3WX4A

Crystal structure of t4 phage arn protein
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
98
structure length
98
Chain Sequence
MIIDSQSVVQYTFKIDILEKLYKFLPNLYHSIVNELVEELHLENNDFLIGTYKDLSKAGYFYVIPAPGKNIDDVLKTIMIYVHDYEIEDYFELEHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anti-restriction endonuclease
publication title The T4 phage DNA mimic protein Arn inhibits the DNA binding activity of the bacterial histone-like protein H-NS
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Viral protein
total genus 28
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2014-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2770 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3wx4A00
3WX4A
chains in the Genus database with same CATH superfamily
5CZVA 5KFOA 4LFBJ 4DG1B 2F4VJ 1QE1B 2R7VA 2MKIA 1ZS6A 3H8YA 4K50A 3I55S 1Q8KA 1RHMB 2ROPA 4GMKA 2AGQA 3RAMA 2V34A 1PYTA 1SKSA 4TU8A 2MLYA 1MLAA 4QR0A 1CVJA 1ZM4A 1S77D 1S0MA 1HNZJ 2OGUA 3PIOQ 1IM6A 5KFTA 3RU0A 3KHRA 4K4TA 2F65A 1N5SA 1SJ4P 4Q7AA 2UUBJ 2W01A 1IJEB 4LJMA 2JL9A 2D69A 1OS5A 2R8HA 2WSEC 1GMWD 1DQ8A 2ZC3A 3C6TB 2DPIA 2YY3A 1UPMB 4TU7A 1QSLA 1RWPB 1RGVA 2CNKB 2CA9A 4KO0B 2GZOA 3RBEA 1PJ6A 1S0VA 4G1IA 2J7KA 4I2PB 1SB6A 4KHRA 2NS1B 3MHYA 4NXNJ 2XLKA 1B7FA 5D77A 1B0PA 2E1AA 3KXDA 4HI1A 4XK8C 1R0AB 1GEHA 3O3LA 4C0OC 5HMZA 2XMAA 3HX9A 1YZ7A 3BR9A 4OX9J 4C3LA 3R2DJ 4NX9A 1KC8T 1AUDA 1RBLA 4TQRA 2NPIA 2K7KA 5F9NA 1RDRA 2VONA 3A8KA 1KEKA 2R2TA 3TUIC 3VAHA 4IYQA 4ED0A 3UD4P 3BH6B 4GC6A 4B3OA 2W9CA 4MK9A 2H54B 4GVLA 2G4BA 3M8QA 4TYBA 4DV6J 2R42A 4YOEA 1QJHA 3G6XA 3T6BA 2YKOA 1IBKJ 2IJFA 1EQMA 1ZAWA 3EJMA 4DL5A 3UR0A 3PW7A 2F4FA 2WVDA 5A6PA 2JC0A 5GMDA 3HP6A 4C11A 2CPFA 5IT9U 1Y10A 3L9ZA 5HMWA 2KFZA 4KJIA 4YY3F 3TJAA 5HN0A 4JI0F 2J76E 2PSZA 1TZ0A 3RZAA 3LWMA 4OZ3A 2JLGA 3BQ2A 2KTQA 4PKDB 4IKAA 1BQXA 2ZDPA 1WC0A 2FTRA 3PW2A 1FK9A 5L46A 4RW6A 2NLWA 1Z4UA 1DQ9A 2ILYA 2YWEA 4IH5A 2CQ3A 5ETOA 1UJ6A 5F3TA 4OI6A 3G2XA 4ICLA 3M2UA 2G0CA 1AXQA 3W9IA 3PFOA 4QIGA 4UOCA 1RA7A 2ZBIA 4I2QA 1NHVA 3K5PA 2MKHA 1RZMA 1RWMB 3THVA 2ROGA 5LSOA 4QCLA 1B0TA 3H5YA 5L8RC 3R27A 3QIPA 4WZQA 5F8IA 2QGFB 4XO0A 4ZJOA 2OKQA 4ED2A 2D3UA 3KJFB 2UUAJ 1P9QC 4DL0C 4DPUA 4B3OB 4BLGA 2ZOFA 2W9CB 4F4WA 3IS9A 2KM8B 3TAMA 1OYEA 5L1LA 3M8QB 5AJ3J 1N34J 1FJCA 3QSYB 2I5JA 2ZUAA 2HNYA 2AF6A 1SQGA 1FDAA 1VQ4S 3MOJB 2XZTB 3HVAA 4RU2A 3H7HB 4IH7A 2HZCA 3M6UA 2MSSA 2VQFF 3N5BA 2VOPA 2B8PA 3FRZA 2AW0A 1HW8A 2BRKA 3IC1A 2UVUA 4C11B 3R9LA 5ETTA 2G2YA 3QSIA 3KJVA 3DOKA 1PO6A 4Q44A 4BBYA 1J5EJ 5D4PA 4DQQA 2RRBA 4L6V3 4USTA 4W92B 1E6YA 4YDDB 4TYAA 4WJBA 3TZYA 2R2SA 4DV0F 1KTQA 2F8EX 2VA2A 2VHGA 2V50A 3CJKB 1FK9B 4RW6B 4EK2A 3SCJE 4MKBA 5KFSA 3EXCX 1N5QA 2DPJA 4A8MP 5DQHA 4NLQA 4EI2A 4ICLB 2R4FA 3M2UB 4C7QA 4DV7F 1JJCB 4J9KA 1D9FA 2K06A 2ZVIA 4I2QB 2LLZA 2C2MB 3Q8PB 3HSJA 3UN2A 3BO2A 2NXCA 4NRTA 4DV1F 3BREA 2OHDA 2XGPA 4ECVA 4DHVA 2FY1A 3CJRA 3QIPB 2CZ4A 2CPYA 3ITHA 3D54A 2CJAA 5HSPA 2ZBCA 3G96A 1H2VZ 5KFZA 3QJJA 1YJUA 3BGUA 1N33J 3N01A 5D0HA 5J1EA 1U24A 3IS9B 1JX4A 3TAMB 1ZAVA 3MPWA 3QIDA 2I5JB 1NHKL 2HNYB 2KJVA 2GQ2A 2EWHA 4DJBA 3GJRB 4OX8A 4DS4A 4I6WA 2HZVA 3KDNA 3RAXA 4FXVA 3MR6A 2IVMA 2ZVSA 4AE5A 1RUSA 3MI7X 3ZC4A 1G2EA 2J8SA 3SI8A 2QIFA 2Q6BA 1N32F 3U1MA 4ECQA 2MKKA 3PIPQ 2DGSA 3DOKB 1SVDA 1NPRA 3KWMA 4ZCIA 2DHHA 2VG7A 1E6YB 4CM2A 1PCAA 2OD6A 2P5VA 5KFJA 5KFAA 2JFDA 5DM7Q 4DV2J 3BV8A 4B08A 3I82A 4IOAQ 1RSCA 2J9DE 5MLCV 2K2PA 4NEZA 1VQSA 4B3SJ 3GCWP 4R5PA 5LL6d 4RUHA 1YBUA 1RAAB 4W90B 2E66A 5GAGI 4RW9A 1HBOA 4AFFA 2HURA 2PGCA 3HHDA 4O23A 4ZJQA 2ZH3A 2B51A 4X62J 1FJEB 1M90T 3M1VA 2R7XA 3GV8B 4CP5A 1ACMB 1FNMA 2WVCA 5F8MA 5LSRA 2CQPA 3IAM9 4ENOA 3ITHB 2LXIA 3MEDB 3A13A 4GKJF 1S9FA 3PEHA 2MZJA 2ZC4A 3MWBA 2KFYA 3MDFA 1PYSB 5J1EB 1UVMA 1F3FA 2B8QA 4G6VB 2GX8A 1Z2LA 4FPIA 2CPEA 3UD5A 4PUOA 2LXFA 1TMMA 2JSXA 1JMTA 3C2PA 3GFYA 1TK8A 2XSFA 3TJ8A 2OPRA 3MM8A 1E6VA 1B99A 4Y2AA 2HRYA 3CCQS 4JV5F 2FDNA 2DCLA 2C3UA 3T3FA 3GJTB 1RWOB 1GXLA 4RBTA 5GAHI 1NPKA 3QATA 2VG7B 4F4AA 2VBXA 2HFSA 2VA3A 1HWLA 1YKWA 2OJ3A 2AD9A 4HKQA 1SQFA 1TVRA 2VFRA 3GSDA 2RS2A 1X8DA 2MJUA 4MAKA 3TWZA 2LCWA 3MFIA 5DG9A 1U8WA 3CJ4A 4AYBD 3CD5A 3WHIA 4FP9A 3T6JA 4UTGA 3M6WA 5HATA 3DLBA 2GHPA 2GO9A 4CH1A 3Q24A 1X31C 4R5PB 5FLXU 3TVYA 2PC6A 3V81A 2DXDA 3BN7A 5H9FK 1S49A 4RW9B 1F9EB 4NLYA 1HBOB 2HPUA 5HJXA 2BYCA 1S9GA 4RW8A 3M1VB 4MFBA 3GV7B 2V63A 1FVSA 3Q89A 4TN2A 3M4XA 3PEJA 3L3CA 1B64A 2E5HA 1F5AA 4QYRA 4WTYA 5BYSA 1FWLA 4QZVB 3BSOA 4DU8A 3K5OA 1LW2A 4USJC 3FRYA 4C9DA 2U2FA 1DTQA 4F26A 2W2PP 4PUOB 1RACB 5D6GA 5EX3A 3ZZPA 1S9EA 1K47A 4CLPA 2UXBJ 2KU7A 2OPRB 1QAJA 3MM8B 1HHQA 2WW4A 1C4AA 1E6VB 3DRYA 1YJNS 3VAFA 2DGXA 3KG4A 4OI2A 3NS5A 3R7BB 5F0UA 5HQMA 3TARA 3EX7B 1GH8A 1SKUB 1U2CA 4P72A 2HNDA 1F5BA 3D1OA 5KFMA 1TFYA 1RCXB 3QGIA 1LKZA 4ED8A 1U0HA 2XHWA 2DNHA 2XMUA 2QA1A 4JI8J 2YKAA 4GRSA 1LWXA 2AYBA 3O2IA 3IP0A 2HHSA 3A3OB 1W7WA 2UXDJ 4F36A 4LFBF 3K57A 3KK3A 1TVRB 2E9ZA 4ALZA 4A8SA 3DHXA 3QZ7A 2AZ3A 2A2DA 3NS7B 1KR4A 2FQQB 4CLTA 2QTWA 3HHLC 3BQ0A 4WFZA 4YQWA 5HP1A 3TX8A 3EM1A 3H59A 4Y2CA 4OZ5A 4IR1A 4EBEA 4UZCA 2CZVC 5EX0A 1TKTA 2BOPA 1S59A 2W2NP 3V81B 3MMAA 5LMNJ 4WXOA 1NK0A 3P5TL 4Y34A 2A6OA 1NDCA 3VF0B 4OHZA 2WW8A 1S9GB 4RW8B 2FHJA 4DUYJ 2QLBB 1KTVA 2FJBB 4MFBB 1S6QB 2AJ2A 5B0CA 5D0EA 1EB0A 4CLZA 5D0RA 1PAUB 1JJ4A 5LJ3Y 4KRWA 1T11A 1WOOA 5K8OA 5KG4A 3CNQP 4J9OA 1LW2B 2C2OB 2P9EA 3SYZA 3H20A 3SBMA 4Q8FA 2AX0A 2R9LA 1DTQB 4C98A 1S9EB 4USKA 3GZ7A 4AQYJ 2CDQA 4LSLA 3DKDA 3PDNA 2JHEA 4QOTA 3D6TB 1XNRJ 1TQLA 1YWXA 1YSJA 4OX9F 1X0PA 4BC7A 4NYOA 3OLAA 3T5JA 4LRAA 2JEIA 1HR0F 4KFBA 1IR2A 4F4XA 1D09B 3LOUA 2DK2A 3W60A 1Q4RA 1VK3A 4P10A 1U0HB 3QT8A 4PZVA 3LW5C 4YB7A 2GO8A 4M95A 2MEWA 3RW6A 5KG6A 1ZYQA 4YB6A 3KK3B 4EMDA 2Y1RI 4O3RA 2XG8A 4DSLA 2IYIA 2HHHJ 1URNA 1G4CA 1IBKF 4M5MA 3KHLA 5DDRC 2KB2A 3DLHA 1H2UX 1XNQJ 4N47A 1D9AA 3K5LA 1LK5A 1TV6A 2MQMA 4ZLLA 1TKTB 3R3TA 4KGVB 3MMAB 3U27A 4HT7A 2QG9B 2C28A 4C8OA 1AFIA 2DRBA 3B8HA 3BS9A 5K14A 5CYJA 4PYDA 1MWZA 4ED3A 2VQEJ 3VQTA 1N54B 4JI2J 2BV3A 2C42A 1J5OA 2XB2D 1QM9A 1U49A 2Q3PA 1FXDA 3T5KA 2PA8D 5HROA 3Q8SB 1VQYA 3PYFA 4CLWA 2G13A 3PV8A 2HVZA 2HW3A 3H4BA 1WHYA 4O3NA 1XIQA 3NCPA 1PGZA 4A8QA 2QLJB 1BQMA 4LSLB 1HD1A 3CE8A 2CQBA 1WC4A 3BGFA 4OYAA 4Y65A 1U1OA 1U1KA 2IA0A 1VQ7S 1T8EA 3FSXA 4KFBB 2WBRA 3W62A 5E3QA 2Y8WA 4OZNA 1RLDA 3HD1A 1GT8A 2EBEA 4MH8A 4LFCJ 3FFIA 4RW4A 1JLBA 1IM4A 1GFWB 1VQ9S 3FQLA 4A8FA 5CAAA 4CO2A 3DRSB 2ZNYA 3IA0A 1M5OC 1R8CA 1Q7LB 1NJYA 4QWDA 4P2XA 2IM2A 4ES3A 1UJ5A 4IOBA 5AJ3F 5A8WA 4B9MA 2DB1A 2XWYA 3DFEA 4CO0A 2ZH9A 3G82A 2DY9A 4EEYA 5F41A 1MWQA 2B9WA 3RBXA 5K9FA 1R8HA 4DX8H 5C2CA 2COLA 5HAOA 3OPKA 4JI7J 1RWXB 1TV6B 4DCJB 4C8KA 1U0SA 2KH9A 4CH7A 1WORA 3LTOA 1UW9A 4OYZA 3QAUA 1KQKA 4LF7J 4OHVA 3HF5A 1WI6A 4O3SA 1J5EF 2WRMA 2QL9B 3EVMA 1XR5A 1ZM2A 5K14B 3DRRA 4WWSA 1UJ4A 1QAXA 4HL9A 5KFIA 3VTIA 3WQPA 2CNLB 1J5OB 2MXYA 1RTDA 5HROB 1S72S 2WB1D 3CCJS 3W2WA 2BQRA 1KVJA 4OYIA 1IUJA 2E5LJ 2ZBQA 4PEOA 1BQMB 4CQ1A 1R6VA 1WTFA 3PM9A 3LANA 3R5DA 1DTTA 1D8YA 5KT2A 3MAQA 2XYHB 4USWA 4QBUA 4HYKA 3I4PA 1FEEA 4O3OA 2GQCA 4ECZA 4NEYA 4PQUA 3FFIB 4RW4B 1JLBB 2FLLA 4WE1A 2DGOA 2LEBA 3M8WA 1U1MA 2BDPA 1L3SA 1N33F 1WTBA 1ZAXA 1WJ9A 4N56A 1QSSA 3LPEA 2DHXA 2YQ3A 5A8WB 2ASYA 2VDHA 1KFDA 5D0GA 3TQEA 4DLGA 4A8WA 2C2KB 3G82B 1NDLA 4IQXA 1VC6A 3FDSA 4PCQA 2RT3A 2GCFA 5JVGQ 2ATLA 4GKKJ 3AD7C 4MIWA 3NOCA 1YZ6A 1U47A 4DFJA 4OX7A 2YH0A 4NLRA 4DN9A 2HZAA 1KQSR 2KT2A 4Z2XA 1WI8A 3PW5A 4I0WA 5C24A 1UVIA 2IFXA 1KONA 2XEXA 4KGMA 3M2VA 2V4RA 1B3TA 1LXJA 5IWAJ 1FWPA 3DRRB 3G9CA 1IBMF 3MFHA 2DR5A 1FRXA 2LECA 3US5A 3K8WA 5H9FJ 3ILJA 1RTDB 2ZKUA 4V19J 2HIQA 3W2WB 2MSTA 2JLEA 1HW9A 5I3UA 2NSCA 3ELHA 1X4EA 3UDCA 3J7A1 1HIYA 1TP7A 1SQEA 1X4FA 1OO0B 1FRMA 4OHWA 4U9RA 5IM0A 4L72B 3DM2A 2VF3A 4JI3J 1DTTB 2DH7A 3QT5A 2QMUB 3FGVA 2VODA 3TVZA 3RB6A 1NKCA 1BHNA 2HHVA 1YG0A 1M5KC 2B5JA 2W25A 1WKKA 2LA6A 3GIKA 2MLZA 2ZH8A 2HFOA 4PQUB 4WE1B 3PRBA 2ZJQQ 2JH3A 5KFVA 1Y5NB 2CRLA 2GC8A 4EZ6A 4ZVFA 3DGPA 2P8IA 2C2ZB 3FBFA 2Z2ZA 3PXGa 2C3MA 2M2BA 4URQU 1JK9B 1SH3A 4CT8A 1RAGB 2EBGA 4RL1A 4YHHJ 1VHIA 4KHMA 4IOCQ 3HKWA 2PA3A 5DM6Q 1JLQA 3JSRA 3WIVA 2MKYA 3T9ZA 1HQ2A 1RAHB 3RUBL 1WC5A 5L38A 2EFOA 3OV7A 1KOHA 4DV3F 1R3NA 1EX8A 1WKLA 2VBYA 4CNZA 2J0WA 4PPDA 3DLKA 2RDDA 3QGHA 5C24B 4BS2A 3RB0A 4N41A 4MMOA 4RNHA 3J7YI 2IJRA 4NYPA 3ETMA 4CDIA 3M2VB 1DBDA 3KDOA 1T9YA 2R7TA 2RUSA 5DO2A 4DF4A 2MQLA 1NJXA 1TELA 5J2PA 2W2MP 1VQ5S 1YRUA 1C1BA 1WG1A 4PWWA 1HMVB 4LR7A 2MKSA 2OPSA 3P4UB 2GA7A 4B02A 1YK9A 1S4EA 4JI5J 4IO9Q 2JC1A 3HDSA 3PVXA 5I3UB 5K8NA 3PJXA 2DR9A 1HBUA 2IVFB 1H74A 4Y0FA 1VIXA 2Y1JA 1UPPA 2ZM6J 5IM0B 1RXOB 3DM2B 2L9DA 4WU3A 3ETOA 4IFVA 5A2QU 7AT1B 1YTYA 2KFNA 5J2QA 3FC9A 2B5JB 4NCAA 1U6FA 2IA6A 1A0OB 1I6JA 5JXSA 4UZBA 3FSYA 2BANA 2BKPA 4BHQA 3DGPB 4J5OA 3CO0P 2WTFA 3OL8A 5LMUF 5M2UA 1YI2S 5BJRA 3HPOA 1UWAA 2A0FB 3C3LA 4EU0A 2HLTA 2V0NA 5KOXA 1JLQB 4FVCA 3D2WA 2UXBF 4O0IA 3ENAA 2YKQA 2EC0A 2JDJA 2P9GA 2YNFA 4NLSA 1OY8A 3K59A 2BJ7A 2M7SA 4RO0A 1NK9A 3DLKB 1NKEA 1ITPA 3C15B 3ZTRA 4UQTA 4AXIA 2CQDA 5C7PA 2FHMA 2OMLA 2AEFA 3W65A 3V4IA 1VLOA 3Q8QB 5J2PB 2PIIA 2UXDF 3NEKA 2M8HA 2RHQB 1C1BB 4C48A 4LBPA 4BWJA 2UP1A 2H5EA 4QIWD 2OPSB 4MKYA 3IRWP 1RYSA 4HACA 3AD9C 2HFUA 3H98A 3M30A 4A8XA 3UO0A 4C0BA 4PPZA 1RB0A 2F5GA 4P73A 1U1QA 3G6ES 3QWPA 3FSIA 1HBUB 2E5GA 4ZK7M 1WEXA 4L3NA 4HR2A 2I1RA 4M5JA 4X64J 4XPCA 3DCAA 1UVJA 3P3DA 4YR0A 5C5JA 2E7WA 4JYAJ 4M5GA 4IFVB 2I6WA 2MQNA 4ZN3A 1FT8A 1S7HA 4DUYF 5J2QB 1U8SA 3BO3A 1S97A 2ZWPA 4C6AA 3SFUA 5ETSA 3THTA 2GJFA 1FFWB 3IGVA 1IXKA 3TVKA 2BANB 1RAOA 4M63A 3H42A 3MPYA 5FDLA 3NMRA 5HBMB 1ZZFA 4N8OA 4PQAA 3K17A 1GMVA 1Q1KA 3H5SA 4TY8A 5IC4B 4AQYF 4DPOA 1KHWA 3AJ1A 4LIRA 2A18A 2DTJA 4RX6A 1XNRF 3TZWA 4PXDA 1S12A 2NCKL 4PG8A 1D9DA 3FEXB 1G1XA 2Z2MA 3E01B 4LVNP 4DPTA 2HLUA 2IDLA 3V4IB 2D3O1 4B9NA 2FHOB 2V6AA 1A9NB 2AJ4A 2PFDA 2AQ4A 2ZWOA 2G2OA 2CKWA 4FPRA 2HHTA 4F3OA 1SCJB 2ZH4A 1WG5A 2DGVA 3M30B 2KHDA 1XNQF 4M8LA 1N0UA 1RTIA 4K4SA 2HSEB 4MT1A 3K8VA 3UNYA 1HARA 1NEEA 1REGX 1FJGF 3TA2A 1P27B 2YWFA 4C8LA 4CO1A 3R7SB 3W61A 2CQ2A 5HQLA 1SIWB 3QMQA 3AQPA 1VQ8S 5BR8J 9RUBA 2E1MC 4V19X 4DU7A 1F3VA 2QV6A 3D6HB 4ED6A 4B9VA 2KT3A 5GVQA 3CB4A 4F25A 3GFXA 5FDLB 2H51B 4P74A 2XCPA 1Y4ZB 2V9KA 1V3ZA 2LYVA 4TY8B 2W8KA 2EK6A 1DURA 1K1SA 4P2MA 3QRRA 1QUVA 3PYGA 2BKNA 2BM1A 3HHLA 3EUNA 3NG8A 4N77A 4RLEA 2G0IA 4NA1A 3J7AN 2HAFA 3M9OB 1SL1A 1EHWA 2DHGA 4USMA 2N82B 1RKIA 4CRJA 3EMTA 4ELTA 2DNGA 1WF1A 3MMCA 2KKHA 4ZPBA 5KFNA 1NDKA 4L76A 4OZ0A 4AL7A 4KHPJ 1Q81T 1UZHA 2K1RA 5AE2A 1SL0A 2HVHA 3FCWA 3DU6A 3Q83A 2GMHA 4KV8A 1C0UA 5JJBA 3TA1A 3JXOA 3RTVA 3S01A 3CMQA 2KYZA 2NXJA 5D78A 4C8YA 3FEYB 1UMJA 3IWXA 4DF8A 3DOLA 1DY3A 3ZO7A 3KMQA 2C2NA 3HJFA 1RTIB 5I3PA 4ZP8A 2C2DA 4UUWA 3TUPA 2UUWA 1NNDA 2DGTA 2LKZA 3OFEA 3S1TA 5A2QY 3ZZ0A 3IRXA 1GXUA 3I9ZA 4LF7F 5HVHA 3FK4A 2KVIA 3TX0A 5KFCA 2XNRA 1RAIB 5FJ4A 1T9TA 2EK1A 4JB8B 4LF2A 4X4VA 1KRPA 1LEOA 2LEAA 1V9OA 1IQZA 1FWKA 1BE4A 4PXBA 5T41A 1CQMA 4CH0S 2ALZA 2CWKA 1LWEA 5KFRA 1QUPA 2VU5A 4RUBA 1FE0A 4U6PA 4J9UE 1RT5A 1TL7A 3VGSA 2ZNZA 4LRFA 4ZIWA 3CO9A 1NK4A 3HHLB 1IQTA 3J80U 2QRRA 2G0JA 1HPZA 2QO3A 4CM0A 3AJDA 3N79A 2XS7A 2QA2A 2JJ4D 3NGDA 4DR4J 4DL2A 3MMCB 2BM0A 2F63A 1Q82T 2IY5B 1Y11A 4ZVEA 4WKRA 4LQ9A 2BQUA 2K1RB 3GB0A 3C16A 4MK8A 2VJUA 4B3MF 1CSJA 4KV8B 1CBKA 1C0UB 1JXEA 1LWFA 2DNZA 4J37A 4H4KA 1Z1ZA 2B43A 2MY8A 3B78A 3OQ2A 5D4NA 2VPYB 1P1LA 4ETXA 3NGKA 2DR7A 3M6XA 3GYNA 1NJIT 3H2LA 4K8RA 4GKKF 3M9NB 3R1HA 2CQHA 1N5TA 4KGZB 4CIOA 1WG4A 5CHCB 1W26A 1P6TA 2RH3A 2DY1A 2M88A 2MLXA 5D8HB 3IRXB 3CMES 3KLVA 3MPUB 3VGUA 3MTJA 4OMFG 5IWAF 1VQOS 5GMKa 2BRLA 4PAAA 4IRCA 2LQ8A 3SSQA 3M05A 1NB2A 3T19A 3V2UC 2D1CA 2FGCA 5DDOC 4OJ3A 1FERA 2DEJA 1RHRB 3OSNA 3V6DA 1WUUA 3PX0A 4FYDA 3AH6A 1LWEB 2AKWB 2GNKA 2XI3A 4ZP6A 1RT5B 1TL7B 1TU0B 4DV4F 1NB7A 3DYAA 3UDVA 4DX7A 4OLPA 3WC0A 4JI3F 4TKTA 3BB5A 1MROA 3K5NA 1HPZB 3JTOA 1OSCA 1FKAF 4OZLA 1VCTA 2E7XA 3MM7A 4KPCA 4USIA 1QDUB 3AHPA 3K7RA 1VC5A 3UCZP 1KHVA 3M8ZA 3H0PA 1U2FA 3PACA 1XWLA 2DNRA 5AXNA 4KE5A 2FJAB 3TQ1A 3C16B 3D0GE 2CQCA 3CJQA 1BD6A 1LWFB 2KXNB 2M5YA 2CQ4A 2N4DA 2HK3A 4YHHF 2YWWA 4KH0B 5M2PA 2B0GA 3ZZYA 3IWNC 4NLPA 5G0RA 2GW8A 4FN5A 4RJVA 5KOWA 1SJ1A 4JV2A 4IRKA 3B6BA 5H9EK 3ZTSA 2GS8A 4J9SA 4DFPA 2R7OA 3ZZOA 3VAIA 4TXSA 1L5UA 2OFGX 3BN4A 1F2HA 3R5BA 5IC6B 2RAQA 4GO5X 4ZLJA 2I9SA 4X65J 2FVRA 2UZAA 3G6YA 1R43A 2ASDA 4OZ1A 4GO7X 1VRQC 1SH2A 3TZZA 5GAGU 4I6AA 2HFVA 2POKA 3GIJA 3T1YJ 1RT1A 4C4WA 1IVZA 1YDLA 3UDLA 3GLJA 4Y2KA 2KT5A 3V6DB 4JI5F 1RBAA 4LF5J 4ZVTB 4EO8A 3MMBA 4K5RA 1M0SA 1D0EA 2OPPB 2P6TA 1H38A 1IKXA 4X4RA 5HK4A 2NXNA 4KBIA 3UCUP 2ZM6F 1G6BA 1LQ9A 4CCHA 4ECSA 1MROB 2Z8QA 3PFEA 4L73A 4LF6J 2OEJA 2AV5A 4JI6J 3W7BA 3MM7B 3EGVA 2VV5A 1MMDA 4LIWA 1WHWA 2V8VA 5A76A 4KGKA 1M5PC 3HSGA 4M5DA 2NPFA 1KSPA 3CC7S 2QN6B 2K3KA 4UOFA 5KFPA 5HVGA 5SUHA 1WKJA 4DEZA 2RB7A 4HEA9 2BJ8A 4ES1A 4JI4J 2JWNA 1X9WA 3SIPB 4DOZA 1HA1A 3KK1A 4K4WA 1J2VA 4BC9A 1KFSA 5G0RB 1YJ9S 3W8PA 2R3VA 3D6MB 2ZH5A 3CT9A 2HBRB 3ISND 3M32A 2B7CB 3B82A 4F02A 3CCWA 3D0IE 3SCLE 5D4LA 4NXMF 5DDPC 2R7WA 3A3PB 3FEZA 4DSKA 3CJ5A 4HT5A 4ZVGA 2J6TA 1FTCA 2EKYA 1SC6A 1RT1B 3OL6A 2FLPA 2QX0A 1X4AA 2DNPA 2PMZD 1M5VC 3P45B 2DR6A 2EFVA 4HLBA 4LR9A 3C8YA 2BACA 4WFYA 4QWEA 4QWCA 3MMBB 3OXFA 4LF4F 1PBAA 4Y2IA 1VHFA 3BYPA 5GADU 1IKXB 2XULA 4EBCA 1P9YA 1I1GA 2XMMA 4U8YA 5B08A 1UP1A 2OSQA 3R7NB 3J80Y 1MWYA 3M8PA 4AL5A 4JYAF 3PW4A 5JVHQ 4EO6A 2RE1A 4H4MA 1U1PA 1NH7A 3OBIA 4O4GA 3RG6A 3G8SA 4M5DB 1OMSA 5IFMA 4DQIA 4DPWA 2JNJA 1Q53A 1D8ZA 4FVMA 1K44A 3R5GA 1DFDA 5DGBA 4CLFA 2A10A 3UN5A 2QA4G 2H9ZA 1AYEA 2L41A 5KT3A 2CPDA 5F8GA 1HWJA 3ILLA 4DMZA 3CGIA 3DDIA 1RT7A 5B0DA 3GSIA 3KJQB 1EETA 1Q79A 3KK1B 2F3JA 2H5IB 2FJWA 3K89A 2H4WB 2W4PA 3O44A 3CCRS 4NLOA 1X9SA 1EZZB 3CDUA 1Q78A 2E1RA 3M32B 4QR1A 3NNCA 1N52B 3A1YG 3V6JA 1D1UA 3ZXWA 3QWUA 1YBTA 2V2KA 2YKMA 4X66J 1J27A 2RD5C 4ZN1A 5KFHA 3OW2R 1Q0NA 2VC1A 5ADZA 3L7OA 2DITA 3FJ2A 2AWZA 3D1QA 3BH7B 1XERA 4U7CA 4G1PA 2RUGA 1MSWD 4F2SA 3ZZRA 4E2FB 2QJ3A 2IMWP 3D6FB 2V67A 3FNNA 1A6LA 1WC3A 3UW1A 4NMLA 2XY6A 4MIAA 1UVKA 5HL7Q 5HVFA 4BDPA 4UY8T 4F0KA 2FC9A 3SEOA 3PHTA 3ENQA 3QPIA 2ZOGA 5M2RA 3DI6A 2G2ZA 1X5SA 3M8PB 4ATNA 2XMKA 4H4MB 3W5XA 2FVSA 4N5SA 3H5UA 4O4GB 3QBCA 4WKYA 3H5XA 3TNVA 4OYMA 4WFBQ 3A8EA 2HQDA 2X3DA 4IQMA 2XZWA 2CPHA 1CLFA 3P96A 4QWBA 1CJVA 2OH2A 1X5PA 2PO4A 2OELA 2RIJA 2NUUG 3IG1A 4OV6A 1RT7B 1EETB 1ZPWX 4M5NA 3MR7A 1UFKA 4DX6A 3AOBA 2CVIA 5KFLA 2FLOA 2CQ1A 4MK7A 1N56A 2HRTA 3GYGA 3D66A 4RNOA 2FPHX 1NLKL 2WVEA 1C4CA 3GIIA 1RWNB 1MN9A 4LF9F 4AT1B 3BO4A 1S1TA 1QSYA 4DSEA 1YLXA 1TKDA 4CLYA 1WACA 2YKMB 5GMEA 4YR3A 2BXJA 1QTNB 2V2QA 4KHPF 2XY7A 1Y9OA 1NK7A 2WK4A 3K5MA 1EKSA 3MEKA 1YJVA 2B9EA 1HHSA 3GP9A 2V4QA 3ADAC 2P6SA 2JEGA 2EG2A 2F9DA 3GWCA 2O66A 5BXIA 4TLRA 2YKPA 2CIMA 4WCEQ 2X1FA 2CG8A 5DLFA 3PX4A 2JOQA 1JLAA 2J0QD 3DI6B 3GE9A 1M1GA 1QVFR 1KNZA 4RPFA 1KP6A 4LQ3A 4DZDA 5F8JA 3HO1A 1T03A 1VQ6S 2V2VA 4Q43A 2HGMA 5E7OB 5MAOA 1S0OA 3SXLA 5IV3A 4GC7A 2FUG9 2GHWA 4OFZA 4KY3A 2J9DA 4PG4A 2RRNA 2XWXA 3MGJA 3D67A 2KHCA 1CJVB 4FNHA 4DPYA 1GMWA 1OWXA 1Y0HA 2UU9J 5DG8A 2KZZA 2IJNA 2O67A 3CCLS 2DVIA 3JTPA 1RHQB 3IG1B 4Q8EA 3W3SA 1H72C 2WONA 2Z4PA 2R7SA 2J5AA 2CQGA 2LQBA 4J9RA 4CNYA 3VAMA 1S1TB 1LV5A 2Z58B 2K8GA 5KAKA 4U67Q 4DR4F 5CCLA 3EGNA 2XMTA 4B9SA 2XNQA 2G1HA 2UV8A 5KFDA 5H9EJ 5K8MA 1C1CA 2YXLA 4DLEA 1IR0A 1U45A 4OV1A 1UVNA 2MMYA 1T95A 5IOLA 3CULA 5B0AA 2GVZA 1I94F 2OFHX 3RR7A 5E41A 1ZPVA 1KLMA 3RW7A 1L3TA 4OI3A 3WC2A 1TKXA 4ANEA 5GAEU 1JLAB 5DGAA 1UTAA 2X7IA 2MZTA 3JS9A 4I68A 4IR9A 5HO4A 1T3OA 1RTJA 1T03B 2VD3A 1S0NA 4QU6A 1Q16B 1VMBA 3X3UA 1GNKA 2O01C 3PYDA 3HKZD 4C8NA 3F56A 3S6EA 3GMGA 2WSCC 3CF5Q 4ZPDA 1H7WA 4ECYA 4P7TA 1RI7A 2BJ3A 2GQQA 3FMWA 5B09A 2FGOA 3CJ3A 2APOA 1U48A 5HI7A 2DGQA 1T3NA 4Q2LA 3HZEA 4EFAC 1NK6A 4YDXA 3N4WA 2IMOA 1X60A 2WONB 2PN6A 3KLGA 3RRHA 4EBDA 3VAKA 4DWIA 1O6XA 2ZUGA 1NMEB 3BBBA 2O1PA 1UFWA 3A3NB 4ILLA 2HQIA 1JLCA 1RWWB 1T94A 4X4UA 1OY6A 5LXYA 3BM7A 2EVZA 3OD2A 1FKPA 5L1KA 4P75A 4OQJA 3DLJA 4MYTA 1LNQA 2DCUB 3CC4S 1LW0A 3GFZA 3IO1A 1SL2A 1C1CB 2MJNA 4CO5A 1NXIA 4CLKA 2F8HA 1NH8A 5F8NA 2CJ9A 4NA3A 4X4OA 2E5IA 4ZCMA 2R7RA 1PJ7A 2HQFA 1NSKL 2KVQE 2ACMA 2GVZB 1M1HA 3LPYA 3BEGB 1K0TA 1GQEA 1KLMB 4WU2A 4WBFA 3PHEA 1TKXB 5A6WA 2RS8A 2BQ3A 1W2IA 4KH1B 4LSZB 1CEZA 2W1BA 3HI9A 3CDWA 4DV5J 2MKCA 3MURP 3O8WA 1URRA 1RTJB 4KKOA 4X4QA 2ABYA 5KFYA 3E2EA 2AYGA 1QAYA 4R25A 1Y3JA 5EWGA 1IKYA 5KG0A 4XPEA 2ROEA 3T1YF 4DX5A 3CUNA 4F4ZA 4TU9A 4FKYA 5DZ6A 4CT9A 3QNWB 2PEBA 4OJ1A 4E8UA 3KJVB 4LF5F 3QJLA 3KLGB 4NLGA 4CLLA 1LK7A 2F7VA 1VDHA 1MMNA 2W7PA 4MJKA 2RSQA 4NLDA 1XTZA 4ECRA 1X5TA 2IAJA 3CJSA 1JLCB 1NU4A 4F04B 1EAYC 2AP6A 1RKJA 1FDBA 2AX1A 4UY85 2RQKA 3G86A 1FRLA 4LT6A 4JI6F 4ANDA 4IDKA 3NRBA 1FKPB 1JLGA 2JFKA 2P2CB 2QLFB 1SXLA 4U8VA 5ITHA 3C6UA 2DT9A 2VFVA 2FZKB 1HNIA 5DQGA 4CZCA 1OPZA 3WDOA 1LW0B 2UUTA 1RLCL 2OUGA 3PKYA 1RBOB 2XS2A 1YITS 3ZTPA 3TP2A 4JI4F 3R2CJ 1UWBA 2EEYA 2RQMA 1OQ3A 1X5OA 4LFAJ 1T9XA 3G87A 5EDWA 4F4KA 3DU5A 3MUMP 1VJWA 3U7JA 2CYYA 2U1AA 2HHPA 4KT0C 1HFEL 3OVBA 3ENWA 1XMOJ 3QJPA 3KG1A 4QIEA 1VOMA 1VBXA 2IIHA 1JB0C 3NWGA 3OXLA 1JNZB 2M70A 4KKOB 4UW2A 1TR0A 5D3GA 3VAJA 1PIEA 1IKYB 1SPBP 3BGLA 4DL7A 1NDPA 4WFAQ 1L3VA 2LEPA 2IDEA 4ZVHA 2R7QA 4CTAA 2DNOA 4DR1J 4O44A 4CWBA 4X84A 5HLFA 3BBCA 2C3YA 4DR6J 2JZ5A 2NZ4A 3CCUS 1WWHA 3NCQA 4FXDA 3M2RA 1S76D 2QLXA 1R31A 2IAJB 1UAWA 2DEIA 1L3KA 1CJKA 1RHJB 3DRXA 1FFGB 2UVWA 2VZ9A 3MCOA 4IDKB 4LMZA 2Z2YB 2HKEA 3OT9A 4DBQA 1JLGB 3T5HA 4RZRA 3OR2A 3C6UB 4YP3A 2FVQA 3MR2A 2OMOA 1HNIB 3SCIE 2KO1A 3PRDA 5CABA 2B9XA 1V5VA 1NCLA 1OJ4A 3OR1A 1TTHB 3SV3A 3EXYA 3OFGA 2Y3YA 4WP3A 3CJ2A 1UWBB 5HQ8A 1KQFB 3ICLA 4M1KA 2DNLA 1IN0A 3T9NA 3C46A 3MD3A 1JXVA 4LR8A 2FB0A 4NYZA 3NWRA 4L3KA 1M1KT 3UI3A 1TL3A 2YNGA 2C2EA 1U1NA 2CZ9A 4OHXA 4KYZA 2B56A 2UXCJ 5KFXA 3R5CA 1HKAA 4NCGA 2BA9A 5F0WA 3EGWB 2XO7A 3GR0A 4A8YA 3PW0A 3CD6S 5IQ6A 1S1VA 5HANA 4YB5A 3PO4A 3DLLQ 5HJYA 3Q8YA 3SSSA 5D3GB 1FXLA 2VJVA 4ED4A 5B0BA 4DR3F 1Y3KA 4CTAB 2W2QP 2RDIA 2VPWB 4O44B 4D3GA 1ZBTA 4XAKA 2QMWA 3OL7A 5HLFB 4GKJJ 3V4MA 4ZVQB 1NRKA 2D7SA 1WEYA 3LGMA 3GIRA 1DHMA 4QW9A 2F4VF 2PMWA 3M2RB 4XIUA 1CJKB 4K4UA 3DRPA 2HGLA 3F41A 2OEMA 1AT1B 1VGYA 4X4NA 3IAS9 3OR2B 3DLGA 1FNOA 2E5JA 1IWAA 1REVA 3D9BA 1HD0A 4OYXA 2Y9HA 1HNZF 3OR1B 5JMNA 2XYGB 2VDIA 2DRAA 2KRBA 1X9MA 3EE3A 3FUYA 4IG0A 3DLEA 3CDEA 2XTJP 4CO4A 2MQPA 2UUBF 2XMVA 1WDTA 4NLVA 1WNEA 1FNXH 3N28A 1K8AT 5KTQA 4OYBA 3VVTA 3D7SB 4QW8A 2E7VA 1QE1A 1QD1A 3QFWA 1TL3B 5KG3A 2YNGB 4J91A 6FDRA 1R27B 4ETZA 2R7UA 3NAHA 4NCGB 3IXQA 2P9CA 2HFNA 1S1VB 4NXNF 1PYOB 1S6UA 4V1Ak 1KBRA 4LREA 1RTZA 2Q79A 1R8PA 4CO3A 2Q43A 4J9LA 1RP5A 4LSNA 2FY8A 5IT4A 2EG1A 4G1QA 2HNDB 2BEFA 2KRRA 2ZOMA 1FO1A 3CPWR 1MNEA 1AB8A 2LQ5A 3PCOB 2DISA 3BSNA 1WD6A 1FFSB 2I0XA 2LDIA 1HBMA 4OHYA 4DV6F 2EFNA 4A48A 7FDRA 3E51A 2M0GB 2J7UA 3DRPB 3PR5B 1N48A 2MQ8A 3IFEA 3S8SA 2M52A 2DNQA 5HP1B 1FRIA 4WXWA 3T41A 3QT7A 1JJ2R 3TAPA 3DLGB 3L09A 3D4JA 3T1HJ 1F2GA 1MG7A 1REVB 2DIVA 2NYIA 4JI1J 4P2SA 1H0HB 1ZETA 4HTJA 4FF4A 4IG0B 3DLEB 3NGTA 2IPOB 4M5IA 2CFXA 1TL1A 1RISA 3BDPA 3KUHA 5J1NA 1VLYA 4ILRA 4I69A 3MAAA 1S7IA 1IKWA 1NSQA 2FIUA 4H4KC 3W9JA 4PR6A 5KG7A 4WPAA 3QRQA 1BQNA 3D28A 5RUBA 2E9TA 3RBZA 4DL4A 4I7FA 3VVUA 2ZZTA 3AQOA 4LF1A 4M5LA 2AGOA 2BW7A 1SH0A 4ZVSB 5DZ7A 2HWTA 1S5ZA 2BX6A 2UVVA 3F44A 2NR0A 1YVFA 3CJ0A 2YX7A 1Y7PA 4K0KJ 2L08A 5AE3A 2CDRB 2FVCA 3BDEA 3OTEA 2L3MA 4LSNB 1DARA 2HS0A 4NZ6A 4G1QB 2MY7A 4Q2MA 1OPIA 3AA8A 4WK1A 4Q5VA 1FJ7A 4C97A 4GVBA 4FYWB 1UA0A 1IWGA 2XZDB 1TK5A 2HYIB 2CPZA 2UUAF 2HS4A 4P2FA 3L7PA 3PJWA 1HBMB 1Q7YT 3RB4A 1N34F 4ECXA 3CEDA 2J6SA 2PMHA 3IMQJ 3MECA 2VFUA 3O1LA 4CLUA 4HVZA 2YKNA 4F0MA 2GIFA 4PRFA 2QT7A 1HR0J 2ZJPQ 2QSWA 2W9AA 1X7VA 4WZMA 2ZDOA 4MKVA 1TL1B 3MF5A 1PILA 4BWMA 1WEZA 4AUKA 3PZPA 2FHKA 2DO4A 3MAAB 1I5OB 1IKWB 1U7LA 2HBYB 2XY5A 4ELUA 2RF2A 4OI1A 5I3QA 1BQNB 3VALA 4I7FB 3I4HX 3BJYA 3ZFVA 2RU3A 1HNWJ 1FRJA 3RBDA 2XQCA 2RHSB 2QMXA 4Q45A 5CYQA 5F8HA 4HI2A 2LMIA 1RU1A 1ZTWA 5KFFA 5E3AA 3W63A 4FKXA 4G65A 2ZHAA 2M3DA 2J9EA 3CDAA 2X1AA 1ZM3A 1KD1T 2HVIA 1YJWS 4GVBB 4DDFA 3JQKA 4J90A 3CJKA 1NAQA 2FVPA 1BY9A 2H1YA 3CCZA 3AD8C 1W2BR 1ULRA 3QGPA 4DS5A 2AJ1A 3BF4A 4QR2A 1SUQA 3OTDA 3HFZB 3SSRA 3AY0A 3SMZA 1DLOA 1WOPA 2B4OA 4F3MA 4AXJA 1N5YA 4J9MA 4DV5F 3I5CA 4JOUA 2GAHC 3NS6A 2BE2A 1EJ7L 4ECUA 3MECB 3EDRB 1UCNA 3M8YA 2JEJA 2OP5A 5IS2A 1F5CA 2N4CA 2YKNB 2YPYA 5LSLA 4DSJA 1TKZA 3WX8A 2DO0A 2BW2A 2JX2A 3NGUA 2ZKTA 3PJ9A 4WP8A 3GONA 3BKFA 3TEHB 4NLWA 4NZ0A 3HT3A 5CD4H 3VGTA 4OL8A 2DNYA 2YWHA 2EXUA 2F8MA 3LGHA 2RF2B 2B3TB 5CH7B 4DV2F 4B9UA 3BR8A 2VH7A 1FXRA 1JLEA 2IRUA 1ZM9A 3KLHA 3I0SA 4B3TJ 5EWFA 3Q8RB 1S57A 1W25A 4B3SF 3BSCA 1R8BA 4Y00A 2F1FA 2VL1A 1L3UA 3FZBA 5CYQB 3U1LA 1CULA 3QRPA 4Y28C 1JLFA 5LM7E 4X62F 3RRGA 4QPXA 1PC5A 2L9NA 5E3RA 4OZJA 1HWIA 4LFAF 5D4OA 2GVDA 3EZOA 2F9JA 3DMJA 4C8ZA 3Q8VA 1APSA 2MQQA 5K20B 2W7OA 1XMOF 2X51A 1SUQB 4M5KA 3KK2A 4DR7J 2VG5A 1DLOB 2LQ9A 1N5YB 4DL6A 2HBZB 1O51A 1WSRA 2NYHA 1S1XA 2CQIA 2BE2B 2XO6A 1KDNA 3EVOA 5A8RA 1T9VA 2XSJA 4ZOSA 2M4MA 3N9UC 2B7BB 2K7JA 4ID8A 1SI9A 2GV1A 4AD6A 1TKZB 2YTCA 2KXHA 4DR1F 3KKFA 1R7IA 4DZ6A 1RYRA 3LP1A 4X4PA 3D0HE 2BJ9A 3MEDA 4DR6F 3ZNJ1 3AXMA 3I32A 2IC3A 3ISNC 2IRYA 1YJRA 1VQLS 2BABA 1XJWB 4DPXA 5E33A 3CXCR 4JBCA 2IYGA 3IBCB 4Q0BA 2FLNA 1JLEB 3GG0A 3KLHB 3I0SB 5KT7A 2KN4A 3MM9A 1F9HA 5L9NA 2IVYA 4Y2MA 2LQJA 1CJTA 1VQMS 1AW0A 4PG6A 4EUVA 3D1HA 2KYXA 2V69A 5CQGA 4ZVPB 1CULB 3E3XA 4U7UK 1JLFB 4NLUA 3GU0A 4PYAA 4F67A 3MZIA 3UWTA 1V3SA 3J7ZT 4YUDA 4X2BA 1FD8A 4O3PA 2M9KA 1NHUA 1S1WA 3DGVA 2EPIA 1YQHA 3KOAA 2GVDB 2BKOA 2J0SD 3DMJB 1GTHA 4ZVOB 3BKTA 4Z7CA 4YB1P 1IBMJ 1UKUA 4QJVA 1XR7A 1UVLA 3I5AA 3MM5A 1O5JA 1HI1A 3G8QA 2UXCF 3KK2B 4Z7YA 2QE5A 1UL3A 2VG5B 4OYWA 1YIJS 3T1AA 2PD1A 1CQNA 1WSVA 1S1XB 1OYDA 5KFEA 2CJXB 4ERDA 5A8RB 4K7QA 3AA9A 2XSJB 3CCTA 1S6PA 3PO5A 2AT1B 4L74A 3IGNA 2V8GA 2A1BA 3M6VA 3W64A 3M9MB 2QFIA 4ZPTR 4IO1A 4Y3CA 3DOMA 2X1BA 3LP1B 1N8RT 4JI8F 2LP4A 2VB6A 3MCMA 5CYMA 2IC3B 4HH0A 1WOSA 2WVFA 3NXZA 2MB0B 1P8GA 3EDQB 4RNNA 4Q0BB 1R0CB 3RJMB 2ASLA 1R89A 5KFGA 4I64A 3MM9B 5L9XA 4DV3J 2NZCA 2Z56B 1Q95G 1NBEB 1CJTB 1RQ0A 3NL0A 1RTHA 1SV5A 2ZZNA 2AMCB 5LMNF 1FTRA 5IT9Y 1FDNA 3OTOJ 2RKIA 2WVBA 4F4YA 3NOGA 3ZTOA 3I96A 2GIRA 1K1QA 2EI5A 4FS1A 2AJFE 1ZA2B 2SXLA 2Y1LB 4W4MA 3OJUA 1S1WB 3MMJA 2V94A 5AT1B 1RT4A 2BMBA 4ZPVR 1SJQA 2V8DA 4PXCA 2X3GA 4ED1A 3E8OA 3GTYX 1UEVA 1RHUB 4KGXB 3I6PA 1U25A 4EYIB 1U6ZA 2KI2A 3ULHA 3WZ0A 3MM5B 2BVZA 2HK2A 4JV0A 1NJWA 5T7LA 3KG0A 3D5MA 3L4BC 4F7VA 2NSBA 1CC7A 4F2RA 4USUA 2OSRA 3AJ2A 2ZJRQ 1S6PB 3LP0A 5FIIA 3JTNA 1ZZNA 1SKRA 2ZZMA 2YNFB 3N5FA 1FE4A 2HVEA 3HXMA 3IR7B 2MZ1A 1I3OB 1RADB 4J9PA 1ZOTA 1S6QA 3P8BB 2GJIA 2HRUA 1Y00A 3DOMB 1BWEA 2FHJD 5GADI 4ER8A 3NMAA 2RQ4A 3GV5B 5B7WA 3GQCA 4ECWA 5LMUJ 5CYMB 3DXBA 3OHAA 3QFHA 5JUMA 4ZDNA 3SQOP 4KPYA 2QL7B 2HHHF 4DUTA 2OI2A 4HACB 3U1NA 2FZGB 2IM3A 1HNXJ 1N36J 1XN9A 4IFYA 1YX2A 2CG4A 3R6GB 1EP4A 5L1JA 3T1HF 4B9TA 2BJEA 1I51B 1SBRA 1RTHB 1SV5B 2JLFA 4JI1F 4A4JA 2WB4A 1F1BB 2YWKA 3HJVA 1FEHA 2RKIB 3W66A 3RR8A 2DD8S 1RT4B 1PG5B 2CPXA 4QYZK 5L1IA 2B4UA 1XMQJ 3VGVA 3I9V9 4U96A 1AZSA 1HNVA 2VQEF 3IN5A 3H4DA 3JB9k 4I4BA 5DETA 4JI2F 2I2YA 1FVQA 3G71S 1TUVA 3FBEA 3K2YA 3NGRA 1FKOA 3UNGC 1RU2A 5T7LB 3CJ8A 4O0NA 3Q8UA 2QYCA 1TUGB 3TUJC 4KR0B 2CJQA 4HHHA 3LP0B 1PC4A 2W2OP 5CZXA 2EKNA 1PKUA 4K0KF 2AYEA 3ZZTA 7FD1A 2VKRA 5I4MA 5C2GA 2XI2A 5LT5A 4CYUA 3BGRA 4LFCF 4P52A 2MTLA 3PNIA 1TL4A 4PWUA 2PI5A 2CJBA 2AYMA 1FI4A 3HZGA 4FBTA 4DFKA 3LF0A 1QAIA 3P6YC 3LO3A 1PSDA 5KFUA 4RUCA 1RK8A 3MCSA 3MR5A 2FJDB 1JKHA 1WF2A 1SJ3P 2AJQA 1FRHA 1F0XA 4HDGA 4IFYB 1EP4B 4JI7F 3JSBA 2DRDA 4OJGA 2CXEA 1BWVA 2RJZA 4DQSA 2UUCJ 1HI8A 1DJ0A 3WBZA 3AAWB 4ZKAA 2MDAA 1WDDA 2CNNB 5F9LA 1PBUA 1EQ0A 2J8AA 4NL5A 5KT6A 1VBKA 3LALA 2FJVA 2VIHA 3DRSA 4EZ9A 1F6TA 2PEHA 4B9LA 5K5MA 5B0FA 2ASJA 4KIAA 1AZSB 2DNKA 2ZFHA 1HBNA 5EN1A 1HNVB 2WSFC 1CS4A 1U6BA 1H6KX 1NK8A 3NLCA 1C0TA 1XK8A 4WFXA 1FKOB 4ED7A 2RMLA 2CWXA 4WIQA 2WHOA 2XC9A 4C8MA 4NLXA 1HQUA 5LXRA 1HNWF 2E5LF 2BUNA 1VQPS 1AUSL 3CVKA 3HVRA 1B7YB 3BQ1A 4I6YA 2R8KA 4ELVA 2OPQA 3RYLA 3X1LB 2XMJA 3FBCA 1PJ5A 1ZTTA 3D3BJ 4PWDA 1FJGJ 2CPJA 2ZD1A 4O3QA 2J7WA 3HHKA 1WC6A 4ID5A 1BMQB 2JEFA 2V4JA 3CCVS 4DN0A 3OVAA 2W7AA 4CYUB 4A8KA 3EICA 3BGRB 2AU0A 2HHQA 3JSYA 4B17A 4E98A 3J7Z5 3JAMU 2QYGA 4JUZA 3W9HA 4RR5A 3U02A 1T0TV 2NXEA 1YRXA 3GFHA 1U09A 2Z0GA 4R8UA 1QLNA 2HS3A 3MM6A 1N0VC 1VYAA 4P6QA 4R0EA 4TLQA 2IRXA 2VC0A 2HQGA 4C3KA 5KFWA 1U1LA 3HD2A 5EUHA 3W8GA 1JKHB 1VRUA 2V5HG 3DOLB 2HWIA 3UCGA 4F3QA 1MN7A 2A3JA 3I5BA 4K59A 4H4OA 2FD2A 3FQKA 3TA0A 2FC8A 3H2VE 4KTQA 3ZZUA 1UEUA 3OTBA 4UQGA 4J9NA 4LF8J 4P71A 3IWLA 3HHEA 3BSAA 4LRDA 2PFFB 1HBNB 2DH9A 1T9WA 3A8IA 1CS4B 4ANCA 2QZ8A 2VKZG 3B4MA 1C0TB 3L7UA 3OFHA 1YBAA 2XMWA 2AEJA 1IKVA 1KVKA 2KXFA 2J6UA 1HYSA 1F60B 5DDQC 4B3TF 4H54A 1HQUB 3PRVA 4ZPAA 2ZITA 4YFUA 3HULA 1ROFA 5FLXY 3Q86A 2BZ2A 4DXLA 4NOHA 2B4PA 3I87A 2OPQB 2BJ1A 2MKJA 2DHAA 4D3HA 2HHUA 2Q6CA 2CJKA 4PWDB 3NKYA 3FBBA 2ZD1B 2ZH1A 2O3DA 4ID5B 5HMXA 3MUTP 2V4JB 3TAQA 3FCHA 2V2ZA 2ADBA 2HHXA 2RNEA 1RT6A 1IBCB 2DYAA 2KL8A 3QO9A 2VPZB 3DXSX 4I56A 4RW7A 3MXHP 4NPOA 3KNAA 5GAEI 2AZ1A 4ZIVA 3HLUA 4N76A 1SIZA 2PDAA 1UFLA 4DR7F 5ETVA 3OVSA 4R8UB 3MM6B 3KJNB 3M8RA 1HLWA 3Q2TC 2GIQA 2HAIA 4U95A 2OO4A 1VRUB 4Z37A 3SFGA 2XM3A 1VBYA 1R0BG 4NI2A 2VPXB 4H4OB 3TOQA 3MUVP 3CCES 3ZZZA 4OYOA 2HQ3A 1NSAA 4LUBA 1S6OA 2L48A 4YEAA 3W1YC 3G8TA 3CIMA 1X0FA 5CCMA 2YPZA 1X4BA 2R2RA 3HCXA 4B3MJ 6AT1B 2C1EB 2RILA 3VWSA 4K4XA 3MAHA 2H3EB 4WF9Q 2MQOA 1ZH5A 2ADCA 2A6MA 6FD1A 1FX4A 5AXKA 1IKVB 3VAGA 4Y6IA 1HYSB 5U47A 3Q22A 3UPFA 1JNRB 1FF2A 2ZH2A 3DDNA 2MZRA 3CSKA 4RNMA 3DYAB 2E9RX 5C25A 1O0PA 3P5BP 4G3IA 4CLSA 3KLFA 3EZUA 4I1TA 1RWVB 1MU2A 2QC3A 2DGWA 3AB2B 4XDCA 1SC1B 4DSIA 4QIFA 3BPSP 1RT6B 2D74B 4N8NA 2ZH6A 3QO9B 4NCBA 3N0VA 1NK5A 4RW7B 3ILIA 3VZIA 1KN6A 3I0RA 1NUEA 5J2MA 1HMVA 4JP8A 1WHVA 3SCKE 4FZVA 4RKUC 1U2RA 5GAHU 2MHNA 3TJ9A 2DHSA 2WOMA 3C14A 2QEXS 2OTLS 1H2TZ 5CXTA 4DV4J 4ZCLA 1AFJA 2W4CA 5D15A 2B4VA 2KJWA 2Y1IA 3AOCA 2RRAA 1JXLA 3LP2A 4NI2B 3GILA 2R8JA 2L9WA 3Q2SC 3V5RA 5BYQA 2RVJA 2GMJA 3ILOA 3KHGA 4MKAA 2Y0BB 2PT0A 3TUZC 1GTEA 4UT4A 4TQSA 5DG7A 3FCVA 4FXWA 3RGIA 5DJBA 3NBPA 2GJ2A 1R6YA 4DI6A 3CD7A 2E1CA 3L95X 1CJUA 3CTRA 3G4SS 1S1UA 5KG1A 2IBKA 1ICEB 4HHUA 2KDOA 4KQZA 3MEEA 4OZ2A 4DR2J 1KS2A 4IUFA 3LQVA 3ONQA 2QSFA 1VBZA 1TAUA 4U7UD 4C3MA 2I38A 4NRUA 2V68A 4URGA 3MEGA 3OLBA 4QYZJ 3N6NA 4X64F 3EPIA 3KYLA 1XQIA 1UETA 4WYWA 3UVJA 1F9FA 5KT5A 2DJWA 3Q23A 1S79A 5C25B 3CIZA 3QT6A 4ZVRB 3KLFB 1BUXA 3C19A 3TI0A 4I67A 3OTOF 4ECTA 2YH1A 1VJQA 3D68A 2ACYA 1MU2B 4ZLPA 2XS5A 2YX4A 5DQIA 4MTPA 2DKOB 3C15A 1H73A 1VK8A 5K8PA 3OSPA 5ETKA 5KFBA 1OSDA 5DRKA 5KG2A 5ETRA 2BBEA 1N4LA 3JAMY 3V6HA 2OEKA 1HWUA 2D3OR 2DH8A 3I0RB 5CD4A 4YN3B 5J2MB 2N7YA 2GGPA 3ET6A 4O4RA 1TAQA 2CQ0A 4MIBA 3JYTA 3O6QA 3CDBA 2VBZA 2WOMB 3LA0A 3C14B 1HL6A 3PX6A 4DUZJ 2DR8A 3ZNUA 4XTTA 3HFVA 3LP2B 1VC0A 4DR5J 3DC2A 4TY9A 2YNIA 3GIMA 2D3ZA 2PE8A 3MPDA 3PYEA 1IBLJ 2C3PA 1RAEB 5ETPA 2ILZA 4ZPCA 2HEKA 3KFWX 2XCAA 1Q8LA 2CVEA 1EKRA 4FBUA 4K4ZA 3NBPB 2HG4A 2WCXA 2W8LA 3NCRA 1CJUB 1S1UB 5DLGA 2CPIA 3J81U 2H4YB 3AOAA 4NMXA 1GMUA 4URSA 1FDDA 5HBMA 3MEEB 2IHR1 5J2NA 3IM8A 4NZ7A 3UD3P 2UVRA 2GAGC 4B3RJ 1HNXF 2R8IA 1N36F 3D3CJ 3MEGB 5G4DA 4QU7A 3N6LA 3UVJB 5EHHA 3RAQA 1Q86T 1IR1A 1O8BA 3HFKA 4NXMJ 3T5LA 2LU2A 2IBOA 4K4VA 3TO8A 3QZ8A 3E01A 1FRKA 2D41A 4TVAB 3TZXA 1XMBA 1XMQF 5BR8F 4ZMMA 3N6MA 3QGGA 4UOGA 1WF0A 4X4SA 4S0MA 2GGPB 1MW7A 3KMSA 3AB4B 1X4GA 2DBBA 3NGSA 4FYVB 4PG7A 3ET6B 4L75A 1LOUA 3JYTB 2XGQA 4LF4J 3KTQA 4C2MA 5SZTA 4LVOP 2D9OA 2BE7D 3HK2A 2ZE2A 1C2PA 2YQ1A 1T02A 2W4DA 1EARA 4RU9A 3HT0A 1KQGB 3GJQB 5KFQA 2YNIB 2JVOA 4P9SA 3IM9A 4EYHB 3SZ2A 2HHWA 4WIIA 4P7VA 3UQSA 2KZMA 1RT3A 2I8EA 1X4HA 4K5SA 2LFVA 2ZHOA 2C3OA 2W9BA 2RQCA 4LRCA 2KG1A 2QFJA 4IRDA 4FF3A 3R5AA 3BKUA 2F40A 3UE2A 3SDEA 3LAKA 1N5VA 2VASA 3FKBA 3HSDA 5J2NB 2MZQA 4K2JA 2CADA 2H48B 2KM8C 2ZHBA 2ALYB 2UV8G 1XEZA 4J7CA 2LA4A 3IR5B 3CCMS 2UUCF 4ZCKA 2BE9B 1G3OA 5KFKA 1G7CB 3OXGA 3A8JA 3HHLD 1GX5A 2G9OA 1T9UA 1NJZA 2LU1A 1XC9A 4E0DA 3R97A 1FX2A 2FJEB 4XDDA 3A4TA 1H7XA 5E3CA 3PKMA 4ZJLA 4PG5A 4USVA 3NP5A 2OAUA 3LAMA 1DZ5A 4ES2A 2B9YA 3PTWA 1RWUA 3DNCA 3TR5A 4QPTA 1U02A 2ZE2B 1VI7A 1YJTA 5HMYA 3THPA 1LFWA 4HH1A 2YNHA 1OQ6A 3KLEA 2H65B 3ZTQA 3JSMA 3MPVA 3VZHA 1GAOA 4ZVUB 3S7RA 2KG0A 3OUYA 5F8LA 4HTIA 5L39A 3I31A 4R0JA 4DCOB 5LOQA 1AA1B 4F8RA 2AJ0A 2OTJS 3W5ZA 1RT3B 4NA2A 3GJSB 5A0YA 3A12A 1JQGA 4HHJA 3AXKA 3MR3A 5H1SV 3GCXP 2FYXA 3WIUA 5A8KA 2W9BB 1YJ7A 2HVDA 2AHOB 3SDEB 2N3LA 3BZQA 3OJSA 2GMLA 2BOAA 4WTOB 2AGPA 5IV4A 2QL5B 3P49B 3K58A 3B54A 3EYZA 1X4CA 1U1RA 2XHCA 2DGUA 4OYPA 1CPZA 2A2CA 1Q5VA 5B0GA 5ETQA 4LF9J 4AL6A 5ETLA 2DNNA 1BGXT 2Z30B 1MMLA 2R8GA 3HMJG 5C42A 1HWKA 4LF8F 4C0HA 1WC1A 3EZ5A 4J9QA 3C66A 3M8SA 1K9MT 3UDEA 2MPUA 3DHWC 5T14A 2QLWA 1V5IB 3QQCD 4HDHA 4M5HA 2XLIA 1S48A 2O5DA 5BYRA 4LBIA 1BXNA 3R1LA 1JWWA 2DXFA 3W2VA 4LRBA 1KOOA 3G6VA 2J0XA 2AEMA 4YMEA 4WFNQ 2YNHB 3KLEB 4FYYB 2VICA 3JSMB 3LWLA 3OUYB 4N7TA 2DIUA 2WZ1A 1CC8A 1RWKB 3CMAS 3TRGA 2HMIA 2MYFA 3QLHA 4QWAA 4UOHA 5A0YB 2ZBPA 4IH6A 2LDYA 3W5YA 3NAIA 4YR2A 4RWWA 2EC2A 5A8KB 3GR1A 3RRKA 2ERRA 3J81Y 4YY3J 3BPDA 1TMJA 5LJ5Y 4JI0J 3IBFB 2HQCA 1Y5IB 2CNOB 3CJTA 1TFWA 4DL3A 4RBUA 3AODA 1YHQS 2MHEA 1U26A 2MGZA 4ZHRA 1UA1A 2FJXA 3MTKA 4WP9A 2YWGA 1U4BA 1CG2A 1B4SA 1NZ8A 5I42A 1S10A 2Y0SD 2ZH7A 1GXTA 4UF4A 1B70B 5C42B 1N6QA 1NSPA 4X65F 2H5JB 2NQPA 4OX6A 2LVWA 4FYXB 3BYRA 1M5SA 1RE1B 2WAQD 3CWJA 4JV1A 3OL9A 2Z57B 3PG9A 4QQBA 5F3ZA 1ELOA 1VRTA 3M7VA 1I94J 5E5NA 1JIHA 1Z2ZA 1H98A 3NNHA 3W2VB 3J81j 2VOOA 3UFCX 1NM2A 3EWGA 2ZBRA 2HGNA 5KG5A 4ED5A 5AXMA 1DAXA 4USHA 1DQAA 3KUEA 2MZSA 1SKWA 4KB7A 4LF6F 3OTCA 4ZP7A 1HI0P 3HVTA 2GHVC 2HMIB 3QLHB 1VIOA 2VQFJ 3CD0A 4DCPB 3B4DA 2E1PA 3VQSA 3ISZA 5E0OA 4UUXA 4LBHA 1DRZA 2V8HA 1BC6A 4YS2A 3J7YU 2N3OA 1VISA 2OPPA 1KLNA 3UR3C 1VS3A 3AFGA 2B6AA 1NO8A 1PAEX 1SJFA 4DV0J 1NZAA 2MGZB 4ZHRB 3SV4A 2ZEJA 2OIHA 1NPPA 1UZDA 2AIRB 4EWTA 2ATCB 2OD4A 4ZA1A 3MOZA 5I42B 5IT0A 1BLUA 4FDFA 4DV7J 2RDJA 4WYLA 2VBWA 1N6QB 1WHXA 2G1DA 1SC3B 3TW0A 5AXLA 2IM1A 4NASA 2QA4S 5B0EA 4DV1J 2YQ0A 3KLIA 5ETNA 2DNMA 3OFFA 1VRTB 1VR6A 4DR2F 4DFMA 3LH2S 1JJHA 2EFQA 2HNZA 4FF1A 3SQGA 2PI4A 2X1GA 3PR4A 3H2UB 1R8AA 3V6KA 3EGZA 2EFGA 2Q66A 2VFTA 2HIYA 1QY7A 8AT1B 4A8OA 3CW2C 5DS7A 1SJRA 3OHBA 4ZPWR 5FD1A 2JVRA 1NKBA 3CCSS 3FMBA 2NXUA 1LWCA 3HVTB 3TEGA 2RU9A 4ZITA 4DQPA 4F50A 1VFJA 3RB3A 1RA6A 3IBWA 2XLJA 3VCDA 1LXNA 5J1PA 4BCAA 1OY9A 3VHQA 1Y5LB 1WELA 3POTA 3QYYA 8RUCA 4A47A 1EIYB 1FESA 3I56S 3R6LB 1N32J 3HVWA 1RCOB 1SC4B 1ZA1B 4ZLNA 1S4FA 4W98A 3VV2B 3NNAA 2LXUA 1KWMA 3HSZA 2YX1A 4DUZF 2B6AB 5IQQA 2N7CA 2V8PA 1VQKS 1RT2A 5EWEA 3Q0AA 1Q8IA 4DR5F 2IM0A 1V6HA 4IG3A 3TANA 4WK3A 5IXUA 3ENVA 1UEKA 3EPGA 4PXEA 2YBVA 2NUHA 4KSEB 1IBLF 4ZS6A 4F0HA 4OI0A 4X66F 1YRTA 4OLOA 1Q8BA 1TK0A 4TNOA 1XR6A 3KLIB 2HWHA 3GG1A 3H90A 4X4TA 3H40A 1P1TA 1HQEA 4ZP9A 4RBVA 1H3DA 3KHHA 3AT1B 1RAJA 4NWBA 4ILMA 2M8DB 4ITSA 4B3RF 2VG6A 1LFPA 1GX6A 3LUYA 4A46A 2HNZB 1M5HA 2FZCB 4RUAA 3SQGB 1RAFB 3MCNA 4CI0B 5KT4A 3WX4A 3H25A 5EGYA 1IJFB 3BBFA 4FNIA 3LGNA 2CAJA 1RJJA 3KUGA 4QIVA 1LWCB 3IR6B 3EVWA 1QTMA 1OIAA 3HM9A 2BJDA 9ATCB 4K4YA 4KAIA 1V3RA 2C22A 2Q1LA 2D9PA 1FHTA 3POTB 2E29A 2E44A 1T05A 4JV5J 2NREA 3F73A 1QVGR 2XBPA 4NE9C 3R5JB 2WBMA 5CA5A 4J9VA 1FA0A 5ETMA 4DG1A 1UW4A 1TL5A 1RT2B 1YGYA 3JQJA 4NLTA 2EW9A 4RNFA 4IG3B 2R2UA 1D3WA 1Q5YA 2J9CA 3O5TB 2K3IA 1HHTP 3PY8A 3JQMA 1T7PA 2HBQB 1TUWA 2Z2LA 5IZHA 3R8YA 3DN9A 1A7GE 3K0JA 3BGOP 2GFFA 1KVIA 3GPAA 4KC5A 1RHKB 1HQEB 4OI4A 1K0VA 5THWA 2EFPA 3FZ2A 4FS2A 1AROP 2VFSA 4FF2A 4EGLA 2CUYA 2JRSA 2VG6B 4OIXA 1XBWA 3VR1A 3C6TA 8ATCB 3KNGA 2W24A 3F0NA 4KO0A 5AE1A 1KKHA 3DDKA 4MYUA 3QAEA 4M94A 3GYXB 4I2PA 1FCAA 1VQNS 3FVYA 5E2QA 1K73T 3MD1A 2OLWA 5E3PA 4RWXA 1N88A 2BR0A 1R0AA 2CJYB 1B0VA 4DQRA 2V9WA 2HFZA 4PABA 1RABB 3UN3A 4DR3J 2VUGA 1T05B 1X4DA 3CC2S 2DXEA 2XYPB 2YVSA 1GK8A 4OJHA 3HHNB 2UU9F 1FD2A 3NY0A 1S99A 4K2XA 2C2RA 3TYTA 4DSFA 2Y8YA
chains in the Genus database with same CATH topology
2W7PA 5CZVA 4P6QA 5KFOA 4R0EA 4MJKA 3C3LA 4DG1B 4EU0A 4TLQA 2IRXA 1QE1B 2VC0A 2R7VA 2RSQA 4C3KA 5KFWA 2MKIA 2HLTA 1U1LA 4NLDA 1XTZA 2V0NA 5KOXA 4ECRA 1X5TA 1JLQB 2IAJA 4FVCA 5EUHA 1JKHB 3H8YA 4K50A 1JLCB 1NU4A 3I55S 1VRUA 3D2WA 2V5HG 2UXBF 2AP6A 3DOLB 1RKJA 1FDBA 2AX1A 4O0IA 2ROPA 2RQKA 4UY85 2HWIA 3UCGA 3G86A 1FRLA 4GMKA 2AGQA 4F3QA 2YKQA 4LT6A 4JI6F 3RAMA 2EC0A 2A3JA 4IDKA 3I5BA 3NRBA 2JDJA 4K59A 2P9GA 4H4OA 1FKPB 1JLGA 2FD2A 2JFKA 3FQKA 2YNFA 1SXLA 3TA0A 2FC8A 3H2VE 4KTQA 3ZZUA 5ITHA 3C6UA 2DT9A 4NLSA 1UEUA 2VFVA 1SKSA 4TU8A 1HNIA 5DQGA 3K59A 4CZCA 1OPZA 3OTBA 2M7SA 1XNQF 4QR0A 3DLKB 3WDOA 4UQGA 1NK9A 1LW0B 1NKEA 1CVJA 1ZM4A 1S77D 2UUTA 1S0MA 4J9NA 3PIOQ 4UQTA 4AXIA 2CQDA 3PKYA 5KFTA 2FHMA 2OMLA 3RU0A 2XS2A 3KHRA 1YITS 4K4TA 3V4IA 1N5SA 1SJ4P 3TP2A 4Q7AA 3Q8QB 4JI4F 3IWLA 5J2PB 1UWBA 2PIIA 2UXDF 1IJEB 4LJMA 2RQMA 1OQ3A 1X5OA 2JL9A 3HHEA 3BSAA 2M8HA 2PFFB 1C1BB 1HBNB 1OS5A 2DH9A 2WSEC 2R8HA 5EDWA 4F4KA 4BWJA 2UP1A 3DU5A 2H5EA 1DQ8A 2ZC3A 4QIWD 2OPSB 3C6TB 4MKYA 2DPIA 3MUMP 3IRWP 1VJWA 3U7JA 1RYSA 2CYYA 2QZ8A 2VKZG 3B4MA 2U1AA 2YY3A 1C0TB 3OFHA 4TU7A 2HHPA 3H98A 1QSLA 4KT0C 1YBAA 2XMWA 3M30A 4A8XA 1HFEL 1IKVA 1RGVA 4C0BA 3OVBA 3ENWA 4PPZA 3QJPA 2KXFA 2J6UA 1HYSA 3KG1A 4QIEA 1F60B 5DDQC 1U1QA 4KO0B 4B3TF 3G6ES 3QWPA 1VOMA 1HQUB 4H54A 1HBUB 3FSIA 2E5GA 3RBEA 1VBXA 4ZK7M 1S0VA 1WEXA 4L3NA 2I1RA 4G1IA 4ZPAA 1LK7A 2J7KA 2ZITA 4XPCA 4YFUA 4I2PB 1ROFA 1SB6A 5FLXY 3DCAA 4KHRA 1JB0C 2NS1B 3P3DA 2BZ2A 3NWGA 1UVJA 3MHYA 3OXLA 2B4PA 3I87A 4NOHA 4YR0A 1JNZB 2OPQB 2M70A 2XLKA 1B7FA 2MKJA 5D77A 2DHAA 1B0PA 4KKOB 4UW2A 4D3HA 2E1AA 2E7WA 5C5JA 1TR0A 2HHUA 2Q6CA 2CJKA 5D3GA 4PWDB 4HI1A 3NKYA 4XK8C 4IFVB 3VAJA 2ZD1B 2MQNA 1R0AB 1IKYB 2ZH1A 2O3DA 4ID5B 3O3LA 5HMXA 3MUTP 1FT8A 2V4JB 3BGLA 4DL7A 4C0OC 3TAQA 1S7HA 4DUYF 5J2QB 3FCHA 1U8SA 5HMZA 3BO3A 1S97A 4WFAQ 2ADBA 1L3VA 2HHXA 2LEPA 2RNEA 3HX9A 1RT6A 3BR9A 3SFUA 4C3LA 4ZVHA 2R7QA 3THTA 4NX9A 4CTAA 1KC8T 1AUDA 3QO9A 2DNOA 2VPZB 3DXSX 3IGVA 1IXKA 4I56A 3TVKA 4TQRA 2BANB 4O44A 4RW7A 2NPIA 3MXHP 4NPOA 4X84A 3KNAA 2K7KA 5GAEI 3HLUA 4M63A 5F9NA 4N76A 1RDRA 2VONA 5HLFA 1SIZA 2C3YA 2PDAA 1UFLA 4DR7F 1KEKA 2JZ5A 3OVSA 2NZ4A 4R8UB 3MPYA 2R2TA 3TUIC 3MM6B 5FDLA 3CCUS 3NMRA 3M8RA 1WWHA 3VAHA 4IYQA 4ED0A 3UD4P 4GC6A 4B3OA 5HBMB 2W9CA 4MK9A 3Q2TC 1ZZFA 4N8OA 4PQAA 2G4BA 3NCQA 4FXDA 3M8QA 3M2RA 4TYBA 1S76D 2GIQA 2HAIA 1R31A 2QLXA 4YOEA 1Q1KA 3H5SA 2IAJB 1UAWA 4TY8A 1QJHA 4AQYF 2OO4A 1KHWA 1L3KA 4DPOA 1VRUB 3AJ1A 2YKOA 4LIRA 3T6BA 2IJFA 3DRXA 3SFGA 4Z37A 2A18A 2DTJA 4RX6A 2UVWA 1ZAWA 1XNRF 1VBYA 2VZ9A 4DL5A 4IDKB 4LMZA 2VPXB 4DBQA 4H4OB 3UR0A 3TOQA 1JLGB 3MUVP 3T5HA 3PW7A 4RZRA 3OR2A 3C6UB 4YP3A 2FVQA 3CCES 4PXDA 3MR2A 2OMOA 1HNIB 3SCIE 2KO1A 5A6PA 3PRDA 2JC0A 3ZZZA 4PG8A 2B9XA 1D9DA 3FEXB 2HQ3A 1G1XA 3HP6A 2Z2MA 4LUBA 3OR1A 1S6OA 4C11A 2CPFA 2L48A 4YEAA 3G8TA 3CIMA 3SV3A 3E01B 4LVNP 3EXYA 3OFGA 1X0FA 5HMWA 5CCMA 2HLUA 2KFZA 3V4IB 4KJIA 4YY3F 1X4BA 2R2RA 4B9NA 2FHOB 3CJ2A 1UWBB 5HN0A 2AJ4A 5HQ8A 1A9NB 2RILA 1KQFB 3ICLA 4JI0F 2J76E 2PSZA 1TZ0A 3RZAA 3LWMA 2AQ4A 4M1KA 2DNLA 1IN0A 3VWSA 2JLGA 3BQ2A 4K4XA 3MAHA 4WF9Q 3T9NA 2MQOA 2CKWA 4FPRA 2KTQA 2HHTA 4F3OA 3MD3A 3C46A 2ZH4A 1ZH5A 4PKDB 2FB0A 2ADCA 4IKAA 1BQXA 1WG5A 2DGVA 2ZDPA 4NYZA 2FTRA 6FD1A 3PW2A 1M1KT 3UI3A 1FK9A 1TL3A 4RW6A 2NLWA 1Z4UA 2YNGA 3M30B 1DQ9A 5AXKA 1IKVB 2C2EA 3VAGA 1U1NA 2KHDA 2ILYA 4Y6IA 4M8LA 5U47A 3UPFA 2YWEA 4IH5A 3Q22A 4OHXA 1HYSB 2B56A 1JNRB 1FF2A 2CQ3A 5KFXA 3R5CA 2ZH2A 1UJ6A 3DDNA 1N0UA 1RTIA 2MZRA 4NCGA 2BA9A 5F3TA 5F0WA 4OI6A 3EGWB 2XO7A 3CSKA 3GR0A 4A8YA 4RNMA 3PW0A 5IQ6A 3CD6S 3DYAB 1S1VA 4ICLA 4K4SA 2E9RX 4YB5A 3M2UA 5C25A 1O0PA 2G0CA 4G3IA 1AXQA 3PO4A 3DLLQ 3K8VA 3KLFA 3PFOA 1HARA 3EZUA 1NEEA 3SSSA 4QIGA 4UOCA 4I1TA 5D3GB 1RA7A 2ZBIA 4I2QA 1FJGF 3TA2A 1MU2A 1P27B 1NHVA 2DGWA 3AB2B 2YWFA 1FXLA 3K5PA 4C8LA 4CO1A 2MKHA 4XDCA 4DSIA 4QIFA 5B0BA 3THVA 2ROGA 2CQ2A 5LSOA 1RT6B 2D74B 4QCLA 4DR3F 1B0TA 1Y3KA 3H5YA 4N8NA 4CTAB 5L8RC 2ZH6A 2RDIA 3QO9B 1SIWB 3QMQA 3R27A 4NCBA 3AQPA 1VQ8S 2VPWB 3N0VA 3QIPA 1NK5A 4O44B 4RW7B 4D3GA 4WZQA 3VZIA 1KN6A 2E1MC 1ZBTA 4V19X 3I0RA 5F8IA 4XO0A 5J2MA 1HMVA 2QV6A 4XAKA 2OKQA 2QMWA 4ED2A 3OL7A 4ED6A 4B9VA 5HLFB 1WHVA 2KT3A 2D3UA 5GVQA 3CB4A 3SCKE 3V4MA 4FZVA 4F25A 4RKUC 1NRKA 1U2RA 2D7SA 3GFXA 5FDLB 1P9QC 4DL0C 5GAHU 2MHNA 4B3OB 1WEYA 3LGMA 2ZOFA 2W9CB 4F4WA 2DHSA 1DHMA 3IS9A 2WOMA 4QW9A 2KM8B 2F4VF 3TAMA 5L1LA 2QEXS 2XCPA 1Y4ZB 2V9KA 3M8QB 3M2RB 4XIUA 2OTLS 1H2TZ 5CXTA 1FJCA 1V3ZA 2LYVA 2I5JA 4TY8B 4ZCLA 2EK6A 2W8KA 1DURA 1K1SA 2W4CA 1AFJA 2HNYA 4K4UA 2AF6A 1QUVA 1VQ4S 1FDAA 3MOJB 2BM1A 3DRPA 2B4VA 3HHLA 2KJWA 3EUNA 2Y1IA 2HGLA 2RRAA 1JXLA 3F41A 3LP2A 3NG8A 3GILA 4N77A 3HVAA 4RLEA 2R8JA 2L9WA 3Q2SC 4RU2A 4IH7A 4NA1A 1VGYA 2HZCA 3M6UA 3M9OB 3V5RA 3IAS9 3OR2B 4X4NA 1SL1A 5BYQA 3DLGA 1FNOA 2MSSA 2VQFF 2E5JA 2DHGA 2N82B 1REVA 1RKIA 3N5BA 2RVJA 2GMJA 2VOPA 3KHGA 4ELTA 3FRZA 2AW0A 1HW8A 2DNGA 2BRKA 4MKAA 1HD0A 1WF1A 3MMCA 2KKHA 3IC1A 2UVUA 2PT0A 4ZPBA 1HNZF 3OR1B 5KFNA 4C11B 3TUZC 1GTEA 4OZ0A 2DRAA 2KRBA 4AL7A 1X9MA 4TQSA 5DG7A 1Q81T 4IG0A 4FXWA 3DLEA 3CDEA 5DJBA 4CO4A 2K1RA 2GJ2A 3NBPA 5AE2A 1R6YA 3KJVA 2MQPA 3CD7A 3DOKA 1SL0A 2XMVA 1PO6A 2E1CA 2UUBF 4Q44A 2HVHA 3DU6A 4BBYA 2GMHA 4KV8A 4NLVA 5D4PA 4DQQA 1WNEA 1FNXH 1C0UA 2RRBA 4L6V3 4W92B 3L95X 3N28A 1E6YA 3CTRA 3G4SS 1S1UA 5KG1A 5JJBA 4YDDB 4TYAA 4WJBA 2IBKA 3TA1A 2R2SA 1K8AT 4DV0F 3RTVA 5KTQA 1KTQA 3S01A 2F8EX 2KDOA 4KQZA 3MEEA 2VA2A 1KS2A 4QW8A 2KYZA 4IUFA 1QE1A 3CJKB 5D78A 4C8YA 1FK9B 3LQVA 1TL3B 2QSFA 3ONQA 2YNGB 4RW6B 5KG3A 1VBZA 3SCJE 1TAUA 4C3MA 2I38A 4MKBA 3FEYB 5KFSA 4NRUA 6FDRA 1UMJA 4URGA 1R27B 3IWXA 4ETZA 3EXCX 4DF8A 1N5QA 3DOLA 3MEGA 3OLBA 4QYZJ 2R7UA 3NAHA 2DPJA 3KMQA 4A8MP 3N6NA 4X64F 3HJFA 1RTIB 4NCGB 5DQHA 5I3PA 3EPIA 3KYLA 3IXQA 1UETA 4WYWA 4ZP8A 4NLQA 4UUWA 1F9FA 5KT5A 2DJWA 2P9CA 2C2DA 2HFNA 1S1VB 4NXNF 4ICLB 3Q23A 1S79A 2R4FA 3M2UB 4C7QA 5C25B 4DV7F 3CIZA 4J9KA 3KLFB 1S6UA 2UUWA 3TI0A 1D9FA 1NNDA 4I67A 3OTOF 4I2QB 2DGTA 4ECTA 2YH1A 2LKZA 2ACYA 3OFEA 1MU2B 2LLZA 3S1TA 4ZLPA 5A2QY 3ZZ0A 2XS5A 3IRXA 3Q8PB 2YX4A 5DQIA 1GXUA 4MTPA 2Q79A 3BO2A 3I9ZA 1R8PA 4LF7F 1VK8A 4NRTA 4CO3A 5K8PA 3OSPA 2Q43A 2KVIA 4DV1F 5KFBA 1OSDA 4J9LA 3BREA 1RP5A 5DRKA 4LSNA 5KFCA 5KG2A 2XNRA 5IT4A 2EG1A 2BBEA 4G1QA 2XGPA 4ECVA 1N4LA 5FJ4A 2HNDB 4DHVA 3JAMY 2KRRA 2FY1A 2EK1A 3QIPB 4X4VA 1KRPA 3V6HA 1HWUA 2ZOMA 2CZ4A 1FO1A 2D3OR 2DH8A 2CPYA 2LEAA 3I0RB 1V9OA 5J2MB 3CPWR 1IQZA 2N7YA 3ITHA 1MNEA 2CJAA 2GGPA 3D54A 2LQ5A 2ZBCA 2DISA 4PXBA 3BSNA 3G96A 5T41A 1CQMA 1H2VZ 4CH0S 5KFZA 4O4RA 3QJJA 1TAQA 2ALZA 1WD6A 2CQ0A 1YJUA 4MIBA 3BGUA 3JYTA 2I0XA 3O6QA 1LWEA 3CDBA 5KFRA 3N01A 2LDIA 5J1EA 1HBMA 1U24A 2VBZA 1QUPA 2WOMB 3IS9B 1JX4A 3TAMB 1HL6A 1FE0A 3PX6A 4U6PA 4OHYA 1ZAVA 4DV6F 2EFNA 1RT5A 4A48A 2DR8A 3MPWA 3QIDA 7FDRA 3E51A 2M0GB 2I5JB 2ZNZA 2HNYB 2J7UA 2KJVA 3CO9A 2GQ2A 1NK4A 3DRPB 3HHLB 2EWHA 4DJBA 3PR5B 1N48A 3LP2B 1VC0A 3IFEA 1IQTA 3S8SA 2M52A 4OX8A 2DNQA 4DS4A 4I6WA 2QRRA 3DC2A 5HP1B 1FRIA 4WXWA 1HPZA 2QO3A 1JJ2R 4TY9A 3RAXA 4FXVA 3TAPA 3DLGB 2YNIA 3L09A 3GIMA 2D3ZA 3N79A 2XS7A 2PE8A 1F2GA 1REVB 2QA2A 2JJ4D 2DIVA 3NGDA 2IVMA 2NYIA 2C3PA 2ZVSA 3MR6A 4AE5A 4P2SA 4DL2A 3MMCB 3MI7X 2ILZA 2BM0A 1Q82T 4ZPCA 1H0HB 1ZETA 3ZC4A 3KFWX 2XCAA 4HTJA 1Q8LA 1G2EA 4FF4A 4ZVEA 4WKRA 4IG0B 3SI8A 2QIFA 2Q6BA 1N32F 2CVEA 3DLEB 3U1MA 4ECQA 4FBUA 4LQ9A 4K4ZA 2BQUA 2K1RB 3NBPB 2MKKA 2HG4A 2WCXA 3GB0A 4MK8A 3PIPQ 2DGSA 3DOKB 4B3MF 2CFXA 1TL1A 2W8LA 3KWMA 1CSJA 4KV8B 4ZCIA 3NCRA 1RISA 1C0UB 2VG7A 1E6YB 1JXEA 3BDPA 1S1UB 5DLGA 1LWFA 2CPIA 5J1NA 1VLYA 2DNZA 4ILRA 2OD6A 4URSA 4I69A 1FDDA 4J37A 1IKWA 5HBMA 3MEEB 2IHR1 5J2NA 4H4KA 4NZ7A 3UD3P 2UVRA 2P5VA 5KFJA 2FIUA 4H4KC 5KFAA 1Z1ZA 2B43A 2MY8A 4PR6A 2JFDA 3B78A 5KG7A 3OQ2A 5DM7Q 1HNXF 5D4NA 2R8IA 2VPYB 1P1LA 1N36F 1BQNA 4ETXA 3D28A 3NGKA 2DR7A 3M6XA 3GYNA 1NJIT 2E9TA 3H2LA 4GKKF 4B08A 3MEGB 5G4DA 4DL4A 4QU7A 4I7FA 3N6LA 3I82A 4IOAQ 3M9NB 3R1HA 3AQOA 2CQHA 2J9DE 2AGOA 5EHHA 1SH0A 5MLCV 1N5TA 2HWTA 2K2PA 4CIOA 1VQSA 3RAQA 2UVVA 1WG4A 3F44A 5CHCB 1P6TA 2RH3A 1Q86T 2M88A 2NR0A 1O8BA 1YVFA 3CJ0A 3HFKA 4R5PA 5LL6d 5D8HB 2YX7A 3T5LA 4RUHA 3IRXB 1Y7PA 3CMES 3KLVA 2LU2A 2IBOA 2L08A 5AE3A 4W90B 4K4VA 2E66A 3TO8A 5GAGI 3QZ8A 4RW9A 2FVCA 3MTJA 1HBOA 3BDEA 3OTEA 2L3MA 3E01A 4LSNB 2PGCA 1DARA 3HHDA 4O23A 4OMFG 1FRKA 2D41A 2HS0A 5GMKa 5IWAF 2B51A 2BRLA 4NZ6A 1VQOS 4G1QB 2MY7A 4IRCA 1FJEB 4Q2MA 1OPIA 3AA8A 4WK1A 1M90T 3M1VA 1XMBA 1XMQF 2R7XA 3SSQA 4ZMMA 3N6MA 5BR8F 3GV8B 1FNMA 3M05A 5F8MA 4Q5VA 3T19A 1FJ7A 3V2UC 2D1CA 2FGCA 4C97A 5DDOC 3QGGA 5LSRA 1WF0A 2CQPA 3IAM9 4X4SA 1UA0A 3ITHB 4OJ3A 2GGPB 1MW7A 1FERA 1TK5A 2LXIA 2CPZA 3MEDB 2HYIB 3KMSA 3AB4B 1X4GA 2DBBA 3PEHA </