2DTJA

Crystal structure of regulatory subunit of aspartate kinase from corynebacterium glutamicum
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
164
structure length
164
Chain Sequence
AVLTGVATDKSEAKVTVLGISDKPGEAAKVFRALADAEINIDMVLQNVSSVEDGTTDITFTCPRSDGRRAMEILKKLQVQGNWTNVLYDDQVGKVSLVGAGMKSHPGVTAEFMEALRDVNVNIELISTSEIRISVLIREDDLDAAARALHEQFQLGGEDEAVVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Aspartokinase
publication title Structural Insight into Concerted Inhibition of alpha(2)beta(2)-Type Aspartate Kinase from Corynebacterium glutamicum
pubmed doi rcsb
source organism Corynebacterium glutamicum
total genus 41
structure length 164
sequence length 164
chains with identical sequence B
ec nomenclature ec 2.7.2.4: Aspartate kinase.
pdb deposition date 2006-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01842 ACT ACT domain
A PF13840 ACT_7 ACT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2dtjA02
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2dtjA01
3DDNA 3MWBA 3IBWA 2J0WA 5IT0A 4GO5X 4LUBA 2I9SA 3KWMA 4X84A 2NYIA 1M0SA 3IXQA 3N0VA 2PA3A 1PSDA 3ENWA 3TUIC 2PC6A 3O1LA 3OFEA 3MAHA 2ZHOA 3MTJA 2RQKA 2MDAA 4M8LA 1O8BA 3HHEA 2JOQA 1U8SA 3DHWC 2CDQA 2KO1A 3LOUA 3U7JA 1LKZA 3NRBA 3DHXA 3ENVA 1LK7A 1Y7PA 2QRRA 2J0XA 2QMWA 2LVWA 3P96A 1UJ5A 3W7BA 2FGCA 1XTZA 5IS2A 4NMLA 1YBAA 2DTJA 3OFHA 2H9ZA 5T41A 3CEDA 2RQMA 1SC6A 1RWUA 5FIIA 1LK5A 3AB4B 4GO7X 3UW1A 5JJBA 2QSWA 1UJ6A 2P9CA 2F1FA 1KS2A 2JHEA 2RE1A 1YGYA 3OFGA 3L7OA 2P9EA 4GMKA 5IT4A 3TUZC 4PWUA 2DT9A 2LQJA 3OBIA 3TUJC 1UJ4A 3AB2B 3LUYA 3ENQA 2P9GA 3OFFA 3AAWB 3DC2A 2QMXA 3K5PA 4IO1A 2F8MA 3S1TA 1ZPVA
chains in the Genus database with same CATH superfamily
3DDNA 1TU0B 3V6KA 3NNHA 4WK3A 5A0YB 1WC3A 1WHWA 1T9VA 2PMZD 1T9XA 1NKCA 1MWQA 2CZ9A 4LVOP 3UN3A 4ZVSB 3V5RA 1S77D 2CQCA 5K20B 1VQ5S 2FLLA 3EYZA 2HNDA 1U02A 4JI5F 2E1PA 2VBYA 1WTBA 4NZ6A 4QJVA 2DR5A 4Y34A 2HHXA 4CLUA 2PFDA 2KJWA 1LV5A 1AUDA 3E51A 2DRDA 5KFAA 1FT8A 2JLFA 4YHHJ 3HVRA 4RW4A 5LSRA 3AB4B 1YTYA 3BR8A 1YRXA 3NMRA 3KK1A 2C28A 3MECB 2MTLA 4NXMJ 3GJRB 4U9RA 4I6WA 3P45B 4ZVHA 1X9SA 1LXJA 5B7WA 4N76A 3VVUA 5LJ5Y 4X62F 1FNOA 4DFPA 1ZETA 2V8DA 1S6QA 2FHKA 1OQ6A 1RBLA 4I64A 3V81B 3S1TA 1AXQA 1SH0A 4QWAA 1VDHA 3R7SB 3AQPA 3UDCA 1NKEA 3RRKA 2JJ4D 3J81U 4JI7F 3M8QA 4CO1A 3KDOA 4P7VA 4K4TA 4TU8A 1SJFA 1WOOA 4NA3A 4KHRA 4AL7A 2B51A 2W8LA 3UVJA 2RILA 5B0BA 3MHYA 1KLMA 4ZS6A 3WQPA 1TUGB 2VA3A 1A7GE 1H98A 5A8WB 2XCPA 3KLIA 2NUUG 2HGNA 3T5JA 4NLUA 4IG3B 2HURA 4M94A 2CRLA 3ZTQA 5KFLA 1R7IA 5IC4B 2CPJA 4E0DA 5HMYA 2DGVA 3MZIA 4K4VA 4NA2A 3CUNA 4ZHRB 2GGPA 1TFYA 3FFIA 4K8RA 2KDOA 3L7OA 1EIYB 4ZP8A 4NYOA 1GMWA 2RT3A 2ZBPA 3HCXA 2JC1A 1HNVA 3HSDA 1MMDA 2MQMA 4RU9A 2A2DA 3CB4A 1VMBA 4ZPCA 5HJYA 2JZ5A 3BPSP 3MM8B 3LH2S 2ZBCA 3CCSS 3MR7A 3EVMA 3HZGA 2QL7B 4F02A 2YPYA 2FD2A 2O1PA 1CC8A 1UWBA 3Q8VA 2I1RA 3E01B 4TU7A 3TARA 1E6YA 2AYEA 3KKFA 3HHEA 4F8RA 4B08A 4JYAF 1G4CA 4OZ2A 5KFFA 3OR2A 2E1MC 1M1KT 3ZNUA 3M30A 2C3MA 2MQOA 1X4DA 4TQSA 1KOHA 4P6QA 3MFHA 2BQUA 1GT8A 4PCQA 5ETVA 3CTRA 1EARA 4NYPA 4PZVA 2XZTB 2OP5A 1FRHA 4LF6J 2O66A 3OTBA 2P9CA 3CSKA 3ICLA 3RBZA 3W65A 3AHPA 2OFHX 3K5MA 3CIZA 1WOPA 2MGZB 1BQNB 1DFDA 2A3JA 3GJTB 4PQAA 3I56S 3NGKA 2MKHA 2ILZA 1NU4A 3JQKA 4OJGA 3RJMB 1N54B 4ZLPA 2B8PA 2ZD1B 5A6WA 5K8OA 3OL7A 4J5OA 4IOAQ 1RT6B 4ALZA 3CCMS 1VC6A 4KHPF 1NZ8A 2XBPA 4C97A 3N6MA 1LW2A 4ED4A 4MKAA 1YHQS 5LSLA 1C0TB 3T5KA 4QWDA 4OHZA 4NLDA 2R42A 3MEGB 4HL9A 2RQCA 3G86A 3NRBA 2ZH6A 4HACA 2VPZB 4CYUB 2GAHC 3HT3A 4WXOA 3IWLA 3WX4A 3PM9A 2OSQA 2WVFA 2OO4A 4FPIA 2JFKA 3D1OA 4QPXA 2B4OA 4EU0A 1J5OB 4WWSA 2I6WA 2PE8A 3H4BA 2NXCA 2J5AA 2P2CB 1XQIA 2HS4A 1JLQA 5A8KB 3KXDA 3RBDA 1ZBTA 3OFGA 2R4FA 1H73A 3DLEB 4KC5A 2K3IA 4TLQA 1JK9B 2XEXA 2CFXA 3TRGA 4NI2A 2XWYA 3D2WA 3KUGA 1NPRA 4KFBA 3C16B 3RW7A 1Y10A 4G65A 2VDHA 3H2VE 5J2QB 1BLUA 2KU7A 5U47A 4RBVA 5F9NA 3TP2A 4WBFA 1SC1B 3W2WA 1WC5A 3V4IB 2QMUB 4FNIA 2E9ZA 3D1QA 2DD8S 2M52A 1C1CA 2KT5A 2RQKA 1X4GA 3P5TL 4OFZA 2OIHA 3GV8B 4MIBA 5GMDA 2IMWP 1VQNS 3P96A 5J2MA 1S9EB 1UFWA 2UV8G 1SJRA 3BGRB 4ZPWR 3G8QA 1FKPB 1U0HB 4K4XA 1DTTA 4L72B 3PFEA 3QT6A 3PYEA 4F4XA 2AF6A 4W4MA 1RADB 4RUHA 3M8RA 1HI8A 2LDYA 1S4FA 2EEYA 3GE9A 3MOZA 3PCOB 1S72S 4PG7A 4AUKA 2DNNA 1NNDA 1U1QA 1YJUA 2GIQA 2RF2A 3CJSA 4JI7J 3M6WA 3FRYA 1NJWA 3PX0A 3CMQA 3MEDA 4M1KA 4RBUA 2OEJA 2HHUA 3GFXA 3TAMA 1Q86T 2PEBA 2WOMA 4RR5A 1FESA 5F8JA 2DXDA 4DDFA 1TVRB 4ERDA 2VFTA 3UFCX 1U1MA 2Q6CA 4KHMA 1NK9A 1QTMA 4WFYA 4HKQA 2G0IA 2BZ2A 3Q24A 3M2UB 5KG1A 1Y0HA 1RTIA 2EFVA 2G1DA 3AD8C 5G0RA 1T94A 3CCRS 4F3MA 4UTGA 1FTRA 3UW1A 4ZIVA 3OTCA 1RT2A 3W66A 2DRBA 2C3OA 1SKRA 3UCUP 3BSAA 1UFKA 3IS9B 2MZTA 4P2MA 1X60A 5M2RA 3BYRA 3W9JA 2HNYA 1NKBA 2VD3A 3OJUA 3MF5A 4P72A 3EDQB 1UVNA 2GX8A 1JLEB 4KSEB 1NK0A 2CPEA 4KYZA 3G87A 3PZPA 2IM0A 1S4EA 1JNZB 5I3UB 3LANA 2B9YA 2CJ9A 2I5JB 4OYOA 3SSRA 2OJ3A 2YKPA 2RUGA 2Y8YA 1HHSA 1WKJA 1WF1A 2RS8A 4NXNF 2W2OP 1SQEA 2GMJA 3D6FB 1FI4A 4RZRA 2MKJA 2W4CA 1VQ4S 3AXMA 2V69A 4DG1A 3M1VA 2ZZTA 3CC2S 1E6VA 4OX9J 5FIIA 4IQXA 1U1LA 3BO2A 1KOOA 3MD3A 4KIAA 2XO6A 1KNZA 4IRDA 4IR9A 4FZVA 5T14A 3HFZB 3TJ8A 1TKZA 5KT5A 4FS2A 3BQ1A 2IDLA 2B9XA 1LFWA 3THPA 3H5XA 1MMLA 1OYEA 3I5BA 1B70B 1S97A 2FHJD 1HBMB 1VYAA 2HKEA 3CJ5A 3IWXA 1HQUB 1X5PA 5CD4H 1HW9A 2AX1A 2UXBF 4Y2CA 4TY8A 5L1LA 3HMJG 4WE1A 4OI3A 3OTEA 4A8WA 2XZWA 4DR5F 1SL1A 4X66F 4CLWA 2N82B 3GWCA 1YJWS 3EDRB 3SCLE 2QYCA 1N0UA 5E33A 5IZHA 5IS2A 2HBZB 1YBAA 2DHGA 5LXYA 2V0NA 1RU1A 4URGA 1N34F 4OYIA 5IM0A 2ZH3A 3MUVP 2H54B 4KKOB 2BKOA 4USTA 3VAGA 2D7SA 2V4JA 5AJ3J 2KJVA 1UL3A 2QIFA 4OJ3A 1KRPA 1U6FA 4USHA 4DL0C 2E66A 1LQ9A 2UUTA 4DPUA 4P9SA 2L08A 1MW7A 3EGZA 1YRUA 3NGSA 3QZ7A 1J5EJ 4KV8A 3IGNA 4ED8A 4AXJA 3MD1A 1FK9B 3V6DA 1RTHA 3CCTA 4CDIA 3BEGB 3C6TA 3W2VB 1TL3B 5CYMA 5BYQA 1KWMA 1BHNA 2UP1A 3TZYA 2FY8A 1VQMS 4Y2AA 4RUBA 3DHWC 4JI1J 4I2PA 2GHPA 1XWLA 4USWA 2F8EX 1X5OA 4ICLA 4ELUA 4LSNA 5L39A 5L1IA 1CLFA 1ZPWX 2F3JA 3MCNA 3ZNJ1 1U7LA 2NXUA 2QFIA 3JTPA 1JWWA 1Q78A 1MN9A 2ASJA 1UEUA 4CLYA 2IJNA 3HFKA 2VBWA 1HNZF 4F50A 3D54A 2FJVA 2D9OA 4DXLA 3D6HB 4UOCA 3IBCB 2NZCA 2AV5A 2DK2A 2IM1A 1EHWA 1JLCA 4PXEA 3R3TA 2BANB 2OEMA 3RBXA 4G1PA 5E5NA 3TANA 4ED3A 3CJ4A 3W63A 1V6HA 5ETPA 2VOOA 1S6UA 1RE1B 1QAXA 3DRSA 2EKYA 4XDCA 4NRUA 4K59A 2H48B 2B3TB 1P8GA 4FF1A 4WFBQ 3K2YA 5DLGA 1K0TA 2HK3A 3ZTOA 2E9TA 1HYSA 1CJVA 1V5IB 3CW2C 2D1CA 1HR0J 3FCHA 3QWUA 4DF8A 3KHHA 1FHTA 1EAYC 2ROPA 5F8MA 4OYXA 4KPYA 3NAHA 4WFXA 4ZPTR 4TNOA 3MPDA 1VJWA 2X7IA 2RKIB 4TU9A 4IDKB 2XI3A 3GIJA 1WWHA 1IKXB 1RCXB 4DR3J 3UCGA 4ES1A 3IAS9 5DQGA 3R1LA 5AXMA 1S5ZA 2F7VA 1YJNS 1CPZA 4KGKA 1VJQA 3ILOA 5FD1A 4USJC 4LRAA 1EKRA 4ECUA 4YB6A 7FD1A 2VG5A 4MKVA 2DH7A 2HRTA 2MLZA 3MAAA 3R8YA 4F67A 3U7JA 3W64A 3K17A 4A8KA 1C1BB 2FTRA 2JLGA 3H7HB 1JQGA 3GG1A 4Q45A 1M5SA 2AU0A 3O2IA 2G0JA 1JLFB 4OX6A 4A47A 3NAIA 2DB1A 3HO1A 4HHHA 2R7VA 4LIRA 3I82A 3V6JA 1UZDA 1LXNA 3M2RB 4LFBF 1YJRA 4O3PA 4ZPBA 5ETOA 4O0IA 1YWXA 2KYXA 1ROFA 1JX4A 1YZ6A 1DTQB 4TKTA 4CTAA 5CAAA 3ZXWA 5GVQA 4DV2F 1HMVA 3PACA 1RT5A 3OR1A 2PT0A 4PYDA 3AAWB 4DCOB 4ED1A 1X4AA 3G6YA 1HHTP 4OI6A 3UE2A 2HNDB 1KHWA 3MM9A 1FJCA 4BHQA 5KFGA 2CXEA 4DL6A 4IKAA 2KHDA 3D0GE 3UCZP 3AJDA 2YNGA 2ZOFA 1CJUA 4B3RJ 5ETQA 2B6AA 3PNIA 4Z37A 4J9SA 2VUGA 4C3LA 1XMQJ 4OV6A 3VAFA 2ZZMA 4YY3F 5H9FK 4LF2A 3C6UA 1IR1A 2ZOMA 4RW4B 3OHAA 4OX8A 4ECYA 1U09A 3KK1B 3MMAB 2VH7A 2XY6A 1NDCA 3NS7B 2F8HA 2W9CA 1H38A 2I0XA 4IH5A 4FXWA 3GR0A 4PQUA 3RZAA 3KJQB 5HI7A 2DGXA 3FQLA 1CBKA 1XNQF 4USMA 1W25A 2QLWA 2Q6BA 2P9EA 4DQRA 4ES3A 2HIQA 3W61A 1MSWD 1VBXA 1SC3B 1JMTA 1KN6A 1UJ4A 1RHJB 2ZDOA 3LAMA 2W2PP 5DRKA 4B3OA 1RWKB 3KLGA 3G4SS 1KLMB 4QBUA 2DHHA 5KT6A 4X84A 2FYXA 1WNEA 2XNQA 4TN2A 3PXGa 3KLIB 4ID5A 2CUYA 4JI8F 3J7ZT 1VLOA 4QR2A 1HHQA 3FUYA 4CLZA 2AJQA 1HWIA 4NLVA 2W2MP 2GGPB 3CD6S 2H5IB 3FFIB 3HT0A 5B0CA 5J2NA 4DSIA 1UP1A 3TQEA 3CMES 1HNVB 5IV4A 2XC9A 3OTOJ 1YJ9S 3EGWB 2L9NA 2VQEF 5D0HA 2ZBIA 2M9KA 3HLUA 3T1HJ 2Y0SD 3SV3A 2Z56B 4NYZA 4WP8A 1UWBB 2R8GA 1E6YB 3TA2A 2WHOA 4LFCF 4K50A 1FDNA 1P27B 2EC2A 3OR2B 1DQ9A 3M30B 1MNEA 2ILYA 4F4YA 3PRBA 4GO5X 3TEGA 4HDGA 3TQ1A 2R8IA 2CQDA 3U27A 2DGWA 4OLPA 3GIRA 5MAOA 1WELA 3M9MB 3Q8RB 1QY7A 2QG9B 4JV1A 1O6XA 1VS3A 1Z1ZA 1QD1A 3PW2A 1I1GA 3FK4A 3R27A 2HWIA 2OKQA 1VRQC 3P8BB 3QO9A 2FC8A 2MKYA 1S1WB 4PXDA 2FJDB 1FRXA 1VBZA 8ATCB 4KJIA 3NXZA 1FCAA 3LP1A 4X64F 1Q8IA 4DSKA 4CO5A 2BV3A 2AJFE 3TA1A 2OMLA 5BYSA 3W5YA 2RNEA 5KTQA 1LW2B 3BREA 3N5BA 3OFFA 1MLAA 5JVGQ 2C1EB 1U6ZA 1FRJA 4ZLNA 4HACB 3OJSA 5HAOA 2XMTA 4DHVA 1QLNA 1FNMA 5EGYA 1WKKA 5RUBA 2XYPB 2WSEC 2JRSA 4DL3A 2R2RA 4WTYA 2VKRA 4P2XA 4ZVRB 5KT7A 3LOUA 1R8HA 1JLQB 2I2YA 2PN6A 5ETTA 4YQWA 1KQSR 3I4PA 1IKYA 2JX2A 3UD3P 4NI2B 4WKYA 2BJ3A 2DCLA 4DZ6A 1UW9A 4UZBA 4KFBB 4DJBA 1IBCB 2C2KB 3T9ZA 2LU2A 4XPCA 3MCMA 3MPUB 5KFYA 5L1KA 4PUOA 2YX4A 2I38A 3QSIA 2MLYA 3W2WB 3C66A 3LGNA 2IC3A 2FLNA 1SH2A 3HHLD 1FE4A 3QATA 2YX1A 1C1CB 2ZKTA 4OJHA 4ES2A 2BQRA 2XO7A 2ASDA 1T3NA 4NLGA 1GFWB 1ZM9A 4OLOA 4NPOA 1G7CB 5J2MB 3KLEA 3T3FA 1EX8A 2NCKL 4YB1P 2CPZA 1DTTB 1M5HA 3RB6A 1QUVA 1AROP 1P6TA 1U4BA 4DQPA 3KHLA 4LF4F 3EXYA 1XNQJ 3BSCA 3GQCA 3TJAA 3ITHA 1RAEB 2ZC3A 1WTFA 2VJUA 3MM5A 5KT3A 2XGQA 1Q53A 2XMVA 4J7CA 5I3QA 4RPFA 2FLPA 3D3CJ 5E41A 5K8PA 2RF2B 1OS5A 5JJBA 3K8WA 4DPWA 2MJUA 2F1FA 3RR8A 3I32A 1YI2S 4DUZF 3MEDB 4FF4A 1V3SA 5HATA 4QR1A 3TAMB 3BZQA 1WDTA 4F4AA 4LFAF 3QQCD 1K73T 1NHKL 4QIGA 4ZP6A 1WHYA 4CP5A 3QJPA 2PA3A 4QOTA 4L74A 3G6XA 4FPRA 4KGZB 3DN9A 1RTIB 3PHEA 4UQTA 2XSFA 4EUVA 5DQIA 3D68A 1U6BA 3VF0B 5G0RB 1BY9A 4NLSA 3BSNA 3QGGA 1ZAVA 1N36J 2UVUA 2QX0A 1RT2B 5A2QY 3C46A 4MTPA 3DOMA 3LF0A 4Y2KA 2KZMA 3ET6A 1R8PA 3CJ3A 4JI2J 3J80Y 1IKVA 1S9FA 4AL6A 4Z7YA 2YKOA 5J1EA 3W9HA 1CC7A 2E44A 4XO0A 3ZFVA 5EUHA 1WACA 3LALA 5DM7Q 4Y3CA 3KHGA 1FRLA 2HNYB 2H4WB 2GJFA 2IJRA 4YOEA 3A3PB 3B78A 5C24A 2VASA 4RKUC 2FHMA 2BOAA 1J27A 5AXNA 2P9GA 3DRPA 1P1TA 1GTHA 4DMZA 3KDNA 1W26A 4IO1A 4C2MA 1RJJA 2MJNA 1QUPA 3VAHA 2CAJA 2VJVA 4FBUA 2EXUA 4PG8A 3RUBL 3R7NB 4ILMA 1YBTA 2GQ2A 2J6SA 5KG4A 4ZCMA 2HQFA 4NCBA 3G82A 3FCVA 2HG4A 2GJ2A 1Y00A 4DG1B 3M1VB 1X4HA 1E6VB 1QAJA 3TA0A 2RVJA 2DNMA 3LWLA 2DNQA 4DR7F 2W7AA 2N3OA 1TKZB 1Y5IB 3B6BA 1T9YA 2DXEA 1QE1A 4U67Q 2LEAA 3QT8A 4USUA 5J2PA 4HYKA 2R7WA 2GCFA 4S0MA 2Q66A 1B3TA 4EYIB 1Y5NB 2GHVC 3R5CA 5ETRA 2IVYA 4OZ0A 1SVDA 3T6BA 4DLEA 2RRNA 3IR6B 2KN4A 2H3EB 2FJXA 3DLBA 3GFYA 3EM1A 3LAKA 4TY8B 4WE1B 2MQ8A 2IY5B 4B9UA 2HHHJ 3NBPA 2KKHA 3UWTA 2M8DB 1FD2A 2NYIA 2ZHAA 4LQ3A 4U8VA 3WDOA 3PY8A 6FD1A 2OLWA 2X3GA 2F63A 3OD2A 2PIIA 3BKUA 2YQ1A 2QN6B 2YKAA 5IM0B 1WHVA 3DHXA 4QPTA 1JNRB 2BE2A 1V9OA 4RUCA 2N4DA 1NZAA 2V4JB 1IXKA 3QRRA 4LBIA 1Q16B 4H4KC 4DV6F 1NJZA 1SPBP 1HIYA 3Q2SC 4ECTA 5CCLA 2B43A 4DV7J 3HSJA 4KV8B 3A13A 4IOBA 3V6DB 1RTHB 2YTCA 3MM6A 1Q8BA 2SXLA 3IA0A 1EZZB 3AFGA 3HVAA 5CYMB 5DG9A 5K9FA 4C8NA 3H8YA 4DS4A 2AZ3A 4DX5A 3FSXA 5GADI 4I2PB 1N0VC 1ZPVA 4ICLB 2F4VF 4NMXA 2ZD1A 2AGPA 4HT5A 2FVCA 2HFZA 5HK4A 1VFJA 2XMUA 1ZZNA 1D8ZA 2L41A 4YB5A 3BJYA 2YBVA 3FSYA 2CPDA 2V9KA 4F25A 4ITSA 1JLCB 1FVQA 3NP5A 5SUHA 3OL9A 3OFHA 1UKUA 3MURP 4Q43A 1U49A 3MI7X 3JQMA 3TI0A 4IOCQ 1NDPA 1TTHB 1IM4A 1TKXA 2HHQA 2PA8D 3CCJS 1RISA 4M5NA 1YX2A 5HVHA 2BMBA 1RTDA 5E2QA 4WFAQ 2ALZA 4C9DA 1N5SA 1FEEA 2DGTA 4L73A 3DRSB 2HHSA 3IN5A 1NK8A 1X0FA 4DV4J 2YWEA 2C2DA 2ZH5A 4PEOA 3TZWA 1HI1A 2KM8C 2ZZNA 4KGVB 1NEEA 4LF8F 3MR6A 3WIVA 2CQHA 2FHJA 3HVTA 3BDPA 4DL5A 1HYSB 1CJVB 4N5SA 2AYGA 1S6PA 3MAHA 3FDSA 3GSDA 2UVRA 4RNOA 1JXLA 3KJVA 4H4OA 4FYYB 3PW4A 2UUWA 4LRCA 5JUMA 2I8EA 2F4FA 2QRRA 1SKWA 3A3OB 1NDLA 5HP1A 1SJQA 1MWZA 4LRBA 1IM6A 5KFEA 3ZC4A 5BYRA 2XS2A 1KBRA 1TELA 2IVMA 1FXLA 3ZZTA 4RU2A 3QFHA 1RUSA 3PEJA 4DQIA 4B9LA 2MZ1A 4M5LA 3HD2A 4XAKA 2HIYA 5E3QA 2AJ2A 1DURA 2XB2D 1YQHA 4Z2XA 3DRRA 3VAIA 4NOHA 1Q8LA 3PEHA 4FF2A 3MTKA 5EX0A 3O5TB 2VG5B 4O3OA 5IQQA 4L3KA 3MAAB 2Z2ZA 5IOLA 1RB0A 2ZM6F 5AXKA 3LWMA 3IBWA 3Q8PB 1Q4RA 3PJXA 2V2VA 4BC7A 2VODA 1YJVA 4A8MP 4MIWA 1QVFR 2KM8B 4Z7CA 4JI0F 4OZJA 3K5NA 3KK2A 5A6PA 3M8SA 3HK2A 4F4KA 2O01C 1RZMA 2M7SA 1RAHB 2JH3A 1KR4A 9RUBA 3GYNA 4CTAB 2LYVA 2ZHBA 1HMVB 1RT5B 3OR1B 3OPKA 3M9NB 2NSBA 1U1NA 1RWVB 1JKHA 4LSZB 1OQ3A 1PJ7A 1OY9A 2DNZA 1HPZA 4L3NA 3BQ2A 3DLLQ 4YR3A 2OPSB 4MT1A 3MM9B 4DR4F 1JLAA 2UXCF 2V67A 4NWBA 5KFVA 5HO4A 1HD0A 2VV5A 1HWJA 3AA8A 2YNGB 1CJUB 3DDIA 3LW5C 2B6AB 2BM1A 1RHRB 2VBZA 3CIMA 2E5HA 3F44A 4B3TF 3C6UB 1OSCA 1YRTA 3QPIA 3VHQA 3GTYX 3I9ZA 2W9AA 4AL5A 3CO9A 1ACMB 2Q43A 2VDIA 2HRYA 4DV5J 4LRDA 1H7WA 1AFIA 4PQUB 2JOQA 4DV6J 2Z8QA 2YNHA 1I51B 2B4VA 4EYHB 3OLBA 1SJ1A 2IRYA 4RWXA 2A6MA 5C2GA 2H4YB 5EWGA 1HKAA 1NH7A 3VR1A 4LRFA 5BXIA 3VALA 1GX6A 1XMOJ 4C3MA 3EGVA 1NSAA 1HQ2A 1Q5VA 4URQU 2QSWA 5AE3A 4B3OB 1VC5A 2W01A 2IM3A 3KLGB 2NUHA 5EWEA 1R0AA 1RT3A 1WC0A 1T02A 3NOCA 1PYSB 3POTA 2BOPA 4ID5B 3CCZA 1RQ0A 2VFVA 2A6OA 2DJWA 4IQMA 2W25A 1IR0A 1S57A 5DDQC 1R43A 3QJLA 2XNRA 3N79A 4LUBA 5J2NB 5DZ7A 4W90B 5KT2A 3K5LA 3OFEA 3I31A 3TYTA 4B3MJ 1VHIA 3T6JA 4DX6A 1F2GA 2KXFA 3CDUA 3DGPA 3AODA 1HNWF 3NS5A 4ZCIA 3MM7A 3RBEA 3G6VA 3Q86A 4YHHF 3J7A1 5E7OB 1HNXJ 3R9LA 1IBLJ 2BJ9A 1WDDA 3RTVA 3O44A 3BGUA 2QC3A 4NXMF 4FVMA 5KFBA 4U6PA 3D9BA 1NJYA 1H6KX 4C8KA 1BQMA 2BJEA 2GZOA 2PSZA 4AXIA 4U7UD 2BVZA 3C8YA 3SQOP 3HULA 4RL1A 3ZZYA 4EMDA 3KJNB 3TOQA 5KOXA 1H2VZ 3CT9A 3VV2B 5K5MA 3M9OB 1LEOA 1B0TA 1OO0B 5HQ8A 4AQYJ 2MDAA 2PMHA 3SIPB 2HBQB 1HBUA 3DI6A 3L09A 3QO9B 4IO9Q 1QDUB 2D3UA 2DR9A 4GC7A 2FJEB 4G6VB 2WAQD 1XK8A 1W2IA 3EVWA 3EE3A 1FVSA 2LVWA 1U1OA 3LP1B 2GMHA 3PRDA 4HEA9 1WC1A 5DJBA 2OTLS 3M8WA 4D3HA 1NDKA 1UZHA 1F2HA 3VAKA 1NCLA 5BJRA 3Q8UA 4FS1A 4N8NA 4NLTA 2QEXS 4YMEA 2UUCJ 4DEZA 2C2ZB 2FJAB 1T05A 2JEJA 4EBCA 4X4PA 4QQBA 1NH8A 1F5BA 3ZZRA 2DH8A 1REVA 4TYAA 1B0PA 4JB8B 5EDWA 4DV3J 2E1CA 3M6XA 2KT2A 3EPIA 3OXLA 2LQ9A 2WK4A 3PR5B 1Z2LA 3QIDA 4WIQA 3L9ZA 2BEFA 3VAJA 2JVOA 1IKYB 3PX4A 4M8LA 4ZVTB 1GEHA 4AT1B 2CPYA 3OUYA 2VG7A 3RB3A 3CCES 3M4XA 3N4WA 3B4DA 2GIRA 3EZOA 4OI2A 3OSPA 4PUOB 3W9IA 1KQFB 1CEZA 3A8IA 4UQGA 1H74A 4LBHA 1KQGB 1NJIT 5DM6Q 4O23A 2UUAJ 2V6AA 5HVGA 1XTZA 4LF6F 1FFWB 2ZH4A 2UZAA 4QIFA 3KMSA 4ZN1A 3AD7C 3SCJE 2RKIA 1RKIA 3UD5A 1RHQB 1TL7A 1HQEA 3KLEB 2DEJA 1Q79A 2LXFA 4K2XA 1SXLA 3BSOA 2DO4A 2C2EA 4O4RA 4R8UB 2QLJB 3DMJA 3I9V9 1ZTTA 2MKIA 2B5JA 3T41A 3OV7A 5LT5A 3I0SA 2K2PA 5CHCB 1U48A 2W2NP 1UMJA 3ITHB 1FWLA 3KMQA 5E0OA 4C8LA 3THTA 3MM5B 2CIMA 4C6AA 4IRCA 3QBCA 2KB2A 1S0VA 2IA6A 1RCOB 4UT4A 5D0GA 3IC1A 1UPPA 2B7BB 4MAKA 2ROGA 3M8ZA 2J6TA 3RW6A 5GAEU 2KXNB 2XY5A 1HFEL 2XZDB 2VHGA 4DPTA 3GMGA 3NG8A 3PW0A 2IM2A 3D0IE 3GV5B 3CEDA 3IRWP 2ASLA 4ELTA 2B4UA 2GVDA 1GXLA 1VHFA 1Q81T 1N8RT 3FVYA 2EC0A 4WU2A 1TMMA 1RT4A 2E7VA 2YNFA 3GSIA 4C98A 4KO0A 1DTQA 3OHBA 3PJ9A 4DN9A 2DEIA 1ZAXA 2QYGA 2YQ0A 1VQSA 4JBCA 1T9WA 4A8SA 3EMTA 2ZC4A 3JTNA 2VFUA 3I96A 1HW8A 3DOMB 4G1IA 2YKMA 3ET6B 2YWHA 2QL5B 1IKVB 1HNWJ 2XY7A 3A8JA 1OMSA 3A12A 5J1EB 3KOAA 2NR0A 5B0FA 4B9TA 3DLGA 4B9VA 4P10A 4BC9A 4ED0A 5KT4A 3EUNA 3MMAA 1QSYA 1ZYQA 4GKKJ 1SJ4P 2CVIA 2HFVA 2BRLA 5C24B 4M5MA 4FDFA 1ZM3A 2H9ZA 4DCJB 4OZ3A 1XR7A 3OL6A 2WVDA 1JLGB 3DRPB 1BD6A 3SBMA 4Y2MA 2CQBA 4LJMA 3ZTRA 2AJ0A 2XCAA 3GB0A 3HHLA 1FJGJ 3QNWB 2G2YA 4DFJA 2FLOA 5LMNJ 4DX7A 1TV6A 1TMJA 8AT1B 4ANCA 1TAUA 3G82B 2AHOB 3UDLA 1FX4A 3DRYA 5EWFA 3TR5A 5ETLA 1RA7A 4M5IA 1F9FA 2K7JA 1X8DA 3MPWA 2I9SA 2G4BA 1RBAA 2VQFJ 2RAQA 4I56A 2XYHB 4X4QA 1S0NA 3JSYA 3S7RA 4JP8A 4CH0S 1IR2A 1Q82T 1QE1B 4A4JA 3ENVA 5J2PB 3M6VA 3HZEA 1DRZA 2AMCB 4RW7A 1LWFA 1OPZA 1DZ5A 2HLUA 3CD0A 2VU5A 2MZQA 2Y0BB 1B64A 2C3PA 3T5HA 3PR4A 5LOQA 4M5JA 3PW7A 1N5TA 2HGLA 3NBPB 4PG5A 3TUZC 1YZ7A 3AOAA 4NLWA 3SYZA 5DZ6A 2A2CA 4CCHA 3OLAA 4HHJA 2XHCA 4DN0A 5F8GA 4CO3A 1AYEA 4A46A 2XLKA 2CWKA 2PEHA 3CF5Q 3NKYA 2BE2B 4ZVQB 5KFNA 1KONA 4J37A 1P1LA 2LECA 1TL5A 3F41A 3SMZA 5KFWA 3M6UA 3HDSA 1NSKL 1X5SA 5HJXA 3DNCA 4JV5F 2W7OA 1PG5B 1N6QA 4NEZA 4LF7J 1U45A 1NM2A 4QYRA 1KD1T 1HD1A 2ZNYA 5I42A 2DGQA 4ZP7A 4L75A 4EO6A 3MM6B 3CULA 2FGOA 4MFBA 4OX9F 4LR7A 1GMUA 4YR0A 3ULHA 1UVKA 2WBMA 4OHYA 1S1WA 3NY0A 1U2RA 1UA0A 4LQ9A 2VPXB 2NSCA 1A0OB 1LWEA 3M32A 4WZMA 1P9QC 1S12A 1FFGB 2UUBJ 2OTJS 2JC0A 3G96A 4FNHA 3J7YU 1U2CA 5EN1A 4WFZA 4DX8H 3D5MA 2MMYA 3KG1A 3HFVA 3VGUA 2AEMA 4B17A 1Q5YA 1TKXB 1RU2A 5KG0A 4ECQA 2E29A 4FXDA 4WCEQ 5E3RA 1W2BR 2KRRA 1RTDB 1WF0A 3AT1B 1KEKA 4CLFA 4J9PA 2WBRA 1F1BB 1S99A 3Q2TC 2YWGA 3JSRA 1CQNA 2CWXA 5CXTA 3H0PA 5AJ3F 4I68A 3GFZA 3BDEA 1F6TA 3TWZA 2YWFA 1V3RA 2FJBB 2DR7A 3HVTB 3VGTA 2HZVA 5KFQA 2FZCB 3KHRA 3I5CA 4J9LA 2WW4A 1S6PB 2DNRA 4XPEA 1J5EF 1DLOA 1VRUA 2ACMA 1S59A 1CJKB 3KJVB 4H4OB 5GAGU 5SZTA 1S10A 1UVIA 2AX0A 2BYCA 2DNOA 2LKZA 5LM7E 5HP1B 3IBFB 2B8QA 1FE0A 1TP7A 3PV8A 4ECVA 4JI1F 2C22A 1WEZA 2Q79A 5HLFA 1FKOA 4GKJJ 4K5RA 2V9WA 1PC4A 5L9XA 4JI6J 3S8SA 4OQJA 4X4SA 2GO9A 3DRRB 4LT6A 3K58A 4DR6J 3L7PA 1ZM4A 4L76A 1S0MA 2GS8A 5F9LA 4ID8A 4USVA 4KTQA 1SKUB 3CWJA 5CZXA 2B56A 2MXYA 2UVVA 3PRVA 3FBCA 8RUCA 4WYLA 3DCAA 1KVIA 4NCGA 3MR5A 4M63A 2MHNA 2B9EA 4KT0C 4DPYA 4ZJOA 1N32J 3WHIA 4OZNA 2MY7A 3JAMY 1WG5A 4HTJA 4ED7A 4R5PA 3KK2B 1RTJA 4J9OA 4RW9A 1REGX 4MKYA 4ZDNA 4J9RA 2XMWA 4F0HA 2AZ1A 3EWGA 1LWCA 5D8HB 5DS7A 3T1YF 1OWXA 1X9WA 3DGVA 4Q2LA 3H90A 4GRSA 2AP6A 2VOPA 1GNKA 3HI9A 1T03A 1JKHB 1RWOB 2QLXA 3DXBA 1HI0P 4J9VA 1VQOS 1HPZB 5F8HA 3PIPQ 1TR0A 2ZUGA 2QMWA 1HR0F 3MCSA 3MUTP 2NREA 1JLAB 5B09A 1JIHA 2AT1B 3CGIA 1TUVA 1Y4ZB 2BBEA 4WJBA 1N4LA 1GMVA 1RHUB 1X4EA 4DSJA 4Y2IA 1ZA1B 3AY0A 2VC0A 2QA2A 1FD8A 5IWAJ 2WONA 3GYGA 3P4UB 2GQQA 1R3NA 1KFDA 1L3VA 4FN5A 5H9FJ 1JJCB 4DR3F 4OZ1A 2JL9A 1KP6A 1O51A 4NZ7A 4ZJQA 1M5PC 1QTNB 3ZO7A 3KLFA 1WI6A 2R2TA 1LW0A 2OD4A 2YNHB 2EBGA 2O67A 1AUSL 3VZHA 2WSFC 4HTIA 2PFFB 4CWBA 4DQSA 1WKLA 2DHXA 4JV5J 2AW0A 2D9PA 2V4QA 2ZOGA 1N33J 1IBMJ 2V8HA 4WP9A 5H1SV 2OPPA 2UXDJ 1FXDA 5FLXY 1SV5A 4EFAC 1RHKB 1R0AB 4ECZA 1RT3B 2V8VA 2A1BA 2HQDA 2K06A 1NUEA 1AT1B 2AGOA 1BC6A 3POTB 3FBEA 3K0JA 1WC6A 2C3UA 2J9CA 5BR8J 1WSRA 2KFZA 1F5AA 3DYAA 3UNYA 1VC0A 2OPQA 2DNHA 5L9NA 3CJ8A 4ECXA 2GQCA 1FNXH 1B7FA 4NRTA 2DKOB 3OXFA 5D0RA 1RHMB 2R7OA 5HBMA 3DC2A 2H5JB 4UY85 1RAAB 5AE2A 2OSRA 4DZDA 4ZP9A 2ABYA 3DGPB 2GW8A 3MMCA 4DOZA 4Q2MA 5A2QU 4B3RF 2MQQA 5B0GA 4CO0A 2H65B 3MM7B 3SCKE 1XMQF 1B4SA 2WVBA 1KFSA 2WVEA 3UN5A 3J80U 1O8BA 3TAPA 1AFJA 2D3O1 3QLHA 5GMEA 1GK8A 3GONA 5KG2A 2CKWA 5J1NA 4JI3J 3G2XA 4PYAA 3DU6A 2OFGX 2FUG9 4QW9A 2BJ7A 2LA4A 1EQ0A 3FEXB 2DNGA 1BQMB 3WIUA 3Q8YA 2ZE2A 1XERA 2XHWA 5E3PA 2V34A 3UPFA 3OVSA 2HVZA 1IBKJ 4WKRA 4UF4A 4LF9J 3CDAA 5KAKA 5IQ6A 2PMWA 5D15A 2R7RA 3HSZA 2KVIA 3N6LA 5KFRA 3GPAA 4K0KJ 2JEIA 1F3FA 1HBUB 3DI6B 1XBWA 1NAQA 1YSJA 2YPZA 2QLFB 3BN4A 2EG1A 1DAXA 2CPHA 1QM9A 3M05A 3G6ES 2Z57B 1NB2A 2J9DE 1IKWA 3NLCA 2J9EA 4K2JA 2HFSA 4MK9A 7AT1B 1U8SA 3RGIA 1X4BA 2IIHA 2MB0B 5C7PA 3UN2A 2COLA 2M3DA 4ZIWA 4KGXB 1XC9A 4LF5J 4RNFA 3N5FA 4DUTA 4H54A 2BJDA 4TYBA 2FPHX 1GXTA 1T05B 3D4JA 4WFNQ 3OTOF 3UDVA 2DTJA 4NLPA 3NGRA 2Q1LA 4PKDB 1REVB 4CT9A 3X3UA 4RW6A 4DWIA 2W1BA 3NCQA 4QW8A 1VISA 2YH1A 4ZITA 2BJ1A 1RI7A 4ZVOB 3T1HF 2YH0A 3R1HA 4GMKA 1D9AA 2CJYB 3AOCA 4H4KA 2EFQA 2LQJA 1HWKA 1T9UA 4X4VA 1ZS6A 1CJTA 2Z58B 3BKFA 3GR1A 3OUYB 2VG7B 4JOUA 3T1YJ 3JXOA 4ZJLA 3R5DA 5E3CA 1G6BA 2W8KA 5KFXA 3PJWA 4B9MA 3P49B 3ISND 1K0VA 4MK8A 3HKZD 1M0SA 1QVGR 4C8MA 2E1AA 1HWLA 4DUYJ 3AA9A 1C4CA 4RX6A 2LQ8A 2PI5A 4HLBA 4RJVA 3IR7B 4P75A 4PAAA 4D3GA 1I94F 3F0NA 4MK7A 2EPIA 1L3UA 3IG1A 1AZSA 4M5GA 4NE9C 2WB4A 2MPUA 1TKTA 1TL7B 2RUSA 4BLGA 2J8AA 1HQEB 4DF4A 1VK8A 1SIWB 3KNGA 1ITPA 1S1TB 3DMJB 3WC0A 4AD6A 1NK7A 2CNOB 2B5JB 4X4OA 3KNAA 3I0SB 2WB1D 3TUJC 2NPFA 4K4SA 1N5YA 2RRAA 3EGNA 2VKZG 3ZZPA 1RT1A 2IDEA 2BQ3A 2Y1RI 1PGZA 2VPYB 4P71A 1R6YA 2V94A 2RQ4A 2OGUA 4FF3A 3RB4A 4W98A 2PC6A 3D7SB 2VBXA 4LSLA 3HHLC 4WF9Q 3MUMP 2ADBA 1FKAF 1UFLA 2GV1A 2VICA 4CNZA 5JXSA 2GVDB 2W9BA 4ECSA 2J8SA 1WG4A 4DL4A 1C0UA 1RT4B 1XN9A 2YNFB 3ETMA 3JSBA 4KO0B 3BQ0A 4NASA 3AQOA 2HSEB 4DV0J 4O4GA 3FMBA 4QU6A 2AWZA 1WEXA 2E5IA 2OPSA 3IRXA 3OTDA 4WIIA 4DR2J 4E8UA 2AEJA 4ILRA 4DLGA 3FMWA 2YKMB 1R8BA 3ENQA 4B3SJ 5HANA 1FJ7A 4M95A 2W4DA 2AEFA 3SEOA 2V2KA 3QT7A 4CLLA 1ZZFA 3DLGB 1QSLA 5GAGI 4N47A 1WC4A 1HWUA 4K5SA 2CNNB 4O3SA 2CZVC 1TKDA 3MCOA 1PKUA 3IXQA 1PJ5A 2ERRA 2CJQA 1GTEA 2ZFHA 5D0EA 2HHTA 3FKBA 3B8HA 3IO1A 3GYXB 4LREA 2K1RA 3M8YA 1FWKA 1VGYA 1M90T 2VF3A 1X9MA 1OY6A 3CVKA 1SJ3P 2V50A 4QIVA 1O0PA 3HHLB 5EX3A 4WK1A 3D28A 2AKWB 1TV6B 3HM9A 2HBRB 1U0SA 1LOUA 3ILLA 1TL4A 2J6UA 4JI4J 3MPYA 2FVRA 4ZN3A 3HF5A 1D0EA 3NWGA 2X51A 1SI9A 2QSFA 4PWUA 3T19A 4Q0BA 4DCPB 1R27B 3JSMA 5LXRA 1KTVA 3FC9A 4ATNA 1UAWA 3W3SA 2ZH8A 2XM3A 4ZVUB 1D1UA 3LP0A 3M2VA 4E2FB 3Q89A 3OW2R 3ZZOA 1XR5A 2X1AA 3U1MA 1UCNA 4RW7B 1SQFA 2DIVA 5DG8A 3TJ9A 1LWFB 3RG6A 2OPRA 2ROEA 4F4WA 2D3ZA 1HNIA 1N36F 2A10A 2GNKA 3N28A 3H5YA 4LR9A 1UEVA 1UA1A 1KHVA 4NLQA 4O3NA 3I5AA 4LMZA 4J90A 4JI2F 3C15A 4F4ZA 2FJWA 3OT9A 4DR1J 1YITS 4WZQA 3CCVS 2VG6A 3P3DA 3FBBA 3LGMA 2DR6A 3SQGA 4DI6A 2DXFA 4ECRA 5D4OA 5DGAA 3S01A 3PW5A 2F65A 1YGYA 1NJXA 4P7TA 3HSGA 4DSLA 4X4RA 1JB0C 4V19X 4OYBA 3QGPA 1D9FA 1MMNA 2N3LA 4EGLA 1X31C 4X65J 3BBCA 4P73A 1B0VA 3FQKA 3HJVA 2F8MA 3DM2A 1YKWA 4PXCA 1N6QB 4FVCA 2XMJA 2HMIA 3G8TA 2NXJA 5I42B 3EXCX 3B82A 2FY1A 4MFBB 1I94J 1U8WA 1B99A 2HAFA 3I87A 1IVZA 1IUJA 2HFUA 1S1XA 4I7FA 4O0NA 5CD4A 1NHUA 3DOKA 2ZH1A 4G1QA 2UVWA 4C48A 1T11A 4HT7A 4XDDA 3IGVA 4K7QA 1H7XA 2MSSA 1XNRJ 1LWEB 2LDIA 1T8EA 4FYDA 5CZVA 3M32B 2JDJA 2RDDA 1VRTA 4JV0A 2B0GA 4GVBA 5IT9Y 2CNLB 2GJIA 4I2QA 2RU9A 5EHHA 1KDNA 4LF1A 2B4PA 3R5GA 5F3ZA 1KS2A 5LMUJ 1F60B 2GAGC 3U1LA 1SCJB 2HHVA 4OYAA 5K8MA 1OPIA 4DL2A 1FXRA 1M1HA 4CH1A 3AJ2A 3LUYA 2HS0A 3N6NA 2C2MB 1BWVA 2R7UA 1BQXA 2HHHF 3J81j 2R9LA 1ZH5A 1Q7YT 1PJ6A 2QL9B 3EZ5A 4FBTA 2WSCC 2J0WA 3ZTPA 3QFWA 3HD1A 3TUIC 2M70A 2NXNA 3M8PA 4L6V3 5B0EA 1WUUA 4QR0A 2J0SD 4JUZA 1WEYA 5DGBA 2CG4A 5A8RA 3R5JB 3QSYB 2CPFA 4JI5J 4QU7A 4C3KA 3DLJA 2N7CA 1FDDA 5ETKA 4ETXA 1S76D 4I67A 4DV7F 3KLHA 1DLOB 4USKA 1VRUB 1LK5A 2YXLA 5K14A 1NK5A 1DJ0A 2HVIA 4ZOSA 4WTOB 2DRAA 1AW0A 3LP2A 4YEAA 3TUPA 5FJ4A 2MZRA 4ZK7M 3W5ZA 4RNMA 4X62J 3Q22A 3RAXA 1VQ8S 1RT7A 5HLFB 5F0UA 2IVFB 4R8UA 1FKOB 1A6LA 4UOFA 2HHPA 2IAJA 3H42A 4OV1A 3EZUA 3DXSX 4OHXA 2O5DA 4F2SA 4RNNA 4PG6A 1NMEB 3U1NA 3C3LA 4AFFA 3NGTA 4ZPDA 2MKCA 2IRXA 4NCGB 1FF2A 1RYSA 3LTOA 1YJ7A 2DY9A 2RD5C 1FFSB 2J76E 3GFHA 2AYBA 3KTQA 3SDEA 5F41A 4R25A 4R5PB 3TNVA 5CYQA 3UDEA 1RTJB 4QYZJ 4RW9B 5CH7B 1FJEB 2AGQA 3M7VA 4Q7AA 4F36A 2DT9A 4DV4F 4LIWA 1LWCB 3MMBA 3RAMA 3OXGA 4F7VA 3HKWA 3W60A 3BO3A 4NZ0A 1NSPA 5HROA 5D4NA 4PABA 1T03B 5M2UA 3HP6A 2YWKA 4U95A 3CDBA 1Y11A 2PGCA 5C25A 1RABB 2E5JA 4JV2A 4OJ1A 3BH6B 4CRJA 1VQ6S 2HQCA 3CD5A 3ADAC 2DH9A 3RAQA 4Q8EA 4EK2A 2IJFA 4JYAJ 1H3DA 1U1RA 2APOA 4DFKA 4GC6A 5LJ3Y 2R2UA 4USIA 2WONB 2V4RA 3EICA 3WZ0A 3BKTA 1U24A 2CQGA 5KFMA 1WG1A 3CCWA 1L3SA 5KG3A 5KOWA 2HNZA 4CH7A 2LEBA 3TVKA 4CIOA 1GXUA 1JLGA 2LQBA 2X1GA 2WW8A 5L8RC 2GMLA 3KLFB 5CA5A 3UNGC 1LW0B 4N8OA 1RSCA 1FDAA 3TZXA 5KFIA 3I0RB 3MEEA 4Y6IA 3WX8A 1M5KC 1GQEA 4IFVA 2ZNZA 2QA4G 4QWEA 4ANEA 2KXHA 5D3GA 5MLCV 1YVFA 2X3DA 4LR8A 2YX7A 4ZPAA 1TK5A 4OZLA 1NXIA 2Z2YB 4HI1A 4DSFA 3VQTA 2OPPB 2BKPA 1SV5B 5KFOA 3BN7A 2VFSA 3SSQA 3ENAA 1VI7A 3DFEA 2LMIA 4KHPJ 2GO8A 2HQGA 2NXEA 4B9NA 2GHWA 1FEHA 4I4BA 1FO1A 1RK8A 1UVJA 2MQPA 2ZVSA 3FCWA 2Z4PA 3MR2A 3DYAB 4HI2A 1PILA 3VWSA 2M88A 4O44A 2OPQB 3FNNA 4P74A 3HHKA 3VGSA 4C0BA 2NYHA 1H72C 4YN3B 1TK8A 5HBMB 2BRKA 1JJ2R 3H98A 1EKSA 1RKJA 2K3KA 2NQPA 4C7QA 1BXNA 2JHEA 2X1FA 2HS3A 1NPPA 1XIQA 2BXJA 1L3TA 3MMCB 1JJHA 6AT1B 5FDLA 3CJQA 3V2UC 3N9UC 4URSA 1MG7A 2H5EA 2KRBA 1UEKA 2YVSA 3QLHB 1F3VA 3R5BA 2ZJQQ 4ED6A 2R8HA 1RLCL 5CYJA 2DVIA 3RR7A 3QIPA 4IRKA 3LGHA 3PYFA 4DV5F 4YS2A 4V1Ak 2W7PA 4DS5A 4BWJA 2DISA 3BBFA 2ZE2B 2V63A 4RLEA 4QCLA 2OD6A 3JTOA 5K8NA 4U96A 4OHWA 4RW8A 2G0CA 3NOGA 2OI2A 4MJKA 4C0OC 4DPXA 3EPGA 3O8WA 2KL8A 2HVHA 1I3OB 4CZCA 2BW2A 1XMOF 3CCQS 1IWGA 2MY8A 2CVEA 2E1RA 2Z2LA 4TQRA 3PKMA 2VB6A 4Y28C 1SH3A 1UJ6A 2ZEJA 4Y65A 5LL6d 3JQJA 2R7QA 1RACB 2U1AA 1LFPA 2VFRA 3GILA 2JFDA 1VQPS 4F0KA 1F9HA 1IJFB 2V2QA 3BV8A 3S6EA 1X4CA 4CO4A 5G4DA 2CJAA 2OELA 1IKWB 5D4PA 2ADCA 4H4MA 1QJHA 1OYDA 3ISZA 1K1QA 3Q8SB 3CDWA 3WBZA 5IXUA 1V3ZA 4B3MF 2EK6A 3PTWA 1UVLA 4Y00A 4MYUA 2XWXA 4QWCA 4RW6B 1G2EA 1JLBA 4FXVA 1EETA 2XMMA 3TX8A 1HA1A 1FTCA 3K89A 3I4HX 2C2OB 2Z0GA 2A0FB 1HNXF 1IBLF 4RO0A 1WI8A 1CJTB 2LXUA 2CYYA 3H40A 3AXKA 2BUNA 2M8HA 4MIAA 2XULA 3G71S 5F3TA 4N7TA 2G1HA 3PFOA 4ZVGA 5IT4A 3KK3A 2CJBA 2RSQA 4B9SA 1OY8A 3ILIA 5DG7A 3QZ8A 2FHOB 2CQIA 4NX9A 5I4MA 1FRKA 2ALYB 1CJKA 3KYLA 3CJTA 1UETA 3TAQA 4AQYF 3IG1B 1AZSB 2HFNA 3N0VA 4C8YA 4ZMMA 1TKTB 3FSIA 2L3MA 4V19J 5GAHU 1CG2A 2DNYA 2HVEA 1H2UX 2C42A 1EJ7L 1RAIB 4OYMA 2BR0A 3F73A 3CJKA 4K4YA 4LBPA 1X4FA 1HBNA 2R8JA 2Y9HA 3J81Y 3TO8A 5DO2A 1L3KA 3FRZA 3SXLA 1XMBA 4NXNJ 5CCMA 2GFFA 1N5YB 2CADA 2VA2A 4DL7A 4OIXA 1RT1B 2UUCF 4YR2A 3A8KA 2EFPA 2CJXB 1RWNB 2DPJA 3CE8A 1IQZA 2V5HG 3WC2A 1DHMA 4DV3F 3JYTA 7FDRA 1DY3A 1IJEB 4LSLB 2GVZA 1EP4A 1CQMA 3AB2B 3Q8QB 1CULA 4QYZK 1ZOTA 1PBAA 2L48A 4X4TA 3DOLA 3FJ2A 4IG0B 4HVZA 1ZA2B 1Y3JA 3EVOA 1RLDA 2HQIA 4C11A 1QSSA 6FDRA 2H51B 3LQVA 2W9BB 2O3DA 3MFIA 2DIUA 3D0HE 2CQ0A 4XTTA 1C0UB 2JVRA 3VAMA 1M5VC 1CS4A 4RWWA 3AJ1A 4DBQA 2XI2A 2HHWA 3PX6A 3R6LB 3OQ2A 4O4GB 3R6GB 1RXOB 5T7LA 2UXBJ 4CI0B 4I6AA 4EZ9A 1Y7PA 5DDOC 5HQLA 1TL1A 2UUAF 2EFGA 3MOJB 3MXHP 4DR5J 3IRXB 3ETOA 5F8NA 4X66J 1S1UA 2W24A 4ZLJA 1S49A 2P6TA 3GIKA 5KG5A 4A8QA 1T7PA 2KYZA 3F56A 2RIJA 1RWUA 4Q8FA 3QYYA 4CLSA 1TQLA 1VK3A 2RE1A 5ITHA 1SUQA 1N34J 3UQSA 3FBFA 3TX0A 1RP5A 5HVFA 2RJZA 3QAUA 3X1LB 1S6QB 2K1RB 2ZWOA 3CC7S 2E5GA 2FZKB 4I69A 2BJ8A 1H0HB 3BH7B 1GX5A 4DFMA 3E2EA 3M8QB 3JB9k 3SCIE 3HHNB 4ZVEA 1Y5LB 5GADU 3CJ0A 4Y0FA 2EK1A 4IFYA 2V8PA 5HMWA 5L38A 2MHEA 3UVJB 3TZZA 3K59A 2VL1A 2JWNA 4NEYA 2J0XA 2RMLA 3SSSA 2RH3A 1VR6A 3QAEA 5HSPA 3TVZA 4Q0BB 1Q1KA 4IR1A 4EEYA 1DARA 4PRFA 3JSMB 1S7HA 1R0CB 3CNQP 3LO3A 4FYXB 1MROA 1HBOA 3JAMU 2YKNA 1HNZJ 3BR9A 3LP0B 3M2VB 3KG0A 3PHTA 3T9NA 5KFJA 1PAUB 3A8EA 2LQ5A 2EI5A 2YKQA 2OPRB 3GV7B 1HNIB 3R7BB 2FVQA 2IYIA 4UZCA 2J0QD 4R0JA 4F3QA 4BWMA 5H9EJ 5F0WA 2ZITA 4I1TA 1G3OA 3C15B 1FRMA 1PSDA 1NBEB 2HZCA 2VG6B 3BB5A 3D67A 3THVA 1XJWB 2IYGA 1RGVA 3SQGB 2RRBA 2XSJA 2UV8A 2OHDA 3BS9A 4ETZA 4GKKF 2CPIA 2ATCB 2LLZA 3U02A 1TZ0A 2HEKA 4PWDA 1RAJA 5IC6B 2MSTA 1MU2A 1Y3KA 4OL8A 4KY3A 3UO0A 1Y9OA 1S1VA 4PR6A 2VIHA 2RB7A 1QAYA 2CQ2A 4UUWA 2QLBB 1FJGF 3DM2B 1ELOA 5LMNF 1SKSA 4N41A 1KVKA 3NWRA 3ONQA 2HMIB 2HAIA 2P6SA 4J9QA 4AYBD 3NCRA 2BDPA 3GU0A 1GAOA 3DLKA 1N5VA 2F9JA 3RU0A 5ETSA 4PWWA 1S1XB 2BM0A 4I7FB 1K47A 2EKNA 3DOKB 4G1QB 2VQFF 2QGFB 3DU5A 4C8ZA 1UPMB 5FLXU 2HLTA 5ETNA 4ZCKA 1U2FA 3CXCR 1VRTB 4YUDA 4WU3A 4DU7A 2CA9A 4GVBB 2C2RA 4I2QB 4QWBA 1NSQA 1VBKA 3UR3C 1RWMB 2PI4A 3PO4A 2NZ4A 2AYMA 2EWHA 2KT3A 2OMOA 4GVLA 4NLYA 1FWPA 4M5DA 4P52A 1UVMA 2ZJPQ 4X4NA 3A3NB 3EJMA 2GA7A 3NEKA 4J9UE 5C42A 1F5CA 1ULRA 4WYWA 1K1SA 2G2ZA 1RDRA 4U7UK 4LFBJ 2DITA 2RDJA 1T0TV 2YNIA 3C14A 3R2DJ 1T3OA 5HMZA 1S6OA 2HVDA 4KE5A 2G2OA 4DV2J 2ZBQA 1S9GA 4CQ1A 3ZTSA 2MYFA 2HZAA 3HX9A 2BE9B 3M8PB 1NO8A 1SL2A 2IBOA 2BKNA 4PPZA 4IYQA 3PG9A 5A8RB 1WF2A 1W7WA 3I6PA 4ILLA 1F9EB 3H20A 1AA1B 4MKBA 2FC9A 4C0HA 4Q44A 4LF7F 2Y1LB 3GCWP 3BYPA 3KLHB 1APSA 1U26A 2PDAA 4YY3J 1NHVA 5K14B 3VGVA 3PVXA 2XMAA 1UJ5A 2EFNA 3LP2B 2G13A 3KLVA 4OYZA 1YBUA 3RRGA 3VCDA 2K8GA 4KBIA 2WTFA 3W5XA 3OL8A 1RT7B 2ZH7A 3FGVA 5L1JA 3PDNA 4GO7X 1S1TA 3BF4A 1R6VA 2IAJB 4TVAB 1BMQB 4UOGA 3IM8A 1R0BG 2UUBF 2WRMA 3H2LA 2DPIA 5D6GA 1GMWD 2P5VA 1JXVA 4A8FA 3BGLA 3UD4P 3D6MB 3AD9C 3DLHA 4KB7A 2KG0A 1IN0A 1SQGA 2WOMB 4KGMA 1TFWA 1R8CA 1VIXA 4N56A 1K44A 2ZBRA 1WHXA 3NNAA 5B0AA 2VONA 1M1GA 2QE5A 1UW4A 1ZTWA 4JI8J 2RDIA 2ZH9A 2V2ZA 1U1PA 3SDEB 2QV6A 2Y1JA 5A0YA 5J1PA 2PD1A 2Y3YA 1WD6A 5CYQB 1NB7A 2C2NA 2HYIB 2MEWA 4FKYA 4F04B 4P2SA 3W7BA 3EX7B 3MMBB 5C5JA 2IHR1 2N4CA 3T5LA 1JXEA 5KFUA 4J9NA 4A8XA 5HROB 1CVJA 1VCTA 3TEHB 3L3CA 3H4DA 3Q0AA 4KQZA 3SV4A 3PO5A 1RBOB 2J7UA 2VQEJ 2LCWA 5C25B 4OZ5A 1PCAA 4ZLLA 3R2CJ 3NCPA 3SFGA 5KFTA 2GIFA 4EBEA 4O3RA 3DKDA 2M2BA 4J9KA 3MECA 4KRWA 4LFCJ 2HBYB 2ZUAA 4YDDB 3C2PA 1Q7LB 4WPAA 3NGUA 2R8KA 2E5LF 3PYGA 2FVSA 3MPVA 2BW7A 2ZJRQ 4GKJF 1TUWA 1Q8KA 3MAQA 1VOMA 2HNZB 3GIMA 5GAHI 2DYAA 3V81A 4JI6F 2QT7A 3K57A 1YLXA 1VQKS 1A9NB 1DQ8A 1FDBA 3HHDA 3MEEB 4DR6F 1U25A 2A18A 4CLKA 1D9DA 2QA1A 2BX6A 2XG8A 3CPWR 4IH6A 4IFVB 3B4MA 3PIOQ 3H5UA 2DHAA 5T41A 4YFUA 2B9WA 5JMNA 3J7Z5 5D3GB 2OEKA 1KTQA 2LEPA 4CM0A 4NCAA 2QTWA 1SB6A 5LSOA 2YWWA 3SZ2A 5A8WA 1RWPB 1N32F 4X64J 4IG3A 3KG4A 4DV1F 2QO3A 2IA0A 2ZDPA 5DETA 3NL0A 2KVQE 4ZHRA 4F3OA 5CABA 3VZIA 2N7YA 5A76A 4CM2A 1EQMA 1XEZA 4K4UA 1VBYA 2WZ1A 2HQ3A 4XIUA 4O44B 2XMKA 3UR0A 3ENWA 1FRIA 4FP9A 2HGMA 3SFUA 3NNCA 1Q95G 1URRA 4NLOA 3K8VA 1SIZA 2E7WA 4YB7A 2EG2A 5H9EK 1O5JA 3NMAA 2HWTA 3MM8A 2U2FA 5KFHA 4N77A 4QIWD 1C4AA 3GJSB 3G9CA 4HH1A 3CC4S 3E01A 2MKSA 5FDLB 4A8YA 1I6JA 2E7XA 4X4UA 4TY9A 4UY8T 2M5YA 2F9DA 9ATCB 5HL7Q 4OYWA 2HRUA 3GP9A 2IPOB 5IWAF 3H25A 4C8OA 2YY3A 2FB0A 1X7VA 1N56A 2AJ1A 3RRHA 3CJRA 3HVWA 3V4MA 4ER8A 3QIPB 3CDEA 3IM9A 3JS9A 4J9MA 1H2TZ 2D3OR 5ETMA 5THWA 2MZJA 3QJJA 3MMJA 5B0DA 2IRUA 3B54A 1BGXT 1KLNA 1KQKA 4RW8B 5IT0A 1YK9A 4KH0B 1RAOA 3C6TB 1GH8A 1N33F 2MGZA 2KG1A 1BQNA 1IBMF 1LWXA 3BGOP 2R7XA 2BA9A 1LNQA 1SBRA 2DHSA 3AOBA 1UWAA 2UXDF 4LSNB 3GLJA 1LKZA 4Q5VA 5KFSA 2JSXA 1RT6A 1OSDA 3IWNC 2R2SA 3IMQJ 1C0TA 1VQ9S 4LF4J 2DGSA 3CJ2A 2AQ4A 5BR8F 3MEGA 4CT8A 2HK2A 2KZZA 4H4MB 2AJ4A 2ATLA 3N01A 1R8AA 1VLYA 4CYUA 3LA0A 3NGDA 1Z4UA 4RUAA 5GMKa 5D4LA 3KFWX 3KUEA 1X5TA 4DUZJ 1J5OA 3FEYB 2Z2MA 3LPEA 2G9OA 2EFOA 4A48A 1R89A 3CCUS 5KG6A 5A8KA 3K5PA 3UI3A 5KFKA 4LFAJ 3OVAA 4CO2A 3W1YC 3DLEA 1JLBB 2W2QP 4NL5A 1PIEA 1EETB 1DBDA 4QZVB 5F8IA 5B08A 2D74B 2IFXA 2M4MA 4OI4A 4OMFG 3C16A 3MR3A 5J2QA 1WOSA 4DSEA 1CSJA 1RA6A 2DCUB 3QRQA 1U47A 4JI3F 1M5OC 1RTZA 2FDNA 4EZ6A 4ED5A 3V4IA 4OI1A 3W8GA 4U7CA 2QFJA 3P6YC 3PKYA 3KK3B 1S0OA 3CD7A 3US5A 4E98A 3QGIA 4NMLA 1URNA 1IBKF 1EB0A 3QWPA 2PO4A 4ZA1A 4HHUA 4DPOA 4LF9F 2OH2A 4C4WA 2QA4S 1RWXB 1KC8T 1S9EA 5D77A 3BGRA 4K0KF 1FKPA 3CO0P 4FKXA 2Y8WA 1AB8A 1U0HA 3ZZZA 1D09B 1X0PA 2Y1IA 2R7TA 2LA6A 4WP3A 2AIRB 2ZVIA 1FA0A 2E5LJ 3FZBA 3CJKB 1HBNB 4BCAA 4J91A 1OJ4A 3C19A 2CQPA 4MH8A 2DR8A 3VQSA 2E9RX 3MDFA 4UOHA 3MTJA 4ZKAA 5DDPC 2KI2A 3KJFB 4LF5F 1YJTA 3D1HA 5IT9U 2MLXA 3QT5A 1LK7A 3PYDA 3ISNC 2K7KA 4DR7J 5DQHA 3JYTB 2HPUA 1TVRA 2BACA 2GVZB 1EP4B 5E3AA 1CULB 5KFCA 2V8GA 3DOLB 4OI0A 1WJ9A 2D41A 4DV1J 3GJQB 3M2UA 4C11B 2UU9F 4HDHA 4B02A 4ZVPB 2BE7D 4X2BA 1QAIA 2M0GB 3HXMA 1N88A 4DQQA 1FERA 3KUHA 3FEZA 4F0MA 3OBIA 2JEGA 4ZPVR 1CS4B 1RAGB 1N5QA 4G3IA 3K5OA 1KKHA 4R0EA 1K9MT 5T7LB 1S7IA 1JJ4A 2KTQA 3BO4A 1TL1B 4MYTA 1F0XA 1K8AT 3KWMA 1TAQA 4ZCLA 4DUYF 2GC8A 3IS9A 2ZHOA 1S1UB 1I5OB 4ENOA 4HH0A 3BGFA 3CCLS 2HFOA 2FVPA 3BBBA 3SI8A 3FZ2A 4EO8A 2F40A 1PAEX 1DQAA 1SUQB 1JLEA 2X1BA 3ZZUA 1SC4B 1YG0A 1S79A 3AH6A 2W9CB 2DGUA 4TXSA 5F8LA 5I3UA 1UTAA 1ICEB 4OHVA 2J7KA 1D8YA 1SC6A 2CQ1A 5KG7A 2I5JA 2CQ3A 3OVBA 4O3QA 2OUGA 3OSNA 1NLKL 3GIIA 1YIJS 1MN7A 2L9WA 2HWHA 4PXBA 2RU3A 4F26A 2P8IA 3I0RA 4KR0B 4ELVA 2L9DA 2H1YA 5D78A 2EVZA 4IFYB 1TK0A 4MMOA 3I55S 3ZZ0A 2EW9A 1VQLS 4XK8C 4K4WA 1NK4A 5C2CA 2VPWB 1KVJA 2EBEA 2XLJA 1S48A 4YDXA 2F4VJ 5GAEI 1FX2A 2W4PA 2D69A 1PYOB 2B7CB 1IQTA 2VC1A 2Z30B 2RHSB 1MWYA 1MROB 3IP0A 1HBOB 2YKNB 3P5BP 4M5HA 1HBMA 1ZM2A 3QMQA 1BUXA 1HQUA 4DV0F 3E8OA 4IH7A 4CLPA 2DNKA 5DLFA 4RBTA 4DR2F 2R3VA 1NPKA 4KPCA 4EWTA 5L46A 2V68A 2C3YA 3Q23A 4B3SF 3L4BC 2R7SA 1WORA 1VQYA 4KAIA 2XGPA 4CLTA 4KKOA 2OAUA 2LU1A 2XSJB 2MZSA 3ELHA 4NA1A 3W8PA 3HPOA 2CJKA 5AXLA 2XQCA 4LF8J 3G8SA 3D6TB 4PWDB 3O1LA 1N52B 1VIOA 1MU2B 4PG4A 2DNLA 1S1VB 4BDPA 1VQ7S 4EI2A 1PYTA 2QJ3A 4EBDA 3H5SA 1FK9A 4UUXA 4FYWB 4WXWA 4KH1B 2XYGB 2Q3PA 3RYLA 4BS2A 2DY1A 2RS2A 2FGCA 3W2VA 1TL3A 2DNPA 2MQLA 3DLKB 4P2FA 1HL6A 1OIAA 4JI4F 2KFYA 1G1XA 2LFVA 1HARA 2CPXA 2NS1B 2BABA 2LXIA 3DDKA 5IFMA 5HQMA 2YQ3A 5KFPA 1L5UA 3QRPA 3D66A 1P9YA 2CQ4A 4ANDA 2ACYA 4QIEA 5KFZA 2AD9A 2QZ8A 3GG0A 1N48A 2XS5A 4RNHA 2CG8A 2QMXA 3J7AN 4W92B 3VVTA 2NPIA 2CZ4A 2LP4A 1U1KA 2DO0A 4UW2A 2MKKA 3MGJA 2KHCA 3Q83A 2CNKB 1Z2ZA 1IWAA 3NS6A 4I6YA 2ZM6J 2POKA 2XLIA 4PPDA 3R5AA 2JLEA 1KSPA 3TW0A 2BANA 4M5DB 1C2PA 2WVCA 3CMAS 2J9DA 4ECWA 2KO1A 1HLWA 4DU8A 2JNJA 4K4ZA 4JI0J 5C42B 3DRXA 4TLRA 5CQGA 4DR1F 2FZGB 2MQNA 3A4TA 4U8YA 2YNIB 2ASYA 3C14B 3O3LA 2UU9J 1BE4A 3R97A 3W62A 2KFNA 4OYPA 2XS7A 5AT1B 1NRKA 4AE5A 5I3PA 5HMXA 2CDRB 2FIUA 1S9GB 2IMOA 1SL0A 3HJFA 5KFDA 2F5GA 1XR6A 3GCXP 3GZ7A 5AE1A 2IC3B 4ZVFA 4A8OA 4LVNP 1D3WA 5M2PA 2ZWPA 4DR4J 3O6QA 2UXCJ 3E3XA 4M5KA 4IUFA 4X65F 1T95A 4ED2A 3IFEA 3ILJA 1ZAWA 1V5VA 1PC5A 3RB0A 5JVHQ 3T1AA 1NK6A 4YP3A 3MWBA 4F2RA 2DBBA 4B3TJ 3D3BJ 4NLRA 4IDKA 3L7UA 2ZH2A 4BBYA 2FQQB 3L95X 2NLWA 2IBKA 1IKXA 5HN0A 3IAM9 1PBUA 3IR5B 4I0WA 2CDQA 4FYVB 3TVYA 1YDLA 3MEKA 4OX7A 3LPYA 1XNRF 2ZKUA 2XTJP 1RWWB 4HR2A 2J7WA 2KH9A 3H2UB 1B7YB 2RHQB 1WSVA 2RQMA 5LMUF 3VTIA 1T9TA 5ADZA 2DGOA 3QGHA 1C1BA 3BPDA 1RAFB 5IV3A 1R31A 1BWEA 2WCXA 1Q0NA 3A1YG 2VZ9A 2JEFA 1RYRA 1JLFA 3V6HA 3J7YI 3BM7A 1PO6A 3K7RA 5DDRC 1J2VA 2HW3A 3H59A 3M2RA 4IG0A 4CNYA 4NLXA
chains in the Genus database with same CATH topology
4C11A 1RTJA 3DDNA 1QSSA 4J9OA 3V6KA 3NNHA 4WK3A 5A0YB 6FDRA 3LQVA 2W9BB 4ZP6A 1WHYA 4RW9A 2O3DA 4MKYA 1WHWA 3MFIA 4ZDNA 2DIUA 4J9RA 2XMWA 2PMZD 3D0HE 3QJPA 2CQ0A 1LWCA 5D8HB 2PA3A 1NKCA 4QOTA 5DS7A 1C0UB 3T1YF 1OWXA 3G6XA 4FPRA 2JVRA 1X9WA 3VAMA 1M5VC 3DN9A 4Q2LA 4RWWA 3AJ1A 1RTIB 4DBQA 2XI2A 4LVOP 3PHEA 2HHWA 4UQTA 2XSFA 3V5RA 2AP6A 4EUVA 2VOPA 1S77D 5DQIA 1U6BA 3VF0B 1GNKA 3HI9A 2CQCA 5G0RB 1BY9A 3OQ2A 4NLSA 3PX6A 4O4GB 1T03A 3BSNA 1JKHB 3QGGA 1VQ5S 2FLLA 5T7LA 1ZAVA 3EYZA 4CI0B 2UVUA 4I6AA 2HNDA 2QLXA 3DXBA 1HI0P 1VQOS 1HPZB 4EZ9A 1Y7PA 1RT2B 5DDOC 4JI5F 5F8HA 5A2QY 3C46A 3PIPQ 1TL1A 1TR0A 4MTPA 2ZUGA 3DOMA 2QMWA 2VBYA 3LF0A 3MCSA 2EFGA 3MUTP 1WTBA 1HR0F 2UUAF 2NREA 4Y2KA 4NZ6A 1JLAB 3MOJB 3MXHP 5B09A 2KZMA 3IRXB 4QJVA 1JIHA 1R8PA 3CJ3A 2DR5A 3ETOA 4Y34A 5F8NA 3J80Y 1S1UA 1IKVA 1S9FA 2HHXA 3CGIA 2W24A 4AL6A 1TUVA 2YKOA 5J1EA 2KJWA 1LV5A 1S49A 2P6TA 3GIKA 1Y4ZB 3E51A 5KG5A 1AUDA 4A8QA 1T7PA 2KYZA 3F56A 1CC7A 5KFAA 1FT8A 2E44A 2JLFA 3HVRA 2BBEA 2RIJA 4RW4A 4WJBA 1RWUA 5LSRA 1N4LA 4XO0A 3AB4B 3ZFVA 1YTYA 5EUHA 1WACA 3BR8A 1YRXA 4Q8FA 3NMRA 3KK1A 3QYYA 3LALA 1X4EA 5DM7Q 4DSJA 1TQLA 2C28A 4Y2IA 1VK3A 2RE1A 2VC0A 3AY0A 3MECB 4Y3CA 5ITHA 2QA2A 1FRLA 1SUQA 3KHGA 2HNYB 3UQSA 4U9RA 1FD8A 4I6WA 4YOEA 1RP5A 4ZVHA 1X9SA 1LXJA 5B7WA 2WONA 4N76A 4X62F 5LJ5Y 3B78A 2GQQA 5C24A 2VASA 1R3NA 1KFDA 2FHMA 4RKUC 1L3VA 1FNOA 4FN5A 5H9FJ 4DR3F 4DFPA 1ZETA 2RJZA 3QAUA 2V8DA 4OZ1A 1S6QB 3X1LB 2JL9A 5AXNA 2P9GA 2K1RB 1S6QA 1O51A 3DRPA 2FHKA 1OQ6A 1P1TA 1GTHA 4DMZA 4I64A 3CC7S 4NZ7A 4IO1A 4C2MA 1RJJA 3V81B 1M5PC 2MJNA 3KLFA 1WI6A 3S1TA 2R2TA 1QUPA 1LW0A 2E5GA 1AXQA 2OD4A 2YNHB 2EBGA 2O67A 4I69A 3VAHA 1SH0A 4FBUA 3VZHA 2WSFC 4QWAA 4PG8A 4HTIA 2PFFB 4DQSA 1H0HB 3AQPA 2DHXA 3UDCA 1NKEA 3RRKA 1GX5A 4DFMA 3E2EA 3M8QB 3JB9k 3SCIE 3HHNB 4ILMA 2GQ2A 2JJ4D 5KG4A 2AW0A 4ZCMA 2J6SA 2D9PA 2V4QA 4JI7F 4ZVEA 3M8QA 4NCBA 4CO1A 1Y5LB 2ZOGA 5GADU 3CJ0A 4P7VA 4Y0FA 4K4TA 4TU8A 1SJFA 2EK1A 4IFYA 2HG4A 2GJ2A 1Y00A 4DG1B 5HMWA 3M1VB 5L38A 2MHEA 3K59A 4NA3A 2V8HA 1X4HA 1E6VB 4KHRA 1QAJA 4AL7A 2B51A 2W8LA 2RILA 5B0BA 3MHYA 3TA0A 2RVJA 2DNMA 2JWNA 2VL1A 5H1SV 2OPPA 1KLMA 4ZS6A 2J0XA 1FXDA 2RMLA 2VA3A 1A7GE 5FLXY 1SV5A 4EFAC 1H98A 3LWLA 2DNQA 3SSSA 4DR7F 2RH3A 1R0AB 2W7AA 5A8WB 4ECZA 1RT3B 2V8VA 2XCPA 2A1BA 2N3OA 3QAEA 3TVZA 3KLIA 2NUUG 2HGNA 3T5JA 4Q0BB 1Q1KA 1TKZB 4IR1A 4NLUA 4IG3B 4M94A 2CRLA 4EEYA 1Y5IB 5KFLA 2AGOA 1DARA 4PRFA 1BC6A 3POTB 1R7IA 3JSMB 1S7HA 2CPJA 4E0DA 5HMYA 3K0JA 2DGVA 3MZIA 4K4VA 3LO3A 4NA2A 3CUNA 1QE1A 4ZHRB 2C3UA 2J9CA 4U67Q 2LEAA 1MROA 2GGPA 1TFYA 5J2PA 4HYKA 1HBOA 3FFIA 2GCFA 2R7WA 2YKNA 2KFZA 1F5AA 2KDOA 3DYAA 2Q66A 1VC0A 3L7OA 3BR9A 4EYIB 1Y5NB 4ZP8A 4NYOA 2OPQA 2DNHA 3LP0B 3M2VB 3KG0A 5L9NA 2GHVC 3R5CA 2IVYA 2RT3A 4OZ0A 4ECXA 2JC1A 1HNVA 2GQCA 1FNXH 1B7FA 3T6BA 4DLEA 2RRNA 1MMDA 2MQMA 4RU9A 3IR6B 4NRTA 2A2DA 3T9NA 5KFJA 3A8EA 2KN4A 2LQ5A 2EI5A 3CB4A 1VMBA 2YKQA 2OPRB 3OXFA 2FJXA 3DLBA 3GFYA 3GV7B 2R7OA 4ZPCA 1HNIB 3DC2A 5HBMA 4UY85 5AE2A 2JZ5A 3LAKA 3MM8B 2FVQA 2OSRA 4TY8B 3LH2S 2IYIA 2ZBCA 3CCSS 4WE1B 2J0QD 4B9UA 3NBPA 2KKHA 2ABYA 3HZGA 4R0JA 4ZP9A 3UWTA 4F3QA 4BWMA 5H9EJ 5F0WA 4F02A 2GW8A 3MMCA 4DOZA 2M8DB 4Q2MA 2ZITA 2FD2A 4B3RF 4I1TA 1G3OA 1FD2A 2O1PA 5B0GA 2NYIA 1CC8A 2MQQA 2ZHAA 1FRMA 4LQ3A 1UWBA 1PSDA 4CO0A 3WDOA 3MM7B 2I1RA 3E01B 3SCKE 4TU7A 1XMQF 3TARA 1JX4A 1E6YA 3PY8A 1KFSA 2HZCA 2VG6B 6FD1A 2OLWA 2X3GA 2AYEA 3BB5A 3KKFA 1O8BA 3HHEA 4F8RA 3THVA 3TAPA 1AFJA 2PIIA 3QLHA 2IYGA 1RGVA 4B08A 4JYAF 3SQGB 2RRBA 2XSJA 5KFFA 3OR2A 2E1MC 2YKAA 1M1KT 2UV8A 5IM0B 1WHVA 3M30A 3DHXA 2C3MA 3BS9A 4QPTA 5KG2A 1JNRB 4ETZA 2BE2A 2MQOA 4GKKF 2CKWA 1V9OA 5J1NA 4RUCA 2N4DA 1X4DA 4TQSA 3DU6A 2CPIA 1NZAA 2OFGX 2V4JB 1KOHA 4P6QA 3MFHA 2LLZA 1IXKA 3U02A 1TZ0A 2BQUA 2FUG9 4PWDA 1GT8A 4QW9A 4PCQA 1Q16B 2LA4A 4H4KC 3FEXB 1RAJA 4QU7A 2MSTA 2DNGA 3CTRA 1MU2A 1Y3KA 1BQMB 4NYPA 4DV6F 2ZE2A 1NJZA 4OL8A 1XERA 2OP5A 2XHWA 5E3PA 1Y9OA 1S1VA 4PR6A 1FRHA 3UPFA 3OVSA 2HVZA 4WKRA 2RB7A 2O66A 3Q2SC 1QAYA 2CQ2A 5CCLA 4UUWA 4ECTA 2B43A 3OTBA 2P9CA 3CSKA 1FJGF 3CDAA 3ICLA 4KV8B 3DM2B 1ELOA 5KAKA 5IQ6A 5LMNF 1SKSA 4N41A 3AHPA 4IOBA 2OFHX 2R7RA 3V6DB 1RTHB 2KVIA 2YTCA 2HAIA 3ONQA 3MM6A 3K5MA 2P6SA 2HMIB 3N6LA 1Q8BA 4J9QA 4AYBD 3NCRA 2BDPA 2SXLA 3CIZA 3IA0A 5KFRA 2MGZB 2JEIA 1BQNB 1GAOA 3DLKA 3HVAA 2A3JA 1DFDA 1N5VA 5CYMB 5DG9A 5K9FA 4PQAA 2F9JA 1HBUB 4C8NA 3DI6B 3H8YA 3NGKA 3I56S 4DS4A 2MKHA 2ILZA 1NU4A 1XBWA 1NAQA 3RU0A 3FSXA 1YSJA 5GADI 4I2PB 1S1XB 2BM0A 4I7FB 1N0VC 4OJGA 3BN4A 1ZPVA 2EG1A 1N54B 3DOKB 4ZLPA 4G1QB 4ICLB 5A6WA 2ZD1B 1DAXA 2F4VF 2VQFF 2CPHA 5K8OA 2ZD1A 3OL7A 4J5OA 4C8ZA 3DU5A 1QM9A 4IOAQ 3M05A 3G6ES 2AGPA 2HLTA 2FVCA 4HT5A 1RT6B 4ALZA 3CCMS 1VC6A 4KHPF 2HFZA 4ZCKA 2XBPA 4C97A 3N6MA 1LW2A 4MKAA 1YHQS 1U2FA 3CXCR 1VFJA 2XMUA 1VRTB 4YUDA 5LSLA 1C0TB 2J9DE 4WU3A 3T5KA 1IKWA 3NLCA 2J9EA 4MK9A 4QWDA 4OHZA 4NLDA 1ZZNA 1U8SA 2C2RA 1D8ZA 3MEGB 2L41A 4HL9A 4I2QB 4QWBA 2RQCA 1X4BA 2MB0B 3G86A 3NRBA 2COLA 2M3DA 4YB5A 3UR3C 2ZH6A 3BJYA 2VPZB 1XC9A 3FSYA 3HT3A 4RNFA 3N5FA 2CPDA 4WXOA 4H54A 2BJDA 2V9KA 4TYBA 2FPHX 3IWLA 3PM9A 3WX4A 3PO4A 2PI4A 1GXTA 2NZ4A 2OSQA 4F25A 2AYMA 1T05B 2EWHA 2OO4A 2JFKA 3D1OA 4QPXA 2B4OA 2KT3A 2OMOA 4ITSA 4WFNQ 1JLCB 4EU0A 3OTOF 1J5OB 1FVQA 3NP5A 4NLYA 5SUHA 3OL9A 2DTJA 4NLPA 4M5DA 3OFHA 2PE8A 2Q1LA 3H4BA 1UVMA 4PKDB 1REVB 1UKUA 3MURP 4CT9A 4Q43A 1U49A 2J5AA 3MI7X 2ZJPQ 3X3UA 4RW6A 4DWIA 4X4NA 3NCQA 3TI0A 4IOCQ 2HS4A 4QW8A 2GA7A 1JLQA 5A8KB 2YH1A 5C42A 1F5CA 1RI7A 3RBDA 1ZBTA 1IM4A 1TKXA 1ULRA 3OFGA 2HHQA 3T1HF 2PA8D 2R4FA 2YH0A 4WYWA 3DLEB 1RISA 3CCJS 4KC5A 3R1HA 4GMKA 1D9AA 2K3IA 4TLQA 1JK9B 1K1SA 2XEXA 2CFXA 1RDRA 4U7UK 1RTDA 5E2QA 2DITA 3TRGA 4WFAQ 2ALZA 4C9DA 2XWYA 4H4KA 1N5SA 1FEEA 3D2WA 2RDJA 2YNIA 2DGTA 3DRSB 2EFQA 2LQJA 1T3OA 4KFBA 2HHSA 3IN5A 1HWKA 1NK8A 1X0FA 4X4VA 5HMZA 1S6OA 2YWEA 3RW7A 4KE5A 2C2DA 2ZH5A 3GR1A 3OUYB 2VG7B 4JOUA 3H2VE 5J2QB 1BLUA 1S9GA 2KU7A 1HI1A 4CQ1A 2KM8C 2MYFA 2ZZNA 5U47A 3HX9A 4RBVA 3M8PB 1NO8A 3R5DA 5F9NA 1SL2A 3TP2A 5E3CA 1G6BA 1NEEA 3W2WA 2W8KA 4LF8F 3MR6A 2IBOA 4PPZA 5KFXA 3PJWA 2CQHA 4B9MA 3P49B 2FHJA 4IYQA 3HVTA 3ISND 4FNIA 3V4IB 2E9ZA 1K0VA 4MK8A 3BDPA 5A8RB 3D1QA 1WF2A 3HKZD 4DL5A 1HYSB 1M0SA 1QVGR 2DD8S 2M52A 4C8MA 4N5SA 2AYGA 2E1AA 3I6PA 1S6PA 3MAHA 3FDSA 1C1CA 2KT5A 4ILLA 2RQKA 1HWLA 3H20A 1X4GA 3GSDA 3AA9A 4MKBA 1C4CA 2UVRA 2FC9A 4C0HA 4Q44A 4RNOA 4RX6A 1JXLA 4LF7F 3P5TL 4OFZA 2OIHA 2PI5A 3KJVA 4HLBA 4H4OA 3GV8B 3KLHB 3PW4A 2UUWA 4MIBA 5JUMA 1APSA 3IR7B 1U26A 2I8EA 2PDAA 4D3GA 2QRRA 1NHVA 5K14B 1I94F 2IMWP 4MK7A 2EPIA 1SKWA 1VQNS 3P96A 5J2MA 1L3UA 3IG1A 3PVXA 1S9EB 1UJ5A 1UFWA 5HP1A 2UV8G 2EFNA 2WB4A 1SJRA 2MPUA 3BGRB 3LP2B 1TKTA 1SJQA 4ZPWR 3G8QA 1FKPB 1MWZA 2G13A 3KLVA 5KFEA 4K4XA 2J8AA 3ZC4A 1HQEB 5BYRA 1DTTA 4L72B 4DF4A 1VK8A 2XS2A 2IVMA 1SIWB 3RRGA 3VCDA 2K8GA 4KBIA 2WTFA 3KNGA 1FXLA 3PFEA 3OL8A 1RT7B 3ZZTA 4F4XA 4RU2A 1S1TB 2ZH7A 3DMJB 3WC0A 3FGVA 2AF6A 5L1JA 3PEJA 3PDNA 4GO7X 1S1TA 1NK7A 4DQIA 4B9LA 3BF4A 2MZ1A 2B5JB 2IAJB 4XAKA 4X4OA 3KNAA 5E3QA 4RUHA 3I0SB 3M8RA 2UUBF 2WRMA 1HI8A 2LDYA 3H2LA 1S4FA 1DURA 3GE9A 3MOZA 5D6GA 2DPIA 2WB1D 1S72S 4PG7A 1YQHA 2P5VA 3DRRA 4Z2XA 3VAIA 4NOHA 1Q8LA 2XB2D 4AUKA 2DNNA 4A8FA 3PEHA 1NNDA 4FF2A 3TUJC 2NPFA 3MTKA 1U1QA 4K4SA 3BGLA 1YJUA 5EX0A 1N5YA 2GIQA 3O5TB 3UD4P 2VG5B 4O3OA 5IQQA 2RF2A 2RRAA 3EGNA 2VKZG 3ZZPA 3DLHA 1RT1A 2BQ3A 2Y1RI 1PGZA 2VPYB 3M6WA 3FRYA 1R6YA 1NJWA 4KB7A 2KG0A 3PX0A 1IN0A 2ZM6F 3MEDA 5AXKA 2WOMB 4M1KA 3LWMA 3IBWA 4RBUA 3Q8PB 4KGMA 2HHUA 3GFXA 3TAMA 1Q86T 2V94A 2RQ4A 1TFWA 1Q4RA 2WOMA 3PJXA 1R8CA 3RB4A 4FF3A 1VIXA 4N56A 2PC6A 2VBXA 4LSLA 1FESA 3HHLC 4WF9Q 5F8JA 4BC7A 1WHXA 2VODA 3NNAA 3MUMP 4DDFA 1YJVA 4A8MP 1TVRB 5B0AA 2VFTA 4MIWA 2ADBA 1QVFR 3UFCX 2KM8B 2QE5A 1U1MA 2VONA 4ERDA 1UW4A 2Q6CA 4JI0F 1UFLA 1FKAF 2GV1A 4OZJA 1ZTWA 4KHMA 1NK9A 4CNZA 5JXSA 2RDIA 3K5NA 2ZH9A 1U1PA 3SDEB 3KK2A 1QTMA 4WFYA 2QV6A 2Y1JA 5A0YA 5J1PA 5A6PA 2PD1A 2W9BA 1WD6A 5CYQB 4HKQA 4ECSA 3M8S