4QIVA

Crystal structure of hexameric microcomparment shell protein from aeromonas hydrophila
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
86
structure length
86
Chain Sequence
DALGLIETKGLVACIEAADAMCKAANVELIGYENVGSGLVTAMVKGDVGAVKAAVDSGVESAQRIGEVVTSLVIARPHNDISKIVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bacterial microcompartments family protein
publication title Crystal structure of a hexameric microcomparment protein from Aeromonas hydrophila
rcsb
source organism Aeromonas hydrophila subsp. hydrophila
molecule tags Structural protein
total genus 23
structure length 86
sequence length 86
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00936 BMC BMC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1710 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4qivA00
4LIWA 4OX7A 3IA0A 2A1BA 4QIGA 2A18A 3VCDA 4DDFA 3NWGA 3SSSA 3H8YA 4PPDA 4AXJA 4RBVA 3BN4A 3DN9A 4QIFA 2EWHA 4OLPA 3CIMA 4QIVA 3I96A 4OX8A 3MPYA 4RBTA 2G13A 5DJBA 3SSQA 3N79A 4OX6A 4P7VA 3MPWA 3NGKA 4P7TA 3SSRA 4AXIA 5L38A 3CGIA 3PACA 4QIEA 3DNCA 4RBUA 2A10A 4P2SA 4OLOA 3I6PA
chains in the Genus database with same CATH superfamily
1UVMA 4LRAA 1SL0A 2UXBF 1XNRF 1K1QA 2YNIB 2DIUA 1LWEA 2EFNA 2VG7A 2G2ZA 1XJWB 2ZH7A 3G8SA 4B3OA 1XK8A 3HCXA 1K44A 3R5BA 2GZOA 3BGRA 1DFDA 1UMJA 1HYSA 2A6MA 1KLMA 4QYRA 5C2GA 4ZJOA 2DR5A 1XNQF 4PXDA 4CNZA 4EBEA 3PV8A 2K1RB 5KAKA 5HVGA 4FF3A 2OPSA 3Q83A 1YTYA 2L08A 3GYXB 3SQGB 3N28A 3MI7X 3MEGA 2EKYA 1YKWA 5ITHA 2JVOA 1U4BA 3DNCA 1HNWJ 3K5LA 2EKNA 1UKUA 4L76A 4OI6A 1Q1KA 3DGPB 5A0YB 3I0RB 1HA1A 3NGSA 2XMWA 3ZXWA 3QIDA 2ADBA 3DLBA 2GJ2A 2N3OA 4QYZK 3UDCA 2WW4A 5AT1B 4GC7A 3EDRB 5CA5A 1RXOB 4ECXA 4K0KJ 3DOMA 1W7WA 2YQ1A 3GJTB 4ZHRA 1S72S 1VK3A 3A1YG 3T19A 2DD8S 1N34J 2G0JA 3KUHA 3RBZA 3NRBA 5B0BA 2N4DA 1N6QB 2CJQA 4PAAA 2C2NA 1MNEA 1U24A 1Y5IB 4HEA9 4RNFA 4Q2MA 4F2RA 2FHMA 4AXIA 3CJ8A 4ID5A 1MMDA 2YBVA 1FKPA 2UUAJ 3G71S 3KK1B 4I7FB 1CBKA 2HHHF 2WONB 3M9OB 3PJWA 2OPRA 1IBLJ 2VJVA 2BXJA 1DQ8A 3N5BA 4DPOA 2CPEA 4JI5F 2YNFB 2A6OA 4AD6A 5SZTA 1H0HB 2BVZA 3OTOF 3MEDA 3QGPA 1IVZA 3PX6A 2HWTA 1I6JA 1FDDA 3K59A 2MLYA 4WFXA 1T3NA 3J81j 2ACYA 5E33A 3CJQA 2WBRA 4DSLA 4DU8A 2RS8A 3EVOA 3P49B 1I1GA 2FHJA 3R1LA 4O3RA 5CYJA 6FDRA 3C6UB 4K4VA 2FJVA 4PXEA 1FWPA 1G6BA 1B0PA 1BC6A 1QJHA 4LVNP 3K8WA 3Q8SB 1APSA 1CQMA 3VAHA 3LP1A 1NHKL 5H9FJ 2MZRA 4DCJB 4DCOB 4IG3A 3G6XA 2E1PA 4A8XA 4WF9Q 4I68A 4IO1A 9ATCB 1NK8A 3QO9A 3CXCR 3R7NB 2I38A 3JYTB 5DDOC 3DYAB 1BGXT 1M1KT 2MLZA 4B17A 3DRYA 4UF4A 4V19J 1S6PB 3HFKA 5GAHU 1QY7A 3TP2A 3UNGC 1S1TB 2ZHAA 3JSMB 1IXKA 2V8PA 1E6VA 3POTA 1RWNB 3R97A 4NRTA 2HURA 4N8NA 2BKPA 3AA8A 1XR7A 1FRKA 1MROA 3NCPA 2DNQA 4DV0J 1GXTA 2GS8A 1YJ9S 1M1HA 3TJ8A 2RMLA 4BHQA 3FK4A 4HYKA 3LP0B 2RU3A 2RB7A 1F2GA 4DV5F 5HLFB 2XY6A 1TAUA 2RQCA 1S79A 3AODA 3A13A 1HBMB 3US5A 2XSFA 3DDKA 2XO6A 1W25A 3ISND 1RTJA 2KO1A 3FUYA 3UDEA 1TV6A 1JLEB 1IUJA 1SJRA 1EQMA 3DOLB 4B3RJ 1P27B 3W8GA 3BPDA 4PG5A 2WVDA 3D5MA 4RW9A 1NUEA 3VAKA 2YNHA 2K06A 4M5LA 3I4PA 1RTZA 4EUVA 4N56A 1IJFB 3IRXA 4AQYJ 4LF4J 1U1PA 1ACMB 4G1QB 1JLBB 4IFYA 4DN0A 3W62A 2BRKA 2EG2A 2V8VA 3R5JB 5H1SV 4RLEA 3A8IA 2V2QA 4BWMA 1UVKA 3OBIA 4S0MA 2XB2D 2EC0A 4ZDNA 3AD7C 4ZLJA 1FK9A 2N7YA 5FDLB 4C3KA 5KFHA 2YKAA 4ED1A 2ZOGA 4I64A 2R7WA 1HQEA 1S1WB 1BWEA 3CUNA 1REVA 4F4ZA 3CIZA 3R7BB 4H54A 3G87A 4RL1A 4OYBA 3BS9A 4DBQA 1KQSR 4ZVHA 2CNKB 3IAS9 2UVVA 1O0PA 1W2BR 3HI9A 2YX1A 4LFAF 2FLOA 1G2EA 4LF9J 4DL0C 4OYAA 3J7YU 2U2FA 2IIHA 3I32A 3IR5B 4QR1A 1OMSA 2LEPA 1V6HA 1FNXH 5AXMA 2HQGA 4DR3F 3Q86A 5J2MA 4DR1F 4WYLA 4CLZA 1ZM9A 3RB0A 1NK5A 4EZ6A 2BQUA 2W9BB 4NPOA 4IOBA 3IC1A 4LFCF 3AD8C 4MK8A 1M0SA 2NYHA 1KVJA 1WEYA 2J0XA 5DLFA 1LK5A 3PHEA 4PZVA 2QE5A 3VGSA 2R2TA 4OQJA 4ELTA 4QIWD 3G82A 4LF1A 4DPWA 3THVA 2CNNB 3CO9A 1GTHA 1ZM4A 3GU0A 2CQ3A 1AXQA 1IBKJ 3SCKE 3JQKA 1WOPA 5CZVA 5BR8F 3KLFB 4C97A 2UUCJ 1WG4A 3D6FB 4WP8A 3W66A 4O3OA 6AT1B 3K8VA 4CM0A 2R2UA 1S1UA 2Y8YA 1VLOA 5KTQA 2A1BA 4R0EA 3M6XA 3M30A 3HJVA 1UTAA 1QSSA 3ELHA 2W2MP 2DEJA 4KV8A 4CO3A 2ZD1A 2FHJD 3JB9k 1HNZJ 2GVDA 5IWAF 1FRJA 4LF7J 1WACA 1EB0A 1Q79A 1Q7LB 1RAGB 2UU9J 1CQNA 2R7SA 2ZOFA 2EG1A 3VV2B 4X4VA 3ZZOA 2BE2B 3CD7A 1U8WA 3IA0A 3WQPA 4Q0BB 2Q6BA 3D68A 5A8KA 3QNWB 2DTJA 5L9XA 1BQNB 4DFJA 2CJBA 4HTJA 4K4WA 4NXNJ 1FJ7A 3A3OB 4ECTA 3CJSA 4Y2IA 3R27A 1FI4A 2Y1RI 1VIOA 3W61A 2EC2A 2RJZA 4PG4A 1RACB 3PM9A 3PIOQ 4WYWA 2HS4A 5B09A 3VAFA 1M5HA 3DRSB 4NLWA 5AXKA 1R0AA 4ZIVA 3AXMA 2CZ9A 4CIOA 3H5SA 4A8SA 1YIJS 3VF0B 2HFVA 3QQCD 3D54A 3QFHA 2AT1B 3NMRA 2M70A 1KOOA 3PW7A 3QZ7A 2BW7A 2JWNA 3LF0A 3QWUA 2XM3A 3I9V9 2BZ2A 3PFEA 1C0UB 1V9OA 3WC2A 3MF5A 3CCZA 1IKWA 2IC3B 2JFDA 2OAUA 3CJ5A 4KPCA 2X1BA 1RHRB 4DX7A 2BM0A 3FC9A 1X5OA 3SCJE 4FS1A 4Q44A 1YBUA 1XBWA 2CZ4A 4ZVTB 4KFBB 2IA6A 2IVYA 3FNNA 5EWGA 2FUG9 4C6AA 3MOZA 4BWJA 3C14A 2FLPA 2KL8A 4O3QA 4N7TA 5KFSA 4NYPA 4X62J 3MTJA 1Q5YA 2QRRA 5F8GA 2ASYA 1NK7A 5CD4A 3HMJG 2DCUB 4MKVA 1UAWA 3EE3A 2AJQA 4PG6A 1D9DA 1KWMA 1VRQC 1GMUA 4RNOA 4FYYB 2LECA 3ZZYA 1RCOB 3J7AN 3EICA 2XY7A 1LXJA 3D6TB 2HK2A 3V2UC 4ZVUB 2Z2ZA 3LAKA 2MGZA 2YVSA 4FKYA 2VBXA 5L39A 4RUCA 4WBFA 1M5KC 3T5KA 2H65B 1ZZFA 4NEZA 5IT9Y 3JS9A 4OZNA 3HHNB 2VG6A 2FVPA 2YPZA 1RT2A 3K58A 4DSIA 3U1NA 1WC0A 3FMWA 3PTWA 3HULA 4F3OA 3IN5A 2Z56B 5DDPC 1CC8A 4YFUA 1NSAA 3KLHA 1HNVB 2OEMA 2V2ZA 2CXEA 4ED0A 9RUBA 3MPWA 1PGZA 1Y00A 4OX7A 3K17A 4CYUA 1QM9A 2FQQB 3AJ2A 1S49A 3CC7S 4XTTA 4YY3J 2J0WA 4I1TA 4NYZA 4Q8EA 2R8IA 5BJRA 4X65F 2ERRA 2M3DA 2RAQA 3SI8A 2WVCA 1J5OA 4OYMA 3EUNA 2J5AA 3CCTA 2B8QA 3NGTA 4IFVA 2RQMA 1SPBP 2YWGA 3OSPA 2DR7A 1XR5A 5L8RC 1QSLA 3W5ZA 1RWXB 1OJ4A 4DV2J 3HX9A 3V6HA 2PN6A 1CJVA 2IFXA 4ZVQB 4TU9A 1RWKB 3DRPA 1S77D 1IKYB 4CLPA 2P8IA 2GMHA 1NK4A 4G6VB 4DS4A 4WZQA 2J6TA 2RUSA 2NSBA 4B3TF 3ENWA 2CPJA 2ZE2B 3ENQA 2MKKA 3J7Z5 3LW5C 3M8PB 3KOAA 3BQ2A 4OZ0A 4WK3A 3JTOA 1WDDA 4DR4J 1FRXA 3GTYX 2AJFE 2HHTA 3MM7B 4LF5F 1GNKA 4N8OA 2VFVA 3O44A 1VQKS 3C16A 3B6BA 2ZJPQ 2KKHA 2LLZA 5B0EA 4DV4J 4P71A 3JTPA 2LYVA 1RAJA 1UVIA 4OX9F 2GQQA 2RRNA 1VQ8S 4DG1A 3CPWR 2G1HA 3OL6A 2ZC4A 4DL5A 5ETSA 3ZTQA 4NLOA 2WSFC 3EGZA 1PAEX 4TXSA 4YB5A 1M5OC 1S12A 2J7WA 3E01B 3PR5B 3PX4A 4LR7A 3UO0A 5CYMA 2UXBJ 1TKDA 1XNRJ 1DY3A 2DR6A 3TA1A 1DQ9A 2EFOA 5HSPA 4J7CA 1SBRA 1K0VA 1CS4B 2HPUA 2GQCA 2VC1A 4F26A 4I2QB 3W5XA 2JEIA 1JNZB 2XMUA 2RKIA 2LMIA 4W98A 3TYTA 2XMMA 3UR0A 4DPXA 3RB6A 1NPRA 3SCIE 3EGNA 1SC3B 2H54B 5C5JA 3BEGB 1BHNA 2PGCA 1KDNA 2MXYA 2AYBA 1Y4ZB 5HVFA 3VGVA 5IV3A 1CJKB 1RHQB 3IS9A 4Q7AA 2CJAA 1TL4A 2RRAA 1QAJA 1ROFA 4ITSA 1CULA 4KSEB 2FJDB 2NSCA 4TU8A 1UJ6A 2MSTA 2YWFA 2XI3A 2XMTA 1Z4UA 4CLLA 5CXTA 1EP4A 2ROEA 1JLQB 4NXMF 4JUZA 2ZBQA 4NZ6A 3DKDA 2YQ3A 2MQQA 3VGTA 4P73A 2H1YA 2JC0A 1S9EA 1BMQB 4DR5F 1PILA 1S0MA 3MECA 5KT2A 1AFJA 3A12A 2HBQB 4ES2A 1JKHA 3MAHA 1N5YB 3E8OA 4MYTA 1C0TA 3K2YA 3HK2A 2HLTA 3ZNJ1 2KT2A 4MFBB 4URQU 5U47A 4QIVA 5AE1A 2XCPA 4P72A 3H25A 2QLXA 2V4QA 4HHHA 2CQHA 3ILIA 5KFRA 1CPZA 4C9DA 2ZEJA 3R5CA 1VRUA 1R8PA 3D3BJ 4URSA 1IQZA 3BO4A 5KFNA 2BRLA 3TUZC 3OTEA 3BJYA 2QA2A 4YQWA 4KQZA 4JI5J 2L3MA 2W1BA 3V6DB 4ES3A 2QYGA 4B9UA 4CH7A 3ZTOA 3GFYA 4WE1A 3HDSA 1GAOA 4G3IA 1N48A 1ICEB 4K4SA 2GX8A 4IR9A 2J9DE 4OV6A 3EZUA 1TELA 1SUQA 2B9WA 3PG9A 2BJ9A 2ZZNA 3HVWA 2EW9A 1TP7A 4LSZB 2KB2A 4C8YA 5HMZA 1S48A 2O67A 3Q2SC 3OUYA 3CC4S 2PMZD 2ZBCA 1YLXA 1Q4RA 2DK2A 2B8PA 2MKSA 4CH1A 4MIAA 1LKZA 3OL9A 2P6SA 2AJ4A 2Y1IA 2DNGA 1NSKL 2OEKA 2GO8A 3P8BB 1FKOB 1FXDA 2W7AA 1VRTB 2C2ZB 2CWXA 3QT6A 2V9WA 2A2DA 4M5DB 2E7XA 2DRAA 4FN5A 1B0TA 1VOMA 2JNJA 4RU9A 1SJ3P 1EETB 3TI0A 1NKBA 8ATCB 2RHSB 2KRBA 3FBEA 1X9SA 3NGKA 2R2RA 4P74A 3DLGA 4I2PB 2VZ9A 4L74A 1VQOS 4LR8A 2M8DB 4MKYA 5CYQA 2W4DA 4DV5J 2CQ0A 5F8HA 2BE9B 4CWBA 5G0RB 2FHOB 2VASA 3N4WA 4FXDA 4Y2AA 5B7WA 1HBUB 1NSQA 3GIKA 1YRXA 1RLCL 4K5SA 5A6WA 2V50A 4E0DA 4ZCLA 4LQ3A 1DTTB 1E6YB 3X3UA 3M8SA 3CB4A 4PXBA 3NBPB 3AJ1A 3FQLA 2B6AA 2ILZA 1RU2A 3DRRA 5H9EJ 3DU5A 4CNYA 3UVJB 3MAAB 1WF0A 3PCOB 3IBFB 3AOAA 4DFPA 3IFEA 1LFPA 4UY8T 1FRMA 1JK9B 3HSDA 4B9LA 3G8QA 4B9TA 5E41A 2MB0B 3D4JA 8RUCA 4KKOB 1NAQA 2DO4A 3W63A 4C0HA 4JI0F 1RT5B 5KOXA 2JOQA 2IM1A 4J9RA 3OVBA 3EXYA 1RUSA 2VOPA 4QR0A 3Q8UA 1FFGB 3DLLQ 1WOSA 3C3LA 2GVZA 4LIWA 5K8PA 2JZ5A 1H7WA 2RT3A 1TVRB 1FJGJ 1FXRA 2DNLA 4HT5A 4TQSA 1VGYA 5HROA 3HZGA 2XO7A 5KFMA 1ULRA 1GX5A 2BR0A 3MM9B 3HP6A 4LFAJ 1FVSA 2IMOA 2JSXA 5D0HA 4ZN3A 1TL1B 4O3PA 1SQFA 3DXSX 2HHQA 2I5JB 3S6EA 4ZJQA 3I96A 3M1VA 1H73A 1KP6A 5C42A 2GIFA 3MPUB 4ECRA 3D67A 2QZ8A 3HKZD 3DLKA 4LFCJ 4OX8A 3PY8A 2XYPB 4JI7F 3OFEA 3OJUA 4IYQA 4C11B 3C8YA 2B3TB 4IG0B 4OZLA 2GNKA 4KYZA 4I69A 1LQ9A 2ZH2A 1Y5NB 4DV6F 4NA1A 1PAUB 4JBCA 2LQ5A 5K9FA 2UVWA 1FDAA 1YK9A 3KMSA 2KH9A 3VCDA 4IKAA 3EDQB 1VBKA 2MDAA 1RDRA 5LT5A 5BR8J 1LWEB 2VG7B 5E3AA 3UN5A 3FVYA 2OI2A 4UQGA 3MCNA 3M8ZA 1UA0A 3BGRB 5LM7E 5KG0A 1HYSB 1VMBA 2GGPB 2HBYB 3OQ2A 2XHWA 3H98A 1KLMB 3SQOP 1YBTA 4JB8B 5C25B 5D3GA 4OFZA 4ELUA 2OD6A 3CDWA 3C19A 4OYIA 2VDHA 3KG4A 3C66A 4Y00A 3OD2A 2OPSB 1WKLA 2JX2A 2WVEA 2XS7A 1RSCA 3MMAA 2XG8A 3ZNUA 1YJUA 3GSDA 3GPAA 2J7UA 1T8EA 3MEGB 3OHBA 3ZC4A 1TU0B 2PIIA 1WKJA 3LAMA 3ZTRA 3GIMA 1HWIA 4RJVA 1FE4A 1WD6A 4WTOB 3R2CJ 5GAHI 1S0OA 3CDBA 3VVTA 2NS1B 1PKUA 1U0HA 1UFWA 1Q82T 2FJXA 3D1HA 2D74B 2RQKA 5GVQA 2ROGA 3V5RA 5GMKa 2EEYA 3DOMB 5RUBA 3AH6A 1DARA 4DV7J 4ZHRB 4X64F 2HKEA 3IBWA 3D0IE 1U25A 4P7TA 1HKAA 1Y3KA 3D66A 3Q23A 2KYZA 1FD8A 3WHIA 4NEYA 2OSRA 4IH6A 1RTIA 4XPEA 5B08A 3MGJA 4ID5B 1KTQA 1FKPB 2KHCA 3V81A 4M1KA 3FCHA 1MWYA 2M0GB 2ZJQQ 4WU3A 5B0DA 3TARA 2BOPA 1SQGA 2X1FA 2MKJA 1ZPVA 4A8QA 1VBZA 2YY3A 2OPRB 1K1SA 1A0OB 4OZ3A 1JNRB 2GIRA 3VAMA 1S97A 5ETMA 3OR1A 4FPIA 4QWEA 2MZ1A 1JQGA 2HQCA 1CEZA 4USVA 2F4FA 4LR9A 2GHVC 2YPYA 4TYAA 1Q5VA 2JFKA 3JQJA 2CZVC 1HNWF 3G6VA 2KJVA 1OIAA 4WWSA 4YEAA 2ALYB 4Y2KA 1NZ8A 5B0GA 2JEJA 2GJFA 3LP1B 4IG3B 4GRSA 1LOUA 4CI0B 1F3VA 3FGVA 3QO9B 2XI2A 4QWCA 2MTLA 4AUKA 1RTDA 1PO6A 1C1BB 5J1NA 4K0KF 4EYIB 1YJ7A 1OY9A 1UZHA 1BXNA 1IM6A 2O5DA 1E6VB 4USKA 1TK5A 4WPAA 2KG0A 4J5OA 4J9VA 4J37A 4Y34A 3MAQA 2OO4A 3QGHA 1HNXF 2PO4A 1KR4A 3MUTP 1MROB 4OI1A 4BLGA 2ZITA 2XYGB 2LEAA 1H98A 1IKXA 5IC6B 4BCAA 4LF2A 5KT5A 4MK7A 2NPIA 2UUAF 2DHSA 1WEXA 1NZAA 1U7LA 3Q8VA 4ED2A 4DI6A 2LEBA 5GAGU 1KQGB 4LJMA 1AZSA 2AP6A 4KGZB 1KONA 1URNA 1RTJB 3HSJA 1LK7A 2NREA 1TV6B 2B9XA 1REGX 1Q7YT 5KOWA 4U7CA 2XS5A 1VI7A 1WDTA 1U26A 5LSLA 4X65J 2WZ1A 2HYIB 5DM7Q 4RW9B 2YNHB 3AQPA 3W2VA 5GAEI 5ETTA 2E5LF 5KFYA 2BKOA 5F8LA 1S0NA 3IRXB 2VPYB 1ZOTA 4P7VA 4Z7YA 1VC5A 3CMAS 4ECQA 6FD1A 4ZPVR 4IFYB 1WELA 4PUOA 1S9FA 5HQ8A 3R6LB 3TRGA 1V5VA 5D4NA 3TR5A 1PYSB 4DS5A 1SIZA 4C3LA 2XMAA 4TLRA 3L7PA 4C0BA 2H5IB 2RQ4A 2I6WA 3OLBA 2IYGA 2U1AA 1WC3A 3M2RA 1HQEB 2GW8A 2ZVSA 3S8SA 2LA4A 4JI8J 4ZMMA 1T9VA 4JOUA 1REVB 4CQ1A 2JRSA 1SB6A 2ZBIA 1IR1A 4PWWA 1V5IB 1BE4A 1FDNA 4TYBA 4ZP7A 4HR2A 2V4RA 3OV7A 2C2MB 4FNHA 4ECVA 2V6AA 3AQOA 4R5PA 4LF5J 3W64A 5H9FK 2J8SA 1NHUA 2E5HA 1NSPA 4DV0F 3GWCA 5ETRA 3ZFVA 3I55S 1U47A 1RK8A 2V4JA 4OX9J 5DETA 3BSCA 4JI4J 1N4LA 5I4MA 4CLTA 2Z58B 1U48A 5J2MB 1NH8A 2M9KA 3HPOA 2XGPA 3E2EA 4DQIA 3HZEA 1HWUA 3HFZB 3NOCA 3EMTA 5CAAA 3MM8A 1B4SA 2YWWA 3P45B 2V2VA 4ED6A 2DNOA 1QAYA 2CNLB 3G82B 1QLNA 4DFKA 3KG0A 4Z2XA 2G13A 1JLAA 2FLLA 2HHXA 2VQFF 1WC4A 1J2VA 5LOQA 4NYOA 2FJEB 4OHWA 2BX6A 2GMLA 4CO4A 1V3RA 2F3JA 2V5HG 3PW0A 4CLKA 3D0HE 2E9TA 1S1UB 2E5IA 3MR3A 3M30B 5JVHQ 2DJWA 3BH7B 3JQMA 2IBOA 3TA2A 1TKZB 4F0KA 4AL7A 4ILMA 4KV8B 2XS2A 2ZD1B 1C2PA 3CMQA 3TZYA 5D4LA 1N54B 4QYZJ 2GVDB 3I9ZA 2NLWA 5EUHA 2VC0A 1SQEA 5KFQA 2W2QP 1YZ6A 1X5PA 2IBKA 1H72C 2A10A 3RAQA 4DPUA 4OZ1A 5A8KB 1MG7A 2G2YA 1TR0A 1F5CA 4OZ2A 4DPYA 2PMHA 4U96A 3JXOA 5ETNA 2N3LA 4KRWA 1R89A 2CQCA 2M8HA 3D6HB 4NI2A 2MQ8A 3TNVA 5KT6A 1MU2A 5IT4A 1SJ1A 1WC6A 1F9HA 1URRA 2R8KA 4DWIA 3QT7A 1X0FA 5E3CA 1Q81T 1PYTA 3IMQJ 3UCGA 3TQ1A 3T3FA 3PYEA 1D9AA 3CCES 4WFAQ 1R0AB 1T7PA 1U09A 1JX4A 3K5PA 3CULA 3BGOP 3OR2A 1TL7A 3BO2A 1YJVA 3PNIA 1IBKF 3UN3A 3CJRA 4JI3F 4ZKAA 4WIQA 2ZBRA 2PDAA 3IR7B 3GCWP 1PG5B 1IKWB 1PJ5A 4ZLNA 4NMXA 3THTA 3B8HA 5DQGA 1RT1A 2M52A 1KN6A 4UZBA 1RLDA 1RWMB 2J6SA 2XYHB 3TUPA 3TW0A 2CJYB 3OFHA 4F3MA 2D3OR 3NOGA 4WP3A 2LDYA 2X1AA 1P9QC 2BJ8A 3W60A 2VFSA 1MN9A 3C14B 3IRWP 1KFDA 4USUA 2KZMA 1VISA 2G0IA 2AX1A 5E0OA 1DAXA 2V8GA 2M7SA 2UU9F 2DR8A 4NLRA 4NX9A 4MMOA 2QSFA 1FA0A 1F5AA 3D2WA 2YKQA 2PFDA 3TX0A 1N33J 1QTNB 4B08A 4HACB 2ASJA 1X9MA 1SCJB 2LA6A 4PYDA 2R7XA 3I5CA 3N6LA 2PD1A 2FJWA 4WCEQ 1WG1A 2ZWPA 1D0EA 1VQLS 3I0RA 1CJUA 2MGZB 3HHLA 5T7LB 4Z37A 1FCAA 2XZDB 2BACA 1EKSA 1BWVA 1TKXA 4MK9A 1RHUB 1FRLA 2LXUA 2NQPA 4M5HA 3DC2A 2VG6B 4KGXB 1GX6A 2D7SA 4KE5A 2JLFA 1JIHA 1RT2B 4DL6A 2J7KA 4X66F 2AYEA 3BR9A 2W25A 1SJFA 4NMLA 4YN3B 5KFOA 2KXHA 1Y9OA 2MEWA 3NGRA 3HF5A 2HMIA 4PG8A 2V34A 2KG1A 4PWDA 1RT3A 1G4CA 3IP0A 2YH0A 1WUUA 2G1DA 1K9MT 3DHXA 1G1XA 2IDEA 4X84A 1UPMB 1SVDA 1SV5A 2J0QD 1RGVA 3GFXA 2HZCA 5FLXU 4CYUB 3TO8A 4LRFA 1HI1A 3QGGA 3RBEA 1NLKL 1NK9A 2UV8A 2I1RA 4HDGA 3BQ1A 3FBBA 1XR6A 3W9HA 3MR2A 2L41A 8AT1B 2AJ1A 1HBOB 2Z0GA 2H5EA 1IQTA 3OTDA 2FDNA 3PW2A 5I42A 5D77A 4X62F 5HL7Q 4ZLLA 3E51A 3A3NB 4IFVB 3M8QB 1AW0A 1Z2ZA 2EFGA 2PFFB 3LGMA 4FVCA 1F1BB 3HVTA 2GAHC 5KT3A 3CJTA 2ZWOA 2J8AA 5E2QA 2FZKB 3LQVA 3M32B 2VJUA 5J2NA 4F0HA 3CJ4A 5KFXA 4RBUA 4GVLA 1NHVA 3JYTA 3DYAA 4WXOA 3CVKA 2ZHBA 3VAJA 3UDVA 3ICLA 4OYPA 1JJHA 2BANA 4F4WA 1N8RT 2LQJA 3KUEA 2BKNA 4HHJA 2FVSA 1S6OA 3ILLA 2YH1A 4FBUA 1QVFR 3PW4A 3C16B 1T9YA 2MKHA 4QPXA 2C42A 4P2FA 4NLSA 5A8WB 4DG1B 2XBPA 5LJ5Y 1UETA 3G9CA 2CA9A 3GJRB 1ELOA 4DV6J 3MM5B 3LP0A 1Y3JA 5DZ7A 5ETVA 3VR1A 5CYMB 2E1AA 1RT4A 1SXLA 4DV1F 4C8NA 2QTWA 2FD2A 4RR5A 2MQPA 2DISA 3F44A 4CO2A 3VHQA 5KG6A 1UJ4A 2W2NP 4C8LA 3ZTSA 2PEBA 3M2VB 2KFZA 3FMBA 1NDKA 2WBMA 3LANA 1WSVA 3T9ZA 5KFCA 3NAHA 2DGTA 4RNNA 4GVBA 4ZPAA 3MDFA 2RH3A 1QVGR 5DGBA 1NM2A 2XNQA 3M6UA 2D41A 3IM8A 2IJNA 3IS9B 3BZQA 4K8RA 3GR0A 2HIQA 4DMZA 3HJFA 3NEKA 4DL2A 1CULB 2DY1A 1RABB 5L9NA 5HK4A 5K8NA 4Q5VA 3EX7B 1EKRA 1D09B 4WJBA 4MH8A 2GCFA 3B4DA 4RW7A 5DLGA 1RZMA 4F0MA 3NCQA 3VALA 1U6ZA 1UWBA 2EWHA 4X64J 2BABA 3GJSB 4OJGA 1EP4B 3BDEA 4DV4F 4UOHA 4GO7X 4ZK7M 1NDPA 2R9LA 5HQMA 2HVIA 2L9WA 3T6BA 3RZAA 5K8MA 3OSNA 2ATLA 1L5UA 2MYFA 1S10A 2BJ7A 4ILRA 3G2XA 4OYOA 3RR8A 2CPZA 1UFLA 2N82B 1S9EB 4FDFA 2NXNA 1S6QA 2RSQA 2FVCA 2DNMA 1ITPA 1JKHB 2UZAA 4CO1A 1IWAA 5G4DA 4QOTA 1OPZA 2CRLA 1C0TB 1U1RA 3ZZRA 2CJKA 1NBEB 5CZXA 2YKPA 1VQYA 4TN2A 3ETMA 4OHZA 5AJ3F 4CLUA 2H48B 5HMXA 1RJJA 2W9BA 2KFYA 3KG1A 1ZM3A 1U45A 3ITHA 4DQPA 3X1LB 2C3YA 1SL1A 2C2OB 4MKBA 1VRUB 4ZPTR 4B3SF 4J90A 4LQ9A 4XDCA 2DH9A 3EYZA 3R6GB 4DR2F 3PX0A 3MTKA 1F0XA 2ZZTA 3EGVA 2HNYB 2P2CB 3Q8RB 5D0EA 4OMFG 4PPDA 2GHPA 3THPA 2R2SA 1Q8KA 2Q79A 2PE8A 4G1PA 3R3TA 2BUNA 1U1KA 3GZ7A 2E9ZA 1SUQB 5A8RB 5LMNJ 2Y9HA 3VQSA 3CDAA 3IO1A 2L9NA 3ISZA 5E3QA 4K5RA 1SH2A 5D0GA 5A2QU 5KT4A 3MXHP 1KC8T 2C3OA 3WIVA 2L9DA 2WW8A 4DX5A 2XWYA 5IXUA 2O3DA 3OUYB 4Y2CA 2QX0A 4AYBD 5K14A 2NR0A 1JLCA 5I3PA 1T11A 1UPPA 5KFVA 4AXJA 2CADA 4DCPB 5AE3A 3F41A 3ADAC 1KOHA 5C2CA 1HR0J 1H38A 2BE2A 3GP9A 1HNXJ 4HL9A 5LJ3Y 4B9SA 3IGVA 5JUMA 1B99A 4Q43A 2JDJA 3PO5A 2ZFHA 3PO4A 3DLGB 4NCGA 1BQNA 3OXFA 4DX6A 1YG0A 4DEZA 1UL3A 4HLBA 4NLVA 2CQBA 2W4PA 2AU0A 2FIUA 1M5PC 5CYQB 1SL2A 2ZH6A 2CDRB 3EM1A 3KMQA 4WK1A 2VONA 3L4BC 1YHQS 5LMUF 1NRKA 2Y0BB 3QRRA 3WX8A 3PFOA 2MKCA 2B6AB 5ETLA 4O4RA 4B9VA 4O44A 4IOCQ 1R3NA 2UUTA 2ASLA 2VG5A 2RILA 4QW8A 3DRRB 1RYSA 1S1XA 4KHMA 4FYVB 2VH7A 3LPEA 2E5LJ 3TOQA 5CHCB 1X4AA 1FTRA 1LNQA 1CC7A 2QYCA 5HJXA 2IC3A 2GFFA 2V68A 5A2QY 1Q95G 1S4EA 2HS0A 3N9UC 3TVZA 2YX4A 2OMOA 4ZPBA 2QIFA 4F02A 3CW2C 3IWNC 1NDCA 4OI3A 2V69A 3BYRA 4EZ9A 2X7IA 4KFBA 2AYMA 3BSNA 2FZCB 1OSDA 4A8WA 4YB6A 2H3EB 1Q86T 5KG7A 1X4EA 2AJ2A 4A8KA 2OPQA 2GVZB 5I3QA 4NCAA 4QIEA 4GKJF 3QYYA 1B64A 2YKOA 1NO8A 3NCRA 4HKQA 4LFBJ 2VPZB 5HROB 4Y0FA 1TAQA 4KHPF 4IH5A 3AOBA 1CG2A 2D1CA 4JP8A 2B5JA 2C2EA 3NKYA 3JTNA 3O6QA 2HSEB 1ZTTA 1QUPA 1MSWD 2XQCA 1HHSA 3M1VB 1KFSA 2DCLA 5ETPA 2LU1A 5C42B 2ZZMA 2P9EA 2ZNZA 3CD0A 5EGYA 2DNNA 5J1EA 4DL3A 2DVIA 3HFVA 2DRDA 2B7BB 3WDOA 1WSRA 1NU4A 4ETXA 4TNOA 4ZVSB 3RB4A 4RBTA 4K7QA 2E1CA 3UR3C 2JC1A 3T5HA 2OUGA 1WJ9A 4UY85 4B3MF 5HATA 1FEHA 1XMOF 1HMVA 2IPOB 3OL7A 1ZH5A 4GKKF 4EFAC 1CVJA 2CQGA 1JLFA 2XMKA 4F3QA 4ZVFA 2VQFJ 4K4XA 5THWA 4XAKA 3RG6A 1Z2LA 3R5AA 5L1KA 3S7RA 3SEOA 3AJDA 2VOOA 1M5SA 1RAEB 4U6PA 3LGNA 3ILOA 3HSZA 1EAYC 4HI1A 2Z30B 3MEEA 4H4MA 4NLYA 5H9EK 3VQTA 3DU6A 5D3GB 1F9FA 4LBIA 2KDOA 2AKWB 3FEYB 2DGVA 4OZ5A 3BQ0A 1NDLA 2LVWA 1S6UA 1X4CA 3DMJA 3MMAB 1FJGF 2E44A 2P6TA 3KUGA 3W2WA 1UW4A 4WFBQ 4KAIA 1HWJA 5IM0A 3QAEA 3UWTA 2B56A 1JJCB 3GLJA 4L3KA 3PZPA 4KH0B 4Y3CA 4ZP6A 2BBEA 1P6TA 1U0HB 4ZCKA 4L72B 5GMEA 1YRTA 3ONQA 3GV7B 5HP1A 2QFJA 1VQNS 2XSJB 5IC4B 1FT8A 2MKIA 2CQ4A 1FO1A 4M63A 1J5EF 1TQLA 4M5NA 2EBGA 3WX4A 3FCVA 1UEVA 4A48A 4WXWA 3HHKA 2F8HA 2CQDA 3BR8A 4PWUA 5C24B 1B70B 1D3WA 3TEHB 4YP3A 1Q8IA 3JSBA 1X4GA 2QMXA 5MLCV 1VQMS 1BQMA 1GXUA 4JI3J 3Q22A 3V81B 2RHQB 1YBAA 1P1LA 3QBCA 4P52A 1GK8A 3LGHA 4C3MA 4GMKA 4J9KA 2HNZA 1IKVA 2DYAA 3OTBA 4FZVA 4J91A 3EPIA 4MTPA 3BGFA 3C2PA 2NCKL 2B51A 2IY5B 1K0TA 2MSSA 1IJEB 2ZH3A 1EIYB 2VFTA 1B7YB 4DJBA 1H3DA 1JXLA 2D3UA 4RW8A 4DF4A 1R8AA 3PKMA 3OR1B 1N5QA 1O6XA 2XTJP 5DQHA 2R4FA 3J81U 3DLEB 2PSZA 3ZZTA 2IM3A 1O51A 2MZTA 4F4KA 1I94J 1KSPA 2CPYA 1KQFB 3FRYA 4WFNQ 3GILA 5LSOA 2DHHA 3ZZPA 3GMGA 4PQUA 1OPIA 2HRTA 3O2IA 1B7FA 4DPTA 1RTDB 3SDEA 2DXEA 1YX2A 5D4PA 2PA8D 3G6YA 3IG1A 4X4PA 5E7OB 1N36F 2FVQA 5FJ4A 4HTIA 4K4ZA 3JSRA 4DV7F 3CC2S 2AD9A 2KU7A 2HFZA 3N5FA 3OL8A 4NASA 2CKWA 3PXGa 3TUIC 4PEOA 3VVUA 5I3UA 3QZ8A 2CYYA 2RDDA 1JXEA 2KXNB 2QJ3A 4EU0A 3BN7A 3H5YA 2X3GA 4X66J 2ZKUA 3SZ2A 3OT9A 2QC3A 1IKXB 3T6JA 2DKOB 1F2HA 4ZA1A 1LW2A 3LP2A 4IH7A 4BBYA 4KO0A 2V9KA 1N0VC 4DX8H 3RRHA 1NJYA 1T05A 1QDUB 1X5TA 1AZSB 2X51A 1KHVA 4A8MP 3LO3A 5GADU 3AOCA 2Q43A 4LMZA 4W92B 2MKYA 2R8HA 1UVLA 3ZO7A 3BV8A 5D15A 3TUJC 5BYSA 3J81Y 2F40A 1V3SA 4TY8B 3HVRA 4WFYA 1DTQA 3HD1A 3P4UB 3T41A 3CDEA 4HDHA 4MKAA 3KLIA 3W2VB 5KT7A 5KFDA 4U67Q 3QRQA 2MJUA 2FC9A 4LVOP 1FESA 3FBCA 3MFIA 2HHSA 2VF3A 3OTCA 4OJ1A 2HFUA 1Q8BA 3FBFA 4ZLPA 2WOMA 1RI7A 2OJ3A 1N52B 3AXKA 4PUOB 2CQIA 1HNIA 4KH1B 2G2OA 4K2XA 4XPCA 2XULA 2WB4A 4LSLA 1U2RA 2EVZA 3NS6A 5B0CA 3M2RB 1OWXA 5CQGA 4RUHA 1D8ZA 2DB1A 2QA4G 1NCLA 2RF2A 2C28A 1TL3B 4QWAA 1SJQA 3IAM9 3P5BP 2HBZB 1QAIA 2XLIA 4PQAA 1G7CB 4OYWA 3UI3A 2IAJA 4F4XA 1VQ9S 1HPZA 1U49A 3BBCA 2KXFA 2DH8A 3CJ3A 5J2PA 4R5PB 1VRTA 4DQQA 3TJAA 4M5DA 4IR1A 1FFSB 4JI6J 2CQ2A 2YKMA 3TAMA 3ILJA 2DBBA 4YS2A 2V4JB 3K89A 2KTQA 3T1YF 3KHGA 2KN4A 5C7PA 3A8KA 3NS5A 2KVIA 3K0JA 3I31A 3VZIA 4DHVA 2WAQD 3VWSA 2HVHA 1FNOA 2KZZA 2ATCB 1D1UA 3W9IA 3RTVA 3CD5A 1KKHA 4FNIA 4R25A 1R0CB 4DV1J 1GMWD 2HHVA 1BQXA 2MQLA 1DTTA 1KTVA 3TAQA 5D0RA 2E7VA 3V4IB 3GG1A 3H4BA 4CTAA 1OY8A 3ETOA 2V2KA 3DCAA 4UOCA 3ZTPA 5KG2A 3MAAA 1OYEA 1O8BA 1U1NA 3HD2A 1XWLA 3LWLA 3V6JA 1RA6A 3OHAA 2R42A 1Q0NA 2OLWA 2YWEA 3NNAA 3SV4A 1TZ0A 3BYPA 1RTHA 4IDKB 4EMDA 3A4TA 3MPVA 4CO5A 2CJXB 4JI8F 4JYAJ 3M2UA 4C2MA 2CPFA 1ZA2B 3HT3A 1RT6B 2F63A 1U02A 3WIUA 3RUBL 2I9SA 2V63A 2D3ZA 5K5MA 1SKSA 3UD4P 3HSGA 4DZ6A 5HJYA 3H0PA 2W8KA 2RDIA 1RWUA 4JI4F 2WTFA 1VQ6S 3HVAA 3KLEB 3PYFA 2WCXA 1ZAXA 3TZXA 3MR6A 5F8NA 1G3OA 4NI2B 5KFGA 1MU2B 4J9PA 2B9YA 3FEXB 1X9WA 5K8OA 4OHYA 4NA2A 1FRHA 3KDNA 3KHHA 5AJ3J 4OI4A 2KJWA 1WC5A 1WORA 2HAIA 3KJFB 2DT9A 2HNDA 4EBCA 3HO1A 2UV8G 2DXFA 4YDDB 3KLGA 3OR2B 2DGSA 4B3SJ 4JI2F 1TL7B 1FX2A 2E7WA 1H74A 3EVWA 4RW6B 2YWHA 4DR2J 1YI2S 2DGUA 1U8SA 3S01A 2CIMA 4YB7A 1A7GE 1JB0C 3VTIA 3R1HA 2D9PA 1IR0A 1RT1B 2DRBA 4HVZA 3NNHA 1S9GA 2XWXA 2BDPA 4DSKA 2EI5A 2H9ZA 3GV5B 1WNEA 2K8GA 4H4KA 4QCLA 2AGQA 4DOZA 1TUGB 2GGPA 1SKRA 2FB0A 4EO6A 5C25A 3HHLC 4RKUC 1XN9A 3NG8A 3I0SA 3ENVA 5HQLA 4F4YA 1UJ5A 4NLPA 2LQBA 5DS7A 3PVXA 5HI7A 2VODA 5DO2A 2HZVA 4Q45A 4IO9Q 3CGIA 2R3VA 3AFGA 2AGOA 1NNDA 4L6V3 2DHGA 2QV6A 3T1AA 4IOAQ 3I56S 2Z2LA 1CJUB 3HHLB 4ECSA 3I87A 2ZH5A 3S1TA 3DLJA 4CT8A 4QW9A 4MYUA 1QE1A 3W1YC 3NXZA 1TKXB 3ZZ0A 2VPWB 1AFIA 3OVSA 5BYQA 3KWMA 1TMJA 2B4OA 2ZBPA 4OZJA 2CJ9A 4H4OB 4W4MA 5LMUJ 4RUAA 4C8MA 1MN7A 3H7HB 2W9CA 4ZN1A 2RE1A 2W24A 1S4FA 2ZNYA 1OS5A 2NUUG 5DDRC 1UP1A 2XZWA 4N47A 3EJMA 1PJ7A 2ZC3A 3GYGA 3UFCX 2Y3YA 2LXIA 2HMIB 3AT1B 4PWDB 1RT3B 1YSJA 5CABA 3ZZUA 2XC9A 2WVBA 2QGFB 4KIAA 3DRXA 1SH3A 2QN6B 1SV5B 4Y28C 3MR7A 2E1MC 5HVHA 4ZPDA 2RD5C 4EWTA 1RBOB 2GIQA 4WKYA 3QJJA 2ZUAA 5CD4H 5FD1A 5IS2A 1NKCA 5E3PA 2RVJA 3BB5A 3DM2A 4X4SA 2O01C 2VV5A 5J1PA 5I42B 4FPRA 4PRFA 3GJQB 2CVEA 2MZQA 2KHDA 4QWBA 4O0IA 1FVQA 4A8YA 3M8YA 5KFPA 4OHXA 3W9JA 4MIBA 1P9YA 2BJ3A 1N33F 2MJNA 4NL5A 1S1VA 3HVTB 4UTGA 2QMUB 4GKJJ 3GB0A 4P6QA 2DHAA 5F8JA 1I51B 4IQMA 2XLKA 3BREA 3PW5A 5J2NB 2JLEA 2NZCA 1VFJA 5SUHA 5IQ6A 2ROPA 4KHPJ 4UZCA 1T9TA 2PC6A 4CLWA 3RU0A 1C1BA 3CCJS 2O1PA 1XMQF 5BYRA 2BANB 1BUXA 4C98A 1JJ4A 4NLDA 3RRGA 2RRBA 4QPTA 1DBDA 4G65A 1TK8A 1BD6A 1WF1A 2DEIA 2QLJB 4PABA 2DNZA 4ZS6A 3GG0A 5IT0A 4WP9A 3BKUA 5LXRA 4JV2A 1PC4A 4M5JA 3I82A 7FD1A 4ZCMA 2RNEA 1RISA 4ZVEA 1OO0B 4B3MJ 5HANA 3Q8QB 1XMOJ 1T03A 2UXCJ 2LXFA 3BO3A 3GQCA 3H90A 1HHTP 3O5TB 2I8EA 4ICLA 2IVFB 2NPFA 4GKKJ 2WVFA 2NZ4A 1VYAA 3PEJA 3PYDA 2OKQA 1NMEB 1RT4B 3QJLA 1PYOB 2HG4A 4M94A 2IJRA 3VZHA 3C46A 1XTZA 2B4VA 3D3CJ 2WSEC 1VBYA 1Q78A 1Q53A 3L95X 3KK2A 1YJNS 4YR3A 4K4TA 4O4GA 1SC4B 2GJIA 2AGPA 1HBNA 1R43A 3CCVS 4DQRA 5CCLA 2OPPA 4R8UA 2ZHOA 1MLAA 3K7RA 3MMBB 3FFIB 1YJTA 1RBLA 1VC0A 4RUBA 4ECWA 1A9NB 2QLWA 4OLOA 4JV0A 4GVBB 4OJ3A 4USWA 1M5VC 3GFHA 4M95A 2MHEA 1DURA 2AEFA 4USTA 1FX4A 4C0OC 3R9LA 5F41A 1N32J 2NUHA 2FY1A 1VK8A 3RRKA 4C7QA 3ISNC 1RB0A 2GAGC 1KD1T 2D9OA 4LBHA 3U7JA 1HI8A 3F0NA 3OXGA 3NS7B 3OVAA 1S57A 4RW7B 1F9EB 3MR5A 4RWXA 1J5EJ 5JMNA 1UWBB 3KK3A 4OI0A 3NMAA 4LSNB 2MY8A 2NYIA 4KGKA 3QT8A 3U1MA 3TJ9A 4PXCA 2QLFB 1S6QB 3MPDA 4LRCA 2CWKA 3SMZA 3BN4A 3VGUA 1FF2A 3BBBA 2J0SD 1SH0A 2JJ4D 4X4NA 5FIIA 3KLVA 2BYCA 4B9MA 5L46A 2YNGA 1PC5A 3KXDA 2HEKA 1VQPS 4B3OB 3ITHB 2H51B 4ETZA 3SXLA 3MM6A 1HIYA 2ACMA 2VBWA 2K7KA 2FLNA 4FF1A 1IN0A 4ID8A 4OI2A 4ENOA 3QLHA 4J9OA 3C6TA 1WG5A 4ZCIA 4QQBA 1IBMF 2CPXA 1WI6A 3T1HF 1HL6A 4AT1B 5GAEU 5IQQA 1FWLA 2OMLA 2QFIA 3DI6A 5KFWA 4DL7A 3KJVA 1KBRA 3FEZA 1TTHB 4BC9A 5DG9A 2EK1A 2HWIA 2CDQA 1VJQA 4HI2A 1QAXA 4NLTA 4F8RA 1T95A 1UW9A 4UUWA 4N5SA 1TKZA 2RU9A 4OV1A 1RAFB 4KB7A 1LWCA 1LWFA 1N5VA 1TUWA 1T02A 4P2SA 1CSJA 5K14B 1JLCB 1N36J 4XO0A 1NJXA 1CJTA 1H2TZ 4DUYJ 4ZIWA 1UVNA 2XMVA 1L3KA 4K50A 1FFWB 1JXVA 4WKRA 4C8ZA 3QIPA 3D1QA 4F67A 3KDOA 3HLUA 1PBUA 5F0WA 2FGCA 4K2JA 3CIMA 1X4FA 4LF8F 2KT3A 4NCGB 3OFGA 2OTJS 3DDNA 2FPHX 3PRVA 4PYAA 3BF4A 3MOJB 4KT0C 2B4UA 1MW7A 2VICA 5M2RA 2JHEA 3EVMA 2EFQA 4N41A 3MCOA 2DHXA 2MPUA 5DJBA 3K5OA 1K47A 1B0VA 3W65A 2K7JA 3NGUA 3D1OA 4USIA 1AYEA 2H5JB 2PI5A 2I2YA 1FDBA 4O44B 5IT9U 2VG5B 3C15A 2XNRA 1YGYA 4OIXA 2A3JA 3EWGA 1S1XB 1UVJA 3MEDB 4NRUA 4DR7J 3IGNA 5ETQA 3PRBA 3H5XA 2HIYA 2DGOA 3V6KA 7FDRA 3TA0A 4FVMA 2FC8A 2C1EB 3SSQA 4R0JA 3MURP 4KBIA 2FGOA 4GO5X 5LMNF 4UQTA 2KM8C 2A0FB 1IBCB 4UOGA 3MUMP 4FYWB 2VFUA 3K5MA 3DDIA 3DLHA 3HT0A 4ED7A 2YKNA 4L75A 4DR6J 2CVIA 4E2FB 1X0PA 3U02A 2Y0SD 1NJZA 2ADCA 2OPQB 2FYXA 2KM8B 3BBFA 3POTB 1HR0F 2MQNA 2HW3A 2A18A 1FHTA 3J7YI 3DFEA 5HBMA 4D3GA 1HD0A 4HACA 3MCMA 4OJHA 2CPDA 2GMJA 4DV3F 2B5JB 2J9EA 1T9WA 2KRRA 4PCQA 3T1YJ 5T7LA 2DNHA 4CLSA 1Y5LB 1M90T 2OH2A 3N01A 3CD6S 4CDIA 1RAOA 2AJ0A 2VHGA 5J1EB 2F1FA 2XZTB 1C1CA 3AAWB 1FERA 1KNZA 2HQFA 4ECYA 3QT5A 4L3NA 1X4DA 2GV1A 2EFVA 3QGIA 2ZVIA 3CTRA 3B54A 2HAFA 5KG3A 3DOKA 4QBUA 1ZS6A 1LEOA 2ILYA 3RAMA 5KFLA 3PIPQ 1HMVB 1SKWA 4P9SA 4HH1A 1K8AT 1Y7PA 2E66A 4ANDA 3R2DJ 4DUZF 5JVGQ 3PEHA 3GIJA 2C3UA 1JLFB 3F56A 4NZ7A 1EZZB 4TVAB 3H40A 1JLGA 2C3MA 1VHFA 2M88A 2XGQA 3QJPA 2FTRA 5D4OA 1RT7A 1LXNA 2MLXA 2ZH8A 4RBVA 1HQUA 1FJCA 4ILLA 2R8JA 1HBOA 5B0FA 2VQEF 4UOFA 4FS2A 1FK9B 3MEEB 4YR2A 4H4MB 3W7BA 2XY5A 5E3RA 2POKA 3QWPA 2BJDA 4J9MA 4FKXA 2IRXA 3DHWC 4EBDA 3M8QA 5DQIA 4J9QA 4X4UA 3CJKA 3GR1A 3DMJB 1FRIA 3QMQA 4LFBF 1WHVA 1S76D 2DGWA 4F04B 2R7UA 3W2WB 4EK2A 2QEXS 1RWVB 3BKTA 4EGLA 4Y6IA 2IRYA 1TKTA 2VKRA 5JJBA 1S7IA 4AL5A 5IM0B 3G4SS 1AUDA 3GSIA 3M32A 4HH0A 1IR2A 1T9XA 4WTYA 2R7TA 4IUFA 3FZ2A 2VA2A 1L3SA 4CM2A 2H4YB 3H59A 1KLNA 3ET6A 2DNYA 3WZ0A 2ZH1A 5HP1B 4J9UE 4EEYA 3KTQA 2CQ1A 3TEGA 5IV4A 1LV5A 4GC6A 2F8EX 2V0NA 2UXDJ 2HVEA 4BC7A 3MZIA 4U7UD 1DLOA 3MD3A 4X4QA 3QRPA 1ZM2A 3L7OA 5A8WA 2BEFA 4JI2J 4YHHJ 2V8DA 1BQMB 4XIUA 4OYXA 3H2VE 2F4VF 3MM5A 5DM6Q 3LH2S 2AF6A 5GADI 1U1OA 3PDNA 3QATA 4O0NA 1RWWB 4DSFA 4CP5A 1ZTWA 4A46A 2HNZB 1RWPB 2YWKA 1X31C 3MD1A 1IKVB 4OLPA 2V67A 3EPGA 3CCUS 3NNCA 4U8VA 1P8GA 4IRCA 1F6TA 2GHWA 1OYDA 1J27A 3TZWA 4U7UK 4RW8B 1VC6A 4KTQA 4ZVGA 2ASDA 3NWRA 1DRZA 4F7VA 4M5IA 1LW0A 2QSWA 4EI2A 2VUGA 3CMES 3MCSA 3M2VA 4RW4A 1XNQJ 4DN9A 4J9LA 1M1GA 2E5GA 3CDUA 1L3UA 3FZBA 1WHWA 3GV8B 4ER8A 3W8PA 4QR2A 1NPPA 4TY9A 4YDXA 4EO8A 3O8WA 3UPFA 3T5JA 4FYXB 3ENAA 1PCAA 3VAIA 2OEJA 2W8LA 3CJ0A 2AX0A 4PQUB 1VJWA 1VQ7S 1QD1A 1U2CA 2VFRA 3SDEB 3PR4A 3ULHA 3G96A 4I56A 3IG1B 3KKFA 2CUYA 2BMBA 1XQIA 1ZETA 5KFIA 3MMCA 2R7QA 1X60A 2DXDA 1MMNA 3OXLA 2G9OA 1RKIA 3NGDA 4F25A 4ED5A 5MAOA 5DG7A 1T9UA 5I3UB 1OQ3A 3LA0A 3V4MA 3M9NB 5J2QA 2E5JA 1RE1B 2CPHA 1TFYA 2HHWA 5T14A 2EFPA 3UN2A 2P9GA 2HK3A 4ZP8A 5F3ZA 4XK8C 4AL6A 1LW2B 3LP2B 2QMWA 1EJ7L 2H4WB 4KO0B 3OFFA 1NB2A 1T05B 4PR6A 2GO9A 4URGA 2YNIA 3GYNA 1N5SA 1U1QA 5AXNA 1VIXA 1VHIA 2HHHJ 4CT9A 4AFFA 1F5BA 4O23A 1HWKA 2DGQA 4W90B 3OLAA 3WC0A 2XHCA 2FZGB 1R8HA 4I0WA 1DTQB 3N79A 1NJWA 3LUYA 4EYHB 1DJ0A 1X5SA 3KLIB 5T41A 3OTOJ 2R7RA 2HNYA 2K1RA 2VIHA 1I94F 2CFXA 3H8YA 3K5NA 3N6MA 2AIRB 2WOMB 2N4CA 1MWQA 3CF5Q 3SQGA 3BM7A 1HNIB 1RADB 5A8RA 2XLJA 1VQSA 2LQ8A 2R7OA 3N6NA 2IHR1 4ELVA 4K59A 4DQSA 4USHA 4Q2LA 4LSLB 3DGPA 2Q6CA 2ZH9A 5A0YA 1HD1A 2QO3A 1CLFA 1HHQA 3CCLS 2KI2A 4F2SA 3I6PA 2B4PA 2RF2B 3IM9A 1XMQJ 3KNAA 2Z8QA 2P5VA 2IAJB 2F5GA 1XERA 4AE5A 1HPZB 4I6YA 5L38A 3G8TA 4ALZA 5J2PB 4HHUA 2F9DA 3TVKA 1HARA 5EWEA 1N6QA 3AD9C 1Z1ZA 3TQEA 4NZ0A 2YKMB 3TAMB 1L3TA 1QUVA 3AB4B 1VR6A 1WI8A 4P75A 1H2UX 4I67A 5M2PA 3KFWX 3GIIA 2JEFA 3KLHB 1UEKA 2LKZA 5D6GA 3SCLE 2HWHA 1VLYA 2AEJA 2HBRB 3PYGA 3KK1A 2FVRA 2DR9A 4PPZA 3UNYA 4LF6F 4I7FA 2PMWA 5KFFA 2WONA 3B4MA 1UA1A 1RAAB 3AA9A 3CEDA 2HGNA 2VPXB 1ZBTA 5A76A 2UUBF 2YNFA 2ABYA 2LFVA 1R0BG 1J5OB 1F3FA 4CTAB 3RJMB 3NY0A 3A8EA 1S7HA 3FSYA 5F9LA 3L09A 3MPYA 2A2CA 4WZMA 2AQ4A 1FKAF 3C6UA 1EQ0A 4FF4A 2YX7A 1CJVB 3LWMA 2Y1JA 3DRPB 1RU1A 2Z4PA 4UT4A 4NLXA 1FNMA 1N88A 2OD4A 1RTHB 3LOUA 1EX8A 2F9JA 5AXLA 3M2UB 4LRDA 4RO0A 2UVRA 3UCUP 2FJAB 3LPYA 2C3PA 2R7VA 1S6PA 1JMTA 5EX3A 2OFGX 1U6BA 1R31A 1SIWB 2OIHA 1S1TA 2ZDOA 3JSMA 3CCRS 4UUXA 4IRKA 3GE9A 1WTFA 3SSSA 1VQ4S 1I5OB 4MJKA 2OFHX 4LREA 5LSRA 1EHWA 4JI6F 2ZM6F 3BPSP 1PSDA 5KG4A 1OSCA 3FJ2A 4MIWA 1SJ4P 4YUDA 4JI1F 1WHYA 2LDIA 1NJIT 2COLA 4NE9C 5FLXY 1YJRA 3OW2R 1WWHA 2MZJA 4RNHA 3EXCX 1R7IA 2W9AA 5DG8A 3AHPA 4DR3J 3CCSS 4DR1J 4O3SA 5HLFA 1UFKA 2DH7A 4FXWA 1N5TA 2NXJA 2LU2A 3CE8A 1HBMA 2B0GA 3OPKA 5CH7B 4WU2A 3Q0AA 1JLEA 4JV5F 2D69A 2HNDB 3TANA 4X4RA 2OHDA 1RHJB 3KLGB 3DOLA 2Z2MA 4YMEA 4H4KC 1Y0HA 1N0UA 3I5AA 1FJEB 4Q8FA 2FY8A 2OGUA 1WKKA 5IOLA 2RKIB 3HHEA 1IBMJ 3BKFA 3N0VA 3T1HJ 4G1QA 1JLBA 2XEXA 2SXLA 4CRJA 1ZAVA 4P10A 4CLYA 3Q24A 4QIFA 3DGVA 2W01A 5KFZA 4U8YA 1RYRA 1DQAA 2RUGA 1S9GB 4UW2A 2GC8A 2E1RA 1WC1A 4JYAF 2NXEA 5FDLA 2G0CA 5HO4A 2CNOB 1T3OA 2AWZA 2RIJA 2X3DA 1HWLA 1S1WA 4O3NA 3OJSA 3CNQP 4RWWA 4Z7CA 2HS3A 3I0SB 1H6KX 5IWAJ 3DN9A 3R5DA 1S5ZA 2W7OA 3MUVP 3Q89A 3QAUA 4CZCA 4A8FA 1UEUA 2I0XA 5L1JA 3FQKA 2J76E 4QZVB 5KFBA 1Q16B 3JAMU 3MEKA 3MECB 1AUSL 1WOOA 4ZVPB 2W2OP 4LF8J 1WF2A 2C2KB 4NCBA 1LWXA 1HFEL 1QE1B 1YZ7A 2HFSA 2OP5A 3PACA 2RS2A 2IVMA 2PT0A 3SIPB 1P1TA 2XSJA 1HLWA 3IWLA 4PKDB 3U27A 1ZZNA 1X4HA 2K2PA 4Y65A 2WHOA 2E29A 2W9CB 3H2UB 3QSYB 2VL1A 2JL9A 2HFOA 3A3PB 3GONA 3WBZA 5C24A 4ES1A 2BOAA 4RPFA 2QA4S 3M7VA 1ZAWA 2FHKA 2CQPA 4WE1B 3M4XA 1KVIA 5KFUA 3H5UA 2Z57B 3IR6B 1NPKA 1GFWB 5F8IA 1Q8LA 4QU6A 5F8MA 3KLFA 1W2IA 1DHMA 2CPIA 4RZRA 5EWFA 4DLGA 3O1LA 1RHKB 2LP4A 1HW9A 4YR0A 4CLFA 1LFWA 4RX6A 4IQXA 1OQ6A 3HXMA 3BGLA 4MAKA 5KFKA 1D9FA 3DM2B 2ZJRQ 4A4JA 1X4BA 2M4MA 1C4AA 3W3SA 1HW8A 2J6UA 4X4OA 2P9CA 3DLEA 4Y2MA 1Y11A 3PHTA 4ZPCA 4N76A 3JAMY 1S1VB 1O5JA 2D3O1 2KFNA 4Q0BA 1U0SA 4NWBA 3BSAA 1FEEA 1RAHB 4E98A 4DV3J 4MT1A 2DO0A 1IM4A 3R7SB 2WSCC 1U1LA 1HQ2A 4ZVRB 5HAOA 1N34F 4KHRA 1GMVA 3CO0P 2Q1LA 2AEMA 3GFZA 3T5LA 2Q66A 4DSEA 1SI9A 5L1IA 2EK6A 3HHDA 3DRSA 3PRDA 3HKWA 1C4CA 5IZHA 3M8RA 5BXIA 4FXVA 3AY0A 2BA9A 5LXYA 3RW6A 5F9NA 1T03B 5E5NA 3IWXA 4DDFA 2BE7D 4A8OA 3NWGA 3UD5A 4ICLB 4DUZJ 1C0UA 3PJ9A 1GTEA 3NAIA 2AHOB 5D78A 2BQRA 3KNGA 1S59A 1IBLF 2MQOA 4B02A 3KK2B 4YB1P 1U1MA 1XEZA 3KYLA 4G1IA 1T94A 4LBPA 4O4GB 2VQEJ 4RNMA 4TY8A 3PJXA 1MMLA 1HBNB 3D7SB 2OPPB 2IJFA 4PG7A 4R8UB 3B78A 3MMJA 1KS2A 1U2FA 3TWZA 4LIRA 3CCMS 2APOA 2MZSA 2K3KA 2DGXA 4ANCA 3CJ2A 2HLUA 2AV5A 3JSYA 1TUVA 5KG1A 1NB7A 3R8YA 5F0UA 1GT8A 3U1LA 4LT6A 1UWAA 3SFGA 2UUWA 2RDJA 2IMWP 4DUTA 2EPIA 4U9RA 5JXSA 4TKTA 2W2PP 4B3TJ 1GH8A 5KFTA 2B43A 1GQEA 1TL3A 3HM9A 2AYGA 3FKBA 3RR7A 3KK3B 3DLKB 3D6MB 2DNRA 4ZJLA 3CSKA 3P96A 4NA3A 2M2BA 2C2RA 4WFZA 3NP5A 2JLGA 3J7ZT 3UDLA 1R27B 4WIIA 2UXCF 2KT5A 4CCHA 1FE0A 1R8BA 3QPIA 5ETKA 1HNVA 3RBXA 1SC6A 4DLEA 2F4VJ 2MY7A 4OYZA 4TLQA 3SSRA 4ECUA 2YNGB 2Y8WA 1XC9A 4FP9A 4USJC 4N77A 2VB6A 4I4BA 2BV3A 1R6VA 4QU7A 2NXUA 2G4BA 3A8JA 1K73T 1X7VA 3MM6B 1H2VZ 2HHPA 4B3RF 1OY6A 2VBYA 1YITS 4DL4A 3RB3A 3V4IA 3CCWA 1DZ5A 2CG8A 3QLHB 5IFMA 1R6YA 3EGWB 3C6TB 3FSXA 2JVRA 2F8MA 2WB1D 4F4AA 4AQYF 3GCXP 2R8GA 4LF4F 2F7VA 3T9NA 5HMWA 3DI6B 2QLBB 4ED3A 1PIEA 3KJVB 4M5GA 3SYZA 2HGMA 1N32F 1YQHA 2HQIA 1IKYA 4C4WA 2WRMA 3BGUA 3SV3A 1RWOB 2JEGA 3SFUA 4HT7A 4IDKA 2WK4A 3Q8YA 1WHXA 1BLUA 2ZE2A 2HQ3A 2X1GA 2ALZA 1LWCB 1LWFB 1RT6A 1T0TV 1ZPWX 3M8PA 4KPYA 4KR0B 2MQMA 3Q8PB 3UQSA 3G86A 1CJTB 4ECZA 4A47A 1HI0P 2LQ9A 3MM7A 3D9BA 3RAXA 4C48A 4BS2A 1NEEA 5KFAA 2W4CA 4LF9F 2LCWA 3QIPB 4NXMJ 3PKYA 4J9SA 1GMWA 4P2XA 3CWJA 1YVFA 1TFWA 5CCMA 1RTIB 1U6FA 1MWZA 3DXBA 2C22A 1R8CA 3QSIA 3TAPA 3KLEA 5GAGI 7AT1B 4DR5J 3Q2TC 2B7CB 3W5YA 2PI4A 3MFHA 3E01A 1ZYQA 4DXLA 2OELA 5ETOA 4V19X 1JWWA 3AB2B 1BY9A 1S99A 3GIRA 3TZZA 4I6WA 4QWDA 1AA1B 3L3CA 1TL5A 4FF2A 2YQ0A 2HFNA 3C15B 1CS4A 4M5MA 3QFWA 5M2UA 5DGAA 5LL6d 2QL7B 4RW6A 2DIVA 2FJBB 3H20A 4I2QA 3LALA 2HRYA 5HMYA 4C8OA 1GEHA 3H42A 1AB8A 2AZ1A 4NOHA 2UUCF 2VKZG 4ERDA 3NL0A 1NXIA 2HQDA 2DNKA 3D28A 4M8LA 1FWKA 4TU7A 2EBEA 1XMBA 2F65A 3EZOA 1NKEA 4DZDA 1CJKA 1TMMA 4ED8A 4KJIA 4X2BA 3J80U 2YKNB 1HNZF 3ZZZA 4C8KA 4LF7F 3MWBA 1AROP 4DUYF 2K3IA 1VDHA 1NK6A 3M6WA 2BJEA 1JLQA 2ZDPA 3I5BA 4KGVB 5HBMB 4NLUA 2O66A 3FCWA 1Y10A 4BDPA 1YJWS 1VS3A 3UE2A 4E8UA 2ZOMA 2XMJA 4CO0A 1NH7A 3K57A 2QL9B 4ZPWR 1B3TA 4NXNF 1RKJA 1V3ZA 2CAJA 3KHLA 4FBTA 3I4HX 2ZUGA 1N5YA 1KQKA 1I3OB 2KVQE 2MMYA 4MFBA 3SBMA 4OX6A 1C1CB 4LF6J 5KFEA 4QJVA 2BM1A 4H4OA 3BDPA 1EARA 1PJ6A 2JH3A 2QT7A 3DOKB 2PA3A 1FXLA 2IDLA 5HN0A 2UUBJ 4DR7F 2BJ1A 2BW2A 3CT9A 3RYLA 3V6DA 1D8YA 1YRUA 2IRUA 2DPJA 3BH6B 2HVDA 4I6AA 5EX0A 3CCQS 4X4TA 2L48A 5AE2A 4OL8A 1JLGB 4ANEA 3RGIA 2QG9B 5DRKA 4K4UA 2HVZA 2HZAA 3BSOA 2Y1LB 2QA1A 3NLCA 4OHVA 4QIGA 1RT7B 3J80Y 2IM2A 3KJQB 2PEHA 5KG5A 1L3VA 1HQUB 2V94A 5GMDA 1YDLA 2E9RX 5EN1A 4YOEA 1S0VA 3F73A 2UP1A 3M8WA 1TK0A 2B9EA 2HGLA 5EDWA 1WEZA 1KVKA 4DR6F 4ZVOB 1KRPA 5D8HB 4JI0J 4TQRA 4M5KA 5KFJA 2HHUA 3CJKB 4ATNA 4USMA 3TVYA 2IA0A 1SKUB 3FSIA 4DF8A 1FKOA 2ZKTA 1TKTB 5A6PA 1A6LA 2DPIA 3P6YC 4KY3A 1GXLA 1RCXB 2VBZA 4JV1A 3R5GA 2ZM6J 2IYIA 1EETA 3KHRA 2VDIA 5DDQC 4IRDA 4XDDA 5ADZA 1UCNA 1YWXA 4P2MA 1ZA1B 3L7UA 4JI1J 3D0GE 4I2PA 3B82A 1IWGA 2XCAA 3ET6B 4D3HA 4DSJA 3EZ5A 5DZ6A 2GA7A 1QTMA 1X8DA 4ZITA 1VQ5S 1JJ2R 2AZ3A 5B0AA 5EHHA 1WTBA 5G0RA 2KYXA 3M9MB 4B9NA 3MM8B 1RBAA 1HBUA 2J9CA 2M5YA 4J9NA 2J9DA 2Q3PA 3IXQA 2DY9A 2N7CA 4DU7A 2DNPA 1N56A 2YXLA 4JV5J 1VCTA 1E6YA 2EXUA 1DLOB 4JI7J 3NBPA 2AW0A 1W26A 3FDSA 2BQ3A 2VU5A 2VD3A 1JLAB 2QL5B 1KHWA 2CG4A 3UVJA 2V8HA 3O3LA 3RW7A 1VBXA 4U95A 3UCZP 4YY3F 4KGMA 1RAIB 2W7PA 4LRBA 3FRZA 2NXCA 3MHYA 1FD2A 2OSQA 2ZH4A 3KJNB 1SC1B 3IBCB 4KKOA 3J7A1 2DITA 1LW0B 3RBDA 1RT5A 4ED4A 2YTCA 4FYDA 4RW4B 4DFMA 3MMBA 4CH0S 3FFIA 2MHNA 1KEKA 1RHMB 1F60B 3P5TL 4F50A 3UW1A 4DV2F 1TVRA 1RP5A 3TX8A 3P3DA 5L1LA 3E3XA 1RA7A 1XIQA 3MM9A 2OTLS 2UVUA 1NK0A 1TL1A 4F36A 3M05A 4L73A 3H2LA 3VAGA 3LTOA 2I5JA 2Z2YB 3MMCB 3G6ES 4DR4F 1AT1B 4K4YA 2UXDF 1PBAA 2HRUA 2VA3A 5F3TA 4LUBA 5J2QB 4KC5A 4LSNA 4NLGA 4C11A 3HHLD 4RU2A 1H7XA 3L9ZA 4IG0A 1UZDA 4YHHF 2C2DA 4NLQA 2GQ2A 5K20B 3M6VA 3H4DA 4ZP9A 4V1Ak 1QSYA 2IM0A 1FTCA 2AMCB 4ZOSA 1RQ0A 3UD3P
chains in the Genus database with same CATH topology
1UVMA 3CJ0A 1SL0A 1YBAA 1P1LA 2AX0A 3LAMA 4PQUB 2UXBF 4B9NA 3GIMA 1VJWA 1HWIA 1XNRF 1K1QA 1VQ7S 2YNIB 4C3MA 1FE4A 2VFRA 3SDEB 1WD6A 4GMKA 2DIUA 4J9KA 2HNZA 3PR4A 3ULHA 1LWEA 5GAHI 2EFNA 1IKVA 2VG7A 3G96A 4I56A 1S0OA 3CDBA 2ZH7A 3IG1B 3OTBA 3G8SA 4FZVA 3KKFA 4B3OA 2NS1B 1UFWA 1Q82T 3EPIA 4MTPA 2FJXA 3D1HA 1XK8A 3BGFA 3C2PA 2D74B 2RQKA 5GVQA 1ZETA 5KFIA 2B51A 2ROGA 3V5RA 3MMCA 5GMKa 1K0TA 2MSSA 1IJEB 2R7QA 2ZH3A 2VFTA 1MMNA 3R5BA 3AH6A 4DJBA 3OXLA 1H3DA 2G9OA 1JXLA 1DARA 1RKIA 2D3UA 3BGRA 3NGDA 1DFDA 1UMJA 4ZHRB 4RW8A 4X64F 4F25A 4DF4A 1R8AA 1HYSA 4ED5A 3PKMA 3OR1B 1N5QA 3IBWA 5MAOA 5DG7A 1KLMA 3D0IE 4QYRA 5DQHA 5I3UB 1OQ3A 1U25A 4P7TA 2DR5A 1Y3KA 1XNQF 3V4MA 3M9NB 4PXDA 4CNZA 2KYZA 3Q23A 4EBEA 2R4FA 3PV8A 3DLEB 2PSZA 5J2QA 2E5JA 1FD8A 2K1RB 3ZZTA 2IM3A 1O51A 2MZTA 2CPHA 5KAKA 4F4KA 1TFYA 2HHWA 4FF3A 2OPSA 5T14A 2OSRA 4IH6A 2EFPA 1KSPA 1RTIA 4XPEA 2P9GA 1YTYA 2CPYA 5B08A 2L08A 3GYXB 3MGJA 1KQFB 4ZP8A 5F3ZA 4XK8C 3SQGB 3FRYA 3N28A 4WFNQ 3GILA 4AL6A 3MI7X 3MEGA 4ID5B 5LSOA 1LW2B 3LP2B 2QMWA 2EKYA 5ITHA 2JVOA 1U4BA 1KTQA 4KO0B 3DNCA 3ZZPA 1FKPB 3GMGA 3K5LA 1UKUA 2KHCA 3V81A 3OFFA 4M1KA 3FCHA 4OI6A 1MWYA 1T05B 2M0GB 2ZJQQ 1Q1KA 4PQUA 4PR6A 4WU3A 1OPIA 3O2IA 5A0YB 5B0DA 3I0RB 1B7FA 2GO9A 4URGA 1HA1A 3TARA 2YNIA 3GYNA 1RTDB 3SDEA 2BOPA 1N5SA 2XMWA 1U1QA 2X1FA 5AXNA 1VIXA 2MKJA 3QIDA 2ADBA 3DLBA 2GJ2A 5D4PA 1ZPVA 2PA8D 3G6YA 2N3OA 3IG1A 4A8QA 4CT9A 4X4PA 1VBZA 2YY3A 2OPRB 1K1SA 5E7OB 3UDCA 1F5BA 4AFFA 4O23A 1HWKA 1N36F 2FVQA 4GC7A 5FJ4A 4HTIA 4K4ZA 2DGQA 3JSRA 4W90B 4DV7F 3CC2S 1JNRB 2GIRA 2AD9A 5CA5A 3OLAA 3VAMA 3WC0A 3DOMA 4ECXA 2KU7A 2HFZA 1S97A 3N5FA 4ZHRA 1R8HA 1S72S 3OL8A 1VK3A 3A1YG 4I0WA 2CKWA 3OR1A 3T19A 1DTQB 4QWEA 3N79A 1NJWA 3PXGa 3LUYA 4EYHB 1DJ0A 1X5SA 2DD8S 3KLIB 3TUIC 5I3UA 2MZ1A 3QZ8A 3NRBA 5B0BA 2N4DA 5T41A 2CYYA 1CEZA 1N6QB 2CJQA 2R7RA 2HNYA 2K1RA 1MNEA 1I94F 2GHVC 1JXEA 2CFXA 1U24A 3H8YA 3K5NA 3N6MA 2KXNB 1Y5IB 4HEA9 4EU0A 3BN7A 3H5YA 4TYAA 2X3GA 4RNFA 4Q2MA 2WOMB 2ZKUA 3SZ2A 2JFKA 4F2RA 1IKXB 2N4CA 2FHMA 3CF5Q 4AXIA 3T6JA 2CZVC 1HNWF 3G6VA 3SQGA 3BM7A 2KJVA 1OIAA 4ZA1A 4ID5A 1MMDA 1LW2A 1HNIB 3LP2A 4YEAA 4Y2KA 4IH7A 5B0GA 4BBYA 5A8RA 4KO0A 2XLJA 2JEJA 1FKPA 1VQSA 2V9KA 2R7OA 1N0VC 3LP1B 3N6NA 2IHR1 4DX8H 3RRHA 3G71S 4IG3B 4ELVA 1NJYA 4K59A 4DQSA 1LOUA 4CI0B 1T05A 3KK1B 4USHA 3FGVA 1X5TA 4Q2LA 3QO9B 4LSLB 2XI2A 3DGPA 2Q6CA 4QWCA 2X51A 2ZH9A 5A0YA 1KHVA 4A8MP 4AUKA 1HD1A 4I7FB 3LO3A 1RTDA 2HHHF 2WONB 2QO3A 5GADU 3M9OB 1CLFA 3CCLS 1PO6A 2KI2A 1C1BB 4F2SA 3I6PA 2Q43A 5J1NA 3PJWA 4LMZA 2B4PA 4W92B 2OPRA 4K0KF 4EYIB 2RF2B 2R8HA 1UVLA 3TUJC 5BYSA 3J81Y 2BXJA 1DQ8A 3N5BA 2F40A 4DPOA 2CPEA 3KNAA 4JI5F 1V3SA 2YNFB 2Z8QA 2P5VA 2O5DA 2IAJB 4TY8B 1E6VB 1XERA 3HVRA 4AE5A 1TK5A 4WFYA 1HPZB 4J5OA 2KG0A 4I6YA 5L38A 3G8TA 1DTQA 3CDEA 4J37A 5SZTA 4ALZA 4HDHA 1H0HB 2BVZA 4MKAA 3OTOF 4Y34A 3KLIA 3MAQA 5J2PB 3MEDA 3QGPA 2OO4A 3W2VB 3PX6A 5KT7A 3QGHA 1HNXF 5KFDA 2F9DA 4U67Q 3TVKA 1HARA 2PO4A 2HWTA 1FDDA 1KR4A 2MJUA 3K59A 3MUTP 1I6JA 2FC9A 5EWEA 4LVOP 1FESA 1MROB 4WFXA 4OI1A 1N6QA 1Z1ZA 1T3NA 3MFIA 2ACYA 2HHSA 3OTCA 5E33A 2WBRA 2ZITA 4OJ1A 4DSLA 4NZ0A 2RS8A 2YKMB 3TAMB 1L3TA 3P49B 1I1GA 1Q8BA 2FHJA 1QUVA 3AB4B 3R1LA 4O3RA 4ZLPA 2LEAA 2WOMA 1WI8A 5CYJA 1RI7A 6FDRA 1H98A 3C6UB 1H2UX 2FJVA 2OJ3A 4I67A 4K4VA 1IKXA 4PXEA 1N52B 1G6BA 4BCAA 5M2PA 1B0PA 3KFWX 4PUOB 5KT5A 4MK7A 3GIIA 1BC6A 1QJHA 2JEFA 2NPIA 2CQIA 3KLHB 2UUAF 2DHSA 2LKZA 4LVNP 5D6GA 1HNIA 1NZAA 1WEXA 3K8WA 1U7LA 3Q8SB 1APSA 1CQMA 4K2XA 3SCLE 2HWHA 3VAHA 3LP1A 1VLYA 5H9FJ 4ED2A 2MZRA 4XPCA 2XULA 4IG3A 3G6XA 4A8XA 4WF9Q 2WB4A 3KK1A 2LEBA 5GAGU 4I68A 4IO1A 1KQGB 2FVRA 1NK8A 3QO9A 1U2RA 4LJMA 4LSLA 3CXCR 2DR9A 4PPZA 4LF6F 2AP6A 2EVZA 4I7FA 2I38A 3NS6A 5B0CA 3M2RB 1KONA 5DDOC 5KFFA 3JYTB 2WONA 3DYAB 1URNA 1BGXT 3B4MA 1UA1A 1OWXA 1RTJB 1M1KT 1LK7A 4B17A 3DRYA 2NREA 3AA9A 5CQGA 4RUHA 4V19J 1TV6B 1S6PB 1D8ZA 3CEDA 2DB1A 3HFKA 2RF2A 2B9XA 2HGNA 2QA4G 2C28A 1Q7YT 2VPXB 1TL3B 1ZBTA 5KOWA 1QY7A 1SJQA 3IAM9 4U7CA 5GAHU 4QWAA 1QAIA 2XLIA 3TP2A 3UNGC 1VI7A 4PQAA 2XS5A 2UUBF 1S1TB 1U26A 2ZHAA 1G7CB 5LSLA 3JSMB 1IXKA 2YNFA 3UI3A 2ABYA 2IAJA 2HYIB 1E6VA 1J5OB 4F4XA 3POTA 1VQ9S 1HPZA 4CTAB 1U49A 2KXFA 4NRTA 5DM7Q 2DH8A 4RW9B 3CJ3A 5J2PA 4R5PB 4N8NA 2YNHB 3AQPA 3W2VA 5GAEI 1VRTA 3AA8A 2E5LF 3A8EA 4DQQA 5KFYA 1XR7A 5F8LA 1S7HA 4M5DA 1FRKA 1MROA 3FSYA 4IR1A 5F9LA 1S0NA 3IRXB 2DNQA 1ZOTA 2VPYB 3L09A 3MPYA 2A2CA 3NCPA 4WZMA 2CQ2A 2YKMA 4P7VA 3TAMA 2AQ4A 1VC5A 3CMAS 2DBBA 1FKAF 4ECQA 1GXTA 2V4JB 6FD1A 4ZPVR 3C6UA 1YJ9S 2KTQA 4IFYB 3KHGA 3T1YF 2KN4A 2RMLA 4FF4A 1WELA 3NS5A 4BHQA 4PUOA 2KVIA 1S9FA 2YX7A 5HQ8A 3LWMA 3TRGA 4HYKA 2Y1JA 3K0JA 3DRPB 3LP0B 3I31A 3VZIA 4DHVA 2RU3A 2HVIA 5D4NA 3TR5A 4DS5A 2RB7A 1F2GA 1SIZA 4C3LA 2WAQD 3VWSA 4TLRA 4DV5F 5HLFB 2HVHA 2Z4PA 2XY6A 1FNOA 3L7PA 4C0BA 2RQCA 2KZZA 4NLXA 1TAUA 1FNMA 1N88A 2OD4A 1RTHB 2RQ4A 3LOUA 2F9JA 3OLBA 2IYGA 3RTVA 1D1UA 1S79A 5AXLA 2U1AA 1HBMB 3CD5A 3US5A 2XSFA 3M2RA 3DDKA 3M2UB 4FNIA 1W25A 3ISND 1RTJA 1HQEB 4R25A 2UVRA 2GW8A 3UCUP 2FJAB 2ZVSA 3S8SA 2HHVA 2KO1A 2LA4A 1BQXA 3LPYA 2C3PA 4ZMMA 1TV6A 1JLEB 1S6PA 2R7VA 1JMTA 2MQLA 5EX3A 4JOUA 1IUJA 2OFGX 1REVB 1DTTA 4CQ1A 1KTVA 2JRSA 1U6BA 3TAQA 1R31A 1SJRA 1SIWB 1SB6A 2OIHA 2ZBIA 3V4IB 3DOLB 3GG1A 1S1TA 2ZDOA 4TYBA 1FDNA 4ZP7A 3JSMA 1P27B 3CCRS 4PG5A 4UUXA 4IRKA 3GE9A 3H4BA 1WTFA 3D5MA 4CTAA 3SSSA 2V4RA 3ETOA 1VQ4S 4MJKA 3OV7A 4RW9A 4FNHA 4ECVA 2OFHX 3VAKA 3AQOA 4R5PA 2YNHA 5LSRA 2V2KA 3DCAA 4UOCA 3I4PA 1NHUA 2E5HA 4JI6F 5KG2A 2ZM6F 4DV0F 3GWCA 4EUVA 4N56A 1IJFB 1PSDA 3IRXA 5KG4A 3I55S 1O8BA 1OSCA 3ZFVA 1U1PA 1U1NA 4G1QB 3FJ2A 1JLBB 4MIWA 1SJ4P 1U47A 4YUDA 1XWLA 1RK8A 1WHYA 2LDIA 2V4JA 1NJIT 4JI1F 3LWLA 3V6JA 2COLA 4IFYA 3BSCA 5DETA 4DN0A 2BRKA 1RA6A 3OHAA 5FLXY 1N4LA 1YJRA 2EG2A 5I4MA 3OW2R 1U48A 1WWHA 2V8VA 2MZJA 5H1SV 5J2MB 4RNHA 1NH8A 2OLWA 2YWEA 1R7IA 3EXCX 4RLEA 2W9AA 5DG8A 3NNAA 3AHPA 4BWMA 3CCSS 2M9KA 3SV4A 1TZ0A 1UVKA 3OBIA 4O3SA 5HLFA 2XB2D 2EC0A 2DH7A 4FXWA 2XGPA 3HPOA 3E2EA 1RTHA 4IDKB 4ZDNA 4DQIA 1FK9A 2N7YA 5FDLB 4C3KA 5KFHA 3HZEA 2YKAA 1N5TA 3MPVA 4CO5A 2LU2A 1HWUA 3CE8A 4JI8F 1HBMA 4ED1A 3M2UA 2ZOGA 3MM8A 4C2MA 2CPFA 2B0GA 3OPKA 4I64A 5CH7B 2R7WA 1HQEA 3HT3A 1RT6B 1S1WB 4WU2A 1BWEA 3Q0AA 4ED6A 1JLEA 4JV5F 3CUNA 2HNDB 2I9SA 2D3ZA 3TANA 1REVA 4F4ZA 3CIZA 4X4RA 2DNOA 1QAYA 5K5MA 4H54A 3KLGB 3DOLA 3BS9A 4DBQA 1KQSR 4ZVHA 1SKSA 2Z2MA 3IAS9 3UD4P 1QLNA 2UVVA 4YMEA 1O0PA 4DFKA 3KG0A 4H4KC 1W2BR 3HI9A 1Y0HA 1N0UA 3I5AA 1FJEB 4Q8FA 4Z2XA 2G13A 2YX1A 1JLAA 2FLLA 4LFAF 2FLOA 2RKIB 1G2EA 3HHEA 2W8KA 2VQFF 2RDIA 2HHXA 4DL0C 1RWUA 3J7YU 1J2VA 3N0VA 4NYOA 2FJEB 2U2FA 4G1QA 4OHWA 1JLBA 3I32A 3IR5B 4JI4F 2WTFA 2XEXA 2SXLA 1VQ6S 4QR1A 2GMLA 1ZAVA 4CO4A 2LEPA 3HVAA 1V3RA 1V6HA 1FNXH 3Q24A 2F3JA 2V5HG 5AXMA 4QIFA 3KLEB 5KFZA 2WCXA 1ZAXA 3PW0A 1RYRA 3MR6A 4DR3F 5F8NA 1DQAA 1G3OA 3D0HE 4DR1F 5J2MA 4WYLA 2E9TA 1S1UB 1S9GB 2RUGA 2E5IA 5KFGA 3MR3A 1ZM9A 1MU2B 4UW2A 2GC8A 3RB0A 3M30B 4J9PA 1NK5A 2E1RA 5JVHQ 4EZ6A 2BQUA 2DJWA 2B9YA 4JYAF 2W9BB 3FEXB 1X9WA 5FDLA 5K8OA 4OHYA 4NPOA 2IBOA 4NA2A 1FRHA 2G0CA 4IOBA 3IC1A 1TKZB 3TA2A 5HO4A 3KHHA 4LFCF 4OI4A 2KJWA 4AL7A 4KV8B 4ILMA 1T3OA 2AWZA 2HAIA 2RIJA 2ZD1B 2XS2A 1C2PA 1HWLA 1S1WA 4O3NA 4MK8A 2DT9A 5D4LA 3OJSA 1M0SA 1N54B 1KVJA 4QYZJ 2HNDA 1WEYA 2J0XA 4RWWA 4EBCA 5DLFA 3HO1A 2UV8G 1LK5A 4YDDB 3PHEA 2HS3A 3I0SB 3I9ZA 2NLWA 2QE5A 5EUHA 3OR2B 2DGSA 3KLGA 2R2TA 1H6KX 4OQJA 4JI2F 4ELTA 4QIWD 2VC0A 2E7WA 3DN9A 3R5DA 2W7OA 3THVA 3MUVP 4RW6B 2YWHA 3CO9A 1GTHA 1SQEA 3QAUA 5KFQA 2DGUA 1YI2S 1ZM4A 4CZCA 4A8FA 2CQ3A 1AXQA 1UEUA 1U8SA 3S01A 2I0XA 2CIMA 4YB7A 1X5PA 5L1JA 3SCKE 2IBKA 2A10A 1A7GE 3RAQA 4OZ1A 1JB0C 5A8KB 3FQKA 3VTIA 2J76E 3R1HA 1TR0A 4QZVB 5KFBA 5CZVA 1F5CA 5BR8F 3KLFB 1Q16B 2PMHA 3MEKA 4C97A 2D9PA 3MECB 1IR0A 1RT1B 1WG4A 2DRBA 2N3LA 4KRWA 4HVZA 1WF2A 4NCBA 1HFEL 1QE1B 4O3OA 3NNHA 1R89A 3K8VA 2OP5A 2R2UA 1S1UA 1S9GA 2CQCA 2M8HA 2XWXA 3PACA 2RS2A 5KTQA 2IVMA 2BDPA 4DSKA 2PT0A 3TNVA 2A1BA 1P1TA 2EI5A 4R0EA 1MU2A 2XSJA 5KT6A 3M6XA 3M30A 5IT4A 3IWLA 2H9ZA 3GV5B 1WNEA 1SJ1A 4PKDB 2K8GA 4H4KA 4QCLA 2AGQA 1URRA 3U27A 4DOZA 2R8KA 1QSSA 4DWIA 1X0FA 5E3CA 2GGPA 1ZZNA 1Q81T 1X4HA 2K2PA 1SKRA 4KV8A 4CO3A 3UCGA 2FB0A 4Y65A 3TQ1A 2ZD1A 4EO6A 5C25A 3HHLC 4RKUC 2WHOA 3T3FA 2E29A 2FHJD 1D9AA 2W9CB 3CCES 3JB9k 1XN9A 3H2UB 2VL1A 4WFAQ 1R0AB 2JL9A 2HFOA 3NG8A 1T7PA 1U09A 5IWAF 3K5PA 1JX4A 1FRJA