5T7LB

Pt(ii)-mediated copper-dependent interactions between atox1 and mnk1
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
75
structure length
75
Chain Sequence
VNSVTISVEGMTCNSCVWTIEQQIGKVNGVHHIKVSLEEKNATIIYDPKLQTPKTLQEAIDDMGFDAVIHNIEGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper transport protein ATOX1
publication title Pt(II)-mediated copper-dependent interactions between ATOX1 and MNK1
rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 16
structure length 75
sequence length 75
ec nomenclature ec 7.2.2.8: P-type Cu(+) transporter.
pdb deposition date 2016-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5t7lB00
2BJEA 1JK9B 1SQEA 1YJTA 2RSQA 1TR0A 3KG1A 2K7JA 1N5SA 3FGVA 4OJGA 2QIFA 2AJ1A 2ROEA 1X7VA 2RU9A 1SI9A 3MZIA 2K1RA 3TRGA 1YJUA 3QMQA 3KG0A 2VH7A 1Q8BA 2BYCA 2OAUA 4DL0C 4EFAC 4A47A 2PD1A 3MCSA 4DN9A 1WD6A 1ULRA 2XMWA 1N5VA 1GXTA 1TL5A 1XBWA 2IYGA 1LQ9A 1JWWA 1S6OA 1YJVA 1Y3JA 3HDSA 3HHLB 3QGPA 3DCAA 1GXUA 2OMOA 2RILA 1URRA 2ROGA 5T7LA 4DPOA 2ROPA 5B09A 1OQ3A 4FNIA 1YJRA 5B0CA 3HHLA 2AW0A 2LXFA 1TZ0A 2GV1A 2G9OA 2KYZA 1FVSA 2HFOA 2XMJA 5B0BA 5A6WA 1U7LA 3BM7A 4NL5A 5F0WA 2K1RB 2FTRA 1R6YA 2GFFA 1OQ6A 4A48A 2RMLA 3BR8A 1TL4A 3BGUA 4Q2MA 3WDOA 3FRYA 2N7YA 2VV5A 1CC8A 1W2IA 4HI2A 1Q53A 2KT3A 2ZDOA 3FMBA 5B0GA 1KVJA 2GA7A 4Y2KA 2FIUA 1P6TA 2FHMA 2N4CA 2ZDPA 3HHLC 2GCFA 4A46A 5T7LB 3BN7A 1FESA 3BDEA 1TUVA 5B0FA 3VTIA 2BJDA 2IYIA 2N4DA 3GZ7A 2OP5A 2OFGX 2LDIA 2HLUA 2ACYA 4ZA1A 1MWZA 2GGPA 4Q2LA 2GO8A 3TOQA 3DXSX 4ZOSA 2HFNA 3CJKB 1AW0A 3LO3A 2XMTA 2FB0A 3BB5A 2QLWA 2L3MA 2W4PA 3TNVA 1YG0A 2AJ0A 1KVIA 2JDJA 3HHLD 1OSDA 2LQBA 4QOTA 3CJKA 4A4JA 4YDXA 1Q4RA 2XMKA 4OJ3A 3LGMA 4OJHA 4NPOA 2OKQA 3T9NA 2HQIA 2IFXA 2XMMA 1AFJA 3UDCA 2QLXA 2OFHX 3KNGA 2BBEA 2LQ9A 2PGCA 1CC7A 1Y9OA 2GGPB 4FNHA 4U9RA 1CPZA 2K2PA 2W4CA 2OD6A 5B0EA 2W4DA 3BF4A 2HLTA 3IWXA 1X8DA 1FE0A 1FD8A 4YEAA 1MWYA 3K7RA 1N5QA 2XMVA 1APSA 2KT2A 1YRXA 2K7KA 1SB6A 5B08A 1FVQA 2EW9A 5IXUA 2OD4A 3HX9A 4Y2IA 5K9FA 1P8GA 4Y2MA 5B0DA 4HI1A 4HL9A 3HFKA 4HH1A 5KAKA 2XMUA 2HIQA 4OJ1A 1IUJA 3IWLA 3F44A 5B0AA 1FE4A 5A6PA 1S6UA 2QYCA 2BUNA 1VQYA 1VQSA 2CRLA 4HH0A 1N5TA 1AFIA 1KQKA 1OPZA 5F0UA 1Y0HA 1FEEA 3I9ZA 2Q3PA 1Y3KA 1K0VA 1X0PA 1V3ZA 1Q8LA 2AP6A 3HF5A 3E8OA 4OIXA 2ASYA 2KKHA 3KKFA 3LGNA 1QUPA 4F67A 1RJJA
chains in the Genus database with same CATH superfamily
5L1JA 3OPKA 4LR8A 3NLCA 2KZMA 1WHVA 2HNZB 3KJNB 4X66J 5IFMA 1S59A 3CDUA 2Q79A 3P4UB 3H20A 1VRTA 5GAEI 2MGZB 1VJWA 2LQ5A 4A48A 5ETOA 4B9SA 4K5SA 2BJ3A 3ONQA 1P6TA 4LRDA 2DCLA 2EG2A 2D3UA 4NXNJ 5FDLA 4K0KF 4ZA1A 2JVOA 4ED7A 2KL8A 2JDJA 4J9UE 4N5SA 2XEXA 3T9NA 1EKSA 4AFFA 1T9VA 2B9EA 4KFBB 2OLWA 2FJAB 1U09A 1J5OA 4HVZA 2XMVA 3S8SA 2DR7A 1NK0A 2U1AA 5KG6A 1F2HA 5K9FA 1IM6A 2FY1A 3HFKA 5J2QB 1NPKA 4P2SA 4PUOB 4XPEA 1BQXA 1U1NA 2HNYA 2Z30B 4C2MA 1V3ZA 1ZA1B 3MDFA 1B0PA 1JK9B 2KFYA 1QD1A 2M3DA 5KOXA 2HHXA 1EHWA 2RRBA 1G1XA 4C97A 2B6AB 3SCIE 3VHQA 2HAIA 3O2IA 3T9ZA 3BREA 3MM7A 3U1LA 2XMJA 3PW5A 2JZ5A 1CJKA 1QE1B 4QWDA 2YNHA 2HFSA 3J7YI 4CLKA 4R5PB 2J8AA 3ILJA 1WKKA 5EWFA 1VQ8S 1H2VZ 3WX4A 4PQAA 5AXMA 4C11A 1WG1A 3ZTSA 1GFWB 2J5AA 2BE2A 1E6YB 1NHUA 4C8NA 2KN4A 5CD4H 4DR6F 1IWGA 2JEGA 2CPHA 3HVWA 5C42B 2QRRA 2HVIA 5KFQA 1MROB 1S1XA 2VUGA 3W2WA 1TFYA 2V4JB 5AE3A 4OX8A 4DR4J 3P49B 2Y0SD 3MM9A 3JQMA 2MQLA 3O6QA 4F0MA 3QGGA 2KT5A 1I1GA 5KG3A 1K0VA 2DJWA 3QRRA 2V2QA 4M5IA 1KOOA 4AL5A 4M63A 3QAUA 3N5BA 4M8LA 2HS4A 2BM1A 3IAM9 3ZNJ1 1IKWB 3QJLA 3RUBL 1S6OA 1U02A 1J2VA 2IDLA 1TKZB 3M2UA 3POTB 3ETMA 2V4QA 3DKDA 5D3GA 3FSIA 2V4RA 4W90B 1UP1A 4KV8A 2HS3A 4RX6A 3OR2B 5L1IA 5K8NA 3MUMP 1LWCB 4CT9A 5M2RA 4DSIA 4H4MB 2W8LA 3ENAA 2DY1A 1YG0A 1HQEB 2D41A 2VZ9A 2FZKB 2UXBF 4EO8A 4OYXA 5KFXA 1G4CA 4OX9J 4UZBA 4QWAA 5U47A 2W4CA 3Q86A 3C15B 5LJ5Y 2QSFA 4CNYA 4KH1B 2LA6A 4H4KA 5IXUA 4URQU 1EP4A 3PEHA 2NSBA 2VIHA 3M32A 1HI1A 2A0FB 3M6VA 3H7HB 1N56A 4URGA 1NDKA 3HHLB 4LBPA 3BPSP 2DGVA 5KFPA 2J6SA 3EVMA 1VS3A 4NA2A 5ETLA 3MM5A 4NLQA 1YWXA 1VK3A 4O4RA 2SXLA 1D8YA 2A1BA 2KRRA 2X1BA 3K5PA 2G13A 2VICA 1DHMA 1VOMA 4Z37A 2Y0BB 3DLJA 2ILZA 2A10A 4DV3F 5DQIA 4NCGA 3BKFA 4RW7B 1D8ZA 4I6YA 2G2YA 1IWAA 2YNGA 4R25A 1RHMB 1REVA 1FD2A 4B3OB 1JJCB 3V4IA 2GHPA 1RT4B 5H1SV 1RCXB 4M95A 1FXDA 1JNZB 1L3UA 2RIJA 3SFUA 4PKDB 2VODA 2LCWA 4AT1B 3BYPA 5D77A 4ES1A 2IPOB 2RB7A 1WNEA 4IQXA 3I5BA 1HIYA 4O0NA 1NMEB 1X0FA 1HD0A 1LNQA 2CPFA 2B5JA 4F7VA 2EFQA 4CP5A 3B78A 4YMEA 1UVMA 1NPPA 3DXBA 2MXYA 4C8YA 3SI8A 3OHBA 1C0TB 2HRTA 5AJ3J 4KIAA 4YOEA 4B3SJ 1V5VA 2JHEA 4C0HA 3IN5A 3NAIA 4L3KA 4URSA 3C3LA 4HT7A 2RS8A 3W64A 4E0DA 3IM9A 4IG3B 1NB7A 4PWDA 1Q0NA 4P9SA 1HBOB 3RRGA 3K5LA 2V8VA 3AJDA 2ZHAA 4YS2A 2DNPA 1YK9A 2RUGA 4IR1A 4AUKA 3GPAA 4NLVA 2RU3A 5F9NA 5H9EK 4MKVA 3K7RA 1ACMB 3OUYB 2VQEJ 2YX1A 2Q1LA 3US5A 5E41A 1WF1A 1OWXA 2KRBA 3UDLA 3DOKB 3D1HA 2G1HA 2HVEA 1K9MT 3UR0A 3ENWA 3GONA 2BE9B 2Y9HA 3JQKA 4QR0A 2AYEA 1VI7A 2NYIA 1EQ0A 2W2OP 3ETOA 1U1RA 3AXKA 3M8QA 4USKA 1IR2A 3W66A 1ZM9A 4LRCA 1TL1B 1SKWA 7FD1A 2QC3A 5T7LA 5CCLA 3F41A 5K8PA 2IVFB 3J7A1 1UETA 1YJRA 3D5MA 3RTVA 3THTA 2AW0A 1SIZA 4CRJA 2GFFA 1WC0A 2AZ1A 5JXSA 3WX8A 1CG2A 2Z57B 4WWSA 4FF1A 3IA0A 3CW2C 4DWIA 3QFWA 3TJ8A 4ZPVR 3HHLD 2C3OA 5A8KA 5D0GA 4A8MP 1HNXF 3NCQA 4KO0A 4IUFA 2ZH6A 1V3SA 5GAEU 1IBKJ 3M9MB 3DLKB 5M2PA 2FVSA 4ZS6A 2BX6A 4RBVA 4LF9F 4NI2A 2M8HA 4B9TA 3M30A 2HBRB 2LP4A 2BUNA 2VA2A 4XAKA 2J9CA 2VG6A 2VBZA 2H3EB 3L95X 4CO5A 1N88A 4M1KA 2J7KA 4MK9A 3UPFA 2YWFA 2YVSA 3W63A 4C0BA 3JSMB 3HPOA 3G96A 1SJQA 1ZTTA 2AZ3A 2RILA 1L5UA 1FKPA 4DG1B 4DL4A 4I67A 2N3OA 2IM0A 3B8HA 2B3TB 4F4AA 4ZVUB 3WDOA 3DDKA 2OPQA 2FPHX 1HYSA 5EGYA 5KFFA 2D69A 2F5GA 3R7BB 2YWWA 1U48A 2XYGB 4RUBA 4M5GA 2XCPA 1YJ7A 5KFYA 3DXSX 4DV1J 2ZWPA 2ZH1A 4DDFA 2HVDA 4KRWA 4LF8F 5LMUF 3G87A 1OS5A 5DQHA 1LWEA 4DQIA 4L74A 4WK3A 2NR0A 2V50A 4USMA 3GR0A 5ETRA 1HNVA 1NK8A 1SBRA 2AYGA 2HNDB 1S6QB 1CS4B 2Q66A 3J7YU 4BBYA 2RQKA 5SZTA 1DQ8A 4F04B 1DZ5A 2YKMB 1WI6A 3DYAB 1N54B 2BR0A 1FRIA 1GT8A 2ZM6J 3OV7A 5C25B 3CDEA 1WORA 4WFBQ 3OFFA 5L9XA 3MZIA 3VF0B 5KFSA 2FVCA 2IJNA 4LFBF 1NM2A 4CO0A 4I2QB 4BWMA 3MGJA 1RAHB 3FRZA 1X5OA 2N82B 3UNGC 4DCJB 1OQ6A 4FBTA 3MOZA 2P9CA 4ZIVA 2C2KB 1T05B 2GA7A 1OMSA 4N8OA 2FJVA 3MUTP 2HLUA 5KFGA 1TK5A 3L4BC 3G6YA 4P71A 4MFBB 3KHHA 4ELUA 1SL1A 4WU2A 3MFIA 4NPOA 1UVKA 4X84A 4PR6A 4TYAA 2UU9J 1W26A 4FF2A 2DGWA 4ELTA 1S0OA 1RTIB 3PW7A 2C1EB 2NSCA 4RJVA 4ZLJA 1DQ9A 4KT0C 3D6HB 4U8YA 3SQGA 5HMXA 2E1AA 4WKYA 3KJFB 4GC6A 3HSDA 2B7CB 2B4VA 4L75A 4OQJA 2HK2A 2YQ0A 2BRKA 4QWBA 3H4BA 4CYUB 4DUTA 5J2MA 3P45B 2OPRB 5KOWA 2LKZA 4RPFA 2Z2LA 2FC9A 2P6SA 2YQ1A 5F0WA 3FC9A 1HMVB 2GO9A 2GMHA 4HI2A 2XC9A 1VC0A 2HQFA 2L9NA 3P6YC 3BDEA 3SDEA 1UVNA 3V6HA 3MR5A 3IR7B 2ZNZA 3Q23A 1XNQJ 3C16B 4QIGA 4FYYB 2XLIA 4B02A 2C3YA 1VDHA 2MLXA 5D4NA 1IKYB 3D6TB 3BF4A 2CPZA 1S1UB 3BSAA 3C6UB 4HHJA 3H5YA 3ITHB 4QWEA 3PJXA 3ZZYA 1UW9A 1VQ6S 2VPXB 3KK2A 1AA1B 2GMLA 1CULB 1KS2A 4KSEB 2DCUB 4MK7A 1HWUA 1EX8A 4QPXA 1H98A 4CQ1A 5DDQC 2H65B 1YJTA 3B4MA 5LJ3Y 5A2QY 5KG1A 1UEVA 3L9ZA 2DBBA 4OI2A 2H1YA 3MECA 1YITS 3NL0A 2Y1LB 4O44A 1TKXB 4LRAA 5AJ3F 4WTOB 4B3SF 3UI3A 2WOMA 4DR1J 5CHCB 2E44A 3GIKA 3TUPA 3RB0A 2MEWA 1VQLS 3R2DJ 4DV6J 4I2PB 2ZWOA 3FCHA 2F9JA 2JLGA 1RAFB 4WU3A 3EDQB 2HWTA 4AD6A 4JYAF 2IC3B 3BN4A 3TJ9A 4Q0BB 4RR5A 1SCJB 2W8KA 2CDRB 4BCAA 1EJ7L 2VJVA 1RZMA 2WSFC 1GK8A 2VC1A 5J2PB 2KXNB 3ET6B 3AD8C 1J27A 1NXIA 5HMYA 3KUEA 2GMJA 4DX8H 4M5MA 4RNMA 4NZ6A 3PYDA 1UCNA 5KG2A 1VHFA 3M9OB 5DDPC 5IM0A 4HDGA 2DGQA 5CCMA 5H9FK 4ZIWA 2LXFA 5RUBA 3GJTB 2I0XA 3CCWA 3RAXA 2FIUA 3SXLA 4A8XA 1IKVA 3T1YF 3A3OB 5E2QA 2MJUA 2M4MA 5A0YB 1VBZA 3CD7A 5K20B 1ZETA 3EZOA 2WSEC 2XNRA 1F3VA 4R8UB 3CWJA 2L41A 4YP3A 2BJ7A 2QV6A 1TKDA 1X4GA 1IBKF 2FUG9 5DG9A 1FXRA 2ZH9A 1S49A 4K59A 1R8HA 3NOGA 1DARA 2VJUA 1S1VA 3K5NA 4UT4A 3RR7A 1TL7B 1YGYA 1S6PB 3VGVA 1GAOA 5CYQB 1K73T 3THPA 1PO6A 1L3VA 2R7RA 2J9EA 2F65A 3I55S 3RRKA 1DTTA 2AEFA 4C7QA 2VG7B 3RBDA 4EO6A 3FSYA 3RBXA 4X62J 2CZVC 3H4DA 4MJKA 3SYZA 4DL2A 3LAKA 4DLGA 2CJAA 2RRAA 1DTQA 2DD8S 2BANA 2HHHJ 1K1QA 5AE2A 2N4DA 3H0PA 1XMQF 4DUYJ 3OFEA 3NGTA 4UW2A 1R43A 1UAWA 2GNKA 3CJKB 3VAKA 2YWGA 1D9AA 4M5LA 3HD2A 3GB0A 2XMKA 3AB4B 5HBMA 3BYRA 3V6DB 5BR8F 4USIA 1U8SA 2XGPA 3Q24A 1WTFA 3TVKA 5IV4A 4CH0S 2B4UA 3VQSA 2UVVA 5EHHA 4JV2A 4PXCA 3M6WA 3IBWA 1RB0A 3KK3A 2AYBA 4M5DB 5BJRA 5CD4A 2DH8A 2E1CA 4CH1A 2RQMA 4IFYB 4M5KA 2OO4A 1U47A 3SCKE 1X4EA 1HWKA 1F6TA 1S1WA 1RYRA 2AJ4A 4U7CA 4YUDA 4KHPJ 4A47A 4JI4J 3CC2S 3RGIA 1UJ6A 1PYTA 1FDDA 1XMOF 3UVJA 1VYAA 2CQ1A 3LANA 3M8YA 4K4VA 3RRHA 2QSWA 2DHSA 4M5JA 1C1CB 3EXYA 3NMRA 4F4WA 1T9XA 4ANEA 2ZVIA 4TN2A 2E5LJ 3IRXA 2QFIA 4MIBA 2DPIA 1RUSA 2RKIB 5I42B 1X5SA 1TVRA 2ZVSA 2DNQA 2CG4A 4ECUA 1CJTA 3WBZA 4BS2A 2V8DA 2PE8A 5JJBA 3G71S 2H5EA 1RT1B 1REGX 2GJFA 1HW8A 1HHSA 1LW2B 2VDHA 4LF4J 2B9WA 1B4SA 2AU0A 1BGXT 2NZCA 4WZQA 3KJVA 3EGZA 3G6ES 2UVUA 3MM6A 4LF2A 1JX4A 4RW4B 3MEEA 3QAEA 4OI0A 2B9XA 1LEOA 1KKHA 5DLFA 2UUAJ 5GAHU 4PAAA 4W4MA 5KT3A 2FJXA 5KFAA 4HHUA 3GFXA 3OFHA 3GTYX 1UFKA 2FGCA 1R0CB 3FKBA 5HK4A 5KFEA 5HAOA 4LRFA 2KT3A 4YB7A 5AE1A 2W7PA 1U0HB 3EM1A 2IYIA 3GZ7A 5IQQA 4UY85 4X4UA 5ETNA 8AT1B 4JBCA 4GRSA 2D7SA 3AOBA 2KHCA 1XNQF 3GJRB 2LQBA 5J1PA 2NUUG 4ICLB 3NNCA 1Q78A 3HVRA 2OEMA 2AD9A 3LAMA 5L1KA 1X8DA 2QT7A 1A6LA 3TX8A 3K2YA 1HNZF 1M1HA 3DLGB 1G7CB 2GIQA 4KHRA 2HNZA 3MPYA 2CQDA 2HQDA 4C6AA 4B3RF 4NX9A 2MGZA 4ECQA 1AT1B 4KQZA 3ZTOA 3G4SS 5HLFB 2BYCA 3TARA 2B8PA 1JLEB 3TQ1A 3T6BA 1RTHB 2E66A 2VBXA 5EWGA 1WC1A 2M2BA 3QWPA 1VLYA 2MKYA 1Q79A 4ZPWR 3I96A 3J80Y 1KLNA 1W2IA 3PO4A 3CT9A 4DSJA 2V8GA 1VCTA 4UOFA 2PFFB 1PAUB 4KFBA 1WEYA 2P8IA 2ZH4A 2HFZA 3IWNC 3LP2B 1Y5LB 5DZ6A 5J2QA 4RW6B 1RTJB 1RSCA 2KO1A 4ECZA 1N5QA 3FNNA 1Y7PA 5CH7B 3KLIB 4F2RA 3GG0A 4HL9A 5JVHQ 1LWFB 4JI3F 1RWXB 5B0AA 4X64F 2B6AA 3T1HJ 3RW6A 2W1BA 4XK8C 2XZDB 4YY3J 1JKHB 2E7XA 4Y00A 2XTJP 4DZ6A 1KQFB 1N5SA 4B17A 1ZM2A 1QE1A 3OLAA 1UKUA 3KTQA 4H4KC 4R5PA 3JAMU 3KLVA 2HQCA 4ZVFA 3NMAA 4FPIA 1W2BR 4QWCA 4K7QA 2MKHA 2DVIA 1WOOA 2Y3YA 5DG7A 4TY8B 1E6YA 1KVKA 2DNGA 1RBLA 2AF6A 5C42A 3HJVA 1MROA 3EICA 2MY8A 2V2KA 2V4JA 1CSJA 2HQIA 2XMMA 1WHWA 3HSJA 2A6MA 4NLOA 1C4CA 3TA2A 2BACA 1T9YA 4F36A 2EFGA 2EW9A 4F4YA 4WE1B 3NGRA 3VV2B 4Z7YA 3M32B 2NXJA 4JI7J 1LOUA 1EZZB 1RT6B 4DV0J 3CPWR 1ZH5A 5IC6B 1IKWA 4DPYA 1WHYA 1TKZA 1IBLJ 3I56S 2AWZA 3POTA 5BYSA 4DFPA 3V5RA 4LFAF 1XNRF 2PEHA 3OR2A 4F26A 3KMQA 4WP9A 1LWCA 3V6KA 4RW9B 2RHQB 3M8ZA 4HTIA 4H4MA 1KHVA 2GIRA 3OVBA 3R6LB 1M5VC 1HQEA 3FBBA 2E5IA 9ATCB 1VQPS 2FHMA 4Y3CA 5DO2A 2HHHF 3TAPA 3W2VB 2MYFA 4Q2LA 2MQQA 4USTA 4DV4J 3C15A 4ERDA 1WEZA 1GMUA 3BGRA 3Q83A 4ZVTB 2ATLA 1EQMA 2W2MP 1T95A 2J0QD 1TK0A 2F1FA 2J0WA 1GMWD 2RDJA 4OHXA 3W5XA 2YQ3A 3R1LA 1N48A 3R8YA 2YKNB 2E1MC 4TLQA 1YRXA 4X2BA 4OI3A 2E1RA 1R8BA 2WZ1A 3C46A 4HI1A 2XG8A 1H2UX 2UVRA 1N5TA 4I64A 1RK8A 3KYLA 2ABYA 1FK9B 3IR6B 2GC8A 1XQIA 1RE1B 4RZRA 4ZVOB 1FEHA 2NS1B 2QE5A 4LVOP 2XHWA 1WF2A 1P1LA 1OO0B 1RAOA 1RAGB 5KFVA 4H4OB 1LQ9A 1S76D 3W1YC 5AT1B 3P3DA 4DUZJ 2LA4A 3CB4A 3NWRA 2OMLA 3NCPA 1KC8T 4RBUA 4IOAQ 4NLXA 4K50A 4UTGA 1FI4A 3FFIB 3KLGA 2CDQA 2WRMA 2UXCF 3IGNA 4QW9A 3QJPA 4B3OA 1FNXH 4DI6A 2WBMA 3J80U 2E5LF 5ADZA 3HCXA 2ASJA 2WVBA 1UFLA 1M5PC 4U9RA 2J7UA 3NWGA 2I5JB 3P8BB 4YFUA 5ETQA 1VBYA 5LXRA 2J7WA 1R7IA 4DR2J 4Y2MA 1IBMF 2Z0GA 5ETPA 1RDRA 2DR9A 4OYZA 3R5DA 4LF4F 4ZP8A 1WHXA 3M8QB 3HVAA 4WCEQ 4X4SA 4NXMF 4RWWA 1C0TA 4O3OA 1TKTB 4LBHA 2WVEA 3CJSA 2YWEA 1JJ4A 3E51A 2NLWA 1FRKA 3NOCA 4JI6J 1YDLA 4EEYA 3LOUA 5KFJA 3MCMA 4JV5F 3UN2A 4ZMMA 3IO1A 5E0OA 3DC2A 2EXUA 3QQCD 4IG3A 4WPAA 2PFDA 4TYBA 1M5SA 2A3JA 1VJQA 2VONA 4ES2A 3AD9C 2LU2A 2LQJA 2AV5A 3W5YA 4NEYA 1NK4A 3OUYA 1Q4RA 1TK8A 4TQSA 4CLPA 2CPIA 3RB4A 4P73A 3ZZOA 1TUWA 3DOKA 4C8MA 3R5BA 3KDOA 3AT1B 5B0EA 4L76A 3RAQA 1SKUB 4KH0B 1N33J 1X5PA 3NRBA 4JI5J 3QT7A 4CIOA 1N6QB 3OL9A 3OTOJ 1TP7A 3MPDA 1TL1A 1S72S 3GE9A 2AGPA 2C28A 3TA0A 3PO5A 1X4CA 3IRWP 1VQ9S 1UZHA 2QMUB 3PHEA 2EFNA 5B7WA 2UVWA 1WWHA 1S7HA 4LFCF 3BDPA 2CKWA 3Q8VA 2XYHB 3CDWA 4Y65A 4FKYA 2XZTB 3HMJG 2FLLA 1UZDA 2X51A 2QLFB 1JJ2R 5ITHA 1BMQB 4AE5A 3PM9A 4KTQA 2QTWA 1GQEA 3DLKA 3MWBA 4N8NA 3BB5A 2AJ0A 3ZZUA 3HT3A 4FS1A 3W7BA 1Q5VA 5LT5A 2NZ4A 3BZQA 4ANCA 5CXTA 4F02A 1IQZA 2HLTA 4YEAA 2ZFHA 2R2RA 4DU7A 5KT7A 3HI9A 3VZIA 5ETKA 2H48B 4JI2J 1Y0HA 1FEEA 2AP6A 4OFZA 2HSEB 4J9OA 4DG1A 4FVCA 4FYDA 1U45A 2UUTA 3K57A 1TR0A 4MMOA 2ZUGA 1KWMA 5KFIA 4ER8A 1RBOB 3IAS9 2IYGA 1JWWA 1E6VB 4F3QA 3CCRS 2C22A 4NLPA 4FNIA 5GADI 2XHCA 1F9EB 2DH7A 2OTJS 4TU8A 2OPPB 4GC7A 1TUVA 1DRZA 1T94A 2VFRA 3LGHA 1SC4B 1N34F 4XDDA 3J81Y 3CNQP 5KT6A 2XMTA 2DGSA 3TO8A 2KG0A 3EDRB 2UUCJ 2HNDA 5E7OB 1S6QA 5IT9U 1CS4A 4ALZA 2H51B 2YKMA 3E3XA 4LQ9A 3DYAA 4P7TA 4DV2F 1Q16B 1Q5YA 3DLBA 5C25A 2M0GB 3N6MA 1C2PA 5CYJA 1BQMB 4J37A 4DPTA 2GJ2A 2F3JA 1SJ1A 1ZZFA 2Q6BA 4ZLNA 3HHDA 4NOHA 4OIXA 4I2QA 2PIIA 3G8SA 2WSCC 2C2DA 1V5IB 2RS2A 2ZBIA 2ROEA 3TRGA 1YHQS 1QAXA 1T05A 3VAFA 2ZZNA 3CGIA 4PEOA 1MMNA 3VAJA 3DFEA 2HIYA 3G8QA 1H73A 3VWSA 3VALA 4MFBA 5FIIA 3P5TL 2Z56B 2C2NA 2X3GA 1NSKL 2ZD1B 2HG4A 3SDEB 2C2EA 3CJRA 4HR2A 4Z2XA 4PABA 2CZ4A 5HSPA 2FQQB 1RTIA 3OL6A 4B3MJ 2L3MA 1WC6A 1TMJA 3QLHB 4YHHF 1ZPVA 2RE1A 4NLGA 2ZHOA 3V4MA 1VQ5S 4PXEA 2PDAA 3UD5A 2UUBJ 2LEBA 3L7PA 3ZZPA 2LECA 4JI1F 2DNMA 3GU0A 4NLYA 4CYUA 4QBUA 2PSZA 1S9EB 2YKAA 2PMWA 2PI5A 2CPYA 2OPRA 3I31A 3E2EA 2HAFA 2BXJA 3KDNA 1YJUA 2UXDF 1FNOA 3MECB 1HMVA 3OSNA 4K0KJ 3D6FB 1WDDA 5KFKA 4CWBA 3M6XA 3CJ2A 3ISNC 1QAJA 3C16A 1XC9A 4HT5A 4YR3A 1JB0C 4PZVA 3KUHA 1FDNA 4ZPBA 1IKYA 4NCAA 1AW0A 1S1UA 1WC3A 3C6UA 1NZAA 1R6VA 1RT5B 3A3PB 3FQKA 3ITHA 3UN5A 4ZLLA 3R5CA 1KTQA 3GSIA 3BSNA 2HHTA 2KJWA 4KC5A 4K4YA 3VAMA 1FRLA 4JOUA 1CULA 1SQFA 2R7VA 3TEHB 4DPUA 5B08A 4ED0A 3CO9A 2VC0A 1S7IA 1LV5A 2VASA 2NCKL 4IRKA 1GEHA 1XJWB 3IWLA 4MTPA 5HO4A 1HNWF 3HKZD 1RWOB 2AEMA 4MKYA 1HW9A 1TKXA 4OJGA 1RADB 2KFZA 3V81B 5F41A 3A1YG 3D1QA 5I3QA 2K06A 5IC4B 5B0BA 4F4XA 1S12A 4I2PA 4C98A 3EVWA 3UD3P 2XYPB 2CQBA 5F8MA 4BC9A 4DR6J 3NGDA 3OFGA 2IC3A 4MYTA 4DV5F 3VVTA 4Q0BA 3UDEA 4X4OA 1QJHA 2V34A 2O1PA 2LVWA 2BW7A 1U6FA 2XSJB 4OV1A 4DHVA 1UL3A 4O3PA 5J2PA 3ET6A 3LTOA 1SC6A 3LP1A 4RKUC 4DR3F 4NRTA 1N33F 4UOHA 3ZC4A 4K4ZA 2FJWA 1Z2ZA 1CJUB 2DGOA 1RHJB 2XMUA 1S97A 2R8GA 5DRKA 1FE4A 5DLGA 1SKSA 2VBYA 1O8BA 1RKJA 2MHNA 1RLCL 1K8AT 3CXCR 1Q82T 4G1PA 4WFNQ 2LLZA 1MN9A 2VFTA 1BWEA 3A8EA 4F3OA 3AJ1A 2MTLA 2VHGA 4OLOA 4Q44A 5KFHA 2ADCA 2UXBJ 4WFYA 5A0YA 1CC8A 1Q53A 1NLKL 4OI6A 3Q0AA 2Y1IA 4R8UA 5A8WB 5A76A 2JWNA 4YR2A 2KHDA 4FS2A 2R2SA 4O3RA 4X4VA 3ICLA 1M0SA 4I4BA 4W92B 3PJWA 5IS2A 1TL7A 4OLPA 2PO4A 1S6PA 4FNHA 5CAAA 1B7FA 4WP8A 3S01A 4IH5A 5CYQA 5LSLA 2M5YA 4J9LA 3AJ2A 3X3UA 3Q2TC 4DU8A 5B0DA 1D1UA 1ZAXA 3CCES 1RAJA 1AFIA 2Q3PA 4DL7A 2BMBA 2GQ2A 2IVYA 2DK2A 2EWHA 3MAQA 3PACA 2OUGA 2NYHA 5F8JA 4OMFG 4YDDB 4TU9A 2YH1A 4DSKA 3QGPA 3QATA 5LMNF 1FX4A 2YY3A 4FF3A 1TMMA 3BH6B 3SSQA 3BM7A 2DKOB 3KNAA 4PG6A 4P2FA 1U49A 2VPYB 1J5EF 3V6DA 3MEDB 3SV4A 2DHAA 3SSRA 2E9RX 2P6TA 3R27A 5J1EB 4K4WA 1A9NB 4X4TA 4TQRA 1LWXA 3RAMA 4RUCA 3JSBA 1SH0A 4CLLA 5HROB 1NJXA 4X65F 5HN0A 2IFXA 1KLMB 3QIPB 2CPDA 4M5DA 5GADU 1JJHA 1TV6B 4KJIA 2E7VA 1CVJA 1WC4A 2POKA 2DHHA 4IFYA 3T5JA 4A8WA 3NS5A 2ASDA 4X4NA 2WBRA 2FJBB 2XGQA 2ALYB 5KG4A 1FRHA 2QYCA 1FERA 3GSDA 2ZKTA 2NUHA 3K59A 5E3PA 4JI8F 2WB1D 2RSQA 1N32F 3NY0A 1S0NA 5L39A 5T14A 3Q22A 4CTAB 2XY5A 3GJSB 3CD5A 1SIWB 1C1CA 4AXIA 3EMTA 3K17A 2HFOA 3EJMA 5J2NA 3M7VA 4OX6A 2EC0A 2KZZA 1RP5A 3LA0A 2CQHA 4L73A 2R7OA 1JXEA 4ILRA 5I42A 3EPIA 3D1OA 3IS9B 4J9RA 2LXIA 2R7TA 4ZOSA 4B3MF 3IC1A 2PMZD 5D0EA 3BKTA 4UQGA 1RT1A 3BKUA 3MAAB 1LW2A 2UUBF 3DLHA 4OZNA 3W8GA 1WTBA 1Y5IB 3CJ5A 4RW4A 2P2CB 2DNRA 1IUJA 2L9DA 3T41A 1UA0A 3H40A 3QT8A 4DBQA 1CLFA 5H9FJ 3EXCX 3TZXA 1RXOB 1A0OB 3KOAA 1VRUB 2CWKA 5D8HB 3ENQA 4I68A 3EWGA 2FLNA 1GXTA 2XM3A 1U0HA 1QTNB 2GHWA 4RO0A 1WELA 3O8WA 2I8EA 5AXNA 2VV5A 3PW2A 4A8QA 1HNXJ 5IOLA 2W9BB 4NLUA 4ICLA 1OY6A 3BS9A 3EE3A 2R8KA 4LF9J 2IA6A 3OT9A 2EFVA 2CJBA 1JLBB 3LGMA 2HRUA 3I0SB 3DLGA 2F4VF 4C3KA 1F0XA 4E8UA 1BD6A 2Q43A 1PSDA 4IKAA 4YQWA 1U1MA 3DMJB 1B99A 3OL7A 4OJ1A 3KHGA 3CCTA 1RGVA 4CLUA 2R42A 5HLFA 2G0IA 1OPZA 3T19A 1JLEA 5D15A 4MAKA 1RTHA 1NSQA 3SCLE 3OTCA 1KTVA 3CCZA 2PT0A 1HHQA 2GQQA 3EGWB 4J7CA 1GMWA 1QSYA 4OYPA 3GCWP 3VAIA 4Y2AA 3HKWA 3IG1B 1N4LA 3MEGB 2HGLA 2C2MB 5CZXA 2HHQA 4XO0A 4ZCMA 3KUGA 5GAGI 4R0JA 4LF8J 5LMUJ 4NE9C 1MSWD 4WIQA 3BBFA 4C48A 1R0AB 2IRUA 4UUWA 3LP2A 1PCAA 2OP5A 4J9NA 5GMDA 4RW6A 1RTJA 4UOGA 5F8IA 5E3AA 4TVAB 5KFBA 2AT1B 1LXNA 1FFGB 4J9VA 3KLIA 5IT4A 3ZTQA 1XIQA 3J7AN 1NEEA 2M88A 4LRBA 1LWFA 3TYTA 1HPZA 3FZ2A 4FVMA 1FT8A 3MMBA 4DX6A 4O0IA 2KYXA 1JKHA 1S1TB 2LDYA 3QGHA 1PGZA 2W9CB 5DETA 4EZ9A 4LFBJ 4RW8B 3MCOA 4UF4A 4EBEA 2WCXA 2NXCA 5E3CA 1YQHA 1JLAB 3T6JA 1K0TA 4U96A 2NPFA 4JV1A 2PN6A 1RA6A 3LH2S 1MNEA 2BJEA 4UOCA 4NEZA 3KG1A 1X7VA 4DXLA 3I9V9 3TR5A 5KFCA 2M7SA 4TY8A 1NU4A 4L72B 4WFZA 2R8IA 2CPJA 2BQRA 1FTRA 1UWBB 3C66A 1FDAA 3QFHA 3R7SB 3CMAS 4BHQA 3HHLC 1X9MA 1NNDA 2VPZB 3BGRB 1U1LA 4PG7A 1Q86T 4ED6A 1VQOS 3N79A 3U27A 5DGAA 2QYGA 4WE1A 3M2VB 3KNGA 1HQ2A 3I0RB 3THVA 1NK7A 1RT6A 2MQOA 4K2XA 1VQNS 1SB6A 1N8RT 4KE5A 2QL7B 5MLCV 3PW4A 1KDNA 5ETMA 2FY8A 4GO7X 3DRXA 4RW9A 2K7JA 4QR1A 2O66A 4O23A 2DT9A 1NHVA 1SL0A 3W2VA 3VGSA 4NA1A 1FVSA 1WKLA 1N52B 1H0HB 4ED3A 4NLSA 3BBCA 2MHEA 3KLGB 1U2RA 3GWCA 1L3SA 4Q5VA 5KFRA 3FMBA 5B0GA 2N4CA 4DOZA 1Q7YT 3L09A 2E5HA 3TZWA 8RUCA 1B3TA 2BDPA 2FB0A 2YKNA 3MHYA 4WFXA 3PV8A 1JXLA 4Z7CA 5A8RB 2E9TA 3CC4S 2QLXA 4LQ3A 2BBEA 2V68A 2IAJA 1NPRA 2IMWP 1DJ0A 3ZZTA 5FLXY 5T41A 1FK9A 7AT1B 1QTMA 3TW0A 1SH2A 4U7UK 4AYBD 1KD1T 3D6MB 1F2GA 5CZVA 4DS5A 3MEKA 4RUHA 4H4OA 1FF2A 3D54A 2JLFA 4WJBA 2I2YA 3BPDA 4U7UD 2AJFE 4WXWA 4DR7F 3CCVS 3B54A 4KGZB 5HATA 3PKYA 1TUGB 3I87A 2ZZMA 1UVJA 2W7AA 3FFIA 3DCAA 2ROGA 1K47A 1GTEA 2BKPA 2HKEA 1L3TA 4AL6A 3IXQA 3NGKA 1RT7B 1LW0B 4JYAJ 1SJ3P 2HZCA 5HJXA 3BN7A 4WK1A 3CJQA 3M1VA 3R7NB 2I5JA 3TX0A 3E01B 1OSDA 4QIVA 5JVGQ 4FZVA 4D3GA 3MURP 1PYSB 2DNOA 4ZVHA 1RCOB 2PGCA 4IH7A 3MPWA 3EGNA 4ZK7M 1CBKA 2QLJB 2KT2A 4LSNB 1VISA 2YNIB 3VVUA 1FVQA 1HWIA 3HX9A 3AFGA 2JNJA 4K4TA 1TKTA 2GVZB 3BGLA 1HARA 3G8TA 1SQGA 2RDDA 4ZPTR 1G6BA 1SQEA 1O0PA 1JLQB 4ZHRA 2VH7A 1AYEA 2G1DA 3T1YJ 4CCHA 2LU1A 4QYRA 3BQ2A 1O5JA 1T11A 1TZ0A 3C2PA 5I4MA 2DO0A 1YX2A 1P9YA 4MKBA 1QAIA 2ZDOA 1U24A 3CIMA 3ZTRA 1RQ0A 5K5MA 1GH8A 1F9HA 4QCLA 1KVIA 4N56A 4QQBA 4IDKA 1NKCA 1N6QA 4QIFA 2CQ0A 2OH2A 2W4DA 1TAUA 3IWXA 3RW7A 4C4WA 3OVAA 4ZLPA 3U02A 1GNKA 2DPJA 3Q8QB 3CMES 3OJSA 3KXDA 2J0XA 1QSLA 3A8JA 3BJYA 2MZJA 5FJ4A 3LGNA 1ZM4A 4CLSA 1DLOB 2V63A 2OGUA 1S57A 2AJ1A 1NDCA 2B4OA 3W8PA 2HBYB 4GKKF 1T03B 3UCGA 1NSAA 2CJQA 1XMQJ 1Y3JA 1WG4A 4DQSA 2EFPA 1Q1KA 1IR1A 5AXLA 5BR8J 4K4XA 5K14B 5HVGA 3TAQA 2GJIA 2C42A 1R89A 3VCDA 3OD2A 1KNZA 2QGFB 4QOTA 4A4JA 4FBUA 1S4EA 1XR7A 4ID5B 2V8PA 2OFHX 2HWHA 1WJ9A 2DY9A 4QIWD 1U26A 5GAGU 3BEGB 4Y2IA 2DNKA 5KFMA 3F73A 2IRYA 1UEKA 3MR2A 2IM2A 4RNNA 2FC8A 1LFWA 1XMOJ 1HBMB 3PR5B 1VQMS 3GYGA 4J90A 1E6VA 3HFZB 1H72C 2EPIA 5FLXU 3GCXP 2PMHA 4NLDA 2WW8A 2EG1A 4A8SA 2OPPA 1RTZA 4U8VA 3A3NB 3UCUP 2RAQA 3CSKA 4P2MA 1UA1A 5BXIA 4LF7F 1FWPA 2BKOA 4Y2KA 3D2WA 2LYVA 4O4GB 1FWLA 3MD3A 5GAHI 3BGOP 1M90T 4OZ3A 4LF6F 3FVYA 2APOA 3OVSA 1M5OC 2VFSA 5G0RB 2KXHA 4F4KA 1HQUB 2ZOFA 3K58A 3CC7S 3TUIC 2FHJD 1FHTA 2LQ9A 1BQMA 2JH3A 2R7WA 1MMLA 2UZAA 4QW8A 1APSA 4KGMA 2MPUA 1S9FA 2VG5B 2C3UA 2BM0A 2G2ZA 2Z2YB 3J7Z5 1QY7A 2V5HG 4F0HA 1HR0F 4ECRA 4J91A 2O01C 5KFLA 5F0UA 4TLRA 3T1AA 4N47A 2P9EA 4O3SA 1WSRA 1UEUA 3GFHA 2FD2A 4KBIA 2IY5B 2MKKA 2ZD1A 1XBWA 3MMJA 2YTCA 2R7UA 3AOCA 1N0VC 5I3PA 1X4FA 1M5HA 1B64A 2GVDA 1RWMB 4ELVA 2V94A 1FWKA 1U7LA 4OHYA 3BGFA 2QJ3A 1EETB 2VFVA 4ZJQA 2VPWB 3D68A 1FNMA 3QLHA 2DTJA 3QYYA 3CEDA 2K3IA 3HZEA 4B08A 2DNYA 1RISA 4YB6A 3Q89A 2KJVA 1HNZJ 2QLWA 2W4PA 2YWHA 2L08A 3I5CA 3NCRA 2JEFA 1RACB 2DRAA 3KLEB 2HFVA 3DOMB 2CWXA 3NGUA 4LIRA 4B3RJ 3ISND 2VKZG 2HHUA 3VAHA 1S9EA 1H6KX 3QRQA 2ZZTA 2EKNA 3MXHP 5IWAF 4N41A 2HEKA 4CH7A 1O51A 1U0SA 5F8HA 2RHSB 2G2OA 1NRKA 1VQYA 4MKAA 1S9GB 1YTYA 1ROFA 4F3MA 1VLOA 3V6JA 3KMSA 1VQKS 3KG0A 2BW2A 2BJ8A 1Q8BA 2YKOA 3MCSA 3A12A 2CQGA 4XTTA 2CFXA 3BSCA 2VL1A 4DL3A 1NK9A 4PXDA 2CQPA 2ZH7A 4PXBA 1RT5A 2OPSB 4DMZA 2AYMA 3M9NB 2RNEA 1U1KA 4B3TF 3HHNB 1ZS6A 2O3DA 4HEA9 4JP8A 2P9GA 5DGBA 2FJEB 1UW4A 3GP9A 5D6GA 4G1IA 4JI3J 1H2TZ 1AUDA 1D3WA 4X64J 3OQ2A 1ELOA 3D9BA 3NXZA 3LP1B 2EBGA 3W5ZA 2BKNA 1FFWB 3TI0A 3JSRA 4E2FB 1JQGA 4CO2A 4FPRA 1Q7LB 3QO9B 1FFSB 1PAEX 5DS7A 2GAHC 3CULA 3QGIA 3JSYA 2JFKA 2J0SD 4RNFA 3C19A 3AB2B 3V81A 2K3KA 1C0UB 3VGUA 1WUUA 3CJTA 1B0TA 2HHWA 1MU2A 4UY8T 4IH6A 4ED5A 5C7PA 3FRYA 1RHRB 5C2CA 3W61A 1FESA 1S4FA 6AT1B 2XSJA 1JLCB 2W2NP 3MMCB 3HM9A 3LO3A 3ZZ0A 1NB2A 3CVKA 2RQCA 3PEJA 2GAGC 3H5XA 5KT5A 3ADAC 4NCBA 1CJUA 3R5JB 3ULHA 4FDFA 4F8RA 5LOQA 4JUZA 2P5VA 3P96A 2CA9A 3LW5C 1U4BA 1SUQB 1O6XA 4C9DA 2OD4A 3MF5A 1RT3B 2XNQA 4LFAJ 1ZYQA 1XNRJ 2BZ2A 3ILLA 2B9YA 2OEKA 5C2GA 1GMVA 3WZ0A 2MLYA 4K4UA 2NQPA 2RRNA 4I56A 2XI2A 3FBCA 1JIHA 4J5OA 1TAQA 1BC6A 1VQ7S 3FEYB 4LSLB 5A8WA 2HYIB 2CNKB 2I6WA 1R3NA 2GV1A 4X4PA 1SXLA 1KN6A 3PYGA 2DXDA 3Q8RB 5L38A 3ILIA 2LDIA 4ZCLA 2VOPA 2ZBPA 1FO1A 2CQ2A 1VR6A 1FXLA 4P2XA 3FSXA 4OJ3A 4JI0F 1V9OA 1HNIB 4FKXA 4WF9Q 5J1NA 2GGPB 5HANA 1T9UA 3L7OA 2BV3A 3HZGA 2D9PA 3D3CJ 2CJKA 2CNLB 1KEKA 1F9FA 1DY3A 3NBPB 1MG7A 4RU9A 4USJC 3K5OA 3QNWB 3DDNA 2XQCA 4FP9A 2EK6A 2GX8A 3HSGA 4I7FB 2Q6CA 5IV3A 2WW4A 5A2QU 3PZPA 2UXCJ 1PBAA 4Y2CA 1TL5A 1H7XA 2MQ8A 3DDIA 1TELA 4G3IA 3MEDA 5J2NB 3QRPA 2DEJA 3LWLA 5J1EA 4C8LA 5LM7E 5HROA 1IKXB 3M8PB 2X3DA 1KLMA 2DH9A 2CNNB 3QIPA 3J81j 1TV6A 3MR6A 3D66A 4EK2A 3EPGA 1IBMJ 4XDCA 2ALZA 2N7CA 4NLRA 3FBFA 5C24B 3D4JA 4OHZA 4G6VB 1MWYA 4NXMJ 3N4WA 5F8LA 4V19X 5D78A 2XULA 3PFOA 3KG4A 1F3FA 4ZN3A 3KJQB 2EC2A 4Y34A 5CQGA 1MMDA 4Q7AA 1ZAVA 4LIWA 1I94J 2JEJA 4JV5J 5KFZA 4QPTA 4U6PA 3U1MA 2HMIB 4I0WA 3DN9A 3OTDA 4CTAA 4K5RA 3EX7B 3RG6A 4ID8A 4ZVEA 4FYVB 2FLOA 1RTDB 3H5UA 4DN9A 1X31C 1FTCA 1ULRA 1SJ4P 2YXLA 3GILA 4M5HA 4QJVA 3LPEA 5GMKa 3IS9A 4MIAA 2K1RB 1PC4A 3BR8A 3M4XA 1HFEL 2ZHBA 4EYHB 2KM8C 4IO1A 1ZOTA 1OSCA 4FF4A 2QX0A 5I3UB 3MAAA 5ETSA 1N0UA 1T0TV 2QFJA 4DQPA 2WK4A 2E7WA 3UR3C 2PA3A 4BC7A 2XMAA 4DQRA 2IBKA 3LP0B 1X4BA 3CDBA 1VRUA 2OTLS 4LFCJ 3G9CA 1X60A 2CRLA 1I3OB 1CJVB 2I9SA 1Q8KA 3E8OA 3PDNA 4NRUA 1FJGF 3RBZA 1ZM3A 2I38A 1RAAB 3JB9k 1N5VA 2W9BA 2J76E 1PILA 4DPOA 3LUYA 4LR9A 1T9TA 3FK4A 3OLBA 1I5OB 1RABB 4HACB 5E33A 1WC5A 3RU0A 4JV0A 1JLBA 2DR8A 3UCZP 5JMNA 4ETXA 3I0SA 4ILLA 2F8HA 4IRCA 3HT0A 2DHXA 4ZDNA 4IFVB 2ZH8A 1C1BA 3OXFA 1WOSA 1IN0A 3FMWA 1YVFA 3OSPA 5L9NA 4B9MA 4H54A 1HPZB 3DMJA 4V1Ak 3BR9A 4M5NA 3MMBB 3OJUA 4EBDA 1QLNA 2X1AA 3GYXB 4NMXA 3TVYA 1S10A 4S0MA 4CT8A 1GX5A 2I1RA 3BV8A 2Z2MA 4ECYA 1RWUA 4P75A 2HRYA 4WYWA 3KFWX 1Y3KA 4PYDA 3BBBA 4DR5F 1VHIA 2OSRA 4F67A 3SEOA 4O3QA 3IG1A 4F4ZA 3MEGA 5F3ZA 1FA0A 2IHR1 1OPIA 4QU7A 1D9FA 4LMZA 3HHEA 2PD1A 1BQNB 3HO1A 2ZJQQ 1JLGB 1N34J 1R0AA 1SL2A 3QT6A 2CXEA 2QO3A 2CUYA 1SVDA 4ZP9A 2BVZA 2C2RA 5EX3A 5HI7A 4AL7A 3NG8A 4L3NA 4PRFA 3DLEB 3N6NA 4X66F 3SMZA 5AXKA 2Y8WA 3K89A 4DV2J 2HZVA 4PQUB 3GIIA 2XZWA 1EKRA 4IR9A 1HLWA 2IJRA 3MAHA 2B51A 1S1TA 2W9CA 3VZHA 4RW8A 4NXNF 3IR5B 1XK8A 3M2RB 1JLAA 4QU6A 2CQ4A 4RNHA 4ED2A 2ZC3A 2JSXA 4IG0B 1X5TA 1P8GA 4E98A 2CQIA 4OYWA 3NAHA 3T3FA 3DU6A 2JEIA 2R7XA 1PIEA 2RDIA 1RJJA 2FZGB 3M6UA 2E1PA 4ZJLA 3TZZA 1RHKB 1UWBA 4DL0C 4IRDA 2V67A 4G1QB 5EN1A 4K2JA 1OQ3A 3AAWB 1FKAF 1BXNA 3A8IA 2JC0A 4NL5A 4YHHJ 2ZUAA 2LMIA 2DB1A 1IVZA 1OYDA 1R27B 2PA8D 1S0VA 3M2VA 2UUWA 3I0RA 4OYAA 4PG4A 3TOQA 3B4DA 2HFNA 5ETTA 2QL5B 4JI1J 2QEXS 1Y11A 4OZ2A 3UE2A 2CQ3A 2W25A 2IAJB 5KFTA 4DJBA 4FXWA 1SJRA 1X4DA 2ATCB 1OIAA 1YI2S 3DNCA 2UXDJ 2AGQA 2CAJA 3BQ1A 1URNA 2KFNA 3GR1A 2N3LA 5D0RA 3DRPB 4C3MA 1L3KA 3KLFB 2YBVA 2E29A 2H4YB 1VRQC 4DR4F 2H4WB 4EFAC 2OELA 3MFHA 1X4HA 2XY7A 2ZH5A 1AZSB 3AHPA 2ZJRQ 2MKIA 2C3PA 2W2QP 3TVZA 1LXJA 2M9KA 1RHQB 5A8RA 1JNRB 4DX5A 1U2CA 3M1VB 1NH7A 2HPUA 2ACYA 4PG5A 3DRSB 4WBFA 1SJFA 5KFWA 3H25A 1GX6A 2DNHA 3NP5A 4A8KA 4ECWA 1LK5A 1HNWJ 3X1LB 4ZPCA 2FHOB 3L7UA 3N5FA 2OHDA 2RT3A 4NZ0A 5C5JA 2BA9A 2O67A 3WC2A 3EVOA 2A2CA 2B56A 1Z2LA 1I94F 2WVDA 4OX9F 3OR1B 2V6AA 5HL7Q 3TJAA 4LBIA 4AQYJ 3FEZA 2KKHA 4ZHRB 2AJQA 4KKOB 3H42A 3K0JA 3DGPB 1VQ4S 5K8OA 4KGXB 1RT7A 1LW0A 6FDRA 2HW3A 4B9VA 4DV5J 2B0GA 2RF2B 4MT1A 2ROPA 2DNNA 2DO4A 4GVBB 3EUNA 3C14A 3JQJA 2R3VA 3OTEA 2YNFB 3IGVA 3IFEA 4Q2MA 2XY6A 3E01A 1S79A 2W01A 2E5JA 5F8NA 2FZCB 4J9QA 2HFUA 5HQ8A 2G4BA 4EYIB 2V69A 1IM4A 4DR3J 4WZMA 4NYZA 1XTZA 3F56A 2IA0A 1D9DA 2JJ4D 3UD4P 1FRXA 4LSNA 2K8GA 5HP1B 2YNIA 4IDKB 3ILOA 3DI6A 4K4SA 4ILMA 1JLFB 1QAYA 2VD3A 3M8WA 2YPYA 2GVZA 5DM7Q 4J9PA 4ZVQB 2KI2A 1HD1A 3UN3A 2IMOA 3MMAB 4CZCA 3OL8A 4QYZJ 4MIWA 1JLQA 4XPCA 1NBEB 2L48A 3ZO7A 1WDTA 2PI4A 2MZ1A 4J9SA 3LWMA 3TAMB 3DM2B 1KSPA 2A18A 3EZ5A 2FHJA 3AQOA 3DOLB 2AJ2A 2XSFA 1BE4A 2RJZA 1F1BB 1YBTA 3CD6S 4KY3A 4XIUA 1IR0A 1U2FA 1DAXA 2G9OA 2YWKA 3MM8B 4DPXA 4TU7A 2E5GA 3S1TA 5DZ7A 1Q8IA 1FRMA 1YIJS 1JXVA 3C6TB 3FEXB 2DGUA 2MSSA 2DISA 4U95A 4A46A 4KHMA 1F60B 2CZ9A 3ELHA 3RB3A 1YZ6A 6FD1A 4OX7A 3JTPA 1HI0P 5THWA 2XWYA 2Z8QA 1ITPA 1WI8A 1I6JA 1TQLA 2NXUA 3HXMA 3SZ2A 2OKQA 1BHNA 1U1PA 2BQ3A 3JYTB 4EMDA 2DXEA 1FKOB 3HSZA 3O3LA 1WKJA 2MB0B 2CNOB 2XI3A 2F63A 4Q45A 4ECSA 1HBUB 1RA7A 3PW0A 1VBKA 2J6UA 1PC5A 1DLOA 2BOAA 3W9IA 3PR4A 2HIQA 3F44A 2HHSA 4OYIA 1U25A 1T03A 4V19J 5LMNJ 1I51B 3QBCA 2VDIA 3HVTB 3CJ8A 3HF5A 2VQEF 3TUZC 5HVFA 1J5EJ 1HBNB 2D3ZA 3HDSA 3PFEA 5K14A 2OMOA 2XO6A 1NUEA 4ED8A 2R9LA 2RH3A 2GS8A 2HBZB 2O5DA 2HS0A 1VMBA 2ACMA 4X65J 3AQPA 1SV5B 4CLWA 1UJ4A 4ID5A 2X1GA 4DCOB 1N36J 4YB1P 3NS6A 2MKCA 3I32A 3NS7B 3ZZRA 1NHKL 2KG1A 1UVIA 1XN9A 4B9NA 2U2FA 4ANDA 3PRBA 3KLHB 3MUVP 2LEAA 2CADA 2V0NA 4D3HA 3AD7C 4P72A 3B6BA 1RT2B 3A8KA 3MTJA 2M52A 3D28A 3O44A 1XMBA 4CI0B 2DHGA 1HBMA 3MR7A 1D09B 4JI8J 2MQNA 1NJIT 4NYPA 1N32J 4A8OA 4MYUA 1YBUA 2JRSA 2PEBA 2DNLA 3V2UC 1QSSA 2AGOA 2BJ1A 2AIRB 3I82A 1Y00A 3PXGa 2JX2A 3G82B 2E9ZA 5L46A 4JB8B 1XWLA 2WONB 3DHWC 1QVFR 5LL6d 2WTFA 2GVDB 2V8HA 4O4GA 2EK1A 5B09A 3BO2A 2M8DB 3OXGA 2RMLA 1R8CA 5G0RA 3OBIA 2DR5A 1HQUA 3SIPB 5CYMB 1MN7A 1ZBTA 4IQMA 1UPMB 2IJFA 1UMJA 2OIHA 1QM9A 4I6WA 3M8RA 3FZBA 1VC6A 2WHOA 2VG5A 4OYBA 3W3SA 2J9DE 3W60A 4EI2A 3QPIA 1N5YB 1W7WA 1S0MA 2NXEA 1VFJA 2ZE2B 4DV1F 1IJFB 4YB5A 3Q8SB 2YPZA 1S99A 1JMTA 3AH6A 4QZVB 5HQLA 1WEXA 5F9LA 3I4PA 4EWTA 5DM6Q 3OW2R 1NDLA 1EETA 2R8HA 4CLZA 2XMWA 4IYQA 2ERRA 3Q2SC 1DFDA 3JAMY 5DDRC 2BEFA 4OV6A 1B0VA 3DLLQ 2ZM6F 5HVHA 2LEPA 2F4VJ 1LFPA 1VIOA 3KLEA 3DOMA 2FYXA 2ZC4A 4TXSA 1MW7A 5KFDA 3UWTA 3ZFVA 1T3NA 4UZCA 2CYYA 3G86A 1HHTP 3PG9A 2HK3A 1DQAA 1KP6A 3CCMS 1X9SA 2KTQA 1YRUA 1S9GA 2R2UA 4WIIA 4ZCKA 4OYOA 2UU9F 3H5SA 1TL3B 1RI7A 4AQYF 4ECVA 3KK1B 3SSSA 2ZBRA 2OAUA 3HLUA 5LSOA 2ZH3A 1MU2B 1V6HA 3TANA 1IXKA 2OPSA 3TA1A 1F5AA 4CO1A 3QZ7A 1RWNB 3SV3A 2BRLA 3R3TA 1ZAWA 2XLJA 2ZOMA 2FJDB 1EIYB 3BGUA 3I6PA 1KHWA 2JFDA 4ZN1A 1D0EA 2A6OA 4Q43A 4TNOA 3DRRA 3PRDA 1VRTB 2QMXA 3VQTA 2FVPA 3CE8A 2IVMA 4Y0FA 3J81U 2YKPA 3R2CJ 1KOHA 2EEYA 1S77D 2F4FA 3T5LA 3F0NA 2IRXA 3TUJC 5FDLB 3QO9A 1Y9OA 1CPZA 2K2PA 1VGYA 2OD6A 1NCLA 2NPIA 2VF3A 5FD1A 2DITA 2F7VA 4CLFA 1G3OA 1RAIB 4OZ5A 4DSFA 3MOJB 4P10A 1C0UA 1J5OB 2AQ4A 3HHKA 2FLPA 1M5KC 1AROP 2QN6B 4K8RA 3DRYA 5F3TA 3CJ0A 3UO0A 3FJ2A 4I1TA 1R0BG 2CJYB 2BABA 3CTRA 2ZBQA 2HNYB 3PKMA 1FDBA 3P5BP 2QA1A 2C3MA 1JLCA 2BOPA 4CM2A 3MMCA 4DV7J 2KU7A 1KQGB 5EWEA 2KM8B 3MM7B 4LT6A 2ZEJA 2JLEA 1CJKB 1P9QC 4YDXA 2YNHB 1SUQA 1U6ZA 4OJHA 1AFJA 3N0VA 1RT3A 2B43A 4DR1F 3K5MA 3LF0A 3AODA 4N7TA 2MDAA 3RB6A 1NDPA 1RYSA 5KG0A 1NAQA 4DV6F 1Q81T 1YLXA 2BE7D 3TWZA 4C11B 2G0JA 1ZZNA 3H2VE 1BWVA 2BE2B 3BO4A 3FCVA 2BJ9A 2HGMA 1C4AA 3TEGA 3CD0A 2MMYA 1NKBA 1S1XB 3W2WB 4PUOA 1Q8LA 4A8FA 2HHVA 4LSLA 2AX0A 3MM9B 1P27B 1NKEA 1X9WA 4NYOA 4NLWA 2EBEA 3LPYA 3M05A 4LUBA 3MPUB 1H38A 3U1NA 4GVLA 2DRDA 3VGTA 3FBEA 2DGXA 3QJJA 5B0FA 1R8AA 4DL5A 1HNIA 1HWLA 4KPCA 1N36F 4ZKAA 1MWZA 2GGPA 3M2UB 3OHAA 3CJ3A 5DJBA 4USVA 3CO0P 3GLJA 5D3GB 2Y1JA 2DR6A 2HQ3A 4KV8B 2D1CA 3NEKA 4OI1A 3NBPA 1NH8A 3ZTPA 2H9ZA 4C0OC 1U8WA 5E5NA 4FYXB 3D3BJ 4DR7J 4ENOA 5ETVA 2MZQA 2VU5A 4I7FA 4B9UA 1Y10A 4LJMA 3R5GA 1PJ7A 2QA4S 1EP4B 1UPPA 3LALA 3L3CA 3AXMA 3A13A 4LF5J 1GXLA 4L6V3 1IKXA 2XS5A 4I69A 3M8PA 4F50A 1QUVA 4P74A 2VB6A 2KH9A 1XR6A 1YJ9S 3WIVA 2DGTA 3UDVA 1RWVB 4Y6IA 7FDRA 4X62F 3UNYA 4CLTA 5L1LA 2QA2A 5C24A 4LVNP 1T3OA 1SH3A 2GIFA 1ZPWX 3MM5B 3WQPA 2CVIA 2W24A 2UV8G 4NMLA 2R8JA 3HP6A 2Z4PA 2F40A 2RQ4A 4ZITA 3PX4A 4KYZA 4DUYF 2HMIA 2C2OB 2KXFA 3AY0A 4UQTA 4DQQA 1V3RA 2VBWA 4DSLA 3EZUA 4NCGB 2COLA 3KHRA 2AHOB 2QMWA 1RTDA 2YNGB 1S6UA 1REVB 1VQSA 4ECTA 4NZ7A 3V4IB 1LK7A 1S48A 4LSZB 2VFUA 3IBFB 4IOCQ 3PIOQ 1OY8A 3S7RA 1QUPA 2FDNA 5EUHA 1TU0B 4IOBA 2RU9A 4USUA 2K1RA 3AOAA 4RUAA 5KG7A 2VOOA 4WXOA 3PYEA 4DEZA 1AB8A 4WFAQ 3HHLA 5I3UA 4P52A 1EAYC 5A6WA 4OZ0A 2AMCB 2B5JB 3EGVA 1NSPA 4X4RA 4ZVRB 3D67A 4KHPF 4WTYA 1BUXA 3ZZZA 4FYWB 1RWKB 4JI4F 3PJ9A 1C1BB 4EU0A 2Z2ZA 1KBRA 3LP0A 2ZJPQ 3QIDA 2XS2A 4BWJA 1A7GE 5IT9Y 4DSEA 4CLYA 3RYLA 3R9LA 2Z58B 4QR2A 5E3QA 3O5TB 2QZ8A 5K8MA 3GQCA 2H5JB 2DRBA 3PRVA 3ENVA 4PWDB 4RW7A 5BYQA 3TQEA 4ED1A 3CF5Q 1ZTWA 1CJVA 4RWXA 5KT2A 4N77A 4GKKJ 1RT4A 2WVCA 4OZLA 2B8QA 4HH1A 1NK6A 2D3O1 2X7IA 2OEJA 1B7YB 2GW8A 3I5AA 3FGVA 2CIMA 4OL8A 2F8EX 2ZNYA 4HACA 2HWIA 2HHPA 2JVRA 2RD5C 2YH0A 1X4AA 1BY9A 5JUMA 1MWQA 4F0KA 4LF1A 4IFVA 2FTRA 2MLZA 2R2TA 1Z4UA 1KVJA 3WC0A 1UVLA 5T7LB 4R0EA 3NNAA 3CIZA 2UUAF 2OFGX 4ITSA 4KGKA 3HULA 4Q8FA 2MY7A 2AEJA 2ZKUA 4IO9Q 3CCJS 4BLGA 1HBOA 3N01A 5MAOA 2XBPA 2F8MA 3DU5A 2QL9B 2CJ9A 3D0IE 5A8KB 4KB7A 4QYZK 3H90A 3R1HA 3DHXA 2DIUA 3U7JA 3W62A 4KO0B 1YJWS 3MR3A 2MKSA 1ZA2B 3R5AA 1KQKA 1BQNA 2WAQD 1RWWB 3G6XA 3MCNA 1KFSA 1JLGA 3VAGA 4DFJA 5CA5A 4LREA 3SCJE 3WHIA 4NI2B 1IQTA 4J9KA 4LF7J 4ZVPB 1UJ5A 3M30B 2MZRA 5KFUA 4LF6J 2VG6B 3DLEA 4X4QA 4ATNA 4C3LA 5F8GA 4F2SA 3QZ8A 4PQUA 4F25A 2EI5A 3CUNA 4DV7F 4O3NA 3CJ4A 1FKPB 4GKJJ 1FX2A 1YKWA 1ICEB 3M2RA 1KR4A 1OY9A 2OPQB 2A2DA 4ECXA 4IG0A 1HYSB 5G4DA 4LR7A 2PC6A 1HR0J 3QSIA 3SFGA 4ZVGA 1U6BA 4DN0A 1TFWA 3AA9A 3CCQS 1IBCB 4Y28C 1G2EA 4GO5X 1LWEB 1CQNA 5LXYA 2OI2A 2XCAA 3JTOA 5DG8A 1HNVB 4G1QA 1RWPB 3CMQA 2W7OA 3H59A 1FJCA 1WF0A 3GV8B 2HBQB 1R8PA 3JSMA 1YJVA 3T1HF 1KQSR 2LFVA 4YY3F 4DX7A 3QT5A 2HVHA 3N28A 2HQGA 4DFMA 2HURA 4PPZA 3HJFA 2FVQA 5KT4A 2J9DA 2UP1A 1VC5A 1F5CA 5IWAJ 3RJMB 2B7BB 3PY8A 1PG5B 3MD1A 4DLEA 3ZXWA 3HD1A 2KVQE 4ZJOA 1FE0A 4RU2A 3HFVA 2K7KA 2YKQA 3DRPA 2CQCA 3KLFA 5IT0A 3Q8YA 3EYZA 1T7PA 4C8ZA 2VQFJ 1NZ8A 1M1GA 4KGVB 4HLBA 1SPBP 4TY9A 3FDSA 3KWMA 5E3RA 1AZSA 3SQGB 4OYMA 1VK8A 4LF5F 2JC1A 4B3TJ 4JI7F 4DV0F 4DPWA 3C14B 2XLKA 1GXUA 1URRA 1UWAA 1Z1ZA 4ED4A 5B0CA 3W9JA 4MH8A 3NNHA 2X1FA 3DRSA 3GIRA 3G6VA 2LQ8A 1Y5NB 1IBLF 5J2MB 3H2UB 2IM3A 4ZVSB 4A8YA 2OJ3A 4I6AA 1H3DA 1OYEA 2DNZA 3N6LA 3GYNA 3S6EA 3AA8A 1UTAA 1H74A 2RVJA 1YBAA 3DI6B 4U67Q 1IJEB 4C8KA 1RKIA 3J7ZT 1Y4ZB 3BQ0A 1QDUB 2CPXA 4P7VA 1RLDA 5D4LA 1K1SA 3OR1A 1HA1A 5H9EJ 1DBDA 1RAEB 5HMZA 4BDPA 5EDWA 2V9WA 4DV4F 3W9HA 1SC1B 2GHVC 3SQOP 4KKOA 3WIUA 3DGPA 5KAKA 4CNZA 5LSRA 1HL6A 3IP0A 2R7QA 4UUXA 1X0PA 2RF2A 3D0HE 4GVBA 2AX1A 4N76A 4WP3A 3KK2B 2YNFA 4PWUA 2V2VA 4FN5A 1P1TA 4AXJA 3R6GB 2W9AA 1FCAA 1AUSL 4DFKA 2ILYA 2FHKA 1WOPA 1LKZA 1R6YA 1TTHB 2N7YA 2L9WA 2HGNA 1HI8A 5HP1A 5DQGA 4OHWA 1JLFA 3MTKA 5HQMA 2IDEA 2VA3A 2V2ZA 2QLBB 2XS7A 1WSVA 4O44B 1FJ7A 2CJXB 4DUZF 4M94A 4HDHA 2D3OR 4CO4A 3GMGA 2WB4A 2WOMB 3MMAA 2R7SA 1GTHA 2DEIA 2LXUA 4MK8A 2D9OA 4DL6A 3TAMA 3DM2A 2XB2D 1K44A 1T8EA 5EX0A 3DOLA 5KTQA 2MZSA 3C8YA 4HHHA 2JOQA 3GFYA 2WVFA 3FQLA 1T9WA 3KKFA 1OJ4A 1NO8A 3MM8A 2ZH2A 2QIFA 4ZP6A 2ZITA 2AKWB 4DR2F 1M1KT 1UFWA 2IM1A 4EUVA 1WD6A 1VBXA 3C6TA 1EB0A 3CCLS 2FVRA 4JI0J 5KG5A 3R97A 2KVIA 5D4PA 3TP2A 1U1QA 3BO3A 3O1LA 1CQMA 2G0CA 2GCFA 3JYTA 5IM0B 4JI6F 2J6TA 3JTNA 1FKOA 2XWXA 2CVEA 1HBUA 4W98A 2F9DA 3MPVA 1DURA 1RU1A 5M2UA 1IKVB 3PX0A 2NXNA 4KR0B 3BH7B 1FD8A 4J9MA 2EKYA 4RNOA 2H5IB 2ADBA 4RL1A 3HVTA 1NK5A 1PBUA 1FRJA 3CCUS 4GMKA 3PHTA 2CPEA 3T5HA 3FUYA 2GZOA 4PPDA 4ZPDA 3GFZA 3PTWA 1HBNA 3GV7B 1RBAA 2MQMA 4YN3B 4USWA 1S1VB 3IM8A 1EARA 3H8YA 3ZNUA 4OZJA 1SI9A 4PYAA 4KAIA 4JI5F 4OZ1A 1SV5A 2ZOGA 3OTOF 4EBCA 3PVXA 4ETZA 1BLUA 1KFDA 1YSJA 1RHUB 1U1OA 1DTTB 2QG9B 5CABA 2KYZA 2ZBCA 1XR5A 2H54B 4PWWA 2MKJA 3UQSA 3KLHA 3OTBA 4TKTA 2ZDPA 2YX4A 2Y1RI 4GKJF 4FXDA 4ZPAA 3PX6A 4CO3A 1WG5A 1RT2A 4OI4A 4DCPB 3I4HX 3TZYA 1DTQB 3PNIA 5D0HA 2BANB 2J8SA 3H2LA 4ES3A 3UDCA 4ZCIA 4EZ6A 1F5BA 1H7WA 3IMQJ 4CM0A 3PYFA 3QWUA 4PG8A 3GV5B 4DF4A 4PCQA 2ASLA 3VR1A 5HBMB 3G82A 2DIVA 4WYLA 3BSOA 2NREA 2C2ZB 2WONA 4Q8EA 4QIEA 3NKYA 5A6PA 4HKQA 2QA4G 3CDAA 3I9ZA 2RUSA 2IIHA 2ASYA 3KK3B 3GG1A 4RLEA 3CCSS 5SUHA 3QMQA 3D0GE 4HTJA 2YX7A 4ZP7A 4RBTA 4CDIA 2FGOA 2VG7A 4JI2F 2DXFA 4USHA 2MQPA 5CYMA 5GVQA 2VKRA 3RZAA 1KONA 3PCOB 1S1WB 9RUBA 1S5ZA 1TL4A 2GQCA 3GIMA 2EFOA 2JL9A 1VIXA 3NGSA 1Q95G 2BJDA 3UVJB 3RBEA 1XEZA 3H98A 4OHVA 1N5YA 2MSTA 1WACA 2BQUA 3QSYB 1W25A 1MLAA 4DZDA 3CJKA 4DS4A 4G65A 2M70A 1B70B 2ZE2A 3HK2A 4DV3J 2W2PP 2MZTA 3LQVA 2V9KA 3K8WA 4C8OA 2D74B 3FCWA 3MI7X 3Q8PB 1PJ6A 1FJGJ 2HZAA 3IRXB 3B82A 5HMWA 3OXLA 2UUCF 1TVRB 8ATCB 1HWJA 3D7SB 1T02A 4DF8A 3M8SA 2DYAA 1FJEB 3SBMA 2VQFF 1CJTB 3IBCB 1PYOB 1QVGR 3DGVA 1PJ5A 4KPYA 2R4FA 1NJZA 1PKUA 1KRPA 1SKRA 2OSQA 5IQ6A 4NASA 3K8VA 5IZHA 3T5KA 3ISZA 5HJYA 4FXVA 5KFNA 2XO7A 2MJNA 3KJVB 4WKRA 5GMEA 2HVZA 3GJQB 3MM6B 3W65A 3UW1A 3MEEB 1YJNS 2CG8A 5DDOC 2IBOA 3DRRB 5KFOA 1NJYA 4P6QA 3Q8UA 1RU2A 4HYKA 3VTIA 1YZ7A 3A4TA 3JXOA 1XERA 5L8RC 3JS9A 1YRTA 2GO8A 2EVZA 3TNVA 4EGLA 1NJWA 4YR0A 1R31A 1CC7A 3G2XA 4B9LA 1HKAA 2RKIA 4DR5J 3GIJA 2UV8A 1CEZA 1TL3A 2B4PA 2KB2A 5BYRA 3RR8A 3PIPQ 5D4OA 1AXQA 4NLTA 3KK1A 4NA3A 1SC3B 3N9UC 3UFCX 4HH0A 3KHLA 2Y8YA 4NWBA 2KDOA
chains in the Genus database with same CATH topology
2JX2A 1G6BA 1SQEA 1O0PA 3I56S 5L1JA 2AWZA 3OPKA 2E9ZA 3POTA 1JLQB 1XWLA 5BYSA 4DFPA 3NLCA 4ZHRA 2WONB 2KZMA 1WHVA 2VH7A 3V5RA 3DHWC 1QVFR 2HNZB 4LFAF 2G1DA 5LL6d 1XNRF 2PEHA 3OR2A 4F26A 2WTFA 5IFMA 3CDUA 3KMQA 2Q79A 2V8HA 4O4GA 4CCHA 2LU1A 4QYRA 3H20A 2EK1A 5B09A 1LWCA 1VRTA 5GAEI 2MGZB 3BQ2A 3BO2A 1VJWA 3V6KA 1O5JA 1TZ0A 4RW9B 3C2PA 2M8DB 2LQ5A 3OXGA 2DO0A 4H4MA 4HTIA 1KHVA 1R8CA 2RMLA 4A48A 5I4MA 2GIRA 4B9SA 4K5SA 4MKBA 1QAIA 1M5VC 3OVBA 5G0RA 1HQEA 2ZDOA 3OBIA 3ONQA 2E5IA 2DR5A 1HQUA 1U24A 1VQPS 1P6TA 2FHMA 4Y3CA 5DO2A 2DCLA 3CIMA 2EG2A 2HHHF 2D3UA 3TAPA 5FDLA 3W2VB 4K0KF 5CYMB 4ZA1A 2MYFA 1RQ0A 5K5MA 1ZBTA 1GH8A 4Q2LA 4IQMA 2JVOA 2MQQA 4ED7A 2IJFA 1UMJA 4ERDA 1WEZA 2OIHA 4QCLA 1QM9A 3BGRA 2JDJA 1KVIA 4I6WA 4N56A 4N5SA 2XEXA 3M8RA 3FZBA 2ATLA 1VC6A 2WHOA 2VG5A 1T95A 3T9NA 3W3SA 2J9DE 2J0QD 1TK0A 4AFFA 2F1FA 2J0WA 4QQBA 4IDKA 1NKCA 1N6QA 4KFBB 2RDJA 2OLWA 3QPIA 4QIFA 2FJAB 1U09A 4OHXA 1N5YB 1J5OA 2CQ0A 2YQ3A 4HVZA 2W4DA 2OH2A 3R1LA 1TAUA 3IWXA 1N48A 1S0MA 2YKNB 3RW7A 4C4WA 2XMVA 2E1MC 4TLQA 3S8SA 2DR7A 1YRXA 1NK0A 2U1AA 4X2BA 5KG6A 1VFJA 2ZE2B 4OI3A 2E1RA 4DV1F 3OVAA 1IJFB 1R8BA 5K9FA 4ZLPA 3U02A 3C46A 2FY1A 1GNKA 4HI1A 3HFKA 5J2QB 2DPJA 4P2SA 4YB5A 3Q8SB 3Q8QB 4PUOB 4XPEA 3CMES 2XG8A 1H2UX 2UVRA 3OJSA 1BQXA 2J0XA 1N5TA 1QSLA 4I64A 1RK8A 1U1NA 3BJYA 2HNYA 1S99A 3KYLA 2ABYA 4C2MA 1FK9B 1V3ZA 1JMTA 2MZJA 3IR6B 2GC8A 3AH6A 5FJ4A 3LGNA 1ZM4A 3MDFA 1B0PA 1JK9B 4QZVB 4RZRA 1WEXA 5F9LA 1DLOB 1FEHA 2KFYA 3I4PA 2AJ1A 4EWTA 2M3DA 5KOXA 5DM6Q 2NS1B 2B4OA 2QE5A 4LVOP 2RRBA 3OW2R 2XHWA 2HHXA 1WF2A 1P1LA 1OO0B 4GKKF 1EETA 2R8HA 1G1XA 4C97A 1T03B 5KFVA 3UCGA 2B6AB 4H4OB 3SCIE 2CJQA 2HAIA 2XMWA 4IYQA 2ERRA 1LQ9A 3Q2SC 1S76D 1DFDA 3O2IA 1Y3JA 1WG4A 3T9ZA 3P3DA 3JAMY 3BREA 3MM7A 4DQSA 3U1LA 5DDRC 2EFPA 2LA4A 1Q1KA 3CB4A 2XMJA 2OMLA 3PW5A 1B0VA 2JZ5A 3DLLQ 2ZM6F 3NCPA 1KC8T 4RBUA 4IOAQ 4NLXA 5AXLA 2LEPA 1QE1B 4QWDA 4K50A 2YNHA 3KLGA 3FFIB 3J7YI 2CDQA 2WRMA 4K4XA 5K14B 4R5PB 1LFPA 2J8AA 3TAQA 1VIOA 2GJIA 2UXCF 3KLEA 3IGNA 3DOMA 2C42A 1R89A 2ZC4A 5EWFA 3VCDA 4QW9A 4TXSA 1KNZA 1VQ8S 3QJPA 4B3OA 1FNXH 1MW7A 1H2VZ 3WX4A 5KFDA 3UWTA 4QOTA 4A4JA 4PQAA 5AXMA 4C11A 4FBUA 1XR7A 4ID5B 3ZFVA 1WG1A 2WBMA 1T3NA 2E5LF 2J5AA 2BE2A 1E6YB 5ADZA 1NHUA 2OFHX 2ASJA 2CYYA 3G86A 1HHTP 2HWHA 4C8NA 1UFLA 2KN4A 5CD4H 1M5PC 4DR6F 4U9RA 2J7UA 2JEGA 2CPHA 3NWGA 1DQAA 3HVWA 2I5JB 2QRRA 5C42B 2HVIA 5KFQA 4QIWD 1MROB 1S1XA 1U26A 2VUGA 3W2WA 4YFUA 3CCMS 1X9SA 5GAGU 2KTQA 1YRUA 1S9GA 3BEGB 2V4JB 1VBYA 5LXRA 1TFYA 2J7WA 5AE3A 4OX8A 4Y2IA 2R2UA 3P49B 1R7IA 2DNKA 2Y0SD 5KFMA 3F73A 4Y2MA 3MM9A 4WIIA 2IRYA 2MQLA 3O6QA 4ZCKA 1IBMF 3MR2A 2Z0GA 2IM2A 3QGGA 4RNNA 2KT5A 2FC8A 1RDRA 2UU9F 1I1GA 5KG3A 1LFWA 3H5SA 2DR9A 1HBMB 1TL3B 3R5DA 3PR5B 1VQMS 4LF4F 4ZP8A 1WHXA 3M8QB 1K0VA 3HVAA 4WCEQ 1E6VA 1RI7A 4X4SA 4AQYF 2DJWA 2EPIA 4NXMF 1KOOA 2PMHA 4ECVA 4RWWA 4AL5A 1C0TA 4M63A 4O3OA 3KK1B 1TKTB 3QAUA 1JJ4A 2YWEA 3N5BA 4NLDA 3SSSA 4M8LA 2HS4A 2OAUA 2NLWA 2WW8A 1FRKA 2EG1A 3E51A 3HLUA 5LSOA 4A8SA 2OPPA 2ZH3A 2BM1A 4EEYA 1MU2B 1V6HA 3IAM9 1IKWB 3LOUA 3QJLA 3TANA 1IXKA 2OPSA 3TA1A 1F5AA 1S6OA 5KFJA 4CO1A 3QZ7A 4JV5F 3SV3A 1J2VA 1TKZB 4ZMMA 2BRLA 3IO1A 5E0OA 3R3TA 3DC2A 3UCUP 3CSKA 3M2UA 3POTB 1ZAWA 2XLJA 2V4QA 2ZOMA 2FJDB 4IG3A 1UA1A 3BGUA 3I6PA 5D3GA 3FSIA 2V4RA 1KHWA 2JFDA 4TYBA 4LF7F 1UP1A 4KV8A 1D0EA 2HS3A 4RX6A 4TNOA 3OR2B 4Y2KA 4Q43A 2LYVA 1M5SA 2A3JA 3D2WA 5L1IA 4O4GB 5K8NA 3MD3A 3MUMP 3DRRA 3PRDA 2VONA 1LWCB 5GAHI 1VRTB 2QMXA 4ES2A 3VQTA 2FVPA 1M90T 3CE8A 4CT9A 2IVMA 4LF6F 5M2RA 2LU2A 4Y0FA 4DSIA 2LQJA 3FVYA 2AV5A 4H4MB 2YKPA 2APOA 3OVSA 2W8LA 1M5OC 1KOHA 1NK4A 1YG0A 2VFSA 5G0RB 1HQEB 2D41A 1S77D 3OUYA 2VZ9A 2KXHA 4F4KA 1Q4RA 1HQUB 4TQSA 3T5LA 1TK8A 2ZOFA 4EO8A 5KFXA 2UXBF 3K58A 2IRXA 3CC7S 3TUJC 2CPIA 3RB4A 5FDLB 3QO9A 3ZZOA 3TUIC 2FHJD 1FHTA 3DOKA 2LQ9A 4C8MA 1Y9OA 1BQMA 1CPZA 3R5BA 2JH3A 2K2PA 4QWAA 5U47A 1VGYA 2W4CA 2R7WA 1MMLA 2OD6A 5B0EA 2UZAA 3RAQA 2NPIA 4QW8A 5FD1A 2QSFA 5LJ5Y 1APSA 2DITA 4KGMA 4CNYA 2F7VA 2MPUA 1X5PA 1S9FA 1G3OA 3NRBA 2LA6A 4H4KA 2VG5B 2C3UA 5IXUA 4OZ5A 4URQU 4DSFA 2BM0A 1EP4A 3PEHA 3MOJB 4CIOA 1C0UA 1N6QB 3OL9A 3J7Z5 1QY7A 1TP7A 1J5OB 2AQ4A 2V5HG 2NSBA 3HHKA 1HR0F 3M32A 4ECRA 1TL1A 1S72S 2O01C 3GE9A 5KFLA 2FLPA 2AGPA 1HI1A 5F0UA 4TLRA 3T1AA 4N47A 1M5KC 2P9EA 1AROP 2C28A 3TA0A 3DRYA 5F3TA 3CJ0A 3PO5A 1X4CA 4O3SA 3IRWP 1VQ9S 3M6VA 3FJ2A 1UEUA 3GFHA 1N56A 4I1TA 2FD2A 3PHEA 2EFNA 5B7WA 4URGA 2UVWA 1WWHA 4KBIA 1S7HA 2MKKA 2BABA 2ZD1A 3CTRA 1XBWA 3MMJA 3RZAA 2HNYB 2YTCA 2R7UA 3PKMA 3HHLB 1N0VC 4LFCF 1FDBA 5I3PA 3BDPA 2CKWA 1X4FA 2QA1A 1M5HA 2DGVA 3CDWA 1B64A 2C3MA 1JLCA 4Y65A 2V94A 4ELVA 5KFPA 2BOPA 1U7LA 4OHYA 2J6SA 3MMCA 3HMJG 3BGFA 2FLLA 1VS3A 1EETB 4NA2A 2VFVA 2VPWB 2X51A 3MM5A 4NLQA 1JJ2R 5ITHA 2KU7A 1FNMA 3QLHA 1KQGB 1YWXA 2DTJA 5EWEA 1VK3A 3QYYA 4O4RA 3PM9A 4AE5A 2SXLA 3MM7B 2KM8B 4KTQA 3CEDA 1GQEA 1D8YA 4LT6A 2K3IA 2A1BA 3HZEA 2KRRA 2X1BA 3K5PA 4B08A 2DNYA 1RISA 2G13A 4YB6A 3DLKA 3MWBA 1DHMA 2KJVA 3BB5A 2JLEA 4N8NA 2QLWA 2W4PA 2YWHA 2AJ0A 2L08A 1P9QC 1VOMA 4YDXA 2YNHB 3I5CA 1SUQA 1U6ZA 4Z37A 4OJHA 3DLJA 3ZZUA 3HT3A 2ILZA 3NCRA 4FS1A 2JEFA 3W7BA 1AFJA 3N0VA 2DRAA 1RT3A 2B43A 5LT5A 2A10A 3KLEB 4DV3F 5DQIA 2NZ4A 3BZQA 4NCGA 5CXTA 4DR1F 4RW7B 1D8ZA 4I6YA 4F02A 3K5MA 3LF0A 1IQZA 2HLTA 2YNGA 2MDAA 4LIRA 1REVA 4R25A 4YEAA 3ISND 1FD2A 2VKZG 3RB6A 4B3OB 2HHUA 3VAHA 1S9EA 2ZFHA 5KG0A 1RYSA 1NAQA 2R2RA 1H6KX 4DV6F 1Q81T 3V4IA 4C11B 2GHPA 1ZZNA 1RT4B 5H1SV 4M95A 3H2VE 1FXDA 1JNZB 1L3UA 2RIJA 3SFUA 4PKDB 2BE2B 3BO4A 2VODA 5KT7A 3MXHP 3HI9A 3VZIA 2HGMA 5IWAF 4N41A 1C4AA 1O51A 2LCWA 4CH7A 3CD0A 5F8HA 5D77A 4ES1A 2MMYA 1NRKA 1VQYA 1NKBA 2RB7A 1S1XB 3W2WB 1Y0HA 1FEEA 4PUOA 4MKAA 1WNEA 1Q8LA 2AP6A 4A8FA 2HHVA 4OFZA 4LSLA 1S9GB 4IQXA 4J9OA 1YTYA 2AX0A 4DG1A 3I5BA 4FVCA 4FYDA 1ROFA 4F3MA 1U45A 2UUTA 3K57A 3MM9B 1TR0A 4MMOA 1P27B 2ZUGA 3V6JA 3KMSA 1VQKS 1X0FA 1HD0A 3KG0A 2BW2A 1NKEA 2CPFA 1Q8BA 5KFIA 2YKOA 2B5JA 3MCSA 2CQGA 2EFQA 3IAS9 2CFXA 3B78A 2IYGA 3BSCA 4NYOA 4NLWA 4YMEA 2EBEA 1X9WA 1UVMA 1JWWA 3LPYA 1E6VB 3DXBA 4F3QA 3M05A 3CCRS 4LUBA 2MXYA 2VL1A 2C22A 4NLPA 4FNIA 4C8YA 5GADI 3SI8A 1H38A 4DL3A 3U1NA 3OHBA 1NK9A 1C0TB 4PXDA 4KIAA 2CQPA 2DH7A 2ZH7A 4YOEA 2OTJS 2JHEA 4C0HA 4TU8A 4PXBA 2OPPB 1RT5A 3IN5A 2OPSB 2DGXA 4DMZA 4GC7A 2AYMA 3QJJA 5B0FA 3M9NB 1TUVA 2RNEA 1R8AA 3NAIA 4DL5A 1DRZA 1HNIA 1HWLA 4URSA 1U1KA 3C3LA 1T94A 4HT7A 2RS8A 2VFRA 1N36F 4ZKAA 4B3TF 1MWZA 1N34F 2GGPA 4XDDA 3HHNB 3M2UB 4E0DA 3OHAA 3J81Y 5KT6A 3CJ3A 4IG3B 5DJBA 1NB7A 2O3DA 4PWDA 2XMTA 4HEA9 5D3GB 2DGSA 1HBOB 2Y1JA 3RRGA 2HQ3A 4KV8B 3TO8A 2P9GA 5DGBA 2KG0A 2FJEB 3K5LA 2V8VA 1UW4A 2D1CA 5D6GA 2HNDA 4G1IA 5E7OB 2ZHAA 1H2TZ 1S6QA 4OI1A 1AUDA 3NBPA 1D3WA 2DNPA 3OQ2A 1ELOA 2RUGA 4ALZA 4AUKA 4IR1A 2YKMA 3LP1B 4NLVA 1NH8A 3E3XA 2H9ZA 4C0OC 2EBGA 5F9NA 2RU3A 4LQ9A 3DYAA 5E5NA 3K7RA 3TI0A 3OUYB 4P7TA 2YX1A 4DV2F 3JSRA 2Q1LA 1Q16B 3DLBA 3US5A 5E41A 1WF1A 4CO2A 4FPRA 1Q7LB 5C25A 1OWXA 2KRBA 2M0GB 3N6MA 3QO9B 3UDLA 1C2PA 2MZQA 3DOKB 5DS7A 1BQMB 5CYJA 3D1HA