2Z2MA

Cefditoren-acylated penicillin-binding protein 2x (pbp2x) from streptococcus pneumoniae
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
159
structure length
159
Chain Sequence
AKRGTIYDRNGVPIAEDATSYNVYAVIDENYKSATGKILYVEKTQFNKVAEVFHKYLDMEESYVREQLSQPNLKQVSFGAKGNGITYANMMSIKKELEAAEVKGIDFTTSPNRSYPNGQFASSFIGLAQLHENEDGSKSLLGTSGMESSLNSILAGTDG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Penicillin-binding protein 2X
publication title Crystal Structure of Cefditoren Complexed with Streptococcus pneumoniae Penicillin-Binding Protein 2X: Structural Basis for its High Antimicrobial Activity
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Biosynthetic protein
total genus 31
structure length 159
sequence length 159
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-05-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2110 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2z2mA02
3.90.1310.10 Alpha Beta Alpha-Beta Complex Penicillin-binding protein 2a (Domain 2) Penicillin-binding protein 2a (Domain 2) 2z2mA01
3UE3A 3ZFZA 1K25A 5KSHA 1QMFA 1RP5A 4DKIA 5M19A 3UPPA 4CJNA 4CPKA 3VSKA 2Z2MA 1MWUA 5M1AA 1VQQA 3EQUA 4N1XA 3LO7A 3ZG5A 4BL2A 3UPOA 4R23A 2ZC4A 1MWTA 3VSLA 1QMEA 4QJGA 4OVDA 2ZC3A 4JBFA 3UPNA 1MWSA 3EQVA 3UN7A 1PYYA 3ZG0A 4BL3A 5M18A 4RA7A 4R3JA 2Z2LA 4R1GA 5U47A 4MNRA 4R0QA 1MWRA
chains in the Genus database with same CATH superfamily
1KKHA 2CJYB 3UFCX 4J9OA 2IM3A 1QMFA 3S7RA 3DI6B 1VQLS 3UR0A 4WJBA 1Y5LB 1HNZF 4JI0J 2LU1A 2ACMA 3MPUB 1X9MA 5I42B 1TL3B 3PYEA 4AXJA 4FYVB 5H9EK 1VQ9S 2DCLA 5DDQC 5KFDA 2GHVC 3RBXA 1KLMA 1UZDA 2QN6B 2AQ4A 3MPDA 2CDRB 2DH8A 4DX5A 4O0NA 3VGVA 4NYZA 3QLHB 2CJBA 3MMCA 1HQEB 1D9FA 3PIOQ 3KK2B 2X7IA 2SXLA 1KC8T 1LK5A 3T19A 4JUZA 2ZJRQ 2FLPA 1W2IA 2I5JA 1FFGB 3GSDA 2LQ8A 1D8ZA 1SKSA 4JI6J 2BKPA 2W2QP 4C6AA 2GJIA 3FGVA 4Q8EA 3MM7A 3THPA 1NJZA 4L3KA 4AL5A 1GX6A 1VDHA 5MAOA 4C3KA 2ASLA 4R3JA 2FJDB 3VAHA 2HVIA 4FN5A 4WYLA 4JV0A 2J9DE 4LRFA 2DGOA 4QWBA 2XSFA 1IBKF 2WVCA 3O44A 4O4GA 3HT3A 2ASYA 1KDNA 1WC5A 3PX0A 1RAAB 3W62A 4F8RA 2IY5B 3L3CA 2H1YA 1QUVA 1RT5B 2CZVC 4UF4A 4M5NA 4KO0A 2G2ZA 3EGZA 1HL6A 2HWTA 1X60A 1U1OA 5D0EA 4WKYA 4O3SA 3G96A 3JYTB 3KDNA 3HSJA 1RT6A 2Q43A 4XK8C 3N01A 1G4CA 2F63A 5KFEA 4DPUA 5J2MA 4JV1A 3C3LA 3ZTPA 1HD0A 1KVKA 2HHVA 2HFZA 2HEKA 4HL9A 3M1VA 4TU7A 3WC0A 2JOQA 2V8HA 2B4UA 4F26A 2VUGA 1NB7A 1VQKS 1FEEA 1Y5IB 5M2PA 2KM8B 2EPIA 4N5SA 1WHVA 2K3IA 3NMRA 3MAAA 1FT8A 1J5EJ 3UE2A 4ZCKA 4URGA 4F3OA 4ID5B 5IM0B 2VC1A 5CCMA 3PY8A 3MD1A 1B4SA 2DNMA 4IFYA 2HMIB 3VVUA 1BWEA 1QTMA 3NS7B 3HP6A 1I3OB 2OFGX 1QAYA 5A8RA 1FJ7A 2UUAF 4CM0A 3R2CJ 2DNPA 3UW1A 3MZIA 1A9NB 1WUUA 1S77D 3BM7A 5IZHA 2V4JB 3W64A 4I6WA 4ZPBA 3ZZZA 4DI6A 4FS2A 5CH7B 2HQ3A 2ZH7A 1S1VA 3U7JA 5DZ7A 4JI5J 4LF4F 4OHZA 4MMOA 4RW4B 3F44A 2AEFA 3MUMP 4KC5A 1KOOA 4Q7AA 5J1PA 1DTTA 3BB5A 2UVWA 3IG1A 4IR9A 1UETA 2FYXA 1U02A 3U1LA 3CC4S 2VL1A 2QFIA 4LRBA 3GV5B 1VQOS 1SC1B 2BW7A 1IR0A 3VSKA 2RJZA 4ZMMA 2DK2A 5D8HB 1BC6A 1DZ5A 3DRYA 2QTWA 2R3VA 1M5SA 2FY1A 1SI9A 2JZ5A 3K5OA 4K4UA 3KJNB 1MN7A 3R5CA 4JI0F 5LXYA 1YBAA 2P8IA 2Q79A 3M6WA 2EEYA 4K4VA 1U1KA 3FQKA 3GYGA 1KEKA 3I31A 1ZTTA 5AE3A 3HXMA 1YJUA 3MXHP 4OYZA 1NK6A 3HFKA 2B7BB 2YKMB 3TAMA 2MZJA 1U6FA 4CDIA 1N5TA 4JB8B 2EFOA 4FNHA 1HW9A 4Z2XA 1RHMB 2DO4A 2CADA 4B9NA 4N76A 4OX8A 5D4LA 4USUA 2MKCA 2OKQA 4E2FB 4LF8J 4P7VA 4DX6A 2DPIA 5IV3A 1QUPA 3LTOA 2DXFA 2QLXA 1GT8A 3QJJA 1JJ2R 3FEZA 4FP9A 2IC3B 3DI6A 3D3CJ 4JI6F 3QSIA 3UPPA 1WELA 5I42A 5A6PA 1TL3A 1SL2A 3PRBA 1X5OA 5EHHA 3RBDA 3S8SA 3BGUA 2RDJA 4EU0A 4DZDA 2KHDA 1NK9A 2O66A 2HRTA 2V8GA 3T9NA 4ECTA 3QQCD 4OX7A 3LPYA 4DV3J 2MSTA 4CO4A 1R43A 4DL0C 5T7LB 3QLHA 1RBAA 2E5JA 4RZRA 1HQEA 3R7BB 3KK2A 3FBFA 3O6QA 2KZMA 1KS2A 2XCAA 5B0CA 5DO2A 3CJSA 4QOTA 1QAJA 3E2EA 2J7UA 3KLIB 2CQ0A 2NXJA 2W8LA 3NG8A 3BH6B 2DR6A 2JDJA 2HLUA 4KHMA 4M5HA 2W9BB 2J9CA 2LQJA 3G87A 4DQQA 2E5HA 1PYYA 2UUWA 2DITA 2CQ4A 2BRLA 3KHHA 2ABYA 1RXOB 4RNOA 3MI7X 2VG5B 2VFUA 3PR4A 2HG4A 1RT5A 1J5EF 3M9OB 3VAKA 1S97A 4QU6A 2BZ2A 4NMXA 1IXKA 1UFLA 2PMHA 3C6TB 3WHIA 1FNOA 2EG1A 4UQTA 1Q8KA 4DR5F 4NLQA 2PC6A 1WNEA 2O01C 3JYTA 3EQVA 1FWKA 2HQIA 3LF0A 4WE1B 3M8ZA 1RK8A 2A18A 3PV8A 4USMA 3BDPA 1KVIA 1JKHB 2OFHX 2NS1B 5GAEI 3GCWP 4ZVQB 3GWCA 1H3DA 2B9YA 2CQ2A 3RB3A 4NCAA 3CJQA 4WPAA 2L48A 3JQJA 1X8DA 3QRQA 4WXWA 3HJFA 2E1RA 1VRQC 1X5SA 2RE1A 4JI5F 2HZAA 2V0NA 4EK2A 1N6QB 2L9NA 1N5QA 2E7WA 3TR5A 1Q86T 4PXEA 3OUYA 3QATA 1AW0A 2KRRA 4ID5A 1LOUA 5IM0A 3A3OB 3CW2C 4CCHA 4BHQA 2HMIA 4WCEQ 2CKWA 3OFGA 3HK2A 1K0TA 3WBZA 4GO7X 3SFGA 3L9ZA 3LAMA 1LK7A 2BE2B 1N8RT 1I5OB 3KWMA 3CGIA 3FCWA 2JFKA 4HTIA 3GYNA 2V4JA 2QL7B 2HFOA 3R3TA 2UUBF 2ZKTA 2Q3PA 1KLNA 1OPZA 3ZFZA 1HNXF 4OL8A 4PCQA 4NX9A 4P75A 3L7OA 4DU8A 1QDUB 1UVJA 4RW4A 3AOBA 5KG3A 3HVRA 5HN0A 1G3OA 5ETRA 2NQPA 2OJ3A 4NLRA 1SH3A 2G4BA 5A8WB 2CQDA 1F1BB 2DGSA 2GCFA 2Z2MA 2HURA 2QG9B 3T1HJ 2XYHB 1NUEA 3MR7A 4ZLPA 4ECSA 3NBPB 3AODA 3UDEA 2IVFB 1SJ4P 1PKUA 1NZAA 2CPHA 4F36A 1MLAA 3I96A 4G1QB 1RAIB 3K8VA 2VU5A 3UD3P 1FX2A 4IO9Q 1ZM9A 4FYWB 1N33J 4WKRA 2HNDB 5EWEA 2VBYA 5EWGA 3Q83A 2QA4G 2X3GA 2EFQA 4DR6J 1VQSA 4LR9A 3IR6B 4Y28C 1NU4A 4LF5J 1EIYB 2YKMA 3BH7B 4OYAA 1S99A 1S0OA 3AB2B 2OEMA 3A8IA 4ZPWR 2M7SA 1FXDA 5CABA 3KNAA 2QYCA 4DV3F 2NZ4A 2PMZD 1AFIA 3KLHB 1FD2A 3MM6B 2IVYA 4DSIA 5E3AA 2ZNZA 2RVJA 1DHMA 4DV0F 4C7QA 1BLUA 1DTQB 4F4ZA 1UW9A 4OV6A 3OFEA 1IQZA 2OIHA 4YN3B 2IC3A 5LXRA 2JLEA 4C97A 2EXUA 3LWLA 2UUCJ 2I8EA 3GQCA 2XZTB 3RTVA 1X4FA 1EP4B 4X84A 4Y2KA 3POTB 3OW2R 2CPYA 2W4CA 1UWAA 4NI2B 4RU9A 2DIVA 4HVZA 1OQ3A 4PEOA 1V3SA 1VQ6S 2DIUA 1LWEB 4UY85 1SXLA 2XS2A 3EDRB 3FCHA 1NKCA 1LW0A 3A8KA 5T7LA 4OV1A 1IKXB 3GE9A 2KJVA 1NHKL 1X4AA 1V9OA 3KLIA 3R5GA 2NYIA 2POKA 4CO5A 1O51A 2W9BA 4K4SA 3DLEB 2HHWA 3CIZA 1T9UA 4R1GA 2BQ3A 3S1TA 4DV2F 1U4BA 4LF7J 3IM8A 1JJCB 3K58A 1FXRA 2MY8A 3PW0A 2EKNA 3GLJA 2CJAA 1KHVA 3IFEA 4U7UK 2BQUA 2BACA 4JYAJ 2VG5A 4D3HA 2DHGA 2W2NP 1KP6A 3LA0A 1VQYA 3RB6A 2CUYA 3JTOA 2F9DA 3NS5A 1HI1A 1HNWJ 3C6TA 3TQ1A 4FPRA 5IV4A 2B9EA 2HHXA 2C28A 3JQMA 1RZMA 2DNHA 1YK9A 3MPVA 4WE1A 2KXNB 4AFFA 3NP5A 3H98A 2Y8WA 1JKHA 4LQ3A 2HVEA 2QJ3A 4A8XA 3D1QA 5DG8A 4TKTA 3GIJA 2DRDA 1CC7A 2ZC4A 2HK3A 4CH1A 5CZVA 2ZHAA 3HHNB 3VAGA 4DWIA 2O1PA 3Q24A 4DV5J 3PDNA 1N6QA 1ZETA 5IOLA 3CJRA 3BGFA 4UZCA 3M8SA 1X4DA 3W8GA 3GFXA 2AEMA 1IR2A 1R31A 3KMSA 1JIHA 1S79A 2V8PA 3Q22A 3EGNA 3ILIA 4GC6A 3PEJA 3WQPA 3TX8A 5GAGU 3MR5A 1QY7A 1JNRB 2P2CB 4F7VA 2OD4A 2BE2A 4CT8A 3UN2A 1I1GA 1Q16B 4P2FA 4UUXA 5M18A 3MWBA 3DLLQ 1IUJA 1OYEA 2R7WA 4CPKA 1WI8A 1SIZA 2JVOA 4X4QA 5ETQA 2BVZA 3ISNC 2M8HA 2CQCA 2OHDA 2H5EA 4EZ9A 3A8EA 3BGRB 2OEJA 4LF5F 3R5AA 4QR1A 5L1IA 2JEFA 4PUOB 5A8WA 1RWOB 2M2BA 1LFWA 1LEOA 2LFVA 4B3RF 3ZG0A 1FRHA 5I3QA 3RR8A 2FHKA 1NJWA 3NBPA 1DY3A 3D68A 1R3NA 3SEOA 3E8OA 2VIHA 2UZAA 2HBYB 1JK9B 4JV5J 3VR1A 3NAHA 4Y2IA 3W9IA 1P1TA 4IH5A 4RUBA 4G1QA 1PYSB 3ZTRA 2ZH9A 3CDBA 3K5PA 3THTA 2Z57B 2HNDA 2NSCA 2UUCF 4XDCA 1Q0NA 4K2JA 1JXLA 4I6YA 1CG2A 1IR1A 5AXMA 5KG1A 1RWVB 5DJBA 2IYIA 4CO0A 2FLNA 2ZBIA 3V4IB 4CNYA 2P5VA 2IM0A 5K8PA 3OV7A 3W5YA 1XNRJ 3PM9A 3CEDA 4UOGA 3G71S 4OI3A 2C2NA 3KLHA 3MM6A 4OQJA 4WP3A 1WI6A 1ITPA 1DTQA 3K59A 1NJXA 4OZ3A 3NMAA 2DNZA 2KYZA 1ZAVA 2G0JA 4YY3J 3ZZTA 2N4DA 2QMXA 2NPIA 2IVMA 4ED8A 2ZDOA 3D67A 4ZPVR 4ZPCA 3DOKB 2WVBA 3MR3A 5SZTA 3FC9A 2V68A 3OQ2A 1EP4A 3J7Z5 3POTA 4IO1A 4USVA 3HJVA 2E5GA 3ISZA 4NI2A 4LF7F 1RLCL 2Q6CA 3ULHA 4DJBA 3CO9A 1LWEA 4QIFA 3CCSS 4OHYA 4IQXA 4G65A 3PHEA 2VBWA 4IDKB 3Q2TC 5BJRA 2CAJA 5JJBA 4AT1B 2M88A 4OJHA 2QLBB 3ENQA 3T41A 1IKXA 1NSAA 4K50A 4CLUA 1SQGA 2BRKA 5B0GA 4ANEA 4ECXA 1WTBA 2GZOA 5ETSA 4PG4A 1QSYA 4HHUA 4CH7A 1HWKA 2K3KA 1FJGF 1IJFB 2MZQA 1S10A 2DNOA 3DLEA 1NK8A 2ZFHA 4LVNP 4RW9B 2DR5A 2JNJA 3FEYB 1PAUB 2I1RA 2H9ZA 2YNHB 3VTIA 6FDRA 4V1Ak 2JEIA 2WVFA 2R8IA 2LQ5A 3GPAA 4MNRA 1Y7PA 3N28A 4YQWA 2KFYA 3MR2A 2BOPA 1TUGB 5K8MA 4NEYA 3SBMA 1F2HA 2CQGA 4DV5F 3BV8A 3GFZA 4DXLA 2YWWA 2ZHBA 1Q78A 2XI3A 3HCXA 1D8YA 1HLWA 3EVMA 3UN5A 3RRGA 4PKDB 4ZHRB 4ZITA 5I3UB 2QFJA 2VDIA 1VBXA 2VODA 4M1KA 3FVYA 2MQPA 1PAEX 3QZ7A 1ZAWA 2QIFA 2FGOA 4RWXA 1SC6A 5LJ3Y 4QW8A 4GO5X 3SSQA 4WU3A 5EDWA 3VV2B 3HKWA 3KUHA 2R7QA 4KKOB 3GJSB 2VJVA 1NK5A 2OMOA 1G1XA 3R5DA 1TAUA 4XDDA 2WSEC 3M9MB 2VICA 2DGQA 1UEKA 2IRUA 2KXFA 5C42B 3DNCA 1ZZNA 3L7UA 1RAFB 4N7TA 4A4JA 3RG6A 2R2RA 1BWVA 3H2VE 2HRYA 2WAEA 2HQDA 1HWJA 3G2XA 1FK9B 2UVVA 2F40A 3T9ZA 3G6YA 4FF2A 2XYPB 1UCNA 4A48A 4JV5F 1JLGB 5KFJA 1RCOB 3A4TA 1RGVA 4B9MA 3H5XA 5C7PA 2MEWA 2J8SA 3IRXB 3TWZA 3NEKA 3R97A 1H0HB 1U2FA 3BN7A 3N5FA 1JXVA 3BGRA 4Q5VA 5LOQA 4I0WA 2ZH3A 4PUOA 1GMWD 5T14A 2M5YA 1QAXA 1QTNB 2KT3A 4WFXA 2JFDA 4OHVA 3SSRA 1AB8A 1KQGB 4ITSA 2HGLA 4Z7CA 1XNRF 4CO1A 2COLA 1NDPA 5ETTA 3PHTA 3KLGB 4LF9F 1X9SA 3M05A 3J80U 1WC6A 4AD6A 5LSLA 4AL6A 1SH0A 4WFZA 1S6PB 3CSKA 4YY3F 2E44A 4I2PB 4MYTA 3MOZA 1MWYA 1ZM4A 3MM5B 1M5OC 1HR0J 1RAHB 4PWUA 4JI8J 7AT1B 4DR7F 1ZTWA 4IR1A 4EGLA 3RAXA 2Y1JA 1DQ8A 5IWAJ 2J7KA 5THWA 2PFFB 1SVDA 4OI6A 5D0GA 4HEA9 3D1HA 4K4XA 1NAQA 1R27B 2G0IA 1Y4ZB 2J5AA 1W2BR 2RILA 2LP4A 1LXNA 5CZXA 3DCAA 2PA8D 3H90A 5KT6A 2D69A 3FK4A 2D74B 1RU2A 3W9HA 2IJFA 4L74A 1WF0A 3DM2B 1P8GA 2VFSA 1RWNB 3H59A 4B9VA 3NGUA 3DOKA 3M8YA 1MROB 2C2RA 2QLFB 2FJVA 2UV8A 3IN5A 5A8KB 2OMLA 4KPYA 1PG5B 3ISND 4DPXA 5FIIA 4RUAA 3J81U 2W7AA 2RKIB 2A2DA 3QGPA 4ED6A 2V5HG 3CWJA 2AP6A 2CJKA 2FD2A 3P4UB 4IDKA 3ILOA 1UJ5A 2ZNYA 5HMXA 3GP9A 2R8KA 1SCJB 5E3CA 1MN9A 1U6ZA 4FYYB 1VQPS 1YWXA 4J9UE 2KO1A 2X1BA 1VQ5S 4Y2CA 2ATCB 3U1MA 1RYRA 1V5VA 3CVKA 4Y34A 4H4MB 3TEGA 4WF9Q 2BW2A 5GMDA 2HS0A 4FVMA 4URQU 2GGPB 4WK3A 4RW9A 2JVRA 3IWXA 2HHSA 2PN6A 2YNHA 3ZTOA 2EVZA 4X65J 2HFNA 3T3FA 2XI2A 2ALZA 4DX7A 2MKKA 1XBWA 2ZC3A 2F8EX 1HMVB 3CCES 3LQVA 2JLFA 2C3OA 3TZWA 1O6XA 1XC9A 3H5SA 3MTKA 2F4VJ 3CCQS 4F4YA 4LFBJ 3ELHA 4Q0BB 4U95A 1G6BA 1KQFB 1Y11A 4XPEA 4N77A 3A8JA 3JSMB 2G1DA 2ZDPA 2YTCA 4ZHRA 2CWXA 4J5OA 1CQNA 4TQSA 2V34A 5I3UA 2DVIA 3A13A 1S76D 3QT8A 1S59A 3TAPA 2IRYA 5IT4A 4IQMA 1TL5A 1YJ9S 3QAUA 2VBZA 1FRLA 1P27B 4DZ6A 2J8AA 4IOAQ 1XR6A 2W7OA 4U67Q 4ZP8A 1T9TA 3PKMA 1CEZA 2HHPA 1JXEA 4RKUC 3SI8A 4KKOA 1XERA 3EZUA 1SPBP 2KN4A 2V94A 1P9QC 5KG7A 2XWXA 2MJUA 1XMQJ 2XHCA 3PFEA 4OX9F 3ZG5A 2MKHA 2C2OB 1V5IB 5C42A 1UA0A 3KLVA 1YQHA 1VLYA 3CCLS 3TW0A 3DFEA 1NB2A 1ZAXA 4Q43A 4MIAA 4MK9A 2F8MA 2V4RA 4RBUA 5CYMB 3G86A 2GIQA 2XO7A 5AE1A 4FF1A 1VBKA 4EYIB 4DF4A 2FC8A 1FK9A 2BQRA 4NCBA 4PXBA 1JLGA 1HFEL 4KB7A 1RP5A 2R42A 3T6BA 2KTQA 2DGWA 3IRXA 4CRJA 3JTNA 1K9MT 4KGKA 3VVTA 3V5RA 1NSKL 3JQKA 2R7SA 3SZ2A 2XMAA 1YRXA 2J0XA 1YIJS 2XZDB 3QT6A 4YEAA 1VOMA 4DEZA 5KFZA 3WIVA 2R7VA 3QSYB 4OZLA 3I4HX 4Q45A 1LWCB 2VB6A 3KLGA 5GAHU 1M0SA 2UXBJ 1FFSB 4HKQA 1EKRA 3QZ8A 1F60B 2J76E 1S6PA 3D2WA 2IPOB 4C2MA 4ZKAA 4RR5A 4L76A 1G7CB 4LF1A 3CF5Q 4I2PA 3PXGa 3J7AN 2YWEA 3HVTB 2ZVIA 1X0PA 3MM5A 2Z0GA 3H8YA 3R9LA 2YWGA 1PCAA 5B7WA 2B56A 4OLOA 3KXDA 2KU7A 5HQLA 5M2UA 5F8IA 2XLKA 3OJSA 3LGMA 1VISA 5E0OA 3W63A 4QPTA 4JI3F 2AYEA 2E9ZA 3QFHA 4I68A 5KFSA 2DNGA 2B0GA 4I7FB 4KYZA 2VPXB 1FVQA 3KOAA 1T02A 3O8WA 4J9QA 2GJ2A 2VOOA 1Y9OA 3CT9A 2B5JA 1YLXA 5CAAA 1PO6A 4N47A 1U0HA 1T11A 4YR3A 5K9FA 2WZ1A 2GQ2A 3DM2A 1PJ7A 4ANCA 4FYXB 1KTQA 3OFHA 3QT5A 3ZTSA 3N5BA 3OXFA 3NOGA 2VD3A 2GMLA 3E51A 1VQQA 1MROA 3BEGB 2HZCA 1TP7A 2EBEA 2C3YA 4G1IA 3I0RB 5A8KA 1FF2A 2RSQA 3IM9A 3WX4A 1U47A 1XR7A 5IT9U 2RKIA 4JBCA 1UTAA 2E66A 1GXTA 3AY0A 2D41A 2G13A 4KT0C 4DBQA 4LVOP 4C8MA 4WTOB 4ELUA 1IWGA 4ED7A 1H2VZ 4P10A 3HFZB 3CJ4A 3P45B 2H65B 3M2UB 2NSBA 1QVFR 1P9YA 4OZ0A 3N6MA 2VH7A 1UFKA 1H73A 3DYAB 4H4MA 1RTDB 1VQ8S 4EEYA 4F4AA 2GGPA 3NCPA 4QCLA 2XTJP 1TMJA 2VPWB 2HAFA 4IOBA 2V69A 2FQQB 1GXUA 4DR4J 1S0NA 1JLCB 5KT3A 1NHUA 5KT2A 3J7YU 2N7YA 2F8HA 3UI3A 1HMVA 2LMIA 4BLGA 3BGOP 1RDRA 4JI7F 1UVMA 4EBDA 4C3MA 4Y0FA 4Q0BA 3SSSA 3JSMA 4B9TA 1B64A 5A76A 4CYUB 2YX4A 2MKIA 4YMEA 1MSWD 1UMJA 1M5PC 1JLQB 3NWGA 1NMEB 4ES1A 1NDCA 2E1MC 1QAIA 4DSKA 3EGVA 4IG3B 1X4HA 1S7IA 1GEHA 1ZM3A 5LL6d 3TANA 2C1EB 1L3UA 5FLXY 3DLGB 1AZSB 2IA6A 2G9OA 4U6PA 2AJ2A 2Y9HA 1UP1A 3DGPB 1WG1A 2B4OA 3OLAA 2XMVA 2D3OR 3MAQA 3K0JA 2ADBA 1K44A 1RU1A 4DQSA 4CT9A 2DYAA 2BBEA 1HNIB 4UW2A 3HHEA 2RT3A 4B3TF 2QMWA 5CYMA 3BO3A 4L6V3 3P5BP 1T7PA 1U26A 2WSFC 3TQEA 1X5PA 2R9LA 2ZVSA 4AQYJ 4DLGA 1IBMF 4F2RA 3D54A 2C2DA 1SKWA 1RT3B 5ETPA 5F9NA 5CD4A 3K2YA 1RHUB 3MAHA 3Q2SC 4DSFA 1AROP 1GMWA 1KRPA 2LA4A 2EG2A 3NGKA 4M63A 1T9XA 1HD1A 1XIQA 4QIEA 5F8MA 1EAYC 2RIJA 4CO3A 2ZKUA 3NGDA 2A6MA 3C6UB 3W5ZA 1FWPA 1NPPA 1N52B 4EUVA 2LQ9A 2R7RA 2XGQA 3I4PA 2Y3YA 2ROPA 3X1LB 1FDDA 1LWCA 2V4QA 2X1FA 3H4BA 5CQGA 2KKHA 3CD0A 3I82A 2DRBA 1EQ0A 3TI0A 5F8NA 5KFQA 4ES3A 4TVAB 1S0MA 2H5JB 5JVHQ 3HSDA 4O3RA 1X5TA 3BBCA 4DFJA 3TZYA 3HVTA 4TXSA 3GU0A 2HBZB 5HP1A 3ZZOA 2VBXA 3SMZA 5ETVA 4IH6A 4A8WA 2X1AA 4OLPA 3OTOJ 1N32J 5HK4A 1VYAA 3D66A 5ITHA 3UO0A 5D0HA 3EE3A 4C0BA 2MZRA 1X4GA 1K0VA 4I7FA 2J6SA 4K0KJ 1VQMS 2ZUGA 8AT1B 4X2BA 1GK8A 1S6UA 4ZDNA 2RDIA 2QC3A 2JSXA 2V2VA 2OO4A 3MMBB 4TY8B 5L1KA 3EGWB 1TL4A 1S9GB 2RMLA 4RJVA 3KFWX 4B3MF 4IUFA 1R8CA 5IS2A 2KG0A 4PXCA 1DQ9A 2H4WB 3UD4P 5LMNJ 1TFWA 1KR4A 4DOZA 2ZBQA 3I0RA 4UOCA 3PNIA 5C2CA 2HFSA 1UPPA 3OBIA 3T1AA 1E6VB 4DR4F 5F0WA 4ES2A 2KB2A 1U7LA 1SKRA 3R5JB 4K7QA 3RYLA 2PA3A 3RRKA 3EXYA 5KG0A 4G1PA 4U7CA 3EMTA 4JI4J 1V3RA 3W5XA 1OY8A 3LANA 3M2UA 1UJ4A 3JAMU 1BMQB 2CQ3A 1FESA 4DS4A 5LJ5Y 3TRGA 3DYAA 4DL4A 2FHOB 2OGUA 4WYWA 4DS5A 2ILYA 4M5DB 4DV1F 1XN9A 1SV5B 5KFMA 4V19X 3TAQA 2EBGA 1XJWB 3ZO7A 1VS3A 5D6GA 2BJ7A 2HVZA 2UV8G 3FRZA 4FF4A 2VFVA 3PO5A 4U8YA 3UNGC 4RU2A 4CNZA 1AYEA 4LR8A 4F0HA 2W1BA 3PYGA 3R6LB 2XCPA 2B3TB 2OPQB 2UXDJ 2XLJA 2G2OA 3T5LA 3QAEA 2VQFF 4X62F 4CLKA 2DT9A 1T8EA 5LT5A 4HT5A 4ZLNA 2MQNA 5KG5A 4U96A 3VWSA 2BJ8A 1T03A 3SQOP 4CYUA 2FGCA 4TN2A 3TA1A 1U2RA 2ZH5A 4DSEA 3FBEA 1SL1A 3HKZD 2AEJA 1S1UB 2R8HA 1JLQA 2QSFA 5DGBA 5AXNA 4MKBA 4NXNF 2AZ3A 2AIRB 4IG3A 2VG7B 3C8YA 4LRCA 3SXLA 3CDAA 3PJ9A 4IFVB 4ZP6A 1X7VA 3DLGA 2EK1A 1AZSA 2FB0A 5KFLA 3DGPA 1WORA 2ACYA 1RBOB 4CLPA 2W2MP 3PTWA 5FDLB 2MHEA 1F6TA 1N34J 1YITS 1HNIA 2B4PA 3O5TB 4ZOSA 3PW5A 4QIWD 4Q2MA 3PX4A 4ZCMA 3ENWA 1I94F 4JP8A 1VR6A 5DLFA 2MLXA 3TARA 1SUQB 1FO1A 2UU9J 1RT3A 3AB4B 1UFWA 2GO8A 1N36J 1IVZA 2XS7A 1HBMB 3EQUA 4R0EA 1MWTA 3B4DA 1VQ4S 3KMQA 2LEAA 1Q7LB 3I55S 2O67A 4MKAA 1HA1A 4M8LA 3OL9A 1EX8A 1YX2A 2AWZA 3OTOF 1N32F 1H2TZ 3ADAC 3DLKB 3ENAA 3C6UA 4K5SA 2YKOA 3VALA 2EFPA 2YKNB 4ZK7M 1K8AT 4P73A 4K0KF 1FHTA 2YQ3A 5F8LA 2NZCA 3QWUA 4P7TA 2RQ4A 3EPGA 2F3JA 5FJ4A 1N4LA 2F7VA 1FE0A 1RWPB 4OI0A 4C8NA 1MWZA 1GX5A 2DNNA 5KFAA 2FJXA 5GAHI 2DJWA 1SQFA 5T41A 2ZWOA 1RHKB 2FJAB 3B4MA 1NO8A 3D6FB 1UVNA 1F5AA 5KG6A 1C1CB 4Y6IA 1TUVA 1EQMA 3VAJA 3W9JA 2DRAA 1YRTA 2V8VA 1IN0A 4IRKA 2BYCA 2DGVA 4JI1J 5DDPC 2MLZA 3HLUA 1DAXA 2YKAA 1JLAB 3BKTA 4CM2A 1YJWS 4KAIA 1CJUB 3EM1A 4JI4F 1PILA 5EWFA 1WOPA 2M8DB 3ZFVA 3M6UA 3MMBA 3CJKB 2E1AA 4TY8A 4B9UA 1S9GA 3GG1A 2HHTA 2CG4A 2HLTA 1UVIA 4MH8A 2A0FB 3QNWB 4ZP9A 4DF8A 3D6TB 3CCTA 4RLEA 3IP0A 2ZWPA 3QWPA 1T9WA 4FKXA 3BO2A 1TV6B 3ETMA 3ZZUA 4PWDB 2VF3A 5F8GA 1QSSA 1ACMB 2IAJB 3PIPQ 2DISA 3CTRA 4ZS6A 3I9ZA 1TAQA 1BQNA 1E6VA 2CVEA 2YH0A 1B70B 3DXBA 5ETKA 2CJXB 2ZZNA 2HHQA 3RBEA 2U1AA 1XWLA 3RRHA 3AJ1A 1U8SA 2BV3A 2LDYA 2QRRA 3AD9C 3IR5B 2J0QD 5HJXA 1N5YB 1PYTA 2WONB 2UXDF 5G4DA 5D78A 1APSA 4EI2A 2XNRA 2Y1LB 3CJ5A 1SV5A 3BPSP 3DOMB 4F50A 1WHWA 4LT6A 2LCWA 1ZPWX 3CUNA 3G6VA 1DQAA 4BC7A 2HPUA 2R7TA 2DNKA 4NYPA 3M32B 4PG7A 5EGYA 1HBUB 2VFTA 1IBLF 2N3LA 2BX6A 1OSDA 3F56A 1VHIA 1PGZA 5FD1A 3CXCR 2N7CA 2NREA 3CJ8A 3QT7A 3BSAA 5M2RA 3J7YI 4USHA 1B99A 1DFDA 2OPQA 2FZKB 4AYBD 2J6UA 2JEGA 1VRTB 1N34F 4ZCIA 2CVIA 4LF2A 3GJQB 2I9SA 4BL3A 2F9JA 4OMFG 1MMLA 3DGVA 1RWMB 1RHQB 3C14B 1S1UA 2CQPA 3DRSB 3TZZA 2F1FA 1NCLA 4A8YA 4RX6A 3GR1A 3KK3B 3KHGA 2JH3A 1JLBB 1YTYA 1TMMA 1OO0B 5AXLA 3PW7A 2UU9F 2VG7A 4ZVRB 3P96A 4KE5A 4EO6A 4IFVA 4OYXA 4ZPDA 1HW8A 1TELA 3GV8B 1CULB 1RSCA 3V4MA 2DR7A 2ZUAA 4DR1J 2GVDB 5CYJA 1VFJA 2ZEJA 4NLTA 1FCAA 1BGXT 4BWMA 4ECUA 2JEJA 3VGUA 2NR0A 1BD6A 3V6HA 4CLFA 5FDLA 4N41A 1L5UA 4JI2F 4Y2MA 4MIBA 2ZH2A 2HNYB 4LFCF 4CLLA 3M8RA 3QO9B 2KRBA 4KGVB 2V6AA 2AYMA 1R6YA 1D1UA 1WC0A 3GG0A 3M30B 4TNOA 2ZBPA 1HBMA 2FVRA 4QBUA 3Q8YA 5DM7Q 4XAKA 4GVLA 2GQCA 3BQ1A 2IBOA 4P2SA 4Z37A 4EWTA 3FEXB 1B0PA 1R7IA 4I4BA 5LMUJ 3DLKA 1K25A 2YKNA 5DETA 2YWKA 6FD1A 5GADU 5IXUA 4JI1F 1UVLA 3DN9A 2X1GA 2RF2A 2W01A 2AV5A 2P6SA 2DPJA 4N56A 4RW6B 4IYQA 2ZH4A 1FEHA 5GVQA 1TZ0A 5ADZA 3W61A 3IWLA 4USWA 3CCMS 1Q7YT 2VFRA 3UD5A 2P9CA 4C8KA 2FC9A 2FZCB 2MY7A 3T5KA 1KD1T 2VHGA 4ZPAA 1E6YB 3FZBA 4ZVSB 1VQ7S 3MFHA 4X4VA 3HDSA 4MK7A 1C1CA 4X66J 4DU7A 3CMAS 3CCUS 3DDIA 2YBVA 2ZM6J 2BXJA 3HT0A 2O5DA 1N88A 2E1PA 5ETNA 1JLAA 1ULRA 1CJUA 1AUSL 4HDGA 3M8QB 3KKFA 2FLOA 3MEEB 5J2QB 3MUVP 3GV7B 3AFGA 4X4OA 3CJKA 4A8OA 6AT1B 4MAKA 1RYSA 1KSPA 2HVHA 2OLWA 4X4RA 4OZ1A 1NBEB 2B6AB 3GFYA 5KT5A 3HZGA 3EX7B 2QO3A 2IJRA 4URSA 2B9XA 3Q8QB 1TV6A 4PWDA 3P8BB 1TVRB 2IAJA 4QU7A 4H4OB 5B0DA 2RRAA 3D5MA 3EVOA 2WB4A 3CD7A 2CWKA 4USIA 4UQGA 4DV4J 3QGHA 1RBLA 3UWTA 2MQMA 2D7SA 3I32A 4D3GA 5H9EJ 3FSXA 2YXLA 1F9EB 4PYAA 5AJ3J 4TU8A 5HMZA 4YR0A 3OSPA 2KFZA 3AQOA 1N5YA 2WONA 3VQSA 2ZH6A 3WC2A 4FDFA 4P2MA 3NLCA 4NLPA 5K14B 2WBMA 3OVSA 3T1YJ 1MMNA 2BABA 2MXYA 2PI5A 3DOMA 4YOEA 5EN1A 1GNKA 5KT7A 5KFXA 4WU2A 1GTEA 3UVJB 1UEUA 3M32A 3NCQA 1HBUA 3C19A 1T3OA 1NEEA 3CULA 3KJQB 4K4WA 1S48A 4DR1F 2K7JA 2Y1RI 3MMAB 2BANB 3JB9k 2MTLA 5CYQB 5C2GA 5K8NA 3CMQA 3G6ES 4PQUB 1UA1A 3EZ5A 4PZVA 2OEKA 1FJEB 5LSRA 1H7WA 1VRTA 5LM7E 1S72S 4RA7A 1C4CA 3LOUA 3HO1A 1TKTB 1Q5VA 3DOLB 2FVQA 3R1LA 4PG5A 3FMBA 1RA7A 1RABB 1SQEA 3IBCB 1NJIT 3EWGA 4ED5A 3C14A 3DRSA 3D7SB 3MD3A 4CZCA 3KK3A 3I9V9 2DR8A 1JLBA 1WWHA 1B0VA 2AHOB 2BEFA 1SBRA 2LQBA 2VKRA 3NNHA 1XK8A 5G0RB 1C2PA 1LWXA 1CULA 4NE9C 5K5MA 3UN7A 3OR1B 1TTHB 4RWWA 1T9YA 5DDRC 2R2UA 1YG0A 4MJKA 2JRSA 3FFIB 3JXOA 1OIAA 2CPDA 1L3KA 4NA2A 5LMUF 1FFWB 2BJ9A 5AE2A 1GFWB 3VAIA 2QE5A 4DQRA 4NYOA 1RAGB 3H20A 3PVXA 2HNYA 2ZE2B 3QO9A 1JNZB 2LLZA 3BSNA 2KT2A 1OS5A 2WB1D 8ATCB 2OPPB 4NEZA 3EVWA 2HQCA 4P2XA 2CPEA 2HZVA 3M30A 4MIWA 2FDNA 1RT1B 3QGGA 4NA1A 4WK1A 2IHR1 5KFHA 3BO4A 2DGTA 1R8HA 1IWAA 4A8SA 4PG6A 3BQ0A 3PEHA 4OI1A 4A8KA 4MFBB 4LF8F 4F3QA 3BBFA 3W1YC 3UPFA 1F3FA 4X66F 2V67A 3R8YA 1RTZA 3N6NA 3DXSX 1U1RA 3MDFA 1Q8LA 5EUHA 4ED3A 2KT5A 1S4FA 1AXQA 1URNA 4L73A 1WTFA 3C15B 4ECQA 4RW6A 4CLWA 3HMJG 1HNZJ 1KNZA 3OR2B 2QMUB 2NYHA 5RUBA 2QT7A 2HFVA 3GR0A 4C3LA 2FLLA 4UZBA 2YX1A 1LFPA 1E6YA 2ZH8A 1C1BB 2BOAA 3ILLA 4YP3A 3TO8A 2AGOA 5DG9A 4HACB 1M1KT 5L38A 2GNKA 1NPRA 4C48A 3TX0A 2BR0A 1Q8IA 3M8QA 4ZCLA 3MEEA 5J2QA 3SYZA 3KG0A 1VIOA 3MR6A 3EZOA 3W65A 3D1OA 1TK0A 3NGRA 1EETB 4ZJOA 2E9TA 4B3OB 2B6AA 1RT6B 2R7XA 5C25B 5KFRA 1IBCB 1KFSA 2GVZB 3DU5A 2UVRA 2XHWA 3J7A1 1TVRA 1S12A 1Q4RA 2VG6B 2XY6A 4H4OA 3CB4A 1Y10A 2OTJS 2RQCA 1IBKJ 3CDUA 1BQMB 2BJEA 2RS8A 4NLVA 3PYDA 2ROGA 2I6WA 2PEBA 4R23A 2Q6BA 2HWIA 4BBYA 1NSPA 3AXMA 5HLFB 4E8UA 4LF6J 4S0MA 4NRUA 1TFYA 5KG4A 3M7VA 5CXTA 1SJQA 3GFHA 3LALA 3RR7A 2XG8A 3FJ2A 3TVKA 4J9LA 5K14A 4RBVA 2FPHX 3VF0B 4DL7A 2OI2A 2DNYA 5D4PA 9RUBA 4YB7A 3M9NB 3MHYA 4LQ9A 4KGMA 4QQBA 1WHYA 4ICLB 3UVJA 5KAKA 2YQ1A 1S1VB 3O3LA 2MZ1A 3HX9A 1NZ8A 1D09B 4O3QA 1BE4A 3EICA 3MMAA 3US5A 3C46A 2BANA 2LU2A 2XBPA 2WBRA 5CYQA 2VPYB 2D1CA 3MUTP 4PQUA 1D9DA 2B4VA 3MCSA 3SV4A 1OY6A 1S1TB 1U25A 4F3MA 2UUAJ 2LDIA 3DOLA 3MM9B 3R7NB 5BYSA 2NXUA 2RQMA 2FTRA 4A46A 2CQBA 1CJKB 1NK0A 3NXZA 2CPIA 2AMCB 1I6JA 4P9SA 1CJTB 2DH7A 1KVJA 1NLKL 2C2ZB 3MEGB 3IXQA 1WG5A 2GMJA 4J9RA 4U7UD 3K17A 2DB1A 2QL9B 5BYRA 4ATNA 4LF4J 5G0RA 4LIRA 3MTJA 1NH8A 3T1HF 4N8OA 3DC2A 4WFBQ 1VBYA 3OR1A 2RB7A 4QYZK 3FFIA 4YS2A 4CLSA 1SL0A 2VKZG 3HM9A 2MSSA 4CIOA 2WW4A 1R0BG 1N0UA 1N33F 2X3DA 1FNMA 1K1SA 2ZE2A 3GIRA 3TJ8A 4DR6F 3R2DJ 1AFJA 5HVFA 5LSOA 4G6VB 1Q95G 3KLFB 3I6PA 4ED2A 3AAWB 2OPPA 4X4SA 4MK8A 2B7CB 2VASA 4Y3CA 4MYUA 1RT1A 4M5GA 4X64J 4QWCA 2MZSA 3D0GE 2JL9A 1ZOTA 1WF2A 2RRBA 4MFBA 1X9WA 1QM9A 1O0PA 4QR2A 5AT1B 3KNGA 1YJ7A 1FWLA 5KFTA 5HL7Q 1GH8A 1JJ4A 2HS4A 4OVDA 3TOQA 1CSJA 3R7SB 4QR0A 3BGLA 2RU9A 1LXJA 3OVAA 2V9KA 2YPZA 3JSRA 4ED0A 4X4NA 3QPIA 2PI4A 1UZHA 3RJMB 2E9RX 1RA6A 2ZZTA 3C15A 4NCGB 1BUXA 4UOFA 5GADI 2CZ9A 4W92B 1ZPVA 4C4WA 2HGNA 3D28A 3OR2A 1K1QA 1LKZA 1HBOB 2DCUB 2DKOB 2L41A 1FRXA 2WAFA 2NUUG 4NZ7A 4C8OA 1RWXB 2A6OA 4NXMJ 2PIIA 3K57A 4NZ0A 1X4EA 2CNOB 3CNQP 4QW9A 4PXDA 1TKZB 1C1BA 3NNCA 1WC1A 5HI7A 4HACA 5KFPA 4H4KC 3PW2A 3FQLA 2FY8A 3GONA 3FZ2A 2QL5B 4M5MA 5A2QY 1WOSA 4P71A 3H0PA 4LF6F 2AX0A 5E5NA 1YJNS 2FJBB 1HI8A 4WXOA 4FXWA 2OLVA 4WP9A 2A3JA 3CCJS 1EETA 4B3OA 1RTHB 5C25A 2B43A 2CA9A 5IC4B 4JYAF 4CI0B 4KHRA 1HQUB 2GVZA 1FXLA 2NUHA 2ERRA 2VG6A 3GYXB 4ECVA 3UR3C 1HHTP 1BQMA 3BDEA 2LXIA 4DX8H 1D0EA 1HNWF 1V3ZA 3W3SA 4O44B 2Z58B 4B9LA 1KQKA 2PFDA 1VJQA 2H4YB 3LH2S 2IDEA 1NKEA 5HLFA 1TKXB 3OUYB 5L8RC 3CIMA 1NSQA 4DR5J 1WOOA 3DRRB 4WZMA 2MQOA 4DUZJ 4J9NA 5U47A 4R0JA 5B09A 3IAM9 2OUGA 3EPIA 5HROB 3G8SA 4CJNA 3Q89A 5CA5A 3P6YC 1UPMB 1H74A 3QYYA 2NPFA 2XYGB 3DRXA 1IM6A 4LFAJ 1QD1A 1FKAF 1EZZB 1NPKA 3FMWA 3RAQA 4DR3J 3FUYA 4ICLA 3GJRB 2W24A 4YB6A 2Y0SD 4OYMA 3IGNA 1NNDA 2DR9A 1REGX 4YDXA 4RNMA 4BDPA 2MKYA 3Q23A 3SDEB 1S1XB 2Z8QA 3HD2A 1HPZB 2W2PP 4DUYJ 4NASA 4ILMA 1SIWB 3KHRA 2XSJB 2HS3A 2XEXA 1S1TA 2W9CB 3MM9A 4OHXA 1JWWA 1FDNA 1CJKA 3PR5B 1CJTA 2ILZA 4WTYA 5E3PA 1LQ9A 2UUBJ 5H9FK 3MEGA 2WSCC 3B82A 1HNXJ 3V81B 1HWLA 2OTLS 4OX6A 4X64F 3D3BJ 3A12A 3E3XA 3MFIA 3UDCA 5DGAA 5DLGA 4RNHA 1OQ6A 3OLBA 1DBDA 1K73T 2E7XA 3CO0P 4DL5A 1WD6A 3RB4A 4ETZA 2RHQB 4EMDA 3G82B 3N79A 2KHCA 2CYYA 3H25A 3FKBA 2RRNA 3LGNA 1PJ5A 4K59A 2GA7A 5JUMA 2A2CA 3PG9A 3KLFA 3OPKA 1XMBA 1N48A 4ZVFA 3CMES 3CJ2A 4TLQA 3DWKA 1UJ6A 2VPZB 2LYVA 3AJ2A 1S9EB 1H38A 2VZ9A 1IJEB 4PAAA 1F3VA 1TUWA 1PYOB 2K8GA 3HPOA 4QYZJ 4NXMF 1U2CA 2ZOMA 3D6MB 3E01B 8RUCA 3NCRA 1SKUB 1CPZA 1RUSA 3TVZA 5L9XA 1NKBA 4DV7J 3HHKA 2YY3A 2P9EA 4WP8A 1LW0B 4KV8B 4B17A 1A0OB 3IR7B 4DV0J 1MMDA 3AQPA 4NCGA 4PWWA 4X4TA 3HI9A 1S57A 2YKPA 4O0IA 3MEKA 4HDHA 4F67A 2CZ4A 5BYQA 3V4IA 2IFXA 3IBFB 2M4MA 3PJXA 4LRDA 1HBOA 4J9MA 3KLEB 4MT1A 3HULA 3DDNA 3SCIE 1U0SA 2AJ1A 4ZPTR 2UP1A 2VJUA 1JMTA 4OZNA 3OVBA 1TKZA 2CQHA 2AF6A 5L39A 1U1PA 1SJRA 1A6LA 2G2YA 4LSNB 1ZM2A 3H5YA 1X4BA 3LW5C 1EARA 3AA9A 3AD8C 3S01A 2W8KA 1SJ1A 4F25A 3H7HB 3PZPA 4KBIA 2O3DA 1DLOB 2GHWA 4PPDA 3MCNA 3LUYA 2HIYA 2PT0A 1NRKA 4E0DA 4RW7B 4DUZF 3HD1A 4QIVA 1RTHA 4YB1P 1YZ6A 3OSNA 1U8WA 4DN9A 2ZBCA 5D77A 2ZH1A 4DUTA 1HQUA 2EWHA 1RT2B 4DV2J 2Q1LA 1Q8BA 3F0NA 4KTQA 3QMQA 4YFUA 1VIXA 1L3TA 4LFAF 4USTA 1J2VA 2W2OP 4KRWA 4O44A 2J0WA 4DR3F 4R8UB 2CPJA 2RNEA 1FRJA 3CJTA 3OL7A 1Y3KA 2YWFA 2DH9A 3BPDA 5J2NB 4B08A 1YJVA 4QWDA 1CVJA 1TKXA 2BKNA 3OL6A 3SCJE 1ZYQA 2MGZB 2L3MA 1TL1B 2H48B 1F9HA 2CXEA 3DRRA 4LRAA 3MPWA 4DUYF 1HYSB 5HROA 2BM1A 5GMEA 3RW6A 4B02A 2KI2A 1RT7B 2LVWA 2J9DA 2OD6A 2R8JA 3LGHA 2VA3A 1TR0A 2XZWA 1K47A 2XWYA 1F9FA 2D3ZA 3BREA 3BBBA 2YNFB 1B3TA 4F4KA 2B8QA 4PPZA 3SFUA 4K5RA 5D15A 3SIPB 3MGJA 4QWEA 3SDEA 1UW4A 1S1XA 4J91A 1HPZA 1OPIA 4PG8A 4OJ1A 1EKSA 3NGSA 1T0TV 2B51A 2XSJA 3G4SS 2W9CA 1FJCA 5A2QU 3JSBA 3T6JA 2FVSA 4WFYA 2CPZA 2F4FA 1GQEA 1DURA 1PBAA 4DFMA 5E33A 3THVA 4C8ZA 2W9AA 2KYXA 4B3SJ 4DHVA 3EXCX 4O3OA 2GX8A 3V81A 3KJFB 5E7OB 4P72A 3DLHA 4W98A 3NS6A 1LW2B 4I69A 3SCKE 2VDHA 2CJQA 3JTPA 2ATLA 3PYFA 1YSJA 1P6TA 1S9FA 2IMOA 4OZ2A 4F0KA 1RKJA 1J5OB 2NXCA 1H7XA 4KSEB 4B3RJ 3FSYA 4DV7F 2JJ4D 2QGFB 3Q8SB 4NLXA 3Q8PB 3G82A 2RH3A 3CC7S 1HR0F 5E2QA 1HARA 3IRWP 5HAOA 2HHUA 4JI8F 4ZVGA 3AOCA 1JQGA 4PABA 1HIYA 3TA0A 3EYZA 5H9FJ 5IWAF 3FRYA 1SC4B 1FDAA 3HZEA 3B8HA 1U45A 2QV6A 2AD9A 3Q8UA 3TNVA 3C16B 3KDOA 1M1GA 1S9EA 4YHHJ 3H5UA 4KGZB 4RW8B 2QZ8A 2G1HA 1OMSA 5DQHA 1B7YB 5HQ8A 2GMHA 3E01A 3MM8B 4HTJA 2YWHA 4HH0A 2JLGA 5HMYA 3TUIC 4ZVEA 1Z4UA 3KTQA 4KV8A 4ZLLA 1QE1B 1VJWA 2AU0A 3H2UB 3MECB 3ZNUA 4E98A 5F3ZA 2OSQA 2DNLA 5A0YB 4Y00A 3MOJB 2R7OA 5HATA 2XO6A 4KQZA 4LR7A 4FBTA 4U9RA 2RS2A 1VI7A 3KLEA 1HI0P 3HHLC 1GXLA 4NA3A 2V8DA 4A8MP 3KJVB 2YPYA 2WOMB 4J9SA 1WEZA 3H2LA 3WZ0A 2DNQA 5F8JA 1BQXA 5DM6Q 3RGIA 4LSNA 3OHAA 1WKLA 4CQ1A 1UL3A 5IFMA 3TEHB 4DG1B 1EJ7L 2YKQA 2Z2ZA 3J80Y 5A6WA 4M5JA 1HBNB 1DLOA 5KFIA 2FUG9 2CNLB 4X65F 2IA0A 2RAQA 2L08A 2M3DA 3JSYA 4RW7A 2BJDA 2NXNA 1RKIA 1FJGJ 2EFNA 2OSRA 2CJ9A 5J2PB 2VC0A 2KXHA 1L3VA 3G9CA 2IMWP 3QBCA 1RT2A 5IQ6A 3AD7C 3ZTQA 1VC0A 1S6QB 4GKKJ 3WDOA 2F4VF 1GAOA 3B54A 2PMWA 2M9KA 4LFBF 4BC9A 3QIPB 3ZZRA 3ONQA 1YBTA 1Q1KA 3ZXWA 4R8UA 2HSEB 1MWSA 4K4TA 3BQ2A 2BA9A 2GV1A 1PSDA 3W66A 1IQTA 2APOA 4DFPA 4RNFA 3NL0A 2KFNA 5J2NA 2MMYA 2E5IA 5B0AA 3DRPB 2V2QA 1H72C 2DHHA 2GAGC 4ILLA 2MGZA 2CNKB 1RTJB 3TP2A 3V2UC 1TL1A 2BMBA 2XNQA 3CCVS 4GMKA 1HYSA 4EFAC 1R8AA 3OXGA 4NLWA 2CDQA 5M1AA 3A3NB 1N0VC 4F02A 1RT7A 4R25A 2FVCA 3FBCA 4OI2A 9ATCB 1GTHA 4WIIA 3CCZA 3BN4A 1SJFA 3J81Y 1XMQF 4UY8T 1KHWA 3O2IA 3CD6S 2MB0B 3HFVA 4B3SF 2XGPA 2HNZB 1YRUA 1DJ0A 4IOCQ 4XTTA 1D9AA 4CLYA 4EO8A 1IKVB 2WTFA 4Y2AA 2YNFA 5GMKa 1FD8A 1HHQA 2ZHOA 2DXEA 2YX7A 2C22A 2J6TA 5IT0A 2PO4A 2Z2LA 1FVSA 1SJ3P 3DHXA 3PRVA 5KOWA 2JX2A 2AJFE 2W4PA 5KFUA 5JVGQ 4EBEA 1IKWB 1Q82T 1V6HA 4DSJA 4ELVA 1P1LA 2IM2A 2HWHA 1C4AA 2RUSA 4I64A 1YDLA 3SV3A 3VAFA 3U02A 5C5JA 3QJPA 2IYGA 4O23A 3U1NA 5CD4H 3UCUP 3CCWA 1WJ9A 4WIQA 1RWKB 4J90A 4DL3A 1LW2A 3IC1A 4YHHF 4JV2A 2UXBF 4A8FA 2XY7A 1J5OA 1SH2A 1VK8A 3IGVA 3KG4A 4EYHB 2FJWA 3DHWC 4R0QA 4LF9J 4KY3A 1Q81T 2HW3A 2KL8A 2D3O1 5B0BA 4OYBA 4FVCA 4KHPJ 3TA2A 3OL8A 4DL2A 4ZP7A 1RB0A 4Q44A 4KJIA 2H54B 4QYRA 1REVB 1KN6A 3HF5A 1U49A 1RT4B 3HVAA 2VQEJ 2JHEA 3B78A 3VAMA 2XMMA 2IJNA 3C16A 2BJ1A 2RHSB 3M8PB 5KFCA 4DR7J 1VQNS 1HWUA 4RW8A 4HLBA 4C0OC 3GIIA 3IWNC 4ECWA 3DKDA 1GMVA 3MM8A 4O4RA 2IIHA 2WAQD 2FJEB 7FD1A 2M70A 1U1QA 3OD2A 1NK7A 1OSCA 1QE1A 2HBQB 4N8NA 3I5CA 2KH9A 2AJQA 1TL7B 2ASDA 1LNQA 3MECA 3GSIA 4ZVHA 2E5LJ 3PX6A 5A0YA 5HVGA 4LSLB 5HVHA 4QZVB 4BS2A 3PJWA 4OYOA 1XEZA 5SUHA 2P9GA 3UE3A 3D0IE 3BR9A 3OTCA 2BDPA 3A3PB 3H40A 4ECZA 4X4PA 1SB6A 1U24A 2HK2A 3VSLA 1NM2A 3ZZPA 4F2SA 4GKKF 3NGTA 1TKDA 3KJVA 5C24B 2WOMA 1Z1ZA 2QEXS 4ER8A 2H51B 3I5BA 2PSZA 3AHPA 2Y8YA 2CFXA 2CPFA 2FVPA 2WVDA 2XULA 2DGUA 4DG1A 2D9PA 2L9WA 4TU9A 2X51A 1HBNA 1I51B 4J37A 4DPOA 1JLEB 2P6TA 2AYGA 4OZJA 5KFWA 2IDLA 2GO9A 2CPXA 2PGCA 5J2PA 4DMZA 5BR8J 4J9PA 1YHQS 4MKYA 1T95A 4Z7YA 1S6QA 1JLFB 1YBUA 3R27A 4DQIA 2V2KA 3QIPA 3I87A 2C42A 3GTYX 3K5LA 5K8OA 1EHWA 1RTDA 4BL2A 3W60A 3QJLA 3RW7A 1O8BA 1RAEB 2WRMA 4FF3A 4OYPA 4KFBB 4XIUA 2ZZMA 3DRPA 3NAIA 1X0FA 2F5GA 1RE1B 4FBUA 2LA6A 1RTJA 3LO3A 1YVFA 1JLCA 3LP1B 2JC1A 2HVDA 4DCOB 1UAWA 3MCOA 1HNVB 4MTPA 2R2SA 4YB5A 1CQMA 2BJ3A 3NWRA 2Z30B 3J7ZT 3FSIA 3ETOA 4NLGA 4GVBB 1WEXA 3HHLD 4H4KA 2WK4A 2B9WA 1KQSR 5IT9Y 2BE9B 1ZA2B 3B6BA 2PDAA 2XMUA 2QYGA 4QJGA 5L1LA 2BM0A 4ELTA 1QJHA 1RCXB 2HNZA 1R8BA 5F8HA 4OIXA 1VK3A 1W26A 1IKVA 3N9UC 4OI4A 2Z4PA 4OX9J 1ICEB 4AQYF 4I2QB 3AJDA 4AE5A 1NDKA 4TLRA 3G8QA 4C11B 2J7WA 2BE7D 3BF4A 2MKSA 1VHFA 4ZN3A 3SQGB 3VCDA 4BWJA 1IKWA 3NY0A 4KHPF 4CP5A 4ZLJA 1RHRB 3W2VB 4UT4A 1WDTA 5D3GB 2VQEF 2ZJPQ 2AJ0A 3CC2S 3WIUA 4QJVA 2FZGB 3BJYA 1RACB 1U1MA 4TYAA 3CPWR 2C2KB 1PIEA 3AOAA 2XC9A 4DR2J 1F0XA 3OT9A 3CDEA 2OAUA 2LXUA 2VV5A 3EDQB 1AUDA 3J81j 2IRXA 2EI5A 3GB0A 1XMOJ 2B5JB 1WHXA 3PACA 1U0HB 2K2PA 4LMZA 2ROEA 1REVA 3L09A 2E5LF 4UOHA 1F2GA 2IBKA 3OXLA 1XTZA 1WSRA 2DO0A 1RT4A 3L4BC 2WVEA 4HHHA 5JMNA 1HHSA 2CG8A 5D4OA 1FKPB 1OYDA 3M8PA 1R8PA 1KOHA 4O3NA 4RNNA 3BSCA 4I67A 1QSLA 1MNEA 4P52A 3D9BA 4JI3J 3BR8A 2I0XA 7FDRA 2YQ0A 4K8RA 4DFKA 3P49B 2L9DA 5KFFA 5HO4A 4B9SA 2W4DA 2GQQA 4G3IA 3LWMA 2RQKA 1TK5A 3IS9B 4ZIWA 5L46A 1GMUA 5LMNF 4FPIA 1Z2LA 1NH7A 4AXIA 4BCAA 1TL7A 4F4WA 1B7FA 5F3TA 3F41A 3MF5A 3BZQA 4LSLA 1CC8A 3VGTA 3K7RA 1J27A 2YNGB 5FLXU 4LREA 2A1BA 2LEPA 1R89A 1UEVA 4ID8A 2YVSA 1CS4B 4WBFA 3UDVA 4C0HA 5BR8F 2GJFA 4CLZA 1A7GE 1URRA 2MZTA 4HR2A 3QFWA 1FKOB 2E29A 5C24A 3M2RB 2LKZA 1YKWA 2EK6A 1IKYB 2YNIB 3U27A 4LUBA 1S0VA 3UQSA 2MKJA 1WF1A 1Y3JA 4DCPB 3TVYA 2Y0BB 4DPWA 5DS7A 2CIMA 2YH1A 4N1XA 4NMLA 1NJYA 4HI1A 2HIQA 3FCVA 3R1HA 1JLEA 4ECYA 2M0GB 4NLOA 1RISA 2KJWA 2EW9A 5DRKA 4OFZA 4LJMA 4C9DA 3BSOA 4I6AA 2HQFA 5EX0A 3RBZA 2N4CA 3QIDA 3KG1A 1JLFA 2NLWA 3TUPA 2ZOGA 1HWIA 4A47A 1WKJA 4ZIVA 2B8PA 3MURP 1W25A 5ETMA 1VC6A 3GIMA 1FTCA 4ZA1A 2C3UA 1WEYA 4JI7J 1S1WB 4M5DA 4KFBA 3HSZA 3RB0A 3GJTB 1RWWB 2PD1A 2C2MB 1L3SA 4ZN1A 4XO0A 3HHLB 1U1NA 5J1EB 5HBMB 3CJ0A 3ET6B 3LP1A 2XLIA 3OC2A 5KTQA 4GC7A 1HNVA 2QSWA 3FDSA 4R5PB 4XPCA 1N5VA 1WDDA 3T5HA 2VA2A 5DG7A 3GMGA 4ZVOB 4GVBA 4L75A 2KG1A 4KR0B 1WC4A 3VQTA 2GIRA 3K5NA 1S4EA 2FHMA 1CJVB 4FXVA 2FHJD 5GAGI 5KFNA 3EUNA 2GIFA 3V6JA 3OFFA 4ZVTB 4CO2A 3CD5A 1RLDA 2MQLA 1S6OA 1MU2B 2Z2YB 1ZA1B 2DHSA 3NOCA 2I2YA 4RL1A 1BY9A 4I2QA 1RHJB 1PJ6A 3JAMY 4DR2F 2E1CA 4L72B 4B3TJ 3BS9A 4C11A 1N36F 2OLUA 4UTGA 2MJNA 2DHAA 3P5TL 4QIGA 4UUWA 1XMOF 4Y65A 1IBMJ 3SQGA 4I1TA 4GRSA 3IO1A 2QLJB 2QX0A 5ETLA 1TU0B 1H98A 1YI2S 3W2VA 4L3NA 4KH1B 3OHBA 5DZ6A 4YR2A 3W2WB 4DLEA 5D3GA 3H4DA 3FNNA 1T3NA 1RJJA 4ZVPB 3C66A 5HP1B 4X4UA 3NKYA 1FX4A 3K89A 1CBKA 1RI7A 2G0CA 1QLNA 3N4WA 1SUQA 1F5CA 4J9KA 1FI4A 4A8QA 4OJGA 2WADA 4IG0B 3VZIA 4WFAQ 5K20B 1BHNA 5ETOA 1Y0HA 3OJUA 4LBPA 1PBUA 3L95X 1WG4A 4RUCA 3OTEA 2AX1A 2KVIA 4RBTA 2C3MA 2A10A 4P6QA 3PKYA 2XMKA 4M95A 2ZD1B 5DQGA 1VLOA 4NLSA 1VRUB 1VC5A 2GHPA 4CH0S 3AXKA 2AYBA 4LBIA 3TZXA 1FKPA 1M90T 3UDLA 4NPOA 3IAS9 3N0VA 2KM8C 4NWBA 3G6XA 1M5HA 2XS5A 5IC6B 3RUBL 4RUHA 3VGSA 3LP0B 3DLJA 4P74A 4W4MA 3W7BA 4TQRA 4ANDA 5B0EA 4PQAA 3O1LA 2XY5A 1MG7A 2WW8A 3V6DB 3PO4A 2WHOA 5JXSA 3R6GB 4ALZA 1R0AB 4F4XA 4NZ6A 5CHCB 4DQPA 1WKKA 3T5JA 3LP2B 3F73A 2LXFA 3PW4A 1R0CB 3IS9A 4M5IA 2DXDA 1OJ4A 1TK8A 2W7PA 1T05B 1ZBTA 3AA8A 2GS8A 4DN0A 2UXCJ 2MQQA 4B3MJ 4NLDA 3ENVA 2YNGA 1VMBA 3BYRA 4ENOA 1MWRA 2PEHA 3ITHB 3NRBA 1EB0A 5M19A 1CS4A 4F0MA 2OELA 1YGYA 3Q8VA 2C2EA 4FKYA 1FKOA 2AW0A 2J0SD 5EX3A 3UCZP 2DD8S 3M2RA 1X4CA 2XMJA 1C0UB 4Q8FA 4PRFA 1IKYA 2YNIA 2UVUA 1DRZA 2GW8A 2NCKL 4QWAA 1FE4A 4PR6A 4LBHA 3ZZ0A 2J9EA 3X3UA 3PCOB 5DDOC 4IH7A 3D0HE 3I0SB 1Q79A 1WSVA 1ZH5A 3SCLE 5B0FA 5KFYA 5KFVA 3M8WA 5F0UA 2E7VA 1FA0A 2MPUA 4NLYA 2IM1A 1T03B 2CRLA 4ETXA 3RU0A 4DV1J 5I4MA 4DL6A 5CCLA 5L9NA 5KT4A 2Z56B 3KK1B 3OTDA 5KFKA 3GIKA 2V2ZA 4CLTA 1LV5A 3CE8A 2QA2A 4NLUA 2K7KA 1KFDA 1AA1B 1FRIA 2EKYA 1RTIB 3KUGA 4W90B 1U1LA 4YDDB 2MLYA 3DMJB 4OHWA 4RPFA 1N56A 3M2VB 3I56S 5KOXA 3UCGA 1S1WA 4DPTA 2AGQA 3ZZYA 4QPXA 1KONA 1C0TB 3M6VA 3KUEA 4F04B 2VQFJ 3HHLA 4X62J 4K4ZA 2Q66A 1R6VA 5J1EA 5HBMA 3AT1B 1MW7A 2OH2A 3ET6A 3CJ3A 1JX4A 1XNQJ 2N3OA 2XQCA 1FDBA 4C8YA 4R5PA 2PE8A 3CCRS 2JC0A 2HRUA 5KFGA 2RUGA 1Y5NB 1NDLA 5I3PA 4HT7A 1VBZA 4NXNJ 1CJVA 2RDDA 3TJAA 3HHDA 4HHJA 4IRCA 5KFOA 1YJTA 1VGYA 5D0RA 3GZ7A 3CDWA 4ERDA 1LWFB 2DEJA 2CNNB 4KH0B 1XR5A 2ZOFA 1MU2A 4V19J 1U48A 4YUDA 2KVQE 4ZJQA 2K1RB 4USJC 3MEDB 1S49A 4CTAB 5DQIA 2OPRB 3IBWA 2DBBA 4EBCA 2OPSB 1S7HA 2GC8A 2HHHJ 3BKFA 1T9VA 2DHXA 4K2XA 2RU3A 2DEIA 2XMWA 1I94J 4C98A 2GVDA 4C8LA 2ALYB 1WACA 5F9LA 4ED4A 2AZ1A 3AH6A 4FNIA 1FTRA 4ZJLA 1TQLA 3RAMA 4JBFA 3W2WA 3C2PA 2CQIA 4OJ3A 1NK4A 4DDFA 1ELOA 1UWBB 3S6EA 2BKOA 4H54A 4U8VA 5IQQA 3DDKA 1ROFA 4DV6J 5HSPA 1M1HA 2I38A 2AT1B 4IRDA 2U2FA 3N6LA 4FZVA 1WC3A 3UNYA 2HFUA 1N5SA 3PFOA 2RD5C 4IG0A 1UKUA 4FXDA 1XQIA 4GKJJ 2NXEA 3QRPA 3LO7A 2DTJA 5H1SV 1X31C 5AXKA 2QLWA 2D9OA 4O3PA 2R2TA 3OTBA 4DSLA 4TY9A 2ZBRA 3JS9A 1KLMB 4DPYA 2ZD1A 2UXCF 4KPCA 3HSGA 1U6BA 1VRUA 3RZAA 1CLFA 2ZM6F 2W25A 3HVWA 2HQGA 3M6XA 4ZVUB 4DCJB 5B08A 5KG2A 3MMCB 4I56A 3R5BA 1W7WA 1PC5A 3Q8RB 1UVKA 5L1JA 1KTVA 2H5IB 4DKIA 4HI2A 3LPEA 1BQNB 1OWXA 2DY1A 5E3QA 2VOPA 2GAHC 1Q53A 2I5JB 3LP0A 2GFFA 2M52A 1RAOA 2EFGA 1FRKA 3MM7B 3V6DA 5E41A 1R0AA 3LP2A 1NHVA 2WCXA 4NRTA 1HQ2A 5HJYA 3UPNA 4AUKA 1T05A 2EC0A 4KGXB 3D4JA 4FS1A 2V50A 2LEBA 2ZITA 4O4GB 3UN3A 4WFNQ 1RAJA 1RADB 1MWUA 5MLCV 2LECA 3ITHA 5F41A 2EFVA 4DV4F 3TYTA 2R7UA 5D4NA 4KO0B 5BXIA 4FYDA 1YJRA 2V9WA 1M5VC 2CQ1A 3K5MA 3EJMA 4M5KA 5AJ3F 3W8PA 4J7CA 1C0UA 3Q86A 4OZ5A 3V6KA 1U09A 5GAEU 1O5JA 2H3EB 1HKAA 2OP5A 4NL5A 2ADCA 1FERA 5J2MB 4TYBA 3T1YF 4EZ6A 3ZNJ1 3M1VB 2DGXA 3K8WA 4HH1A 3I0SA 2AGPA 2C3PA 3M4XA 1QMEA 1F5BA 4J9VA 1T94A 3D6HB 2BUNA 4LSZB 1B0TA 1IM4A 5KFBA 3PRDA 2XM3A 4AL7A 3LAKA 1N54B 4MKVA 3DLBA 4ILRA 1XNQF 4ECRA 3UPOA 3G8TA 1H6KX 4USKA 3MAAB 2MHNA 1VCTA 3KK1A 2DNRA 3H42A 4ED1A 2XB2D 2V63A 2D3UA 2MQ8A 4IFYB 2QA1A 3P3DA 3MPYA 1FRMA 4M94A 1RTIA 5HMWA 2ASJA 3BYPA 1DARA 1IBLJ 3DMJA 1ZZFA 2AJ4A 3GCXP 3M2VA 5A8RB 3ICLA 1QVGR 4NOHA 2AKWB 2EC2A 2MDAA 1Y00A 2R4FA 1C0TA 2JWNA 4Q2LA 1FNXH 1MWQA 1KBRA 1S5ZA 2FHJA 2Y1IA 2HHHF 2KZZA 2HGMA 2VONA 4PYDA 3VHQA 2UUTA 5J1NA 3ZC4A 2N82B 3WX8A 3MMJA 1NXIA 5HANA 2HKEA 5HQMA 1Q5YA 1JB0C 3TJ9A 3DU6A 4KIAA 2MYFA 1DTTB 2HBRB 3KHLA 3IG1B 3L7PA 4CWBA 1RQ0A 4WWSA 3VZHA 1YZ7A 2DY9A 1TKTA 2XMTA 1OY9A 1H2UX 2HAIA 1LWFA 5E3RA 2QA4S 1D3WA 2KDOA 3MCMA 4JOUA 4DV6F 3NNAA 4LIWA 2K1RA 1BXNA 3MEDA 3IA0A 4CTAA 2OPRA 1JJHA 2FIUA 2OPSA 1PC4A 1M5KC 4JI2J 3ILJA 4OYWA 3TUJC 2F65A 3Q0AA 3QGIA 4OYIA 4RO0A 4IKAA 4LFCJ 5KSHA 1AT1B 4GKJF 2RF2B 2ZJQQ 1RWUA 3KYLA 3BKUA 4K4YA 2R8GA 3TAMB 1G2EA 3A1YG 1SC3B 4WZQA 4M5LA 3I5AA 1Z2ZA 1KWMA 2HYIB 1ZS6A 1UWBA 4HYKA 2K06A 3IMQJ 3TUZC 3GILA 3QRRA 3FBBA
chains in the Genus database with same CATH topology
1GNKA 4IDKA 3UFCX 4J9OA 1SJ3P 1UJ5A 2IM3A 1QMFA 2ZNYA 3DHXA 5HMXA 3S7RA 5KT7A 5KOWA 2JX2A 2AJFE 5KFXA 2W4PA 4WU2A 2R8KA 1GTEA 5KFUA 3DI6B 5E3CA 1VQLS 3UR0A 4WJBA 1Y5LB 5JVGQ 4EBEA 1IKWB 1HNZF 1UEUA 1Q82T 2LU1A 3M32A 1V6HA 3NCQA 4DSJA 1U6ZA 1HBUA 1VQPS 1YWXA 1P1LA 2KO1A 4ELVA 1X9MA 1T3OA 1NEEA 5I42B 1TL3B 2IM2A 2X1BA 1VQ5S 3CULA 2HWHA 4AXJA 1C4AA 4Y2CA 4I64A 3U1MA 3SV3A 3VAFA 4K4WA 1RYRA 3U02A 1S48A 3CVKA 2DCLA 4Y34A 5DDQC 1VQ9S 4DR1F 5C5JA 2K7JA 3QJPA 2IYGA 4H4MB 2Y1RI 3MMAB 4O23A 4WF9Q 2BW2A 5KFDA 2BANB 3U1NA 5CD4H 2GHVC 3UCUP 2HS0A 3CCWA 3JB9k 4FVMA 4URQU 5CYQB 5K8NA 2GGPB 3G6ES 4PQUB 1UA1A 4WK3A 3EZ5A 1KLMA 1FJEB 5LSRA 4RW9A 4DL3A 1LW2A 1H7WA 2AQ4A 2JVRA 1VRTA 3IWXA 1S72S 2HHSA 3IC1A 2PN6A 1C4CA 4RA7A 4YHHF 4JV2A 2DH8A 2UXBF 3LOUA 4A8FA 2YNHA 3HO1A 1TKTB 2EVZA 2XY7A 4NYZA 3DOLB 2FVQA 3QLHB 2HFNA 2CJBA 2XI2A 3MMCA 3T3FA 3R1LA 2ALZA 4PG5A 1HQEB 3FMBA 1RA7A 3PIOQ 1J5OA 1D9FA 3KK2B 2MKKA 1SH2A 1VK8A 1SQEA 3IGVA 1XBWA 1NJIT 2SXLA 1KC8T 1LK5A 3KG4A 3T19A 2ZC3A 4EYHB 4ED5A 3DRSA 3MD3A 2FJWA 4JUZA 4CZCA 2F8EX 2ZJRQ 3DHWC 2FLPA 1HMVB 3KK3A 3CCES 3I9V9 3LQVA 2DR8A 2JLFA 2C3OA 4R0QA 1W2IA 1JLBA 2I5JA 1Q81T 3GSDA 1XC9A 1D8ZA 1SKSA 2HW3A 3H5SA 1WWHA 1B0VA 3MTKA 5B0BA 4FVCA 3TA2A 2GJIA 3OL8A 3CCQS 3FGVA 4F4YA 4DL2A 4Q8EA 1SBRA 3MM7A 4ZP7A 2LQBA 2VKRA 3THPA 1XK8A 3NNHA 5G0RB 4Q44A 4Q0BB 1C2PA 4KJIA 1G6BA 4QYRA 1KQFB 1NJZA 1REVB 4AL5A 1KN6A 4XPEA 1GX6A 3HF5A 4N77A 5MAOA 3JSMB 5K5MA 4C3KA 2ASLA 4R3JA 2FJDB 3UN7A 3VAHA 2G1DA 3OR1B 1U49A 2ZDPA 2HVIA 2YTCA 4RWWA 4ZHRA 5DDRC 1RT4B 2R2UA 4FN5A 1YG0A 4MJKA 4J5OA 3HVAA 2J9DE 4WYLA 2JHEA 2JRSA 3B78A 1CQNA 3FFIB 4TQSA 4QWBA 2DGOA 5I3UA 3VAMA 2DVIA 2XMMA 2XSFA 2IJNA 1OIAA 1S76D 2CPDA 1L3KA 3TAPA 1IBKF 2IRYA 3M8PB 3O44A 5KFCA 4NA2A 5IT4A 5LMUF 4O4GA 1VQNS 3HT3A 1HWUA 2ASYA 4IQMA 3PX0A 4RW8A 1TL5A 1YJ9S 4F8RA 3QAUA 4HLBA 2VBZA 5AE2A 3VAIA 1FRLA 4C0OC 2QE5A 4DQRA 3GIIA 1P27B 2J8AA 4NYOA 3IWNC 4ECWA 3L3CA 1QUVA 3MM8A 4IOAQ 4O4RA 1RT5B 1XR6A 2CZVC 3H20A 2W7OA 3PVXA 4U67Q 2HNYA 4ZP8A 2ZE2B 2WAQD 2FJEB 7FD1A 3PKMA 4KO0A 3QO9A 1CEZA 2HHPA 1JNZB 1JXEA 2M70A 2LLZA 4RKUC 3BSNA 3SI8A 2KT2A 1U1QA 3EGZA 4KKOA 1HL6A 1OS5A 2HWTA 1XERA 2WB1D 1U1OA 4WKYA 3EZUA 4O3SA 2KN4A 1NK7A 2OPPB 2V94A 1P9QC 1OSCA 1QE1A 2CPEA 2XWXA 3I5CA 3M30A 4MIWA 2FDNA 4N8NA 2KH9A 3G96A 1RT1B 3JYTB 2MJUA 2AJQA 2ASDA 3MECA 3PFEA 4OX9F 3ZG5A 2MKHA 1RT6A 2Q43A 3QGGA 4NA1A 4XK8C 4WK1A 2IHR1 3N01A 5KFEA 5KFHA 4ZVHA 3BO4A 5J2MA 3PX6A 2DGTA 5A0YA 5C42A 4JV1A 1R8HA 3C3LA 4LSLB 1UA0A 4QZVB 3KLVA 4BS2A 1YQHA 1HD0A 1VLYA 4A8SA 4PG6A 3TW0A 3BQ0A 3PEHA 3CCLS 3PJWA 4OI1A 2HHVA 2HFZA 4A8KA 4HL9A 4MFBB 3DFEA 3M1VA 1XEZA 4TU7A 3WC0A 1ZAXA 2JOQA 4LF8F 4Q43A 2V8HA 2P9GA 5SUHA 4MIAA 4F3QA 3UE3A 2B4UA 3D0IE 4F26A 3UPFA 2VUGA 4MK9A 2F8MA 2V4RA 3BR9A 4RBUA 5CYMB 1NB7A 1VQKS 3G86A 3OTCA 2GIQA 2BDPA 2XO7A 1FEEA 5AE1A 1Y5IB 5M2PA 3H40A 4X66F 4FF1A 4ECZA 2KM8B 2EPIA 4EYIB 3N6NA 3DXSX 1U1RA 4N5SA 1WHVA 4X4PA 4DF4A 1SB6A 2FC8A 3MDFA 1U24A 1FK9A 1Q8LA 2K3IA 2BQRA 3VSLA 5EUHA 3ZZPA 4F2SA 4ED3A 1TKDA 4GKKF 2KT5A 3KJVA 5C24B 2WOMA 4NCBA 1Z1ZA 1S4FA 1AXQA 3NMRA 4PXBA 1FT8A 1URNA 1JLGA 1HFEL 2QEXS 4KB7A 1RP5A 3UE2A 1WTFA 3I5BA 4ZCKA 2PSZA 3AHPA 3T6BA 2CFXA 2CPFA 2FVPA 4URGA 2KTQA 4F3OA 2DGWA 4ECQA 4ID5B 4RW6A 2XULA 5IM0B 3HMJG 2VC1A 5CCMA 3PY8A 3IRXA 3MD1A 2DGUA 3JTNA 4DG1A 2DNMA 2D9PA 2L9WA 1KNZA 4IFYA 1K9MT 4KGKA 2HMIB 4TU9A 3OR2B 1BWEA 3V5RA 2X51A 1HBNA 1QTMA 3HP6A 2R7SA 4J37A 3SZ2A 4DPOA 2OFGX 1QAYA 5A8RA 1FJ7A 1YRXA 2QT7A 1JLEB 2P6TA 2UUAF 3GR0A 2AYGA 4C3LA 2DNPA 2J0XA 4OZJA 1YIJS 2FLLA 4YEAA 3UW1A 5KFWA 1VOMA 2YX1A 3MZIA 4DEZA 2GO9A 1A9NB 2CPXA 5KFZA 2PGCA 1LFPA 1E6YA 2R7VA 1S77D 3BM7A 5IZHA 2V4JB 4I6WA 2ZH8A 5J2PA 4ZPBA 4OZLA 3I4HX 3ZZZA 4DMZA 4Q45A 1C1BB 1LWCB 4FS2A 2VB6A 3KLGA 4J9PA 1YHQS 5CH7B 1T95A 1M0SA 2HQ3A 5GAHU 2ZH7A 4MKYA 1S6QA 4YP3A 3TO8A 2AGOA 5DG9A 4HKQA 1JLFB 1M1KT 5L38A 2GNKA 3R27A 1S1VA 4DQIA 3U7JA 3QZ8A 1F60B 2V2KA 4LF4F 4OHZA 3QIPA 2J76E 4MMOA 2BR0A 3I87A 2C42A 1S6PA 4RW4B 1Q8IA 3D2WA 4C2MA 4ZKAA 3M8QA 4ZCLA 3MEEA 1G7CB 3F44A 3CF5Q 4I2PA 5J2QA 3PXGa 3SYZA 3K5LA 3KG0A 1VIOA 3MR6A 2YWEA 3MUMP 3HVTB 4KC5A 1X0PA 1KOOA 5K8OA 1RTDA 4Q7AA 5J1PA 4BL2A 3QJLA 3RW7A 3MM5A 1O8BA 2Z0GA 3H8YA 1DTTA 2WRMA 3BB5A 4FF3A 2YWGA 4KFBB 2UVWA 4XIUA 3D1OA 5B7WA 2B56A 1TK0A 3IG1A 4IR9A 1EETB 1UETA 2E9TA 4OLOA 3U1LA 4B3OB 2KU7A 2B6AA 3CC4S 2VL1A 1RT6B 3DRPA 2ZZMA 5M2UA 3NAIA 1X0FA 5C25B 2R7XA 5KFRA 5F8IA 2XLKA 4FBUA 3OJSA 1KFSA 2LA6A 3LGMA 1RTJA 3GV5B 1VQOS 5E0OA 4QPTA 3LO3A 4JI3F 3DU5A 1YVFA 2UVRA 2AYEA 1IR0A 1JLCA 2XHWA 3LP1B 3J7A1 1TVRA 2E9ZA 4I68A 3VSKA 1Q4RA 2VG6B 2JC1A 2RJZA 5KFSA 2DNGA 2XY6A 1UAWA 4H4OA 2B0GA 4ZMMA 3CB4A 1HNVB 2DK2A 5D8HB 4I7FB 4MTPA 2OTJS 1DZ5A 2R2SA 2VPXB 1BC6A 3DRYA 1FVQA 2RQCA 4YB5A 3KOAA 1CQMA 1M5SA 1T02A 3CDUA 3O8WA 2FY1A 1BQMB 1SI9A 2JZ5A 4J9QA 3K5OA 2GJ2A 4K4UA 3J7ZT 3FSIA 2VOOA 3ETOA 4NLGA 1Y9OA 2BJEA 2RS8A 3CT9A 4NLVA 2B5JA 1WEXA 3R5CA 2ROGA 3HHLD 4JI0F 5LXYA 4H4KA 1PO6A 1YBAA 4N47A 2WK4A 2B9WA 4YR3A 2Q79A 5K9FA 1KQSR 3M6WA 5IT9Y 2Q6BA 4R23A 4K4VA 1U1KA 2PDAA 2XMUA 2HWIA 3FQKA 4BBYA 4QJGA 5L1LA 2BM0A 2GQ2A 5HLFB 3DM2A 1KEKA 3I31A 1ZTTA 4E8UA 4ELTA 5AE3A 3HXMA 1YJUA 1QJHA 4NRUA 1KTQA 3MXHP 3OFHA 2HNZA 1R8BA 1NK6A 5F8HA 3HFKA 2B7BB 1TFYA 5KG4A 4OIXA 3N5BA 2YKMB 3OXFA 1VK3A 3TAMA 2VD3A 1IKVA 2GMLA 2MZJA 3N9UC 1U6FA 1N5TA 3E51A 1VQQA 1MROA 5CXTA 3BEGB 4OI4A 2EFOA 1SJQA 2Z4PA 1HW9A 2HZCA 4FNHA 1TP7A 2EBEA 2C3YA 3GFHA 3LALA 4G1IA 4Z2XA 3RR7A 2XG8A 3I0RB 5A8KA 3FJ2A 2DO4A 1FF2A 2RSQA 3WX4A 3TVKA 4J9LA 4B9NA 5K14A 4AQYF 1U47A 4RBVA 4N76A 1XR7A 4I2QB 2FPHX 3VF0B 4OX8A 5D4LA 4DL7A 2RKIA 4JBCA 2DNYA 4AE5A 2E66A 4TLRA 5D4PA 2MKCA 1GXTA 2OKQA 3AY0A 2D41A 3G8QA 2G13A 4YB7A 4C11B 2J7WA 4KT0C 4P7VA 2DPIA 4DBQA 3BF4A 4LVOP 3MHYA 3M9NB 4C8MA 4LQ9A 1QUPA 4KGMA 4QQBA 2QLXA 4ELUA 4ED7A 1H2VZ 1GT8A 2MKSA 3QJJA 1VHFA 1JJ2R 3FEZA 4FP9A 2IC3B 1WHYA 3CJ4A 3DI6A 4ICLB 3SQGB 4BWJA 1IKWA 4JI6F 3VCDA 5KAKA 4KHPF 3M2UB 5KG7A 1S1VB 3UPPA 2NSBA 3O3LA 2MZ1A 1QVFR 3HX9A 1WELA 4OZ0A 5I42A 3N6MA 5A6PA 1TL3A 3W2VB 1SL2A 3PRBA 1X5OA 4O3QA 2VH7A 5EHHA 3RBDA 5D3GB 3DYAB 3S8SA 4H4MA 1RTDB 3MMAA 3US5A 2VQEF 2ZJPQ 1VQ8S 2AJ0A 3C46A 4EEYA 3BGUA 2BANA 2RDJA 2LU2A 2XBPA 2WBRA 4EU0A 5CYQA 3CC2S 2KHDA 2VPYB 2D1CA 2GGPA 1NK9A 3MUTP 4PQUA 4QJVA 2O66A 3NCPA 4QCLA 3BJYA 1D9DA 2V8GA 2VPWB 2B4VA 3MCSA 1U1MA 4TYAA 3T9NA 4ECTA 4IOBA 3CPWR 3SV4A 4OX7A 3LPYA 1GXUA 2MSTA 1S1TB 4CO4A 1U25A 2XC9A 4F3MA 1R43A 4DL0C 1S0NA 2LDIA 5T7LB 3DOLA 3QLHA 3MM9B 1F0XA 2E5JA 4RZRA 1JLCB 3CDEA 1HQEA 5BYSA 5KT3A 2OAUA 2LXUA 2NXUA 2VV5A 1NHUA 2RQMA 3KK2A 2FTRA 4A46A 5KT2A 3O6QA 1AUDA 2CQBA 3J7YU 1NK0A 2CPIA 1I6JA 2IRXA 2KZMA 1KS2A 2N7YA 2F8HA 2XCAA 2EI5A 3UI3A 5B0CA 2DH7A 1HMVA 2LMIA 1KVJA 3GB0A 5DO2A 4QOTA 1QAJA 3E2EA 3MEGB 2B5JB 1RDRA 1WG5A 1WHXA 2GMJA 3IXQA 4J9RA 4JI7F 2J7UA 3KLIB 2DB1A 2CQ0A 3PACA 2W8LA 5BYRA 2K2PA 3NG8A 4ATNA 1UVMA 4EBDA 4LMZA 2JDJA 4C3MA 4Y0FA 2ROEA 5G0RA 4Q0BA 2HLUA 4LIRA 3MTJA 4KHMA 2W9BB 1NH8A 3SSSA 1REVA 3L09A 3T1HF 4N8OA 3DC2A 2E5LF 4WFBQ 1F2GA 2IBKA 2J9CA 3JSMA 3OXLA 1VBYA 2LQJA 3OR1A 4B9TA 1XTZA 2DO0A 1B64A 1RT4A 2RB7A 4DQQA 3FFIA 2E5HA 1PYYA 1HHSA 5D4OA 1FKPB 2YX4A 1SL0A 2MKIA 2UUWA 2VKZG 4YMEA 3M8PA 1MSWD 1R8PA 1KOHA 4O3NA 4RNNA 2DITA 2CQ4A 3HM9A 1UMJA 2BRLA 1M5PC 2MSSA 3BSCA 3KHHA 2ABYA 1JLQB 4CIOA 4I67A 3NWGA 4ES1A 1QSLA 1MNEA 4RNOA 3MI7X 1N0UA 1N33F 2VG5B 2E1MC 1QAIA 2VFUA 3PR4A 1FNMA 4JV0A 1K1SA 3BR8A 4DSKA 2HG4A 4IG3B 2I0XA 7FDRA 1RT5A 1X4HA 1J5EF 4DFKA 3M9OB 3VAKA 1ZM3A 2ZE2A 1S97A 5LL6d 3TANA 1L3UA 2L9DA 3P49B 4DR6F 4QU6A 2BZ2A 5KFFA 5FLXY 1AFJA 5LSOA 5HO4A 1IXKA 3DLGB 4G6VB 1UFLA 4B9SA 2PMHA 3C6TB 3KLFB 1CVJA 1FNOA 3I6PA 4ED2A 2W4DA 3AAWB 2GQQA 4G3IA 2EG1A 4UQTA 2OPPA 4X4SA 4MK8A 3LWMA 2IA6A 2RQKA 2B7CB 2G9OA 4DR5F 1TK5A 4NLQA 2PC6A 2VASA 3IS9B 4Y3CA 4U6PA 1WNEA 4MYUA 2O01C 5LMNF 1RT1A 3JYTA 1UP1A 1Z2LA 1NH7A 1WG1A 4AXIA 4BCAA 2B4OA 3OLAA 3EQVA 2HQIA 2XMVA 2D3OR 3MAQA 4F4WA 5F3TA 3K0JA 1B7FA 3LF0A 4WE1B 3F41A 1RK8A 3MF5A 2ADBA 4QWCA 3BZQA 2A18A 3PV8A 2MZSA 3D0GE 4LSLA 2JL9A 1ZOTA 4DQSA