4QIVA

Crystal structure of hexameric microcomparment shell protein from aeromonas hydrophila
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
86
structure length
86
Chain Sequence
DALGLIETKGLVACIEAADAMCKAANVELIGYENVGSGLVTAMVKGDVGAVKAAVDSGVESAQRIGEVVTSLVIARPHNDISKIVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a hexameric microcomparment protein from Aeromonas hydrophila
rcsb
source organism Aeromonas hydrophila subsp. hydrophila
molecule tags Structural protein
molecule keywords Bacterial microcompartments family protein
total genus 23
structure length 86
sequence length 86
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00936 BMC BMC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1710 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4qivA00
3DN9A 3CGIA 4QIEA 3I96A 4OLOA 4QIFA 3MPYA 4OX6A 4P2SA 3H8YA 2A1BA 4QIVA 3SSQA 5L38A 3N79A 4AXJA 2G13A 3CIMA 4PPDA 3SSRA 3BN4A 2A10A 3MPWA 4DDFA 2A18A 3IA0A 3SSSA 4QIGA 3DNCA 4P7TA 3I6PA 5DJBA 4AXIA 3NWGA 3VCDA 4RBTA 4P7VA 4RBUA 4OX8A 3PACA 2EWHA 4OX7A 3NGKA 4LIWA 4OLPA 4RBVA
chains in the Genus database with same CATH superfamily
5AXNA 4MKVA 4UOGA 4B9NA 2MJUA 3PW5A 4LF4F 2ACYA 4DUZJ 2D3O1 1I5OB 2HZVA 4CO5A 5SZTA 2ZH6A 6AT1B 1TUVA 3K2YA 4U95A 3QFWA 3BDPA 1RKIA 4P72A 4C0OC 1SC3B 2QLXA 5FJ4A 4NI2B 1SVDA 2LLZA 3JTPA 4EEYA 3AJ1A 2J0QD 4B3SF 2K2PA 2P9EA 3AA8A 4WYWA 4JI3J 5HJYA 1IN0A 1YSJA 5BR8F 1WTBA 1GXTA 1H2UX 1LFPA 5LSRA 5EDWA 4Q45A 1IKYA 2KRRA 1KEKA 4C0HA 2WONA 4J90A 2BEFA 2IPOB 2OFHX 3A3OB 3KK1A 5HLFA 3D4JA 2QL9B 4ID5A 5EX3A 2VASA 2C2KB 1GEHA 3MECA 4TNOA 3K5MA 3NS5A 3OBIA 1VR6A 2BQ3A 2WHOA 1ZA1B 5HL7Q 1YTYA 3RB0A 1W2IA 2RHSB 4H4KC 2D3ZA 1YIJS 2VPZB 2YNHA 1WDDA 4ES1A 3TAQA 2HHVA 3KWMA 1RT1B 3SCKE 2Q3PA 4FDFA 3ULHA 4ZKAA 1YK9A 2IM2A 1MN9A 2ADBA 4KTQA 2IA0A 4I6AA 2VBZA 2AJ4A 2MTLA 4LBIA 1VISA 1I3OB 1PYTA 2R7QA 2A6MA 2KT5A 3D6TB 3IR6B 1FWKA 1XTZA 3BM7A 1Q7LB 2RILA 3EWGA 4ECQA 2ASDA 1T7PA 4HL9A 2Z0GA 5KFPA 1Q0NA 5A8WA 1VHIA 2BM0A 1PO6A 1X4FA 1TVRB 5GAHI 2XQCA 4C8NA 2C2EA 1VJQA 4B02A 3UD5A 3DLKB 1TV6A 3WX4A 4K2JA 1IR2A 2BA9A 3OT9A 2W4PA 4NLXA 3RAMA 4Q43A 3EYZA 1S99A 3FGVA 5KFGA 4KR0B 4JV1A 5K14A 4H4KA 4PYAA 3BF4A 1FKPB 3NG8A 1XEZA 2QN6B 4MJKA 4OZLA 2GAHC 2RJZA 3M05A 3LH2S 3NGTA 3W5YA 4F04B 1H3DA 3PR4A 3CCVS 2QA4S 4LF8F 2XCPA 1X7VA 2X1BA 4ZVFA 3U7JA 2ZH1A 2H1YA 1GX6A 4LRAA 1U6BA 5B0BA 1YLXA 5DGAA 2BUNA 4OZJA 4IOCQ 4P7TA 4OHXA 1NLKL 1IKYB 1FVQA 5IZHA 2HVZA 4E2FB 4PWDA 1JNRB 8RUCA 2E7XA 2XGPA 3MR2A 1FCAA 4ED1A 3D54A 3U1NA 2C22A 2BBEA 2XZWA 4HHJA 1SC4B 4TY9A 3QZ7A 1SKSA 4FPIA 2PEHA 3AAWB 3HI9A 1BQNA 4HACB 2B3TB 5C5JA 4FF3A 2HLTA 3IMQJ 2FPHX 2EBGA 3CGIA 3F41A 1CJKA 3A3NB 2ZEJA 1VQNS 2W4DA 2HLUA 4C7QA 2NXJA 1FDDA 4JV2A 1UJ6A 1GXLA 2ZFHA 3Q24A 3NCRA 4F4ZA 2YWEA 3DOKA 4WU3A 2YNFB 1S9GA 1F2GA 1SC1B 1LXNA 1KHVA 4ZVQB 2GIRA 2NPFA 4WIIA 4PWUA 2LA4A 4NA3A 4C8YA 3DRRB 3HVTA 2DYAA 1NK0A 2EPIA 4NX9A 4CNYA 1UA1A 2UXBJ 4DUTA 2PI4A 2G2OA 1RTHA 2CNLB 2HK3A 1NJYA 5KFIA 4KBIA 2YPZA 2AKWB 2FC8A 3BBCA 3DDNA 4DX7A 1S0OA 3JXOA 3MAAA 3THTA 2W25A 3H59A 1V3RA 2ZZTA 3QT7A 5FLXU 4DL4A 1S1VB 4C8MA 2D3OR 3TAMB 2Z4PA 3V6KA 1L3SA 3AJDA 3LA0A 4WE1B 3OQ2A 4ZDNA 2UVRA 1XNQF 1VYAA 4NCAA 2AV5A 5ETMA 2MLXA 3JS9A 3P96A 4ITSA 2VFSA 2CPYA 3NGRA 3QO9A 3R97A 2DNOA 3UN2A 1UAWA 4FYVB 5F3TA 3CCUS 5HVGA 4UOFA 4HDGA 1REGX 1S5ZA 3DOMA 3KG4A 2DVIA 5HQLA 2L48A 1RQ0A 2V0NA 4DL6A 1IR1A 4I56A 2BKNA 4F0HA 3N28A 3OUYA 4RUAA 3JQKA 1LKZA 3VGTA 3V81B 2H5IB 4NWBA 4DHVA 3ZZPA 4ECTA 4B9SA 1S9EA 2WVCA 3LW5C 5EX0A 3TYTA 5LOQA 2V8HA 4CQ1A 2XC9A 4PRFA 1BWVA 2JHEA 3NKYA 3WX8A 4DR2F 2KXNB 4RNMA 1HNWF 2FY1A 3QIPA 3L9ZA 3NOCA 2E29A 2OKQA 4OHZA 3K8VA 3EE3A 4IKAA 4KPCA 4OZNA 3H2LA 1X4EA 4DUYJ 4P2SA 2YNGA 3FVYA 2B6AB 1LV5A 1WG4A 2OUGA 4OV6A 3BPDA 1XNQJ 1KDNA 2IMOA 2FZCB 4LSLA 8ATCB 2V4QA 2AZ1A 4DV2J 2EFPA 4I64A 3FUYA 5B7WA 5DDRC 5LMUJ 4R8UA 3CCES 1N5QA 2PGCA 3EZOA 3CDWA 3GSDA 4WKYA 5K8MA 3OJUA 1TKTA 1LWCB 4OX9F 3R5DA 4RBUA 2F4FA 1QE1A 2C3MA 3NCPA 3ZZ0A 1M5SA 2KU7A 2KFZA 1RGVA 4PG7A 3U27A 3GILA 3CSKA 3BYPA 2Y9HA 3CDUA 1MN7A 4HACA 4ELUA 4AL5A 3GIMA 3O44A 4HHUA 2JEIA 4L76A 3RAQA 1HWLA 1G3OA 1YVFA 1VBYA 1FWPA 2PSZA 1JLBB 1HBOB 1Q4RA 3GJSB 3QLHA 4QIFA 4DEZA 4N5SA 4QWDA 3BQ2A 4B9MA 3HCXA 4YR3A 4DR6F 1S4FA 3KK3B 1ACMB 1T9TA 2BRKA 3DHXA 1OJ4A 3R6GB 3SSQA 4DQIA 2R2RA 8AT1B 3CIMA 3QJJA 2NXEA 1F9HA 3IRWP 1TU0B 4LFAJ 1S0VA 1MU2A 4B3OB 1X5TA 3Q8YA 2DR7A 3AXKA 1ELOA 2C2NA 3DU5A 2HPUA 3QYYA 3I0RA 3KHLA 4OHYA 1N6QA 2RKIA 3TA1A 2D9PA 1G2EA 3D1HA 2GGPA 4DQRA 4U7UK 2OEMA 3PFOA 3JAMY 1YJTA 3CVKA 2ZH8A 3CC4S 1RTIA 2E1RA 1VLYA 2H3EB 2ZE2A 5DQHA 4ZN3A 3KOAA 1QSSA 3F44A 2RKIB 2MY8A 3ZTPA 3CXCR 1L3VA 4R8UB 3OFGA 4NASA 2HHHJ 4NYOA 1IKWB 1EAYC 3DDKA 4B08A 2CA9A 4EUVA 4USMA 5D8HB 5B09A 5D4OA 3X3UA 3SBMA 4G3IA 1ZPVA 4WPAA 4P73A 2JLGA 2VDHA 1VC0A 3CCTA 1AXQA 4UY85 1VGYA 2EBEA 2WVBA 1UEKA 3EICA 1PG5B 3MWBA 4GMKA 2V4JB 5ETNA 4FS1A 3RB4A 3H98A 3LF0A 4OYWA 2VIHA 2AGPA 1S76D 3MMBA 2MYFA 3F0NA 2YPYA 3VGUA 3CCLS 2QZ8A 2M7SA 4USVA 1TAUA 4DQSA 2XM3A 1UFWA 2E5HA 2H51B 3MEKA 2B4PA 3G6ES 4KT0C 2M2BA 4YR2A 2HQGA 4W98A 3T5KA 2JX2A 3T1HJ 5A2QY 3V6HA 4H4MB 4QZVB 3RR8A 4AYBD 1N54B 1JLCA 4N41A 1DTQB 3M8ZA 2VC1A 1VQSA 1HQUA 1KS2A 2DY1A 4M5JA 2QX0A 4CLWA 4OYIA 2OSQA 1P9QC 2V2VA 1UETA 2H5EA 5GMKa 4WFAQ 2MKSA 1RJJA 1XN9A 3AH6A 3KFWX 3PRBA 3W5ZA 4URGA 3FMWA 3VALA 4NLQA 1YQHA 2HW3A 2X51A 2FVQA 1OYDA 1H72C 3PKMA 2GQ2A 1LK7A 3CJ2A 3J81Y 4Q5VA 5KFDA 4X62F 4OYBA 3M6VA 1KQFB 4RZRA 3QT5A 3N0VA 5D4PA 1TELA 2EG2A 2HRYA 4ER8A 3OVSA 5THWA 2QA4G 3M8WA 5DZ7A 4KH1B 3PIOQ 1I1GA 1LW0A 5KFFA 1C0UB 2YX7A 2XMKA 1BXNA 1YZ7A 2GVDA 3DI6B 3CIZA 3PRVA 4Y00A 2VONA 1RTHB 3BKUA 4ERDA 1FRKA 1PC4A 1WOOA 3BKTA 1XIQA 1U2FA 4HDHA 4F4AA 3FRZA 3GYNA 1RT7B 3OFFA 4I2QA 4YUDA 3CD6S 3FBFA 5I42B 3G8TA 5F9LA 4DV3J 5DG7A 4K4ZA 1VS3A 2AGOA 5I3UA 2V6AA 2MGZA 3G4SS 1N48A 3AOCA 4KKOB 1PAUB 1LWEB 3QRRA 3G6VA 2G1DA 3QNWB 2AU0A 1H74A 5JXSA 4K4VA 1HI1A 4QIWD 2OPQB 1IKVB 2ZNZA 3GIRA 3NEKA 1IM4A 2ZKTA 2CQPA 1D9AA 1LXJA 2CJAA 1FFWB 1SQFA 1B4SA 3H2UB 1NCLA 4CT8A 5AXKA 4WFXA 2R2UA 2ZNYA 2RDJA 5C25A 3M8YA 1NKCA 2DXFA 2JRSA 2M5YA 4DL7A 5DS7A 2BDPA 4JOUA 1PJ6A 4BBYA 3HX9A 2VHGA 3ILIA 2HSEB 2V94A 1SQEA 4OI4A 4CYUB 4TQRA 3PDNA 2HYIB 1MLAA 1EKRA 3GG0A 4RWXA 4TU7A 2DO4A 2WW8A 1ZETA 4E98A 2DNNA 1NUEA 4JB8B 4F26A 1QDUB 2IVFB 4U8VA 1WF0A 4JI6J 5KG4A 3DGPA 1VHFA 2WAQD 1NJWA 4NXMJ 2EI5A 3W9HA 2BMBA 3BSOA 3WIUA 2WK4A 1S9FA 4W90B 4ID8A 5ETLA 2ACMA 2BXJA 4ENOA 4O44B 4RW6A 1RTJB 5IXUA 3KG1A 4OZ0A 1CULA 2KZZA 1GX5A 4KJIA 1QSYA 4LF8J 5AE3A 4LF4J 4F67A 2JFKA 3BGLA 5LL6d 3SMZA 2F63A 2UV8G 5DG9A 4QR2A 2DPJA 1Q8IA 2HVIA 2VG6A 3AJ2A 1RADB 4EMDA 4IFYB 3I56S 1RAOA 2QFIA 2CKWA 1TVRA 3QQCD 1NZ8A 1RLCL 4P71A 5HN0A 3M6WA 2YX1A 2RS8A 5DDOC 1H7XA 3HHLC 2ZJPQ 3HT3A 3DLBA 2LA6A 3FBBA 3V2UC 3FK4A 4WFZA 3LQVA 3GYXB 1VQKS 4ZVPB 1XMBA 2YWKA 3QJPA 2PA3A 1GTEA 2W9AA 4PAAA 1M90T 4QIGA 5F3ZA 3W2VB 4EGLA 3BGUA 2LU2A 1WKLA 3R6LB 3WC0A 2K7JA 4L3NA 7AT1B 1T3OA 3IM8A 3W5XA 3T9ZA 5DDQC 3DHWC 1N36J 2VUGA 5IC4B 4NCGB 5D3GB 1EX8A 1TL3B 2OPRA 2ZD1B 3MEDB 5B0CA 1RWPB 2YQ1A 5KTQA 2C28A 2GAGC 5EGYA 2AYMA 2WVDA 4M5MA 1OQ3A 2HK2A 2O3DA 2I5JB 4P6QA 4PPZA 1MROA 4RW4B 3DRYA 4MKAA 1WC5A 3HZGA 1HHSA 1U09A 1WTFA 1RT2B 2ASYA 2XHCA 1X8DA 3DRSB 3H5UA 3MEDA 2VQEJ 3MZIA 4OZ3A 4RW8B 4GKJF 3CUNA 4M94A 1FA0A 3RW7A 3Q89A 4I69A 4HEA9 3KLHA 3KDNA 4KGXB 3G86A 4K4UA 1JLQB 2H65B 1HWJA 3SCIE 2MQOA 2ZHBA 1EZZB 2DEJA 3P4UB 2VBXA 4PABA 4ANDA 4QBUA 4NLPA 3K0JA 1RISA 4D3GA 3ICLA 3OW2R 1S9EB 3D0GE 3UFCX 1TKTB 4DSJA 1TFWA 4AFFA 4Y6IA 3VGSA 2F9JA 3PACA 1NK4A 4Z37A 2YNHB 3KMQA 1AYEA 4IDKA 4OJHA 3CMAS 1TFYA 1WSRA 1UTAA 3C6UB 3FFIB 2YQ3A 1NSQA 4CO4A 3GR1A 3AT1B 3OR2B 1PSDA 1S1XB 4XAKA 1LW2B 5KT4A 4G1PA 3K57A 5JVGQ 4DSFA 1SXLA 1OWXA 2V8VA 4GC7A 2CAJA 2H4YB 2PO4A 1HNIA 4Q7AA 1IWGA 4QIVA 1U2RA 4FNIA 2HAIA 3SXLA 3GB0A 4DL3A 1HARA 1AUDA 3QSIA 5HROA 4TQSA 4ZPBA 4DN9A 2CG4A 4IQMA 1SKRA 3GFYA 2B4OA 3NWRA 2DGVA 1V3ZA 5IQ6A 5E3QA 3TZZA 3HFZB 3WHIA 3PZPA 3BR8A 2JZ5A 4WZQA 3FZ2A 2AW0A 2XMTA 1U1OA 1RWNB 1WHYA 2P8IA 3TNVA 1UJ4A 4ZMMA 1FXDA 3BGRA 5MAOA 5A6WA 1CVJA 4WXOA 3BREA 3G6XA 1PYOB 2DIUA 3I96A 2RQKA 3FBEA 3OTOJ 1CQNA 2CYYA 3TAPA 4ZLJA 1G4CA 3LP2B 7FD1A 2GVZB 2ZJRQ 1C0UA 1Y5NB 1SKUB 3W66A 2DH7A 2QC3A 1LFWA 1JLFB 2CDQA 3TVZA 4DLGA 5J2PA 4F8RA 1EKSA 5CHCB 4NRUA 1HBMB 3VHQA 3BGRB 3HHLB 1YBTA 3Q2TC 4ETXA 1FXRA 2XHWA 4ZCMA 4G1QA 1CJTA 1T11A 2GIFA 2MLYA 2VFUA 2A0FB 4DPOA 1FDNA 3I4HX 2GVDB 3O2IA 3TP2A 3HHKA 1JKHA 1K1QA 4PG6A 4QR0A 2YKMA 1EB0A 1HNVA 1UFKA 1DY3A 5CYQA 5A0YB 4YHHJ 3M9OB 1F2HA 1ULRA 5B0EA 3H25A 3J7AN 2CZVC 3DMJA 1Q5YA 4N7TA 2CPHA 5KG1A 4A8QA 3ZZRA 3O3LA 1C4AA 4DUZF 2OTLS 1UPMB 3IRXA 3G96A 1UVJA 4USHA 1SJRA 4ZVOB 2YNFA 2IDLA 2V4RA 2VV5A 3CB4A 4ZPCA 1WI6A 4I6YA 3EVMA 4ZVSB 4C11A 1KSPA 2WOMA 1WSVA 2DNGA 4MFBB 2OD6A 3MM9A 1FNMA 3T6JA 3KLFB 3IS9B 3MAHA 2VC0A 1FWLA 1ZM4A 1S10A 2DHHA 5LMNJ 3R1LA 1U2CA 4NXNJ 4RNFA 2PEBA 3MEGA 5KFSA 1NPRA 3UNGC 2ZH4A 2V4JA 4ECYA 2DRDA 1RWUA 5IC6B 4B3TF 2RF2B 2LXUA 4LFBF 4X66J 2RAQA 2DK2A 3DLHA 1NDKA 4HYKA 4OLPA 5IV3A 2F4VJ 2OAUA 2HBZB 4UZBA 2AX1A 2MJNA 2W9CA 2CG8A 3C19A 2VJVA 4DV6J 3ILOA 3LAMA 1U4BA 4B3TJ 1HW9A 2QE5A 1TAQA 2G13A 2RT3A 2GZOA 2P6SA 2R8IA 3HHEA 1XMOF 4WCEQ 2AYGA 2VODA 3KNAA 4ZN1A 1IQTA 1G1XA 5H9FJ 1MROB 1P6TA 2MEWA 5J2NA 1YX2A 5DQIA 1FE0A 2ALYB 5C24B 2V8GA 2CVEA 3I87A 3TA0A 1HFEL 2UUCJ 1RSCA 1CSJA 3OTCA 3PHTA 2XI3A 3IAM9 4G1IA 1N0UA 3T19A 4DUYF 1VBZA 3CD5A 3S7RA 3KJNB 4F36A 2NLWA 2ROGA 2CQ2A 4USTA 4V19J 2QLWA 3D3CJ 2VICA 1FJEB 4OJ3A 2ZH9A 2M8DB 3M6XA 4NI2A 2XYHB 2V34A 1HYSA 5J2MB 4RLEA 2AEFA 3I5BA 1HA1A 2ZVIA 5ETVA 5CCMA 1J5OA 1D1UA 3CULA 4TU8A 3T3FA 3TWZA 4PWWA 4DV5F 1HBNA 1Q82T 3LANA 5L1IA 1V6HA 2OEKA 3IG1A 2F4VF 4DSIA 1IBCB 3AOBA 3LP1B 1YGYA 3UR0A 5KFCA 4DX8H 2M70A 1FJCA 2YH0A 5AXLA 1RWOB 3L3CA 2VG6B 2XY6A 1KC8T 2I2YA 1FO1A 3KNGA 4C6AA 1TL1B 1XERA 4YS2A 2OI2A 5DETA 4DV5J 4DS4A 4NPOA 2XYPB 4I67A 2H4WB 2A2CA 3PFEA 4ZLNA 1JLAB 5IM0A 3GV5B 2N7YA 1UZHA 2FHOB 3ENWA 4DV4J 1Y4ZB 2I38A 3GONA 1Z1ZA 3I9ZA 3ZTQA 3OVAA 4GO7X 5L1KA 4ILMA 1URNA 2E44A 2EFQA 2RUSA 3NS7B 4YEAA 3EZUA 2DHSA 2RVJA 3UDEA 3W8PA 2F5GA 4DV0F 4EZ6A 3EM1A 3P3DA 3HJVA 4X4UA 1E6VA 4RNHA 4F2SA 5B0GA 1LW0B 2I9SA 2EFVA 2QA1A 4ZJOA 1N0VC 2KHCA 2Z56B 1I6JA 5IV4A 2GVZA 4OJ1A 4D3HA 3DLGA 3UE2A 4GVLA 2JVRA 3EGWB 1Y3JA 3CCRS 2J7UA 3C14A 2DNHA 1U0HB 3KLGA 3GFZA 2EVZA 1ZBTA 2CPZA 2G0IA 2V67A 4PXDA 2B43A 1JLFA 4U96A 2XO6A 1RKJA 4TYBA 1HMVB 4FN5A 2WB1D 4CO0A 1CS4B 3QWUA 1UVKA 3TX0A 2WSCC 4EBEA 3OD2A 1KKHA 1R6VA 3SI8A 4RKUC 3JSYA 1HQ2A 1VIXA 3AQOA 3TJ9A 3Q8QB 2KTQA 1LWXA 4ZPVR 1NRKA 2RRAA 1QM9A 1Y9OA 3Q23A 2IRUA 1J5EJ 1P9YA 4AXJA 4BCAA 4KY3A 2XLIA 3EVOA 3G71S 2LQ8A 4NEYA 2XB2D 4G6VB 1Q95G 2HMIB 4A8FA 2E66A 2G2YA 1OIAA 1P8GA 3J7YU 1RWVB 4DN0A 3CWJA 4I7FA 2ZDPA 2CQGA 1DZ5A 2X7IA 5LSLA 3AY0A 2R7RA 1KNZA 3NLCA 3MR6A 3TUPA 2VB6A 1APSA 4UY8T 4RW9A 3RGIA 4GO5X 5E3CA 2W2QP 3HHLD 4WTYA 4A4JA 1UCNA 3TUZC 5L8RC 2FVRA 3MM8A 2PMZD 2UUWA 1RTDB 3FSYA 1E6VB 4CLLA 4HTIA 4WU2A 5IS2A 2DR6A 2W9BA 1F5CA 1XR7A 1FTCA 2EKYA 1QY7A 2HS3A 5HBMB 2G2ZA 3TZXA 3QJLA 4LRCA 1YKWA 1CC8A 3KJVA 3JYTB 3MF5A 1UFLA 2IC3B 4TY8B 5AXMA 3LP1A 5CZVA 4OI3A 3R8YA 2MQPA 1E6YB 1NJIT 1FRJA 5DLGA 3NNAA 5KT6A 3MDFA 2APOA 1SJ1A 4ZCIA 3CCJS 2BQUA 2P9GA 4E0DA 1ZOTA 3TARA 3LALA 1BQNB 3ITHA 2ZWPA 3M2VB 5J2QB 3KHRA 3PHEA 5C42B 3R3TA 2QRRA 1PILA 5GMDA 4QWAA 4OZ5A 4P74A 1VQPS 4S0MA 5L9XA 1U1RA 2Q1LA 4K0KF 2CADA 2D7SA 4NCGA 3VAJA 1RAGB 2AZ3A 4DV0J 1CJVA 2E9ZA 1Q16B 1A9NB 2VFRA 2ZDOA 4HLBA 1RAJA 1WC4A 2QL5B 5KFOA 3C6TA 4RW4A 1B7FA 4ZVEA 4K5SA 1IVZA 1VQLS 1RXOB 3BN4A 3KLVA 1N34F 4DDFA 4QU7A 3IA0A 1CJVB 2AEMA 5K8NA 1GAOA 5ETSA 2UXBF 2AJFE 2GO9A 3GU0A 4FP9A 3R5JB 1BD6A 1FFGB 2W7PA 1I94J 4L6V3 1I51B 2XEXA 4RW7B 2R42A 1SH3A 2H9ZA 5KAKA 2OPSA 4LF6J 5F41A 1Y5IB 4UUWA 5KFWA 4MMOA 1O51A 4GRSA 1BQMB 3DLKA 5DRKA 2DGXA 4WFYA 1R8CA 5E5NA 3T9NA 2ATLA 3WZ0A 2N82B 3W3SA 3VAMA 4IG3B 3UO0A 3J81j 5BYSA 4MK8A 1RCOB 2UXDJ 2CQHA 1NXIA 4TY8A 2HBQB 1F5AA 2MQ8A 3MEGB 3FCHA 4N8OA 4JI2F 2ZH7A 1OY8A 2CJXB 1DAXA 2RD5C 3MOZA 4JI7F 3CMES 3L95X 1E6YA 1KR4A 1CULB 1MMDA 2LMIA 3W9JA 4MAKA 5AE1A 3KLFA 1AB8A 3R5AA 3N4WA 1WF1A 3FEZA 3MD1A 4X4PA 1N5YB 3ENAA 2R7VA 1VK3A 3S6EA 3V81A 3SQOP 5L1LA 5HMXA 2JH3A 3CJ8A 5DM6Q 3PYEA 2CZ9A 4B3MJ 3KUEA 2CWKA 4YY3J 1RE1B 4JV5J 2NPIA 1ZAXA 4CLSA 3BR9A 4O3QA 1HNZJ 4KO0B 2W9BB 5CYQB 1YDLA 2YKAA 5A0YA 1FJGF 1KP6A 4PQUB 4LSLB 1PCAA 3JSRA 4LF1A 3MMCA 2RU3A 1KTQA 3LWMA 2V9KA 3QAEA 4OYXA 2J6TA 4NLOA 4ETZA 3O6QA 2YY3A 1NPKA 4CM0A 2Y8YA 4KKOA 1H6KX 2F8EX 2YBVA 5AE2A 3QMQA 4DQQA 4ED6A 3MPWA 4CLUA 1W2BR 1KRPA 1HBMA 2B5JB 4F4WA 2XTJP 3SV3A 2OIHA 1WEZA 4I0WA 1QLNA 1WDTA 3D68A 2FJWA 2ZOGA 5DJBA 4ZLLA 1UMJA 4ZHRA 5LT5A 1CJTB 2DRAA 1K0VA 3QAUA 3AD9C 3J7A1 3LP2A 4O0NA 3HVTB 1MSWD 1VFJA 1LOUA 2IIHA 3SFUA 3U1LA 2ZBQA 4H4OA 3WDOA 1VC6A 3BSCA 3HP6A 3CCZA 1F0XA 5J1EB 5K5MA 1QVGR 1KQGB 1WG1A 5D6GA 5K8OA 2BR0A 4O3SA 3GG1A 4WYLA 1U0HA 4OL8A 1RHUB 1VBKA 3MM7A 4KB7A 2YWWA 2KH9A 2KM8C 4G65A 4WE1A 4HTJA 4ZHRB 2IJFA 4EYHB 4V1Ak 2Y8WA 2R7TA 2F8MA 4P75A 1PBUA 1C1BA 3WIVA 3PW7A 3B78A 4YDXA 4F0MA 3CO9A 4U9RA 3MEEA 4LRBA 3L7PA 2ZBCA 1D0EA 4O3PA 1Y7PA 2MXYA 3OV7A 2DJWA 4Z7CA 4RNNA 4N56A 1RT5B 4DL0C 3DRPA 3EGZA 3R7SB 4RL1A 1FERA 2LQBA 3R9LA 4CH7A 1M1GA 1ZS6A 3ZZUA 4ECVA 4WJBA 2QO3A 4ZPTR 2IRXA 3DOKB 1JLAA 3OL9A 2XG8A 2KT3A 1S1XA 4LF9F 1X4BA 3V4IB 1WHWA 4LR8A 3LWLA 2EFOA 3UCGA 2HS0A 3KK2A 5IFMA 2X3DA 2IBOA 2UXCF 4B9TA 1CG2A 3BB5A 5HI7A 4DQPA 5EWFA 4RX6A 1EP4A 4LBHA 3VAHA 3U02A 2HNZA 2V9WA 2HNDB 3H8YA 2U1AA 3N79A 1Q8LA 2OEJA 1Q5VA 2V5HG 3EX7B 3RTVA 4XPCA 2IBKA 3O8WA 1VLOA 4ECWA 4ECXA 3T5LA 2N4CA 2IYIA 5D0EA 5F8NA 2DHAA 4LF5F 3BDEA 3CC2S 2AJ2A 2K1RA 4PWDB 2RQCA 1RT3A 1TKZB 5GAEI 2AEJA 2MKJA 2ZH5A 2PFFB 1R6YA 1S7HA 3OTDA 4PG4A 2EK6A 1VQMS 1W7WA 1NK8A 2FGCA 3ISZA 3TW0A 4RW7A 2ZJQQ 3H40A 1JLGA 1NO8A 4JYAJ 2HHQA 2CXEA 4X4RA 2VA2A 1RAEB 2CPJA 2I5JA 2RHQB 3QIDA 2AD9A 1HR0F 5IOLA 1VQ4S 4MKYA 1FX2A 1NK7A 2VOPA 1RT2A 3DRSA 5FD1A 3A3PB 1VOMA 3LP0A 4ZPDA 4F7VA 2BOPA 3SDEB 2R7WA 5C42A 5IT9U 2OD4A 1CBKA 2XCAA 2FLNA 3BGOP 5EN1A 3OL6A 2HNYB 4J9KA 4O4RA 3A1YG 2DNYA 3FSXA 4FZVA 5C2CA 3KK3A 2RRBA 2AJ1A 1AT1B 3M8QA 1FESA 1RDRA 3KUHA 3MHYA 3NGUA 4Y2KA 1HBOA 4BLGA 3N6MA 5A8KB 3SEOA 1CC7A 2AMCB 2HWTA 3D0IE 3EDQB 2HQFA 4P10A 4IRKA 2BRLA 4HI2A 1AFIA 2HHWA 5KFVA 3GSIA 2V68A 4RPFA 2UV8A 2VFTA 3PW0A 4B17A 5HBMA 2J9DE 1LEOA 1UVMA 3BQ1A 3H4BA 1RTJA 2IC3A 1RAFB 4DL5A 5FDLA 3PXGa 3R1HA 2UP1A 3KJVB 3OLBA 4PPDA 4RR5A 4WXWA 4ZVGA 4IQXA 2VD3A 2A18A 1ZA2B 2CQ4A 2YWFA 1EJ7L 2BJ1A 2KJWA 5KG6A 3DXBA 1IQZA 2Q6CA 5KFUA 4DWIA 2B8QA 1F5BA 3K17A 4YFUA 4UW2A 3DYAA 1OQ6A 5HATA 1EHWA 4CTAB 4LF2A 3IBCB 1I94F 3H42A 5A8RB 2DPIA 3AFGA 2EC0A 2XS2A 2QT7A 1T9WA 3MM6B 4BWJA 2QLBB 1BC6A 4CYUA 3NMRA 3OFEA 2FGOA 1RTDA 2H5JB 2YKMB 4W92B 1IJFB 2VG5B 1FI4A 2YNGB 1F9EB 2KHDA 2MSSA 4UF4A 3DMJB 4QW8A 2FLPA 3UDVA 3GP9A 1RTZA 2CPXA 2OP5A 5AJ3J 4EWTA 1GT8A 2BKOA 3E3XA 1NK5A 1JNZB 3CO0P 5CYJA 1TL5A 4MYUA 2YH1A 1AZSB 1T9VA 1R8PA 2O67A 1S49A 3HSZA 4GVBB 4DFMA 5G0RA 5GAHU 1FE4A 3TI0A 3M30B 1JMTA 1TMMA 1ZM2A 2FLLA 1HNWJ 1T02A 2BYCA 5E2QA 4YDDB 5I3UB 1V5IB 4BDPA 1GNKA 4Q0BA 4QJVA 1WNEA 2KJVA 5J2PB 2UVWA 4EO8A 4BWMA 1SKWA 5F8LA 2QLFB 4M5LA 4JI5J 4LIRA 4OX8A 1HBUB 2OGUA 2AYEA 3K5OA 3KMSA 3CEDA 5LXYA 2GNKA 4X65J 4WIQA 3FC9A 4ED0A 2H54B 1ZTWA 4IRDA 1J27A 2ABYA 2E9RX 3BJYA 4U7UD 2LVWA 5KFTA 1UPPA 2UUBF 2OMOA 3D3BJ 4WK1A 1HD1A 1H38A 3MD3A 1CJUA 1ZYQA 2L9WA 1MWZA 2I1RA 3DU6A 4QW9A 2MQLA 4JYAF 3MM6A 3Q8RB 1RI7A 1C4CA 5BYQA 2NS1B 2J9CA 5HVFA 5A8RA 5I4MA 3NBPB 2E1AA 3IR5B 2VG5A 1K47A 3ZZTA 1UVIA 4B9VA 2Q43A 1HD0A 2VPWB 4XPEA 4A8WA 1RABB 2WB4A 3GLJA 1CJKB 3R27A 4C3MA 4JBCA 4LFCJ 2M0GB 3DOLB 3H5SA 2KYZA 4KGVB 1DTQA 3AQPA 4TKTA 4ZPWR 4EFAC 1IBMF 1W25A 2DH9A 3VZIA 1U02A 4LFAF 1RCXB 1FHTA 2DNRA 2O66A 4IH7A 3M6UA 3M30A 3OR1A 2NCKL 2DXDA 5KG5A 4K4WA 1R0AB 1SH2A 1S79A 2QSWA 2ZZNA 4OLOA 2Q66A 1U25A 2BJ9A 2MLZA 3E51A 4KRWA 5BYRA 2HWHA 1VQ5S 1WEYA 2G0CA 3B54A 4YB7A 3T5JA 3MMBB 2EG1A 2HG4A 3IG1B 5L38A 3HVRA 1N5YA 3MMJA 2ZUAA 1HBNB 1TZ0A 4DF4A 2LQ9A 1U1QA 3BBFA 4F3OA 2AIRB 2X1AA 1FTRA 1HI0P 3CJRA 2BX6A 1KBRA 2BOAA 4LSNA 1D09B 3FRYA 3JSMA 1GQEA 3GR0A 1R7IA 3N9UC 1Q8KA 5HQMA 2LXFA 5L39A 2HNYA 3MM5B 1VQOS 2JC0A 2MSTA 2ZVSA 1L3TA 4BS2A 1DLOB 2CQDA 1DHMA 5DM7Q 1PGZA 3M8QB 4URQU 1NDLA 2GX8A 3VWSA 2R8KA 2XMMA 1XWLA 2GW8A 5T7LB 4I4BA 3AODA 1ROFA 3UDLA 9ATCB 4ZP6A 2R7OA 2MQNA 4P2MA 4K0KJ 2WCXA 5B0AA 4NCBA 2DY9A 2OPPA 5MLCV 5KFRA 1PJ7A 1VBXA 5L1JA 4EZ9A 3CCMS 2OO4A 3BQ0A 3NS6A 2Z2ZA 3AOAA 1YJVA 2LQJA 3DKDA 3SSSA 3HHNB 4L75A 2ALZA 4MIAA 1FT8A 5DO2A 3CT9A 2MY7A 2Z57B 5IQQA 3ZO7A 1WACA 2VU5A 3ETOA 4ICLA 4DJBA 1RYRA 1N34J 1RAHB 3L7OA 2R7SA 2DGQA 2HFNA 4C4WA 1GMWA 2MKKA 5HP1B 1B3TA 3PJ9A 3HD2A 4N76A 2VG7A 3ZZZA 4DPWA 4ES3A 1PKUA 4RU2A 1B64A 1FRHA 2DNKA 2HNDA 4LF7F 2CZ4A 2R7UA 3UCUP 4WF9Q 3Q8PB 1H0HB 3HKZD 1TMJA 2DHXA 2C2OB 1X4HA 3ZTSA 5KFMA 2W8KA 2CPIA 3EXCX 4X64F 2J9DA 2VZ9A 4P52A 5HMZA 2B0GA 3IXQA 4M1KA 1R0AA 1FDAA 1RWMB 2A1BA 1GTHA 3K59A 5KFKA 4DFPA 1KTVA 2BE2B 2CJQA 5AJ3F 3THVA 3L09A 2F1FA 3D5MA 4OI2A 5E3PA 2HHUA 1D8ZA 1T0TV 1ZM3A 2P2CB 1HNVB 2PMHA 1K1SA 2XBPA 2XMUA 5A76A 2ZHAA 4AQYF 1HNXJ 4FKYA 4HI1A 1ZAWA 3B6BA 1F1BB 1VMBA 5B0FA 2EC2A 4YHHF 4WWSA 4U8YA 2DXEA 2FY8A 4WP3A 4DX5A 2YTCA 4TVAB 4WBFA 3MM8B 3KJQB 2F9DA 1GXUA 1KQSR 1U47A 4EK2A 2B6AA 4OHVA 1HWKA 1D9FA 2R2TA 2HRTA 1K73T 2B9WA 3PYFA 1FKAF 3QGHA 3OSNA 2E1CA 4X65F 2CPFA 1B0VA 2GCFA 3POTA 2FZKB 2JEGA 2ATCB 5DZ6A 5BXIA 1N5SA 1F9FA 3PEHA 1R3NA 5CD4H 4LF6F 6FD1A 4Z2XA 1FRMA 1MW7A 2JSXA 2W7AA 3K7RA 2MGZB 1RWKB 3VZHA 4EBCA 1FNXH 2D41A 4USWA 1RUSA 1S6QA 3M32B 4ZCKA 3T41A 1SV5A 3CF5Q 2IM1A 4C8ZA 4KGMA 4Y2IA 2FHJA 2UXDF 4NLSA 4DCJB 4JI4J 3DLGB 3LTOA 3TJAA 3WC2A 3FKBA 3K5NA 2J0SD 2AX0A 5E7OB 5G0RB 3NGDA 2XNRA 5HK4A 3V6DA 4MK7A 4ZOSA 4M63A 4NOHA 4C3LA 3M2UA 3J81U 4PEOA 4YB1P 3J7YI 2HHSA 3Q2SC 1CLFA 2HQCA 7FDRA 5HSPA 5KG7A 3WBZA 4CTAA 2DR5A 1OMSA 3D0HE 2YWGA 1GK8A 1RT6B 3I0SB 2QFJA 5IT9Y 3DLEA 1RHQB 2G9OA 1HQUB 3F73A 3NAIA 2DKOB 2VQFJ 4TYAA 3IGVA 4GC6A 1YRUA 3RUBL 2ZH2A 2CQIA 2QSFA 2XS7A 2DTJA 2NYHA 3EVWA 4UOCA 4UT4A 1XR6A 1UZDA 5L46A 3HSDA 4OYZA 4UOHA 3UWTA 1QAIA 1Y10A 2CJYB 2QV6A 2XYGB 1KN6A 4J9NA 5KFQA 2FYXA 5D0GA 4C3KA 3NXZA 4NA2A 3T1HF 3HZEA 1JLQA 2YQ0A 2JWNA 3PX6A 5DGBA 1NSAA 4HR2A 2DR9A 4NLRA 2LECA 1N52B 1NMEB 4C97A 1ZH5A 1WOSA 1VIOA 2HQ3A 4AT1B 1WC1A 4RW8A 3K58A 4CI0B 2XZDB 1B70B 4DV1J 4A8SA 4W4MA 2FHKA 1J5OB 2DO0A 4LF7J 1D8YA 3KLEB 3KLHB 1X4DA 3EGVA 2PIIA 2VPYB 1M5PC 3NOGA 2FHJD 2L41A 4ED7A 4DCPB 1TL3A 4NYPA 4J9QA 3RG6A 2XY5A 4A46A 3AHPA 1OSDA 5G4DA 3VQTA 3KTQA 3PYGA 4IR9A 1LNQA 2PD1A 4ZLPA 3ISNC 2K3IA 3QGGA 1BY9A 3I0RB 3GIKA 5EUHA 2OPRB 2ZD1A 4QWCA 2RH3A 3M8PB 4CZCA 2C2DA 3KYLA 4DZ6A 4A48A 1M0SA 4EO6A 3D2WA 2UUBJ 2FZGB 1UEVA 1HNZF 2NUUG 2L08A 4CO2A 5F8GA 1FJGJ 4CNZA 2CDRB 3FCWA 1OO0B 3B82A 4MKBA 3SV4A 2QMWA 1JLGB 2FD2A 1F60B 4XTTA 3W7BA 1YHQS 4B3RF 1R89A 4JP8A 4BC7A 3OPKA 4IFYA 2Y1LB 3BGFA 1MU2B 2N4DA 2ZHOA 3IP0A 4FXWA 1U8WA 5KFLA 3J80U 3TANA 3A8IA 1WEXA 5KT3A 3BH7B 3Q8VA 1TKDA 2UVUA 1TL4A 3PW2A 3H5XA 5HQ8A 1RYSA 1RP5A 4FVCA 1EQMA 4LVNP 3ENQA 1QSLA 5A8WB 1NPPA 1N32J 1Y0HA 2GJIA 2QA2A 2CQ0A 3N01A 5JJBA 1AROP 4PXEA 4ZJLA 2N7CA 4ELVA 3SZ2A 1F6TA 4B3OA 4RW6B 1OY6A 4XDDA 4JI0J 3G87A 4K4SA 2YKPA 3KK1B 2WOMB 1RHMB 2YNIB 4ID5B 2IAJA 2LCWA 2CPEA 2YKNA 5M2RA 4OI1A 1RT6A 1YBUA 2C3YA 3M9NB 4RO0A 2KL8A 2KZMA 3QRPA 5HMWA 3RRKA 5CQGA 4LFCF 4A8XA 1X5SA 5H9EJ 3MMAB 4X4SA 1FFSB 3KLEA 2ASJA 3MURP 1WOPA 1U1LA 2J8AA 4AXIA 4NLYA 2Y1JA 4K59A 3DLLQ 4RW9B 1MWYA 4ZVHA 3FQKA 1IKXB 3JQJA 5E0OA 4AD6A 4UQGA 2RUGA 3N5FA 1YJRA 4MK9A 1SV5B 2AHOB 2VF3A 3D1OA 5JVHQ 1Z2LA 2V50A 4C0BA 4N8NA 3A8EA 3S1TA 4ZK7M 1EETB 1RT7A 3P8BB 3PTWA 2D1CA 3MM7B 2RSQA 2M9KA 1S97A 1U6FA 3ZZOA 3BS9A 3H4DA 2B8PA 2B4VA 2CQBA 2W24A 3QO9B 4OHWA 4DS5A 3I31A 1N88A 1S6PB 2DNMA 2PN6A 1H98A 1GMVA 3I4PA 4IO9Q 4ALZA 1FX4A 3MUTP 1TR0A 1LWFB 4Q2MA 5F8HA 4DR1J 1SCJB 2LEBA 4PQUA 4Q0BB 3MXHP 3IO1A 2HHHF 1U0SA 3ILJA 3AD7C 3LPEA 4J91A 4X84A 1NEEA 5M2UA 1JQGA 2B4UA 1PAEX 2DBBA 2PA8D 3O5TB 3UPFA 3IN5A 1SB6A 4MYTA 3DN9A 4O23A 4F4XA 4WTOB 3RW6A 4NMLA 5KFBA 3FSIA 3PW4A 4P2FA 3NNHA 1DTTB 3HDSA 1LWFA 3LGMA 4A47A 4DFJA 4X4QA 3OTOF 3HM9A 2JVOA 3M8RA 4O0IA 2ERRA 2RIJA 3CJ0A 2XLJA 4IR1A 5BR8J 2GHPA 2P5VA 2MZ1A 2D3UA 3FZBA 1S9GB 2ZC3A 3ISND 1WC3A 2K8GA 2MZJA 3SQGA 1NSKL 4OI0A 4DF8A 4U67Q 4ED3A 1YITS 2XWXA 1J5EF 5E33A 4DU7A 2AT1B 1TL7A 4A8MP 1WORA 3I5CA 4YR0A 1Q86T 1NU4A 1C2PA 1EETA 3HKWA 1KHWA 1S57A 1Y5LB 1JXLA 3TX8A 4EYIB 4M5GA 2RS2A 4ED8A 1JB0C 2DR8A 3QGPA 2PMWA 5LM7E 1P1LA 5IT0A 3Q83A 1VQ7S 2MZQA 1S12A 2ZOMA 1X0PA 4NLDA 3H0PA 3I82A 4RUCA 4X4NA 2BVZA 2L3MA 2OMLA 4FYXB 3RZAA 4X4OA 4LFBJ 1BWEA 2CFXA 1NZAA 4Q8FA 1VI7A 1AW0A 4K2XA 5FIIA 2B9EA 1DQ9A 1NNDA 3E2EA 2RMLA 1X4GA 1B0TA 1VRUB 2DCUB 3UD3P 2AJ0A 4QR1A 3PJWA 3DNCA 4HHHA 4DV6F 5C24A 3MMAA 3QGIA 4NLUA 3V6JA 2UU9J 4PUOA 4USIA 1GMWD 1RU2A 2RNEA 3MTKA 5K8PA 3NP5A 1TL1A 1PYSB 3MCOA 4J9OA 1GH8A 2ZE2B 4F2RA 5GVQA 4CWBA 2Q6BA 4WFBQ 3GJTB 3I55S 2ZBRA 3PRDA 3CCSS 1KVIA 1FK9B 2EK1A 2EXUA 1BE4A 2B56A 3BZQA 4NMXA 3TVKA 1U1KA 1X9MA 1TK5A 2R4FA 4RNOA 3C8YA 3ZFVA 3RBDA 2WSEC 3R7NB 4Q2LA 1OSCA 3KHHA 2MZSA 2FJEB 3D9BA 2O5DA 3ZXWA 3PYDA 1WF2A 1N6QB 1HYSB 2HBRB 4L72B 4CO3A 4IUFA 2NZCA 3H7HB 2FJAB 5KOXA 2B9YA 1OYEA 3ITHB 1UEUA 1TKZA 2QJ3A 3UN3A 2XSJA 4ZVUB 1M5VC 4C8KA 1QVFR 4OYMA 4CLTA 5LSOA 2KYXA 1H2VZ 2NSCA 2MQQA 1HWIA 3PIPQ 1VJWA 2J7WA 1QUPA 3MM9B 2ILZA 3TEGA 1EP4B 3MR7A 3MECB 4YN3B 2JFDA 3V5RA 4QWEA 3GMGA 3K5LA 4NZ7A 5CAAA 2N3OA 2W8LA 2GV1A 2CIMA 4LRDA 1S6UA 4OX7A 3NGKA 2YWHA 4ZPAA 4ANEA 3GV7B 3JYTA 4NXMF 2Y0SD 3GV8B 1KLMB 2VFVA 2V2QA 4QIEA 5CCLA 1DLOA 3DFEA 3E8OA 1JLEA 4DU8A 2ADCA 1DTTA 2A6OA 4I7FB 5HAOA 1VRUA 1K9MT 2DISA 2BKPA 3FDSA 1CJUB 1HI8A 1RT3B 5E3RA 1VC5A 5AT1B 2JC1A 4AQYJ 3MPDA 4B9LA 4IRCA 3GCWP 3PX0A 1U1NA 3P5TL 3BO4A 1UWAA 4AL7A 1IUJA 4JI4F 3C46A 4C98A 2ROEA 1N8RT 4YQWA 4P2XA 1V3SA 3IC1A 1JXVA 2FJDB 5EWGA 4LMZA 2AQ4A 1RT5A 4OYOA 1SL2A 4Y0FA 1GMUA 4TLQA 2BQRA 3IS9A 1X0FA 3LAKA 3J7Z5 4C9DA 2GMHA 1X5PA 1DBDA 2RDIA 3PG9A 4OQJA 3CDEA 4FKXA 1FJ7A 1RHJB 1UW9A 2KG0A 2IJNA 3CPWR 3HO1A 1KQKA 1RU1A 2FHMA 3CCWA 4KGKA 5KG2A 3RB3A 1YI2S 2FQQB 4JI8J 3KK2B 2J6SA 2NZ4A 4IO1A 2E1MC 4LT6A 4ECUA 2F65A 4I2PB 4IOBA 1O8BA 1SJQA 1UWBB 1HW8A 1RBAA 1JWWA 2YXLA 3ILLA 3DOMB 2AGQA 2C1EB 2GA7A 2FVCA 4KC5A 3LUYA 5KT2A 1DRZA 1OY9A 2W1BA 4K7QA 1UKUA 3A4TA 3W63A 3ZTRA 4QOTA 2KFYA 2OLWA 3AB4B 2EFGA 3VQSA 2VA3A 5D3GA 3C14B 1O0PA 1NDCA 4USUA 4G1QB 3KLGB 3MPVA 3RRHA 3OHAA 4ZIVA 4EBDA 2BJ7A 2LYVA 2XMJA 1FRLA 1GFWB 3TAMA 1L3UA 4PZVA 1VRTB 1H2TZ 2Z30B 3KG0A 3I9V9 1RHRB 4ATNA 4R5PB 2UXCJ 1UA0A 2OH2A 3MAAB 3MI7X 3Q0AA 3G8QA 1S48A 1BHNA 5GAGU 2ZUGA 1S1TA 4KQZA 2ILYA 2QYGA 1RB0A 1U24A 2F3JA 1RAAB 1T9XA 2BM1A 3HXMA 1DFDA 1QUVA 4LREA 3NL0A 2DNPA 4IDKB 2E1PA 3TQ1A 1ZM9A 1JXEA 4KO0A 3JTNA 4N47A 5LJ3Y 2W2NP 1NDPA 4OMFG 4NRTA 4ZP7A 3QZ8A 5IWAF 4USJC 5J1PA 4JI8F 2CQCA 2EFNA 2V63A 2YVSA 5KFYA 2W7OA 1ICEB 3LPYA 1KOOA 4GVBA 2LP4A 1CQMA 2FJXA 1X4CA 3NMAA 2JLEA 3K8WA 3POTB 5CH7B 1WKKA 3TZWA 3DLJA 3MUMP 1IBMJ 1T03A 4RUHA 4LBPA 2G1HA 3HFKA 5B0DA 2AWZA 4DV7J 2OELA 2IDEA 3UNYA 1SI9A 4UUXA 1BQMA 2DGUA 2DNQA 3IFEA 5F8MA 2BANA 1L5UA 1NHUA 1UL3A 4O4GA 1IR0A 3UVJB 3OJSA 2Z2YB 4YB6A 4DZDA 3SDEA 3G8SA 1LW2A 2NXUA 3N5BA 3M1VA 4LVOP 2YKNB 4TLRA 5HJXA 2I0XA 2IVYA 3ONQA 3ZC4A 1RA7A 2IM0A 1MMLA 4DOZA 4K4TA 4DV4F 4MT1A 3R5CA 2KVQE 2F8HA 4HT7A 2HGNA 1HL6A 4DMZA 3KKFA 4PXCA 3IR7B 3Q86A 1ZTTA 1KONA 3BV8A 4JI6F 1JX4A 4JI3F 4O3RA 4IOAQ 5F8IA 5M2PA 4EI2A 3D28A 4F0KA 4DR7F 3M9MB 1D3WA 2C2ZB 2K1RB 3MCMA 2P9CA 4ZJQA 3EUNA 2Z2MA 2RF2A 4M5DB 3EPIA 1KLNA 3UI3A 4LR7A 1SUQB 3IWXA 1AA1B 2KI2A 2MB0B 4K5RA 2HHXA 2BJDA 1XMQJ 1F3VA 1Q81T 2JEJA 3FCVA 1XNRF 3Q8UA 2W9CB 1YJWS 1Y00A 4FYYB 2E5JA 1O5JA 1REVA 2CQ1A 2QG9B 3HFVA 3LOUA 2J8SA 1K44A 3TZYA 1Z2ZA 4ZS6A 2HQDA 1FVSA 1SUQA 2LFVA 3ET6A 4IG0A 1B0PA 4BHQA 4CM2A 3BSNA 1NJZA 2WTFA 3CC7S 4WKRA 1T03B 4Y65A 4K4YA 1RZMA 1JJHA 2PC6A 5F8JA 5DG8A 3VAIA 1HLWA 2WONB 1TP7A 2VDIA 3NWGA 1BGXT 5D78A 5GADI 1AFJA 2GQCA 4DR5J 2NREA 3NY0A 4ZCLA 2LU1A 3KXDA 4I68A 3TJ8A 3S8SA 2XMAA 4O44A 4DI6A 1RHKB 3BYRA 1RA6A 1T9YA 3QBCA 4NLWA 3D1QA 4ZVTB 1FD2A 3ADAC 4KV8B 1X5OA 5HLFB 4QU6A 3CCQS 4X4VA 2JOQA 2QMUB 3OXGA 4XDCA 6FDRA 4CCHA 1JKHB 1S59A 3M1VB 1PIEA 1SIZA 1URRA 2FC9A 1D9DA 3MOJB 2RE1A 2ZC4A 3D6MB 4HH1A 5J2QA 3NBPA 3W65A 3EPGA 1S0NA 2J0WA 2Y3YA 2XSFA 3FMBA 4N77A 3UVJA 4DX6A 1NH7A 1RBLA 1R43A 3QIPB 3DCAA 4NZ0A 2KKHA 3FJ2A 1X4AA 4YMEA 1HHQA 2AYBA 2CPDA 2VOOA 1ZZFA 3GFXA 3TUIC 3UCZP 4ZA1A 4DBQA 1TL7B 5C25B 5JUMA 3L7UA 3DGVA 1R0BG 3Q8SB 3DM2B 1K8AT 2HHTA 1L3KA 1WHXA 1HPZB 2K7KA 1S4EA 3D7SB 4KHMA 3MPUB 1T05B 1IBLJ 2L9NA 2XMWA 1DJ0A 4MIBA 5H9EK 5F0UA 3FNNA 2XS5A 4JI1F 1ZAVA 2NYIA 3QWPA 2XO7A 4UQTA 2GMLA 3OSPA 2CWXA 1PBAA 4HT5A 2IHR1 3DI6A 5I3PA 3S01A 2QL7B 2FVSA 4FNHA 2CNOB 2V2ZA 4ZVRB 4EU0A 4OIXA 3M2UB 3EDRB 1YJ9S 3K89A 2PDAA 4ES2A 4C2MA 1XQIA 4Y34A 3IBWA 3PNIA 3MCSA 2ZITA 4Y2CA 2Y1IA 4DR3F 1ZZNA 1SH0A 4JV5F 4AE5A 1YRXA 3HHDA 2B9XA 5DDPC 1QJHA 2BE9B 2N3LA 4DSKA 4PG8A 4WK3A 3G6YA 1Z4UA 3V4MA 3CDAA 4J9RA 2M52A 5D15A 2NQPA 1IKVA 2E5LJ 1WKJA 3A8KA 1SJ3P 4DR1F 2OJ3A 4B9UA 4PR6A 2VPXB 2DNLA 4I2PA 2R7XA 2BW2A 2BJ3A 2C2RA 3GZ7A 1JLCB 2DCLA 2HBYB 2DEIA 5ETTA 1PJ5A 5I42A 1OPZA 1JLEB 3ZNUA 2PE8A 4J9SA 3WQPA 3IWNC 1FF2A 3EXYA 1A7GE 5T41A 3HSGA 4Y3CA 2DHGA 2U2FA 2V8PA 2PT0A 2RQ4A 3OR2A 4CT9A 2MZRA 3H5YA 2G4BA 4UTGA 1JJ2R 2J9EA 2GFFA 5ETRA 2COLA 2OHDA 3OL7A 4H4MA 4OZ2A 3D67A 4NLGA 1VQ6S 2ZBPA 3EGNA 4F4YA 3DM2A 3PEJA 2XY7A 4O3NA 4XIUA 2HRUA 3BO2A 3B4MA 4I1TA 1QAYA 5DLFA 1MG7A 3GJQB 2MKIA 4F50A 4WZMA 2K3KA 1JJCB 3HLUA 3CD0A 2G0JA 2DH8A 4URSA 3SCJE 4NL5A 2R9LA 1NKBA 1IKWA 1LQ9A 1HKAA 4DV3F 2E5IA 4KFBA 2PI5A 1C1CB 4MTPA 3CJKA 2QGFB 4ED5A 2OSRA 1NHVA 1RWWB 5CYMA 3TO8A 4UZCA 3M2RA 2AP6A 4PXBA 1U7LA 2BE7D 4Y2MA 3DRXA 3KUGA 4MIWA 3ENVA 4CH0S 2GGPB 1S7IA 4K4XA 1QD1A 3X1LB 1FK9A 4NE9C 2EKNA 4PG5A 4HH0A 4Y28C 1IJEB 2B51A 1HR0J 1RACB 1RTIB 1N4LA 1HNXF 3VAGA 5KFXA 1KWMA 1Y3KA 3GYGA 3OTBA 5ETPA 1Q8BA 1REVB 3QPIA 2HVDA 4RBTA 1S6OA 3P45B 5ETOA 3RRGA 4DL2A 1FKPA 2GC8A 3PX4A 5J2NB 1MWQA 2VH7A 3HULA 2XULA 2J5AA 4L73A 4CIOA 4ECZA 3C15A 3FQLA 3HPOA 3BPSP 1IM6A 3AB2B 2DGTA 3MM5A 1LK5A 3GIIA 2ASLA 4GKKJ 1N33F 1Q78A 3TVYA 2E7WA 2JLFA 3JAMU 4NXNF 4X64J 1UP1A 2A3JA 3PV8A 3QLHB 2A2DA 2KXFA 4DR2J 2HFSA 4CO1A 4CLPA 2WW4A 2J7KA 3A13A 2CQ3A 1IBLF 3H2VE 4B3RJ 4GKKF 4CLZA 3DXSX 2DNZA 4X66F 4FVMA 1G6BA 2XZTB 3HF5A 4NLTA 5K9FA 2HHPA 1X60A 2OPPB 4K8RA 3OR1B 5KG0A 3CJ4A 2D9OA 3RYLA 1LWCA 1NK6A 2WSFC 2YX4A 2GS8A 2HNZB 2HURA 4MFBA 3PY8A 3C6TB 4L3KA 2ZWOA 1U8SA 2DITA 3MTJA 5T7LA 1DURA 5JMNA 5H1SV 4A8KA 4KHPF 1SBRA 4KIAA 2HFZA 5KFHA 4DV7F 5CYMB 1FXLA 1R27B 3IRXB 4DR3J 4OYPA 2KXHA 4QYZJ 2GO8A 2VKZG 2EWHA 4DR4F 3OLAA 4PUOB 3GJRB 2BABA 4C11B 2LEPA 3UQSA 1VK8A 4KPYA 1S77D 1YZ6A 3JSBA 4KFBB 4FXDA 4V19X 1EARA 4ZP8A 4TU9A 3C2PA 3VV2B 2H48B 2ZZMA 1X9WA 4LRFA 3HD1A 2XGQA 4JI1J 4CRJA 3GE9A 5ITHA 5HANA 2XI2A 1R8BA 2LQ5A 5GMEA 4ECRA 1A6LA 2BV3A 2EEYA 3R7BB 4C8LA 2NXNA 3JQMA 2IJRA 3SQGB 3W2WB 4YP3A 2GHWA 2NR0A 4RJVA 2LEAA 2SXLA 4NYZA 4J9MA 4QQBA 2RQMA 4FBUA 3DOLA 5J1EA 4CH1A 5CA5A 1DARA 2IRYA 3P5BP 5ADZA 2GJ2A 3BSAA 2KG1A 4LQ3A 9RUBA 3BN7A 4I2QB 1FKOA 1OPIA 4DXLA 1S1TB 5D4LA 3W9IA 1BQXA 2E9TA 2E5GA 3BH6B 1CPZA 5CZXA 2UUAJ 4OX6A 4CDIA 2CRLA 1AZSA 2MKYA 1WD6A 5KFEA 2B5JA 1NKEA 2UZAA 2W4CA 2RU9A 3DLEB 4DPUA 3I0SA 4Y2AA 1NM2A 2HIQA 2KB2A 4J37A 3N6LA 2BW7A 2CJBA 5HROB 1UWBA 1FRXA 3G82A 3VGVA 5KFNA 1M1HA 3VCDA 2BJ8A 3MUVP 2X1FA 1XBWA 2WVEA 3HT0A 1YJUA 4QYRA 1QAXA 1TK0A 3A12A 4FBTA 1TKXA 2B7BB 1MNEA 3M7VA 2MZTA 4KAIA 2QEXS 4LF9J 4JI5F 2KFNA 1JK9B 5LXRA 1HHTP 1RT4A 1S6PA 4JI2J 1R31A 4JI7J 3TRGA 4XO0A 1T94A 2POKA 4ED4A 5F0WA 3TA2A 1T05A 2GIQA 2ROPA 1W26A 5KFZA 4ECSA 1R8HA 2JDJA 2HQIA 2Z8QA 4PQAA 2KDOA 3LGHA 2R8GA 4DG1B 4B3MF 3R2DJ 4GKJJ 2KO1A 4NEZA 4OZ1A 1Q53A 3G2XA 5GAGI 4FS2A 4AL6A 2C42A 3W2WA 3BO3A 1IBKJ 3QATA 5BJRA 2MKCA 2FJBB 1B7YB 2C3PA 2L9DA 1RWXB 5HMYA 2R2SA 1U48A 2IYGA 2WRMA 1DQAA 3VVTA 2GHVC 3AXMA 3OVBA 3SIPB 1EIYB 1FEEA 3CTRA 5A8KA 2I8EA 4IG3A 5KOWA 3M8SA 1X31C 4X62J 5EWEA 3NAHA 3GWCA 3IBFB 3A8JA 1YRTA 4OX9J 3NCQA 3MMCB 1HQEB 4RWWA 1RBOB 4QPTA 2GJFA 1C0TB 1QTNB 3HVAA 4MH8A 4XK8C 2MQMA 1U6ZA 2CNNB 4ZIWA 2VBWA 5ETQA 1N56A 4FF4A 4HVZA 5D77A 5FDLB 3HSJA 2NSBA 1UVLA 4KV8A 5GADU 4J7CA 4M5KA 1KLMA 2ZKUA 3TUJC 4L74A 4WP9A 3F56A 3IGNA 4DCOB 3R2CJ 4H54A 1UW4A 3C6UA 3GPAA 2VJUA 1TUGB 2BJEA 2JJ4D 3MAQA 2IAJB 1SL0A 4DR4J 3W8GA 1NH8A 4LUBA 5KG3A 3ET6B 4IG0B 4PKDB 4FPRA 4IH5A 4F02A 5KT7A 2HZAA 2HVEA 1N32F 1V5VA 3G9CA 3R5BA 1TQLA 4Z7YA 4OYAA 4CLYA 1XC9A 3B8HA 2FIUA 4QCLA 4WP8A 2CNKB 4J9UE 3TEHB 1WUUA 5J2MA 1ITPA 3GFHA 3M4XA 2KM8B 1O6XA 1WHVA 3US5A 2HS4A 4A8OA 3M2VA 2QIFA 3P6YC 3QRQA 4K50A 1P1TA 1S1WB 4CLKA 3JB9k 2J76E 2ZOFA 4ILRA 3PO4A 3QT8A 4CP5A 2V8DA 5IWAJ 3LP0B 4X2BA 1SJFA 2IM3A 3C66A 5KFAA 3C15B 1KFDA 1NAQA 1H73A 3AD8C 2FB0A 3E01A 4IFVA 2JNJA 1RT1A 2W2PP 3ZZYA 4M5DA 3B4DA 4FYWB 2QYCA 3CD7A 1WJ9A 4KGZB 4M95A 3IAS9 3M8PA 2VL1A 4FF2A 2HAFA 1R8AA 1BLUA 4U6PA 3PKYA 2YKOA 3KHGA 2CJKA 1Q1KA 1X9SA 2FUG9 1KVKA 1C0TA 2KVIA 1G7CB 4J5OA 5C2GA 2WZ1A 4F25A 3VAKA 4O4GB 1QAJA 4DR5F 4B3SJ 3AA9A 4KH0B 2Q79A 3DRPB 4USKA 4QPXA 2BANB 4ZITA 2I6WA 5FLXY 3RR7A 4LIWA 2KRBA 2MHEA 1C1CA 1IXKA 2Z58B 3KJFB 4FXVA 4R0EA 5K20B 4IH6A 3UR3C 4DR6J 4PCQA 2M3DA 4M5NA 2MKHA 1KVJA 1S72S 5E41A 4WFNQ 3OUYB 2IFXA 2GMJA 1MMNA 4LF5J 2P6TA 2OPQA 5I3QA 2FJVA 4DG1A 2LDYA 2Z2LA 3SSRA 2KN4A 5RUBA 4HKQA 2F40A 4KYZA 5SUHA 3KLIA 1SPBP 3P49B 3QFHA 3V4IA 3RAXA 4DR7J 5B08A 4PYDA 1RAIB 3TQEA 4C8OA 1F3FA 2OFGX 1WI8A 1DQ8A 4YB5A 3UDCA 1P27B 1NB2A 2W2MP 3L4BC 5H9FK 5J1NA 4LJMA 1YJ7A 2QLJB 1NBEB 3C16B 1VDHA 5D4NA 2MMYA 2J6UA 2PFDA 3C3LA 1C1BB 1TKXB 4OI6A 2XNQA 3PR5B 3EMTA 2W01A 3VF0B 3EZ5A 2HKEA 1Q79A 3G82B 3MPYA 2VQEF 4J9VA 1S1UB 3CW2C 3MEEB 2Y1RI 3HJFA 3W1YC 3O1LA 2BZ2A 5GAEU 1FDBA 1FRIA 2HFUA 2UU9F 2MDAA 4KHPJ 1VQYA 1U1PA 2HMIA 2HGMA 4DPTA 1FNOA 1S1UA 1V9OA 1U45A 4ANCA 1XMOJ 1N36F 2HVHA 4M8LA 2IY5B 1U1MA 4BC9A 2AF6A 4R25A 1SC6A 3PVXA 1T3NA 4A8YA 1NSPA 3OL8A 1S6QB 3M32A 2IMWP 2RB7A 3MCNA 3PJXA 3UN5A 2EW9A 5IM0B 4I6WA 2DIVA 3LO3A 3CJQA 4ELTA 1HBUA 1CS4A 4OV1A 2C3OA 2HZCA 1ZPWX 1BUXA 3CJ3A 3K5PA 2NXCA 1HWUA 5LMNF 4DSEA 1HPZA 3ZNJ1 3RJMB 4TN2A 4RUBA 5C7PA 3W62A 4OJGA 3BBBA 3FEXB 4LSZB 3HMJG 3T1YF 2D69A 1IKXA 1VRQC 3J7ZT 1N33J 5CXTA 2DGOA 2VG7B 3I32A 3SYZA 1JIHA 1YBAA 4LR9A 1HNIB 5ETKA 3EJMA 3VVUA 1T8EA 2K06A 4P7VA 1BMQB 4JUZA 2YKQA 3SFGA 2M4MA 3OHBA 5IT4A 2WVFA 3BKFA 2XMVA 3TR5A 3MR5A 1J2VA 2R8JA 2MPUA 2CJ9A 5U47A 3QT6A 1S0MA 3CMQA 1RLDA 2JEFA 1WWHA 2YNIA 2LKZA 2BE2A 3IM9A 3QSYB 3DYAB 3FEYB 2R8HA 2DRBA 1T9UA 4ED2A 4DLEA 3HK2A 1IBKF 1XNRJ 1KOHA 5K14B 4Q44A 2UUCF 2CVIA 2CUYA 2V69A 3CNQP 2FLOA 3THPA 5KT5A 1JJ4A 4JI0F 2NUHA 4NA1A 1TV6B 2MHNA 2XSJB 2OPSB 2F7VA 4LQ9A 2ZH3A 3I6PA 1S1WA 2B7CB 3E01B 4IFVB 4ICLB 3MR3A 1QTMA 3RBXA 2FVPA 3OXLA 4M5HA 2WBMA 1U26A 1YG0A 3W60A 1UVNA 1K0TA 1TUWA 2IVMA 2ZBIA 5HVHA 3JSMB 5HP1A 4DPXA 1M5HA 3PM9A 3MFIA 1FEHA 1WC6A 2ZM6F 3PO5A 1M1KT 3RB6A 5LMUF 3D6FB 3MFHA 1WC0A 5A2QU 4J9PA 1XMQF 3Q22A 1U49A 3W61A 2HIYA 2O1PA 3GTYX 3JTOA 2LDIA 4KHRA 1T95A 1M5OC 1H7WA 1JLBA 3MGJA 4DSLA 1N5TA 3W64A 3CJ5A 1KFSA 1Q7YT 1A0OB 1WELA 5KFJA 3PCOB 3RBEA 3DGPB 3T1AA 3CE8A 3ELHA 3ETMA 1M5KC 3W2VA 2M88A 4DV1F 3CDBA 2V2KA 4X4TA 5HO4A 1NJXA 1OS5A 1SQGA 1CEZA 2LXIA 3M2RB 4C48A 5DQGA 1QE1B 3T6BA 3I5AA 1XR5A 2FTRA 2R3VA 3CJKB 3GQCA 4IYQA 2HFVA 3OTEA 1VCTA 3GCXP 2HWIA 1UJ5A 2BACA 2UUTA 3UW1A 3H20A 5L9NA 1HQEA 2HGLA 4LSNB 4CLFA 1B99A 3J80Y 4R0JA 2M8HA 3VTIA 4JV0A 1EQ0A 2O01C 3T5HA 1LWEA 5D0HA 1HIYA 2VQFF 2XLKA 2ZM6J 3HHLA 2JL9A 3N6NA 4TXSA 2QMXA 4KE5A 3LGNA 5CD4A 1NB7A 2WBRA 5T14A 1SL1A 2FDNA 3CJTA 5A6PA 1VQ8S 2DGSA 3R5GA 2UVVA 1XK8A 1FD8A 3SCLE 4J9LA 2GQQA 2DB1A 1YWXA 2W2OP 2OTJS 1PC5A 4DPYA 1AUSL 2E7VA 4M5IA 3VR1A 2VKRA 4DFKA 3D66A 5E3AA 3GIJA 4KSEB 1VRTA 4R5PA 4FYDA 2E5LF 2QTWA 1RT4B 3IWLA 1WG5A 2KT2A 4YOEA 1N5VA 2D74B 1NHKL 3UD4P 3TOQA 1IWAA 2DGWA 5CABA 4RBVA 3BEGB 4OFZA 3D6HB 5D0RA 4E8UA 1NK9A 3NRBA 5LJ5Y 2UUAF 2DT9A 3V6DB 1RK8A 1R0CB 3DDIA 4F3MA 4NZ6A 4QWBA 2RRNA 2X1GA 4O3OA 3RU0A 1SJ4P 4F3QA 4F4KA 4ZP9A 2C3UA 4RU9A 2HEKA 3U1MA 3NGSA 1S1VA 4YY3F 3CJSA 4U7CA 4Q8EA 2IA6A 1FKOB 1Y11A 2C2MB 2VBYA 2A10A 3DRRA 3HVWA 2XWYA 3OFHA 4NLVA 4P9SA 4QYZK 2AJQA 1YJNS 4ILLA 3OXFA 1SIWB 4DV2F 3NNCA 2Y0BB 3C16A 1VQ9S 5EHHA 2HFOA 2RDDA 3RBZA 3KDOA 1TTHB 4AUKA 1XJWB 3T1YJ 2X3GA 3ZTOA 5F9NA 3FBCA 3DC2A 1HMVA 3FFIA 1TK8A 2DD8S 1KD1T 2J0XA 4FF1A 4H4OB 3VAFA 3KLIB 3H90A
chains in the Genus database with same CATH topology
5AXNA 4B9NA 2MJUA 3PW5A 4LF4F 2ACYA 4CO5A 5SZTA 2ZH6A 3BDPA 1TUVA 3K2YA 1RKIA 4C0OC 2QLXA 5FJ4A 2LLZA 3JTPA 4EEYA 2J0QD 3AJ1A 4B3SF 2R7TA 2K2PA 2P9EA 3AA8A 4WYWA 1IN0A 1YSJA 5BR8F 1WTBA 1GXTA 1H2UX 1LFPA 5LSRA 5EDWA 4Q45A 1IKYA 2KRRA 1KEKA 4C0HA 2WONA 5HLFA 2OFHX 3KK1A 2KZMA 4ID5A 5EX3A 2VASA 3MECA 4TNOA 3K5MA 3NS5A 3OBIA 2WHOA 5HL7Q 1YTYA 3RB0A 1W2IA 4H4KC 2D3ZA 1YIJS 2VPZB 2YNHA 3TAQA 4ES1A 2HHVA 3KWMA 1RT1B 3SCKE 2Q3PA 3ULHA 4ZKAA 2IM2A 2ADBA 4KTQA 2IA0A 4I6AA 2VBZA 2AJ4A 1N6QA 2R8KA 2R7QA 3IR6B 2KT5A 4UUXA 1XTZA 3BM7A 4ECQA 1Q7LB 2RILA 2ASDA 1T7PA 4HL9A 2Z0GA 5KFPA 5A8WA 2BM0A 1PO6A 1X4FA 1TVRB 5GAHI 2C2EA 4C8NA 4B02A 3DLKB 1TV6A 3WX4A 2BA9A 3RAMA 4NLXA 2W4PA 3EYZA 4Q43A 4JV1A 1M5KC 1S99A 3FGVA 5KFGA 4KR0B 5K14A 4H4KA 3BF4A 1FKPB 3NG8A 1XEZA 4MJKA 4OZLA 2RJZA 3M05A 3LH2S 3CCVS 3PR4A 2QA4S 1H3DA 4LF8F 2XCPA 1X7VA 2X1BA 4ZVFA 3U7JA 2ZH1A 1GX6A 1U6BA 5B0BA 5DGAA 2BUNA 4OZJA 4IOCQ 4P7TA 4OHXA 1IKYB 1FVQA 5IZHA 2HVZA 4PWDA 1JNRB 2XGPA 2E7XA 4ED1A 3MR2A 1FCAA 2C22A 3D54A 3U1NA 2BBEA 2XZWA 4HHJA 4TY9A 3QZ7A 1SKSA 2PEHA 3AAWB 3HI9A 1BQNA 5C5JA 2B3TB 4FF3A 2HLTA 2FPHX 2EBGA 3CGIA 3F41A 1VQNS 2W4DA 2HLUA 4C7QA 1FDDA 4JV2A 1UJ6A 1GXLA 2ZFHA 3Q24A 3NCRA 4F4ZA 2YWEA 3DOKA 4WU3A 2YNFB 1S9GA 1F2GA 1LXNA 1KHVA 2NPFA 2GIRA 4WIIA 4PWUA 2LA4A 4NA3A 4C8YA 3DRRB 3HVTA 1NK0A 2EPIA 4NX9A 4CNYA 1UA1A 2PI4A 1RTHA 1NJYA 5KFIA 4KBIA 3DDNA 2FC8A 1S0OA 3THTA 2W25A 3H59A 1V3RA 4DL4A 1S1VB 4C8MA 2D3OR 3TAMB 2Z4PA 3V6KA 4WE1B 1XNQF 3OQ2A 4ZDNA 2UVRA 4NCAA 2AV5A 3P96A 4ITSA 2VFSA 2CPYA 3QO9A 2DNOA 1UAWA 3CCUS 5F3TA 4HDGA 3DOMA 3KG4A 2DVIA 2L48A 1RQ0A 2V0NA 4DL6A 4I56A 3N28A 3OUYA 4RUAA 1LKZA 3V81B 4NWBA 4DHVA 3ZZPA 4ECTA 4B9SA 1S9EA 3LW5C 5EX0A 3TYTA 2XC9A 2V8HA 4CQ1A 4PRFA 2JHEA 3NKYA 1HNWF 4DR2F 2KXNB 4RNMA 2FY1A 3QIPA 2E29A 2OKQA 4OHZA 3K8VA 4IKAA 4OZNA 3H2LA 1X4EA 4P2SA 2YNGA 3FVYA 2B6AB 1LV5A 1WG4A 2V4QA 2IMOA 4LSLA 2EFPA 4I64A 5B7WA 5DDRC 4R8UA 3CCES 1N5QA 2PGCA 3GSDA 3CDWA 4WKYA 5K8MA 3OJUA 1TKTA 1LWCB 4OX9F 3R5DA 4RBUA 1QE1A 2C3MA 3NCPA 3ZZ0A 1M5SA 2KU7A 2KFZA 1RGVA 4PG7A 3U27A 3GILA 3CSKA 3CDUA 4ELUA 4AL5A 3GIMA 3O44A 3RAQA 1HWLA 1G3OA 1YVFA 1VBYA 2PSZA 1JLBB 1HBOB 1Q4RA 3QLHA 4QIFA 4DEZA 4N5SA 4QWDA 3BQ2A 4B9MA 4YR3A 4DR6F 1S4FA 3KK3B 2BRKA 3DHXA 3SSQA 4DQIA 2R2RA 3CIMA 3QJJA 3IRWP 1S0VA 1MU2A 4B3OB 1X5TA 2DR7A 1ELOA 3DU5A 2HPUA 3QYYA 3I0RA 3KHLA 4OHYA 2RKIA 3TA1A 2D9PA 1G2EA 3D1HA 2GGPA 4DQRA 4U7UK 3PFOA 3JAMY 1YJTA 3CVKA 2ZH8A 3CC4S 1RTIA 2E1RA 1VLYA 2ZE2A 5DQHA 3KOAA 1QSSA 3F44A 2RKIB 2MY8A 3CXCR 1L3VA 4R8UB 3OFGA 4NYOA 1IKWB 3DDKA 4B08A 4EUVA 5D8HB 5B09A 5D4OA 3X3UA 4G3IA 1ZPVA 2JLGA 1VC0A 3CCTA 1AXQA 4UY85 1VGYA 2EBEA 3MWBA 4GMKA 2V4JB 4FS1A 3RB4A 3H98A 3LF0A 2AGPA 3MMBA 2MYFA 3CCLS 2QZ8A 2M7SA 4DQSA 1UFWA 2E5HA 3MEKA 2B4PA 3G6ES 4KT0C 2M2BA 4YR2A 3T5KA 2JX2A 5A2QY 3V6HA 4H4MB 4QZVB 3RR8A 1N54B 1JLCA 4N41A 1DTQB 2VC1A 1VQSA 1HQUA 1KS2A 4WFAQ 2OSQA 1P9QC 3T3FA 1UETA 2H5EA 5GMKa 2MKSA 1RJJA 1XN9A 3AH6A 3KFWX 3PRBA 4URGA 3FMWA 3VALA 4NLQA 1YQHA 2HW3A 2X51A 2FVQA 3PKMA 2GQ2A 1LK7A 3CJ2A 3J81Y 4Q5VA 5KFDA 4X62F 3M6VA 1KQFB 4RZRA 3N0VA 5D4PA 2EG2A 2HRYA 3OVSA 5THWA 2QA4G 3PIOQ 1I1GA 1LW0A 5KFFA 1C0UB 2YX7A 2XMKA 2VONA 3DI6B 3CIZA 4Y00A 4ERDA 1RTHB 1FRKA 1PC4A 1S76D 1U2FA 4HDHA 3CD6S 3FRZA 3GYNA 1RT7B 3OFFA 4I2QA 4YUDA 5I42B 3G8TA 5F9LA 5DG7A 4K4ZA 1VS3A 2AGOA 5I3UA 2MGZA 3G4SS 1N48A 4KKOB 1LWEB 3G6VA 2G1DA 2AU0A 5JXSA 4K4VA 1HI1A 4QIWD 2OPQB 1IKVB 2ZNZA 1IM4A 2ZKTA 2CQPA 1D9AA 1LXJA 2CJAA 3H2UB 2R2UA 1X0FA 4CT8A 5AXKA 4WFXA 2RDJA 2ZNYA 5C25A 1NKCA 2JRSA 2M5YA 4DL7A 5DS7A 2BDPA 4JOUA 4BBYA 3HX9A 4OI4A 2V94A 4TQRA 1SQEA 2HYIB 3PDNA 4RWXA 3GG0A 4TU7A 2DO4A 2WW8A 1ZETA 4E98A 2DNNA 4F26A 2IVFB 1WF0A 5KG4A 3DGPA 1VHFA 2WAQD 2EI5A 3BSOA 4W90B 2WK4A 1S9FA 4ID8A 2BXJA 4O44B 4RW6A 1RTJB 5IXUA 3KG1A 4OZ0A 2KZZA 1GX5A 4KJIA 1QSYA 5AE3A 4F67A 2JFKA 3BGLA 5LL6d 3SMZA 5DG9A 2UV8G 2DPJA 4QR2A 1Q8IA 2HVIA 2VG6A 3AJ2A 4IFYB 3I56S 2CKWA 1TVRA 4IR9A 5HN0A 3M6WA 2YX1A 2RS8A 5DDOC 1H7XA 3HHLC 2ZJPQ 3HT3A 3DLBA 2LA6A 3V2UC 4WFZA 3LQVA 3GYXB 1VQKS 1XMBA 2YWKA 3QJPA 2PA3A 1GTEA 2W9AA 1M90T 4QIGA 5F3ZA 3W2VB 4EGLA 3BGUA 2LU2A 3WC0A 2K7JA 4L3NA 1T3OA 3T9ZA 5DDQC 3DHWC 2VUGA 4NCGB 3MEDB 1TL3B 2OPRA 2ZD1B 5B0CA 2C28A 5KTQA 5EGYA 2AYMA 4P6QA 4PPZA 1OQ3A 2O3DA 4RW4B 2I5JB 4YMEA 1MROA 3DRYA 4MKAA 3HZGA 1HHSA 1U09A 1WTFA 1RT2B 2ASYA 3DRSB 1X8DA 3H5UA 3MEDA 1NJWA 3MZIA 4RW8B 4GKJF 3CUNA 4M94A 1FA0A 3RW7A 4I69A 4HEA9 3KLHA 3G86A 4K4UA 1JLQB 1HWJA 3SCIE 2MQOA 2ZHBA 2VBXA 4QBUA 4NLPA 3K0JA 1RISA 4D3GA 3ICLA 3OW2R 1S9EB 3D0GE 3UFCX 1TKTB 4DSJA 1TFWA 4AFFA 4Y6IA 2F9JA 3PACA 1NK4A 4Z37A 2YNHB 3KMQA 4IDKA 4OJHA 3CMAS 1TFYA 3FFIB 3C6UB 4CO4A 2YQ3A 5KT4A 3GR1A 3K57A 3OR2B 1PSDA 1S1XB 4XAKA 1LW2B 5JVGQ 4G1PA 4DSFA 1SXLA 1OWXA 2V8VA 4GC7A 2PO4A 1HNIA 4Q7AA 4QIVA 4DL3A 1U2RA 4FNIA 2HAIA 3SXLA 3GB0A 1HARA 1AUDA 5HROA 4TQSA 4ZPBA 4DN9A 2CG4A 4IQMA 1SKRA 3GFYA 2B4OA 2DGVA 1V3ZA 5IQ6A 5E3QA 3PZPA 3BR8A 2JZ5A 4WZQA 3FZ2A 2AW0A 2XMTA 1U1OA 1WHYA 3TNVA 1UJ4A 4ZMMA 1FXDA 3BGRA 5MAOA 5A6WA 1CVJA 4WXOA 3BREA 3G6XA 2DIUA 3I96A 2RQKA 1CQNA 2CYYA 3TAPA 3LP2B 7FD1A 2ZJRQ 1C0UA 1Y5NB 4AYBD 2DH7A 5J2PA 1LFWA 1JLFB 2CDQA 3TVZA 4DLGA 4F8RA 3HK2A 5CHCB 4NRUA 1HBMB 3BGRB 3HHLB 3Q2TC 4ETXA 1FXRA 2XHWA 4ZCMA 4G1QA 2VFUA 4DPOA 5D3GB 1FDNA 3I4HX 3O2IA 3TP2A 3HHKA 1JKHA 1K1QA 4PG6A 4QR0A 2YKMA 1HNVA 5CYQA 5A0YB 3M9OB 1ULRA 5B0EA 3H25A 2CZVC 3DMJA 2CPHA 5KG1A 4A8QA 3ZZRA 3O3LA 1C4AA 4DUZF 2OTLS 3G96A 3IRXA 1UVJA 4USHA 1SJRA 2V4RA 2YNFA 2VV5A 3CB4A 4ZPCA 1WI6A 4I6YA 4C11A 1KSPA 2WOMA 3T6JA 2DNGA 4MFBB 2OD6A 3MM9A 1FNMA 3KLFB 3IS9B 3MAHA 2VC0A 1ZM4A 1S10A 3R1LA 4RNFA 3MEGA 5KFSA 3UNGC 2ZH4A 2V4JA 4ECYA 1RWUA 4B3TF 2RF2B 2LXUA 4LFBF 2DK2A 3DLHA 4HYKA 4OLPA 2OAUA 2W9CA 2AX1A 2MJNA 3LAMA 1U4BA 1HW9A 2QE5A 1TAQA 2G13A 2RT3A 2P6SA 2R8IA 3HHEA 1XMOF 4WCEQ 2AYGA 2VODA 3KNAA 1IQTA 1G1XA 5H9FJ 1MROB 1P6TA 5J2NA 5DQIA 1FE0A 5C24B 2V8GA 2CVEA 3I87A 3TA0A 1HFEL 3OTCA 1CSJA 2XI3A 3IAM9 4G1IA 1N0UA 3T19A 4DUYF 1VBZA 3CD5A 3S7RA 4V19J 2NLWA 2ROGA 2CQ2A 2QLWA 1FJEB 4OJ3A 2ZH9A 2M8DB 3M6XA 1HYSA 5J2MB 4RLEA 5CCMA 3I5BA 1HA1A 1J5OA 1D1UA 3CULA 4TU8A 4DV5F 1HBNA 1Q82T 3LANA 5L1IA 1V6HA 3IG1A 2F4VF 4DSIA 3LP1B 1YGYA 3UR0A 5KFCA 4DX8H 2M70A 1FJCA 2YH0A 5AXLA 3L3CA 2VG6B 2XY6A 1KC8T 2I2YA 1FO1A 3KNGA 5DETA 1TL1B 1XERA 4DS4A 4NPOA 4I67A 3PFEA 2A2CA 1JLAB 5IM0A 3GV5B 2N7YA 2FHOB 3ENWA 1Y4ZB 2I38A 3I9ZA 1Z1ZA 3OVAA 4GO7X 5L1KA 4ILMA 1URNA 2E44A 2EFQA 4YEAA 3EZUA 2DHSA 2RVJA 4DV0F 4EZ6A 3P3DA 4X4UA 1E6VA 4RNHA 4F2SA 5B0GA 1LW0B 2I9SA 2EFVA 2QA1A 1N0VC 2KHCA 1I6JA 4OJ1A 4D3HA 3DLGA 3UE2A 2JVRA 3EGWB 1Y3JA 3CCRS 2J7UA 3KLGA 2DNHA 3GFZA 2EVZA 1ZBTA 2CPZA 4PXDA 2B43A 1JLFA 1RKJA 4TYBA 1HMVB 4FN5A 2WB1D 4CO0A 3QWUA 1UVKA 2WSCC 4EBEA 3SI8A 4RKUC 3JSYA 1VIXA 3AQOA 3Q8QB 2KTQA 4ZPVR 1NRKA 2RRAA 1QM9A 1Y9OA 3Q23A 2IRUA 4AXJA 4BCAA 2XLIA 3G71S 2XB2D 4G6VB 2HMIB 4A8FA 2E66A 1OIAA 1P8GA 3J7YU 4DN0A 3CWJA 4I7FA 2ZDPA 2CQGA 1DZ5A 5LSLA 3AY0A 2R7RA 1KNZA 3NLCA 3MR6A 1APSA 2VB6A 4UY8T 4RW9A 4GO5X 5E3CA 3HHLD 4WTYA 2FVRA 3TUZC 5L8RC 3MM8A 2PMZD 2UUWA 1RTDB 3FSYA 1E6VB 5IS2A 4HTIA 4WU2A 2W9BA 1F5CA 1XR7A 1FTCA 2EKYA 1QY7A 2HS3A 5HBMB 3QJLA 1CC8A 3KJVA 3JYTB 3MF5A 1UFLA 2IC3B 4TY8B 5AXMA 3LP1A 5CZVA 4OI3A 2MQPA 1E6YB 1NJIT 1FRJA 5DLGA 3NNAA 5KT6A 3MDFA 2APOA 1SJ1A 4ZCIA 3CCJS 2BQUA 2P9GA 4E0DA 1ZOTA 3TARA 3LALA 1BQNB 3ITHA 3M2VB 5J2QB 3KHRA 3PHEA 5C42B 3R3TA 2QRRA 1PILA 1VQPS 4QWAA 4OZ5A 1U1RA 4K0KF 5L9XA 2Q1LA 4NCGA 2D7SA 3VAJA 2E9ZA 1Q16B 1A9NB 2VFRA 2ZDOA 4HLBA 1RAJA 5KFOA 1B7FA 3C6TA 4RW4A 4ZVEA 4K5SA 1VQLS 3BN4A 3KLVA 1N34F 4DDFA 4QU7A 3IA0A 5K8NA 1GAOA 2UXBF 2AJFE 2GO9A 4FP9A 1BD6A 2W7PA 4L6V3 2XEXA 4RW7B 1SH3A 2H9ZA 5KAKA 2OPSA 5F41A 1Y5IB 4UUWA 5KFWA 4MMOA 1O51A 1BQMB 3DLKA 5DRKA 2DGXA 4WFYA 1R8CA 5E5NA 3T9NA 2ATLA 3WZ0A 2N82B 3W3SA 3VAMA 4IG3B 5BYSA 4MK8A 2CQHA 4TY8A 3MEGB 1F5AA 2ZH7A 3FCHA 4N8OA 4JI2F 4JI7F 2RD5C 1DAXA 3MOZA 3CMES 3L95X 1E6YA 1KR4A 5AE1A 1MMDA 2LMIA 3KLFA 4MAKA 1N5YB 3R5AA 3N4WA 1WF1A 3FEZA 3MD1A 4X4PA 2R7VA 1VK3A 3S6EA 3V81A 5L1LA 5HMXA 2JH3A 5DM6Q 2NPIA 1ZAXA 3BR9A 4O3QA 4KO0B 2W9BB 5CYQB 2YKAA 5A0YA 1FJGF 4PQUB 4LSLB 3JSRA 3MMCA 2RU3A 1KTQA 3LWMA 2V9KA 3QAEA 2J6TA 4NLOA 4ETZA 3O6QA 2YY3A 4KKOA 1H6KX 2F8EX 5AE2A 1W2BR 3QMQA 4DQQA 4ED6A 3MPWA 1KRPA 1HBMA 2B5JB 4F4WA 3SV3A 1QLNA 2OIHA 1WEZA 4I0WA 2JEIA 2FJWA 3NL0A 2ZOGA 5DJBA 2DRAA 1UMJA