2DTJA

Crystal structure of regulatory subunit of aspartate kinase from corynebacterium glutamicum
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
164
structure length
164
Chain Sequence
b'AVLTGVATDKSEAKVTVLGISDKPGEAAKVFRALADAEINIDMVLQNVSSVEDGTTDITFTCPRSDGRRAMEILKKLQVQGNWTNVLYDDQVGKVSLVGAGMKSHPGVTAEFMEALRDVNVNIELISTSEIRISVLIREDDLDAAARALHEQFQLGGEDEAVVY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartokinase
publication title Structural Insight into Concerted Inhibition of alpha(2)beta(2)-Type Aspartate Kinase from Corynebacterium glutamicum
pubmed doi rcsb
source organism Corynebacterium glutamicum
molecule tags Transferase
total genus 41
structure length 164
sequence length 164
chains with identical sequence B
ec nomenclature ec 2.7.2.4: Aspartate kinase.
pdb deposition date 2006-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01842 ACT ACT domain
A PF13840 ACT_7 ACT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2dtjA02
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2dtjA01
1PSDA 2QSWA 3DDNA 3TUIC 2QRRA 1LK7A 3NRBA 4PWUA 2KO1A 3K5PA 5FIIA 3U7JA 3UW1A 2RE1A 3TUZC 1SC6A 1U8SA 4IO1A 1O8BA 3KWMA 3ENVA 3OBIA 3DHWC 2LVWA 3HHEA 5JJBA 1XTZA 5IT0A 1UJ5A 3AAWB 2ZHOA 3IXQA 3TUJC 3S1TA 1YBAA 4LUBA 4GO5X 1UJ4A 3AB4B 3O1LA 2F1FA 3OFGA 1ZPVA 1M0SA 2P9GA 2P9CA 3W7BA 4GO7X 3MWBA 4GMKA 3N0VA 3MAHA 3ENWA 3MTJA 2DT9A 3OFHA 2NYIA 2MDAA 2J0WA 5IT4A 2I9SA 2QMXA 3L7OA 1LK5A 3OFFA 1KS2A 4NMLA 3LUYA 2H9ZA 4M8LA 3DC2A 1RWUA 3DHXA 2CDQA 2LQJA 3IBWA 2PA3A 4X84A 2QMWA 2DTJA 1YGYA 3LOUA 5T41A 2JOQA 2F8MA 3AB2B 2JHEA 1Y7PA 1UJ6A 3OFEA 2P9EA 3CEDA 2FGCA 2RQMA 2PC6A 3ENQA 2J0XA 1LKZA 3P96A 5IS2A 2RQKA
chains in the Genus database with same CATH superfamily
3Q8QB 4DUZF 2EC2A 3FRZA 1EIYB 2Q66A 2V4QA 5KFHA 3CDAA 4PG4A 1C0TB 4BHQA 1XR5A 5BYRA 1U1NA 1F2GA 3MM5A 5KG4A 1X7VA 3AH6A 4N7TA 2E5JA 4QIWD 1GMWA 1JLCB 2BKPA 3JTNA 3T5HA 4LF7J 3RB4A 2K3KA 3G6ES 3MUMP 1Q81T 4MAKA 4NZ6A 1S0VA 2KJWA 3F41A 2I0XA 3MM7B 2ZH6A 3IGNA 1UMJA 1AFJA 1WHYA 5CCMA 4DR1F 3T1HJ 5E5NA 2WK4A 3I9ZA 3BV8A 2CQPA 3F44A 3O5TB 4HHJA 4CLZA 2VHGA 3CMQA 1YSJA 1FERA 2PA3A 4USMA 3JAMU 1R8BA 3FBCA 3CCLS 3KHLA 3J81j 2W4PA 4FXDA 5E33A 5E41A 1ZZFA 2V6AA 2L3MA 3SXLA 2ZHBA 2ZKUA 4YY3J 1QSSA 2LA6A 1NXIA 2HURA 2Z0GA 3MMBA 4DZ6A 1LWCA 4XPCA 4Q43A 3OSNA 1BD6A 3C19A 1FI4A 5D0EA 4UZCA 4RW8A 5DG9A 4O44B 4MK7A 3HMJG 4KKOA 2Y1JA 1SC6A 3U1LA 2BJDA 4NYZA 2B6AA 2OLWA 5E7OB 1WG1A 2KXHA 3M8PB 3SV4A 3ETMA 1RTZA 2GQQA 2ERRA 2WCXA 5KFKA 3K5LA 4IDKA 2XHWA 3MCMA 4WFXA 5FJ4A 1HI1A 3CB4A 3BDPA 2WVEA 5KFXA 1OYDA 4WKYA 2DRBA 1TVRA 2ZH8A 4NLVA 4OHZA 1U0HB 3M30A 2LDYA 4WP8A 1ZETA 1HNVA 3R2CJ 3O2IA 3MZIA 3Q0AA 4JI6J 2PMWA 1F6TA 3RW7A 1FKPA 3GV7B 4L3NA 1NK8A 3NGSA 1X4GA 4LMZA 1HNZJ 4QR1A 1PBAA 4CO1A 3OL6A 5K14A 3ET6A 3NWGA 4B3OB 1CG2A 1JLAB 2KT3A 5L1LA 2CQCA 1NH7A 2CQ4A 3I0RB 8ATCB 3V6KA 2ZE2A 2B8PA 1I6JA 3CW2C 3NMAA 3KLVA 2HAFA 2N3LA 2VG6A 2YKOA 4K0KJ 4DQRA 3IG1A 1ZM4A 2GJIA 3DOLB 1V6HA 5DG7A 3HFKA 4FXWA 3O6QA 5B0DA 1TKTA 1HARA 2L48A 5F9LA 5KFPA 2R8IA 1N6QB 1CBKA 4ED5A 2V2KA 3OR2A 4NRUA 3EZ5A 3POTA 2OTJS 1AB8A 1G2EA 2HWTA 2OFHX 3UDCA 1G6BA 1FK9B 4RNFA 1RSCA 1M0SA 3W7BA 3G82A 3CJQA 2HFUA 4A8QA 2YWGA 1P1LA 4ZJLA 4F04B 3LTOA 3D6MB 4JI2J 2HEKA 2KXFA 3KLGA 3KK3B 2HK3A 2Q3PA 4RW6A 3J81Y 3L95X 1IKYA 3SQGA 1RTDA 2ZVSA 3U1MA 3DRRA 4WYLA 2XO7A 4ZJOA 1RWNB 1AT1B 4IR1A 2Z2YB 1JLBA 1Z2LA 1IBKF 3MD1A 3DU6A 4RJVA 1X4CA 1RXOB 4YB5A 4ILMA 1OPIA 2HMIB 4BLGA 3TJ9A 4K7QA 2FLPA 1HWJA 3EDRB 2R8GA 1RTJA 2OEKA 1FJGJ 6FD1A 3Q8RB 2LVWA 3D1QA 3DLEB 1IQTA 1HQEA 1WTFA 1WKJA 5FD1A 3KHGA 4R8UA 4RL1A 5A8KB 3G8QA 1KDNA 1WF1A 5IXUA 4DPWA 4K50A 2OGUA 1H73A 3JS9A 1B3TA 4ZVSB 3K58A 2HBRB 1U7LA 2B4PA 2BACA 1J5OB 1IWGA 1K47A 4A8OA 4TU9A 4C8YA 3CO0P 5J2MB 4ZITA 4ID5B 1LOUA 3QGHA 3MOJB 3T5JA 2O3DA 4Y6IA 1QDUB 1K0VA 4KR0B 3DM2B 2UUCJ 1RACB 4HYKA 4PR6A 1S9EA 4IOAQ 4OYIA 2ZM6J 1RT4B 1SH3A 2V50A 2EBGA 4HVZA 1B0PA 4WU3A 3A4TA 3MURP 5DDRC 1SKSA 1ZOTA 1JJ2R 4K2XA 2WRMA 4CTAB 2EKYA 1VRTA 4ZVHA 3MCSA 1T95A 4B3TF 1SV5B 1VGYA 2H51B 2RILA 2Y0BB 2R7WA 4ERDA 4U67Q 4GRSA 2Q6BA 5C2CA 2DGWA 4JI8J 2R2RA 3M9OB 1U1LA 3MR6A 5KFTA 4B3SF 2K2PA 1DTTA 3DNCA 3A1YG 4KYZA 3W64A 2CNLB 2YKNB 3RRHA 1HYSB 2FJEB 1XMQJ 4Z7CA 4M95A 2OPRB 3KHHA 3TP2A 1ACMB 4DR7J 4OHYA 1FE0A 2ASLA 4U96A 2GGPA 3J7YI 3VGTA 4U6PA 2F8EX 2JNJA 3Q83A 4BC7A 4K4XA 2GAGC 3A8IA 2HBQB 4C3LA 5MLCV 3PO5A 1M1HA 4F3QA 2AX1A 2NYHA 4FBTA 5D4PA 1R8PA 2ASDA 1LW2B 2C28A 3GILA 3CXCR 2YWFA 2J6SA 2W9BA 5A0YB 5DO2A 2JC0A 1UJ5A 3EM1A 3TANA 5KT2A 2BOAA 3LP0A 4QIEA 1ULRA 3BGLA 3H42A 3BN7A 1IBLJ 4S0MA 5F8GA 1A9NB 1Y5IB 4X4NA 1S99A 4BWJA 3M05A 3T9NA 1JLEB 2UZAA 2F1FA 1WWHA 3MHYA 1FVQA 4WPAA 2UVVA 4B3RF 4LF8J 2VFSA 5G4DA 5AXLA 1A0OB 2HLTA 1TK0A 3C16A 4QIGA 1S10A 3K17A 5BYSA 1VJQA 3MFHA 3SBMA 3AOCA 4E0DA 2K8GA 3JB9k 1YKWA 3QT5A 1P6TA 4FN5A 2HVIA 1SB6A 2GVZB 4DUZJ 1R0CB 3EE3A 1VS3A 4G65A 5D78A 4ALZA 1BY9A 4F4AA 3EGWB 3OUYB 4DSEA 3OW2R 2CJ9A 4DSJA 5C25B 5RUBA 2WSCC 3TAQA 1UPMB 4WTYA 4FS1A 3KG0A 1KVKA 4YEAA 2OMOA 1OQ3A 3H5SA 4YN3B 3SDEA 3NNHA 2Z4PA 3PIOQ 2DXFA 2OFGX 3VALA 1KNZA 2CJYB 4PKDB 2FGOA 1UFKA 4I69A 3FZBA 3MXHP 1YVFA 3HHLB 4DR1J 4G3IA 4WJBA 3FEYB 4I2PB 5GADI 1JLFA 2ACMA 3TZYA 4A8YA 4PUOB 4ZVUB 3JQKA 2UU9F 2FLNA 3V4MA 3I82A 3OFFA 1VLOA 2GMJA 4IUFA 2FJAB 1PC4A 2CNNB 5DETA 4OYPA 2ILZA 4NZ7A 4UOFA 1VRUA 1RWWB 1WKLA 3GJRB 4WU2A 1PCAA 4X4RA 2AF6A 2ADBA 3AJ1A 4QJVA 2R2UA 2RQKA 5HMZA 2AJ4A 1RP5A 1K0TA 4X62F 4KJIA 1WC1A 4PYAA 1NEEA 2D3ZA 3PYGA 3JSYA 4RNMA 2LEBA 5KT3A 4O4GB 4FS2A 1MMNA 5K8PA 3N79A 2KL8A 2AQ4A 4M5MA 5CQGA 4HH1A 1UEUA 1XMBA 4ZVOB 3SSQA 4P2MA 3M2RA 3UD3P 1NSQA 1AUSL 1LFWA 2A6MA 1W7WA 2EFNA 3M8QA 4NI2B 3PX6A 1HD1A 2CPYA 5D4OA 5IFMA 1L5UA 4RUBA 5CYQB 3KLHB 4WXOA 5EX0A 4LF4F 3KOAA 2HFZA 2DXDA 2XZTB 3NP5A 2C42A 5CAAA 1E6VB 1U6ZA 4OJHA 2PC6A 2XI3A 3OR1A 4HHUA 1UVKA 4QW8A 5KTQA 1OWXA 2EXUA 4JP8A 2KO1A 4DV2F 4YR2A 2MLYA 2U2FA 3DLKB 4WFAQ 3RR7A 2CPFA 2FIUA 2XZDB 2MKJA 3BR8A 2IDLA 2YX7A 1D1UA 4YB1P 1RYSA 5CD4A 3ITHB 3TVYA 3A3NB 2MQNA 3V4IB 3CF5Q 2CJAA 4IFVA 4EK2A 1XK8A 1HBOB 5CD4H 5J2PB 4LFCF 3RUBL 3QRRA 2DIUA 4QWEA 4CLPA 4HHHA 5IT9U 3D4JA 3NAIA 4B02A 2MY7A 4DR4J 2ZUAA 2AD9A 4A8KA 3MEDB 1FX4A 2W24A 5AXKA 3IN5A 2VIHA 2X51A 4F2RA 4XPEA 2O5DA 1IBKJ 3CUNA 3MGJA 2DHAA 4ILRA 1B4SA 2E1MC 3OXFA 5B0BA 2EFOA 1Y00A 2KDOA 2VFTA 1GXUA 2DH8A 2D3OR 4NCGB 5AXMA 2OPQA 4B9MA 3W66A 4DUTA 1KHWA 5L46A 3BYPA 1XNRJ 2P6TA 4WF9Q 4DS4A 1FNMA 3FMWA 2RMLA 2DHXA 3JQMA 3G87A 4GKJF 2IAJA 2QX0A 2DO0A 3D9BA 5BYQA 1URNA 1VK3A 6AT1B 4LIRA 5K8NA 1IN0A 1HI8A 2NUUG 2VU5A 2B3TB 1U45A 5IQQA 3GIIA 2LQJA 1MROB 5D4NA 1NM2A 3QSIA 2M52A 1TL3B 5DDOC 1Q78A 3VQTA 2PI4A 2IJFA 1FRJA 2FVRA 3LPEA 4QWBA 2DGTA 3ULHA 3O3LA 1KQFB 3EMTA 1GTEA 2JVRA 4DFJA 3HHKA 3UCZP 3CNQP 1U6BA 3HULA 3UNYA 4CO0A 5EHHA 3D6FB 1N5QA 3FQKA 1N56A 1RAGB 1KTVA 1V5VA 3D7SB 2M0GB 3CJ2A 3UDVA 2AEJA 3DOMA 2HVZA 3UVJB 4G1QB 1R43A 3T6JA 2B8QA 5L38A 2ZH3A 1SPBP 2M5YA 1MLAA 4OZ5A 4TYAA 4DQIA 3UDLA 5D0GA 3WBZA 5KFVA 4B3SJ 3G71S 3CCUS 3HFVA 3RU0A 3RW6A 1VQNS 2RQ4A 1IJEB 1R6VA 4JV2A 1WSVA 3FQLA 2NZCA 3CDBA 2GHVC 4CQ1A 2IYGA 1R0AA 4KY3A 3NKYA 3GJSB 2AEMA 7FD1A 5HQLA 4XIUA 1X8DA 2HHXA 2VDHA 4I7FB 3VF0B 1G7CB 3RYLA 2QG9B 3I87A 2P8IA 2D41A 1TUWA 4B9NA 4NLRA 4C8KA 2LMIA 1PSDA 2CJKA 1WC6A 4UUWA 3K5MA 2A2DA 3ZZRA 3HZGA 3R7NB 2ZITA 2J0QD 1N52B 3G96A 1RK8A 1TZ0A 5L9XA 4KV8B 3L7UA 1X9MA 1QE1A 2VDIA 3MMBB 2OPSB 1BQXA 3DRSB 1Y10A 2MZJA 2ZBCA 4F0KA 2DGXA 4OJ1A 2MLXA 2BXJA 2CZ9A 4LRAA 4RUCA 1C2PA 2RS8A 4U7UK 2LQ9A 2DGQA 4B3RJ 3M1VA 3NBPA 1HLWA 2LXIA 4HDGA 3TZZA 3R8YA 2BANA 4OYWA 5B0AA 2JRSA 2QIFA 4TQRA 3KUHA 4U8VA 4LSLB 4OI2A 2LFVA 2GVDB 3FNNA 2QT7A 4P7TA 4PWDB 3I5BA 2HIYA 3W9JA 1K1QA 3MF5A 2MQMA 5C2GA 1HNVB 3PHEA 4IFYB 4IQXA 2B4UA 1FKPB 1S79A 2OD4A 1EQ0A 3GV5B 2CQ1A 5K14B 4DPYA 2QGFB 3ET6B 1URRA 5J1PA 2DNGA 2OELA 3R3TA 4CT8A 2VC1A 5ETRA 2DY9A 3BKTA 4P74A 5IV3A 3ZC4A 3D3BJ 3MCOA 1RYRA 2MSSA 2ZE2B 2KI2A 1M5VC 2VD3A 1XBWA 4QIVA 2J76E 4NLPA 2HS0A 3DLLQ 4OI0A 3VAFA 1XERA 4TU7A 1FTRA 5LL6d 1IKWB 2GW8A 3PNIA 2YWKA 3OR2B 2HHTA 4DLEA 1XIQA 1XR7A 3SZ2A 2FJDB 3BBCA 4CH1A 3F0NA 1N5VA 1RWVB 1VC6A 1S49A 1V3RA 1TV6A 2I1RA 1BE4A 2HNDA 2W7AA 1FKOB 1GFWB 2VBYA 1RT1B 4M5JA 4W4MA 1RTDB 3LP2A 2W9CB 2HPUA 1WG5A 2BKNA 4X62J 3PFEA 2GQCA 1BXNA 1LXJA 2W2OP 1H2TZ 3OHBA 1JLBB 2Z57B 4KBIA 4F4YA 4HDHA 3R1LA 1N5YB 1TKXB 3BO2A 1FD8A 1S6PA 3QPIA 1S1WA 1W26A 1EKSA 4NASA 3O1LA 4ED0A 5LM7E 4YQWA 3MEGA 1WOOA 2H4YB 1QJHA 1RTHA 3M2VA 3RBXA 2B0GA 4DN9A 1HA1A 2BVZA 4OIXA 2IM3A 3OVAA 2LA4A 1HMVA 4DQPA 4LF4J 3MMJA 3P4UB 3DGVA 3L3CA 2DGOA 2P9EA 3DLGA 2YKMA 3ENQA 5AE2A 2WBRA 3JSMB 4DV2J 2RD5C 4OYXA 1TTHB 4ZVQB 4ECTA 1ZH5A 1R3NA 2D7SA 4RNNA 2EVZA 1VYAA 2ROGA 3ENVA 3J7Z5 2QYCA 1S9EB 2KG0A 1T05B 2JJ4D 2PO4A 3IXQA 3RZAA 3UDEA 1Q5YA 5LMNF 4LFCJ 1JKHA 4CYUA 1EETA 4OZJA 4I6AA 3GYNA 1VRTB 1T9UA 5F8NA 3DRPB 2HIQA 4QU7A 2HZAA 2NXEA 4N8OA 2GMHA 1BQNB 3MEKA 2D3O1 5HQMA 4I68A 3M8RA 4I2QB 3W65A 3SEOA 5E3QA 2MDAA 5CCLA 3CCZA 5J2QA 1YBTA 3DHXA 4QPXA 2HNZA 1N32F 1HHQA 3D1HA 1OQ6A 1DTTB 1N34J 4FYYB 2BX6A 2BDPA 3QGGA 2C3UA 3Q8YA 2FPHX 4X4VA 1NK4A 3N4WA 3KK1B 3I5AA 1RT6B 1EHWA 2LXUA 4OL8A 2GGPB 2VBZA 2BM1A 4MK9A 3KDOA 3NMRA 4J91A 3UN3A 4CLUA 2MKIA 2W2NP 5IT0A 1TKDA 4WFYA 2ZHOA 4J37A 3TUJC 3R7BB 1HHSA 3TQEA 5FLXU 1IUJA 3CCJS 2WBMA 3OVSA 4U9RA 3CJ0A 1TL1B 1GQEA 4RWWA 2F4FA 2E7WA 3BR9A 3MDFA 2RB7A 2JLGA 2YNFB 3EJMA 2M7SA 2K1RB 4K4VA 1M5OC 5AXNA 3DGPB 2QYGA 1ZAXA 3EGVA 2IVYA 3HP6A 2HW3A 2VPYB 1S0MA 4RNOA 5DDPC 4KAIA 2XMUA 5HI7A 3QT6A 2QFIA 4X4TA 2O66A 4CT9A 3BREA 4M94A 1GH8A 2PD1A 2BYCA 3OTDA 2OO4A 2AZ3A 2KT5A 2XB2D 1Z1ZA 1YRUA 2JVOA 3L7PA 4FYVB 3VAMA 3OV7A 4CRJA 2V2VA 2WONA 1DARA 3A8JA 2V94A 1H38A 1MU2B 2R4FA 3C15A 1QAIA 4IRKA 1TL7B 4GO5X 1R8HA 3T9ZA 4QYZJ 1QVGR 1FDDA 4C4WA 3GE9A 4Y65A 1C0TA 2P9GA 3NCPA 4OLOA 4C0HA 4UOCA 1QM9A 4MIBA 5IWAF 5E3PA 1Q7YT 1R27B 4MKVA 5CYJA 2BZ2A 1KRPA 1SC4B 4C97A 1S0OA 1JLCA 4P52A 1RT7A 2DGUA 1TELA 2QV6A 4XTTA 3MM7A 3VVTA 5DS7A 3IR6B 4ER8A 1JLFB 3K2YA 5HMWA 4H4MB 3AODA 1PG5B 1Z2ZA 3DDNA 2VKZG 4ZPVR 2VA3A 3UWTA 2IC3B 5L1IA 1DRZA 2DJWA 1S12A 4FF2A 4USTA 3KJFB 2GCFA 3SI8A 2KN4A 4I6YA 1VBYA 5DM7Q 1HI0P 1N8RT 3E01B 3M9NB 2YNHB 2E5LF 4GVLA 3RG6A 2CAJA 1AZSB 4O44A 3N9UC 3JTOA 2VF3A 2DT9A 1YJWS 2O67A 3M8PA 4C0OC 3VGSA 4URSA 2DK2A 2NPFA 3TWZA 2YY3A 5AT1B 2FLOA 5GADU 2BJ8A 4AD6A 4RZRA 3DDIA 3OFEA 2APOA 3ZZYA 4ES2A 2FGCA 4ZVRB 1G3OA 1RAOA 3M8QB 4ZVFA 3H25A 4O0NA 1VQPS 1KVIA 3HHDA 2EFGA 3K5PA 3R5CA 1UPPA 1EJ7L 2BJ7A 4QWDA 1UCNA 4M5IA 2XBPA 4K4ZA 4R25A 3NWRA 1F3FA 4B3OA 2IYIA 4KB7A 3GMGA 3PZPA 4P2XA 2ZZMA 3GSIA 2DNNA 3ICLA 1JXVA 3I0RA 2I5JB 1XEZA 3FGVA 3ZTPA 4DLGA 2ATCB 3DI6B 4M5NA 5BJRA 1PJ5A 4GMKA 1KWMA 1VDHA 3DOLA 3VZIA 3V5RA 1U02A 1N6QA 2AYGA 2XC9A 2XSJB 3KK2A 1V5IB 5JUMA 3CCES 4TLRA 5HN0A 2OPPA 1FK9A 2V8PA 1DURA 2QSFA 3D28A 3RTVA 1LW0B 4B17A 3NLCA 3R7SB 2N4DA 1S72S 3CE8A 5F8IA 5JMNA 3ENAA 3LAMA 3KK3A 1H72C 3HJVA 3GJQB 1GK8A 2KJVA 1YJTA 3H90A 1UA0A 5L39A 3FUYA 5HLFB 1FRIA 4O3RA 2BV3A 1RWPB 2HSEB 2DCLA 1KHVA 4TLQA 1CSJA 4D3GA 1APSA 4NYPA 5KFGA 2QEXS 3AXMA 2CQ0A 4RBTA 2YKPA 4A46A 3R6LB 2XM3A 5KAKA 4HT5A 4ECUA 1S1UB 2DNYA 1VQ6S 3AJDA 4IKAA 2VBXA 4NYOA 2OPQB 5KFJA 4KHPF 4W98A 5HATA 2HWHA 1WI8A 4N76A 2L9NA 2CVIA 1RT3B 2FJWA 2DO4A 1YX2A 4JV1A 3QT7A 2PIIA 2IVFB 3DLEA 4OLPA 5A8KA 4ZLLA 4LF5F 4EMDA 1AYEA 3GG0A 4PQUA 1EARA 1M5HA 4Y3CA 2RUGA 4IH7A 1JNZB 1S57A 1RLCL 3EPGA 4U95A 4JV5F 4QBUA 1J5OA 3I96A 1EZZB 3SV3A 4KRWA 3PRDA 1W2BR 1KFSA 5J2MA 3UO0A 3I4HX 4ID5A 3PYEA 4DI6A 4ZN1A 2DNRA 1WDTA 3TZXA 3NNAA 2OKQA 2FHMA 3GG1A 3DM2A 3T1AA 1TFYA 2GA7A 5KFFA 4P73A 5LMNJ 2BR0A 2BOPA 1VIXA 4DCOB 1NH8A 2CQHA 5EN1A 3A8EA 1RT4A 2VOPA 3D5MA 4ZN3A 3PIPQ 3RB6A 4URGA 3FBEA 4C6AA 4CTAA 2J6TA 1DFDA 2Y1IA 2PA8D 1WC3A 4QIFA 3D6TB 5KFSA 3G6VA 3F73A 5IT4A 1OY8A 2AX0A 3L7OA 2X1GA 4OYMA 3LUYA 4JOUA 3AQPA 1T02A 1JLGB 4IQMA 2UVWA 3HVTB 1N32J 4Q45A 2E1RA 3IR5B 3MPDA 1CQNA 2YPYA 5IM0B 2I2YA 2CG4A 2YKNA 3E8OA 5IOLA 4GC7A 1HYSA 4M5LA 1T9YA 3M6XA 3G4SS 3OT9A 4O0IA 1U48A 2OEJA 2OPRA 3KLIB 2DH7A 3BQ0A 3J80Y 5ITHA 2XTJP 3IWLA 3S6EA 2DR5A 3HJFA 1HWKA 2XG8A 5A2QU 5ETKA 1L3UA 2XMAA 3T5KA 2ZOFA 4OI3A 1OIAA 2P6SA 3LGMA 4ETXA 3QIDA 1I51B 5C24B 5KFDA 4C3KA 1SL2A 1X0PA 2LLZA 1LW2A 3CJRA 3PV8A 1GNKA 3HXMA 2QA1A 5KFRA 4ILLA 1QE1B 5KT7A 1SKWA 3DC2A 4YUDA 4WE1B 5ETOA 1MN7A 4DCPB 2YH1A 5I3UB 5CYMB 2RUSA 1HNWF 1GX6A 3M6UA 4HACA 2BE2B 5HP1B 1SL0A 1JLEA 4Q0BA 2RHSB 1L3KA 1AXQA 2ABYA 4BDPA 2BANB 1FRLA 2G1HA 4F36A 2JEJA 3AOAA 1T11A 1QTNB 2KT2A 4BC9A 2R7UA 2F9JA 2OTLS 4DV4F 1VK8A 1YRTA 3CCRS 2GHWA 4D3HA 1Q53A 8AT1B 1RAAB 4LSNB 3UPFA 2VFVA 2DCUB 4Z37A 3TA0A 4PXDA 3ONQA 2V9WA 3RBDA 4PAAA 3WHIA 4JI6F 2V34A 2HQ3A 3OUYA 2AGPA 5C25A 4KTQA 5IWAJ 9RUBA 2WW8A 4XDCA 4DF4A 1K1SA 3CMAS 3D54A 2B9EA 1SQEA 2XNRA 1WHVA 1FF2A 2ZDPA 1S76D 3HHLA 1KSPA 4ZKAA 4I2PA 2W4DA 4MKAA 2B7BB 3H7HB 2CWXA 4UF4A 1ICEB 3KTQA 4KT0C 3DLHA 3RGIA 4PUOA 1U26A 1SVDA 3BGRB 1CLFA 2NSBA 2R8KA 2KH9A 4YDXA 3UR0A 2JL9A 4NOHA 3K5NA 2G2YA 1IKVB 4KH0B 4NL5A 3EGZA 3VAHA 1CJKA 3AJ2A 4F67A 4ANDA 1FNXH 4L6V3 1NSAA 1MSWD 1FCAA 2DRAA 2AJ0A 3TEGA 3RBZA 2WSEC 3MM6B 3M6VA 5KFIA 3QRQA 2BA9A 2E5LJ 2J9DE 2FHJA 4DPXA 3E51A 1WEZA 4OI1A 2EWHA 3MM9B 4V1Ak 3UN5A 2XQCA 3OTCA 1CJTB 5HVHA 3AQOA 4KHRA 1YZ7A 4O4GA 1S1WB 1NPPA 3GONA 1FA0A 4WWSA 2RDIA 2HHQA 3C8YA 1HHTP 4B9VA 1TAQA 2ZJRQ 2HS3A 1YJ9S 1MWZA 1CJUB 2OSQA 2CZVC 2EW9A 2N82B 2Z30B 1Q82T 4P9SA 4ZCLA 4ETZA 1N4LA 4LR8A 2ZBRA 3W61A 3G8TA 2C2MB 5FIIA 3FDSA 3OSPA 2E7XA 5CYQA 3KLHA 3GIJA 2FVQA 1Q8IA 2EBEA 4LBIA 3P3DA 2V8GA 3GWCA 2MQOA 3TJAA 4NX9A 3QJLA 1TKZB 2XY6A 2YKMB 2WVDA 4WFBQ 2CPHA 1NK6A 1UVLA 4TVAB 4FVCA 5GAGI 4DV3J 3S8SA 4J9RA 5B0GA 2B4OA 1RBLA 5HJXA 2PGCA 1RTIB 1NSPA 2XLJA 1X5PA 5E3CA 3ILJA 2NYIA 1RT2B 4KHMA 3IGVA 2FJVA 2G0IA 4ZP9A 1JKHB 1HWIA 1VR6A 4QOTA 4MYUA 3ITHA 2CQ2A 3LANA 3V4IA 3B78A 4NWBA 1HBOA 5J2PA 3UD5A 4Q5VA 2G0CA 2JC1A 4ZK7M 2UVUA 1QTMA 2V68A 3EXYA 5J2QB 3TAPA 3W63A 2W2MP 4X4PA 2RRAA 2GNKA 4ECZA 3MEDA 2NXCA 5CXTA 1WELA 5AE1A 3T19A 4CLWA 5KFEA 1OSDA 1VFJA 5B0CA 1Q95G 1OY9A 3FSYA 2HAIA 1KFDA 3LWLA 4GC6A 3KMQA 3VHQA 3SCIE 3K8WA 4KHPJ 2XMWA 3BPSP 4ZCMA 4CO3A 2A3JA 3JSBA 4DV5F 1RABB 4NCGA 3W1YC 2YKAA 3NL0A 1KS2A 2B43A 4LF5J 1KVJA 3LPYA 2N3OA 1BQMA 3BH6B 1FEEA 1V3SA 3OL7A 2I38A 3EICA 2AWZA 4KGKA 2ZBPA 3O44A 4Q8FA 4L75A 3D6HB 4USVA 4JI7F 2PEBA 2E5GA 2WOMB 1U4BA 1T9TA 2XCAA 4UY8T 3CJ3A 3CJKB 3UE2A 3M6WA 1RWMB 4R0EA 1TMJA 2H48B 1MROA 1RA7A 1IVZA 4DN0A 4A8FA 1TL3A 2ZBQA 4P2FA 2MKKA 1EQMA 2IMWP 4OHVA 4LQ3A 2AYEA 1KQGB 1TAUA 1ZPVA 4YOEA 1JJCB 5F8MA 1LV5A 2B51A 4USUA 3C15B 2QFJA 1FJEB 4KO0A 2QL7B 3UVJA 4G1QA 4C8NA 3QJPA 3ZTSA 2L41A 2GS8A 2PFFB 4NCBA 2GC8A 1T9XA 1HNXF 2NSCA 1UVNA 3KLFA 4RBUA 3P49B 2H1YA 3V81B 3PDNA 5H9EK 2IRUA 4CLLA 4NLOA 1B0VA 5JVGQ 5T14A 2YTCA 4F26A 3RRGA 2EI5A 2OI2A 4F2SA 1RT7B 3H4DA 2GQ2A 1SIZA 4KSEB 1WD6A 4I7FA 2R2SA 2XMJA 1Y9OA 3MM8A 1WF2A 1NKEA 1ZTWA 3HKWA 3FSXA 1FO1A 3AT1B 4DR2F 4DR5F 1CVJA 1YJVA 4WBFA 3ISND 2FVSA 1A6LA 4UT4A 2JSXA 3I0SB 2JFDA 1PYOB 5IC6B 5A76A 3NS7B 3W9IA 1B7FA 1DTQB 1WF0A 4PG7A 4C8ZA 3CC4S 5GMKa 2DHSA 3GFHA 1DLOB 4KV8A 1GAOA 1FJCA 2MQ8A 2ZHAA 2JLFA 4DL7A 1Q79A 4B9UA 2OPSA 4ANCA 1HNWJ 2CUYA 3DRSA 3M8ZA 4Y28C 4RW7B 3KG1A 4NLSA 1N48A 1RHUB 3X3UA 1AUDA 4WYWA 1HPZB 4ZVTB 2Z56B 2C2EA 2JZ5A 3W2VB 3UFCX 1NO8A 2RS2A 3QT8A 3ZNJ1 2DRDA 1PJ7A 3AFGA 4AL7A 5J1EB 4DV4J 3E3XA 4NLYA 3KJVB 1ZS6A 4LSLA 3CJ5A 2HQCA 2KYXA 2GVDA 3QWUA 3LH2S 4V19X 4ECRA 4PWDA 2DEIA 4Y2CA 4JB8B 3PJXA 5THWA 4EZ6A 1SKUB 4IFYA 2HFOA 3QLHB 4WFNQ 3VV2B 3HHLC 4AXJA 1IQZA 2VV5A 1FTCA 4X4QA 3OFGA 3P5BP 1NSKL 2GO8A 2XLKA 1DZ5A 4IYQA 1F2HA 3QAUA 3ZZZA 3PXGa 3I9V9 1FRMA 4Q2MA 4LF2A 2DD8S 2Z2ZA 1VQ8S 4IG0B 4ZCKA 3HSJA 4LVNP 2QN6B 4TXSA 4DX7A 5KFYA 2X3GA 1HBNB 3V6HA 3HZEA 2JHEA 2NPIA 1Q8BA 3JXOA 4RUHA 4RLEA 4O3PA 3PYFA 3LWMA 3NOCA 4AYBD 2XMTA 1NK9A 1RE1B 4ED1A 5T7LA 4J9PA 1FEHA 3MECB 5EWEA 1IKWA 1C0UB 1WC4A 2BW2A 1JXEA 3NCRA 3KK2B 4NLGA 1SJQA 3C66A 2OPPB 1V3ZA 3HX9A 3HO1A 1SQGA 2H65B 2OHDA 1J2VA 2BEFA 2Y8WA 3AAWB 5EDWA 3M8WA 3A3PB 1X31C 3CC7S 3B4DA 2AT1B 3WZ0A 4DR4F 2W25A 1FKOA 4OZ3A 4I6WA 1RT1A 1NPRA 1NUEA 1TU0B 4QWAA 2W9CA 2W8LA 3NCQA 2YX4A 1QAYA 4X64F 3RB3A 5C42B 3QBCA 2RAQA 3W8PA 3RR8A 3MPYA 3KMSA 1Y3KA 3SQOP 1N5YA 2FVPA 3H5UA 4W90B 1TKXA 1Q7LB 1VLYA 1VQSA 2MZSA 4DSIA 4PXEA 5E2QA 4LF9F 4EEYA 3HCXA 2LU2A 4TQSA 4UOGA 2Z58B 3M9MB 1NZAA 3AY0A 3DXSX 5A6PA 2X1BA 3TUIC 4F0MA 1KQKA 3QFHA 3UN2A 2V0NA 5DZ7A 1XNRF 4PQUB 4CM0A 1CC8A 2OMLA 3K59A 3GIKA 2CQ3A 1VQ9S 1C4CA 2DNZA 1EP4B 1OMSA 3RBEA 1HIYA 3ELHA 5DLFA 2D74B 2EFPA 4NLTA 1SL1A 4IR9A 5A8RA 3JSMA 3MMCA 3K0JA 2R2TA 4LFAJ 2F9DA 4MIAA 2W2PP 3N0VA 4FF3A 2POKA 3BKFA 1U6FA 2VG7A 2RIJA 2I9SA 1WI6A 2CADA 2YPZA 1VQ7S 1T05A 1BMQB 1ZAVA 3PEHA 3GQCA 5HROB 4DQSA 1C1CB 1T0TV 5LSRA 1F9FA 3RB0A 4QWCA 2C2NA 2HLUA 1NJWA 1AA1B 1F60B 3H2VE 3TR5A 3LW5C 3H0PA 3R5GA 2J0SD 4ZMMA 4DFPA 3DRPA 2K7JA 1GXLA 4QW9A 1BQNA 3Q8PB 2DITA 4B9SA 4I2QA 2MHNA 4DL4A 4ED3A 1S7IA 2UV8A 4XO0A 2WAQD 1LWEA 5HJYA 1SXLA 3IS9A 3HK2A 1T8EA 1IWAA 2MYFA 2E29A 4WCEQ 1YDLA 5LMUJ 2V63A 2HYIB 2QLWA 4UQTA 4TNOA 3QSYB 2LCWA 5J1NA 2M2BA 2L08A 3KK1A 3TAMB 1NKBA 1RT6A 2FUG9 5F41A 1LWXA 2G4BA 3GYXB 4DV5J 2ADCA 4ZS6A 5H9FK 3PW0A 3BSAA 4ELUA 4DF8A 3QQCD 1S1TB 1YHQS 1XQIA 3OD2A 4NLXA 1GT8A 2D3UA 2GV1A 5CZXA 3WIUA 1MMLA 4W92B 3D67A 4J90A 1XR6A 2QMWA 2ROEA 4WIIA 4J9KA 3WX8A 3BEGB 2GIQA 4L3KA 4O3SA 4JI7J 1PYSB 1TL1A 4CNYA 4USIA 5A6WA 1TMMA 2B5JB 1QD1A 3FFIA 1CULA 2YNFA 3RAQA 5KG2A 3DMJB 4NEZA 2K1RA 4HACB 3DYAB 3BO4A 3DGPA 3OVBA 4J9NA 4Q0BB 4K4YA 1UWAA 1S97A 3FK4A 4ZPCA 4UUXA 5I42B 3ISNC 4OV6A 4FP9A 2R42A 1G1XA 2B9XA 1F0XA 4K8RA 2BUNA 3QMQA 4OX6A 1MU2A 2BJ1A 2E9TA 5M2RA 4ZIWA 2MQLA 1TL7A 2HVEA 2DXEA 1U47A 1UP1A 3CD5A 4A8SA 1HNXJ 2MGZA 3PRBA 4FKYA 2DB1A 4DV6F 3CJ8A 2BW7A 1OJ4A 3IBCB 1LNQA 3EXCX 1FRKA 4DV0J 5KFCA 5DG8A 4CI0B 3HI9A 4J9VA 1B70B 1S48A 1F9HA 1P9YA 1DAXA 4WTOB 1S9GB 4Z2XA 3HM9A 3DDKA 2NUHA 2HFVA 3UQSA 3A13A 3LA0A 5KFUA 3TRGA 1MWYA 4DR2J 4DR5J 1FESA 3G9CA 3CCQS 4A4JA 1RU2A 4H4MA 4B3MF 5KT4A 2MJUA 4TYBA 1CJKB 3NNCA 2IC3A 1KOHA 2VQEF 1S9FA 3TOQA 2HS4A 3KLEA 2Y9HA 4OYZA 1WORA 3PW7A 1T3NA 2NR0A 4EBCA 5B0EA 4BBYA 3GTYX 2QJ3A 4RW4A 4F3MA 1VQYA 3TUPA 3E01A 1P9QC 2YNHA 3K57A 2C2KB 2L9DA 2R7RA 1AZSA 4RR5A 2DHGA 4OJ3A 3EZUA 2VPXB 1UTAA 4K2JA 2PEHA 3BGUA 3H4BA 5F8LA 4OJGA 4EFAC 3IAM9 2XULA 4M63A 1X9WA 2J6UA 1YK9A 3IRWP 3S01A 2MZQA 4OZ0A 1IR1A 2XCPA 4ZPWR 1PJ6A 2XNQA 4U7UD 4K5SA 4X4SA 1TK5A 4KH1B 3HF5A 1U8WA 4MMOA 1FX2A 2Y1LB 3C6UB 3MMAB 4QYRA 2EPIA 3M7VA 3B54A 1VBZA 3S7RA 2Z2MA 1D0EA 1Y3JA 4R5PB 5A8WA 1WOPA 4QR2A 2KU7A 4CO4A 4AQYF 3WX4A 3T6BA 1F5AA 3QIPB 3QO9B 3U02A 2CDQA 1NJZA 3T5LA 4QPTA 1YJUA 1UW9A 3QATA 1JK9B 4TY9A 4J5OA 4F4KA 1O5JA 2I5JA 3SSRA 2BRKA 5HK4A 1X4BA 4HL9A 4BWMA 5KFBA 2CNOB 3MUTP 3DI6A 1O51A 3FMBA 2ZFHA 4NXMF 1FDBA 4C11B 2WB1D 1R8AA 2J9CA 3WDOA 3T1YJ 1VBKA 1S1XA 1REGX 2GIRA 2XSJA 2ZJPQ 2Y1RI 5HO4A 1K73T 4NLQA 2DNKA 5KG3A 2QE5A 1LW0A 4Q8EA 5DJBA 2GX8A 2JH3A 5LXRA 3OL8A 4DJBA 3R9LA 1UEVA 4ANEA 1U1MA 3LF0A 1RKJA 4AFFA 2IBOA 4X64J 4ZP7A 2V67A 4TY8A 4P72A 1RT5B 5HLFA 1N34F 1WEYA 5CABA 3H20A 5GAGU 2H9ZA 1JB0C 1RGVA 3KKFA 1HW8A 3SCLE 2FZGB 4LF9J 5C5JA 1RBAA 3CJTA 2EFVA 3LGHA 3EUNA 2K06A 3AB2B 5B7WA 3HPOA 1SH0A 5LT5A 2XO6A 2R9LA 4KGZB 1U24A 1S1UA 4V19J 1NDPA 4DQQA 1NDKA 5D77A 4NA3A 1NBEB 1RT3A 1ZAWA 1U2CA 1N33F 3OQ2A 1JJ4A 4ZVPB 4LBPA 1C1BA 1BQMB 2P2CB 2AJFE 2UV8G 1EKRA 3U7JA 2ZBIA 3QGIA 1U8SA 2Q1LA 5IQ6A 2OEMA 5KG7A 2J8AA 1NK7A 2FLLA 1QLNA 1XJWB 1VRQC 1TFWA 2YNIA 2QLJB 4K4TA 3ZO7A 4N47A 3BBFA 2IA6A 1NJXA 2ZUGA 2KVQE 4CLSA 2EFQA 3K7RA 5F3ZA 1M5KC 1Y5LB 4KFBA 2WHOA 2RRNA 4PEOA 2ASYA 5LJ5Y 3W5ZA 1IJFB 4GKKF 2MJNA 1VQKS 3SCJE 2WB4A 4WZQA 1ZZNA 1U1QA 2LQ5A 5HMYA 5KG6A 2CIMA 3PKYA 3IM9A 5F8JA 2C3MA 4KC5A 4M5HA 2YWWA 5CH7B 1NKCA 4KO0B 2PMZD 1KKHA 2NS1B 1T9WA 5D3GA 2V8DA 4MIWA 3PJ9A 3W2WB 4YP3A 3FZ2A 2C1EB 2HZCA 1RWXB 3NS5A 1GX5A 4I56A 1JLGA 3BGFA 3HVTA 4IO1A 3U27A 1O8BA 3KWMA 3HT3A 3KLFB 4M5DB 4NMXA 1S0NA 1TUGB 2YQ3A 5JJBA 5IM0A 4C48A 3H2UB 2R7SA 4IRDA 2LEPA 5IC4B 2ZKTA 4ITSA 3PW2A 3VCDA 3H5XA 4MKYA 3KLIA 4USHA 4PCQA 3FEXB 2P9CA 3MM8B 1O6XA 2V2QA 2DIVA 5I3QA 1RHMB 2Y3YA 2HWIA 5L1KA 3QWPA 1TQLA 4F8RA 1REVB 1QUVA 1UZHA 3P45B 5C24A 1YRXA 3RAMA 2ZNYA 4OYOA 5FLXY 4ZCIA 3HVAA 1J5EJ 3BM7A 1LKZA 1RAHB 1NJIT 1YWXA 2G1DA 4DR3F 4J9UE 4DL0C 2PE8A 2LKZA 2ZH5A 4RU2A 2E7VA 2VFUA 4F0HA 4WE1A 1GMWD 3N5BA 2MY8A 5I3UA 5CYMA 3G6XA 5DDQC 2KYZA 5EGYA 2BE2A 5HP1A 4ATNA 1L3VA 1SJRA 1NB2A 2KHCA 1PKUA 3KNGA 5HBMB 2VOOA 2FQQB 3CO9A 2VUGA 3H2LA 2Y8YA 2M4MA 2DNMA 1ITPA 4F3OA 2XHCA 2X1FA 3OLBA 4LSNA 3MTJA 1Y4ZB 1X9SA 4R0JA 2BJEA 4YHHF 4M8LA 2H4WB 3D3CJ 2DTJA 4LFBF 3LOUA 4DV6J 4MKBA 1UL3A 1FJ7A 1WEXA 1S4FA 3OXLA 4N8NA 2KB2A 2BE7D 1U1OA 4EI2A 2OAUA 2AYMA 3HD1A 3NY0A 1Q5VA 3DKDA 1F5BA 4KGVB 1UWBB 1Y0HA 4WZMA 2DPIA 4FNHA 1VCTA 3IMQJ 2HVDA 2DBBA 5HAOA 4B3MJ 2CPJA 2HHSA 5T7LB 1D8ZA 3BGRA 4CP5A 2DNLA 2QLXA 2WW4A 4OZ2A 2G0JA 5KG1A 3MPVA 4L76A 2VQEJ 5KFZA 1IKVA 2AGQA 2MZTA 1IR0A 5SZTA 3PKMA 3Q24A 4F4ZA 4I0WA 5LSLA 5T41A 5EUHA 3MM6A 4OZNA 2ZC3A 1NAQA 4RO0A 1SC1B 2F40A 2BQUA 4YS2A 3EVMA 2ZNZA 2OJ3A 1SJ1A 4RPFA 4JV0A 3W62A 1H2VZ 3HHNB 3MM9A 4USJC 2DPJA 1NZ8A 4FYDA 2C3OA 3IRXA 5L8RC 1CJTA 4ECQA 4FKXA 2HRYA 3UI3A 3CULA 3RRKA 1VHIA 3CC2S 4J9QA 2V8HA 2FJXA 1XC9A 4LR9A 4PXBA 4ED7A 1DHMA 3MEEB 1NDCA 3R5DA 4K59A 3BKUA 5LOQA 5HVFA 2A2CA 1CJUA 2M8DB 2ACYA 2RH3A 1JNRB 1UJ4A 4NLWA 1EB0A 5DQHA 4ZP8A 2KRRA 3I55S 1U1KA 1TUVA 3QZ7A 4JI3F 4RW9B 2HZVA 3MAHA 1SIWB 2MLZA 3BJYA 3HDSA 1RA6A 4AQYJ 2J0WA 2PDAA 1TKZA 5F8HA 4RNHA 4CZCA 4YDDB 2RDDA 3EVOA 5A8RB 3IWXA 1UZDA 1A7GE 3MMCB 4PG8A 1V9OA 1ZM2A 2IBKA 2FC9A 3NOGA 4NXMJ 1RTIA 4DPUA 2VG7B 4ZPAA 4XAKA 1F9EB 4OX7A 3CT9A 2DR7A 2KZZA 1H3DA 9ATCB 4AT1B 5HQ8A 2LECA 1RT2A 1LK7A 4Y2AA 2MZ1A 2V5HG 2YWHA 1DY3A 4ELTA 2DVIA 3NGUA 4DV1F 2KHDA 3JTPA 2XI2A 3PJWA 1QY7A 4AL5A 2F4VF 1RKIA 1E6YA 5DGBA 3H8YA 1X5OA 2HKEA 5EWGA 1LWEB 2MTLA 4DSKA 3IS9B 5B09A 1UVMA 3PM9A 2KZMA 2FC8A 2CRLA 3M8YA 4X66F 3G86A 4LF1A 4P71A 1UVJA 2VB6A 4C7QA 4DR6F 2XYPB 1NHUA 3BSCA 3FRYA 2UVRA 2E1AA 2AGOA 5KT6A 3MOZA 1VHFA 3JYTB 1ZM3A 2B9YA 4I4BA 2DGSA 1UETA 1PAUB 3J7AN 1X4FA 3I5CA 1N33J 4DL6A 1IM6A 4LJMA 1SUQB 2ALZA 3ZZ0A 1S6QB 4QZVB 1CS4B 1SCJB 5JXSA 3CD7A 1YITS 1U25A 2MPUA 2J7UA 2IA0A 5CZVA 1RHRB 1PILA 1Y11A 3PVXA 3LP1B 3V2UC 2MQQA 4DEZA 3FFIB 3NAHA 1CULB 2WOMA 2O1PA 1TL4A 2LU1A 3CJKA 4C8OA 1FHTA 1FE4A 1RHKB 1MN9A 2KXNB 4DPTA 1T03B 4TKTA 1XMOF 2D9OA 3CDWA 1KEKA 1DQ9A 4NA2A 4PWWA 1HBUB 2BBEA 1WNEA 4GKKJ 1RLDA 4NRTA 1LK5A 5KOXA 4DG1B 2AJ1A 1B99A 3J7YU 4DU7A 2HBZB 2IRXA 3OHAA 3X1LB 3MAAB 1VIOA 2R8HA 2WVCA 3NGTA 4MK8A 4KPYA 1VMBA 5AE3A 2VPZB 3W3SA 4H4KA 4NEYA 2QA4S 2MGZB 4PXCA 2MKSA 2EEYA 1VC0A 3A8KA 2GZOA 3TX8A 3RAXA 1X5TA 4NXNF 3MD3A 2RF2B 4OI6A 2RNEA 2C3YA 2DY1A 3V81A 4FF4A 4OYAA 1P1TA 2PT0A 5J2NB 1I94F 1EAYC 3H59A 1HNIB 1WHXA 3AB4B 2H5JB 5FDLB 2ZD1B 3BN4A 5DZ6A 2WTFA 2CYYA 5L1JA 4GVBA 1OS5A 3AD7C 2MZRA 2HG4A 2C2DA 1R7IA 1N5SA 2JFKA 4C8MA 1RWUA 1DQ8A 1T9VA 1Z4UA 2KKHA 5A2QY 2GO9A 3I0SA 4OQJA 4QU6A 2XY5A 1R89A 4DOZA 3KLEB 4P75A 1DTQA 2ZVIA 4O3OA 2OIHA 1ZYQA 1Y5NB 2VFRA 4DR3J 1WACA 2BABA 1KLMA 3WC0A 1DLOA 4PG5A 2CPZA 2VG5B 1NLKL 1IKXA 4RW4B 7FDRA 3J81U 4K4WA 4O23A 5KFLA 2HNYB 2ZH4A 4HKQA 2UXBF 4X4UA 1AFIA 4RW7A 4USWA 1VOMA 2ASJA 2OP5A 2SXLA 4OZLA 1WHWA 2ZZTA 1HPZA 2JEFA 3TNVA 3LALA 3GIRA 3W2VA 3GP9A 1F1BB 2HQIA 2G2ZA 3ZZOA 2ILYA 2IFXA 5J1EA 3GJTB 4Z7YA 3CVKA 3PO4A 5CA5A 1YJNS 3KJVA 4F4WA 1U1RA 1N0VC 1O0PA 3K8VA 2AMCB 1KOOA 4ZHRB 3MAQA 3TI0A 2KM8C 3ZZUA 4YHHJ 4PABA 1CJVA 2CQIA 3MTKA 4ICLB 4LFBJ 2Z2LA 4JI4F 1KQSR 3MR5A 3DLJA 1AW0A 1TP7A 4DFMA 5D0RA 4KQZA 4L72B 5DLGA 4CLKA 4IO9Q 3QLHA 3R1HA 3DXBA 1MWQA 4F02A 1NHKL 3ZTOA 3J7A1 5A8WB 2HHHF 1U2FA 4CH7A 3UCGA 3R5BA 4FYXB 1HWUA 1KTQA 4L73A 1N36F 2A18A 4IG0A 3I56S 3JQJA 5GAEI 2L9WA 2ZH7A 4DV3F 4DX5A 2W8KA 4PZVA 1HBNA 3OBIA 2RVJA 2W7PA 1D3WA 4WIQA 4AXIA 3GCXP 2HHVA 1JMTA 3MUVP 1IBMF 1HWLA 3FVYA 3TZWA 3H98A 1FRHA 4DPOA 5G0RB 5ETLA 2CPXA 2YNGB 3VAJA 3SFUA 3MECA 2AJQA 1C0UA 2XMMA 1HFEL 2E1CA 4IH6A 4P7VA 1S1XB 2CJBA 5GAHI 4EU0A 1QAJA 4LVOP 4C0BA 2RHQB 2FHKA 3L9ZA 1G4CA 4NLUA 5AJ3F 2RQCA 5K20B 2VC0A 3DOKA 4DX6A 1J27A 2B4VA 4K4UA 1RISA 4AL6A 2LYVA 2JLEA 4KIAA 4TY8B 1XN9A 2VPWB 3CCSS 1WC5A 4NLDA 4YFUA 5C42A 4F50A 1FFSB 4ZOSA 4C9DA 1B64A 3K89A 3GYGA 4NPOA 1S1VB 5KFAA 1RHQB 4X65F 1X4AA 1ZM9A 5M2PA 5KFWA 3ETOA 4ZIVA 2ZOGA 1OO0B 2PSZA 2CXEA 3BDEA 4ECWA 4LT6A 4LRBA 3PW5A 2MB0B 3BB5A 2RRBA 1C1BB 3EYZA 2F8HA 2MKHA 3KFWX 4EBEA 4HTJA 3ADAC 2HQGA 4JI3J 4CCHA 3CJSA 3LGNA 3RJMB 1U49A 3R2DJ 1I1GA 1MNEA 5ETMA 3BBBA 4J9OA 4FF1A 1WSRA 4H4OA 1S6UA 4C2MA 4E98A 1GTHA 2YBVA 2UXCF 2QMXA 4WK1A 3C2PA 1MW7A 2YNIB 3W5YA 2OH2A 1EP4A 3C6TB 3NXZA 3IBWA 2CJQA 2KTQA 4YMEA 4EO6A 1GXTA 3R5AA 4Y2MA 4M1KA 2X1AA 3F56A 4KE5A 2CPDA 4KFBB 1WG4A 4JYAF 2J0XA 4WK3A 4ZVEA 1T94A 1VQOS 4CH0S 3Q8SB 2WVBA 4J9LA 3D66A 3FCHA 3BGOP 2GJFA 5KG5A 2J5AA 2QC3A 2D1CA 4DV1J 5HROA 3AD9C 2NZ4A 1C1CA 5F0UA 1SQFA 2F4VJ 3BQ1A 3Q22A 1K44A 2XSFA 1ZA2B 1VQLS 1YG0A 4JI0F 5D3GB 3PG9A 5DM6Q 3OXGA 1LXNA 3GV8B 2E44A 4IG3B 4B3TJ 4FVMA 3OPKA 2RKIB 4ECSA 2MXYA 2VJUA 2IJRA 4X66J 5KFNA 3FBBA 3B82A 5KG0A 1RAJA 5KOWA 2IM1A 2W2QP 4RU9A 4DR6J 2JX2A 1N5TA 4IRCA 2CZ4A 4A8XA 1CEZA 2JOQA 2YVSA 3TAMA 2UUBF 1VQMS 3MM5B 4UTGA 2IDEA 4K4SA 3GFYA 3PX4A 3CWJA 5K8MA 3TEHB 3BF4A 4I67A 2RQMA 1T7PA 4LF6F 1S1TA 1JLQA 3NS6A 4X2BA 2E66A 2UXDF 2NCKL 5ETSA 1LWFA 3I31A 2XWYA 5SUHA 2VQFF 2EK1A 4E2FB 2J7WA 3IO1A 2DH9A 2X7IA 2IM0A 2A1BA 2VASA 1Q16B 4QR0A 2CQDA 1HW9A 2VZ9A 4M5KA 4A8MP 3HFZB 2B5JA 4ZLJA 4PQAA 3FC9A 3KUGA 2VJVA 2E5HA 1S77D 1XMOJ 3EWGA 2NXUA 3DMJA 3CSKA 2LQBA 2XYGB 2ALYB 3JSRA 4UY85 2IVMA 3DYAA 1PIEA 1LWCB 2A10A 2MKCA 4ELVA 3FKBA 4RW8B 4H4KC 1PO6A 4KKOB 3CDEA 4JI1F 2B6AB 2QO3A 1IM4A 5I42A 1RCXB 2KVIA 1L3SA 5U47A 2XGPA 1FWLA 2DYAA 4IDKB 3R97A 4YB6A 3IR7B 4Y2KA 2EK6A 1TVRB 1HBMA 1X4DA 1Q8KA 3M30B 3K5OA 3OTOF 2AW0A 4MYTA 2C2ZB 2ZZNA 4NXNJ 2CA9A 2IRYA 2HRTA 3GZ7A 4QYZK 1U2RA 1MMDA 2HHUA 3UCUP 1I94J 1RADB 2KM8B 2AV5A 4DS5A 3T41A 5E3AA 3R5JB 1QUPA 2DNPA 2XS2A 2N4CA 3R27A 2ZEJA 3MWBA 1S9GA 2DNOA 2AU0A 1W25A 1F3VA 2R7TA 2U1AA 1KD1T 3G8SA 3PEJA 3FBFA 4EGLA 1XNQF 1FXDA 2QZ8A 1C4AA 2VG6B 4DUYF 4TN2A 3BSOA 2W9AA 3IG1B 4PG6A 5H1SV 1D8YA 3W60A 2KG1A 4J9SA 1JQGA 2IY5B 4QQBA 1TKTB 2UU9J 1S6OA 1SJFA 1UJ6A 5KFOA 2JEIA 4DFKA 4MFBA 2ZDOA 4DMZA 1RAIB 4Y00A 3POTB 5F3TA 2H54B 4CLFA 2G13A 5B08A 2QSWA 3JAMY 2NQPA 1BC6A 3L4BC 3TX0A 3G82B 3CCMS 3QJJA 3THPA 2UXBJ 3M2UA 4KGMA 2JWNA 2MEWA 2BKOA 3HSZA 3KLGB 2YWEA 4RW6B 4OX9F 2C2OB 1IKYB 3CCWA 3SQGB 3IRXB 2GIFA 4CLTA 3N28A 5K5MA 2CFXA 3DRRB 3HKZD 2A0FB 3VAKA 5M2UA 1X4HA 3CIMA 5I3PA 2DNQA 4CLYA 2R3VA 2HFNA 3FSIA 2YKQA 3D1OA 2QLBB 5DGAA 3US5A 3C14A 1VC5A 4I1TA 3CPWR 5E3RA 4MT1A 4NA1A 2HQDA 5DRKA 5B0FA 1N54B 3ENWA 3PRVA 2LDIA 1LEOA 3M32A 3EPIA 4HEA9 1HR0F 4JI4J 2V4RA 4EYIB 4JUZA 1RTJB 2XY7A 2DKOB 5IV4A 3C6UA 3MMAA 1HQEB 5ETTA 2V4JA 3IM8A 4R8UB 2QLFB 2HHHJ 3W5XA 2DEJA 3R6GB 2UUTA 2Y0SD 5IS2A 4R5PA 4AUKA 5D6GA 1N36J 4BS2A 4N56A 3EGNA 2FZCB 1M5PC 2AP6A 3QIPA 3QO9A 2V9KA 4ZDNA 1UEKA 5KT5A 2UUAF 5LSOA 4PYDA 2C2RA 1IBMJ 3THTA 1TL5A 3BPDA 4LFAF 2DHHA 1NU4A 1DQAA 3ZZPA 3C46A 3THVA 2CVEA 4C11A 3H40A 2FY1A 3ILOA 4F25A 5MAOA 3DLBA 1NJYA 4G6VB 3MR7A 3ZZTA 4ZA1A 2CNKB 3KHRA 5AJ3J 2YQ1A 1E6YB 2RDJA 1YZ6A 1YI2S 1NHVA 3PW4A 1FVSA 4JBCA 4Q2LA 1HQUA 3TO8A 4ES1A 1RT5A 3P96A 2K3IA 2W01A 2AJ2A 5LMUF 3VR1A 3UR3C 4G1IA 2VBWA 1YJRA 3N6LA 2QRRA 1BUXA 1FWKA 2MQPA 4X65J 1FFGB 2RE1A 4O3QA 1KN6A 2H3EB 3B8HA 3AA8A 3IWNC 3WIVA 1OSCA 3GIMA 3TARA 1PBUA 4EYHB 1SI9A 2FJBB 3BS9A 3NEKA 3AXKA 1RQ0A 4OYBA 3IFEA 1U09A 3I6PA 1AROP 3NGKA 1WOSA 2XEXA 3TVKA 4LBHA 5F9NA 2UXCJ 3SMZA 3V6DA 1BHNA 2XZWA 1RDRA 1QAXA 3UNGC 4CWBA 4GKJJ 4LQ9A 2NXNA 1Q4RA 2W9BB 2IPOB 2YH0A 2ATLA 4LREA 2GJ2A 2IJNA 3ISZA 3KXDA 1BGXT 3VZHA 3TVZA 4DZDA 4JYAJ 3LP0B 5GVQA 4C8LA 1NCLA 1KC8T 2Q43A 5HSPA 3PX0A 3ZNUA 4WXWA 3O8WA 1HD0A 3N6MA 1FXLA 1FNOA 3C16B 4JI0J 2OD6A 2PN6A 2MHEA 1FT8A 1X4EA 3V6JA 3W2WA 4ENOA 2HK2A 4KPCA 2XMVA 1RZMA 2WSFC 3CD0A 2B56A 4CIOA 1RCOB 4DCJB 2AZ1A 4P10A 3BO3A 1RHJB 4ZLNA 2PFDA 4G1PA 2VL1A 4M5DA 2CPEA 5LJ3Y 3PY8A 5HVGA 2GMLA 4DV0F 2E5IA 4N41A 5KFQA 1RB0A 1YGYA 4IOBA 1D09B 1UKUA 3QGPA 2UUBJ 3KG4A 5HANA 2DGVA 4X4OA 3VQSA 3SDEB 4DV7F 4L74A 4GVBB 4LF6J 1YTYA 3CEDA 4PPZA 3GU0A 1SJ4P 4B08A 2UXDJ 3OL9A 2F7VA 1R6YA 2MSTA 2O01C 3D2WA 1SBRA 2VQFJ 2V8VA 1REVA 5L9NA 1Q1KA 2XS5A 1VI7A 1WDDA 4B9TA 2FVCA 2BM0A 2GHPA 1BLUA 3PR4A 8RUCA 1KLMB 4DL3A 4ED6A 3MPWA 1IKXB 3QAEA 1YJ7A 1VRUB 4LSZB 4IOCQ 3GLJA 1VISA 3DCAA 1Q8LA 4Y0FA 4ZJQA 4JI1J 5HBMA 4A48A 1FRXA 3VWSA 2EG1A 3Q86A 3DRYA 4ZPBA 4EZ9A 2YX1A 3ZTQA 4LRDA 2E1PA 3QZ8A 4ZLPA 2DR6A 4ZP6A 1S59A 4XK8C 1CJVB 3BZQA 2AYBA 3CGIA 1X0FA 2BE9B 2WVFA 3BQ2A 1M90T 4RX6A 2FZKB 3FCVA 3OTOJ 1R8CA 4YR0A 2YQ0A 3QFWA 4FPRA 3SIPB 2R7VA 1U0HA 1M5SA 3M2RB 4ECYA 3HHEA 4HTIA 5IZHA 4USKA 3QRPA 5ETNA 1IXKA 2FB0A 2NLWA 3TW0A 3S1TA 3EVWA 2VODA 3CD6S 2G2OA 1JIHA 4ID8A 2W4CA 5GMDA 3M8SA 1JX4A 4DL2A 4MJKA 1UWBA 2VICA 3OR1B 4OFZA 1JLAA 4A8WA 3KYLA 3IBFB 1XNQJ 3J7ZT 1ZBTA 4DUYJ 2DISA 1S5ZA 1I3OB 4JI5F 4CO2A 3IAS9 1YLXA 2CQBA 4C98A 2XS7A 1U1PA 1IR2A 3P8BB 4RWXA 3T1YF 2N7CA 3PACA 2QA2A 4OZ1A 4CM2A 4HI1A 2N7YA 1YIJS 4EWTA 2ZH2A 3W8GA 4IFVB 3DOKB 5K9FA 2IIHA 2C3PA 2R7XA 2NREA 3CTRA 1FWPA 4OX9J 2UP1A 4WP3A 5CHCB 1H98A 5BR8F 3BSNA 4DSFA 2V2ZA 3Q23A 3H5YA 1UFLA 1VQ4S 5GAEU 4U8YA 4WP9A 1D9FA 2PI5A 1DJ0A 2HQFA 2OSRA 3PYDA 3VGUA 1KBRA 3Q2TC 3M4XA 2H5EA 4OHWA 3C3LA 1WJ9A 2AKWB 3MEEA 1HR0J 4HI2A 2HMIA 1NPKA 2QTWA 1BWEA 2OUGA 4K5RA 3KNAA 3N01A 5GAHU 2HRUA 3IP0A 2BRLA 3N5FA 1UFWA 5E0OA 2VONA 1S4EA 2RSQA 2VH7A 4H4OB 5DQIA 3Q8VA 1X5SA 1LFPA 3KUEA 1NK0A 4NZ0A 4RW9A 3EDQB 1H2UX 4J9MA 2JEGA 2BQRA 5D0HA 2IAJB 2X3DA 3HVRA 2UUAJ 3MPUB 3Q89A 4J7CA 3BH7B 1D9DA 4UW2A 2AHOB 5ETQA 3SFGA 1MG7A 4HLBA 2GFFA 4CO5A 1GMUA 3LAKA 3OTEA 1Q0NA 3NG8A 3IC1A 2HHPA 1ROFA 3CCTA 2RU3A 1JJHA 1OYEA 2Q6CA 1FXRA 2IHR1 4ECXA 2I6WA 3D0HE 2ZC4A 4OMFG 3Q8UA 1H0HB 1CPZA 4N77A 2D9PA 1H7XA 2E9ZA 4H54A 1QVFR 2B7CB 3TJ8A 5IT9Y 2QMUB 3PFOA 3DOMB 4ED4A 1JWWA 1Y7PA 4EBDA 3HLUA 1SV5A 3G2XA 1OPZA 1PGZA 1FD2A 3A12A 5H9EJ 4QCLA 2FDNA 4PWUA 2ZJQQ 3WC2A 2BMBA 3UW1A 4IH5A 3KJQB 4KGXB 1KLNA 1R0AB 1KP6A 1DBDA 2VKRA 1SC3B 4A47A 3JYTA 1JLQB 5EX3A 1TR0A 3DRXA 1YBAA 3HVWA 4LF7F 1RAEB 2HFSA 2M8HA 2G9OA 1LWFB 5HMXA 2YXLA 1EX8A 5D8HB 3MFIA 4ES3A 3ZFVA 1SUQA 2M3DA 3T3FA 4GO7X 3SSSA 3T1HF 4ZPDA 2ZOMA 1W2IA 1WC0A 1S6QA 1CQMA 1CS4A 1M1KT 4LR7A 2VA2A 2KFYA 2J9EA 2FD2A 3HSGA 2F63A 2CPIA 3EZOA 2B9WA 3CJ4A 1J5EF 1S7HA 4P6QA 3LP1A 3VAGA 1ZTTA 3LQVA 4CNZA 3GR1A 1P8GA 5A0YA 5ADZA 3GR0A 1T03A 2HGLA 3KDNA 1IBCB 3GCWP 4YY3F 1RUSA 3GB0A 4OX8A 1HBUA 3ILIA 2Z8QA 4FYWB 2CJXB 3M1VB 3NBPB 3VAIA 4DG1A 3B6BA 2MKYA 3UD4P 1RI7A 2M88A 3U1NA 4BCAA 2HBYB 1GEHA 1WTBA 5ETVA 1GMVA 3MAAA 1B0TA 1BWVA 1VBXA 2ZWOA 3L09A 1F5CA 3QNWB 1HBMB 2RT3A 1UVIA 4DSLA 2JDJA 5K8OA 4UQGA 2QA4G 4O3NA 1YQHA 3TQ1A 3OFHA 4CDIA 1OY6A 1XWLA 1RWOB 1B7YB 2RF2A 2GVZA 3SCKE 4UZBA 3HSDA 3EX7B 2EG2A 5F0WA 3N6NA 4DWIA 2R8JA 5J2NA 4Q7AA 1HNZF 4DV7J 1HNIA 4YR3A 1WUUA 1K8AT 5FDLA 2ZD1A 1VQ5S 1Q86T 1NB7A 2F5GA 4ECVA 3KJNB 4XDDA 4PPDA 4FXVA 4F4XA 2COLA 2J9DA 2AIRB 2W1BA 4EO8A 2HGNA 4DBQA 1NNDA 2HVHA 1NK5A 4K0KF 1RU1A 2XWXA 4DDFA 3CCVS 3OJUA 1NMEB 4MFBB 2PMHA 4OV1A 2C22A 1P27B 3SYZA 1H6KX 1I5OB 1ZPWX 1QSYA 1R31A 4FDFA 4U7CA 3OTBA 4LUBA 4E8UA 5GMEA 3PHTA 2MMYA 3ZTRA 2GAHC 1N88A 4Y34A 3M2UB 4FZVA 1TV6B 2VG5A 3GSDA 2HNDB 5KFMA 5I4MA 4B9LA 2HNYA 1NDLA 1FKAF 3PR5B 3LP2B 4NCAA 3VVUA 4JI2F 1FFWB 4ZPTR 3HHLD 4YB7A 4RUAA 2AEFA 4DHVA 2HHWA 4ZVGA 4UOHA 3C14B 4ED2A 2J7KA 3VTIA 1S6PB 3CDUA 2J8SA 3CIZA 5JVHQ 2A6OA 2D69A 3AHPA 3M32B 1K9MT 4DU8A 2FHOB 3OLAA 5DQGA 3D0IE 4ZHRA 4P2SA 3LO3A 4TU8A 5BXIA 2Q79A 3GPAA 3MEGB 3D68A 1WKKA 1RTHB 4ICLA 4OHXA 2KFZA 3E2EA 3M2VB 1H74A 1H7WA 4LRCA 2V4JB 1FJGF 2EC0A 4MH8A 4M5GA 4PRFA 1QSLA 1XTZA 1ELOA 3MR3A 2FHJD 2EKNA 1UW4A 2XYHB 4RKUC 1HMVB 4NI2A 2HGMA 2K7KA 2CKWA 4FPIA 2F3JA 3VGVA 3TA2A 3PCOB 5EWFA 3DLGB 2CWKA 1E6VA 2QL5B 4NE9C 2I8EA 4OI4A 4I64A 4NMLA 3WQPA 4JI5J 1M1GA 5C7PA 1SJ3P 2ROPA 2LXFA 3FEZA 2RJZA 3BYRA 5G0RA 2CQGA 2BJ3A 2F8MA 3DFEA 2IM2A 5D4LA 3DLKA 2YNGA 5LXYA 2ZH1A 4DX8H 2UUCF 2LQ8A 4MTPA 2V69A 1FDNA 2R7QA 1N0UA 2CG8A 2ZM6F 4Q44A 4CYUB 1EETB 1HQ2A 1UAWA 2F65A 3GFZA 3NRBA 1YBUA 2QL9B 1JXLA 3FJ2A 2DR8A 3DHWC 3A3OB 3NGDA 1HL6A 1X60A 5BR8J 1HQUB 1SKRA 3FCWA 5ETPA 2UUWA 7AT1B 1RBOB 4LIWA 2HNZB 2M70A 4O4RA 4URQU 1T3OA 2WZ1A 1SH2A 4AE5A 3AOBA 4FNIA 4JI8F 3DU5A 2W7OA 1PAEX 2IMOA 1PC5A 3MCNA 1RAFB 3AD8C 3Q2SC 2DNHA 1S1VA 2CDRB 4HT7A 3TYTA 4HR2A 3J80U 3HT0A 5H9FJ 4EUVA 1XMQF 3ZXWA 3W9HA 3TA1A 4F7VA 4Y2IA 4DR7F 2KRBA 4X84A 1L3TA 3NGRA 1TK8A 4FBUA 4N5SA 3D0GE 4C3MA 2BJ9A 6FDRA 1KR4A 3CMES 3IA0A 3V6DB 1CC7A 3P5TL 4RBVA 3G6YA 2KFNA 2FYXA 1KONA 2P5VA 2FTRA 2NXJA 3TUZC 4DL5A 3C6TA 5HL7Q 2DR9A 2FY8A 4JV5J 3B4MA 2LP4A 3HD2A 2M9KA 4LRFA 3PTWA 1U0SA 2R7OA 1D9AA 4ED8A 1ZA1B 1RWKB 1FDAA 1IBLF 1R0BG 3I32A 4WFZA 3OJSA 2ZWPA 2RU9A 3DN9A 1RJJA 1PYTA 3GFXA 1HKAA 4LF8F 2XLIA 2H5IB 2E9RX 3I4PA 2BQ3A 3ILLA 3MR2A 2WONB 1UA1A 4HH0A 1LQ9A 2XMKA 2XGQA 3QYYA 1NRKA 3P6YC 4IG3A 1VJWA 3AA9A 2ZH9A 3MI7X 4WKRA 5D15A 2RKIA 4DXLA 2LEAA
chains in the Genus database with same CATH topology
3Q8QB 2B5JB 4CT9A 3BREA 2E66A 4M94A 2UXDF 2PD1A 1GH8A 3FFIA 2BYCA 4DUZF 3FRZA 3OTDA 2OO4A 2V4QA 2Q66A 2KT5A 5KFHA 2YNFA 1Z1ZA 3CDAA 4PG4A 3RAQA 2XB2D 5KG2A 1YRUA 1C0TB 2JVOA 3L7PA 3DMJB 4BHQA 2K1RA 3VAMA 3OV7A 1LWFA 3I31A 2XWYA 5SUHA 2VQFF 2EK1A 2WONA 1XR5A 1DARA 3DYAB 5BYRA 3DGPA 3BO4A 2V94A 3OVBA 1H38A 4J9NA 2J7WA 3IO1A 1U1NA 1F2GA 4Q0BB 3MM5A 1MU2B 2R4FA 5KG4A 4K4YA 1QAIA 1X7VA 3AH6A 4IRKA 2E5JA 1S97A 4QIWD 1JLCB 3JTNA 3T5HA 2DH9A 2IM0A 2A1BA 2VASA 1Q16B 3RB4A 2K3KA 4QR0A 3G6ES 2CQDA 3MUMP 1HW9A 4ZPCA 1Q81T 4MAKA 4NZ6A 2VZ9A 4UUXA 5I42B 4GO5X 4A8MP 1R8HA 2KJWA 3T9ZA 1S0VA 3F41A 3ISNC 1QVGR 4QYZJ 2I0XA 3MM7B 1FDDA 2B5JA 4FP9A 2ZH6A 4C4WA 3IGNA 4PQAA 3GE9A 4Y65A 1UMJA 1AFJA 2E5HA 1S77D 1G1XA 1WHYA 5CCMA 4DR1F 2NXUA 1C0TA 2P9GA 2B9XA 3NCPA 3DMJA 4OLOA 4C0HA 1F0XA 4UOCA 3CSKA 2LQBA 5E5NA 1QM9A 4MIBA 2BUNA 3JSRA 4UY85 2IVMA 3DYAA 2WK4A 5IWAF 5E3PA 1Q7YT 1R27B 3QMQA 3I9ZA 1LWCB 2A10A 2CQPA 2MKCA 4OX6A 3F44A 5CYJA 4ELVA 2BZ2A 1KRPA 1MU2A 3O5TB 4RW8B 4C97A 4H4KC 2E9TA 1PO6A 5M2RA 1S0OA 4HHJA 2MQLA 1JLCA 1YSJA 4KKOB 1UP1A 1U47A 1FERA 3CDEA 2PA3A 1RT7A 4JI1F 1R8BA 2DGUA 3CD5A 2B6AB 4A8SA 3CCLS 2QO3A 1IM4A 3KHLA 2QV6A 2MGZA 5I42A 3PRBA 2W4PA 4FXDA 2DB1A 4DV6F 3MM7A 5E33A 5E41A 1ZZFA 5DS7A 2KVIA 3IR6B 2L3MA 1L3SA 3SXLA 2ZHBA 1JLFB 5U47A 2ZKUA 3K2YA 2XGPA 5HMWA 3EXCX 4IDKB 1FRKA 4H4MB 1QSSA 2LA6A 5KFCA 4YB6A 5DG8A 1Z2ZA 2Z0GA 3IR7B 4CI0B 3MMBA 3DDNA 2VKZG 1LWCA 4XPCA 4Q43A 4ZPVR 3OSNA 2VA3A 1BD6A 3HI9A 4Y2KA 2EK6A 1TVRB 4RW8A 5DG9A 1HBMA 3UWTA 1S48A 1X4DA 4O44B 1DAXA 4MK7A 2IC3B 5L1IA 3HMJG 4KKOA 3M30B 1S9GB 2Y1JA 1SC6A 1DRZA 2DJWA 3U1LA 3K5OA 4Z2XA 3OTOF 2AW0A 2BJDA 4NYZA 2B6AA 4MYTA 3HM9A 4FF2A 2OLWA 5E7OB 2ZZNA 3DDKA 1WG1A 2IRYA 2KXHA 2NUHA 3M8PB 3SV4A 3UQSA 3GZ7A 2GCFA 2GQQA 5KFUA 2ERRA 3TRGA 1MWYA 1U2RA 2WCXA 5KFKA 3SI8A 2KN4A 1MMDA 3K5LA 2HHUA 1FESA 4I6YA 1VBYA 3G9CA 5DM7Q 3UCUP 4IDKA 4A4JA 3CCQS 1HI0P 2XHWA 4H4MA 1N8RT 2KM8B 4B3MF 2AV5A 4DS5A 5KT4A 3E01B 2MJUA 5E3AA 3M9NB 2YNHB 4WFXA 4TYBA 5FJ4A 1HI1A 3CB4A 3BDPA 2E5LF 5KFXA 4WKYA 2DRBA 1TVRA 2ZH8A 4NLVA 1QUPA 2DNPA 3NNCA 4OHZA 4O44A 3N9UC 2N4CA 2XS2A 2IC3A 1KOHA 3R27A 3JTOA 3M30A 3MWBA 1S9GA 2LDYA 2VQEF 2DNOA 1S9FA 3TOQA 2AU0A 1W25A 2HS4A 2R7TA 3KLEA 1ZETA 1HNVA 2U1AA 2DT9A 3O2IA 1YJWS 3MZIA 1KD1T 3G8SA 3PEJA 2O67A 3M8PA 3Q0AA 4EGLA 1XNQF 4C0OC 3PW7A 4URSA 1FXDA 2QZ8A 2DK2A 1C4AA 2VG6B 2NPFA 3RW7A 1T3NA 2NR0A 4DUYF 1FKPA 4EBCA 2YY3A 4TN2A 5B0EA 3GV7B 4BBYA 3BSOA 2W9AA 4L3NA 3IG1B 4PG6A 5H1SV 1NK8A 2FLOA 1X4GA 4LMZA 4QR1A 4RW4A 1D8YA 5GADU 4CO1A 4F3MA 4J9SA 2KG1A 1VQYA 3E01A 1P9QC 2YNHA 3K57A 2L9DA 2R7RA 3OL6A 4QQBA 1TKTB 1S6OA 4RZRA 5K14A 1UJ6A 3OFEA 1SJFA 2APOA 3ZZYA 5KFOA 3NWGA 4DFKA 2JEIA 4MFBA 2ZDOA 4B3OB 2DHGA 1CG2A 1JLAB 4DMZA 4ES2A 2FGCA 4OJ3A 2KT3A 4Y00A 2CQCA 5L1LA 3EZUA 2VPXB 1G3OA 3POTB 1NH7A 5F3TA 2G13A 2CQ4A 5B08A 3M8QB 4ZVFA 3I0RB 3H25A 2QSWA 3JAMY 2PEHA 3BGUA 3H4BA 5F8LA 1VQPS 3V6KA 1KVIA 4OJGA 4EFAC 2NQPA 3IAM9 2ZE2A 2XULA 3HHDA 1BC6A 1I6JA 2EFGA 3K5PA 4M63A 3NMAA 3R5CA 3KLVA 3CCMS 2N3LA 3QJJA 2VG6A 1X9WA 2YKOA 2J6UA 3THPA 4DQRA 3IG1A 3M2UA 3IRWP 3S01A 4QWDA 2MZQA 4OZ0A 4KGMA 2JWNA 1ZM4A 2GJIA 2XBPA 3DOLB 1V6HA 2XCPA 5DG7A 3HFKA 4ZPWR 4FXWA 2XNQA 3O6QA 3KLGB 4K5SA 2YWEA 4RW6B 4X4SA 4OX9F 5B0DA 1TKTA 1HARA 1IKYB 4K4ZA 2L48A 3CCWA 5F9LA 4R25A 1TK5A 5KFPA 3SQGB 2R8IA 3IRXB 1N6QB 2IYIA 4B3OA 4KB7A 3GMGA 3PZPA 4ED5A 2V2KA 3N28A 3OR2A 2CFXA 4NRUA 3HF5A 3DRRB 5K5MA 3EZ5A 3POTA 2ZZMA 4MMOA 2OTJS 3HKZD 1G2EA 2DNNA 3ICLA 3I0RA 3VAKA 2I5JB 3C6UB 3MMAB 1XEZA 2HWTA 2OFHX 5M2UA 3UDCA 1X4HA 4QYRA 2EPIA 1G6BA 1FK9B 4RNFA 3CIMA 3FGVA 5I3PA 4DLGA 2DNQA 1VBZA 3S7RA 1M0SA 2HFNA 3FSIA 2YKQA 3D1OA 3W7BA 3DI6B 5DGAA 5BJRA 2Z2MA 3US5A 1VC5A 1D0EA 4I1TA 3CPWR 5E3RA 4A8QA 4GMKA 1Y3JA 2YWGA 4NA1A 5DRKA 4R5PB 1P1LA 3DOLA 5B0FA 5A8WA 1N54B 3ENWA 2LDIA 3VZIA 2KXFA 4QR2A 2KU7A 3KLGA 3KK3B 3M32A 3EPIA 2Q3PA 4HEA9 4RW6A 3V5RA 4CO4A 4AQYF 3WX4A 3J81Y 1HR0F 3L95X 2V4RA 3T6BA 1IKYA 1F5AA 3QIPB 3QO9B 4EYIB 4JUZA 3U02A 1RTJB 2CDQA 1NJZA 3SQGA 1RTDA 2ZVSA 1N6QA 3T5LA 2XY7A 4QPTA 2AYGA 1YJUA 2XC9A 3U1MA 2XSJB 3DRRA 3KK2A 4WYLA 2XO7A 1JK9B 4TY9A 4J5OA 5JUMA 3CCES 4F4KA 1O5JA 2I5JA 3C6UA 4TLRA 3MMAA 3SSRA 5HN0A 1HQEB 2BRKA 2OPPA 4IR1A 1X4BA 1FK9A 2V4JA 4HL9A 1JLBA 4BWMA 1DURA 4R8UB 2QSFA 3D28A 5KFBA 1Z2LA 3MUTP 3RTVA 1IBKF 3MD1A 3DI6A 1LW0B 3DU6A 4B17A 3NLCA 2UUTA 1O51A 2N4DA 1S72S 3FMBA 2ZFHA 2Y0SD 4NXMF 1X4CA 3CE8A 5IS2A 4R5PA 1FDBA 5F8IA 4C11B 4YB5A 4ILMA 2WB1D 1OPIA 4AUKA 1R8AA 5D6GA 4BS2A 2HMIB 2J9CA 3LAMA 3KK3A 3WDOA 4N56A 3EGNA 2FLPA 1HWJA 1M5PC 2AP6A 3QIPA 3QO9A 2KJVA 1YJTA 2R8GA 1RTJA 2V9KA 1UA0A 5L39A 5HLFB 4ZDNA 1FRIA 5KT5A 4O3RA 1S1XA 2UUAF 2GIRA 2XSJA 2BV3A 2ZJPQ 5LSOA 6FD1A 2DCLA 2Y1RI 1KHVA 4TLQA 3Q8RB 2C2RA 2LVWA 1CSJA 5HO4A 3D1QA 3DLEB 4D3GA 4NLQA 1K73T 4NYPA 1HQEA 1APSA 1IQTA 5KFGA 2DNKA 1WTFA 5FD1A 2QEXS 3THTA 3KHGA 1TL5A 4R8UA 5A8KB 4LFAF 2CQ0A 2QE5A 5KG3A 1NU4A 4RBTA 1LW0A 2YKPA 4Q8EA 1DQAA 5DJBA 3G8QA 2GX8A 3ZZPA 2JH3A 3C46A 5LXRA 3OL8A 3THVA 1WF1A 4A46A 5IXUA 4DJBA 4K50A 2CVEA 4C11A 3H40A 5KAKA 2FY1A 1UEVA 4HT5A 4ECUA 1S1UB 2DNYA 1VQ6S 1U1MA 4IKAA 3LF0A 2VBXA 4NYOA 4F25A 2OPQB 5KFJA 1RKJA 4AFFA 4KHPF 3K58A 2IBOA 2HWHA 1U7LA 5MAOA 1WI8A 4ZP7A 3DLBA 1NJYA 2B4PA 4TY8A 4N76A 2BACA 1RT5B 2L9NA 4G6VB 5HLFA 2CVIA 1RT3B 1J5OB 2FJWA 3ZZTA 1N34F 1WEYA 4ZA1A 2DO4A 4A8OA 4JV1A 4TU9A 4C8YA 2PIIA 2IVFB 3KHRA 3H20A 1E6YB 5J2MB 5GAGU 3DLEA 4OLPA 2RDJA 2H9ZA 1JB0C 4ID5B 1LOUA 1RGVA 3QGHA 1YI2S 1NHVA 3MOJB 5A8KA 3T5JA 3KKFA 4LF5F 1HW8A 2O3DA 4Y6IA 3SCLE 3GG0A 4PQUA 5C5JA 1K0VA 2EFVA 3EUNA 3AB2B 5B7WA 3PW4A 3HPOA 1SH0A 5LT5A 4KR0B 1M5HA 3DM2B 4Y3CA 2R9LA 1FVSA 1U24A 1S1UA 4V19J 2RUGA 4IH7A 4JBCA 4DQQA 1JNZB 5D77A 4Q2LA 4HYKA 4PR6A 1S9EA 4NA3A 1HQUA 4IOAQ 3TO8A 4ES1A 1RT4B 1RT5A 1SH3A 3EPGA 4JV5F 4QBUA 1RT3A 3P96A 1J5OA 3I96A 2K3IA 1ZAWA 3SV3A 3OQ2A 4KRWA 1JJ4A 1N33F 2EBGA 4HVZA 1B0PA 5LMUF 4WU3A 3VR1A 1C1BA 3UR3C 4G1IA 3PRDA 2VBWA 1YJRA 3MURP 1BQMB 1W2BR 3N6LA 1KFSA 5DDRC 5J2MA 2QRRA 2AJFE 1SKSA 1ZOTA 1JJ2R 3I4HX 2WRMA 2UV8G 4ID5A 4K2XA 2MQPA 4CTAB 3U7JA 2RE1A 4O3QA 2EKYA 1VRTA 2ZBIA 2DNRA 3QGIA 1KN6A 1U8SA 2Q1LA 4ZVHA 3MCSA 1T95A 5IQ6A 3B8HA 3AA8A 3IWNC 5KG7A 2OKQA 2FHMA 4B3TF 3NNAA 2J8AA 1OSCA 3GG1A 1SV5B 1NK7A 1VGYA 3DM2A 3T1AA 3GIMA 2RILA 2FLLA 1TFYA 1QLNA 3TARA 2R7WA 4EYHB 4ERDA 4U67Q 1SI9A 2GA7A 2FJBB 5KFFA 2BR0A 2BOPA 1VIXA 3BS9A 1NH8A 2CQHA 2Q6BA 5EN1A 3A8EA 1TFWA 2YNIA 1RT4A 2DGWA 2VOPA 3D5MA 2R2RA 3M9OB 4K4TA 1RQ0A 1U1LA 3MR6A 4N47A 3IFEA 3PIPQ 5KFTA 2IA6A 3RB6A 4B3SF 1NJXA 2K2PA 1U09A 2ZUGA 4URGA 3I6PA 1DTTA 3DNCA 3A1YG 2EFQA 2YKNB 3K7RA 5F3ZA 4CTAA 3RRHA 2J6TA 1HYSB 1AROP 2Y1IA 1DFDA 2PA8D 3NGKA 1M5KC 1Y5LB 4KFBA 2FJEB 2XEXA 4QIFA 3TVKA 5F9NA 5KFSA 4M95A 3SMZA 3V6DA 3G6VA 2WHOA 2XZWA 2RRNA 2OPRB 3F73A 2ASYA 5LJ5Y 3KHHA 5IT4A 2AX0A 3L7OA 1RDRA 3TP2A 1IJFB 4GKKF 2X1GA 3LUYA 4JOUA 4OHYA 3AQPA 1QAXA 2MJNA 1T02A 3UNGC 1VQKS 1FE0A 1JLGB 2WB4A 3SCJE 4IQMA 2UVWA 2ASLA 4WZQA 1ZZNA 2GGPA 4LQ9A 3J7YI 1U1QA 3HVTB 2LQ5A 4Q45A 2E1RA 5HMYA 1Q4RA 4U6PA 2W9BB 2F8EX 2CIMA 3IR5B 5KG6A 3PKYA 4BC7A 2YH0A 4K4XA 5F8JA 2C3MA 2ATLA 4KC5A 1CQNA 2GJ2A 5IM0B 2IJNA 3ISZA 2I2YA 1BGXT 3VZHA 4C3LA 5CH7B 5MLCV 3PO5A 2CG4A 3TVZA 2YKNA 1NKCA 3E8OA 1HYSA 4GC7A 4KO0B 2PMZD 3M6XA 3LP0B 3G4SS 2NS1B 4F3QA 4O0IA 5D3GA 2V8DA 4MIWA 2AX1A 5GVQA 3W2WB 4YP3A 4C8LA 3FZ2A 1U48A 2OPRA 2HZCA 1KC8T 4FBTA 5D4PA 1R8PA 3KLIB 3NS5A 2Q43A 2ASDA 1GX5A 2DH7A 3BQ0A 1LW2B 4I56A 1JLGA 2C28A 3PX0A 3J80Y 3BGFA 5ITHA 3GILA 3HVTA 4WXWA 3CXCR 4IO1A 3IWLA 2YWFA 3U27A 2J6SA 1O8BA 3KWMA 3HT3A 3S6EA 3O8WA 3KLFB 4M5DB 2W9BA 5A0YB 2DR5A 5DO2A 1HD0A 3N6MA 3HJFA 1FNOA 1S0NA 1FXLA 2YQ3A 5JJBA 1HWKA 2XG8A 2JC0A 1UJ5A 5IM0A 2OD6A 1L3UA 2PN6A 2MHEA 3T5KA 3H2UB 2R7SA 2ZOFA 1FT8A 1X4EA 4OI3A 5KT2A 3TANA 4IRDA 1OIAA 2P6SA 3LGMA 4ETXA 2LEPA 3LP0A 4QIEA 1ULRA 2ZKTA 3BGLA 3QIDA 4ITSA 3VCDA 5C24B 5KFDA 3BN7A 3V6JA 3PW2A 4C3KA 3W2WA 1SL2A 3H5XA 4MKYA 1X0PA 5F8GA 1A9NB 2XMVA 1Y5IB 4X4NA 1S99A<