3WX4A

Crystal structure of t4 phage arn protein
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
98
structure length
98
Chain Sequence
MIIDSQSVVQYTFKIDILEKLYKFLPNLYHSIVNELVEELHLENNDFLIGTYKDLSKAGYFYVIPAPGKNIDDVLKTIMIYVHDYEIEDYFELEHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anti-restriction endonuclease
publication title The T4 phage DNA mimic protein Arn inhibits the DNA binding activity of the bacterial histone-like protein H-NS
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Viral protein
total genus 28
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2014-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2770 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3wx4A00
3WX4A
chains in the Genus database with same CATH superfamily
3HFVA 3UD3P 3PW4A 1LV5A 4HTJA 4RW8B 2ZBPA 2RE1A 3CGIA 3CJTA 1IR1A 1NUEA 4KIAA 4PWUA 3EMTA 2DNLA 4WU3A 3V81A 1TKZA 2AW0A 3BZQA 4J91A 3QFWA 3K5OA 3GV7B 1XERA 1IN0A 3CCSS 4DOZA 3TANA 5KFVA 4DN0A 2J7WA 1V5IB 3E01A 1R3NA 1F1BB 2CPZA 3MF5A 4C8LA 1FRJA 2PN6A 2W4CA 2OELA 1XWLA 1TV6A 1B64A 3GG0A 4CWBA 1VC5A 1K47A 3PIPQ 2QLJB 1PC5A 2EK6A 5EWGA 1T3OA 1VOMA 1EKSA 2E1PA 1VISA 3H98A 3BKTA 1RDRA 4O3PA 4KGMA 1FT8A 4V19J 3W3SA 2KG1A 3DI6B 3Q83A 2YKOA 2LXFA 2E7XA 1OSDA 1WHYA 3CIMA 3SQGB 4TNOA 4AD6A 4A8YA 4MH8A 1RU2A 3M2VB 2DCUB 3OXGA 5A8KA 4HDHA 3W9HA 2CPJA 1FK9A 5IT9Y 4Z7CA 1VI7A 3T41A 2PMHA 3QZ8A 3CO0P 4WJBA 4C11B 3QIPA 4JI2F 3ZZ0A 2V8HA 1E6VA 3D0IE 4YY3F 2ZOFA 2VQFJ 2DBBA 2C42A 5DM6Q 2GCFA 4WP9A 1RTZA 4ES1A 2KRBA 2YWFA 4X65F 4QYZK 3OR2A 2MQMA 3OTEA 4OI2A 4P52A 3D68A 4F0HA 2JLFA 2A2DA 2GMJA 1UVLA 1LWCA 4NA1A 5ETRA 3OL7A 4HI2A 5HMWA 2GQCA 2MZJA 4C3MA 3MPVA 1GQEA 5KFCA 5KT2A 2W24A 3DOKA 4Y2MA 4N5SA 2MKCA 5MAOA 2XYGB 3PX6A 2VG7B 1Q81T 3GILA 2YQ1A 4K8RA 3PTWA 5I3UA 3G96A 1U1NA 1HHTP 3VVUA 5BYSA 2H5JB 2WVBA 3DHWC 3HLUA 2IRYA 7FD1A 1FRMA 3QWUA 1RT2A 4EGLA 1DZ5A 4DPWA 3PX4A 2HYIB 1GK8A 3QATA 2XSJA 3CJKA 1BHNA 3NNHA 2RU9A 4QYRA 4OI3A 1Y5IB 2J0WA 4I2QA 4NX9A 2EBGA 4OYIA 2VOOA 5DQHA 4OYAA 2OI2A 4UUXA 1JJCB 2FJXA 2LYVA 3HSZA 2V4JA 5BXIA 4DSIA 3KK1B 3HHLC 4JB8B 1BQMB 1I3OB 4L74A 2QN6B 2GIFA 5KAKA 1FKPA 5LL6d 2OAUA 3MPWA 3MEKA 3MAAB 2QMWA 4I0WA 3MEEA 4J9RA 4WTOB 3IC1A 4FF4A 4RR5A 3R7SB 2EI5A 3OVAA 1TAQA 2ZOMA 1OPZA 2XYPB 3LP0A 1WD6A 1TUGB 3GLJA 3HO1A 4TYAA 4DV2J 4PZVA 2HHWA 3HSGA 1ICEB 2G2ZA 3EWGA 1R8CA 3IRXB 4NLPA 3Q8SB 1Q5VA 3PJ9A 3D2WA 4YB6A 3E3XA 2ATLA 1TKXA 3OTBA 1PJ7A 1Y9OA 2DXFA 1SH2A 4KRWA 3SSSA 1C1BA 3BBFA 1HIYA 4UW2A 1RAEB 4CM0A 3R27A 3D1HA 1Y3JA 4X4RA 5H1SV 3KNGA 3N01A 3HP6A 3EPGA 3QGGA 3M2RB 2KXFA 4J37A 3DM2A 2DO0A 3EZ5A 4UZCA 1CQMA 4KHPJ 2FZGB 2ASJA 1R31A 1RAOA 1OIAA 3TRGA 4OHZA 1FWKA 4OMFG 3GCXP 4EYIB 1XC9A 1FXRA 4D3GA 1NK0A 4U7UK 3EYZA 1S5ZA 1FEEA 3DYAB 1ZZFA 4P72A 5JVGQ 4USVA 2GAGC 2KT5A 2QLWA 3AODA 4DQIA 1RT4B 4A8FA 1PAUB 2LDIA 2KYZA 3THTA 3K17A 3JB9k 2DYAA 1MN7A 4YS2A 1H7XA 3D3BJ 4HTIA 4HT5A 2CJ9A 2GFFA 3F44A 1ELOA 4NLVA 2XY7A 2DPJA 4NLWA 4DFMA 3KDOA 1ZM4A 3BGUA 5FLXY 1ZA1B 2UXBJ 1HQ2A 4FYYB 2N3OA 4BCAA 2D69A 2M8DB 2JEGA 1PILA 2ZEJA 3KUHA 1NLKL 1RWUA 4EMDA 1S6OA 1NEEA 1XQIA 3U27A 3UDEA 3M8YA 1S1TB 1N36J 4ZPCA 4PWDB 3JYTB 2UUCJ 2BE2B 4ZP8A 1FRHA 3CCRS 3MM9A 3WX8A 2J5AA 2NPIA 1GXUA 3CDWA 4LF1A 2QSFA 1IWAA 2AJFE 1UL3A 5F3TA 3BV8A 5D0HA 2H65B 1FD2A 4UF4A 5KFBA 3KLEA 4OX9J 1BY9A 3EDQB 2HNYA 5I3QA 4NXNJ 4R8UA 1UA0A 4M1KA 1JLCB 1R8HA 3PR5B 2VH7A 5GAEU 3NMRA 5L39A 5J1NA 5D0GA 2B4UA 2G1DA 3ZZYA 4DR3F 3KK2A 1PC4A 5M2RA 1IM4A 3BSOA 5A2QU 1H38A 4OLPA 2DH9A 2MSTA 2FQQB 2R8IA 4DV4F 3AD9C 3SCJE 4ES3A 4N41A 1UAWA 1WKKA 3F73A 2HGNA 1ZM3A 1FNMA 2QL5B 5KFGA 1DTQA 4A8MP 3SBMA 2AGOA 2CQBA 5KFWA 2YVSA 4CRJA 4QIFA 1XR5A 2XGPA 2R7WA 5IT4A 3DRSA 1S1VB 4ECUA 2RQ4A 4H54A 4J90A 3I6PA 3VAHA 2ZNYA 1XR7A 3UD4P 4NA3A 4NLGA 2MGZA 1X9SA 2LLZA 3D28A 4Z37A 2E5LF 2VG6B 4RU9A 2D7SA 2JVRA 1S10A 1DQ8A 2MKKA 2RKIA 4I6YA 2L08A 3T9NA 8ATCB 2CJXB 4CCHA 2FC9A 5DRKA 2PO4A 4C3KA 4DCOB 3D6MB 4O4GB 1V5VA 3K7RA 4WU2A 1WF1A 2ZVIA 4ZITA 3S01A 3DRYA 4N56A 2ZNZA 2YNGB 2CRLA 4B3MJ 4IFYB 1NM2A 1S9EA 2MHNA 1P9YA 5LXYA 1ITPA 4L73A 2N7YA 4EI2A 2D3OR 2PFFB 2RS2A 4H4KC 2HS3A 3FFIB 3V2UC 3PXGa 1DTTB 3AJ1A 5KFPA 4K2JA 2Q79A 3NOGA 4WTYA 3ZXWA 2MMYA 3LP1B 3Q23A 3EGWB 1YVFA 1S99A 3M4XA 1VRUB 4WBFA 1PGZA 3FGVA 3KYLA 4GO5X 4M5HA 5KT7A 4B3OB 4ETXA 3LPYA 2K06A 2RQMA 1GH8A 2XCPA 5E3QA 3A8IA 2XNQA 2BW7A 2GVDB 1L3KA 4RW9B 4K4VA 3LOUA 5T7LB 3TAMB 2R2UA 3NGUA 2X1AA 1KOHA 3CCLS 4ZJQA 2FLOA 2Y9HA 4FZVA 5D15A 4PQUA 1SJ1A 2LQ9A 3CCJS 4JV2A 1OPIA 3KG0A 5C2GA 4DV2F 1LXNA 1KDNA 5AE3A 4NRTA 4DV1F 3T5JA 3OUYB 2XZWA 3BM7A 1EHWA 2QLXA 3CC2S 2XCAA 1FFWB 1Q7LB 5L38A 1JXLA 2HHHF 1F3VA 1IBLJ 4CI0B 3FCVA 4CO2A 1FJCA 1HD0A 1DRZA 4LQ9A 3VVTA 2G2YA 3RUBL 4JI4F 4RW6A 1PAEX 3WZ0A 4IFVB 2CUYA 1B7YB 4LQ3A 3FVYA 3G6XA 3VGUA 1VR6A 4F4YA 1TK5A 4C8OA 2UUTA 4B9SA 2OTJS 1U48A 3MM5A 2BJEA 1S7IA 1NH8A 2HIYA 5KG6A 3RBEA 1HNWJ 4LF7J 3EZUA 1REVA 4TU9A 3T5HA 3OTOF 4MIAA 4M5NA 1WORA 2FYXA 2UZAA 3PZPA 4LR7A 3K89A 1FVQA 3W65A 3UNGC 3TAQA 1TVRB 4NYOA 2CDQA 4KKOA 3W5XA 4DX6A 3R2CJ 2YPYA 3UVJB 4RNMA 3LWLA 3C2PA 3B4DA 2HHUA 2JSXA 5D77A 4G1QB 1TL4A 4XAKA 1HYSA 3Q8YA 2BMBA 2MQLA 4DV7J 2IDLA 4TLRA 3K2YA 3TVYA 5K8OA 4ELVA 3IS9A 4C0HA 4ZN3A 2F9JA 4DR4F 3V4MA 1RAFB 2UXBF 1REGX 2UUWA 5B0FA 3C15B 4F50A 4Z2XA 3SCIE 2R7RA 5KFZA 4PR6A 4WFXA 3L9ZA 1GMVA 3DDKA 3DLEB 2R7UA 2FY1A 3D4JA 3AD8C 1T05A 3FKBA 5CYJA 1EX8A 1FKOA 2I5JB 4NASA 4R0EA 4ZVUB 1Q5YA 1KNZA 2V0NA 4U67Q 5LSLA 3FCHA 2DITA 1UPMB 4Q44A 3GU0A 2LVWA 2QA2A 4ZCIA 4BC9A 5B09A 2XZTB 4RW8A 3OFEA 3M32B 3ZO7A 4I7FB 3DC2A 1Y00A 1F3FA 4OX9F 1XMBA 4EZ9A 3NWGA 5KG0A 2KXNB 3DCAA 1R6YA 2GW8A 4ZMMA 2V8DA 1VIOA 2NSCA 2C1EB 2K1RB 4B17A 1ZPVA 4O4RA 2L9NA 4F4ZA 2WVFA 2HAIA 4DV0F 4WPAA 4QR2A 4QWCA 3RTVA 5JXSA 1DJ0A 4QJVA 3OL8A 3MR3A 2J9DE 4F04B 3PJWA 2YKAA 2VC0A 5KG1A 2DB1A 1VHFA 3PACA 4NEZA 1RBAA 4ZOSA 3Q8PB 3FBBA 4PRFA 1CS4B 3H40A 1UA1A 3DI6A 2IM3A 4URGA 2RS8A 1Q78A 2AEMA 2RNEA 1H6KX 3SQGA 2D3O1 1H2UX 2H3EB 1SJQA 3M2VA 3BREA 4DR1J 4F36A 2RRBA 4DI6A 2EBEA 1PCAA 4OHYA 2HIQA 5JMNA 5E5NA 4OL8A 2NR0A 4C11A 4JUZA 1MWYA 3NKYA 2ZM6J 4FNIA 3D6HB 3WIUA 1LFPA 1NK6A 3ELHA 3T1HJ 4C4WA 5C5JA 3EXCX 4B3MF 4N8NA 5GVQA 1TMJA 2O66A 1TK0A 1KOOA 4KY3A 3FRZA 3NCPA 2YXLA 1VQ6S 3OTCA 4ZJLA 4R25A 2ZWOA 2WBRA 2H9ZA 2VG7A 2Y1LB 5GAGU 1N32J 3TQEA 2C3UA 3OD2A 2QA4S 1UEVA 2SXLA 3ICLA 5JVHQ 5JUMA 2J9CA 2C3YA 3MECB 8AT1B 2HQFA 1RWXB 3OLAA 2DRDA 3Q0AA 1JIHA 3FEZA 4IDKB 4KE5A 4XPCA 3MCOA 2MEWA 3IR6B 4IOCQ 5H9FJ 3V6JA 2BJ8A 2B9EA 2A10A 2VPXB 2BANB 2BJ1A 5LJ5Y 4EZ6A 3RRGA 5K9FA 3FQLA 4B3RJ 1GTEA 4N7TA 2O1PA 3KK1A 3LAMA 3J81U 1YKWA 1VHIA 1BQMA 3I9V9 5EX0A 3ZZUA 3H5YA 3TUIC 4OYZA 3MAAA 4DR5J 1KKHA 1X0PA 1BUXA 3W62A 4ILMA 2MQ8A 1JWWA 2G4BA 3J80U 2RU3A 1O0PA 2FJEB 2HMIB 4RZRA 1B0PA 4ZVHA 2MZTA 4QCLA 4I69A 5HP1B 5LMNF 3FMWA 3DGPB 3IRXA 2V8GA 1HBOB 4DR6F 5KG4A 4TY8B 2DXDA 3OW2R 3HXMA 4JI1F 4FXDA 5MLCV 2OP5A 3K57A 4ATNA 1RKJA 3VAFA 2DNMA 2V5HG 3UDVA 3R5AA 1WOOA 1I5OB 3GB0A 3PKMA 3CMAS 3I0SB 3BSAA 3DLKB 2CJBA 1RAIB 4O44B 1U6BA 2QSWA 3U1MA 3K8VA 2HGMA 3M2RA 5GMDA 2DIVA 2MQNA 1UZHA 4M5LA 1VLYA 5A76A 3B78A 3V6DB 4Q5VA 2AX0A 4ZLPA 2B9YA 3PX0A 1CJKB 3OT9A 2XHWA 3CCZA 1SJ3P 3J81j 3MMJA 4YEAA 4CO3A 4FF3A 4YB5A 3DYAA 5M2UA 2OSQA 3BF4A 4GKJJ 1LEOA 2XWYA 3CWJA 5F0WA 1X4BA 4TQSA 5B7WA 3AXKA 4DV7F 4MAKA 2CNNB 1RT4A 1TZ0A 1U2CA 3FBCA 3I31A 3UR3C 3D9BA 3C6UB 3GZ7A 2H51B 5DS7A 3K5MA 2H5IB 2HWHA 4OV1A 4UQGA 1S1UB 2M3DA 2ZZMA 3FK4A 2DJWA 3WHIA 4YDDB 2LP4A 2HVIA 5GAHI 4LREA 3PHEA 2MTLA 4A8OA 2HLUA 3L7UA 3M8WA 1FWPA 1RA6A 2E1CA 3SXLA 4WYWA 2OEKA 4PAAA 4UTGA 1XNQJ 3M8RA 1S1TA 4X66J 1CLFA 1NK5A 2XWXA 3DLGB 4PWDA 4ECSA 3JYTA 2BE2A 2GGPB 2DXEA 1X4EA 2PMZD 2DEJA 3C14B 2M52A 4MIWA 5ETVA 1FRIA 4M8LA 1VBKA 2HW3A 5D4NA 4ES2A 2NXEA 5D0RA 2WVDA 1MMLA 2VBXA 1WACA 4LUBA 2BM0A 2CVIA 4P73A 3B82A 4K4UA 2CQ3A 2QO3A 4A46A 1Y10A 4OYPA 4OX8A 1JLCA 1FVSA 3RR8A 5EN1A 1CC7A 3KK3B 3CDAA 4X4UA 3MMCB 1I6JA 1FNXH 3JSYA 2WSEC 1SL1A 3AY0A 1N0UA 3CE8A 4UOFA 2F7VA 4NLDA 4LF9F 2GJFA 3P8BB 4JI0J 4DU7A 2MJUA 1AUSL 3BQ0A 3N0VA 2J6TA 4ED3A 2N3LA 4DR1F 2OFGX 2N7CA 2MXYA 3QRRA 3GMGA 3W64A 1XNRF 3T1YF 5K14B 2CPFA 2F5GA 2D3ZA 2LXIA 2HNDB 3MTJA 1S1VA 4KBIA 1B99A 4USWA 2W01A 5J2PB 5G0RB 1T03B 1HPZB 4K4SA 3G6YA 1OWXA 1PYOB 3NRBA 1SH0A 3HFKA 2ZH5A 3WC2A 4MKVA 2A6MA 2VG6A 2KT2A 1G2EA 1BWVA 5HK4A 1RE1B 3T1HF 2IBOA 4W90B 2KL8A 1FFSB 2ZHBA 4JI7J 4NXMJ 1IBMF 4O4GA 1LW2B 2V2VA 1X60A 3SI8A 4GMKA 3O2IA 2YNGA 4ZP6A 3THVA 4P6QA 4IFYA 1VQNS 2M0GB 2FVPA 4BBYA 4B9LA 5K8MA 3IWNC 2R7SA 3FFIA 2WZ1A 5DLGA 2IC3B 3AFGA 1DTTA 2ADCA 5ETNA 2V63A 1N33F 1J27A 3OLBA 2GHVC 3LP1A 4I1TA 1U24A 1X5SA 4DPOA 1X4HA 4MYUA 3PM9A 1VRUA 1IBCB 1U6FA 4B3OA 4C8KA 2EKNA 3DXBA 4ECWA 3RB6A 2B4VA 3M6VA 4ZA1A 1S6QB 1GAOA 4PEOA 2BXJA 1GTHA 5IC6B 2UV8G 2GVDA 5LJ3Y 4RW9A 1PBAA 5T7LA 3TAMA 4CLUA 5DDRC 2XMUA 3RGIA 4CQ1A 5K5MA 2FVSA 4ZDNA 3POTB 4B3TF 2DNGA 1TTHB 4ED4A 3EX7B 3V4IB 4LSLB 2HFVA 4DX7A 5I42B 1S97A 1JKHB 1NJZA 2QA1A 1NDPA 4U9RA 4A8KA 3G6VA 4NL5A 2XLIA 3OUYA 3RG6A 2W2QP 3JTOA 3L7OA 5F0UA 3HI9A 3OL9A 1GMUA 2EFOA 2IPOB 1JLBB 1ZETA 1QAIA 2OTLS 5KT5A 2W2MP 4B08A 3OQ2A 2RH3A 2QIFA 2UUAF 4LFAF 7AT1B 4YOEA 4DL0C 4IFVA 4M5JA 2UVWA 3SV4A 1Q79A 1WNEA 1NAQA 2F3JA 3TAPA 1H3DA 2XMJA 5KFRA 4ZLLA 2UP1A 2OHDA 2LQBA 4PG4A 2CJYB 2PGCA 5F8NA 2HKEA 2A0FB 4MKYA 1QTNB 4P2FA 2IM1A 2KKHA 4F8RA 2KZZA 1SH3A 3EVWA 4ZN1A 3LUYA 5J2NB 4JOUA 4LR8A 2K7KA 1HW9A 2DCLA 3BSCA 1XMOF 2OUGA 5IT0A 2XLJA 2KVIA 1ZA2B 1TVRA 2E5IA 1HLWA 3VAIA 4NZ7A 1LW0B 3UVJA 3I55S 4DV3F 4DV6F 3SCKE 1VLOA 4RNOA 1CQNA 2IJRA 4JV5F 4G1QA 4HT7A 5KFJA 1B3TA 2FGOA 4KGVB 4JYAJ 3IGNA 2QZ8A 1RWOB 2VIHA 2BJ9A 4KGKA 1M5HA 1S72S 3PFOA 3MUTP 2AHOB 1J5OB 3C15A 3B4MA 2IDEA 2IFXA 2AYBA 1O6XA 3VZHA 1ZH5A 3KJFB 1VQ7S 1UW4A 3DLEA 3TO8A 5CD4A 1F9FA 3DRPB 5HANA 1SV5B 4I68A 4DFKA 1I94J 2I5JA 5L1LA 1OY6A 3LWMA 4WK3A 3OVBA 1SQEA 1IVZA 1M90T 4RO0A 3KJVB 1KN6A 2J7UA 3IO1A 1EQMA 4DUYJ 4IQMA 3CCVS 3SZ2A 4OYWA 2VKRA 2O01C 2FDNA 3M32A 4ECYA 2HLTA 4I7FA 3NEKA 8RUCA 5KT6A 3JTNA 5ETPA 4PYDA 3LF0A 3KHGA 2V2ZA 2K1RA 2C28A 3SSQA 3TJAA 3FBEA 1WWHA 4LIRA 3I4PA 2M7SA 3OBIA 1FJGF 1U2FA 3AOBA 3NAIA 2A3JA 3MR2A 1PIEA 2DNZA 2R42A 2NQPA 1TKDA 2UVUA 2HQCA 2NXUA 1RLDA 4X4TA 5DG7A 4N47A 4DR2J 2VB6A 1EARA 1MWZA 2NXCA 1N34F 5KG3A 2QX0A 2FHOB 1CS4A 1SKSA 4AYBD 1HWJA 4RJVA 3TI0A 4CLYA 4DFPA 3EPIA 3KG1A 3ZTPA 1RT7B 4ZVGA 3QMQA 4WCEQ 2ASYA 1KONA 3PO5A 2CADA 4YUDA 3KJNB 4DR7F 4DV5J 2LECA 1HWLA 2R2TA 3NAHA 2BKOA 5THWA 3UD5A 4DPXA 4QU7A 4XK8C 4QR0A 4E2FB 3CCTA 4HDGA 2XNRA 2DNYA 2QLBB 1CJTB 1LK7A 2MDAA 4H4OB 1YJNS 2K7JA 1V3RA 4P74A 4J9SA 4RBTA 2IVMA 3D6FB 4WE1B 1HNXF 1KVIA 4OYBA 4DU8A 1EP4B 4O3SA 2XG8A 2X1BA 5E7OB 2MZQA 3ZZZA 3MD3A 2M8HA 2KHCA 4Y6IA 1SPBP 3JQMA 4RL1A 4NI2B 3QWPA 2AJ1A 4ZVEA 4ED2A 4LFCJ 4O3NA 1WELA 2DR7A 4ZVFA 1K1QA 3C16B 1Q53A 2CQDA 1RWPB 4KGZB 1HMVB 4PXEA 2W9BB 5HROB 2W7OA 1XBWA 4DQSA 3QPIA 3BDPA 2ASDA 2AP6A 3RBXA 2LQJA 3MECA 3QFHA 1R8AA 3J7Z5 2OPRB 2Z56B 4IDKA 3FDSA 1KBRA 1ZTWA 4Q7AA 3R5JB 1B0VA 5KFDA 2WW4A 4HHJA 4ZVTB 3MURP 3HJFA 5KTQA 3UCGA 2BANA 2IA0A 5L9NA 3BQ1A 4XDDA 4GVBB 2XLKA 4B3SF 2HURA 2ZH2A 3AJ2A 4DPTA 4B9MA 2OMLA 1LNQA 1VMBA 2M2BA 2ACYA 2UXCJ 4QPTA 3EUNA 1R8BA 2BOAA 4G6VB 2Y8YA 2HMIA 4K50A 3BGLA 2YWKA 3F56A 1IQZA 4F4AA 3UQSA 4QPXA 2VQEJ 4U96A 5HP1A 4PXDA 2LA6A 2MPUA 3DGPA 2YH0A 1HBOA 4OZ5A 3N6NA 1C1CB 4TY8A 3OFGA 3AOCA 3M1VB 3IMQJ 4P9SA 2K2PA 1S4EA 3KHHA 1FJEB 2BABA 3IRWP 3RU0A 1S57A 1KQFB 2W8LA 4J9QA 1S1WB 3I0SA 3DLKA 2V50A 4O44A 2KZMA 1RWKB 2I6WA 4DSLA 2VPYB 3PHTA 2DR5A 4RU2A 4NLOA 1KLNA 4JI5F 3M8QB 2KFYA 1YRXA 2UXDJ 4IO9Q 3AB4B 2BDPA 3CUNA 3V6DA 2D3UA 1MWQA 2CPXA 1N5TA 3MM6B 1CJKA 1OQ3A 4MKBA 2DO4A 3MR6A 2CWKA 5IC4B 1RWMB 3BYRA 2PSZA 4ELTA 4HLBA 2JFKA 2M5YA 4M5KA 4QWDA 2VL1A 3NG8A 1KHWA 3C6UA 4Q43A 3ILOA 3RBDA 4YDXA 3QQCD 1YZ7A 4WFAQ 1QM9A 4ZVPB 5EUHA 3BEGB 2FJBB 2VODA 1S1UA 3AOAA 3VAKA 5FJ4A 1GXLA 5HQLA 1H0HB 2Z0GA 3GE9A 4ER8A 1IBKF 2HGLA 4RNNA 2VICA 1SUQB 1EJ7L 3CJ3A 1BXNA 3MM8B 4URSA 1JK9B 4WFYA 2VUGA 3IAS9 1JNZB 3GCWP 4ED5A 3GP9A 4OZ2A 4KPYA 1YRTA 4RW4B 3HZGA 4ID8A 3PV8A 2HHXA 2OEJA 2UVRA 2A18A 2L9DA 5EGYA 1U49A 2GGPA 3I5CA 4Y2KA 4LF2A 3A3OB 5ADZA 2ZC3A 2HBYB 3Q22A 4ZVQB 4JI2J 2RQKA 3C14A 4RUAA 5BR8F 3NCQA 3W5YA 4YY3J 3NCRA 1HL6A 3FJ2A 4N76A 1Y5NB 1H2TZ 4ELUA 4KGXB 5A0YB 5LMUJ 3MWBA 5D4PA 1W2BR 3CEDA 3TZZA 3TZXA 4RUHA 2G0IA 2DPIA 3CJ4A 4EBCA 2VD3A 3KK3A 1UMJA 3CW2C 3MMCA 1VQ8S 5IOLA 3W7BA 3DN9A 4G1IA 4JI6F 4EK2A 2C3PA 2YTCA 3GV5B 1Y0HA 5KFOA 1C4CA 4O3OA 1HFEL 1JJHA 3NLCA 1WG1A 4ANCA 1U1MA 1X4CA 4AE5A 3CSKA 3FZBA 2YWWA 1Q8LA 4ZP7A 4X62F 4M95A 3AD7C 1RCOB 1HR0F 1WF0A 4DN9A 2MB0B 2YNIB 3C46A 3P6YC 1Q95G 5SUHA 4CLTA 1MROB 4F4WA 2F4FA 3VAMA 2VONA 3KLFB 1HWUA 5K14A 2HNDA 4QOTA 2IM2A 5J2PA 5AJ3F 5G0RA 1T03A 1HPZA 1NK4A 2CQIA 2ZC4A 1TL1B 3X3UA 3KUEA 2QEXS 4DFJA 1VC0A 1BQNB 3S1TA 5GADI 1B0TA 1R0CB 4W98A 3M6WA 4KPCA 4L72B 3G4SS 3MZIA 3ILIA 4L3KA 3BS9A 4XO0A 1X9WA 1NHUA 1RHJB 1LW2A 3QSIA 2IVYA 2LFVA 1WI8A 1DQAA 2XM3A 4YB7A 4NMLA 5F8LA 2KM8B 3R9LA 3AAWB 2IC3A 3ZNUA 3QGIA 1X5OA 2OSRA 4Y2CA 3FMBA 3DLLQ 3TUJC 1QUPA 3K8WA 2CG4A 4FS2A 3NY0A 4TYBA 2QYGA 2G9OA 2RRNA 2DNOA 5GAHU 2NYHA 4AL6A 2P2CB 2XGQA 4FYVB 1S49A 5CZVA 4USKA 5LSOA 1U1LA 1T94A 2PEHA 4OZ3A 1S6QA 1VBXA 3J7YI 2VZ9A 5D0EA 3OXLA 1UW9A 2KT3A 1J5EF 1VC6A 4ANEA 3HX9A 1UKUA 4EO8A 2UXCF 3UR0A 3POTA 1SQGA 1F5CA 3EDRB 1GT8A 4IG0B 2F40A 2KYXA 2KRRA 1RT6B 2OIHA 3V4IA 2F4VF 4LSZB 2E5GA 4LSLA 3B8HA 5ETSA 3G8TA 1DARA 5I42A 1S0OA 2HHSA 1JKHA 5J2MB 4ZPDA 3RW6A 1UETA 1U1RA 1HARA 3T3FA 3W66A 4ITSA 2Z57B 1H73A 1NKCA 4LBHA 5GAGI 3KFWX 2ZBQA 3QLHB 3CCUS 1JLBA 4DUTA 1NO8A 4R5PB 1SIWB 3MMAB 1OMSA 3VZIA 3D1OA 2IAJB 1FRXA 4CNYA 2ZKUA 3FCWA 3PW5A 4DPYA 3L09A 3TEHB 4KO0B 1T3NA 3W8PA 1C0UB 3A8JA 5F8GA 3PVXA 3HCXA 2PMWA 2FIUA 5DQIA 1VCTA 2BYCA 3ETOA 1OS5A 1SI9A 1NSQA 2XQCA 4LRCA 1VBYA 2FC8A 4C7QA 4LBPA 5ETOA 5DJBA 1IR2A 1QAXA 1HI8A 2VFSA 3ZZTA 1AT1B 2UU9F 2ERRA 1U0HB 5J2NA 2PI4A 2QGFB 2NXNA 3A4TA 2DGWA 2J8AA 1OO0B 5DETA 4J9MA 3AH6A 2EFPA 5KFEA 4EU0A 1SKWA 5IWAJ 1WDDA 3TX0A 3S8SA 1LW0A 3N9UC 3FEXB 1U26A 1WG5A 4WKRA 4OIXA 1S9GB 4CLPA 1QLNA 1V9OA 3P45B 4UZBA 1WEXA 2WCXA 4J7CA 3BGFA 2ROEA 4PCQA 2DH8A 3BB5A 2WTFA 2V9KA 3ENVA 3CCES 2Z2MA 1ULRA 4IH6A 2ADBA 2AWZA 4YN3B 1J5OA 4ED6A 3OSPA 4DR3J 3A3PB 3VGTA 2PDAA 4DSKA 5FIIA 1VK8A 4DV4J 1W25A 4TLQA 4DL5A 3CMES 4JI3F 4ZVSB 1SKUB 4WFZA 1F0XA 3HSJA 4C9DA 3DRPA 2DISA 5B08A 1SV5A 3I56S 3QZ7A 3DU5A 1RHKB 2BJ3A 1ZAVA 4A47A 1XMQF 3KJVA 3MHYA 2KXHA 3OFHA 3N28A 1TELA 3ADAC 3S6EA 2KTQA 4MYTA 1HHSA 3SMZA 2XS7A 4YHHJ 4IYQA 1NBEB 1R0BG 2E5LJ 1AW0A 1JJ2R 2ZZTA 5LMUF 3EGVA 2HRTA 3M05A 3WC0A 5CXTA 2P9GA 4PXBA 5CABA 1KTVA 3SIPB 4KYZA 1PJ6A 3QT8A 4UUWA 5DDQC 4IKAA 2VJVA 3C6TB 3CC7S 1WOPA 1S6UA 4RPFA 3GIIA 2AF6A 2VF3A 3DNCA 1VQPS 3ETMA 1CC8A 1KQKA 2YX1A 3O6QA 1TUVA 3AJDA 1Q4RA 4BS2A 1SC6A 4NYZA 4C6AA 4IOBA 1F6TA 3BR9A 2RDDA 2U1AA 3A3NB 2VHGA 2JNJA 4U95A 1NKEA 4LVOP 3CCWA 4DUZJ 3RZAA 4MJKA 2JOQA 4J9UE 2POKA 1RT7A 1FX2A 4M5GA 4E8UA 2E9TA 2DRBA 4K59A 2R2RA 2CQ1A 3A12A 2YQ3A 2NSBA 2IA6A 4DSFA 4M5IA 4DF8A 2VKZG 3CDUA 2GS8A 3JAMU 2B4OA 4O0NA 4FYXB 1XR6A 3EICA 3DGVA 1O8BA 2R7VA 1CJTA 4KC5A 2HHQA 4H4OA 2R7QA 1K73T 2V67A 2E1AA 5EWFA 4WE1A 1EP4A 3L4BC 1KQSR 1ACMB 3JQJA 2G1HA 1NJIT 4OJHA 2E7WA 2R8JA 5KOWA 1RHUB 2DRAA 5EWEA 4E0DA 3AQPA 5IZHA 3UN2A 2JHEA 4DV1J 2DGTA 4NI2A 1R6VA 4NRUA 2P6TA 2A1BA 5E3CA 3A8EA 1T9XA 3IN5A 3PKYA 4WWSA 3C16A 2F1FA 2HHHJ 1HMVA 2NYIA 2W9BA 1F5AA 3J7ZT 5HROA 2K3KA 2VA3A 2C3OA 1Q86T 3IR7B 4F3OA 1N0VC 2V8VA 4JI4J 1IJFB 3DU6A 1WHXA 4ICLB 3DRXA 2OPRA 4USMA 4OYMA 4X4PA 5L1IA 5EDWA 3GJTB 4AFFA 2VPWB 2IIHA 2KI2A 3JSRA 4TVAB 2JJ4D 3TWZA 3ULHA 2PFDA 4K7QA 2NXJA 4P75A 4URQU 1D09B 4Q2MA 3R5BA 4GVBA 2LCWA 1IQTA 4LF5F 1HI0P 2CQGA 2RHSB 4LF6F 3OTOJ 3NXZA 5IFMA 1ZBTA 5KFTA 2Q6BA 1T9UA 1N5VA 1BC6A 1BGXT 2KB2A 2HG4A 4HEA9 4OYOA 1N48A 3K5LA 2ZUAA 1KFDA 3ONQA 1NK9A 5F41A 4Q8EA 3TA0A 2F63A 2ZUGA 2NREA 3MAHA 3CNQP 3GJQB 4CO5A 2WVCA 2MHEA 3SQOP 3MDFA 2BZ2A 3C8YA 4ZKAA 2JX2A 1C1CA 1NSAA 2CQ4A 2V4RA 1NNDA 3G82B 3M1VA 2ZFHA 4ECVA 2RDIA 1AUDA 4BWJA 4DR4J 3HT0A 2V68A 5AXKA 3MUVP 2LU2A 2IJNA 4EO6A 1S1WA 1ZPWX 2B9WA 3KLGB 2LEAA 1WEZA 1ZAXA 4RNFA 1JLEB 1N88A 1ZZNA 3H4BA 2ILZA 4XPEA 3M8QA 1QUVA 2B9XA 3I87A 3HM9A 3J81Y 4U8YA 1FDNA 3PW7A 3U1NA 2VFTA 3F0NA 2GMHA 1KS2A 3MM6A 3W8GA 5IWAF 1JNRB 5E33A 1QDUB 2HWIA 1CSJA 4R0JA 3QIDA 3J80Y 4I67A 2GX8A 2IYGA 2G0JA 1FA0A 1OY9A 2WAQD 4FVCA 4CO1A 1U4BA 1NSPA 3BR8A 2QRRA 2IMOA 2X7IA 3T5LA 1CVJA 5ETMA 2CZ9A 4HR2A 4OLOA 2W7PA 1UVNA 4QIWD 5DQGA 4LRBA 5A8RB 4DV0J 1H74A 4EYHB 3OV7A 2ROGA 5DG9A 2LA4A 2PT0A 2QFJA 1O51A 2VFUA 1YX2A 3K0JA 1RT3B 2V94A 3ZFVA 1SUQA 4B02A 2PI5A 2NZCA 2WSCC 3PY8A 3MM8A 4B9NA 4ZP9A 2HSEB 2MLXA 5IQ6A 1MNEA 3P5BP 4ZCLA 2G2OA 3GQCA 3AB2B 4HI1A 1SC1B 4RKUC 4RW4A 1S76D 3TOQA 4HH1A 4MK7A 3CB4A 2RB7A 4YHHF 3R1HA 1YRUA 2Y3YA 3C19A 2GJ2A 5D4LA 3HHLB 3D0GE 3P4UB 3ZNJ1 1KTQA 2VJUA 3P49B 2BACA 5HVFA 2N4DA 1PSDA 4X64J 5DG8A 2FJAB 3Q8UA 1QSLA 3DXSX 2X1GA 3G87A 3M9MB 5A0YA 2XO7A 1AB8A 2A6OA 4TQRA 3FEYB 1M5KC 1RYRA 4FVMA 4FYDA 1FRKA 4P2MA 1SJ4P 3NWRA 5IM0B 3GSIA 3OXFA 2ZDOA 3TW0A 3H5UA 1UPPA 3QBCA 1N8RT 2RD5C 2DR8A 1EIYB 1J2VA 4DUZF 4NLRA 2RUSA 2YNIA 1M1KT 1M0SA 2NZ4A 3GV8B 1FI4A 2XMTA 4AXJA 1MROA 3UNYA 1HNVB 2L3MA 4RBUA 5FD1A 3KLFA 1YDLA 1XTZA 3HDSA 2KVQE 5DZ6A 1B70B 1C0TB 2MY7A 4HVZA 5E2QA 4USUA 1HI1A 1TL1A 2ZH1A 4YR3A 4YQWA 3TP2A 1BQNA 2HVDA 5G4DA 1SCJB 3L3CA 3GIRA 3JS9A 3GG1A 2PD1A 2R2SA 1QSSA 2CQCA 4F02A 1GFWB 3TA2A 1L5UA 2OD4A 3M9NB 2Y1JA 1FWLA 3H7HB 1TQLA 1MW7A 4OX6A 3ZTOA 1XJWB 4Q0BB 3C66A 1RWWB 2IY5B 3HD2A 5LMNJ 3NGKA 2KU7A 4OZNA 4DR6J 2BX6A 4JI8F 1T9WA 4JI1J 3DFEA 5SZTA 2HVHA 2R8HA 1S59A 2DK2A 2NCKL 2YKMB 5EX3A 2J76E 5IV3A 2ATCB 1NKBA 6AT1B 3NBPB 1VQMS 4FKXA 5B0CA 4ALZA 2XMVA 3SDEB 1M5OC 5CYMB 3JXOA 1WUUA 1FJ7A 3H8YA 4A8SA 3RAQA 1CJUB 5F8JA 3T19A 4C98A 1JMTA 3MFIA 5FDLB 2GHPA 3DDNA 3KOAA 5BYQA 2J0SD 5HMXA 4K4ZA 1FERA 1XN9A 3CD6S 2O67A 4IG0A 4J9NA 5KFAA 3HJVA 4FN5A 1YBUA 4CLLA 1RT6A 2GC8A 2PIIA 3GSDA 1WC3A 3HT3A 2CWXA 1IKVB 3I9ZA 4RWXA 3CDEA 2XS2A 1OYDA 2V34A 2LQ5A 2OMOA 5J2MA 4LR9A 4CLKA 2QC3A 2FLNA 3OL6A 1Y3KA 5HQ8A 1D9DA 2XYHB 2ZBRA 3GFXA 3VGVA 4PG5A 4NCGB 1OJ4A 1HWIA 2PA3A 4QR1A 4ANDA 1XEZA 2E66A 3QLHA 2HS0A 5T14A 3VAJA 3N5FA 2CNOB 4HACB 4R5PA 1UJ5A 4LRAA 2W1BA 3MMAA 1D9AA 3ENAA 2IAJA 4C8ZA 2E1RA 2JLGA 4NLSA 2HRYA 2JVOA 4KO0A 4LT6A 2OKQA 1C0UA 4USHA 3E2EA 2JLEA 5KFFA 4F25A 2DNKA 5DM7Q 4U8VA 3KKFA 2OPPB 4IOAQ 4LSNB 1NH7A 1F9HA 1Q8KA 3QAUA 2W2PP 4V1Ak 2HQIA 1Q8IA 2HZCA 3BO4A 1SJRA 4ZVOB 2D41A 2YKNB 4ECZA 1U0HA 4QW8A 4O3RA 2M4MA 2FD2A 2UV8A 4DJBA 1AZSB 4DZ6A 3ITHB 4ETZA 1U02A 3KLIB 3LAKA 2W9CB 2HHPA 4F0KA 5HN0A 3ZTQA 2V69A 2XMWA 2YQ0A 3GYGA 5GADU 2D1CA 4B9VA 1YSJA 2HK2A 2M88A 2KJVA 4XIUA 1R89A 3VCDA 1S9GA 2EFVA 3HHKA 2YY3A 3M2UB 5C25B 2GAHC 4FBTA 2BKNA 3R6LB 3RYLA 3OHAA 3P96A 4WIQA 2WONB 4OYXA 2AGQA 1URRA 3NP5A 2OLWA 1AFJA 5C2CA 3NNCA 2DNRA 2YWGA 2OGUA 1L3SA 2VFVA 2E9ZA 2MKHA 1T9YA 1S0VA 5J2QB 3ZZPA 3HVRA 2WRMA 4LRDA 1NMEB 4HHUA 2ROPA 4CLWA 3US5A 2CJAA 2V9WA 1FRLA 4LF9J 3EJMA 2FJVA 1MG7A 1YIJS 1UJ4A 1SL2A 2WB1D 2DGUA 1S0MA 2COLA 2E5HA 3GR1A 1RTIB 2Q6CA 1XNRJ 3J7YU 2KG0A 3T1YJ 4LVNP 2EC0A 3H5SA 4BLGA 1FXLA 1V3SA 3AHPA 1IM6A 3UI3A 3G8SA 1TMMA 2CPYA 3UO0A 4X64F 4OHVA 3QJLA 4P71A 2GVZB 4CH0S 4J9OA 1UEKA 5B0GA 4RW7B 4OI0A 3MGJA 2B51A 1PYSB 1FE4A 2LQ8A 5AT1B 2QA4G 1CEZA 2C2MB 4LFBJ 1HNZF 2OPSB 3CULA 1IBMJ 2WSFC 3DOMB 3C6TA 2XB2D 2YKPA 1YJUA 2CFXA 1PJ5A 4JBCA 2AYEA 1SIZA 4GKKF 1D3WA 2B43A 2ALZA 4N8OA 1HW8A 1E6YB 5DDOC 1YQHA 3BO2A 4KFBB 5CAAA 1VFJA 2Z2LA 2GMLA 5KFNA 3THPA 1N33J 1NZ8A 4P10A 4F26A 4U7UD 3NMAA 4A8QA 5KFXA 3W5ZA 2CNLB 3BBCA 4L3NA 4UT4A 1VQKS 3G6ES 5AE1A 3M30B 2E7VA 3HD1A 2GIQA 3CD5A 2VBZA 1TFYA 1NPKA 2J9EA 1F9EB 1NU4A 2W8KA 4A8XA 1SKRA 1QSYA 2RMLA 1RB0A 4B3TJ 2AT1B 4U7CA 3MPYA 2VOPA 2EKYA 2EEYA 3PW0A 1SJFA 1EZZB 4OV6A 4KQZA 2NPFA 1F5BA 1N52B 2FZKB 3OJSA 6FDRA 4C8NA 5C42B 2Z30B 2Y0SD 2KO1A 2MZSA 3IBFB 5H9EK 3WX4A 3M8PB 2ZVSA 2YX7A 1GMWA 5EHHA 3I0RB 2E44A 1X9MA 5F3ZA 4F3MA 1S1XB 2QE5A 3NS5A 4LFAJ 2UUAJ 2C2KB 4ICLA 4C2MA 4ILLA 1UTAA 1Q0NA 1TFWA 3ISND 5CA5A 2E1MC 1V3ZA 2J7KA 3HHNB 5HAOA 1JB0C 2FVCA 1WG4A 2L41A 1NCLA 4IRKA 2Q43A 2LEBA 1U6ZA 2HRUA 2IYIA 3FRYA 5HATA 4LF4F 2VPZB 4DLGA 3I5BA 1JLFB 2CYYA 1YLXA 1ZM9A 4CO4A 1XMOJ 4DL2A 2DKOB 2G0CA 5A6WA 2JEIA 5KFLA 3G2XA 5T41A 4ZS6A 1RAHB 4DV3J 4DV6J 2MKIA 4OZ1A 1NK8A 4JV5J 5B0DA 3TA1A 1K0TA 5D78A 1OY8A 3CCMS 3PFEA 3MUMP 4PG7A 1EETB 3G82A 4L6V3 1HHQA 4DCJB 2DY1A 1TL3B 3DHXA 1CULB 1RWNB 4QWAA 1RBOB 2WHOA 4Y28C 5B0EA 4YP3A 4NLQA 1CJVB 1WKJA 3H2VE 2XHCA 2AV5A 1NXIA 3UDCA 1KWMA 1RHMB 3HHEA 5AE2A 3CJ8A 2XS5A 2LXUA 3AT1B 4DSJA 5CQGA 3KLGA 1QAYA 4QIEA 3Q8VA 1JLEA 4A4JA 1WF2A 1VQLS 5L1KA 1F2HA 2XI3A 2EPIA 2RAQA 2I8EA 3S7RA 2DNPA 4WFBQ 4EUVA 3SYZA 4ED0A 3ILJA 2DGSA 4LJMA 4G1PA 3MEDB 1F60B 2D9PA 3D0HE 4MK8A 1VGYA 3UWTA 2FVQA 1K44A 1RTHB 2AX1A 2RT3A 5CHCB 3BYPA 1P1TA 2BE9B 4PUOB 1LWEB 2F8HA 2VA2A 3UCZP 1U2RA 1FJGJ 5A8RA 1M1GA 4NZ0A 2DR6A 1Y11A 1KVKA 1UVKA 4OI6A 3FNNA 1RT3A 2J0XA 3QO9B 4F4KA 2CZ4A 2Q1LA 1N34J 4MIBA 4NA2A 2RSQA 3PYGA 2UUBF 2W4PA 5F9NA 1V6HA 1WC0A 4PPDA 3TVKA 4I2PB 1P6TA 2HVZA 2V8PA 4XTTA 4KHMA 4DCPB 2OPQB 3ENQA 3D6TB 4QU6A 4USIA 3HF5A 3LQVA 2H4WB 2DEIA 4DR7J 3CVKA 1VJWA 3HHLA 6FD1A 4PWWA 2FB0A 1HQUB 3V5RA 2CQHA 2P8IA 3FUYA 1YJRA 3CPWR 2B0GA 3WIVA 4ECQA 4LFBF 1HWKA 3ZZOA 3IFEA 3ILLA 3KJQB 4WIIA 1HNXJ 2M9KA 2DGOA 4MKAA 4CT9A 2W25A 1CBKA 4FF1A 3PDNA 4WYLA 1SVDA 1RACB 3W9IA 3RRHA 3IM9A 2ZH4A 4FXWA 4DQQA 2OO4A 5E3AA 5IM0A 1NJWA 2H54B 5U47A 3RJMB 1JX4A 3Q89A 1ZYQA 3OHBA 2YBVA 3W61A 4DPUA 2DNNA 3A13A 4A8WA 4J9KA 1RISA 4IR1A 2ZD1B 2Q3PA 2DGVA 2GQQA 3GYXB 3Q8QB 2CJQA 1A9NB 5ITHA 1KEKA 2JH3A 1VBZA 2FPHX 1D9FA 5KG7A 3I82A 2HAFA 4MMOA 3KTQA 4FPIA 4WXOA 2DD8S 5HLFB 4TN2A 1U7LA 4C8MA 1HNVA 4UOCA 3MPUB 4YR2A 1Y7PA 4DX5A 3PEHA 5IV4A 4W92B 5L1JA 3PRBA 2V2KA 1C0TA 5DDPC 2R7XA 2B7BB 1WC1A 4B3SJ 3M7VA 2VQFF 1YJ7A 5CCMA 1DLOB 1QE1B 3HHDA 1DURA 3EVMA 4WZQA 3LGHA 2P5VA 4DF4A 1RI7A 1JLGB 1Q16B 3MM7B 1H2VZ 1WHWA 1ZOTA 1KC8T 2MKSA 1GX5A 2HNZB 2CIMA 4YMEA 5HSPA 2C2NA 4I56A 2UVVA 1HBMB 4Q0BA 4KT0C 4CLFA 4DSEA 5CD4H 2IRXA 4TU8A 3T1AA 2R9LA 1H7WA 3UCUP 4DMZA 3MD1A 2AKWB 9RUBA 2KN4A 1N56A 4NWBA 2YKMA 3VTIA 1U0SA 1TK8A 1MU2B 1VQ4S 5B0BA 2PE8A 4GVLA 1EQ0A 4OJGA 1CG2A 3O8WA 3TEGA 4D3HA 4KTQA 3EE3A 3NBPA 3TQ1A 2W4DA 3MOJB 4ZPVR 3SDEA 2DNQA 1HQEB 5CYMA 1TL7B 3QGHA 3KUGA 3BGRB 1CJUA 3OPKA 1UJ6A 2DIUA 4JI5J 3HVAA 5FDLA 2BA9A 2XMAA 4UY8T 4DX8H 2MSSA 2L48A 1S79A 3I96A 2IJFA 1WEYA 4MT1A 4ZPBA 3W60A 4DG1B 2VG5B 2NLWA 4CDIA 1U1PA 4ZPWR 3E8OA 1LK5A 1IKVA 2YKQA 1IUJA 2FHJA 3D5MA 1PG5B 5D6GA 2B5JB 2PEBA 4QWBA 1KLMB 2XY6A 4NPOA 3TJ8A 2H48B 3H20A 2O3DA 2QLFB 2ACMA 4NCGA 4IRDA 3MXHP 1RHRB 1JLAB 4Z7YA 1YBTA 2B6AB 4HACA 3DLHA 3GPAA 1FCAA 2B4PA 3DOLB 1NHKL 2Y8WA 1GEHA 3R6GB 4NZ6A 1RGVA 3I5AA 3Q24A 3I32A 2JC0A 2HHVA 3KHLA 4DWIA 4ZJOA 3IG1B 2ZBIA 2AYMA 4KJIA 3OVSA 5HVGA 3PYDA 3B6BA 1IBKJ 3TNVA 3AQOA 3GJSB 2AIRB 3CT9A 1XIQA 3T6BA 4KB7A 1A0OB 2FTRA 2VDHA 4NCBA 4KH0B 2OPPA 4KHPF 1H72C 4LSNA 3CTRA 4GO7X 5HBMB 3FZ2A 2E9RX 1U25A 3J7A1 5IT9U 2EXUA 2JEFA 2YKNA 1UFKA 1HBUB 3DMJB 3H42A 1AZSA 1Y5LB 3ITHA 4ZK7M 3IP0A 3PIOQ 1WJ9A 3KLIA 2W9CA 2KFZA 2O5DA 2ZE2B 1ROFA 1EKRA 3H90A 2K3IA 3GTYX 3D1QA 2QG9B 1FEHA 5ETTA 5BR8J 2A2CA 4K5SA 1BMQB 5KFYA 2IVFB 2MYFA 2DGXA 3IM8A 1UCNA 2KDOA 2BQUA 1R27B 2RDJA 1LFWA 2X51A 3M2UA 2Q66A 5C25A 3UDLA 1TL5A 3TYTA 3QRPA 2QJ3A 2WONA 4MFBB 3UW1A 1URNA 4PQAA 4ZCMA 2WBMA 2DHSA 2K8GA 1AA1B 1UZDA 4DL4A 1F2GA 4H4KA 4JI6J 1APSA 1UWBB 1MLAA 5J2QA 4OI4A 1Q1KA 1B7FA 5KG5A 4CYUB 3Q2TC 3TZYA 4C0OC 2GJIA 5K8PA 4DXLA 2AD9A 4NMXA 3MR7A 4X62J 2M70A 1VQ9S 4NLYA 1HR0J 5HVHA 2DGQA 3BPDA 3VHQA 2H1YA 4AQYJ 3QT6A 1N36F 1O5JA 1YI2S 3U7JA 4G3IA 1RTIA 1RK8A 2UUCF 4X4SA 3AA9A 1TAUA 4F0MA 1M5PC 4TU7A 2RUGA 5AJ3J 5KFUA 2CPDA 1NJYA 2GVZA 3K58A 4DL7A 4Y34A 2P9EA 1VYAA 1RTJB 2H5EA 2PA8D 2EK1A 2ZH7A 2HHTA 4RW7A 5KFIA 3D67A 1VS3A 4AL5A 3LH2S 3EGZA 2XMKA 4Y3CA 1WSVA 3ZTRA 3W2WB 4O0IA 3M8SA 3AA8A 3E51A 4NXNF 3ISNC 2R7OA 2OPSA 1LKZA 1FE0A 2ZOGA 3SV3A 3DOMA 3CJ2A 2HFOA 4I4BA 4EWTA 4RUCA 3HULA 2CNKB 2PC6A 1S6PB 4CH7A 3IBWA 3DKDA 3ZZRA 1NJXA 4X4QA 4B9TA 2VC1A 1HBNB 1E6YA 2MLYA 4BDPA 4KFBA 2CQ0A 3CJSA 1DFDA 1ZTTA 1RTDB 5A8WB 4FDFA 1BLUA 2ZJRQ 1GX6A 1S7HA 3EGNA 5HI7A 2YWEA 2R8GA 1VIXA 2JDJA 1K9MT 2AU0A 3OFFA 3LO3A 1FDBA 1WC5A 4PG6A 5DGBA 1KHVA 3M30A 5C7PA 3JSBA 1C4AA 4V19X 3HFZB 3HK2A 3KLHB 1J5EJ 5HMYA 2ALYB 2CVEA 4PABA 1D1UA 1X4AA 2N82B 2RF2B 3LPEA 2F4VJ 4LF8J 3NNAA 1N5YB 1FXDA 1FF2A 2EG2A 3R2DJ 4L76A 1RXOB 1X0FA 2HVEA 3N79A 5C42A 1UFLA 2AJ4A 5J1PA 1KR4A 3PNIA 1PYTA 2W2OP 4EEYA 3NGRA 3M8PA 2I2YA 4X4VA 3HMJG 3TUPA 1Z2LA 2WOMB 1NRKA 3I0RA 4DL3A 4M5DB 1FO1A 1S1XA 2DHAA 2GHWA 3LP2B 1NB7A 1A7GE 3GIMA 3NL0A 4F7VA 1G3OA 1YWXA 5FLXU 1JLQB 1S77D 3QJJA 3ZC4A 4HYKA 2V6AA 3VR1A 4Q8FA 5C24B 4DLEA 2QYCA 4DQRA 4ZIVA 3IWLA 1FHTA 5L46A 1N54B 4FS1A 3JAMY 3GWCA 2ASLA 2CJKA 1T9VA 3MAQA 1BQXA 3MMBB 2UU9J 4CO0A 2AJQA 2W7AA 2EG1A 4KR0B 3MR5A 1JLFA 1BD6A 1TKTB 1VRQC 3V6KA 1K8AT 1IKXB 2J8SA 2JRSA 3HPOA 5KT4A 3U02A 2YH1A 1WOSA 1U8SA 4HHHA 5JJBA 1GXTA 1H98A 2YPZA 4WKYA 4CT8A 3KLVA 1RA7A 1L3UA 2QTWA 2HFZA 2FLLA 1QJHA 1IBLF 5L8RC 3BDEA 4K4WA 5DZ7A 3TZWA 1EETA 3KMQA 3MCNA 3OR1B 1YTYA 2DHGA 4MK9A 4FNHA 3DRRB 4L75A 1OYEA 3QSYB 1YBAA 4FF2A 4DQPA 1TL3A 1CULA 3N4WA 4I64A 3LW5C 1CJVA 2BJ7A 3I4HX 2V4QA 2P6SA 4P7VA 1N5SA 2X3GA 3RB4A 1DBDA 4TY9A 4DS4A 1VRTB 4I6AA 2MQQA 4BC7A 1W2IA 4C3LA 1TR0A 4OZJA 1HNWF 4JI3J 4LF7F 1X7VA 2B8PA 3LTOA 1FD8A 3G9CA 4J9PA 4X2BA 3N6MA 3MPDA 1IWGA 1MSWD 1Q8BA 3WDOA 4FYWB 5GMKa 1XMQJ 2XSFA 1N6QB 2AEFA 4ID5B 3MEDA 2DY9A 3Q8RB 2C2RA 4ZPAA 4Y0FA 3EXYA 1RTHA 4IG3B 1DY3A 1PO6A 2MKYA 1C2PA 1YJ9S 2RRAA 5E0OA 1RKIA 5J1EB 4PUOA 5H9FK 1LWEA 3CJ0A 5K20B 5BJRA 4CTAB 3R7NB 1I1GA 1KRPA 1HA1A 1RQ0A 2GZOA 1YITS 1WI6A 3BSNA 3JSMB 4O3QA 1QY7A 5ETLA 1I51B 4WK1A 3GFYA 2DHXA 3L7PA 5E3PA 2KHDA 3VALA 3D54A 3VF0B 1LWFB 4Y2AA 3QO9A 2J0QD 2ILYA 1YG0A 3RBZA 5F8MA 4KV8B 5LOQA 3CJQA 2YX4A 4AQYF 5KFHA 3G71S 1Z4UA 4I2PA 4HH0A 4PYAA 5K8NA 2XMMA 2YNHB 1QD1A 2OPQA 5E41A 2I1RA 4YB1P 2GA7A 3FBFA 1WSRA 1WTBA 1SBRA 4C8YA 1LOUA 1X4FA 4DDFA 4ECRA 4ILRA 4OX7A 4WP3A 3RW7A 4PKDB 4DL6A 4P7TA 4DEZA 2XULA 1G7CB 1UVMA 2MLZA 4Y65A 2AZ3A 1U8WA 5LSRA 4NYPA 2WW8A 7FDRA 2DNHA 1HQUA 2HFSA 1VK3A 2CPEA 3D7SB 3R7BB 2HEKA 2YNFB 4K4XA 3W1YC 1WC4A 3HVTB 5KFKA 1BWEA 3ET6B 3MEGB 3MTKA 2BRKA 3M8ZA 2BBEA 2RIJA 2EC2A 3BN4A 3KMSA 3QRQA 4AXIA 1S4FA 4JV1A 5A2QY 4FKYA 4WF9Q 3IA0A 4H4MB 5RUBA 2ZD1A 2X1FA 1TUWA 2DHHA 3BO3A 2LEPA 1RT5B 1RT1B 4G65A 3VV2B 1FNOA 5HLFA 3KG4A 2AGPA 4BHQA 2R3VA 4PXCA 5DGAA 2CKWA 4JP8A 4MTPA 2H4YB 2VFRA 1FDAA 1NDKA 2CZVC 4LF5J 2HFNA 4LF6J 2ZM6F 3U1LA 4WFNQ 2DVIA 1DLOA 1QE1A 1KSPA 1LQ9A 3RRKA 1JJ4A 4LF8F 3W2VB 1JLGA 4K0KJ 1RWVB 3IR5B 3MM7A 5HMZA 3LGMA 3GFHA 3Q2SC 1RYSA 2HNZA 2F8MA 3C3LA 4RNHA 3KWMA 4I6WA 2D74B 1AXQA 1HBMA 4ENOA 1PBUA 2I0XA 1S0NA 3PO4A 2ZHOA 1N32F 3NS6A 3DDIA 4NLUA 3B54A 1T7PA 1P1LA 4W4MA 3CC4S 1JQGA 3HVWA 5D3GB 3H2UB 2ZDPA 4NCAA 1MU2A 4F3QA 1NSKL 3G86A 5CCLA 4CH1A 3H2LA 5CZXA 5HJXA 5LM7E 4QYZJ 3R1LA 4N77A 4K4YA 2FLPA 1KP6A 3UFCX 3IXQA 4WZMA 2EFQA 2XTJP 4ZCKA 4K2XA 5LT5A 1IXKA 2JWNA 1HQEA 4ECTA 4U6PA 2QT7A 1TL7A 2FJDB 4DBQA 2AMCB 1FFGB 3FC9A 3P3DA 3R3TA 5I4MA 3BGRA 4B3RF 1ZS6A 1FTRA 3UN5A 4X4OA 5F9LA 3RB3A 4B9UA 4CLSA 3BQ2A 4JV0A 3K5PA 2XBPA 3UE2A 5KOXA 2FZCB 1FTCA 4DR5F 2Z8QA 3HZEA 4NE9C 1RABB 4ED8A 3CMQA 4DG1A 4LBIA 3H25A 2VG5A 4F2RA 2MZRA 4FP9A 1IKYB 2AJ2A 2C2DA 2QFIA 3CJRA 5HJYA 4EBDA 2B5JA 2Z2ZA 5HL7Q 5CYQB 4EBEA 1KLMA 1AROP 2HZAA 1AFIA 1R0AB 1RADB 3MCMA 2CXEA 4P2XA 4P2SA 3VQTA 2MY8A 1S9FA 1JLAA 2F8EX 4ZHRB 3ENWA 2B6AA 2C3MA 3CDBA 2IHR1 2L9WA 3LGNA 3DOLA 5B0AA 3IAM9 2CAJA 4QBUA 2JFDA 2NUUG 2HBZB 3IG1A 2CQPA 3H4DA 1YK9A 3QYYA 3PG9A 4ZLJA 2WB4A 2BQ3A 3PRVA 1IKWB 2FHMA 3NS7B 2RQCA 3BKFA 2QL9B 1XK8A 2X3DA 3FSXA 1VQ5S 2BKPA 5IXUA 4GC6A 2IM0A 5AXNA 3FSYA 2XZDB 3JQKA 2CPHA 5HBMA 3A8KA 1HNIB 1RBLA 4X4NA 5DO2A 2WK4A 4C0BA 9ATCB 4CM2A 1HBUA 4GC7A 3DMJA 2EW9A 1L3VA 2ZE2A 4GKJF 4RWWA 3IWXA 4ZIWA 2CG8A 5GMEA 3V81B 1TKZB 2RJZA 4HL9A 3M9OB 2F9DA 4LRFA 3UPFA 3BJYA 3E01B 1QTMA 5F8IA 1WKLA 1X5TA 1TV6B 4MFBA 3L95X 1YZ6A 2BQRA 5KFSA 3DLJA 2ZWPA 1UWBA 3PW2A 1T11A 4RUBA 2IBKA 2XO6A 2BV3A 4CYUA 1SC3B 4OFZA 3TX8A 1ZAWA 1UP1A 2Y1RI 2BM1A 1G4CA 4YFUA 5AXMA 4UOGA 1GNKA 1XNQF 3H0PA 1S48A 5A8KB 4X66F 1N5QA 2VBYA 1U1QA 5IQQA 1FK9B 4J5OA 1RHQB 3N5BA 1RZMA 1A6LA 1GMWD 2FGCA 3QIPB 2MKJA 1E6VB 3NGTA 3TARA 3BH6B 2DT9A 2RILA 1RSCA 1AYEA 1RTJA 5BYRA 1X31C 3O5TB 1CPZA 3N6LA 4TXSA 3TJ9A 1W7WA 3OR2B 3PEJA 3W2WA 3R8YA 3FSIA 3AXMA 1LWCB 4IO1A 4Y2IA 3TR5A 1T02A 1BE4A 4ZPTR 2NS1B 2J6SA 5AXLA 4FBUA 1MN9A 5ETKA 3OJUA 4UQTA 3DOKB 2R4FA 1S6PA 1RLCL 2OFHX 4S0MA 2Z58B 2QMUB 2XY5A 3GR0A 1HBNA 3W9JA 5I3UB 3F41A 4JI0F 4JI8J 1P8GA 1T8EA 1RTDA 5A8WA 1SC4B 3NGDA 1RT2B 2XEXA 2XSJB 1Y4ZB 2Z4PA 3CJKB 1MMNA 3VQSA 1Q82T 3FQKA 1X4GA 3K5NA 1RAGB 3VWSA 4I2QB 3V6HA 1W26A 4ZVRB 2EVZA 2ZH6A 2G13A 1UVJA 2AZ1A 5ETQA 3IGVA 2V4JB 4ECXA 4DHVA 2OH2A 2GO9A 1FKPB 3KLHA 4DS5A 4K0KF 2ZH9A 3MEEB 3T9ZA 4J9LA 3NGSA 4JI7F 4NXMF 1YGYA 2RF2A 2J6UA 3P5TL 1L3TA 1SB6A 1N5YA 2OD6A 4K4TA 3KDNA 1RU1A 3LP0B 4CP5A 5GAEI 3HKZD 1X5PA 3R5GA 2HQDA 1SL0A 1UWAA 3WBZA 2ZJPQ 2C2OB 3GJRB 2JZ5A 2QMXA 2EFNA 1MMDA 2BUNA 3GFZA 2WOMA 1R7IA 1TKXB 4M5DA 3IBCB 2ZH3A 1T0TV 1X4DA 1C1BB 3LP2A 2VASA 3KXDA 1WTFA 1JLQA 1TP7A 5C24A 2FJWA 5F8HA 1P27B 1ZM2A 2RVJA 3DM2B 3RR7A 1UVIA 4USTA 3QNWB 3LA0A 2ZHAA 2VBWA 3MMBA 4QIVA 1VQOS 1R43A 1TKTA 4RBVA 3NOCA 1KD1T 2ZITA 3BN7A 1IKXA 2BVZA 2FVRA 4OHXA 5LXRA 3SEOA 4CLZA 3TUZC 3M6XA 3QT7A 2CPIA 4F2SA 2B8QA 3SFGA 3KNAA 2U2FA 1JXVA 4KHRA 4A48A 2GNKA 2VU5A 1VDHA 3QGPA 2B56A 2APOA 5L9XA 3EVOA 3SSRA 1IR0A 2F65A 2RHQB 2KM8C 3OSNA 2D9OA 3HHLD 3WQPA 2MZ1A 2AQ4A 1G1XA 2HWTA 3OR1A 3DRRA 2LMIA 3ZTSA 3BPSP 3R5DA 1VRTA 4ED7A 2LKZA 3GIKA 1YJTA 4PPZA 4XDCA 2ZKTA 4BWMA 5E3RA 2ZZNA 3RAXA 3KHRA 2E29A 1B4SA 1NK7A 3T5KA 1NPPA 1NZAA 4FXVA 2Z2YB 3CXCR 2W2NP 4QIGA 3MM9B 1R8PA 1N6QA 1WHVA 3M6UA 4ID5A 1U45A 1RP5A 2KH9A 1Z1ZA 2OJ3A 3CJ5A 4USJC 2DTJA 4IG3A 4EFAC 4UOHA 3KLEB 3BBBA 3GYNA 1RUSA 1FESA 2ABYA 1U09A 2HNYB 4JYAF 2HFUA 5J1EA 4OQJA 4R8UB 3T6JA 2QV6A 1HNZJ 2FY8A 4OJ1A 4X84A 1KQGB 2Y0BB 4CTAA 3GIJA 4IR9A 1K0VA 4AT1B 2CA9A 2GV1A 2OEMA 5D8HB 3JSMA 3R97A 2VDIA 5KFQA 3KK2B 4GKKJ 4NEYA 4ED1A 4NLXA 2JC1A 2LU1A 1NDCA 2AEJA 2FUG9 2MJNA 1FKAF 2BOPA 1LWFA 3K59A 4M5MA 3PYFA 4KV8A 3MOZA 4FPRA 1DTQB 1EB0A 1I94F 1QVGR 3JTPA 4M94A 2B7CB 1KVJA 2YNHA 3D66A 3R5CA 3GONA 2P9CA 4OHWA 4O23A 2KJWA 1VJQA 2CDRB 3DRSB 1Z2ZA 3PJXA 4DUYF 1QVFR 1DHMA 5KT3A 3DLGA 3MI7X 4IH7A 2AJ0A 3O44A 2MGZB 2YWHA 3RAMA 2Y1IA 1FDDA 2GIRA 4RX6A 2FHKA 1RJJA 5HO4A 3VGSA 2RKIB 3PRDA 4M63A 2HK3A 4OZ0A 4C97A 1DQ9A 1WDTA 4IQXA 3QT5A 4K5RA 2HPUA 2YNFA 4Q45A 3HVTA 4HKQA 3LANA 4DZDA 4X65J 3ET6A 4NOHA 1LWXA 1P9QC 3MEGA 5A6PA 2ZJQQ 1TU0B 2HQGA 3QJPA 3PR4A 4KAIA 1S9EB 4J9VA 3D3CJ 2HZVA 4DR2F 2C2EA 4YR0A 2HBRB 2WVEA 2HBQB 4IUFA 3RB0A 4H4MA 2FHJD 5DLFA 3H5XA 1NHVA 1NPRA 4KSEB 1RT5A 2W9AA 1RT1A 1EAYC 3BH7B 4WP8A 4E98A 2B3TB 2XC9A 4WXWA 4DV5F 2NUHA 2LDYA 4QW9A 3BGOP 1LXJA 1DAXA 2DH7A 4F4XA 1NB2A 2HQ3A 3O1LA 5KG2A 1RAJA 1M5SA 2XI2A 3QAEA 4UY85 3O3LA 4LF4J 2GQ2A 1UFWA 4OJ3A 3MCSA 3W2VA 4PQUB 5IS2A 4TKTA 1UEUA 4LIWA 2EFGA 4AL7A 3Q86A 4QWEA 1U1KA 2BEFA 1IJEB 4Y00A 1U1OA 1QAJA 1SQFA 1VQSA 3PYEA 2DR9A 1VQYA 4LFCF 4QZVB 4F67A 3LALA 1OQ6A 2R7TA 5D4OA 1NDLA 3CD0A 5D3GA 4C48A 4RW6B 2N4CA 1FX4A 1SXLA 1YJVA 2BR0A 3CCQS 3HSDA 2BJDA 1K1SA 2V2QA 4LMZA 2HS4A 1PKUA 3PCOB 3MM5B 2C2ZB 2BE7D 4OZLA 3CO9A 1REVB 2BW2A 1D0EA 3OTDA 2MQOA 1X8DA 5CH7B 1YJWS 3MFHA 5KFMA 1D8YA 1U47A 3X1LB 1T9TA 1M5VC 3CF5Q 2KFNA 4KH1B 2R8KA 4IH5A 3SFUA 1HKAA 4Q2LA 3VAGA 3UN3A 4KKOB 3ISZA 1KFSA 3W63A 1T95A 1IKYA 2VQEF 4CIOA 5CYQA 2ZBCA 4NLTA 2BRLA 1HYSB 3G8QA 1R0AA 2C22A 2J9DA 3H59A 1OSCA 2E5JA 2CQ2A 3HKWA 1S12A 4ZHRA 4RLEA 3J7AN 3IS9B 2GO8A 3CD7A 2IMWP 2MQPA 4ERDA 4OI1A 2IRUA 2ZH8A 1M1HA 3DLBA 3CIZA 4CZCA 3EZOA 2VV5A 3TVZA 2JL9A 1WC6A 1IKWA 3SCLE 1G6BA 1RAAB 1JXEA 1N4LA 5HQMA 1T05B 3EM1A 4PG8A 1D8ZA 4IRCA 4GRSA 5M2PA 2I9SA 2UUBJ 4ZLNA 1FKOB 2EWHA 2UXDF 1RCXB 1HD1A 2I38A 4QQBA 3BKUA 5H9EJ 5I3PA 4CNZA 1HNIA 3A1YG 2QL7B 1Q7YT 1YHQS 2JEJA 4AUKA 2AYGA
chains in the Genus database with same CATH topology
5DG9A 2B4VA 2LA4A 3M6VA 3UD3P 3PW4A 1LV5A 4ZA1A 4HTJA 1X0FA 4RW8B 2PT0A 2RE1A 1S6QB 2QFJA 3N79A 1GAOA 1O51A 5C42A 2VFUA 1UFLA 2AJ4A 5J1PA 3CGIA 3K0JA 1RT3B 1KR4A 2V94A 3PNIA 2BXJA 1GTHA 4KIAA 4PWUA 2DNLA 3ZFVA 1SUQA 2UV8G 4B02A 2PI5A 4EEYA 4WU3A 2WSCC 5LJ3Y 1TKZA 2AW0A 4RW9A 3V81A 3BZQA 3PY8A 3MM8A 3M8PA 5T7LA 3TAMA 2I2YA 4B9NA 5DDRC 2XMUA 3K5OA 4CQ1A 3HMJG 4ZP9A 5K5MA 3GV7B 4X4VA 1XERA 1IN0A 2FVSA 5IQ6A 1MNEA 3CCSS 4DOZA 4ZDNA 3TANA 1Z2LA 3POTB 5KFVA 4DN0A 4B3TF 2WOMB 2J7WA 1NRKA 2DNGA 3E01A 3I0RA 4ZCLA 4DL3A 1R3NA 4M5DB 2CPZA 1FO1A 3MF5A 3GQCA 3AB2B 4C8LA 1FRJA 4HI1A 2PN6A 3EX7B 4RKUC 2W4CA 1S1XA 4RW4A 3V4IB 2DHAA 1S76D 1XWLA 2GHWA 3LP2B 1TV6A 3TOQA 4LSLB 1NB7A 4HH1A 1A7GE 3GIMA 1B64A 3GG0A 3NL0A 1G3OA 1YWXA 5I42B 1VC5A 1JLQB 3PIPQ 1S97A 1S77D 4MK7A 3CB4A 1PC5A 2EK6A 2RB7A 5EWGA 4YHHF 3ZC4A 3R1HA 1JKHB 1T3OA 3QJJA 4HYKA 1NJZA 1VOMA 1YRUA 2QA1A 3VR1A 2GJ2A 4U9RA 5D4LA 4Q8FA 5C24B 3HHLB 4DLEA 4A8KA 3G6VA 2QYCA 3H98A 4NL5A 3D0GE 2XLIA 1KTQA 3OUYA 4DQRA 3P49B 3IWLA 1RDRA 3JTOA 1FHTA 2BACA 3L7OA 5F0UA 3HI9A 4O3PA 1N54B 2N4DA 1PSDA 3JAMY 4FS1A 3OL9A 5DG8A 2FJAB 3GWCA 4KGMA 2ASLA 2CJKA 1FT8A 4V19J 3W3SA 2EFOA 1QSLA 3DXSX 2KG1A 3DI6B 1JLBB 2YKOA 2LXFA 1ZETA 2E7XA 1QAIA 2X1GA 3M9MB 5A0YA 2XO7A 2OTLS 5KT5A 4B08A 3MAQA 1OSDA 1WHYA 3CIMA 1BQXA 3MMBB 3OQ2A 3SQGB 4TNOA 4CO0A 2RH3A 4A8YA 2AJQA 4MH8A 2QIFA 2EG1A 2W7AA 3FEYB 4KR0B 4TQRA 2UUAF 4LFAF 1M5KC 1RYRA 4YOEA 3M2VB 2DCUB 3OXGA 4DL0C 5A8KA 3MR5A 1JLFA 4IFVA 1BD6A 2UVWA 1TKTB 4FVMA 4FYDA 3SV4A 1Q79A 4HDHA 1FRKA 3V6KA 2CPJA 1K8AT 1FK9A 1IKXB 1WNEA 1SJ4P 5IT9Y 1NAQA 2F3JA 1VI7A 5IM0B 2PMHA 3TAPA 1H3DA 2JRSA 2XMJA 5KFRA 3OXFA 3HPOA 3QZ8A 2ZDOA 2UP1A 4WJBA 5KT4A 3U02A 4C11B 3TW0A 3H5UA 2YH1A 3QIPA 4JI2F 3ZZ0A 2V8HA 1E6VA 1U8SA 3D0IE 2LQBA 4PG4A 5JJBA 1GXTA 1H98A 1N8RT 2RD5C 4WKYA 4YY3F 2PGCA 2DR8A 2ZOFA 5F8NA 1J2VA 4CT8A 3KLVA 2DBBA 2C42A 5DM6Q 1RA7A 1L3UA 2GCFA 2HFZA 2FLLA 4DUZF 4MKYA 1QJHA 1IBLF 4ES1A 5L8RC 2KRBA 2IM1A 2KKHA 4F8RA 2YWFA 3BDEA 4K4WA 2KZZA 4X65F 1SH3A 3OR2A 2MQMA 4NLRA 3LUYA 1EETA 3OTEA 3KMQA 3OR1B 1YTYA 2DHGA 4MK9A 4OI2A 2YNIA 4FNHA 3DRRB 1M1KT 5J2NB 4JOUA 1M0SA 2JLFA 2NZ4A 2K7KA 1HW9A 2A2DA 2GMJA 3GV8B 1UVLA 1LWCA 1YBAA 2XMTA 4NA1A 4FF2A 4AXJA 2DCLA 3OL7A 4DQPA 1MROA 1TL3A 3BSCA 4HI2A 1XMOF 3N4WA 1HNVB 2L3MA 4RBUA 5IT0A 4I64A 5HMWA 2XLJA 2KVIA 2GQCA 2MZJA 3LW5C 5FD1A 4C3MA 3KLFA 3I4HX 2V4QA 1TVRA 2P6SA 2E5IA 1GQEA 3MPVA 5KFCA 5KT2A 2W24A 4P7VA 1XTZA 3DOKA 3VAIA 1N5SA 2X3GA 3HDSA 4Y2MA 4NZ7A 1LW0B 4N5SA 2MKCA 1DBDA 5MAOA 3RB4A 4TY9A 4DS4A 3I55S 4DV3F 1VRTB 3SCKE 2VG7B 4I6AA 4DV6F 3PX6A 1Q81T 1C0TB 2MQQA 4RNOA 4BC7A 1W2IA 3GILA 1CQNA 4C3LA 1TR0A 2MY7A 4HVZA 5E2QA 4JV5F 4G1QA 4HT7A 4OZJA 4LF7F 1HNWF 1X7VA 1HI1A 5KFJA 5I3UA 3G96A 1TL1A 1U1NA 2ZH1A 1HHTP 4YR3A 2FGOA 1FD8A 5BYSA 4YQWA 3TP2A 1BQNA 3DHWC 3G9CA 3HLUA 2IRYA 5G4DA 4J9PA 4X2BA 3L3CA 7FD1A 3N6MA 1FRMA 3IGNA 3QWUA 1RT2A 3GG1A 4EGLA 3PX4A 2QZ8A 1DZ5A 2PD1A 2HYIB 2R2SA 2XSJA 1QSSA 4KGKA 1MSWD 2CQCA 4F02A 3CJKA 3TA2A 1M5HA 1L5UA 2OD4A 1Q8BA 3M9NB 3WDOA 2Y1JA 1S72S 3NNHA 5GMKa 2RU9A 3PFOA 3MUTP 4QYRA 4OI3A 1Y5IB 1TQLA 1MW7A 2XSFA 2J0WA 4OX6A 4I2QA 4NX9A 1N6QB 2EBGA 2VOOA 5DQHA 1J5OB 4ID5B 3MEDA 4Q0BB 4UUXA 3C66A 3B4MA 3Q8RB 2IFXA 2C2RA 2FJXA 2LYVA 2AYBA 4ZPAA 3VZHA 4Y0FA 1ZH5A 3NGKA 1VQ7S 2KU7A 1UW4A 3EXYA 3DLEA 1RTHA 2V4JA 4IG3B 4OZNA 3TO8A 4DSIA 3KK1B 1PO6A 1F9FA 3HHLC 1C2PA 3DRPB 2RRAA 1YJ9S 1BQMB 1SV5B 5E0OA 1RKIA 1FKPA 4JI8F 5LL6d 5KAKA 4I68A 5J1EB 4PUOA 2OAUA 3DFEA 3MPWA 3MEKA 5SZTA 1LWEA 2HVHA 4DFKA 2QMWA 2R8HA 2DK2A 4I0WA 3CJ0A 3MEEA 2YKMB 5BJRA 4J9RA 2I5JA 5EX3A 4CTAB 2J76E 3IC1A 5L1LA 1I1GA 3LWMA 1KRPA 4WK3A 3OVBA 1SQEA 1HA1A 1M90T 3KJVB 4FF4A 1RQ0A 2J7UA 3IO1A 1NKBA 1KN6A 1YITS 1WI6A 3NBPB 1VQMS 2EI5A 3OVAA 3BSNA 1TAQA 2ZOMA 1OPZA 3JSMB 3LP0A 5B0CA 4IQMA 4ALZA 2XMVA 3CCVS 4O3QA 1WD6A 3SDEB 1M5OC 5CYMB 3SZ2A 1QY7A 3HO1A 4TYAA 2HHWA 1FJ7A 3H8YA 4WK1A 4A8SA 3RAQA 2VKRA 3GFYA 2DHXA 2O01C 3L7PA 5E3PA 2FDNA 5F8JA 3T19A 1R8CA 2KHDA 3M32A 3VALA 3D54A 3IRXB 2HLTA 1JMTA 4NLPA 4I7FA 3VF0B 4C98A 3Q8SB 1LWFB 4Y2AA 3QO9A 5KT6A 2J0QD 3MFIA 2ILYA 1YG0A 5FDLB 5F8MA 2GHPA 3DDNA 4KV8B 3JTNA 3KOAA 5BYQA 2J0SD 3LF0A 3KHGA 5HMXA 4K4ZA 3D2WA 2YX4A 4AQYF 2K1RA 2C28A 3SSQA 5KFHA 4YB6A 3E3XA 3G71S 1WWHA 1Z4UA 2ATLA 4I2PA 1TKXA 3OTBA 1FERA 3I4PA 1XN9A 4HH0A 2M7SA 4LIRA 3OBIA 5K8NA 1Y9OA 2YNHB 2XMMA 3CD6S 2O67A 4IG0A 4J9NA 1FJGF 2OPQA 5KFAA 1SH2A 4KRWA 5E41A 4FN5A 2I1RA 1RT6A 1C1BA 1U2FA 2GA7A 2GC8A 3SSSA 4YB1P 2PIIA 3NAIA 1SBRA 3GSDA 2A3JA 1WTBA 3HT3A 3MR2A 4C8YA 1IKVB 3I9ZA 1LOUA 1X4FA 2DNZA 3CDEA 4RWXA 4UW2A 4DDFA 4ECRA 2XS2A 4ILRA 4OX7A 2NQPA 1TKDA 2UVUA 3R27A 3D1HA 3RW7A 4PKDB 4DL6A 1Y3JA 4P7TA 2LQ5A 2XULA 2NXUA 2OMOA 4DEZA 5H1SV 4X4RA 5J2MA 2FLNA 1G7CB 1UVMA 4Y65A 4X4TA 3OL6A 5DG7A 1Y3KA 4N47A 5HQ8A 2VB6A 1D9DA 1MWZA 3KNGA 3N01A 3GFXA 5LSRA 4NYPA 2WW8A 7FDRA 3HP6A 3EPGA 3QGGA 2DNHA 1HQUA 3M2RB 1N34F 4PG5A 2KXFA 4NCGB 4J37A 3DM2A 5KG3A 1VK3A 1HWIA 2DO0A 2PA3A 4QR1A 3EZ5A 2FHOB 1XEZA 2E66A 3QLHA 1CQMA 2HS0A 5T14A 2CPEA 3N5FA 4AYBD 3VAJA 1SKSA 1HWJA 2ASJA 4R5PA 1R31A 1UJ5A 3TI0A 2YNFB 4K4XA 4DFPA 3EPIA 3HVTB 1OIAA 3KG1A 5KFKA 1BWEA 1RT7B 4ZVGA 3TRGA 3QMQA 4OHZA 3MMAA 4WCEQ 1D9AA 2ASYA 4OMFG 4EYIB 3MEGB 3MTKA 1XC9A 1FXRA 2BRKA 2IAJA 4D3GA 1NK0A 4C8ZA 2E1RA 1KONA 3PO5A 2BBEA 4U7UK 2RIJA 2JLGA 4NLSA 3EYZA 2HRYA 3BN4A 4YUDA 3KMSA 1FEEA 4DR7F 3DYAB 1ZZFA 2JVOA 4AXIA 2LECA 4KO0A 1S4FA 2OKQA 4LT6A 1HWLA 2R2TA 3NAHA 5JVGQ 4JV1A 1C0UA 5THWA 5A2QY 4QU7A 4XK8C 2KT5A 4QR0A 4USHA 3CCTA 2QLWA 4DQIA 4HDGA 2XNRA 4WF9Q 3E2EA 2JLEA 3IA0A 1RT4B 2DNYA 5KFFA 4A8FA 4F25A 1LK7A 2MDAA 4H4OB 2DNKA 1YJNS 2K7JA 5DM7Q 1V3RA 2LDIA 3KKFA 2KYZA 4RBTA 3THTA 4J9SA 4H4MB 2IVMA 2OPPB 3JB9k 2ZD1A 4IOAQ 2X1FA 4LSNB 1NH7A 4WE1B 3QAUA 1HNXF 1KVIA 1EP4B 1H7XA 2HQIA 3BO3A 1Q8IA 2HZCA 3BO4A 1SJRA 2XG8A 2LEPA 4O3SA 2X1BA 2D41A 1RT5B 1RT1B 2YKNB 4HTIA 4QW8A 4HT5A 4ECZA 5E7OB 4O3RA 2M4MA 1FNOA 2MZQA 3ZZZA 2FD2A 2UV8A 2CJ9A 2GFFA 3MD3A 4DJBA 3F44A 2M8HA 3ITHB 5HLFA 3KG4A 1ELOA 4ETZA 3KLIB 4NLVA 2KHCA 3LAKA 4BHQA 2W9CB 4Y6IA 2XY7A 2AGPA 2DPJA 4NLWA 4DFMA 2HHPA 1ZM4A 3BGUA 4PXCA 5FLXY 5HN0A 3QWPA 2XMWA 5DGAA 2CKWA 2AJ1A 5GADU 2D1CA 4B9VA 4ZVEA 2N3OA 1YSJA 4BCAA 4MTPA 2M8DB 4ED2A 4O3NA 1WELA 2M88A 2VFRA 2KJVA 4XIUA 1FDAA 2JEGA 2CZVC 2DR7A 4ZVFA 1PILA 1K1QA 1Q53A 1R89A 2HFNA 2CQDA 2ZM6F 3U1LA 3VCDA 1HMVB 4PXEA 4WFNQ 2W9BB 1RWUA 5HROB 2W7OA 2DVIA 1XBWA 1DLOA 1S9GA 1QE1A 3HHKA 2EFVA 2YY3A 3QPIA 4DQSA 1KSPA 1S6OA 3M2UB 1NEEA 3BDPA 1LQ9A 5C25B 2ASDA 2AP6A 3RRKA 1JJ4A 4FBTA 2LQJA 3MECA 3U27A 4LF8F 3W2VB 1JLGA 3RYLA 3OHAA 1S1TB 3P96A 1R8AA 3IR5B 2WONB 3J7Z5 3MM7A 2OPRB 5HMZA 2AGQA 1URRA 3LGMA 3NP5A 4IDKA 3GFHA 3FDSA 2OLWA 3Q2SC 1ZTWA 1AFJA 4ZPCA 4PWDB 3JYTB 1RYSA 3NNCA 2DNRA 2YWGA 4Q7AA 1L3SA 2BE2B 2HNZA 4ZP8A 2F8MA 1FRHA 1B0VA 5KFDA 3CCRS 3C3LA 4RNHA 3MM9A 2VFVA 4HHJA 2E9ZA 3KWMA 2J5AA 2MKHA 2NPIA 3MURP 1GXUA 3CDWA 5J2QB 1S0VA 3HJFA 3ZZPA 5KTQA 3HVRA 2WRMA 4I6WA 3UCGA 2D74B 1AXQA 1HBMA 2QSFA 2BANA 2IA0A 2AJFE 1UL3A 2I0XA 5F3TA 5L9NA 3BQ1A 1S0NA 3PO4A 2ZHOA 4XDDA 2ROPA 1N32F 2XLKA 1FD2A 3US5A 4B3SF 3NS6A 2CJAA 2ZH2A 2V9WA 1FRLA 4NLUA 3AJ2A 2FJVA 1T7PA 5KFBA 1P1LA 3KLEA 1YIJS 1UJ4A 1SL2A 3CC4S 4B9MA 2OMLA 3HVWA 2WB1D 1BY9A 5D3GB 2HNYA 5I3QA 3H2UB 4R8UA 1UA0A 4M1KA 1VMBA 2DGUA 2M2BA 2ACYA 2ZDPA 2COLA 1S0MA 4NCAA 1JLCB 1R8HA 3PR5B 2VH7A 5GAEU 1MU2A 4F3QA 3NMRA 3G86A 2E5HA 4QPTA 5CCLA 3EUNA 4CH1A 1R8BA 3GR1A 3H2LA 5CZXA 5L39A 5J1NA 1RTIB 4G6VB 4QYZJ 2Q6CA 3R1LA 4N77A 3J7YU 2KG0A 4K4YA 4LVNP 2EC0A 3H5SA 2FLPA 2HMIA 3BGLA 2YWKA 3F56A 4K50A 1FXLA 1V3SA 2B4UA 1IQZA 3UFCX 3IXQA 3AHPA 2EFQA 4WZMA 2G1DA 3UI3A 3UQSA 4ZCKA 3G8SA 4K2XA 5LT5A 2CPYA 3ZZYA 4QPXA 4X64F 1IXKA 4OHVA 4DR3F 3QJLA 3KK2A 2JWNA 1PC4A 1HQEA 1IM4A 5M2RA 4U6PA 2QT7A 3BSOA 2FJDB 4ECTA 1H38A 4DBQA 4OLPA 2DH9A 4CH0S 5HP1A 4J9OA 2MSTA 2R8IA 4DV4F 4PXDA 3P3DA 2LA6A 3R3TA 2MPUA 5I4MA 3BGRA 2E9TA 4B3RF 5B0GA 3SCJE 3DGPA 4RW7B 1FTRA 4ES3A 4X4OA 2YH0A 1UAWA 1HBOA 5F9LA 3RB3A 4B9UA 4N41A 4OI0A 3F73A 4OZ5A 3MGJA 2HGNA 3N6NA 1C1CB 2B51A 1ZM3A 4TY8A 1FE4A 1FNMA 3BQ2A 3OFGA 4JV0A 5KFGA 3K5PA 3M1VB 2QA4G 2XBPA 3UE2A 1CEZA 1DTQA 5KOXA 2K2PA 4A8MP 1HNZF 2OPSB 1FTCA 3CULA 3KHHA 2AGOA 2WSFC 2CQBA 2BABA 1FJEB 4DR5F 2Z8QA 3HZEA 5KFWA 4ED8A 3IRWP 3C6TA 4DG1A 3RU0A 3H25A 2VG5A 1KQFB 2W8LA 2YVSA 4J9QA 4QIFA 2XB2D 1XR5A 2XGPA 4F2RA 2YKPA 1S1WB 2MZRA 2R7WA 3I0SA 5IT4A 1YJUA 4FP9A 2CFXA 3DLKA 3DRSA 1S1VB 4ECUA 4JBCA 1IKYB 2C2DA 2RQ4A 2AYEA 1SIZA 4EBDA 4H54A 4O44A 2B5JA 5HL7Q 5CYQB 1D3WA 2B43A 3I6PA 4EBEA 3VAHA 2ALZA 4N8OA 4GKKF 2ZNYA 1HW8A 1XR7A 2KZMA 1KLMA 3UD4P 4NA3A 4NLGA 1AROP 2MGZA 1X9SA 2LLZA 3D28A 1AFIA 1E6YB 4Z37A 5DDOC 4DSLA 2E5LF 1R0AB 1YQHA 2VG6B </