3DOLB

Crystal structure of l100i mutant hiv-1 reverse transcriptase in complex with gw695634.
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
427
structure length
405
Chain Sequence
b'IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKDSTKWRKLVDFRELNKRTQDFWGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase/ribonuclease H
publication title Structural basis for the improved drug resistance profile of new generation benzophenone non-nucleoside HIV-1 reverse transcriptase inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Transferase
total genus 107
structure length 405
sequence length 427
ec nomenclature
pdb deposition date 2008-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3dolB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dolB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dolB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3dolB03
4B3OB 3IGNA 1TL3B 2GC8A 3DRSA 3NAIA 4MIAA 2AQ4A 4LSLA 4I7FB 4J9LA 4ECWA 1C1BA 2BQRA 3V81B 2ILYA 1DTTA 2IC3A 4H4MB 4O3RA 3MR6A 4WYWA 1RT6B 3DDKA 3N6NA 4IKAA 5KG0A 2WONB 4RW9B 3GIMA 3H4DA 4DL2A 4K50A 1FKPB 3ISNC 5KFCA 2DPJA 4URQU 5KFEA 5F8GA 1S1XA 2YNIB 4MFBA 5K14B 3Q8SB 3ISND 2AWZA 4G1QA 3NGDA 3KHRA 3T5JA 2OPRA 4DL3A 1UWBB 5CYMB 3DI6A 2FJVA 3PW2A 3LALA 1TVRA 4MKAA 5L1JA 2WOMB 4H4OA 5KT7A 3M9NB 3DLKA 4KSEB 5KG1A 2AGOA 4PQUB 3M9OB 3V6HA 2OPPA 5F8HA 1LW0B 3IG1A 2RDIA 2E9TA 3OHAA 4NLWA 1K1QA 3MEEA 4RW7B 1QE1B 4QWAA 4IDKB 3H5XA 2E9RX 3DLGA 4R0EA 1SH2A 1TKZA 1TP7A 2GIQA 3BJYA 1JLFA 4J9NA 2OPSB 3DOKB 3DRPA 3OLAA 4Q8FA 3PW5A 1S10A 1JLAB 5J1EA 2D41A 2WK4A 1RTHB 2JC0A 3CJ4A 3KLHA 2HMIA 3CJ5A 2ZE2B 3CIZA 1KLMA 1HNVB 1RTIB 4H54A 1SH0A 3C6UA 2XGQA 3BSCA 3HVWA 5KFSA 4FBUA 3JSMB 1HNIA 3RB4A 1MMLA 1RT7B 4O44A 4TN2A 1HMVB 4KO0B 5KFOA 3I0SA 4IFVA 1VRTA 3MEGA 4NLOA 3UPFA 1HQEB 2RDJA 2RKIA 4TQRA 2VG6A 4TYBA 3KHLA 3PZPA 1JLCB 1S4FA 1RT2B 3KNAA 2VA3A 3KMSA 5EWGA 5C24B 5L9XA 5DQHA 5HLFA 2QE5A 1RTDB 3OL6A 4QWBA 4RW6B 2XCPA 3JYTB 1RT4A 1RYSA 3E01B 4F4WA 5JUMA 3M8QA 4HKQA 1S1UB 3CJ0A 3QIPA 1BQMA 1S6PB 2BE2B 1XR7A 5KG3A 4IRDA 2BQ3A 3VQSA 3KMQA 2HNYA 3NL0A 4ZPCA 4NLVA 3IN5A 1S1VB 3SFUA 3PR5B 5HBMB 3GYNA 1SUQA 1YVFA 4R8UA 2V9WA 3V6JA 1EP4B 3IS9B 1JLQB 1R0AB 1DTQA 4ZP6A 1C0TA 3KLGA 5C42B 3M8PB 3NBPA 2BRLA 5KFYA 4Y3CA 3G6VA 2XI2A 4GC7A 1FKOB 1TKXA 5DLGA 4RZRA 3QZ8A 2YNFA 1IKWB 1HQUA 5KG5A 3BSNA 2XI3A 2V4QA 5J2PA 2VG5B 3UR0A 3BGRB 3HVTB 1S9EA 2YNHB 3C6TB 3LP0B 1HYSB 3GIKA 1DLOB 3DRRA 4KFBA 1REVB 5KFQA 3KLIA 3DYAB 4ECYA 3PW4A 4LSNA 5EWFA 4NCGB 4Q44A 3OHBA 1CSJA 1JLEB 5F8LA 2FVRA 3KLEA 4MH8A 2IM1A 1JKHA 2IMWP 2R8GA 4K4YA 4MK7A 2FLLA 4Q45A 5KFXA 5I42B 3N6LA 4IFYB 2YKNA 1SV5B 1LWFB 4Q0BA 4NLXA 3RAQA 3OL8A 4MKBA 3QO9A 5DLFA 3I0RB 4QW9A 1IKYA 3V4IB 2JLEA 4DL5A 3RB6A 4XPEA 4WZMA 4F50A 1IKVB 3KJVA 2HAIA 3H40A 1D0EA 4WXOA 5KT2A 3T1AA 1RYRA 4IH7A 5L1IA 5F9LA 3RB3A 3KOAA 1TL1B 1N6QA 4IH5A 3TAMB 4RW4B 1S6QA 1RT3A 3LP1B 3H5SA 5DG7A 5JXSA 2EC0A 2ALZA 3FSIA 1IM4A 4J9PA 2OPQB 3CWJA 4U6PA 4J9QA 5I3UA 3OSPA 4O4GB 4WFYA 1RTJA 3E51A 4URGA 2E9ZA 3LP2A 4IRCA 5HROA 5L1LA 5DQIA 5KFAA 2W9BB 4J9RA 1RA7A 4TLRA 2FVSA 4YR2A 4ECXA 4Y2AA 2IBKA 4F4ZA 1EETB 2YNGB 2JC1A 1LWEB 4ID5B 3Q8RB 2R8JA 3V6KA 2HNDB 4ZVGA 2JEFA 2C2RA 2IA6A 1RT5A 1QUVA 3RAXA 3H5YA 1S1TA 1S9GB 3BR9A 4LQ9A 3CDUA 3FQKA 3SFGA 5KFKA 5CYQB 4I2QB 1T05A 3CO9A 2IJFA 4TY9A 1HPZA 3DMJB 3IRXA 2WHOA 3GV7B 4B3OA 5KFZA 4PUOB 2VA2A 1TL3A 1RAJA 4DL6A 3MEDB 3EPIA 3Q8QB 4RU9A 4I7FA 1S97A 5DGBA 3V81A 1S9GA 3ICLA 4ZMMA 4X2BA 4ICLB 4H4MA 5J2MB 4K4TA 4GC6A 1MU2B 1RT6A 5J2NB 3EPGA 2WONA 1HARA 2ZD1B 4RW9A 4JV0A 1FKPA 3KLFB 4O3PA 2UUWA 2J6UA 1S9FA 5F8JA 2YNIA 5K14A 5J2QB 2FVPA 1UWBA 5CYMA 5KFTA 4TYAA 2BANB 3MECB 2O5DA 4O3OA 3M9MB 2WOMA 5HP1B 1LWCB 5KT4A 3DM2B 4PQUA 1WNEA 4NRUA 2J6TA 1LW0A 2DPIA 2B43A 4RW7A 1QE1A 4ZPAA 1N48A 4IR9A 4IDKA 1FK9B 4NLTA 4EBEA 3PW0A 3DLEB 2UUTA 1N4LA 3GV8B 3V6DB 1QAJA 4RNHA 4ZPBA 2ILZA 2BQUA 4NLSA 2OPSA 3DOKA 4ZVEA 1JLAA 4YQWA 4ZHRB 1RTHA 4TY8A 3OSNA 2I5JB 4J9OA 4QWCA 4WXWA 4K4ZA 3QLHB 1IKXB 5KFGA 3CJ3A 1TQLA 3QGHA 2ZE2A 4KHMA 3EZUA 4K4WA 1RTIA 1HNVA 1D1UA 3KK1B 3JSMA 3UQSA 3KK3B 3GILA 1RT7A 2XCAA 1RT1B 1HMVA 4KO0A 4WFXA 4NLUA 4ECZA 3UDLA 1HQEA 5KFIA 4DG1B 3PW7A 5C25B 4Q8EA 1JLCA 2VG7B 2ATLA 4ZVFA 1RT2A 4IH6A 4KB7A 2V0NA 2AX0A 1S0MA 4ED0A 4ZP7A 5KFHA 3RB0A 5C24A 1VRUB 1ZTTA 2HWHA 3PHEA 4IG3B 2XC9A 1KHWA 1RTDA 4O3SA 2FLPA 4RW6A 3BSOA 4EYHB 3JYTA 1KHVA 4NLDA 3D5MA 3E01A 1T03B 3TVKA 2FVCA 4RNFA 4WE1B 5DG8A 4KKOB 1S1UA 3KHHA 2D3ZA 1S6PA 2BE2A 1JLBB 2CJQA 3I5AA 4MIBA 3G6YA 4K4UA 1S1VA 4RW8B 4NZ0A 5HBMA 1J5OB 4ED1A 2F8EX 2WCXA 2B5JB 1EP4A 3IS9A 1JLQA 1R0AA 5KT3A 5C42A 3M8PA 1XR6A 4IG0B 3OL7A 1FKOA 4KE5A 2YKMB 5DGAA 2XWYA 3LAKA 3MFHA 1IKWA 4QWEA 2WTFA 2GIRA 3I5CA 4PWDB 3KK2B 5KFPA 3PR4A 2VG5A 3BGRA 3HVTA 2CKWA 2YNHA 3C6TA 3LP0A 1HYSA 3QGGA 4K4VA 1DLOA 4G3IA 1C0UB 1REVA 2J6SA 3DYAA 5D3GB 3BQ0A 4NCGA 3I5BA 3DOLB 2W7OA 1S0OA 1JLEA 2IM3A 1JLGB 4XPCA 4Y34A 4RUAA 4NLRA 5I42A 4MK8A 4WYLA 1BQNB 2B6AB 4IFYA 2HNZB 1LWFA 1SV5A 3H2LA 4ED8A 4IR1A 1LW2B 3I0RA 3V4IA 1C2PA 2UVUA 1IKVA 4JV1A 4OL8A 4ZP8A 3NAHA 4J9KA 4ZP9A 1RA6A 1TL1A 3FFIB 2UVVA 3TAMA 4RW4A 3T5LA 3LP1A 2B6AA 1GX6A 5KFFA 1QAIA 2R8KA 2OPQA 2W9CB 3OL9A 4NLPA 4I2PB 3ITHB 1TKTB 4O4GA 5DQGA 3MR5A 4J9SA 3N6MA 5KFMA 3BQ2A 4KAIA 4ED7A 4DL4A 2JEIA 4R5PB 4YMEA 4O4RA 4FS2A 3LANA 4F4YA 1S1WB 5FDLB 2W9BA 4TY8B 5F8NA 3H59A 2JEJA 5KT5A 1EETA 2YNGA 3DRSB 2R2TA 1LWEA 4ID5A 3D28A 4LSLB 3MTKA 1C1BB 2HNDA 2ZKUA 4IRKA 1DTTB 2IC3B 3IGVA 5F8MA 5T14A 2W8LA 2W9AA 4YR3A 2BR0A 4ECTA 1S1XB 5CYQA 4I2QA 4MFBB 5KFWA 4G1QB 2AX1A 3FRZA 2OPRB 3DMJA 2OH2A 3GQCA 3DI6B 4IQXA 1TVRB 4PUOA 4H4OB 4NLYA 3DLKB 3MEDA 4RNNA 2R2SA 2IM2A 2OPPB 1S0NA 3IG1B 4ICLA 2FJWA 5J2MA 2FJXA 3MEEB 3PVXA 3KLVA 1OS5A 1MU2A 3MF5A 5J2NA 3FDSA 2ZD1A 5KG7A 3DLGB 3KLFA 3T19A 4O3NA 1TKZB 4EBCA 5J2QA 1JLFB 2RF2B 1U09A 2WB4A 3DRPB 4NLQA 4JUZA 5J1EB 4KBIA 2BANA 3MECA 4DL7A 2FVQA 5HP1A 1LWCA 3QYYA 4TXSA 5KFRA 3DM2A 4Q43A 4ED3A 2C22A 3KLHB 2HMIB 3LAMA 4YP3A 3PJXA 3RBEA 1KLMB 2V4RA 4EEYA 3C6UB 1HNIB 1FK9A 4Y2CA 3CDEA 4ED6A 3GIIA 3DLEA 2RF2A 4O44B 2IJNA 3QGIA 3NMAA 3V6DA 2AU0A 3TQ1A 3T5HA 3I0SB 4IFVB 1VRTB 3MEGB 4QWDA 3G6XA 1NNDA 2AGQA 1C1CB 2RKIB 2VG6B 5EDWA 3MR3A 4K4SA 4ZHRA 2R2RA 5KFBA 2I5JA 2XGPA 4HYKA 1I6JA 4ECRA 3QLHA 1IKXA 5F8IA 4ED2A 1ZETA 1ZTWA 2UVRA 2QV6A 4LQ3A 5KG4A 5HLFB 5EWEA 3KK1A 2IAJB 2ASJA 4ZPDA 2R2UA 3KK3A 4YR0A 2W8KA 1RT4B 1RT1A 4XO0A 4ZVHA 3HKWA 1C1CA 2HWIA 3G86A 3H4BA 3M8QB 2I1RA 2ASLA 4DG1A 5F9NA 3CJ2A 3QIPB 1BQMB 5C25A 2VG7A 2HNYB 1HPZB 4TQSA 3KHGA 4FS1A 2IM0A 2IAJA 4ECVA 3BSAA 1SUQB 4R8UB 5DG9A 1VRUA 5KG6A 1N56A 1DTQB 4IG3A 1SH3A 1C0TB 3SI8A 3KLGB 5EUHA 2R8IA 3NBPB 1N5YB 3T5KA 4NRTA 4NLGA 1T03A 1TKXB 5KFLA 3CDWA 5KG2A 4WE1A 4KKOA 2YNFB 1HQUB 3PJWA 3FQLA 5C5JA 4K4XA 5J2PB 1JLBA 1S9EB 4RW8A 4F4XA 3DRRB 4KFBB 1J5OA 3Q8PB 1N5YA 3KLIB 2B5JA 3HVAA 4U7CA 4LSNB 3H5UA 4QPXA 4RNOA 4JV2A 5KT6A 3KLEB 1K1SA 1T94A 1JKHB 4IG0A 2C28A 2YKMA 3QIDA 2FLNA 2YKNB 4Q0BB 4PWDA 3KK2A 3QO9B 1JIHA 1IKYB 1Z4UA 2BRKA 3KJVB 1JX4A 1C0UA 5KFVA 4KHRA 4ECUA 5D3GA 3GV5B 4O3QA 3DOLA 4NYZA 3H98A 2W7PA 5KFJA 1N6QB 1T3NA 1S6QB 1JLGA 4M95A 1RT3B 1NHUA 4URSA 4EO8A 3RBDA 1TV6B 1BQNA 2HNZA 5I3UB 4FBTA 1RTJB 1NHVA 1LW2A 3LP2B 5KFNA 4ECQA 2C2DA 5HROB 4ECSA 1S48A 3HHKA 4WFZA 3BREA 1RDRA 2JEGA 4EYIB 3BQ1A 1GX5A 2D7SA 4DEZA 3MR2A 3NKYA 3FFIA 3MFIA 1TV6A 4KV8B 3QZ7A 2ASDA 4EO6A 2D3UA 5KFDA 4RNMA 1JXLA 2UVWA 1S49A 2R8HA 4J9MA 2AGPA 1RT5B 3GIJA 4WZQA 2W9CA 1S1TB 4IOBA 5KFUA 4I2PA 3ITHA 1TKTA 4M94A 2WRMA 4MK9A 5L1KA 2C2EA 1W25A 1XR5A 4QW8A 4R5PA 3OLBA 4EBDA 3CVKA 1T05B 4RUCA 1S1WA 5FDLA 3IRXB 4KV8A
chains in the Genus database with same CATH superfamily
3IGNA 2RNEA 1VQ7S 1BHNA 3DDKA 4C2MA 1X4AA 3JQJA 4AL7A 1DURA 4URQU 5KFEA 2YNIB 4MFBA 1I94F 1V3SA 3Q8UA 4USWA 2AF6A 2HS3A 3PRDA 1KOHA 5DM6Q 2GHVC 3MMAB 4ZPTR 1JLFA 2ZEJA 1KVKA 1VBKA 4OYIA 3VAIA 5HVGA 2DGWA 4CO3A 1B99A 1OY8A 2XGQA 4LF6J 3JSMB 5DS7A 3RB4A 2DGSA 4R0JA 3QBCA 2DNMA 4OZ3A 3MEGA 2VBZA 1HQ2A 3FNNA 1NU4A 3LWMA 1AA1B 3OTEA 5DQHA 3QQCD 1Q8IA 4EGLA 1W2BR 5KG3A 3M30A 1U0SA 9RUBA 2IA0A 2DT9A 1UEKA 1V5VA 1X31C 3PX0A 3RUBL 2YH1A 4ES2A 4LR8A 3TEGA 3TARA 3UN5A 3OFHA 3D1HA 3CCES 4NCGB 3EMTA 1TMMA 1FEHA 2YXLA 4MH8A 1GMUA 4F3QA 2M8DB 3W62A 1Y3KA 4X62F 2ZZNA 3L7UA 3P3DA 1XMOJ 4CYUB 4OYMA 4U6PA 2BJ7A 5ETOA 3R7BB 2ADBA 3NMRA 2YNGB 2JC1A 2GJ2A 2EFQA 3H5YA 2LQ9A 2QG9B 2MLZA 1JK9B 4R25A 1LXJA 4I2QB 2X3DA 3PYEA 3LA0A 1S9GA 2M7SA 4O3PA 1N5VA 2JWNA 2GFFA 5CXTA 4O3OA 1LWCB 2FGOA 2CQ2A 3FZBA 2OJ3A 5CZXA 5HMXA 4RW7A 5GADI 3GR0A 4I6YA 2M70A 2PMHA 1WF0A 4MKYA 5KFGA 4DPOA 4YFUA 2KJVA 2V63A 4CTAA 2EWHA 4ECZA 2ASYA 4PYDA 2LCWA 1Q16B 2UV8G 4IH6A 4GVBA 4Y0FA 1I3OB 3I87A 2XG8A 2BZ2A 1F6TA 2CQHA 3MUVP 4UZCA 1QAYA 3TA2A 1XIQA 3BBBA 1J5OB 2V50A 1F3FA 4YOEA 4OI3A 2YKMB 3E8OA 3NRBA 4DSIA 3N0VA 4ELVA 5IM0B 3I5CA 5MLCV 1QTMA 1VQKS 5E5NA 1Q78A 1UVMA 1JLEA 4XPCA 4Y34A 2C2OB 2R9LA 1Q95G 2MJUA 3TUZC 5E3RA 1KEKA 2R8KA 4IOAQ 5DQGA 3QRQA 4OI1A 2LEPA 3BKUA 4A47A 2BEFA 5GMKa 5LMUF 4LSLB 1CJKB 3D6HB 1DTTB 1U0HB 2W2OP 2YQ3A 1JJ2R 4PWWA 2AX1A 3B8HA 1EB0A 1BXNA 4EZ6A 2CA9A 1F9HA 2V69A 5J2MA 3BGOP 3OTDA 4QIVA 3KLVA 2V4JB 3CCMS 1FJ7A 2Z0GA 2C3UA 2VPXB 1JJ4A 3UDEA 3KDNA 2MQPA 1T9YA 2GMJA 3V5RA 1FXLA 3RG6A 4ES1A 1VRTB 2R2RA 1P9YA 4M1KA 5ETRA 2HVIA 5AT1B 5KG4A 5EWEA 4O0NA 4NEYA 3KK3A 4ZVHA 3M8QB 3UFCX 4E0DA 3KHGA 2IAJA 2RQCA 1YGYA 5HVHA 1C0TB 4H4KC 4PAAA 2ZH7A 3QNWB 2A6OA 2YKPA 1X9SA 1T03A 1TKXB 3CDWA 4EWTA 2YNFB 3GFYA 4K4XA 2GGPA 3W64A 1H0HB 4LF2A 4F0KA 1P6TA 3I6PA 3DRXA 1SC6A 5B0DA 4Q0BB 5IZHA 2CZVC 2ZWPA 5KFVA 4KHRA 4NXNJ 1SI9A 2AEJA 2W7PA 1IR1A 5HL7Q 4DLGA 4NI2B 3FBBA 1IJFB 3MZIA 3MR2A 3UDVA 2UXBJ 2D3UA 1KC8T 5CD4H 4EK2A 4RUCA 4OYXA 3NEKA 4YS2A 2L3MA 3D3CJ 3CJTA 2MZQA 2RHSB 2HBRB 4ECWA 4LF7F 3BH7B 2N7CA 4K50A 2KT3A 5RUBA 1CQMA 2AGOA 1G1XA 2PGCA 3M6UA 3R2CJ 3PKMA 3NS5A 3UCUP 4KGXB 2ZOFA 1S10A 1JLAB 1GEHA 1YJ7A 5A8RA 3HVWA 2W01A 4TN2A 1KQGB 2NYHA 2VFSA 2R7TA 1OJ4A 1P9QC 2DJWA 2HVDA 3KNAA 1YI2S 5D78A 1E6VB 3JQMA 2XMTA 4J90A 4X66J 4DSJA 1RU2A 4Q7AA 1X7VA 2P8IA 4CLSA 4ZLPA 2CNOB 3MWBA 4RZRA 2B9XA 2VOPA 2KYZA 1VQNS 1CSJA 1U1RA 2AV5A 3QFWA 4RL1A 2HBQB 2EXUA 2L08A 2VODA 5A0YA 4F50A 3DCAA 3RAMA 5A2QU 4IQMA 4ZA1A 3I4HX 5G4DA 3KXDA 1NK9A 2W9BB 4JI0J 1RWNB 1S9GB 4CWBA 3CDUA 3NXZA 2KT2A 5KFKA 2N4CA 3DMJB 1M5VC 4DQPA 5B0EA 1S6UA 2PT0A 3EPGA 2Y3YA 2FJBB 2YX1A 2OMOA 3O8WA 4MYUA 2H3EB 5HP1B 2XBPA 2HIYA 3C2PA 2NSCA 4NRUA 4F04B 1LXNA 4X64J 3D2WA 1QUPA 3A8JA 3ULHA 4RNHA 1RAOA 3DOKA 4CTAB 2VPZB 4KHPJ 3D6FB 3W9HA 4PABA 1S4EA 4HHUA 1D1UA 2HFOA 4P2XA 3THVA 1SPBP 2YPYA 3MAHA 1K47A 2VPWB 2K2PA 4IYQA 1NPKA 2AX0A 1KNZA 4LUBA 4TU8A 1OY6A 3D5MA 4CNYA 2DBBA 5B0GA 1YJUA 2Y9HA 3HULA 1R0AA 3IS9A 4C97A 1PJ7A 1VFJA 2DNQA 4WU2A 1K0TA 2FHOB 2WBRA 1VK3A 2HFUA 3C6TA 1R43A 4G3IA 1DZ5A 3RGIA 2W7OA 1XEZA 2W4DA 1JLGB 1QJHA 1HWUA 4F3OA 4IFYA 1LW2B 4JI5J 2YTCA 2RHQB 2E7VA 3X1LB 3FFIB 4DV6F 1SKUB 4LRFA 1A7GE 4OX9J 4LIRA 2C1EB 1GTHA 3AA9A 2JEIA 3KYLA 3GE9A 1WELA 3CJ8A 2DR5A 3CMES 1KTVA 4M63A 3AJDA 2F4VF 2OH2A 1H38A 3NS6A 3QRPA 1NMEB 3MEEB 3MF5A 4LF4F 4C8MA 1WC1A 1PJ5A 1R8CA 1YLXA 2O01C 3KLHB 2ZBPA 3C6UB 3Q83A 4E98A 3OTOJ 2J9CA 5A8KB 2C3MA 3T5HA 4HT5A 4DV2F 3G82A 5M2UA 2A10A 2IAJB 2VD3A 4B9SA 4EUVA 1FNXH 2RQMA 4MTPA 2VOOA 1RHRB 4DV0F 5KG6A 2FHMA 3FJ2A 5DRKA 2R8IA 2I8EA 1U1PA 5H9FK 3R1LA 2V8GA 2LU1A 1C4AA 2MZTA 4ATNA 5I4MA 2E7XA 4BC9A 4U7CA 2B5JA 4LSNB 1F9EB 3ZZRA 4IG0A 3M32A 4NA3A 5HQ8A 3SMZA 4PWDA 1KQKA 5D0HA 3IR7B 2HQFA 1WJ9A 3GV5B 1N6QB 2QGFB 4LF9J 2XLJA 1XNRF 3RBDA 2VFUA 2JEGA 4EYIB 3PNIA 3CULA 1RT5B 2HHXA 2W9CA 1S1TB 4IOBA 4I2PA 1N5SA 2CQIA 4RKUC 2MQMA 3R1HA 3W7BA 4R5PA 4CLFA 4M5KA 4DN0A 3NLCA 3NNHA 2MQLA 2XHCA 4O3RA 2HHQA 2VFRA 1SKSA 2GQCA 2D1CA 3R5DA 1HBMB 5GADU 3NOCA 4QIWD 3TA1A 3K5PA 1E6YA 2AWZA 5CYMB 2WOMB 3JS9A 2F9JA 5F8HA 1D3WA 1K1QA 4FKYA 4R0EA 1TP7A 3SV4A 3PW5A 2WK4A 1WI8A 2R7XA 3CC2S 1CVJA 1FFWB 4V19J 4DV4J 4WBFA 3I0SA 3BDEA 1NDCA 2E29A 2B9YA 2RUSA 5GAEU 4B3TF 1Q81T 3MAAA 3OL6A 3HP6A 3H0PA 4HKQA 2D69A 2X1BA 3CB4A 3IBCB 4CO2A 2BQ3A 1YVFA 1WORA 3V6JA 1X5SA 2FDNA 3MM6B 2DKOB 4QR1A 4USVA 4DSLA 4D3HA 1L3KA 3S8SA 3I32A 2QFJA 5IT4A 3HVTB 2JSXA 1AUDA 1X4DA 4UY8T 1SL0A 4JI4J 2XZDB 2W4PA 3OW2R 2IVFB 2KG1A 2DHAA 1IN0A 4DL5A 4XPEA 3H40A 3MM8A 4DR4F 3IWNC 1MWYA 1NJZA 1PYTA 2X1AA 2MQNA 3S7RA 3ZTRA 4NOHA 4K5RA 3UCGA 4LREA 1NXIA 3A3NB 3V6KA 2JEFA 1H7WA 2EFOA 5I3QA 3CO9A 1OPZA 2OLWA 2CQ1A 1Q8BA 1TL5A 1S97A 3PJ9A 1RT6A 5J2NB 3WZ0A 2WONA 2ZD1B 3KLFB 3UO0A 2FVPA 4DV5F 3PIOQ 1L3SA 1FO1A 3U1MA 4DR7J 1YJVA 1FK9B 2BBEA 4ZVEA 1A6LA 1RTHA 2XSJA 4ED2A 3GJTB 2ZE2A 1HNVA 2H1YA 4I68A 4KO0A 4WFXA 2MKIA 1Q5YA 2VICA 1YKWA 4ED0A 3R2DJ 3RB0A 2HK3A 3PHEA 5AE1A 3E01A 3A8IA 5F3ZA 1T0TV 2QA2A 3HSZA 2MZRA 3F56A 2F8EX 1WDTA 3NCRA 3NY0A 4ZPVR 1DJ0A 2OIHA 2BABA 3IM8A 3PR4A 1H72C 4C11B 1HYSA 1RABB 2DGOA 4ZOSA 2XO7A 1LQ9A 3I55S 5I42A 1BQNB 1VCTA 3TAQA 2EG2A 2HHHF 1C2PA 4Y2KA 1FJEB 3NAHA 1NLKL 2R7WA 4LJMA 1TZ0A 3CSKA 3C46A 2MPUA 4L3NA 4OLOA 1SXLA 4O4GA 4BS2A 2BM0A 2A3JA 3LANA 3K5NA 3K8WA 4LF5J 3TX8A 1WTBA 2NLWA 1NDLA 1YITS 4UOGA 5B7WA 3NGRA 4M5NA 2JX2A 1N88A 3BV8A 5AXNA 5K8MA 2OO4A 3MEDA 3RJMB 2YX4A 2F3JA 1YRXA 3WIVA 2BANA 2NQPA 4DZDA 3PJXA 1WF1A 1KLMB 3D0IE 1TMJA 3S6EA 4ZLJA 2MGZA 3GFXA 1AT1B 2BMBA 3QT6A 4WP3A 5A6PA 2RVJA 2BX6A 1ZM9A 4F0HA 1ZZNA 1ZETA 1RWKB 2BA9A 2ACYA 1FRXA 1BQMB 4FPRA 2PFFB 2BDPA 1CC8A 1ZYQA 1MMDA 1OO0B 2BJDA 3T5KA 3FBEA 1IR2A 4WE1A 1UVKA 5LOQA 5SUHA 3IP0A 3DRRB 4DZ6A 1RADB 1Q8KA 3W2VB 4NASA 2V8VA 2XMAA 2YKNB 2HWTA 4C8ZA 1HR0F 3ZFVA 3MCNA 5AJ3J 1U1LA 4JBCA 5A6WA 4M95A 1L5UA 1HBOB 4USMA 5K8NA 3PEHA 1KS2A 4I6WA 4ZPWR 4WZQA 3LO3A 3ITHA 4OJ1A 2DK2A 2QLFB 4B3OB 1FX2A 2ZJQQ 3NAIA 2HLUA 1Q4RA 3HFZB 3N6NA 4FXWA 1RWPB 3NGDA 1F60B 3J80U 3OV7A 2ZKTA 2EFNA 2W1BA 5J1NA 5CHCB 3DLBA 4J9NA 3AOCA 1S7HA 3MOJB 1DQ8A 2HLTA 4LFBJ 3TZYA 1HNIA 4MAKA 1RT7B 1G3OA 4OHXA 2OD4A 4K8RA 1O51A 5LMNF 3QFHA 3KMSA 1R6VA 2OEKA 2XLIA 1J5EJ 2L9NA 1WACA 5LXYA 2G4BA 1HI1A 2HURA 3VZHA 5KOXA 3R5JB 2HNYA 3CEDA 3SFUA 2K3KA 3DKDA 2Q66A 3C15B 4A8KA 2CVEA 3UR0A 3HT0A 3P96A 2XYHB 4QU6A 1JKHA 3R5AA 4Q45A 3N6LA 1VQ9S 1QTNB 2NXEA 4QW9A 4IH5A 1HW9A 5DG7A 2EC0A 1VHFA 1XC9A 3A13A 1S79A 1NB7A 2FZKB 4TLRA 4UY85 2ZHAA 1LWEB 4ID5B 4PG8A 4XAKA 3C8YA 1VC5A 4LQ9A 4XIUA 1FDBA 5FLXU 1PBUA 1HPZA 1NB2A 2WHOA 2EFGA 2GAHC 2FZCB 3L9ZA 5HAOA 2DHXA 4DV7J 2UUWA 5A76A 4ZITA 2Z30B 3MD3A 4PQUA 4Y2IA 3MMJA 2QLJB 3PW0A 1CG2A 2XNQA 4B9UA 2FTRA 1QM9A 2BQUA 3D68A 4M8LA 2VDIA 1YBTA 3R8YA 1RTIA 2DHSA 3PDNA 4RO0A 4Q5VA 2YKOA 4NLUA 2FY1A 5C25B 2BACA 2KVIA 2ATLA 1TU0B 1RT2A 3JYTA 3BN4A 1NZAA 2FVCA 4RNFA 4Y65A 5DG8A 3C16B 4B08A 1LNQA 2HPUA 3ELHA 3NS7B 1HBNA 4NXMF 3ETMA 1GFWB 3MFHA 3CJKB 7FD1A 5L8RC 3QT5A 1LFWA 3PYGA 3DOLB 2H65B 2XNRA 1FF2A 3AODA 1Q82T 3T1HJ 3MGJA 3M4XA 3CNQP 4WF9Q 2QLXA 3H2LA 1X4EA 4ZP8A 3TEHB 2A18A 1TL1A 5KFFA 3PRBA 3I56S 1JXVA 4YMEA 4GRSA 4FS2A 3R97A 4ZIVA 2DY9A 2DTJA 1CBKA 1HNXF 2IC3B 3OT9A 1S7IA 1HHQA 2WB1D 1Q53A 4J91A 1S1XB 4LR9A 1WD6A 5KFWA 3VAGA 3G8SA 4NLYA 2EPIA 4FF4A 1DBDA 5T7LA 1RSCA 1VRQC 1GH8A 2HVHA 3FDSA 3DLGB 1UPPA 2FUG9 4JUZA 4DL7A 2F8MA 3HJFA 3HVRA 3DM2A 2V8DA 4Y2CA 3RBZA 3M8RA 2NYIA 2VG6B 4WU3A 4HYKA 4ECRA 5IWAJ 1IKXA 3HFKA 2Y0SD 2UVRA 4LQ3A 2K7JA 1SJRA 2ZBIA 4A4JA 1V5IB 1VDHA 3HD1A 3UDCA 5M2PA 2VG7A 2ZH1A 1LK7A 4TQSA 2AP6A 1TL7A 4F36A 2E5LF 3N4WA 1GMWD 5J2PB 3PHTA 4RW8A 5B09A 3VCDA 4OMFG 2WVFA 4ENOA 1TFWA 4KTQA 3DDNA 2FHKA 4EU0A 3L7OA 5KFJA 2KG0A 1FRHA 2O3DA 2HNZA 3EUNA 2CYYA 2C2DA 3CT9A 1XTZA 1RDRA 1Q5VA 2DITA 5FD1A 4DU8A 3MM9B 2UVWA 4RNMA 1RHJB 1XR5A 2Z2LA 2HHVA 3SYZA 5GMDA 3WQPA 4K7QA 3IRXB 2DNNA 4BLGA 1YX2A 4CT9A 3JSYA 1MNEA 4DV1J 4FPIA 5ETSA 3J7YI 4BCAA 2E5HA 2C42A 4GKKJ 4DL3A 1OSCA 4X4VA 3R6GB 3L3CA 3DLKA 3V6HA 3TQEA 3H5XA 5IT9Y 3MM5B 2QA4G 2DGQA 2G2ZA 3DRYA 4ZVQB 2D41A 4P52A 4IUFA 4B3SJ 1B3TA 4FBUA 2VQEJ 2POKA 3MMBA 4ERDA 2H5IB 1KD1T 1FJCA 2QE5A 3KG0A 3PM9A 2V2VA 3S01A 4ZCLA 3M6WA 4RLEA 1FWPA 4I69A 3PR5B 3FVYA 1N33J 1NRKA 3LQVA 2XB2D 4W92B 2VG5B 3BGRB 1WUUA 2ZHBA 2VHGA 1DLOB 2HQDA 3DNCA 4Q44A 1TK0A 3N5FA 2H48B 2CADA 3HHLD 3AXKA 2QLWA 1HBUA 3VTIA 2HZAA 4MKBA 2AJQA 2PMZD 1IKVB 3M2UA 5KT2A 3DU6A 5HI7A 2FHJA 2ALYB 2GJFA 2QMWA 1UA1A 2MQ8A 1YSJA 4ETXA 4LFAF 5HQLA 3BR8A 2IYGA 3G6ES 2IA6A 3RRGA 3HT3A 4ZKAA 1WC6A 1W26A 2DGXA 3ET6B 1WSVA 5DDPC 2ZZTA 1N32J 3BYRA 3WDOA 4Z7CA 2XYGB 2OEMA 5KFTA 2CJKA 4FNHA 4YN3B 3HSDA 1ELOA 1QY7A 4AL5A 3QSYB 1QE1A 3G8TA 2QL7B 5GAGI 1QAJA 3SSRA 4U7UK 3AOBA 3QLHB 2GZOA 3ILLA 3Q0AA 5FJ4A 3OXGA 1TTHB 4C3MA 4LIWA 1SQEA 1T9XA 3PACA 3CJQA 4JI8J 2HWHA 4TLQA 2XC9A 1BLUA 4NLDA 4WCEQ 3BBFA 1B0TA 3I5AA 4MIBA 3G6YA 4NZ0A 1X9WA 1MMNA 2CVIA 1JLQA 1U6FA 5C42A 4L76A 3P45B 2V8PA 3Q2TC 3EVOA 5CA5A 3VGUA 2F7VA 2OEJA 5D0EA 3MPWA 4AFFA 2F4FA 3WC0A 3KG1A 5D77A 1GX6A 4OZJA 1UPMB 3QJJA 4OYWA 3BO3A 2VBYA 5A8WB 1QVGR 1C1BB 2ZKUA 2W9AA 3GZ7A 3AXMA 4ANEA 3GJQB 3DI6B 3GQCA 3VALA 4DWIA 2DNZA 4JI7F 4YHHJ 1S0NA 3AFGA 3QAEA 3OR1B 1QSLA 1QDUB 4RU2A 2AHOB 4X4RA 5ETVA 4F25A 3MECA 1AW0A 5B0AA 2M3DA 2HMIB 2BKOA 4DR3J 1EQ0A 3CDEA 4DX5A 2I2YA 3OXFA 3BPSP 4P7VA 2V94A 4DFKA 1PJ6A 2RKIB 1N34J 3SDEA 2D74B 1XQIA 3PX4A 3D1OA 1TELA 2ASJA 5D4PA 1I5OB 4L72B 4X4OA 5DG9A 4IG3A 1SH3A 4MT1A 4LF6F 3K59A 3L7PA 2J76E 5KG2A 1PYSB 3Q2SC 3CCZA 2QT7A 3RR8A 1U6ZA 1S57A 1C0UA 4QR2A 3MUTP 5DM7Q 1KN6A 4ZVTB 3H98A 4AL6A 1T3NA 3SQGA 2RB7A 2QC3A 4FBTA 3EGZA 2MQOA 4ECQA 3EE3A 3M2RB 4WFZA 2HGLA 2IMOA 3QZ7A 2ASDA 3T3FA 2LQBA 1BC6A 5C2GA 1Y11A 1PG5B 3RZAA 2Y0BB 5FDLA 4C3KA 4I7FB 2RAQA 1XMOF 2ILYA 4W90B 4ZVUB 5BJRA 3MR6A 2A0FB 4RW9B 4TU9A 2DPJA 2ADCA 3KHRA 2OPRA 2VPYB 1UVJA 2OPPA 3NGUA 2N4DA 4PQAA 1UL3A 3DRPA 3QRRA 1FA0A 3CJ4A 3CIZA 2J0QD 1Y3JA 3KJFB 3DLJA 1GMVA 2HW3A 5C24B 2MEWA 1IBMJ 1RTDB 5K5MA 4RW6B 1FWLA 3FK4A 1SC3B 3W8PA 2F63A 1S6PB 2CG8A 3HDSA 2JFDA 2RH3A 3KLGA 1NK6A 2YPZA 1AROP 4DX6A 1OY9A 2VQFJ 2XI3A 2ZWOA 1S9EA 2YNHB 1REVB 5LMUJ 4XTTA 4X4NA 4DOZA 1NJWA 1IBLJ 3T6BA 2XYPB 4U9RA 2CNKB 3A4TA 3D3BJ 1YZ6A 3FSIA 3ISZA 4J9PA 4ZCMA 4WJBA 1XNQJ 5I3UA 4JI6J 2JFKA 4IRCA 3C66A 4EI2A 4YR2A 2R7VA 2M2BA 4OV6A 4WPAA 2IVMA 3CCQS 1SIWB 2JH3A 5BYRA 2GAGC 5E7OB 4FYXB 1FERA 2FZGB 4JI2J 1TL3A 4DL6A 4WWSA 2HGMA 3EVWA 1D9DA 2CQPA 1FKPA 2B8PA 4B3RF 2ZJPQ 1HD1A 3PXGa 5J2QB 1UJ5A 4NA1A 1UWBA 2K1RB 3M9MB 4YUDA 2IY5B 4IDKA 3GV8B 2OAUA 2ILZA 4NLSA 3PIPQ 4YQWA 4J9OA 4FKXA 4BC7A 4BHQA 1P27B 4LMZA 4DPXA 5IFMA 2PI5A 1RBOB 3FCVA 4OZ0A 2DH7A 4UF4A 4KKOB 3VAJA 4NPOA 2H4WB 1JLBB 4N77A 3UE2A 1WEZA 2B51A 3LWLA 4OYPA 2AT1B 5DGAA 2Z4PA 5KFPA 4OZ2A 1H3DA 4LF8J 4OX8A 1X0PA 4NX9A 1Y0HA 5D0RA 3VWSA 2KL8A 3I0RA 3OR2B 4ANCA 1N54B 2AZ3A 1KVJA 3EYZA 1RA6A 4F8RA 1WKLA 4DX7A 2VDHA 5D15A 3QSIA 2BKPA 4XDCA 2KB2A 2OPQA 3CW2C 3JSRA 2H9ZA 4CLYA 1YBAA 2JLGA 4NXNF 4TY8B 4OI2A 2JEJA 4ELUA 2ZZMA 3MCMA 3CO0P 4PG7A 4A8SA 1X8DA 1M5OC 4H4OB 4RNNA 1NKEA 2IM2A 2UXBF 1AUSL 3D54A 2DRBA 2UV8A 5J1EB 3J7Z5 4NMXA 1WG4A 3O2IA 2C2ZB 4N8OA 5LJ5Y 4ZHRA 2NS1B 2I5JA 2XGPA 7FDRA 1PCAA 2D3O1 5HLFB 3KK1A 4DPWA 3MPDA 4HL9A 1IWAA 3NG8A 1ZA2B 4YDDB 3FEYB 1JJCB 2FC9A 2LU2A 3CD5A 3FQLA 4MKVA 1UVIA 1UAWA 4DU7A 1NK4A 2GX8A 3KLIB 3HVAA 1U47A 2DD8S 1MW7A 1AZSA 5LJ3Y 5IV4A 3M8SA 2AYMA 4M5JA 3KJVB 1WHXA 3W5ZA 1TK5A 4OYZA 4I4BA 3AH6A 2ZNYA 5KFNA 3AA8A 2VKZG 4ECSA 4OHYA 3BREA 3GWCA 1MROA 3GCWP 2HRYA 2R8HA 4MK9A 3D6TB 3QWUA 4ER8A 4J9LA 1FWKA 4H4MB 3TW0A 5F8GA 5GAGU 4TKTA 2KXNB 5KT7A 2GO8A 3OJSA 3D4JA 8AT1B 4LSZB 1GQEA 2GMLA 4QWAA 1CJUA 2E9RX 3B6BA 3ZTSA 2Y1IA 2OPSB 1IUJA 4PXEA 3GJRB 1Q79A 4DPTA 4J5OA 1HNZJ 5A2QY 1WEYA 3UPFA 3CCRS 3M1VB 4TYBA 1JLCB 2G9OA 2XS5A 2PA3A 2CPXA 4X64F 2XCPA 2NPFA 4KHPF 1RBLA 3EDQB 2KU7A 4NLVA 1SUQA 3K7RA 3M8PB 2BRLA 3HHLB 4UOFA 1FKOB 3TZXA 1CEZA 1ZOTA 1HQUA 2ZC3A 2V4QA 2RRNA 1DY3A 3DYAB 3ZZPA 2J0SD 2XY5A 2HKEA 2HQ3A 2VV5A 8ATCB 2FLLA 1VQ4S 4UTGA 1LWFB 4U8YA 1UW9A 3RAQA 3OL8A 5M2RA 3FBCA 4WXOA 3HZEA 4IH7A 4AT1B 2M88A 4RW4B 2NSBA 5KTQA 4CM0A 5JVGQ 3LP2A 5HROA 4LF4J 1X4GA 1J2VA 1RA7A 2QFIA 3IR5B 1EETB 2J9DA 2HNDB 1S99A 4DR6F 3AT1B 2XSFA 3MPVA 2AJ1A 3J7AN 2HRTA 4TY9A 3GV7B 3VAMA 3T1YF 3K17A 3DGPB 1RAJA 2UXDJ 3Q8QB 1VQSA 4F0MA 1CS4A 2R3VA 4OX9F 5HANA 4JV0A 1VIOA 4HHJA 2KFYA 5F0WA 1J27A 1RBAA 1B4SA 1WG5A 4DV0J 5K8OA 1PC4A 2DR9A 1LV5A 1ZS6A 4TU7A 2XZTB 1UJ6A 2BW7A 2ZBQA 3OSNA 1UFLA 2I38A 4B9MA 1Y9OA 2XCAA 4ZCIA 1YJTA 3GP9A 2NREA 1RAHB 5IOLA 2V0NA 5KFHA 1VRUB 3GFZA 3OTOF 1RWWB 1R27B 1XNRJ 4ZDNA 5HBMA 3TAPA 4BWMA 3TYTA 4JYAJ 2IPOB 1NO8A 4DUYF 3A12A 2IRUA 1LK5A 2NXCA 2IM3A 1RTZA 4M5DA 3NP5A 1FEEA 1A0OB 1SV5A 1VBZA 4K59A 5GAHI 4L75A 3Q24A 4FVMA 2NUUG 1UEUA 1X0FA 3VAHA 2A1BA 1CLFA 2XWXA 3B4DA 2ZH3A 1FXRA 5K9FA 2DIUA 5LL6d 5F8NA 2BJ3A 4GKJJ 3DRSB 2K8GA 4J37A 1LEOA 1APSA 4ECTA 4DL0C 4G1QB 4K2XA 2LXUA 3KWMA 2XMMA 2KH9A 4PUOA 4UUWA 1NH7A 1B70B 2W2PP 2YWHA 5KG7A 5LT5A 4P10A 2CWXA 1TKZB 3DOMB 4KBIA 4HH0A 3RBEA 1HNWJ 3ZZZA 3OVBA 4Q2MA 4O44B 3TQ1A 3CDBA 2BV3A 1NHKL 2RQKA 2MHEA 2HYIB 1RT4B 3T9NA 2I1RA 5HN0A 4DR1F 4DG1A 3POTB 4RUBA 2Z57B 4KYZA 4USIA 3BB5A 2B4VA 4ECVA 4R8UB 3BN7A 1DTQB 5FIIA 3NBPB 4DV4F 1ZA1B 2DNOA 1CJVA 4A8FA 1UZDA 3PKYA 1U24A 3DN9A 5HSPA 4DF8A 3KLEB 1U8SA 1D8ZA 4A8WA 2E1RA 3QO9B 3AD9C 3M2VA 4ECUA 1T95A 3J81U 2QL9B 1NHUA 3PFOA 2DISA 1KTQA 1LOUA 4A8YA 1RTJB 3VVUA 2WVCA 1I1GA 4I0WA 2DR8A 3MM7A 1ZPWX 4JI4F 1TKTA 2E1PA 4FF3A 2GVDA 3EVMA 2AQ4A 4F2RA 1PILA 1LWXA 4F7VA 3V81B 1F5BA 2KM8B 5KG0A 2RIJA 4L6V3 3KJQB 1CULA 2C3OA 3T5JA 3ISND 4ZJOA 4DHVA 4ILLA 4B9VA 1LW0B 3IG1A 2E9TA 2P9EA 4MMOA 2YKQA 3SBMA 3BJYA 3FSYA 3UD3P 3MTJA 3M05A 3W2WB 4DCPB 1HQEB 1JNRB 3KHLA 3FZ2A 4ZJLA 5EWGA 4DR7F 3H20A 3SSSA 1RYSA 2LA6A 1S1UB 3QIPA 2BE2B 2CDQA 2DNPA 4ZPCA 1F3VA 1S1VB 4NYOA 2C2NA 1EP4B 2AJ0A 3IR6B 2C2MB 2WSCC 1FDNA 1Q1KA 3GSIA 3AD7C 4HVZA 2U1AA 2WBMA 3G4SS 1M1HA 2KRBA 2CAJA 3HHLC 2FVRA 1P1TA 1WC4A 4HACB 2XLKA 2JJ4D 3DC2A 4NLXA 5DLFA 1IKYA 3KFWX 1ZAXA 3EXCX 2DB1A 1RT3A 4QBUA 3CWJA 4WP9A 4KGZB 5HK4A 2V34A 4URGA 3THTA 2D9PA 4J9RA 1XK8A 4ECXA 2CPHA 4F4ZA 2MKJA 3Q8RB 1WOSA 1QUVA 1VQLS 2Q79A 3C14A 1T05A 1B0VA 1B0PA 1Q7YT 3MMCA 3OQ2A 4OHZA 5ETMA 4ICLB 2DYAA 2BYCA 1JJHA 5K14A 3TO8A 2YQ1A 2MKKA 4LF5F 1C4CA 1OWXA 1LFPA 2B43A 2G2OA 2PSZA 1RAGB 3BO4A 3A8KA 2HBZB 2EBEA 4P2FA 2QMXA 4Y6IA 1HD0A 2IRXA 3CJ3A 1X4BA 3UQSA 4CLUA 1RT1B 1HMVA 2MMYA 4AYBD 1I51B 1IWGA 5BR8J 1U25A 4DF4A 1FVQA 5B0BA 1N0VC 4YY3J 1O0PA 4QPTA 1VLOA 3TVKA 1T11A 4CP5A 4EFAC 4DPYA 4DLEA 4CT8A 1JQGA 4ED1A 4B3MJ 2MKHA 3LUYA 1XR6A 3KUHA 4KC5A 3K5LA 2XO6A 3MR7A 3RRHA 4A8MP 2KYXA 2YBVA 3LAKA 1IKWA 1RQ0A 3KK2B 3LP0A 2V2QA 2KFZA 2BUNA 2V68A 3LTOA 4DV3J 1PC5A 2GVZB 2HZVA 4UW2A 4KPCA 4HR2A 3V4IA 1FESA 4J9KA 4ZP9A 3TAMA 1M1KT 3LP1A 3AY0A 1ZAWA 3FRYA 2AKWB 4NL5A 3H2VE 1RAAB 1VK8A 2RU9A 4C9DA 3W5YA 4RBVA 5AJ3F 1S1WB 1XMBA 1VHIA 2R7RA 4AQYJ 2BR0A 2NXUA 4QIGA 5G0RA 5CYQA 4MFBB 1VI7A 3GCXP 1NSAA 4OJ3A 4RWXA 4QU7A 2FJXA 1MU2A 4ZLLA 2Q3PA 4O3NA 2X1GA 1JLFB 2WB4A 1X4HA 4Q43A 2ZH5A 2H5JB 4ED6A 3DLEA 3QGIA 3V6DA 2AU0A 4ZVOB 3MEGB 3AD8C 1NNDA 2ZVIA 3ILIA 1ZTWA 5E3AA 2QV6A 1RCXB 3MAQA 3WIUA 3HKWA 2ZH9A 3M30B 4X4SA 2PMWA 5AE2A 2YVSA 2MKSA 4JOUA 2KT5A 3CIMA 3BKTA 1KKHA 3IC1A 3GYGA 2M4MA 2CXEA 1N36J 3O3LA 1J5EF 2V6AA 4QPXA 3H8YA 2X1FA 3J80Y 3OFEA 1IR0A 3IFEA 1JIHA 2BRKA 5D3GA 1QVFR 4KQZA 1NSPA 2A2DA 4DEZA 2FJAB 3ENVA 2KFNA 4F02A 3CVKA 4KV8A 2LKZA 2JOQA 2BE9B 3UD4P 3J7A1 2J8SA 1Y10A 5CZVA 2AD9A 4HTJA 3FSXA 4X4QA 1YJNS 2DR6A 5HJYA 2DNGA 1TVRA 2LP4A 2OSRA 1FKAF 4KSEB 3OHAA 4RW7B 3AB4B 4HI2A 2CQ0A 1ZM3A 2KM8C 2QSFA 2RMLA 4CM2A 1ICEB 4JV5F 3AQOA 1SH0A 2P9CA 5KFSA 5D0GA 2WVEA 3VAFA 2VB6A 4IFVA 4DSKA 1QLNA 3U7JA 2C2KB 2M0GB 2P2CB 4GVBB 4DS5A 5L9XA 4H4KA 4ZJQA 2HFNA 4YEAA 1PSDA 1EZZB 1M5KC 3NL0A 1V3RA 4A46A 3OUYA 2EKYA 5FLXY 1EKSA 3ADAC 4WTOB 4UOHA 2CDRB 2QJ3A 1KR4A 4KFBA 1JLEB 4J9VA 2IM1A 4MK7A 1MLAA 1HNXJ 3TR5A 3EJMA 4WZMA 2IDLA 1D0EA 2GS8A 2R4FA 1S6QA 2B9EA 5JXSA 4M5MA 5CABA 1EX8A 3OSPA 1Y4ZB 4K0KJ 1RU1A 3C14B 2GHWA 5ETPA 3RR7A 3ZZUA 3T1HF 4ZVGA 1JXEA 2DVIA 1TFYA 4JP8A 3TANA 1GT8A 1OYEA 3GB0A 5KFZA 4ZVSB 4XDDA 1EAYC 3ICLA 1QSSA 5HVFA 2HBYB 4LRBA 5J2MB 2UUAJ 5F8JA 3K89A 2YNIA 4P2MA 2UUCJ 1M0SA 3W9IA 1X5PA 5KT4A 4LR7A 2Y1RI 5AXMA 3PTWA 3UWTA 3MMAA 1XJWB 2A2CA 1FNOA 2QTWA 2B3TB 2QLBB 2RUGA 3JSMA 3ENAA 3KK3B 1RZMA 3PW7A 1XN9A 3QAUA 3ZC4A 2GNKA 3N28A 3DFEA 2UUBJ 1T03B 3K57A 2QN6B 2XMVA 2HHTA 4FDFA 4NMLA 2GGPB 3K58A 3GONA 3BS9A 5IWAF 3OJUA 2UU9J 1KQFB 5IT9U 2QL5B 4X4PA 2VONA 3I9ZA 4KE5A 3ZZYA 1SB6A 2DNHA 2DXDA 3HD2A 4X65J 5F3TA 4D3GA 3HI9A 4NCGA 3I5BA 4ES3A 1RAIB 3UI3A 4DN9A 1VQ8S 2LLZA 2FGCA 4B9TA 1RP5A 2P6TA 1PAEX 4AXIA 4CYUA 2B4OA 4O4RA 4J7CA 3T9ZA 1F0XA 1FE4A 1IXKA 2YNGA 3MTKA 4CLTA 4KJIA 1U7LA 2QA1A 3TOQA 2DH8A 3S1TA 4I2QA 2N7YA 1RWVB 3O5TB 1U8WA 2G1HA 2R2SA 3CD7A 3I96A 2NCKL 3P49B 1IVZA 4E8UA 2RJZA 1LWCA 3OTCA 2CPEA 5A8RB 3HM9A 5BYSA 2K06A 2N3LA 2IRYA 4GKKF 1T7PA 4QWDA 2OD6A 2PIIA 3MR3A 1VQ6S 4Y28C 4DBQA 2AEMA 3H4BA 5KAKA 4B3SF 2FC8A 4ZK7M 3SI8A 2M9KA 2VQEF 4LBHA 5IV3A 1M5HA 4KR0B 1J5OA 2V8HA 4LFAJ 2KDOA 4JV2A 4WIQA 1VQOS 2J7KA 2YKMA 2FQQB 4JI1F 2JVOA 2G13A 3HZGA 4UUXA 3CMAS 4EMDA 2GO9A 5A0YB 5HO4A 3TJAA 4DR2J 1N33F 5L38A 1RAEB 4OI4A 2HQGA 1SJ1A 2GMHA 3LGHA 2YWFA 5ITHA 2DGUA 1NKBA 1GX5A 2KVQE 4QCLA 4KV8B 2BJ1A 4M5GA 2HFVA 3O1LA 1LKZA 3MCSA 2C2EA 4CLZA 4EBDA 3ENQA 4UT4A 3U27A 3K5OA 4DUZF 4A8OA 4LSLA 1CJKA 1DTTA 1U0HA 2HHSA 2VFTA 3VAKA 2QIFA 2GJIA 5DZ7A 3PW2A 2LEBA 3D0HE 5KG1A 5LSLA 2Q1LA 5ETTA 2V4JA 4RBUA 2FLOA 4ZN1A 3DOKB 2LYVA 2OGUA 2GQ2A 4QQBA 1YRUA 2Y8WA 1PAUB 1D9FA 3PCOB 3FCHA 5KFOA 1VRTA 2QSWA 3PZPA 2JZ5A 1URRA 5E3PA 3K0JA 4MIWA 1WTFA 2NPIA 3IWLA 5JUMA 4YDXA 3M8QA 3VV2B 1Q0NA 4RUHA 5DDOC 1N8RT 3VQSA 3NNCA 4QOTA 1RWXB 2E1MC 1R0AB 3IS9B 1C0TA 2WAQD 2VUGA 5EX0A 3RTVA 1TKXA 2DEJA 2O66A 2YNFA 1OQ3A 3IRWP 3C6TB 4JI8F 1ZH5A 4I56A 2O67A 1MSWD 1S5ZA 4IFYB 4Q0BA 4ILRA 1JMTA 2Q6CA 9ATCB 3EICA 3B54A 3MOZA 3JAMU 4G1IA 4LBIA 1UCNA 1RWOB 1S59A 3E51A 2E9ZA 3LPEA 4NI2A 3WBZA 3HHNB 2AJ4A 5GMEA 3GTYX 4NYPA 3RAXA 2V67A 4USKA 1T3OA 4DMZA 4JI3F 1R8AA 2VA2A 3CMQA 4ZMMA 1DARA 2I0XA 3D6MB 1BGXT 4TNOA 5E41A 2J6UA 2OSQA 2JHEA 5DETA 3UNGC 2UP1A 3LGNA 4ANDA 3L09A 4OYAA 2DPIA 1IJEB 4ZPAA 1HWJA 2AJ2A 3I9V9 4DQQA 1ZM4A 3SXLA 5CQGA 3HKZD 3G9CA 2Z56B 1JLAA 5E3CA 2EW9A 1GXLA 4YHHF 2Y1LB 3QGHA 3G82B 1RHMB 3EZOA 3HHEA 3UDLA 5KFIA 4WKYA 3WX8A 5LXRA 4O3SA 1KHWA 4DR3F 1E6VA 3MHYA 1N34F 3DHWC 2B5JB 3CD6S 1HKAA 4IG0B 3M32B 4C3LA 1ZZFA 1B64A 4PWDB 2ZBCA 1KFDA 4K4VA 4CLWA 2WVBA 3THPA 3TZWA 1KSPA 4ALZA 4J9UE 3CCSS 1F9FA 2CQBA 3B82A 2HVEA 1FJGF 1MWQA 1GNKA 1K0VA 2W9CB 4I2PB 2J9DE 5KFMA 4KAIA 4R5PB 3KTQA 2W9BA 2OMLA 3FMWA 3WC2A 4TVAB 1IBKJ 1BD6A 1W2IA 2J5AA 4CH0S 1E6YB 1HHTP 3DMJA 1QSYA 1L3TA 3LOUA 4V19X 3TVZA 3PVXA 2MYFA 4UQTA 1NJYA 4WK1A 2IDEA 4B9NA 2KO1A 1HW8A 3VGVA 4A48A 2FY8A 5HP1A 2XMWA 4TXSA 4CI0B 2X7IA 3BM7A 3I0SB 2PI4A 5EDWA 2HVZA 1FRLA 1G7CB 3MAAB 3RU0A 3QMQA 3N79A 4PRFA 1C1CA 1KLNA 5THWA 3AAWB 3M8WA 5GAEI 2RS2A 2W24A 3VVTA 5D8HB 4UQGA 4NLGA 4F4KA 4P2SA 4FZVA 1WG1A 5C5JA 1YJ9S 2ZNZA 3BF4A 2E1AA 1IBMF 4RNOA 1K1SA 4HTIA 3NOGA 4UOCA 3H42A 1B7YB 2XS2A 3PO4A 3MM8B 1DFDA 3EDRB 2EVZA 2YH0A 1TAUA 4ED4A 1JLGA 2B9WA 2CJBA 2VQFF 3FEXB 1NHVA 2XM3A 1LW2A 4PKDB 4B3RJ 1WOPA 3FFIA 1VC6A 4DDFA 2ZM6J 2FHJD 3LW5C 2ZOGA 1UKUA 2ZHOA 1N52B 1IBLF 2LEAA 4DR5J 4L74A 1XNQF 1RT6B 4JI6F 2WONB 2GA7A 3ISNC 1M1GA 4CH7A 4CZCA 2G0CA 4MKAA 1AB8A 2QEXS 2AIRB 3M9OB 1VJQA 2ZOMA 3MEEA 3SSQA 2FPHX 2MTLA 1Y5LB 3D0GE 2BJEA 2ZDPA 4JI2F 4OIXA 1RTHB 2JC0A 2XSJB 1KQSR 3KLHA 3CJ5A 1FTRA 2ZE2B 5HMZA 1HNVB 3C6UA 4LFCJ 5A8KA 4KO0B 3UCZP 1SL1A 5BXIA 1S4FA 3GIRA 5DO2A 2J7WA 4HI1A 3E01B 4F4WA 2F1FA 2XEXA 2JVRA 1VLYA 1EQMA 1NUEA 4P73A 3FKBA 1KFSA 4Y3CA 3G6VA 3RW6A 4N8NA 1HYSB 1VQYA 4ECYA 4LSNA 3IAM9 4RR5A 5F8LA 5KFXA 5I42B 3QT8A 1TUVA 3AOAA 1NM2A 4NWBA 3GJSB 2EFVA 4CIOA 4ED5A 1N6QA 1UVNA 3KUEA 1FD8A 3SEOA 4J9QA 4MJKA 4O4GB 4ELTA 5KFAA 4LF8F 2HFZA 6FD1A 2WZ1A 1UA0A 1B7FA 1YHQS 5D4LA 1RT5A 1S1TA 2HHUA 3SFGA 2VIHA 3TWZA 4USUA 4X4UA 5IXUA 2CNNB 2R7QA 3MEDB 3EPIA 5DGBA 4X2BA 1HBMA 4PZVA 3VZIA 5CYMA 1UWAA 2MKYA 3ONQA 2BANB 2ACMA 2WOMA 1WNEA 1NAQA 3BZQA 1N48A 4K5SA 1N4LA 2MGZB 3DLHA 2CQ4A 3GR1A 2Y1JA 2MB0B 1NDKA 1RLDA 4WXWA 4K4WA 4OJGA 4N76A 1V3ZA 2RD5C 3VQTA 4WIIA 1FFSB 3J81j 2DEIA 1ZTTA 3IBFB 3MEKA 1WC3A 3D66A 5EGYA 3BSOA 1XWLA 4WE1B 1F2GA 4NEZA 3R5GA 2HG4A 5IC4B 2HGNA 3MM6A 3BGUA 4K2JA 3TRGA 5I3PA 2LQJA 2WTFA 2OTJS 4NE9C 4ZIWA 2MZSA 3HVTA 3ZZ0A 2J9EA 4BBYA 1HFEL 4RUAA 2MDAA 3TP2A 5GVQA 2AW0A 1S6OA 2XMUA 1G2EA 2BW2A 1RISA 3P6YC 1RXOB 3R5CA 2UVVA 1WSRA 5D6GA 3T5LA 2B7CB 1OMSA 1NH8A 3ITHB 2ZDOA 5J1PA 3R3TA 5KT5A 2BE7D 4EZ9A 4N56A 3U02A 4U96A 1FI4A 1X4FA 2ZJRQ 2HS4A 2KHCA 2R7SA 2BM1A 2MJNA 3T6JA 5J2NA 2ZD1A 3KLFA 4L73A 2DO4A 3CJRA 4C48A 5KFRA 1U1OA 1ZBTA 2CPJA 1HNIB 1FK9A 1T9TA 2DNLA 3FBFA 1C1CB 4NZ6A 2OUGA 1Q8LA 2R7OA 2K7KA 5KFBA 4USJC 3W8GA 2VH7A 3G86A 3HK2A 2OFGX 4Z7YA 1BY9A 2ASLA 3CJ2A 2CPYA 1QAXA 2HNYB 4DQSA 2IM0A 3RBXA 2R42A 5EUHA 2NXJA 3EGVA 1CJTA 1HNZF 4B17A 4B02A 1F1BB 4C4WA 2HRUA 2I6WA 2UXCJ 1RKIA 5KT6A 1T94A 1JKHB 3QGPA 3MD1A 1SCJB 4DR6J 4GMKA 2MZJA 4C11A 3BO2A 3N01A 4NA2A 4O3QA 1RB0A 3T1YJ 4CQ1A 4EO8A 1BQNA 4DFMA 1S48A 1HI0P 2DHHA 3Q8YA 1RKJA 4M94A 1XMQJ 2M5YA 2KN4A 1UP1A 1HPZB 2IIHA 2VC1A 2MXYA 3O6QA 3KJNB 1WC0A 1ZPVA 5K8PA 2L9WA 1ACMB 3D67A 5L1JA 3SQOP 4U7UD 4PQUB 2RDIA 3TVYA 1SKRA 5H9EK 1GXUA 5HMYA 2GIQA 1RWMB 1YK9A 3I4PA 1UZHA 2UXDF 3D1QA 3R7NB 1KLMA 1RTIB 3NWGA 3TUPA 4ZVPB 2KTQA 3O44A 4LVNP 3HXMA 4DUYJ 3NCPA 5C7PA 1RT2B 3ZNUA 1VQPS 3JYTB 3K5MA 1BQMA 3OFGA 5E2QA 4E2FB 1NK8A 4P7TA 1Q86T 1N5TA 4A8XA 1HBNB 2KXFA 3A1YG 5DLGA 4FNIA 3QZ8A 2VFVA 2WSFC 3MCOA 3DRRA 2RRAA 2DO0A 3OHBA 2VKRA 3W2VA 2IMWP 2XQCA 3CCWA 2YKNA 3OTBA 3NCQA 2P9GA 4NCBA 2HAIA 2C3YA 4DS4A 1RYRA 3RB3A 2WW4A 1TL1B 3KOAA 4JYAF 1AXQA 1HBOA 1TKDA 5DQIA 1I94J 4RJVA 3CXCR 1H98A 2EFPA 2KHDA 1PO6A 4A8QA 4USTA 2E66A 2J8AA 3BR9A 3U1LA 5AE3A 5B0FA 3CE8A 3EGWB 1RACB 4PYAA 4B3OA 5T7LB 2LQ5A 1KONA 4WK3A 3OBIA 4FXDA 4WTYA 3TA0A 1FVSA 2Z2MA 3WHIA 4GKJF 4DR1J 1U1KA 4OQJA 3DM2B 2J6TA 4IR9A 4NLTA 3PX6A 3FEZA 7AT1B 1Q7LB 2B56A 1OPIA 1F5AA 4QWCA 1HI8A 3IXQA 1IKXB 5EN1A 2I9SA 1K44A 2GV1A 1RT7A 4KPYA 4ZLNA 3A8EA 2DCUB 2VG7B 2M52A 2KJWA 2NUHA 4ZP7A 5SZTA 1HNWF 2B4UA 3IM9A 1TL7B 1HWIA 3HLUA 2IBOA 1FHTA 1MN7A 2MZ1A 2XS7A 2CUYA 1T02A 3KHHA 4S0MA 4RW8B 2F40A 2WCXA 4X62J 1L3VA 4ID8A 5KT3A 2DNRA 3C15A 3CTRA 1NDPA 3JQKA 2GW8A 1RUSA 1WHWA 3QGGA 4X84A 1MG7A 1VBYA 4YB5A 2HZCA 1YG0A 3R6LB 1GAOA 4WYLA 4KY3A 2HNZB 1FT8A 3M7VA 1HHSA 2R7UA 4JV1A 4OL8A 2PC6A 3DXBA 3BBCA 1FRJA 2EG1A 4CDIA 3NGKA 3SCLE 1VQMS 1P8GA 3N6MA 1DRZA 1WHYA 4F4YA 3SCKE 2Y8YA 4PXDA 3G2XA 4QZVB 3L95X 2R2TA 3D28A 1LWEA 4ID5A 2EC2A 3P5TL 2PEHA 2OI2A 2COLA 3ENWA 4IRKA 1IM6A 4P9SA 3GFHA 3U1NA 3FC9A 5HQMA 3FRZA 2MKCA 3DLKB 4PG4A 5F41A 4I6AA 3T19A 4KT0C 4B9LA 2YWWA 3GU0A 4FXVA 4PR6A 4ED3A 1WI6A 4FYWB 1U4BA 2MQQA 1VBXA 1FXDA 3MMBB 3G6XA 3J81Y 1PKUA 4O0IA 1RAFB 4U67Q 1FDDA 2MLXA 2Z2YB 1H2VZ 5F8IA 5LSRA 2GHPA 3E3XA 4XO0A 2HWIA 4F3MA 2CG4A 1UEVA 1CJTB 5F9NA 5C25A 2AEFA 3W61A 3DU5A 3C16A 4FVCA 2L41A 1Z2ZA 1L3UA 2V5HG 3NGSA 1RLCL 1IQZA 3CCUS 1A9NB 3H5UA 2L48A 5IQQA 2B8QA 3I31A 1HBUB 3CJKA 3HHDA 5CAAA 3HO1A 1Z4UA 3M2UB 5JJBA 4IO1A 3DOLA 2E7WA 3TX0A 4URSA 3N5BA 4I1TA 2CPIA 2PFDA 2DH9A 2YKAA 2D7SA 1VGYA 1TV6A 2ZUAA 1S77D 1S49A 1PIEA 5L39A 1VQ5S 2YX7A 1ULRA 4WFAQ 5DZ6A 1UETA 4V1Ak 2DHGA 5JMNA 1TUWA 2IC3A 3AB2B 3WX4A 5IS2A 5KFCA 1S1XA 2VJUA 1SL2A 3LALA 4N47A 2CQDA 1QE1B 4USHA 3DLGA 2RSQA 3D7SB 3LPYA 4KRWA 2QO3A 2ZH8A 3UVJA 3PRVA 4H54A 3HF5A 4AXJA 1D9AA 1X9MA 4OI6A 4TQRA 2VG6A 2SXLA 4C8OA 3VR1A 4M5LA 4X4TA 2MSTA 1UVLA 3CJ0A 2IYIA 3ILOA 3P8BB 3IN5A 4Z2XA 1JLQB 2PA8D 1NKCA 5C42B 2XI2A 1N5QA 4GC7A 4FF1A 1WHVA 5J2PA 3CPWR 5BR8F 3GIKA 1PGZA 4YY3F 2P6SA 2D9OA 1V6HA 2VU5A 1JNZB 2IFXA 3AJ2A 1PBAA 3KG4A 2Z58B 2JLEA 1F5CA 4B3MF 3T1AA 5F9LA 3T41A 1FFGB 2JLFA 3KNGA 4LF7J 4WP8A 3OVAA 2U2FA 2H54B 2V2KA 2G0IA 4DCOB 3B78A 3UW1A 2PD1A 3MM9A 4DV3F 1WKKA 3PV8A 3J7YU 3FQKA 3IRXA 1U49A 4RU9A 2J0WA 4IOCQ 4GC6A 1UFWA 2EKNA 4GO5X 1S9FA 2F8HA 5H9EJ 4W98A 3MECB 1ITPA 2O5DA 2J0XA 2FJEB 1U1NA 3FGVA 3SZ2A 2BKNA 4AQYF 4EBEA 4CLLA 3MM5A 2OTLS 3HSGA 2KZMA 5BYQA 3SDEB 4CO0A 4C8KA 4ZVFA 4KB7A 5H9FJ 4P71A 4JB8B 4IG3B 3D9BA 2RQ4A 3JTOA 1KHVA 4ETZA 3G8QA 4WFNQ 4K4UA 1SJQA 1VJWA 1DQAA 1SIZA 3OL7A 2XWYA 4QWEA 3MURP 3BPDA 4RPFA 2VG5A 2LDYA 1EIYB 3BGRA 1NJIT 1TR0A 5ETNA 1DLOA 5U47A 1NK5A 1C0UB 4ITSA 3SQGB 4X66F 4NLRA 1QD1A 2JL9A 1N36F 1S72S 2UVUA 1IKVA 4HLBA 4PPZA 2WSEC 2Z2ZA 2B6AA 4OLPA 4NLPA 1Y7PA 5FDLB 3DHXA 3H59A 3UD5A 4PXCA 4QR0A 2CNLB 5T14A 4JV5J 2CPZA 3H25A 2CJYB 1DQ9A 2BVZA 2DCLA 4ZS6A 2OPRB 5K20B 3JTNA 3AHPA 2CJ9A 2E5IA 2OPPB 4HEA9 2HK2A 3ET6A 4JI0F 1U09A 3DRPB 3P5BP 4KH1B 4NLQA 3QWPA 2FVQA 1M5SA 2IJNA 3NMAA 1NZ8A 2AGQA 1NEEA 2W2QP 2Q6BA 2LFVA 1HIYA 3QLHA 3BYPA 2W8KA 1URNA 2ERRA 4Y00A 5B08A 1S12A 1OSDA 2DNKA 2F65A 1N56A 3KLGB 2V2ZA 4LT6A 3Q8VA 2QRRA 4OZ5A 2VJVA 3LH2S 2W2NP 2DY1A 1S9EB 1RGVA 1N5YA 3W3SA 1U2FA 5D4NA 3NNAA 1NBEB 1O8BA 4DV6J 3GG1A 2AZ1A 3W63A 2LXFA 2RT3A 2FLNA 1YDLA 2ZC4A 2KZZA 1AFJA 1R3NA 3TJ9A 1T8EA 1YIJS 1H74A 1R0CB 3H90A 1TV6B 5I3UB 4I67A 3NWRA 3US5A 4NZ7A 2F4VJ 1NPPA 3BQ1A 3KKFA 1ZAVA 4FP9A 4U8VA 4YB6A 2E44A 5KFDA 2FJDB 3R27A 3GIJA 3BGFA 5KFUA 2XZWA 3PO5A 2VBXA 5A8WA 3E2EA 1TL3B 1AFIA 1C1BA 3GIMA 4JI5F 1FKPB 3PYDA 2O1PA 1SQFA 4K0KF 2ZH2A 1UWBB 2FJVA 3DI6A 1VISA 3A3OB 4DV2J 2NXNA 3PY8A 2HS0A 4NLWA 3OR1A 4IDKB 1UW4A 3UVJB 1VC0A 4Q2LA 4Q8FA 1KRPA 1TL4A 1CPZA 2HMIA 2QA4S 3IWXA 2FB0A 2XMJA 2UUAF 2Q43A 3EXYA 5HATA 4F2SA 1AYEA 2RKIA 2UUCF 2N82B 1Y5IB 5CYJA 2EEYA 2VA3A 2V9KA 4QWBA 2BOAA 2DXFA 4ZCKA 3A3PB 1BQXA 2F9DA 1R0BG 4DPUA 1XR7A 4IRDA 3KMQA 4CCHA 1Y00A 2V9WA 5EHHA 1YJRA 4HDHA 4ZP6A 2MY8A 4KGMA 1FD2A 5LSOA 1SQGA 1U02A 3MPYA 4NCAA 1Y5NB 3PW4A 2X51A 2UUBF 3I0RB 4G6VB 1PYOB 2UU9F 4FF2A 2H51B 3Q89A 1R8HA 3HJVA 2OPQB 1NSQA 3TZZA 1M90T 4X65F 3M2RA 5C2CA 4Y2AA 4C0OC 2R8JA 1U2CA 1RI7A 2C2RA 5IC6B 1FNMA 4N5SA 1D09B 1WDDA 1GXTA 2IJFA 2QMUB 4DI6A 3QJLA 4LF9F 4DJBA 4I7FA 4K4TA 4RW9A 2CZ4A 1SC1B 3R9LA 1FDAA 5DJBA 1H73A 4HT7A 1FRKA 4B3TJ 2ROEA 5DDQC 2ZVSA 4OYOA 2UUTA 4RBTA 5ETQA 2CIMA 3ZO7A 1U2RA 2CPFA 4ZHRB 2H4YB 2I5JB 4K4ZA 2HEKA 2AMCB 1N0UA 5AXLA 3RW7A 3EX7B 3KK1B 3GILA 2CPDA 2CWKA 3PEJA 3F0NA 1KWMA 4JI1J 3KUGA 4C8NA 1S0MA 3MUMP 5C24A 2XMKA 1RTDA 4RW6A 3VGSA 4MYTA 3MDFA 1S6PA 5ADZA 3G87A 1JWWA 4DR4J 3LGMA 1AZSB 2RU3A 2HSEB 2QX0A 2GIRA 3M6VA 3ZTQA 2CKWA 2YNHA 1REVA 5H1SV 2YWEA 1EJ7L 4YB7A 1S0OA 4G1PA 5HMWA 4DUZJ 4O23A 2B6AB 5E33A 4ED8A 4M5HA 4IR1A 1EHWA 1MROB 2B7BB 5CH7B 1QAIA 4PXBA 2MY7A 3ZNJ1 3BQ2A 4ED7A 4F4AA 4DV5J 2CZ9A 3GG0A 2YY3A 4DR2F 3ZZTA 1H2UX 3GPAA 3CUNA 1GK8A 4IQXA 4Z37A 1UFKA 2RRBA 1WOOA 2BOPA 3CCLS 2FJWA 1REGX 1OS5A 4I64A 1CJUB 2DR7A 4EBCA 5J2QA 1NPRA 1HL6A 2HIQA 2K1RA 3QYYA 4YP3A 2HFSA 4EEYA 1UTAA 1DHMA 2H5EA 3ZTOA 4G65A 2FYXA 4K4SA 2LECA 4AE5A 1SBRA 1RK8A 2PN6A 3QJPA 4YR0A 3W65A 4C0HA 2KXHA 3VF0B 2VL1A 1XERA 4LRDA 1T9WA 1SUQB 1OQ6A 3AJ1A 1JB0C 4ZVRB 4BDPA 1N5YB 5KFLA 4DX8H 4P72A 4KKOA 1HQUB 2VZ9A 2HHHJ 1JLBA 4F4XA 5E3QA 2MLYA 2DXEA 1KBRA 3QIDA 2WW8A 2BJ8A 4L3KA 4OYBA 4XK8C 4NYZA 4N7TA 2D3OR 4JI3J 3VGTA 1FX4A 4WKRA 3LP2B 3X3UA 5HROB 3HHKA 3QT7A 2CJAA 3OR2A 3GSDA 2JNJA 3HPOA 5DDRC 1H6KX 1O5JA 1VIXA 1UJ4A 4J9MA 2G0JA 3J7ZT 4OX7A 4QW8A 3OLBA 4LVOP 4TY8A 3HMJG 4OZ1A 2GC8A 1CS4B 3R7SB 4WYWA 4IKAA 3H4DA 2F5GA 1YRTA 3CC4S 2X3GA 4OJHA 4H4OA 4ILMA 1SH2A 1YQHA 2CJXB 5J1EA 4C7QA 3ZTPA 2AYGA 3BSCA 2B0GA 1U26A 4NLOA 5KOWA 3JAMY 3CCJS 4OHWA 1ZM2A 2XY6A 2MHNA 5HLFA 3G71S 1GMWA 5CD4A 4P74A 1HR0J 5HBMB 2VBWA 1SJFA 2CFXA 1CQNA 1FJGJ 4LRCA 4QIEA 3BSNA 1UMJA 2QZ8A 5KFQA 2FIUA 3KLIA 4Y2MA 2R8GA 1BWEA 4M5DB 1SV5B 3F41A 1VOMA 2LDIA 3KJVA 5L1IA 4KGKA 2HQIA 3H5SA 2ALZA 4WFYA 2LA4A 2FVSA 2ZITA 1KDNA 1TUGB 2EK1A 2PDAA 2CRLA 2M8HA 4U95A 4PUOB 4PCQA 3W1YC 1HLWA 1F2HA 4CNZA 3W5XA 4H4MA 3VHQA 4OFZA 1EARA 5EX3A 1YZ7A 5LMNJ 1G6BA 4HDGA 3SV3A 5IQ6A 1IBKF 3TNVA 1U45A 1SC4B 2CQGA 1WKJA 4ZPBA 5CCMA 2GCFA 2OPSA 4ZN3A 3CGIA 3JTPA 5L9NA 2KKHA 2QYCA 1TQLA 2ZBRA 4KHMA 3EZUA 3HCXA 1NJXA 1G4CA 4DG1B 3M1VA 4Q8EA 1JLCA 2W25A 4RX6A 2EI5A 3B4MA 3R5BA 1FTCA 3RRKA 2FLPA 4EYHB 2LVWA 2GIFA 2YWKA 3CCVS 1CJVB 2D3ZA 4OI0A 2CJQA 4LFBF 5AXKA 2A6MA 1FRMA 1OIAA 3M8PA 3HHLA 1FKOA 3HFVA 3CC7S 1BUXA 3M2VB 1K73T 2HHPA 2J6SA 3DYAA 4YB1P 2LXIA 3TUIC 5JVHQ 3JXOA 1WC5A 2B4PA 1LWFA 4FYYB 3V4MA 2P5VA 4QYZK 1R6YA 1DAXA 4RW4A 4M5IA 3MM7B 1YBUA 2IHR1 3OL9A 3DDIA 1TKTB 3EGNA 3MR5A 4DL4A 3N9UC 2GVDB 3H7HB 4QJVA 4C6AA 4UZBA 2ABYA 1EETA 2HNDA 5F8MA 3F73A 1RWUA 1CULB 3DGPA 4KH0B 3IG1B 5IT0A 2W2MP 3H2UB 2ZM6F 3TI0A 2XTJP 2GQQA 2FD2A 3MPUB 2XHWA 2EK6A 4DCJB 4DR5F 2C22A 1RHQB 4DQIA 2V4RA 1U6BA 3FMBA 3GIIA 2RF2A 3OD2A 1TK8A 4FYVB 1OYDA 4DV7F 2IJRA 5B0CA 1Z2LA 2AJFE 4AD6A 1T9VA 2R2UA 1R8PA 3UR3C 3AQPA 4NXMJ 3QIPB 2RS8A 2BXJA 1X5OA 4PG5A 1X60A 4OZLA 3BSAA 2Z8QA 1S0VA 1VRUA 3MXHP 3W9JA 3IAS9 4LFCF 4NRTA 3G96A 4QYRA 1NK0A 1HWKA 1R89A 3CD0A 3TJ8A 5GAHU 1RCOB 1IKYB 3EM1A 2ZUGA 1IQTA 1GTEA 6FDRA 3HX9A 1RT3B 1CC7A 1YTYA 1S76D 1YJWS 4QIFA 3EWGA 3IA0A 2HQCA 3MFIA 4EO6A 1JXLA 2AGPA 1X4CA 3C3LA 2HHWA 2WRMA 1W25A 1T05B 1WF2A 1RHUB 3IBWA 3DRSA 4MIAA 3MMCB 2BQRA 4AUKA 4BWJA 4DL2A 1RJJA 2VF3A 4PWUA 2DRDA 3Q8SB 5K14B 1R7IA 4G1QA 3DXSX 1HA1A 1V9OA 3M9NB 4P75A 1KP6A 3ZZOA 1NSKL 1VS3A 4KGVB 2DRAA 4PEOA 1O6XA 1TKZA 4LRAA 4CO1A 3OLAA 3DOMA 2DGVA 3OFFA 3CCTA 2RE1A 3FUYA 1K8AT 1BMQB 2E5GA 2E5LJ 1MMLA 4O44A 1HMVB 2PEBA 3OXLA 1NK7A 8RUCA 2RDJA 2EBGA 4CLKA 2NZCA 3UNYA 1RT4A 4WFBQ 3FCWA 4C8LA 1KVIA 4W4MA 3POTA 3V2UC 3GMGA 3CJSA 3GYNA 4R8UA 5LM7E 2OELA 1DTQA 2G1DA 3MI7X 3NBPA 2DNYA 5KFYA 5CCLA 1T9UA 3GLJA 1H7XA 4FYDA 1IKWB 5KG5A 1U1MA 3Q23A 3LP0B 3BKFA 1FRIA 5EWFA 2YWGA 2HAFA 3KLEA 4K4YA 1RE1B 3QO9A 1XBWA 3V4IB 3RB6A 2UZAA 3RYLA 5F0UA 3L4BC 3TAMB 3LP1B 5T41A 1IM4A 1Z1ZA 1RTJA 1TAQA 3DGVA 3I82A 4DXLA 2ZFHA 5L1LA 2PE8A 4FN5A 3QPIA 2IBKA 1SJ4P 3M6XA 1KOOA 3W66A 1MN9A 4N41A 3KDOA 1EKRA 5G0RB 2ATCB 5CYQB 4GO7X 2AYBA 4LBPA 2ROGA 3K2YA 5ETLA 3V81A 2W4CA 1MU2B 1HARA 2JDJA 3LF0A 3BH6B 1FCAA 2W7AA 4TYAA 2N3OA 3ETOA 2OHDA 2L9DA 2WVDA 4GVLA 1WWHA 4DSFA 1BE4A 1LW0A 2AYEA 2BJ9A 1SKWA 4C98A 3DLEB 4CO4A 3V6DB 1U1QA 4DFPA 4DV1F 3DLLQ 2DGTA 3ZXWA 4DFJA 5D4OA 3W2WA 2APOA 3UN3A 2DIVA 1HQEA 2JRSA 3EZ5A 4CO5A 1U48A 4RWWA 2IVYA 5MAOA 2RDDA 4C8YA 3P4UB 1R8BA 3C19A 3K8VA 5HJXA 4DSEA 2CQ3A 1S1UA 2BE2A 1FE0A 1S1VA 3SCIE 2VC0A 1EP4A 3IO1A 3M8ZA 4DUTA 5ETKA 3BEGB 4CRJA 4F67A 5D3GB 3BQ0A 4KIAA 5IM0A 4HACA 4MK8A 3M8YA 1HWLA 2VASA 2UXCF 2OFHX 3SIPB 2C3PA 3BDPA 3HSJA 4J9SA 2ZH6A 3CF5Q 3PG9A 2KI2A 3IGVA 1X5TA 2W8LA 4P6QA 2ZH4A 4YR3A 2OP5A 3GYXB 4LF1A 1VR6A 3UN2A 1TVRB 3NGTA 2QYGA 3JB9k 1M5PC 4ICLA 1R31A 2E5JA 1XMQF 1W7WA 2RF2B 2XY7A 2J7UA 2E1CA 4OV1A 1RHKB 3LAMA 5L46A 2LMIA 3OPKA 3Q22A 2G2YA 4IFVB 4PPDA 4IO9Q 1K9MT 2OKQA 1I6JA 1BWVA 2MSSA 4HHHA 1N32F 4ZPDA 3SCJE 5E0OA 1RT1A 1WEXA 1SJ3P 4FS1A 4CLPA 2KRRA 3OUYB 4CH1A 6AT1B 4C0BA 3PFEA 2CQCA 4OZNA 3PJWA 1IBCB 2NZ4A 1NCLA 4KFBB 3Q8PB 2K3IA 1P1LA 4HH1A 2ROPA 2LQ8A 1H2TZ 2C28A 3TUJC 4DQRA 3CDAA 1VMBA 3IMQJ 3QATA 3JSBA 3KK2A 1YWXA 1JX4A 2NR0A 1MWZA 2XULA 4PG6A 3F44A 1S6QB 3BGLA 2YQ0A 2GVZA 4QYZJ 1ROFA 1SVDA 4F26A 1VYAA 2PO4A 3NKYA 4JI7J 1D8YA 3OVSA 2RILA 3PYFA 4OHVA 3W60A 3ILJA 5L1KA 3Q86A 4OX6A 1S1WA
chains in the Genus database with same CATH topology
2LKZA 2JOQA 3IGNA 2RNEA 4CT9A 3UD4P 3J7A1 3JSYA 2IC3A 1MNEA 3AB2B 1VQ7S 3WX4A 3DDKA 5CZVA 3J7YI 4BCAA 2E5HA 1X4AA 4C2MA 2AD9A 2C42A 5IS2A 4AL7A 4HTJA 3FSXA 1DURA 4URQU 5KFCA 5KFEA 1S1XA 2YNIB 4MFBA 4X4QA 1YJNS 4DL3A 1I94F 1OSCA 1V3SA 1SL2A 4X4VA 2DNGA 3LALA 1TVRA 2OSRA 3L3CA 3DLKA 1FKAF 4KSEB 2AF6A 2HS3A 3PRDA 3V6HA 4N47A 1KOHA 5DM6Q 3OHAA 2CQDA 2GHVC 4RW7B 3AB4B 1QE1B 2CQ0A 1ZM3A 4HI2A 2KM8C 3H5XA 3MMAB 4USHA 5IT9Y 3MM5B 3DLGA 2QSFA 2QA4G 4ZPTR 2RMLA 2RSQA 1JLFA 2DGQA 3DRYA 2D41A 3VAIA 3LPYA 2DGWA 4CO3A 4IUFA 4KRWA 2QO3A 2ZH8A 4JV5F 3AQOA 4H54A 1SH0A 2P9CA 2XGQA 3HF5A 5KFSA 4FBUA 3JSMB 5DS7A 3RB4A 4AXJA 2DGSA 1D9AA 3VAFA 4R0JA 2VB6A 2DNMA 2POKA 3MMBA 4ERDA 1X9MA 4IFVA 3MEGA 2VBZA 4DSKA 3FNNA 4OI6A 1QLNA 3U7JA 4TQRA 2VG6A 1NU4A 2SXLA 3LWMA 3OTEA 4C8OA 2M0GB 1KD1T 1FJCA 4DS5A 5L9XA 5DQHA 2QE5A 3KG0A 3VR1A 3PM9A 4H4KA 3S01A 4ZCLA 2HFNA 4X4TA 2MSTA 1Q8IA 3M6WA 4RLEA 1PSDA 4YEAA 4EGLA 1UVLA 3CJ0A 1W2BR 5KG3A 1M5KC 2IYIA 3M30A 4I69A 3NL0A 1V3RA 2IA0A 3IN5A 3PR5B 4Z2XA 2DT9A 4A46A 3OUYA 1JLQB 2EKYA 2PA8D 1NKCA 3FVYA 5C42B 5FLXY 1NRKA 2XI2A 1N5QA 4GC7A 3PX0A 3LQVA 4FF1A 2XB2D 1WHVA 2YH1A 4W92B 4ES2A 5J2PA 2VG5B 3CPWR 1KR4A 3BGRB 5BR8F 2ZHBA 3TARA 3GIKA 1DLOB 4KFBA 3OFHA 3DNCA 1PGZA 3D1HA 3CCES 4NCGB 4YY3F 4Q44A 1FEHA 1TK0A 3N5FA 2P6SA 2D9OA 1JLEB 1V6HA 4MH8A 2IM1A 3HHLD 1JNZB 2IFXA 2QLWA 4MK7A 3AJ2A 4F3QA 1HBUA 3VTIA 3KG4A 2M8DB 3TR5A 4MKBA 2AJQA 2JLEA 4WZMA 2PMZD 1IKVB 1Y3KA 3M2UA 1D0EA 1F5CA 5KT2A 3T1AA 4X62F 4B3MF 5F9LA 3DU6A 2R4FA 5HI7A 2JLFA 3KNGA 1S6QA 3P3DA 2ZZNA 5JXSA 3OVAA 2FHJA 4U6PA 2QMWA 3OSPA 1UA1A 1YSJA 2U2FA 1Y4ZB 4ETXA 4LFAF 2V2KA 2ADBA 3BR8A 2GHWA 3B78A 3NMRA 3UW1A 2IYGA 2YNGB 2PD1A 2JC1A 3RR7A 2GJ2A 3ZZUA 3MM9A 4ZVGA 4DV3F 3T1HF 3G6ES 2EFQA 3PV8A 1JXEA 3J7YU 2DVIA 2IA6A 1TFYA 3H5YA 3RRGA 2LQ9A 3FQKA 1JK9B 4R25A 3TANA 1LXJA 4I2QB 3HT3A 3IRXA 1GT8A