3WX4A

Crystal structure of t4 phage arn protein
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
98
structure length
98
Chain Sequence
b'MIIDSQSVVQYTFKIDILEKLYKFLPNLYHSIVNELVEELHLENNDFLIGTYKDLSKAGYFYVIPAPGKNIDDVLKTIMIYVHDYEIEDYFELEHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anti-restriction endonuclease
molecule tags Viral protein
source organism Enterobacteria phage t4
publication title The T4 phage DNA mimic protein Arn inhibits the DNA binding activity of the bacterial histone-like protein H-NS
pubmed doi rcsb
total genus 28
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2014-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2770 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3wx4A00
3WX4A
chains in the Genus database with same CATH superfamily
1T3NA 4NLGA 2L08A 1O8BA 5DO2A 2DR8A 2M8DB 4DR1F 3G6YA 2XSJA 2VF3A 3AA9A 4K0KJ 1FJ7A 1IM6A 1R8HA 1RAEB 2BEFA 2QA1A 3IFEA 5KTQA 2LXFA 2ZD1B 1RTHA 4ZCKA 1U2CA 1PC4A 2VPYB 3KNGA 4KV8A 4NEYA 5I3UA 1Y11A 1DTQB 3DI6B 5EN1A 1HLWA 1P8GA 2HBRB 1VLYA 3NCPA 2I0XA 3CCRS 3GFZA 5KFFA 2YX7A 3VQTA 3U1LA 4Y0FA 2V2QA 1B3TA 1HNXF 4LFAF 2DT9A 3TUZC 1U09A 3BKTA 5DG8A 3BN7A 1U4BA 2RQ4A 1OPZA 4K2XA 4CLSA 5L1KA 2BACA 4IDKA 4NYZA 1P27B 2KT5A 3HLUA 5T41A 2C22A 2FIUA 1NPRA 3P3DA 2JEGA 3FQKA 3M2UB 2NR0A 2H51B 3W8GA 2ZWPA 2NPIA 1F3VA 3BGLA 3GU0A 5GVQA 2D3UA 4PXCA 1HWKA 2ZFHA 2W9AA 1G1XA 4BBYA 2DNPA 2WVFA 1ZM2A 3KJNB 4USUA 3MXHP 3QQCD 5BXIA 3CDWA 3IS9B 1MMDA 1L3KA 2QX0A 3BGUA 3CJ5A 4ICLA 2XS2A 2IJRA 4H4MB 3D0GE 2IJFA 5AXMA 3ZO7A 2BBEA 1MMLA 2KM8B 5DGAA 3CUNA 2DNQA 1RTHB 2E5JA 2BQ3A 1IKWB 3AJDA 4KAIA 2FPHX 1Z4UA 1FRLA 1R27B 1XIQA 1OY8A 1RTDB 3D6HB 1R8CA 2H3EB 2VKZG 1CQMA 1C1CA 1E6VB 3HKZD 1IN0A 5H9FK 2I9SA 3VGTA 2MQOA 5DRKA 2J9CA 2OKQA 3DLKA 3DOLB 3OUYA 3JQJA 4HDHA 4ALZA 4DF4A 1UJ6A 3MM8A 4KYZA 4QWBA 1X0PA 2AW0A 4R8UA 4F67A 1DBDA 3QAEA 2RNEA 2AEFA 1S9GB 1OY9A 2G2ZA 3MPUB 1HQEA 2O01C 1MWZA 3DLEA 3GIRA 1DLOB 1T9XA 2A3JA 2QSFA 5CYMA 4DL7A 1EKRA 3MEGA 3CCWA 4AQYJ 2MJNA 3ILJA 3C15A 1U6ZA 3LUYA 2NLWA 3MR7A 2FHOB 3K8WA 4FNIA 5KFVA 4CTAA 3ULHA 2G0JA 4OX7A 2ZE2A 4DCOB 2CG4A 3CD7A 5KFGA 3K59A 4ZHRB 1J5EJ 2FUG9 1TKDA 4LF4J 3AJ1A 2GQ2A 3SV4A 1UPPA 3PW7A 3GE9A 1J5OB 1MW7A 3MI7X 3T3FA 1FVSA 1HQUB 2KG0A 3NG8A 2QJ3A 3LP2A 1FRKA 1U8WA 4K59A 3HSDA 3IG1B 3HVRA 1ZOTA 3VAIA 5DLFA 2DCLA 2F8MA 4HI1A 4LR8A 1UETA 1WEYA 1SH2A 1RWXB 3AJ2A 4UOHA 4I56A 4LJMA 3NRBA 3QGPA 4IOCQ 1T9WA 4QU7A 4TLRA 3OLBA 1ZETA 1UW9A 3BEGB 4DR2F 5ETOA 9ATCB 5I42A 5DG7A 2AJFE 2EVZA 3AXMA 2RQCA 3QYYA 5CYMB 5H9FJ 3IP0A 1NAQA 1GMUA 2B9EA 1S1VA 3PYEA 1KVJA 2XY7A 4LVNP 5FIIA 4X65J 1JKHB 3NNAA 4NPOA 1JK9B 4TN2A 2G0IA 4HH1A 2FB0A 2HLUA 2FTRA 2HKEA 2PD1A 4NRUA 5C25B 1FXLA 1KN6A 2GW8A 3VF0B 4O0NA 2B8PA 5D3GB 1SQFA 3UD5A 2HRUA 2WW8A 4KBIA 4K4XA 4DR1J 1B7FA 4LF7J 2RHQB 4M5NA 1RYRA 2D69A 5BJRA 3GJTB 1P1TA 1RWPB 4CDIA 2W7PA 4ECQA 4I6AA 2CWXA 5KOWA 1EQ0A 1SJFA 3PW5A 7AT1B 1FK9A 3JQMA 2VG6B 1RT7A 3W66A 2VA2A 2B7CB 4QR1A 1CVJA 5HMWA 4EYIB 1QVFR 1IWGA 3HVAA 2J0SD 1RKJA 4NXNJ 2HPUA 3WX8A 4C9DA 4M5MA 4USMA 3PX6A 5DDOC 1N54B 2CYYA 3MMCB 1ZTTA 1S99A 4DL6A 3KUGA 4V19J 2PC6A 2JL9A 2P9CA 4PG4A 5CQGA 1K1QA 5K8PA 1OJ4A 3H2LA 3IO1A 3ZZ0A 1IKYA 1YX2A 2VBYA 3IRWP 1ZS6A 1XBWA 2Y9HA 2UUCF 1FO1A 4NMLA 4CNZA 3OL6A 5DM7Q 1YKWA 1NSKL 3EPIA 4OLOA 2J9DA 4OZ0A 4WIQA 3DLLQ 2XS7A 3KDOA 1XR7A 1REGX 3ZZTA 4ZOSA 2O5DA 4CI0B 1FE0A 1JLQB 1UEVA 1B99A 4RUHA 1ZAXA 4QW8A 3TZXA 3OL7A 4ECXA 3DU6A 2DRBA 4LQ3A 1W26A 3RBDA 1FTRA 4J91A 3R5BA 4BWMA 5EHHA 2Y0BB 3BO4A 2XNRA 5E0OA 4X4SA 2K8GA 2R7SA 3O6QA 1G4CA 2AWZA 2CQBA 2YQ0A 4QWEA 2JVRA 1LFWA 1D8YA 3QMQA 1NHKL 3J7YI 2YVSA 4LF6J 2H9ZA 1FNXH 3GSDA 1I5OB 5F41A 5T14A 1RWNB 3ILIA 4QR2A 1M5PC 2HWTA 3VV2B 3ENVA 1U1OA 1X5PA 2MY8A 1KD1T 4LREA 4CM2A 3AB4B 3LP2B 2GQCA 3TZWA 2XI2A 2R8GA 2ZHBA 1LWCB 4DV3F 4L72B 3DLBA 2JJ4D 4OYBA 4C6AA 3BSOA 3GIMA 1LK7A 1WTBA 1I94F 4Q7AA 1Q78A 1DARA 4P2XA 2CNKB 1RAGB 4PCQA 2QT7A 4RUAA 2FHMA 3LANA 4YR2A 4AL6A 3QGHA 2ZH9A 2FZGB 4OIXA 3T6JA 1AFJA 1JLFB 1SJ1A 1RT2A 4YHHJ 3CJ8A 4DQSA 2BYCA 4ECUA 5KT7A 3J7Z5 3RRHA 2HZCA 4M8LA 2DK2A 1TUWA 3MECB 4DX6A 3TZZA 3UCZP 2EKYA 1TVRA 1Q1KA 3DNCA 3NMRA 3BGFA 3VAJA 2C3OA 1IQZA 3D6MB 3PYGA 4WFNQ 1N52B 1RHJB 3OHAA 4DS5A 4ELUA 4ECTA 3HVWA 3MEDA 1M1KT 3K0JA 3D66A 4DWIA 3DLJA 3PJWA 3UDEA 2CJYB 3R1HA 4NA1A 4L6V3 1ZPVA 5AT1B 2RDIA 4ER8A 3I4HX 3IR5B 4DX8H 2HWIA 2MZRA 2OMOA 4YQWA 2HK2A 1HNVB 2QSWA 4WTYA 5B0AA 3PG9A 3Q8YA 2QO3A 4F3QA 2CPXA 1F5BA 3BM7A 3TI0A 1YJUA 3LA0A 2OD4A 3V6KA 1TU0B 2PT0A 2DGWA 5DDQC 1UFWA 3JSBA 3SBMA 4OZJA 3ISNC 3HVTB 2IMWP 3D54A 4XAKA 4OZ3A 4USIA 4DR4F 1SJRA 5AXLA 3NEKA 1KHWA 1SIZA 3OV7A 2RSQA 4OZ2A 1SKWA 2HQIA 3EXCX 4UUXA 1KRPA 4JB8B 5J2QB 5E5NA 4JUZA 3LGNA 2PI5A 1NSPA 2R9LA 1SH3A 2FLPA 5AE2A 5L38A 1VMBA 1PBUA 3DRRB 2W2OP 1W7WA 1WORA 4JI2J 2IBOA 4OX9J 1WSRA 3GWCA 1RT6B 4B3TF 2VBXA 3DDNA 3W65A 2XCPA 2AGOA 3N6LA 5E7OB 2J7KA 1K0TA 1ZAWA 2IC3A 4BLGA 2PMWA 4JI5J 3W9IA 2GVZA 4PQAA 2HS3A 2YNGA 4QPTA 4ZLNA 5B0DA 3W63A 1YBAA 2GZOA 1BQMB 3DC2A 3HDSA 4YB6A 3SCLE 3MURP 4LBPA 2FZCB 4ES3A 2YNHB 2KXFA 1K1SA 2NXUA 1OIAA 5LXRA 4J9KA 1DTTB 3SSQA 2KVIA 5KT5A 1PAUB 3RW6A 2D7SA 2CADA 5A8KA 7FDRA 2C28A 3L7UA 3Q89A 1DFDA 1KONA 2C2EA 3SSRA 3SEOA 4K4SA 1WG1A 4MJKA 2CNLB 1HNWJ 2R8KA 1S1VB 1S79A 5E3RA 1YHQS 1D09B 3AOAA 3PIPQ 1NDCA 2BABA 1JNZB 2UUBJ 3VZHA 3VAMA 3W7BA 3HZEA 2ZZNA 3PJXA 3V6DA 2OMLA 2E9TA 4JOUA 3HFVA 1X4GA 4L3NA 5CAAA 5DZ6A 1S0MA 3OTCA 3SCKE 2ILYA 4GO7X 1G6BA 2HVZA 4OI3A 5HQ8A 3GIIA 4O4GB 4P2FA 3V5RA 2CQ1A 3ZTOA 1FD8A 1RT7B 4ZK7M 2XO6A 4L74A 3DFEA 1SV5B 2A0FB 1Z2ZA 2PA3A 2RS8A 3AODA 3ZZUA 1BWVA 4ZCMA 4FPIA 4CLUA 5GAGI 1T05A 3NOCA 1WWHA 1JLCA 2NREA 3KNAA 1HYSA 4C2MA 3T1AA 1KQFB 1QJHA 2CJ9A 2N82B 2KU7A 1TV6B 4OJ3A 3KYLA 4U9RA 2DHAA 1PJ6A 1UKUA 3FMWA 3IWLA 4IFYA 1WOSA 2PFDA 3NGUA 1Y5LB 1GXTA 2B8QA 3LPEA 3M32B 3TAPA 2F3JA 2CXEA 2BX6A 1WEZA 2Z2ZA 3H5SA 4G1PA 2BRKA 3ZZRA 4TU7A 3WC2A 2GC8A 1TKTB 3KTQA 3M1VA 4ZJQA 2FGCA 1S4EA 3MCNA 3FZBA 3NOGA 4H4OB 5FDLB 3DLKB 3DOLA 4KGMA 1UWBA 4Q5VA 1S1XB 4TNOA 2FYXA 2QLFB 2BJDA 3FBFA 3P6YC 2IFXA 4ECZA 1QAXA 2BM0A 4ELTA 3E8OA 3O3LA 1WF2A 2HQ3A 4F26A 1JXLA 2DIVA 2ZOFA 3MM6A 4KGXB 4E2FB 4ZITA 1Y10A 1NSAA 1U2FA 4X84A 3T1YF 1FFGB 5KT6A 1HPZA 2POKA 4RW7B 5D78A 1TUGB 4RBTA 4DSLA 2OO4A 1RHRB 1R8BA 1RT4B 4FPRA 3R7NB 3L7OA 2ZDPA 3U1NA 3FQLA 2I2YA 4B9UA 1Q8BA 4IRKA 1ZH5A 3G6ES 2UU9J 3R9LA 4UOGA 2HIQA 2M9KA 4FS2A 2ZUGA 4LT6A 4PKDB 3ITHA 3S7RA 1O51A 2IYGA 4LMZA 3M2UA 3G6XA 3THVA 1SC3B 5DZ7A 3IBCB 2DBBA 2WTFA 4P7TA 3MR5A 2IM0A 5D0EA 1C4CA 2WVBA 2YKAA 5ETRA 1GT8A 5J1EB 3T5LA 1CJUB 3OTEA 4DFKA 1T05B 3UN3A 3M8RA 2ZDOA 3OXGA 4C8MA 2LCWA 1KKHA 2CPEA 2LU1A 2CVIA 4MTPA 4HTJA 4C4WA 2BKOA 4RWXA 4F50A 3PR5B 3QT6A 3OR2A 2EK6A 2FJEB 1HWUA 4ED8A 2CQ2A 3NS6A 5HQLA 4K4ZA 2HNDB 4EUVA 2DRAA 2CKWA 2B6AB 1H6KX 2M4MA 4ZVPB 1VQMS 2WBRA 4PXBA 1KQGB 4ZPAA 5A0YA 3KHLA 4ES1A 1TKXB 2PMZD 3M8SA 1JLBB 4EBCA 1Z2LA 2YNFA 2NPFA 1FRJA 1I51B 5CCMA 1U47A 3PHTA 2XWXA 3D1QA 2KI2A 3G8TA 2VV5A 1XERA 1ZM3A 4CZCA 3IM9A 4NE9C 3DOKB 1BY9A 4KPCA 1RTJA 4X62F 4C11B 2HGMA 5ETPA 2C3YA 1TFWA 3IN5A 5I3QA 1AA1B 4DZDA 1NJWA 1VBXA 4FXWA 2B4VA 2OPQB 3AD7C 5LM7E 4ZLJA 2HVHA 5LXYA 1Q4RA 3D1OA 1B64A 3NS5A 4URQU 4USHA 4OI4A 2R7OA 1LW2A 1S77D 4ZJOA 3IR6B 3GQCA 3LPYA 1Q81T 5KFXA 1QLNA 2V2KA 3RU0A 2DHGA 1WC4A 3GJQB 3PKYA 3N5FA 1HBNA 5BR8J 3QIPA 2AYGA 3GR1A 2WW4A 2MSSA 2YWFA 3DXBA 5J2NA 2AF6A 1N34F 4NXNF 1VRTB 4PG7A 1IBMJ 4C0OC 4CQ1A 3MOJB 2YTCA 1Y00A 2KB2A 1HBUA 3B4DA 4TVAB 2Y8YA 2X3GA 3QT7A 4PR6A 4RNMA 1S1TA 4NLWA 3CO0P 1FRHA 1VQ7S 4UOFA 5KFYA 2GS8A 3N01A 2VUGA 4KH1B 4HYKA 3ISND 2RMLA 3KJFB 4B3MF 2GO8A 1VRUB 3ILOA 4A8QA 4BDPA 2GX8A 3OL8A 5H9EJ 2E7VA 3M8QB 6FDRA 1H7WA 2V2VA 4AT1B 2XGQA 2AD9A 3NNHA 2OH2A 1LK5A 1Q53A 1DAXA 1JIHA 5GADU 1D1UA 2MZ1A 2JZ5A 5L46A 2ILZA 1RA6A 3GP9A 2Q6BA 1KVKA 2PN6A 2CQGA 5B0EA 2QLJB 4CLLA 1BQNB 2V4RA 2IRUA 4UZCA 2JDJA 4X4UA 3DM2B 1VLOA 3BGRB 3PFEA 1HQEB 3DLEB 3V2UC 5GAGU 1OWXA 2C3MA 2N3OA 4B3OB 3M2RA 2DGVA 5FLXY 4LF8J 1WKJA 4TU9A 2E5LJ 2NXCA 3A12A 4DR2J 1C0UA 2J6SA 3LO3A 4B9MA 3QJJA 3F41A 4UY85 1IUJA 4O3SA 5IM0B 4X64J 2QFIA 2OEMA 4IRCA 1WI8A 2IM3A 3CJ0A 4RU2A 1YBTA 3Q0AA 4ED2A 3UDVA 3CCUS 4IH7A 2UXDJ 1ICEB 4KSEB 5KG3A 3MM9A 4B3MJ 3K5LA 1J5EF 2QLBB 5J2NB 2HBZB 3FEZA 3HJVA 3MWBA 2L3MA 5A2QU 1K47A 1LWCA 3VHQA 2YQ3A 3LTOA 5K20B 3HHKA 3CT9A 4F04B 3H5YA 1DY3A 3MM7A 4O4GA 1AFIA 1U8SA 1U0SA 4DV1F 1VYAA 2E9RX 1XR6A 1H38A 2HW3A 3HK2A 1IBMF 3SV3A 4IDKB 2RD5C 1N34J 2VC1A 1M1GA 4FKYA 3EICA 1KBRA 3AD8C 3VVUA 5BR8F 5HJYA 1NDLA 1CJKA 4NLTA 1NJZA 3DRRA 4RWWA 5DQGA 1NZ8A 4KHMA 1FKOA 2D3OR 4E0DA 3G8SA 4CH1A 5BYSA 2Y1RI 4U6PA 2EFQA 3CMAS 2QG9B 3FMBA 5T7LB 2JWNA 4LFAJ 1KS2A 2LU2A 1XJWB 1JLQA 1W25A 4ZMMA 2WONA 4FZVA 5G4DA 2V34A 4YS2A 2KJWA 1QSSA 5THWA 4M95A 2V4JB 2VHGA 1UPMB 1QVGR 4A46A 1NMEB 2V63A 4QOTA 5JMNA 2QFJA 2XBPA 4A8YA 2F40A 1EP4A 2FJAB 4P2MA 4CO1A 5B08A 2KJVA 1S9EB 2HBYB 5IXUA 4ED0A 2ATLA 1NB7A 3DYAB 3OR1A 3PX0A 2ROEA 3AXKA 4GO5X 4DUZJ 4TKTA 4DX5A 5LJ3Y 2QTWA 5LSRA 2MZTA 2KYZA 3EVOA 4DMZA 4C48A 5CZXA 2LFVA 3H20A 4DG1A 5ETTA 2R2TA 4JYAJ 3AQPA 4I2PA 4N8NA 3RB4A 4JV0A 3G96A 5F0UA 2MKYA 3NCQA 3ZNJ1 4O3RA 2OPSA 3CD0A 3WX4A 2KYXA 2BRLA 2CWKA 3N5BA 3ICLA 1WHYA 3I31A 1F5AA 4YY3J 4IO9Q 4DBQA 2WB1D 1S6PA 2X51A 3P5BP 3M2VB 1ZZNA 2HHVA 2Q66A 4V1Ak 2VG7B 3W2VB 4CTAB 3U1MA 2YKMA 3VAFA 1CULB 2J9DE 2CNOB 3CC7S 2DNNA 2UUCJ 3O2IA 3KK2A 2VBZA 4OV1A 3CCMS 3PZPA 1N5QA 2CPYA 1X5OA 4HI2A 4CYUA 1HIYA 3I4PA 4WKYA 4DV2F 1SI9A 4K4WA 4AQYF 4PPDA 3A1YG 1PC5A 2GHWA 3G87A 5K5MA 2YH1A 1FJGJ 3I5BA 4WFYA 4R0EA 3KJQB 2GAHC 1RWKB 2DNRA 3RBZA 1YK9A 1IR2A 2HBQB 1B70B 4WFZA 4GMKA 1KFDA 8AT1B 4DFJA 5IT9Y 5KFUA 3DRPA 2HNDA 2KT3A 2GIFA 3KLFA 3POTA 3JYTB 2RILA 3VGVA 5JXSA 2G9OA 2HFUA 4LSLA 1PGZA 1UWBB 1LWEA 2MKJA 5A8WA 4EWTA 4USKA 4Q43A 5DETA 3MAAB 2QYCA 4F02A 4YUDA 2AT1B 5J1PA 1YI2S 2JLEA 3EVMA 4OI1A 2OD6A 4BHQA 1N33F 3EGVA 2DH7A 1CJTA 2DEIA 2HFOA 1NHUA 3I0RA 4PWWA 4WK1A 2OPRB 1XNRJ 3M6UA 2GQQA 3SDEB 5IT0A 4DS4A 2DD8S 3DRYA 2B9XA 4DPUA 4UTGA 5KG5A 2W25A 2JEFA 4U7UD 3C6UB 3OL9A 2RF2B 1TQLA 4DJBA 1WC1A 4LQ9A 2DCUB 2FVRA 4GKJJ 3ZZZA 2IDLA 5AE1A 3FZ2A 5AE3A 3THPA 1HARA 1WUUA 3E01B 3DYAA 1C4AA 3QRRA 2K7JA 4KKOA 3EDRB 4ENOA 5C42B 1VC0A 2BMBA 3THTA 3HSGA 3QPIA 1P6TA 2R3VA 1ZPWX 3IGVA 3OTDA 4U7UK 3RW7A 5F9LA 3CCLS 1DTQA 3DI6A 2E1CA 4B3RF 4DLGA 5K8NA 4HVZA 4BC9A 3MHYA 4F3MA 4RNFA 2V4JA 1RGVA 4G1QB 2XLJA 1QDUB 3SZ2A 1H73A 1XMQJ 1TZ0A 2UUBF 3AH6A 4I64A 3I5AA 2H4WB 4KFBB 4F4XA 3ZFVA 3P5TL 3V6DB 3BYPA 2DGUA 3GB0A 3OJSA 1YJWS 5KOXA 4JI0J 2PEBA 1RSCA 3VCDA 1OSCA 2AZ3A 2F8EX 3BSCA 4HACA 2M5YA 1RU1A 3QZ8A 3V81A 1S9FA 1U24A 3CXCR 2IAJA 3CJKA 1VFJA 1XC9A 2V50A 2K3KA 4MMOA 3US5A 2WB4A 3VZIA 1M90T 1IM4A 3LGMA 1RBOB 3RRGA 3I96A 1FDDA 1VIXA 1IKYB 2CJQA 4ETZA 2PMHA 4ECVA 1CJVA 1NK7A 3MR6A 2RRAA 4B9SA 1JWWA 3TVKA 2EFOA 1WKLA 3TQEA 5ETKA 5LMNF 4JI1J 3E01A 1VR6A 4I7FB 3PYFA 1HMVA 4PXDA 1JX4A 2OJ3A 4C8YA 3QLHB 4ZA1A 1N8RT 4CO0A 1HWIA 1UFLA 2YX4A 5GMKa 2H5JB 3KFWX 3MEKA 4KIAA 4DZ6A 1CPZA 4JP8A 4J7CA 3PV8A 4X4OA 4D3GA 1WF1A 2V8PA 3JAMY 2LKZA 1MU2B 3CNQP 5D77A 4J9LA 2JFDA 2VONA 4K4UA 2KRRA 1QM9A 1S6QA 5KAKA 1UJ4A 2XZWA 1FJCA 4EEYA 4JV5J 4V19X 4A48A 2RIJA 3TX0A 3V81B 1OMSA 2KH9A 1I6JA 3MMBB 5D6GA 2JEIA 3HO1A 4NEZA 4KHRA 3HFKA 2OUGA 3IRXB 3UNGC 4KHPJ 1CBKA 1OQ3A 1PJ5A 3O8WA 1NDPA 4MYUA 1RKIA 2ZE2B 1WG4A 1IKVB 5F8IA 2NUUG 4ANEA 4K7QA 1YGYA 2AHOB 4C0HA 4OZ1A 2ZZTA 2YWWA 4DV0J 2BOPA 5KFBA 1A0OB 4QZVB 2N7CA 2XY5A 1PYSB 1MG7A 4CT9A 3SQOP 1L3UA 2GMHA 4XDDA 3PKMA 2FGOA 3QFWA 4OYZA 2XG8A 2V69A 4DXLA 3B6BA 1BC6A 1O0PA 3I32A 3PDNA 2EKNA 1YLXA 4AXJA 5EGYA 3NCRA 1HNZJ 2ZJRQ 1K73T 4LUBA 2E5LF 1N5SA 3BBCA 4JI7F 3C6UA 3MEDB 3V4IB 5JJBA 5K9FA 1PCAA 4DCJB 3J80Y 2Y1JA 2AYBA 4FF3A 2DISA 3TUJC 4TY8A 4MH8A 3BO2A 5J2MA 1XR5A 2Z2YB 5L39A 4FN5A 2MJUA 5AJ3F 4BC7A 5HL7Q 1T03A 2ASYA 3DU5A 2P9GA 2I38A 3D0HE 2KHCA 4I2PB 4I68A 4WTOB 1YZ6A 1XEZA 3TVZA 4XPCA 5AJ3J 2KTQA 4A8WA 4CNYA 1NJYA 4IQXA 3QO9B 1U02A 5F8LA 2C2KB 1I94J 2LXIA 1GTHA 3I9V9 4KQZA 2CQ3A 3S8SA 1Q8KA 4M1KA 4NLDA 3MUTP 5EDWA 1HNZF 3D5MA 3HSZA 1W2IA 3HP6A 1G2EA 3IAM9 5KG6A 5AXNA 2C1EB 5M2RA 1KHVA 3FVYA 3K2YA 4O23A 3T9NA 2EFVA 2KL8A 3A8EA 3BSAA 4ANCA 3CCTA 2AJ4A 4OYPA 5IQ6A 2F5GA 2HNYA 4DV2J 4DU8A 3TA1A 1HNVA 3WQPA 1S97A 3EE3A 4NZ6A 2JSXA 4ED5A 3RG6A 4ED3A 3EZUA 1R3NA 3OTOJ 3TW0A 3TANA 1HHTP 4PWDA 3EDQB 1GEHA 4QCLA 4YB5A 2HURA 2QIFA 3GMGA 4KHPF 3D7SB 2AQ4A 2KFZA 4DDFA 4EZ9A 1HR0F 2EI5A 3F56A 4H54A 3SDEA 2MB0B 4J5OA 5D3GA 3K8VA 1URNA 1HBMA 2EFPA 5KFSA 2KO1A 2HMIB 2DJWA 1LWEB 5A8WB 5E3PA 3UCUP 5E41A 1S6UA 1JMTA 2VU5A 3OTBA 3I55S 4F4WA 1LW0A 2BKPA 3KLIA 4WYLA 1YG0A 2YWHA 2KXHA 1KTQA 4ZLPA 2ZH4A 1DRZA 3PACA 2DR9A 1R0BG 1TL1A 3EUNA 1LQ9A 2NXEA 3MM7B 3Q2SC 4YB1P 3A3OB 1OPIA 4RNOA 1M5HA 4ZP8A 2G4BA 1NO8A 3FK4A 3TJ8A 3BO3A 4UQGA 1YTYA 4P6QA 4DEZA 4PG8A 3OFHA 4NMXA 4F4ZA 3GR0A 3CIZA 4DR7J 2B5JA 4ZPTR 3C6TB 2PE8A 2O1PA 3ZC4A 4CRJA 3HT3A 3GLJA 4JI1F 2X3DA 1AZSB 4QYZJ 2AEMA 3VAHA 2EXUA 3RR7A 3C16B 1OY6A 2M70A 2YY3A 1VQNS 4ED7A 3WIUA 4B9VA 3C8YA 5CD4A 1U1LA 2OLWA 1OSDA 1HW9A 4PAAA 4RW7A 2NZCA 1MMNA 3PRDA 4UF4A 3OVAA 3CPWR 1RDRA 2CPZA 1RK8A 2VL1A 3QFHA 4G65A 2DPIA 3RRKA 4F2RA 4RLEA 4EZ6A 3AFGA 2VOPA 4LR9A 1WHWA 2IY5B 3UE2A 3FJ2A 4ZPDA 4ID8A 5KFRA 2W24A 4Q0BA 3QWUA 2H5EA 4RKUC 3QWPA 1XMQF 2GGPB 2UVVA 1BUXA 5FDLA 1ITPA 2E1PA 4OYAA 4RW4A 4X65F 1UVLA 2Z57B 2QA4S 1SJQA 2B0GA 2HHQA 1WJ9A 1NKEA 4CO2A 3D2WA 1EAYC 5HVGA 1BE4A 1YIJS 5CYQA 1WC3A 2BJ8A 2IJNA 1EP4B 1C1CB 3MD1A 3O5TB 4P73A 5DS7A 3J7ZT 4ZVOB 2W9BB 3DGPB 1FD2A 4N41A 3CF5Q 4PUOA 2VQFF 2WRMA 1DHMA 2XC9A 3HHLA 1LW0B 4P75A 4AFFA 1X5SA 4R5PB 3LWLA 1H3DA 3QRPA 2KKHA 3PFOA 1U2RA 2FC8A 3OHBA 4QYZK 5D0HA 3VGUA 4B17A 3M30A 4ZS6A 1N33J 1QUVA 2LLZA 4LF4F 2EFGA 3ZTPA 4A8FA 3KWMA 4F0HA 3J7A1 2DGXA 1HWJA 3GYGA 5DDRC 1RZMA 2GFFA 4NYOA 1IWAA 3A3PB 7FD1A 2HFVA 1ELOA 3LAKA 3OFEA 4CLTA 3O44A 1EZZB 4P10A 3MUVP 3VVTA 3OQ2A 3VALA 1KNZA 1LW2B 2FD2A 4J9QA 3CJSA 2VJUA 4GKKF 5C5JA 4FKXA 3R5JB 1U1PA 1KEKA 3T1HF 2QC3A 2CFXA 2UZAA 5HVHA 1S1WA 1SPBP 1FKPA 1XN9A 2CQDA 3BF4A 3B54A 1S0VA 4OYXA 4P7VA 4C8LA 3KK3A 3ET6B 4MIAA 3DXSX 5B7WA 2QEXS 2MKHA 4CYUB 3QJPA 4FYDA 1A9NB 2BW2A 3G71S 4Y28C 4WKRA 1FXRA 1DTTA 1B7YB 1GMWA 1UZHA 1MWQA 2RVJA 1FWLA 3IS9A 5AXKA 3HSJA 4OHVA 2XMAA 5CXTA 3BBFA 4ZVUB 1XNQJ 2XS5A 2DR7A 1SKSA 1WTFA 3CIMA 1KP6A 3Q83A 4NZ0A 3PJ9A 3OXLA 2R7RA 2RF2A 2MLXA 2VB6A 2UXBF 2IC3B 2K1RA 4HH0A 4CWBA 3KHGA 3UWTA 4IG3A 4UUWA 4JV1A 3DRSA 3W2WA 1NB2A 3A8KA 3G6VA 2F65A 3EGNA 1HHSA 5F9NA 3MPVA 3EWGA 4DPOA 5DQIA 3NGDA 3T5JA 1RHMB 4JYAF 2ZC4A 1RCOB 3D28A 1UEUA 1JLEB 4UT4A 5KFCA 4RUCA 1R0AA 2MKSA 3QBCA 3KJVA 1FDNA 3H90A 4ZDNA 4HHHA 3C15B 4EFAC 2KZZA 4XK8C 4C7QA 2ZWOA 3BGOP 5IV4A 4ZVEA 2FVSA 4W4MA 2HHXA 4DSJA 1WI6A 1RUSA 4RU9A 1LKZA 2MTLA 3R7SB 2HVIA 4ZKAA 1YJ7A 4KT0C 4WXWA 5KT4A 3FKBA 2PO4A 1NPPA 3N79A 4M5DB 5KFWA 1C2PA 2VODA 5HK4A 3WZ0A 2NZ4A 5LSOA 2JOQA 1RTJB 4HR2A 1VK3A 1BHNA 1F9FA 1FEEA 5B0GA 4J9UE 3TUPA 3FDSA 1SKUB 3L7PA 2DTJA 5B0FA 1TL4A 1CULA 2MQNA 4B9NA 5FD1A 5KG4A 2YH0A 4USJC 2C42A 1TELA 1SKRA 1RI7A 4UW2A 2E7XA 5KFTA 3ZZPA 4BCAA 4C98A 4FBUA 4JI8J 2DKOB 4NX9A 4U96A 4DUTA 3H5UA 1VQPS 1YJNS 3JSMB 4GC6A 3JTPA 5KFKA 4NASA 2M0GB 2DNLA 1PIEA 1VCTA 3MF5A 4DQRA 2LDYA 4A8SA 4F36A 3C46A 2E9ZA 2ZJPQ 4X66J 4K4YA 4DR3F 4K50A 3BR9A 5C24A 2DR6A 4HT5A 4ITSA 3MPWA 3KOAA 1DQ8A 3Q24A 3W3SA 2W9CB 4B3SF 4LF1A 2KDOA 3FRZA 3TJAA 2RS2A 3WHIA 2D74B 5L1IA 1GNKA 4J9VA 1DQ9A 3IWXA 2HZVA 1X4HA 1JLCB 2VICA 4WPAA 4MKYA 3DGVA 4Y3CA 5B0CA 5DDPC 3M6XA 4YP3A 1VQ6S 1VRUA 4NZ7A 3H2VE 2UXDF 1Z1ZA 3D1HA 1YWXA 4U7CA 1FDAA 2J0XA 2UUAJ 2XI3A 3B82A 1H0HB 1UJ5A 5B09A 3CE8A 5KFMA 4X64F 4NI2B 5A8RA 4CO4A 3H5XA 1P1LA 3NBPA 3MTJA 2LP4A 1NDKA 1FVQA 4NLRA 4MFBB 3MUMP 2R2RA 1CS4B 4DR6F 3DMJA 1XQIA 2CZVC 4UOCA 3DLGB 2RKIB 2MGZB 4KH0B 1G7CB 3HHNB 3QIPB 3M2RB 3HD1A 4YMEA 4B3OA 5F8GA 1JJHA 1TL3B 5HLFA 2Z8QA 4AXIA 3X1LB 2V8HA 2ABYA 4B08A 3KLHA 5KFJA 4DN0A 3NGKA 1HBOB 4HLBA 4NCGB 3PXGa 4IKAA 3K58A 1S1UA 2D41A 3NGRA 4YDDB 1NM2A 5KG7A 1QTNB 1QSYA 1N36F 2IPOB 4Q2LA 2ADBA 3VAGA 3GG0A 4NA2A 4Q2MA 4U95A 2MKKA 1URRA 3G82B 1UFKA 3R97A 1FTCA 2HEKA 4FVMA 2F1FA 1Y5NB 2J0WA 3M30B 2VC0A 4CM0A 4QWDA 1QAYA 4M5JA 2Y8WA 1IBCB 3JB9k 2KZMA 3J7AN 4QR0A 2XNQA 1LWFB 4KO0A 4J9RA 2IMOA 2KT2A 1Q82T 4NLPA 1ZA1B 4UY8T 1Q79A 3KUHA 4G6VB 4I69A 1GFWB 2DNYA 1S1XA 2OP5A 2HMIA 2FC9A 1Y7PA 2G13A 3DRPB 1RT5B 5ETQA 4WCEQ 2WAQD 1TUVA 2F63A 2R4FA 2DHSA 3T9ZA 4MKVA 2DGSA 1X4AA 2I8EA 2DNGA 2JC1A 3R5GA 4JI6F 1MN7A 3CDEA 3F0NA 3A3NB 1EETA 1E6YB 1PYOB 3C16A 5DQHA 1RYSA 2CZ9A 2M88A 1X5TA 2YNIA 1MROA 2EFNA 4QWAA 3W5ZA 4N8OA 1FT8A 2YNHA 2FHJD 2F4VF 4Q45A 3TOQA 1P9QC 1F9EB 2OI2A 5D0RA 4C8OA 5GADI 3M8YA 2C2MB 2PEHA 1JLAB 2CJKA 2YNFB 3L4BC 5KFOA 2JEJA 3GCWP 2PGCA 4WFBQ 1S12A 1SCJB 3C3LA 3UFCX 2EBEA 1RT3B 2N4DA 4M5HA 2XO7A 4DUYF 1IVZA 4L3KA 3TAMA 2A1BA 2XMWA 3N0VA 4NLVA 3VQSA 3W8PA 3D3CJ 3AA8A 1CQNA 3EX7B 1R0AB 1IKXB 2CG8A 3C6TA 5DG9A 2V5HG 1N56A 3TNVA 3QJLA 5F8NA 3K17A 4RW6A 2GNKA 1VRTA 2A6MA 1RT2B 3K5PA 4OHXA 4EO8A 3QZ7A 2IYIA 2CJAA 1UMJA 2W8KA 4QIVA 3NAIA 1AUSL 1CJUA 3OR1B 4XDCA 2UV8G 3Q8QB 2QA4G 1RT3A 1SBRA 1REVB 1TL1B 3CEDA 1AROP 1RWWB 2E44A 2HYIB 5HVFA 2IM2A 2NUHA 4QPXA 1LXJA 1Q95G 1S59A 1WSVA 2DO4A 3CB4A 3RB3A 4RPFA 4M5GA 1HR0J 2CQIA 4RO0A 2QA2A 2I5JB 4RNNA 3OSPA 4J9SA 2A6OA 1T95A 2KG1A 1NCLA 4QWCA 2P6SA 4RW9A 2X1AA 5D4LA 1AZSA 3K7RA 2MQPA 3I87A 1AYEA 2RAQA 4OI2A 3F44A 1N0UA 4H4KA 4D3HA 4GVBB 3PW2A 2ZBRA 4HHUA 2AMCB 2FHKA 2ZVIA 2RU3A 1KLNA 3LH2S 1L3VA 3PO4A 4QJVA 3RR8A 1B0VA 1U0HB 2XHWA 2LEBA 3R1LA 4X4RA 1JLEA 2OELA 2RT3A 2VDIA 3FCVA 3RBXA 3GILA 5D8HB 1NNDA 2IVYA 1EKSA 1VI7A 3M4XA 4XIUA 2HZAA 2E66A 2CPJA 3HX9A 4LBHA 4EGLA 3MAHA 1T9TA 5E2QA 2J8SA 1F60B 4ZPBA 2DNZA 5A76A 2VPWB 5KFHA 4DU7A 4M63A 2XMKA 1R7IA 1UVIA 2D1CA 4LSNB 3PVXA 5I4MA 2BKNA 3Q8VA 4RL1A 1SH0A 3UN2A 4IOAQ 1FJEB 4ZP9A 2BW7A 2IVMA 4YB7A 5HN0A 1T8EA 4O3QA 2QL7B 4PZVA 3H25A 1N36J 3LAMA 2HHHJ 2VD3A 2FJVA 3HF5A 4A8MP 3CCVS 4DV3J 1BQMA 4WP8A 2FHJA 3FNNA 5A2QY 1ULRA 1FWPA 1NKCA 5CABA 4GRSA 3KLEB 4OHYA 3LP1B 1NSQA 3FBBA 2FZKB 1MLAA 1JB0C 2WOMB 1VQ5S 1HPZB 1JLGB 1VHFA 4Y00A 4UZBA 3NMAA 1APSA 3UNYA 4EYHB 2IIHA 1D3WA 4OYOA 3EXYA 2HLTA 2NXJA 2AX0A 2Z56B 4WE1B 5HLFB 3KG0A 1GX6A 4FNHA 2BA9A 2ZD1A 4FDFA 2HNZB 4Q0BB 4IH6A 4OYWA 3HPOA 1V6HA 4ZPWR 2APOA 2RRNA 1XK8A 2Z4PA 2ZOMA 3NKYA 1BQNA 4KC5A 3KKFA 5IS2A 2ADCA 1SJ3P 5ITHA 1Q5VA 5A8RB 3BS9A 1U7LA 1SUQB 2EG2A 2K2PA 3I9ZA 1OQ6A 2BZ2A 1YRUA 4DL5A 4F2SA 4OLPA 2W1BA 3LW5C 4A4JA 1KQKA 2HHPA 4Z37A 2HS4A 1FFSB 1U48A 1Y5IB 3BH7B 4I0WA 4LF9F 1R8AA 3M32A 3M8PB 4A8OA 4C0BA 4CIOA 2PA8D 1SQEA 1YRTA 3UW1A 1UA1A 2ZBPA 2JH3A 1QAIA 1TV6A 3RBEA 4M5LA 2V8VA 2CQHA 1S1TB 3IAS9 2VIHA 4DLEA 1H2UX 4I7FA 4X66F 4DR3J 1LWXA 3TRGA 1V3SA 3MM5A 3HM9A 4I67A 1H98A 5GMDA 3D6FB 4TYAA 4ZIVA 2HGLA 1CJVB 2QMUB 2K3IA 1VQYA 3IG1A 1U6BA 3I6PA 4K5SA 3PRVA 5CH7B 2Z0GA 1SQGA 1S49A 1UTAA 2RU9A 2VG6A 2V8GA 1X4BA 2H54B 2U2FA 1MNEA 2Y1LB 2X7IA 3DRSB 1EB0A 3T41A 5DM6Q 4DCPB 3M6VA 1M0SA 3JSMA 5IT9U 2BE7D 5LSLA 3NAHA 4LBIA 4TLQA 5IOLA 2ZHOA 3EM1A 2HHTA 4HT7A 2VPZB 4I4BA 2HQGA 2VJVA 3GFYA 6FD1A 4ZCIA 1HBMB 2MPUA 4IR9A 2QL9B 4DR4J 3S01A 4TYBA 1VBYA 1XMBA 2B4OA 2OAUA 2QRRA 2RRBA 4DQIA 2H1YA 2HGNA 2RQKA 2QE5A 2COLA 3NWRA 1CEZA 2B5JB 3VGSA 1F9HA 2JRSA 2MQMA 3AB2B 4B3RJ 2EK1A 2MZQA 1RABB 2FQQB 3PHEA 2OEJA 1Y3JA 2UVRA 2VG5A 4F4AA 1TAQA 3M8WA 2Z58B 4CO3A 3D68A 4DV6F 5D4PA 4DR6J 1WDDA 2B51A 4HTIA 4BS2A 1H72C 2VFSA 1DZ5A 4JI4J 1RWMB 2FLOA 4WK3A 1CSJA 2WBMA 3N4WA 3UD4P 3R27A 2DYAA 4Y2KA 4L75A 2EW9A 2O3DA 3W9HA 5C2CA 4Y6IA 1LNQA 1F3FA 1T3OA 2G1DA 2HQFA 4J90A 2EWHA 3H4DA 3LF0A 4LSZB 3UR3C 5GAEU 1VBKA 2EBGA 2UUAF 1XNRF 2NCKL 1T9UA 1S10A 1J2VA 3DDIA 3OW2R 1S4FA 2L9DA 3NY0A 3RTVA 4HACB 2K1RB 3H8YA 3M7VA 1VDHA 4YN3B 3KLFB 4DG1B 2BUNA 3ZTSA 3ITHB 2VKRA 4OYMA 3JYTA 4F8RA 1XMOJ 1VBZA 2ROPA 3HULA 3IA0A 3MCSA 1GAOA 1YZ7A 3KK1A 2CIMA 4L76A 3GJRB 1U0HA 3ETMA 4IQMA 3BREA 2ZKTA 1YJRA 2YKPA 3A4TA 1T0TV 3T1HJ 2AU0A 1JJ4A 2N4CA 2MLZA 3EYZA 1VC6A 2R8IA 3NL0A 2R42A 4HKQA 2RKIA 3HHDA 1ROFA 2XMJA 2Q6CA 3GSIA 5IQQA 2ZHAA 2YKMB 4DSEA 3IC1A 2LQ8A 4ECYA 1WELA 2MZJA 1A6LA 3H42A 3QO9A 4O4RA 5KG1A 4USTA 1S6PB 5KFLA 8ATCB 3OSNA 5KT3A 5KFQA 4EU0A 1HQUA 2ZNYA 4OQJA 1GTEA 4F7VA 5F3ZA 2Y1IA 2BV3A 1WNEA 1RWVB 2QL5B 6AT1B 1CJTB 2ZC3A 4YY3F 1MROB 2MKCA 4DV4J 2CQ0A 1RADB 4C8KA 4AYBD 1CJKB 2LEAA 2QV6A 1HKAA 1R31A 1TL5A 3N6MA 3PRBA 1TTHB 1RAIB 3GFHA 1S6QB 1EHWA 1FWKA 2IRYA 2QZ8A 4IO1A 1WDTA 4LSLB 3M8ZA 4E98A 4EMDA 2RDJA 3GCXP 2WSCC 4J9MA 3CJRA 3Q22A 3KLGB 2X1GA 1D9FA 1FE4A 2EEYA 5HP1B 1N88A 1HA1A 1NLKL 1SL1A 3SSSA 4DUZF 2MDAA 3TUIC 3QSIA 1NJIT 3W64A 1S9GA 4WU2A 1V3ZA 3AT1B 4HHJA 4W98A 3CJQA 4OJHA 1G3OA 2XYHB 2YBVA 1X4CA 1Q86T 5EWFA 1UL3A 3RJMB 1TL7B 3JAMU 2B43A 5HJXA 1CLFA 2WHOA 1WC0A 1X31C 3CVKA 2X1BA 4OMFG 3KK2B 4KGKA 3CC2S 1GMWD 2FJBB 2GVDA 1F2GA 4FF2A 5T7LA 1S48A 3K57A 3B78A 3SMZA 3MPYA 4E8UA 2LQJA 1FKAF 2PDAA 3DLHA 4JI3F 2ZKUA 1HI0P 4TY9A 1S9EA 2NS1B 3KMQA 1V5VA 2OSRA 1QE1B 1WG5A 4BWJA 5L9NA 4LF7F 4ZIWA 2OEKA 5MAOA 1TK8A 2DXDA 1XNQF 3JQKA 4U8VA 1OS5A 1L5UA 3WDOA 2CJBA 2C2NA 2P9EA 3TWZA 1KWMA 2OPSB 1RE1B 3W9JA 1HBOA 1VHIA 3UN5A 3ZZYA 2Y0SD 5IV3A 3HFZB 4CCHA 1UP1A 4I2QB 3FEYB 4OJ1A 3LP1A 1EETB 5HSPA 1TP7A 2OTJS 3E2EA 2DIUA 4GKKJ 3CCJS 3KJVB 1TL3A 3HZGA 2FY1A 2RH3A 2BE2A 3IGNA 4YDXA 1VQ8S 4ZP6A 4CLPA 3RAXA 5ETNA 4MAKA 2BXJA 3RYLA 4MK7A 2YQ1A 1M5VC 1ZBTA 1CC7A 3MAQA 3TEGA 1YDLA 1KQSR 3FGVA 5EWEA 3HXMA 4ILMA 2L41A 2ACMA 5F8HA 2BJ9A 2E5IA 1EARA 1KC8T 1SIWB 1Q8LA 5F0WA 1YSJA 3BKFA 2H48B 1RU2A 2IAJB 4IFVB 3CJKB 2GV1A 4J9NA 2GHVC 2LQBA 3T5KA 4ETXA 3ISZA 1SUQA 2WK4A 4X4QA 1HFEL 5J2MB 3WIVA 3BKUA 4IG0A 1Y0HA 1F6TA 2AZ1A 2VASA 4IH5A 4EK2A 1XMOF 4DV7J 1RHQB 4CT8A 1UVKA 3N6NA 3J81U 2VQFJ 2VFTA 4ZVFA 3MM9B 3BPSP 2CZ4A 3OVBA 1IQTA 1BGXT 3P4UB 1NK6A 4G1QA 4WXOA 2VZ9A 4TXSA 2W9CA 3TA0A 4PYDA 1K9MT 2RQMA 1QAJA 1C1BA 1CS4A 1H74A 1S1UB 1UZDA 2QMWA 2HHWA 5F3TA 3BN4A 3CJ4A 3MEGB 1WHXA 2QGFB 3PTWA 5E3QA 4EO6A 2ZH8A 3IR7B 1NK8A 3BR8A 1K44A 1NBEB 3H59A 5HI7A 4JI8F 5HMZA 5G0RB 1RBAA 4OJGA 5E3AA 4CLYA 5C7PA 4LFCJ 1FCAA 4P71A 2DY1A 1RWOB 2GO9A 4NLSA 1XTZA 4L73A 2DEJA 1AB8A 2DR5A 1S5ZA 5KFEA 2M8HA 3JSRA 1VQ9S 2ZITA 3C14A 3C66A 3R7BB 2G1HA 4MK9A 3A13A 2P2CB 3I0RB 3V4IA 2E29A 4QU6A 3ZXWA 5JUMA 4FBTA 4R5PA 2A2DA 3IBFB 5HBMA 2OFGX 1FX4A 2QN6B 4H4MA 4WP3A 4WWSA 1UVNA 2VBWA 1S0OA 5IC4B 2GJIA 1ZM4A 1X4FA 2CUYA 2DHHA 1VRQC 4NLOA 2KFNA 4CP5A 1KLMA 5CYJA 5M2PA 3Q8UA 3FFIA 2JLGA 1Y4ZB 2JLFA 3CO9A 2DXFA 1REVA 2NSBA 2VFVA 4ZHRA 3GIJA 2OHDA 2Z2LA 4JI4F 3MCMA 3DOMA 5J2PA 3K5MA 3HHLD 4PPZA 3QATA 4NLQA 5HROA 3IWNC 2ZBIA 1NKBA 4I6YA 4RW6B 2JVOA 1HW8A 3ZTRA 2UVWA 1A7GE 1FX2A 1IJFB 2BJEA 1IBKF 3LWMA 1SC1B 1X8DA 2Q43A 3BQ0A 3FCWA 3JSYA 2CPFA 3FFIB 3CCSS 1OYEA 3FEXB 1N5TA 4NA3A 2B9WA 2IA0A 5KFAA 1NJXA 2J6UA 3OJUA 5GAEI 1RT4A 2XWYA 3MM8B 4Y2MA 5ETSA 3LALA 1NUEA 2AX1A 2OPPB 2ZH2A 3M2VA 2DNHA 2AEJA 2IDEA 5DJBA 4R25A 2J6TA 4DQPA 5EX0A 4TQRA 5DLGA 1VOMA 3K5NA 2OTLS 4JV5F 1D9AA 2HNZA 4N77A 2ALYB 1O6XA 3MD3A 2I6WA 1R6YA 3CCZA 1VQ4S 1HHQA 1ZA2B 1DURA 2KHDA 2W4PA 4J9OA 5KG0A 4J9PA 4ZPCA 4DV5J 4K2JA 2JX2A 2A2CA 3P45B 3SYZA 3RUBL 3VWSA 4RX6A 2D9OA 3TO8A 2B6AA 2ZH7A 4ELVA 1WHVA 2MZSA 4IFYB 1Q5YA 3CDUA 4DOZA 1X9SA 5KFIA 2GJFA 1VIOA 4ECWA 1FFWB 1H2VZ 2XYPB 5D15A 4LRAA 1QTMA 4ED1A 1Q7YT 4LFBJ 2C3PA 4ZVTB 1JJ2R 3TR5A 3PX4A 1PJ7A 2J7WA 2V9KA 2CQPA 5EX3A 3FSYA 3R6LB 3Q8RB 2J5AA 2XMUA 4NYPA 4LF9J 4QBUA 2XEXA 2GIRA 1SL2A 3KG4A 1SL0A 4IG3B 2C2DA 1JQGA 4GVBA 3JTNA 5J1NA 3UQSA 1FNMA 3CW2C 4LF2A 4FVCA 2N3LA 1FERA 2FLLA 1LXNA 4JI0F 3L3CA 1UWAA 3DGPA 4Z7YA 2MXYA 4Q44A 1RBLA 3R5CA 1LOUA 3EPGA 4OZ5A 3WBZA 3CTRA 3DDKA 4ID5A 4NCGA 2HWHA 2ROGA 3CSKA 3IXQA 4F25A 2AV5A 1F1BB 1W2BR 2VQEF 3GYXB 2YKOA 1IXKA 1QUPA 3QGIA 2D3O1 2IM1A 5KT2A 1PSDA 1IR0A 1WACA 3BGRA 1KTVA 1S1WB 1UEKA 3MR3A 4DSIA 4PXEA 5LMUJ 5A8KB 1U1RA 1KR4A 2RUGA 2W01A 3DMJB 4RW9B 4Y2IA 1HI8A 5J1EA 4YFUA 4O44B 1EIYB 4Q8FA 4RW8A 1N6QB 1WOOA 3EZOA 1HYSB 4IG0B 1VK8A 3MFHA 2FVQA 2ZZMA 3EGZA 3LQVA 1QE1A 2Z2MA 3B4MA 2LEPA 2SXLA 3ZTQA 4M5IA 2QLWA 1WOPA 1VJQA 2P5VA 4OI6A 3PNIA 3V6JA 3SCIE 4X4PA 4LFCF 2A18A 4FYXB 2IVFB 4OHWA 5H9EK 2NSCA 1RQ0A 2H4YB 3KLHB 2KVQE 2FVPA 5L1JA 3MM5B 2GA7A 1T11A 1U6FA 3I82A 4X4VA 4DX7A 3M9NB 3QAUA 3KG1A 5C24B 3Q8PB 3H4BA 1GQEA 2VG5B 2XYGB 3L09A 3Q23A 3D6TB 3M8PA 2DGQA 2DH9A 5CZVA 2JNJA 4WZQA 1GXLA 1GX5A 3HVTA 1NHVA 1VISA 2HSEB 2DNOA 3FBEA 2PIIA 3P96A 5GAHI 4XPEA 2GGPA 2RE1A 3ENAA 3A8JA 2HVEA 5HO4A 2XLKA 1U1NA 2YWEA 5HBMB 4F0MA 5ETLA 1ACMB 2W2QP 2YNIB 2RJZA 2DGOA 2AP6A 4DL0C 1RLDA 4A47A 4F4KA 2RHSB 3G9CA 1IKWA 4OZLA 1R89A 1RWUA 2GVDB 1S6OA 3UI3A 2UP1A 1RLCL 1TAUA 4URSA 3R3TA 2ZJQQ 3M9MB 1QSLA 4ICLB 1LV5A 2R7XA 2WOMA 4YR0A 4QIGA 5MLCV 3KLVA 2DNMA 2DH8A 2V2ZA 4M5KA 2HS0A 3KLEA 3UCGA 4JI2F 2Y3YA 3KUEA 5HP1A 2G0CA 3OR2B 1NXIA 4F3OA 5HAOA 4EBEA 1K8AT 2ZH1A 4DUYJ 3DHXA 1I1GA 2AJ1A 1J27A 3J7YU 1RXOB 2MSTA 3GV8B 2V9WA 2YPYA 3KK1B 1T94A 3BZQA 4WIIA 1EQMA 3MFIA 1YITS 4P2SA 2XZDB 1KSPA 2AJQA 2QMXA 3LP0B 3U02A 3G82A 4C11A 4NCAA 4WBFA 3TJ9A 3KXDA 3DOKA 1JXEA 2XB2D 3W60A 4PWDB 2ZM6F 2CPDA 3PEHA 2A10A 3BB5A 2IHR1 4ZN1A 1B0TA 2R7UA 4QQBA 4P74A 1MWYA 2DITA 1RACB 3SIPB 3UR0A 1AUDA 1JLBA 4KFBA 5HATA 4PRFA 2DY9A 4WFAQ 1NU4A 1X4DA 2GVZB 3CJ2A 3N28A 2FVCA 5I3PA 3W5YA 2WSEC 3OVSA 1P9YA 1U1QA 2UVUA 1MSWD 4KR0B 4QIWD 2DXEA 1TR0A 2RDDA 2BQRA 1N32F 2DHXA 3TAQA 5D0GA 4ERDA 3GFXA 4Z2XA 1X7VA 3E51A 3HHLC 3MPDA 4KPYA 1FJGF 3UVJA 4RUBA 1FDBA 3CD5A 1FRMA 3JS9A 4C8NA 1SXLA 4FS1A 5G0RA 1LFPA 4EBDA 1BMQB 4DF8A 2D9PA 2UV8A 3HCXA 4C3KA 3G2XA 2ZUAA 4MYTA 4NI2A 3S6EA 4DV1J 2R8JA 4C8ZA 1AT1B 1YJVA 4CH0S 2XCAA 3TARA 5IC6B 3SI8A 2B9YA 4WP9A 1SB6A 2YKQA 3HHLB 3SCJE 5LOQA 1M5SA 5EUHA 2ZOGA 1V9OA 4K4TA 3QT5A 4FYYB 3UD3P 2U1AA 1RTZA 1QY7A 1RT1A 4O3NA 3BQ1A 5EWGA 2ZH5A 1WC5A 2Z30B 2HRTA 4USVA 1X9MA 4LRBA 4F4YA 1WD6A 3NXZA 3RGIA 5BYRA 5DGBA 2R7TA 2MHEA 2N7YA 3G86A 3RB0A 1OYDA 4I1TA 4U8YA 4KJIA 3D0IE 2HIYA 1ZYQA 4C3MA 1IBLJ 1PAEX 3C14B 3SFGA 2W7AA 1WC6A 3MMAA 1VQSA 4B02A 3R5DA 2FJDB 3BQ2A 4DL2A 1KOHA 2ALZA 1D0EA 1HNIB 4NLUA 3D9BA 2HHUA 2FY8A 3H98A 3KHRA 5FLXU 1NPKA 1Q8IA 2BE2B 3CWJA 5K14B 3NNCA 1NH8A 5KFPA 4ILRA 4RW4B 1TVRB 2BM1A 3H7HB 5U47A 4OX6A 2G2YA 4AE5A 4PG6A 4RZRA 4I2QA 2NYHA 2MHNA 3UO0A 4CH7A 5C25A 1C1BB 3L9ZA 4PEOA 1E6YA 2I5JA 2ZBCA 3U27A 1F5CA 5K8OA 3RAQA 2V8DA 2IA6A 4URGA 4FP9A 1XWLA 5C2GA 1RP5A 1M5KC 5LL6d 2BDPA 3AD9C 4JI3J 2XGPA 4ZVHA 1D9DA 1U1MA 3MMCA 1SV5A 4FYWB 3M9OB 3QSYB 1CC8A 4B3SJ 3CD6S 3M05A 2BJ1A 2CNNB 2E1RA 3R6GB 3W62A 1UW4A 3OLAA 4LRFA 3SQGA 4AL7A 4FYVB 1F2HA 2AGQA 1RTIB 3O1LA 1BLUA 5GAHU 4IYQA 1MU2A 4YR3A 4RNHA 1N4LA 4ZVSB 4KRWA 2W4CA 5KFNA 3MDFA 2YWKA 3FBCA 4DN9A 1YRXA 3W2WB 4PQUA 3T19A 3UDCA 2HAFA 4G3IA 4N7TA 3GZ7A 4LRCA 1HMVB 3R2CJ 3HT0A 4ED6A 3KHHA 1N0VC 2AYMA 2HFSA 4RW8B 3CJTA 2H65B 3KDNA 5IWAF 1N6QA 3R5AA 2CPIA 4DV4F 2K06A 3BPDA 4ANDA 5BYQA 2OPQA 4RJVA 3ETOA 4X62J 2CAJA 3AOBA 5L8RC 1PBAA 4LR7A 5H1SV 5LJ5Y 5E3CA 1FKOB 1RAFB 3T5HA 1HWLA 5CCLA 2ZBQA 4DL4A 2F7VA 3N9UC 3DLGA 1T9YA 5D4NA 4EI2A 4TQSA 4DFMA 4DPYA 2H5IB 4LF5F 4LF8F 4HEA9 2W2PP 1RT6A 4DL3A 1RTIA 3UPFA 3C2PA 1Q16B 3GPAA 5KFDA 4ECSA 1MN9A 4X4NA 2ZEJA 4PABA 5F8MA 2HNYB 1IBLF 2BANA 2J9EA 4B9LA 3PIOQ 3CULA 2LA6A 2CDRB 1F0XA 2M2BA 5E33A 1K0VA 1VS3A 1PILA 3CGIA 3ENQA 2MQ8A 2W4DA 1B0PA 1N5YB 4NWBA 1TK0A 2V4QA 4DFPA 1FNOA 1FHTA 1X60A 5HANA 4NXMJ 2J7UA 2ZVSA 1NZAA 2F8HA 1VQLS 1BD6A 4NXMF 1T02A 2V6AA 2GMLA 2RB7A 3NWGA 5IM0A 3IM8A 3W5XA 4ZVRB 1M5OC 4OL8A 4F0KA 2J76E 2LA4A 3BBBA 3I56S 3T1YJ 1Y9OA 4HDGA 3H0PA 2E1MC 3IMQJ 2GAGC 2XULA 4DPWA 1UVJA 3HD2A 4W92B 3K89A 3QIDA 1Y3KA 3BYRA 3T6BA 3VTIA 3BJYA 1RAJA 3MEEB 3WC0A 9RUBA 1O5JA 4DV6J 2ATCB 4ZLLA 1NK4A 3P49B 5I3UB 2GJ2A 2L9WA 2HFZA 2LYVA 1KDNA 1RTDA 2M7SA 4CLFA 4LF5J 3MMBA 2WCXA 2E5HA 2F9JA 3MEEA 1NK0A 2VDHA 4N5SA 2C2ZB 2R8HA 2JFKA 4NCBA 3G4SS 2E1AA 2QLXA 5B0BA 2ZH3A 1NH7A 4DQQA 5LT5A 4OI0A 3PY8A 4S0MA 4DR5J 2OPPA 1TKTA 4RBUA 2RUSA 2UUTA 2WSFC 3EJMA 3JTOA 3NP5A 1RAOA 4M5DA 5KFZA 1VQOS 1VC5A 1T03B 5SUHA 2PI4A 2E5GA 1OO0B 4FXVA 2D3ZA 2F9DA 5GMEA 4NRTA 4M94A 5IWAJ 2ERRA 3SXLA 2DGTA 4DI6A 4Y2AA 4ED4A 2WVDA 3J81Y 2B7BB 2B3TB 3V4MA 3GV7B 3TEHB 1TMMA 2B4UA 2V68A 3V6HA 1DJ0A 1ZAVA 1VQKS 2KFYA 1N48A 4IR1A 2YPZA 3I0SA 2VH7A 4LIWA 2DRDA 3BDEA 2PFFB 2MEWA 2EPIA 3DHWC 3HHEA 2XM3A 1HNIA 3PW0A 1JXVA 1QD1A 3PCOB 2VPXB 1JLGA 3B8HA 3L95X 3MMAB 1GK8A 3TAMB 1HNXJ 3FC9A 5HQMA 2VA3A 2I1RA 2BANB 2UUWA 3AHPA 4KB7A 4KV8B 2LQ9A 4AUKA 3PW4A 2GHPA 4J37A 1JLAA 1KVIA 1E6VA 2AIRB 3RB6A 2R7VA 2Q79A 2C2RA 2FDNA 1TK5A 1PYTA 2CDQA 2PSZA 3E3XA 3PM9A 1U25A 3OXFA 4FXDA 1HNWF 2UXBJ 4ZVQB 2AGPA 4DSFA 4K0KF 1RT1B 3MTKA 4NLYA 1VGYA 4PG5A 1S76D 4MIWA 3ET6A 2R7WA 3KMSA 2M3DA 5CHCB 3VR1A 4WE1A 1RAHB 4C3LA 3F73A 1FKPB 3S1TA 4AL5A 4IUFA 2HK3A 3TA2A 4ATNA 2AJ0A 3NGSA 4LSNA 3TZYA 2W8LA 2LVWA 2ZH6A 1TKXA 5HMYA 2WVEA 1UA0A 2DPJA 3CMES 1R0CB 5K14A 1KOOA 4QIEA 1HD0A 3AOCA 3H2UB 3NLCA 2O67A 2XSFA 2C3UA 4CLWA 2R2UA 1FA0A 2GIQA 3QLHA 4AD6A 4B3TJ 4Q8EA 2C2OB 1PKUA 3BV8A 4OX9F 3GG1A 4G1IA 1FI4A 2CQ4A 3MZIA 2BVZA 3P8BB 1TMJA 1N5VA 3BH6B 1FRXA 1ZZFA 1S7IA 2HHSA 3OFGA 3AQOA 2OSQA 2P6TA 4MKBA 1KFSA 1S7HA 4YEAA 3SQGB 2Q1LA 1WKKA 2LECA 3GV5B 3MAAA 4IFVA 1L3TA 3ADAC 1UVMA 1V3RA 3RZAA 2HHHF 2R7QA 5J2QA 4DSKA 3FUYA 2OGUA 3A8IA 4C97A 2B56A 4KGZB 1Q7LB 2MY7A 5CA5A 4W90B 4ZPVR 5LMUF 4H4KC 1R6VA 3I5CA 4WFXA 3R2DJ 4X2BA 1HBUB 2WZ1A 4K5RA 4O3OA 1U45A 4NLXA 3OTOF 5JVGQ 1SVDA 4A8XA 3RAMA 2BR0A 2IBKA 1AW0A 1H7XA 4HL9A 2DVIA 2VQEJ 2HAIA 4RBVA 3VAKA 2XTJP 1DLOA 2LDIA 5C42A 1RA7A 3POTB 4UQTA 2NXNA 5I42B 1RHUB 3W1YC 3D3BJ 2AJ2A 4ZJLA 3HKWA 1HBNB 3DN9A 2VG7A 3W2VA 1N32J 2BJ3A 1UCNA 3CJ3A 2YWGA 1YJTA 4P52A 3M1VB 4GVLA 3OBIA 2E7WA 4Y2CA 5SZTA 3J81j 2WVCA 3MR2A 4ZN3A 3FCHA 2ACYA 3K5OA 1X4EA 1CG2A 1L3SA 2OIHA 1T9VA 3DCAA 3OFFA 2UXCF 5M2UA 2UU9F 4NOHA 1D8ZA 2XMTA 4YHHF 1YBUA 2KRBA 5L1LA 2ZM6J 2CQCA 1M1HA 4MK8A 2MLYA 3D4JA 3CDAA 3Q2TC 1R8PA 1TL7A 1JLFA 3QGGA 1TKZA 4PWUA 4QIFA 3TVYA 2MQQA 2LQ5A 3HJFA 5HROB 5HMXA 4KE5A 4JI5F 1RCXB 2B4PA 4Y65A 2W9BA 1S0NA 4DR7F 1TFYA 1N5YA 2VFUA 2XMMA 4LVOP 3UDLA 5A0YB 2ASLA 2BE9B 4I6WA 2CVEA 3KLGA 1HL6A 3TP2A 3R8YA 5A6WA 1DQAA 3DKDA 3PEJA 3W61A 5JVHQ 3FRYA 1WF0A 2JHEA 3GJSB 4GC7A 3DRXA 1FEHA 4MIBA 1X0FA 4ID5B 3M6WA 3TYTA 4LF6F 2R2SA 3C19A 3OUYB 1IKXA 1S57A 3TQ1A 3UVJB 5ETVA 3FSIA 3AAWB 1FK9B 5CD4H 3GTYX 1S72S 2MQLA 4JBCA 1T7PA 4CLKA 4FF1A 4DHVA 3FSXA 3GYNA 4O3PA 1FF2A 3LOUA 4NL5A 2BQUA 4P72A 1YQHA 4KY3A 2XY6A 2AKWB 2F4VJ 4ZCLA 1BQXA 3SFUA 2VFRA 4A8KA 2XMVA 2MYFA 2BOAA 2F4FA 4USWA 1NK5A 1IR1A 2CJXB 4B9TA 2CA9A 4QYRA 4CO5A 5ADZA 4KGVB 5IT4A 2M52A 4MKAA 4Y34A 2W7OA 2XHCA 1EX8A 4JI6J 1C0TA 2ASDA 2LMIA 1IBKJ 2HG4A 3KK3B 3EMTA 4K4VA 1H2TZ 3X3UA 3PYDA 2FJWA 3LP0A 2KXNB 4JV2A 4ZVGA 3QT8A 1RAAB 1RISA 3IBWA 1PG5B 3GIKA 3DOMB 5J2PB 1U1KA 2OFHX 3TX8A 1SJ4P 3Q8SB 4KKOB 2DB1A 2FLNA 1NK9A 3D67A 1B4SA 1RT5A 3CCQS 4N56A 2W2MP 5RUBA 2NQPA 3EVWA 3GONA 4OYIA 2IRXA 1C0TB 3KLIB 4K8RA 8RUCA 3CMQA 5LMNJ 2VOOA 1ZTWA 3J80U 4WJBA 1WEXA 1SC6A 4QW9A 1YJ9S 3PO5A 1AXQA 1RHKB 1LWFA 1YVFA 2YXLA 1PO6A 5FJ4A 1NEEA 3EZ5A 4WU3A 3U7JA 2WONB 3CDBA 1RB0A 3AY0A 2OPRA 1J5OA 3BDPA 2XSJB 4KTQA 3QRQA 1JJCB 1FXDA 2CPHA 4DPXA 1GXUA 1C0UB 3ZNUA 2UXCJ 3MM6B 3OD2A 1TKZB 2EG1A 5A6PA 4X4TA 2YKNA 4JI7J 4O0IA 4LIRA 2L9NA 3MOZA 3MCOA 5ETMA 3HMJG 3BSNA 3MMJA 2MGZA 4N76A 5F8JA 4YOEA 4N47A 2X1FA 4ILLA 3NS7B 2QYGA 2NYIA 2V94A 2L48A 4LRDA 4PYAA 2V67A 2V0NA 3LGHA 3HI9A 3ZZOA 3NBPB 2YX1A 4DPTA 2HQCA 1VJWA 2KN4A 2W2NP 2KM8C 4P9SA 1U49A 5IFMA 4IRDA 4WYWA 1JKHA 2EC2A 1HI1A 4DV0F 4OX8A 3IRXA 1GH8A 4OHZA 4ES2A 3OPKA 1SC4B 2DO0A 2HQDA 1BXNA 3NGTA 4U67Q 2AYEA 3DM2A 4OFZA 4GKJF 5K8MA 2J0QD 3MECA 4DV7F 3G8QA 2GCFA 3ELHA 4H4OA 1HD1A 2MMYA 4KO0B 1BWEA 2LXUA 4DR5F 1JNRB 1RJJA 1LEOA 2HFNA 1EJ7L 3Q86A 4TY8B 5IZHA 1R43A 4PQUB 1V5IB 1FESA 2CRLA 4OZNA 4ZP7A 2ZNZA 2P8IA 4PUOB 1IJEB 4LFBF 5D4OA 4IOBA 3CCES 3EGWB 2XQCA 2K7KA 2G2OA 2Q3PA 2YNGB 5CYQB 2EC0A 1I3OB 1Q0NA 3ONQA 4XO0A 3PR4A 2DNKA 3JXOA 1UAWA 3I0SB 1X9WA 4O44A 1FRIA 4MT1A 2GMJA 3H40A 1ZM9A 3QNWB 2FJXA 3OT9A 1NRKA 5KG2A 2JC0A 4Z7CA 2XLIA 4ECRA 4XTTA 4R0JA 4DV5F 1HQ2A 3ILLA 4TU8A 1U26A 2HVDA 2ASJA 3MGJA 2XZTB 3CC4S 2J8AA 1KLMB 4WZMA 1IKVA 5L9XA 2HRYA 2YKNB 4R8UB 2MKIA 4WF9Q 1GMVA 2O66A 4OV6A 4RR5A 2BJ7A 4MFBA 3ENWA 4FF4A 3M8QA 4CLZA
chains in the Genus database with same CATH topology
1T3NA 4NLGA 2L08A 1O8BA 5DO2A 2DR8A 2M8DB 4DR1F 3G6YA 2XSJA 3AA9A 1FJ7A 1R8HA 3IFEA 5KTQA 2QA1A 2LXFA 2ZD1B 1RTHA 4ZCKA 5I3UA 1PC4A 2VPYB 3KNGA 4KV8A 5EN1A 1DTQB 3DI6B 1P8GA 1VLYA 3NCPA 2I0XA 3CCRS 3GFZA 5KFFA 2YX7A 3VQTA 3U1LA 4Y0FA 1HNXF 2DT9A 3TUZC 1U09A 5DG8A 3BN7A 2RQ4A 1OPZA 4K2XA 5L1KA 2BACA 4IDKA 4NYZA 1P27B 2KT5A 3HLUA 5T41A 2C22A 2FIUA 3P3DA 2JEGA 3FQKA 3M2UB 2NR0A 2NPIA 3BGLA 5GVQA 2D3UA 4PXCA 1HWKA 2ZFHA 2W9AA 1G1XA 4BBYA 2DNPA 1ZM2A 3MXHP 3CDWA 3IS9B 1MMDA 1L3KA 3BGUA 3CJ5A 4ICLA 2XS2A 4H4MB 3D0GE 2IJFA 5AXMA 2BBEA 1MMLA 2KM8B 5DGAA 3CUNA 2DNQA 1RTHB 2E5JA 2BQ3A 1IKWB 4KAIA 2FPHX 1Z4UA 1FRLA 1R27B 1RTDB 1R8CA 2VKZG 1CQMA 1C1CA 1E6VB 3HKZD 1IN0A 2I9SA 1U4BA 2MQOA 5DRKA 2J9CA 2OKQA 3DLKA 3DOLB 3OUYA 4HDHA 4ALZA 4DF4A 1UJ6A 3MM8A 4QWBA 1X0PA 2AW0A 4R8UA 4F67A 1DBDA 3QAEA 2RNEA 1S9GB 1S9FA 2D3OR 1HQEA 2O01C 1MWZA 3DLEA 5CYMA 1DLOB 2A3JA 2QSFA 4DL7A 2UVWA 3MEGA 3CCWA 2MJNA 1U6ZA 3LUYA 2NLWA 2FHOB 3K8WA 4FNIA 5KFVA 4CTAA 3ULHA 4OX7A 2ZE2A 2CG4A 3CD7A 5KFGA 3K59A 4ZHRB 2FUG9 1TKDA 3AJ1A 2GQ2A 3SV4A 3PW7A 3GE9A 1J5OB 1MW7A 3MI7X 3T3FA 1FVSA 1HQUB 2KG0A 3NG8A 3LP2A 1FRKA 4K59A 3IG1B 3HVRA 1ZOTA 3VAIA 5DLFA 2DCLA 2F8MA 4HI1A 1NK7A 1UETA 1WEYA 1SH2A 3AJ2A 4I56A 4LJMA 3NRBA 3QGPA 4IOCQ 4QU7A 4TLRA 3OLBA 1ZETA 3BEGB 4DR2F 5I42A 5DG7A 2AJFE 2EVZA 2RQCA 3QYYA 5CYMB 5H9FJ 1NAQA 1S1VA 1KVJA 2XY7A 4LVNP 5FIIA 1JKHB 3NNAA 4NPOA 1JK9B 4TN2A 4HH1A 2FB0A 2HLUA 2FTRA 2PD1A 4NRUA 5C25B 1FXLA 1KN6A 2GW8A 3VF0B 5D3GB 2HRUA 2WW8A 4KBIA 4K4XA 1B7FA 1RYRA 5BJRA 1P1TA 4ECQA 2W7PA 4I6AA 5KOWA 1SJFA 3PW5A 1FK9A 2VA2A 2VG6B 1RT7A 1CVJA 2B7CB 4QR1A 5HMWA 4EYIB 1QVFR 3HVAA 2J0SD 1RKJA 2HPUA 4C9DA 3PX6A 5DDOC 1N54B 2CYYA 3MMCB 1ZTTA 1S99A 4DL6A 4V19J 2PC6A 2JL9A 2P9CA 4PG4A 5CQGA 1K1QA 5K8PA 3H2LA 3IO1A 3ZZ0A 1IKYA 3IRWP 2VBYA 1XBWA 2UUCF 1FO1A 4NMLA 4CNZA 3OL6A 5DM7Q 3EPIA 4OLOA 2J9DA 4OZ0A 3DLLQ 2XS7A 1XR7A 4RUHA 3ZZTA 4ZOSA 2O5DA 4CI0B 1FE0A 1JLQB 1UEVA 1ZZNA 1ZAXA 4QW8A 3OL7A 4ECXA 2DRBA 3DU6A 4LQ3A 3RBDA 1FTRA 3R5BA 4BWMA 5EHHA 3BO4A 2XNRA 5E0OA 4X4SA 2K8GA 2R7SA 3O6QA 4QWEA 2AWZA 2CQBA 1D8YA 2JVRA 1LFWA 3QMQA 3J7YI 2YVSA 2H9ZA 1FNXH 3GSDA 5F41A 5T14A 1M5PC 2HWTA 3ENVA 1U1OA 1X5PA 2MY8A 1KD1T 3AB4B 3LP2B 2GQCA 2XI2A 2R8GA 2ZHBA 1LWCB 4DV3F 4L72B 3DLBA 2JJ4D 3BSOA 3GIMA 1LK7A 1WTBA 1I94F 4Q7AA 1Q78A 1DARA 4PCQA 2QT7A 4RUAA 2FHMA 3LANA 4YR2A 3QGHA 2ZH9A 1AFJA 4OIXA 3T6JA 1JLFB 1SJ1A 1RT2A 4DQSA 2BYCA 4ECUA 5KT7A 3J7Z5 3RRHA 2HZCA 4M8LA 2DK2A 3UCZP 3MECB 2EKYA 1TVRA 1Q1KA 3DNCA 3NMRA 3BGFA 3VAJA 2C3OA 1IQZA 4WFNQ 1N52B 3OHAA 4DS5A 4ELUA 4ECTA 3HVWA 3MEDA 1M1KT 3K0JA 4DWIA 3DLJA 3PJWA 3R1HA 4NA1A 4L6V3 1ZPVA 2RDIA 3I4HX 3IR5B 4DX8H 2HWIA 2MZRA 2OMOA 4YQWA 1HNVB 2QSWA 4WTYA 5B0AA 2QO3A 4F3QA 2CPXA 1F5BA 3BM7A 3TI0A 1YJUA 3V6KA 2OD4A 2PT0A 2DGWA 5DDQC 1UFWA 3JSBA 4OZJA 3ISNC 3HVTB 2IMWP 3D54A 4XAKA 4USIA 4DR4F 1SJRA 5AXLA 1KHWA 1SIZA 3OV7A 2RSQA 1SKWA 2HQIA 3EXCX 4UUXA 1KRPA 5J2QB 5E5NA 4JUZA 3LGNA 2PI5A 2R9LA 1SH3A 2FLPA 5AE2A 5L38A 1VMBA 3DRRB 2IBOA 3GWCA 1RT6B 4B3TF 2VBXA 3DDNA 2AGOA 2XCPA 3N6LA 5E7OB 2J7KA 1ZAWA 2IC3A 4PQAA 2HS3A 2YNGA 4QPTA 5B0DA 1YBAA 1BQMB 3DC2A 3HDSA 4YB6A 3SCLE 3MURP 4ES3A 2YNHB 2KXFA 1K1SA 2NXUA 1OIAA 5LXRA 4J9KA 1DTTB 3SSQA 2KVIA 5KT5A 3RW6A 2D7SA 5A8KA 7FDRA 2C28A 1DFDA 1KONA 2C2EA 3SSRA 3SEOA 4K4SA 1WG1A 4MJKA 2R8KA 1S1VB 1S79A 5E3RA 1YHQS 3PIPQ 2BABA 1JNZB 3VZHA 3VAMA 3W7BA 3HZEA 2ZZNA 3PJXA 3V6DA 2OMLA 2E9TA 4JOUA 1X4GA 4L3NA 1S0MA 3OTCA 3SCKE 2ILYA 4GO7X 1G6BA 2HVZA 4OI3A 5HQ8A 3GIIA 4O4GB 3V5RA 2CQ1A 1FD8A 1RT7B 4ZK7M 3DFEA 1SV5B 1Z2ZA 2PA3A 2RS8A 3ZZUA 5GAGI 4ZCMA 1T05A 1WWHA 1JLCA 2NREA 3KNAA 1HYSA 4C2MA 3T1AA 1KQFB 1QJHA 2CJ9A 2N82B 2KU7A 1TV6B 4OJ3A 3KYLA 4U9RA 2DHAA 1UKUA 3FMWA 3IWLA 4IFYA 1Y5LB 1GXTA 3M32B 3TAPA 2F3JA 1WEZA 3H5SA 4G1PA 3ZZRA 2BRKA 4TU7A 3WC2A 2GC8A 1TKTB 3KTQA 3M1VA 2FGCA 3FZBA 4H4OB 5FDLB 3DLKB 3DOLA 4KGMA 1UWBA 4Q5VA 1S1XB 4TNOA 2BJDA 3P6YC 2IFXA 4ECZA 1QAXA 2BM0A 4ELTA 3E8OA 3O3LA 1WF2A 2HQ3A 4F26A 1JXLA 2DIVA 2ZOFA 3MM6A 1U2FA 4X84A 3T1YF 5KT6A 1HPZA 2POKA 4RW7B 5D78A 4RBTA 4DSLA 2OO4A 4FPRA 1R8BA 1RT4B 3L7OA 2ZDPA 3U1NA 3FQLA 2I2YA 4B9UA 1Q8BA 4IRKA 1ZH5A 3G6ES 2HIQA 2M9KA 4FS2A 2ZUGA 4LT6A 4PKDB 3ITHA 3S7RA 1O51A 2IYGA 4LMZA 3M2UA 3G6XA 3THVA 2DBBA 2WTFA 4P7TA 3MR5A 2IM0A 5J1EB 1C4CA 2YKAA 3T5LA 1GT8A 1T05B 4DFKA 3OTEA 3M8RA 2ZDOA 3OXGA 4C8MA 2LCWA 2CPEA 2LU1A 2CVIA 4MTPA 4HTJA 4C4WA 4RWXA 4F50A 3PR5B 3OR2A 2EK6A 2FJEB 1HWUA 4ED8A 2CQ2A 3NS6A 4K4ZA 2HNDB 4EUVA 2DRAA 2CKWA 2B6AB 1H6KX 2M4MA 1VQMS 2WBRA 4PXBA 1KQGB 4ZPAA 5A0YA 3KHLA 4ES1A 1TKXB 2PMZD 3M8SA 1JLBB 4EBCA 1Z2LA 2YNFA 2NPFA 1FRJA 1U47A 5CCMA 3G8TA 2XWXA 3D1QA 2KI2A 2VV5A 1XERA 1ZM3A 4CZCA 3DOKB 1BY9A 1RTJA 4X62F 4C11B 2HGMA 2C3YA 1TFWA 3IN5A 5I3QA 1VBXA 1NJWA 2HVHA 4FXWA 2B4VA 2OPQB 5LXYA 1Q4RA 3D1OA 1B64A 3NS5A 4URQU 4USHA 4OI4A 2R7OA 1LW2A 1S77D 3IR6B 3GQCA 3LPYA 1Q81T 5KFXA 1QLNA 2V2KA 3RU0A 2DHGA 3PKYA 3N5FA 1HBNA 3QIPA 2AYGA 3GR1A 3DXBA 2MSSA 2YWFA 5J2NA 1N34F 2AF6A 4NXNF 1VRTB 4PG7A 4C0OC 4CQ1A 3MOJB 2YTCA 1Y00A 2KB2A 1HBUA 3B4DA 2X3GA 4RNMA 4PR6A 1S1TA 4NLWA 1FRHA 1VQ7S 5KFYA 1FHTA 3N01A 4HYKA 2VUGA 4B3MF 3ISND 2RMLA 2GO8A 1VRUB 4A8QA 4BDPA 2GX8A 3OL8A 5H9EJ 3M8QB 6FDRA 1H7WA 2XGQA 2AD9A 3NNHA 2OH2A 1LK5A 1Q53A 1DAXA 1JIHA 5GADU 1D1UA 2MZ1A 2JZ5A 2ILZA 1RA6A 2Q6BA 2PN6A 2CQGA 5B0EA 1BQNB 2V4RA 2IRUA 2JDJA 4X4UA 3DM2B 3BGRB 3PFEA 3DLEB 1HQEB 3V2UC 5GAGU 1OWXA 2C3MA 2N3OA 4B3OB 3M2RA 2DGVA 5FLXY 4TU9A 1C0UA 2J6SA 3LO3A 4B9MA 3QJJA 3F41A 4UY85 1IUJA 4O3SA 5IM0B 4IRCA 1WI8A 2IM3A 3CJ0A 4RU2A 3Q0AA 4ED2A 3CCUS 4IH7A 4KSEB 5KG3A 3MM9A 3K5LA 1J5EF 5J2NB 3FEZA 3MWBA 1K0TA 2L3MA 1LWCA 2ZJQQ 2YQ3A 3HHKA 3CT9A 4O4GA 3MM7A 1AFIA 1U8SA 4DV1F 2E9RX 1XR6A 1H38A 2HW3A 3HK2A 1IBMF 3SV3A 4IDKB 2RD5C 2VC1A 5BR8F 4NLTA 1NJZA 3DRRA 4RWWA 5DQGA 4KHMA 1FKOA 4E0DA 3G8SA 4CH1A 5BYSA 2Y1RI 4U6PA 2EFQA 3CMAS 3FMBA 5T7LB 2JWNA 1KS2A 2LU2A 4ZMMA 1JLQA 1W25A 2WONA 4FZVA 5G4DA 2KJWA 1QSSA 5THWA 4M95A 2V4JB 1QVGR 4A46A 4QOTA 2QFJA 4A8YA 2XBPA 2F40A 1EP4A 2FJAB 4CO1A 5IXUA 5B08A 2KJVA 1S9EB 4ED0A 2ATLA 1NB7A 3DYAB 3OR1A 3PX0A 2ROEA 4GO5X 4TKTA 5LJ3Y 5LSRA 2MZTA 2KYZA 4DMZA 5CZXA 3H20A 4DG1A 2R2TA 3AQPA 4I2PA 4N8NA 3RB4A 4JV0A 3G96A 5F0UA 3NCQA 4O3RA 2OPSA 3CD0A 3WX4A 2KYXA 2BRLA 3N5BA 3ICLA 1WHYA 3I31A 1F5AA 4IO9Q 4DBQA 2WB1D 1S6PA 2X51A 3M2VB 2HHVA 2Q66A 4CTAB 2VG7B 3W2VB 3U1MA 2YKMA 3VAFA 2J9DE 3CC7S 2DNNA 3O2IA 3KK2A 2VBZA 4OV1A 3CCMS 3PZPA 1N5QA 2CPYA 1X5OA 4HI2A 3I4PA 4WKYA 4DV2F 1SI9A 4K4WA 4AQYF 4PPDA 3A1YG 1PC5A 2GHWA 5K5MA 2YH1A 3I5BA 4WFYA 4R0EA 2DNRA 4WFZA 4GMKA 1KFDA 4DFJA 5IT9Y 5KFUA 3DRPA 2HNDA 2KT3A 3KLFA 3JYTB 3POTA 2RILA 5JXSA 2G9OA 4LSLA 1PGZA 1UWBB 1LWEA 2MKJA 5A8WA 4EWTA 4Q43A 5DETA 2QYCA 4F02A 4YUDA 5J1PA 1YI2S 2JLEA 4OI1A 2OD6A 4BHQA 1N33F 2DH7A 2HFOA 1NHUA 3I0RA 4WK1A 2OPRB 3M6UA 2GQQA 3SDEB 5IT0A 4DS4A 2DD8S 3DRYA 2B9XA 5KG5A 2W25A 2JEFA 3C6UB 3OL9A 2RF2B 1TQLA 4DJBA 4LQ9A 2DCUB 2FVRA 3ZZZA 5AE1A 5AE3A 3FZ2A 3THPA 1HARA 3E01B 3DYAA 1C4AA 2K7JA 4KKOA 5C42B 1VC0A 3THTA 3QPIA 1P6TA 4U7UK 1ZPWX 3IGVA 3OTDA 5F9LA 3RW7A 3CCLS 4B3RF 1DTQA 3DI6A 2E1CA 4DLGA 5K8NA 4HVZA 4BC9A 3MHYA 4F3MA 4RNFA 2V4JA 1RGVA 4G1QB 2XLJA 3SZ2A 1TZ0A 2UUBF 3AH6A 4I64A 3I5AA 4KFBB 4F4XA 3ZFVA 3P5TL 3V6DB 2DGUA 3GB0A 3OJSA 1YJWS 5KOXA 3VCDA 3QZ8A 1OSCA 3BSCA 2F8EX 2M5YA 3V81A 1U24A 3CXCR 2IAJA 3CJKA 1VFJA 1XC9A 2K3KA 4MMOA 3US5A 2WB4A 3VZIA 1M90T 1IM4A 3LGMA 3RRGA 3I96A 1FDDA 1VIXA 1IKYB 2CJQA 4ETZA 2PMHA 4ECVA 1JWWA 4B9SA 3MR6A 2RRAA 3TVKA 2EFOA 5LMNF 3E01A 4I7FB 2OJ3A 1HMVA 4PXDA 1JX4A 4C8YA 3QLHB 4ZA1A 1N8RT 4CO0A 1HWIA 1UFLA 2YX4A 5GMKa 3KFWX 3MEKA 4KIAA 3PV8A 4X4OA 4D3GA 1WF1A 3JAMY 2LKZA 1MU2B 5D77A 4J9LA 2JFDA 2VONA 4K4UA 2KRRA 1QM9A 1S6QA 5KAKA 1UJ4A 2XZWA 1FJCA 4EEYA 4V19X 4A48A 2RIJA 3V81B 1I6JA 2KH9A 3MMBB 5D6GA 2JEIA 3HO1A 4KHRA 3HFKA 3IRXB 3UNGC 1OQ3A 3O8WA 4MYUA 5F8IA 1RKIA 2ZE2B 1WG4A 1IKVB 2NUUG 1YGYA 4C0HA 4OZ1A 2BOPA 5KFBA 4QZVB 2N7CA 2XY5A 4CT9A 1L3UA 2GMHA 4XDDA 3PKMA 2FGOA 1BC6A 2XG8A 1O0PA 3I32A 3PDNA 4AXJA 5EGYA 3NCRA 2ZJRQ 1K73T 4LUBA 2E5LF 1N5SA 4JI7F 3C6UA 3MEDB 5JJBA 5K9FA 3J80Y 2Y1JA 2AYBA 4FF3A 2DISA 3TUJC 4TY8A 4MH8A 3BO2A 5J2MA 1XR5A 5L39A 5AJ3F 4FN5A 2MJUA 1T03A 4BC7A 5HL7Q 2ASYA 3DU5A 2P9GA 2I38A 3D0HE 2KHCA 4I2PB 4I68A 3TVZA 1XEZA 4XPCA 2KTQA 4A8WA 4CNYA 1NJYA 4IQXA 3QO9B 5F8LA 2LXIA 1GTHA 3I9V9 4KQZA 2CQ3A 3S8SA 3MUTP 4NLDA 5EDWA 1HNZF 3D5MA 3HP6A 1W2IA 1G2EA 3IAM9 5KG6A 5AXNA 5M2RA 1KHVA 3FVYA 3K2YA 4O23A 3T9NA 2EFVA 3A8EA 3BSAA 5IQ6A 3CCTA 2AJ4A 2HNYA 3TA1A 1HNVA 1S97A 4NZ6A 4ED5A 2JSXA 4ED3A 3EZUA 1R3NA 3TW0A 3TANA 1HHTP 4PWDA 4YB5A 2QIFA 3GMGA 4KHPF 2AQ4A 2KFZA 4DDFA 4EZ9A 1HR0F 2EI5A 3F56A 4H54A 3SDEA 2MB0B 4J5OA 5D3GA