4MIBA 1I3OB 4WPAA 3NS5A 4DR5F 4NLGA 4D3HA 1EX8A 3ISNC 3BGRA 4M5GA 4A8MP 2DPJA 1RBLA 2JH3A 4IQXA 2XNRA 5KFNA 2ZM6F 3K8WA 2IYIA 4X4TA 1ITPA 1RDRA 2OPRA 5LMUJ 3BGOP 3TX0A 1SUQB 4YDDB 2FGOA 3DLLQ 2LKZA 1UW4A 4JI4J 2YKMA 3NCPA 3MMCB 1UVIA 1A7GE 4ES1A 2VD3A 4IG0A 1T9TA 2DY9A 3CCRS 2XHCA 4NYOA 1NK0A 2XTJP 4K59A 4OZ5A 4ZLLA 3UD5A 3PRBA 2UVUA 4QWBA 5J2NB 1U1OA 1FRMA 3G2XA 3MTJA 3MCSA 5GAHU 2AJ4A 5I3UB 1X4DA 3M30B 2G9OA 4TXSA 4CLWA 1WC0A 3V6DA 3IR6B 4PQUA 1F2GA 3BBFA 3R5AA 3QPIA 1X4FA 2WVBA 4OZ2A 2C3YA 2VG6B 1DTTB 3QJPA 4MYUA 3KHHA 3K0JA 1Z1ZA 3K58A 1RWPB 3GILA 1CJKA 3QJJA 2NREA 2MLZA 4DF8A 2VFUA 1S99A 2M3DA 3PO5A 4XDCA 4RW8A 3OBIA 2LDIA 3M8PB 4EBDA 2CQDA 1TL3A 5IV3A 4A8YA 2Z2LA 3P49B 3IO1A 2UXCJ 5GAEI 1AA1B 3O6QA 1PILA 2L3MA 2Y0BB 3ILJA 4MKAA 4PXDA 4K50A 2W9BB 3CCSS 3G8TA 1PC5A 1LWFA 4PYDA 3DLEA 3BH7B 4DCPB 1RTJB 3DOMB 4M5HA 5GAGU 1FNMA 1T8EA 2DNPA 2GGPA 5HATA 4WF9Q 1DHMA 4N41A 4I0WA 3HVTB 5AXMA 1B64A 1ZETA 2HLUA 2HFZA 2Z2ZA 3HZEA 3D0GE 3MPYA 1Q7YT 3IGNA 4NI2A 1MMLA 2OPPA 2FY1A 3NGKA 3MMJA 1VMBA 4ZN3A 2AYGA 1S1XA 1ZAVA 1RT1B 2JHEA 1HHQA 2M7SA 2Y8WA 3CC2S 1WD6A 3K5MA 1IKWA 1TKXA 2HS3A 3A3NB 2RU9A 3AA9A 2IJFA 1PG5B 1FKOA 3IG1B 1Y5IB 4P71A 2CNNB 4LSLB 1YRTA 3GE9A 1E6YA 1YG0A 4ELVA 3K2YA 3T9ZA 2R8JA 4QU7A 1KOHA 5CYMB 1U4BA 2PMHA 2YX4A 4LSNA 4LF5F 3TA0A 3ZTQA 2XS5A 4KHPF 2R7OA 1S6OA 2VBYA 2AZ1A 4F26A 3EXCX 1A6LA 5EN1A 3R7BB 3KLFA 1N48A 2FLPA 3ZNUA 2CZ4A 3CC4S 1ZBTA 2OFHX 4JP8A 4K4ZA 3RBEA 4O3NA 1VC6A 3H2UB 3VAFA 1N5SA 4B9UA 2DRDA 2HQ3A 3N28A 4CO0A 1AFJA 3HHEA 1YJVA 4OYBA 3HP6A 1PSDA 4IOBA 2VASA 3LAKA 2KZZA 2VZ9A 3TQEA 2HMIB 3SDEB 4ZCKA 3PKYA 3FRZA 2MKYA 4YR3A 3AB2B 3MD1A 3ZTPA 3BSCA 1VHIA 5IOLA 3BO2A 1DLOA 2GIFA 4P9SA 2UXDJ 5FDLB 4LREA 4GC7A 4OHXA 2ZUAA 2G2YA 2XZTB 4ZVGA 4LVOP 5IS2A 4Y3CA 2E44A 1M5KC 1RHMB 1EZZB 4OI6A 3O1LA 1SV5A 4ED2A 2MKKA 2WB1D 3EM1A 3AFGA 5HLFB 4Y2IA 3PYGA 4F4KA 2JLGA 3IR5B 1IKXB 3JSMA 2HHVA 2MQQA 4P74A 1VQ5S 2IVMA 1VGYA 4X62F 4NCBA 1TV6B 4FXWA 4CZCA 1PYTA 2EBGA 5KFAA 3GQCA 2HZVA 3KJVB 5LMNF 2W2OP 2V4RA 5F8GA 2DGTA 5D6GA 2I0XA 1UZHA 2GHPA 1LOUA 4HI1A 3GIJA 4PKDB 2JEJA 3OTEA 1QE1A 1HYSA 1S9FA 3AJ1A 1NJYA 2EEYA 3IAM9 2ZDOA 3SEOA 4C11A 2D3OR 3DRSA 3QMQA 4JI7J 4P10A 4A8SA 1VC0A 2I2YA 3ZNJ1 2WVCA 4M5KA 4LFCF 4JI1F 2VKZG 3IBWA 5F0WA 2PFDA 4DBQA 2KT2A 1GMUA 4DXLA 2HHQA 3QSYB 4RW9B 5I4MA 1Q8LA 2KVIA 5B09A 1UA1A 4DV5J 5KOWA 2FHKA 2Y1RI 4DV6J 1MLAA 2F4FA 2E7VA 4NOHA 1TZ0A 3BYRA 2DXFA 2ZWPA 5C24A 1D9AA 2KZMA 3AODA 1S1WA 4ZVSB 2DHSA 1SL0A 3ENQA 3FZBA 3JSBA 1HQUB 4A8WA 3K5LA 2E5IA 4CH7A 5KFDA 4LSZB 2CPDA 2YNFB 4LF2A 2OD4A 1SKRA 2Q43A 2HW3A 2EPIA 2K3IA 4OZ0A 5K8NA 1KWMA 1ROFA 3W63A 4TQSA 2HFSA 4CNZA 4OJHA 4WIIA 3FFIB 4MK9A 2UZAA 1V5VA 8RUCA 5HI7A 2HQIA 4QR0A 3GV7B 1NEEA 4OYMA 1ZAXA 3J7ZT 3P5BP 2FY8A 2KRRA 5A2QY 2N82B 3LTOA 3POTA 2HNDB 1PAEX 5L39A 5I3QA 1IXKA 4KH0B 5K9FA 3OVSA 2VBWA 1FKPB 3CNQP 2CAJA 4DR4J 3NGRA 3ENWA 4ED3A 3M2RB 4EBEA 2ATCB 4A46A 2H4YB 1JKHA 1S1UA 5LJ3Y 4H4MA 2XLKA 3RAXA 1XERA 4K8RA 2DCUB 3DU5A 3W61A 2LU1A 1N56A 3NL0A 5D78A 3AHPA 1FNOA 3D7SB 3FKBA 2BVZA 1R0CB 2ZWOA 4TKTA 3MOZA 4N8NA 1QUVA 3CDUA 5LXYA 3BGRB 2ZHAA 2HVZA 4V1Ak 1T9XA 4DSFA 5J1EA 3DRPB 3TZWA 3D3CJ 3MECA 4TVAB 3LP0A 1X5TA 1IBCB 1PJ6A 2YWEA 2MQMA 2OPRB 4DOZA 3ELHA 3EGZA 2VPXB 2AGOA 1KRPA 4URGA 1Q78A 1RAHB 5CD4H 2A18A 1O51A 2J6SA 2HQGA 3I4PA 2V4JA 2DGWA 2VDIA 1VRUA 2YKMB 3TANA 3S6EA 3HKZD 4OV1A 1W2IA 5HVFA 2J0QD 2D69A 1NDLA 3B54A 2N3LA 2KXNB 4JI8F 2DEIA 4J9NA 1X9MA 5B7WA 1HLWA 1JB0C 2NXCA 3ISZA 1AXQA 3QGIA 2WRMA 4CLUA 3PCOB 2DGVA 1DY3A 1SJFA 4F4WA 5KFIA 5HJXA 1QAYA 3AXKA 4FVCA 2DH9A 2R2SA 1SI9A 5AE2A 1F1BB 4DX7A 5CHCB 3TWZA 4QIFA 3TYTA 4CO4A 4IRCA 4W98A 4ZP6A 1VK8A 4KHRA 3TZZA 5AJ3F 5BXIA 1CQMA 1N6QA 2P5VA 3LA0A 3G4SS 1VI7A 3D6HB 2KG0A 3PJWA 2LA6A 4RW8B 3ULHA 2HBYB 2AMCB 4X4NA 1TL3B 4I6AA 1KR4A 4TY9A 1C0TA 3CVKA 1JLGA 3ZZOA 1I94J 1PBUA 4IDKB 3MMBA 2O1PA 2R2RA 3BKTA 4JV1A 2RDIA 4LQ3A 3TZYA 3SCJE 2IHR1 4RKUC 2WZ1A 1LWFB 3M4XA 1V3ZA 5JXSA 2DRBA 2AGPA 2RQKA 4HTIA 2GGPB 3ZTOA 2XULA 4IQMA 1HWUA 3H42A 5IQQA 2W7PA 3I5AA 4USHA 2XYHB 1VFJA 2EK6A 4CWBA 1U2CA 1WG5A 5DDRC 1JK9B 2C2MB 1U24A 2E5HA 1M1KT 1RAOA 1SJQA 2CPFA 5KT5A 1S1XB 4Z7CA 4Y65A 1F9FA 4WZQA 3I6PA 1KTVA 5M2RA 3L3CA 1X9WA 2E9TA 3BN4A 3CJTA 2XQCA 2JZ5A 2B7CB 1CLFA 4USUA 1FKOB 2HAIA 2MMYA 2AKWB 2GHVC 1YSJA 4O3RA 3MM9B 1YVFA 4FKXA 2MYFA 1FD8A 1FERA 3C19A 4USTA 4IG3A 3BH6B 3ONQA 4LF1A 3PXGa 4LSNB 1Z2ZA 1ZZFA 2L9DA 1GXTA 1VQKS 3ENAA 3MGJA 4I4BA 3F0NA 1U26A 2EFGA 4F04B 2Y1JA 2CVEA 2MLXA 4QQBA 2DR7A 2CRLA 3P8BB 5A6PA 2KM8B 1UW9A 3GCWP 2YWWA 2OFGX 3DLHA 3SSQA 3CW2C 4MH8A 5GMKa 2XI3A 2LQJA 5C2CA 4P2MA 3D67A 2PA8D 3CMES 4BLGA 1ZAWA 4ECXA 2BW7A 5EWFA 3KYLA 3CJRA 2BYCA 3K7RA 2QSWA 3DMJA 4PUOB 2AP6A 2CJYB 4DPOA 5K5MA 3W3SA 1DLOB 2K7KA 3TO8A 3MPUB 1XIQA 3ILOA 4DQIA 3C6TA 4XK8C 2CQ2A 5E3CA 2MKJA 1R3NA 2W8KA 5A8KA 2XMAA 2R7VA 3T3FA 4A47A 5HMWA 2VJUA 1XN9A 3LUYA 4DR6F 2J0WA 1PJ5A 1SV5B 1S1TA 3HM9A 3V4IB 4ZA1A 2DHXA 1RWKB 3JTPA 3DLJA 1SL2A 4AD6A 3EVWA 4MK8A 3JSMB 3QATA 3OFFA 3VTIA 4F0KA 1NHVA 3T1YF 2ZNYA 1S1VB 2GO9A 2V2KA 3A3PB 2EFQA 4DR7J 3G82A 2XLJA 5L38A 2W2PP 3PZPA 2JFDA 2CQPA 2RT3A 4M5LA 2HGNA 4UZBA 2WONA 5D4NA 5F0UA 2FHMA 2MY8A 1RK8A 1RWVB 1PYSB 3MPWA 4JOUA 1B7YB 3M8WA 3R2DJ 3OTOF 1HYSB 3KNGA 1TFYA 4WTYA 3VAGA 2Z58B 4C11B 4QOTA 5F3ZA 1TAUA 2I6WA 2JFKA 2YWFA 1X4AA 2VL1A 3CJKA 1L3KA 4EZ6A 1RHRB 4ECTA 2M9KA 3VVUA 2G0JA 4MKVA 2HGMA 2B51A 5G4DA 2JL9A 2V34A 2IM3A 2YX7A 3D1QA 3F44A 4O0NA 3I0RB 1RKJA 5J2QA 2OP5A 1RT7A 3GB0A 4NXNF 1UTAA 4OLOA 3JB9k 3ZZTA 2YQ3A 3PG9A 5BR8F 2PEHA 3ZZPA 1NLKL 1FKAF 2UVVA 2WVFA 1WSRA 4LVNP 1GXUA 2VKRA 1G3OA 1LW2A 4FS1A 1FTRA 1NPKA 1HHSA 3H8YA 3QGPA 1VR6A 2CQ0A 4K5SA 2C22A 5HK4A 1IKYB 1SKUB 4G65A 4C8NA 3KFWX 4HHHA 3BKFA 4F02A 5DG7A 3MR6A 1RU1A 4G1QA 2F8HA 4X4OA 2J7KA 3W66A 1KTQA 1GQEA 1ACMB 3S01A 3MM8A 1ZH5A 2FZKB 1HD0A 1P9QC 1IBKF 4WFAQ 2QGFB 2VJVA 1YJWS 4F4YA 3VGTA 3IM9A 4JI3F 3ET6A 3BO3A 1KBRA 4LF7J 4MKBA 3OXLA 4OYIA 4YY3J 4PABA 1A9NB 3BQ2A 2QZ8A 4K5RA 3N01A 3MUMP 3KLGA 4CM0A 3MURP 1N32F 4KHMA 1CS4B 2HS4A 1P9YA 1FE0A 1S1UB 2OI2A 5KFEA 1LXJA 1TU0B 3ZZUA 5IM0A 2P6TA 2ZFHA 3TARA 2NYIA 1LWXA 3QAEA 4JUZA 2WCXA 3KNAA 4LF6F 2B9XA 4ZVQB 4NXMJ 1WHXA 3L09A 2HRTA 1YRUA 4C2MA 4U8VA 3S1TA 4DFPA 4BWMA 5J2PA 4QIVA 7AT1B 1REVB 2ASDA 3LP2B 1UPPA 4TU7A 5HP1A 3KK1A 5KTQA 4ECQA 5CXTA 4DUYJ 1RE1B 4R0JA 1S79A 3H7HB 4A8FA 2WBMA 1B3TA 1EP4B 4CQ1A 4ZMMA 1F0XA 5F8MA 2ZZNA 1WDDA 3H2VE 4NMXA 2FJXA 3EX7B 2C2NA 2RD5C 8AT1B 1SQEA 3Q8UA 2JRSA 1LWCB 3DDKA 1TKZA 1P6TA 2Q6BA 2XZWA 2I5JB 1DQAA 3PRDA 5KG0A 1KFDA 3K17A 2MZJA 3NGSA 4CH0S 3NOCA 2XMVA 2ADCA 4NLWA 2DIUA 2LEAA 2F3JA 3R9LA 2VF3A 2P6SA 2NXJA 2VA2A 1YLXA 1HNZJ 4ED4A 2YWKA 1U25A 4GRSA 2F7VA 4A8KA 1SKSA 3OTCA 3I96A 2VONA 4GO5X 4DQSA 4FF3A 4J90A 1Y4ZB 1FCAA 1RT3A 1N4LA 3NGDA 2P8IA 1ZA2B 1BXNA 3LPYA 1AFIA 4UF4A 3OJUA 1ICEB 3H0PA 3VQTA 1JLGB 1FK9A 4XAKA 3JAMY 4DCOB 3FSYA 3MMBB 2R4FA 2IA0A 4Q0BB 2HG4A 4DQPA 4YR2A 2ZD1A 4CNYA 1TK5A 3EDRB 3AOBA 4OYWA 5B0FA 4DX6A 2RHQB 2PI5A 2PDAA 4PPZA 4ECVA 1FESA 4QBUA 3EZ5A 2H3EB 3FNNA 3M7VA 1NNDA 2ZH7A 4UY8T 3THTA 3V2UC 5KFTA 1JIHA 4CI0B 1CJTA 3W5YA 1F60B 4DV4J 5AE1A 3OL6A 3SCKE 1NAQA 2G13A 4XO0A 1VRTA 2LDYA 1SL1A 4P52A 1VJWA 4YDXA 2BACA 3M32A 2Z2YB 3IN5A 4O3SA 4FS2A 5AT1B 2LEBA 4KGMA 3OD2A 2H5EA 1NM2A 4DLEA 4KFBB 4DS5A 3BO4A 1NK7A 2OJ3A 2APOA 1UWBA 1IBLF 1OPIA 5HMZA 3GIMA 3O44A 3BPDA 1RYRA 3KHRA 2R7SA 2J8AA 2VOPA 1FWLA 1X4BA 2RB7A 3HFKA 4CLYA 4LBIA 5T14A 2BKNA 4JI1J 2Z57B 4C0HA 4OLPA 4DPWA 2QX0A 1O8BA 3R7SB 2YH0A 3OR1A 2BUNA 2VU5A 3W7BA 5KT7A 1EQ0A 2VQEF 2CQHA 4RBVA 2DGSA 2J9DA 4NLDA 5E33A 2GC8A 3DRRB 4C8MA 4CDIA 3K5NA 1NJIT 5HN0A 4XTTA 1RT6A 2CQ4A 1HMVB 2C28A 1HWIA 4OX9F 2MQPA 2K2PA 1OWXA 3B4MA 2KXHA 2O01C 2VV5A 2CFXA 2QMWA 4ECRA 4LFBF 1T05B 3QQCD 2GIQA 3KMSA 5L8RC 3HT0A 2B0GA 1SB6A 2FD2A 1Q8KA 5HROA 3PYDA 2OMLA 1SJ3P 5ETVA 3Q23A 2YNGA 5LXRA 3OL8A 5B0BA 4JYAJ 2N4CA 1FO1A 4O0IA 3Q24A 1FWKA 1EB0A 4ZITA 3RRGA 4ZP8A 3QLHA 3MPDA 2WSCC 3A13A 1AZSB 3VAMA 1YZ7A 1F3FA 4CO3A 3EGWB 4ITSA 2POKA 2V2QA 2NXEA 4Q2LA 2KT3A 5D4OA 4TYAA 1BQXA 3LGMA 3NXZA 3CD6S 1KQGB 3E3XA 3GR0A 1WI8A 3AT1B 3W64A 3VALA 2GZOA 3TJ9A 3ILIA 3M8ZA 1IUJA 1TELA 3H5YA 3NG8A 1R8PA 1UVLA 3OLAA 4TN2A 3OXFA 5DDQC 3V5RA 4QIEA 2L9WA 5CYQB 1VLYA 4UOFA 1RADB 4Z2XA 3P45B 1CJVA 4USWA 5JVGQ 5J2MA 2FDNA 3GPAA 4DN0A 1JLAA 2ZH9A 4ED0A 5L1KA 1NK5A 3ITHA 5I42B 4C8LA 3TEGA 3Q8RB 3UD4P 3G86A 4B9NA 4ID5B 4PYAA 4USVA 4A8XA 2N7CA 3DOLA 2DITA 2FJDB 1S5ZA 2IBOA 1K73T 4GVLA 1Y3KA 5KG1A 3FCHA 1IBMF 4H4OA 3NEKA 3VQSA 3IAS9 2GW8A 2L08A 3PEJA 3S7RA 2WOMB 3P3DA 3V6KA 4C0BA 1L3SA 4B9VA 2JLEA 1LW2B 5HQMA 1VISA 2JEIA 2LA4A 4R5PB 1NKBA 1WC6A 1JLFB 4HR2A 1FF2A 2DJWA 2E29A 3HVRA 1SC3B 2AT1B 1Q5YA 4EI2A 2BKPA 1Q8IA 3B4DA 4G1QB 4RBUA 5KG4A 3GYXB 4X66J 4RNHA 1SVDA 5LMUF 3HHLD 1M1HA 1LNQA 1K9MT 2IRUA 2ZH3A 3VZIA 3UCGA 2HVDA 2ROPA 3MHYA 2R7TA 2YPZA 2XCPA 3IBFB 3SI8A 2HVHA 4JI4F 4NLQA 3ET6B 3AAWB 2A1BA 3PW7A 3W65A 1MU2A 3J80Y 1RQ0A 1FI4A 1XNQJ 2KN4A 2FIUA 3P96A 4ETZA 4RR5A 3KHLA 1F5BA 3PIPQ 2XM3A 3HXMA 4W4MA 2AQ4A 2VOOA 1DBDA 3AOCA 2KI2A 5IM0B 1R8CA 3DXSX 1M5OC 2W7AA 1PYOB 3BV8A 2V4QA 2LXUA 2RRBA 5J1PA 1XQIA 5GADU 1G7CB 4LR7A 2FZCB 1HPZA 3PR4A 2UVRA 3R1HA 3HULA 1VQ7S 4J9VA 5F9LA 4ERDA 3JTOA 2DEJA 3KLEA 3FEZA 4FNHA 1NKCA 1QTNB 4FYWB 1S59A 1SPBP 2O5DA 4OZ1A 4OZLA 4YB5A 3NLCA 2OPSA 4DFKA 1R8AA 3LGNA 5ETTA 2ASYA 2Y3YA 1H38A 2ZZTA 4M5DB 2OPQB 1C1CA 3VV2B 2DH8A 3TQ1A 5CABA 3MCMA 2KDOA 2IBKA 5EUHA 4A8QA 4NYPA 2J7UA 2W7OA 1C1BA 2VBXA 2O66A 5HAOA 2F9JA 4K4YA 4KGXB 4B9LA 1OY6A 2HNYA 2YVSA 1OQ3A 3CJ3A 3LP1A 3MFIA 4J9RA 2JX2A 2FJWA 1XWLA 4IUFA 5ADZA 2YTCA 4DI6A 1HBOB 5KFOA 5KFMA 1IKVA 4C8ZA 2ATLA 4UOHA 5D15A 3JS9A 4PXBA 1GMVA 1YK9A 2R7UA 3FEXB 3I55S 5EX3A 2U2FA 3CPWR 1QUPA 2RSQA 2V68A 4FN5A 1VRQC 1WI6A 1TUGB 5ITHA 3G6VA 5D77A 4DUTA 3UD3P 1I1GA 1LWEA 1BMQB 2X1AA 1MNEA 1UPMB 1NO8A 3G8SA 1LXNA 2IFXA 5F41A 3SCIE 3T1YJ 4X64J 2MEWA 1OYEA 3C2PA 2DO4A 2YNHA 1HD1A 4U7CA 3H5UA 1SQGA 1YJ7A 1FDAA 1U8WA 3NS6A 3M32B 4NPOA 5B0CA 4OZNA 3DI6B 1HNWJ 3V81A 4PZVA 2FVCA 3C14B 5RUBA 2J8SA 5HMXA 1PC4A 3AJ2A 1SJ1A 2CNKB 4E8UA 1RA6A 2UXDF 2GVZA 1R89A 4IFVB 3I5BA 3OTBA 2KH9A 4YHHJ 4DLGA 3M1VA 2HWHA 1JLQB 3ETOA 1X9SA 3GLJA 2YBVA 2PEBA 2RDJA 2BW2A 1XMBA 2XSFA 3M2VB 2XYPB 3SYZA 2V5HG 4HVZA 3OR1B 3FCWA 4UQTA 3DYAB 2DNQA 1IR0A 1T95A 2MJNA 3PFOA 1TKTA 1FDBA 2IM0A 2FVPA 3MEKA 4HT5A 3G6XA 4F36A 2WVDA 2R7QA 3IRXB 3SZ2A 1H2UX 3MPVA 4NZ7A 2DYAA 3HSJA 3ZFVA 4WBFA 3MUTP 4NLVA 3BM7A 2ZKUA 2VFVA 2HHTA 1OY9A 2EBEA 4JI7F 3PY8A 2EFPA 5HROB 3IRWP 1FWPA 1WOSA 4IH5A 4B3TJ 3CDAA 2KYZA 1OS5A 2DB1A 4QIWD 1FDDA 3M8RA 2YNGB 4AQYJ 3NGTA 2COLA 1SUQA 4CYUB 3OLBA 1J5EJ 2CQBA 4P75A 5M2UA 1GEHA 4J5OA 4ZCIA 2LECA 1RP5A 1XJWB 3QLHB 3WIVA 4EZ9A 2NZ4A 1NBEB 2FPHX 4DV5F 3MMCA 3GYGA 1KN6A 2QMUB 2LVWA 4DV6F 4FF1A 2CG4A 4EBCA 1ELOA 2RQ4A 1Y5NB 4B3SJ 1FRLA 2QA1A 1CBKA 3TW0A 2BKOA 3NAHA 1JQGA 2DGXA 2G0IA 2C2DA 3U7JA 1UEUA 3M30A 4ZCMA 3AQOA 1Y00A 4P2FA 2FTRA 2HHUA 3N5BA 2JC1A 1SXLA 4RNMA 3O8WA 1NMEB 2VG6A 4ZHRB 1K44A 2XMWA 1DTTA 4I2QA 1N33J 2DO0A 1S77D 1C2PA 5K8MA 2RQCA 4F2SA 2KM8C 1NJZA 3CCTA 3D28A 2PI4A 1WORA 3ITHB 1NU4A 3MMAA 3TUIC 1LQ9A 3HPOA 2FHJD 1RI7A 1ZM4A 2K3KA 3A4TA 2XBPA 3DGPA 4IO9Q 5KFFA 2OELA 2DNGA 3DOLB 3M6XA 4DR4F 4KKOB 4R8UB 4CO5A 4KT0C 2W2NP 1YRXA 2ZEJA 3E01A 3FK4A 1XMQJ 1RTJA 3DOMA 4H4OB 2NXNA 3I56S 4J9SA 4EEYA 4WP3A 1VOMA 1HNXJ 3H4DA 2KKHA 1UA0A 4DPXA 1IQTA 1XR6A 3R5GA 4FBUA 3SMZA 2AX1A 5G0RB 3H20A 3U02A 1RT1A 3TI0A 1BE4A 2QO3A 3C15A 3LWMA 4RU9A 3I4HX 4IH7A 1XMOF 5ETKA 4L3KA 1WC4A 3RR7A 2IDLA 3Q86A 3MR2A 1BC6A 3GV5B 2CQIA 3DHWC 4ED7A 2JC0A 5CYMA 3T5HA 3H5SA 1Q53A 3DNCA 3GG1A 4L72B 2X7IA 1SH2A 3DRYA 2MB0B 1MU2B 3PX4A 3A3OB 3QSIA 4F50A 2F4VF 1QSSA 2M0GB 2GNKA 2DXEA 1ZM9A 3TA2A 3MI7X 2W24A 2HFVA 4ATNA 2UXBF 2B43A 3KTQA 3V6JA 2GV1A 3X3UA 2HNZB 2CWXA 2XWXA 3QNWB 3HMJG 1WHWA 3UDVA 5L9NA 1H98A 5D3GA 3PTWA 5KG7A 1H7WA 5DLGA 2OAUA 1HQEA 2FC8A 5E3QA 1HPZB 3TUPA 5KFPA 2R7RA 5KFJA 1YTYA 4RUCA 5JMNA 1NHKL 4LIWA 4OX6A 4QWDA 1VC5A 4KGVB 2R8IA 2ZOMA 3O2IA 5GVQA 4K0KJ 3D2WA 1WHYA 3AD8C 4EUVA 3ILLA 3KLEB 5FDLA 2DH7A 4HKQA 5T41A 3KJNB 4PQAA 1I94F 2IM2A 3CE8A 3PW2A 2K7JA 4B3MJ 4ES2A 5HANA 5H1SV 2RVJA 3J7AN 4LBHA 1NB7A 4OHYA 1WOPA 2I9SA 4PPDA 3GMGA 5HLFA 5DZ6A 4W90B 4DN9A 2EG1A 2VQEJ 1IKXA 3M2UA 1JXEA 2XY5A 2R42A 2CJXB 3AJDA 5C7PA 4J37A 3SQGB 4NLTA 4JI0J 3TJ8A 2B56A 2EW9A 4OX9J 1KQFB 4FYYB 4OHVA 4C98A 3PW0A 4RX6A 3GIRA 1WKLA 1JX4A 3M9NB 1QAIA 2AYMA 3V4MA 5ETMA 3LP1B 4JI6J 2NPFA 4N47A 3BJYA 2LQ9A 2LFVA 2Z8QA 1GFWB 1SC1B 4DV1F 2JSXA 4WE1B 4OJ1A 1N34J 4MFBB 1IR2A 3UCZP 1B4SA 1B70B 1WJ9A 2HFOA 5E3RA 1KKHA 2KJWA 3TUJC 3WDOA 4WP8A 3KG4A 4KE5A 2P9EA 2CADA 4X65J 1LWEB 3DU6A 1X0FA 2ZOGA 5E0OA 3IFEA 2ZH8A 4N8OA 3R5DA 3JQKA 4WK1A 3NBPB 1Q79A 1RT5A 2UVWA 4Y2MA 2YNHB 1HQUA 3K5OA 1VQ9S 3C3LA 3N0VA 1WKJA 4HACB 5KFQA 1H2TZ 3ZO7A 4KGKA 4TLRA 1OSDA 1UVKA 3TX8A 3R6LB 1MWZA 5MAOA 5H9EK 2V8DA 1GT8A 3FFIA 2RRNA 3ZZ0A 2GVZB 2UP1A 4ER8A 2W01A 4LIRA 1J5OB 3G87A 1LFPA 2NLWA 4LF9J 2LMIA 5HQLA 2QEXS 1EJ7L 4HDHA 3UR3C 1S72S 1TK0A 2CZVC 3IM8A 1NDKA 3UR0A 4OI0A 4BWJA 3G9CA 4WKRA 1XC9A 3BDPA 2FVRA 2BXJA 3LAMA 1TFWA 2QL9B 1TKTB 5GADI 4Q7AA 1NSPA 2QMXA 3OL7A 1FJCA 1QVGR 4DR7F 1IBMJ 2ILZA 5HMYA 3NMAA 2DKOB 3BGFA 9ATCB 4DR3J 2RHSB 1KSPA 1NB2A 1RGVA 4Q2MA 1DZ5A 4MKYA 3QO9A 1JMTA 4ANEA 1YJNS 2EI5A 3UFCX 2O3DA 4TQRA 1FRKA 3DRPA 4CT8A 1GAOA 1BQNA 1RWMB 3NNHA 3OW2R 4KYZA 3HJVA 3MM5B 1S10A 1Q4RA 2VPYB 1VS3A 4TNOA 1IVZA 2GQ2A 2HHSA 1X5OA 3CJ8A 4QWCA 2ACYA 2IM1A 5F8HA 1C4AA 4DR1J 2DBBA 1RT4B 2XO6A 3C6UB 1B0TA 4EU0A 4FBTA 3ENVA 5K8PA 4NA2A 4K4XA 2A0FB 3BDEA 2IDEA 2ZHBA 5K14B 2B4OA 4WZMA 4TU9A 2BJ7A 2BM1A 1X7VA 4NRUA 3M8YA 3F73A 2C2OB 5A8WA 2HQDA 2AJ1A 2CNOB 1C0UA 2MQNA 2RJZA 5E3AA 4KTQA 4J9LA 2W8LA 1KD1T 2CJAA 2MSSA 4I2QB 2GIRA 1JJ2R 3T5JA 3DXBA 3FVYA 2PC6A 3FQKA 1WUUA 4OMFG 3Q2TC 1HARA 1YITS 1NCLA 2P2CB 4K7QA 5FLXY 3MMAB 2ZDPA 2KT5A 4LF7F 3CGIA 4DV7J 4YY3F 2MHEA 4IDKA 2HBRB 3W2VA 3DGPB 2Z2MA 4R0EA 2KXFA 1M5VC 3MEEB 2GFFA 2YKPA 5A6WA 1RABB 3NRBA 2V0NA 2YKAA 3MUVP 4EWTA 5LL6d 1TMMA 3H2LA 4YMEA 4EFAC 3E01B 4CTAB 4QU6A 4LRFA 1F3VA 1FXDA 3KHGA 3Q22A 1JJHA 2E1PA 4DF4A 4DWIA 2HKEA 4RUAA 2NZCA 3PVXA 1V3SA 3CJ0A 2IIHA 4XIUA 1D0EA 4IKAA 3M05A 2AV5A 3D4JA 4NXMF 2CDQA 2W1BA 2Y0SD 4I1TA 5LM7E 1I51B 1U2FA 3DC2A 2RRAA 4YEAA 4CP5A 5CD4A 3C15B 1T7PA 2BJ8A 3VF0B 3PRVA 3SV4A 2L9NA 1R0AA 2IY5B 3CWJA 4DUYF 3ZXWA 3MM9A 4OYPA 4C9DA 2FJEB 2ROGA 3MM6A 3QFWA 2YH1A 3MM7A 5FLXU 1TVRB 2DCLA 4NLPA 3C46A 1FRIA 2MZTA 2MLYA 2YQ1A 4Y34A 1YHQS 2OEJA 2IRXA 4NLOA 5IFMA 1AB8A 3RG6A 2Y8YA 5E41A 4RO0A 4ZJLA 1BWVA 4DSEA 2VA3A 1G2EA 1HIYA 1HBUA 2ROEA 1QJHA 2BQUA 4FXDA 1SH3A 3RB3A 2VPWB 3I82A 1SH0A 5LJ5Y 2ZC4A 5D3GB 1HQ2A 4IR1A 1S97A 5THWA 1HNZF 4OQJA 1HFEL 3HSZA 4O3QA 3IXQA 5KFYA 5KFWA 1RB0A 1VBYA 2D41A 1K1SA 1HQEB 3KUHA 4N56A 2QRRA 4PUOA 2F1FA 2YKNB 2J76E 2MJUA 1S0VA 2OEKA 3B8HA 4F4ZA 2B9EA 8ATCB 1N8RT 2HHXA 4K2XA 4OZ3A 1KDNA 3PYEA 4KJIA 5E2QA 1EETA 5GAEU 4HEA9 4M5JA 1Q82T 4B02A 2JNJA 4WFYA 1NK4A 1BWEA 4KH1B 3V4IA 2C2ZB 2FYXA 1FJGJ 1FRXA 1U1LA 4DDFA 1HBNB 3M2UB 2QA2A 3DM2A 1S1VA 5BYQA 2A6MA 3CDEA 4DV4F 2VUGA 4JV2A 1RTZA 5H9FK 1E6VB 9RUBA 3TAMA 4RZRA 3CCUS 3N6NA 2AZ3A 1NH8A 1OO0B 2H5IB 3RB6A 3W8PA 2BX6A 1HI8A 2GVDA 3PM9A 2CVIA 5DDOC 3PX6A 1PKUA 2PIIA 4WCEQ 2D3O1 3MEGB 1ZPVA 2M52A 1U1RA 1YZ6A 2W9CB 2BANA 2RILA 3CF5Q 3AA8A 2RDDA 3PV8A 2PMWA 2WAQD 1RTIB 4TYBA 4C6AA 1NDPA 2E7XA 3JYTB 2B9YA 2ZC3A 4E98A 2K1RA 1AROP 4KV8A 5K8OA 2V67A 5F8IA 2OLWA 3W2WA 3X1LB 3OV7A 1H73A 3I0RA 2RAQA 1APSA 4NA3A 1NK8A 3T9NA 4G1PA 2BQRA 4C0OC 2VC0A 4I7FA 3F56A 1QD1A 1RT5B 1OJ4A 3R5BA 1VQMS 1RZMA 3BZQA 3M6WA 3UO0A 1FDNA 1R0BG 4B3RJ 1IKYA 1YBAA 4L74A 4ZIWA 2GJFA 3RBDA 2HFNA 4ZPBA 1ULRA 1TR0A 2OSRA 1XR7A 2IMWP 2J6UA 4JYAF 2M4MA 3I5CA 2CPYA 5EHHA 1FRHA 3CJQA 2HQFA 2HWIA 1RBAA 4U7UK 3D3BJ 5C42B 2V50A 1LK7A 3OJSA 3LW5C 3FBBA 3KJFB 1R6YA 1T03A 1U09A 2DISA 5SUHA 2HRUA 4LF4J 1IN0A 4DPTA 5IWAJ 3MAHA 3J7YU 4Q8EA 1CS4A 3UVJB 4ECWA 5JVHQ 2M8DB 3CCVS 1RAJA 2VFTA 4ZJQA 1DAXA 5DG8A 6FD1A 2FC9A 3RGIA 4XPCA 3AXMA 1TL4A 3ISND 2XS2A 3D54A 3QRQA 2GJ2A 2GJIA 2VHGA 3QWUA 4E2FB 3DLKA 1H6KX 4DQQA 3DLGB 1KLNA 5FD1A 3QO9B 2VQFJ 1R6VA 1UFWA 1PIEA 1JNZB 3H25A 2IYGA 3EYZA 3I31A 1B7FA 4L76A 3CCLS 1BQNB 4NZ0A 4CLFA 3O5TB 1VCTA 2JLFA 1REVA 2BJDA 3PR5B 3LP2A 4M94A 4DMZA 2HEKA 4I67A 5A2QU 4L6V3 1XMOJ 1CVJA 3TEHB 4RW4A 2H9ZA 3ZC4A 4N77A 4UOCA 3W62A 4LR8A 3HSGA 1S9GA 1EP4A 2AX0A 1JLEB 1R27B 4PAAA 3Q2SC 2F4VJ 3LF0A 1LWCA 1UFLA 5CCLA 3RAMA 2AGQA 2OIHA 5KFBA 2I5JA 2UXBJ 4DV3J 1TAQA 5KT3A 3J81j 2BE2A 1VBZA 1CC7A 2Y9HA 4F67A 4JV0A 5A8WB 4M1KA 1BGXT 1FVQA 1I6JA 2E1AA 2E5LJ 4DG1A 1C0UB 2Q1LA 2V8HA 4PXCA 4ED6A 1KOOA 3UDEA 4GO7X 1DFDA 3SXLA 3GJSB 2DNOA 4ENOA 2ZH6A 4X66F 2XMTA 3FQLA 3OXGA 2HLTA 1Y5LB 2QIFA 1M1GA 4DEZA 4AL5A 1VIXA 1ZA1B 3U1MA 1R8BA 3HT3A 4IOAQ 1RKIA 4HLBA 4DUZJ 2Z30B 2QSFA 3L4BC 4R25A 4JI2J 2ZITA 2XY6A 2QLXA 5ETRA 1TMJA 2EC0A 1U1QA 1AW0A 3D6TB 3VAKA 3HSDA 1QLNA 4Q0BA 2AWZA 3W2VB 5CH7B 1XNQF 3KK2A 3RB0A 3ICLA 3TJAA 2WSFC 1Y11A 3HHDA 1TP7A 1G4CA 1N0UA 2KG1A 1N5YA 4UUXA 2ZJRQ 4DHVA 1VLOA 2DTJA 2FHJA 3VGSA 2ZHOA 1S7IA 1FX2A 5A76A 1D8ZA 2E1RA 3MTKA 3MZIA 2Z56B 3UNGC 4G1IA 4GC6A 1YBUA 3LALA 3SSSA 4QR1A 4PR6A 3R2CJ 4J9QA 2B8PA 3GFHA 2VICA 3KG1A 4KFBA 1AUSL 4RW6A 2V69A 2CA9A 2AEFA 1RAAB 2MXYA 1HWJA 2LYVA 2X51A 2RH3A 2F65A 3HHKA 1R0AB 1NSKL 2HHHJ 2DVIA 1V9OA 5ETLA 3QRRA 2UUWA 3CD0A 3MM6B 1WEZA 4FPRA 3MM7B 5BYRA 4DV1J 3QT6A 3AB4B 5A0YB 4DFJA 1FJ7A 5KFXA 3NAIA 3D1HA 4B3OB 1UFKA 2LLZA 2OO4A 5IZHA 2MKCA 3I87A 1RHQB 3HHLB 4HH0A 5DQIA 4OHWA 3LGHA 1DTQB 2H5JB 3OFEA 2UUCF 5B0AA 3DRRA 3GTYX 1NPRA 1HBUB 4ID8A 2XC9A 6FDRA 4NLRA 1VIOA 3TVKA 4KAIA 3V6HA 1RWUA 3UI3A 2IMOA 1HMVA 4MAKA 2C3UA 1I5OB 2AJQA 4QCLA 1H0HB 2MPUA 2R7WA 2D1CA 3NKYA 5HVGA 4ECUA 4OHZA 4GKJJ 1WF0A 3OHBA 2BQ3A 2E9RX 1UEKA 2J5AA 4ZCLA 1T05A 3CCQS 4H4KC 4KBIA 1CULA 1Q16B 2DR9A 2X3DA 5C5JA 1N5TA 3QT5A 1IM6A 4C3LA 1LEOA 1QSYA 2B4PA 2ZOFA 1CQNA 2IC3B 3EPGA 1EETB 5GAHI 3BREA 4NCGA 2JOQA 2E66A 4Q44A 4HYKA 2QL5B 3FSXA 2F5GA 3E8OA 3GWCA 5ETNA 3W1YC 1AZSA 5GMDA 1UVMA 3FBEA 5ETSA 1F5AA 3PDNA 3DM2B 1G1XA 4FXVA 3NCRA 4O4RA 4X64F 3IWNC 1XK8A 3M6VA 4KO0A 5J1NA 2JVOA 1T11A 1U0HB 1S76D 4M5MA 2M70A 3TAMB 2W9AA 3OVAA 3VGUA 2V8PA 4DZDA 3FDSA 4I2PA 3DCAA 3TUZC 2MQOA 5D4LA 3WC0A 1HNWF 4DZ6A 3FZ2A 2GVDB 2XI2A 1SIWB 1Y9OA 2HGLA 5CYQA 3MAQA 2HFUA 5D0RA 1HHTP 1X31C 3T41A 3DFEA 1HL6A 1Q0NA 1VYAA 4F0HA 2KYXA 2A6OA 2BANB 4YHHF 1X60A 5GAGI 1UJ6A 1S0NA 3HI9A 1RJJA 4C7QA 2AEMA 1HBMA 5I42A 3IGVA 4NLXA 5KG2A 4ID5A 1Q95G 2V94A 4HH1A 2K1RB 2EK1A 4KV8B 1RLCL 3OT9A 4ZVHA 2GMLA 3W2WB 3IR7B 2B6AB 1SQFA 4H54A 2Q66A 1IWGA 1BQMA 3OR2B 4UQGA 4I7FB 5KT4A 4EO8A 1RAFB 4NA1A 2M5YA 2ZBPA 1MMNA 3KDOA 1GMWD 2ZNZA 3HD1A 1Y7PA 3G6YA 3EMTA 2VH7A 2WOMA 3GP9A 4ECZA 2R8HA 1O6XA 4R5PA 2JVRA 1MROB 2VDHA 1JLFA 2XMJA 1Y0HA 2A2DA 5FJ4A 2E9ZA 4USIA 4K4VA 2Z4PA 4J9UE 4B3TF 3SV3A 4AQYF 3UCUP 3U1NA 4ED8A 2LXFA 1J5EF 3KLVA 4OX8A 2HAFA 3LH2S 5AXKA 2FLNA 4FNIA 1LW0B 4WTOB 4NEZA 2V2ZA 2DD8S 2E7WA 4L75A 2OD6A 2MZ1A 4Y0FA 1T03B 2ZBCA 2H1YA 3Q8PB 3KLHA 1RU2A 2C3MA 2CJKA 2CG8A 4B3SF 2DGQA 3A8JA 1GTHA 4DV2J 3EGNA 1AT1B 4ICLA 4ZPWR 3QYYA 3CMAS 3QZ7A 4TLQA 4QYZJ 1TKDA 2AHOB 1HR0J 4UT4A 1D8YA 4QPTA 3DLKB 1KP6A 2M2BA 4ZLPA 3H90A 2X1FA 1H72C 4ZVRB 1TL5A 1N5QA 1WSVA 4LRAA 1N33F 4O4GB 1OYDA 3BQ0A 2I1RA 5CQGA 4MIWA 4RWWA 3CCMS 4RWXA 3M8QA 2XGQA 1RWNB 2FQQB 3WZ0A 2WBRA 5KT6A 4U8YA 3I0SB 4DR2J 3I9V9 2DNRA 3HZGA 4QJVA 3CO0P 2BOPA 4UOGA 2C42A 4QW8A 1KEKA 5KFZA 4DL2A 4RW4B 3L7PA 2XB2D 3CC7S 5AXNA 1S9GB 2A2CA 3GIKA 1S49A 4ILRA 2BRKA 4DPYA 2G4BA 1XMQF 4M5DA 2MTLA 3T19A 2OPQA 4HTJA 2HWTA 5IC6B 3Q89A 1HNXF 2V63A 2BE2B 2MZQA 1M0SA 1MWQA 2UUAJ 4OYAA 1ZOTA 2C3OA 4BC9A 3PW4A 1ZZNA 5DGAA 4M95A 2HK3A 3BEGB 3UE2A 1BD6A 4DS4A 4DG1B 3QFHA 5AE3A 2P9GA 2VC1A 1TUVA 3K57A 3M9OB 2DNLA 1N88A 2RQMA 1WG1A 4MYTA 2V8GA 1NZAA 4HT7A 3KJQB 2CZ9A 4OJGA 2D9PA 3PHTA 4C8YA 4FYXB 1NDCA 1HBOA 2BR0A 4USMA 2FGCA 1X5SA 2W25A 3BKUA 3GSDA 3NNAA 4LJMA 2G0CA 1RHKB 4CLLA 3NP5A 3EZUA 4KC5A 3NCQA 3KK2B 1LK5A 4WFNQ 2BEFA 2OHDA 4RW7A 2XMKA 5C25B 2QV6A 1YDLA 5KG6A 1N5YB 2VB6A 3N9UC 4F2RA 3HO1A 5ETOA 3RR8A 4G6VB 2IJRA 3QJLA 3HVWA 4DSKA 2BV3A 3T1HJ 1RUSA 2NUUG 3PNIA 3BYPA 3DI6A 4E0DA 3C14A 1DRZA 2ABYA 1J27A 3QBCA 4RPFA 5HBMB 4X4SA 4RW6B 4K0KF 1N0VC 2CIMA 2FLLA 2WW4A 1CG2A 4DQRA 3J7YI 4LF8F 1U45A 2N7YA 4IFVA 2HZCA 3LWLA 1FXLA 4B3MF 3N79A 3VVTA 1JLQA 2XG8A 1YGYA 3G6ES 5IT4A 1KQSR 2EVZA 3HFVA 3JAMU 3NOGA 4O3OA 3DLBA 2PGCA 4PXEA 5EX0A 3M2VA 2KFNA 4LFAJ 1DQ9A 2MQ8A 1TL7A 7FDRA 1KONA 3PEHA 3DYAA 2QA4S 2BABA 4QZVB 2UUBF 4ED5A 2HK2A 2OMOA 4WU3A 5CAAA 2KTQA 1U7LA 3THPA 1U49A 4PG5A 3RW6A 2LEPA 1JWWA 2NSBA 4ANDA 1KLMA 4JI0F 2UV8A 3IS9B 1EQMA 3MR3A 3IRXA 1N54B 1SC6A 2LU2A 2JJ4D 1RISA 2WTFA 4LR9A 1HWLA 3RRKA 3D6FB 4JI6F 3WX4A 2QYGA 1CULB 2W4CA 2FB0A 4Y2CA 3DDNA 1U8SA 3W9IA 4PWWA 4C8KA 3B78A 2HBZB 4QR2A 4CYUA 1U1PA 1N34F 1U1NA 1EARA 1QAXA 2CPEA 1FA0A 5DQHA 1VHFA 2ZKTA 4DL0C 4KR0B 4NCGB 4TY8A 4HI2A 2AD9A 5ETQA 4KPCA 1HI0P 1NZ8A 5LSRA 3K8VA 4X65F 1R31A 5DGBA 4V19J 3CO9A 4WFXA 1B0VA 4J9MA 3N6MA 1VQ8S 3GG0A 4DL4A 4URSA 3EXYA 3M9MB 4KO0B 5L1LA 2FUG9 2ZBRA 1OY8A 1V5IB 4WK3A 4I2PB 3VWSA 2DIVA 2J9EA 2B3TB 1WC3A 2D9OA 2GX8A 4RNOA 4ZHRA 2G2ZA 4D3GA 2UU9F 4FPIA 4UW2A 1W2BR 3DOKB 3G8QA 3D9BA 4AYBD 1RWWB 4N5SA 1MMDA 3MAAB 4LF9F 5DRKA 1PGZA 5KFUA 3EWGA 1NXIA 3C16B 1HBMB 2GMHA 1N36J 3KUGA 4ZVUB 3MF5A 4EMDA 1WG4A 1VQ4S 3BSOA 2PA3A 1XEZA 4KKOA 4R8UA 2MQLA 1BQMB 1B0PA 2EFNA 4QIGA 3FMBA 4H4KA 1HW8A 3RTVA 1U0SA 1L5UA 2MSTA 4DR3F 2CWKA 1URNA 2OUGA 3MD3A 2VBZA 2QL7B 1S48A 3EVOA 2ASLA 3ADAC 3NWGA 5G0RA 4GMKA 3R5JB 3LQVA 4CLZA 3H5XA 3UDLA 1FFWB 4O23A 4PG4A 3VZHA 5D0GA 3G96A 4CO1A 3HFZB 3P4UB 4IG0B 5KFHA 2XHWA 4QWEA 5KFVA 2RUSA 1RAIB 4KB7A 3T5LA 4LUBA 4ZP7A 2BE9B 2CQ1A 3US5A 4ILLA 4DR1F 4JI5J 1VQPS 3O3LA 1VQOS 4J7CA 2WK4A 4CM2A 5L1JA 3FBFA 4Q45A 2DHAA 3KLHB 3V6DB 4PQUB 2WB4A 3TRGA 4WIQA 4ANCA 3DHXA 5DDPC 4ICLB 3AQPA 4MMOA 1CJUA 2MGZA 1CJKB 3BBCA 2HNZA 4WYLA 4I56A 2MDAA 4X4PA 2CQCA 3OTDA 3D66A 2IAJA 2R2TA 3B82A 3MEDA 3HJFA 1X0PA 5F8LA 3M8QB 5HJYA 2RKIA 4JV5J 2H48B 3DLEB 4BCAA 5IXUA 1S9EA 4L3NA 1T9VA 2EFOA 4Q5VA 3TOQA 5DETA 4DV7F 2BBEA 3E51A 3PKMA 5B08A 2ZE2A 2OSQA 2R3VA 1GX6A 3KMQA 3GU0A 1ZM3A 2LP4A 3J80U 4NI2B 2F9DA 4Y28C 2OPPB 4HL9A 1FNXH 1U48A 2BJEA 1NHUA 4DV0F 4Y2KA 2UUCJ 5CYJA 4USJC 1IKWB 1TKXB 1XBWA 1RWOB 4LRCA 2XMMA 3SQGA 1WC5A 2YX1A 4MTPA 4S0MA 1E6YB 2GAGC 3F41A 4NLSA 4OJ3A 2R2UA 4ZPDA 4J9PA 3VAHA 2HYIB 2IA6A 2O67A 4ALZA 1NPPA 4NMLA 3KLFB 1SJ4P 3HLUA 2RU3A 1AUDA 4GKKJ 3J7Z5 3GSIA 5F9NA 2RS8A 2EKYA 2HS0A 1ZTWA 4WE1A 1FD2A 1UJ4A 2H54B 4MFBA 4IR9A 5E5NA 1HKAA 3DN9A 4IRDA 1X4HA 5KFGA 3Q83A 1O0PA 4J91A 2Y1LB 2ZUGA 4RW7B 4ZDNA 4KPYA 3R5CA 1FJEB 5B0GA 3HX9A 1VBXA 1IM4A 2ACMA 5KFCA 2P9CA 2GAHC 1X4EA 2EKNA 3CIMA 5KT2A 5HL7Q 1A0OB 3OVBA 3NBPA 1VQNS 4CLSA 1UL3A 2CXEA 3CTRA 4X4QA 4OV6A 5A8RA 3KXDA 5HO4A 3WBZA 4KSEB 1HNIA 4HACA 1LKZA 4NX9A 3P5TL 4DL5A 1UWAA 3PYFA 3RYLA 1YI2S 2CPIA 1XNRF 1NJWA 1KHVA 1UKUA 3RUBL 3QRPA 1J5OA 4C4WA 3GCXP 2JEFA 4DSLA 1S6PA 3J7A1 1HI1A 3C8YA 3QAUA 4I64A 1Y3JA 3TAQA 3GFZA 2DRAA 3BN7A 2F8EX 1QY7A 2R7XA 1N52B 1WELA 3GV8B 2HBQB 1SBRA 1RYSA 4F3OA 4O44A 1WTBA 1TL7B 2H51B 2RE1A 2OH2A 4OZJA 1Q86T 2CPZA 1FJGF 4YQWA 1WACA 2KU7A 4K4WA 4DR5J 4ELUA 3MDFA 3MFHA 1CEZA 3CD5A 2FJAB 4N76A 5DG9A 1QE1B 1Z4UA 4KIAA 2N4DA 2W4DA 1KLMB 1YQHA 2XY7A 2PSZA 3DRSB 2ZM6J 3Q0AA 1H74A 5MLCV 1OMSA 4X2BA 1K0TA 1KQKA 1GH8A 5LSOA 3HVAA 4ZPTR 3ZZYA 1KVJA 1NK6A 4JB8B 3MM5A 4NLUA 3D0HE 4OI3A 2EFVA 3BGLA 1YJTA 5C24B 1U6ZA 4MIAA 4M5IA 5ETPA 1RACB 2SXLA 1S1WB 1RWXB 4DL7A 4TY8B 4EO6A 1RT4A 1O5JA 3GFXA 5CA5A 3C6UA 1K8AT 2U1AA 3SFGA 3WC2A 3QGGA 2PT0A 4AXJA 3DDIA 4YB6A 4ZOSA 2OTJS 5K14A 2PMZD 1S0OA 3IA0A 1NJXA 1FT8A 2GCFA 3SSRA 1X5PA 4CT9A 3Q8QB 2KO1A 3W5XA 2QLBB 4WWSA 4FF4A 3OQ2A 2E1CA 1U6FA 4B3RF 2CNLB 3IBCB 3POTB 2PD1A 3HHLC 1R8HA 2ASJA 2B5JA 1JJ4A 3CJ4A 4EYIB 2YY3A 3EUNA 3UN5A 4YP3A 2NS1B 2WVEA 4LRDA 1H3DA 1BLUA 4KGZB 3A12A 2ALZA 2WHOA 2ZBIA 1WKKA 1UAWA 4A8OA 4DSJA 1GK8A 1JKHB 3EPIA 2C1EB 4H4MB 4IFYA 3UQSA 2XMUA 1YKWA 2V2VA 3JQJA 4HDGA 3HF5A 3HDSA 4LF4F 3MEEA 1CSJA 5L46A 2LQ5A 4OYOA 2D3ZA 5IWAF 2ZZMA 4DX5A 1P1TA 4CTAA 3CDBA 1RA7A 5J1EB 2GO8A 3PIOQ 1RBOB 2CPJA 1M5SA 2DY1A 3MECB 4AL6A 3LP0B 4NCAA 3CMQA 1ZTTA 4F7VA 3GZ7A 2E5GA 1NUEA 2VQFF 5CZVA 2F8MA 1HW9A 5F3TA 2X1GA 2EG2A 1SKWA 3PACA 4FZVA 2V4JB 1MN7A 3UN3A 1MW7A 1VRUB 3RB4A 2KJVA 1GMWA 3IMQJ 4LF5J 4KHPJ 5EWEA 1T3NA 3MWBA 3JSYA 1FE4A 1PCAA 2UV8G 2ZBQA 2G2OA 2KB2A 2G1HA 2R9LA 3OSNA 1TVRA 4ZPCA 3BGUA 2AW0A 3FUYA 1WHVA 3GIIA 3ZTSA 2YWGA 1Q7LB 3W9JA 2VPZB 5JJBA 2BJ9A 4A48A 1UJ5A 3BQ1A 2Q79A 3CEDA 3L95X 1TK8A 4DV3F 5AXLA 1Z2LA 1WF1A 1W26A 3CB4A 5C2GA 4NWBA 3UDCA 1CJUB 4WXOA 2DHHA 2MGZB 1FFSB 5KFKA 1M90T 3EE3A 4C8OA 1URRA 1N6QB 2GQCA 1RHJB 2E5LF 4GVBA 1KNZA 1C0TB 1JXLA 4W92B 1KFSA 2QLFB 5K20B 2L48A 2IAJB 3MEDB 4AT1B 2YKNA 4ZLNA 1KVKA 5H9EJ 1U02A 2EXUA 1SIZA 3TZXA 4KQZA 1U6BA 2FLOA 4DUZF 2Q3PA 2RKIB 4JI2F 4YS2A 1VQLS 2D74B 4LF8J 3BSNA 1S9EB 3VAIA 3QGHA 5IC4B 4QYZK 1NK9A 4Y6IA 1RAGB 1ZPWX 3C66A 3GFYA 2ZE2B 3AD7C 1RSCA 4X62J 3TVYA 1MWYA 2BA9A 2N3OA 4YR0A 1BY9A 2NYHA 3NWRA 1EIYB 2XSJA 3IWXA 2QG9B 2ZH5A 2QC3A 5LMNJ 4PWDA 3DKDA 4RLEA 3U27A 2BJ3A 1HBNA 2UUBJ 4V19X 3FJ2A 5EWGA 3Q8SB 1MN9A 2DK2A 4L73A 3HD2A 1E6VA 2ZH1A 3LO3A 4ZPAA 2OKQA 3AH6A 2AF6A 4IG3B 1P27B 2KRBA 4LFCJ 2JWNA 3MEGA 3CT9A 1JLBA 5B0DA 2K8GA 2C2RA 1TL1A 4K4SA 4DCJB 2W9CA 5CCMA 4QW9A 2HHHF 3EVMA 5I3PA 4ZIVA 3D6MB 2AIRB 5E7OB 3CIZA 3W9HA 4WP9A 1RTIA 1CPZA 4LRBA 1RTHA 3JYTA 2DR5A 3KDNA 1T02A 2OEMA 4JBCA 2QLJB 2B9WA 1WNEA 4WFBQ 1S12A 3EZOA 2YNIA 1Q81T 3DMJB 3OSPA 4ECYA 2KHCA 3QIPA 4YN3B 4ES3A 4QPXA 3N4WA 5A8RB 1HWKA 1HNIB 3C6TB 3GYNA 4GKJF 2PFFB 1X4GA 2NR0A 5HVHA 3CDWA 5A8KB 1CC8A 1FRJA 3JTNA 1XR5A 2AJ0A 2UU9J 1FFGB 4OFZA 2Z0GA 1S1TB 1UZDA 3A8IA 1RAEB 1S6PB 1K0VA 3NNCA 2QE5A 4X4UA 2FZGB 1FEEA 1RCOB 1C4CA 5DO2A 5SZTA 4PRFA 2D7SA 1M5PC 1X4CA 3CJ5A 4IH6A 5C42A 3FEYB 1P8GA 1S7HA 2QJ3A 3G82B 5IQ6A 4ILMA 1EKSA 4RJVA 5T7LA 4O44B 4RBTA 3PHEA 3AOAA 4I6YA 2WONB 3LANA 3R6GB 4ZVOB 2QTWA 5JUMA 4UZCA 1MG7A 3UVJA 1S57A 3K5PA 2IJNA 3PFEA 7FD1A 2M8HA 1U2RA 3GR1A 2NQPA 2ALYB 2H65B 4B9TA 4NLYA 4AL7A 1QAJA 5D8HB 3D1OA 3CUNA 1YWXA 3MOJB 4OI1A 4AXIA 3CJKB 3DLGA 4Z7YA 2NPIA 4DFMA 1T9YA 3RZAA 4P2SA 2ILYA 1W25A 4LQ9A 4K2JA 4K4TA 4KRWA 1UVJA 1S6QA 4BS2A 3R8YA 3G71S 3PJXA 2HVEA 2KVQE 2IPOB 5EDWA 2PN6A 4AE5A 4U95A 4P72A 5J2QB 5LOQA 3BR8A 1RT7B 4JI8J 3EGVA 1WOOA 2CDRB 2XNQA 4CCHA 2DPIA 3P6YC 1RHUB 2ERRA 2J9CA 4USKA 5LT5A 3OUYA 1VJQA 1T94A 2J9DE 2QT7A 4C3KA 1OIAA 2XGPA 2XS7A 4U67Q 2C2KB 5E3PA 1LV5A 2Q6CA 2W2QP 1TUWA 1JLEA 3VR1A 3ZZRA 2QYCA 4LT6A 3AY0A 3FSIA 4Z37A 1SCJB 1D9DA 3Q8YA 1NKEA 3JXOA 1H7XA 2F40A 2XO7A 2QFIA 1KS2A 4UY85 1IR1A 5AJ3J 3MM8B 4ZPVR 1FHTA 1VQSA 2V8VA 1WC1A 2DNMA 3ETMA 3BBBA 2B5JB 2AJ2A 1HA1A 1ZM2A 1J2VA 3PJ9A 3KLGB 2YKOA 3TP2A 1S0MA 2CPXA 1FXRA 1WEYA 3RBZA 3WHIA 4IFYB 1JJCB 2DHGA 4G3IA 4WKYA 4N7TA 2XLIA 3JSRA 3KK3A 1M5HA 2JDJA 2BJ1A 1F2HA 3BSAA 5FIIA 4X4RA 1D3WA 2J6TA 1F6TA 2E5JA 2DR8A 4M63A 3T6BA 1F9EB 1WDTA 2M88A 5DM7Q 4DV2F 4O3PA 4IO1A 3H4BA 4F4AA 3CCES 3KKFA 3I9ZA 4WYWA 3N5FA 2YXLA 4DV0J 1HR0F 5J2PB 3FMWA 2XCAA 2FVQA 3RRHA 4P6QA 4PG8A 1JLCA 5H9FJ 2L41A 1FTCA 3CCZA 2GQQA 3A8KA 3KLIA 5HP1B 3KK1B 3OFGA 4C48A 1JNRB 2UXCF 2DGOA 3WQPA 3SCLE 1D1UA 4X84A 1HNVA 2CJQA 4J9OA 3FCVA 1XTZA 5GMEA 4FDFA 1YJRA 1T0TV 1RT2A 2FHOB 4DR2F 4ETXA 2DXDA 1D9FA 2HQCA 1WF2A 3IWLA 3MCNA 1TKZB 3M6UA 2VG7A 1PO6A 1BHNA 1AYEA 2V9KA 2W4PA 4I69A 1RTDA 5A0YA 3UNYA 3QT7A 4B3OA 4F8RA 3QZ8A 2VFRA 3R1LA 2JEGA 3BB5A 2BDPA 3HHLA 1PBAA 4Y2AA 1EKRA 1PAUB 4F4XA 3TAPA 2RUGA 2ZJQQ 1DTQA 3CJ2A 3W8GA 4OYZA 3CCJS 1RXOB 1TTHB 2NUHA 4XPEA 3K59A 3H98A 4NYZA 1DURA 1R7IA 2GHWA 4F0MA 4LBPA 1S4FA 2UUAF 4P7VA 1RT3B 2MKSA 5BJRA 4CH1A 4OIXA 3L7OA 4ZKAA 4NRTA 3R97A 4KY3A 3RAQA 3H40A 2QA4G 4GVBB 1U1MA 2B4UA 1YJ9S 4CLTA 2BOAA 1FK9B 4ZK7M 3T5KA 4UUWA 3HKWA 4P7TA 2CQGA 4URQU 2B4VA 4X4VA 1WEXA 2QLWA 4BC7A 3BS9A 2C3PA 2HIQA 2ZD1B 4YUDA 4MT1A 3QWPA 4DL6A 1XNRJ 4DR6J 4OL8A 2AU0A 1RLDA 2HPUA 2R8KA 2J0XA 1OPZA 1Q1KA 2IC3A 1IJFB 1IQZA 5CZXA 3DGVA 3Q8VA 1ZS6A 1KC8T 3THVA 1CJTB 4BDPA 3U1LA 5LSLA 1VRTB 3IP0A 2XSJB 4C3MA 4PWDB 2A10A 3RJMB 1V6HA 2MHNA 1T9UA 3R27A 1NH7A 4EK2A 1X8DA 1FVSA 3NY0A 2V6AA 1UWBB 1U0HA 3OTOJ 2DGUA 2DNKA 4FVMA 1SJRA 3T1HF 4BHQA 4EYHB 3SFUA 4FKYA 2MKIA 1Q5VA 3K89A 4F3QA 4FF2A 2NXUA 4DJBA 2ZH2A 1JLBB 4HHUA 3SBMA 2VG5A 1TL1B 1VQYA 3NMRA 1PJ7A 2WSEC 4YOEA 1NRKA 1OSCA 1H2VZ 2LQBA 4U96A 4NXNJ 1RT6B 2RF2A 4U9RA 1RTHB 3CD7A 5BR8J 4LFAF 4U7UD 4Q8FA 3QIDA 4ED1A 2B6AA 3R7NB 1VBKA 2CUYA 3OR2A 4B08A 4B17A 4ZVTB 2CYYA 2YNIB 1N5VA 2AEJA 2H4WB 6AT1B 2HURA 3QIPB 5F8JA 2IRYA 4FP9A 4ZLJA 4B9SA 3KUEA 4Y00A 3IC1A 3UPFA 1MROA 1IBKJ 3W5ZA 1L3UA 3KOAA 4JI3J 4DSIA 2ADBA 4XDDA 4ZP9A 2EC2A 3TVZA 5KFLA 4OI2A 3TNVA 3OPKA 1N32J 5D0EA 4OYXA 5J2NA 1W7WA 2AYBA 3TA1A 2I8EA 3BF4A 4RU2A 1LW0A 2J7WA 4DX8H 2FJVA 3I32A 1FEHA 5T7LB 3PX0A 5I3UA 5KG3A 3WIUA 2BZ2A 5D0HA 4FYVB 4WJBA 2CPHA 2NSCA 3CSKA 3AD9C 5IT9Y 2B8QA 2DNNA 1QM9A 3CCWA 2BE7D 3PO4A 2IVYA 5F8NA 4LF6J 1KHWA 3D0IE 5M2PA 4Q43A 4MJKA 4DU8A 1RCXB 2GA7A 3D68A 2QFJA 3CXCR 1CJVB 5DLFA 1KVIA 5J2MB 3KWMA 1QTMA 3M8PA 1JLAB 2LXIA 1WTFA 4K4UA 4C97A 2ZVSA 5L1IA 1BUXA 4O4GA 1QVFR 4B9MA 2YWHA 3VGVA 3HK2A 3VHQA 1S6QB 2KFZA 3ZTRA 1FX4A 2E1MC 5HQ8A 2RIJA 1SC4B 5KFRA 2W9BA 2I38A 3I0SA 2HSEB 2VFSA 5IT0A 2MZSA 4QWAA 2BMBA 3N6LA 4YB7A 1S4EA 1DARA 3L7UA 4NEYA 4U6PA 1N36F 3GONA 2HVIA 2LCWA 4RUHA 3OUYB 1L3TA 3HVTA 1T9WA 3T6JA 5DS7A 3BR9A 3RW7A 1MSWD 2HHWA 1TQLA 2UUTA 2DNZA 2Y1IA 4FYDA 4OX7A 1YIJS 1R43A 2V9WA 2B7BB 5IT9U 1IJEB 1NSQA 3MCOA 1NSAA 4P2XA 2G1DA 1Y10A 4CO2A 3BPSP 4CRJA 4F25A 2QN6B 4RL1A 3IG1A 4J9KA 2YPYA 1U1KA 3TR5A 4LSLA 1YJUA 4DU7A 2DNYA 3M8SA 4NZ6A 3VCDA 4PG7A 3FC9A 1K47A 2XWYA 5KOXA 3FGVA 2X1BA 2CJ9A 2VODA 4YFUA 1UEVA 1K1QA 1EAYC 3HCXA 5DM6Q 1UMJA 1UETA 2F63A 1UVNA 1VDHA 5B0EA 4PCQA 3LOUA 1YBTA 5KAKA 4JI5F 3MR5A 3KK3B 2FVSA 2HIYA 5KFSA 1YX2A 4WXWA 3OFHA 4PWUA 3HHNB 4A4JA 1T3OA 2EWHA 5DQGA 1QDUB 5IV4A 1QSLA 2YQ0A 2BRLA 5C25A 4NASA 4CLPA 4WU2A 5HSPA 2HMIA 2KFYA 1U47A 3B6BA 4MK7A 3SDEA 2XZDB 3R3TA 3OL9A 3T1AA 2CQ3A 2X3GA 2LQ8A 3PW5A 2NCKL 2XYGB 3GJTB 2KHDA 2HHPA 1B99A 2WW8A 4IOCQ 4I6WA 3FBCA 1JLCB 4ZJOA 1IBLJ 1P1LA 3EICA 3W60A 3J81Y 3NGUA 4EGLA 3KLIB 3UN2A 1GNKA 4ELTA 3QT8A 2OPSB 3LPEA 4NE9C 3L9ZA 4I68A 2DR6A 4ECSA 4RNNA 1HNVB 2BM0A 3GJRB 5HBMA 1S6UA 4AUKA 1UCNA 1RT2B 2PE8A 4RNFA 4JV5F 1VQ6S 1VK3A 3UWTA 3FRYA 2VG7B 4WFZA 1C1CB 3EJMA 3WX8A 1REGX 3MXHP 4BBYA 1RTDB 1UP1A 1TV6A 4HHJA 3DRXA 2KL8A 4ZS6A 2OGUA 1GTEA 4IRKA 3KJVA 2OTLS 1C1BB 2RS2A 2AJFE 2HRYA 4NL5A 2XEXA 4UTGA 3ZZZA 4IYQA 3SQOP 1OQ6A 1JXVA 5BYSA 2HNYB 3H59A 1DQ8A 2MY7A 4F3MA 4LFBJ 5U47A 2PO4A 3CULA 3IS9A 1LFWA 3J81U 2C2EA 4M8LA 4CIOA 1F5CA 1IKVB 2W2MP 4QYRA 3KG0A 1ZYQA 1L3VA 2J0SD 5DJBA 4AFFA 3EDQB 4RW9A 4DL3A 2CJBA 4YB1P 4GKKF
chains in the Genus database with same CATH topology
1HI8A 1HMVB 3PM9A 2CVIA 5DDOC 1NJWA 5L9XA 2C28A 1KHVA 2R8GA 1UKUA 4C4WA 1HWIA 1J5OA 2FJBB 3PX6A 2JEFA 4DSLA 4OX9F 2PIIA 4WCEQ 1S6PA 2DNHA 3J7A1 3MEGB 1HI1A 2MQPA 2K2PA 3C8YA 3E2EA 3QAUA 4I64A 1ZPVA 1OWXA 1Y3JA 3B4MA 2M52A 3OHAA 1U1RA 2KXHA 3TAQA 2O01C 3GFZA 2DRAA 2VV5A 3BN7A 2F8EX 1GX5A 2W9CB 1QY7A 2R7XA 2CFXA 1N52B 2MKHA 2BANA 2MZRA 2QMWA 1WELA 2RILA 3GV8B 4ECRA 4LFBF 2YNFA 5D4PA 1T05B 3CF5Q 1SBRA 1V3RA 2GIQA 3AA8A 5L8RC 3KMSA 1RYSA 4F3OA 2D3UA 2B0GA 3PV8A 1DJ0A 1SB6A 2FD2A 3V81B 4O44A 1WTBA 5HROA 2WAQD 1RTIB 4TYBA 2RE1A 2OMLA 2OH2A 4OZJA 1SJ3P 1Q86T 3Q23A 2CPZA 2YNGA 2E7XA 1FJGF 3JYTB 4YQWA 5LXRA 2B9YA 1WACA 2KU7A 4K4WA 4ELUA 3OL8A 5B0BA 2N4CA 1FO1A 2A3JA 3MDFA 3MFHA 2ZC3A 4O0IA 4E98A 1CEZA 2K1RA 1AROP 3Q24A 4KV8A 3CD5A 5K8OA 2FJAB 2RMLA 5F8IA 2OLWA 3W2WA 1WWHA 3RU0A 1GXLA 4N76A 3X1LB 3OV7A 4TU8A 5DG9A 3I0RA 3RRGA 1QE1B 4ZP8A 3M1VB 1APSA 1Z4UA 4NA3A 4KIAA 3QLHA 2N4DA 2W4DA 1KLMB 1YQHA 2ZJPQ 2XY7A 2PSZA 1NK8A 2HNDA 2AYEA 4G1PA 3T9NA 3DRSB 2BQRA 4C0OC 2VC0A 2WSCC 4I7FA 3UW1A 3F56A 3Q0AA 5MLCV 1K0TA 4X2BA 3VAJA 1RT5B 3VAMA 4CO3A 1G6BA 2ZH4A 3R5BA 3EGWB 4ITSA 1KQKA 1GH8A 2IVFB 1FKPA 2POKA 1VQMS 2VG5B 3DOKA 3BZQA 5LSOA 5EGYA 3M6WA 4Q2LA 3HVAA 2KT3A 5D4OA 5KG5A 4ZVEA 4TYAA 1BQXA 3LGMA 2DT9A 4ZPTR 3CD6S 1KQGB 3M2RA 1FDNA 3ZZYA 3S8SA 3E3XA 3GR0A 1WI8A 2CKWA 1KVJA 3D5MA 3VALA 1IKYA 1NK6A 1YBAA 4ZVFA 2YKQA 3MM5A 1Q8BA 4NLUA 4OI4A 3D0HE 2RF2B 4OI3A 1IUJA 4PG6A 2EFVA 3BGLA 3H5YA 3NG8A 1R8PA 3RBDA 2HFNA 2RNEA 1UVLA 3OLAA 1YJTA 4LMZA 4ZPBA 4TN2A 5C24B 1U6ZA 3A1YG 1ULRA 4MIAA 3A8EA 2GMJA 4MIBA 1TR0A 2OSRA 3OXFA 1XR7A 5DDQC 3V5RA 4QIEA 2IMWP 2J6UA 3NS5A 2SXLA 4DR5F 1S1WB 2L9WA 4NLGA 5CYQB 4D3HA 4JYAF 2M4MA 4DL7A 3I5CA 1VLYA 4TY8B 2CPYA 5EHHA 4EO6A 1FRHA 3ISNC 1RT4A 1O5JA 3GFXA 3BGRA 5CA5A 4Z2XA 2HWIA 3C6UA 1K8AT 2U1AA 4U7UK 5JVGQ 4A8MP 2DPJA 3SFGA 2JH3A 5J2MA 2FDNA 5C42B 1LK7A 3WC2A 4IQXA 3QGGA 4DN0A 3OJSA 1JLAA 3LW5C 2XNRA 2PT0A 5KFNA 2ZH9A 4ED0A 5L1KA 1NK5A 4AXJA 2ZM6F 1R6YA 3K8WA 4YB6A 1T03A 3ITHA 2IYIA 4ZOSA 2OTJS 1U09A 2DISA 5SUHA 5I42B 1RDRA 2OPRA 4X4TA 4C8LA 2HRUA 5K14A 3Q8RB 3UD4P 2PMZD 3G86A 1S0OA 1IN0A 4B9NA 4ID5B 3IA0A 1NJXA 3MAHA 1SUQB 3J7YU 4A8XA 4Q8EA 1FT8A 2GCFA 2N7CA 4ECWA 5JVHQ 3SSRA 3DOLA 1X5PA 2DITA 2FJDB 4CT9A 2KO1A 3Q8QB 2M8DB 4YDDB 2IBOA 2FGOA 1K73T 3DLLQ 3CCVS 2LKZA 1UW4A 1RAJA 2VFTA 4FF4A 1DAXA 5DG8A 6FD1A 2FC9A 3OQ2A 4XPCA 2E1CA 1TL4A 1U6FA 4B3RF 2YKMA 3POTB 1Y3KA 5KG1A 3ISND 2XS2A 3NCPA 3D54A 3FCHA 1IBMF 2GJ2A 2GJIA 2PD1A 4H4OA 3HHLC 3MMCB 3QWUA 3DLKA 1H6KX 3VQSA 1UVIA 1A7GE 4ES1A 3IAS9 4DQQA 1R8HA 2GW8A 2L08A 2VD3A 2B5JA 3DLGB 3CJ4A 4IG0A 4EYIB 2YY3A 2ASJA 3EUNA 1JJ4A 3CCRS 1KLNA 3PEJA 5FD1A 3QO9B 3S7RA 1UFWA 4NYOA 4YP3A 2WOMB 1JNZB 1NK0A 2NS1B 4OZ5A 3P3DA 4K59A 1H3DA 3H25A 3V6KA 2IYGA 1BLUA 4C0BA 1L3SA 3EYZA 3I31A 3PRBA 1B7FA 2UVUA 4B9VA 2JLEA 4QWBA 2WHOA 2ALZA 5J2NB 1U1OA 1LW2B 3CCLS 1FRMA 2JEIA 2ZBIA 1BQNB 3MTJA 1UAWA 3MCSA 2LA4A 4A8OA 4DSJA 4R5PB 5GAHU 1NKBA 1JKHB 3EPIA 4NZ0A 4H4MB 4IFYA 2AJ4A 1JLFB 3O5TB 5I3UB 3UQSA 1FF2A 1X4DA 2DJWA 2E29A 1REVA 2BJDA 2JLFA 3M30B 3HVRA 2G9OA 2XMUA 3PR5B 3LP2A 4TXSA 4M94A 3V6DA 3IR6B 3B4DA 1Q8IA 4G1QB 4RBUA 4DMZA 4PQUA 5KG4A 1F2GA 4HDGA 3GYXB 4I67A 3HF5A 3R5AA 3QPIA 4L6V3 1X4FA 3HDSA 4RNHA 2C3YA 5LMUF 4LF4F 1CVJA 3HHLD 2VG6B 3MEEA 1K9MT 2IRUA 1CSJA 2LQ5A 4RW4A 2ZH3A 3VZIA 2D3ZA 3UCGA 1DTTB 2H9ZA 3ZC4A 5IWAF 3QJPA 4N77A 4MYUA 4UOCA 3KHHA 2ZZMA 3K0JA 1Z1ZA 3K58A 2ROPA 1P1TA 3GILA 1S9GA 3MHYA 2R7TA 1EP4A 3QJJA 2NREA 4CTAA 4DF8A 3CDBA 2AX0A 2XCPA 2VFUA 1S99A 3SI8A 1RA7A 1JLEB 1R27B 2M3DA 5J1EB 2GO8A 3PIOQ 2HVHA 3PO5A 4XDCA 2CPJA 3Q2SC 4RW8A 1M5SA 4JI4F 3OBIA 2LDIA 3LF0A 4NLQA 3M8PB 3AAWB 3MECB 1LWCA 2A1BA 1UFLA 4AL6A 4EBDA 2CQDA 1TL3A 3PW7A 5CCLA 3LP0B 1MU2A 4NCAA 3RAMA 3J80Y 4A8YA 2AGQA 1RQ0A 2OIHA 2Z2LA 5KFBA 1ZTTA 3P49B 3IO1A 3GZ7A 2I5JA 5GAEI 2E5GA 2VQFF 2KN4A 5CZVA 2FIUA 3O6QA 1PILA 2L3MA 3P96A 2F8MA 1TAQA 4ETZA 1HW9A 5KT3A 2BE2A 5F3TA 2X1GA 2EG2A 3KHLA 1CC7A 4MKAA 1VBZA 4PXDA 1F5BA 1SKWA 4K50A 3PIPQ 4F67A 2W9BB 3CCSS 4JV0A 3G8TA 5A8WB 1PC5A 3PACA 4FZVA 3HXMA 2V4JB 4M1KA 1BGXT 1LWFA 1FVQA 1I6JA 1MW7A 2AQ4A 3DLEA 1VRUB 2E1AA 3RB4A 2KJVA 4DG1A 1DBDA 2VOOA 1C0UB 2V8HA 2Q1LA 1RTJB 4PXCA 4ED6A 1KOOA 4GO7X 5GAGU 1DFDA 2KI2A 1FNMA 1T8EA 5EWEA 2DNPA 2GGPA 5IM0B 1R8CA 3SXLA 1T3NA 4WF9Q 2DNOA 3MWBA 1DHMA 3DXSX 1M5OC 4N41A 2W7AA 2ZH6A 3JSYA 1FE4A 4X66F 4I0WA 2V4QA 2XMTA 3HVTB 5AXMA 1B64A 2LXUA 2RRBA 2HLUA 2HFZA 1ZETA 3FQLA 3OXGA 2HLTA 2UV8G 3HZEA 1Y5LB 3D0GE 2QIFA 3MPYA 5J1PA 1Q7YT 4DEZA 3IGNA 4AL5A 1VIXA 5GADU 1G7CB 2KB2A 3U1MA 2R9LA 1R8BA 1HPZA 3HT3A 3OSNA 1MMLA 1TVRA 4ZPCA 3PR4A 4IOAQ 2OPPA 1RKIA 4HLBA 2UVRA 3BGUA 2FY1A 3R1HA 2QSFA 3NGKA 4R25A 2AW0A 1VQ7S 2ZITA 5F9LA 1WHVA 3MMJA 3GIIA 2XY6A 4ERDA 1VMBA 2AYGA 2QLXA 1S1XA 2YWGA 3JTOA 1ZAVA 1Q7LB 1RT1B 2JHEA 2EC0A 1U1QA 3KLEA 2M7SA 3FEZA 1AW0A 4FNHA 3CC2S 1NKCA 3VAKA 2VPZB 1WD6A 5JJBA 3K5MA 1QLNA 4Q0BA 2O5DA 1IKWA 4OZ1A 2AWZA 1TKXA 2HS3A 4A48A 4OZLA 3W2VB 1UJ5A 3BQ1A 5CH7B 1XNQF 2RU9A 4YB5A 3AA9A 3KK2A 3RB0A 3NLCA 2IJFA 3ICLA 2Q79A 1FKOA 3CEDA 2OPSA 1Y5IB 3IG1B 3L95X 2WSFC 1TK8A 4DV3F 5AXLA 1Z2LA 3HHDA 4LSLB 1WF1A 4DFKA 1YRTA 3CB4A 3GE9A 1TP7A 4NWBA 3UDCA 1E6YA 1R8AA 1YG0A 4WXOA 1N0UA 2MGZB 2KG1A 1N5YA 4ELVA 3K2YA 3LGNA 3T9ZA 4UUXA 5KFKA 2ZJRQ 1M90T 2ASYA 4DHVA 2R8JA 4C8OA 1URRA 1N6QB 2GQCA 1H38A 4QU7A 1KOHA 5CYMB 2DTJA 2FHJA 2E5LF 2ZHOA 1U4BA 2PMHA 2YX4A 4LSNA 4LF5F 4M5DB 3TA0A 2XS5A 1KNZA 4KHPF 2R7OA 1D8ZA 2OPQB 1C0TB 2E1RA 1JXLA 1C1CA 1S6OA 2DH8A 3TQ1A 3MTKA 2VBYA 1I94F 4F26A 3MZIA 4W92B 3EXCX 1KFSA 1A6LA 3UNGC 4G1IA 5EN1A 2KDOA 3KLFA 1N48A 2L48A 2IAJB 2IBKA 2FLPA 3MEDB 5EUHA 4GC6A 2YKNA 4A8QA 2CZ4A 3LALA 4NYPA 3SSSA 4QR1A 4PR6A 5H9EJ 3CC4S 4J9QA 1SIZA 2J7UA 1ZBTA 4KQZA 1U6BA 2OFHX 2FLOA 4K4ZA 4DUZF 3GFHA 3RBEA 2Q3PA 2RKIB 4O3NA 1VC6A 3H2UB 4JI2F 2W7OA 1C1BA 3VAFA 1N5SA 2VBXA 4B9UA 2HQ3A 2O66A 3KG1A 4KFBA 1VQLS 2D74B 2F9JA 3N28A 4RW6A 4K4YA 4CO0A 1AFJA 3BSNA 1S9EB 2MXYA 3VAIA 3QGHA 4B9LA 1HWJA 3HHEA 1YJVA 2LYVA 1NK9A 3HP6A 1PSDA 2X51A 4IOBA 4Y6IA 2RH3A 1ZPWX 2HNYA 3C66A 3GFYA 2ZE2B 3HHKA 2YVSA 2VASA 3LAKA 1R0AB 1OQ3A 3CJ3A 2KZZA 2VZ9A 2HMIB 3LP1A 3SDEB 3MFIA 2DVIA 3TVYA 1MWYA 2BA9A 2N3OA 4YR0A 4J9RA 1V9OA 4ZCKA 2JX2A 2UUWA 3CD0A 3PKYA 1BY9A 3FRZA 3MM6B 1WEZA 4FPRA 2FJWA 1XWLA 3MM7B 5BYRA 4YR3A 3AB2B 4IUFA 5ADZA 3AB4B 5A0YB 2YTCA 2XSJA 3IWXA 3MD1A 4DFJA 3BSCA 1FJ7A 5KFXA 1HBOB 5KFOA 5KFMA 3NAIA 3D1HA 2ZH5A 4B3OB 2LLZA 2OO4A 4PWDA 1IKVA 4C8ZA 5IZHA 4RLEA 2ATLA 3BO2A 2MKCA 4PXBA 3U27A 3I87A 3HHLB 2R7UA 1DLOA 3FEXB 3I55S 1HBNA 4HH0A 5EX3A 5FDLB 5DQIA 4OHWA 4GC7A 4V19X 3FJ2A 2U2FA 5EWGA 3Q8SB 3CPWR 1QUPA 2RSQA 4OHXA 2DK2A 4FN5A 1DTQB 1WI6A 1E6VA 3OFEA 5ITHA 2UUCF 5IS2A 5B0AA 4ZVGA 4LVOP 3DRRA 4Y3CA 2ZH1A 3G6VA 1HBUB 4ID8A 3LO3A 2E44A 4ZPAA 5D77A 6FDRA 2XC9A 3UD3P 2OKQA 3AH6A 4NLRA 1M5KC 1VIOA 1I1GA 3TVKA 4KAIA 3V6HA 1LWEA 1RWUA 3UI3A 4OI6A 2AF6A 2IMOA 2X1AA 1HMVA 3O1LA 4IG3B 4MAKA 1SV5A 1P27B 2C3UA 2KRBA 4ED2A 2MKKA 1MNEA 2JWNA 2WB1D 2AJQA 3G8SA 1NO8A 1LXNA 4QCLA 5HLFB 2IFXA 4Y2IA 5F41A 3MEGA 1H0HB 3SCIE 3CT9A 2MPUA 2R7WA 4F4KA 2JLGA 1JLBA 3IR5B 5B0DA 2D1CA 3NKYA 4ECUA 1IKXB 2DO4A 2K8GA 2YNHA 4OHZA 3JSMA 1TL1A 2C2RA 3C2PA 2HHVA 1HD1A 4K4SA 1WF0A 4U7CA 2W9CA 3H5UA 5CCMA 2MQQA 3OHBA 2BQ3A 4QW9A 1VQ5S 2IVMA 2E9RX 1VGYA 1FDAA 2J5AA 4X62F 2HHHF 4NCBA 1TV6B 4ZCLA 1T05A 3CCQS 4FXWA 3NS6A 4CZCA 3M32B 4NPOA 2EBGA 5KFAA 5B0CA 4OZNA 3GQCA 4H4KC 3DI6B 4KBIA 3V81A 5I3PA 5E7OB 2FVCA 3CIZA 3KJVB 1Q16B 2DR9A 1RTIA 1CPZA 5C5JA 5LMNF 1N5TA 5HMXA 1RTHA 2V4RA 1PC4A 3JYTA 2DR5A 3AJ2A 1T02A 4C3LA 5F8GA 1SJ1A 2DGTA 4E8UA 1RA6A 4JBCA 2UXDF 1QSYA 2B4PA 2ZOFA 5D6GA 1CQNA 2I0XA 2IC3B 3EPGA 2GHPA 1EETB 1R89A 1LOUA 4IFVB 5GAHI 4HI1A 3GIJA 3I5BA 4PKDB 2B9WA 2JEJA 3OTBA 1WNEA 3OTEA 2KH9A 1QE1A 3BREA 4NCGA 4DLGA 3M1VA 2HWHA 2JOQA 2E66A 1HYSA 1S9FA 3AJ1A 4WFBQ 1NJYA 3IAM9 2ZDOA 3SEOA 4C11A 4Q44A 1JLQB 2YNIA 3ETOA 3DRSA 2D3OR 1Q81T 3QMQA 4HYKA 1X9SA 3FSXA 3DMJB 3E8OA 2RDJA 3OSPA 3GWCA 4A8SA 1VC0A 4ECYA 2BW2A 1XMBA 2I2YA 2XSFA 3M2VB 2KHCA 1UVMA 3QIPA 1F5AA 3SYZA 4LFCF 4JI1F 4ES3A 2VKZG 2V5HG 3IBWA 4QPXA 4HVZA 3OR1B 3N4WA 5A8RB 3PDNA 4UQTA 5F0WA 3DM2B 1G1XA 4FXVA 3NCRA 4O4RA 4X64F 3DYAB 2DNQA 1IR0A 3IWNC 1HWKA 1HNIB 1T95A 1XK8A 2MJNA 3PFOA 4DBQA 1TKTA 2KT2A 3M6VA 1FDBA 3C6TB 4KO0A 3GYNA 4GKJF 5J1NA 2JVOA 2PFFB 1X4GA 2HHQA 1S76D 2IM0A 3TAMB 2M70A 2W9AA 4RW9B 2NR0A 5I4MA 3OVAA