5T7LB

Pt(ii)-mediated copper-dependent interactions between atox1 and mnk1
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
75
structure length
75
Chain Sequence
VNSVTISVEGMTCNSCVWTIEQQIGKVNGVHHIKVSLEEKNATIIYDPKLQTPKTLQEAIDDMGFDAVIHNIEGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Copper transport protein ATOX1
publication title Pt(II)-mediated copper-dependent interactions between ATOX1 and MNK1
rcsb
source organism Homo sapiens
total genus 16
structure length 75
sequence length 75
ec nomenclature ec 7.2.2.8: P-type Cu(+) transporter.
pdb deposition date 2016-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5t7lB00
1FE0A 3T9NA 1OPZA 3I9ZA 2LDIA 3HHLB 2N4DA 2HQIA 1S6UA 2KT3A 2XMUA 4OJGA 4OJ1A 1GXUA 1Q4RA 1SB6A 1R6YA 2PD1A 1FVQA 1FE4A 1W2IA 2XMWA 1WD6A 2K7JA 2VH7A 2AW0A 1FESA 5A6WA 2QLXA 2BJDA 2N7YA 3BR8A 3IWLA 3KG1A 1CPZA 4DN9A 3CJKA 2GFFA 3BN7A 5B08A 4NPOA 3TRGA 2BJEA 1Y9OA 1ULRA 4Y2MA 1Y3KA 2PGCA 1Y0HA 1TR0A 4FNHA 2CRLA 2GCFA 2RMLA 3BM7A 3MZIA 1XBWA 2ZDOA 2FHMA 3FMBA 3FRYA 3CJKB 3BB5A 3MCSA 5B0DA 1IUJA 1SQEA 2ROGA 2BUNA 1X7VA 5B0FA 2OFHX 2OKQA 1GXTA 3DXSX 4HI1A 1RJJA 1MWYA 2KT2A 1FVSA 1TL4A 1N5SA 2OD4A 1JK9B 2JDJA 3LO3A 2GGPA 4HH0A 1U7LA 2ROEA 4OIXA 3HFKA 3F44A 3HF5A 4OJHA 1AW0A 2EW9A 2HLTA 4YDXA 1K0VA 1N5VA 1TL5A 2ROPA 2BBEA 4U9RA 1TUVA 5B0EA 2GV1A 1SI9A 5K9FA 4Y2IA 1APSA 2W4CA 4HL9A 2GGPB 1VQYA 1OQ3A 5IXUA 3VTIA 5A6PA 5B0AA 2LQBA 1Q8LA 2VV5A 3E8OA 2GA7A 2HFOA 2OP5A 4ZA1A 2RU9A 5B0GA 2QLWA 1AFIA 2OD6A 3IWXA 2IYGA 3HX9A 5F0UA 5B0BA 1V3ZA 2XMKA 1P6TA 2OMOA 2RILA 2KKHA 3QMQA 2HFNA 2XMMA 4YEAA 4OJ3A 1CC7A 4F67A 1Q8BA 1Y3JA 3UDCA 4NL5A 4DL0C 2OFGX 2Q3PA 1YJRA 2K2PA 2ZDPA 2L3MA 1CC8A 2XMJA 3K7RA 1YG0A 4A47A 1URRA 1AFJA 1FEEA 3KNGA 1Q53A 1TZ0A 3TOQA 2FB0A 3DCAA 5T7LA 1YJTA 3BF4A 3TNVA 4A4JA 3GZ7A 2BYCA 3LGNA 2ACYA 2AJ0A 2W4DA 3HHLD 2AJ1A 1KQKA 1VQSA 1N5QA 5B09A 1P8GA 2HIQA 2FIUA 2LXFA 2RSQA 3FGVA 3BDEA 1X0PA 1OQ6A 4FNIA 4HI2A 4ZOSA 1YRXA 2IYIA 1MWZA 5F0WA 3WDOA 4A48A 2QYCA 1X8DA 5T7LB 1QUPA 2FTRA 2W4PA 2LQ9A 2ASYA 2HLUA 2KYZA 5B0CA 3KG0A 4EFAC 4Y2KA 1LQ9A 2GO8A 2AP6A 5KAKA 1KVIA 3BGUA 2K1RA 1FD8A 1KVJA 3QGPA 2XMTA 2N4CA 3HHLA 4A46A 1JWWA 1S6OA 4Q2MA 1N5TA 3HDSA 1YJVA 3HHLC 2IFXA 2XMVA 2K7KA 4Q2LA 4QOTA 3LGMA 2G9OA 4DPOA 2OAUA 1OSDA 4HH1A 2QIFA 1YJUA 3KKFA 2K1RB
chains in the Genus database with same CATH superfamily
1WF1A 4LQ9A 3I9ZA 1S1WA 2VB6A 4LFAJ 4I6YA 1Z1ZA 2MKJA 1JLGB 2Q79A 3R8YA 1ICEB 5G0RA 1H0HB 3I87A 1B0PA 3RW7A 5J2PB 3T9ZA 3CCRS 4AD6A 3K17A 3DLHA 3I0RB 3TARA 2Z2ZA 4WE1A 1GXTA 3MMBB 3RRHA 3I0SB 3W5ZA 2DNHA 4Q8EA 2IY5B 2IVYA 1QJHA 2ALZA 2CZ9A 3WHIA 2MZTA 2AEFA 2JWNA 4CNYA 1RABB 5I4MA 1JKHB 3RB4A 4WBFA 2DNGA 2PA8D 1IBCB 1Q8BA 5GMDA 1HHTP 4F02A 2KZZA 2AYBA 5ETQA 2HQCA 2QFJA 1TKTA 2QL9B 4RNHA 2MZSA 4Q45A 2X1AA 2CDRB 3QT5A 3G4SS 3DLEA 2WOMA 1R31A 5B0CA 1K47A 1Y11A 2QEXS 4WKRA 2FDNA 3ZZYA 4KHPJ 3HHLC 2MTLA 2UVWA 4OMFG 3IN5A 2KXHA 1UW9A 1M1HA 4K8RA 2V2KA 1WD6A 3M7VA 3MPUB 5T14A 3THTA 2E9RX 4DL2A 3FZBA 1U6ZA 4ECQA 3ISND 4DR1F 1SBRA 1X5SA 1A6LA 4ELTA 3O8WA 2XC9A 4HI1A 3SEOA 5C7PA 3R5AA 4HT7A 3O1LA 1S0OA 1L3UA 2W9AA 1FXRA 2ADBA 1JXEA 3T1AA 4UQTA 5GAEI 5KTQA 2E1MC 4IO1A 2AHOB 1SQFA 4OYWA 4Q5VA 5F9LA 1PKUA 1RACB 2VBXA 5DLGA 5C42B 2IJNA 1GMUA 2V50A 1TELA 4N76A 1T03A 2B4OA 2W2OP 2E44A 2KYZA 3ENAA 4TYAA 2C2ZB 3CIMA 4EEYA 3KKFA 2ZBQA 3BZQA 5C2CA 4PXCA 2NZ4A 1I6JA 4ZVSB 2Y9HA 4M94A 5A0YA 1BY9A 2J8SA 2HS4A 3EZOA 1R8AA 2AJFE 2J9CA 2IDLA 3UD5A 3E3XA 4DL6A 3ZZOA 1WG1A 4YB1P 1Y4ZB 2FJBB 1AYEA 3M32B 4K4UA 3M2VA 4AL7A 3TZYA 4DS4A 4WFYA 2AGPA 5CZVA 2EXUA 3MEDA 1WKJA 4LFBF 3T41A 2QSWA 1MMDA 2EI5A 4YQWA 1NDLA 1X9SA 4NL5A 2FVSA 4DR3J 2ASDA 3BGOP 2KHCA 4Y34A 2O66A 3AD7C 1VIOA 4QWDA 4B3OA 1X0FA 3H5UA 2VBWA 4P10A 4O4RA 2ZVSA 3A3PB 2IJFA 1RHRB 1SC6A 1SPBP 2CZ4A 3OVBA 1DTTA 3CW2C 2VICA 2N4DA 3BO3A 4G1QA 1FRHA 1RISA 2KG0A 1JXLA 2PFDA 4B3MJ 1NH7A 4F3OA 2BW2A 1DFDA 1PAEX 5KG1A 2R7SA 4L74A 3A3NB 3OPKA 2OPSB 3TP2A 2YQ3A 5U47A 1U49A 2ADCA 1S77D 3BQ0A 3EJMA 1DQAA 4NLSA 5MLCV 2HVZA 3DI6A 1J5OA 1SJRA 2W7PA 4USHA 3U02A 1VBZA 1R7IA 2L3MA 3K7RA 4UF4A 1NZ8A 4EBCA 1TZ0A 2HNDB 2AGQA 2AJ0A 2W4DA 1ZH5A 4K4ZA 2DY9A 1X0PA 1MWZA 2AX1A 1J27A 4CO0A 3AB2B 2B5JA 4GC6A 3BKFA 3MMAB 5GADU 2MZ1A 2H4YB 4HACA 1TKZA 2JX2A 2BJ3A 2MZQA 4OI1A 2D41A 4HH1A 1FE0A 3RAMA 2O5DA 1LWFA 4LSNA 1YIJS 3GB0A 3MFIA 4ZVGA 3RUBL 3CSKA 3NCQA 1S6QA 1NO8A 1XK8A 4USUA 3R7NB 3BQ2A 2ZM6F 1XIQA 1MWYA 1BQXA 1RLCL 2RD5C 4DG1B 2C3OA 1MNEA 5L9XA 1YGYA 2Y3YA 2GS8A 1X4GA 3R2CJ 4WYLA 2DIUA 2IBKA 4MH8A 5E2QA 4M8LA 3NOCA 1S12A 1JIHA 1WHWA 1XR7A 2R3VA 3LGNA 3KLFA 2ASYA 4TNOA 2J6TA 1TKXA 3EZUA 2UUCF 4X4QA 1DURA 2HHTA 4P2XA 4LFAF 4C6AA 2IFXA 5D4PA 1AZSA 2LEPA 1RADB 2IDEA 1Q86T 4CLFA 2VH7A 4XDCA 1KTVA 1NKBA 1B4SA 3FVYA 1Q0NA 5CYMA 4LBPA 4GVBB 4UOCA 2CJQA 2FHMA 4RR5A 2RUSA 3OL8A 5CCMA 3NGRA 4ZVTB 2KT2A 3KUGA 5JMNA 3BJYA 3V4IA 1X4DA 2FVQA 4RUHA 1WEYA 2W2MP 3BEGB 3S01A 1HQEA 5H9EK 3B8HA 3AOBA 4ECUA 3IRXB 3OL7A 3MM9A 4M5JA 4I68A 3GYXB 2DK2A 1T9VA 3UD3P 3GFXA 4ZVOB 1ZTTA 4DHVA 2V4JA 5L1JA 4N47A 4O3PA 4E98A 3HK2A 3MMCB 3MM8A 3ZNUA 4CT9A 3J7ZT 4OHYA 4X4UA 4P74A 3EUNA 3CD7A 1F2GA 1TU0B 1WSVA 5KFXA 4KHPF 2BMBA 2R7TA 5E3PA 3A4TA 3SCKE 4MTPA 4V19J 4IH5A 4NLRA 2NXUA 3SDEB 3M2UB 2FJAB 3FBFA 4HT5A 4GKKJ 2DNNA 4IOBA 3H8YA 4YS2A 4PQUB 1P1TA 3J81U 1I94J 4JI6J 2AW0A 1PYTA 2OSQA 3GSDA 1WHYA 1F9EB 3NGTA 4KKOB 1QAXA 4KHRA 3LP0B 2VU5A 4K5RA 1SQEA 2VJVA 3CCQS 3CVKA 1YWXA 1EIYB 2HS3A 3FK4A 3GPAA 4NOHA 2LECA 3H7HB 5AXNA 4OZ2A 4O3RA 2HRUA 1TTHB 1T05A 3VGTA 4DX7A 4RJVA 4DFJA 1GX6A 2BW7A 3HFVA 3OSPA 3HVTB 4RUBA 1RK8A 4OX9J 1D9DA 4E0DA 3D6TB 2RE1A 3MFHA 2VG7B 4TXSA 3W9HA 2KN4A 5IT0A 2DRBA 1HPZB 1JLCA 3CE8A 3A8EA 3OTOF 4X84A 4NMLA 1S72S 1SIZA 1C1CA 1YI2S 3U27A 2W4PA 2ZBIA 2LQ9A 2DBBA 2E5JA 3P8BB 2CQBA 4F4WA 4WIIA 5CQGA 1VC6A 4FF4A 1S6UA 2XS5A 2BABA 2GC8A 2IRXA 2WSCC 3QO9A 4ZPWR 4CLPA 4HEA9 3CDUA 2HBYB 2ZKTA 1IBLJ 3LGHA 2RMLA 2RB7A 5DM7Q 3G86A 3FRYA 4J37A 3MCSA 4EWTA 5J2MA 1JK9B 4RL1A 1KP6A 4OYAA 4LF4J 3UVJB 3M1VA 2NZCA 3CGIA 3P49B 1RBAA 2LQBA 4Z7CA 4TU7A 4DR3F 2QLWA 4LRAA 4Y2AA 3TX8A 3RRKA 2HBZB 1ZPVA 3IXQA 4JYAF 2CPDA 2DNLA 1Q53A 3WC2A 4O3QA 4U67Q 1T9UA 5IM0A 2P9CA 5C24B 3OSNA 3Q8QB 1QM9A 1HNIA 3BGUA 4DCJB 3P3DA 4MJKA 3KK3B 1HR0J 3H25A 3OR1B 1OSDA 4NCAA 3O2IA 1PJ5A 3DOLB 4QU7A 3HI9A 4DMZA 4B3MF 2MQNA 2QTWA 1FRMA 5G4DA 2WONA 2N7YA 2XZTB 4K4VA 5B08A 2EPIA 4JI8J 1RQ0A 2EKNA 3ULHA 1IUJA 4ANEA 3OW2R 4C0OC 1VGYA 4B9UA 1RT3B 5J1EB 3L7UA 3R5BA 2DR9A 2OTJS 1UWBA 2W9BB 1UVIA 1FDBA 1QDUB 2VPZB 2ZNZA 2BZ2A 5JUMA 1LWCB 3WIVA 4K0KF 4LT6A 4OI2A 1N5YB 1B70B 2KTQA 4JI3J 2RRBA 4ECZA 3Q8VA 2R7RA 2CG8A 3CCJS 5FLXU 2GJ2A 4DN0A 1FRXA 4HR2A 5D6GA 3DDNA 2W2NP 4A8WA 2K1RA 4BWMA 4HYKA 2YWGA 4GC7A 2LU1A 2UVRA 3UCZP 4EI2A 1EETB 1VJQA 3DOMA 2FLOA 2XMUA 3GG0A 2NYHA 2VZ9A 4JI1J 4QCLA 2J7KA 4N77A 1GEHA 4ZHRB 4DPXA 3BO4A 2XULA 1HHQA 1XMBA 1JLAB 2BANB 1UL3A 5L46A 4IQXA 3HVRA 4A8KA 2XS2A 2M52A 1DZ5A 4FPRA 2HIYA 1N5SA 1RT7A 1PSDA 1WC1A 2H4WB 2HHVA 4M1KA 4CO5A 2DNZA 3H42A 4UY8T 2W2PP 4X64J 3M8QB 4ED7A 4X65F 5KG2A 5K14B 4OHZA 2V34A 2E5LF 1SL1A 5DGBA 2YX4A 1K0TA 3KMQA 1CULA 3KMSA 2YX1A 5ETOA 2DH7A 4J9RA 3TQ1A 5T7LA 4DLGA 2BYCA 1TMMA 2ACYA 3NCPA 2B9WA 2QL5B 2G4BA 3QGGA 2GMJA 4WFBQ 4MK7A 2YNFA 3K5MA 2P9EA 4RW9B 2V67A 4RW7A 4PPZA 5K8MA 2I5JA 3MTJA 3PV8A 4X4OA 2H5JB 3KG4A 2HZCA 3FUYA 5C5JA 2JEGA 2B3TB 4CRJA 3QQCD 2C3PA 5DJBA 4ED6A 2KJVA 3Q8UA 1JLFB 2ZH9A 3FBEA 2Q66A 2E5IA 1TL3B 5GAHU 4PWDB 3AODA 1N32J 1LW2B 2HBRB 1APSA 4NEYA 2EVZA 4JV0A 3JXOA 2ACMA 2XY6A 1HNXJ 4CM2A 3GV7B 4KV8B 1Q79A 2HZVA 2WBRA 4G65A 4U95A 5AE3A 4DFMA 3G96A 4B9MA 5HO4A 3VAMA 4YMEA 3DLGA 1VC5A 3SBMA 2VPWB 1D09B 4OFZA 4RW4B 1BWEA 5EUHA 3T19A 3DRPA 5ETPA 2FTRA 3D9BA 5AXLA 4IRKA 5CYQB 4TY8A 4ZP9A 5C25B 5DQGA 3L4BC 4C98A 2GW8A 9ATCB 3DRYA 1R6VA 4P73A 4ZPCA 5BJRA 3JQKA 3MECA 1OSCA 4I6WA 5L8RC 1QLNA 4NXNJ 3FMBA 1NJYA 5KFFA 4ZLPA 5J2QB 2ZHOA 2P5VA 1G4CA 3U7JA 3S6EA 3R97A 3ZTSA 3QPIA 1XMOJ 2GIRA 4YDDB 3D5MA 1HW9A 5F3ZA 1DAXA 4JV5F 1VQ4S 3PXGa 2VV5A 3TAMB 4LF9J 4N8OA 3QT6A 3GIJA 2CAJA 3WC0A 4DUYF 1E6YB 3HHDA 3KJVB 3KNAA 4OQJA 1HMVB 2HKEA 2EFVA 3DLKB 1WC5A 1SJ1A 3AY0A 3CJ8A 4C11B 1RBOB 5FDLA 5KFRA 3PKMA 4NLGA 3UN2A 3HZGA 3R5CA 4O44B 1X9MA 1H6KX 1C1BB 3KJNB 2HQ3A 3OL6A 2L48A 4NXMJ 3NS7B 2MKSA 1MROA 4FN5A 1RHJB 3BN4A 3V6HA 1CQNA 1WNEA 3N6LA 3PW4A 4P7TA 4WK1A 2F65A 1PBAA 3B54A 1IBLF 5KT6A 1IR1A 3O3LA 2CQCA 3TUIC 1LEOA 3D67A 3W64A 4FXWA 3ZTPA 1WDTA 1TR0A 2VPXB 4H54A 2ZD1A 3B4DA 5HLFB 4PABA 4IFYB 2KG1A 2Z57B 1GAOA 1S0MA 1HNWJ 2XI3A 3BPDA 3MCMA 1RWNB 3BR9A 4GKJJ 3A1YG 2HLTA 2BE2A 2VPYB 4C3MA 2WCXA 2BJ8A 2IAJB 2WVDA 2HHWA 2RU9A 1K44A 2EFOA 2KRRA 3P5TL 4H4MB 2YNIA 2M5YA 4LBHA 3G6XA 3Q2SC 5KFZA 4DQSA 4CI0B 1Z2ZA 2J9DA 2J5AA 2AYGA 3ICLA 2C22A 4H4OA 1JLEB 4ZIWA 3M4XA 4R8UA 3FEXB 3TJ8A 2ZBCA 2FUG9 2PMWA 3OTEA 1YRTA 3N28A 5HI7A 3D2WA 2Y1JA 5KFMA 4NWBA 4JI8F 1ZBTA 1VBKA 2FJVA 3PKYA 2QZ8A 2K7JA 3AOAA 4QW9A 4ID5B 3GR0A 2QLXA 4LF7F 3KG1A 5K8NA 3OR2B 2DIVA 3LW5C 1HI1A 5HBMB 5DZ6A 2PE8A 4NLOA 2NQPA 3BM7A 2KDOA 5AXKA 3EE3A 3MM6B 1HI8A 1IKVB 1Y5IB 2BUNA 2XWXA 3PJWA 4DZDA 3QGIA 1IWGA 2IMOA 4J5OA 3JQMA 1TUVA 3MUMP 3PIPQ 2QE5A 4CT8A 4IR9A 2AT1B 4DSFA 1T7PA 1FWLA 5KFBA 5DM6Q 5CXTA 2UZAA 3LP2A 4ZVHA 2UXDJ 1FX2A 3PYFA 2CPFA 1B3TA 3SQGA 4Y0FA 1ROFA 1FI4A 1AXQA 1GTHA 1N54B 3FDSA 4HTJA 4DV5J 4WJBA 4PWWA 5HMXA 2XCAA 4L76A 1YBUA 1VC0A 3PR4A 1D9FA 1RWWB 2IA0A 3T5HA 4E8UA 4WFNQ 1UA0A 3ZZUA 2XMVA 2J8AA 2VD3A 5E0OA 5F8JA 2LYVA 4C0BA 4DSJA 2MZRA 1DTQB 1WTFA 5I42B 4Q44A 2OPQA 2OTLS 3KLHB 4U8YA 4FS1A 2JRSA 1VRUB 3MEEB 4RBVA 3CJ5A 5L1LA 4FYDA 1VQ5S 3DGVA 2Z2LA 2DHSA 1NLKL 4USIA 1NAQA 4GMKA 3ZFVA 3NBPA 2FC9A 3CEDA 2FJXA 3VCDA 3DLLQ 1HWKA 1FK9A 4PYAA 1CJTB 2HEKA 2B4VA 3VQSA 1RBLA 1N0UA 4PAAA 1U1PA 2GNKA 3MDFA 3ZO7A 3TVZA 3AH6A 2ZH3A 4TU9A 1TFWA 4JV2A 2HWTA 3QJPA 1RT5B 1UVKA 1VQSA 5HROA 3BGRA 2FIUA 1B64A 2M70A 5E41A 3PACA 1JLGA 3HZEA 1JJ4A 1HQUB 2LQ5A 5KFWA 3KTQA 3Q8YA 4C8ZA 3UN3A 3IGNA 5HJYA 3GE9A 1NJXA 3OVSA 4ECRA 2ASJA 5J2PA 2JEFA 4OL8A 2BOAA 3OJSA 3CJTA 3I0SA 3BB5A 2QG9B 4ZJLA 1Q8KA 4ITSA 3OL9A 2NSCA 2OIHA 1NHVA 2FLLA 3GV5B 1HNXF 3OXFA 4O3OA 2NXCA 2X1GA 2MSTA 3TAQA 1X4FA 3PX4A 1B7FA 2AU0A 5CH7B 3DU5A 4K4YA 1GMVA 4DL0C 2IVMA 3W1YC 1WACA 3TZWA 2HBQB 3H5YA 3DU6A 4FVCA 1U1NA 3AA9A 5A8WB 1S48A 4DR5J 3F41A 4EFAC 3TX0A 1R8HA 2V63A 1WG4A 1HNVB 1RCXB 2DGQA 2DR5A 2MKHA 2IRUA 4K4XA 3KLEA 2RHSB 1IWAA 4DPWA 5L1KA 3JYTB 2PFFB 4OHVA 1ZYQA 2E1PA 1YZ7A 5M2UA 1VIXA 1N34F 4NYZA 3ET6B 2G0IA 2D3ZA 1XQIA 1XMOF 1S1UB 4OYPA 3CDWA 5HSPA 1EAYC 2XEXA 2AGOA 2HHQA 3CUNA 1NNDA 2EKYA 1F0XA 5BYQA 3OT9A 2N82B 2XGQA 4RUCA 4PZVA 2DVIA 1VQYA 5A8RA 2Q1LA 2B0GA 3JSMA 3RAXA 1U1KA 3D1HA 3KLGB 3CCUS 3HSGA 1LFPA 3ILOA 3EXCX 1KLNA 2E29A 3TA0A 5C42A 1HW8A 3M05A 4DQIA 1LOUA 2C2MB 4LIWA 2DT9A 1XTZA 3C15B 3CJSA 4CO4A 4ELVA 3MR2A 1RT2B 3PYDA 3W2VA 4LVNP 1IQTA 3A8IA 1JNZB 2RS8A 4F0HA 3LQVA 2XSJB 3GYGA 3FNNA 4H4KA 4CLTA 2H54B 2G9OA 3UR3C 1V6HA 4F3MA 3NMAA 1FO1A 4OYZA 4A8MP 4LF6J 3CDBA 3D68A 5E3CA 3DDKA 3N6NA 1RHKB 2ZH5A 3RU0A 4Z7YA 2QA2A 3NWGA 3OVAA 2CPIA 4CLSA 1HNWF 3GONA 4DV4J 3M32A 4GKJF 3SCJE 1FD2A 1H38A 1M5OC 3HP6A 1TL4A 4J90A 2FVPA 1X4EA 1T9YA 5CABA 3A8JA 4J9OA 1F3FA 5B0GA 5KFLA 3NLCA 2LCWA 2YX7A 5MAOA 3M8WA 4CCHA 2HGLA 4G3IA 4JP8A 4UT4A 1NBEB 3AFGA 2JEIA 1TVRB 1DY3A 2ZOFA 2DNRA 3PFEA 4CH7A 1RWXB 1N4LA 4RZRA 2CXEA 2CQ1A 3Q8RB 3RGIA 1CJKB 2CFXA 5KFNA 3MAAB 1WOPA 1P9YA 2Y1IA 2DNQA 2VHGA 5GADI 2P6SA 2HAFA 3AXKA 3V5RA 4QR2A 4DLEA 2KXNB 3LPEA 2ILYA 1XMQJ 1YJUA 1UKUA 3JSBA 4ED4A 5B7WA 1KQFB 2KB2A 2PI5A 4YUDA 3M8YA 1LWXA 1R43A 1VISA 5C2GA 6FD1A 4J9LA 4TN2A 2ZZNA 1D1UA 2JHEA 2V6AA 1D8ZA 2DPIA 1RKIA 1NSAA 3QAUA 2HSEB 2QL7B 2DGSA 3OV7A 1RTDB 4TY9A 2UXCF 2H5EA 4CLWA 4PG8A 1QD1A 2YQ0A 2V0NA 4IRDA 3ILIA 4NZ7A 2IM1A 1UFKA 2D74B 3EMTA 4IKAA 1P6TA 2O67A 4O3SA 2KXFA 1OO0B 2HNDA 5K20B 4YP3A 4C8MA 3ZZ0A 2XLIA 3TA2A 2DEIA 1YJTA 2D69A 3H20A 5EHHA 1T94A 2V94A 3MMAA 5KFCA 3GU0A 2AEJA 3ISZA 4LR8A 3UO0A 3C6TB 3MPVA 2VQFJ 2RKIA 4DV0F 2Q6BA 2XLKA 5HQMA 3A8KA 4DPYA 1KVKA 4DPOA 2MLYA 4HHUA 2HWIA 3M6XA 3HJFA 4UTGA 3FCHA 5F8IA 3DXSX 3D3BJ 4BLGA 1U8SA 4OHXA 4JI7J 1RTJB 2YWEA 3P96A 4UOGA 1EX8A 1R89A 2MKIA 1O8BA 3O6QA 3Q8PB 1S7HA 2MKYA 5EWFA 3S7RA 5IT9Y 1VK8A 5H9FJ 1Q82T 4F4KA 2Z56B 2CQHA 2ZKUA 5LL6d 2IVFB 4ZMMA 2WSFC 1KDNA 3OLAA 3ZZPA 1KQSR 1ZTWA 2MQPA 2XYPB 3EICA 3IR7B 3AJDA 3HHLB 1H2VZ 4UW2A 4AUKA 4DQQA 2DEJA 4GVBA 3QZ7A 2DR7A 3GIMA 3DRXA 2XYHB 4E2FB 1NB2A 2OO4A 5AXMA 3FSYA 2GMHA 1WSRA 3QIPB 1AUDA 1X7VA 4YY3F 1URNA 2RF2B 4USTA 3C2PA 1EQMA 4ECYA 2RDIA 2MQOA 3IP0A 2WVCA 1ZETA 2V4RA 2CUYA 3IRXA 4I0WA 3HSJA 1CJVB 4F25A 2JH3A 4FYXB 4RNFA 2LLZA 5DG9A 3HSZA 4YEAA 3C66A 3AOCA 4J9QA 3M30A 2K2PA 2AYMA 2DHHA 1FDDA 1ZM3A 4ZPAA 2BEFA 1FFGB 1NHUA 5AE2A 3M2UA 3C3LA 1TL7B 1VHFA 3UWTA 4PQUA 1NKCA 2UU9J 5HVGA 2V8DA 1SXLA 4ECVA 3C6UB 2EG2A 2I9SA 4YB5A 3TW0A 3AA8A 5HATA 2AX0A 4KKOA 2DNMA 2HVDA 4I67A 2XMAA 4IOAQ 3LP0A 3GMGA 4EK2A 2B43A 3OUYA 3Q22A 3EGWB 1WELA 5GAGI 5KG0A 3MD3A 2OFHX 1FJGJ 4G1IA 5K8OA 4R5PA 2NPFA 2ZJRQ 4LF8J 3G8SA 3FBCA 4OIXA 4OZ1A 3CF5Q 1D0EA 1OJ4A 2BBEA 2W25A 3ZZZA 3KHLA 5KOWA 3NS6A 2FLNA 2XLJA 2DD8S 3FJ2A 2J0XA 3IFEA 5KFTA 1TV6A 1SJ4P 2RDDA 3PEJA 2LEBA 4WZQA 4B9VA 1G6BA 1XC9A 1QE1B 1BUXA 2QSFA 4M63A 2J9DE 5KG6A 3I56S 2DY1A 1RTIB 2UP1A 4CWBA 2UUTA 1B7YB 3EZ5A 3CD6S 3KJFB 3GCXP 5A2QU 2A2DA 4DV4F 2D1CA 2JFDA 3QATA 2CJAA 4EO8A 3B78A 4QR1A 4O0IA 2R2TA 4LBIA 3H2VE 2DYAA 3GP9A 1EP4B 3K58A 4AL5A 2OI2A 5LM7E 2HRTA 3UVJA 3G71S 4QU6A 3I5CA 1PYSB 5H1SV 2NREA 2FHOB 1S1WB 1KLMB 1D8YA 2KJWA 2JL9A 3H90A 3TJ9A 4N7TA 1RHMB 5SUHA 4RLEA 2GQCA 4PUOB 3FEYB 2KZMA 4ED1A 5C24A 2LXUA 1M5SA 1VMBA 3MF5A 1ZAXA 5E7OB 1SL2A 4FBUA 2QYCA 2R2RA 1RYSA 4PQAA 3KK3A 4EYIB 3A13A 2I0XA 1XMQF 4OZJA 2F3JA 3TJAA 4CNZA 3OR1A 1N36F 3CDEA 2KL8A 3DOLA 5T41A 1FX4A 3K5NA 2EFQA 2J7UA 1RWVB 2G1HA 1KRPA 3GG1A 1DRZA 1TKTB 3IWLA 4RKUC 2DO0A 3DM2A 2FGOA 2R8IA 3J81j 1RT3A 4LUBA 2I8EA 4FNHA 4NLWA 2J6UA 4ANDA 4FBTA 2VFTA 2MB0B 1MLAA 2W9BA 3DGPA 1XEZA 2OD4A 2JDJA 3CXCR 3AHPA 4OJHA 5LOQA 1KQGB 1LWCA 5D0HA 1I3OB 3KLIA 1A0OB 4K59A 1N5YA 2MHEA 1XR6A 4F50A 2DITA 3J80U 3ETOA 1DHMA 1KTQA 3T5JA 3QJLA 2FVRA 2VQFF 4XAKA 1WC3A 3EX7B 3F73A 3CJ2A 3F0NA 4JBCA 5AT1B 4X4SA 5FIIA 3DRSB 1EETA 2UUAJ 3QGHA 3CO9A 1JLQA 2W8LA 4IH6A 2R9LA 3PW2A 1UVLA 2C3UA 2QC3A 4ZHRA 2M0GB 2KFYA 1JLAA 4EYHB 2BANA 2POKA 1T03B 4WU2A 2E1RA 3HM9A 4DL5A 2Z2YB 3NRBA 2R7XA 1QAYA 4NRTA 2F5GA 3ELHA 4JI7F 2M7SA 2ZH8A 3K57A 4F8RA 1C0UB 1NMEB 5GAHI 4N56A 3HF5A 5DDQC 4LFBJ 2DGWA 5K14A 4J9UE 4OYOA 1GFWB 2LVWA 3I9V9 4DX6A 4ZA1A 2CJKA 5F0UA 4P7VA 2J0QD 2OELA 2HYIB 1DQ9A 2E5GA 5KG5A 2VA3A 1KSPA 2R42A 1HL6A 4QWBA 5IQQA 4EBDA 3D3CJ 4DV2F 2H48B 4RW9A 3N01A 3MEDB 3MEKA 4M5DB 4DSIA 2IIHA 3MAHA 2FHKA 4IH7A 4F26A 2VJUA 1HWLA 3RBEA 5IV4A 4IDKA 2P9GA 2HGMA 3R1HA 2JVOA 3CCZA 3VVTA 2JNJA 1VRQC 3PFOA 4M5IA 2OSRA 3X1LB 4XPEA 4OV1A 1SJQA 2ATLA 1JLFA 2DGOA 1NPRA 4L75A 1RAHB 1TL3A 1SUQB 1ACMB 1R8BA 4PWDA 2BJ7A 2HFSA 3SV4A 5D0EA 2VONA 2P2CB 4MYTA 5A8KA 1EHWA 4KV8A 5HP1B 2PEBA 3DC2A 5IXUA 4XPCA 3PRDA 2BKOA 2PSZA 1R0AB 4P2FA 3IWXA 5BYRA 4TLRA 2ZJQQ 2XMMA 4ECWA 2YWWA 4CLZA 2P8IA 4RW4A 1GK8A 1VFJA 3W3SA 1FEEA 1L3SA 1RUSA 5H9FK 4DF8A 3R2DJ 2RU3A 5IOLA 3N5FA 2WRMA 3HPOA 1HD0A 1KOOA 2IYIA 1U09A 2UU9F 3GQCA 3DI6B 2JLEA 5LMUF 5C25A 2B8PA 3CCMS 5DGAA 4OYBA 2V8PA 3SZ2A 3THPA 1QSLA 2LQJA 4J7CA 1SKSA 4ED8A 1CS4A 2XMWA 4Z37A 3I32A 4J9MA 3ETMA 4HHHA 2EK1A 2KHDA 2QA1A 2WHOA 4ECSA 5ADZA 5GMKa 1FJGF 5J2QA 2DCUB 2B5JB 2ZDOA 4LF8F 3H0PA 1ZM2A 5ITHA 2BE7D 4X66J 3PDNA 3LO3A 1TP7A 5ETNA 4KY3A 3TAMA 3MM5A 3CCTA 1RAEB 1RZMA 2XCPA 1WI6A 1X5OA 8AT1B 3E8OA 3HVAA 1AB8A 3V81A 4CP5A 1HMVA 4QIEA 3DLKA 4OLPA 4QBUA 3I5AA 2D7SA 3W7BA 1G2EA 1X4CA 2IM3A 1UCNA 3KK2B 3TVKA 4O44A 4OI0A 1FRIA 3TOQA 2QGFB 1RTHB 2UUCJ 4NLTA 2YNHA 4JI5F 3NXZA 5IC4B 2CQ0A 1H72C 3JS9A 3KG0A 1LQ9A 4NEZA 3GJTB 1WORA 4HHJA 2UXBF 2XG8A 4WP9A 2RAQA 3LGMA 1PYOB 2PD1A 4NLYA 1PGZA 1QAIA 4IG3B 3MURP 2OEKA 3N4WA 4OX8A 4IFYA 3QSIA 3N9UC 1S0NA 2UUWA 3KLFB 2BQUA 1IKYB 2NXNA 3BH6B 1AROP 3CWJA 1UEKA 1C0TB 2HVHA 1AZSB 2DKOB 1Q5YA 1VK3A 1UTAA 3T6BA 2IAJA 1G1XA 3GFHA 1S1XA 5J1PA 5CAAA 1FFWB 1V5IB 3IRWP 4DEZA 1N48A 2HZAA 1ZA1B 1Q8LA 2E9ZA 3D0GE 4ZN3A 3E51A 1K9MT 4FYVB 2QMWA 5JXSA 4RU2A 2ZFHA 3DMJB 1JLEA 2WB1D 3QFWA 1SVDA 1RU2A 2YKPA 4XIUA 3RAQA 1SC4B 2G2ZA 1JX4A 3TWZA 3ZTOA 2BA9A 5HK4A 4ID5A 1X9WA 3SMZA 3OR2A 3MR3A 1LWEB 4CO3A 3GILA 4O4GB 2J7WA 2WAQD 3MM6A 1U1QA 1K8AT 1RAGB 4NPOA 3DYAA 1IKVA 1RWOB 2MLZA 4C4WA 1NRKA 3HCXA 3D1OA 2FVCA 4UQGA 2YKOA 1F60B 1M1GA 3E01B 2DXDA 3KWMA 3JB9k 2KH9A 1RTZA 2A18A 5L9NA 1KNZA 3QLHB 4KGZB 1SC3B 1NPKA 2BE9B 2GV1A 2FGCA 1GQEA 1NDKA 4JI2F 3CNQP 3VHQA 1C4AA 1KR4A 3P5BP 3OTOJ 4ANCA 3PW7A 1ZOTA 3BH7B 5KFOA 3M6UA 2VG5B 4BHQA 3BDEA 1T02A 2UUAF 4JI4J 3ILLA 4DWIA 1S5ZA 4B3SJ 2Z2MA 4U7CA 4LRBA 1DTQA 1NK8A 3GJQB 1HA1A 1PCAA 3OXLA 4C0HA 2L9DA 4DXLA 3KLHA 3CD0A 1JLCB 2BJDA 4ZVRB 2BQ3A 3AQOA 3MEEA 2NR0A 3Q2TC 2PGCA 3I4PA 5A76A 2RJZA 3MZIA 2CPZA 5ETVA 3TI0A 1RWKB 2QLJB 1YDLA 3W62A 1TFYA 3D1QA 3UNYA 3ISNC 4DUTA 2DGVA 3VAIA 1YVFA 1FWKA 3UN5A 5AJ3J 1SIWB 2COLA 4JYAJ 2MQLA 2Q43A 1AFIA 3GTYX 2DXFA 2BR0A 5E3AA 1RT5A 2VKRA 4EZ6A 4F4XA 3R5DA 3V6JA 1PC4A 1S59A 3NOGA 1TUGB 3T5LA 1NB7A 1RAAB 3M8PB 3RG6A 4FNIA 3WIUA 3ZXWA 1KN6A 3G6VA 4WPAA 1HQUA 8ATCB 1XNRF 1YRUA 3UDVA 2K7KA 2DH8A 4DV6F 1EJ7L 4ILMA 3EPGA 3KFWX 1WC0A 1GXLA 2G1DA 3MI7X 1YBTA 3CCLS 1H3DA 4P71A 2IA6A 4ED3A 3Q8SB 4Q0BB 2YPYA 2NLWA 3CC7S 3CJRA 3CJKB 3EDQB 2ZH2A 4IG0B 2CYYA 1YTYA 2ZZMA 1NKEA 2XTJP 1RXOB 4K0KJ 3CCVS 1NXIA 2W7AA 4A8XA 4UUWA 4KE5A 4F2RA 1N6QB 1I5OB 4DJBA 3T5KA 3MEGB 2KKHA 4C9DA 3FCVA 3FC9A 3PW0A 3WZ0A 4WFAQ 3CMES 1NH8A 7FDRA 1AFJA 4DQPA 4BCAA 5A8WA 2YTCA 2QYGA 3TNVA 3IAM9 3C16B 1UWBB 4NMXA 1GNKA 1CSJA 1X8DA 3HD2A 2RDJA 3H98A 3LP1B 2JZ5A 2H51B 4CO1A 3JYTA 4F0KA 2IBOA 5BR8F 1HBNA 1C2PA 2YKMB 1NK5A 4P2MA 3PHTA 2ALYB 4RNMA 2W9CA 5D3GB 3UFCX 1WF0A 2FC8A 3ET6A 3OFHA 1S1UA 3W9IA 4X66F 1U8WA 3MUTP 4IFVB 4NLXA 3BGLA 2MEWA 2OKQA 1NSKL 3JTOA 3CO0P 4URGA 4X65J 3HT3A 1FA0A 3SXLA 2E5LJ 1IR0A 3TA1A 3MCOA 2CQPA 4U9RA 2KFZA 3KLGA 1WEZA 5CYJA 2CWKA 3GJRB 5ETMA 4C8LA 1YZ6A 5HQLA 3MM7B 5ETLA 3GLJA 1EB0A 4F67A 4NCGB 1L3KA 3C15A 1JB0C 1X4BA 3TQEA 4DR4F 2F9JA 1RT7B 4FZVA 1RT2A 3KK1B 3T6JA 5ETSA 3D4JA 1SL0A 1KOHA 3QSYB 3K89A 1NSQA 1HNZF 2V8VA 3UI3A 2DTJA 3J81Y 1S6OA 3HDSA 1CULB 3NG8A 4FP9A 5I3UA 1NPPA 2VFSA 2VDHA 3H2UB 1A7GE 2MJNA 1RT1B 3SV3A 2GQ2A 1Y0HA 4W4MA 4MK8A 3QJJA 3BKUA 5KFAA 4K4TA 5KFKA 4DOZA 2WTFA 2YNFB 1MN7A 4RW7B 4DI6A 4PG6A 2K3KA 2I5JB 2G0JA 2D9PA 3N6MA 2NXEA 3V6KA 1JLBB 2B51A 2IM0A 2OP5A 2MGZB 4FYYB 2ZE2A 1V3ZA 5KT3A 3QMQA 2HWHA 2DO4A 4CYUA 5DZ7A 1CJKA 3RBDA 2VA2A 3DNCA 3LANA 2RH3A 1URRA 2RQKA 3OHBA 1GMWA 4TKTA 4W90B 4MKAA 2OPRB 4NZ0A 3BQ1A 4DQRA 2CQDA 1WKLA 3V2UC 4WKYA 1XNQF 1U6FA 1L5UA 5DG7A 4DL7A 5THWA 4ZCLA 3BSNA 3HXMA 3U1MA 2XO7A 2ZH1A 4I56A 3R7BB 4LSLA 2KM8C 3B4MA 4ETXA 2HNYB 1VQNS 4KRWA 1UWAA 4B3RF 1U2RA 4U96A 1RTDA 3CMQA 3UPFA 2XNQA 4ZLLA 5FD1A 5K8PA 2F8MA 2R8GA 4TY8B 2BX6A 4JV5J 1NK0A 1IKXB 3G82A 3H5XA 1MW7A 1ZM4A 2E1AA 2E66A 4DUYJ 3DOKB 1WHVA 2CWXA 3NEKA 1MU2B 4I4BA 3MECB 3HX9A 2WVBA 4RNOA 2VKZG 2Y0BB 4PG4A 2ATCB 4WTYA 3R5GA 4A47A 2XY5A 4JI4F 2X51A 4K5SA 3K59A 3GZ7A 3ZZRA 4B3SF 3DRRA 1BLUA 1JJHA 5DQIA 4KFBA 3G87A 2ZUAA 2CNNB 4C3LA 4PEOA 2QJ3A 3GYNA 5K5MA 1UA1A 4AT1B 4B9NA 2V2VA 5GAGU 3MGJA 2EC0A 4P72A 1QUVA 4NRUA 3Q24A 2JEJA 4DV3J 3NGKA 1PILA 2N3LA 1XWLA 4AXJA 2VC0A 1S10A 2GVDA 3LOUA 1UJ4A 3VAKA 3JTPA 1RTJA 1MROB 1HBUB 3H4BA 5AJ3F 2W7OA 1EZZB 2E7WA 2YBVA 2FQQB 2X1BA 1J5EF 1E6VB 2WZ1A 3JSYA 2V8GA 1FTCA 3ILJA 1O6XA 3N0VA 2F7VA 2FJEB 5FLXY 1NCLA 1SV5B 2LMIA 4IYQA 2BRLA 2IM2A 2IHR1 3W2WA 1SQGA 2VQEJ 2DHXA 4ICLB 3M8SA 5IV3A 1VQLS 2F40A 5KFJA 2D3OR 3R6GB 3KJQB 1TK0A 3EGZA 1TAQA 1PIEA 2UV8A 4J91A 4USKA 3IG1A 5KFSA 1K1SA 3IR5B 3HHLA 4ID8A 4ZJOA 1YHQS 3R6LB 1PO6A 1TL1A 5EWGA 4LF7J 1RP5A 3G6ES 1N8RT 4B3TF 3TUJC 2R7OA 2JSXA 3T1HF 3DHWC 4C3KA 1N52B 2LXIA 2CQ3A 4TQRA 1CQMA 3T3FA 2F4VJ 4H4OB 2RF2A 4X4VA 3W60A 2EFNA 2GO9A 3E2EA 2YPZA 3CMAS 1FRKA 4PPDA 3IS9B 4PG7A 1RT4A 1BHNA 4N8NA 4KO0B 9RUBA 3LF0A 2G2YA 1RHUB 3I55S 4ZPDA 4ZVPB 2R2SA 2APOA 2KYXA 4LREA 3FSXA 4W98A 2HFNA 2CADA 3TVYA 1FWPA 2XB2D 3BF4A 4YN3B 1HKAA 2BACA 3UD4P 4LF5F 1A9NB 3TR5A 4KPYA 1REVA 3C6UA 2RRNA 2ZH4A 1SH0A 2CJBA 3H4DA 1S9GB 2NCKL 4J9SA 3SQGB 3D54A 4L3KA 1T0TV 4NI2B 1Y00A 2VDIA 3VF0B 2AMCB 2ZWOA 1S1TA 2Y0SD 3C14B 1I1GA 3VV2B 2AEMA 3M2RB 2XZWA 1MMLA 3ITHB 1OWXA 4ZVEA 3HFKA 3AD8C 2A6MA 1WOOA 5L38A 3ZTRA 4QWEA 2O3DA 4LVOP 2MYFA 2ZITA 4R25A 5D0GA 1UPMB 4F7VA 2MY8A 2RILA 3EVWA 1QE1A 1U2FA 3U1NA 4I7FA 3Q83A 3Q86A 3HHLD 4QZVB 1ITPA 1RTIA 2VUGA 2YKNA 3GIIA 1P1LA 3IBCB 5D0RA 1TUWA 3H2LA 4QOTA 2HNZB 2QIFA 4NA1A 2EWHA 1U26A 1IJEB 4B9SA 4OJ1A 2XNRA 1V3RA 2ZUGA 3LUYA 2RNEA 2CZVC 1TK8A 1HI0P 4KR0B 5HROB 4RUAA 3BGRB 3VZIA 1G3OA 4CLYA 2DISA 2UUBJ 3LAMA 5KG4A 4KH0B 1H7XA 5JVGQ 2EBEA 1TKDA 1KLMA 2GVZB 2B7BB 2X7IA 1O51A 3D7SB 1Y5NB 2I2YA 1N33F 3IM8A 2YWFA 2GHVC 4DCPB 4PUOA 1ZAVA 4X62F 2V8HA 2XMKA 3QWPA 4DR7F 3GCWP 4C7QA 3M8RA 3DLBA 2DHAA 3NCRA 1CLFA 4MYUA 1ZZNA 3PNIA 1KQKA 2CPXA 2Z8QA 1H74A 2BV3A 1FF2A 4EZ9A 3VQTA 1PJ6A 1JJCB 5IT4A 1SKUB 3I6PA 2LQ8A 2LDIA 5DO2A 4MIWA 3K8VA 1J2VA 3RJMB 1N34J 2V5HG 2OUGA 3BR8A 5HAOA 2KRBA 4QIWD 1JJ2R 1F2HA 4ZPVR 4ZVQB 1UVMA 1CJUB 1ELOA 1VCTA 3CULA 1ZAWA 5KFVA 3MAQA 3KLEB 1RYRA 1G7CB 3F44A 4USJC 1F3VA 3CTRA 2HS0A 2B9EA 3QRRA 2ABYA 3KHRA 2QMXA 2F8HA 3CJQA 5B0BA 5D4LA 3POTA 2OGUA 1X5PA 4OJ3A 4WCEQ 1DJ0A 4DV1F 1Y3JA 4J9VA 4Y2CA 2WSEC 3J7AN 4XO0A 4PKDB 5KT4A 2C3YA 1VRTA 4RBTA 3WQPA 3OFGA 4KPCA 3MD1A 3BYRA 3EGVA 1EQ0A 1W26A 3DRSA 2XBPA 5A8RB 4ECXA 3VWSA 4LIRA 3IAS9 3JSMB 2GMLA 2LEAA 2N4CA 2XMTA 4UZBA 2DCLA 4DV3F 1FKOB 4YB6A 5KT2A 1OPZA 1BE4A 1Q5VA 3C46A 3OBIA 4WZMA 4MK9A 4DN9A 1X4HA 2GFFA 5DQHA 3EWGA 1X60A 4R0EA 3BV8A 3W2VB 1SJFA 1C0UA 3H59A 4JUZA 1T11A 1BXNA 3EXYA 2MY7A 2ROEA 2GJIA 4M5NA 2XHCA 4YR0A 2GGPB 4FDFA 4KC5A 1UEVA 5CHCB 4FYWB 4L6V3 2J0WA 2VQEF 3I5BA 4LMZA 3C8YA 4J9NA 1Y5LB 2HHSA 2W01A 2GIQA 4A8YA 4QWCA 1BQMA 2Z58B 4MKYA 5J2NA 3VZHA 2HMIB 2LU2A 4M5DA 1FJ7A 3UR0A 1HBMB 3OTCA 2M8HA 1U0HA 4LJMA 5KAKA 4WK3A 3M6VA 4PCQA 1WC6A 2XHWA 4M95A 3HVWA 4RW8B 3NY0A 1T9TA 1GXUA 1F9HA 2YXLA 4K2XA 1VQ6S 1FE4A 2F4VF 2EK6A 1SUQA 5KOXA 3R9LA 2UXCJ 1FNMA 3OQ2A 2J9EA 1WUUA 5HP1A 1FEHA 3QNWB 3QAEA 2A2CA 3Q0AA 1EARA 1R0AA 2OPPA 2HVEA 2HGNA 2RQMA 3PG9A 2PEHA 2CQGA 4AXIA 1S57A 3M9NB 2HK3A 1CC8A 3RB3A 3BBFA 5E3QA 2ZNYA 1FHTA 1FJCA 4DV0J 3BDPA 2VASA 4ZOSA 4YHHF 5EDWA 5I3PA 2LA6A 4DX8H 4OLOA 4OZ3A 2DR6A 3FKBA 2RS2A 2DGUA 4FXVA 3L3CA 2NPIA 4Q2MA 4QYZJ 2B6AA 1FERA 1LW0B 2BJ1A 1GX5A 2C1EB 5F8GA 1SB6A 3FFIB 1Q1KA 2L08A 1FKPB 3ENVA 3O44A 5FJ4A 1HHSA 3V6DB 2CQIA 2E7XA 3LPYA 4KGVB 2AYEA 4AQYJ 2BKNA 1HBOB 5F41A 2RKIB 1S4FA 1NHKL 2K8GA 4EU0A 4NYOA 2AZ3A 2C2KB 1FNOA 1QTNB 1X5TA 3HHNB 2KO1A 2HFVA 2VFRA 5BXIA 2CNLB 4KSEB 3QFHA 4CTAA 3KK2A 1RAFB 2V4QA 3RR8A 4FF3A 1SJ3P 3PO5A 3BGFA 1RTHA 2ZH6A 2C2NA 2B56A 4M5KA 4DU8A 2HAIA 3SCLE 2RSQA 3UQSA 1OQ6A 3KYLA 4OZ0A 3PR5B 4PWUA 4DFPA 3F56A 2AP6A 2QT7A 3I0RA 2A6OA 1VQKS 4DSEA 1R8PA 3MMBA 4DV7F 1IVZA 4IG3A 4JB8B 2KT3A 2UUBF 1FVQA 1W2IA 4I64A 3GIRA 1WWHA 4I6AA 2KT5A 4FKYA 1IKYA 4YY3J 2O01C 1AT1B 2BJEA 1JKHA 2YWKA 1C0TA 5GVQA 2LP4A 1RDRA 4NLQA 2UVVA 1RJJA 1O5JA 2MKCA 1AA1B 1OPIA 4O23A 1NUEA 3G2XA 4DCOB 1JNRB 4BWJA 4G6VB 4RO0A 4WXWA 2CJYB 3QWUA 2GIFA 3DMJA 4QR0A 1RE1B 5ETTA 1H7WA 2XY7A 4USWA 2FB0A 1PAUB 1RAJA 4RWXA 4FXDA 4HVZA 3X3UA 2W1BA 3CPWR 2J6SA 2N3OA 3L7PA 4URSA 4DSKA 4OYMA 1FCAA 2E5HA 1LWEA 3FSIA 4PXDA 1S49A 1WHXA 4O4GA 3M30B 1S6PB 3BKTA 3HJVA 1LXNA 1U1RA 2BDPA 1BD6A 5DDRC 3E01A 4Y2MA 1WOSA 2FY1A 1RT6B 2VG6B 4NLVA 1LXJA 1SH2A 2E9TA 1JQGA 3QLHA 2PIIA 2HVIA 3BO2A 2RRAA 5I3QA 3C19A 1H2UX 1MN9A 2XSFA 1IN0A 2OEMA 3RB0A 1DQ8A 1GH8A 4P75A 1FDNA 3OUYB 2OMOA 3A12A 1VJWA 2CDQA 2YY3A 2JVRA 3MOJB 4PXBA 3NNCA 2VG5A 3CJ0A 3CC2S 2YNGB 4R5PB 4QPXA 5LSLA 1IBMJ 2AIRB 5D8HB 3BPSP 2KFNA 2WVEA 2BXJA 4RW6B 5IFMA 1YJVA 4Q2LA 2JOQA 3SFGA 3WX4A 4LRCA 4DL4A 1H2TZ 3FQKA 1TV6B 3J7YI 4YOEA 1WI8A 3EM1A 2QA4G 2HQDA 3H40A 1B99A 2WW8A 1LK5A 2NUHA 2PDAA 4P6QA 3W8GA 2FD2A 1IR2A 2RQ4A 3FRZA 3EDRB 1FFSB 1RLDA 1S9FA 4P9SA 2EW9A 2U2FA 4Q8FA 1SI9A 2M88A 5K9FA 1U48A 4HL9A 3W66A 4KGMA 4X4PA 2BRKA 2UV8G 4QPTA 4NE9C 6AT1B 1S9EB 4ZP6A 5D77A 3CDAA 1NDCA 2SXLA 4AFFA 4KQZA 3W5XA 3M8PA 2C2RA 4KIAA 1F5AA 2AJQA 2ZJPQ 1RKJA 1N36J 3M6WA 2WVFA 4A48A 1VI7A 3HO1A 2EG1A 1BQNB 2MKKA 3VAGA 3KLVA 1S7IA 5KFYA 3NAHA 2OJ3A 1KVJA 2OPSA 3QGPA 4OX6A 2UVUA 4NCBA 1H73A 4CH1A 3AT1B 4Y65A 1Q7LB 1VLOA 4Q0BA 3K8WA 1Q78A 4ATNA 3CJKA 4IG0A 4ES2A 1T8EA 2QN6B 2OH2A 5CCLA 2VFUA 2C28A 3NL0A 4WYWA 5DETA 2R2UA 4I2QB 3NKYA 2M8DB 3PRBA 3G8QA 3UDEA 1HWJA 2G2OA 1N6QA 4MFBB 4LF1A 3MEGA 3R7SB 3JAMY 3MTKA 3DM2B 2J0SD 1M0SA 4ZCIA 1UAWA 1WC4A 1RB0A 3C16A 3DGPB 4DSLA 2D3O1 1TMJA 3LWLA 4ES3A 2MSSA 3PZPA 1U02A 3LP1A 5KFDA 4KHMA 3GIKA 3KLIB 2HRYA 4K7QA 4V19X 4USVA 3LTOA 4DBQA 2QRRA 2YKMA 4QYRA 3EGNA 1UMJA 3DKDA 4DG1A 1DARA 3PJ9A 1VQPS 1DLOB 5D3GA 2BQRA 4TVAB 4B17A 4AQYF 1QAJA 3PVXA 1Z4UA 5KT5A 4V1Ak 1FRJA 4IFVA 2YKQA 2C2OB 2VBZA 2MZJA 2QMUB 1ZZFA 2BKPA 4URQU 1QTMA 3CB4A 4WIQA 2ZVIA 2BOPA 4FKXA 5E3RA 2W8KA 4WFXA 2Y8WA 1RAIB 1JLQB 3W9JA 3W5YA 4USMA 3JAMU 4HKQA 3R5JB 2F8EX 3MM7A 1KEKA 1HYSB 3MOZA 1UZDA 5KFQA 1R0CB 3O5TB 4NCGA 3TANA 2AJ4A 3QYYA 3RYLA 5KFIA 4PR6A 2KI2A 4YR3A 3KK1A 4ZPTR 2FPHX 4WWSA 4TU8A 3NWRA 2O1PA 4DV2J 4HDGA 2ZC4A 2H1YA 5D15A 2DNOA 5LXRA 2CQ2A 4LR9A 2V68A 3MHYA 2K3IA 3B6BA 2V69A 2HLUA 4EMDA 1KVIA 4Y2KA 1HIYA 4I2PB 4F2SA 4DX5A 4H4KC 3VGUA 4QYZK 3QZ8A 5F8LA 1NK7A 2G0CA 4F0MA 1RT1A 4OJGA 4BBYA 4NX9A 2I1RA 5F9NA 1KC8T 2MQQA 5A6WA 3SFUA 2VL1A 3TO8A 2J76E 3BN7A 3IBWA 4DR2J 1ULRA 2H65B 1NU4A 3TZXA 4B08A 2EBGA 2ZWPA 1IKWB 3IM9A 1YK9A 2M2BA 3MMCA 1OS5A 4ZITA 3SCIE 2D3UA 2MLXA 3HHKA 1JLBA 2MQMA 2ROPA 2ZBRA 4IDKB 2MGZA 2M9KA 4D3HA 1D9AA 2MJUA 4F3QA 1T9WA 3W8PA 3AXMA 3SDEA 1T9XA 3TZZA 3D6FB 4M5LA 4LRFA 2XQCA 2OPRA 2XMJA 4CQ1A 2HHHJ 2V2ZA 1M5HA 5LMUJ 3JTNA 3S1TA 5A8KB 5LT5A 4ZP8A 1NM2A 1C4CA 4I69A 4KJIA 1NJIT 2EC2A 5M2PA 4EBEA 1FD8A 1UETA 4Y00A 5A2QY 2HNYA 1SKRA 4IRCA 1S1VB 5E33A 4CLLA 3OTBA 3M9OB 3TUZC 2I6WA 3GFYA 4GKKF 4LSZB 4ZDNA 1N88A 2FZGB 2NSBA 4JV1A 3HVTA 1I94F 3NAIA 1IKXA 4JI6F 3J7A1 2VG7A 1HARA 2IPOB 4DU7A 3ZNJ1 1HPZA 1FKAF 3DOKA 3CIZA 1AW0A 4YDXA 3KOAA 1MU2A 1CS4B 3SI8A 4N41A 2IC3B 2ZOGA 3PX6A 4KB7A 1QVFR 4JI5J 1IBMF 4UOHA 3UW1A 2EFPA 2NUUG 3KDOA 4OX9F 1Q95G 2QA4S 2JC0A 3VAFA 2UXBJ 3MM5B 1HQ2A 5IS2A 3BSCA 1HWIA 3HHEA 5IQ6A 3MWBA 2KU7A 3FCWA 3BS9A 3ENWA 5DG8A 3V81B 2CVIA 1VQOS 1SKWA 4DPTA 5D78A 1HFEL 4K4SA 1M5PC 2DNYA 4DF4A 4YB7A 5ETKA 4U7UK 4OHWA 4ZCKA 1NDPA 1O0PA 5HJXA 1REGX 2YNHB 3G9CA 3TRGA 4FPIA 1HBUA 1XBWA 4CDIA 4NASA 5G0RB 2ROGA 1F5CA 1E6VA 1VHIA 4OZ5A 3J80Y 2FHJA 5M2RA 2B4UA 4WFZA 1MWQA 4WE1B 3GJSB 3WX8A 2X3DA 1SV5A 5A6PA 4F04B 4LF4F 3EVOA 4ICLA 1CC7A 3EVMA 4MT1A 2H9ZA 1Q7YT 4CO2A 2ZDPA 1YG0A 4L73A 1SC1B 5ETRA 1RHQB 4OI6A 1U0SA 1S1XB 1R8CA 4PG5A 2MPUA 3Q89A 3DLEB 2WOMB 1UFWA 2Y1RI 5J1EA 4RBUA 2NXJA 2W2QP 1QSSA 3BBBA 3DN9A 2MQ8A 4LR7A 1HR0F 1U47A 2IMWP 4OZLA 4ED0A 3ZTQA 2XGPA 3FEZA 4DZ6A 3VAJA 3ZZTA 2HK2A 2RVJA 4ZCMA 2YKAA 4HDHA 4OYXA 5E5NA 1FDAA 3IS9A 5HMWA 2U1AA 1WEXA 2R7QA 3Q23A 4KO0A 3UCGA 2LKZA 2CPHA 4JI2J 1K0VA 4ZIVA 3D66A 2CNKB 2B7CB 3HSDA 4QJVA 4MAKA 1UVJA 4C8KA 2WB4A 3DYAB 3OHAA 3M9MB 1S4EA 3NNHA 4DPUA 4C2MA 4A4JA 4JI3F 3MCNA 1U1LA 4C8OA 1VQMS 1CBKA 1YKWA 1RWPB 4LF2A 1Q8IA 3W61A 1S9GA 3MMJA 4F4YA 3VGVA 3PHEA 4NI2A 2G13A 4UZCA 1S99A 1M90T 3NNAA 3C14A 3M8QA 4YR2A 3RRGA 3L9ZA 5LJ5Y 4FVMA 1WKKA 2FHJD 3M2RA 1UVNA 4BC9A 2QLFB 3ITHA 5A0YB 2K06A 4JI1F 2L9WA 2HG4A 3FMWA 2DXEA 3NS5A 4ED5A 3P45B 1NSPA 1OQ3A 1U25A 2QX0A 3M2VB 5GAEU 2GA7A 5DS7A 3QRQA 5KFHA 2ZZTA 3L95X 2ZBPA 4X64F 3UDCA 3IC1A 4NA3A 3ZC4A 2IJRA 1KWMA 2RT3A 4HTIA 2DGTA 5F8MA 1FJEB 3EYZA 1CG2A 1P8GA 1XNRJ 2LXFA 4HI2A 1Y10A 4DV6J 4OX7A 3RBZA 2F63A 1I51B 2Z30B 4B3OB 1RA6A 2HNZA 2V9KA 3D6MB 1QSYA 1IQZA 3FQLA 4NZ6A 3N5BA 2LA4A 3NGDA 4DR2F 1LW2A 2OLWA 3IBFB 4PXEA 3PJXA 3K5OA 1DTTB 4X2BA 1CEZA 1IM4A 2KM8B 3CCES 4U6PA 4Q43A 7FD1A 3HLUA 3D0HE 4G1QB 2GVZA 3TAPA 2VODA 4ZLJA 2XS7A 3PYEA 5F3TA 2GAHC 2YWHA 4JI0J 5HVHA 3HFZB 2OMLA 1IJFB 2MHNA 5B0EA 3RR7A 3OFFA 2X3GA 4C8NA 4PRFA 1UZHA 3BBCA 3VTIA 2AKWB 2ZHBA 2X1FA 1VOMA 2WBMA 5CYQA 1N32F 1PJ7A 2HHHF 1J5OB 3PX0A 2FY8A 4LRDA 4Z2XA 5HVFA 3D0IE 3MUVP 4QQBA 1KS2A 2HQGA 3KXDA 4KH1B 4ECTA 5BR8J 3MR5A 1YBAA 8RUCA 2ZC3A 3AAWB 2QV6A 1N5TA 1U1OA 4HACB 1TKZB 1IBKJ 2R8HA 2E1CA 3DHXA 4XK8C 1JXVA 1LWFB 4LSNB 2LDYA 1CJUA 1E6YA 3KJVA 1U2CA 4TLQA 1S6QB 1RCOB 4C11A 3WBZA 5LXYA 3K5LA 4HH0A 2ILZA 4NXNF 1B0TA 2BM1A 2OHDA 1HBNB 2VBYA 4A8QA 1BWVA 4X4NA 4OV6A 3TUPA 1FXLA 1L3VA 4R0JA 3I4HX 1C1BA 2W9CB 1MG7A 1RA7A 4MIAA 4DR4J 4NLPA 2DGXA 1IXKA 3KHHA 4JOUA 4ZS6A 1VBXA 4ELUA 2AQ4A 1BGXT 1XERA 4LF9F 1VBYA 4DL3A 1HNZJ 3M8ZA 7AT1B 4OI3A 1R0BG 5HLFA 3AJ2A 1FKOA 3GFZA 4F4AA 1M1KT 2QO3A 1TKXB 1P9QC 3US5A 2IRYA 5CZXA 3KUEA 2GQQA 4NXMF 5KFGA 2RQCA 3H5SA 4DDFA 1IM6A 2A0FB 2C42A 1Y9OA 2DNKA 2WK4A 2R8KA 4H4MA 4B9LA 2FLPA 3DXBA 5CYMB 2B4PA 2CIMA 2PA3A 5I3UB 4EGLA 2GGPA 4EO6A 3PW5A 3AJ1A 1F1BB 1LKZA 2R4FA 5KFEA 2NS1B 1V9OA 3V4IB 2DHGA 4WTOB 1LNQA 2W24A 4GVLA 1VDHA 1HQEB 3N79A 1OIAA 4ZP7A 4YFUA 5IWAJ 3MM9B 2HMIA 4BDPA 5LMNJ 4C48A 5LSOA 2R7WA 1HBMA 1XN9A 2V4JB 3MM8B 5HBMA 1XNQJ 4Y6IA 2WW4A 4RW8A 4A46A 2ZE2B 3V4MA 1NJZA 3CCWA 3DFEA 1KFDA 4CYUB 3HT0A 3KDNA 4B3RJ 3SQOP 1RGVA 3SSQA 5EX0A 4ZKAA 1Q4RA 3W65A 1R6YA 4ILLA 2GZOA 5KFUA 2PMZD 2GAGC 2JFKA 3AD9C 2VOPA 4DR6J 3NGUA 1YJNS 1U4BA 4KT0C 3JQJA 4W92B 2AD9A 4LSLB 1M5KC 3IMQJ 2N7CA 4NYPA 3U1LA 2CNOB 2HFOA 3SSRA 1KHVA 1NK4A 4KBIA 1T05B 2JLFA 4ALZA 3JSRA 3MPDA 4RNNA 1W7WA 5KT7A 3SSSA 5I42A 1HD1A 2DR8A 3G82B 1OY9A 2B9XA 2ASLA 2UXDF 1ZPWX 4QIFA 3FGVA 3HD1A 4XTTA 1QUPA 2FYXA 1LW0A 1L3TA 1VRUA 1WG5A 4DV5F 1C1CB 3FFIA 1FKPA 3VVUA 3TEGA 2L41A 4WXOA 3T9NA 2HQIA 3V6DA 3ADAC 5HMZA 4QIVA 2JLGA 4BC7A 1UW4A 1CJTA 1HBOA 5CD4A 1DBDA 3DRRB 4OYIA 3AQPA 3UCUP 4KFBB 3QO9B 4RU9A 2DPJA 4QW8A 1LK7A 5B0DA 1J5EJ 2GX8A 5B0FA 2HFZA 2VC1A 3IWNC 1SH3A 2PMHA 2HQFA 1UPPA 1U7LA 1VR6A 1N5VA 1TL5A 5JJBA 4NLDA 5J2MB 3IO1A 3KUHA 3M1VB 4HLBA 3PYGA 4B02A 1OY6A 3HMJG 2GVDB 1WDDA 5HN0A 1YJRA 3T1YJ 4CLUA 4MKBA 3TYTA 4M5GA 2DH9A 1N5QA 2DRAA 4FF1A 3P6YC 2QLBB 4KTQA 4QIGA 1T3NA 1UP1A 5F0WA 2CQ4A 3J7YU 4AE5A 1F5BA 2GJFA 1V3SA 2AV5A 4CM0A 3CT9A 5IM0B 3HKWA 5KFPA 1FTRA 4U7UD 3ENQA 4B3TJ 1WF2A 4GRSA 2BM0A 1S79A 4F36A 1YJWS 5HANA 1HNIB 3T1HJ 3THVA 1Q16B 2KVQE 2H3EB 3OFEA 2BJ9A 3W2WB 2AF6A 1BMQB 1FESA 4AYBD 3LALA 4Q7AA 2HURA 4CH0S 3HKZD 1Y3KA 2WONB 4JI0F 2CRLA 2DJWA 5CA5A 3IG1B 1W25A 4IO9Q 1TL1B 1FVSA 3VALA 1KBRA 3RW6A 4DUZJ 4MMOA 1SCJB 1YITS 1QY7A 4QWAA 3RB6A 2V9WA 3MR6A 1HNVA 4LF5J 5BYSA 2OFGX 1D3WA 1GTEA 2YVSA 4RPFA 1LFWA 4K50A 2AJ1A 4A8FA 5B09A 1RT4B 2HIQA 1TQLA 1S97A 5IT9U 2CG4A 3CCSS 1S6PA 1IBKF 1VQ8S 3GSIA 5HL7Q 1Z2LA 4FS2A 1YJ7A 4DR5F 2K1RB 3WDOA 2F4FA 1W2BR 1QVGR 4GO7X 1RAOA 4XDDA 1RT6A 4ES1A 2VG6A 3DOMB 4ZN1A 5EWEA 3LA0A 1FRLA 2PO4A 1REVB 4C8YA 4L3NA 2CPEA 1VYAA 3BSAA 2C2EA 5F8HA 2ZH7A 1UFLA 5L39A 4WU3A 3I31A 2W4CA 1X31C 3GV8B 4F4ZA 1GT8A 1K73T 3PTWA 3J7Z5 4K2JA 5JVHQ 2XSJA 1YLXA 2E7VA 1S1TB 2YNGA 1UJ6A 1U1MA 2MMYA 1WTBA 3CJ3A 2Q3PA 3DDIA 2R7VA 3KNGA 5CD4H 3IA0A 2PC6A 2CVEA 2YQ1A 3FZ2A 4J9PA 4M5MA 4LFCJ 1XR5A 4RW6A 5T7LB 5KG3A 4P2SA 2GO8A 1OYDA 2ZOMA 5DDPC 1KFSA 5LJ3Y 5EX3A 2Z4PA 4B9TA 2I38A 3PEHA 4OZNA 2FZKB 2GHWA 4I7FB 1VQ7S 2OEJA 2ZHAA 4N5SA 1MMNA 2A10A 5L1IA 2XZDB 4L72B 1YQHA 4LF6F 2YKNB 2DNPA 1K1QA 1B0VA 2GCFA 3BYPA 4IOCQ 1N33J 4MKVA 1TVRA 4UOFA 3CJ4A 3BREA 3QRPA 2FZCB 2YH1A 1TK5A 2DB1A 5D4NA 4X62J 4WF9Q 2XWYA 3MAAA 3MXHP 1R27B 2CPYA 3ONQA 1KKHA 4Y2IA 4Y28C 4DR7J 1S9EA 1HWUA 5GMEA 5IWAF 5LMNF 2H5IB 5IZHA 1EKRA 1CVJA 3UE2A 3SIPB 3OTDA 3OXGA 5EGYA 3LAKA 5IC6B 1BQNA 4LQ3A 2AJ2A 1F6TA 2AWZA 3DLGB 4ZVUB 3MPWA 4K4WA 3EPIA 4J9KA 4WP3A 1RWUA 1Y7PA 2B8QA 3DRPB 2AZ1A 4CLKA 2Q6CA 3PRVA 5HMYA 3PO4A 4S0MA 2OAUA 2HFUA 2CA9A 3NP5A 2FJWA 4KGXB 2V2QA 4PYDA 2A1BA 2MXYA 4DR6F 3G6YA 4ERDA 1YX2A 3OJUA 1RSCA 2VFVA 4ZVFA 3CC4S 1XJWB 5AE1A 1YSJA 4EUVA 3CD5A 3RBXA 3A3OB 4I2QA 4DFKA 4TYBA 2ERRA 1V5VA 4A8OA 2HW3A 4MFBA 2CJXB 4ZPBA 4DR1J 3R1LA 5F8NA 3OD2A 4TQSA 2EFGA 1N0VC 1S76D 1NK6A 4DV1J 2P6TA 2HHPA 4BS2A 3C6TA 4MIBA 2XI2A 1OY8A 1U24A 1FNXH 4ZJQA 2EEYA 2HPUA 4RX6A 2XYGB 3LWMA 5FDLB 1T3OA 3RZAA 3LH2S 4WP8A 1UEUA 3S8SA 1DLOA 3POTB 1RU1A 5RUBA 1FT8A 3RTVA 3AB4B 3VAHA 1KHWA 4IR1A 1VRTB 1EKSA 4X4TA 4Y3CA 1CPZA 2LFVA 3DLJA 1VLYA 4X4RA 3PCOB 3KHGA 3R3TA 2CJ9A 3G8TA 4O3NA 1YJ9S 3B82A 4ZLNA 1GMWD 2DRDA 3VR1A 4OI4A 2ZD1B 2NYIA 2YH0A 1PG5B 4KGKA 3W63A 1HYSA 1PC5A 3K2YA 1AUSL 3MR7A 2M3DA 2C3MA 4ED2A 3BSOA 2XO6A 3D6HB 1RI7A 3GR1A 5B0AA 2BE2B 1PBUA 2F9DA 3T1YF 2IYGA 2BVZA 4AL6A 1UJ5A 3L7OA 2Y1LB 1TAUA 2XM3A 1LV5A 3QT8A 1JMTA 4NLUA 2YNIB 5DLFA 1ZA2B 3IR6B 2JC1A 1U45A 1P27B 4ETZA 1VQ9S 4I2PA 3QT7A 2VIHA 3R27A 4ER8A 2MDAA 3GWCA 3MPYA 3QIPA 2KVIA 1NJWA 1OMSA 4D3GA 1R3NA 4R8UB 3PY8A 5LSRA 1Q81T 4O0NA 4G1PA 3K5PA 1BQMB 2CPJA 1CJVA 4GO5X 6FDRA 5J2NB 1U6BA 3PIOQ 4RWWA 1IKWA 2PI4A 1MSWD 5SZTA 3SYZA 4UY85 5J1NA 2HHXA 1U0HB 3QBCA 1KD1T 2RIJA 2ZEJA 4DUZF 5HQ8A 1HLWA 4ILRA 2GHPA 2CKWA 2FJDB 2VOOA 1FXDA 3UDLA 3I96A 4IQMA 1NEEA 4P52A 1TL7A 2D9OA 3P4UB 1KONA 2M4MA 3PM9A 3HULA 2OD6A 2HHUA 1H98A 1WJ9A 4FF2A 1NK9A 4IUFA 1N56A 4YHHJ 1X4AA 1S0VA 3NGSA 3LP2B 3QIDA 4DS5A 4A8SA 3TEHB 1VS3A 4UUXA 2R7UA 1F9FA 1NZAA 2OPPB 1RWMB 1JWWA 3OLBA 4U8VA 3IGVA 5D4OA 1S1VA 3L09A 5DDOC 1BC6A 2F1FA 2QFIA 5DRKA 1ZM9A 4C97A 2OPQB 3UNGC 2R8JA 2L9NA 2B6AB 2Z0GA 2C2DA 3D28A 2IC3A 5EN1A 1T95A 5H9EJ 4CZCA 2ZM6J 4KAIA 4M5HA 1ZS6A 2RUGA 4NA2A 3NBPB 2B9YA 1OYEA 1FK9B 3NMRA 2Y8YA 3I82A 3K0JA 4LFCF 2JJ4D 5KG7A 3DCAA 4CIOA 3VGSA 2VF3A 4I1TA 4ENOA 1YRXA 1M5VC 4DV7J 4KYZA 3FBBA 2RHQB 2PN6A 1EP4A 4CTAB 2A3JA 4ZK7M 2PT0A
chains in the Genus database with same CATH topology
1WF1A 4LQ9A 3I9ZA 4IRCA 1S1WA 2VB6A 2VFSA 1S1VB 5L1KA 4I6YA 3JYTB 1Z1ZA 5E33A 2MKJA 3H2UB 1JLGB 3OTBA 3M9OB 2PFFB 3TUZC 2Q79A 4OHVA 3GFYA 1ZYQA 4GKKF 1A7GE 2MJNA 4ZDNA 1RT1B 3SV3A 1N88A 2GQ2A 5G0RA 1H0HB 3I87A 1B0PA 3RW7A 5M2UA 1Y0HA 2NSBA 1VIXA 4MK8A 3HVTA 4JV1A 3QJJA 1N34F 5J2PB 3T9ZA 1I94F 3NAIA 3CCRS 1IKXA 4NYZA 4JI6F 3DLHA 3I0RB 3TARA 2D3ZA 5KFAA 4K4TA 5KFKA 1XMOF 1S1UB 4DOZA 4WE1A 3J7A1 1GXTA 2VG7A 1HARA 2WTFA 3MMBB 3RRHA 2YNFB 3CDWA 3I0SB 4RW7B 4PG6A 1HPZA 2XEXA 1FKAF 2AGOA 2DNHA 3DOKA 2HHQA 4Q8EA 3CIZA 1AW0A 2K3KA 2I5JB 3CUNA 4YDXA 1NNDA 3KOAA 1MU2A 2EKYA 2IVYA 1F0XA 1QJHA 2D9PA 3N6MA 5BYQA 3SI8A 2ALZA 2N82B 2XGQA 3V6KA 4RUCA 1JLBB 2B51A 1VQYA 2IC3B 2MZTA 2Q1LA 5A8RA 2DVIA 2B0GA 4N41A 2JWNA 2IM0A 2ZOGA 4CNYA 3PX6A 3JSMA 2OP5A 3RAXA 4KB7A 1QVFR 2MGZB 1U1KA 2ZE2A 3D1HA 3KLGB 3CCUS 1V3ZA 5I4MA 1JKHB 1LFPA 3QMQA 5KT3A 3RB4A 2DNGA 2HWHA 2PA8D 2DO4A 3EXCX 1Q8BA 1HHTP 1KLNA 2E29A 3RBDA 2VA2A 3TA0A 5C42A 3DNCA 3LANA 4F02A 1IBMF 1HW8A 1URRA 2RH3A 2KZZA 3UW1A 2EFPA 2RQKA 3M05A 3OHBA 2AYBA 2NUUG 4TKTA 4DQIA 1LOUA 4W90B 4LIWA 4MKAA 2DT9A 4OX9F 2QFJA 1XTZA 1TKTA 2OPRB 2QA4S 4NZ0A 4CO4A 3BQ1A 4RNHA 4ELVA 2JC0A 2MZSA 4Q45A 2CQDA 3MM5B 3MR2A 2X1AA 3G4SS 3VAFA 4DQRA 3DLEA 1RT2B 2WOMA 5IS2A 3BSCA 1HWIA 3HHEA 1R31A 5IQ6A 3W2VA 3MWBA 4LVNP 5B0CA 2KU7A 1IQTA 3BS9A 3ENWA 1JNZB 2RS8A 5DG8A 3V81B 2QEXS 3V2UC 2CVIA 3LQVA 1VQOS 1SKWA 4WKRA 2FDNA 2XSJB 3ZZYA 4WKYA 1XNQF 1U6FA 3FNNA 3HHLC 4H4KA 5D78A 2UVWA 4OMFG 1HFEL 1L5UA 5DG7A 2G9OA 3UR3C 1V6HA 5THWA 2KXHA 4F3MA 3IN5A 4DL7A 2DNYA 4ZCLA 3BSNA 3HXMA 1FO1A 4DF4A 1M5PC 3U1MA 2XO7A 3NMAA 4A8MP 2ZH1A 4YB7A 3CDBA 4I56A 5E3CA 4LSLA 4U7UK 2KM8C 3B4MA 4OHWA 3DDKA 4ZCKA 2HNYB 3N6NA 1O0PA 4ETXA 2V2KA 1WD6A 2ZH5A 3RU0A 4KRWA 1VQNS 2QA2A 3NWGA 5T14A 2YNHB 3THTA 2E9RX 4B3RF 4DL2A 3OVAA 3G9CA 3FZBA 1U2RA 2CPIA 3TRGA 1U6ZA 4ECQA 1HNWF 1RTDA 3ISND 3M32A 3UPFA 1HBUA 4DR1F 1XBWA 1SBRA 1X5SA 1A6LA 2XNQA 4ELTA 3O8WA 2XC9A 4GKJF 5G0RB 2ROGA 1F5CA 5FD1A 5K8PA 3SCJE 2F8MA 4HI1A 1E6VA 1FD2A 4TY8B 1H38A 2R8GA 1M5OC 3HP6A 3SEOA 1TL4A 1NK0A 3R5AA 4OZ5A 1IKXB 3J80Y 4HT7A 3H5XA 2FHJA 5M2RA 1MW7A 2FVPA 2B4UA 4WFZA 4WE1B 1ZM4A 3O1LA 1X4EA 1S0OA 2E1AA 2E66A 1L3UA 2W9AA 1FXRA 3DOKB 1JXEA 1WHVA 1SV5A 2ADBA 3T1AA 4UQTA 5GAEI 5A6PA 4J9OA 1MU2B 4I4BA 5B0GA 5KTQA 3MECB 4LF4F 2E1MC 3HX9A 5KFLA 3NLCA 2LCWA 4IO1A 2YX7A 5MAOA 4RNOA 4CCHA 2HGLA 4Q5VA 4ICLA 1CC7A 4G3IA 2VKZG 2H9ZA 2JEIA 4PG4A 1Q7YT 1TVRB 4CO2A 2ZDPA 2ZOFA 2DNRA 3PFEA 4WTYA 1YG0A 4CH7A 4A47A 5F9LA 2XY5A 1N4LA 4JI4F 2X51A 4RZRA 2CQ1A 3Q8RB 4K5SA 3K59A 3GZ7A 2VBXA 3ZZRA 5DLGA 2CFXA 5KFNA 5C42B 4B3SF 2IJNA 4OI6A 1S1XB 1R8CA 1BLUA 3DRRA 1JJHA 5DQIA 4N76A 1T03A 2B4OA 2Y1IA 4KFBA 4PG5A 2MPUA 2DNQA 5GADI 2E44A 2KYZA 2P6SA 4TYAA 4C3LA 3DLEB 3V5RA 2WOMB 4QR2A 4DLEA 1UFWA 2KXNB 2Y1RI 3GYNA 5K5MA 5J1EA 1UA1A 4B9NA 3CIMA 2ILYA 4RBUA 4EEYA 1YJUA 3KKFA 1UKUA 3JSBA 3BZQA 5GAGU 5B7WA 3MGJA 2KB2A 1KQFB 4YUDA 2PI5A 4PXCA 2EC0A 1QSSA 2NZ4A 1I6JA 3DN9A 1QUVA 1R43A 4NRUA 3Q24A 2JEJA 6FD1A 3NGKA 1HR0F 1PILA 4J9LA 1U47A 4TN2A 2IMWP 4M94A 4OZLA 5A0YA 1BY9A 4ED0A 2ZZNA 2XGPA 2HS4A 2N3LA 3FEZA 3VAJA 2JHEA 1D1UA 1XWLA 1D8ZA 4AXJA 1RKIA 2DPIA 3ZZTA 2VC0A 1R8AA 2RVJA 4ZCMA 1S10A 3QAUA 2AJFE 2J9CA 2YKAA 4HDHA 5E5NA 3LOUA 3E3XA 1FDAA 3IS9A 1UJ4A 2DGSA 5HMWA 3ZZOA 3OV7A 4DL6A 1WG1A 2U1AA 4YB1P 3VAKA 3JTPA 1Y4ZB 2FJBB 1RTJA 1WEXA 1RTDB 2R7QA 3M32B 4TY9A 1MROB 1HBUB 3H4BA 3Q23A 2UXCF 4KO0A 3UCGA 2H5EA 5AJ3F 2LKZA 2W7OA 4PG8A 2E7WA 2CPHA 4K4UA 2V0NA 2X1BA 1J5EF 3M2VA 1K0VA 1E6VB 2B7CB 4AL7A 4IRDA 4DS4A 4WFYA 2AGPA 4QJVA 4MAKA 1UVJA 3JSYA 2V8GA 1FTCA 4C8KA 4NZ7A 2WB4A 2IM1A 5CZVA 3MEDA 3N0VA 3DYAB 4LFBF 2F7VA 2FJEB 5FLXY 2D74B 4IKAA 1P6TA 2O67A 4O3SA 1SV5B 2KXFA 1MMDA 1OO0B 2EI5A 2QSWA 2LMIA 4IYQA 4YQWA 3OHAA 3M9MB 1X9SA 2BRLA 2HNDA 2IM2A 4NL5A 2FVSA 3NNHA 2ASDA 4YP3A 2KHCA 4C8MA 2IHR1 3ZZ0A 4Y34A 3W2WA 2XLIA 4C2MA 3TA2A 2DHXA 4ICLB 2O66A 4A4JA 3M8SA 1YJTA 3H20A 1VIOA 5EHHA 1T94A 2V94A 4QWDA 1VQLS 2F40A 3MMAA 4JI3F 4B3OA 5KFJA 2D3OR 4C8OA 1U1LA 5KFCA 1X0FA 3H5UA 1VQMS 2VBWA 1TK0A 3ISZA 3EGZA 1TAQA 2UV8A 3C6TB 3MPVA 3IG1A 2RKIA 1Q8IA 2ZVSA 4O4RA 1S9GA 5KFSA 3MMJA 1K1SA 2IJFA 3IR5B 3HHLA 4ID8A 4DV0F 2Q6BA 4F4YA 1YHQS 2XLKA 1SC6A 1PO6A 1TL1A 2CZ4A 5EWGA 3PHEA 3OVBA 4DPOA 1RP5A 2G13A 1DTTA 2HWIA 2N4DA 3G6ES 3M6XA 1N8RT 3BO3A 1S99A 3TUJC 4B3TF 3HJFA 1M90T 3NNAA 2R7OA 4G1QA 1FRHA 2JSXA 1RISA 3M8QA 4YR2A 3T1HF 2KG0A 3DHWC 4C3KA 1JXLA 1N52B 3FCHA 2LXIA 5LJ5Y 3RRGA 4FVMA 2CQ3A 4TQRA 1NH7A 1CQMA 3T3FA 4F3OA 2FHJD 2BW2A 3M2RA 4H4OB 1UVNA 1DFDA 4BC9A 2RF2A 3ITHA 5F8IA 4X4VA 5A0YB 5KG1A 4JI1F 2R7SA 3OPKA 2EFNA 2OPSB 2L9WA 2HG4A 3TP2A 2GO9A 2YQ3A 3DXSX 5U47A 1U49A 3FMWA 2ADCA 3E2EA 1U8SA 3NS5A 1S77D 3CMAS 4ED5A 1FRKA 4PPDA 3IS9B 3BQ0A 4OHXA 4PG7A 1RTJB 1RT4A 1DQAA 4N8NA 4KO0B 3LF0A 4NLSA 3I55S 5MLCV 2HVZA 3DI6A 2YWEA 4ZPDA 1J5OA 1OQ3A 1SJRA 1U25A 2W7PA 3M2VB 5GAEU 2R2SA 2GA7A 2APOA 3P96A 4USHA 4DR4F 2KYXA 5DS7A 3U02A 1R89A 5KFHA 3FSXA 2HFNA 3L95X 2MKIA 1VBZA 4X64F 1O8BA 3O6QA 3UDCA 3IC1A 4NA3A 3ZC4A 3Q8PB 2RT3A 3TVYA 1S7HA 5EWFA 1R7IA 2DGTA 2L3MA 3K7RA 4HTIA 1VK8A 3S7RA 5F8MA 5H9FJ 1Q82T 5IT9Y 4F4KA 4EBCA 1TZ0A 2XB2D 1FJEB 3EYZA 3BF4A 2HNDB 2CQHA 2AGQA 2AJ0A 2W4DA 1ZH5A 2BACA 3UD4P 4LF5F 1CG2A 4K4ZA 1P8GA 1A9NB 2LXFA 2ZKUA 1X0PA 4HI2A 5LL6d 3TR5A 1MWZA 2AX1A 4CO0A 3AB2B 2IVFB 4KPYA 4OX7A 2B5JA 4GC6A 1REVA 3MMAB 4ZMMA 5GADU 4B3OB 1RA6A 2HNZA 2MZ1A 2WSFC 2V9KA 3OLAA 3C6UA 1TKZA 2JX2A 2RRNA 2ZH4A 3ZZPA 1KQSR 1QSYA 2MZQA 1IQZA 4OI1A 3FQLA 2MQPA 1ZTWA 1SH0A 2CJBA 3H4DA 4NZ6A 2D41A 4HH1A 1S9GB 3N5BA 1FE0A 3IR7B 2LA4A 3HHLB 3NGDA 4J9SA 1H2VZ 3RAMA 3SQGB 3D54A 2O5DA 1LWFA 4UW2A 4LSNA 4DR2F 1LW2A 4AUKA 2OLWA 4PXEA 4DQQA 3QZ7A 3PJXA 3K5OA 1Y00A 1DTTB 3VF0B 2DR7A 4X2BA 1YIJS 1CEZA 3GB0A 3GIMA 1IM4A 2KM8B 3MFIA 4ZVGA 3CCES 4U6PA 4Q43A 3DRXA 3CSKA 3NCQA 7FD1A 3HLUA 3D0HE 1S6QA 4G1QB 3TAPA 1S1TA 1NO8A 2OO4A 2Y0SD 1XK8A 5AXMA 3FSYA 2GMHA 2VODA 3QIPB 2XS7A 1AUDA 1X7VA 5F3TA 1I1GA 4YY3F 3BQ2A 2YWHA 2ZM6F 1MWYA 3M2RB 2XZWA 1URNA 1MMLA 1BQXA 2RF2B 3ITHB 3C2PA 1OWXA 2OMLA 2RD5C 4ECYA 4ZVEA 2RDIA 4DG1B 2MQOA 2C3OA 3HFKA 1MNEA 1IJFB 2V4RA 1ZETA 5L38A 2MHNA 4QWEA 3IRXA 4I0WA 2O3DA 1YGYA 5L9XA 5B0EA 4LVOP 3RR7A 2MYFA 3OFFA 2X3GA 4C8NA 2ZITA 4F25A 4PRFA 4R25A 2JH3A 3VTIA 4RNFA 2ZHBA 2X1FA 1VOMA 2WBMA 5CYQA 2LLZA 5DG9A 1N32F 2MY8A 2RILA 1X4GA 2HHHF 1J5OB 4WYLA 4YEAA 3C66A 2DIUA 4J9QA 2IBKA 3M30A 4MH8A 5E2QA 4M8LA 1QE1A 1U2FA 2K2PA 3U1NA 3PX0A 2AYMA 4I7FA 1FDDA 1JIHA 1ZM3A 1WHWA 1XR7A 4ZPAA 3LGNA 3HHLD 4QZVB 4Z2XA 3D0IE 3MUVP 1NHUA 1RTIA 2VUGA 4QQBA 2YKNA 5AE2A 3M2UA 1KS2A 3GIIA 3C3LA 3KLFA 2ASYA 1VHFA 4TNOA 2J6TA 4ECTA 1P1LA 3MR5A 1TKXA 1YBAA 3EZUA 2UUCF 2ZC3A 4X4QA 1DURA 3AAWB 2QV6A 3UWTA 2HHTA 4LFAF 4PQUA 3H2LA 1N5TA 1NKCA 2IFXA 4QOTA 5D4PA 2HNZB 2LEPA 2QIFA 2V8DA 1U1OA 1SXLA 4NA1A 3C6UB 1TKZB 1U26A 1IJEB 2EWHA 4ECVA 2EG2A 1Q86T 2I9SA 4B9SA 4OJ1A 4YB5A 2R8HA 3TW0A 2XNRA 3AA8A 1V3RA 2AX0A 2ZUGA 3LUYA 4KKOA 2DNMA 2VH7A 4I67A 2RNEA 4XDCA 2CZVC 4IOAQ 1TK8A 1HI0P 2E1CA 1KTVA 3DHXA 3LP0A