3WX4A

Crystal structure of t4 phage arn protein
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
98
structure length
98
Chain Sequence
MIIDSQSVVQYTFKIDILEKLYKFLPNLYHSIVNELVEELHLENNDFLIGTYKDLSKAGYFYVIPAPGKNIDDVLKTIMIYVHDYEIEDYFELEHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The T4 phage DNA mimic protein Arn inhibits the DNA binding activity of the bacterial histone-like protein H-NS
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Viral protein
molecule keywords Anti-restriction endonuclease
total genus 28
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2014-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2770 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3wx4A00
3WX4A
chains in the Genus database with same CATH superfamily
2KHDA 2VDIA 3AD9C 3WX4A 3LUYA 1WI6A 1PJ7A 2CQ2A 5AXKA 3K58A 1S72S 4ED3A 1RTHA 3BQ1A 4R25A 2OGUA 4XO0A 5AXMA 1HYSB 4IOAQ 5KFOA 4X4SA 4IR1A 4HTJA 2B5JB 3SCIE 1ZA2B 3KXDA 4TKTA 1TL3B 3UVJA 1WC3A 1P9QC 3DXSX 4ICLB 1M1KT 1N36F 1W7WA 2ZKUA 1B4SA 3QLHB 2ZH5A 4LQ3A 1HBMB 3BR8A 3LOUA 3M32A 1NNDA 2DR8A 4LF4J 2YH0A 1VQ6S 3CD7A 5IQQA 3TYTA 2FJAB 3MOZA 1FHTA 1TKXA 3DRYA 1XNQF 4K5SA 1HI0P 4Z7YA 2HMIA 2M3DA 1U0HA 4K7QA 2YNGA 4QU7A 4G3IA 3ZNUA 2K3KA 3V6DA 5ETVA 4J9RA 2NSBA 3NY0A 5HBMA 3IN5A 1NHKL 2QMUB 2PA8D 3ZZZA 1VIOA 2DXDA 2DNMA 5KG1A 4FPRA 3CJ2A 1S9GB 4V1Ak 3TVYA 2FJWA 2VA3A 2NZ4A 3M2VA 3PJ9A 3QYYA 1UWBA 4KGKA 3T1HF 2EK6A 2PDAA 4UOFA 4G6VB 5DLFA 1S6QA 1IBCB 3QFWA 1R89A 1QD1A 4P71A 3W66A 4CO0A 3DM2B 3R6GB 1FEHA 4Z2XA 4IRCA 1RUSA 1MN7A 4R8UA 3CJTA 4DV4J 1KLNA 1TQLA 3D28A 4MK9A 4Y28C 4PG4A 5DO2A 2AW0A 1RISA 2DGTA 2Y1LB 3IGVA 3P8BB 4ZCLA 4C7QA 3CJQA 1QUPA 1BE4A 2ROGA 2YNGB 4LR7A 2ROPA 1JB0C 4ZK7M 2J9CA 3H7HB 3HHLA 2BJ1A 2YQ1A 1EX8A 1N88A 3OXLA 4KH1B 5IS2A 2BJDA 2UUCF 4U8VA 5K20B 2J76E 2GW8A 1IR1A 3IM8A 3MMBA 4TLRA 4ZVHA 5GADU 2VJVA 4DL6A 4P10A 1DLOB 1H72C 2ZOFA 1TL4A 3N28A 5A8WB 1YTYA 3K5PA 3MM6B 1P6TA 4XDCA 2DEIA 3QLHA 3GILA 2W2OP 2RB7A 2XI2A 1WWHA 3E51A 3ZC4A 2JFDA 3PW4A 4O3PA 5D15A 5EWFA 2BE7D 2XG8A 2VDHA 2M70A 1CC8A 1RCXB 3ADAC 5B0BA 4PXEA 2FVPA 2AYEA 1RT7B 1FJEB 2Z58B 1AB8A 1V5VA 1RKIA 5IV4A 4WJBA 3CTRA 4LF7J 1VRTA 3HK2A 2E7XA 2ZOMA 1M5HA 3QIPA 1B0VA 1AFIA 1U02A 3NCPA 5DG9A 1WC6A 4F0HA 3VAMA 1VQ4S 5HK4A 3I5AA 4ZN1A 2QA4S 2UUAF 2B9WA 4HVZA 3S01A 3UDEA 1DTTB 2XO7A 1RT2B 4JV5J 4N76A 1QLNA 2RQ4A 2LCWA 3S6EA 4C8YA 2CG4A 4F8RA 2VFRA 2R7WA 1FNOA 1KSPA 3A13A 4NYPA 3MEEB 3ZZ0A 3OXFA 2R8JA 3TVKA 4B3SF 4CNYA 4ED6A 1U1PA 3EVOA 3HSJA 4FPIA 4NLYA 4WK3A 2RS2A 5L1KA 1HNVB 1NK5A 4ZPDA 5I42A 4UTGA 1WG1A 4RBUA 4C4WA 1S5ZA 3SFUA 3KHGA 1PILA 1RDRA 4YS2A 4C8LA 2IVYA 4K4SA 2YKQA 3HJFA 1Q8LA 2F4FA 4CNZA 2UXDF 1RB0A 2QE5A 4HACB 4OZ1A 2LVWA 2KT2A 1PJ5A 1SC3B 2UZAA 1GFWB 4DPUA 2AWZA 4I7FA 2VC1A 4NCGB 4WIIA 1FF2A 5HAOA 1Q5YA 1YI2S 4MH8A 3GZ7A 3VAGA 4JI3F 1U26A 2OKQA 2HWHA 4E8UA 2J7KA 3TJ8A 3FJ2A 1X31C 1Y5IB 1HW8A 4A8WA 1AZSB 5AJ3J 2NREA 1NSKL 1CEZA 1IQTA 4OX7A 1PC5A 2GVDA 4JI7F 1DJ0A 1T94A 1SJRA 2MJNA 2R7RA 1IWGA 1GEHA 4RWWA 3KK3B 1WHWA 1KHWA 2JLFA 3PXGa 1N0VC 3OR2B 3P5TL 2MLZA 2EFVA 5L38A 4P7VA 2M4MA 1RU1A 2LECA 1S7IA 2CJ9A 2DT9A 3RAQA 1JLEB 2DR9A 1RT5A 3HHKA 1U6BA 3H5XA 4GKKJ 3ZZPA 4CZCA 5KG3A 4JB8B 1Q8KA 3D0HE 1TAQA 3BPDA 1KKHA 3ENVA 3Q8VA 4WIQA 4OV1A 5HROA 2VPXB 1MMNA 4O3NA 2QYGA 5K8PA 1SJQA 3D68A 2XMUA 1JLAB 2RF2A 2RUSA 1K44A 4I64A 4Q5VA 2V4RA 1BQNA 2HNZA 1ZZNA 1HBNB 1WF2A 1KP6A 2NCKL 2QV6A 2V67A 2EI5A 4ECRA 2UUBF 3TAMA 4P9SA 2H48B 5I4MA 2CZ9A 4QPTA 2PT0A 2FY8A 3ILJA 5K8NA 3I0RB 4DQIA 3TR5A 3LP2B 2D7SA 3MUVP 2QTWA 3FUYA 4AL6A 4R5PB 4WKYA 2A3JA 2B51A 3OTCA 2V9KA 2DGOA 2MB0B 2V8HA 1B7YB 2HHHF 2QO3A 3MEKA 2KYXA 4RKUC 2ZH8A 1ZAWA 2DY1A 3CW2C 3GCWP 2DPIA 1RWMB 1XJWB 2DITA 2IIHA 3NAHA 2L3MA 5KFKA 1WKJA 5KOXA 3WC2A 1CJUA 2A2DA 1N5VA 2O67A 2BX6A 3CJSA 3PR4A 1OY9A 2AYMA 3ETMA 2V9WA 3MR2A 4NCGA 4OYWA 1OY6A 3K17A 5BR8F 1FVSA 1SJ1A 3L9ZA 1RP5A 4KBIA 4U95A 4YY3J 4YQWA 4WWSA 3OR2A 2AIRB 3R5BA 3HFVA 4J7CA 1KN6A 1HARA 2FVQA 2ROEA 4IOBA 1T3NA 5CQGA 1Q4RA 3SIPB 1H2UX 3HD2A 3UE2A 4WYLA 5J1NA 2HGNA 2BVZA 4OYXA 4CO3A 1HBOA 2HPUA 1RT6A 1C4CA 1VJWA 1ZAXA 4RW4A 3MWBA 4WFXA 3WQPA 4BC9A 1DQAA 2FJVA 1F2HA 3LWLA 2AQ4A 2G0CA 2RNEA 5MLCV 4FS1A 4B3MF 1WHXA 1RT1B 1EHWA 1VBXA 1CC7A 1K9MT 3Q89A 3J7A1 5KOWA 1JLGB 4LRCA 4WU2A 4ZCIA 5GADI 2IDLA 3C14B 3T5KA 2VG6B 3W65A 2DKOB 2J9DE 4CDIA 5C25A 2J9EA 1BXNA 3LTOA 4Z37A 2JSXA 3OTOJ 1RSCA 3POTB 3TUJC 1UA0A 3QJLA 1VR6A 2NXJA 3I4HX 3NOCA 1XNRF 3NNHA 2ACYA 3EJMA 5FJ4A 1BQXA 3FZ2A 4ECXA 2XMWA 3DRRB 5F8GA 1U2FA 1UEKA 2K2PA 4LSLB 2AV5A 4Q2MA 3SCLE 1GTHA 5KFRA 3Q8RB 1IJFB 3CT9A 3CD6S 2GO8A 3ENQA 1VQNS 4ILLA 1BGXT 2Q79A 4ECUA 2ZBIA 3OV7A 4O44A 1RHJB 2QGFB 2E1PA 2IM0A 2XBPA 4UT4A 5A2QY 4DR1J 4U6PA 1J5OB 3PVXA 5DJBA 3FEYB 1UCNA 2YX7A 5LMUF 2MLYA 1DBDA 2O5DA 4IO1A 2MQPA 3CPWR 1NK6A 2ILZA 4OJ1A 4QWAA 4NXNF 1BC6A 3SSQA 2WBRA 2VBYA 1G7CB 3UWTA 1JJ2R 4QPXA 5JVGQ 2R7SA 3HCXA 2DRBA 4NLDA 2OD4A 1PSDA 4EEYA 4J91A 1FE0A 4ID8A 4OJ3A 3W61A 1JJHA 1ZPWX 1OPIA 4I69A 3AOAA 3E01B 5F9LA 2QL9B 5KFJA 1PBAA 1R8AA 3K5LA 2LXFA 2XI3A 1Q86T 2A18A 2NS1B 5LMUJ 4NXMF 3BKTA 3IAM9 2V8GA 2DISA 3D5MA 2WSEC 2VFTA 4DV1F 2DPJA 4F36A 5FDLB 4GVBB 1CJKA 2KTQA 3LAMA 1FFGB 4DZ6A 1JLQA 3TUPA 2ZC4A 3RYLA 4DV4F 1PBUA 2HAIA 2RF2B 3ICLA 4MYTA 3PYGA 4WP9A 1R3NA 1Y3JA 2JH3A 4NCBA 2VFVA 2XCAA 2DCLA 2K06A 3R2CJ 2VG5A 3B54A 5CH7B 3MMCB 3M7VA 5F8NA 3H5YA 3DM2A 4CRJA 3QJPA 1RCOB 1IJEB 2CJBA 3IS9B 3EMTA 3N9UC 1SUQA 1TKZA 2OTJS 2MQNA 1RWKB 1XIQA 1Q0NA 3CSKA 4CO2A 4DCOB 1N5TA 3F73A 4CCHA 4HKQA 5RUBA 1SQFA 2HEKA 2RILA 2NXCA 3NCQA 2OPPB 2OH2A 1UJ6A 4NA2A 1YZ6A 1C1BA 2RVJA 3HI9A 2ZBQA 3T41A 4ZMMA 2FGCA 2ZH2A 2CQIA 5IZHA 4K2JA 3SXLA 3JYTB 1LFPA 1YDLA 3US5A 2DNLA 3LP1B 3OT9A 3T1AA 3M9NB 1UVJA 2VPYB 1I51B 2OFHX 4YR2A 2C2MB 5ETRA 3NBPB 4QIVA 3R1LA 1ZTTA 4DFPA 1NJXA 3RR8A 3E2EA 2HIQA 2RH3A 3H2LA 2XM3A 2DGSA 2ASLA 1H2VZ 4ZVTB 1DZ5A 2MGZB 3KTQA 4IFYA 4LF8F 1QE1A 1Q16B 1RK8A 4CYUB 2BDPA 1SC6A 1JLCA 4MIAA 3T9NA 1TAUA 4AFFA 1UVMA 1WTFA 2CQDA 2C3PA 1UFKA 1SBRA 2YKPA 4CP5A 5KT5A 4NASA 4WXOA 2EC0A 4FVMA 3VWSA 3SV4A 4FBTA 2BANB 3NRBA 4DU8A 5DQIA 2B4OA 3EGNA 1KQGB 1Q79A 2QMXA 1H74A 3QWPA 1FDAA 5GAHU 4ED4A 3NG8A 3QZ8A 3UN2A 3UI3A 4NZ0A 3CCLS 5EHHA 2UV8G 3RTVA 2ACMA 2R2SA 1YQHA 2DHAA 1Y7PA 1NLKL 2CPDA 4OLPA 3GB0A 3RRHA 1DTTA 2MXYA 2E1AA 5M2UA 2KFZA 1ZZFA 1RWVB 2XYGB 1F1BB 3M4XA 1NB2A 3CVKA 2PIIA 4PG7A 3CCUS 4B3TJ 3TVZA 4LBPA 4UF4A 3FMBA 3BH6B 4O23A 3PTWA 1S1UA 2GQCA 2J7UA 3W9IA 5F8IA 1NPKA 1HNVA 1XMQF 3DRRA 4RO0A 4H4KA 2H9ZA 4C6AA 4C0OC 3R7BB 5K8OA 1XNQJ 1MU2A 1RTJB 2CPEA 1S1WB 1IKXB 3UR3C 4M5IA 2ZJQQ 2E1CA 4W90B 1TV6A 2XHWA 2OSRA 2QLWA 1FVQA 3I32A 5GMDA 4DX6A 3AH6A 3I87A 4TQSA 4DV6F 1X4GA 3DYAB 4B3RJ 3G2XA 4MK8A 2IBKA 2Y1RI 5KFWA 4F3MA 1XEZA 1ZYQA 4ILMA 1UETA 1QM9A 1R6YA 3HSGA 5B0AA 1S1VB 3EDQB 1RAHB 4PXDA 4Y6IA 5EN1A 1U48A 1S4FA 4RBVA 3C6UA 2KXNB 4HH0A 5JVHQ 2HFVA 2W9AA 2YX4A 5C5JA 3HHLD 2W4DA 4LRDA 2I8EA 4X84A 2E7VA 2AZ3A 3MM5B 3SQGB 1B7FA 1TMJA 2J6UA 2YX1A 2VD3A 3AY0A 3F56A 3LWMA 1NDKA 2VQEJ 3DLHA 2FHMA 1R7IA 2MQOA 1J27A 2FB0A 4Y65A 1N5YA 8RUCA 2LYVA 2D9OA 2NZCA 3DLEB 4LT6A 4K4YA 1IR2A 5HP1B 4NEZA 3EX7B 4DF8A 3SZ2A 3DLLQ 2RDDA 2VG7A 3NS5A 2YNIB 4IOCQ 2EKNA 1IBLJ 3R7NB 4A8FA 2XS2A 5MAOA 3JSYA 4LF5J 5HQMA 1N33F 2WVCA 3F44A 4G1QB 3IXQA 3UQSA 5F8LA 1TELA 3OSNA 2DXEA 1H7WA 4DQRA 1T03A 3DOKB 2F9DA 2G2YA 2C3UA 4O4RA 1WOPA 1M1HA 2Q3PA 1WI8A 3EZUA 4I56A 2XYPB 3PEHA 4L76A 4OYBA 2DGVA 4GO5X 4M5HA 4ANCA 4F4XA 2EFQA 1BLUA 2KO1A 4NMXA 4J9LA 3VALA 4NA1A 3VGSA 1YKWA 1ZM9A 4G65A 3EXCX 2RT3A 2FQQB 4QR2A 2HFZA 3KUEA 2JHEA 4P2XA 4Q7AA 2XCPA 2DYAA 5CD4H 2ERRA 4I68A 2LQBA 2EEYA 4C3MA 3IRXA 4XAKA 2Q6BA 2H5JB 3MPUB 2ZOGA 3W3SA 2AJ4A 3UO0A 1NJYA 3M6UA 4KFBA 1PYSB 2VOOA 2OPRA 1WHYA 2CYYA 2WRMA 1O8BA 1WEZA 5KFNA 1WNEA 4HT5A 3OJSA 3Q23A 1PGZA 2OFGX 1N34F 2AKWB 1TK8A 2F9JA 4YN3B 4X66J 4NYOA 2EPIA 4JI4F 4K0KJ 1IKWA 3QO9A 3D2WA 3BREA 3NKYA 2W8KA 3I5CA 4CLUA 1WSVA 2D3OR 3KNGA 2AEJA 3CB4A 1YJNS 2YPZA 2ZUGA 2QFIA 4I1TA 2Q1LA 4ZVFA 1FJGF 5LSRA 1YHQS 1GMVA 2KL8A 3H42A 2CDQA 2GCFA 2LA4A 2MY7A 3HKWA 4CO1A 5BJRA 2DNZA 1WF0A 4DV2J 3AODA 1YJRA 2C2KB 4OYOA 1YRTA 4LSNB 5EGYA 1NZ8A 5D8HB 2MQ8A 3U02A 3J80Y 2J9DA 1W26A 2B4UA 2EXUA 1WOSA 1LWFA 4XPCA 3M8QA 3HD1A 2XMTA 4EO8A 1N54B 2H5EA 1GMWD 3W5YA 2V69A 3NWRA 2XHCA 1S6UA 2FPHX 4H4OB 1PKUA 1IKYA 3ETOA 3QIPB 2RU9A 4W98A 1HQUB 3IMQJ 4N5SA 4B9VA 1KLMB 3BO4A 4JP8A 1DQ8A 2BOPA 2MHEA 3M2RA 3QNWB 3TRGA 4AD6A 4ZN3A 1NUEA 2F1FA 2I5JB 2N4DA 5L1LA 3HSDA 4WFNQ 1XMOJ 3M8YA 2KFNA 1RT6B 2GZOA 1YK9A 1YSJA 1K0TA 2JL9A 3WDOA 4FDFA 3JTPA 1H2TZ 2CXEA 2JNJA 3GFXA 3ISZA 3CJKB 1YIJS 1SKWA 2UUCJ 1HNXJ 4P2MA 3ZFVA 5DM7Q 3D67A 5IC6B 1QAYA 5KFFA 4X62F 2X1FA 2HHTA 4FXDA 1A6LA 3JQKA 2V2VA 2IM1A 4DF4A 5D3GB 2V6AA 1N34J 1C0TB 4P2FA 2ZHBA 3M8QB 5G4DA 1AUSL 2WVFA 3MXHP 1C2PA 2EKYA 2NXUA 3KK1B 2AEFA 4OZNA 3EZOA 5HJXA 3CD5A 1S9EA 1G1XA 5E3AA 3SSRA 5DRKA 2DO4A 4FYWB 1TK5A 1P1LA 4HI2A 4RR5A 3VF0B 2I5JA 1LFWA 1NEEA 1FCAA 1S57A 2ZD1A 4MFBB 3ILLA 1T0TV 4S0MA 2XZDB 5JMNA 3KK2B 4DR5F 3PO4A 1Y5LB 2PFDA 4Q2LA 5E5NA 1PYTA 1G6BA 2HRYA 4RLEA 5KG7A 2NXEA 2Y9HA 2G0IA 2PI5A 3EDRB 5ITHA 2Y3YA 2LU1A 3UNGC 3DRSA 3D6MB 3MUTP 4JOUA 4B3OA 3PZPA 1AUDA 4P7TA 5AE1A 2D3UA 2AHOB 1BQNB 3MGJA 3QT5A 3N6NA 4PWUA 4TNOA 2HURA 4NRUA 2YVSA 3EVWA 5D4PA 4PUOB 4X4QA 1URNA 4WFBQ 2YWFA 1S0OA 1V5IB 3LA0A 1JJ4A 1C1CB 1M1GA 1JNRB 1KTQA 3C15A 4RW9A 4ID5A 4L6V3 3UDCA 4CWBA 3T1HJ 4TU9A 2EVZA 5KFDA 5J2NA 3KNAA 1G2EA 1KVKA 5M2RA 1HW9A 5ETLA 1S4EA 1SIWB 2CZ4A 3EXYA 2VKRA 4FS2A 1I3OB 5DETA 4KGMA 2L41A 4OYIA 2CNLB 2GQQA 1VQ7S 2CQ3A 1FJ7A 3DOLA 3HHDA 3IFEA 5HO4A 1T11A 2R8HA 3BO2A 1T9WA 2QLFB 1HQEA 5KFMA 3FKBA 3HX9A 1FRMA 3G6VA 3M2VB 3TEGA 2IC3B 2MZJA 4QBUA 4LBIA 3FEZA 2NPIA 1RWXB 3OFGA 4NLGA 4JYAJ 4ECYA 4DU7A 1SH0A 2WZ1A 1EP4B 1EAYC 1FEEA 5CYQA 2JJ4D 3KLFB 3RW6A 2PSZA 3DKDA 5J2QA 3GIRA 2HGMA 2IHR1 1D8ZA 2KU7A 4RU9A 2L9NA 2H54B 3BH7B 4ECQA 4KV8A 1SCJB 2ZBPA 1P9YA 3LH2S 5C2GA 3TA2A 7FD1A 1NKCA 2JEFA 1SUQB 4YB6A 1VC6A 3X1LB 1CJVA 1FXDA 3DRSB 1R0AA 4DUZF 1G3OA 4WE1B 1XK8A 1L3KA 2HHPA 2V8VA 4OHXA 3TJAA 3C46A 4Y2KA 1HWJA 3ZTPA 1CSJA 3H0PA 1SKRA 3NXZA 2HHWA 2EK1A 3MHYA 4M5JA 3B6BA 1KC8T 4RNHA 2XTJP 2ZH4A 4I67A 3OL8A 1UMJA 3SSSA 2WVEA 3DN9A 2HLUA 4M5NA 3RW7A 3I56S 1S1UB 1VK3A 2HQDA 4OYAA 5K14A 4LR8A 2ZH3A 1LV5A 3H25A 3HKZD 3ITHB 1FRJA 3DLJA 2MEWA 2OPSA 3HVAA 2DHGA 4X4RA 1M5KC 1PYOB 3PM9A 5HVHA 2ADCA 3L3CA 4TVAB 2AGPA 4DL7A 1JK9B 2CQBA 4X4UA 1YLXA 3MCMA 2V68A 3LPEA 4CLKA 4C48A 2QG9B 1RA7A 2Y0BB 1VIXA 3DYAA 3CJKA 3A1YG 4C3LA 3PG9A 4DG1B 4ZVEA 4EK2A 3PIPQ 4JYAF 2DH9A 3B4MA 2OPQA 4I0WA 5AJ3F 2W01A 2LQ8A 4F26A 4V19J 3V4MA 5BR8J 1O6XA 1S76D 5HQ8A 4HYKA 1X5TA 1YBAA 3R5DA 2EBEA 2D3O1 4JI3J 2CRLA 1FFSB 2EFGA 1S10A 3EUNA 1NSPA 4ZPBA 2VG6A 2CQPA 2VHGA 1XN9A 4ZPWR 3BSNA 4EZ6A 3SBMA 1RE1B 2XMKA 1FXRA 2HNDB 2RQKA 2P5VA 1CULB 3GR1A 4Y2IA 5HN0A 5C42B 2XULA 3KLFA 5K8MA 1XWLA 2DHHA 2HLTA 2LLZA 2PD1A 3C66A 2XLJA 2BQUA 4B9TA 2HHVA 4XDDA 4JI0J 3PRBA 3OD2A 2G4BA 3JS9A 3K8VA 2VIHA 1EJ7L 2K1RA 2UUWA 1C1BB 2R2RA 2F8MA 3MFIA 2P9CA 1R27B 2ZC3A 3HMJG 1F5BA 1SL2A 1QDUB 4WFYA 3R97A 1DQ9A 2DXFA 2EG2A 4BHQA 2ATLA 1R0AB 1Q7YT 2KI2A 2MZSA 2W2MP 3MM6A 4LF9J 4TN2A 2OPSB 3AB4B 4K8RA 3VVUA 4B17A 2IJNA 2RU3A 2IVFB 2J0SD 1L3UA 1EP4A 3OPKA 4HR2A 1QAJA 3NS7B 1VISA 4Y2MA 5B0GA 4DV5F 5J2QB 1M5OC 2VL1A 1QTMA 4DN9A 3H40A 2VC0A 4RW8B 3HT3A 2HS0A 3OBIA 2MQMA 2XO6A 3SV3A 3DHXA 3FGVA 4KT0C 1VQMS 2EW9A 1T02A 1EZZB 3OTBA 1RADB 2B8QA 5FIIA 4DSEA 1GTEA 2RIJA 1VBZA 5KFVA 4FF1A 4KPCA 3IAS9 3L4BC 4JV0A 4IQXA 2QL7B 3MM9B 1HBNA 3DLKA 1TK0A 1HNWJ 4NXMJ 5L1IA 1T9TA 4DV5J 1SV5A 3IS9A 1Q1KA 2W9CA 2DHXA 2LFVA 4NXNJ 4WTOB 4QWEA 3OL9A 2ZE2A 1RGVA 2HZAA 3LPYA 3ULHA 4ENOA 2ZH9A 5CYQB 4ZVPB 2LEPA 1HKAA 2BE9B 4UOHA 2ZWPA 3CJ3A 4JI0F 7AT1B 2CWKA 3TAQA 4GKJJ 1RQ0A 2R4FA 2XWYA 5DG8A 2IPOB 3OQ2A 5KT6A 2C3MA 4ZLLA 2GIQA 1BHNA 1S1XA 4R5PA 1Q53A 1U1OA 4RW6A 4C8MA 4TXSA 1NHUA 1SPBP 2DK2A 5LM7E 4YMEA 3N5FA 3GQCA 1FWKA 1IM4A 2CPHA 2LA6A 3IBFB 3V6JA 1HHTP 2N7YA 1TKDA 3QT8A 1YJTA 1RTIA 1X4CA 3NMRA 2M8HA 4F4WA 1BUXA 1N4LA 2UVVA 1D9FA 4PAAA 2RHSB 3PYFA 3QAUA 2C2OB 3CF5Q 1KRPA 1UL3A 4M8LA 3M2UA 4M94A 5A6WA 3AD7C 2HQCA 3J7Z5 1XMQJ 1JKHB 3CO0P 4X2BA 3W2WA 5DDOC 1HQUA 3BBCA 2DO0A 4P74A 3FFIA 1YJVA 3VTIA 2KT3A 4KY3A 4WTYA 3TEHB 3TARA 1T9UA 4DOZA 4NMLA 3P3DA 2DH8A 2HSEB 2KKHA 2YKMA 1FRKA 3DLEA 3IR6B 3MR5A 4J90A 4RWXA 3SCJE 4GVLA 4IR9A 1VLOA 4ES2A 4X65J 2EFNA 2ZITA 5D77A 3FNNA 3M1VA 2VBZA 4OX9J 2HZVA 3R2DJ 4DCJB 5DM6Q 1HMVB 1RU2A 4KAIA 1UWAA 4YB7A 3JAMY 2NQPA 4JI8J 4JV5F 3FSIA 1REVA 3Q8QB 3HHEA 1ELOA 3WX8A 3IG1B 1KS2A 1WD6A 4DL4A 4ERDA 4LF4F 1NK9A 4DR4F 2FLOA 4TYAA 4JI4J 3PX6A 4DX8H 2BM0A 4QR1A 2AU0A 5LSOA 4YY3F 1LWFB 3CDWA 3CULA 4WXWA 1VC0A 2AMCB 2F5GA 2YKAA 3PX0A 4FP9A 1EARA 1UVLA 3WIUA 2MMYA 3K5OA 3PRVA 5G0RB 4DCPB 1VBYA 2O1PA 1TFYA 1MWYA 3SDEA 5C2CA 2VJUA 1S0NA 3D0IE 4URQU 3SFGA 4WP8A 3K8WA 4YHHF 1QJHA 1GX6A 3CJ5A 3C16B 4KGZB 2DR6A 2LKZA 4BS2A 2A10A 3GJQB 2HRUA 1SC4B 2DNKA 1GXUA 3IM9A 1IKVA 2XS5A 3HM9A 2ZH1A 3VQTA 1F5AA 3AOBA 3TA1A 4Q0BB 4ZJQA 1QY7A 1NJIT 4BDPA 1RBAA 4PABA 4ZITA 5HVGA 2ZHAA 3W2VB 1FA0A 4YDDB 4YOEA 3OVSA 2LMIA 5IT0A 2HVZA 4ZPAA 2AGQA 5HMZA 3TUZC 4DSKA 5E41A 1WHVA 4BWMA 4DDFA 3VAIA 3A8KA 3QMQA 4EMDA 4ZLJA 4C2MA 3J7ZT 3PKYA 2KM8B 4ANEA 3CMAS 3G9CA 2I9SA 4USIA 4CLPA 5CCMA 3P4UB 4GRSA 2WSFC 5KFYA 2AT1B 2CADA 2KXFA 2OELA 2WHOA 4I6YA 4P6QA 1QVFR 5KT7A 3TNVA 3LP0A 2IAJA 2VOPA 1NDCA 3D4JA 3HFKA 2W1BA 1FNMA 2VU5A 2CFXA 2CQ0A 5F8MA 1VFJA 2FGOA 2PN6A 4ZS6A 4PXBA 3CCQS 4DUYJ 2GV1A 3IBCB 1SKSA 3GSIA 1VI7A 3HVWA 3ZZYA 3RG6A 1QSYA 3UD4P 1DFDA 4RNMA 2FJXA 3S8SA 2VQEF 4ED8A 2Y1IA 2QIFA 3KKFA 1FE4A 1HWKA 3BZQA 3S1TA 3J80U 1SKUB 4HEA9 2FHJA 1QSSA 1P1TA 5A8KA 3A8IA 3K89A 4C97A 1RI7A 2GMHA 2ABYA 2QN6B 3E8OA 1PG5B 3HDSA 2VZ9A 5A8RA 1S49A 1C4AA 2U1AA 3CEDA 2ZM6J 4ELTA 4DS4A 2ZZNA 1FRHA 3LP0B 4RX6A 1D1UA 2G1DA 1U6FA 4KC5A 1IKVB 2DIUA 4DR6J 1J5EJ 1KONA 2R7OA 4U7CA 4JUZA 3OLAA 2QYCA 5KFGA 1HL6A 3CCZA 5KFUA 5B09A 5LJ3Y 3T5HA 3NGKA 1X4EA 1S0VA 1XNRJ 3KDNA 4Q8FA 3BGRA 2MPUA 4A46A 3THVA 2ZNZA 3CDAA 4OX6A 3FVYA 4YB1P 3GJTB 1VC5A 4F4ZA 4OHWA 1U1LA 1HD0A 3J81Y 3HXMA 1UEUA 1OO0B 1E6VA 4Q0BA 1P27B 3QGIA 3O3LA 2CPZA 2Z2LA 3R6LB 1AT1B 2W7OA 3IRWP 3D9BA 4O4GB 4C98A 1PO6A 2LDIA 1RZMA 2OTLS 5LL6d 4U7UD 1UP1A 1RYRA 2BJEA 4CH0S 1R43A 4AL5A 4WYWA 3C16A 5DDQC 1QTNB 1L3TA 3VAFA 1VGYA 4LF7F 3JTNA 1KVIA 2YY3A 3M30B 2YNFA 1OQ6A 2VQFF 2MKJA 3DLGB 1ACMB 1QVGR 3CCMS 1CJTA 2MY8A 3KLEB 2F8HA 3Q8PB 1LWEB 1CULA 2FHKA 2R8KA 1IN0A 3ET6B 3AHPA 1TUWA 1WOOA 2V2QA 3QRPA 5KFXA 2CNKB 3QGPA 1QE1B 4DSFA 2HS3A 1FRIA 3ITHA 4ZJOA 2J8AA 3BSAA 4U7UK 2IRUA 4BCAA 4C11A 2E44A 2KG0A 4LF8J 4I2QA 1A7GE 2Z4PA 3FCHA 1HNIA 1BD6A 2HS4A 2WAQD 4PEOA 3NAIA 1TUGB 4DL2A 2V63A 3OL6A 3VR1A 4K4WA 3RB4A 2ZZTA 2PMWA 4USUA 1NPRA 1ZM4A 2C42A 1U49A 1SQGA 1SI9A 3W5ZA 3W60A 2WVDA 3H98A 4DFJA 4FF2A 4WZMA 2MSSA 4DLEA 1NJZA 4NLTA 3ZZOA 2XS7A 2W7AA 4LQ9A 3BN4A 1CG2A 3AXMA 1NH8A 4Y3CA 4CYUA 2QJ3A 2P6TA 5L39A 2V2KA 1TL5A 3KLHB 3UCZP 2R2TA 1IBMF 3DRXA 5ETOA 4DJBA 1YVFA 3H59A 4WZQA 4DBQA 2X1AA 1Q81T 1N32F 2J0XA 3U1MA 3OTOF 2J5AA 5F8HA 1Y5NB 1TU0B 1CS4A 1SVDA 1GXTA 2CVIA 2WW8A 3KJQB 4P73A 3BQ0A 1A9NB 3TWZA 1GT8A 4HDGA 3BSOA 1X9WA 2W24A 3J81j 4TY8A 1EETA 2KFYA 1QSLA 3VQSA 1VOMA 4PUOA 1KNZA 5B0FA 3R9LA 1ZOTA 2ZH6A 1HNXF 4L3NA 1YG0A 4NZ6A 2AGOA 3J7AN 3H2VE 3H90A 2XMAA 3GWCA 4CLLA 4DFKA 2CQHA 1YJUA 3IBWA 2ZH7A 2NSCA 3UN5A 1MNEA 1Y3KA 3BS9A 3OFFA 3FZBA 4CLYA 4DPXA 2WCXA 4ZP6A 2E5JA 2E5LF 2QC3A 4TYBA 5D6GA 1W2BR 3PKMA 4LMZA 2B4VA 4F50A 1G4CA 3T6BA 4UOGA 2BM1A 1NSQA 2BJ8A 4ID5B 4F4AA 4QYZJ 1GAOA 4IDKB 4N8NA 4IUFA 2HHSA 2CJYB 1FDDA 1T05B 2IYIA 4A48A 1TKTA 4PQUB 4LF6J 1JMTA 3L09A 3FRYA 3T1YJ 2Z2YB 1GX5A 2FY1A 3GR0A 2OEMA 3CCRS 4CQ1A 5FDLA 2IM3A 4WF9Q 1S6OA 1ZA1B 3MPVA 2YNIA 2DTJA 2OUGA 4B3OB 3D3BJ 1HHSA 3DMJA 3DXBA 4QWBA 3A3OB 4FVCA 4QIFA 2GGPB 4OI1A 1S1TB 1EKRA 2E5LJ 1N33J 1VQLS 2HVIA 2HRTA 5AT1B 3EGZA 1CJTB 2Y8YA 2C3OA 4IO9Q 4C8OA 3MDFA 2VICA 2YNHB 4JI1F 5BYSA 3JSRA 2FC8A 1NKEA 3GPAA 1RLCL 2UUBJ 5LMNJ 1RHMB 4PG5A 2I6WA 4EYHB 3G8QA 2N7CA 1REGX 4DR2J 3G71S 1N0UA 2C2ZB 1MN9A 2I38A 1PC4A 3MI7X 5KG4A 3GYGA 5HROB 2E1RA 3D3CJ 2W25A 4ED7A 2ADBA 2IJRA 1R0CB 1VLYA 2DBBA 1HI8A 2M52A 3KLGB 4UY85 1SJFA 2LEBA 3NGDA 3RB6A 2UVRA 3PHEA 3PX4A 1Y4ZB 2VQFJ 1IR0A 2CPYA 2JEGA 1MMDA 1D9DA 4NCAA 1REVB 3T19A 3TQEA 1N5YB 2R7VA 3KG1A 2O3DA 4B3MJ 2BW7A 1IBMJ 2MKYA 2CZVC 4LF2A 2GFFA 3CCES 3P49B 3KLEA 1YZ7A 1H38A 3CCSS 3LW5C 5T7LA 1LW2A 1SIZA 1RTHB 2IVMA 5LMNF 3BDPA 2HBYB 1URRA 2AJFE 1WC4A 3GV5B 3GFYA 1NDLA 1N5SA 1FERA 2JC1A 2BV3A 3BBBA 1MW7A 2OP5A 4L75A 5IQ6A 4O0NA 5DDPC 9RUBA 2HWIA 3C3LA 3LGHA 4XK8C 1U47A 1F3FA 1I94F 2P8IA 4Q45A 4IG0A 3NEKA 4HACA 3G87A 2VKZG 4DHVA 1NDPA 3LGMA 3KJVA 4DL3A 3EVMA 3SI8A 4LFBF 3FQKA 4KB7A 4TY9A 4FXVA 1T05A 2BE2A 1KQSR 1HPZA 3Q2SC 4FN5A 3MCNA 4PQUA 5E3PA 2OSQA 2OPQB 2WOMA 2Z57B 5KFBA 1W2IA 2JRSA 3ELHA 5AE2A 1FESA 5JUMA 2B9EA 2C22A 4K4UA 2YWWA 2DNGA 2E5HA 1FKOB 2AP6A 3M6WA 1HLWA 5F0WA 3TJ9A 4CTAA 4YDXA 4NLWA 4R8UB 1EIYB 4OZ0A 2FLLA 2IM2A 1FI4A 3ZTQA 4H4OA 1S1TA 1FX4A 1ZBTA 4M5MA 3OSPA 4HT7A 3NLCA 2HKEA 3H8YA 3OLBA 4EYIB 3KLGA 3HP6A 5IT9Y 4DS5A 1JX4A 1B0TA 2A1BA 2GHWA 2ZNYA 4RW6B 4ANDA 4B02A 1UVNA 2UXCJ 3FSYA 2Z2MA 4W92B 4JI8F 4KGVB 3TO8A 4EUVA 4XIUA 2C2EA 1RWOB 3MEGA 4NWBA 2XEXA 1OS5A 1S77D 1R8HA 2AZ1A 3MM8B 2R3VA 1SV5B 2DEJA 1NO8A 2NLWA 1Z2ZA 2PE8A 4DV0F 4YEAA 1ZETA 1JNZB 3OR1A 1KFSA 1RWUA 3GG1A 1S6QB 3ENAA 2DNRA 4MJKA 5HMXA 5L46A 1TVRB 3CNQP 2ZWOA 4MT1A 2ZEJA 4M5DA 3TAMB 4AXIA 4AT1B 4C0BA 4E98A 4URGA 2UXDJ 2JLEA 2G9OA 4C3KA 3IWLA 3NNCA 2DNYA 2VASA 4HL9A 2AYGA 3IGNA 3WBZA 4F7VA 3NGRA 1SQEA 3B78A 4DZDA 2WTFA 5CXTA 5A0YA 4DLGA 1TZ0A 4EZ9A 2FUG9 8ATCB 1KBRA 2POKA 3HF5A 3MZIA 1WDTA 4MFBA 1U1MA 3T5LA 2YKNB 1LOUA 2B3TB 2K3IA 2CJAA 3FK4A 4HLBA 1HPZB 2FYXA 3VZHA 4DV0J 1I5OB 4ED5A 1U1NA 1WG4A 2ZE2B 4P2SA 4D3GA 2MQQA 2GJ2A 1JJCB 2D9PA 3C6UB 5T14A 3PW0A 3RR7A 2ZJPQ 2BUNA 3WZ0A 4X64F 3BQ2A 4DFMA 1BQMB 1UEVA 4A4JA 4DMZA 1TVRA 3MEDB 2FZGB 1S6PB 4OZLA 4M5GA 3Q24A 4Y2CA 2HHUA 2F40A 2PMZD 3PCOB 4LRAA 4QJVA 1VK8A 5CZVA 3VGVA 4DPOA 4F67A 1YJ9S 1U24A 4UZBA 1FKOA 4OYZA 2B7BB 1TL7B 1OQ3A 2EFPA 2N4CA 2ZD1B 3D54A 3KK2A 3MPDA 1E6YA 1N6QB 4ZA1A 1XBWA 4C8KA 1AFJA 3BN7A 3M9MB 4O3RA 1Y11A 2J8SA 4NLSA 4NA3A 5E3RA 3KJVB 1ZPVA 3KG4A 3AAWB 1GQEA 2COLA 3HSZA 4QW8A 2IDEA 3W7BA 1D09B 1U6ZA 3V4IA 1U8WA 3RB0A 2FJDB 2PI4A 4Y0FA 3KHLA 4C8NA 3BYPA 3G82A 2BKPA 2AX1A 1M0SA 3FFIB 2HVDA 4IFVA 4M63A 4ZVQB 4DQQA 1FD8A 1APSA 4B3RF 4QWCA 1KD1T 3Q83A 2NUUG 1UW4A 2E7WA 3JSBA 4NI2B 4Y2AA 2RHQB 5CA5A 1X4DA 1NK7A 2GX8A 5LXRA 5ETTA 3POTA 4N8OA 3JSMB 4QYZK 4P52A 4DEZA 3EE3A 4OI2A 2LU2A 3MURP 2KJVA 2CJKA 3SMZA 1KDNA 1HNIB 1ZS6A 1FK9A 2CWXA 3AFGA 3CDBA 2RKIB 3A3NB 2V4JB 4YR3A 4LFCJ 3W5XA 2ASYA 1CPZA 4DR6F 1FWPA 2B0GA 2PEHA 1E6VB 5IM0B 3G86A 5U47A 3CJ0A 4M1KA 3P96A 4PZVA 4QIWD 2QZ8A 1X8DA 2C2NA 5L8RC 3TZYA 3QZ7A 2ZFHA 3QT6A 2FVRA 2LXIA 3FC9A 4LIRA 3M8WA 3VV2B 2K7KA 3QGGA 2ZBRA 5J1EA 3D66A 1HHQA 3N5BA 3THTA 4RU2A 2XNQA 4H54A 2W9BB 3M8PB 1UZDA 4ETXA 2RDIA 2OPPA 4C0HA 5I3QA 4USKA 2H5IB 1Q95G 5T41A 2GC8A 4ED1A 2HG4A 2VFUA 3RRKA 1TKZB 1VDHA 3VGUA 3DOMA 3CD0A 1Q8IA 2A2CA 3GJRB 2R42A 3W62A 4X65F 2GAGC 4CM0A 3V4IB 3TANA 1SL0A 2HYIB 5CZXA 5A8RB 2QLBB 1EETB 4F4YA 1V3SA 2HQ3A 3MM8A 5BYRA 4RUAA 3L7PA 1T9YA 2MHNA 3HZEA 4P75A 5DQGA 3V6DB 5GAHI 3JYTA 1U45A 3NGSA 4OV6A 1X5PA 4NLPA 1YITS 3IRXB 4LF1A 3FRZA 4PG6A 3TA0A 4J9NA 1YRXA 3HPOA 1X9MA 2N82B 1B3TA 1RBOB 2FLPA 2UU9F 2UXBF 2OI2A 3PYEA 1D3WA 3EPGA 2H65B 1DARA 1S6PA 5KG5A 4M5KA 1S9FA 1I94J 4ETZA 2ZJRQ 2M88A 2Z30B 3LP2A 3U27A 4F3QA 1WJ9A 1RAIB 1PAUB 2WK4A 4KKOB 1H73A 4ILRA 3DRPB 2B5JA 2GO9A 2UVWA 1H3DA 3KJNB 5EX3A 5IV3A 1J5EF 5DQHA 4RW8A 3RUBL 1GMUA 4LJMA 1D8YA 3VHQA 1M5VC 1AYEA 3EICA 2ASDA 5CYMB 5GMEA 5DS7A 1K47A 2J0WA 3PJWA 3QFHA 4J9OA 5JXSA 4G1IA 3MFHA 4CH1A 2KH9A 1CQNA 2BW2A 2OEJA 1S48A 1R0BG 2P9EA 4EGLA 3MM9A 2GS8A 2IAJB 5ETSA 1U7LA 3I0RA 3O44A 5E2QA 2B9XA 4O3OA 4A8YA 1NKBA 1M5SA 4LUBA 1VQ8S 2XB2D 4EFAC 1TL1B 1HD1A 1MROA 1W25A 3M6XA 3O1LA 2BMBA 5HANA 2VB6A 2VA2A 1VYAA 2VPWB 4FYXB 3SEOA 4K59A 5J2NB 2W9BA 2DCUB 1U09A 4B3TF 1F60B 2HFSA 4IH5A 1ZAVA 2RMLA 2HHXA 4NL5A 1IKXA 3EM1A 2AX0A 2DY9A 1YWXA 5KFCA 5DLGA 4OX9F 3G96A 4PWDB 5KG0A 3W63A 4XPEA 2FVSA 3RRGA 3VZIA 1JIHA 3HVTB 2D1CA 1MMLA 3PACA 1V3RA 3GFHA 2B43A 2IRXA 5KFAA 1KQKA 3GLJA 3G8SA 2CPIA 3OTEA 4HI1A 1UPMB 3M6VA 2P2CB 3GIKA 2E29A 3V2UC 4FYDA 4MTPA 4CLFA 1YBTA 4O0IA 2QL5B 1FKAF 5HLFB 4DQSA 5KFIA 2R7XA 1WDDA 2YXLA 4EBCA 3FBBA 3I96A 2E9TA 2QFJA 4RL1A 5I42B 1Z2LA 4LSLA 4X4NA 3MAHA 2XQCA 3TQ1A 3KDOA 1YRUA 3W1YC 1NK0A 3H20A 1K0VA 1U2CA 1AROP 1XTZA 4PKDB 3IWXA 3KWMA 3MAAB 4J9VA 4CI0B 1L3SA 2C2DA 1Z4UA 1OMSA 4EO6A 1RT2A 4I7FB 1JLGA 3M8ZA 4MKVA 2JC0A 3PO5A 4A8SA 2C3YA 3MPWA 3S7RA 5C24B 2N3LA 4WPAA 3DGPA 1F3VA 3ET6A 2CKWA 1NBEB 2APOA 2MQLA 2MKHA 3FBCA 1YGYA 5GAEI 1EB0A 1RT1A 2XMJA 4N56A 2DIVA 2KT5A 2ZUAA 3K59A 4LF6F 1JXEA 3R5CA 5B0DA 1HA1A 2WBMA 2V2ZA 2CNNB 2LQ9A 4ER8A 4EU0A 1NHVA 2XSFA 4MMOA 2E66A 1ZTWA 4KH0B 4KYZA 5IFMA 2KDOA 1PIEA 2L9WA 4ZPTR 3F0NA 5GVQA 1X60A 3L7OA 3NWGA 1NAQA 3GJSB 2C2RA 2IMWP 1MROB 2ILYA 4KIAA 1CJVB 3CJ8A 3DU5A 2DGUA 3MPYA 4QYRA 4YP3A 5J2PA 4OI4A 1ZH5A 3BKFA 4KO0A 4PCQA 2BRKA 1Q5VA 4K5RA 4YR0A 5LXYA 3MUMP 3LANA 5CYMA 1F9EB 3BB5A 4U8YA 2B6AB 1S0MA 4CIOA 2XSJB 4V19X 3P5BP 3M2UB 3UD3P 5KT2A 1FJGJ 3MMAB 2FHJD 5DZ7A 3GIMA 2OPRB 4LVNP 4NRTA 1VRUB 4RW7B 5M2PA 4URSA 4ALZA 2V50A 2Q43A 1WC5A 2BANA 4ES3A 2D74B 3DC2A 3P45B 3M8RA 4JI5F 2KRBA 1F6TA 5A0YB 1X9SA 2MKSA 4MIBA 4DSJA 4F0MA 4D3HA 4KKOA 1FFWB 1JLEA 1UKUA 3NMAA 2ZKTA 1Y00A 1HBUB 2GVZB 2KM8C 2YWEA 4JI6J 4OI0A 4U9RA 1RHKB 2HK2A 4TU7A 3Q8YA 5B08A 3OJUA 4KJIA 4K0KF 2QA2A 2M8DB 2M9KA 3MD1A 4ZP9A 5HBMB 4NLVA 3KUGA 4RZRA 3AQPA 1JLAA 4YB5A 2MLXA 3I31A 3MMAA 4X4OA 2H1YA 1M5PC 2WB1D 2RRAA 3E3XA 4LRBA 1VHIA 1FTRA 1ZM2A 2C1EB 2DNOA 4OHZA 4MIWA 4QIEA 4CLWA 1GMWA 4DX5A 2KRRA 2V94A 5HL7Q 2VUGA 4WBFA 4ICLA 5SUHA 3AXKA 3IR7B 4DV7F 3Q86A 1H7XA 2QSWA 4JV1A 2UXCF 2GQ2A 2HNZB 2K1RB 2XWXA 3MMCA 3KLIA 5J1PA 1Q82T 2VONA 4PWWA 3LF0A 3PFEA 1JLFB 1IUJA 6FD1A 5KT3A 2FJBB 2V34A 3O2IA 3UDVA 4UW2A 3I4PA 4LFCF 2XSJA 4TU8A 1HFEL 3WHIA 3T6JA 1VQSA 4CLTA 1QUVA 2BE2B 3GYXB 3CC2S 1WORA 2G1HA 4TLQA 4DI6A 3G82B 4IFVB 5E3QA 2X1GA 3CGIA 5EWEA 3M9OB 2CPFA 1NRKA 2QLXA 3C14A 1WF1A 2O66A 4ITSA 1J2VA 4NOHA 1JWWA 4HHUA 5HVFA 2JOQA 1VQYA 2HGLA 1BWVA 3FMWA 3R3TA 4ZP8A 1U1QA 3I5BA 3IC1A 3L7UA 4USVA 2KN4A 3N01A 5F9NA 2XY5A 2PGCA 4DR3J 1VHFA 3CJ4A 1KWMA 2HFNA 3B8HA 4MAKA 5L9NA 3BV8A 2JLGA 4OJGA 2W2PP 2R9LA 3M2RB 2KVQE 3T5JA 2L08A 1RJJA 4K4XA 2LP4A 4GO7X 5D78A 1X4FA 2IJFA 4OL8A 1ICEB 3SQOP 1F9FA 6AT1B 2DVIA 4WCEQ 2BXJA 5K5MA 5D0HA 5KTQA 2OO4A 4ZIVA 3PV8A 1S1VA 4NE9C 4NPOA 4W4MA 6FDRA 1N8RT 5EUHA 4O3SA 3MMBB 3LALA 3MECB 4RUBA 2QA4G 3C6TB 3PW7A 5FLXU 1I1GA 4DUTA 3QPIA 1RYSA 1Y0HA 4JI2J 5E33A 1K1QA 3L95X 4WK1A 2P9GA 1EQ0A 3DLGA 4A47A 4F25A 1SJ4P 1D9AA 5CCLA 1UTAA 3BGUA 3BGRB 2RUGA 2JVOA 2JVRA 3GTYX 4RUHA 3OHBA 4K4TA 1B70B 1Y10A 1JLFA 1S59A 2CNOB 4KRWA 1DAXA 2RD5C 3BGFA 3CJRA 2IC3A 4KTQA 1GH8A 4USTA 5F41A 1ITPA 3JAMU 1WKLA 3PNIA 2XLKA 1XQIA 4ZKAA 1VRQC 2L9DA 2NUHA 2BACA 1LKZA 3OXGA 2FD2A 4L3KA 2BQRA 4BBYA 4FYYB 3MTJA 4GC7A 2F7VA 1YBUA 1UA1A 1SXLA 2AJ2A 5A8KB 3QT7A 4PG8A 2KJWA 3AD8C 4DR3F 4ZJLA 2HAFA 2LEAA 1VRUA 2SXLA 3D0GE 4DV1J 3KMSA 4ECWA 2KVIA 2JWNA 1PCAA 3H5SA 3QAEA 3CIZA 4R0JA 2EC2A 4LFAF 1PAEX 4WE1A 1F2GA 2DB1A 2I1RA 3PDNA 4ZVUB 5H9FJ 2CQ1A 3CC7S 1RTDB 2QX0A 1VBKA 2KYZA 3ZTRA 4FYVB 1H98A 2UUAJ 2HVEA 3KHRA 2MKKA 5ETPA 1UW9A 1NK4A 1RBLA 3E01A 4O3QA 4N77A 1R8BA 2KZZA 4MK7A 4DPYA 2W8LA 3MEGB 3P6YC 4J9UE 2WOMB 3CDUA 5DZ6A 3RGIA 4Q43A 1RWNB 3BGOP 4GVBA 2F8EX 1M90T 1TKXB 4PXCA 3PYDA 1IWAA 3DGVA 1MSWD 3QSYB 1WACA 2X51A 2V5HG 4A8QA 3EYZA 4J9MA 1OIAA 4NEYA 5E0OA 3KLHA 4USHA 5ETNA 1HIYA 1HBMA 2LQJA 3KK3A 2HQIA 1FK9B 1N32J 3ILIA 1LWEA 4CH7A 2KXHA 5KFZA 1VCTA 5FD1A 3MR7A 1IQZA 3ZZTA 4KHRA 4TY8B 4H4MB 2RS8A 3ZZRA 3V5RA 2QLJB 3CMQA 3U1NA 1AZSA 2R7UA 3SCKE 1FDBA 2VBWA 5J1EB 1VJQA 3CUNA 3DDIA 4OZ5A 5C42A 3V6KA 3G4SS 4ZPCA 3MECA 4N47A 4RPFA 2FTRA 2E5GA 3QRQA 4CO4A 4JI6F 1RHUB 3JTOA 3PW5A 4B9UA 3M32B 5FLXY 3O5TB 3D7SB 1OWXA 3IG1A 2CIMA 3MR3A 3MOJB 2ATCB 3OFHA 2ZVIA 3WIVA 2XY6A 1K73T 3K5MA 1O0PA 3CE8A 3UCGA 5HI7A 2B4PA 1EKSA 1FXLA 1TV6B 1H6KX 2YWKA 4PPDA 4OZ2A 3PJXA 4WU3A 5DG7A 1N6QA 4GKJF 5E3CA 3BGLA 1BWEA 1NM2A 4QOTA 3FEXB 3BBFA 5G0RA 2XYHB 3K2YA 4H4KC 4OQJA 4CT9A 4F02A 2XGQA 2MKIA 1JLBA 2WVBA 4NLOA 4NX9A 1VQOS 3DMJB 1RWWB 5F3TA 2DNPA 1C0TA 1R8CA 2AJ0A 2VF3A 3BSCA 2VH7A 3NCRA 1X0PA 3IR5B 3DLBA 3F41A 2RAQA 4QCLA 1OPZA 4HHHA 1XR7A 2DGXA 4Y00A 3UW1A 3PRDA 3Q2TC 1XR5A 4P72A 1RAGB 1VRTB 4YFUA 1RT4B 2XZWA 3X3UA 2DRDA 2CJXB 4L72B 3HHNB 2R7TA 3JSMA 3KJFB 2GJFA 4ECTA 4QZVB 4ELUA 2Y0SD 1F0XA 3A12A 2ZZMA 4RW4B 4H4MA 1FJCA 2BJ3A 3DI6A 4PYAA 3LGNA 5KG6A 3O8WA 2H3EB 3GV8B 1NPPA 2MSTA 4XTTA 3IO1A 3J7YU 5K9FA 3DCAA 2RQMA 3CCTA 4DPTA 1Q78A 1FRXA 1UWBB 2UV8A 2M7SA 3I9ZA 1T3OA 2EFOA 2YH1A 2R8IA 5A2QU 1IBKF 1RLDA 3D1HA 3KG0A 3QATA 2CG8A 2ZDOA 1KFDA 1S79A 3AA9A 3I82A 3K7RA 5ETQA 5C7PA 4I4BA 5D4LA 1OYEA 2ALYB 4DL0C 1LK7A 4ZLPA 4RNNA 1MWQA 2YKOA 3FCVA 2OMOA 1HNZF 2J0QD 1HBOB 2G2OA 3CIMA 2W4CA 3DRPA 1S99A 4FZVA 1ULRA 2ZVSA 4FKXA 4GMKA 4IG3B 4PR6A 1OY8A 1BMQB 1HWIA 3ZXWA 4LBHA 3AT1B 4OJHA 2MZ1A 2QEXS 3HJVA 4DSIA 2FVCA 1ZM3A 3J7YI 1XERA 2RDJA 2WW4A 4ZIWA 1DLOA 4PQAA 1LWCB 3IWNC 3I6PA 2DGQA 3V81A 2I0XA 3QSIA 3GIIA 1LNQA 4DV3J 3R5JB 5AXLA 2VPZB 2FJEB 3VAJA 4G1PA 4LFBJ 2LXUA 1EQMA 2V8PA 5LSLA 5CD4A 1VQ9S 2VG5B 4J5OA 5LOQA 2XLIA 1C1CA 3UCUP 2BR0A 2M5YA 4U67Q 1QAIA 4M95A 2B6AA 2IA6A 1RXOB 2DGWA 2PMHA 1RT4A 3FQLA 2Z56B 2XZTB 1O5JA 4A8KA 2NYIA 4PRFA 4PYDA 1OSDA 1V9OA 4ZHRA 4I2QB 4L73A 4EBDA 1WTBA 4DUYF 4ATNA 1NH7A 4UZCA 5HMWA 4OZ3A 4Y34A 4RNOA 2DNNA 2IMOA 2E9RX 2D69A 3M05A 2OLWA 2R2UA 1I6JA 3NP5A 3V6HA 3UNYA 4JV2A 2HBQB 3EGVA 2CJQA 1KR4A 2O01C 2CPXA 2NXNA 4HH1A 4K2XA 3PY8A 2J7WA 2X1BA 2GVDB 1WG5A 1WKKA 2DD8S 1RAOA 2RQCA 2DNHA 4OHYA 2HNDA 4QIGA 2R8GA 1AXQA 2PO4A 4G1QA 5HLFA 1UFWA 2UXBJ 2V4QA 3C6TA 4KGXB 2KG1A 1B0PA 3D6TB 1X0FA 4E0DA 2R7QA 2HHQA 4DN0A 4USWA 4QW9A 4DR2F 1KOHA 3HVTA 4Q8EA 2OAUA 4DV3F 1U0SA 1X4BA 3NNAA 2B56A 3HZGA 3DI6B 3BKUA 1KQFB 2H4YB 2B9YA 1E6YB 3RU0A 2X3GA 3ZTSA 2XMMA 4DG1A 3IP0A 2ZDPA 4CO5A 4ZCMA 3HLUA 2FHOB 4ECZA 2UP1A 4JI1J 5L1JA 4ZP7A 2GA7A 1U25A 2HBZB 2HQFA 4NI2A 1RWPB 1T95A 4AL7A 3T1YF 5H9EJ 5HJYA 4FF3A 1FKPB 4HHJA 2KB2A 2MZTA 1LXJA 1NSAA 1IKYB 1OSCA 5IT9U 2MZQA 4F2RA 4YHHJ 4IRKA 2HZCA 3QQCD 5BXIA 4LR9A 4M5LA 2CQ4A 3R5AA 2BZ2A 4RNFA 1SJ3P 1K8AT 2V4JA 4EWTA 3HVRA 3BYRA 3N79A 3OTDA 2WSCC 1TKTB 4FXWA 5K14B 3TZXA 5D0EA 2NPFA 5KFLA 5IOLA 1TL7A 2A0FB 2ZBCA 3BF4A 4N7TA 4EI2A 2BKNA 1N52B 4MKAA 2GMLA 3A4TA 2MTLA 1T8EA 2W9CB 2OIHA 1N48A 1KLMA 2FLNA 5SZTA 1HWLA 2UU9J 4C8ZA 2G0JA 1KVJA 3MEDA 4ZVSB 1VMBA 3HT0A 3TP2A 3H2UB 1CLFA 1Q7LB 5CAAA 8AT1B 5GAEU 1T7PA 1FX2A 3MCSA 2B8PA 4LSNA 5D4OA 2ALZA 4DR5J 1L5UA 4X66F 3QIDA 4WFZA 2IBOA 4WKRA 3CO9A 4J37A 5HATA 3GIJA 2YWHA 1RAEB 3RBEA 1TR0A 2OJ3A 1UVIA 4K50A 1T9VA 5HQLA 2QMWA 1HI1A 1VS3A 3FCWA 3JQJA 3JQMA 1IBLF 2AYBA 2CAJA 5BYQA 1PJ6A 3OL7A 4OI3A 4UUXA 4ES1A 3TAPA 5J2PB 2DJWA 3RJMB 4X64J 4CT8A 2IFXA 1U4BA 1OJ4A 2ZM6F 4KPYA 3AJDA 4BLGA 5A8WA 3M8SA 5KFPA 4X4PA 1U2RA 2BJ7A 1U1RA 4NLRA 2WONA 2BYCA 2JEIA 3C15B 4LSZB 1CJUB 1RKJA 3FBEA 2YBVA 3M8PA 5HSPA 4K4VA 1XMOF 2XC9A 1IVZA 4RW7A 3DFEA 2PA3A 4I6AA 4RW9B 3LAKA 4OFZA 4AQYF 2PFFB 2XMVA 5H1SV 3K5NA 5KT4A 1UZHA 2W4PA 1LW0A 4I6WA 4YUDA 1CQMA 3RBXA 4ZVRB 3UFCX 5IC4B 4UQGA 2AJ1A 4A8MP 1JLQB 3K0JA 4IG0B 1HQEB 1WEXA 2CPJA 5IM0A 3C8YA 3CMES 4F3OA 3CCVS 3DOLB 5D3GA 1NZAA 4DR1F 3W8GA 4O44B 5CYJA 4U96A 4KSEB 4QU6A 3RZAA 1QAXA 2BJ9A 3DOKA 1SH3A 1WC0A 2V8DA 2JX2A 2DR7A 4B9LA 4OMFG 3PIOQ 1KHVA 2QRRA 3N6LA 2YQ3A 2F63A 3M30A 3CCWA 3MEEA 5IT4A 1D0EA 1GNKA 3GONA 1DURA 1C0UB 3EWGA 4DPWA 3EZ5A 3EPIA 3QBCA 2OHDA 2CA9A 4LFAJ 1LXNA 3W9HA 1KEKA 1F5CA 2JZ5A 5H9EK 4UUWA 5EDWA 4J9PA 3ENWA 4K4ZA 1S97A 1BY9A 4LF9F 1FT8A 4FNIA 1RT5B 1WUUA 3KMQA 5D0RA 3UPFA 4C11B 3D6HB 1N36J 1J5OA 3I0SB 3GFZA 1FD2A 5HP1A 4LF5F 1TTHB 1TUVA 1VQPS 1S7HA 3B4DA 4DV2F 4DSLA 2E9ZA 3MAQA 1R6VA 2AJQA 1HYSA 4OYPA 3AQOA 3M1VB 3D1QA 3SDEB 3C2PA 4IQMA 4LRFA 2OMLA 1FWLA 1H0HB 2YNFB 1CBKA 3AOCA 4MYUA 3OUYA 2RJZA 4ZLNA 4KQZA 3W64A 3Q8SB 3Q22A 3QGHA 4C9DA 4KHPJ 2P6SA 1FRLA 1SB6A 2GIFA 4B08A 4DV7J 2VFSA 5HMYA 1RHQB 3RAXA 1T9XA 1RAFB 4JI2F 4KHPF 2EWHA 2LQ5A 3NS6A 1RACB 4FKYA 3CXCR 3QWUA 1JKHA 4I2PB 1RT7A 1IXKA 2YWGA 4PPZA 3G6XA 4ECSA 5EX0A 4IH7A 2JFKA 1NJWA 4DR7J 3CDEA 2EBGA 1HMVA 1V3ZA 1AW0A 4NLUA 2HHHJ 4RUCA 2CQCA 1TP7A 2RE1A 2GGPA 1HR0F 5F8JA 2RRBA 2XGPA 3V81B 3TI0A 3PEJA 3GCXP 1DY3A 2D41A 2Z2ZA 2CDRB 4DQPA 2MGZA 1RHRB 4A8OA 2DNQA 3OR1B 4DL5A 1O51A 3GG0A 2H4WB 3MM7A 4NLXA 5KG2A 1UFLA 4KR0B 4DUZJ 1A0OB 3QJJA 4CM2A 4J9QA 5ETMA 3QRRA 2DHSA 5A76A 4JI7J 1C0UA 4ZCKA 3KYLA 1LWXA 1UJ5A 2Q6CA 5I3UA 5THWA 3HHLB 4ECVA 2OEKA 4PWDA 5H9FK 2X7IA 4OHVA 1CS4B 2M0GB 5CABA 1NB7A 3LP1A 4OLOA 1UPPA 2CUYA 5B7WA 5EWGA 3N0VA 4DR7F 4MKYA 2BEFA 5I3PA 2K8GA 1LWCA 3A8JA 3ISNC 4CLZA 3OHAA 3K57A 4EBEA 2K7JA 5L9XA 3Q8UA 4DXLA 3DLKB 5CHCB 2NR0A 2M2BA 4HTIA 4DX7A 2HK3A 4IFYB 2GIRA 3VAKA 3R1HA 4R0EA 3PR5B 3KLVA 5DDRC 1TL3A 2GJIA 3UVJB 2HQGA 3NBPA 3G8TA 3KHHA 2H51B 4ELVA 1LEOA 4B3SJ 2KHCA 4FF4A 2BA9A 3MM5A 1S12A 3JXOA 3IA0A 4USMA 5AXNA 1X7VA 3KK1A 2BQ3A 2HFUA 1R31A 1NXIA 2HMIB 1HNWF 3G6YA 3DOMB 1HR0J 1L3VA 3R27A 4OZJA 1HBUA 2GVZA 3NGUA 2BABA 2MJUA 4A8XA 3VCDA 4LVOP 3N6MA 4LIWA 4FBUA 3GMGA 3UR0A 3I9V9 1JLBB 5KAKA 1TFWA 4RJVA 1IBKJ 3W8PA 3B82A 4CTAB 4GC6A 1RA6A 1WSRA 3BO3A 2BKOA 5IXUA 2G2ZA 3G6ES 2HVHA 3HFZB 5IWAF 1JXLA 4F4KA 1X4HA 2PC6A 3GP9A 3SQGA 2RRNA 3TW0A 2J6TA 1MU2B 1RTJA 3CWJA 1T03B 4F2SA 5I3UB 2GHPA 3R7SB 4JI5J 1S9EB 2CQGA 5KFTA 3RBDA 2DR5A 2MDAA 1F9HA 1Q8BA 2HW3A 2IYGA 3MD3A 1YX2A 3BPSP 3MM7B 3U1LA 2A6OA 3O6QA 4OYMA 4QR0A 5A6PA 2F4VF 3RAMA 2VG7B 5KFSA 3DHWC 2JDJA 4AYBD 1DTQB 4QWDA 3OW2R 1CVJA 2HFOA 4N41A 1FO1A 2QA1A 2MYFA 2FZKB 3W9JA 1X5SA 4ZPVR 5GAGI 2D3ZA 2MKCA 4ZDNA 3BDEA 3THPA 3BR9A 1RAAB 3GSDA 3ZO7A 1DHMA 2YTCA 5T7LB 2IY5B 3TOQA 5KFQA 5E7OB 1FNXH 1YJ7A 1RTIB 3T3FA 3AJ2A 1IKWB 3QO9B 4J9KA 1LK5A 2F3JA 3TX8A 2FZCB 1B99A 1LQ9A 2UUTA 3VGTA 1UJ4A 2BOAA 5GMKa 4OX8A 3BEGB 4J9SA 4DR4J 1S1XB 2FC9A 3W2WB 4IYQA 3RBZA 2YQ0A 5AE3A 2XNRA 3MR6A 2YPYA 2CVEA 3CC4S 3D6FB 2GMJA 1OYDA 4ZVGA 3GU0A 3DU6A 1MLAA 5KFEA 1YJWS 2NYHA 5F0UA 1Y9OA 1KOOA 3U7JA 7FDRA 4OIXA 4L74A 2MZRA 3ZZUA 4ED2A 2XY7A 1RAJA 2F65A 4X62J 3H4DA 1NMEB 3CCJS 1X4AA 2HNYA 2ASJA 1K1SA 5F3ZA 4AUKA 1TL1A 2Z8QA 3AJ1A 4NZ7A 2VBXA 1JLCB 2F4VJ 1TMMA 1R8PA 1X5OA 4DV6J 3HULA 4F0KA 2OD6A 4KV8B 4MKBA 3R5GA 1JQGA 4IG3A 1N5QA 4QQBA 4KE5A 4X4TA 3GV7B 5ETKA 3DDKA 3FSXA 1SC1B 1GK8A 2HWTA 3H5UA 3N4WA 2QT7A 2LDYA 5LT5A 5J2MA 2E5IA 4IDKA 3BM7A 3UDLA 3AA8A 3H4BA 3MMJA 5IWAJ 4KFBB 2N3OA 5DGAA 4B9MA 4DWIA 2DRAA 2Q66A 2X3DA 3DNCA 3KLIB 1CJKB 3SYZA 3KOAA 2KZMA 1MG7A 2WONB 2E1MC 1GXLA 2A6MA 2HIYA 1DRZA 5KFHA 5DGBA 4Q44A 3JB9k 4GKKF 2WB4A 1BQMA 1S9GA 1FDNA 4M5DB 5GAGU 2B7CB 2GNKA 4KHMA 3TZWA 1RTDA 2VODA 2IRYA 2GAHC 4ZHRB 5B0CA 2JEJA 4B9NA 3OVBA 2W2NP 1LW0B 3C19A 3VAHA 1WC1A 1XC9A 2FIUA 2PEBA 2L48A 4RBTA 3OFEA 2BRLA 1WELA 3J81U 2YKNA 2Z0GA 1V6HA 2AEMA 1XR6A 3LQVA 4IKAA 5J2MB 2W2QP 1RTZA 4HDHA 4AE5A 4UOCA 1U0HB 3TUIC 3NOGA 1P8GA 2EG1A 4BWJA 3HO1A 3DGPB 4KO0B 4E2FB 3R8YA 2UVUA 5C24A 3ISND 2G13A 3PFOA 4NLQA 4WFAQ 3A3PB 2HNYB 1UAWA 3FDSA 4OI6A 1ROFA 1FKPA 4WP3A 3KFWX 5JJBA 5LJ5Y 1IM6A 3VVTA 1HQ2A 1N56A 4USJC 4AXJA 1VQ5S 2Y8WA 1HNZJ 1RT3A 4ZVOB 3Q0AA 2DH7A 1S1WA 1KTVA 1SH2A 1UVKA 1B64A 1FTCA 4CLSA 3TZZA 2V0NA 2AD9A 1NU4A 4ZOSA 3EGWB 1XMBA 5D0GA 1NCLA 3W2VA 3FBFA 3KUHA 3ZTOA 1NK8A 3I0SA 1RABB 2IA0A 1DTQA 3PHTA 3LO3A 2Y1JA 3RB3A 1U1KA 3GE9A 3HHLC 2AF6A 3ILOA 4ED0A 2QSFA 3A8EA 3MF5A 2W7PA 4B9SA 4IRDA 1Z1ZA 2RKIA 3MTKA 3MAAA 3D1OA 3BJYA 1SL1A 2J6SA 4UQTA 4F04B 3AB2B 1MWZA 3OUYB 3ZNJ1 2I2YA 4IH6A 3NL0A 9ATCB 5ADZA 1JXVA 1LW2B 4UY8T 3OVAA 2YNHA 3MCOA 1RT3B 3UD5A 3PW2A 2VV5A 5C25B 3I55S 2HBRB 4AQYJ 2U2FA 1AA1B 2ZHOA 4I2PA 3UN3A 2GHVC 4FNHA 4LREA 2RSQA 2FDNA 2YKMB 3GYNA 1HWUA 4X4VA 3NGTA 2C28A 3DDNA 2BBEA 1WEYA 4JBCA 4O4GA 5B0EA 3ONQA 4BC7A 4Z7CA 4TQRA 3TX0A 5D4NA 3T9ZA 1VQKS 3WC0A 4NYZA 1U8SA
chains in the Genus database with same CATH topology
2KHDA 3WX4A 3LUYA 1WI6A 2CQ2A 5AXKA 3K58A 1S72S 4ED3A 1RTHA 3BQ1A 4R25A 4XO0A 1HYSB 5AXMA 4IOAQ 5KFOA 4X4SA 4IR1A 4HTJA 2B5JB 3SCIE 4TKTA 1TL3B 1P9QC 3DXSX 4ICLB 1M1KT 1N36F 2ZKUA 3QLHB 2ZH5A 4LQ3A 1HBMB 3BR8A 3LOUA 3M32A 1NNDA 2DR8A 2YH0A 1VQ6S 3CD7A 5IQQA 3TYTA 2FJAB 3MOZA 1FHTA 1TKXA 3DRYA 1XNQF 4K5SA 1HI0P 2HMIA 2M3DA 2YNGA 4QU7A 4G3IA 2K3KA 3V6DA 4J9RA 2NSBA 5HBMA 3IN5A 3ZZZA 2BR0A 2PA8D 1VIOA 2DNMA 5KG1A 3TVYA 4FPRA 3CJ2A 1S9GB 2VA3A 2NZ4A 2FJWA 3M2VA 3QYYA 4KGKA 1UWBA 3T1HF 2EK6A 2PDAA 5DLFA 4G6VB 1S6QA 1R89A 4CO0A 3DM2B 1FEHA 4Z2XA 4IRCA 4R8UA 1KLNA 1TQLA 3D28A 4MK9A 4Y28C 4PG4A 5DO2A 2AW0A 1RISA 2DGTA 3IGVA 4ZCLA 4C7QA 1QUPA 2ROGA 2YNGB 2ROPA 1JB0C 4ZK7M 2J9CA 3HHLA 5IS2A 2UUCF 3OXLA 1N88A 1BWEA 2BJDA 2J76E 2GW8A 3MMBA 4TLRA 4ZVHA 5GADU 4DL6A 1DLOB 2ZOFA 1TL4A 3N28A 5A8WB 3K5PA 3MM6B 1P6TA 4XDCA 3QLHA 3GILA 2RB7A 2XI2A 1WWHA 3E51A 3ZC4A 2JFDA 3PW4A 4O3PA 5EWFA 2XG8A 2M70A 1CC8A 5B0BA 4PXEA 2FVPA 2AYEA 1RT7B 1FJEB 1RKIA 4WJBA 3CTRA 1VRTA 3HK2A 2E7XA 2ZOMA 1M5HA 3QIPA 1B0VA 1AFIA 3NCPA 5DG9A 3VAMA 1VQ4S 3I5AA 2QA4S 2UUAF 2B9WA 4HVZA 3S01A 1DTTB 2XO7A 1RT2B 4N76A 1QLNA 2RQ4A 2LCWA 3S6EA 4C8YA 2CG4A 4F8RA 2VFRA 2R7WA 1FNOA 1KSPA 4NYPA 3MEEB 3ZZ0A 3OXFA 2R8JA 3TVKA 4B3SF 4CNYA 4ED6A 1U1PA 1URNA 4WK3A 2RS2A 4NLYA 1NK5A 4NCAA 5L1KA 1HNVB 3KMQA 4ZPDA 5I42A 4C4WA 1WG1A 4RBUA 3SFUA 3KHGA 4K4SA 1PILA 1RDRA 4C8LA 2IVYA 2YKQA 3HJFA 1Q8LA 4CNZA 2UXDF 2QE5A 4OZ1A 2LVWA 2KT2A 2UZAA 2AWZA 4I7FA 2VC1A 4NCGB 4WIIA 1FF2A 1YI2S 4JI3F 4MH8A 3GZ7A 3VAGA 1U26A 2OKQA 2HWHA 4E8UA 2J7KA 3FJ2A 1Y5IB 1HW8A 4A8WA 1IQTA 2NREA 1CEZA 4OX7A 1PC5A 4JI7F 1DJ0A 1T94A 1SJRA 2MJNA 2R7RA 4RWWA 3KK3B 1WHWA 1KHWA 2JLFA 3PXGa 1N0VC 3OR2B 3P5TL 2EFVA 5L38A 4P7VA 2M4MA 2LECA 2DT9A 2CJ9A 3RAQA 3H5XA 1JLEB 2DR9A 1RT5A 3HHKA 1U6BA 3ZZPA 4CZCA 5KG3A 3D0HE 1TAQA 3ENVA 5HROA 4OV1A 2VPXB 1MMNA 4O3NA 5K8PA 1SJQA 2XMUA 1JLAB 2RF2A 4I64A 4Q5VA 2V4RA 1BQNA 2HNZA 1ZZNA 1HBNB 1WF2A 2QV6A 2UUBF 2EI5A 4ECRA 3TAMA 5I4MA 4QPTA 2PT0A 5K8NA 3I0RB 4DQIA 3TR5A 3LP2B 2D7SA 3MUVP 4AL6A 4WKYA 2A3JA 2B51A 3OTCA 2V9KA 2DGOA 2MB0B 2V8HA 2HHHF 2QO3A 3MEKA 2KYXA 4RKUC 1ZAWA 2DPIA 2DITA 3NAHA 5KFKA 3WC2A 2L3MA 5KOXA 2A2DA 3PR4A 1N5VA 2O67A 2V9WA 2AYMA 3MR2A 4NCGA 5BR8F 1FVSA 1SJ1A 1RP5A 4KBIA 4YQWA 3OR2A 3R5BA 1KN6A 1HARA 2FVQA 2ROEA 4IOBA 1T3NA 5CQGA 1Q4RA 1H2UX 3UE2A 4WYLA 5J1NA 2HGNA 2BVZA 4CO3A 1HBOA 2HPUA 1RT6A 1C4CA 1VJWA 1ZAXA 4RW4A 3MWBA 4WFXA 4BC9A 2FJVA 1DQAA 3LWLA 2AQ4A 2G0CA 2RNEA 5MLCV 4FS1A 4B3MF 1WHXA 1RT1B 1VBXA 1CC7A 1K9MT 3J7A1 5KOWA 1JLGB 4WU2A 4ZCIA 5GADI 3T5KA 2VG6B 2J9DE 5C25A 2J9EA 4Z37A 2JSXA 1UA0A 3POTB 3TUJC 3QJLA 1XNRF 3I4HX 3NNHA 2ACYA 5FJ4A 1BQXA 3FZ2A 4ECXA 2XMWA 3DRRB 5F8GA 1U2FA 2K2PA 4LSLB 4Q2MA 2AV5A 3SCLE 5KFRA 1GTHA 3Q8RB 1IJFB 3CT9A 3CD6S 2GO8A 3ENQA 1VQNS 4ILLA 1BGXT 2Q79A 4ECUA 2ZBIA 4O44A 2IM0A 2XBPA 5A2QY 4U6PA 1J5OB 3PVXA 5DJBA 3FEYB 2YX7A 5LMUF 1DBDA 2O5DA 4IO1A 2MQPA 3CPWR 1NK6A 2ILZA 4OJ1A 4QWAA 4NXNF 1BC6A 3SSQA 2WBRA 2VBYA 1G7CB 3UWTA 1JJ2R 4QPXA 5JVGQ 2R7SA 2DRBA 4NLDA 2OD4A 1PSDA 4EEYA 1FE0A 4ID8A 4OJ3A 1JJHA 1ZPWX 1OPIA 4I69A 5F9LA 3E01B 5KFJA 1R8AA 3K5LA 2LXFA 2XI3A 1Q86T 2A18A 2NS1B 4NXMF 3IAM9 2V8GA 2DISA 3D5MA 2WSEC 2VFTA 4DV1F 2DPJA 5FDLB 2KTQA 3LAMA 1JLQA 2ZC4A 3RYLA 4DV4F 2HAIA 2RF2B 3ICLA 4MYTA 1R3NA 1Y3JA 2JH3A 4NCBA 2VFVA 2XCAA 2DCLA 2VG5A 5CH7B 3MMCB 5F8NA 3H5YA 3DM2A 3QJPA 2CJBA 1IJEB 3IS9B 3N9UC 1SUQA 1TKZA 2OTJS 2MQNA 3CSKA 3F73A 4CO2A 1N5TA 4CCHA 4HKQA 2RILA 3NCQA 2OPPB 2OH2A 1UJ6A 4NA2A 2RVJA 1C1BA 4ZMMA 3HI9A 2ZH2A 2FGCA 2CQIA 5IZHA 3SXLA 3JYTB 4F4ZA 1LFPA 3US5A 2DNLA 3LP1B 3T1AA 1UVJA 2VPYB 2OFHX 4YR2A 3NBPB 4QIVA 3R1LA 1ZTTA 4DFPA 1NJXA 3RR8A 3E2EA 2HIQA 2RH3A 3H2LA 2ASLA 2DGSA 1H2VZ 1DZ5A 2MGZB 3KTQA 4IFYA 4LF8F 1QE1A 1Q16B 1RK8A 2BDPA 1SC6A 1JLCA 4MIAA 3T9NA 1TAUA 4AFFA 1UVMA 1WTFA 2CQDA 2C3PA 1SBRA 2YKPA 5KT5A 4WXOA 4FVMA 3VWSA 3SV4A 4FBTA 2BANB 3NRBA 5DQIA 2B4OA 3EGNA 1KQGB 1Q79A 2QMXA 5GAHU 3QWPA 1FDAA 3CCLS 1Q81T 3NG8A 3QZ8A 3UI3A 4NZ0A 3RTVA 5EHHA 2UV8G 2R2SA 1YQHA 2DHAA 1Y7PA 2CPDA 4OLPA 3GB0A 3RRHA 1DTTA 2MXYA 2E1AA 5M2UA 2KFZA 1ZZFA 3M4XA 4PG7A 3CCUS 3CVKA 2PIIA 3TVZA 3FMBA 4O23A 1S1UA 2GQCA 2J7UA 5F8IA 1HNVA 1XMQF 3DRRA 4H4KA 2H9ZA 4C0OC 5K8OA 1MU2A 1RTJB 2CPEA 1S1WB 1IKXB 3UR3C 2ZJQQ 2E1CA 4W90B 1TV6A 2XHWA 2OSRA 2QLWA 1FVQA 3I32A 3AH6A 3I87A 4TQSA 4DV6F 1X4GA 3DYAB 4MK8A 2IBKA 2Y1RI 5KFWA 4F3MA 1XEZA 1ZYQA 4ILMA 1UETA 1QM9A 1R6YA 5B0AA 1S1VB 4PXDA 5EN1A 4Y6IA 1U48A 1S4FA 4RBVA 3C6UA 2KXNB 4HH0A 5JVHQ 2W9AA 2YX4A 5C5JA 3HHLD 2W4DA 2I8EA 4X84A 3MM5B 3SQGB 1B7FA 2J6UA 2YX1A 2VD3A 3AY0A 3F56A 3LWMA 3DLHA 2FHMA 1R7IA 2MQOA 2FB0A 4Y65A 1N5YA 2LYVA 2D9OA 3DLEB 4LT6A 4K4YA 5HP1B 3EX7B 4DF8A 3SZ2A 2VG7A 3NS5A 2YNIB 4IOCQ 4A8FA 2XS2A 5MAOA 3JSYA 1N33F 3F44A 4G1QB 3IXQA 3UQSA 5F8LA 3OSNA 1H7WA 4DQRA 1T03A 2F9DA 2C3UA 4O4RA 2Q3PA 1WI8A 3EZUA 4I56A 3PEHA 4F4XA 2DGVA 4GO5X 2EFQA 1BLUA 2KO1A 4J9LA 3VALA 4NA1A 1ZM9A 3EXCX 2RT3A 4QR2A 2HFZA 2JHEA 4Q7AA 2XCPA 5CD4H 2ERRA 4I68A 2LQBA 4C3MA 3IRXA 4XAKA 2Q6BA 2ZOGA 3W3SA 2AJ4A 1NJYA 3M6UA 4KFBA 2VOOA 2OPRA 1WHYA 2CYYA 2WRMA 1O8BA 1WEZA 5KFNA 1WNEA 4HT5A 3OJSA 3Q23A 1PGZA 2OFGX 1N34F 1TK8A 2F9JA 4NYOA 2EPIA 4JI4F 1IKWA 3QO9A 3D2WA 3BREA 3NKYA 2W8KA 3I5CA 2D3OR 3KNGA 3CB4A 1YJNS 2ZUGA 4I1TA 4ZVFA 2Q1LA 1FJGF 5LSRA 1YHQS 2CDQA 2GCFA 2LA4A 2MY7A 3HKWA 4CO1A 5BJRA 2DNZA 1WF0A 1YJRA 1YRTA 4LSNB 5EGYA 5D8HB 3U02A 3J80Y 2J9DA 2B4UA 4XPCA 1LWFA 3M8QA 2XMTA 4EO8A 1N54B 2H5EA 3PIPQ 2R9LA 3SYZA 1S6UA 2FPHX 4H4OB 1IKYA 3ETOA 3QIPB 2RU9A 4B9VA 1HQUB 4N5SA 1KLMB 3BO4A 1DQ8A 2BOPA 2MHEA 3M2RA 3TRGA 2F1FA 2N4DA 2I5JB 5L1LA 4WFNQ 2KFNA 1RT6B 1K0TA 1YSJA 2JL9A 3WDOA 3JTPA 1H2TZ 3ISZA 3GFXA 3CJKB 1YIJS 1SKWA 3ZFVA 5DM7Q 4X62F 2HHTA 1QAYA 5KFFA 2X1FA 4FXDA 1A6LA 2IM1A 4DF4A 1C0TB 2ZHBA 3M8QB 5G4DA 3MXHP 1C2PA 2EKYA 2NXUA 3KK1B 4OZNA 3CD5A 1S9EA 1G1XA 5E3AA 3SSRA 5DRKA 2DO4A 1TK5A 1P1LA 4HI2A 3VF0B 2I5JA 1LFWA 1NEEA 1FCAA 2ZD1A 4MFBB 3KK2B 4DR5F 3PO4A 1Y5LB 5E5NA 4Q2LA 2HRYA 1G6BA 4RLEA 5KG7A 2PI5A 5ITHA 2LU1A 3UNGC 3DRSA 3MUTP 4JOUA 4B3OA 3PZPA 1AUDA 4P7TA 5AE1A 2D3UA 1BQNB 3MGJA 4PWUA 3N6NA 4TNOA 5D4PA 4NRUA 2YVSA 4PUOB 4X4QA 4WFBQ 2YWFA 1S0OA 1JJ4A 1C1CB 1JNRB 1KTQA 4RW9A 4ID5A 4L6V3 3UDCA 4TU9A 2EVZA 5KFDA 3KNAA 1G2EA 5M2RA 1HW9A 1SIWB 2CZ4A 3EXYA 2VKRA 4FS2A 5DETA 4KGMA 2L41A 2GQQA 1VQ7S 2CQ3A 1FJ7A 3DOLA 3HHDA 3IFEA 5HO4A 2R8HA 3BO2A 1HQEA 3G6VA 3HX9A 1FRMA 3M2VB 2IC3B 2MZJA 4QBUA 3FEZA 2NPIA 3OFGA 4NLGA 4ECYA 1SH0A 3KLFB 1EP4B 1FEEA 5CYQA 3RW6A 2JJ4D 2PSZA 5J2QA 2HGMA 2IHR1 1D8ZA 2KU7A 4RU9A 2L9NA 4ECQA 4F2SA 4KV8A 7FD1A 3LH2S 1NKCA 3TA2A 2JEFA 1SUQB 4YB6A 1VC6A 3X1LB 1FXDA 3DRSB 1R0AA 4DUZF 1G3OA 4WE1B 1XK8A 1L3KA 2HHPA 2V8VA 4OHXA 3C46A 4Y2KA 1HWJA 1CSJA 1SKRA 2EK1A 3MHYA 1KC8T 4RNHA 4I67A 2ZH4A 3OL8A 1UMJA 3SSSA 3DN9A 3RW7A 2HLUA 3I56S 4F3OA 2XB2D 1S1UB 1VK3A 5K14A 2ZH3A 1LV5A 3H25A 3HKZD 3ITHB 1FRJA 3DLJA 3HVAA 2OPSA 2DHGA 4X4RA 3PM9A 2ADCA 3L3CA 2AGPA 4DL7A 1JK9B 2CQBA 4X4UA 1RA7A 3DYAA 1VIXA 3CJKA 4DG1B 3A1YG 4C3LA 4ZVEA 4JYAF 2DH9A 3B4MA 2OPQA 4I0WA 5AJ3F 4V19J 4F26A 3V4MA 1S76D 5HQ8A 4HYKA 1X5TA 1YBAA 3R5DA 2EBEA 2CRLA 2EFGA 1S10A 3EUNA 4ZPBA 2VG6A 2CQPA 1XN9A 4ZPWR 3BSNA 4EZ6A 2XMKA 1FXRA 2HNDB 2RQKA 2P5VA 3GR1A 4Y2IA 5HN0A 5C42B 2XULA 3KLFA 5K8MA 1XWLA 2HLTA 2XLJA 2LLZA 2PD1A 3C66A 2BQUA 4B9TA 2HHVA 4XDDA 3PRBA 2G4BA 3K8VA 2K1RA 2UUWA 1C1BB 2R2RA 2F8MA 3MFIA 2P9CA 1R27B 2ZC3A 3HMJG 1F5BA 1SL2A 4WFYA 1DQ9A 2EG2A 2ATLA 4BHQA 1R0AB 1Q7YT 2KI2A 2MZSA 3MM6A 4TN2A 2OPSB 3AB4B 4B17A 2IJNA 2RU3A 2IVFB 2J0SD 1L3UA 1EP4A 3OPKA 1QAJA 4Y2MA 5B0GA 4DV5F 5J2QB 1M5OC 2VL1A 1QTMA 4DN9A 3H40A 2VC0A 4RW8B 3HT3A 2HS0A 3OBIA 2MQMA 3SV3A 3DHXA 3FGVA 4KT0C 1VQMS 2EW9A 1T02A 3OTBA 4DSEA 5FIIA 1GTEA 2RIJA 5KFVA 4FF1A 3IAS9 4JV0A 4IQXA 3MM9B 1HBNA 3DLKA 1TK0A 5L1IA 1SV5A 3IS9A 1Q1KA 2W9CA 2DHXA 3OL9A 4QWEA 2ZE2A 1RGVA 3LPYA 3ULHA 2ZH9A 5CYQB 3BJYA 2LEPA 4JI0F 3TAQA 3CJ3A 1RQ0A 2R4FA 2XWYA 5DG8A 3OQ2A 5KT6A 2C3MA 2GIQA 1S1XA 4R5PA 1Q53A 1U1OA 4RW6A 4C8MA 4TXSA 1NHUA 2DK2A 4YMEA 3N5FA 3GQCA 1IM4A 2CPHA 2LA6A 1HHTP 3V6JA 2N7YA 1TKDA 1YJTA 1RTIA 1X4CA 3NMRA 2M8HA 4F4WA 1N4LA 2UVVA 1D9FA 3QAUA 3CF5Q 1KRPA 1UL3A 4M8LA 3M2UA 4M94A 5A6WA 3J7Z5 4X2BA 1JKHB 3W2WA 5DDOC 1HQUA 2DO0A 3FFIA 1YJVA 3VTIA 2KT3A 4WTYA 3TARA 4DOZA 4NMLA 3P3DA 2DH8A 2KKHA 2YKMA 1FRKA 3DLEA 3IR6B 3MR5A 4RWXA 3SCJE 4IR9A 4ES2A 2EFNA 2ZITA 5D77A 3FNNA 3M1VA 2VBZA 5DM6Q 1HMVB 4KAIA 4YB7A 3JAMY 2NQPA 4JV5F 3FSIA 1REVA 3Q8QB 3HHEA 1ELOA 3IG1B 1KS2A 1WD6A 4DL4A 4ERDA 4LF4F 1NK9A 4DR4F 2FLOA 4TYAA 3PX6A 4DX8H 2BM0A 4QR1A 2AU0A 5LSOA 4YY3F 1LWFB 3CDWA 4WXWA 1VC0A 2YKAA 3PX0A 4FP9A 1UVLA 2MMYA 3K5OA 5G0RB 1VBYA 2O1PA 1TFYA 1MWYA 3SDEA 1S0NA 3D0IE 4URQU 3SFGA