2Z2MA

Cefditoren-acylated penicillin-binding protein 2x (pbp2x) from streptococcus pneumoniae
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
159
structure length
159
Chain Sequence
AKRGTIYDRNGVPIAEDATSYNVYAVIDENYKSATGKILYVEKTQFNKVAEVFHKYLDMEESYVREQLSQPNLKQVSFGAKGNGITYANMMSIKKELEAAEVKGIDFTTSPNRSYPNGQFASSFIGLAQLHENEDGSKSLLGTSGMESSLNSILAGTDG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biosynthetic protein
molecule keywords Penicillin-binding protein 2X
publication title Crystal Structure of Cefditoren Complexed with Streptococcus pneumoniae Penicillin-Binding Protein 2X: Structural Basis for its High Antimicrobial Activity
pubmed doi rcsb
source organism Streptococcus pneumoniae
total genus 31
structure length 159
sequence length 159
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-05-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2110 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2z2mA02
3.90.1310.10 Alpha Beta Alpha-Beta Complex Penicillin-binding protein 2a (Domain 2) Penicillin-binding protein 2a (Domain 2) 2z2mA01
3EQVA 5M19A 5U47A 3UPOA 2Z2LA 1PYYA 4MNRA 3UE3A 1MWSA 5M18A 2ZC4A 3UPNA 4DKIA 4CPKA 4R0QA 5M1AA 4R3JA 1QMFA 4OVDA 4QJGA 4RA7A 4R1GA 3ZG5A 3UPPA 3ZG0A 2Z2MA 1K25A 3UN7A 4CJNA 2ZC3A 1MWUA 3VSLA 3LO7A 5KSHA 1VQQA 4BL3A 4BL2A 4R23A 1MWRA 1MWTA 3EQUA 1RP5A 3VSKA 4N1XA 3ZFZA 1QMEA 4JBFA
chains in the Genus database with same CATH superfamily
4W92B 1Y11A 1LWEA 2EWHA 1KTQA 2GVDB 3MM8A 1S72S 4PRFA 3L9ZA 1KN6A 4MTPA 3POTB 2W7PA 3CMES 3WQPA 1X4HA 3CJKA 2E5LF 2ROEA 2ATLA 5C25A 3BJYA 1LQ9A 2KJVA 5A8RA 4HT7A 2BQUA 5EX3A 2N3LA 3EGWB 2CDQA 4CPKA 4OL8A 1FVQA 2WVCA 2XS2A 4KH1B 1WSRA 3OJUA 1X5TA 4OI4A 3BH6B 3M2UA 3V6DB 4BS2A 2XM3A 2VFVA 2DEIA 3IBCB 3DLGB 3GWCA 3FMBA 4V19J 5DDQC 4I1TA 5L46A 1Q78A 3RAXA 1LNQA 2NREA 2R7QA 5HLFA 3ZTQA 4K4YA 2BKNA 3RB3A 5HQMA 3Q0AA 4HYKA 3PHEA 3E8OA 1UWBA 1QDUB 2PMHA 1F3FA 3T19A 5IT0A 2ZBQA 2FHMA 4WK3A 1DTTB 2I2YA 3TRGA 4YDDB 2JEGA 4OX9J 4TN2A 1SV5A 5M18A 3I9V9 3V81B 4KJIA 4BDPA 3DI6B 4DZDA 3CCZA 1J5EJ 3VGSA 1HD1A 1OQ6A 5BYSA 2QL9B 1QAYA 4XK8C 2MQNA 3FFIB 2AEJA 1EZZB 3K7RA 1PYYA 5LMUF 1UPMB 5CCMA 1HKAA 3DC2A 3M9NB 5DQGA 4LT6A 1MSWD 3MPDA 2QYCA 4UZBA 1FO1A 5DM6Q 3GB0A 3H90A 1TR0A 3KUHA 1RU1A 1D9DA 2VF3A 3MMCB 2XLIA 4HHHA 3IS9A 1Q4RA 1XJWB 3HXMA 5ETVA 3O44A 1M0SA 4J9NA 1UJ4A 3PO5A 4ECTA 5CYQA 3ZZZA 1H38A 4LF7F 3PDNA 1IBKJ 2GJIA 3CJ4A 2Q79A 3F0NA 2HWHA 1REGX 3HHDA 5F0WA 3VR1A 2C3YA 5E3PA 4K4VA 1NK8A 2VPWB 1JLCB 3V4IB 2CYYA 5KFOA 2WAFA 4CRJA 1N54B 4WWSA 4KKOB 1S57A 2G2ZA 3UCGA 3GJSB 2B3TB 3NNAA 2DNQA 4HTJA 2UV8G 2MQOA 1MW7A 2MJNA 2KJWA 1TKZB 1E6YA 4DX7A 4NA3A 1BD6A 5LJ3Y 2P9EA 1C4AA 2W9BA 3BREA 1Q79A 3LF0A 3KLFB 4DQRA 3EQUA 1UVLA 4U8VA 3IFEA 3JSBA 3QJLA 5BR8F 1C1BB 4XO0A 4IR9A 1KS2A 5F3ZA 3BF4A 1OPIA 1LK5A 2MKKA 2UVVA 3ILIA 3HP6A 5LSOA 3OJSA 3MPUB 1LWCA 5AXLA 4MFBA 1QLNA 4TY9A 1V3RA 1S0OA 2LEAA 1C0UA 5KFAA 3PW7A 2WW8A 4N5SA 4QWEA 3VAFA 2AJ1A 3QRQA 1R8CA 4X62J 1HHSA 1VRUA 4HH0A 4IH5A 3PG9A 2CQIA 2V8VA 3UW1A 3CJQA 1ZETA 1N36J 4KO0A 4NCBA 4YB7A 4RBUA 1YJ9S 3PJXA 1DTQB 1ZOTA 1XNRJ 1X4GA 2KM8B 1X4FA 1JXLA 2HS3A 2HAIA 2OLVA 6FD1A 1YZ6A 5C42A 1YQHA 3CC4S 1HQEB 5F8NA 5HP1A 1QAIA 4OV6A 1U1OA 4RWWA 2R7SA 3OL8A 3G6YA 5ETKA 2HMIA 1Q5VA 2HHSA 3VF0B 4LSNB 2ZH6A 3R5AA 4C8ZA 2G1DA 2E9ZA 4NCAA 1XWLA 1MU2B 2IVMA 4DV0J 5ADZA 3MEGA 3GIIA 1FKAF 3CWJA 2D1CA 1Q8BA 4JI5F 4MYUA 2VJUA 5KFIA 1S9EA 5K14A 2U1AA 2CPJA 3SSSA 3CUNA 1XMOJ 3MAAA 2KU7A 1I94J 4BWMA 3CCUS 4JV2A 2VG7B 2ZH2A 1IKWB 2Z0GA 4DV4F 1S1WA 3C6UA 3H5XA 3OT9A 3KHHA 2UUAF 1TUVA 1S9GA 4J9KA 1V3ZA 1R8BA 3Q2SC 4OI1A 1GQEA 3OL6A 5KG6A 1R8PA 2RHQB 2HBZB 4FZVA 4PWDA 4OHZA 2X3DA 3T1YF 2HHHJ 4FNHA 3QLHA 3OR2A 1BY9A 5SZTA 4NXMJ 4ICLA 4NZ6A 1DLOB 5KFLA 2YX1A 4ZVEA 1FKOA 4R3JA 1TMMA 2IC3A 2IMOA 1NU4A 3W2VA 3LW5C 4M5NA 1WKKA 2ZBPA 4QWBA 3H25A 3OVBA 1N0VC 4CLKA 4RW8A 3UR0A 3C2PA 2CWXA 4FF3A 4MKYA 1HWLA 2QMXA 2ZH3A 4EYIB 3T1HF 3CF5Q 1GT8A 4PUOB 2QLJB 1N5QA 3GV8B 4XIUA 1UZDA 1X31C 3AJ2A 2HBRB 3MEKA 4DWIA 1D1UA 5LXYA 2DNGA 3FEYB 2JFDA 2NXUA 4KPCA 4B3OA 2RDDA 3DRPA 2KXNB 2K8GA 2G2OA 4X4OA 3WX8A 2CZ4A 2D3ZA 5H9FJ 3KHLA 4IG0A 2MB0B 3IWLA 4OYMA 3MF5A 4AXIA 2GFFA 4PEOA 4H4OA 5DO2A 2HURA 2H5IB 3FDSA 2C3PA 2WHOA 1HR0J 2QGFB 2PN6A 5H1SV 4XTTA 2ZBIA 4B3TJ 3NP5A 1WKLA 3ZTRA 5B09A 2I9SA 3VGVA 4RUAA 2C42A 1JX4A 4MK8A 1IM4A 2V8GA 3FSIA 4PXDA 4R0EA 1LWXA 3L7PA 1U0SA 4J9MA 2RSQA 3TUZC 1UJ5A 1KQFB 4LF9J 1WHVA 3RAMA 2XULA 4KFBB 1FTCA 3LOUA 4NMLA 1KRPA 1RABB 2W2NP 1H7XA 3EM1A 2IYIA 3BSNA 3M4XA 4CI0B 3QGPA 3Q24A 3DOKA 2R8GA 2OLUA 3FZ2A 3BKFA 3BV8A 1AUDA 1HNVA 4RW7B 2FHOB 4Q8EA 2VPXB 2BX6A 1RBOB 3V6KA 3KMQA 1NMEB 4MJKA 4DJBA 2HK3A 4D3GA 5B0EA 4Y00A 2J9CA 3NL0A 1S1TA 4GKKJ 1HBMB 4OJGA 3ILJA 2WZ1A 2XYGB 1FNXH 3KLGB 1QTNB 4ZN3A 3TZXA 1RT1B 1CBKA 4B9TA 1Y5IB 4U9RA 2OPQB 3BQ1A 1CJVA 1J5EF 4IFYB 4M63A 3U1NA 3ENWA 3M32A 2O67A 2OPPB 1WORA 4B17A 1NKEA 4IYQA 2RU3A 1HI1A 4AQYJ 3MUVP 2D74B 2KRRA 3GLJA 1FFGB 4GC6A 1NK4A 1WC6A 4EGLA 4F67A 4RUCA 5HVGA 1FNMA 2VFRA 2IJFA 1K25A 3IG1B 4RNMA 1KWMA 2XZTB 1HQUB 4MK9A 5CZXA 2DHGA 4IO9Q 4UOGA 2F63A 4X66J 1IBKF 3KLHA 2NSBA 2VPZB 1FNOA 3DGVA 1L3KA 3D1QA 3MPWA 5J2NB 3QZ8A 2QL5B 1FK9A 1XERA 2ZBRA 1SUQA 4G1PA 4OVDA 4NZ0A 1RAHB 4FBUA 3SQOP 4R1GA 3P49B 2SXLA 2AGOA 2E5JA 5KFRA 4DCJB 3PNIA 1BHNA 4DR2J 2ATCB 4CCHA 1H98A 1VQ6S 3TAQA 4A47A 3AB4B 4FYDA 5GMKa 4CLFA 2XMVA 4QIGA 5M2RA 4NX9A 2XMJA 2GC8A 3AD8C 1YRTA 2OI2A 4UY8T 5DS7A 2E5IA 5KFJA 3BKTA 1CJTA 1ZM3A 2CQ2A 3H2LA 4H4MB 5LSRA 5DG8A 5B7WA 3PZPA 2AZ3A 3ITHB 2DNLA 2HGMA 3UN3A 2XLJA 1YJRA 4LBIA 1KQKA 1F60B 2RKIB 4FYWB 4L76A 2HVDA 4KY3A 1RTJA 2W4CA 2POKA 4CZCA 4X62F 2HVZA 1UEVA 1S0VA 3BR8A 2RAQA 4B08A 2B8PA 4RR5A 2JH3A 1WC5A 3LQVA 1IM6A 2DNZA 4PPZA 5G4DA 1XNRF 2CQ4A 3SZ2A 4B3MJ 2KL8A 2P6SA 3OTOJ 3J7ZT 1RWNB 4DV3J 2BYCA 2M3DA 3UN7A 5HO4A 3KK1A 5HQ8A 1RWMB 4TU8A 2V0NA 2XC9A 4A8QA 5HROA 1NJXA 1RBAA 2XLKA 3BSAA 1V5IB 2XO6A 4FKXA 4M5HA 2DHHA 2P9CA 4BC7A 1VCTA 2VU5A 3BBCA 2OFGX 3ET6A 1ZYQA 2QMUB 4F0MA 4DV0F 4ZCKA 1OY8A 3WC2A 3Q8RB 2RQCA 2KN4A 1ZA2B 4FN5A 2MXYA 1LOUA 4Y6IA 4CLUA 3SFGA 1VIXA 3TX8A 1XMOF 9ATCB 2LECA 2RUSA 1I94F 4C8NA 1CVJA 4P2FA 4DUYJ 4ERDA 4NLYA 1VQLS 5J1PA 3CCQS 4DUZJ 1R0AB 2DB1A 3PRVA 2M8HA 3R5JB 5D0EA 5HQLA 5JMNA 2ZWPA 2RVJA 5H9EJ 1EX8A 3BSCA 1NK5A 4HTIA 3AD7C 4M5JA 4ALZA 2IHR1 1UW9A 2VONA 3MMAA 2HHHF 1VRTB 3W7BA 4NXMF 3EQVA 4LRFA 2GS8A 1JK9B 4O3RA 4OYZA 1WG5A 4I56A 3QSYB 5D4PA 1PC5A 4FPIA 4NI2B 3I32A 1SBRA 4DKIA 1HI8A 3PRDA 1SQFA 3GV5B 2BA9A 4OZLA 3BBFA 1Y7PA 2HLUA 1RLCL 1JWWA 3RU0A 4X4VA 2DNRA 2BRKA 2GQ2A 3K17A 4CT8A 4WJBA 3G6VA 1NKBA 1XN9A 1TFYA 1RTDB 5KT4A 2GVZB 4CLSA 4DQSA 4B9NA 2J9DE 1RBLA 3CD0A 2YKNA 1S79A 1YI2S 3BYPA 3HD1A 4ZN1A 2JZ5A 3PYGA 3HLUA 4QYRA 2B56A 1HWIA 1HR0F 1C0UB 3DLEB 1RHJB 4BBYA 1UTAA 4F0HA 5I3QA 1MN9A 4PWWA 3WIUA 4B3TF 1HQ2A 1VMBA 2BDPA 2CG8A 3DLHA 3W1YC 3UDVA 3NCQA 3IR7B 1FVSA 1HNIA 1U1MA 1RTHA 5K8PA 5B0AA 1BWVA 5A8KA 4LF9F 2KXHA 2V4JA 3I31A 4L3KA 2W7AA 4EO8A 1WKJA 2UUWA 3AHPA 5HP1B 5EUHA 2EG2A 1CJUA 2LYVA 5KFSA 1JQGA 2K1RA 2ZFHA 2WOMB 3R97A 4ECRA 1EHWA 2CJ9A 1TL3B 5FLXU 2DKOB 1QY7A 3ISND 4M5MA 2W24A 3ILLA 4JI3J 3M6VA 2ZJPQ 2E5GA 1MN7A 1RTIB 3JTPA 2KFNA 4P2XA 2AJ4A 2WB4A 1ZPVA 3K8VA 3OVAA 1WOSA 2GHVC 4GKKF 3AQPA 4ITSA 1AFIA 1UETA 4MK7A 4U95A 4B3RJ 2DISA 3MAAB 3K5OA 3LP0A 3KLEB 2F40A 4O4GB 4RW9A 3H5UA 3HMJG 2BKOA 2L08A 2YY3A 4C7QA 1R8AA 1BQMA 3PCOB 2J6SA 4LF4F 3GE9A 1QJHA 1KD1T 2H54B 1RHQB 2E29A 1QSYA 4KIAA 2W8KA 3THTA 1N56A 2BJ1A 4ZVOB 4AQYF 4BWJA 3TJ8A 4KE5A 2KFYA 1BQNB 4PG4A 3P4UB 5E7OB 1XR7A 3BS9A 2DNMA 2DNPA 4G3IA 1PSDA 3QLHB 3J81Y 2HK2A 4ECYA 5KT7A 5AXKA 4LRCA 2V2KA 3EWGA 2DVIA 2EKYA 2BM1A 3N28A 2YNGB 1FKOB 1PYTA 1JKHB 3NWRA 3CT9A 2MQ8A 5DETA 5AXMA 1ZAWA 2M2BA 3W63A 5LOQA 2WVFA 4HR2A 2ZJQQ 2AEFA 2HKEA 4CM2A 1FEHA 4TYAA 2MJUA 4X66F 3HVAA 2KXFA 3AFGA 4I2PB 3W5ZA 1NAQA 4F36A 2CZ9A 5BXIA 3CIZA 1GNKA 1NK6A 2W2OP 2BXJA 2HHTA 2DGOA 1ZH5A 1VC0A 2HG4A 3UI3A 4DV7J 4DR2F 3QRPA 3ISNC 4F2RA 3GTYX 3BPDA 4IFVA 4ZIVA 1LWFB 2U2FA 3FRYA 1SL2A 3P8BB 1HBNB 2DXFA 1S12A 1GXLA 4JYAJ 2AHOB 3UCUP 2ZKTA 1G7CB 4UF4A 5DLFA 2P6TA 1ZPWX 3DRSA 4H4OB 2K3IA 2BQ3A 5CHCB 1N6QB 2JEFA 3NGKA 2G0CA 2J8SA 2GZOA 3RAQA 1HPZA 1KBRA 4J9UE 3KTQA 3SXLA 4C3KA 2FC8A 5J2QA 2LMIA 1H6KX 4ZVGA 1YX2A 3NBPA 4RBTA 1DRZA 3C19A 5DQIA 4O4RA 2ZE2A 4USWA 5AE3A 3E01B 3GYGA 1R8HA 3K58A 3A3NB 2DGUA 1ZM9A 4ID5B 3C14A 1CULA 3H0PA 1T94A 3ZTPA 2CNLB 1U49A 4PG5A 1KHWA 2HVEA 4EFAC 4PG6A 2E7XA 4J90A 5F8IA 4RNNA 4B3MF 2LP4A 3L7UA 3OTOF 2P2CB 4DV3F 1H7WA 1KLMA 3OPKA 1S6UA 1YJNS 3KNAA 2LQJA 3NXZA 3ZZTA 4ES1A 3IRWP 2PA3A 4UOFA 4ZVQB 1S1TB 5G0RA 3QGGA 4KSEB 2GIQA 4CT9A 4CDIA 4G1QB 4I6AA 2QX0A 1RT4A 3AOBA 4X4NA 2XNQA 3CJTA 1FF2A 2WAQD 2CWKA 5CQGA 2GIFA 4KGMA 2X1BA 3U7JA 1FJ7A 2ZOGA 2OEMA 4B3SJ 3C6TA 3GIMA 1NZ8A 2E1PA 4DUYF 4A46A 4Z37A 1T9VA 1RSCA 4FPRA 2UVUA 4DUZF 2V2QA 4K5SA 1AA1B 3D0IE 3SV3A 1NNDA 2WRMA 2EFPA 2AZ1A 1F0XA 4WU2A 3N9UC 2EG1A 4OFZA 4JUZA 2B4OA 3G2XA 4KHPF 3VAJA 2KTQA 2LQ8A 2F9JA 4AFFA 2AEMA 2CJQA 4IDKB 2CJXB 4NCGA 5J1EA 2X1AA 3QSIA 4K50A 1FK9B 2YH1A 2CPEA 5J1NA 1GH8A 3IBFB 4CTAB 2QTWA 1TVRA 4ID8A 2O66A 3OC2A 4KV8A 3WDOA 4KBIA 4K4UA 2RQMA 2CPYA 3TVKA 4ANEA 4CWBA 4P6QA 2GGPA 1JJCB 1GAOA 2OFHX 2MSTA 2GMLA 4K4SA 3M30A 5D3GB 2DY9A 1WSVA 2HFZA 4OMFG 2JLEA 3OHBA 2KHCA 2KG0A 2W9AA 4HT5A 3PHTA 3KOAA 5ETLA 4D3HA 1A9NB 1ZM2A 1MWQA 5CXTA 3CD6S 3OFGA 3D3BJ 1GTEA 3SDEB 4DV6J 1TK8A 1T8EA 3D0GE 1XMBA 2ZITA 4KHMA 1D9AA 4WFNQ 2B9EA 3JYTB 4I2QB 1RAGB 5KFUA 3V6JA 2ZH5A 3GCWP 4DPOA 2B9XA 1UFLA 4KGVB 1FD2A 2OH2A 1YHQS 4FF1A 2N7YA 2OLWA 2V2VA 1RWPB 3JS9A 4QIVA 3D54A 3PKYA 3HX9A 3G8TA 2AYBA 6AT1B 2KI2A 3BZQA 1MMNA 3T9ZA 3NNHA 3R6GB 3BM7A 1EP4A 4JP8A 3RUBL 2YKMB 3KK1B 3R1LA 5HATA 3M6XA 1Q8LA 3GIKA 2LA6A 2YBVA 3UDLA 3MPVA 2HNYA 4LSLA 4A8KA 3TI0A 2ZKUA 1NDCA 5KT2A 5BYRA 1RE1B 3DOMA 5I42B 5KFCA 2DIVA 3R8YA 3EDRB 3GG1A 4NRTA 3DM2B 2EVZA 4JI3F 7FDRA 4CO0A 1I6JA 1HWKA 4I64A 1WHXA 3ET6B 1HW8A 2PI5A 4MNRA 3UDCA 1SC4B 4NYPA 4N8OA 2YWFA 3ZZYA 2E1MC 1B7FA 4PQUA 1T7PA 2N3OA 1O5JA 4KAIA 4B3RF 3FBCA 1CG2A 1B4SA 4NRUA 3FGVA 2LFVA 3TJ9A 3DRRB 2BJ8A 1RADB 5H9EK 1H3DA 3ONQA 1ULRA 3FVYA 3MTKA 1P8GA 3SCKE 3WHIA 2IAJB 1FKPA 4YMEA 2ZH4A 4UT4A 4NEZA 1N33J 1UCNA 3TAMA 1T05A 9RUBA 4QZVB 1U8SA 2Z2ZA 1SL1A 2ABYA 3I5AA 1C1CB 2J7WA 1LW0B 4DXLA 4RW4A 3G8SA 3MMAB 3F44A 2MLXA 2GW8A 4HACA 3QMQA 1WOPA 2AYEA 2QLWA 3MEDB 5JXSA 4H4KC 5ETOA 5IFMA 2RDIA 3G86A 4PYDA 3MR2A 4N47A 4LVNP 3N0VA 2H4YB 4TY8B 1PYOB 3H42A 3QO9A 3DMJA 2OEKA 3BGOP 3I6PA 3LANA 1H2VZ 2YPYA 3KJQB 2E44A 3MOJB 4QYZK 4NYOA 4DL0C 3D4JA 3US5A 4RBVA 4M5DB 2C3MA 5B0DA 4ELTA 3J80U 2BJ7A 4OI6A 2FJAB 4NA2A 3MD3A 3DGPA 2OEJA 2VD3A 4DV7F 3QWPA 3IWXA 1FRJA 2XY6A 2LLZA 4BL3A 3M2VA 2QJ3A 4TKTA 1ITPA 3LA0A 1TKXB 2YKAA 4S0MA 1TV6A 4JYAF 2FJWA 3QRRA 3I4PA 2ZD1A 3WIVA 2DNOA 5IM0B 2DGTA 1SJ1A 3Q8SB 4ZVPB 1U1KA 5F8JA 5KFBA 3NGUA 2EBEA 1N52B 2I1RA 3ENVA 2H5JB 2VBZA 1WF2A 5C5JA 1UW4A 4USKA 3MEEA 1UVIA 1IR1A 2HZAA 4FXVA 2MZJA 4ZJQA 4CO4A 3U02A 5M2UA 1RTHB 3CJRA 2JDJA 1CS4A 4Y0FA 5A8KB 1Q0NA 3ZZOA 8ATCB 2G0JA 3RRHA 3CSKA 4AL6A 3DDKA 4Y2AA 2OELA 5HANA 3JSYA 1A7GE 5LJ5Y 4OJ3A 2ACMA 3MM6A 3KLIA 5GAGI 2I0XA 3U27A 2MLZA 4GKJJ 2BE9B 2BW7A 5D4NA 2WW4A 3KUEA 2X1FA 4EBCA 3LUYA 3VQTA 1Z1ZA 1U47A 4A8XA 3M8SA 4TYBA 1FRIA 5HBMA 3CPWR 3HSDA 5KFDA 5RUBA 4Y2KA 2FLNA 1KQGB 4JI7J 2Y9HA 3BQ2A 2L9DA 1U6BA 4F4WA 1RT2B 1VHFA 3TA0A 4USVA 2Y0BB 3VQSA 3D28A 4KHRA 4MYTA 3UVJB 3MR5A 2VJVA 1CEZA 1X60A 3KDOA 2XNRA 2YNHA 5C7PA 4CLLA 3FZBA 1BQMB 3PXGa 3AODA 1B0TA 4B3SF 2HRYA 2GJFA 2BE2B 1DQ8A 4OZJA 2B7BB 3OSPA 3QNWB 4R25A 2KRBA 4LF8J 2DGXA 5HK4A 1D8ZA 4GVLA 4A48A 2ZUAA 2HSEB 1AZSB 1A6LA 3SEOA 4C8MA 3AAWB 2UUBJ 1M5KC 2FVSA 3AQOA 1JLGB 3NGRA 2XYPB 3M8ZA 4UOHA 4QPXA 5KT5A 4IH7A 2W25A 1JLEA 7FD1A 3DRXA 4I6WA 1NLKL 1U02A 4TQSA 1Y9OA 2KYZA 5GAGU 4ECSA 1NSPA 3H40A 1S77D 2J8AA 1YZ7A 1EIYB 3M1VA 2VDIA 3HI9A 4DV2J 5CH7B 2D7SA 2ILZA 3AXKA 2ZUGA 1Q82T 2QE5A 5T7LA 3WZ0A 1MWTA 2VIHA 2A0FB 2ZZMA 5DM7Q 2BVZA 2MZQA 1GMVA 4P74A 2UXBJ 3TX0A 3HDSA 4CO5A 2JRSA 4IFVB 3ICLA 1FESA 5KG0A 5HVFA 2UUCJ 4M5IA 1LK7A 1OWXA 1YJWS 1S6PA 3ZG5A 2C3OA 2ZOMA 3G82A 3IN5A 1YBTA 2LU1A 4P73A 4X4PA 1E6VA 1KC8T 3FSYA 1QAJA 1PAEX 4KGXB 2RF2B 5M2PA 1G4CA 3CW2C 2OIHA 1IR0A 2DPIA 2F4FA 5KFMA 2Z2YB 4JBCA 3B82A 2XGPA 2HFVA 4DV6F 5K5MA 4K4TA 1HBOA 3ADAC 3LWLA 3HHLB 5AE1A 2ZEJA 4QOTA 4DS5A 4M94A 2PA8D 1VHIA 2MZSA 3HHKA 3D7SB 1T03B 1AYEA 3NS7B 5CYMA 4DR1J 1MWUA 2OPRA 1IUJA 3DYAA 1HMVB 3VZIA 3KK2A 2QC3A 1PCAA 2GAHC 2CVEA 3C15B 7AT1B 1W2BR 2DK2A 2BOPA 2B4VA 4HDGA 1TKTA 4N41A 1VLOA 4WYWA 4ZPDA 3SI8A 4YHHJ 5A2QY 1U2RA 2UV8A 2KVIA 4N8NA 5L1JA 1U6ZA 1B0PA 3ZNJ1 2ACYA 3IA0A 3PX6A 4QCLA 1H73A 1SC6A 4ZHRB 3R2DJ 4C8KA 1C4CA 2EK6A 1P9YA 1TL7B 2JSXA 4DF8A 4MIAA 2OPSA 2BMBA 4H4KA 2R8HA 1B0VA 3FSXA 2F9DA 4WFXA 4OYXA 5HI7A 4DL2A 2A10A 3KG1A 4KTQA 1X4EA 5C24B 4PABA 2WVDA 3CJ2A 2BJ3A 4Y65A 1IJEB 2M0GB 5IQQA 4P52A 5ETTA 2RH3A 4MIBA 2IA0A 1N33F 3OTBA 4AXJA 1IR2A 2VODA 3MAQA 3T5LA 2HBYB 1VBZA 1JB0C 5DG9A 3DLBA 1M5PC 3NGTA 1S1UA 4C2MA 3ENAA 3G87A 5GADI 4R8UB 3UNYA 2X3GA 3A12A 2RRBA 1JLFA 1KOOA 4LJMA 1IKYA 2I6WA 3GP9A 2PE8A 5F3TA 5J1EB 2FLLA 3CO9A 2FGOA 1J2VA 1Y4ZB 3KK3A 1IKXB 4YQWA 4WF9Q 1VJWA 2V34A 2ASDA 2OTLS 1OYEA 1TVRB 2W2QP 3T41A 1EKRA 5KSHA 4I7FA 5EWGA 3SMZA 3KFWX 2NUUG 3EXYA 3FKBA 3W3SA 4WCEQ 2HFOA 4PXBA 5F9LA 4CYUB 5KG1A 2MGZA 1X4BA 3D0HE 3TOQA 3EYZA 5IV4A 2QSFA 4ZPCA 5GMEA 2HWTA 4UY85 3HKZD 2DRBA 3TZWA 3W64A 1QSLA 3QATA 3M30B 3CJ8A 2ZOFA 3W2WB 3GILA 3QIPB 2O5DA 1VBKA 1F2HA 4QR0A 2CJBA 5KT6A 3P3DA 5J2MB 3LGHA 2ROGA 4DX6A 2PT0A 1IBCB 4MAKA 1Q53A 4HL9A 3EGZA 2RQ4A 4ED3A 3MUMP 2VICA 4PZVA 4LR9A 4MH8A 3GR0A 1GEHA 2CPZA 3P45B 1QVFR 1UA1A 2OP5A 3ZZUA 4F02A 2XY7A 5GADU 3K57A 4DSJA 1ICEB 1D3WA 2JVOA 1WELA 2JC1A 5EDWA 4CO1A 5EWEA 2O01C 2H9ZA 4CO2A 3J7Z5 2M5YA 4DG1A 1RQ0A 3GYXB 1S97A 4ED7A 1JLQB 1EP4B 1D09B 3P96A 4DFJA 4HHJA 3K5NA 4C9DA 2J0XA 4X84A 1RXOB 4DEZA 4MKVA 5FIIA 3MM7A 3OBIA 3CC2S 4GKJF 3B54A 2HPUA 1TELA 1JLBB 1LFPA 3UCZP 3IXQA 3Q2TC 4DZ6A 2WTFA 3HFZB 3LO7A 1UWAA 2EFQA 4JI7F 2ZH7A 3TVZA 2EXUA 2XI3A 3DOLB 5F8MA 4NLGA 5KFEA 4O3OA 1EETA 3UPNA 2MLYA 2MMYA 2M9KA 2F7VA 4Q0BB 1HYSA 2HIYA 1DQ9A 2EW9A 4NLVA 2VA3A 1SCJB 1SL0A 2EC2A 4ZP9A 3G9CA 1EKSA 1Q1KA 1XR5A 2PO4A 3W61A 3LPEA 3CCTA 2LDYA 1VISA 3MR3A 4DV1J 4ZCMA 2B5JA 1FKPB 2A6MA 1S76D 2FJBB 2ZVSA 1FWKA 3GJTB 2DIUA 4LF8F 3FCVA 3LGMA 1OPZA 3VZHA 1M5OC 4LRDA 2V63A 4L75A 3MD1A 4Y28C 2WVEA 2XWXA 3BGRA 3JTOA 2UUBF 3BB5A 4TNOA 1KR4A 4QU6A 4JI4J 2MY7A 2GV1A 1U0HA 3UO0A 4GO7X 2F8MA 4PYAA 1KEKA 2XMTA 4LFBF 4XAKA 2RE1A 4M5KA 2BRLA 3N79A 1KDNA 1RT5B 1CJKB 4B9LA 4CO3A 2PFDA 2E5HA 4R5PA 2XSFA 2ZZTA 3MR7A 1NPKA 3W5XA 1X9SA 3WX4A 2E66A 3SIPB 1N4LA 4NLUA 4A8FA 4V1Ak 3CDEA 4DV2F 4B9MA 2V6AA 4N7TA 2XI2A 2PMWA 3EGVA 4OI2A 5IT4A 1REVB 2KG1A 4C6AA 4FBTA 4CJNA 4ZLNA 4IKAA 4LF5J 1OSCA 1U26A 4FVCA 2UXBF 1HLWA 5KFNA 3M2VB 2R7TA 4ANDA 3LO3A 4DCOB 1S6QB 2BUNA 3S1TA 1LKZA 1TV6B 4UOCA 3K89A 3T5KA 3DLKA 3CCSS 2V50A 1W26A 2DNNA 1U45A 1U1QA 5HSPA 4K2XA 2UUCF 5EX0A 2ZD1B 2Z2MA 2MQLA 2KM8C 2XHWA 4TQRA 3OR1A 2WONB 3UPFA 5J2PA 4CNZA 2B6AA 1VQKS 5CD4H 3JSMA 1DHMA 3T1AA 3NGDA 4Q2MA 5A8WA 2RNEA 3LP1B 1N5TA 3BDPA 3CIMA 4F4YA 1CC7A 3M8PA 4DSIA 4NLRA 1JNRB 5LT5A 4QQBA 3ZFZA 3H98A 3CCLS 1S99A 4WFAQ 3KJVB 1NH8A 1YITS 4RU2A 1CS4B 3OFHA 4MKAA 4XDCA 2Q43A 2VG5B 1WWHA 1U1PA 4DR1F 2QN6B 2P8IA 2DXEA 2YWGA 1QUPA 1LW2A 5AE2A 3HD2A 5L8RC 2YNFA 2BABA 1MWRA 1FDBA 5L39A 5BJRA 5I3UB 2MHNA 4YHHF 1LFWA 1FJGJ 4OZ5A 5KFVA 1XK8A 2CZVC 3RTVA 5FD1A 3BGLA 3PO4A 3SYZA 2XSJA 4L73A 3RYLA 1S4FA 4LVOP 4F4ZA 3FCWA 4LF2A 3M8RA 1ZAXA 3NEKA 1S1XB 2RHSB 4IOBA 1D9FA 4RX6A 3PV8A 2YXLA 3A8EA 4LREA 4IRDA 2GHWA 1B64A 1SQEA 2DR6A 2HNZB 3A8JA 1TUWA 1IXKA 1IQTA 3HSZA 2ALZA 4F2SA 4IUFA 3L7OA 2LEBA 4M5GA 1G2EA 3DFEA 1ZZNA 3A4TA 1Z4UA 2ZM6J 5IV3A 3F73A 3KHGA 3IC1A 2E9RX 3POTA 3ENQA 2E1CA 5L1KA 4PQAA 2KYXA 1FJCA 4KT0C 1TQLA 4AUKA 2FVPA 4L3NA 2HW3A 2HFNA 3TARA 2YKOA 5ETNA 4DX5A 2YTCA 2QL7B 5ITHA 2V94A 2ZVIA 1FDAA 2ZNZA 1NCLA 3V6DA 4ILMA 3KLVA 3A13A 3DLGA 3I0RA 4CLWA 2PEHA 3AH6A 2Q3PA 1IWGA 1T9WA 1VQNS 3KDNA 3OUYB 4WKYA 1AT1B 1RWVB 3MCMA 4JOUA 3DCAA 2LXIA 3VALA 1DJ0A 2CA9A 3S6EA 3K5MA 1N5YB 1O8BA 2C2MB 1TK5A 4J9OA 5C2CA 3PFOA 2HVIA 1DTTA 1NDLA 1RAOA 1K47A 2K3KA 4Q8FA 2FZKB 2K7KA 1ZM4A 3M8YA 3V81A 3DI6A 2B9YA 2KT3A 4I67A 2KB2A 2V9KA 1HHQA 3ZC4A 4K59A 1WG4A 3X3UA 4NA1A 3TNVA 2XGQA 2HHQA 4DR3J 2JEIA 3FFIA 2NYIA 4USIA 2IBKA 3CGIA 1P1TA 2B8QA 3C16B 5ETMA 2CQPA 1K1QA 3MMCA 4EYHB 2MZRA 2OPRB 2QRRA 2ZH1A 1APSA 3DYAB 3H2UB 4BL2A 3R7NB 1YDLA 1F5CA 2KKHA 4EU0A 3VCDA 2BJEA 2ERRA 2MQPA 3OFEA 5MAOA 2AJ0A 3ZO7A 4YR3A 2J6TA 5IC4B 3TWZA 5E3RA 4J7CA 1JLCA 5M19A 3HVTA 3FBEA 2A6OA 1M1HA 1SJQA 1OJ4A 4KKOA 1BE4A 3VAHA 4J9RA 4EUVA 5FDLA 3D6FB 2DHSA 2IDLA 2FVCA 2IA6A 2PD1A 2VB6A 2AIRB 5IXUA 1TKZA 5DZ6A 1R0BG 2ADBA 5E2QA 3V6HA 2EEYA 2XY5A 3H59A 5L38A 4Q5VA 1HWJA 5L1LA 1NJYA 1HNXF 1QE1A 1MROB 3QPIA 1X9MA 3KLFA 3TW0A 3DHWC 3NCPA 1M5SA 4DPTA 2FJEB 1TZ0A 3EMTA 1C1BA 4OHVA 1JJHA 4F7VA 3W66A 4MT1A 5HMXA 1NK0A 3EZUA 4DDFA 2NPIA 4DV1F 2EFOA 4C3LA 1WHYA 1FCAA 4F26A 4RNFA 5CD4A 2N4CA 3T3FA 4K4XA 3W8GA 3T9NA 2VFUA 2JC0A 2K7JA 3I87A 4RNOA 2NQPA 4ZVFA 1IBMJ 2YH0A 4BC9A 1YLXA 1JLFB 2C2NA 2UZAA 3O5TB 2Q66A 3RW7A 4JI4F 4QJGA 2GQCA 2PDAA 4DQIA 4IG3B 1FX2A 4LRAA 2YKPA 2J76E 2YNIA 3V2UC 4CLYA 1DTQA 3ELHA 4CP5A 3G4SS 1VBXA 2KVQE 1HNWJ 1CPZA 1HQEA 3MWBA 4BHQA 1SVDA 3AJ1A 3BQ0A 4ZPAA 5IT9U 2ASYA 3QFWA 4TU9A 4R23A 1EJ7L 2H4WB 1X4AA 2NZ4A 5EGYA 2IM1A 3HJVA 3VAKA 4I6YA 2KDOA 1PJ5A 4LSNA 3EVMA 2PEBA 2QO3A 2HIQA 1MU2A 2AMCB 1V6HA 4LF5F 3HF5A 4B02A 3SQGA 3FBBA 1RA7A 3QT5A 1EQMA 1Z2ZA 5BYQA 3DXSX 3BSOA 3ZNUA 4J5OA 3VHQA 2N4DA 2BANA 2DHXA 4ZDNA 1UFWA 3C8YA 4W98A 5ETSA 2W9CB 3EZOA 3IM9A 5DDPC 1TL1B 2VG7A 3UN5A 1IKWA 1UEKA 2V9WA 4IRKA 1DFDA 4FS2A 5D0HA 1FHTA 4V19X 3D5MA 4DBQA 4X4TA 4Y3CA 2BACA 6FDRA 5DJBA 2FC9A 5FJ4A 3FMWA 1NDPA 3CDBA 1F9EB 4YEAA 4YFUA 4LF6J 3QBCA 2XMUA 2AX1A 3PEHA 3PIOQ 1DLOA 1F1BB 4LF4J 1KLNA 4RUHA 3FQKA 2JLFA 3ZZ0A 1Y10A 3M2RB 3OTCA 1IKVB 3M6UA 4UZCA 1BWEA 1RWXB 3HZEA 2PSZA 1FA0A 2XMKA 1S6OA 4ZVRB 2RQKA 4Z7CA 2HQIA 1XC9A 3M8QB 1FJGF 3FEZA 3L09A 4PUOA 2J9EA 1W7WA 4USUA 3SCJE 2MKJA 4F4XA 2EI5A 4O44B 3PW2A 3CO0P 4HI2A 4X4UA 1HYSB 2HZCA 2XBPA 1KVKA 3H5SA 2DITA 3CDUA 4QJVA 1HFEL 1RT7B 3NCRA 3QGIA 4DQQA 3RB4A 3L3CA 4OI3A 2FY8A 2QZ8A 1UVJA 4ZPVR 2ZM6F 2VG6A 3QWUA 2D9OA 1KP6A 4GVBB 4W90B 3TAPA 3MM5B 1TL5A 2Y8WA 2P5VA 4GMKA 2XHCA 4L6V3 3MM9A 1RT3B 4FXWA 4IO1A 1SKWA 3FQLA 3IP0A 3UFCX 1LWEB 2AX0A 2IMWP 1U0HB 3MCSA 3MM8B 3L95X 1YJUA 2RRNA 3NRBA 2OO4A 4ZS6A 3CJKB 1F2GA 3U1LA 5C25B 2XZDB 5D4LA 5A8RB 4KFBA 4KB7A 1K73T 4QW9A 4YN3B 4M1KA 1RA6A 5A6WA 4K8RA 4F50A 1YTYA 4J9QA 2YWHA 2B0GA 3PR4A 4ZLLA 4EZ9A 3M2UB 3AJDA 4FP9A 2BQRA 2MSSA 2VDHA 4CH1A 1HIYA 5DQHA 1U2FA 2BW2A 3MI7X 4ZP8A 3O3LA 2RD5C 3NNCA 1T11A 4K4ZA 2P9GA 4F3QA 2ADCA 1HBMA 3NGSA 1TMJA 1YBUA 5HLFB 3KLGA 2Z30B 1Y5NB 1Q8KA 1VGYA 5F0UA 4K7QA 1S9FA 1NM2A 1F5AA 1RT1A 4DPYA 2UXDJ 3OR1B 2OPQA 3LP2A 2AKWB 4HH1A 5AJ3J 2ILYA 4IFYA 3WC0A 1S7IA 3PYEA 3FC9A 4AT1B 1UWBB 3TANA 2DGVA 2KT2A 4DR3F 4QIWD 1TP7A 2Q6BA 4Q43A 5DGAA 3G96A 3JTNA 4R0JA 4OYWA 2D3O1 2GAGC 1SV5B 2LQBA 3NMRA 2CDRB 1GMWD 1JJ2R 2QV6A 4O0NA 3FK4A 1PGZA 3R9LA 2COLA 1FXDA 4LFAJ 3S8SA 5DDRC 4P2MA 1WD6A 5CYJA 3IG1A 1UA0A 5DGBA 3MR6A 2R7XA 1HARA 1DBDA 2KFZA 3G6ES 1HQUA 4NXNJ 3QFHA 3BPSP 1KSPA 2VC0A 2BOAA 2J5AA 4BCAA 1M5VC 5KFXA 2V5HG 1NK9A 3J81j 2DEJA 1ZBTA 5J2NA 3IR5B 2VBXA 3IS9B 3AOCA 1T95A 4KHPJ 4HHUA 3DWKA 3NWGA 4DL4A 4UUWA 4OX8A 2LKZA 2F1FA 5CYQB 1KQSR 3MPYA 2V69A 3D9BA 3OD2A 1K8AT 3EJMA 1FRMA 1TKDA 4XPCA 1RGVA 3BGUA 2RIJA 2I5JA 4ZP6A 1FFWB 1TUGB 3S7RA 3GYNA 4ED2A 3Q23A 3CD5A 3HKWA 3IAS9 2R7RA 5U47A 2OD6A 3QT6A 2H5EA 2HAFA 2IVFB 1P1LA 3OTEA 3EVOA 4H4MA 3QYYA 3AB2B 1MNEA 4OHWA 4WE1A 3SSQA 2CJAA 1E6YB 4NMXA 3ITHA 2FYXA 1IBLJ 1NK7A 1RAJA 1DQAA 1EAYC 2W9BB 2RKIA 4C48A 1R7IA 4A4JA 1OMSA 4U6PA 1IBMF 2HYIB 4FYYB 2VHGA 4WFZA 2VZ9A 4P72A 1RWUA 2H51B 1RU2A 1LWCB 3I0RB 4MFBB 1RAAB 3P6YC 1PC4A 1F9FA 1IQZA 4OZNA 4EO6A 4O3PA 1B99A 4UTGA 3IR6B 1HNWF 4E0DA 1NHUA 1VRUB 2CIMA 1VR6A 5KG4A 3O6QA 2NXJA 3UD3P 3CMQA 3U1MA 4NYZA 4KO0B 3NMAA 4WP9A 3ZTSA 1HW9A 1VK3A 2NYHA 1VDHA 2R8JA 3CCVS 3DU6A 1R6VA 4WYLA 1WG1A 4KC5A 1T9TA 1K0TA 1U25A 2LEPA 5C42B 2I8EA 4LMZA 1FRHA 4F3MA 2XMWA 3CJSA 4EBEA 1P6TA 1UP1A 3H2VE 3GJQB 4ZJLA 2D3UA 4OZ2A 4TVAB 2HMIB 5F41A 1Q7LB 2DR8A 2H48B 1XTZA 3FNNA 3BN7A 3W60A 4YR0A 4L72B 3O2IA 4F04B 4QWAA 4Y2IA 2D69A 4FKYA 2MY8A 5ETRA 5D0RA 3MEGB 4YP3A 1R0AA 1BGXT 2EKNA 1S9EB 5K14B 3HCXA 1LV5A 3DLJA 3MHYA 2M70A 2QLXA 3AA8A 3TQEA 3EDQB 1RAIB 2G2YA 2ZJRQ 4FDFA 3EICA 1X8DA 4HI1A 4LF6F 1Q81T 2Q1LA 4ED1A 1VRTA 3Q89A 4LFCJ 1VFJA 1NSQA 4CM0A 1Q95G 4ZCLA 1N5SA 1V5VA 1S1WB 2NS1B 4NL5A 3C6UB 2CG4A 3OQ2A 1S9GB 3LPYA 1OIAA 4Y2CA 3MFHA 1DARA 2VFTA 4FS1A 3HVTB 2E7VA 5F8LA 2IM0A 4NI2A 3PJWA 2IVYA 3B6BA 3CCJS 4PWDB 1GTHA 3Q8PB 1SH0A 4DR6J 3OR2B 2DJWA 5FDLB 4ICLB 3AT1B 5D8HB 5D6GA 1DURA 3M05A 1WTFA 2IC3B 5I4MA 4DFKA 5LMNJ 1EQ0A 3W2VB 4F4KA 5E41A 2UUTA 2HBQB 4FNIA 2R2RA 4X4QA 3ZZRA 1QE1B 4C0BA 4ZITA 4A8YA 1RTDA 2GVZA 1TL4A 3TR5A 4C8YA 3H8YA 3OHAA 4RW8B 3GPAA 4ZLJA 4ATNA 1WDTA 3TUJC 1X5OA 2D41A 5KG5A 2FB0A 3RRGA 3GSIA 2UU9J 3QT7A 2QA2A 1RDRA 3VSKA 1H0HB 2W7OA 3TA1A 4XDDA 1YG0A 3B4MA 4KPYA 2V68A 2CNKB 5E3CA 2HRUA 2ZBCA 4QIEA 3DLEA 1YJVA 5H9FK 3LH2S 4DPUA 3OXGA 4B3OB 3DRPB 2IBOA 3UDEA 1Y5LB 4QR1A 3E2EA 2RDJA 3CB4A 4IG0B 3IM8A 2Y1RI 3BO2A 4YB6A 2V8PA 4J9LA 1RB0A 3M8WA 2UP1A 2X1GA 2YNIB 4A8SA 5KG2A 2OHDA 4HEA9 3AOAA 2DR5A 4DFPA 3MGJA 1IJFB 1YJTA 1CLFA 2NR0A 3GU0A 2ZHBA 2BZ2A 3PYFA 1QSSA 4WZQA 2EK1A 2QMWA 2VASA 3RB6A 2WVBA 2B9WA 2H1YA 4C4WA 2FTRA 2WOMA 2AQ4A 1WC3A 4F4AA 1WC4A 4ECQA 1TL3A 4F25A 3CCES 3HPOA 2HQCA 1UVNA 2XTJP 1RTIA 4YDXA 2CKWA 3HVWA 3SQGB 5FLXY 3DOKB 4FYXB 3CE8A 2QFJA 3FRZA 1FDDA 1R43A 3VSLA 1T02A 2BANB 1HNVB 3RB0A 4RO0A 2FZGB 1BLUA 2HVHA 5F8GA 2DO4A 1YRXA 1H74A 3KLEA 4O4GA 2UXDF 5AJ3F 2FY1A 4DN9A 3L4BC 3KG4A 5SUHA 3G6XA 3KWMA 2DH8A 3I9ZA 4WKRA 1U4BA 2Z2LA 1MWSA 5IWAJ 4USTA 1ZTWA 4AE5A 1ZZFA 2WADA 1BQNA 1K9MT 3H4BA 1S1VA 1CJVB 1KVIA 2FVRA 2V67A 4LFAF 2IIHA 4OZ3A 3CC7S 1VK8A 4URSA 3M32B 1WDDA 2DO0A 4X64J 2YNGA 1JKHA 4WU3A 3BKUA 1SB6A 3G71S 5KFFA 4NXNF 3N4WA 4CNYA 4IRCA 2M8DB 2MZTA 3BO4A 1IN0A 4I2PA 4QWCA 3GR1A 3KUGA 2L3MA 2QEXS 1NHKL 3PX0A 3PFEA 1RI7A 2R42A 4MIWA 3T6JA 1TAQA 2XQCA 4YY3J 4Y34A 1YK9A 2NSCA 3RGIA 3S01A 1YWXA 1WTBA 2E9TA 4DL7A 1VQSA 3LAMA 3R7SB 5B0CA 3KLHB 1RHRB 3HO1A 1N8RT 2B43A 2CVIA 4LIRA 1S4EA 2Y0SD 3R1HA 3W65A 2QLBB 3QAUA 1GMWA 3R6LB 2LQ5A 1LWFA 1O51A 1SUQB 1HBNA 2VC1A 2N82B 1MWYA 2IJRA 2VG6B 5IOLA 4BLGA 2FDNA 3VVUA 4Q2LA 1S10A 1AB8A 1X7VA 1N6QA 1PIEA 3R5DA 5L9XA 3GFXA 2R7VA 3UN2A 2MQMA 4JB8B 3MM9B 2Z56B 1IBLF 1NPRA 1GXTA 1VQQA 5D0GA 3M9MB 2Q6CA 4ES2A 4W4MA 4G65A 4N1XA 2XCPA 4ECWA 3IMQJ 2CQHA 5CABA 5KTQA 4JI2J 1CJTB 4DR5J 4R0QA 1RJJA 3UE2A 4RNHA 4YUDA 1PO6A 2QA1A 3E01A 3I96A 4O3SA 5E3AA 1PYSB 1HHTP 4ID5A 2HFUA 1FRLA 3P5TL 1B3TA 3F41A 2V4QA 4PWUA 2H65B 1WI8A 2RRAA 3D1OA 1S0MA 5GAHI 5KOWA 3OXLA 3GIRA 1RTJB 3EE3A 3THVA 1N32J 3TUPA 3I5CA 2EBGA 5A6PA 4C11A 4LR8A 3K5PA 4LR7A 2WCXA 2R2SA 5A0YA 4KGZB 1O0PA 5KG3A 3ULHA 4YB1P 4K5RA 2JLGA 2YKQA 1KONA 4DHVA 4G6VB 1I51B 1ELOA 3CJ5A 3N5BA 1N0UA 2E7WA 4UUXA 4OX9F 3CULA 4G1QA 5HN0A 2Y8YA 2OTJS 1VC5A 4UQTA 4ZMMA 4IH6A 4ELVA 3EXCX 3JQKA 3M9OB 2DGQA 3K8WA 1VOMA 4ETZA 3LP2B 2EPIA 3MCOA 1RP5A 2JOQA 4N76A 2CQGA 2DR7A 3PIPQ 2K06A 1S7HA 5AXNA 5HROB 3D3CJ 2DNKA 2CUYA 4TLQA 3OLAA 3J7A1 4P9SA 1U6FA 2HZVA 1FRKA 3PY8A 1X4DA 3D66A 4ECVA 2LXFA 2UXCJ 4ZVHA 1NO8A 4ILLA 1WC1A 4ZIWA 5IC6B 2W4DA 4RL1A 2E1RA 2QA4G 4LFCF 2C2RA 2WSCC 1R6YA 1NB2A 1G3OA 1OS5A 2J7KA 2WBRA 1FEEA 1TU0B 1H2TZ 4IDKA 5GAHU 3ISZA 2NUHA 1FWLA 1T9UA 2CFXA 4PCQA 3HHLD 2VBWA 2V2ZA 1RWOB 3A3OB 4U7UD 3M6WA 5CAAA 4K4WA 4OYBA 4U8YA 5DRKA 2HEKA 4CTAA 2MDAA 4DR6F 3NAIA 4QR2A 2X51A 1VJQA 2DRDA 2FJDB 2CQ3A 2L9WA 1QVGR 5K9FA 2ROPA 1MMDA 1WEXA 2I5JB 1TTHB 4ZVUB 4UQGA 5LMNF 2OSRA 4P75A 2CQBA 5L9NA 3BN4A 1N34J 1J5OA 2MKIA 4ZP7A 3AD9C 3I56S 1PILA 4DOZA 3NAHA 3KNGA 5D3GA 2MKSA 2Y3YA 4RPFA 1NJZA 5E5NA 4WE1B 3UWTA 2UU9F 3EPGA 3DKDA 3UPOA 2OJ3A 2DD8S 4WIIA 1AFJA 4ZKAA 3SDEA 1WUUA 1G6BA 5IQ6A 1SXLA 1U48A 2AWZA 3JYTA 2MEWA 2LQ9A 1BMQB 4I2QA 3MDFA 4L74A 2C3UA 1JXEA 4OZ0A 5KG7A 1YVFA 2YKNB 1G1XA 4ED0A 5KFTA 2R4FA 1F3VA 1N36F 4NLSA 2JFKA 1RYRA 1YKWA 2DNHA 2CQ0A 2QIFA 3RBZA 4OLPA 5HMYA 5T14A 3LAKA 2Z8QA 4USHA 2RS8A 1HNZJ 4NOHA 4QWDA 2YKMA 2VH7A 4C8LA 2NPFA 1SKUB 2A2CA 5T41A 1HNIB 2FD2A 3D6TB 5HMWA 2HLTA 3HHLC 2NXCA 3W9HA 3C46A 4B9SA 5I42A 4ZA1A 3OL7A 3DU5A 3DM2A 2V4JB 4DS4A 4NPOA 3GFHA 4C0HA 2CRLA 2CNOB 2J0SD 1RKIA 4DR4J 1FXRA 4ZLPA 2D9PA 1CJUB 3T6BA 2HQGA 2G13A 3VGTA 2ZZNA 2GO9A 2HQFA 4YB5A 2K1RB 1WEZA 1RCOB 4ZPWR 4DCPB 4WP3A 1FTRA 3DRRA 3NG8A 3O8WA 1P9QC 1MWZA 2IAJA 1CC8A 2MYFA 2CJKA 2HNDA 4EK2A 3BH7B 5IWAF 2WSEC 3CEDA 2V4RA 3LP0B 1C1CA 1LW0A 4DR7J 4E98A 2DNYA 3C3LA 4RW9B 5KT3A 2AP6A 1AXQA 4ILRA 1WEYA 2NLWA 4X64F 3MEDA 4IR1A 4RW6A 3HK2A 3RR7A 4ZCIA 3SSRA 1SC1B 2GQQA 5KAKA 3J81U 4WFYA 4P7TA 5JUMA 2MPUA 4TY8A 1O6XA 1VQ9S 1V3SA 2CPDA 3EZ5A 3D6MB 2F65A 4ED4A 2JVRA 4ER8A 4WTOB 2AF6A 3OXFA 4LBPA 4M5DA 4YY3F 4O23A 4LFBJ 4URQU 3D1HA 2M7SA 5D77A 3BBBA 1OQ3A 3UPPA 3ZG0A 4ED5A 4QYZJ 4EEYA 2FLOA 4OX7A 5ETPA 3ILOA 1KOHA 3J80Y 4WIQA 4PXEA 3QGHA 5DDOC 4WXOA 3KG0A 1TKXA 2CPXA 2BV3A 1BUXA 1RISA 4RZRA 2EFGA 4HDHA 1SC3B 5IM0A 2Y1JA 2F5GA 2W8LA 1WC0A 1R27B 4DU8A 2ASJA 2AJFE 4IOAQ 1KHVA 1A0OB 1GX6A 3IAM9 4DN0A 4JI8J 4OX6A 3VVTA 3PEJA 2KT5A 2CPIA 5B08A 3M7VA 4O3QA 2MHEA 2ZC4A 3BR9A 1RK8A 3QAEA 2HQ3A 2MKYA 4JI2F 1HD0A 3DRSB 1NUEA 4DR5F 1D0EA 4KRWA 1SPBP 2HHUA 2MKCA 4OV1A 2DH9A 2FJXA 4IQMA 8AT1B 4ZJOA 1IWAA 2M88A 5HAOA 1FXLA 1KTVA 3RBXA 2FVQA 4LSZB 4DPWA 1HPZB 2IFXA 3I82A 3D68A 5J2QB 1SJ3P 3X1LB 1T0TV 1XEZA 3NBPB 2X7IA 1H72C 5D15A 2A18A 1N32F 4OQJA 3TJAA 2ZE2B 3DRYA 3OVSA 2ZDOA 3HT3A 2XB2D 3GV7B 4ZK7M 4LBHA 4IOCQ 3NLCA 2W2PP 4Q7AA 3C14B 1CULB 5KOXA 3Q86A 3T5JA 3A3PB 5EN1A 4MKBA 4ED8A 2HHPA 2DY1A 1TAUA 1QMEA 4M95A 1RT2A 2YVSA 1RT6A 2AJ2A 2FJVA 1WACA 2AV5A 3RG6A 2HHXA 3NOGA 2IPOB 1U8WA 3UVJA 1KLMB 2HHWA 3PW5A 2ZH9A 4O3NA 1VQ5S 3HM9A 2OAUA 2VUGA 2IRYA 1U2CA 2BE2A 5G0RB 3NS6A 1XQIA 2DXDA 3RBEA 1N48A 4RLEA 1K1SA 4KGKA 3TZYA 2DGWA 1RT4B 3RRKA 2V8HA 1Q16B 1FJEB 2UXCF 1AZSA 1S1VB 2C2EA 2DR9A 3R3TA 4PPDA 3IWNC 2LXUA 4OJ1A 1T3OA 3PKMA 1JLGA 3TQ1A 1L3VA 4PXCA 3GFZA 3NKYA 3C6TB 2GMJA 2JNJA 1U7LA 3DDNA 2MZ1A 1BXNA 4FF2A 3FBFA 3VGUA 1SH3A 3W5YA 2JL9A 3WBZA 3PJ9A 2JWNA 1X0FA 1XNQJ 3PR5B 4LIWA 4NLPA 5E0OA 2VQEJ 2CNNB 4U96A 2QT7A 2FLPA 2QSWA 4IQXA 2FIUA 1NXIA 2ZWOA 2V8DA 1NJIT 2VL1A 1I5OB 1LEOA 1RKJA 2R2TA 4DU7A 1L3SA 4NCGB 4N56A 2BM0A 3ZTOA 4DSFA 2KHDA 1WHWA 4J9SA 1X9WA 4U7CA 4X4SA 2JHEA 4USJC 2RJZA 2GX8A 3GG0A 2YQ0A 4ED6A 1FDNA 2GIRA 3SCLE 1N34F 2OSQA 3KJNB 3MECA 2B4UA 1HBUA 2VFSA 1QM9A 4KV8B 1Q7YT 1X5PA 3QQCD 2RF2A 3Q22A 1HL6A 3R27A 1PKUA 1VRQC 4DQPA 3H5YA 4OYAA 3BGFA 2GGPB 1VQPS 3HHLA 3N01A 3MAHA 2M4MA 2FHKA 1YJ7A 3HHNB 4WP8A 1T03A 3MUTP 2XMMA 4I0WA 3IGVA 4ECXA 3H4DA 1YBAA 1HMVA 3KJFB 3NY0A 4WFBQ 2W4PA 3OV7A 2I38A 2E1AA 1RACB 4GRSA 3C15A 5JVGQ 1XMQJ 1HNZF 3Q8YA 4JI0J 5KFPA 4C11B 2ZDPA 2BBEA 3JXOA 4OYOA 5A0YB 2FHJD 1R89A 1KFSA 2HRTA 1NDKA 3PYDA 1NPPA 3OSNA 5LL6d 3IRXA 4ZHRA 2YX4A 1N5VA 4ZVSB 4DR4F 1TL7A 2Z58B 4K2JA 4KH0B 3KMSA 2EFNA 1K44A 2CQDA 3RW6A 1KFDA 3GSDA 3HJFA 4JI1J 4OYPA 3R2CJ 4LSLB 2HNYB 4YOEA 4DI6A 3CCMS 2H3EB 4ZPTR 3DOMB 8RUCA 4J91A 3JSRA 2BE7D 1FERA 5C24A 2PMZD 2ZC3A 3RR8A 3J7AN 3FCHA 3BYRA 4P2SA 1X4CA 1RUSA 2YQ3A 4JI6J 5DLGA 2DYAA 4DV5J 4U67Q 3O1LA 1VYAA 1R0CB 4LRBA 2CQCA 4PQUB 1M1KT 4DL3A 1DZ5A 1HNXJ 5IZHA 3EPIA 1C2PA 2FZCB 2XWYA 2R8IA 4DUTA 4DR7F 4HLBA 4CH0S 3JAMY 2DT9A 1TFWA 4R8UA 2CAJA 4WTYA 4XPEA 3MXHP 3MMBA 3K2YA 1RZMA 4I68A 3MCNA 1JJ4A 4C8OA 3TAMB 2GNKA 1T05B 5THWA 1C0TA 1JIHA 3LGNA 3PVXA 1IKXA 3BEGB 4RW4B 3FEXB 4LF1A 4NLTA 2AT1B 1RHMB 1J27A 4HACB 1IVZA 2LDIA 4RU9A 3OLBA 2LVWA 5KFGA 4CYUA 1QTMA 1Z2LA 1NSKL 2J9DA 4NASA 5CA5A 3CD7A 1M5HA 2ZH8A 3CTRA 5CZVA 4NLXA 3QO9B 4PAAA 5DZ7A 3DMJB 1J5OB 1PJ6A 1F9HA 1RCXB 3W2WA 3K5LA 1Q5YA 2MQQA 3QIPA 4QU7A 2AGQA 1NSAA 4NLDA 1GMUA 2VKRA 5J2MA 2LA4A 4AL5A 2C2KB 4E8UA 1KVJA 1FD8A 3V5RA 2B7CB 1OYDA 2F4VJ 2B4PA 3AXMA 2CPFA 4NE9C 2VV5A 3DGPB 1UZHA 4DFMA 2K2PA 1ZTTA 1UFKA 2HGLA 2CPHA 1RWKB 3GFYA 4JI8F 4JV5J 1URRA 4JV1A 3VAIA 3F56A 5M1AA 2VPYB 5K20B 4NLWA 4Z7YA 5KFYA 2HWIA 1WJ9A 3TZZA 4AL7A 2XS7A 4A8OA 2L9NA 4X2BA 1PJ7A 4FYVB 2NZCA 2NCKL 3D6HB 1JLQA 2BR0A 3MEEB 1UAWA 4J37A 4HKQA 5ETQA 4QPTA 2YX7A 3CNQP 3GJRB 4E2FB 4N77A 1JLBA 3R5BA 4OLOA 4CLTA 4O0IA 3GCXP 2VQFJ 2KO1A 1M90T 2HQDA 4DSKA 5EWFA 1JLAA 4ZVTB 3DOLA 3JQJA 1ZAVA 4QBUA 3MM6B 3KLIB 2WBMA 4CLZA 4EWTA 2APOA 3SFUA 4Q0BA 2L41A 1I3OB 3RZAA 2A1BA 2C2OB 3HFKA 1UMJA 1PBUA 1Y3JA 3W62A 2VOPA 3LALA 1Y3KA 3HHEA 1ZA1B 5HBMB 2VKZG 3DDIA 5LSLA 4A8MP 2GHPA 2O1PA 2RILA 1VQ7S 3N6LA 2OKQA 3OW2R 3R5GA 4MMOA 2HNDB 2YWWA 1CQNA 2RS2A 4DF4A 4X65J 1KKHA 1S0NA 1F6TA 3N5FA 1WOOA 3TEHB 2UVRA 3LTOA 1HWUA 5KFKA 1K0VA 3I0SA 4K0KJ 4NWBA 3BDEA 1M1GA 2C1EB 2CJYB 2YNHB 1B70B 1NKCA 5D78A 3GONA 1FE4A 3TA2A 2HFSA 3SCIE 2GVDA 3DNCA 4RW6B 4ZOSA 4B9UA 3BO3A 1FWPA 1RT5A 1CJKA 4A8WA 4PR6A 2DCUB 1RLDA 2A2DA 4Y2MA 1XNQF 2VQEF 4DPXA 2KZMA 1JMTA 2GJ2A 2YPZA 2J7UA 2DTJA 1JLEB 4Z2XA 2BJDA 5HJYA 1REVA 1VQMS 5HJXA 2XS5A 1YRUA 4EI2A 4Q45A 4F3OA 2F8EX 3M1VB 1S6QA 2LCWA 3EX7B 2OGUA 5EHHA 1AUSL 1FRXA 3C66A 5I3PA 1U09A 2AW0A 5T7LB 2IM2A 4DX8H 5HVHA 2WONA 1DAXA 1SH2A 4CIOA 1FX4A 1UL3A 1FE0A 3RBDA 3JB9k 2A3JA 3DLLQ 4J9PA 4NEYA 3LP1A 1RTZA 3TVYA 3HSJA 3PRBA 5LXRA 3CCWA 4OI0A 1U1RA 2LU2A 1GX5A 2O3DA 1S6PB 5KFWA 3THPA 1QMFA 2QYGA 3G82B 3PM9A 3J7YI 3KJVA 1E6VB 1HI0P 1CSJA 2VG5A 1FI4A 4B9VA 2PGCA 4OHYA 3QZ7A 1YSJA 4JV0A 2GA7A 2MKHA 1HBOB 1WI6A 3QJPA 1UEUA 3DN9A 2IYGA 2WSFC 4KQZA 3W8PA 3E3XA 5HL7Q 1XMQF 1L3TA 3CDWA 4EZ6A 5MLCV 3CXCR 4JI0F 2R7UA 1U1NA 1JNZB 5I3UA 4GO5X 3KHRA 5CYMB 1VQYA 3T5HA 1FFSB 1R3NA 3EVWA 3KK2B 3UNGC 1RT6B 5A2QU 1S1XA 3MOZA 1TKTB 1VC6A 1XIQA 2YQ1A 4ES3A 3VAGA 3Q8QB 3D67A 3VV2B 1URNA 3HULA 5E33A 2HNZA 2G0IA 5JVHQ 1VBYA 1ZS6A 3IBWA 4JI1F 3A8IA 3KKFA 1OY9A 2C2ZB 2AU0A 3V4IA 1U24A 3G8QA 5E3QA 2C22A 1QAXA 3PW4A 3HZGA 3PX4A 5K8OA 1X5SA 1VS3A 1GK8A 2W01A 5DG7A 4C0OC 1S49A 4RWXA 1UPPA 2Y1IA 3MMJA 1MLAA 3B78A 4JI6F 2R7WA 1NHVA 4P71A 4DV5F 1VQ4S 2OPSB 4EBDA 3N6NA 1UKUA 4WK1A 3J7YU 5IS2A 1SIWB 3ETMA 2IM3A 1VLYA 1D8YA 2XMAA 2VOOA 2FHJA 4RUBA 2IRUA 4AD6A 2DCLA 1DY3A 2GMHA 1RWWB 2XZWA 3B8HA 2OD4A 2AJQA 3UD4P 2E5LJ 1UJ6A 4OHXA 2G9OA 3CCRS 4TXSA 2XEXA 3UD5A 1W2IA 2J0WA 3HFVA 3A8KA 1SQGA 3EUNA 3Q8UA 3K0JA 5F9NA 2JEJA 1XBWA 3OUYA 2FUG9 3CMAS 3TP2A 3CJ0A 1SKSA 2QLFB 1VIOA 1S1UB 2ALYB 4ENOA 3PW0A 4Q44A 2GCFA 2ZHAA 3R5CA 5GAEI 3ETOA 1IKYB 1SI9A 4HVZA 3TYTA 4ETXA 5A76A 2G1HA 2PFFB 1S48A 1SIZA 3VTIA 2OMLA 4DLEA 3DXBA 1N5YA 1WF1A 1EARA 5KFQA 1JXVA 2DHAA 5B0GA 4TLRA 3KK3B 2XG8A 5LM7E 3MECB 4OYIA 1HBUB 4I7FB 3QJJA 4QIFA 4I4BA 4C97A 3GQCA 2DBBA 5D4OA 4C3MA 2MGZB 3IGNA 1Y00A 5KFHA 2F4VF 1RYSA 1NB7A 3MURP 2EC0A 3RJMB 2UVWA 1T3NA 2VA2A 3K59A 1H2UX 3MZIA 4OIXA 4JV5F 3C16A 1Q86T 2R2UA 2J6UA 2IY5B 4DL6A 2JX2A 1MMLA 2AD9A 1L3UA 5B0FA 5LMUJ 4USMA 5JJBA 2ZHOA 3I5BA 4ANCA 2AYMA 1FT8A 2FGCA 2HGNA 2RUGA 2PI4A 4ELUA 1EB0A 5C2GA 1N88A 3UQSA 2NXEA 4DSEA 1QUVA 1AW0A 1NEEA 2XO7A 5F8HA 5GMDA 1OO0B 4P7VA 1F5BA 4WPAA 1VQOS 3W9IA 3QIDA 5GAEU 2GO8A 2B51A 5CCLA 2XCAA 2RB7A 3PACA 2WAEA 1PAUB 3N6MA 3W9JA 4DG1B 4LF7J 2OUGA 3IRXB 1XR6A 1TK0A 5HMZA 2QG9B 3E51A 2C28A 2DRAA 2AGPA 2VQFF 3MFIA 2EFVA 4DLGA 4LUBA 5AT1B 4DMZA 3OTDA 2CQ1A 3MM7B 2FQQB 2IDEA 1SKRA 4DSLA 3GIJA 3AY0A 4PG8A 1MROA 4FVMA 3CDAA 2N7CA 4C98A 1SJRA 1T9XA 4AYBD 3D2WA 1R31A 4F8RA 4J9VA 2Y1LB 3A1YG 3QT8A 1RAFB 2HHVA 2FPHX 1BQXA 1EETB 3JAMU 3KYLA 1OY6A 4X65F 1ROFA 2YWKA 2VBYA 2F3JA 4RJVA 3PTWA 3NS5A 2DPJA 4K0KF 1S5ZA 5BR8J 2R3VA 1W25A 3IO1A 4ECUA 2BKPA 3UE3A 3JQMA 2R9LA 3GMGA 3MMBB 3CVKA 2QA4S 2B5JB 4IG3A 1KNZA 1GXUA 1C0TB 3I55S 3EGNA 2W2MP 1S59A 4KR0B 2OMOA 2RMLA 2JJ4D 2L48A 4F0KA 3KXDA 2PC6A 3BGRB 1YGYA 1SJ4P 4FXDA 1RHUB 3Q83A 1LXJA 3VAMA 3P5BP 1MG7A 3TUIC 3DHXA 4CQ1A 4G1IA 3HVRA 3ZZPA 1CQMA 2PIIA 1V9OA 3ZXWA 1NH7A 2KH9A 5IT9Y 4R5PB 2QFIA 4TU7A 4JBFA 4U7UK 3H20A 2XYHB 3GZ7A 4M8LA 4WBFA 1VI7A 2D3OR 1WF0A 4RA7A 2WB1D 4NZ7A 1I1GA 3R7BB 4NLQA 3ZFVA 1QD1A 4RW7A 3HSGA 1WNEA 2BJ9A 2CADA 2W9CA 2IJNA 3TO8A 4ZPBA 1TL1A 4OJHA 3SV4A 1NZAA 2C2DA 3FUYA 2Z57B 3LWMA 4JI5J 2J0QD 1BC6A 3H7HB 1HA1A 1PG5B 3DLKB 4DL5A 2YWEA 2BEFA 1RAEB 2ASLA 2ZNYA 2AYGA 4PG7A 4P10A 2NXNA 5L1IA 5J2PB 3HT0A 4H54A 2B6AB 4DV4J 4EMDA 3JSMB 4OZ1A 3SBMA 2OPPA 5A8WB 2R8KA 2MTLA 4KYZA 1Q8IA 2UUAJ 3M8PB 3M2RA 1AROP 1IKVA 4LQ3A 4GC7A 1B7YB 1L5UA 3B4DA 3T1YJ 1X0PA 5K8MA 2F8HA 1NJWA 3M8QA 2WK4A 3TEGA 2RT3A 3CJ3A 4URGA 1T9YA 3VWSA 4LQ9A 3V4MA 4I69A 1JLAB 1LW2B 4O44A 4CLPA 1LXNA 2M52A 1NRKA 1U1LA 1Y0HA 2KZZA 4NLOA 3I4HX 3FJ2A 4YR2A 1P27B 1SJFA 4RKUC 4WZMA 2YNFB 2Z4PA 2RU9A 2HS0A 3OL9A 2IRXA 4UW2A 4FF4A 1YIJS 1OSDA 1VQ8S 1RT7A 3T1HJ 2W1BA 2XSJB 1UVKA 1GFWB 1RHKB 2R7OA 5K8NA 3OFFA 4X4RA 2HS4A 2CXEA 3UR3C 3MTJA 4PKDB 4WXWA 1NBEB 3AA9A 4GVBA 3MM5A 5KFZA 5B0BA 5GVQA 2G4BA 4M5LA 1ACMB 3Q8VA 4YS2A 1UVMA 3NOCA 2DH7A 2DGSA 3I0SB 4CH7A 1PBAA 1RT3A 4ECZA 4QW8A
chains in the Genus database with same CATH topology
3OXFA 4F26A 4W92B 4M5DA 4K50A 1FK9B 1LWEA 4O23A 2EWHA 4URQU 4YY3F 4RNFA 3D1HA 2YH1A 2N4CA 2M7SA 3T3FA 1KTQA 2CPEA 5J1NA 4K4XA 5D77A 3MM8A 1GH8A 1S72S 4PRFA 1OQ3A 4CTAB 1KN6A 4MTPA 3POTB 3UPPA 3ZG0A 4ED5A 2W7PA 3T9NA 4QYZJ 2VFUA 2JC0A 1TVRA 2K7JA 3CMES 3I87A 4ID8A 2O66A 1X4HA 3CJKA 2FLOA 2ROEA 4EEYA 5C25A 4RNOA 2ATLA 2E5LF 3BJYA 4OX7A 2NQPA 4ZVFA 1LQ9A 3OC2A 2KJVA 1KOHA 2YH0A 4KV8A 5A8RA 4HT7A 4KBIA 3WDOA 4BC9A 5EX3A 3J80Y 2BQUA 2N3LA 4K4UA 4PXEA 1JLFB 3QGHA 5DDOC 3EGWB 4WXOA 2CDQA 3KG0A 4CPKA 1TKXA 4OL8A 2CPXA 2UZAA 3O5TB 2Q66A 3RW7A 2BV3A 2RQMA 4JI4F 1FVQA 4QJGA 2GQCA 2CPYA 2PDAA 1RISA 4RZRA 2EFGA 4HDHA 3TVKA 4DQIA 2XS2A 4IG3B 2YKPA 2J76E 5IM0A 3OJUA 2Y1JA 2YNIA 1X5TA 3V2UC 1DTQA 2W8LA 4P6QA 2GGPA 1GAOA 1R27B 2OFHX 4OI4A 2AJFE 2MSTA 2ASJA 4IOAQ 1KHVA 2GMLA 1GX6A 3IAM9 3M30A 4K4SA 5D3GB 3G4SS 3M2UA 3V6DB 1VBXA 4BS2A 4DN0A 1CPZA 1HQEA 2HFZA 4OMFG 4OX6A 3PEJA 2JLEA 3MWBA 2VFVA 4BHQA 3OHBA 3AJ1A 3BQ0A 2KHCA 2KG0A 2W9AA 4HT5A 3DLGB 4ZPAA 2KT5A 2ASYA 3KOAA 3GWCA 4D3HA 4TU9A 3FMBA 4V19J 4R23A 1A9NB 1X4AA 5DDQC 2CPIA 5B08A 1ZM2A 4I1TA 4O3QA 2MHEA 2NZ4A 5EGYA 2IM1A 1Q78A 3RAXA 5CXTA 2ZC4A 3BR9A 3CD6S 1RK8A 3QAEA 2HQ3A 3VAKA 2NREA 3OFGA 1GTEA 3SDEB 1TK8A 2R7QA 1T8EA 4I6YA 3D0GE 1XMBA 5HLFA 2ZITA 2KDOA 1D9AA 4KHMA 1HD0A 3DRSB 4JI2F 4LSNA 4WFNQ 4DR5F 1D0EA 4K4YA 4KRWA 3JYTB 3RB3A 2HHUA 2MKCA 4OV1A 3Q0AA 2DH9A 4I2QB 2QO3A 5KFUA 4HYKA 2FJXA 4IQMA 2HIQA 1MU2A 3V6JA 2ZH5A 3PHEA 1V6HA 4LF5F 2M88A 4DPOA 2B9XA 1FXLA 1UFLA 3HF5A 1FD2A 3E8OA 1KTVA 4B02A 2FVQA 2OH2A 3SQGA 1YHQS 2N7YA 4FF1A 2OLWA 1HPZB 1RA7A 2IFXA 3I82A 1UWBA 1Z2ZA 4QIVA 2PMHA 5BYQA 3DXSX 3D54A 3BSOA 3T19A 5IT0A 3PKYA 5J2QB 4J5OA 1SJ3P 2FHMA 3HX9A 4WK3A 3X1LB 2N4DA 2BANA 1XEZA 2DHXA 3G8TA 2AYBA 3NBPB 4ZDNA 1DTTB 2KI2A 3BZQA 2I2YA 3TRGA 1UFWA 1MMNA 4YDDB 2JEGA 3T9ZA 3NNHA 2A18A 1N32F 3C8YA 4OQJA 4TN2A 2W9CB 2ZE2B 3DRYA 1SV5A 3OVSA 5M18A 2ZDOA 3I9V9 3HT3A 3V81B 2XB2D 4KJIA 4BDPA 3DI6B 3BM7A 5DDPC 3GV7B 4ZK7M 1EP4A 1TL1B 2VG7A 4IOCQ 3NLCA 1IKWA 3CCZA 4Q7AA 2YKMB 5KOXA 3KK1B 3R1LA 2V9WA 4IRKA 1DFDA 4FS2A 1FHTA 3M6XA 1Q8LA 3GIKA 3T5JA 1HD1A 4V19X 1OQ6A 3D5MA 5BYSA 5EN1A 4MKBA 4DBQA 2LA6A 4ED8A 1QAYA 2HHPA 4XK8C 3UDLA 2MQNA 3FFIB 2HNYA 3MPVA 4LSLA 4Y3CA 4X4TA 2BACA 4M95A 1TAUA 1RT2A 2YVSA 4A8KA 3TI0A 2ZKUA 3K7RA 1RT6A 6FDRA 1PYYA 5DJBA 5LMUF 2FJVA 1WACA 2AV5A 2FC9A 5KT2A 5BYRA 5FJ4A 5CCMA 3FMWA 3DOMA 5I42B 3CDBA 5KFCA 2DIVA 4YEAA 3DC2A 3GG1A 4YFUA 4NRTA 3M9NB 2HHXA 3DM2B 5DQGA 2EVZA 2XMUA 4JI3F 4LT6A 2AX1A 7FDRA 1MSWD 2QYCA 1KLMB 4CO0A 2HHWA 1I6JA 1FO1A 1HWKA 5DM6Q 3PEHA 3GB0A 3PW5A 4I64A 1TR0A 1WHXA 2ZH9A 4O3NA 3PIOQ 1HW8A 2PI5A 1DLOA 1VQ5S 4MNRA 3UDCA 1D9DA 3MMCB 4NYPA 1KLNA 4RUHA 2XLIA 3FQKA 3HM9A 4N8OA 2YWFA 3IS9A 2OAUA 2VUGA 1Q4RA 2E1MC 3ZZYA 2JLFA 3ZZ0A 1B7FA 3M2RB 3HXMA 4PQUA 2IRYA 1T7PA 2N3OA 3O44A 3OTCA 1IKVB 1M0SA 3M6UA 1O5JA 4KAIA 4J9NA 1UJ4A 4B3RF 2BE2A 5G0RB 3PO5A 1CG2A 4ECTA 1BWEA 3NS6A 5CYQA 3HZEA 4NRUA 2PSZA 1FA0A 2XMKA 1S6OA 3ZZZA 1H38A 3FGVA 3RBEA 2RQKA 4LF7F 1N48A 4RLEA 1K1SA 4KGKA 2DGWA 3DRRB 1RT4B 3PDNA 2HQIA 2V8HA 3RRKA 2GJIA 1Q16B 1XC9A 1FJEB 1H3DA 3M8QB 2UXCF 3CJ4A 3ONQA 1S1VB 1ULRA 2C2EA 2Q79A 2DR9A 1FJGF 3R3TA 2HWHA 3FEZA 3FVYA 4PPDA 3L09A 3IWNC 3MTKA 1P8GA 3SCKE 3HHDA 5F0WA 3VR1A 4PUOA 2J9EA 2C3YA 2LXUA 4OJ1A 1T3OA 5E3PA 2IAJB 4K4VA 1NK8A 3PKMA 1FKPA 1JLGA 2VPWB 3TQ1A 3SCJE 2MKJA 4F4XA 1JLCB 1L3VA 2EI5A 4O44B 3V4IB 4PXCA 2CYYA 5KFOA 3PW2A 4YMEA 2ZH4A 2WAFA 3GFZA 3NKYA 3TAMA 3C6TB 1T05A 4QZVB 1N54B 1U8SA 1SL1A 2GMJA 4HI2A 4X4UA 4KKOB 2ABYA 1U7LA 3I5AA 1C1CB 2J7WA 1HYSB 3DDNA 2MZ1A 1LW0B 2HZCA 2XBPA 4RW4A 3UCGA 2B3TB 3NNAA 3H5SA 3G8SA 4FF2A 2DITA 3MMAB 3F44A 3CDUA 2DNQA 1SH3A 4HTJA 2UV8G 4QJVA 2MQOA 2JL9A 3WBZA 2GW8A 1HFEL 1MW7A 2JWNA 2MJNA 3QMQA 1RT7B 3NCRA 1X0FA 2AYEA 3QGIA 3PR5B 4DQQA 3RB4A 2QLWA 4LIWA 2KJWA 1TKZB 1E6YA 3MEDB 4NLPA 5E0OA 5JXSA 3L3CA 4OI3A 4NA3A 4H4KC 1BD6A 2QZ8A 1UVJA 4ZPVR 5IFMA 5LJ3Y 2RDIA 2P9EA 2QT7A 3G86A 2ZM6F 3MR2A 2VG6A 4N47A 2FLPA 2QSWA 4LVNP 1C4AA 3QWUA 2D9OA 4IQXA 3N0VA 2FIUA 2W9BA 3BREA 1Q79A 4TY8B 4W90B 3LF0A 3KLFB 4DQRA 3EQUA 3TAPA 3MM5B 1UVLA 1TL5A 3IFEA 3JSBA 3QJLA 2V8DA 3QO9A 1NJIT 5BR8F 1C1BB 2VL1A 4XO0A 3DMJA 4IR9A 3I6PA 1RKJA 3LANA 1KS2A 2P5VA 4GMKA 5F3ZA 2R2TA 1H2VZ 3BF4A 1L3SA 4L6V3 4NCGB 1OPIA 4N56A 3MM9A 2BM0A 1LK5A 2MKKA 1RT3B 2E44A 3MOJB 2UVVA 4DSFA 4FXWA 4NYOA 4IO1A 3HP6A 4DL0C 5LSOA 3OJSA 1SKWA 3US5A 1LWCA 2KHDA 5AXLA 3FQLA 4MFBA 4RBVA 4M5DB 3UFCX 1QLNA 1LWEB 1WHWA 4TY9A 2AX0A 4J9SA 1X9WA 1QMEA 2C3MA 2IMWP 5B0DA 4U7CA 3MCSA 4ELTA 1V3RA 1S0OA 4X4SA 2LEAA 2JHEA 3MM8B 4USJC 3L95X 4OI6A 1YJUA 2FJAB 1C0UA 2GX8A 2RJZA 2RRNA 3GG0A 3MD3A 3NRBA 4NA2A 5KFAA 4ED6A 1FDNA 2GIRA 3PW7A 3SCLE 1N34F 3DGPA 2WW8A 2OSQA 4N5SA 2OO4A 3MECA 4ZS6A 2VD3A 4DV7F 3QWPA 3IWXA 3CJKB 4QWEA 2B4UA 1FRJA 3U1LA 5C25B 1HBUA 2AJ1A 2VFSA 3VAFA 2XY6A 2LLZA 5D4LA 1R8CA 4BL3A 5A8RB 1QM9A 1HHSA 4KV8B 4KFBA 1Q7YT 1VRUA 4KB7A 1X5PA 4HH0A 3M2VA 4TKTA 4IH5A 1K73T 2RF2A 3Q22A 1HL6A 4QW9A 2CQIA 2V8VA 4M1KA 1TKXB 1RA6A 2YKAA 5A6WA 3UW1A 1TV6A 1ZETA 4KO0A 4NCBA 3R27A 4YB7A 4JYAF 2FJWA 4F50A 1YTYA 3I4PA 4DQPA 3H5YA 4RBUA 2ZD1A 4J9QA 3BGFA 1YJ9S 2DNOA 2YWHA 3PJXA 5IM0B 2DGTA 1DTQB 1SJ1A 2B0GA 3Q8SB 1ZOTA 2GGPB 1VQPS 3PR4A 3HHLA 3N01A 1X4GA 1U1KA 5F8JA 2KM8B 5KFBA 1X4FA 1JXLA 3MAHA 4EZ9A 2M4MA 2EBEA 1N52B 2HS3A 2I1RA 3M2UB 2HAIA 4FP9A 2BQRA 6FD1A 2OLVA 2MSSA 3ENVA 1YQHA 5C42A 4CH1A 3CC4S 2FHKA 1HQEB 5F8NA 2VBZA 5HP1A 5DQHA 3HHNB 1T03A 1QAIA 1U2FA 2BW2A 1U1OA 3MI7X 4RWWA 4ZP8A 1WF2A 5C5JA 3MUTP 1UW4A 2XMMA 4I0WA 3IGVA 4ECXA 3MEEA 3O3LA 3H4DA 1UVIA 2RD5C 3NNCA 2R7SA 1YBAA 3OL8A 4K4ZA 2P9GA 4FXVA 4F3QA 2MZJA 1HMVA 4WFBQ 2ADCA 2W4PA 3OV7A 3G6YA 1HBMA 2I38A 4CO4A 2E1AA 2HMIA 3U02A 5M2UA 2HHSA 3VF0B 5HLFB 3KLGA 1RTHB 1Y5NB 4LSNB 2ZH6A 1VGYA 5F0UA 3R5AA 4C8ZA 1S9FA 2JDJA 2G1DA 2E9ZA 4Y0FA 4NCAA 1XWLA 5JVGQ 5A8KB 1F5AA 1MU2B 1RT1A 1HNZF 2IVMA 3OR1B 2OPQA 3ZZOA 3LP2A 4HH1A 5ADZA 2ILYA 4IFYA 3WC0A 3RRHA 3MEGA 3GIIA 5KFPA 4C11B 1FKAF 3CWJA 2D1CA 1Q8BA 3CSKA 3DDKA 4AL6A 4JI5F 2ZDPA 4Y2AA 4MYUA 2BBEA 1UWBB 3TANA 2DGVA 2KT2A 4DR3F 5KFIA 5A0YB 4QIWD 3JSYA 1TP7A 1S9EA 5K14A 2Q6BA 2FHJD 1A7GE 1R89A 5LJ5Y 2U1AA 4OJ3A 4Q43A 3MM6A 2CPJA 3KLIA 5GAGI 5DGAA 1KFSA 3SSSA 2I0XA 3U27A 3CUNA 3G96A 3JTNA 2KU7A 3OSNA 4R0JA 5D4NA 5LL6d 2X1FA 4BWMA 3CCUS 1SV5B 2LQBA 3IRXA 4EBCA 3LUYA 3VQTA 4ZHRA 2YX4A 3NMRA 1Z1ZA 1U47A 4A8XA 3M8SA 4JV2A 4TYBA 1JJ2R 2VG7B 2ZH2A 2QV6A 1N5VA 1IKWB 1PGZA 1FRIA 4DR4F 2Z0GA 4DV4F 5HBMA 3CPWR 2COLA 1FXDA 5KFDA 1S1WA 3KMSA 2EFNA 3C6UA 3H5XA 2CQDA 3RW6A 4Y2KA 1KFDA 3GSDA 3S8SA 2FLNA 1KQGB 5DDRC 3KHHA 3HJFA 2UUAF 1TUVA 3BQ2A 1S9GA 1WD6A 2HNYB 2L9DA 4LSLB 4YOEA 4J9KA 4F4WA 1V3ZA 1RT2B 5CYJA 3IG1A 1UA0A 1U6BA 5DGBA 3MR6A 3CCMS 1VHFA 3TA0A 2R7XA 1R8BA 3Q2SC 1HARA 4OI1A 1DBDA 1GQEA 3OL6A 2KFZA 3G6ES 1HQUA 3VQSA 4ZPTR 5KG6A 1R8PA 3D28A 3JSRA 4KHRA 4FZVA 4PWDA 1KSPA 2VC0A 4OHZA 1FERA 4MYTA 5C24A 3T1YF 2PMZD 2J5AA 2ZC3A 3RR8A 3MR5A 1CEZA 4FNHA 3QLHA 3FCHA 3OR2A 1BY9A 4BCAA 5SZTA 4P2SA 1M5VC 5KFXA 2V5HG 4ICLA 1NK9A 2XNRA 1X4CA 2YQ3A 4NZ6A 5DLGA 2YNHA 1DLOB 5KFLA 1ZBTA 5J2NA 4U67Q 3O1LA 2YX1A 3IR5B 4ZVEA 2VBXA 1FKOA 3FZBA 3IS9B 1BQMB 2CQCA 4R3JA 2IC3A 4PQUB 1T95A 1M1KT 4DL3A 2IMOA 3PXGa 1NU4A 1B0TA 1DZ5A 3NWGA 3DWKA 5IZHA 4B3SF 3EPIA 4DL4A 1C2PA 2HRYA 3W2VA 3LW5C 4UUWA 2BE2B 4OX8A 1DQ8A 4OZJA 2B7BB 2LKZA 2F1FA 3OSPA 5CYQB 2XWYA 4QWBA 3H25A 2R8IA 1KQSR 3MPYA 4R25A 2KRBA 3OVBA 4DR7F 1N0VC 2DGXA 4HLBA 4CH0S 1K8AT 1D8ZA 3JAMY 1FRMA 4A48A 1TKDA 2DT9A 1TFWA 4R8UA 4XPCA 1RGVA 4RW8A 3UR0A 3BGUA 4WTYA 4XPEA 3MXHP 3C2PA 4FF3A 1A6LA 2RIJA 3SEOA 4C8MA 3AAWB 1HWLA 2QMXA 2ZH3A 4EYIB 3T1HF 4MKYA 2I5JA 3MMBA 4ZP6A 3CF5Q 1GT8A 4PUOB 1M5KC 3S7RA 1N5QA 3GV8B 3GYNA 3AQOA 4ED2A 2FVSA 3K2YA 1JLGB 4XIUA 4I68A 3Q23A 3CD5A 3HKWA 3IAS9 2R7RA 1JJ4A 4C8OA 4QPXA 3AJ2A 3TAMB 2GNKA 5KT5A 4IH7A 1T05B 5U47A 2OD6A 2W25A 3MEKA 5THWA 1C0TA 2H5EA 4DWIA 1JIHA 1JLEA 7FD1A 1D1UA 3DRXA 3LGNA 2IVFB 4I6WA 5LXYA 3PVXA 2DNGA 1IKXA 3BEGB 3FEYB 1P1LA 2JFDA 3OTEA 4RW4B 4TQSA 3FEXB 1Y9OA 4NLTA 4H4MA 2KYZA 3QYYA 2NXUA 1MNEA 3AB2B 4OHWA