3DOLB

Crystal structure of l100i mutant hiv-1 reverse transcriptase in complex with gw695634.
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
427
structure length
405
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKDSTKWRKLVDFRELNKRTQDFWGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Structural basis for the improved drug resistance profile of new generation benzophenone non-nucleoside HIV-1 reverse transcriptase inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase
total genus 107
structure length 405
sequence length 427
ec nomenclature
pdb deposition date 2008-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3dolB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dolB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dolB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dolB03
3SFUA 2V9WA 1RTHA 1LWCB 1N4LA 4LSNB 4IOBA 3H4DA 1S9EB 5KFPA 4WFZA 4YQWA 2OPQA 3N6MA 5F8NA 4I7FA 2DPIA 5C5JA 4K4TA 1SUQB 1N6QA 5KFBA 1TL3A 3CJ2A 1T05A 1RT1B 4WZQA 4PWDB 1RTDB 4RNNA 4IG0B 3KOAA 2JC0A 1IM4A 3V6JA 1CSJA 3C6UB 1SH3A 2XI3A 5I3UA 2ZE2B 4YP3A 3LP0B 4RNFA 3DRRA 4DG1A 1S10A 4OL8A 5HROB 1JLAA 4FS1A 3BSCA 3I5CA 2WONB 4ZVFA 5KFSA 5KFDA 2AX1A 3G6YA 3LANA 1MU2B 3DM2B 3C6TA 3RBEA 3T19A 5DG8A 4M95A 1S97A 4J9SA 1S9FA 1N48A 3M8QA 2VG6A 4NLTA 1S1TA 1RYSA 2V0NA 1DLOA 2WB4A 3LP1A 1JLEB 2XGPA 2HNDB 3CJ0A 4KO0A 1HARA 3KLFB 4RNHA 4R5PB 4NLOA 3GQCA 2J6UA 3KK2A 4URGA 1HPZA 3EPIA 1RT3A 5KFXA 4F4ZA 5KFHA 2D41A 4Q43A 5EDWA 5KFEA 3CDUA 3NAIA 1JLQA 5EWGA 1JLFA 4WE1A 2I5JB 2BE2B 1XR7A 3MECB 5KFAA 4K4YA 3KLEB 2WOMB 2W9BB 2R8JA 3CJ4A 4J9PA 4ECTA 2VG7B 4F4XA 4KFBA 2W7OA 3DOLB 2ILYA 4KHMA 5KT3A 2ATLA 2OH2A 2BQRA 1RTJB 2C2DA 1FKPB 3M8PA 2B43A 3QGIA 5KFZA 4RW9A 2IA6A 4O44A 5J2NB 4EBDA 1IKYA 1VRUA 4ID5A 3IRXA 1Z4UA 3QLHB 3PR5B 5KFFA 3SI8A 3FSIA 2AGQA 2UUTA 1S1WB 1DTQA 5DQGA 4MK8A 4WZMA 4KSEB 3LP2B 4RW4A 5J2QA 1JIHA 1S9GA 4LQ3A 5KFRA 3T5LA 4GC6A 4EEYA 3QO9B 3G86A 1HQEA 4RUCA 4GC7A 2YKMA 2YNIA 4ECWA 1UWBB 4RW7A 2IMWP 1S4FA 4PUOA 4MFBA 3KLIA 1HNIB 4RW6A 4WXWA 1S1UB 3GIMA 1ZTTA 5KFWA 1ZETA 1RT4A 4NRTA 5CYQB 1S49A 2FLNA 1LW2A 3QIPB 1EETA 4H4OB 5J1EB 4ZPBA 2E9ZA 1HMVA 2FVQA 5L1IA 1RT6B 4WFXA 4EO8A 1BQMB 3KLFA 4NLQA 3MR5A 3V4IA 5CYMB 3CO9A 3MR3A 1JLCA 4NCGA 4R0EA 4ECVA 1D0EA 3KLHB 3DOKA 4I2QB 1RTHB 2D3UA 4K4XA 2YNGA 1HYSA 2IM0A 3Q8SB 1YVFA 2OPQB 1C0UA 3QYYA 4I7FB 1FK9A 3JSMA 2R2TA 4KBIA 3MR6A 4URSA 3CJ5A 3RB6A 1N6QB 1QAJA 1TL3B 3FQLA 1T05B 3CJ3A 3UPFA 3Q8QB 4G1QA 2R8HA 3ICLA 5KG6A 3M9OB 5I3UB 4U7CA 1XR5A 3FQKA 3DRRB 4PQUA 2HMIA 4DG1B 2W9CA 3KHGA 1TV6A 5C24A 1QUVA 1REVA 1JLAB 2W9AA 4O3PA 3QZ7A 2CJQA 3UDLA 3C6TB 3DDKA 3HVTA 4IRKA 2WCXA 4ZVEA 4IFVA 4J9LA 1GX6A 4IH6A 3M8QB 2VG6B 1S1TB 1DLOB 4NLRA 4ED6A 2I1RA 2YKNA 3LP1B 3MEGA 3H59A 4KO0B 4ED1A 4TQRA 3KK2B 1HPZB 4TQSA 3OL7A 4TYAA 1RT3B 4ZVHA 2AGPA 3FDSA 4DL2A 4EBCA 1TKXA 1N5YA 4JV0A 1C1CA 1N56A 2UVWA 3D28A 2RKIA 5DQIA 5DG7A 1JLQB 4MH8A 1JLFB 4WE1B 3RB4A 5DLFA 4IR9A 4TYBA 2R2SA 5C25A 4NLXA 4KFBB 4KE5A 3MEEA 3OSNA 1JKHA 3M8PB 4YR0A 3PR4A 1RTIA 4RW9B 4O44B 2VA3A 4K4SA 1IKYB 1VRUB 3IRXB 4ID5B 4ZP7A 1S6QA 3H2LA 3KHHA 3H5XA 3DI6A 4ED7A 4YR2A 1DTQB 1J5OA 3UQSA 2QV6A 3BQ1A 1GX5A 4RW4B 4XO0A 5J2QB 1S9GB 3H4BA 2RDJA 3M9MB 1HQEB 2YKMB 4IG3A 3PW7A 2YNIB 4RW7B 2XCAA 3NAHA 4B3OA 4PUOB 3RB3A 4MFBB 2ASJA 3ITHA 3KLIB 1U09A 4RW6B 2VA2A 2RF2A 5HP1A 5F8IA 1RT4B 3GYNA 2IC3A 3I0RA 3PVXA 3T5KA 2HAIA 1LW2B 4Q44A 1EETB 4ZHRA 3CVKA 2WTFA 1C0TA 1HMVB 1S1XA 2YNFA 3EPGA 3V6KA 3LAMA 1SH0A 1S48A 3V4IB 1ZTWA 2FVRA 2R8IA 1K1SA 4KB7A 1JLCB 4NCGB 2ILZA 5DLGA 1XR6A 5I42A 5KG4A 3TVKA 3DOKB 4IRDA 2UVRA 3CIZA 2YNGB 1HYSB 2FVCA 3ISND 1C0UB 4IRCA 5J2MA 3JSMB 1FK9B 4EYIB 4DL3A 1C1BA 3DMJA 2D3ZA 4XPCA 4NYZA 4WYLA 1LWFA 4NLPA 1TL1A 4G1QB 3H40A 2UUWA 3N6LA 4Y2CA 4ECQA 3KNAA 2W8KA 4QWEA 3JYTA 4K4VA 2IJNA 5F9NA 4PQUB 1TP7A 2HMIB 2XI2A 5KG3A 2W9CB 1TV6B 5C24B 4KHRA 2C22A 4YMEA 1EP4A 1REVB 5KFLA 4Y3CA 3I5AA 1QE1A 2B6AA 2FJVA 3CDWA 3HVTB 1S0NA 2QE5A 4IFVB 2HWHA 4NRUA 5EWEA 1SV5A 2FVSA 5KFGA 2B5JB 3DLKA 4J9RA 2EC0A 2YKNB 5KT5A 3MEGB 2ZKUA 1T03A 3Q8PB 3DYAA 3BREA 5KT4A 4X2BA 4EO6A 1K1QA 1TKXB 3MEDA 2BANA 1C1CB 1N5YB 3KLGA 4F4YA 5KG5A 3ISNC 2RKIB 2F8EX 3T5JA 2W8LA 3RAXA 3LAKA 5DGBA 2OPPA 4EBEA 2ASDA 2ASLA 3MF5A 5L9XA 2IBKA 2ZD1B 5C25B 2J6TA 3RBDA 4WYWA 3RB0A 3MEEB 2HWIA 3Q8RB 4LQ9A 3NL0A 4ZVGA 1JKHB 2ALZA 1RTIB 3TQ1A 1LW0A 1S6QB 4ICLA 3E01A 3DI6B 3OLBA 4TN2A 1J5OB 5KFUA 2HNZA 4K4UA 3OL6A 3IS9A 2AQ4A 3KHLA 4QWDA 3PW0A 4DL7A 1S0OA 5HBMA 2J6SA 1IKWA 3KK1A 4IG3B 5DQHA 1S6PA 4Y2AA 3OLAA 3H5SA 4I2PA 4B3OB 4M94A 1RA7A 3GILA 4IDKA 3ITHB 5K14A 4HKQA 2BRLA 2RF2B 4O3RA 5HP1B 4RNMA 4IKAA 2IC3B 5L1KA 3I0RB 4QW9A 2IAJA 5D3GA 5KFYA 4O4RA 3DLEA 5JUMA 3H98A 3G6VA 4ECRA 1KLMA 4ZHRB 2AWZA 2V4QA 2B5JA 1C0TB 1S1XB 2YNFB 1IKXA 4MK9A 4RW8A 2FVPA 1WNEA 4O3OA 5J2PA 4Q8FA 4G3IA 1BQNA 1JLGA 3CDEA 5KFCA 4TY8A 2FLLA 5L1LA 5I42B 1W25A 4ZPAA 3QZ8A 4DL6A 2UVUA 4NLUA 5F8MA 3HHKA 4K4ZA 1FKOA 5EWFA 3GIIA 5J2MB 4ED2A 3NGDA 5KFIA 1C1BB 3DMJB 2W7PA 2E9TA 2ZD1A 4WFYA 1LWFB 1TL1B 5KG7A 2IM2A 3PJWA 3TAMA 5KFVA 3DRSA 3JYTB 4U6PA 5KT2A 2OPSA 3NBPA 4Q0BA 4ECZA 2BR0A 5JXSA 3HKWA 2RDIA 3BSOA 4IH7A 4LSLA 1EP4B 4ECSA 4NLDA 4Q8EA 4HYKA 4KAIA 4H4MA 2WK4A 1SH2A 2D7SA 4QPXA 1QE1B 2B6AB 2XGQA 5DGAA 1D1UA 3KMQA 3HVWA 3I5BA 1SV5B 3N6NA 4FBUA 1S1VA 4ED3A 3DLKB 3V81A 2FJWA 3VQSA 3DRPA 3GIKA 1T03B 5KFNA 1IKVA 1TKZA 3DYAB 4KV8A 4QW8A 2HNYA 4QWAA 2UVVA 4O4GA 4NLSA 3MEDB 2BANB 4ED0A 3KLGB 1JLBA 1RT7A 5FDLA 2FJXA 2VG5A 3BQ2A 3PW2A 2AU0A 3NMAA 2OPPB 4EYHB 4K50A 4YR3A 4FS2A 1NHVA 3BQ0A 1KHVA 1RT5A 5KG0A 2BQUA 3H5YA 4O3NA 5KG1A 2R2UA 2YNHA 3D5MA 2OPRA 4JV2A 5F9LA 3E51A 4NLGA 1LW0B 5HLFA 3DLGA 3GIJA 4ICLB 4ZP8A 3E01B 2IM1A 4IH5A 1S0MA 4KKOA 2XCPA 4J9KA 4JV1A 2IJFA 4ZPCA 2HNZB 4IFYA 1TVRA 3IS9B 3LALA 4ECYA 4MK7A 5HBMB 1IKWB 3I0SA 3OSPA 3KK1B 1S6PB 2O5DA 5C42A 4XPEA 3OL9A 4I2PB 2E9RX 1TKTA 5F8JA 3BSAA 4IDKB 3KJVA 3IGVA 1VRTA 3KLVA 5K14B 3BGRA 3FFIA 3PZPA 4J9MA 3UR0A 3EZUA 2R2RA 2IAJB 5D3GB 1R0AA 3DLEB 1QAIA 1TQLA 3MTKA 1HQUA 1KLMB 1RA6A 4R8UA 2JEGA 4JUZA 3PW5A 2DPJA 1IKXB 1RAJA 4Y34A 3M9NB 4RW8B 1MMLA 3CWJA 3KMSA 4O3QA 5J2PB 3PJXA 4ZP9A 4DEZA 1BQNB 1JLGB 3V6DA 1T3NA 4NLWA 2GIQA 4TY8B 1HNVA 2C2RA 1RT2A 3KK3A 3GV5B 1LWEA 2JC1A 3IG1A 1DTTA 5F8HA 1LWCA 4LSNA 5DG9A 4QWBA 1S9EA 5KFMA 3MR2A 5KFOA 5KFTA 3BSNA 1FKOB 4J9NA 4URQU 4F50A 2GC8A 1SUQA 1RT1A 4PWDA 1RTDA 4IG0A 2WHOA 3QGHA 3MFHA 3C6UA 2C28A 3TAMB 3OL8A 4F4WA 1JXLA 3DRSB 4MKBA 2ZE2A 2OPSB 3LP0A 3NBPB 4Q0BB 4WXOA 4TY9A 3BR9A 4FBTA 1JX4A 4LSLB 5HROA 3OHAA 4K4WA 2AGOA 2WONA 5KT6A 1RYRA 4H4MB 1MU2A 3DM2A 2FLPA 3BJYA 5KFJA 1NNDA 2XC9A 1S1VB 1KHWA 3IGNA 4ED8A 3V81B 4IR1A 1I6JA 1JLEA 3DRPB 2HNDA 3PHEA 5F8LA 4J9OA 4ECXA 4R5PA 1IKVB 1TKZB 2JLEA 1DTTB 3GV8B 4KV8B 3NKYA 4TLRA 4ZMMA 4MIAA 5KFKA 2HNYB 3G6XA 2C2EA 4O4GB 3RAQA 4TXSA 2IM3A 3FRZA 1JLBB 1RT7B 3HVAA 5FDLB 2VG5B 4NLVA 2I5JA 2BE2A 4NZ0A 3MECA 4ZPDA 3PW4A 3KLEA 2WOMA 2W9BA 2VG7A 4MIBA 1RT5B 2XWYA 3DOLA 1NHUA 2JEFA 2YNHB 2BQ3A 1RTJA 1FKPA 2OPRB 4ECUA 4J9QA 4O3SA 2AX0A 5J2NA 4Q45A 3QLHA 3DLGB 5HLFB 2CKWA 3GV7B 3MFIA 3SFGA 1S1WA 4NLYA 4KKOB 4IFYB 3LP2A 1TVRB 5KT7A 5L1JA 1T94A 3KHRA 3T5HA 4QWCA 2JEJA 4MKAA 3I0SB 3QO9A 4H54A 3V6HA 4ZP6A 4RZRA 2R8GA 1UWBA 2GIRA 3QIDA 5C42B 5EUHA 4RNOA 4DL5A 2WRMA 1TKTB 3QGGA 4DL4A 3KJVB 1HNIA 1VRTB 1S1UA 3BGRB 2BRKA 3FFIB 5KG2A 2V4RA 3IN5A 2JEIA 5KFQA 5F8GA 5CYQA 3QIPA 1R0AB 1RDRA 4H4OA 5J1EA 1HQUB 4R8UB 3OHBA 1C2PA 5T14A 1RT6A 3T1AA 1BQMA 3H5UA 4IQXA 1OS5A 4RUAA 3V6DB 5CYMA 4RU9A 1HNVB 1RT2B 2R8KA 3KK3B 3KLHA 1LWEB 3IG1B 4I2QA
chains in the Genus database with same CATH superfamily
1RTHA 1X5SA 1RT1B 3KOAA 3I87A 1SH3A 2O01C 3VGVA 4DR4J 3UD3P 1HNXJ 3JQJA 4HVZA 1A0OB 3RBEA 1H74A 2XULA 2CQ2A 2POKA 4V19J 3THTA 4PG4A 5AXLA 3MECB 3T3FA 2W9BB 1GAOA 1KQSR 1RAIB 3DOLB 2BQRA 4EMDA 2VQEJ 2JZ5A 3M8PA 4EBDA 2FLLA 2HBRB 2QMXA 5LJ3Y 2KZZA 4N47A 1AUDA 4UUWA 4ZK7M 1S1UB 1ZTTA 2FVQA 3FZBA 5L1IA 3KUEA 1U0SA 2HGMA 2M70A 1AXQA 1NHKL 2Z56B 3MI7X 1TFYA 1NK5A 1CQMA 3ZZOA 3R2CJ 3ENQA 3F44A 3JQKA 1YVFA 2W1BA 1XMQF 3BR8A 1VCTA 4MT1A 1HNZJ 4QQBA 4B9SA 2F40A 3MM9A 2MKCA 4NLRA 3H59A 1PYTA 3CJSA 1H98A 1BHNA 2DR9A 3TJ8A 5HMZA 1JLQB 4O44B 3H5XA 2Z57B 1Y10A 5KOWA 1FJEB 3WQPA 2J9DE 2BMBA 3EDQB 1GMWA 1S1XA 4DFPA 4RJVA 3VTIA 1JLCB 4JOUA 3LUYA 4HTJA 2GNKA 2NR0A 4ID8A 3OVSA 1BWVA 4NCBA 1RB0A 1EKSA 4Y3CA 3I5AA 3CDWA 2Y0SD 2HWHA 2CPJA 5KT4A 2AZ1A 1SIZA 1SL0A 4C0OC 1I51B 2KN4A 2LKZA 1YIJS 3LAKA 4PAAA 2MKHA 5C25B 1M1KT 8ATCB 1RLCL 3Q8RB 5U47A 2W7AA 2JRSA 2CNLB 4K4UA 1GT8A 5DQHA 2IIHA 3T9NA 1NJZA 4ZCKA 2MZJA 1JB0C 3IBWA 3ZC4A 4JI1J 4K7QA 2V8DA 4MK9A 1GXLA 4KH0B 4Q7AA 2C2NA 1JLGA 2Z2YB 2UVUA 5F8MA 4HH1A 2E66A 3MCOA 3OTEA 3K5NA 5KT2A 3CCLS 4CP5A 2A2CA 2MY8A 1XC9A 3QWUA 2WK4A 1UWAA 3NCPA 3MAAB 4YS2A 3MM7B 5LM7E 4B3TJ 1UKUA 1S1VA 3DLKB 2KFZA 3EGNA 1MMNA 1XMOF 2K3KA 2B56A 2U1AA 2JVOA 4N41A 1K47A 2DNMA 1ZAWA 2N3LA 2O3DA 1HHSA 4K2XA 5F3ZA 4N7TA 3QJLA 1F9HA 2IJFA 3Q83A 1YG0A 3IR5B 4C6AA 2R2RA 1YHQS 1N5QA 2JEGA 4JUZA 2BJDA 5DO2A 5J2PB 1ULRA 1T3NA 2RJZA 4LF4J 3IR7B 1Z1ZA 3W2WB 5KFTA 3CC7S 2WHOA 4C48A 4UOGA 4JI3J 2NXJA 2YH0A 4PZVA 1S76D 2G13A 1Q0NA 2BW2A 1T9VA 5BYSA 2JLGA 1VBXA 3NKYA 3P5BP 5FDLB 1T9WA 3BO2A 3ZTPA 3MM5B 4P2FA 3W63A 1NHUA 2V2QA 4A8MP 2MQQA 2V8GA 2ZVIA 1RWKB 5J2NA 4B9LA 1WKKA 4NXMF 1RU2A 3MM8A 1YJ9S 3I0SB 1NDKA 4CH1A 2WRMA 3J81U 1UVJA 2RRNA 1FFSB 4LIWA 2DGWA 2DNOA 5CAAA 3H5UA 5CYMA 3GU0A 1LWCB 3N01A 2EBEA 2ZC3A 1FD8A 3PO4A 1G1XA 5I4MA 4OJ1A 3T19A 5ETMA 4BCAA 1F3FA 3PNIA 5ETRA 1HPZA 3QT5A 2MGZB 3EPIA 5KFHA 3BV8A 4Q43A 2DH8A 2HYIB 1IBLF 2WOMB 4J9PA 5CQGA 1TZ0A 2QFJA 1ZAVA 1VRUA 3JTOA 1DTQA 5DQGA 2LECA 1N52B 3M8WA 1JIHA 2OTJS 4CLYA 4EEYA 3EGZA 3KNGA 8AT1B 2IMWP 1U2CA 1JJ4A 1FXRA 2PI5A 4WXWA 4X66F 2FGCA 3M1VB 2ZHAA 2MDAA 3Q8SB 2VD3A 4NL5A 3DHXA 2QLJB 4M5MA 5HO4A 2PMHA 4R25A 4Y0FA 1A6LA 5K8OA 4DX5A 2BV3A 3H90A 4IH6A 1VRQC 1DLOB 2G4BA 3D1OA 4TQRA 2ZNZA 1ZH5A 1FVSA 4EBCA 4AFFA 1RXOB 4IOCQ 1NK6A 2AEFA 2M52A 5DQIA 2EK6A 3EVWA 4DSJA 3UN5A 2HZAA 4L6V3 3OFFA 1FEEA 2VODA 1IBMF 1R27B 3W64A 4I67A 4ED7A 2I8EA 2L48A 3DLJA 5D0GA 5BXIA 2CQ0A 3K17A 1LFPA 5HP1A 3M2RA 4FYXB 1YWXA 5A6PA 1C0TA 4DV1J 1R43A 3EM1A 4YDDB 3CIMA 4OYBA 3LGHA 2EG2A 5I42A 1MN7A 2IFXA 2YNGB 1TMMA 2A10A 3TARA 5DJBA 2DNPA 3BKTA 2XI2A 5ETLA 5B0CA 3T9ZA 2M4MA 3ENAA 5KFGA 2IDEA 2YX7A 3ZNUA 3DHWC 4ZVTB 1RISA 1Y00A 4LBHA 3T1HF 3X1LB 2ASDA 4DR6F 3CJKA 1M1GA 4HACA 2MZQA 4I64A 3NL0A 3IAM9 1S6QB 3L09A 4DR2J 1R8CA 2Y1RI 3N28A 4ATNA 3RJMB 1CJTB 4L75A 4O3RA 4EU0A 4O4RA 2MZTA 1NDPA 4F0HA 2AWZA 1WOPA 3GCXP 4TY8A 2E7XA 3GONA 1S6UA 2IRUA 3RGIA 2GGPA 1PYOB 2Z30B 1KFDA 3E8OA 1MROB 5D77A 5B08A 2IPOB 4IH7A 4DFMA 4RL1A 4OX7A 4L74A 2CWXA 2XGQA 2J7KA 5GMEA 3W66A 2E5JA 4LF7J 2X1BA 2Z0GA 4NI2B 2LEPA 1X4HA 4CLPA 3NMAA 2XHWA 3OR1B 2K3IA 2YWKA 3HM9A 5KG0A 5A8WA 2KVIA 2A1BA 4U8YA 3SV4A 1R89A 4U8VA 3QMQA 1XWLA 1ZM4A 5F9LA 2B4OA 1UVNA 3CTRA 5HLFA 2MZSA 4A46A 5CXTA 4XK8C 4ZPCA 3IS9B 2L41A 2CJYB 1WJ9A 1CS4B 2F9DA 1U1QA 3Q22A 1VIOA 4OHZA 3HX9A 2DGVA 3AD8C 3A3PB 5A8RB 3OUYA 1QAIA 1KLMB 2X3GA 3KTQA 4O3QA 3PJXA 2DO0A 1TKDA 1IQTA 2JC1A 3G8QA 2NPFA 4J9NA 3CC2S 1WEXA 1WG5A 1Y0HA 4YB1P 2OFHX 3HHDA 3BO4A 5LXRA 5HROA 3JQMA 1FDDA 3TZZA 2HVZA 2HRYA 3P96A 4NXNF 5L38A 3DRPB 3F56A 2CPHA 5HMYA 4I6WA 4ETZA 1X5OA 2VG7A 4M1KA 1RT5B 3TZWA 4CZCA 4DV3J 4O3SA 1WHVA 3DLGB 4GRSA 2HFZA 3KHRA 2M2BA 2VFSA 3V6HA 2FUG9 1VRTB 3S1TA 2PO4A 1B99A 5J1EA 1GXTA 4UY85 3AODA 4X4VA 2EFGA 2R8KA 1UA0A 1SJFA 1U26A 2YWHA 2QL9B 3N6MA 3TZYA 3TX8A 1NDLA 4WU3A 1RTDB 3C6UB 2XI3A 3MM6A 3J7YU 2AJ0A 2ZE2B 3IBCB 1V6HA 3BSCA 4DR3J 2AX1A 4NZ6A 5DG8A 5CD4A 4LRAA 3C14A 3EXYA 2P2CB 4FF3A 3CJ4A 1HWJA 1VBYA 4E2FB 4RWXA 2DNQA 5KFZA 2IA6A 5CCMA 4UUXA 3IRXA 2H5EA 3MCSA 5ETQA 4OHYA 1S1WB 5J2QA 3CPWR 1N0UA 4GC6A 4DLGA 2ZM6J 4F8RA 4LJMA 1S4FA 1PCAA 1PAUB 4L3NA 4AUKA 5CYQB 1EETA 1DQAA 2NREA 4F25A 4LIRA 2B4UA 1OY6A 1D0EA 3DOKA 1RI7A 3PIPQ 1EX8A 3RBXA 4DZ6A 3CJ5A 4DPYA 1F5CA 3FC9A 4ITSA 5KG6A 2CA9A 1JLAB 4OX6A 2ZZTA 2CJQA 4WFBQ 1H73A 2UV8A 2WCXA 1GX6A 2VG6B 1H2VZ 2YKNA 2GMHA 1BXNA 1RE1B 3FDSA 4S0MA 3L7OA 1CJKA 4ANEA 1PBUA 2Y9HA 2ADBA 4FXWA 4ZVSB 4ER8A 3NRBA 1EKRA 1XBWA 1XMQJ 4IOAQ 1SC1B 3BQ1A 5HQMA 3IMQJ 2ADCA 3MD3A 1L5UA 3PW7A 2C3YA 4RW7B 4OZNA 3VHQA 1O8BA 2BACA 4DQIA 2RF2A 2HIQA 1U25A 3VZHA 4ELTA 1LW2B 2RH3A 2E44A 3MPDA 3LAMA 1SH0A 3LGMA 4J91A 4GO5X 2XY6A 4X4NA 4H4KA 4KB7A 3PRDA 3JXOA 2J0SD 3H20A 4KR0B 3JYTA 1OPZA 3WZ0A 9ATCB 1N8RT 2B6AA 3PYGA 3RG6A 2AT1B 4N5SA 3UVJB 1AT1B 3PKMA 3MEGB 1KTVA 4JI8F 2GJIA 4QU7A 1N5YB 3UW1A 1LKZA 1SXLA 4LRDA 1JKHB 3EZ5A 3HD1A 1XK8A 1PG5B 4F04B 3O2IA 3G2XA 4LVNP 1Q86T 2M0GB 3PW0A 1VLOA 3S01A 4IDKA 3ITHB 4HEA9 1TK8A 3MD1A 2VJVA 5JUMA 5DETA 1U8SA 4LF5J 4YHHJ 2FGOA 5H9EK 4ZPAA 4WKRA 5EWFA 1Q95G 4ELVA 2V4JB 2V8PA 2YQ3A 1U6FA 1R6VA 2BR0A 2BW7A 2VICA 1P8GA 1SKSA 3TAPA 5IC6B 3KMQA 4CLWA 1FRLA 1WSRA 1U0HA 2HNYA 3MEDB 2ROPA 3J7A1 2FJXA 3VQTA 1G3OA 1BUXA 1CG2A 3PDNA 2R2UA 4LFCF 2MKJA 1FE4A 1O51A 2KYZA 5B0FA 3OTDA 2HHHF 4B3SF 2PGCA 3OSPA 2AJ2A 5HQ8A 3KDOA 4NMXA 1CJUA 2W2NP 1YITS 1FD2A 3AOBA 2IRXA 3U1MA 1TMJA 3M9NB 3I4PA 1BQNB 2ZOFA 1T3OA 1XMOJ 2DNYA 1S9EA 1B7YB 1RHJB 2VPYB 3QGHA 2AIRB 3OL8A 4MKBA 1YJRA 4PXDA 2ZC4A 2BM0A 3CGIA 2KH9A 2DGTA 1MU2A 2XM3A 5THWA 2XC9A 2CJBA 2R7WA 3GV8B 3PEHA 2QYCA 4TLRA 2DTJA 1WG1A 3KUGA 3FRZA 2LLZA 1HHTP 3ETMA 2Z58B 3AXMA 1ICEB 4WKYA 2BQ3A 1RTJA 2FJEB 4Q45A 2XB2D 4EK2A 3GMGA 3GB0A 2R7OA 5MLCV 4ZP6A 1KLNA 5EUHA 4RNOA 4DL5A 4PWUA 4B17A 2V4RA 2OMLA 5KFQA 2C2OB 4DU8A 5HJXA 4UQTA 3C66A 1OS5A 3V6DB 1K44A 4USVA 1UEVA 4OHXA 1HL6A 5GADI 4L76A 2CXEA 2XSJB 4Q2MA 4X84A 1N6QA 1AB8A 3HZEA 4P52A 2N7YA 1MWZA 1WUUA 1HBNA 2EC2A 4NXMJ 3UE2A 3PIOQ 1U02A 1XEZA 4ECQA 2YTCA 2J6UA 1RT3A 4C11B 1J2VA 2D41A 4FXVA 2AJQA 5GMKa 4ECTA 5DM7Q 4KHMA 1A7GE 2OH2A 2EBGA 5E3QA 4DFKA 5EN1A 2B43A 1Z4UA 3FSIA 1WD6A 1VC6A 2HHQA 4M5KA 4HTIA 4LT6A 2HS4A 1RCXB 1RBAA 3FBCA 2F4VF 1K9MT 4YOEA 2L9WA 1HMVA 2MQPA 1ZOTA 3OFGA 2ZITA 4R0EA 3HF5A 3QYYA 1IBLJ 1F2HA 1VIXA 1HI8A 3M9OB 1QUVA 4ZJLA 2OGUA 1DZ5A 1FX4A 3QZ7A 1HA1A 2HFVA 3JSBA 3LP1B 4MTPA 1PBAA 2HQCA 4X66J 4DV4F 3EGVA 1TKXA 2UVWA 4NX9A 1JLFB 1VJQA 3TQEA 2VQFF 3B6BA 3KHHA 1URRA 1PC4A 1GX5A 2XMTA 3R1LA 2MZRA 4OHVA 1KDNA 2HQIA 4OYOA 4AYBD 4ZOSA 4RW6B 3W3SA 3D54A 3EPGA 4LBIA 2F63A 3UWTA 2PD1A 3CIZA 1HYSB 2H5JB 4A8XA 3POTB 1WC3A 4M5GA 3LPEA 4FF1A 4M5IA 4ES2A 1LWFA 2HEKA 2W8KA 4DX8H 1IBMJ 2HMIB 4YMEA 1Q16B 2DCUB 5B0GA 2JX2A 2VZ9A 1F60B 1PJ6A 2HRTA 1SL1A 1C1CB 3T5JA 3DLLQ 2HK2A 4WPAA 2B8QA 2IJRA 2R42A 2J6TA 4DWIA 2HWIA 2HK3A 3K5LA 1BWEA 4KHPF 4CLSA 2ZJRQ 3IWNC 1YJUA 1BMQB 1IWGA 5KFUA 3OL6A 3BYRA 2J6SA 1IKWA 4J7CA 4HKQA 2BRLA 1RHMB 1TUVA 5L1KA 4RW8A 2FVPA 2VASA 1RAAB 2KM8B 3T1HJ 2CFXA 3Q86A 2IYIA 1FKOA 2E9TA 4J5OA 4GVBB 6AT1B 3QRRA 2W7PA 3LPYA 2R7UA 5IT9Y 1UPPA 4Q0BA 2GHWA 2RDIA 1EP4B 2B51A 4E98A 3A8IA 2VC0A 4USHA 1P27B 1TL7A 5LOQA 3KG0A 3FNNA 4M5HA 1HI1A 2BANB 2R4FA 3HLUA 1NSAA 2B9YA 2DRAA 4O3NA 3KG1A 1HLWA 2M9KA 3E01B 2Q79A 2RNEA 4IH5A 3ZNJ1 4KKOA 5A2QU 4ANDA 1I94F 4C3LA 2G2YA 5K14B 1KNZA 1SI9A 5D3GB 1R0AA 1RCOB 1DQ8A 3GFXA 4OI0A 3MR7A 3D68A 2DNKA 3N0VA 5F8HA 1DTTA 5HATA 4KJIA 1T95A 3FGVA 4BC9A 4IG0A 4WIIA 2KM8C 3TOQA 5HMWA 2GS8A 2D3OR 3WIUA 2ZWPA 2WONA 5KT6A 2PEHA 1HQ2A 1TKZB 2D1CA 5KFKA 4CTAB 4O4GB 4TXSA 1JLBB 3KYLA 3D66A 4LF6F 4Y65A 3MMBA 3HMJG 3C15B 3AT1B 1JXEA 3QLHA 4Q5VA 4M5DB 2ZOMA 1KQGB 2DHAA 1HW8A 4LF2A 1QSLA 5AT1B 3PACA 1X9WA 4JYAF 1ZZFA 3SDEB 5F8GA 4P2XA 4NXNJ 2GAGC 4TU7A 1HNVB 1YX2A 1K73T 3W8GA 3AB2B 2L3MA 3BS9A 4YQWA 3UCGA 2HHWA 2DGOA 2FY8A 2HQFA 5C5JA 2GQQA 2XO7A 3A3NB 3LA0A 4WFAQ 2W24A 2DITA 4AD6A 1WKLA 2P9EA 4BDPA 4ALZA 3E2EA 2KYXA 2WZ1A 3OQ2A 1C4AA 3KLEB 5IT9U 4KFBA 2D3O1 2W7OA 1HWIA 4WU2A 4B9UA 3QGIA 3TZXA 2H4YB 2NZCA 5DZ6A 3AHPA 3KLIA 4YB5A 2J9EA 1XNRF 4NRTA 2DNLA 2ZKTA 2E5HA 5JMNA 3Q89A 5J1PA 2A6OA 4ZPTR 4NCGA 3HSZA 4GKJF 1NSPA 1K0TA 1C0UA 2H54B 4I7FB 1VK8A 5CYJA 1KFSA 2KDOA 5JJBA 2J76E 2VU5A 4PRFA 3UDLA 3C6TB 3O44A 2OD4A 2RQMA 1NB7A 1I1GA 3HP6A 5EGYA 3M30A 1NKEA 4TYAA 4DL0C 2BJ9A 5SZTA 4CYUB 3IWXA 5F41A 3VF0B 2C2ZB 3MEEA 4RW9B 1IKYB 1J5OA 2YKQA 2XCAA 3NAHA 2CPYA 2CPIA 1W2BR 3RTVA 4BS2A 3I0RA 2F65A 2CQIA 2CG8A 5ETSA 3V6KA 3ZTOA 2ILZA 1RACB 2HVDA 2YKOA 1VQ6S 2HBQB 3NCRA 4DL3A 1U7LA 1QDUB 1RAEB 1RHRB 4WYLA 1CC7A 1RAGB 3FRYA 3WBZA 4X64J 3PJ9A 1TP7A 4KHRA 2EK1A 3R5GA 4OJGA 3HVTB 1U1KA 1VJWA 2FZCB 4DUYF 3CD6S 1NO8A 4F4YA 2RKIB 3F41A 1CBKA 1R31A 4Y28C 4J90A 5DGBA 5K5MA 1JJHA 2ASLA 2UUBF 2MKYA 2ALZA 3TEHB 3BBFA 2MTLA 2VFUA 1HNWF 3CF5Q 3FSXA 4FNHA 2BKNA 4IG3B 5H9FK 2MQLA 3NLCA 1U6ZA 3OR2B 1X5TA 1HBMA 1Q8LA 4JI8J 1ROFA 1TK5A 3DGPA 1SJRA 4DL6A 1HW9A 3DMJB 2NCKL 3C8YA 3R8YA 4U6PA 3OJSA 4FNIA 4KAIA 1M0SA 1SH2A 2RUSA 1QE1B 2YBVA 1SCJB 1SV5B 3N6NA 2HQ3A 3VQSA 1YBAA 3QRQA 1KRPA 2VQEF 2UVVA 4PXCA 4ANCA 3VAJA 5B0EA 1UCNA 2OPPB 4FS2A 1NHVA 2ZH3A 2RS8A 4KQZA 1O0PA 2AV5A 1TR0A 4CM2A 2BZ2A 1L3SA 2HNZB 2XYHB 3KK1B 4E8UA 3ILOA 3HD2A 3KLVA 4M8LA 1PIEA 4J9MA 3UR0A 4Z7YA 4B9VA 2HSEB 4DEZA 3JAMY 3CMAS 4X4OA 2XQCA 3Q8UA 3CE8A 4LFCJ 1U1PA 1PJ7A 1JXLA 2XBPA 3P6YC 3S6EA 3KJNB 4F0MA 3IRWP 4DN0A 2AEMA 1KVKA 1H7WA 3GFYA 2HHHJ 4B3SJ 1G6BA 3FUYA 2Q6BA 1JLEA 2HNDA 1IKVB 2JLEA 3PCOB 5B0AA 4C8YA 5M2UA 1RT7B 3TWZA 4DMZA 1W7WA 2W4PA 2JSXA 4TNOA 2OI2A 1L3VA 2I38A 2IVFB 2EW9A 4KY3A 2DHSA 2DT9A 3LP2A 3JTNA 3M8ZA 5C2CA 1NM2A 4QPTA 3QO9A 1U45A 4DV7F 1X4FA 3BGRB 2QMWA 4C97A 2LQJA 2X51A 3TNVA 1FWLA 2G0CA 2LEAA 5KFPA 3GJRB 3ENVA 4K4TA 1SUQB 2ROEA 3NS6A 1VOMA 2DEIA 2RQCA 2H48B 4JI0F 2HPUA 4ZVFA 5T7LA 1MSWD 2MEWA 3DM2B 4B08A 5IXUA 3M8QA 4NLTA 2A6MA 3BYPA 3QT6A 1RU1A 3DFEA 4J9VA 2MQMA 1X0PA 3NS7B 4YY3F 1H7XA 4IQMA 4UZCA 4WE1A 1T11A 1E6YA 1U1RA 4ILLA 2W2OP 2R7RA 5LMUF 3P8BB 1WSVA 3ILLA 1WACA 4KSEB 1UW4A 2YKMA 3M32B 1IM6A 2E1AA 2OFGX 2J0XA 4KGVB 4ZITA 1NKCA 3PFOA 2XEXA 4EO8A 4BWJA 2LA6A 4I2QB 1YQHA 4MYTA 3SCIE 3VGSA 5G0RB 1F2GA 4UT4A 4PQUA 1R8AA 2PDAA 3DGVA 3M2VB 4JI7F 2YWGA 4NEZA 4NOHA 2AJFE 4LRBA 2XMAA 2FB0A 2CYYA 5C2GA 2PIIA 1AZSA 2F4VJ 3AB4B 2OKQA 3QSYB 4DSIA 4U67Q 2NXUA 3SXLA 1KD1T 2HHUA 4KE5A 1HD1A 2XG8A 3PR4A 3VR1A 4UOCA 2G9OA 4YR2A 4DCJB 4C8KA 5HQLA 3O1LA 4KGMA 5CH7B 1BD6A 1UVKA 2HAIA 2B7CB 1KQFB 1YLXA 2BJEA 3M2UB 4ES3A 1GK8A 3MURP 2VOOA 4GMKA 4DV4J 2XSFA 4OI6A 2UVRA 3JSMB 3QWPA 2MQNA 3VAIA 4XPCA 2UXBF 2IY5B 1VMBA 3TR5A 1D3WA 3NGSA 1RWMB 2ZH7A 2VQFJ 2DVIA 1TFWA 5C24B 1FHTA 1ELOA 1FI4A 2RE1A 3I82A 3GFZA 3EVMA 3U7JA 2FZKB 1NH8A 2EC0A 3HJFA 1T03A 4FP9A 2GVZA 3OTOF 2ALYB 4AQYF 1NSKL 4QYRA 4OZLA 2EWHA 1OSCA 3RB0A 5IQ6A 4QIFA 4A48A 2XLIA 1UA1A 2CJ9A 1X0FA 5L39A 4ZCMA 4FPIA 1REGX 3OVBA 3MOZA 2CPXA 2IAJA 3G6VA 4ZHRB 2YNFB 5IS2A 5A8KA 3MHYA 2EFVA 2KTQA 3VALA 4K4ZA 3QFWA 1TL1B 3DRXA 4KHPJ 3A8KA 1NCLA 2WBMA 2OPSA 3NBPA 2GVDA 3TEGA 2GV1A 3MMCB 4DQQA 5AE3A 3HVWA 3IA0A 4N56A 3UI3A 3W60A 2DHGA 3RW6A 1LXNA 2VBWA 1UZDA 3QJPA 4L73A 4YR3A 4OFZA 5D6GA 4F26A 2QN6B 1QAYA 4IFYA 1M90T 1FXDA 5EX0A 2RHQB 1S6PB 4OX9F 1HWKA 4ENOA 2NXCA 4Z7CA 2EKYA 3AQPA 4OV1A 3CD0A 3M6VA 3DLEB 3MTKA 1RA6A 5M2RA 2VPXB 4OYZA 2W2MP 3IG1A 4LSNA 3C16A 2K2PA 4ED4A 2RU9A 4RU2A 2ZHBA 2CQ3A 3WX4A 3DRSB 3CCSS 3LP0A 4K4WA 1XMBA 4KC5A 3N9UC 1ZPVA 1Y3JA 1W2IA 1I94J 3V81B 4KV8B 3TJ9A 4C98A 1X4EA 4FVCA 4QR0A 4NMLA 3GSDA 3SQGA 2OPRB 4LBPA 2M88A 3AOAA 3M4XA 3SFGA 4NLYA 2NSCA 4QWCA 4QYZJ 1UWBA 2GIRA 4ZVRB 3Q8YA 1OQ3A 3FFIB 1R0CB 4R8UB 1N0VC 3A8JA 5LJ5Y 3MCMA 4RU9A 2W2PP 1RT2B 1R3NA 1LWEB 4BLGA 3PRBA 1XJWB 1TL3A 4WZQA 4RNNA 3ZZYA 5I3UA 2M8DB 3PO5A 2DO4A 3IFEA 1S5ZA 4ZDNA 1RYSA 3CJ0A 4R5PB 5ETOA 5KFXA 2WVFA 2VBXA 4JYAJ 4CLKA 2RAQA 2MJUA 2BE2B 5KFAA 1U2RA 4DR2F 4JI5J 2MLXA 4X4PA 2ZH5A 1DY3A 4O0NA 1S9GA 1IR2A 5KFRA 3ZZ0A 1L3TA 3G86A 1HQEA 4CO2A 2YNIA 5FD1A 4PUOA 2PA3A 2OUGA 3CJQA 1DFDA 3S7RA 5ITHA 4H4OB 3HSGA 1KTQA 2HVHA 3CCTA 3BKFA 1BQMB 3R6LB 1S57A 2CUYA 4Z37A 3MR3A 2HG4A 3KLHB 4EI2A 4PG5A 2OPQB 1T9XA 4LF1A 4G1QA 2G0JA 3B4MA 2DR6A 3FQKA 3DDKA 4ZVEA 3UD5A 2ZH4A 1R8PA 1UJ5A 1E6VB 4PABA 3W2VB 5BJRA 2KHDA 3KK2B 1UPMB 1UJ4A 1H38A 2NQPA 1XNRJ 4WF9Q 4EUVA 4MH8A 2GJFA 3GYXB 1F5BA 2VB6A 3OTCA 1EB0A 5E7OB 3DI6A 1F5AA 1V9OA 1Q79A 1RSCA 3NP5A 1Y3KA 4EZ9A 3RRHA 2JOQA 4ED5A 4A8YA 1WDTA 4P72A 1ZTWA 3R5BA 4FYYB 2HAFA 5J2MA 1FK9B 1H2UX 2FJBB 1ZA2B 4QWEA 2W9CB 1TV6B 3BGUA 1ZS6A 4IFVB 3MMAB 3PV8A 2XS2A 2B5JB 4NE9C 2ZKUA 2V8HA 4P7TA 4WJBA 4RPFA 3KLGA 2F8EX 2NXEA 2ZDOA 2O1PA 1VQKS 1X4AA 4CNZA 4CH0S 2CNOB 1RTIB 3VCDA 1U4BA 4LF9F 4DXLA 2AZ3A 3UDVA 5HJYA 3RR7A 4CIOA 1IBKJ 1VR6A 4UW2A 3H5SA 1UVMA 4B3OB 1RA7A 2FC8A 2E1RA 5D8HB 2W4CA 2IC3B 3VVTA 3MEKA 1PGZA 1CJVB 4DUYJ 4Q8FA 4KTQA 4EGLA 5E3AA 3W1YC 4OLPA 3ZZZA 5E3RA 3GIIA 4DR3F 5EX3A 2X7IA 4WFYA 2UUBJ 3C19A 3TAMA 1AFJA 1HBUB 1Q8IA 2H4WB 4JI4F 1T9YA 2D7SA 1HNWJ 4LRFA 5HN0A 5E0OA 4UOFA 2DJWA 3DOMB 1OPIA 1PILA 4C3MA 2G2OA 4FZVA 2V6AA 2HIYA 3NCQA 2HLTA 3NY0A 3PTWA 1X4DA 2QIFA 3R5CA 3BQ0A 2YNHA 3FVYA 2ZM6F 1LW0B 2V2KA 4ZP8A 4NPOA 3PM9A 3QAUA 4DV6F 1CLFA 1F3VA 2V34A 2O67A 3PZPA 1ZZNA 2DNHA 1HQUA 4HDGA 5DDQC 2DPJA 2UXCF 3TAQA 5IV3A 1NU4A 4RBTA 2C2RA 4RR5A 3EGWB 3TA0A 4PWDA 4DUZF 3ZZUA 3NEKA 1AFIA 4LSLB 4F67A 4H4MB 4A8SA 4M5NA 3J7AN 4DUTA 1KHWA 4RX6A 4JI6F 4J9OA 3NXZA 2LVWA 2DXFA 2C2EA 4K8RA 2VG5B 4NLVA 4QIWD 2I5JA 4ZA1A 4EWTA 2N4CA 1IVZA 1Q78A 3DN9A 5D78A 5D4OA 4LR8A 5C42B 2FJDB 1TKTB 1HNIA 4F3QA 3WC0A 1NAQA 3BKUA 1RHQB 1RT6A 5A0YA 5IM0B 3OTBA 1D8ZA 3H2UB 3MGJA 2RQKA 4F4KA 1RWXB 1T05A 4KPYA 1FX2A 3B82A 2NUUG 3DRRA 3DDNA 2CDRB 3SSSA 5KFDA 2NYHA 4DSFA 4PXEA 3T41A 1S1TA 1WG4A 1OY8A 3M6WA 4DV7J 4CT8A 1DURA 3BH6B 2PMWA 4ZIWA 3PY8A 1RHKB 3HT0A 2DBBA 3CDUA 3AJ1A 2GHVC 2KRRA 1BLUA 2ATLA 2QSFA 3D0GE 4M63A 1KSPA 2DRBA 3KG4A 4WP8A 4RW4A 1DRZA 4FYWB 2XNRA 1UFWA 5E3PA 4DS4A 4JI0J 4LF5F 4PXBA 3CCJS 4MFBA 4YHHF 3PEJA 3QIPB 1X4BA 4WFXA 2XZDB 3V4IA 4YB6A 2GO8A 4MJKA 4YY3J 2D3UA 1NB2A 3L7UA 2ACYA 3UPFA 5J1NA 4DG1B 5ETKA 1REVA 5LMUJ 2K1RA 2FHMA 2WW8A 1FRHA 4USIA 4DLEA 3T6JA 1NPPA 3UNYA 4KO0B 3DXSX 3UCUP 2DXEA 4L72B 4XAKA 1N33F 2R2SA 2XMWA 1MLAA 3ET6A 4ID5B 1MWYA 1Q5VA 3Q0AA 2UXDF 1FRMA 5M2PA 4X62F 4YDXA 3DRYA 5DM6Q 4JI7J 1RT4B 4USMA 1FCAA 5LSLA 4W98A 2R8IA 1P6TA 5LL6d 1SC6A 2RU3A 4P73A 1U47A 4OYIA 2CJXB 2N4DA 3HHLB 4DBQA 3W5ZA 3EE3A 3PYEA 2E5GA 1VBZA 2MXYA 2ZH8A 2XLKA 1CULB 1P1TA 1S0NA 5GAGI 4ZVUB 4C9DA 2FVSA 2L08A 3MDFA 3CCRS 4PPDA 3DYAA 1RUSA 4PG6A 4C0HA 4G6VB 2C3PA 2CDQA 1WOSA 3DLHA 2CG4A 2BOAA 4ZVGA 2LQ9A 3OLBA 2UXBJ 3A4TA 3CCVS 1PAEX 1N5TA 3OLAA 4I2PA 3DLBA 5HANA 2CQHA 2V4QA 2B5JA 1IKXA 2GQ2A 1RBLA 3OTOJ 5IC4B 4AQYJ 1KC8T 1W25A 1C1BB 2B4VA 1HWUA 3AOCA 2IM2A 4OV6A 2BVZA 4ECSA 1Q82T 1SKUB 3CJRA 3AY0A 3HHLC 2K7KA 5L8RC 2VJUA 2Q6CA 3GIKA 5HVGA 2OSRA 2EFQA 1ITPA 3CCES 3TA1A 4MMOA 4ZN1A 3GIJA 4ICLB 1S0MA 2XCPA 2RT3A 1TVRA 1M5PC 2MLYA 5HBMB 1V3ZA 2AHOB 2LU2A 3OL9A 1SC4B 3KJVA 5KOXA 1RHUB 1K0VA 1X9MA 3J80Y 1AUSL 3MAQA 1RAJA 1HBOB 5DDOC 1VQOS 3KK3A 4ZCIA 2G0IA 5FLXY 3D1QA 3VAGA 1RT1A 4TLQA 5K20B 1YJ7A 3H8YA 3OHAA 4FVMA 3LW5C 3G82B 1NNDA 2DHHA 2E5LF 4ED8A 4OX9J 4ECXA 3EICA 4OI1A 1DHMA 2W01A 3HVAA 1L3UA 1NK4A 1DARA 4NA2A 5H9FJ 3MECA 2ZVSA 2W9BA 1VQ9S 4MIBA 3DOLA 4B9MA 5CCLA 2M3DA 4Y00A 2CQBA 2KKHA 2AX0A 1YJVA 3BH7B 2HZCA 1SPBP 3PXGa 3ZTSA 2Z4PA 5CA5A 1T94A 4DQSA 4PQAA 1GNKA 1S1UA 4CLZA 5GADU 4JP8A 4KIAA 2GCFA 1IR1A 2DK2A 2JL9A 1S59A 4QR2A 1UFKA 3ISZA 2JC0A 4YP3A 2P9GA 4FS1A 3HJVA 1WELA 1F0XA 4RNHA 4NLOA 3EUNA 4WFNQ 5KFEA 3NAIA 1JLQA 3DNCA 1YI2S 2R8JA 1GFWB 4UF4A 4F4XA 1H6KX 1UVIA 3H2VE 4HL9A 5KT3A 2HHVA 3M8SA 1VQ8S 2BM1A 1FKPB 4O44A 1EARA 2XY5A 4JB8B 4MK8A 4ZS6A 4DHVA 1V5VA 3ZZRA 2OELA 2C2MB 2OEMA 5L46A 3BGFA 1Q8KA 4JI2F 4MIWA 5CZVA 3IC1A 1JLCA 1RP5A 1RTHB 2R7TA 3OPKA 2GO9A 2XMUA 2J9CA 3RB6A 1AROP 2MKIA 3RU0A 2W9AA 1M5SA 2QLXA 4AE5A 2NS1B 2CQ4A 4C8NA 2DB1A 4ED1A 1FNMA 1L3KA 1M1HA 1NK9A 1SJ4P 1MG7A 1FJ7A 5C25A 3OBIA 3FEZA 1T9UA 2PMZD 3M8PB 1RWNB 4ZP7A 1HIYA 2HS3A 4YUDA 2BX6A 1VQ4S 2H51B 3FK4A 2ASJA 4DCPB 2FY1A 5F8IA 5H1SV 3CB4A 1OY9A 1YGYA 2OJ3A 4USUA 1K1SA 3D3CJ 2MLZA 2ZH9A 1FTCA 4I56A 5D0EA 4N76A 1KOHA 4NYZA 2JFKA 4DCOB 4CH7A 2C22A 2VFRA 4CCHA 3MOJB 3MAAA 3MM7A 5EWEA 3MM9B 2J8AA 3DLKA 4P9SA 5AXNA 3B54A 3I9ZA 2W8LA 4F7VA 3RAXA 4EBEA 2DGQA 2LQ8A 2HWTA 2BE7D 1OYDA 2N7CA 2AYBA 4G1IA 1JJ2R 2WVEA 3LTOA 4OI2A 2XO6A 3E3XA 2RRAA 1SC3B 3R9LA 1NKBA 2MZ1A 4M94A 3GILA 2BYCA 2LA4A 4RNMA 3NWGA 3H98A 1S1XB 4O3OA 5J2PA 1OYEA 4NLUA 3W2WA 2XY7A 1FE0A 3I31A 3M05A 4DPXA 3IBFB 3H7HB 3R1HA 2X1FA 1WOOA 1LV5A 1Q4RA 5KFVA 3T1YF 1JNZB 4LF9J 3K8WA 2QT7A 3CW2C 3SSRA 2APOA 1D9AA 3I5BA 2BJ3A 2ZBIA 4BC7A 1NSQA 1NJWA 2P8IA 5C7PA 5FDLA 3AJDA 1UEUA 3MM5A 5K8MA 5KG1A 2DNZA 7AT1B 3W65A 1Q7LB 2QL7B 4N77A 2YQ0A 3I0SA 4OYMA 4JI4J 4ES1A 4D3GA 4AT1B 5AXMA 1JMTA 3B78A 3CWJA 3KMSA 5HVHA 3TA2A 1JLGB 3HFVA 4ILRA 1LWCA 1U1NA 4WWSA 4OZ1A 2FTRA 3K58A 3K89A 3Q24A 1OMSA 1KS2A 3QPIA 4DV6J 1S1VB 3NNHA 4ILMA 1SJ1A 2MGZA 4OYPA 4NZ7A 2KFYA 1JNRB 4DX7A 2AJ1A 2BE9B 2WOMA 2UXCJ 3ZXWA 3BZQA 2ZDPA 3U02A 2V5HG 2XWYA 2QSWA 3D6TB 1RAHB 4Y6IA 1IN0A 3ZZTA 2YY3A 3I55S 4DUZJ 2M8HA 1EQ0A 2W25A 1QSSA 3ZTQA 4CO0A 1NEEA 1YBUA 3M1VA 2CQGA 1N5SA 4OIXA 1RDRA 4JI6J 3MXHP 1I5OB 1D9FA 4IYQA 4GKKF 1U1LA 3SFUA 4X64F 3AJ2A 4DR1F 4P6QA 2HGLA 4C2MA 3SYZA 2V9KA 3LANA 1XNQF 3OXGA 1DLOA 3KLFB 4CDIA 2VHGA 1UW9A 1GQEA 2K7JA 3HXMA 5D0HA 2OIHA 2LDIA 4XDCA 3IM9A 4O23A 1GMVA 2ILYA 3D1HA 2DHXA 2C2DA 5J2NB 5KFFA 4AXIA 3G8SA 2BJ8A 2VONA 4HHJA 3MM8B 1BC6A 1OO0B 3HVRA 4ZCLA 3ZZPA 1GTEA 3N79A 2JH3A 1SKWA 5D4LA 3GIMA 1H0HB 2BJ1A 5L9NA 2HFOA 2FLNA 4F02A 2RD5C 3MR5A 5CYMB 3BEGB 4K4XA 2YNGA 2IM0A 1FDBA 4KGXB 1QAJA 4UTGA 1VGYA 2PE8A 2GQCA 3VGTA 4DQPA 4LUBA 2KRBA 3KDNA 1VQMS 1XIQA 2RS2A 3PX4A 4XTTA 4WTYA 3GPAA 2DRDA 1XTZA 1HPZB 1IQZA 2RB7A 3D28A 2HHTA 4P74A 4TYBA 2FHJD 1B0TA 4ETXA 2B7BB 4CO4A 2R7SA 2BEFA 4A8WA 1VRUB 1S6QA 3NMRA 1DTQB 2XMKA 3UQSA 1SJ3P 4XO0A 1WI6A 2M5YA 2J8SA 1AYEA 1RJJA 2I9SA 1CJTA 1U09A 4N8OA 1RKIA 1VFJA 4DFJA 1S48A 4AL5A 3FJ2A 1GTHA 1FEHA 1N33J 2KJVA 3D6FB 2D3ZA 2HGNA 4DPOA 4LR7A 1MROA 5F9NA 5KG3A 1R8BA 4FDFA 1EHWA 3Q2TC 2UXDJ 1SVDA 1QY7A 4X62J 2DKOB 1NLKL 4NI2A 3GE9A 4EO6A 1K1QA 4USKA 3OR1A 5L9XA 1S12A 2P6TA 3VWSA 2ZBPA 3L9ZA 1Q5YA 2HFSA 4PYAA 3IS9A 3THVA 1CS4A 2Z2LA 1VQYA 4ZLLA 2X3DA 3NG8A 5HP1B 3M2RB 1R8HA 5A8RA 2OP5A 1KLMA 1C0TB 1A9NB 4C4WA 3BF4A 2F5GA 4G3IA 3MZIA 5L1LA 5I42B 2R9LA 2H5IB 2QA4S 2K06A 2XTJP 4P7VA 4F4AA 3RBZA 4DV0J 3HKWA 3O8WA 4NLDA 1WC4A 1TAQA 3VGUA 2UP1A 3FEYB 1FNXH 2KO1A 3DRPA 3SZ2A 3R5DA 2FDNA 2IVYA 4QW8A 3D2WA 4QWAA 1KWMA 2QL5B 2AU0A 2DH7A 4G1PA 1BQXA 3CJKB 1RT5A 4HACB 4RLEA 4B3MF 2KZMA 2DIVA 4OX8A 3E51A 4ZLJA 3DLGA 3CSKA 4K2JA 2CZ4A 4JV1A 1WF2A 1CPZA 3LALA 2ASYA 5D0RA 2O5DA 3JS9A 4FN5A 5F8JA 1VRTA 3QGPA 2Q3PA 3BDEA 2EI5A 4DQRA 4TY8B 2ATCB 3J81Y 5KFOA 3V4MA 2GGPB 1RTDA 4DR7F 3C6UA 2X1GA 3GR0A 2GHPA 2ZE2A 2KXFA 3VAMA 2QFIA 1PSDA 3F73A 1VDHA 4DJBA 2UV8G 1FT8A 5KFJA 4OJ3A 2HBZB 4ZKAA 3IGNA 2DY1A 2KL8A 4X4QA 2QEXS 3U1NA 5ETVA 3UD4P 1EQMA 1KOOA 4HI1A 3JSYA 1Y5IB 5A8WB 4GVLA 3GJSB 2LCWA 1WHYA 2BUNA 5HLFB 2MHNA 3DC2A 1S1WA 2VDIA 3LWLA 5KT7A 1KONA 3W5YA 1VC5A 2JFDA 2RILA 1RBOB 5AXKA 4DL4A 2MYFA 1JWWA 5CYQA 3OUYB 3OHBA 2BKPA 2E5LJ 1C2PA 3T1AA 2ZBCA 3DDIA 1CEZA 3RAMA 1B3TA 1U48A 2PSZA 3OD2A 3H4DA 4U96A 3L3CA 2XYGB 3TUPA 2B3TB 3TP2A 1WC5A 5BR8F 3DU6A 4B3RF 5HROB 1JLAA 3D67A 2A2DA 4WP9A 2VG6A 2GA7A 5K8PA 2HKEA 1S79A 1VK3A 4URGA 4DN9A 4DR5J 3CCZA 4YEAA 2ERRA 5EDWA 3BBBA 2LQ5A 5EWGA 1QAXA 2VG7B 2B8PA 3TW0A 5GVQA 3PYFA 2AYMA 2QYGA 2AGQA 2UUTA 5BYQA 3T5LA 2MKSA 4RUCA 3OV7A 2MB0B 4RW7A 2DNNA 2DD8S 5IWAF 3HSDA 2CZVC 1P1LA 1N32F 2V50A 1LW2A 5J1EB 2YKAA 5HVFA 3KLFA 4LREA 2MQOA 2HBYB 2HHXA 5DRKA 2VFVA 2HVEA 1YKWA 4LVOP 1EAYC 2LU1A 3Q8QB 3FQLA 4C8ZA 3TVYA 3MM6B 3MUTP 4RKUC 4X4TA 3CT9A 4B9NA 5GAEI 5IOLA 5KAKA 2I1RA 3UVJA 1X9SA 3MEGA 3C14B 4QZVB 3M8RA 1N5YA 4JV0A 5B0BA 4JI2J 2NLWA 4IR9A 5ADZA 1R6YA 1I3OB 3P49B 1JKHA 4FF4A 3PKYA 1YZ7A 3IRXB 3EYZA 3NOGA 2J5AA 5J2QB 1QUPA 3M9MB 2RSQA 4K0KF 4P2MA 4DF8A 1LOUA 3ITHA 3A3OB 3BPSP 1UP1A 3I6PA 3GYNA 2L9NA 4JV5F 3PVXA 3EDRB 4Q44A 1EETB 1IUJA 2QG9B 2WVCA 4UOHA 2FVRA 1NZAA 3R3TA 1XR6A 1HKAA 3DOKB 3CXCR 2FVCA 3WC2A 2P9CA 4LR9A 3NGUA 2V4JA 2WSFC 1N36F 4LF8F 2ZH6A 1QVFR 4FXDA 4E0DA 2OD6A 3GR1A 1FRXA 2QE5A 3W9IA 2VPWB 3G8TA 2YKNB 3EWGA 1B0PA 5G4DA 2LDYA 1ACMB 3MEDA 3ISNC 5D4PA 1N34F 5LMNF 1CJKB 1B4SA 2V63A 2ZD1B 2XWXA 3LGNA 3QSIA 3C2PA 1XN9A 3UR3C 3NNCA 4NCAA 2FLOA 3KHLA 3D3BJ 3EJMA 2AYGA 2YWWA 4I0WA 4J37A 4NEYA 3L95X 1BE4A 2RF2B 3UDCA 5KFYA 3OJUA 2FQQB 5AJ3F 4FKYA 1BQNA 3ADAC 3S8SA 4DV5J 2MQ8A 4NWBA 1G7CB 4HLBA 3CULA 3JYTB 1Y4ZB 2DR8A 1VC0A 4OZ5A 3L4BC 2F3JA 5LT5A 2B6AB 1VQLS 2NUHA 4U95A 1LNQA 1T8EA 2RRBA 3CMQA 4L3KA 4OJHA 4JI5F 3BM7A 3LH2S 3K5MA 4EYHB 4KGKA 4LRCA 3D5MA 1B64A 1FF2A 2HRUA 1VQPS 4ECYA 4RWWA 3T1YJ 1FRJA 4IDKB 1TL5A 1W26A 3N4WA 1DBDA 2VH7A 2Q43A 3PFEA 4WP3A 3V6DA 2GIQA 1Y5LB 3GV5B 5KFMA 2XSJA 5IFMA 2GC8A 3MAHA 1Y5NB 4H4KC 2EFOA 1VBKA 2EFNA 4MAKA 2LXUA 2H65B 1U0HB 4DPTA 3M6UA 2Y1IA 4ZMMA 4C11A 2HNYB 3V2UC 1P9QC 1HI0P 3CCQS 2F8HA 1K8AT 2A18A 1WHXA 1WC1A 1QLNA 2BDPA 4BWMA 2YPZA 1TU0B 1FNOA 1YTYA 2R8GA 4OLOA 1CJUB 1TELA 2UUCJ 1YZ6A 1ZYQA 5T14A 4F2SA 5DDPC 4DF4A 2QV6A 1QSYA 1S9EB 1G4CA 4CO1A 4HI2A 4BHQA 1VYAA 4X4RA 1U6BA 5ETNA 2GX8A 1MU2B 5HSPA 1F9EB 4A8FA 2B4PA 5ETTA 3LP1A 1MW7A 8RUCA 2KXNB 4F3OA 1JLFA 5LSOA 4K4YA 4NYPA 3HT3A 2ZEJA 5E5NA 4GKKJ 2V67A 2AP6A 1RTJB 1IBKF 2CAJA 3IWLA 4DR1J 2ZUGA 1S77D 4OI3A 1S4EA 2R3VA 2VDHA 2QLBB 4IO9Q 1KKHA 2QRRA 4RW6A 1XNQJ 1M5KC 2KVQE 1M5OC 2XHCA 1CC8A 3GJQB 1YRUA 3W9JA 2DISA 2E5IA 2HHSA 3DU5A 1HYSA 3POTA 4ZVQB 2R2TA 5HMXA 4URSA 1SQFA 4X4UA 1N6QB 2R8HA 5GAHU 2OAUA 2OMOA 2HMIA 5AE1A 1J27A 1HBNB 3QATA 4X65F 2XYPB 4IRKA 4J9LA 5BYRA 2VPZB 4ZVHA 1RT3B 1X4CA 3JTPA 1C1CA 3SIPB 2WVBA 2ZBQA 2FZGB 3WX8A 5DLFA 2CWKA 2PI4A 1VQNS 2VIHA 3OSNA 3NGRA 3R97A 4CLUA 3J81j 4LSZB 4C8LA 3H4BA 4NASA 2R7VA 4PG8A 3RB3A 4RUBA 2CVIA 1J5EJ 2WTFA 3CJ8A 1HMVB 2HFNA 1WKJA 4OYXA 1IWAA 3GZ7A 4GO7X 1N5VA 4GVBA 2F7VA 4C3KA 1YDLA 2MSSA 1RTZA 1EP4A 3SQOP 4NRUA 2PFDA 4M5JA 5KT5A 4TU9A 4IO1A 2B0GA 4X2BA 1TKXB 2BANA 4A8QA 2CZ9A 3IAS9 2V2ZA 4WYWA 4ZLPA 2O66A 5KTQA 1U8WA 1JK9B 3K5PA 3AD9C 3E01A 1SBRA 4DOZA 4U7UD 1S0OA 4ZLNA 2CRLA 2JNJA 5K14A 1ZPWX 3K8VA 5D3GA 4F2RA 3HHLD 3FBFA 4YFUA 1EJ7L 1M5HA 5I3PA 1ZAXA 1V3SA 5DDRC 2ZD1A 1LWFB 1WF0A 4USJC 3TUJC 4QIGA 4C8MA 3W61A 4ZN3A 3UO0A 3D4JA 1TUGB 1EIYB 3QJJA 1VQSA 1FRIA 1UMJA 4I4BA 5EHHA 1TKZA 3QFHA 3SCJE 4FF2A 4CTAA 4O4GA 4ED0A 1JLBA 3BBCA 4K50A 2KG0A 5F0UA 3EVOA 2H3EB 4D3HA 2JVRA 4OI4A 3C15A 2J0QD 4M5DA 1RGVA 3AA8A 1URNA 1IKWB 2E9RX 3BSAA 2LMIA 2CJAA 3SDEA 3RYLA 4RW8B 4QBUA 3DCAA 4B9TA 1MNEA 1HNVA 1T7PA 3G6ES 5F0WA 1FKOB 1Y11A 3R5AA 2YQ1A 4URQU 5LSRA 1NDCA 3GG1A 2BA9A 1KR4A 1RLDA 4B3MJ 5JVHQ 4ZJOA 4Q0BB 4FBTA 1X4GA 1TL7B 5F8LA 1YJWS 2RMLA 4QIEA 3RAQA 2IM3A 2QC3A 4W90B 2COLA 1KQKA 2KJWA 3KLEA 1X60A 1IJEB 4CO5A 2CPZA 4ECUA 4J9QA 2CADA 4HT7A 4QYZK 3UN2A 3MFIA 4KKOB 2G1DA 1NJIT 1X5PA 1N54B 4DR7J 4MKAA 3JAMU 2DR5A 3K0JA 2UUAF 3TYTA 1NK7A 4CNYA 1R0AB 3HHEA 1YRXA 2FHKA 3A8EA 3D6MB 4G65A 4HDHA 5IQQA 1DTTB 3BGOP 4IOBA 3LOUA 1SJQA 2KXHA 4I7FA 4IG0B 4HHHA 1NZ8A 2I2YA 2IVMA 2HQGA 3BGLA 2XS7A 2WONB 4CI0B 3ELHA 5MAOA 1XERA 3C6TA 1FJGF 1S97A 1SQGA 2WB4A 5HAOA 2BQUA 2C42A 5E3CA 3US5A 5AE2A 1VHFA 2A0FB 4ZIVA 4F4ZA 4CLTA 3DXBA 5ETPA 4CYUA 2W2QP 2ZJPQ 3MMBB 4RW9A 1IKYA 3SI8A 2QGFB 3QLHB 2RUGA 1JXVA 2Y3YA 1TK0A 4LQ3A 2GMLA 4I68A 4AL7A 1CVJA 5BR8J 4ECWA 4B3RJ 1LFWA 3WDOA 3KJFB 2ZFHA 3JSRA 2VKZG 1NUEA 1T02A 5CD4H 1OWXA 1WEYA 3K7RA 4WK3A 2RQ4A 2QA1A 2WVDA 2Z2ZA 4PR6A 4KBIA 1MMDA 2H9ZA 2F8MA 3RR8A 2D9OA 3KHGA 2Z2MA 3B4DA 3HVTA 3I56S 1YJTA 4QCLA 1F6TA 5IWAJ 1RADB 2EVZA 3OXFA 3HK2A 4DL2A 4PKDB 3GWCA 1N32J 2RKIA 2WAQD 3GTYX 2VKRA 1Q7YT 1VQ7S 4KFBB 4LFBF 3J7ZT 3F0NA 2D74B 4W4MA 3TANA 4IG3A 4LFAF 3DKDA 5DZ7A 4CT9A 3KLIB 1RK8A 2CPEA 2YX1A 4R0JA 3VV2B 3OR2A 4PCQA 2FPHX 3P4UB 3CC4S 1S0VA 4NCGB 4IRDA 1C0UB 4IRCA 4OZ0A 3DMJA 3N6LA 4Y2CA 3W62A 1PJ5A 5GAGU 3AD7C 3RW7A 2ZH1A 3OFHA 1QE1A 2FJVA 1S7IA 1SV5A 4K0KJ 1N88A 3H0PA 3M30B 3Q8PB 2RVJA 1OQ6A 3PHTA 4JV5J 2OPPA 4PG7A 3R7BB 1CQNA 1FXLA 1TUWA 3MEEB 2E7WA 2DGSA 2ZNYA 3MPVA 1J5OB 2HNZA 3K57A 1N36J 1U49A 4LF8J 3KK1A 1H3DA 3NNAA 4W92B 3I0RB 4ECRA 2OO4A 5A2QY 4B02A 3P3DA 1WNEA 4DSKA 4KH1B 2Y8YA 2I6WA 1N34J 5LMNJ 4BBYA 5H9EJ 3VAHA 1PYSB 2QLFB 3BSOA 3W5XA 1UJ6A 4XIUA 2E1MC 2XMVA 5HI7A 3CJTA 4Y2MA 6FDRA 5KFNA 1IKVA 2FC9A 3I9V9 3TX0A 4NLSA 3RZAA 1RT7A 1WC6A 5AJ3J 1UETA 4ZPWR 3H5YA 1X31C 5E33A 1RAOA 1GMWD 1Q81T 1KEKA 3QT8A 1LQ9A 2LXFA 1SB6A 2KT5A 3CCMS 4XPEA 3ETOA 3RRKA 3BGRA 2VBYA 4ERDA 1HBMB 2B9WA 1LXJA 4DX6A 2J7UA 4ZP9A 2KB2A 2LQBA 3DGPB 1VHIA 4C7QA 2Q66A 4TKTA 4F50A 1FFGB 1SUQA 2BABA 2ZOGA 3MFHA 2CNNB 2NZ4A 4PWWA 3CMES 3U1LA 3BR9A 3FCWA 2AGOA 5IT4A 3DM2A 4CQ1A 3BJYA 2GIFA 3AQOA 4WCEQ 4ZVOB 3PHEA 5DS7A 2DH9A 2JHEA 3G6XA 3TUZC 3FBBA 3BO3A 2JEFA 1U2FA 2DYAA 2X1AA 4DR6J 2Y1LB 4I69A 1DAXA 3NOCA 5GAHI 4H54A 3M32A 2EXUA 2FHJA 1APSA 1GEHA 3AFGA 5KG2A 3C3LA 3IN5A 1WF1A 4YN3B 4OYAA 2KI2A 2RDDA 2HVIA 4I2QA 2V9WA 5F8NA 5LXYA 2DPIA 5KFBA 3MUVP 3BN4A 5G0RA 1UL3A 4XDDA 4QJVA 1O6XA 4MYUA 3M2VA 3J7YI 3R2DJ 1S9FA 1N48A 2V0NA 3HCXA 4P10A 1JLEB 2HNDB 3GQCA 1HARA 1YSJA 4FYDA 3L7PA 1MWQA 1TTHB 3QBCA 2QZ8A 3ILJA 2DIUA 2MHEA 3C46A 4QIVA 2AEJA 2Y0BB 4O0IA 3LP2B 3QO9B 4GC7A 3CD7A 2QTWA 3HULA 3ONQA 2N82B 5KFWA 3A13A 2Y1JA 4KGZB 3JB9k 2HW3A 2WSEC 1S49A 1WEZA 4ZPBA 2ZUAA 3IP0A 3M2UA 4PYDA 1F1BB 1JJCB 2F1FA 1MN9A 3SV3A 3JSMA 2UZAA 4Y2KA 1QTMA 3K59A 5C24A 3OT9A 5T7LB 4JBCA 5FJ4A 2VC1A 1KP6A 3M8QB 3G87A 2CQPA 4ED6A 5HL7Q 2IRYA 3OL7A 2AKWB 3H42A 2IMOA 4WE1B 4RBUA 1E6YB 4YR0A 3CUNA 4X4SA 2VA3A 2OLWA 1ZM2A 4KRWA 4Y2IA 3RUBL 3LO3A 4OZJA 1VS3A 3CCUS 2YKMB 1WI8A 3VAKA 3A1YG 1Z2LA 1SIWB 4X65J 2Z8QA 3GCWP 2QA4G 4ZHRA 3CVKA 2YNFA 3PRVA 2YVSA 3VAFA 2NYIA 1WTBA 1O5JA 4NLPA 1TL1A 3QRPA 2UUWA 1IR0A 2Y8WA 2XMMA 4PQUB 3ENWA 4MKYA 3MMCA 1JQGA 5KFLA 2QO3A 3O6QA 4J9RA 4AL6A 2HHPA 3KJQB 9RUBA 1QTNB 1AZSB 2A3JA 2OEKA 3MF5A 4M5LA 4C8OA 1B7FA 4RUHA 3RBDA 2CIMA 2UU9F 4LQ9A 2C1EB 1RWWB 2VV5A 1B0VA 1S72S 2ACMA 4TN2A 3KFWX 1ZBTA 2AQ4A 2OTLS 3KKFA 1S6PA 3QT7A 3GLJA 3TI0A 2QX0A 1KVJA 1NPRA 1RWUA 4QW9A 3PW5A 1N56A 3DLEA 3G9CA 5KFCA 3BB5A 4OHWA 4ZVPB 3TVZA 2LFVA 5I3QA 3HHKA 1WTFA 4ED2A 5T41A 2SXLA 3H25A 3PJWA 2MY7A 4I6YA 3R27A 5JVGQ 3DRSA 3FMWA 2GW8A 4ECZA 3X3UA 2IA0A 4HYKA 2HFUA 3OW2R 5DGAA 1D1UA 5CHCB 3V81A 1HFEL 1T03B 2GVZB 4KV8A 4J9UE 3BQ2A 2CJKA 1HR0F 1M5VC 1KHVA 3M8YA 2LP4A 2YWEA 4C0BA 2OPRA 2AF6A 2MPUA 1Q1KA 3SCKE 4CWBA 3IM8A 3SBMA 5CABA 2R7QA 2LXIA 4J9KA 4I6AA 2E1CA 3O3LA 4MK7A 1U1OA 3SMZA 3BN7A 1TAUA 7FD1A 3FFIA 2IAJB 1TQLA 4R8UA 3WHIA 5A8KB 3LF0A 2FIUA 1RT2A 1HD0A 2WSCC 4NYOA 1LWEA 4I1TA 4K5RA 4QWBA 3MR2A 4DV2F 3NGTA 2CQ1A 2OPSB 3NBPB 2GVDB 3GG0A 2LYVA 4TY9A 1UZHA 4ELUA 3IXQA 2CNKB 2PC6A 1NRKA 1RWPB 3WIVA 3ZFVA 2GAHC 4R5PA 4TU8A 2WW4A 2D9PA 2BE2A 4ZPDA 3G4SS 4CLLA 2J0WA 4WIQA 3ZO7A 4DR4F 5IT0A 1HNXF 1R0BG 4CO3A 4IFYB 5L1JA 1YRTA 2RHSB 3T5HA 2JEJA 1ZA1B 3GFHA 1VQ5S 3OFEA 3QGGA 2OSQA 1ZM9A 3UNGC 2D69A 1FWPA 2OEJA 1F9FA 4USWA 2XMJA 4H4OA 3D9BA 3HZGA 2P5VA 2QMUB 1BQMA 5A76A 1WORA 2HLUA 4FYVB 1AW0A 3HPOA 3KLHA 2CKWA 1QD1A 5RUBA 3IG1B 4LSNB 4WFZA 2OPQA 1UFLA 1FTRA 4HR2A 3C16B 7FDRA 3CJ2A 4OYWA 1IM4A 1CSJA 1FESA 1IBCB 3LP0B 1V5IB 3FSYA 4OL8A 4IUFA 5KFSA 3G6YA 2XZWA 4M95A 2JWNA 4F36A 2E7VA 1OJ4A 1E6VA 1SL2A 1FRKA 2E1PA 3W2VA 2UUAJ 3KK2A 2GZOA 3MPUB 4ZJQA 1XR7A 4DSLA 2V69A 2XNQA 4DSEA 3SQGB 3Q2SC 3FBEA 3EXCX 4NA3A 1HNZF 1TL4A 4WK1A 4DI6A 3P45B 2XS5A 3CD5A 5D4NA 3TJAA 4CLFA 3EX7B 1UWBB 3GYGA 1ZETA 1FJGJ 3UN3A 6FD1A 2VOPA 3HHNB 2E9ZA 3K2YA 3QNWB 1YBTA 3AAWB 3CO9A 4ECVA 4DV0F 1FK9A 2YXLA 3MR6A 2OHDA 1TL3B 3ILIA 4QOTA 2DY9A 4OZ3A 5I3UB 1XR5A 2W4DA 2W9CA 1TV6A 3MCNA 4O3PA 4IFVA 3MMAA 1Q8BA 4N8NA 4TQSA 1U24A 2AGPA 2JDJA 4PPZA 3K5OA 5DG7A 4NLXA 3GP9A 3GJTB 2J7WA 3D0IE 4V19X 2ABYA 3PG9A 5CZXA 1RTIA 3BDPA 3TRGA 1S9GB 2RDJA 4UY8T 3GIRA 2F9JA 1HQEB 2YNIB 4B3OA 4PUOB 1RAFB 1EZZB 4U9RA 2VA2A 2IC3A 2I0XA 1NXIA 3AA9A 1D09B 1KBRA 1CJVA 1QJHA 5DLGA 1Z2ZA 2RIJA 3I32A 3ISND 2XLJA 3H40A 4G1QB 4LFBJ 3KNAA 1Q53A 2FD2A 1XQIA 1RQ0A 3HO1A 1FVQA 2ZHOA 1HBUA 2JJ4D 3KUHA 2VL1A 2QA2A 3DOMA 3NS5A 4JI1F 3B8HA 2EEYA 4LFAJ 1FA0A 1ZM3A 5KG5A 2DR7A 2HS0A 2KFNA 2VBZA 3CNQP 2IBKA 1LW0A 1FDAA 2MSTA 1LK5A 3AXKA 1NPKA 3DI6B 4QWDA 4DL7A 3MPYA 4B3TF 3LQVA 1BGXT 4Y2AA 1KVIA 3D6HB 1QM9A 2FYXA 2BBEA 2C3MA 2ZWOA 2Q1LA 4F0KA 3NGKA 5J2MB 2QLWA 3NGDA 3MWBA 1PKUA 5KG7A 2VUGA 2PT0A 1UAWA 5A6WA 5JXSA 3GSIA 4LSLA 2BJ7A 4H4MA 4DR5F 2MKKA 4OQJA 2AD9A 4USTA 4ED3A 2F4FA 1FDNA 1IXKA 1DQ9A 3KLGB 4LF4F 2M7SA 2VG5A 1WDDA 4RO0A 3FMBA 1NK0A 3HFKA 1D8YA 4DU7A 1UTAA 2IM1A 4JI3F 4DDFA 1GXUA 2VFTA 3EZOA 5C42A 3ULHA 1TKTA 3MTJA 3IGVA 3NWRA 2YKPA 3W9HA 1FWKA 2FHOB 4HT5A 2PFFB 4Y34A 5IM0A 2ZH2A 2DCLA 4NLWA 1WWHA 3PX0A 4HH0A 1RKJA 3HI9A 2PEBA 5IV4A 3CO0P 2C28A 3TAMB 2CQCA 4F4WA 5E2QA 4P75A 2HURA 4WXOA 3MUMP 2ZJQQ 2XZTB 2FLPA 5B7WA 1FKAF 4IR1A 2ZZNA 4MIAA 2VF3A 3IR6B 3PX6A 2YNHB 2ZZMA 3M7VA 1VISA 3HSJA 2WBRA 3J80U 3R7NB 1S99A 1S7HA 5D15A 1GH8A 1AA1B 1SKRA 3TO8A 3CEDA 5FLXU 1VLYA 2JEIA 1U1MA 3QIPA 1HQUB 2IDLA 4RUAA 3G96A 4A4JA 4HHUA 2J9DA 2PA8D 2N3OA 3P5TL 1N4LA 3Q8VA 4LMZA 4CM0A 5K9FA 4PWDB 1HWLA 4DZDA 3V6JA 2KG1A 2IHR1 4RNFA 3KWMA 4DG1A 1S10A 3FEXB 3I5CA 4CRJA 2E29A 4MKVA 4J9SA 5B0DA 3VVUA 1T9TA 2XGPA 4KO0A 2C3OA 4WBFA 3FCVA 4KT0C 4A8OA 2YPYA 2I5JB 3SSQA 3SCLE 2NSBA 2AYEA 4F3MA 2JLFA 2YWFA 2LEBA 4A8KA 4ID5A 3PR5B 1H72C 4WZMA 5IZHA 3HKZD 1YJNS 2GMJA 2G1HA 1SQEA 1HNIB 1FFWB 4TVAB 4U7UK 1RT4A 4DV5F 3UFCX 2NXNA 1RT6B 1PC5A 5A0YB 4NLQA 3D7SB 1FO1A 2P6SA 3N5BA 3LWMA 5E41A 3O5TB 1FERA 5GAEU 1T05B 3CJ3A 3ICLA 2NPIA 4DPUA 3D0HE 3MMJA 4U7CA 3HHLA 4FPRA 3DRRB 4DS5A 1CULA 4QU6A 1S1TB 3FZ2A 1R7IA 2AJ4A 4DV1F 1RWOB 3EMTA 1H2TZ 3UCZP 3FKBA 2EKNA 3N5FA 3RB4A 3OVAA 3QAEA 2R7XA 4YB7A 3PYDA 4K4SA 1PO6A 4OMFG 4Z2XA 3H2LA 4LF6J 4RW4B 2L9DA 2ROGA 2CVEA 4MFBB 1BY9A 3T5KA 1RABB 5F3TA 3I4HX 1RWVB 2YX4A 2H1YA 3V4IB 2FJAB 2DEJA 2IYGA 5KG4A 3TVKA 4EYIB 1C1BA 1OSDA 2QJ3A 1NJXA 4K4VA 3HDSA 2IJNA 3R5JB 2DNRA 2EG1A 1REVB 2EPIA 2K1RB 2U2FA 3BPDA 2B9XA 2DXDA 2IBOA 1LEOA 1X8DA 2ZBRA 2AMCB 3KXDA 2CPFA 3BREA 3IO1A 3W7BA 2GFFA 4UQGA 5SUHA 2PN6A 3ET6B 2B9EA 3TQ1A 4ICLA 1Y9OA 3R6GB 2UUCF 1NK8A 2MMYA 4EZ6A 5B09A 5HBMA 4LF7F 2DGXA 3HFZB 1NBEB 3ZTRA 4IKAA 1JX4A 1NH7A 1WC0A 1HBOA 3TUIC 3CCWA 3CDEA 1G2EA 3R7SB 3QZ8A 4Q2LA 4KYZA 1KN6A 5KFIA 2KU7A 2BXJA 4RBVA 4DPWA 2UU9J 1OIAA 4GKJJ 4Q8EA 4KPCA 4QPXA 3G82A 3VZIA 2KHCA 3G71S 4FBUA 1D9DA 2HZVA 4A47A 2FJWA 3W8PA 3DYAB 1T0TV 1V3RA 3PW2A 1UVLA 3MPWA 2V8VA 3V5RA 3T6BA 3CDAA 4JV2A 4NLGA 3FCHA 5GMDA 1YK9A 2KT2A 3UDEA 1VI7A 1P9YA 4I2PB 1B70B 1C4CA 1Y7PA 2YH1A 3EZUA 3Q23A 1IKXB 1MMLA 2EFPA 4OZ2A 1QVGR 2DGUA 4DV3F 3U27A 1LK7A 2BKOA 5DG9A 3BSNA 1HR0J 3AH6A 4FKXA 3QQCD 3THPA 4AXJA 2V2VA 2K8GA 1HHQA 1DJ0A 1FJCA 5HK4A 1RYRA 4WTOB 4K59A 4UZBA 3I96A 4K5SA 2KT3A 1I6JA 2DNGA 2HQDA 2CQDA 2C3UA 4P2SA 4V1Ak 3PW4A 4NZ0A 4PEOA 5FIIA 2V68A 2AW0A 3RRGA 1FKPA 4DV2J 2V94A 3GV7B 4P71A 3M6XA 4NA1A 2WB1D 1TVRB 4ZPVR 1J5EF 2MJNA 1NMEB 1S6OA 1X7VA 3J7Z5 4RZRA 1GMUA 3QIDA 2G2ZA 3SEOA 1UEKA 5K8NA 3KJVB 1WHWA 1RZMA 2C2KB 2BRKA 3CDBA 1IJFB 4QR1A 1NJYA 3A12A 1LWXA 4IQXA 3OXLA 2CPDA 2GJ2A 3KK3B 2BOPA 4EFAC
chains in the Genus database with same CATH topology
1RTHA 3AB2B 4IOBA 2L3MA 3BS9A 3LOUA 3UCGA 1SJQA 2KXHA 4YQWA 2HHWA 2DGOA 4I7FA 1X5SA 5C5JA 4QR2A 1RT1B 3ISZA 4IG0B 3KOAA 2JC0A 3I87A 2I2YA 2GQQA 1SH3A 2IVMA 2XO7A 4YP3A 2O01C 2P9GA 3UD3P 3BGLA 4FS1A 2XS7A 4HVZA 2WONB 4CI0B 4WFAQ 5MAOA 1XERA 3C6TA 3RBEA 1FJGF 2XULA 1S97A 2CQ2A 1WELA 2W24A 2POKA 1F0XA 2DITA 2WB4A 4V19J 2P9EA 2BQUA 2C42A 4RNHA 5E3CA 4BDPA 4NLOA 3US5A 4ALZA 5AE2A 1VHFA 3EUNA 4WFNQ 4F4ZA 3E2EA 2KYXA 3THTA 3OQ2A 5KFEA 4PG4A 3DXBA 3NAIA 1JLQA 3DNCA 5AXLA 1YI2S 1C4AA 3MECB 3T3FA 3KLEB 2W9BB 2R8JA 1GAOA 4F4XA 1KQSR 1H6KX 1UVIA 4KFBA 2W7OA 3DOLB 1HWIA 3H2VE 4HL9A 5KT3A 2HHVA 4WU2A 3M8SA 1VQ8S 2BM1A 2BQRA 2ZJPQ 4B9UA 1FKPB 2JZ5A 3M8PA 3MMBB 3QGIA 4RW9A 4O44A 4EBDA 1IKYA 2FLLA 3SI8A 3QLHB 2XY5A 2RUGA 4MK8A 2QMXA 1TK0A 4ZS6A 4LQ3A 4DHVA 5LJ3Y 2GMLA 3ZZRA 4I68A 3AHPA 4AL7A 1CVJA 2KZZA 4N47A 4ECWA 1AUDA 4UUWA 1LFWA 3KLIA 4YB5A 4ZK7M 1S1UB 3WDOA 1ZTTA 2J9EA 2ZFHA 3JSRA 2VKZG 1XNRF 3BGFA 4NRTA 1T02A 5CD4H 4JI2F 1OWXA 2DNLA 2ZKTA 2E5HA 2FVQA 4MIWA 1WEYA 3FZBA 5CZVA 5L1IA 3IC1A 2HGMA 5J1PA 2M70A 3K7RA 1AXQA 4WK3A 3MI7X 4ZPTR 1TFYA 1JLCA 4NCGA 1NK5A 1CQMA 3ZZOA 1RP5A 3ENQA 2RQ4A 3F44A 2QA1A 1RTHB 2R7TA 3OPKA 4GKJF 1YVFA 1K0TA 1C0UA 4PR6A 4I7FB 1VK8A 4KBIA 2GO9A 2XMUA 2J9CA 5CYJA 1MMDA 3RB6A 1XMQF 1AROP 3BR8A 2H9ZA 1KFSA 2F8MA 2KDOA 2MKIA 5JJBA 3RU0A 3RR8A 2J76E 2D9OA 3KHGA 2Z2MA 3B4DA 4QQBA 2W9AA 1M5SA 4PRFA 2QLXA 4B9SA 3UDLA 4AE5A 3C6TB 3O44A 2NS1B 2OD4A 3HVTA 2CQ4A 2RQMA 3I56S 1YJTA 2F40A 3MM9A 4QCLA 4C8NA 2MKCA 4NLRA 1NB7A 1I1GA 3H59A 3HP6A 2DB1A 5EGYA 4ED1A 3M30A 1FNMA 1H98A 2EVZA 1NKEA 3OXFA 4TYAA 3HK2A 1L3KA 4DL2A 4DL0C 4PKDB 3GWCA 1NK9A 2RKIA 5SZTA 5HMZA 2DR9A 2WAQD 1JLQB 2VKRA 1SJ4P 3IWXA 5F41A 3VF0B 1Q7YT 1FJ7A 5C25A 3OBIA 3FEZA 1VQ7S 4KFBB 4LFBF 3J7ZT 3MEEA 2PMZD 3M8PB 2D74B 4RW9B 4O44B 1IKYB 4ZP7A 2HS3A 3H5XA 4YUDA 1J5OA 1VQ4S 2YKQA 3TANA 5KOWA 1FJEB