3WX4A

Crystal structure of t4 phage arn protein
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
98
structure length
98
Chain Sequence
MIIDSQSVVQYTFKIDILEKLYKFLPNLYHSIVNELVEELHLENNDFLIGTYKDLSKAGYFYVIPAPGKNIDDVLKTIMIYVHDYEIEDYFELEHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Anti-restriction endonuclease
publication title The T4 phage DNA mimic protein Arn inhibits the DNA binding activity of the bacterial histone-like protein H-NS
pubmed doi rcsb
source organism Enterobacteria phage t4
total genus 28
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2014-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2770 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3wx4A00
3WX4A
chains in the Genus database with same CATH superfamily
4F3OA 2BW7A 1XR6A 3JSRA 1P6TA 4DUYJ 4PG6A 3T41A 1VLYA 1JLQB 1HNWF 2AGOA 3K2YA 1RKIA 5B09A 2APOA 1UVMA 4JI6F 5GMKa 1C0UA 4ALZA 4CCHA 3M6XA 1RT6A 2W7AA 4OHZA 5KFDA 1X0FA 3TI0A 1ZZFA 1OQ3A 4K0KJ 3CD0A 1RDRA 2JJ4D 2EK1A 3TZXA 4OYIA 4NZ7A 3D1OA 1G4CA 2AHOB 2XZDB 3POTA 3T1HF 4Q0BA 4ZVGA 3E8OA 1NSQA 5D4PA 2VBWA 1RAJA 4B9MA 5AXNA 3BQ1A 1RT6B 2ZBIA 2E1RA 4LR9A 5KFFA 1WC3A 1RYRA 3P96A 4KPYA 3M6WA 3GYNA 3OQ2A 5D0EA 4ZP6A 5HROA 3TEHB 1JJCB 3MEEA 3GCXP 2A2CA 3LF0A 2B56A 1NKEA 5L38A 3POTB 4Q0BB 3TRGA 2GHPA 2HVHA 2D41A 3HXMA 2FJEB 1UJ4A 3EZOA 4DPWA 5LL6d 2BKPA 4KGKA 5A8WA 3TUZC 1P8GA 2C28A 2P6TA 3HVAA 2XO6A 3HULA 4KJIA 5HROB 3GU0A 5BJRA 1YRXA 3MEEB 2OUGA 3RRKA 2DGTA 2E5IA 4F50A 2UVRA 2EXUA 3FQLA 1CJTA 3DRRA 1R0BG 4ZMMA 2W8LA 4P7TA 2W9BA 2WW8A 5LSLA 2CJBA 1UJ5A 3M8WA 4J9UE 4HACA 5A8WB 4NXMJ 2DNRA 1VC6A 1CJKA 1V6HA 2YNIB 3RBZA 3VZHA 1LOUA 2JC0A 4YR2A 1HMVA 1VQMS 1NSKL 4K8RA 3KJFB 2VKRA 3E3XA 3ZZOA 4J9QA 2IMWP 1CJTB 3DRRB 2W9BB 3EE3A 4ECYA 3ENAA 3KKFA 2HHXA 3V6JA 4HACB 2VASA 2ERRA 2FJDB 4LF8F 3S8SA 2V9KA 1CJKB 1VC5A 4WTYA 3W3SA 1HMVB 4WWSA 2ZH5A 2VG7A 4GKKF 5K8MA 2HHSA 3FMBA 4DPUA 2YX4A 3CJ8A 3IWLA 1RADB 2E1AA 4YMEA 3JXOA 5KG7A 2ZUGA 2YBVA 1YJVA 4M5HA 3X3UA 3LP2A 4KQZA 2XSFA 5CQGA 5KT6A 4OZJA 1N33J 2PSZA 3AOBA 2VG7B 2DR7A 2HRYA 3CJ3A 1FFWB 2HGMA 2CPXA 2WRMA 5HJXA 2OD4A 2FC9A 5ETOA 5F8IA 1T9YA 4DBQA 2E29A 3IBWA 1GK8A 2BABA 3M8YA 1O6XA 3AJDA 3QATA 5JXSA 1YJWS 4WFXA 2CQ2A 3M7VA 1NEEA 2BMBA 1X4HA 3PYFA 4UY8T 1MLAA 1XMQF 5HQ8A 4DMZA 3AODA 5AE1A 1OPZA 2ZH3A 1KWMA 1N0UA 2GMHA 3FBFA 3W9JA 4C9DA 4ZITA 2YH1A 3LO3A 2YKNA 4ZIWA 3EGZA 2JX2A 2PN6A 5DG9A 5DG7A 3DXSX 4DF4A 3DRXA 2KT5A 4I0WA 4WBFA 3Q8RB 1VQOS 3OL7A 4NA2A 3I82A 4L3NA 3I6PA 3R1LA 1NK0A 5I3UA 5T14A 4QZVB 2M2BA 4Q2MA 4DUTA 3E51A 2BYCA 2QX0A 3NWGA 4ID5A 1RAIB 1KVJA 4F26A 2WSCC 4Q7AA 4U9RA 3MAQA 1O8BA 4J91A 4LQ3A 2IFXA 3U7JA 3BN7A 1ZA2B 3RYLA 2MKIA 3BO3A 3C66A 5I3UB 3KLHA 2ZEJA 5K5MA 4ZLNA 1N5YA 1S97A 1RT7B 1SJ3P 4OZLA 3G8SA 3NKYA 1B0PA 4ID5B 5F3ZA 4NLYA 4OL8A 1Q7LB 4K7QA 5C25A 3DHWC 4ELTA 1Y00A 3I5BA 3NLCA 3BO2A 1X4AA 3DOLA 4N8NA 4OZ0A 1ACMB 1F9FA 3ISND 1QUVA 3WHIA 4M5KA 2ZH1A 3KLHB 4NLGA 2HQCA 4LFCF 4QPTA 4FN5A 4OZ5A 2GFFA 2YWWA 1N5YB 3CCSS 5DZ7A 2IPOB 1SI9A 1BQMA 3J81j 2XNQA 4LREA 5C25B 2Z8QA 1RTIA 1K9MT 3CCZA 3SSQA 2X1GA 1RWUA 3HLUA 3DOLB 1IR1A 3OXGA 4B3OA 2QL9B 4RBVA 1C1BA 4K4UA 2KB2A 1TL5A 2HQ3A 3R6GB 5HSPA 1FF2A 2AEFA 4RLEA 2KG0A 2E1MC 4DR3J 2ZZMA 3MUVP 2O67A 2H65B 4C97A 4TVAB 2RD5C 3PHTA 4JI0F 1BQMB 4B9LA 1RB0A 3CJ4A 1RTIB 3MCNA 1Q95G 2KJVA 2YPZA 4DV7F 1RHUB 1SL2A 2F8HA 1RA6A 4B3OB 4FPRA 3OW2R 1TL3B 4OZ1A 1C1BB 2CWKA 3OFHA 3K8VA 2QA4G 1NH8A 2H5IB 3E01A 1U1NA 5HVGA 1XNQJ 1MG7A 3M30A 4HH1A 1RKJA 2CQCA 2RUGA 5ETMA 4CWBA 4LVNP 2YKMA 4GMKA 5KFJA 3ZTOA 3PNIA 2C3OA 4USWA 4PG4A 4O0IA 4N5SA 2QLXA 1N8RT 2H48B 3GQCA 2LEAA 3LW5C 3NAIA 1XC9A 4DHVA 3EVMA 1IQTA 3G2XA 3E01B 4AQYF 3RB4A 3RBDA 1T05A 3Q2TC 2QLJB 3C8YA 4DS5A 3M30B 4FDFA 3SBMA 1YJNS 2QN6B 1XEZA 1F0XA 3QWPA 3CMAS 4F02A 2YKMB 3C14A 4JYAF 1F5CA 2CPDA 2FY8A 1X8DA 1N0VC 3FCVA 1OSCA 3A8KA 3KWMA 3OTOF 4Y28C 1WHWA 1Q16B 1T05B 4KTQA 2CQDA 4OV6A 3KMQA 2AYBA 3C14B 3HVTA 2M52A 5LMUJ 2R8HA 3BH6B 1NB7A 1U48A 1YIJS 5J2PA 3H59A 4OLOA 4O4RA 3DOKA 3SYZA 2J0XA 1UVJA 1Q4RA 4RNMA 2MEWA 2VU5A 3DI6B 4E0DA 2CNLB 1FRHA 1SIZA 2ZM6J 2CPZA 2KVIA 2ROEA 3GJRB 5KFSA 3ENVA 2HBYB 5H1SV 3WX4A 4G3IA 5J2PB 3PIOQ 4QIFA 3EGNA 3V4MA 4KHMA 4B9UA 4DV3F 1IUJA 1SH2A 2E5LJ 1QE1A 3DOKB 5L1KA 5ADZA 1ZM2A 5FIIA 3SCLE 2HFZA 4OI3A 1B3TA 1TL7B 2R9LA 3RAQA 3L09A 2DHXA 2WCXA 4DXLA 1ZETA 3CC4S 2GIQA 3FK4A 4YFUA 2VFUA 3BGOP 3DLKA 3DMJA 3D9BA 2YQ1A 1X7VA 2ZFHA 3MR7A 2V94A 2CPHA 1QE1B 2DYAA 2RU9A 2Z58B 4DX5A 5I4MA 4AYBD 2V4RA 4DV0F 1V3ZA 1UMJA 1NXIA 2OAUA 2XYPB 4Y6IA 1JXLA 1HWJA 4C8OA 4JV5J 2OP5A 4PXCA 1IWAA 3CJ2A 4OYOA 3CCES 1FD2A 3DMJB 3BKTA 4K2XA 2H5JB 4ICLA 1LWCA 2N4CA 1UZDA 1HNVA 2ZOFA 3HMJG 1U49A 2HIYA 4ZK7M 1G1XA 1S77D 4DV1J 1D09B 5DS7A 1VIOA 3LP1A 2P8IA 2C2EA 4LSLA 3N6NA 4DQPA 4ICLB 1SJ4P 4ED3A 1KDNA 2IVMA 1LWCB 4I7FA 1UFKA 4HL9A 3HSGA 1WC1A 1VLOA 3I4HX 1HNVB 4RO0A 4LJMA 2ZVSA 5HBMA 3H2UB 3BJYA 4FF4A 2EFQA 2YVSA 4NX9A 2HQFA 4KO0A 1K73T 2CQ4A 3LP1B 3H20A 4DQRA 3CUNA 4ECUA 2I2YA 4LSLB 4J9RA 1S0MA 1U8SA 3UI3A 4Y34A 4I7FB 4KGZB 4OQJA 4UF4A 1FJCA 1HHQA 4B9TA 5HBMB 3FEYB 1IVZA 3HO1A 4FYDA 2MQPA 4KO0B 4MIWA 3NCRA 4WU3A 2X1AA 3IM9A 1QM9A 2AD9A 1W25A 1OY9A 3U27A 4MK9A 2F9DA 4RBTA 2I38A 2LQJA 1N56A 4IG3A 4CTAA 4WCEQ 3ILJA 1QVGR 2NLWA 2JZ5A 2Z2YB 1HL6A 2FYXA 4PXDA 2R2SA 2PMWA 1FXLA 1CLFA 2NXEA 2GQQA 5CABA 4ECZA 3CVKA 2ZWPA 5KT4A 1N34F 3T5HA 3ADAC 1FRXA 4AL6A 4IG3B 4CTAB 1Q8IA 4NA1A 4FBUA 2J7KA 4L6V3 3BR8A 2JEJA 5DJBA 1CPZA 4P71A 4MIAA 1D9AA 1G2EA 3S7RA 1KNZA 4MMOA 2IJNA 1Q5VA 4ZPWR 1EAYC 1VMBA 1KP6A 4X84A 2CPJA 4YP3A 1T11A 1UETA 4PCQA 3T9NA 5C2GA 1W26A 2RQCA 4M5NA 1FJEB 3TEGA 5IV4A 4Y65A 3MI7X 4X64J 1VBXA 5E3PA 2DY1A 1H2TZ 3G6XA 1F1BB 3RU0A 1ZAWA 1RLCL 3AB4B 4CLYA 3C3LA 4N7TA 3CCLS 2ZC4A 2UXCJ 2VDIA 2OFGX 4OIXA 5HANA 1DHMA 3MM7A 4KYZA 3TJAA 1H2UX 1RT3A 2BM1A 2IA0A 2L41A 1L3VA 3D7SB 4DEZA 1ZTWA 3QPIA 1SB6A 2DKOB 1SV5A 4H54A 4Z7CA 2KHCA 4F25A 3CD6S 5B0BA 3A3PB 1Y3KA 4KAIA 1FJGJ 3QT7A 4B9SA 4WFBQ 3MM7B 1T9UA 5DLGA 3J7AN 4J9LA 2Q66A 2C2MB 5F0UA 2Y8WA 4XPCA 5LXRA 3KLFB 5KFXA 4OYPA 4JUZA 1VJQA 3UN5A 3A8IA 3MZIA 1RT3B 1QSLA 4X65J 3M8SA 2VJUA 1UFWA 4WU2A 2L48A 2GQCA 4TXSA 1SV5B 5KG3A 3P4UB 4ID8A 2J8SA 3US5A 3KK3A 3S6EA 3VGSA 5LSRA 3G9CA 2ZH8A 3LQVA 2AIRB 2JFKA 3AD9C 3T6BA 4P7VA 4TLQA 3W5XA 3VAKA 2NXUA 1JLEA 3H42A 3CO0P 4J9SA 1Y5NB 1RBLA 2AF6A 3KK3B 4MH8A 4GC7A 4OYAA 9RUBA 3MD3A 4DL7A 4DLEA 4L76A 4X4UA 4I6WA 2NYIA 3NCQA 4LUBA 2EVZA 4BBYA 2AGPA 3TO8A 3CDWA 2HHWA 3HHDA 4ZN3A 2MY8A 1WSRA 1JLEB 3DDNA 1TMJA 1ELOA 2BEFA 4LF9J 3V6HA 1VQNS 1URNA 2LQ8A 2C3YA 2ZH7A 4UY85 5FDLA 6FD1A 2MZQA 4MK7A 5ETSA 3L7PA 2W4DA 2EFPA 3KG4A 4KHPJ 3RBEA 5BYQA 4DR4F 4URSA 2NYHA 3MMBA 1U0HA 2VJVA 2V4QA 4U96A 5EUHA 2PT0A 1K47A 2VV5A 1R31A 2W9AA 2D3O1 2A10A 2JL9A 1FRJA 2QZ8A 3ITHA 4FF2A 3LAMA 4I6AA 4ZLLA 2OELA 1MN9A 2RMLA 3TA2A 4EMDA 1PIEA 2KYZA 2VD3A 1JWWA 3CJRA 1X5SA 3NNAA 4QOTA 3M1VA 1HW8A 4I2QA 1WUUA 1SC6A 3MMBB 1U0HB 4Q8FA 5KG5A 4U8VA 4KFBA 3HM9A 3AHPA 1CS4A 1MMDA 1B64A 3UN2A 3ITHB 1PYOB 4QBUA 1KQFB 8ATCB 3CC2S 4R0JA 3QRQA 3ZO7A 1FVQA 2DH8A 2IRUA 4DV6J 4RWWA 3JSMB 3M1VB 4V19J 5HATA 2G2ZA 1ZZNA 4ZVUB 2LXIA 2P9EA 1S9EA 4YDDB 3PKMA 1RWOB 1TUWA 1Y5LB 4EO8A 4KFBB 4NXNF 3D0IE 5B0CA 4CLLA 1Q8LA 3AB2B 2I6WA 3JS9A 4K0KF 1NJWA 3W1YC 1P1TA 3HHKA 4S0MA 1U2RA 3CDUA 2ALZA 4IUFA 4XTTA 4NLOA 4PPZA 3AA9A 6AT1B 2RH3A 1S9EB 4LF6F 2EPIA 4XO0A 3BPSP 4CO4A 1NPPA 3IG1A 1SKUB 2ACYA 3ELHA 3VTIA 5KFTA 1VK3A 3THVA 1EETA 1M1HA 2RRBA 3QQCD 3JTPA 3OXFA 3SIPB 1QTMA 1HHTP 4JP8A 3RB0A 2ZH2A 4RUHA 4FKXA 2QO3A 1RWMB 3VR1A 1WC6A 4DX8H 2XHCA 3IG1B 4Q5VA 1YITS 3A13A 3C6UB 3RR7A 3CCTA 4WE1A 4CT8A 2MQLA 3KLVA 1EETB 3VZIA 1CSJA 5DO2A 2YKPA 2V0NA 3KFWX 3PFOA 1G6BA 2AV5A 2AW0A 3QRPA 2DNZA 2D69A 1VQ7S 2ACMA 3RGIA 1PO6A 1IKYA 5BXIA 3TUIC 2WSFC 1XR7A 5CYQB 1U25A 1NK9A 2YWFA 2KDOA 5GADU 4NXMF 5HI7A 3G87A 3D67A 2FLPA 4O3SA 4AL5A 1TELA 3GLJA 1X4DA 4YEAA 3TAMA 2CQ0A 4FXDA 3HHNB 2GVDA 2BDPA 3OTDA 1BLUA 1PSDA 3LANA 3NG8A 2HVIA 3UFCX 2V50A 5D0RA 1IKYB 2VODA 2AEJA 4C8ZA 2ZHAA 1KLNA 1N52B 4F2RA 3H5XA 3ET6A 1FEHA 4B17A 3OR1A 1RHRB 2U2FA 1SKSA 2EG2A 3TAMB 3T1AA 3I5AA 1FI4A 2OSRA 2GVDB 4FYVB 2WVCA 1TL1A 2R8IA 5KFQA 1B7YB 2KZMA 3LUYA 5IS2A 2IAJA 4LF8J 1RI7A 3NGKA 3G6YA 2EI5A 2W2OP 1X60A 2GJ2A 1H6KX 3VAJA 3P5TL 2V8VA 3G6VA 1VHIA 3ET6B 4CZCA 4NMXA 2XZWA 4IG0A 4Q45A 1VBZA 5IT9U 2GHWA 2VBXA 4F0HA 3OR1B 4FYXB 4NLPA 3PXGa 1X5TA 3D1QA 2BJEA 4HKQA 3W9HA 3N6MA 1VFJA 1TL1B 1UA0A 2IAJB 4OI0A 1RE1B 2A2DA 5L46A 3VQTA 3QO9A 2XBPA 3Q22A 5D0GA 1URRA 2BE9B 4IG0B 3MUTP 1RXOB 1R8HA 2C3MA 1X4BA 2FJBB 4ER8A 2OO4A 2KN4A 3MGJA 2OH2A 1S72S 2DNMA 4P2MA 4ZJQA 2LXFA 3CXCR 4A8KA 3RW7A 3CMES 4NLQA 1TU0B 2ZOGA 2UUAJ 3QO9B 3MOZA 1TAQA 3MM5A 4YHHJ 1L3SA 3BREA 4ZCMA 1M5SA 2KHDA 2Q43A 1TQLA 4QR1A 5GAEU 4DCOB 4Y00A 1U8WA 3KJNB 1Z2ZA 4UUXA 3ZZTA 5ETPA 2GGPA 2AU0A 4XIUA 4EEYA 5MAOA 3NOCA 1S1VA 1FDAA 1IXKA 3MM5B 3SI8A 2XMUA 5C7PA 3G96A 2DR9A 1YWXA 4KBIA 2DHSA 2DRDA 3KLIA 3BS9A 3DNCA 3TP2A 1Q0NA 2GO8A 1Q82T 4LT6A 1PYTA 1RBOB 1KN6A 2GGPB 2J9DA 1T95A 3GIRA 4ZVSB 1KEKA 1TKZA 1F3VA 4LQ9A 3OL8A 2G0CA 1S1VB 4RJVA 1SQGA 4DR6J 2DK2A 4IOBA 1BMQB 4F3QA 2AQ4A 5IT9Y 4K50A 4JI3J 1QVFR 2XWYA 4FYWB 4ZCLA 2C2DA 1TAUA 3LALA 2D7SA 1F5BA 2MZRA 3KLIB 1KOHA 3ILOA 4ERDA 4PRFA 1FVSA 1KQGB 2WAQD 3F56A 1LNQA 4J9PA 4ELVA 3ZZRA 3QFWA 4YB7A 4BCAA 3MEDA 1TKZB 2Y1IA 1R6YA 3J80U 3C46A 3DYAA 2IM0A 4MKBA 1APSA 1VDHA 3CJSA 2YNHA 1RU2A 5E7OB 4L3KA 4LFCJ 1JJ4A 3G6ES 1VBYA 1V5IB 3OSPA 3GV8B 4O23A 3B82A 2PEBA 1C4CA 3SFUA 2M70A 4NI2A 3CT9A 1RYSA 4KGMA 4DR3F 3BSCA 5KFYA 1RHJB 2GVZA 3K5LA 2VQFF 3MEDB 4BLGA 4DL5A 2IRXA 3OUYB 2DD8S 3FVYA 3GPAA 4J37A 2ZUAA 4JI4F 3FBCA 2YNHB 2AEMA 3DCAA 3R6LB 2ZNZA 3P6YC 3KUEA 3MPVA 2GMJA 1AA1B 3SCKE 4DQSA 4YOEA 1PYSB 4NI2B 3LTOA 3R1HA 1UVLA 5J1EA 2GVZB 2DIUA 2EFGA 3CD7A 1C4AA 5LJ5Y 1XNQF 5B0AA 2Q6BA 3W5ZA 2GW8A 3MCSA 4IRKA 4OHVA 3VAFA 1LWFA 5AT1B 5D8HB 3BEGB 1S0OA 3OLAA 3MMCA 4X4QA 2R7TA 2GCFA 1U02A 3EGVA 4A8MP 1NLKL 3B8HA 5U47A 2H4WB 2J0WA 5J1EB 2HS4A 2B5JB 2FJWA 3P8BB 3QT8A 4HT7A 3KTQA 1Q1KA 2GIFA 3M2RA 3OHBA 2LQ9A 2IJFA 4P73A 3NMRA 2HS3A 5HVHA 3MMCB 4LRCA 3OVSA 4A8YA 4OX9F 4RU2A 1DZ5A 2YWHA 3UPFA 1H74A 3N6LA 3NNCA 5LJ3Y 2RSQA 2OIHA 2CNKB 1GAOA 4C4WA 4C6AA 2IRYA 4OZNA 4DI6A 4HDGA 2EW9A 3M2RB 3J80Y 2HSEB 3UWTA 3V2UC 2Y1RI 5LMUF 3I9V9 1U2CA 3OTOJ 2DH9A 2QJ3A 2A6MA 4LRAA 1DQAA 1X5PA 2J0SD 2GAHC 2IM3A 5M2RA 2F4VJ 3CCMS 4CIOA 2UUWA 3BSAA 1Q8KA 3D2WA 1RISA 2DT9A 2GS8A 1EKRA 1TV6B 3PW5A 2ZM6F 1WHYA 4B3TJ 2ATCB 2A0FB 2B9EA 5KFCA 4RNHA 3FSIA 1TK8A 1HBUA 2E5LF 5EWGA 4DFKA 4EYHB 2UXDJ 2Z4PA 2D9PA 2ZBCA 2NUUG 4WFNQ 4IO1A 2ZWOA 4ETXA 4YB5A 3PO4A 5DDPC 2HNZA 4CRJA 4DFPA 1C0TA 1AFJA 3UO0A 3CO9A 3TOQA 2BR0A 4WYWA 1KKHA 4CI0B 1XK8A 3R8YA 5DM6Q 3IR5B 2B51A 2C2RA 3SSRA 1YKWA 2XS7A 4DOZA 4X4NA 3T9ZA 3MAHA 4URGA 3IP0A 2RU3A 4LFAJ 1HNIA 4M5DA 3H90A 1T3NA 2HNZB 1EP4A 1C0TB 4NA3A 2HQGA 1KFSA 5KFGA 3EDRB 4DSJA 3BBCA 1M0SA 2IYIA 1S7HA 2X3GA 2UXBJ 2V8PA 4UOCA 1JKHA 2XY7A 2R2RA 2BZ2A 4DV1F 1HNIB 2GJFA 4M5DB 4LBHA 1HHSA 2CQGA 3A12A 1AB8A 1T8EA 2KT2A 2YQ3A 1EP4B 1S6PA 2V34A 1EHWA 3QGIA 3Q8SB 4F36A 3BSOA 4O3QA 1DAXA 2ZITA 2HLTA 1PJ5A 1JX4A 2XMTA 1UL3A 1JKHB 2CFXA 1JNZB 4CO3A 3QZ7A 1D9FA 1X31C 2K8GA 3CW2C 4N56A 4MKAA 4NRUA 5DLFA 4A8FA 2NREA 1S6PB 1X0PA 1M1KT 5IC6B 4P6QA 4QWBA 2Z0GA 1LKZA 5BYRA 4IDKB 7FDRA 1SQFA 4ECSA 1TL4A 4WXWA 3IRXA 4NLRA 4N76A 1WEYA 3V4IB 5CCMA 2Z2LA 3TJ9A 1WDTA 5CYMB 3VGVA 4KHRA 4B02A 3M8PA 1R7IA 1NM2A 1I1GA 4MTPA 1F2GA 4X4OA 3W62A 2HZVA 3KHLA 3K5NA 4DG1A 3OR2B 4QW9A 1VIXA 5D78A 2AZ3A 3WX8A 4C8YA 2G0IA 3W2WA 3NGUA 3IRXB 2I8EA 5LSOA 4C0HA 4EZ6A 1S76D 2W2PP 4IYQA 2XYGB 4G65A 3NS7B 2BE2A 3D0GE 4UQGA 1WNEA 3M8PB 2ATLA 2DHGA 4ES3A 3CCVS 3IBFB 2MKHA 3KUGA 5ITHA 2K1RA 2J6UA 3EXYA 2WW4A 3K59A 1YDLA 1NK5A 2WVEA 1N34J 4U7UK 1KD1T 4MYTA 4I6YA 3RG6A 1X4GA 2BE2B 2R7XA 2KO1A 2F8EX 3SCIE 3A3OB 3QBCA 3DN9A 1S9GA 5KT5A 3TZZA 1KVIA 2V8HA 4RW7A 5JUMA 4X64F 2K1RB 3UNGC 3QGGA 4JI8J 3R9LA 1G3OA 5CXTA 5C5JA 4PXBA 5K14A 4M8LA 3GZ7A 2BRKA 1J5OA 1RZMA 2DPIA 2UXCF 2M88A 3GJSB 4LVOP 4O3PA 3IWNC 2FHMA 1NDKA 1R0AA 4ED6A 1RHKB 1T9XA 4FVMA 2MKYA 4DWIA 4DF8A 3F44A 1YHQS 5GMDA 1S9GB 4DU8A 4IR9A 4RW7B 1VC0A 3ZTRA 1NDPA 3VF0B 3GSDA 4M5IA 5K14B 1RTZA 3IAM9 1RAHB 2F9JA 1J5OB 2QL7B 1FJGF 1T9TA 1VK8A 5K8PA 1EIYB 4HEA9 4DL6A 4B3SJ 5DQHA 1R0AB 1IJEB 4IH7A 2MY7A 4A4JA 5B0GA 5H9FJ 4DV4J 4X65F 2QE5A 2V2QA 2IVFB 5D4NA 1NNDA 3HF5A 3OTEA 3EX7B 1UFLA 4X4SA 1FDDA 2RVJA 1VQ8S 3W8PA 3G86A 4QCLA 3HZGA 3EDQB 4DQIA 1QAXA 1X4FA 3I32A 4DR2J 2HQDA 2E5JA 2NR0A 2CZ4A 3S1TA 1J5EJ 5AE2A 4MKVA 3QZ8A 2R42A 1YBTA 1XBWA 3NAHA 1V9OA 2JVRA 5A6WA 5KG4A 4PUOA 4TY8A 2OEMA 3JQMA 1JLBA 4ENOA 3VALA 2YTCA 1S48A 2Q6CA 3UNYA 5KFKA 2LYVA 4ZVFA 1S1WA 1RLDA 5LMNJ 4IH6A 4I4BA 5IC4B 3MTKA 2DNQA 3PW7A 3Q23A 2RRAA 2Q1LA 4PUOB 3HHLD 5AXMA 4LF9F 2EC2A 2D9OA 4TY8B 1XJWB 3PVXA 2EEYA 1JLBB 2HQIA 2B4PA 3EPGA 3LWLA 3SV4A 1S1WB 1Q78A 2FIUA 1QAIA 4KHPF 1S4EA 3VGUA 3KOAA 3LWMA 1T9WA 3CD5A 4Y2MA 1HBNA 1OY8A 2QLBB 4OJGA 1I6JA 3PR5B 3HD1A 3CTRA 1MN7A 4DL0C 3JQJA 1FXDA 1UWBA 3RZAA 2RDIA 3L4BC 3BZQA 1MROB 4HHHA 4CLFA 2ROGA 2VL1A 4EI2A 4ZPBA 2W2QP 2B7BB 2VFTA 2BQRA 2W7OA 2HGLA 3WQPA 2X51A 1HBNB 2EWHA 5J1NA 4UQTA 5EWEA 2DNLA 2FZCB 3UDEA 3BH7B 3NEKA 1UWBB 1WI6A 4NEZA 3GR1A 4YR0A 3SEOA 1VRUB 1YG0A 2DISA 3GIIA 2LDYA 3VAIA 2ZHOA 2IIHA 3KG0A 2MHEA 4DV6F 1R8BA 4E8UA 3IBCB 2O3DA 4PG7A 2LFVA 1VOMA 1HPZA 2FVQA 5HK4A 1V3SA 4F04B 1ZA1B 5KFNA 1NB2A 3CCUS 3QFHA 2VC1A 3I4PA 2WVBA 2VQEJ 3UDLA 1BQNA 1DLOA 1HQUB 2AT1B 1HYSA 4WK1A 3R7BB 3B54A 3JSYA 2AMCB 2HFNA 3B78A 3EM1A 4CQ1A 5GADI 2KRRA 4NXNJ 4F4YA 1Q79A 3BGRA 5RUBA 4LF2A 1HPZB 4A8SA 4DFJA 2JHEA 2FVCA 2DGWA 2CQHA 2XO7A 2B4OA 4MKYA 3PG9A 4CNYA 1PCAA 3O5TB 2ROPA 1BQNB 1DLOB 1GX6A 5IT0A 3AQPA 4ED4A 1HYSB 2VIHA 1U6BA 1IKWA 3MFHA 4LF6J 2W9CA 3TZWA 2R8JA 1N88A 3BGRB 4H4OA 2NZCA 4ECXA 4PG5A 2N3OA 2D3UA 4M5JA 4K4WA 1NBEB 1QY7A 2MQOA 4YY3J 1HFEL 4K4TA 4GO7X 4USKA 3WBZA 1UCNA 4E98A 1ZH5A 1IKWB 3BPDA 2J7UA 1F60B 1BE4A 3U02A 3N01A 2W9CB 2XI3A 5DDOC 1FNXH 5F9LA 3ZZPA 3R27A 2F7VA 1UVIA 9ATCB 4NYPA 1LFWA 4H4OB 2ADCA 4F4KA 4MT1A 1TMMA 4D3GA 2YNIA 1TZ0A 4UZBA 2M5YA 2M3DA 2KFNA 4IQXA 1WF2A 2MKKA 4LF5J 4ZKAA 1GH8A 1RJJA 3A8EA 3CCJS 3HDSA 4C3KA 1SCJB 2NXJA 3H4DA 2OMLA 4WKRA 1HWKA 4FNHA 3HFVA 3L7OA 4UT4A 3GJQB 1LEOA 5DQIA 3CE8A 2CVIA 3NGRA 4F67A 4ZN1A 3MM8A 1H7XA 1IBLJ 4DSEA 3HX9A 1IBMJ 2V2ZA 3PJXA 2V67A 2M7SA 2XMMA 1GQEA 5E0OA 2J76E 4ED7A 1RT1B 2DGUA 2RHSB 4TQRA 4I56A 3W7BA 3JSBA 2XWXA 4NRTA 3Q8QB 3VVTA 1D3WA 3G8TA 2CNNB 4DLGA 4HYKA 2ABYA 2CQIA 2Y0SD 4X66F 4O0NA 3GILA 3M9OB 1RT5A 3MM8B 1V5VA 4JBCA 4OI1A 1UW9A 1KC8T 1FJ7A 4L73A 4O4GA 4WXOA 1DTTA 4DX6A 2Q3PA 1FKPA 3CCRS 1U0SA 3SQGA 2HURA 4GKJJ 5DZ6A 3G71S 3PW2A 2NZ4A 5DETA 3L3CA 2BQ3A 2MQ8A 1NJXA 2YX7A 1VR6A 3QGPA 1VQ4S 2C2KB 4OI6A 4TYBA 1RT5B 2CAJA 2ZKUA 3WC0A 5G4DA 4O4GB 3GFYA 4Y0FA 1DTTB 1FKPB 2R8KA 1X9WA 3SQGB 2V8DA 2NXCA 2X3DA 4QWDA 2MQNA 2M8HA 3ZNUA 3BO4A 2VBZA 1ZOTA 5L9XA 3R5DA 3N5FA 4CO0A 3AH6A 4EK2A 3THTA 5JMNA 4GRSA 4TY9A 1T02A 4QYRA 4DUZJ 1K44A 1WKKA 3I31A 4DFMA 2IJRA 4C98A 3W8GA 3ZFVA 2WB4A 2W24A 1HKAA 1S12A 2UUAF 4L72B 1X9SA 1GT8A 2UVWA 4K5SA 5L8RC 4YHHF 3H2LA 2FJAB 5KFIA 3D28A 1WHXA 4ED8A 4DPYA 3NXZA 2QMWA 2AX1A 1TFYA 3MMAA 4P52A 3NY0A 3HSDA 1DRZA 3HJFA 3UDCA 2W25A 1M90T 3WDOA 2HHQA 4J5OA 2UUBJ 1Z1ZA 5CHCB 1M5OC 4XDDA 2E7XA 2BV3A 2MYFA 3CDBA 2CZ9A 2B8PA 4RW4B 2L08A 3MMAB 3ZTSA 2DHAA 1RT7A 2KI2A 5HO4A 1DARA 2IY5B 3K89A 1H72C 2AJFE 1P1LA 3H4BA 3JB9k 5HMXA 4O3NA 5A76A 3EVOA 2BKOA 1RACB 1JIHA 4DR6F 3M9NB 3LGHA 1Y7PA 3F0NA 2RB7A 4JI3F 2E5GA 2G1DA 3VAMA 3THPA 1T9VA 1NK6A 1OMSA 3AQOA 3DOMA 2DNOA 3AJ1A 2G9OA 1WOOA 2Q79A 2XMWA 4C3LA 1KHWA 4YN3B 1U1RA 2YX1A 1BQXA 2C3PA 1UP1A 2YWGA 1SVDA 3KG1A 1SXLA 4ANEA 1BXNA 4OX7A 4K4ZA 2GQ2A 5KFVA 4NLWA 3X1LB 4P72A 2QA1A 2DEJA 1U1MA 1RSCA 4NLUA 4WK3A 3K57A 3DOMB 5ETVA 5EGYA 1EZZB 5KFUA 2I0XA 2X1BA 3RW6A 4G1PA 4ECRA 3OVBA 4ZOSA 2O5DA 5KFEA 2DGOA 2VZ9A 1WF0A 4HHUA 1U1KA 3GYGA 1TL3A 1XMBA 2DO0A 3VVUA 1AUSL 3FQKA 1F5AA 2VQFJ 4R5PA 2I1RA 2M8DB 3MPDA 1O51A 4JI4J 4OYZA 1FWKA 2MHNA 2QLWA 1RT2A 1EQ0A 5DM7Q 4QIGA 3BYPA 4QQBA 4NLTA 2RJZA 2AJ2A 5MLCV 4J9KA 2H9ZA 5T7LA 4Y2CA 3HVWA 1VS3A 4DR7J 4MIBA 3DGPA 4RPFA 1WG4A 2MZJA 3UD3P 2ZH6A 3K5OA 4LIRA 3AD7C 4R5PB 2QL5B 1SQEA 4AXIA 2MKCA 3R7SB 4ZPCA 2UVVA 3CULA 1RT2B 2DGVA 2E5HA 2U1AA 5BR8F 4N77A 3HT0A 2IBKA 3QMQA 5T7LB 2J9DE 3VWSA 3DGPB 5D4LA 3MURP 3A4TA 3LGNA 3R5BA 4YUDA 1FE0A 3PRVA 1YJUA 5KOXA 4ELUA 3J7A1 2PMZD 2VA2A 3ZZUA 3WC2A 3V5RA 3CC7S 4GVBA 3KK1A 2CA9A 3ENQA 1QJHA 2N7CA 1ITPA 1CC8A 1IJFB 4OX9J 2B4VA 4Q2LA 2ZZNA 5GAHU 1FRIA 4OHXA 1L3KA 2M4MA 3Q8PB 3GWCA 2Z30B 3BYRA 1PILA 3ZZZA 2JEFA 1UEVA 3EJMA 4GVBB 3KK1B 4KB7A 3DI6A 1D8ZA 2P9CA 2F4VF 2FLLA 3SMZA 4PQUA 3NCPA 3PYDA 4ZVTB 1ZS6A 2QFIA 3N4WA 3W9IA 3DKDA 4F0KA 2RT3A 3D0HE 2YWEA 1HQEA 1UWAA 1WEXA 4LF7F 4B3TF 1WEZA 5DDQC 3MR3A 1VQSA 1SH3A 1T94A 1F9HA 4RUCA 1TP7A 5H9EK 1TL7A 5L1JA 1FXRA 1JJHA 1NAQA 5FLXU 4PQUB 3ZNJ1 3B4DA 1T03A 1EKSA 3C16A 1YTYA 2UXDF 1OYDA 1NSAA 4ZPAA 2KKHA 1N5TA 1HD0A 3TYTA 1HQEB 3NBPA 1U1PA 1TKXA 2OEKA 1HNXJ 3EXCX 3L7UA 2QMUB 3VAGA 2Y1LB 1VQYA 1MU2A 3ISNC 1WG5A 2OMOA 3UW1A 5KG1A 3FSYA 1T03B 4AD6A 3C16B 2F40A 4K4XA 1RCXB 4Y3CA 1RWKB 1Q53A 4LFAF 2MQMA 2VDHA 3C6TA 2EFOA 2V2KA 5DGBA 4JI1F 2K7KA 3NBPB 1TKXB 4LF4J 4PQAA 1MNEA 1K0TA 4JI5J 3GFZA 1NCLA 1FK9A 1MU2B 1OYEA 2EKNA 3CMQA 3GIJA 1JMTA 1WKJA 1KLMA 3I0SA 2UXBF 3EUNA 2VG6A 3ETMA 1RQ0A 2AJQA 4DSKA 2KXNB 3C6TB 3MCMA 4EGLA 1N6QB 3B6BA 2DJWA 1U1OA 5J2MA 5HLFA 1HI8A 3DC2A 4LRDA 2MSSA 5CAAA 4O44A 1CQMA 3OTCA 1FK9B 4QR0A 4EZ9A 2DNHA 2XLJA 3GONA 5H9EJ 1HBOB 2MZTA 3CF5Q 1M1GA 2A3JA 3IAS9 3TVYA 3I0RA 3I0SB 1KLMB 3GCWP 4ZHRA 1IQZA 4QU7A 2HG4A 2VG6B 2MMYA 2LVWA 1CBKA 4CO5A 3VQSA 4CO2A 4QJVA 5AJ3J 4RNNA 2J9CA 2JH3A 2RKIA 2ZHBA 5J2MB 2J0QD 3J7ZT 2MJNA 2MLYA 5HLFB 1AT1B 3UR0A 3R2DJ 1OWXA 2KH9A 4O44B 4UOHA 3C19A 3MPUB 3Q2SC 5FLXY 2QA4S 2JLEA 1VQ6S 2P9GA 2PIIA 5A6PA 3I0RB 4OJHA 3RRGA 4I69A 4ZHRB 1JLCA 4I1TA 4K4YA 3UDVA 1WOSA 3MAAA 3TR5A 1SUQA 4DV2J 1CULA 1MWQA 2LA6A 3IWXA 4C11B 2QYCA 2RKIB 3M6VA 2HWIA 1TR0A 2DIVA 1LW2A 3DLGA 3D6HB 4EUVA 2OPSB 2KM8C 2GHVC 3OJSA 2XLKA 3SCJE 3PX6A 1JLCB 2F65A 3BR9A 2V6AA 3MAAB 3DRSB 1SUQB 1CULB 2FGOA 1RTHA 1X4EA 3PIPQ 1RHQB 2QG9B 2MQQA 3TAPA 2VOOA 4DPXA 4CLSA 1HI1A 3O1LA 1RTDA 1LW2B 3DLGB 2J6TA 4P2XA 2HVZA 3KMSA 2C2OB 4O3OA 3UCGA 3N0VA 4IQMA 4U95A 5KFPA 2LA4A 1L5UA 2CJKA 3HKZD 2Y0BB 1RTHB 3CGIA 3F41A 2XB2D 1YJ7A 3PRDA 2DRAA 5J2NA 2R3VA 1YBUA 3KJVA 2LKZA 3BKUA 3ILLA 1RTDB 2L9DA 3LAKA 1VJWA 2F63A 4IRCA 1YJRA 2R4FA 4EU0A 4M95A 2BXJA 4WFYA 3LGMA 5F8NA 2YH0A 4KY3A 4JI8F 4USJC 5LXYA 3EGWB 2HFOA 4R8UA 5J2NB 3KJVB 4OHYA 4CLKA 1FERA 4WZMA 4WIQA 4TU7A 5A0YB 1XERA 4KH1B 2IYGA 4ED1A 1A6LA 3SDEA 2IVYA 3SFGA 2CPEA 3PHEA 3KLFA 5KFHA 3D68A 4EBDA 5F8MA 5ETKA 3G82A 3R3TA 3D54A 2VPYB 3T5LA 4C8MA 3D6FB 1GTEA 2NSBA 2ZBPA 2ZOMA 4R8UB 4B3SF 4DV5F 3ICLA 2NXNA 2F4FA 4YB6A 1RWWB 4EBCA 4DV4F 1UEKA 1WTBA 2F3JA 1IR0A 4TYAA 2JNJA 2LEPA 5LM7E 5K8NA 4KT0C 4DSFA 3SDEB 1DTQA 1DQ9A 1IKVA 4IO9Q 4Q8EA 1RAEB 1RUSA 3G82B 2VFRA 2G2OA 4A47A 1C0UB 4X4RA 1QSSA 4ZPTR 4NYOA 1VQKS 4DR2F 2HKEA 1GXUA 1J5EF 4ZA1A 3TARA 4ZVHA 1REGX 2GIRA 2FHKA 2GV1A 4A8WA 4CLWA 1B70B 1RAFB 1MW7A 1UVKA 5T41A 2RQ4A 1DTQB 2CG4A 1IKVB 4PAAA 4U6PA 2BQUA 4DCPB 4G1IA 1NMEB 4HR2A 5FD1A 4DL2A 5FJ4A 2VONA 1F9EB 1S5ZA 3GE9A 2KT3A 2IDEA 5LMNF 3ZTQA 4OYMA 1OY6A 3M2VA 3TQEA 1KSPA 2DVIA 3DDKA 1GMVA 3M05A 2P5VA 2M0GB 1NKCA 1PJ6A 2X1FA 2R2UA 2QTWA 4QWAA 2EFVA 1C1CA 4EO6A 1REVA 2AP6A 1IKXA 3PW4A 2OHDA 2VFSA 2IA6A 2HS0A 4AUKA 2KRBA 3M2VB 1QUPA 3PYEA 3JTOA 2OPPA 2ZC3A 3PY8A 2PC6A 4DSLA 4ES1A 4CM0A 1YBAA 3FDSA 1RA7A 4RR5A 3R5AA 2KM8B 2LMIA 4LFBJ 4A8XA 1C1CB 4IH5A 1REVB 1IKXB 4RZRA 2ZJPQ 5EWFA 3RAXA 4ECQA 1Q81T 1FRMA 2OPPB 1NDLA 3IMQJ 1YZ6A 4D3HA 2ASJA 1DBDA 2EG1A 4MK8A 3FJ2A 3EMTA 1W2IA 2MXYA 2KYXA 2XLIA 1N5SA 4X4PA 3OBIA 3JSMA 3KK2A 4DR1J 1ZAXA 3AA8A 2UZAA 3DRPA 1RK8A 4HDHA 3QGHA 2XS5A 2KXFA 4IFVA 4MAKA 3TJ8A 2HWHA 3GV5B 1X5OA 1NO8A 4PYAA 4PWDA 1F2HA 2H3EB 2JWNA 1N5VA 4KPCA 1U4BA 4OJ3A 2IM2A 3RTVA 4FS1A 4DCJB 2VQEF 3J7YU 4PKDB 3KK2B 3KHRA 3BDPA 1I94J 3DRPB 4RW9A 2LQBA 1FFSB 4I64A 3JYTA 2GNKA 4CLPA 4LIWA 1SIWB 4IFVB 4F3MA 4IOCQ 3LP2B 5HVFA 2MLXA 3RB3A 2VB6A 2ADBA 1LWXA 1ZPVA 2HHHF 2DY9A 1GX5A 5K8OA 4AE5A 5CZVA 4PWDB 1Y11A 4ZS6A 1IR2A 2BJ3A 4ED2A 1TTHB 1S0NA 2WZ1A 3TZYA 2B0GA 1RAGB 1HW9A 3FGVA 2BBEA 2KG1A 5AXLA 1MSWD 3LA0A 4RW9B 5L1IA 3UCZP 2HAIA 2HFVA 5HAOA 2RF2A 3JYTB 3ETOA 5EX3A 5GMEA 1D0EA 2C2NA 3TANA 1HWUA 3T5KA 1KFDA 4CDIA 4G1QA 1H3DA 3OLBA 1RCOB 1H0HB 1HNZJ 1FNOA 4BDPA 1N48A 2ZNYA 3C6UA 1QAJA 2RILA 1VCTA 4P75A 3MR6A 2Y8YA 2PFDA 3MM9A 4NCAA 1XWLA 1X4CA 4X62J 3GIMA 5D3GA 4YY3F 2AGQA 4ZVPB 2PGCA 3Q86A 3ZTPA 2YKNB 2RF2B 4JI7J 4RL1A 4LSZB 1WWHA 5EN1A 5CYQA 3PZPA 5IOLA 1R89A 2GO9A 4JI2J 2EKYA 2WVDA 4G1QB 2XG8A 3ZC4A 2XS2A 3CDEA 4C7QA 4LF5F 4ZVQB 3MM9B 5B7WA 1RAOA 1H7WA 2H5EA 1ICEB 5D3GB 3V6KA 4RX6A 4C8KA 2Z2ZA 1F3FA 3M9MB 3QT5A 1UA1A 1U24A 2HBZB 1IBLF 1IBMF 2FUG9 1NJZA 1Q86T 3NGDA 1H38A 4TLRA 3HK2A 2V4JA 3GP9A 4KGXB 1H2VZ 1EJ7L 5D6GA 3HFZB 1IN0A 2FJVA 2OI2A 1JK9B 3IFEA 2DNYA 3VCDA 2DNGA 5C42A 5M2PA 1JLGA 2AYMA 4DPOA 1JB0C 1VQPS 2W4CA 4QIWD 2MKSA 5GAGU 2FDNA 5KTQA 4KSEB 1U1LA 3TWZA 3KNAA 3BM7A 3TA0A 4Y2KA 3UCUP 2R7VA 1E6YA 2V4JB 1H98A 1IBKJ 3TNVA 5KAKA 4GKJF 3QIDA 4X66J 3NS6A 2JSXA 3UE2A 1Y9OA 2FJXA 2CRLA 5C42B 1JLGB 4UOFA 4XK8C 3T3FA 1T7PA 5E3CA 5IFMA 4NLDA 2EK6A 2VC0A 4ZDNA 2VPZB 1M5PC 4ZIVA 5IQ6A 1Q7YT 1RTJA 1E6YB 1VISA 2H54B 3EYZA 1S6UA 1WOPA 2R7WA 2PD1A 3H0PA 4C0BA 3FSXA 4KGVB 1DFDA 1AROP 2CQ3A 1CC7A 4OMFG 3MOJB 3FC9A 3D3CJ 3AAWB 2V9WA 1U2FA 2AYEA 5KFMA 3QAEA 4ZVOB 3AJ2A 1S99A 4DUZF 4AFFA 4EWTA 2LP4A 1RTJB 2QV6A 3DLJA 2UUTA 4B3RF 1YJTA 3BGFA 1E6VA 5KFWA 2FQQB 4ZP7A 2DGXA 2RDJA 1S6OA 4M94A 1YJ9S 3P5BP 3IA0A 3BKFA 4PABA 3KLGA 1RBAA 1WC4A 3N9UC 2KFZA 2XCAA 4HH0A 3GB0A 3H5YA 2FTRA 2WSEC 5B0DA 1SJ1A 3L9ZA 2DBBA 2XY6A 2RAQA 3PKYA 4YQWA 4K5RA 1M5HA 3UR3C 1JQGA 3IR7B 2UUBF 1SC3B 3K17A 4DZ6A 1E6VB 2F1FA 3LPEA 2N4DA 3NWRA 2DGSA 4PWWA 2DGQA 1BD6A 3M8QA 2D74B 3MEKA 2YXLA 2WBMA 4ILMA 3KLGB 4LMZA 1OPIA 1YRUA 2E9ZA 3QJLA 1KONA 1FHTA 4WZQA 3RBXA 4OHWA 2CJ9A 3Q8UA 3CJ5A 4ANDA 4MJKA 2KXHA 3LOUA 1PG5B 1YVFA 5F8LA 2POKA 4C2MA 3M8QB 1IM6A 3HCXA 1ZM4A 3H7HB 3BDEA 1KS2A 4OX6A 2ASLA 4B08A 1FX2A 1NZAA 3HVTB 2HFUA 3O2IA 3CCWA 1VHFA 4LF1A 3E2EA 3HVRA 3KDNA 4WP8A 4F8RA 2W01A 3PACA 2DR5A 1UTAA 1DY3A 2EBEA 4EYIB 1WC0A 3J7Z5 2CXEA 1TKTA 2YNGA 4OYBA 3FFIA 1QDUB 2WONA 3OFGA 2XGPA 3OUYA 3MXHP 2XQCA 1TK0A 4YS2A 3ZXWA 1U09A 1JLAA 5ETTA 3FEZA 1MWZA 4B9VA 1N32J 1KBRA 2BM0A 4JB8B 4KKOA 5F8GA 1TKTB 2YNGB 4RUBA 1K0VA 1WELA 3FFIB 1D8YA 1I3OB 3CIMA 3W64A 2O1PA 3RB6A 5IT4A 2WONB 3D4JA 3MM6A 1U1QA 2O01C 5GAHI 3M4XA 4NL5A 1OQ6A 2VH7A 3HI9A 1FWLA 3TX8A 1JLAB 4URQU 4PG8A 4QR2A 4PEOA 3DLKB 1FRKA 2K3KA 2CQ1A 4DR7F 5SZTA 3K7RA 4KKOB 4USTA 2YY3A 3WIVA 2B5JA 3MM6B 2IBOA 3GFHA 2MB0B 2R7RA 2NCKL 1B0VA 2AKWB 5HL7Q 1QD1A 2VG5A 1N36J 2HEKA 1FKOA 4UZCA 1RWPB 2ASDA 2FLNA 4Z2XA 4Q43A 4TU9A 2PO4A 2G1HA 1SL1A 3G8QA 3DGVA 4FF3A 3QIPA 4QIVA 5BR8J 2IDLA 2RNEA 1UVNA 2H4YB 1EARA 4LBIA 1WORA 1KVKA 4ETZA 5ETQA 2OFHX 3V6DA 1WF1A 3QRRA 2VG5B 4ZP8A 1TUGB 1RAAB 4XAKA 2VA3A 1FKOB 4PZVA 2P2CB 2JRSA 1F6TA 2GC8A 5KG0A 2FPHX 3QSYB 4BWMA 5D4OA 3QIPB 2G4BA 1JXVA 4BWJA 2HK3A 4J90A 3WIUA 1WC5A 1GMWA 5KFOA 3QJJA 5K9FA 4F4ZA 1TV6A 4KE5A 3V6DB 5J1PA 1R27B 3UQSA 1ZYQA 3Q0AA 1RWVB 2ILYA 3OPKA 4KV8A 4DN0A 4X4TA 3PR4A 3T1YJ 2QGFB 1BGXT 2E44A 3GIKA 1UEUA 2J6SA 2K06A 1MMNA 4C0OC 4PR6A 1C2PA 2J9EA 5CD4H 2PE8A 1NHUA 4WIIA 4CM2A 2OPRA 4TN2A 2XMAA 4A48A 4LF7J 3HP6A 5EX0A 4KV8B 3U1NA 4USIA 4RW6A 1LFPA 2B7CB 4GVLA 5CZXA 1S59A 3D1HA 3IGNA 1HNXF 4OYWA 4ILLA 2RDDA 1NJYA 1OS5A 2CYYA 2FC8A 2OPRB 2LQ5A 1HI0P 4UW2A 5D15A 4DS4A 4P2SA 2YKAA 2CZVC 3OD2A 4RW6B 2UP1A 4OI2A 2QMXA 2QIFA 3G4SS 4LF4F 1SC1B 1S49A 2EFNA 4KC5A 4W92B 2HRUA 4JI5F 2COLA 7AT1B 1NJIT 2KFYA 1R3NA 3NS5A 3ZZ0A 4JI1J 4B3MJ 3HZEA 2DXEA 3ISZA 1PAEX 3H98A 2E7VA 5E5NA 3BGLA 4C3MA 2OTJS 2FZGB 1HR0F 4ANCA 2HHPA 2DXFA 3A3NB 1U7LA 3CB4A 2RS8A 2LECA 3LP0A 2DNPA 3TUPA 1A7GE 3DXBA 3EPIA 1RT4A 3NRBA 4F4AA 3PM9A 2Z57B 1U6FA 3FBEA 2HIQA 2D3OR 3KLEA 5AJ3F 3P3DA 2N82B 2DPJA 4IDKA 4A8QA 3N79A 3OT9A 3BV8A 5IZHA 1FA0A 1VBKA 3O3LA 5JVHQ 3MUMP 3TQ1A 3V4IA 1MMLA 3LP0B 3MPYA 1SH0A 2BJ1A 2RRNA 3D6MB 5CYMA 1EX8A 2WOMA 2OSQA 3DLLQ 1XR5A 1RT4B 1O5JA 3MMJA 5I42A 4DV2F 3MR5A 3UD5A 2CG8A 4F4WA 3T5JA 3KLEB 1VRTA 5DG8A 3OR2A 2DRBA 4CYUA 2BJDA 4AT1B 2LEBA 3D3BJ 5F8JA 5IWAJ 5C24A 1BUXA 2XMVA 1NKBA 3DHXA 4CNZA 5HQLA 1ZPWX 2OKQA 3R7NB 1AYEA 2WOMB 1Z4UA 1P9YA 2XHWA 4USUA 4U7CA 5I42B 2HYIB 3SZ2A 2H51B 4OI4A 1PC5A 3OL6A 4DL4A 2QC3A 1AFIA 1VRTB 2R8GA 4DJBA 4CYUB 4X2BA 4LR7A 4LBPA 3QSIA 2WVFA 4L75A 3GV7B 4CLUA 3IR6B 3TAQA 2YQ0A 3OFFA 4ATNA 2XSJA 1JXEA 3JQKA 5C24B 1DJ0A 3IS9A 1GTHA 2LXUA 2BKNA 2MZSA 5B0EA 2AJ0A 3PRBA 5H9FK 2SXLA 3RRHA 5IQQA 2AJ1A 2MJUA 2JFDA 2AX0A 1CVJA 2UUCJ 2B43A 2K3IA 3DU5A 3EVWA 3CJQA 4A8OA 3HPOA 2J7WA 2LCWA 3HD2A 4HLBA 4V19X 4J7CA 3CJTA 2B6AA 2R7QA 5F9NA 5KG6A 4DZDA 1S6QA 2XULA 1FTRA 5FDLB 4OX8A 2XSJB 2XC9A 3CEDA 2FVSA 4LRFA 4EBEA 2RQKA 1FDBA 2FLOA 2XY5A 1O0PA 3OL9A 1XNRJ 3IS9B 1XMOF 3KUHA 4W4MA 3IO1A 4MYUA 5AE3A 1HWLA 4WFZA 2BANA 2JDJA 3AD8C 1NRKA 3I87A 2OGUA 4DR5J 4FF1A 2HRTA 3IGVA 2B6AB 3SXLA 4W98A 3KJQB 4J9NA 2Y3YA 1S6QB 4NLSA 3CPWR 1NDCA 3R5JB 2HWTA 4ED5A 2UU9J 4HT5A 4DUYF 3AT1B 3M32A 4USHA 3QJPA 1NK4A 2P6SA 4F4XA 2NPIA 2V5HG 4ECVA 2BANB 3EWGA 2W8KA 4KIAA 1A9NB 2ILZA 4I2QB 4C48A 3FZBA 1ZBTA 2HZAA 5G0RA 2Y9HA 1CS4B 1HNWJ 3T6JA 5KOWA 4JI6J 4FZVA 3M32B 1KHVA 4A46A 5JJBA 4ITSA 4DV5J 2CPIA 1WTFA 2VUGA 2W2MP 2VFVA 1SJFA 4K59A 5G0RB 2JVOA 3HFKA 2HBQB 1EQMA 3KHHA 4DX7A 4K4SA 1WKLA 4BC9A 2ZZTA 3AXMA 3T1HJ 1J2VA 1LK5A 1GMWD 3IC1A 2ZKTA 4Y2AA 1FEEA 4FXVA 4H4KC 2R7UA 3V81A 2V69A 3QT6A 4B9NA 1T3OA 3TW0A 2B9XA 2IC3A 4F7VA 4NLVA 2PI4A 3OFEA 2XGQA 1QLNA 1UKUA 3OVAA 3O8WA 5DDRC 4NLXA 3NL0A 4U7UD 1W7WA 3K5PA 2AJ4A 2CPYA 5KT7A 3HKWA 1VRQC 1IM4A 2W7PA 3V81B 4K2JA 1FFGB 1GNKA 1Z2LA 1I5OB 3DRYA 1VQ9S 4ECTA 2CPFA 3Q24A 2IC3B 1W2BR 3BSNA 4RKUC 4FBTA 1NK7A 1GFWB 2ZH4A 1CG2A 2VPXB 1LWEA 2AWZA 4F0MA 2WB1D 3FEXB 1RWXB 4JOUA 3BQ0A 3BF4A 3J7YI 1MROA 1YI2S 1GXLA 4WE1B 4CH1A 1VGYA 2BA9A 5E33A 4WTOB 1FRLA 2FVPA 2CJYB 2R7OA 1NPRA 5E2QA 5THWA 4ZCKA 2B8QA 3IXQA 5E3QA 2PFFB 1Q5YA 2CIMA 5IV3A 4FS2A 4LFBF 1S9FA 3GG0A 2DB1A 1LWEB 1NH7A 5CH7B 5LT5A 2ZDOA 1AXQA 1SJQA 4J9OA 1S1TA 2E1CA 2BJ7A 1KQSR 2QSFA 4I2PA 1VRUA 4NWBA 5A8KA 3ENWA 2AYGA 1PJ7A 4QWEA 3W63A 5ETLA 3Q8YA 4UOGA 3M8ZA 2XZTB 1I51B 3QNWB 2WHOA 2DR8A 3AOCA 4DR1F 4V1Ak 3UD4P 2WTFA 1VI7A 5LOQA 1PKUA 4GKKJ 1LQ9A 1S1TB 2NUHA 5F0WA 4I2PB 5A8KB 2DO4A 1N33F 3I55S 3FUYA 1HQUA 2J5AA 4C8LA 2CKWA 1WDDA 7FD1A 4NEYA 2MSTA 3PEHA 2L9NA 2V68A 3HT3A 1U6ZA 1R8PA 1OSDA 2CQBA 1I94F 3AXKA 3HJVA 1HA1A 2ZE2A 4W90B 5B0FA 2HVDA 2QYGA 4G6VB 4LRBA 2JLFA 1P27B 3F73A 4QYZK 2JC1A 4Q44A 2HGNA 3JAMU 4WP9A 2ZJQQ 5KFBA 1SKWA 2BW2A 3NGTA 3U1MA 1GEHA 1LK7A 1SPBP 1OJ4A 1WD6A 4QPXA 4OV1A 2HW3A 3K8WA 1YSJA 3PEJA 3BN4A 1FWPA 2HHHJ 1UPPA 2XMKA 2ZE2B 3P49B 2NPFA 1XMQJ 3W65A 1YLXA 3T19A 4FPIA 2VPWB 1Y4ZB 3R5GA 2I9SA 3QYYA 3DLHA 2QRRA 5HMWA 5HQMA 3K5MA 1HNZF 1Y10A 2ZBRA 1SKRA 4UTGA 1FTCA 1FT8A 4KH0B 2LDIA 5GAGI 4OZ3A 2BJ9A 2MZ1A 2VKZG 5A8RA 4DSIA 4H4KA 4X62F 4TQSA 1B0TA 2G13A 2GA7A 1GXTA 1WSVA 1ZAVA 1N5QA 4M5GA 1N54B 3PX4A 4IOAQ 2FZKB 5K20B 5SUHA 4JI7F 3OTBA 4CLTA 3QLHA 4CO1A 3TVKA 3MF5A 2DEIA 2ZDPA 4JI2F 4HI1A 4P9SA 1M5KC 2BOAA 2HBRB 2BJ8A 2DXDA 1NK8A 3FKBA 3VAHA 4LSNA 2C3UA 5F41A 1B4SA 5A8RB 2Z56B 2LU1A 3NMAA 5ETRA 2HAFA 3D66A 3R97A 4BC7A 2B9WA 3Q83A 3QLHB 4R25A 1RT1A 4O3RA 1JJ2R 3IRWP 3C15A 5A2QU 1KOOA 3SV3A 2Z2MA 2I5JA 5KFAA 4QYZJ 4IR1A 4DU7A 1PC4A 4LSNB 2D1CA 3H2VE 5DRKA 2FGCA 2DHHA 3MR2A 4WPAA 4WF9Q 3HHLC 2L9WA 3HHEA 1M5VC 4NOHA 5ETNA 1LXNA 3PV8A 3BBFA 4U8YA 4HTIA 3PJ9A 5CCLA 4F2SA 3K58A 1KR4A 2KU7A 3C15B 1Y0HA 2HMIA 4GO5X 2XTJP 2A18A 3JAMY 2PA8D 2HHTA 2I5JB 2A6OA 5L9NA 2FHJA 2OEJA 1IBKF 4DPTA 5L39A 3U1LA 2RE1A 4CLZA 4H4MA 1YQHA 1UJ6A 2HZCA 4WYLA 1EB0A 3FCHA 2VF3A 3RUBL 2V63A 4WKYA 2CJXB 1CJUA 1WHVA 5GAEI 1UZHA 3DYAB 4FP9A 1CEZA 4QIEA 2KJWA 3EZ5A 2HMIB 1SL0A 2UVUA 2YKQA 2KZZA 4GC6A 2DNNA 1NZ8A 2ZBQA 4JI0J 5F3TA 4H4MB 3R5CA 1S79A 3OXLA 3DM2A 2G0JA 2QA2A 1B99A 2VHGA 4DV7J 4U67Q 3BBBA 2BE7D 1CJUB 4NE9C 1PBAA 3FNNA 2F5GA 2GX8A 3NNHA 2WK4A 1JLFA 2XCPA 2RUSA 2ZVIA 1FKAF 1AZSA 2F8MA 4FNIA 3ONQA 2FY1A 1ZM9A 4USVA 2XYHB 1LXJA 5F8HA 5L1LA 4RUAA 1A0OB 3S01A 3GYXB 3ILIA 2KL8A 2BACA 3PYGA 4FYYB 1AW0A 1XTZA 2KVQE 3PTWA 3DM2B 1S0VA 2JOQA 3RR8A 1FNMA 3OSNA 1XN9A 2HLUA 5A2QY 4B3RJ 2QT7A 1JLFB 3ULHA 1LWFB 1AZSB 3I5CA 3MEGA 4RW8A 4YDXA 4L74A 1WACA 1HWIA 4OYXA 1QAYA 1WI8A 4AQYJ 5HN0A 3BGUA 2XMJA 1NUEA 3TUJC 4R0EA 5E41A 1BY9A 3N28A 4RW4A 2BRLA 3N5BA 4ZP9A 4ECWA 4N8OA 1HLWA 1RU1A 4JYAJ 4ED0A 2UV8G 5E3AA 3Q89A 2Y1JA 5JVGQ 3NOGA 4M1KA 2RHQB 3VGTA 5CA5A 3MEGB 4RW8B 4IFYA 5KT2A 4CP5A 2B9YA 3MDFA 1YGYA 3MTJA 4PYDA 1AUDA 3QWUA 6FDRA 4AXJA 4Z37A 1Q8BA 4YR3A 1S4FA 2ZJRQ 3GJTB 2HVEA 2CDRB 1S57A 1X9MA 4XPEA 5J2QA 1R6VA 4P74A 4P2FA 4IFYB 1L3TA 4M5LA 2E66A 1VQLS 2QSWA 2WBRA 2VBYA 3BQ2A 1IBCB 1XQIA 1PAUB 2W2NP 2V8GA 2DH7A 2FD2A 4TU8A 2R7SA 3D6TB 2QFJA 3H40A 4OZ2A 1K1SA 1SBRA 1IWGA 3GTYX 4ILRA 3HHLA 3JTNA 1BHNA 4NASA 2CJQA 1UPMB 5J2QB 1KTQA 3LH2S 2HPUA 4WFAQ 2DR6A 4ZLJA 2DITA 4JV0A 1NSPA 4DV3J 2MPUA 4HHJA 1FCAA 1XIQA 4ZJOA 2C1EB 2MKJA 4FKYA 1DURA 1N32F 1S7IA 4CT9A 2D3ZA 1BWEA 2UV8A 4JV1A 2FHOB 1KRPA 3GSIA 2N3LA 1HBUB 4X4VA 3GFXA 2W1BA 1NPKA 5E3RA 4PWUA 2B4UA 3HHLB 2E9TA 4QU6A 4MFBA 3FMWA 4CH7A 4C8NA 2BUNA 3HSJA 2E9RX 2YNFA 3I96A 3TVZA 1NHVA 5KT3A 4JV5F 1S1XA 4NCGA 2LLZA 3I56S 3QAUA 1ULRA 1P9QC 5DGAA 4RNFA 2MDAA 3H25A 1SC4B 5AXKA 4RWXA 4DV0J 1N4LA 2EBGA 1MWYA 3CDAA 3D5MA 1UAWA 2HFSA 3EICA 3IM8A 2DTJA 2BOPA 3NGSA 3H8YA 4NZ6A 3J81U 4MFBB 4HI2A 4QWCA 4QW8A 1CQNA 1YX2A 2YNFB 3CCQS 4ZVEA 3M6UA 3I9ZA 1S1XB 4OJ1A 5IXUA 4NCGB 3CJ0A 2IM1A 5HP1A 1N36F 2V2VA 1R8CA 2HNYA 4ZJLA 2JEGA 3MPWA 4UUWA 5EHHA 5EDWA 3VV2B 2CDQA 4IKAA 3MFIA 3W5YA 4PPDA 1HIYA 5KG2A 2DNKA 2PDAA 2E7WA 3LPYA 2BX6A 2BVZA 5HP1B 2HNYB 4HTJA 2W4PA 2VOPA 4WP3A 1TK5A 1D1UA 3DU6A 2N7YA 1WJ9A 4WJBA 2CUYA 3AFGA 2IHR1 3DLBA 4K4VA 4Z7YA 4YB1P 1YRTA 1VQ5S 2A1BA 2ZH9A 4N47A 1PGZA 5HMYA 1OO0B 4TNOA 3KHGA 3PDNA 2CJAA 4ES2A 3W61A 1K8AT 2ZD1A 1WG1A 1Y3JA 3CJKA 4BHQA 1HARA 3PO5A 3CSKA 4OFZA 4PXEA 2CVEA 3T1YF 3FZ2A 4E2FB 5IM0A 3GMGA 4NMLA 3MCOA 1KQKA 1D9DA 2LU2A 5HMZA 1RABB 3KDOA 2G2YA 1BWVA 2FHJD 4TKTA 3W2VA 4XDCA 3PX0A 2ZD1B 1B7FA 2MLZA 1QSYA 3CJKB 3DFEA 3GR0A 3PW0A 2M9KA 3HSZA 2QEXS 4DG1B 4EFAC 5B08A 2C2ZB 1TVRA 1S1UA 2L3MA 3L95X 3A8JA 5IM0B 2CNOB 3W2WB 4M63A 3J81Y 4ZLPA 2DCLA 2E1PA 4FVCA 5D0HA 1ZTTA 1CJVA 4RNOA 3W2VB 2RQMA 3W60A 3MHYA 2RS2A 2YWKA 4I68A 2VICA 2OLWA 1FD8A 3PCOB 3KNGA 4M5MA 1SJRA 1L3UA 3A1YG 1FDNA 4DN9A 1ROFA 1TVRB 1S1UB 4OLPA 1FX4A 3TA1A 1QTNB 5HJYA 1RGVA 3UVJA 3B4MA 2X7IA 1CJVB 3O6QA 5KFRA 2IMOA 8RUCA 2MGZA 2CADA 2NSCA 1N6QA 3RJMB 1U26A 3R2CJ 3OJUA 2K7JA 2MTLA 3MD1A 1ZM3A 3RAMA 4B3MF 3OV7A 3W66A 1LW0A 1HQ2A 3GG1A 4RU9A 3C2PA 1U47A 1HBOA 1HD1A 1TFWA 2GAGC 4IRDA 3UVJB 4LR8A 5GVQA 1YK9A 3O44A 2CWXA 2MGZB 2HK2A 2O66A 4ZPVR 5I3QA 1R0CB 2PI5A 1BC6A 1JNRB 3BB5A 3WZ0A 2C42A 3FBBA 1HR0J 4KR0B 1V3RA 5CD4A 4HVZA 2FVRA 2R2TA 4USMA 3K0JA 5KFLA 4J9MA 2XI2A 1LW0B 4J9VA 1R43A 3H5UA 2GJIA 1LV5A 3PFEA 8AT1B 4NZ0A 5M2UA 1H73A 4C11A 2AZ1A 4P10A 1T0TV 2PMHA 2PEHA 4ZVRB 2B3TB 2JLGA 3FRYA 2OTLS 1R8AA 5I3PA 1RP5A 3M8RA 4JV2A 2ALYB 2OPSA 2HNDA 4DDFA 3MWBA 4N41A 4I67A 5IWAF 2QLFB 3DRSA 1NHKL 1HBMA 3DLEA 5DQGA 2HHVA 1RWNB 2XNRA 2ASYA 2YPYA 3MECA 1FO1A 1NU4A 3KXDA 2XEXA 1UW4A 3AOAA 2FB0A 2RIJA 1FESA 4DQQA 2C22A 5D77A 3P45B 3CWJA 2HNDB 4Y2IA 1TKDA 2CQPA 3NP5A 1J27A 1HBMB 3DLEB 2GMLA 2OD6A 2KTQA 1DQ8A 1U45A 3IN5A 1GMUA 3DDIA 5C2CA 4NYZA 2YKOA 3MECB 2XM3A 2K2PA 1FE4A 2NQPA 3VHQA 2UUCF 3M2UA 1G7CB 4CH0S 4NPOA 2H1YA 3ZZYA 3PJWA 3UN3A 1VYAA 2OJ3A 4DR4J 5CYJA 3SQOP 2PA3A 3FCWA 2OPQA 3AY0A 4DL3A 4ZPDA 4RBUA 1XNRF 4ZCIA 5KFZA 1Y5IB 2HHUA 4NCBA 2EC0A 3CIZA 2NS1B 2GZOA 3EZUA 4DR5F 3M2UB 5A0YA 1K1QA 3H5SA 4FXWA 4AL7A 1TUVA 1OIAA 3CNQP 1JLQA 3Q8VA 1XMOJ 3OHAA 3SSSA 5BYSA 1YZ7A 2JEIA 2UU9F 1KTVA 1S10A 1PBUA 2OPQB 4KRWA 2DCUB 2J8AA 3KYLA 4BS2A 3FRZA 1RHMB 3TX0A
chains in the Genus database with same CATH topology
1R3NA 3OR1B 4NLPA 2I1RA 3NS5A 3PXGa 3ZZ0A 2M8DB 1X5TA 3D1QA 2BJEA 4F3OA 4HKQA 1O51A 1XR6A 3JSRA 3N6MA 1P6TA 4PG6A 1VFJA 2MHNA 2QLWA 1RT2A 3HZEA 1TL1B 3ISZA 1VLYA 5DM7Q 4QIGA 1UA0A 1JLQB 2IAJB 4QQBA 4NLTA 2RJZA 3H98A 4OI0A 5MLCV 5E5NA 3BGLA 1HNWF 4J9KA 2AGOA 3K2YA 4C3MA 2H9ZA 1RKIA 4Y2CA 5T7LA 2A2DA 1VS3A 2APOA 3HVWA 4MIBA 3VQTA 5B09A 1UVMA 3QO9A 1HR0F 3DGPA 4JI6F 5GMKa 2HHPA 2XBPA 1WG4A 1C0UA 2MZJA 3Q22A 1URRA 3UD3P 2ZH6A 4IG0B 4ALZA 3MUTP 3K5OA 4CCHA 1U7LA 1R8HA 4LIRA 3CB4A 3M6XA 2RS8A 2C3MA 4R5PB 1RT6A 1X4BA 2FJBB 2LECA 3LP0A 2W7AA 2DNPA 4OHZA 5KFDA 2OO4A 1A7GE 1SQEA 2KN4A 3MGJA 4AXIA 3DXBA 2MKCA 2OH2A 1X0FA 1S72S 2DNMA 3TI0A 1ZZFA 3EPIA 1OQ3A 3CULA 3CD0A 4ZPCA 2UVVA 1RDRA 1RT2B 2JJ4D 2LXFA 3CXCR 2EK1A 2DGVA 1RT4A 2E5HA 3NRBA 4A8KA 2U1AA 5BR8F 3PM9A 4NZ7A 3D1OA 3RW7A 1U6FA 3CMES 4N77A 4NLQA 2HIQA 2D3OR 2IBKA 2ZOGA 3POTA 3QMQA 3P3DA 5AJ3F 3KLEA 5T7LB 2N82B 3T1HF 2J9DE 2DPJA 4Q0BA 4ZVGA 3QO9B 3VWSA 5D4LA 3MOZA 4IDKA 3MURP 3LGNA 3R5BA 3E8OA 1TAQA 4YUDA 1FE0A 4A8QA 3N79A 5D4PA 2VBWA 1YJUA 3MM5A 5KOXA 1RAJA 4ELUA 1L3SA 3J7A1 2PMZD 5IZHA 4B9MA 3BREA 3ZZUA 5AXNA 2VA2A 3BQ1A 1FA0A 4ZCMA 3O3LA 5JVHQ 1RT6B 1M5SA 2ZBIA 3MUMP 3TQ1A 3V4IA 1MMLA 2E1RA 3LP0B 3MPYA 5KFFA 3WC2A 1RYRA 1SH0A 3V5RA 3CC7S 2KHDA 3P96A 2RRNA 4KPYA 5CYMA 2Q43A 1TQLA 4QR1A 5GAEU 3M6WA 3GYNA 3KK1A 4Y00A 3OQ2A 3ENQA 2WOMA 4ZP6A 5HROA 2OSQA 3DLLQ 1XR5A 1QJHA 1RT4B 1O5JA 3MMJA 5I42A 1Z2ZA 4DV2F 3MEEA 3MR5A 2N7CA 4UUXA 3ZZTA 1CC8A 2A2CA 4F4WA 1IJFB 2B56A 3LF0A 3T5JA 1NKEA 5L38A 2B4VA 2GGPA 4Q2LA 3KLEB 3POTB 2ZZNA 1VRTA 5DG8A 5GAHU 4Q0BB 3OR2A 2AU0A 3TRGA 4XIUA 2GHPA 4EEYA 2HVHA 2DRBA 5MAOA 2D41A 2BJDA 2LEBA 1S1VA 1FRIA 1FDAA 5F8JA 3HXMA 2FJEB 1UJ4A 1IXKA 3MM5B 4OHXA 1L3KA 3SI8A 2XMUA 2M4MA 3G96A 3Q8PB 5LL6d 2DR9A 5C24A 1YWXA 3GWCA 4KGKA 2XMVA 4KBIA 5A8WA 1PILA 3TUZC 1P8GA 2C28A 2DHSA 2P6TA 1NKBA 3DHXA 3HVAA 3ZZZA 4CNZA 2JEFA 3KLIA 3BS9A 3DNCA 1UEVA 1ZPWX 3KK1B 2OKQA 3TP2A 2GO8A 4KB7A 1Q82T 4KJIA 3DI6A 2WOMB 4LT6A 1D8ZA 5HROB 1Z4UA 2XHWA 2P9CA 5BJRA 2F4VF 2FLLA 4U7CA 3SMZA 5I42B 4PQUA 1YRXA 3MEEB 2HYIB 3NCPA 3SZ2A 1KN6A 4OI4A 1PC5A 3OL6A 4DL4A 1AFIA 3RRKA 2GGPB 2J9DA 1T95A 1VRTB 2DGTA 2E5IA 1KEKA 4F50A 2R8GA 1TKZA 4DJBA 2UVRA 4LQ9A 3N4WA 3OL8A 3FQLA 2G0CA 4X2BA 1S1VB 3DRRA 3GV7B 2RT3A 2DK2A 3D0HE 4ZMMA 2W8LA 4IOBA 4P7TA 2YWEA 3IR6B 4F3QA 2W9BA 3TAQA 2AQ4A 1HQEA 5IT9Y 1WEXA 2WW8A 4K50A 5LSLA 2CJBA 3OFFA 4ATNA 4LF7F 1QVFR 1UJ5A 2XSJA 1JXEA 2XWYA 4ZCLA 1WEZA 5C24B 2C2DA 4B3TF 1TAUA 1DJ0A 3LALA 5DDQC 3MR3A 1VQSA 5A8WB 1SH3A 2D7SA 1F5BA 1T94A 2MZRA 3KLIB 3IS9A 1KOHA 1GTHA 4RUCA 2LXUA 1TP7A 2DNRA 1VC6A 4ERDA 2MZSA 1V6HA 4PRFA 5B0EA 2YNIB 5L1JA 2AJ0A 1FVSA 1FXRA 1KQGB 1JJHA 2WAQD 3F56A 3VZHA 3PRBA 1LOUA 1NAQA 2SXLA 4J9PA 2JC0A 4PQUB 3RRHA 5IQQA 2AJ1A 4YR2A 2MJUA 4ELVA 1HMVA 2JFDA 3B4DA 3ZZRA 2AX0A 1CVJA 1T03A 2B43A 2K3IA 1YTYA 1VQMS 2UXDF 3DU5A 4A8OA 4YB7A 3HPOA 2J7WA 2LCWA 4HLBA 4BCAA 2VKRA 4V19X 3E3XA 3MEDA 1TKZB 2B6AA 2R7QA 3ZZOA 2Y1IA 5F9NA 5KG6A 4J9QA 2IMWP 1R6YA 3DRRB 4ZPAA 1S6QA 2XULA 1FTRA 5FDLB 3C46A 2KKHA 1N5TA 2W9BB 3DYAA 4ECYA 1HD0A 3TYTA 4OX8A 1HQEB 3KKFA 3NBPA 2IM0A 4MKBA 1U1PA 1APSA 1TKXA 2YNHA 2XSJB 2XC9A 3CEDA 2FVSA 2HHXA 4EBEA 5E7OB 2RQKA 3V6JA 1FDBA 2VASA 2ERRA 3EXCX 2FLOA 2XY5A 1O0PA 2FJDB 1JJ4A 3G6ES 4LF8F 3IS9B 1VBYA 3VAGA 3OL9A 1XMOF 3S8SA 2V9KA 3OSPA 1VQYA 3IO1A 3GV8B 1VC5A 1MU2A 4MYUA 3ISNC 1HWLA 1WG5A 5AE3A 4O23A 3B82A 4WTYA 2OMOA 4WFZA 1C4CA 2BANA 2JDJA 3SFUA 2M70A 1NRKA 1HMVB 3I87A 3UW1A 3W3SA 3CT9A 5KG1A 3FSYA 2ZH5A 1T03B 1RYSA 2VG7A 4KGMA 4DR3F 3BSCA 5KFYA 2F40A 4K4XA 2VQFF 3K5LA 4FF1A 4GKKF 5K8MA 3MEDB 2HHSA 3IGVA 2B6AB 4Y3CA 1Q53A 2IRXA 3SXLA 4DL5A 2MQMA 4LFAF 3FMBA 3C6TA 4J9NA 3OUYB 2DD8S 3FVYA 1S6QB 2EFOA 2V2KA 4J37A 5DGBA 4JI1F 2YX4A 4NLSA 3CPWR 2K7KA 4JI4F 2HWTA 3NBPB 3IWLA 4ED5A 1TKXB 2YNHB 2E1AA 4HT5A 4DUYF 4YMEA 3DCAA 3M32A 4USHA 5KG7A 4PQAA 2ZNZA 1MNEA 2ZUGA 1YJVA 1K0TA 3P6YC 3GFZA 3QJPA 3X3UA 1NK4A 2P6SA 3LP2A 3MPVA 2GMJA 4F4XA 2OTJS 1FK9A 1MU2B 2NPIA 2V5HG 4ECVA 4KQZA 2XSFA 2BANB 5CQGA 5KT6A 4OZJA 3SCKE 4DQSA 4YOEA 2W8KA 3GIJA 2PSZA 4KIAA 1A9NB 2ILZA 1JMTA 4I2QB 3I0SA 1KLMA 2UXBF 2VG7B 3R1HA 1UVLA 3EUNA 2DR7A 2VG6A 1ZBTA 3FZBA 5J1EA 2HRYA 3CJ3A 5G0RA 1RQ0A 2AJQA 2DIUA 2EFGA 4DSKA 2KXNB 3CD7A 1C4AA 3C6TB 5LJ5Y 1XNQF 5B0AA 2Q6BA 4EGLA 2HGMA 2GW8A 2CPXA 3MCSA 2WRMA 4IRKA 1N6QB 3T6JA 4OHVA 2DJWA 5KOWA 2OD4A 3VAFA 2FC9A 1U1OA 1LWFA 4FZVA 5J2MA 3M32B 5F8IA 5HLFA 5D8HB 1HI8A 3BEGB 3DC2A 4DBQA 1S0OA 2E29A 3IBWA 3OLAA 2MSSA 3MMCA 4X4QA 2BABA 4O44A 1CQMA 2R7TA 1KHVA 3OTCA 4A46A 5JJBA 1FK9B 4QR0A 4ITSA 5JXSA 1YJWS 4EZ9A 2GCFA 2DNHA 2XLJA 4WFXA 5H9EJ 2CQ2A 4A8MP 2CPIA 1HBOB 1NEEA 2MZTA 3B8HA 3CF5Q 1WTFA 2A3JA 3IAS9 3TVYA 1X4HA 2VUGA 3I0RA 3I0SB 1KLMB 4UY8T 1XMQF 5U47A 4ZHRA 2VFVA 1IQZA 4QU7A 2J0WA 2HG4A 4DMZA 4K59A 2VG6B 5HQ8A 5J1EB 1SJFA 2HS4A 2B5JB 2MMYA 5G0RB 2FJWA 2JVOA 3HFKA 2LVWA 3KHHA 4HT7A 3KTQA 4K4SA 1Q1KA 5AE1A 4CO5A 3M2RA 1OPZA 3OHBA 2ZH3A 1N0UA 2GMHA 4BC9A 3VQSA 4CO2A 4QJVA 2LQ9A 2IJFA 4RNNA 1J2VA 2J9CA 2JH3A 2RKIA 4C9DA 2ZHBA 1LK5A 3NMRA 5J2MB 3J7ZT 2MJNA 2ZKTA 3IC1A 2YKNA 3LO3A 2YH1A 2J0QD 4Y2AA 5HLFB 2HS3A 3EGZA 1FEEA 4FXVA 4H4KC 3UR0A 1OWXA 3MMCB 2KH9A 2R7UA 3V81A 2JX2A 4O44B 4B9NA 3OVSA 2PN6A 4A8YA 4OX9F 5DG9A 5DG7A 3DXSX 4DF4A 1T3OA 3DRXA 2KT5A 4I0WA 3Q2SC 4RU2A 1DZ5A 5FLXY 2YWHA 3TW0A 3Q8RB 3UPFA 2QA4S 1VQOS 2JLEA 1VQ6S 3OL7A 2B9XA 2P9GA 2PIIA 3N6LA 4NA2A 2IC3A 5A6PA 3I82A 3NNCA 3I0RB 4OJHA 5LJ3Y 2RSQA 4L3NA 2OIHA 3RRGA 4I69A 4ZHRB 3I6PA 4NLVA 1JLCA 1GAOA 4C4WA 4I1TA 4K4YA 2PI4A 2IRYA 4OZNA 3OFEA 2XGQA 3TR5A 3R1LA 1SUQA 1QLNA 4HDGA 1UKUA 2EW9A 3OVAA 1NK0A 3M2RB 3J80Y 3O8WA 5DDRC 2LA6A 3UWTA 5I3UA 4NLXA 3IWXA 4C11B 3NL0A 2QYCA 5T14A 3V2UC 4QZVB 2RKIB 3M6VA 2M2BA 3K5PA 4Q2MA 2Y1RI 2HWIA 5LMUF 2AJ4A 2CPYA 3E51A 3HKWA 5KT7A 3I9V9 1TR0A 1IM4A 2DH9A 2BYCA 2DIVA 2W7PA 3V81B 3NWGA 4ID5A 1LW2A 3DLGA 1DQAA 1X5PA 1GNKA 2J0SD 1Z2LA 1KVJA 4EUVA 4F26A 3DRYA 1VQ9S 2IM3A 2OPSB 2WSCC 4Q7AA 4U9RA 4ECTA 2CPFA 3Q24A 3MAQA 2KM8C 2GHVC 1O8BA 2IC3B 4LQ3A 3OJSA 2XLKA 3SCJE 2IFXA 3PX6A 1JLCB 3U7JA 1W2BR 5M2RA 3BSNA 4RKUC 4FBTA 1NK7A 3BR9A 3CCMS 3BN7A 3RYLA 3DRSB 1SUQB 4CIOA 2ZH4A 1CG2A 2UUWA 1LWEA 2AWZA 2VPXB 3BSAA 2MKIA 2FGOA 3C66A 1RTHA 3BO3A 1X4EA 2WB1D 5I3UB 3FEXB 3PIPQ 3KLHA 3D2WA 4JOUA 3BQ0A 3BF4A 5K5MA 2MQQA 3TAPA 2VOOA 1N5YA 1RISA 3J7YI 1S97A 1MROA 2DT9A 1RT7B 1SJ3P 1YI2S 1TV6B 3PW5A 2ZM6F 1GXLA 4WE1B 4OZLA 1WHYA 4CH1A 1VGYA 3G8SA 1HI1A 3NKYA 3O1LA 1B0PA 1RTDA 4ID5B 5F3ZA 1LW2B 4NLYA 2BA9A 3DLGB 5E33A 1Q7LB 2J6TA 4OL8A 2HVZA 3KMSA 1FRLA 2FVPA 5C25A 3DHWC 2R7OA 4ELTA 1Y00A 4O3OA 3UCGA 3I5BA 3N0VA 5E2QA 5THWA 3NLCA 3BO2A 4ZCKA 4IQMA 1X4AA 3DOLA 3IXQA 5E3QA 2PFFB 4N8NA 4OZ0A 5KFCA 2CIMA 5KFPA 4LFBF 4FS2A 4RNHA 3FSIA 1TK8A 1HBUA 1S9FA 1F9FA 2LA4A 3GG0A 1L5UA 3ISND 1QUVA 5EWGA 2E5LF 2DB1A 4DFKA 1LWEB 2CJKA 2ZH1A 3HKZD 1NH7A 1RTHB 4EYHB 5CH7B 3KLHB 3CGIA 4NLGA 4LFCF 2Z4PA 4QPTA 5LT5A 3F41A 2D9PA 4FN5A 4OZ5A 2ZDOA 1AXQA 2XB2D 1SJQA 2ZBCA 2NUUG 2GFFA 1S1TA 4WFNQ 4J9OA 2E1CA 3PRDA 2DRAA 5J2NA 1KQSR 1N5YB 2QSFA 4I2PA 3CCSS 1VRUA 4IO1A 4NWBA 4ETXA 3KJVA 5A8KA 4YB5A 3ENWA 2LKZA 2AYGA 1RTDB 4QWEA 2L9DA 3PO4A 3LAKA 1SI9A 5DDPC 1VJWA 1BQMA 2XNQA 2HNZA 4DFPA 5C25B 4IRCA 1C0TA 1YJRA 2R4FA 1RTIA 2Z8QA 4EU0A 1K9MT 1AFJA 3CCZA 3SSQA 2X1GA 3CO9A 3TOQA 2BR0A 4WYWA 4CI0B 1XK8A 2BXJA 5DM6Q 1RWUA 3HLUA 4WFYA 4M95A 3LGMA 3DOLB 3IR5B 2B51A 5F8NA 2C2RA 2WHOA 2YH0A 3OXGA 2DR8A 3SSRA 2XS7A 4B3OA 4JI8F 4USJC 4RBVA 1C1BA 4DR1F 4DOZA 4K4UA 4X4NA 5LXYA 2KB2A 1TL5A 3UD4P 2HQ3A 3T9ZA 3EGWB 2WTFA 2HFOA 3MAHA 1FF2A 4RLEA 2KG0A 1VI7A 2E1MC 4URGA 2ZZMA 1LQ9A 1S1TB 2RU3A 3MUVP 2NUHA 2O67A 5F0WA 4R8UA 5J2NB 1HNIA 4I2PB 4C97A 2RD5C 4M5DA 3KJVB 5A8KB 2DO4A 4OHYA 1N33F 1FERA 3I55S 4JI0F 4WZMA 1T3NA 1BQMB 1HQUA 4TU7A 2J5AA 2HNZB 4C8LA 4B9LA 1EP4A 1XERA 5A0YB 2CKWA 1C0TB 3CJ4A 1RTIB 7FD1A 4NA3A 2KJVA 4DV7F 2IYGA 2MSTA 3PEHA 1SL2A 2L9NA 4ED1A 1A6LA 2F8HA 1KFSA 3SDEA 1RA6A 5KFGA 3HT3A 2IVYA 1U6ZA 4B3OB 4FPRA 3OW2R 4DSJA 3SFGA 1TL3B 1M0SA 2CPEA 2IYIA 4OZ1A 1R8PA 3PHEA 1C1BB 3KLFA 5KFHA 4EBDA 1S7HA 1OSDA 2CQBA 5F8MA 3R3TA 2X3GA 3OFHA 3D54A 1I94F 1HA1A 2ZE2A 4W90B 2VPYB 5B0FA 3K8VA 4UOCA 1JKHA 2QA4G 1NH8A 4G6VB 4C8MA 3T5LA 3E01A 2XY7A 1GTEA 2NSBA 2R2RA 2BZ2A 4DV1F 2JLFA 2ZOMA 1P27B 4R8UB 1HNIB 4B3SF 1U1NA 3F73A 4DV5F 3ICLA 2JC1A 3M30A 4M5DB 2HGNA 4Q44A 4HH1A 4YB6A 1HHSA 2CQGA 1RKJA 2ZJQQ 2CQCA 2RUGA 4EBCA 4DV4F 5KFBA 1SKWA 1T8EA 1WTBA 2F3JA 2KT2A 1IR0A 2YKMA 2YQ3A 4LVNP 4TYAA 2BW2A 1EP4B 1S6PA 2LEPA 3U1MA 5K8NA 4GMKA 1LK7A 5KFJA 4KT0C 1WD6A 3PNIA 4QPXA 2C3OA 4DSFA 3QGIA 4OV1A 2HW3A 3SDEB 4PG4A 3Q8SB 4O0IA 1DTQA 4N5SA 1DQ9A 3BSOA 1IKVA 4O3QA 4IO9Q 4Q8EA 3K8WA 1YSJA 3PEJA 1DAXA 2QLXA 1N8RT 3BN4A