3CPWR

The structure of the antibiotic linezolid bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
81
structure length
81
Chain Sequence
SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Oxazolidinone Antibiotic Linezolid Bound to the 50S Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S RIBOSOMAL RNA
total genus 21
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2008-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3cpwR00
2J76E 4CH0S 3CTRA 5D77A 1O0PA 2DHGA 2KM8C 1IQTA 2OIHA 3CCUS 2HVZA 3J7ZT 3UCGA 1FJEB 2RT3A 1WWHA 2I2YA 1OPIA 1K8AT 1JJHA 4YOEA 4WIIA 2KRBA 2QA4S 3CMAS 2MKHA 2Q79A 2DIUA 2CPFA 1D8ZA 2NLWA 3I56S 2AYBA 3D2WA 2DITA 1VQPS 1WF2A 1N88A 2FPHX 2GHPA 3VAMA 5LXYA 2DNGA 1WHYA 2FC8A 4ZKAA 3P5TL 2B0GA 1WTBA 1NU4A 2ZJPQ 1QVFR 2MHNA 3V4MA 2XS7A 1VQ7S 2O3DA 4C7QA 1U6BA 2DGVA 5LJ5Y 3MURP 1ZZNA 3LQVA 1YI2S 2QFJA 2MPUA 2RRBA 2M0GB 2EVZA 3MUMP 1WI8A 2DNMA 4J5OA 2CQGA 5LXRA 3MI7X 2ADCA 1JJ4A 2MKSA 2MQQA 1K9MT 1YHQS 2CJKA 3RW7A 3H2UB 1VC5A 1M5OC 2RNEA 2MY8A 3SDEA 3Q2TC 4ERDA 2DNRA 2XS5A 1WHWA 2V94A 2MGZA 1QVGR 1YWXA 3G6ES 1U1OA 4TLQA 3G96A 3FEYB 2KHCA 2CQPA 2NZ4A 1WEZA 2DGQA 2LYVA 2LCWA 2MB0B 3ZZZA 3BO4A 3NMRA 1HL6A 2E5JA 1WG4A 3CCMS 4OZ0A 1U1PA 2AYMA 3U1LA 2M8HA 2KN4A 3Q2SC 2MQOA 3UD4P 4ED5A 5EN1A 3P49B 2E5GA 2RQCA 2M9KA 2CQHA 3VAFA 2EK6A 2DGOA 3SDEB 5DDOC 3MUVP 2BOPA 2DH7A 1PO6A 3CC7S 3H2VE 1VQOS 2DO0A 2QEXS 2K8GA 1SJFA 2DGTA 1SJRA 4W92B 5GADU 1U1MA 2X1FA 2MKJA 2M4MA 2MQNA 2DIVA 3N9UC 1FNXH 3U1MA 3UE2A 5GVQA 1U1NA 2VONA 1YIJS 2YKAA 3J7YU 3CD6S 2HGNA 3VF0B 3P6YC 3TO8A 2DNKA 2DGUA 3VAHA 3CUNA 2DH9A 1X4FA 2CPJA 3CULA 2KXNB 1N8RT 3ULHA 2JWNA 5CA5A 2MZJA 3JB9k 2RU3A 5MLCV 3G4SS 2G1DA 5CYJA 2GO9A 3IRWP 2M88A 4PR6A 1W2BR 5CXTA 1URNA 1G2EA 3CPWR 2FC9A 1WI6A 1WF0A 4WFAQ 1ZH5A 1M5VC 1U6FA 4UY8T 4CIOA 3UCUP 1K73T 2KG0A 4OZ1A 2MZSA 4IO9Q 2E44A 1L3KA 1WF1A 1UW4A 4IOAQ 2L41A 3CCLS 3EGZA 1N54B 2DNNA 3ZZYA 1VC6A 2M2BA 3B4DA 2KM8B 1Q86T 1DRZA 2YH0A 5DDPC 3HHNB 4PRFA 5HO4A 4YB1P 3MOJB 3EGNA 1U1KA 5JVGQ 3G8SA 1S72S 5IQQA 2MJNA 5GAGU 2OSRA 2CQ0A 2DO4A 2RS8A 3SXLA 2CPIA 4F25A 5BJRA 1SXLA 3RW6A 5LSLA 1FJ7A 3CC2S 3UCZP 3MD1A 5IFMA 4RU2A 2JX2A 2FY1A 2MZRA 2YH1A 1X4GA 4UQTA 1X5OA 2KH9A 2CQ2A 3CCQS 2X1AA 2LQ5A 2MZTA 2E5IA 3BO2A 2DGXA 2MKCA 1A9NB 3SMZA 2I38A 3L3CA 2KRRA 4TU7A 3G9CA 5GMKa 4QQBA 1YJWS 2DNLA 5LSOA 2YTCA 2DH8A 2EK1A 4Y0FA 3CCES 4F26A 2ZJRQ 3S7RA 1X5TA 1D9AA 2HGMA 3DLLQ 3UD3P 1AUDA 2BZ2A 2VODA 2CPDA 1H2VZ 1H2UX 2DNOA 4BS2A 2CQDA 2J8AA 2OSQA 2RRAA 2ADBA 2HGLA 1UFWA 2A3JA 2LXUA 1JJ2R 1FHTA 1VQLS 2OTLS 1R8PA 2D3OR 1SJ4P 1X4DA 2DGWA 1B7FA 2RQ4A 4EGLA 2X1GA 2N82B 1YJ9S 2F9DA 2XNRA 1DHMA 1UAWA 1NJIT 4YUDA 1U1QA 3EX7B 3TP2A 2DNQA 1VQ6S 1VQKS 1VQNS 2N7CA 4QU7A 1OWXA 4C4WA 2MY7A 4IOCQ 4CQ1A 4C0OC 4M5DB 1WHXA 1KQSR 2XSFA 1U1RA 1VQ5S 3VAGA 2RUGA 2MSSA 3FEXB 4WCEQ 3R27A 4CH1A 1KOOA 1HA1A 2MZ1A 5ITHA 2M7SA 2RVJA 4LMZA 1WEYA 3LPYA 1X4EA 3THPA 1FT8A 2CPYA 5GAHU 1VBZA 1OIAA 2RS2A 2LECA 1U1LA 2DK2A 3R1HA 3VAJA 2CQCA 2DGSA 2CQ1A 2KG1A 2KFYA 2KXHA 1KD1T 2KI2A 1Q82T 1XN9A 2DISA 1QM9A 2KXFA 1VQ4S 2DNZA 2MJUA 2AD9A 2ERRA 1WEXA 3VAKA 1DBDA 5LJ3Y 2VOOA 2KT5A 1HD0A 2XB2D 1F9FA 4TU9A 2L9WA 2LEAA 2M8DB 5DM6Q 1VQ8S 1M5PC 2G0CA 2CQ4A 1ZZFA 3BO3A 2LKZA 1KC8T 1KOHA 3CCJS 1RK8A 2AYEA 1VQ9S 3G71S 1WHVA 2K3KA 4W90B 2E5HA 5DETA 2HZCA 1PGZA 1CVJA 2MGZB 3MDFA 2LEBA 5JVHQ 1X4BA 2D9PA 1R8HA 2XNQA 5IM0B 3CXCR 1FXLA 2U1AA 3HI9A 2CQ3A 1Q81T 3CF5Q 2G4BA 1U2FA 3DXBA 2D9OA 2KU7A 2DNYA 2DNPA 1WG5A 2CPEA 4FXWA 3THTA 2OTJS 1JMTA 4LJMA 3US5A 1N52B 2CPZA 3P3DA 5D78A 1DZ5A 2DHAA 1X0FA 1H6KX 2SXLA 3CMES 2N3OA 2J0SD 4TU8A 3MXHP 3MUTP 3NNAA 5IM0A 4U67Q 1OO0B 1FJCA 4QPTA 3NNHA 2VOPA 1P1TA 1X5SA 1S79A 1VQMS 2MSTA 5DDRC 3BS9A 4P6QA 2L08A 1VBXA 3TYTA 3VALA 2JVRA 3UWTA 3PIOQ 2LXIA 2PE8A 2F3JA 4Y00A 3B4MA 4Z2XA 2MQMA 2YWKA 5H1SV 1UP1A 2KVIA 4WKRA 1H2TZ 4A8XA 2U2FA 3IWNC 2CQBA 2MKKA 2J0QD 2N3LA 4LIRA 2HYIB 2F9JA 1M5KC 2X1BA 2MQPA 1RKJA 1YTYA 2DHSA 2M70A 4WF9Q 2LMIA 2MKIA 2ZJQQ 5FJ4A 2UP1A 1M90T 1X4AA 5DDQC 3S8SA 1VC0A 2M52A 1M1KT 5DM7Q 1SJQA 3BEGB 4PKDB 3OW2R 3NS5A 1SJ3P 1WG1A 1X5PA 3CCVS 1Q7YT 4IUFA 1X4CA 3I55S 4WFNQ 3MD3A 3S6EA 1YITS 2OJ3A 2CPXA 2JRSA 5HL7Q 1WELA 1A7GE 2DNHA 1FO1A 2PEHA 2XS2A 3R1LA 2JVOA 3NNCA 2KYXA 4V19X 3PIPQ 1X4HA 1HD1A 3CCSS 3NS6A 4F02A 2CQIA 1BY9A 2MMYA 4QU6A 3K0JA 1P27B 1VBYA 2MYFA 2MQLA 2AYGA 3G8TA 2MZQA 1YJNS 2WBRA 3CCRS 2CPHA 2DB1A 3CC4S 5GAEU 2DHXA 2MXYA 2LA6A 1NO8A 4WFBQ 3S01A 2LA4A 2FHOB 3VAIA 4FXVA
chains in the Genus database with same CATH superfamily
1CJVA 4O3PA 2UVRA 4DX6A 5KG1A 3K5LA 1VISA 2IMWP 4G1QA 4HT5A 3H59A 3KOAA 4CRJA 1O0PA 1NK9A 4DFKA 4OI6A 2DCLA 1XR5A 2XY7A 4AUKA 1QUPA 4DSFA 3IG1A 5I42A 2OIHA 4DV4J 3QBCA 4JI3J 2HNDA 1KN6A 1UZHA 3UCGA 2J7KA 3SBMA 1T7PA 4PZVA 4LSNB 3N79A 1Y10A 4K4ZA 1JJHA 1SC4B 4PABA 4YOEA 2BRLA 2ZVIA 2FVSA 4HHJA 2FVQA 2UUAJ 3M4XA 5J1PA 3LP1A 4UOHA 3CMAS 4X62J 4N56A 3J7AN 3A8IA 1HNZF 1YVFA 1WDTA 1N8RT 2IRYA 3JTNA 4ZLPA 4DUZF 2G2OA 1EIYB 1NK7A 2DVIA 1UKUA 1WF2A 5F8JA 1TV6A 1HBUB 3PX4A 1RT2A 2N7YA 2HHUA 1GX6A 3PYFA 4ANEA 1NSPA 2AQ4A 4ZKAA 2WAQD 2R8KA 3P5TL 1HNVB 2F7VA 4USJC 1WTBA 3QQCD 2BQ3A 4EBCA 1AZSB 3SV3A 1LWFB 1QVFR 4B3RF 3HFZB 4Y3CA 2QRRA 3J81j 5A8KB 3IRXA 3MMAA 4YMEA 4LFBF 3G2XA 4F50A 2WRMA 2RQKA 2NYHA 3GB0A 4BWMA 3MURP 4WXWA 4DWIA 1BWEA 4J7CA 4ECUA 2M0GB 2EVZA 5B0GA 1CQMA 2LDIA 1WI8A 4EK2A 1TUGB 3Q8PB 3TA2A 5LXRA 2FLPA 5IC4B 4NYOA 2ADCA 5CAAA 3KLHB 2Y1RI 3IA0A 3RB3A 4PWWA 3RBEA 2IM0A 4KH0B 3JSBA 2B6AB 2FJDB 4KFBA 5HAOA 4QWEA 2RNEA 3ADAC 1O8BA 4I2PA 2V4QA 4ERDA 2H5JB 2QL7B 3M1VB 1TL7A 3PV8A 2XS5A 3CWJA 2JH3A 5BYSA 4LQ3A 2G13A 4KBIA 1AFJA 2QMXA 4P2MA 2UVVA 3ILOA 2FJEB 2CQPA 4J9KA 2GW8A 3HSJA 1B0PA 2DGQA 2LYVA 4I7FB 5ETVA 4F4ZA 3ENWA 3K5MA 5FLXY 4JI5J 1T3OA 4FF2A 4LFCJ 1N33J 2E5JA 3GV7B 4LREA 3HP6A 1U1LA 2XY5A 3K58A 1WC1A 3FCVA 2H65B 4BDPA 4CT8A 1ZM3A 2KVQE 3Q24A 4YN3B 4NI2A 5EN1A 2VD3A 2HFVA 4C0BA 3FVYA 4KGVB 1IR1A 2MEWA 3VAFA 1P8GA 1YJUA 2V5HG 4O4GA 2EK6A 3TVKA 5A8WA 1T3NA 3KG0A 1TL3A 3G6VA 3D67A 3KLFA 3EE3A 1MLAA 1R0BG 2AGOA 2BOPA 3K89A 4LF9J 3CC7S 4RR5A 1HWIA 3HHLA 3BYPA 1EARA 5K14B 4CO5A 5BR8F 2DYAA 5L38A 2VA3A 3H2VE 4X4VA 1M1GA 2WVDA 1R8BA 1PJ6A 1R6VA 1UPMB 2QA1A 3RR8A 2BJ8A 3R5AA 2DGTA 4I6YA 1LFWA 2V8VA 4OX6A 1NXIA 2HNZA 2XYHB 5GADU 2A18A 4J9UE 5CH7B 3VAIA 2DTJA 2MQNA 5E3PA 1EX8A 2QTWA 1S9GA 3QWUA 3GIMA 2Y1JA 2JEIA 3OQ2A 1AUSL 3PJWA 4OX7A 3RUBL 4KHPJ 5GVQA 1U1NA 2V4RA 1YIJS 2YKAA 1V6HA 2ILZA 2HGNA 2ZBCA 1RTDA 3NGUA 2FLNA 5CQGA 4ZA1A 1NPKA 2DNKA 2F63A 4DUTA 5IT0A 4RUAA 2ZH3A 4CLFA 3K59A 2Z8QA 3UI3A 1HNWF 2DH9A 2OEMA 3CULA 3W7BA 1XBWA 3FNNA 3FBFA 4H4MA 1SIZA 4LSZB 2JWNA 4O44B 1Q78A 3SQGA 4J90A 2KXNB 3J80Y 1S0VA 2VPYB 2R7UA 2W4DA 5A6WA 3JB9k 2RU3A 3NGSA 3JTPA 1C1CB 1YSJA 2IBOA 4GKKF 5CYJA 5E3CA 2NUHA 2ASLA 2NXJA 4FS2A 4GC6A 3BM7A 4IR9A 4K5SA 2EBGA 4KKOB 3AOCA 2PD1A 4PYAA 2HFSA 1HNXJ 1VI7A 4ETXA 2P6TA 1YLXA 3PM9A 1ZH5A 2J9DE 4CDIA 1M5VC 1F5BA 4WFXA 3VWSA 3CVKA 5DO2A 4K8RA 2MZSA 1HQEB 1SC6A 1UZDA 1DJ0A 1XIQA 1RLDA 2E44A 2GVZB 2QMUB 4G1QB 4O4GB 3BB5A 1X8DA 3KG4A 5GAHI 2Z4PA 1DURA 2VKRA 3FBCA 2HMIA 4QYRA 4N41A 1TL4A 4NXNF 4ES2A 2H5EA 3AXKA 3AXMA 1FTCA 3D3BJ 4I4BA 1Q1KA 2C42A 4DLGA 2OMOA 2P5VA 2YKMB 2ZBIA 1N54B 2QLFB 2VBWA 2DNNA 5G0RB 4K7QA 4KQZA 4EI2A 2VQEF 4DR3J 3B4DA 4WIQA 2KM8B 4JB8B 1Q86T 3MR7A 1S10A 2D3ZA 1QTMA 2WONB 4FYVB 2YH0A 3UFCX 3ISND 5KFIA 2JLEA 3M32A 5IS2A 3OTBA 1HBNA 4C8NA 2OELA 3FC9A 4YB1P 4OYOA 2VA2A 4O3SA 2OGUA 3RGIA 4FF3A 4L74A 3QJPA 3QSIA 1FXRA 4IFYB 2XMAA 3C46A 2IC3A 1L5UA 5M2UA 5JVGQ 2PT0A 4MFBB 5HJXA 3NG8A 2ZH8A 4OJGA 5IQQA 1LW2B 3M1VA 4L3NA 3DLGA 3SCIE 3OVSA 2R8IA 4ECXA 2DO4A 3D28A 4U7UK 4WYLA 1Y11A 2WSFC 3IS9B 5F0WA 4ZVEA 3RAMA 4F25A 4LVNP 3V5RA 1JLBA 3AFGA 2QLBB 5D15A 5AJ3J 3RW6A 2ZD1A 1S97A 1RT4B 4CTAA 1TV6B 5B0DA 3DLGB 4CO3A 1P9QC 1OYEA 4F4AA 4EO8A 4DV0F 4MFBA 2KDOA 1Q5VA 4ILRA 4YB5A 2W9AA 2N4DA 2QFIA 2XZWA 1PJ5A 5HJYA 2ZC3A 2KH9A 1K47A 4I0WA 4X4TA 2RDIA 2X1AA 4LF2A 4X84A 2DXEA 4B08A 4WFZA 5KFPA 3HHLD 4OX9F 2FHJD 3HT3A 2LQ9A 1U09A 2I38A 3D7SB 1JLFA 5DQGA 4DX7A 3KLGA 3H25A 3WX4A 3KMQA 4B9MA 4HACA 1NCLA 1RT7A 2XMVA 2YTCA 2UV8A 4WWSA 1M5HA 1YJWS 5HLFA 3MPWA 1S1UA 4L6V3 3IO1A 5F9LA 2F8HA 2YWFA 3CJ0A 3CCES 3QFWA 2UXBJ 4JI4J 1F9EB 1X5TA 4RW8A 2HGMA 1RT2B 3UD5A 2WTFA 2IJRA 3TEHB 3CMQA 3UN2A 3UD3P 2BQRA 4GKKJ 3B78A 2VG7A 3FBEA 3LAMA 1YKWA 2B9YA 4FPIA 4F7VA 4RNFA 5F8GA 4AXIA 3TQ1A 1N5YB 2CQDA 5IWAF 3KUGA 5U47A 4PG8A 3NP5A 1HBNB 4ILLA 3H20A 3CJRA 2LXUA 2VQFJ 2ZC4A 4HT7A 4KO0B 4ZVUB 2YKPA 2V9WA 1R8PA 1SC1B 3R6GB 1AROP 1RAAB 5GADI 4ECSA 1SJ4P 2GIQA 2C3MA 1X4DA 3HX9A 4G1IA 3BSAA 4USIA 1JLCA 1S6UA 4JV5J 1S0OA 3GSDA 2RQ4A 2W1BA 3MR6A 3E51A 1XNQF 3SV4A 4YR0A 2H51B 4G6VB 4WFYA 3WC0A 1BQNB 1NZAA 3HD1A 3MCMA 4WKYA 1Y3KA 2V2KA 4OYMA 5EWFA 3LGNA 4JI4F 1VLYA 2HS4A 4TQRA 3W65A 4M5MA 8AT1B 3FMBA 2OFHX 3EX7B 1SPBP 2BOAA 2YKNA 3M8RA 4PQUB 3TP2A 1Y7PA 2JFDA 1CG2A 2DNQA 2ZUGA 3FDSA 3OBIA 3P5BP 3PHEA 3Q8UA 2N7CA 2MY7A 3BSNA 4IOCQ 1SKSA 3QRPA 4K50A 3ZZOA 1HWLA 3IGVA 4ZCIA 3OL6A 4KKOA 4AD6A 1WHXA 4IDKB 1U1RA 3D6FB 4B3TF 2VJVA 4C4WA 3LOUA 1TAQA 2J9EA 4DQQA 2RUGA 2VBZA 4IOBA 3M6UA 3NGKA 3R27A 4KH1B 1KOOA 3BGRB 5CYQA 4DL3A 3PW4A 2AEFA 2CNLB 1HA1A 2POKA 2RF2B 3KK2A 3EZ5A 2MZ1A 3PW2A 4UZBA 3MCSA 5L1KA 4FN5A 4JI8F 1WEYA 4ZVSB 3THPA 2DHHA 2HNYA 3KFWX 3PJXA 2AJ4A 4RNHA 4RW7A 3L9ZA 5C24A 5GAHU 4DR1J 2RS2A 5HROA 1VBZA 1RTZA 5A8WB 2R8JA 2C2MB 3W9IA 3R1HA 1TL3B 2CQCA 4DV0J 4NLDA 3F56A 2IVFB 1J27A 2V63A 1HBMB 4ED2A 2W2MP 4IH7A 3UW1A 4DG1A 4KHMA 1Q82T 2FHJA 3DRYA 2QZ8A 3DDIA 2W25A 4LIWA 4RW4B 3AT1B 2HIYA 5L39A 2XMMA 3POTB 1KDNA 1VJWA 2KXFA 2C2NA 2GVDB 2CDQA 2PO4A 4CLPA 4DBQA 1TL1A 4FYWB 1IKVA 2MJUA 3NWRA 2F65A 1H3DA 1IVZA 2UXBF 3FCWA 3KLFB 3MM5A 5D0RA 3AJ1A 4R25A 5GAEI 2RDJA 4JYAJ 1UVJA 3O1LA 4RW4A 4B02A 2Z56B 4RUBA 3DYAA 2VOOA 1TL5A 4B9TA 2XQCA 4TU9A 2XB2D 2HFZA 2H54B 1DFDA 2LEAA 5DM6Q 3HFVA 1XJWB 3QJLA 1ITPA 3FQLA 2G0CA 4EEYA 1T95A 2VQFF 1QSLA 1KC8T 1VDHA 1S9EA 2B6AA 1NDKA 2DKOB 3BREA 1RZMA 1IUJA 1WHVA 2VL1A 3KJNB 2K3KA 1YRTA 5E41A 4B9SA 4W90B 1QD1A 3CJ4A 2VDHA 3V4IA 4KT0C 4IRDA 1N0VC 4EZ6A 2LEBA 2X3GA 2K7KA 4MT1A 1RTHB 4OX8A 4DR7F 3OTOJ 4FYDA 1N0UA 2MHEA 3RTVA 2J5AA 3NOCA 2D9PA 3KK1A 2PI4A 2XNQA 3HSZA 5IM0B 3PX6A 2CJ9A 3QIDA 4TY8B 2CQ3A 2GQQA 4ZPBA 3OTCA 1JLGB 1PKUA 1HR0F 1MMNA 4LT6A 4O44A 3D6MB 1PBUA 4IH5A 3RBZA 1BMQB 3DXBA 4XO0A 2UUCF 1LWFA 4P2SA 4WE1A 2CPEA 5KFXA 3MPUB 3E01A 4W98A 4XPCA 3ZTRA 1MWZA 1B70B 1K44A 3NXZA 4RBTA 4W4MA 3VGTA 3W2WA 3DLHA 3Q89A 2XMTA 2HLUA 5B0CA 4JV2A 1SC3B 3BYRA 1X0FA 2VPXB 1WOOA 2FJVA 4DPXA 2HK2A 4NRUA 2LP4A 3CMES 4CNYA 4UY8T 3PW7A 3LP0A 5K8PA 3MUTP 3CJ5A 2F40A 2BX6A 2R2UA 4DF4A 4KAIA 2GMHA 5C7PA 1CS4A 2FJXA 3EJMA 4OJ1A 3OJUA 5LMNF 4DSLA 2F4VF 1PJ7A 1GXTA 1PYOB 3M6WA 3MPVA 4ZLJA 4Y6IA 2B51A 3T6BA 1EKRA 1I94F 3AHPA 3H4BA 1X5SA 3EWGA 4JI7F 1KVIA 2GQCA 2QJ3A 3EXYA 2V8PA 3PRBA 1CJKB 1LKZA 4P6QA 4ZPDA 3R7SB 3HPOA 3TYTA 4U95A 2Y1LB 1JLEA 1WORA 4LR8A 5J2MB 2XCPA 4M95A 4RBUA 2LXIA 5CCMA 5IOLA 4TKTA 5E3RA 4Y00A 5FDLB 4Z2XA 1J5OA 1QAYA 1RWWB 2JOQA 4NWBA 2KVIA 1RTIA 5ETLA 4ZVFA 3WZ0A 3DHXA 2D69A 4Y34A 4C11B 2C3OA 4Y2IA 4A8XA 1APSA 1IKXB 4IG3B 2R7WA 3IWNC 5JXSA 2J0QD 2N3LA 1BE4A 4LBIA 2M5YA 1SIWB 2F9JA 3UQSA 2W9BA 2MQPA 4ELTA 3OFFA 4I69A 3ILLA 4ATNA 1X9SA 2HRYA 1NSQA 2UUAF 4A8SA 3M2UA 2GJFA 1S1VB 1S99A 1RHMB 1RTHA 5IZHA 1NZ8A 1D09B 2ZJQQ 5FJ4A 3KLEB 1GQEA 2I5JB 4DPUA 3MR3A 1SB6A 1VLOA 3FMWA 3AY0A 4I64A 3BSOA 3BR9A 1VC0A 4OYZA 1RYRA 1SJQA 1M1KT 4ZJLA 1T9UA 3DRRB 5F8LA 3K57A 2DRDA 1R27B 5F3TA 3KLHA 2AZ1A 1RT1A 1SJ3P 1WG1A 4KGXB 3BN7A 2ZNYA 1HQ2A 2OEKA 1GTEA 5C42B 5F3ZA 2BM0A 5I3UA 4GVLA 1REVB 4WK1A 1VQYA 4R5PB 1U4BA 2YNGA 2E1MC 4EMDA 1FX4A 3GTYX 3MM5B 1QAJA 2IDEA 3HKWA 3FZ2A 4WFNQ 3S6EA 3T5LA 4B17A 1TFYA 1S49A 1CJTB 3R9LA 3BSCA 5J2PA 2CJXB 2XEXA 3M2RB 3PXGa 5HL7Q 3K5PA 1A7GE 4TY9A 1GTHA 2DNHA 1SH2A 1Y00A 4LRAA 1HBUA 3CD7A 2JVOA 3I6PA 1PC4A 2RKIB 2WHOA 5T7LB 2BJ1A 1LV5A 1K1QA 4P75A 4YY3J 1FFWB 3D0IE 3R5CA 2CQIA 2AJ2A 2MMYA 5F41A 2JLGA 1HWKA 1RB0A 3N01A 2GHVC 3FKBA 3SCKE 2OPRA 2MQLA 3TX8A 2AYGA 1HYSB 3TUPA 3T1YF 4YB7A 4LFBJ 1REGX 3B82A 4LUBA 4X4NA 4K4SA 2G0IA 2OPQA 3LPEA 3D5MA 4QIGA 5BYQA 2NXNA 1U47A 5I42B 3CC4S 3C2PA 4LFCF 2DHXA 1NMEB 1RWUA 1F60B 2GQ2A 1LNQA 2R7TA 2VZ9A 3UNGC 3ZZPA 5BXIA 4DV5F 2L9NA 1S6PA 3BR8A 3W66A 2Y9HA 1IBKF 1U24A 2BYCA 4FXVA 2J76E 3CD0A 4C3KA 4C3MA 3CTRA 4N77A 4CLTA 5LSRA 4U9RA 4ICLA 1RT3B 4O0NA 2J6UA 4ILMA 5C25B 4TQSA 2CG8A 3A8JA 5KFQA 5HANA 3DDNA 1IQTA 1KR4A 2PA3A 3H8YA 3MM7A 3GR1A 2HVZA 2V67A 1MW7A 4CLUA 2IIHA 3ISNC 2I2YA 4ZCKA 4K4XA 3WDOA 3CJQA 4ICLB 3BN4A 1S6PB 3CB4A 4PCQA 3MMJA 1JLGA 2D7SA 2V50A 3DI6B 2FY8A 1C0TB 2KRBA 2QA4S 1N36F 1WTFA 3H5XA 4ZVGA 4EWTA 2DR6A 3IBWA 3KKFA 4OHVA 4C3LA 1WKJA 2DIUA 2CPFA 3PFEA 2NLWA 5DQIA 3I56S 2W7PA 3D2WA 3CD5A 4HH0A 5KG3A 2AYBA 3CJ3A 2ASYA 3CSKA 4RLEA 2KL8A 4DV5J 4ECTA 2ZWOA 1B3TA 2V9KA 4DSJA 1FKOA 2GHPA 3VAMA 4C98A 4N8NA 1IBMJ 4HI1A 1I5OB 5LXYA 1KEKA 2HQDA 4J37A 1WHYA 3PYDA 3TUJC 2RIJA 2B0GA 1RT3A 3DDKA 4C48A 2J0XA 5HATA 2ZJPQ 5EX3A 2MHNA 3V4MA 4ZVTB 5HVFA 1VQ7S 4C7QA 2AMCB 4DR4J 3EM1A 1U0SA 2PMZD 3QATA 4KV8B 2E1AA 3CD6S 1JLCB 1RAFB 1FVSA 4J5OA 1JX4A 3M9NB 2OPQB 5L46A 1AXQA 1N4LA 1JJ4A 3OXFA 4XIUA 3L7OA 2B4UA 4DR5J 4J9VA 2RHSB 2YNHB 2CJKA 4U7CA 1S1TB 3FEZA 2QIFA 1F9HA 2P9CA 1M5OC 3K7RA 4IO9Q 2YNGB 4LBHA 5H9FJ 3SDEA 2HG4A 3QAEA 1CULB 4CM0A 4ECVA 2IAJB 4JOUA 1UJ4A 3GFXA 4DFJA 3MAHA 2V94A 2PGCA 4L3KA 1H7XA 1S1XA 4AYBD 1RKIA 2MGZA 1VMBA 3UR3C 3LWLA 4C8YA 1Q4RA 1HWUA 1RXOB 2AZ3A 2BW2A 2HQ3A 1CLFA 3FEYB 5HROB 2H1YA 4I2PB 2CJAA 5I3QA 2UV8G 5ETKA 2VBXA 1H7WA 5B08A 4DR3F 1WKLA 1MU2B 1LEOA 3G86A 4OQJA 1CQNA 2H9ZA 4K59A 4E98A 3BO4A 2X3DA 1LW2A 4OFZA 2Z0GA 3V81A 1T03A 3NMRA 2PC6A 4C97A 3MHYA 4OZ0A 5CYQB 9RUBA 2AYMA 4Q0BB 4M5NA 1KQGB 2YKQA 3Q2SC 1LWXA 4R8UA 1KP6A 2AEJA 3IM9A 1QE1B 3DGPA 1XK8A 2E5GA 2RD5C 2YX4A 3OTDA 4IG3A 4P10A 4UTGA 2D74B 3GYGA 3GG1A 5FD1A 2PFDA 5KG5A 5DDOC 3LALA 1Q8KA 3R5JB 1CEZA 2BV3A 2YPZA 1HHSA 3DM2B 3MEEA 2PEBA 2VFTA 2OD6A 1B99A 2RHQB 3ZZ0A 4ES3A 2APOA 1FK9B 1PO6A 5ETOA 3DLBA 2YKMA 5G0RA 4NXNJ 4KSEB 1XTZA 2UVUA 1FI4A 2QSFA 2ILYA 4KGKA 2BE2B 1VQOS 1JNZB 2FHMA 4BCAA 2K8GA 5D0GA 1YBUA 4B3SF 1TTHB 1LXJA 3FSXA 4W92B 1T9XA 2V8DA 4DV3J 1X9WA 1U1MA 2FIUA 4AQYF 1Q0NA 1EJ7L 2IDLA 5D0HA 4MIBA 4RWXA 2HZVA 3U1MA 2CG4A 1BQMA 1GMUA 3KLIA 2ZZNA 1JLQB 2W2NP 2H4YB 4DF8A 4PWDA 1IBCB 2EW9A 4DQSA 2DGUA 2V0NA 2CRLA 5FDLA 2HFNA 4UQGA 5L1IA 1RSCA 3NGRA 1S76D 3CUNA 2XMJA 2CPJA 2VV5A 2HBYB 3ULHA 2I1RA 3C6TA 4LF7J 2RB7A 1JK9B 5H9EJ 2EWHA 3QZ7A 2C2EA 2JC0A 4MTPA 1H74A 2G1DA 2VKZG 4U8YA 4ZVRB 2GO9A 3PEHA 2M88A 3V6HA 2F1FA 3TAPA 5IWAJ 4LBPA 3V6DA 2OPSA 3RB6A 1W2BR 5CXTA 1RT6A 2WVEA 2FC9A 1WI6A 5K8OA 4WFAQ 1Q16B 3KK3A 2O1PA 1RTJB 3EGVA 1YBAA 1S9GB 4EBEA 2HFUA 1JIHA 1NPPA 1U6FA 1C4CA 4ID5B 5ETRA 2A2DA 3TUIC 2H4WB 1K73T 3QGHA 3GJSB 4O3NA 1FRKA 4NCBA 2QLJB 1N56A 3TZYA 4ZP7A 2WSCC 3IXQA 3DOKA 4OZLA 1WF1A 1SV5A 1UW4A 2B3TB 3CDAA 4Y2KA 3WIUA 2EG2A 2IM3A 2BW7A 3JSRA 4USKA 4O0IA 3OR1B 4NMXA 3M8QB 2W2QP 3KLVA 2WB1D 4KR0B 5K14A 3EGZA 1BHNA 1ZAWA 2VG6B 2YQ1A 3PDNA 4UOFA 5KG6A 3D0HE 3W2VA 2DRBA 3OR2A 2ZH5A 3T9ZA 2WK4A 1AB8A 4MYTA 1FX2A 2HHVA 2E1RA 1FKPB 4OV6A 5DJBA 1S1XB 1G6BA 4LF5J 3MOJB 5FIIA 4PG5A 4PRFA 2K7JA 3T5KA 3KDNA 1N6QB 1HIYA 3HO1A 3MTJA 1VQ6S 5HP1B 2NUUG 1KHVA 2XGQA 2HBQB 1T03B 1MG7A 3G8SA 1MU2A 3T3FA 1TKZB 3SIPB 1IKXA 4Q44A 3OUYA 1KQKA 2DJWA 2HVIA 5KOXA 4JI2F 3POTA 1FFSB 1EP4A 1RE1B 2NSBA 3ZFVA 5BJRA 2XMUA 4RNMA 4ER8A 2GVDA 2QYGA 3MD1A 5IT9U 1UL3A 2PIIA 4RU2A 1YJTA 3A13A 3MEDA 2DPIA 3TW0A 3IBFB 2C2RA 2VJUA 2YH1A 1X4GA 2HRUA 1RU2A 3W62A 5KT4A 4NXMJ 4OZ2A 1X5OA 4ETZA 1SL2A 1QUVA 4F4YA 4P7VA 4ZDNA 2LQ5A 4DV7F 4OHWA 3VGVA 5EGYA 2MKCA 4QWAA 1E6VA 4DFMA 1J5EF 4H4OA 3L3CA 2FJWA 4QIFA 3BGRA 1Y5NB 3ENAA 4TU7A 4LF4F 1SV5B 2V8GA 2LQJA 2DNLA 3HVWA 5LSOA 3KWMA 2DH8A 3GILA 3RAQA 3EUNA 3SEOA 1XR6A 2EK1A 2J7UA 2ZBQA 3DU5A 4QJVA 4Y0FA 5D3GA 4QCLA 1YX2A 1TAUA 2BEFA 4DV6F 2B7BB 4JYAF 3OFGA 4LF7F 3GYXB 3MFHA 2BZ2A 2VODA 2BJ7A 3I9ZA 4FF4A 1AFIA 3ISZA 4HVZA 4CH7A 2DNOA 1H2UX 1Y5IB 1AZSA 3GFYA 3RBDA 5T7LA 1WC4A 4FKYA 1DTQA 4QR0A 3BV8A 4FP9A 1YJ7A 1JJ2R 2FVCA 3R2CJ 2XMWA 4KGZB 4RUHA 4B3TJ 1RWXB 3QNWB 4LQ9A 1FWPA 5IT4A 3OVAA 3CJTA 3HVRA 3RRHA 4ZITA 2D3OR 4G3IA 1KLMA 1VRQC 2DGWA 3GMGA 1ACMB 3PVXA 3PCOB 4RJVA 5J1EA 2KTQA 1JKHA 1RWPB 3WC2A 3M9MB 1CJUB 1EETB 1Y3JA 5L8RC 1KFDA 3HFKA 3AH6A 4G65A 4EGLA 2BBEA 3KK3B 2R2SA 1YJ9S 2OPPB 1NK0A 4KIAA 2FJBB 2XNRA 3OLBA 1TQLA 4FBUA 2OUGA 4XTTA 1YZ6A 1J2VA 1RHUB 4USUA 2BANA 2D3O1 2E7WA 5A8RA 2XI2A 3PRVA 1RGVA 1RCXB 3A1YG 4QZVB 4F0MA 1OWXA 5CCLA 2HK3A 4YQWA 4CQ1A 2Y8WA 1FNMA 5HK4A 4OJHA 4BC7A 4C0OC 4ECYA 1Z2LA 4M5DB 5KFCA 4QW9A 4K4TA 2BANB 2GMJA 2RAQA 2VG5A 4DR2F 4A8MP 1P1LA 4ED7A 1UVLA 2MSSA 1RT7B 4HHHA 3FEXB 8ATCB 4WCEQ 2CIMA 1S1UB 2JLFA 3GJTB 4KYZA 5KFUA 5ETQA 4GO7X 4M5IA 4QWDA 4HACB 2E1CA 2ZZMA 2M7SA 2CNKB 1TU0B 2ZUAA 3BBFA 2EKNA 3PEJA 1KLNA 2VFSA 4FNIA 3PJ9A 4JI6F 5KFFA 1NNDA 3HULA 4N5SA 4ECWA 2R7OA 2OHDA 2LECA 2FZCB 1VQSA 2WW8A 3SSSA 1ULRA 3K5OA 3GJQB 3VAJA 1ZTWA 4QIEA 4CO1A 4ZLLA 4LSLA 2HW3A 2CQ1A 2KFYA 2KI2A 4KJIA 4ECRA 1I6JA 1FKPA 1XN9A 2DISA 3GLJA 4IYQA 4JI1J 4Y65A 3HCXA 2IMOA 2VPZB 4CLLA 1QM9A 2J6TA 1WNEA 2G0JA 5KFHA 2KZMA 2G2YA 3C15A 3NCPA 2P2CB 1UVMA 1JWWA 2OI2A 1VQ4S 3CE8A 1C4AA 4L72B 4J9NA 2DNZA 2NPFA 2JDJA 3EGWB 4LSLB 3QO9A 1GFWB 4OYIA 5KFSA 3HLUA 2ERRA 1UFKA 3VAKA 1DBDA 4PPDA 1R6YA 2R9LA 2W7OA 4ZPWR 4G1PA 1Q8IA 2KT5A 1HD0A 2FGCA 4ENOA 1F9FA 1F3VA 1PYTA 2XHCA 4IQXA 1E6VB 2XI3A 4DDFA 1N32F 2DD8S 2VFRA 1VQ8S 2VASA 3IFEA 1M5PC 1XERA 4JI0F 1UA1A 4PPZA 3ZXWA 2F8MA 1ZZFA 1Z1ZA 2XMKA 1IKWB 1V3ZA 4XAKA 3I32A 5T14A 3BO3A 1BXNA 2W8LA 1RK8A 4RPFA 3CCJS 2C28A 1HNXF 1VQ9S 4OI0A 2W8KA 1SQGA 4DQRA 4USMA 4UY85 1NLKL 4HDHA 2E9RX 1SKRA 1JJCB 4LRBA 3MDFA 1GK8A 2MGZB 1K0TA 1ZA1B 4Y2CA 2IC3B 2DR9A 3CO9A 4X4RA 1X4BA 3A12A 1ZBTA 3JSYA 4OZNA 4ZIWA 2XULA 4HH1A 1T9TA 2JEGA 1R8HA 1TVRA 3O6QA 3CXCR 3EPIA 4UW2A 2G2ZA 3TNVA 3E2EA 1Q81T 3CCWA 3M32B 5KG4A 3CF5Q 1OY8A 1UPPA 3OV7A 3L95X 1VK3A 2W2OP 1NUEA 2ZBRA 3M8WA 4HI2A 2JC1A 4M1KA 2CWXA 3LWMA 1WACA 4OV1A 3ZZRA 2KU7A 2V68A 4N8OA 4DCOB 5HMXA 1TKXB 1T05A 4C8ZA 1E6YA 3K2YA 4O3QA 4F3OA 3OL9A 2AJQA 3FCHA 4AL6A 3PO4A 1RWOB 5J2NA 1I3OB 2BE9B 3LP0B 4LJMA 3US5A 5J2MA 2ASJA 1ZM2A 2C3UA 2ZH7A 1MN7A 1UVNA 4J9SA 1B0TA 1NDCA 5KFBA 1JB0C 1DZ5A 2DHAA 1FJGJ 2B5JA 3OR2B 1NDLA 3M6XA 2SXLA 3FGVA 2C3PA 2VG6A 1HPZA 4YY3F 3W2WB 1NH7A 4N47A 2KFNA 5A8RB 2UUBJ 4ZVHA 1TP7A 2FTRA 4LFAJ 1S1WA 2XZTB 4YP3A 3W9JA 2IBKA 4F8RA 3I5CA 4JUZA 4QPTA 3EVOA 4RW9B 4Q8EA 3LP2A 3T1YJ 2HURA 4X65J 2VOPA 2IA6A 4Q5VA 1OJ4A 4A8KA 2HNZB 3NAIA 3SSQA 2XY6A 1S79A 4N7TA 3RB4A 2E29A 3WHIA 3I82A 5DDRC 2QV6A 4YHHF 4KTQA 3EYZA 5LMUJ 2CUYA 3SZ2A 3QRRA 4RUCA 1YBTA 2AGQA 2KFZA 3OXLA 1IR2A 5KG0A 4NLUA 3B54A 1AYEA 5E5NA 1WSVA 2J8SA 4CTAB 3GCXP 5C2GA 3PY8A 3BDEA 1Y9OA 4NMLA 1RP5A 2JJ4D 3ZTSA 3HZGA 3PO5A 3CDBA 1UP1A 2XC9A 5L1JA 3KTQA 3C66A 4K0KF 4WKRA 6FDRA 2HIQA 4NZ0A 1VFJA 3L4BC 5HVGA 2QMWA 4AE5A 4ED4A 1D0EA 3OLAA 1S77D 2GA7A 4Q8FA 2VUGA 3K8WA 2WOMA 5BR8J 2MKKA 3NCQA 1CC8A 1F3FA 1OYDA 2HYIB 4IFVA 1M5KC 4OYWA 2C2OB 2Y0BB 4E0DA 1S5ZA 3AQPA 2E7XA 3GE9A 3LANA 1YGYA 2DHSA 2HFOA 2E9ZA 1VGYA 4UUXA 4QYZJ 2JFKA 4WF9Q 2DEIA 4WPAA 2MKIA 1IKVB 3N5BA 5J2PB 4ZJOA 1NRKA 2B7CB 2W9CB 5LMUF 1NJXA 1YJRA 2YNFA 1YJVA 3BBBA 4V19J 2CA9A 4JI0J 4PG7A 4X64J 1M90T 1R0CB 1SUQB 4MK9A 1X9MA 4WP8A 1IBKJ 3S8SA 2HKEA 2M52A 1D9FA 3W1YC 5DM7Q 4R5PA 2FLOA 2ZVSA 3IR7B 2BKNA 1FKAF 1RQ0A 2YX7A 3BEGB 4LRFA 3GJRB 4NEYA 3ZTPA 1ZAVA 2QC3A 4NL5A 2ROEA 4PKDB 4DL7A 3EDRB 4OI4A 4R0JA 3UVJA 3FK4A 3NS5A 4U8VA 3VZIA 4K4UA 3PW5A 3I9V9 4TN2A 2JL9A 1X4CA 3P4UB 1EP4B 2Q3PA 4NOHA 4YS2A 4IKAA 3GONA 3MD3A 4FF1A 1BGXT 1S59A 4TLRA 5AXKA 2RH3A 5KFZA 3MM6A 4F36A 3NGDA 2XWXA 2IYIA 3M2UB 1I51B 1JXVA 3VR1A 3HKZD 3NMAA 5HP1A 1U8WA 5C42A 1OY9A 1P6TA 5K9FA 1XMQJ 3R1LA 2XS2A 1RAOA 4EBDA 4V19X 3JS9A 1X4HA 2FJAB 2W4CA 4I2QA 3D9BA 1NHUA 3LP2B 4WU2A 3CCSS 1HD1A 3NS6A 5E3QA 2EC0A 1K1SA 3RRKA 2AWZA 1BY9A 5KT2A 4QU6A 3IS9A 2IY5B 3K0JA 4CT9A 1P27B 4D3GA 5BYRA 2F5GA 3BQ1A 4QIWD 3JYTB 5AXNA 3CT9A 4I67A 2MZQA 2ZKUA 2AJFE 3IGNA 1HPZB 2GX8A 4IQMA 2VHGA 3CCRS 1U49A 2B5JB 4XPEA 1KVJA 2E5LF 5F9NA 3G6YA 1QVGR 3O5TB 1N48A 3RB0A 1S6QB 2P9GA 4CP5A 4F2RA 4ZPAA 3LAKA 4CO0A 3DU6A 2B9WA 3M8PB 3OL7A 2ZWPA 3S01A 2LA4A 1RTJA 4ED6A 5AE3A 1IXKA 3F41A 1YDLA 1HKAA 1XMQF 5B7WA 1XNRJ 2B56A 3PKMA 1QSYA 1GMVA 3AJDA 1HQUB 2VF3A 3UDEA 1RWMB 3PHTA 3CEDA 2DHGA 2IHR1 2QX0A 2KM8C 4LF6F 1U2RA 4NA1A 4ZJQA 2HHQA 1FJEB 4DX8H 1QDUB 3C6TB 4MK8A 2XM3A 1LFPA 5A6PA 1OPIA 2IRXA 4OYBA 2HWHA 1DLOB 3JQKA 4Y28C 1R0AB 5KFKA 3HHDA 3IMQJ 1KTVA 2ACYA 1LW0B 2MKHA 2Q79A 3WIVA 1QY7A 2QGFB 2HZAA 1D8ZA 3C16B 2EPIA 2PMHA 4ZHRA 3AQOA 4AQYJ 3TANA 2RRNA 3DRSB 3IP0A 1VQPS 2FPHX 2UXDF 4ZPVR 3CGIA 5KFVA 2EBEA 3ZTOA 2FC8A 2PN6A 4ZN1A 1NB2A 3PX0A 4NZ6A 1LXNA 1EB0A 4RKUC 5EWEA 1YK9A 3TA1A 3JYTA 1RWKB 2ZHOA 3MM7B 2R7SA 1IWGA 2DGVA 5LJ5Y 1ZZNA 4NLYA 3LQVA 3V4IB 3NGTA 2RRBA 3DRRA 1YI2S 1OY6A 2HQGA 3U02A 3MUMP 3HHLC 3KDOA 4KFBB 4S0MA 4JV0A 3RAXA 1JLAA 2DR7A 3RR7A 3FRZA 4I2QB 4IRKA 2RQMA 3A8KA 2PFFB 4P73A 3G87A 2AEMA 2DCUB 2MKSA 2O5DA 3CJ2A 2HLTA 2MQQA 1K9MT 2BJEA 3HT0A 4LRDA 3LTOA 4F0HA 1V5IB 3TA0A 3KHLA 2B4OA 2CZVC 1DTTB 2L48A 2AT1B 2MY8A 1B7YB 4KGMA 4J9OA 4C9DA 5F8NA 1RABB 3IC1A 3T1HF 3I31A 2BDPA 1I1GA 5HMYA 3NL0A 3IRXB 1X31C 4BWJA 1Q53A 2VU5A 5DLFA 2K1RB 1VRTA 4K2JA 3BH7B 2R8GA 1W26A 2BABA 1HBOB 4HYKA 1FTRA 1BUXA 1VS3A 1WEZA 2LCWA 2OFGX 3MAAA 5B0AA 3UN5A 1L3VA 3ZZZA 2RKIA 2BM1A 1I94J 1BD6A 4DEZA 4X4OA 4DV3F 1WG4A 1VRUA 4FZVA 4URGA 4DUZJ 2RE1A 1VIOA 2PDAA 1QAIA 2IYGA 2MQOA 2CZ4A 3M2RA 4DS5A 2W9CA 4X2BA 2KHDA 2PA8D 3P49B 1OQ6A 1S1TA 2M9KA 2RQCA 2KJWA 4ELUA 4RW7B 2DY9A 2GGPA 3FBBA 5J1NA 2HHXA 4IFVB 5C5JA 5E0OA 3MUVP 3H5YA 4J91A 4Q43A 1FD2A 3RZAA 3J80U 1UW9A 3AAWB 2NCKL 2VC1A 3H90A 3HM9A 1FRIA 1YRXA 1F2GA 2XHWA 4DU7A 7FD1A 4YEAA 3RG6A 1ZYQA 4ZP8A 3TZWA 2DO0A 4ZK7M 2QEXS 1FNOA 1RAHB 3BJYA 2VQEJ 2DRAA 3W3SA 4GMKA 2P9EA 3CDUA 2Q6CA 3U1NA 2R7XA 1SJRA 1U2CA 3MEGA 4HDGA 5EX0A 1X7VA 2JEFA 2AW0A 4QIVA 1RAJA 3P96A 4ZP6A 3W5YA 3N9UC 4WXOA 1FNXH 2BE7D 3UE2A 4BHQA 5D4OA 1R8CA 2VONA 2YQ0A 5EUHA 1L3UA 1N5TA 3Q23A 2HVDA 1M5SA 2AF6A 2ZOGA 3L7UA 1GEHA 3N28A 3QT5A 4NLSA 4QWBA 1RHJB 3P6YC 1KKHA 3D3CJ 3TO8A 5A76A 1C1CA 1VOMA 1FDBA 1BQNA 3A3NB 2OH2A 2ALYB 2ZHBA 5KOWA 1B64A 3DXSX 1BLUA 1G4CA 2IM2A 1MMDA 4NCGB 1ROFA 3PYGA 3TRGA 4LF8F 2GIFA 5CA5A 3GIKA 3ICLA 4DSKA 2HRTA 4DJBA 5RUBA 2JNJA 2D1CA 5MLCV 1RHKB 2IVMA 2XG8A 1F6TA 3LGHA 3M2VB 4P74A 3MEGB 1RAEB 1H0HB 2FVPA 3QT7A 3IRWP 5DG8A 4ITSA 3B8HA 4MH8A 5H9FK 1MNEA 2CAJA 5HSPA 4QW8A 1S12A 4ECZA 1URNA 1G2EA 5DLGA 3HSGA 3VQTA 4LF9F 1WF0A 3OL8A 1ZM9A 1RA6A 1SQEA 2YWHA 2ZFHA 3V2UC 4C0HA 5HI7A 3UCUP 2GO8A 3FUYA 4OZ1A 3T5JA 4JV1A 1PILA 1A6LA 1L3KA 2ZITA 4AFFA 5HLFB 1TKXA 3M05A 1CJTA 2D41A 5KFNA 3FSIA 5CABA 4C8LA 3CCLS 3BGFA 3QRQA 4CLYA 1KS2A 2I8EA 2FHKA 4YB6A 2XLJA 2KT3A 2IJFA 4LF8J 1RWNB 1QJHA 2V2QA 3MECB 3KNAA 1UFLA 3CJSA 1VC6A 2V2ZA 3BGUA 1DRZA 4Y2AA 2Q1LA 2EI5A 1N5YA 2JEJA 2GFFA 4DMZA 1GXLA 3N6MA 2CXEA 3HHNB 5KT3A 5HO4A 5GMDA 1HBOA 1IBLJ 3KJVB 1Q8LA 2BQUA 5E7OB 1FDAA 1HMVA 3AB4B 1RT4A 2K06A 2MDAA 1KFSA 4CNZA 2FGOA 1WUUA 1L3TA 1JLBB 3WBZA 1VCTA 3QGGA 3E8OA 3VTIA 1OMSA 3AD8C 2BUNA 2OAUA 1S72S 1IKYB 2KT2A 4TNOA 2B43A 4D3HA 5GAGU 4B9UA 4DV4F 4B9LA 4JI3F 1LOUA 2CQ0A 2RS8A 1QE1A 3DGPB 3MCNA 4NEZA 4RO0A 1WC0A 2CPIA 1NM2A 4IR1A 2AIRB 4Q0BA 2V34A 1REVA 3UCZP 1Z2ZA 2KB2A 5DRKA 5IFMA 1FJ7A 4OJ3A 1N36J 4PQAA 5ETMA 1KONA 2KJVA 4DPTA 3QJJA 4CI0B 1HWJA 2MZRA 4NYZA 1ZETA 2W2PP 2YY3A 4M5KA 1S9EB 3H2LA 3AOAA 3DFEA 4UQTA 3T1AA 5AE2A 2WONA 3R7NB 5B09A 2OPSB 3KJVA 1SKWA 1Y5LB 1MROB 3EZUA 4OLPA 3BO2A 3W5XA 2MLXA 5IQ6A 1IBMF 4WZQA 5A0YA 1A9NB 4TYBA 2AV5A 3QT6A 2ACMA 3SMZA 4B9VA 3L7PA 1AA1B 2BA9A 2KRRA 1CULA 2EC2A 1CJKA 1VHFA 2HMIB 1VBKA 2GZOA 4C8OA 4DQIA 1R8AA 2X51A 2R7VA 3PRDA 3FSYA 3TR5A 4KHPF 1F2HA 2W01A 3MECA 2GIRA 2VFVA 5ETSA 3KHGA 1C1BB 1HNIA 3S7RA 1TKDA 3K5NA 4JI8J 4OYAA 3DLLQ 3W5ZA 1RTIB 2V69A 1HNVA 1GMWA 4DR1F 3EICA 2WB4A 3J7Z5 4XK8C 4BS2A 1PBAA 1S57A 3DOMA 2OSQA 4PWUA 4J9LA 2ADBA 4QPXA 2A3JA 3M8PA 4K4VA 2LQ8A 9ATCB 1LW0A 1D3WA 2A6MA 8RUCA 1PAEX 3GV5B 2YWGA 2HHSA 4WU3A 4O3RA 1Z4UA 3H0PA 1U6ZA 5AE1A 1VQLS 1KTQA 2QLWA 2DXDA 1TK5A 4X4QA 1QTNB 2FLLA 3MMBB 4DV1F 2XYPB 1B7FA 3BBCA 2CZ9A 4EZ9A 3Q8YA 1IJEB 1XR7A 1CBKA 2GC8A 4Z7CA 3ETOA 5GAGI 3JAMU 3E01B 5IXUA 1ZA2B 2UU9F 5B0BA 3G8QA 2N82B 2P8IA 3DN9A 4O3OA 3QSYB 1DQ9A 1NJIT 4B3OA 3ONQA 4YUDA 1C1BA 1HNIB 1W25A 1NHKL 1N5QA 1VHIA 2CNOB 3CCZA 3HJVA 4EU0A 5DGBA 4QYZK 1G7CB 3AD9C 1C0TA 1KQFB 3U27A 1CSJA 2QN6B 3H7HB 3Q83A 3W9HA 5KT5A 1VQKS 3LF0A 1W7WA 3VHQA 4QU7A 4DPOA 1FRHA 1TMMA 4NE9C 3HZEA 4IG0B 3Q0AA 2AP6A 4Q2MA 2CNNB 4FKXA 5AXMA 2E1PA 5M2RA 2VICA 1OSCA 3PTWA 4I6AA 4DUYJ 2FDNA 4MK7A 1FK9A 4J9QA 4ZVQB 5B0FA 1GH8A 3QT8A 3H5SA 3VAGA 4NX9A 3H4DA 1R7IA 2UUTA 2CADA 2ZD1B 4DV1J 4RNOA 2NSCA 4CH1A 3UR0A 2DR5A 4M5GA 5ITHA 4TY8A 4ZIVA 2UU9J 4ZLNA 4LMZA 5IV3A 3LPYA 1X4EA 2V2VA 3KK1B 1FT8A 1T94A 2CPYA 2VH7A 4ZPTR 1OIAA 1ZOTA 2NXEA 2FYXA 3I0RB 3NLCA 5MAOA 3HVTA 1RUSA 2UUCJ 2DK2A 3VQSA 4F3QA 5D4PA 4L76A 3D4JA 1R31A 2RJZA 3R5DA 3D6HB 1DAXA 2DGSA 2YNFB 5D4LA 3RYLA 2YNHA 4CLWA 5ETPA 2KG1A 5I3PA 2BKPA 2G9OA 2QSWA 2FB0A 4OYXA 4PXEA 5KAKA 5AT1B 5K8MA 3T9NA 4QR2A 3KHRA 4A47A 1MSWD 5DZ7A 1HMVB 1FJGF 2WZ1A 1F5CA 2WOMB 1BC6A 1NEEA 4OZ3A 3SCLE 4DG1B 3HXMA 3KG1A 4YDXA 3MEDB 1JNRB 2LFVA 3PNIA 2Z30B 2LU1A 4RU9A 2UUBF 5KFWA 1WEXA 2ZDPA 1G3OA 5LJ3Y 3I87A 5D6GA 5F8HA 4PEOA 3T6JA 2RU9A 1ZTTA 1FESA 1SUQA 3AD7C 2L9WA 4NLXA 1OQ3A 2M8DB 1NPRA 3M30A 4EUVA 3QIPA 3HVTB 3EXCX 2CQ4A 2LKZA 4LRCA 3BPSP 1DTTA 4A46A 5I3UB 2Q66A 3I0SB 4IDKA 1TR0A 2HZCA 1PGZA 1CVJA 1JLAB 4DHVA 3V6JA 1B4SA 2BKOA 4DN0A 3SI8A 2FD2A 3C15B 3QWPA 3JTOA 4ANCA 2VIHA 1T8EA 2K1RA 4I68A 3ZNUA 1M1HA 4B3RJ 3V81B 5C24B 2U1AA 1X60A 3HI9A 3MM8B 3O3LA 3T19A 3UDVA 3R2DJ 1S7HA 3CO0P 2ZH4A 4PAAA 3PKYA 1U45A 4IFYA 1V3SA 3CNQP 1OSDA 1WG5A 5DGAA 3X1LB 1O6XA 1ELOA 2LDYA 3SCJE 4A4JA 2W9BB 3KXDA 1TKTA 4LF5F 3OFHA 3HK2A 1JMTA 4X66J 1N52B 2COLA 2DXFA 5KT6A 3P3DA 2RMLA 2W4PA 4PUOB 4AL7A 3HDSA 4X64F 4DZDA 2CJBA 1N5VA 4B3OB 1H6KX 1EQMA 4RW9A 4HHUA 1YG0A 3TJ9A 3ZNJ1 4CLZA 2R3VA 3M8YA 2N3OA 4YR3A 4V1Ak 1XQIA 5EDWA 4TU8A 1J5OB 2J0SD 3BKUA 3DMJA 2KYZA 2V8HA 1LWCA 3HHLB 1NSAA 3F73A 2NXUA 2D3UA 1JLEB 1WC6A 4QOTA 2ALZA 1Y0HA 2AJ1A 1FJCA 2WVFA 4DI6A 2A10A 4F4XA 3AOBA 3D6TB 1T02A 3PACA 5HQMA 3O2IA 1LWCB 4DV2J 4FDFA 1NKCA 1EHWA 3P8BB 4WYWA 5J2NB 1VQMS 1T05B 4LF1A 4LVOP 3DRSA 3VGUA 4NXMF 4ZMMA 1RHRB 1E6YB 2L08A 3MTKA 5HBMA 1URRA 4LSNA 1NJYA 1VBXA 4PXDA 1UWBB 2JVRA 1CS4B 2RDDA 4ZPCA 2HNDB 3BGOP 3RU0A 4YFUA 2GJIA 3I5BA 2PE8A 4A48A 1DLOA 3IAS9 1R0AA 2MLYA 2AJ0A 2QE5A 3B4MA 1KHWA 4E8UA 2RILA 4CZCA 2YWKA 3UDLA 1XMOF 2VG7B 1QSSA 1TVRB 2GMLA 2J0WA 3TEGA 1H2TZ 3AA9A 3W8GA 2VDIA 1RT1B 2VPWB 2U2FA 2C22A 5LT5A 2J7WA 2ZOFA 1MMLA 3N0VA 2BXJA 4ES1A 5KFOA 3KMSA 1LK5A 3W61A 4F3MA 2R7RA 5H9EK 2AU0A 2AGPA 3C3LA 4X4UA 4TVAB 2A1BA 1JQGA 2X1BA 3DKDA 2YNIA 2RSQA 2FQQB 4CLKA 4DV2F 5SZTA 5KFDA 2LMIA 1RBOB 4C2MA 3UPFA 5KFMA 4QWCA 4R8UB 2DPJA 1XMBA 1H73A 4GKJF 5AXLA 1T11A 1TUWA 1NJWA 3QYYA 2IPOB 7AT1B 4DXLA 3QLHB 3OD2A 4M5LA 1RAGB 4ID8A 1MWYA 3Q8RB 2WVBA 2R2TA 4DPWA 3MM6B 1XNQJ 2Z2MA 2OEJA 3M30B 5DZ6A 1DARA 4ZS6A 2A6OA 1X5PA 3M7VA 3TZXA 3CCVS 1TK8A 4LF6J 3R5BA 1XNRF 2ZDOA 3IWLA 1RAIB 3L09A 3PG9A 1RBLA 2Z57B 2YX1A 1Q7LB 4XDDA 3K17A 1H72C 4K2XA 2E5LJ 1ZPVA 1S1VA 4NZ7A 1H38A 3MR2A 2IAJA 2HPUA 3EMTA 2BMBA 3MWBA 4URSA 4X66F 3G6XA 1HHTP 3ITHA 4NCAA 3BZQA 2OP5A 2A0FB 1FO1A 2PEHA 1NAQA 2R42A 1EZZB 2XWYA 2ZE2B 3GYNA 3J81U 3Q8QB 1TFWA 3NNCA 2KYXA 4Q45A 2N4CA 3PIPQ 2C1EB 2ZBPA 1TKZA 4FPRA 1K0VA 1UEUA 3PFOA 4I7FA 2L3MA 5CD4A 4DPYA 1VJQA 3ZO7A 3LGMA 3NCRA 1HARA 2ZH6A 2FUG9 4NYPA 3IG1B 1FFGB 5K8NA 3K8VA 1GX5A 3EVWA 4JBCA 3BQ0A 4A8FA 2MYFA 3G8TA 2PSZA 2VG5B 1HFEL 1VYAA 3DLKB 3I4HX 4WZMA 2CPHA 2LVWA 3ET6B 4FNHA 2ZH9A 2DB1A 2YPYA 2MXYA 2LA6A 4PXBA 3JQMA 4DR6F 2XCAA 2F4FA 5K5MA 5CD4H 5CYMB 4DL5A 2FHOB 1U02A 2LU2A 3AJ2A 4DCPB 2Y1IA 4P9SA 4CH0S 3UN3A 2XO7A 4F4WA 2KKHA 2MKYA 1ZM4A 1DQAA 5D77A 4XDCA 1NKBA 3W60A 1KWMA 3BQ2A 2WVCA 3DI6A 2YVSA 3H98A 4NCGA 1CJUA 1EETA 2HS3A 2M3DA 4O4RA 4WJBA 2XGPA 1S6QA 3CCUS 2EFOA 1VIXA 5G4DA 3J7ZT 2ZHAA 2MTLA 2CVIA 2XBPA 1QAXA 2RT3A 3T5HA 1WWHA 1AW0A 2BACA 3DHWC 5CYMA 1JXLA 4Z7YA 1K8AT 4H4OB 4H54A 4URQU 2LXFA 1F1BB 4WIIA 4UF4A 1N32J 2NR0A 1RTDB 3EZOA 1V5VA 3ZZTA 5HMZA 3DC2A 3ET6A 1RT5A 2FZKB 4FYXB 4M94A 3NBPA 2EFPA 3TWZA 3HHEA 2DITA 4IH6A 5KFYA 4F04B 1N88A 4LR7A 1NJZA 3MFIA 3J81Y 4DV7J 2EEYA 3LP1B 3W64A 3GQCA 5K20B 2DNGA 1J5EJ 3GG0A 3OTOF 4IO1A 3OT9A 1NU4A 2J9DA 3DOMB 4MKVA 2ZKTA 1RBAA 1VK8A 3QIPB 2UXCF 4KRWA 2OPRB 1HYSA 2IM1A 4CLSA 2XS7A 5C2CA 2O3DA 3KYLA 1U6BA 4CCHA 4KO0A 4BBYA 5IT9Y 2QFJA 2MPUA 2QT7A 4KPCA 4RW6B 3SFUA 1UVIA 4DZ6A 1WSRA 3ILJA 2DNMA 2NPIA 1VRUB 2EFGA 2CQGA 3OJSA 1SI9A 3KJFB 2XLKA 3QZ8A 1L3SA 3MI7X 1U25A 2OKQA 4OL8A 3CJ8A 4RW8B 1YHQS 4FBTA 1LQ9A 4FVMA 3NEKA 5CZXA 3VV2B 3NWGA 3O44A 1IKWA 1IM6A 3RW7A 2QLXA 3VCDA 3H2UB 3MAAB 2OO4A 1VC5A 1R89A 2HVEA 1FA0A 3CCTA 3W2VB 1Y4ZB 4N76A 1S7IA 1CPZA 4USHA 4UT4A 1FDDA 3Q2TC 5KFTA 2DNRA 4H4KA 4ZCMA 4I6WA 1WHWA 1PC5A 3DOLB 1YWXA 3C6UB 1GXUA 3O8WA 3KUEA 4TLQA 3G6ES 1U1OA 3QAUA 4EYIB 2UXCJ 4ELVA 1WOPA 4FXDA 3G96A 3ELHA 2EFQA 4UZCA 2KHCA 4B9NA 4NLRA 4KPYA 2F4VJ 2HHTA 4EYHB 4PG6A 3CIMA 2MB0B 2NZ4A 4J9MA 1EAYC 2HSEB 1C0UA 2AX0A 1C2PA 1HW9A 2Y0SD 1HNZJ 1HL6A 4Q2LA 3CCMS 1MROA 4F67A 1U1PA 1YQHA 4DR6J 2O66A 3C19A 3U1LA 2M8HA 3BKTA 1RT5B 4DL2A 2KN4A 2VC0A 3HF5A 2Y8YA 1P9YA 2HNYB 3KLEA 3UD4P 4ED5A 2CVEA 2QA2A 3A4TA 1IBLF 4P7TA 2I0XA 4PQUA 2CQHA 3GIJA 3JSMA 4DL6A 1SCJB 2KO1A 5JUMA 1SL0A 3RRGA 3CW2C 1UEKA 4P71A 2DGOA 3SDEB 2GAGC 2GHWA 2B4PA 3DOKB 2J9CA 3LUYA 2UVWA 2HWTA 1S48A 2DH7A 4DR4F 2LLZA 2QYCA 3I4PA 1HI8A 5A8KA 1AT1B 4K5RA 5GMEA 1UWBA 6FD1A 1UMJA 2W7AA 3GFHA 3IR5B 4PWDB 4L73A 5HVHA 2OLWA 3OTEA 5E2QA 1PCAA 2OMLA 4A8QA 1SJFA 5ADZA 1RT6B 4BC9A 4C6AA 1IWAA 2XTJP 1N33F 3HVAA 2X1FA 4L75A 2Z2YB 4OMFG 2MKJA 4P2XA 3VVUA 2M4MA 5FLXU 2DIVA 2NQPA 1F0XA 1RLCL 5CHCB 2HVHA 3OXGA 2HQIA 3ENVA 4MYUA 2QA4G 4JI1F 1UETA 4U6PA 4K4YA 1UCNA 3GU0A 2BE2A 3VF0B 2DBBA 5KT7A 4RW6A 4ZVPB 3DMJB 3PYEA 3QFHA 3ZC4A 3UNYA 3VAHA 3CJKB 5J2QA 1F5AA 2DR8A 3DGVA 3RJMB 4DFPA 2HHPA 1WC3A 1X4FA 1ZS6A 3NAHA 5DS7A 1BQMB 3DLEB 3LH2S 3MR5A 4DSEA 2Q6BA 4CO2A 2UUWA 1JLQA 4JI2J 2MZJA 1MWQA 3M8ZA 1B0VA 3P45B 4USWA 2BVZA 2E66A 1JKHB 2FVRA 4EFAC 3G4SS 3ETMA 2ASDA 1KLMB 1NH8A 2XO6A 3W63A 3TQEA 4PR6A 4X4SA 4M5JA 5J1EB 4M5DA 1T0TV 1GMWD 3SSRA 1D1UA 3CPWR 3PW0A 1KRPA 5KTQA 2F8EX 4NLVA 3D1HA 4KHRA 2W24A 3B6BA 3MM8A 4P72A 5A0YB 2UZAA 1T9VA 3D54A 5T41A 1SL1A 1DY3A 2E9TA 4CIOA 4WE1B 2KG0A 4FVCA 3U7JA 3MAQA 3GWCA 4NA3A 1IN0A 2CWKA 1JLFB 3KLGB 2C2DA 5ETNA 3F0NA 1N5SA 4IOAQ 2L41A 1WDDA 2ATCB 1HNWJ 3A3OB 3I0SA 1UJ6A 2EKYA 3QPIA 4MAKA 4NLOA 3NS7B 2A2CA 3OSNA 3FZBA 2VBYA 3C8YA 3ZZYA 3SYZA 2M2BA 2XSJA 1XC9A 4NLPA 3N6LA 1NK4A 3MMCB 3KUHA 2BJ9A 2Q43A 3IAM9 3Q8VA 1XMOJ 4OLOA 4HL9A 5DDPC 3DOLA 1ICEB 5DG7A 2VB6A 3KHHA 4USVA 1HLWA 4GO5X 3GV8B 1OS5A 2ZH2A 1O51A 2YXLA 3WX8A 1NK8A 5JMNA 2LQBA 4ZVOB 1YZ7A 4RBVA 4X4PA 3IN5A 2GS8A 3EGNA 1PG5B 2I6WA 1XWLA 2ROPA 1U1KA 5B0EA 5A2QY 3TAMA 5F8IA 3GFZA 1UVKA 4GC7A 1RADB 2K3IA 4PUOA 2MJNA 5IC6B 1U26A 2OSRA 3R3TA 2FZGB 2GV1A 2K2PA 4NI2B 3SXLA 2V6AA 1D8YA 7FDRA 2EXUA 4FS1A 1SXLA 3TAMB 4ALZA 4AT1B 5LSLA 3CC2S 1UA0A 1VRTB 3JAMY 3EDQB 1SJ1A 1CC7A 3CIZA 2JX2A 1WOSA 3N6NA 1TL1B 4M63A 2CFXA 2FY1A 5KG7A 2WCXA 1HI1A 2X7IA 4KC5A 4WK3A 2QL9B 3MCOA 1FWLA 1DQ8A 4M8LA 3PZPA 4ED3A 2H5IB 3IWXA 3LA0A 2CQ2A 1FE4A 3CCQS 4DUYF 2AKWB 2MZTA 2E5IA 1FERA 3I0RA 2DGXA 5KFGA 3D0GE 2CKWA 4FYYB 4KV8A 4DL0C 1PIEA 3TJ8A 5DG9A 3M9OB 1U0HB 1HBMA 2HHHJ 4K4WA 3G9CA 5GMKa 4QQBA 3I5AA 2PI5A 3GIIA 1HQEA 2R8HA 5D4NA 2V4JA 3A8EA 3M8SA 1MN9A 3EVMA 1SKUB 3OR1A 4U7UD 5CZVA 2HEKA 2HQCA 4F26A 2ZJRQ 2HS0A 1D9AA 1V3RA 2OD4A 3HSDA 4ZOSA 3SQOP 4E2FB 1AUDA 3FQKA 4CYUA 3DNCA 2CPDA 3N5FA 2G1HA 5F8MA 1H2VZ 4DLEA 2WBMA 1WJ9A 3NKYA 4OI3A 2J8AA 2XSJB 4ID5A 2RRAA 4IG0A 1Q95G 5E33A 3MZIA 2HGLA 3S1TA 1UFWA 5HQ8A 4DR5F 4MIWA 1N6QA 4C8MA 1Q8BA 4MIAA 4NPOA 4DOZA 4DSIA 1FHTA 1WD6A 3MMAB 1FCAA 3NBPB 4F0KA 2ZZTA 2OTLS 4PXCA 5L9NA 1RWVB 2YNIB 2NREA 1FF2A 3D1QA 5HQLA 4OI2A 1N34J 3UO0A 3T1HJ 4QR1A 1A0OB 5JJBA 1G1XA 2CJQA 1RU1A 2YKNB 3NOGA 5SUHA 3G82B 3FFIB 4NRTA 3CJKA 2X1GA 4HLBA 5J2QB 4B3MJ 2V4JB 4AL5A 5AJ3F 2F9DA 1BWVA 1DHMA 1UAWA 1KBRA 2DEJA 3T41A 1RA7A 3J7YI 1U1QA 1QLNA 5D8HB 3RBXA 4OI1A 2PMWA 2E7VA 2IA0A 4CO4A 1VQNS 1RJJA 2IJNA 4H4KC 3TX0A 3C16A 1IJFB 2BJ3A 3V6DB 2O67A 2NYIA 3KJQB 3NY0A 1KQSR 2XSFA 1VQ5S 2B4VA 1FXDA 2H48B 4O23A 3A3PB 5LL6d 3LO3A 3HJFA 2XZDB 4HEA9 1FEEA 2JHEA 3F44A 2I9SA 4DX5A 4DS4A 4ED8A 1N34F 2YQ3A 3H42A 3LW5C 3MMBA 4MJKA 1S4FA 2C2KB 4WBFA 4I56A 1TZ0A 3JXOA 2DY1A 4DU8A 2RVJA 3QGPA 1TUVA 4B3MF 3Q8SB 4DV6J 4RL1A 1IQZA 3JSMB 1H98A 3OHAA 3H5UA 1UWAA 4WP9A 3KLIB 4B3SJ 3QGIA 4P2FA 3MOZA 2H3EB 4OZJA 1ZAXA 2I5JA 4UUWA 2KXHA 3CDEA 3TI0A 1NB7A 2QG9B 2HAIA 6AT1B 1KD1T 1SH3A 4KB7A 1TKTB 3NRBA 4ED1A 3J7A1 4DL4A 4OX9J 1BQXA 1R43A 2GJ2A 4NASA 4PYDA 4TXSA 4ZP9A 2HHHF 4JV5F 1IM4A 1EKSA 2ABYA 3IR6B 2MLZA 1R3NA 1W2IA 4PG4A 1TL7B 2AD9A 1NDPA 1NK6A 1XEZA 3C6UA 4RX6A 1IKYA 3X3UA 2IRUA 3DM2A 3MEEB 4LR9A 4Y2MA 2EFNA 3HHKA 3MEKA 3TZZA 1FWKA 3MPDA 5LOQA 3N4WA 1U0HA 3ENQA 2AX1A 3M8QA 4RNNA 3R8YA 3DRPA 4X65F 3VVTA 3GIRA 3MGJA 3UVJB 3R97A 2HBZB 4ECQA 1GAOA 4JP8A 2GCFA 5EWGA 2WW4A 1KOHA 4DQPA 2AYEA 3OPKA 2Z2ZA 3GZ7A 3G71S 2YWEA 3D68A 4WP3A 5DQHA 4OIXA 4YDDB 2E5HA 2C3YA 1FRMA 1U7LA 4Z37A 5DETA 5KFRA 3PR4A 3BGLA 5JVHQ 1PAUB 4NLWA 4Q7AA 3D66A 4UOGA 2RUSA 4DCJB 4ZHRB 1PSDA 4C11A 5LM7E 4K0KJ 2B9XA 3BPDA 3QMQA 1TMJA 2GNKA 4J9RA 1FXLA 5E3AA 2VFUA 3ZZUA 1RHQB 5HMWA 5L9XA 2HAFA 2G4BA 1U2FA 1PYSB 3TAQA 2GVZA 3BDPA 2D9OA 4R0EA 1FEHA 2DNYA 2DNPA 4HTIA 2Z58B 4FXWA 3G82A 4ZCLA 3THTA 5L1LA 3FJ2A 5KFEA 4A8WA 2OTJS 3E3XA 2ZH1A 2CPZA 5ETTA 1S0MA 4NLGA 1V9OA 1FKOB 4EO6A 3Q86A 1HQUA 5D78A 5HBMB 4GKJJ 2OPPA 1HI0P 4MKYA 2MQ8A 4RZRA 1NSKL 4HTJA 2NZCA 1NKEA 4F4KA 1VR6A 1LWEB 1FRXA 1UEVA 3OFEA 4A8YA 2EG1A 2GAHC 3H40A 3MXHP 3NNAA 4DR7J 4ZN3A 5IM0A 1U8SA 4U67Q 3Q22A 1OO0B 3MM9A 4WTYA 5EHHA 4OHZA 1CJVB 4P52A 4NLTA 4WTOB 3FFIA 1GNKA 2CJYB 2ROGA 3CDWA 1HR0J 2R2RA 1GT8A 3DCAA 4H4MB 3SQGB 3NNHA 2IFXA 1JXEA 2WSEC 3AODA 2CDRB 3HD2A 2ZM6F 4MKAA 1P1TA 2QO3A 1OPZA 1YRUA 3M2VA 2P6SA 4IRCA 1KNZA 2MSTA 1TK0A 3BS9A 5C25A 2ZEJA 3GR0A 3R7BB 1DTQB 4HR2A 4MMOA 4UOCA 4CM2A 1FRLA 1S6OA 1T9YA 2DT9A 2IVYA 4OYPA 3VALA 1S0NA 3UWTA 3MM9B 2JZ5A 3TOQA 3DLKA 3R6LB 1RCOB 3GCWP 2Z2LA 4A8OA 4AXJA 2XYGB 3PIOQ 2HBRB 5D3GB 4LF4J 2F3JA 3FRYA 2QL5B 2R7QA 5THWA 3OSPA 1LWEA 2YWWA 3DYAB 1D9DA 2MQMA 3MF5A 4M5HA 3R5GA 4I1TA 5H1SV 4CYUB 2B9EA 4BLGA 3BH6B 3GP9A 3DLEA 4OHXA 5KFAA 1S1WB 4GRSA 1RYSA 4RWWA 3TVYA 3GPAA 1SQFA 1TELA 2CQBA 4TYAA 4ED0A 4NA2A 2GGPB 3W8PA 2YBVA 5LMNJ 1EQ0A 1LK7A 1Q79A 1SBRA 4LIRA 3J7YU 2HHWA 5F0UA 1T9WA 2LEPA 1RKJA 3C14A 4GVBB 4NLQA 3TVZA 2B8PA 2ZM6J 1YTYA 2L9DA 3D1OA 2M70A 2ZOMA 2JSXA 3AB2B 4QBUA 1SH0A 4X62F 2BR0A 1KSPA 5KFLA 2HQFA 3TUZC 5KFJA 4OHYA 1FVQA 3BF4A 1O5JA 2UP1A 4F2SA 1X4AA 3C14B 4GVBA 3BKFA 3UDCA 5DDQC 4YR2A 2EFVA 1RI7A 2BRKA 3KNGA 1X0PA 1S9FA 1KVKA 3DLJA 3TJAA 5D0EA 3IBCB 1FDNA 3OUYB 3OW2R 5A2QU 4LFAF 2O01C 4HKQA 1Q7YT 2RF2A 1FE0A 1M0SA 2ZE2A 4DN9A 3KK2B 2ATLA 2BJDA 4CWBA 3JQJA 4IUFA 3ITHB 5KG2A 1FD8A 1WKKA 3I55S 4U96A 2C2ZB 3V6KA 2XLIA 1S4EA 2YKOA 1WC5A 3DRXA 3IM8A 3MPYA 5M2PA 3GSIA 3WQPA 1YITS 2OJ3A 4C8KA 2CPXA 4JI7J 1HW8A 1U48A 3DRPB 4YHHJ 2JRSA 1WELA 2CYYA 2J6SA 1Q5YA 3EPGA 1RACB 4DR2J 1C0UB 2HWIA 3ILIA 2UXDJ 3HMJG 4KY3A 1UTAA 5HN0A 4F02A 3QLHA 1NBEB 2KZZA 3MMCA 4KE5A 3M6VA 3OVBA 2AHOB 3THVA 4USTA 2NXCA 3VZHA 2B8QA 3QO9B 2NS1B 1VBYA 3PR5B 3TARA 2Y3YA 2R4FA 4JI6J 1NHVA 1HHQA 1YJNS 2WBRA 5I4MA 1SVDA 1RISA 5IV4A 4ANDA 1NK5A 1IR0A 3VGSA 4JI5F 3OHBA 1UJ5A 5GAEU 4MKBA 3ZTQA 1ZPWX 4J9PA 1FRJA 1NO8A 4WFBQ 3SFGA 2ZNZA 3I96A 1RDRA 3AA8A 4OZ5A
chains in the Genus database with same CATH topology
4O3PA 2UVRA 5KG1A 3K5LA 2IMWP 4G1QA 4HT5A 3H59A 3KOAA 1O0PA 1NK9A 4DFKA 4OI6A 2DCLA 1XR5A 2XY7A 4AUKA 1QUPA 4DSFA 3IG1A 5I42A 2OIHA 1KN6A 2HNDA 3UCGA 2J7KA 1T7PA 4LSNB 3N79A 4K4ZA 1JJHA 4YOEA 2BRLA 2FVSA 4HHJA 2FVQA 3M4XA 5J1PA 3LP1A 3CMAS 4N56A 1HNZF 1YVFA 2IRYA 3JTNA 4ZLPA 4DUZF 1NK7A 2DVIA 1UKUA 1WF2A 5F8JA 1TV6A 1HBUB 3PX4A 1RT2A 2N7YA 2HHUA 1GX6A 2R8KA 2AQ4A 4ZKAA 2WAQD 3P5TL 1HNVB 2F7VA 4USJC 1WTBA 2BQ3A 4EBCA 3SV3A 1LWFB 1QVFR 4B3RF 4Y3CA 2QRRA 5A8KB 3IRXA 3MMAA 4YMEA 4LFBF 4F50A 2WRMA 2RQKA 3GB0A 4BWMA 1BWEA 3MURP 4WXWA 4DWIA 4ECUA 2M0GB 2EVZA 5B0GA 1CQMA 2LDIA 1WI8A 3Q8PB 3TA2A 5LXRA 2FLPA 2ADCA 4NYOA 3KLHB 2Y1RI 3IA0A 3RB3A 3RBEA 2IM0A 3JSBA 2B6AB 2FJDB 4KFBA 4QWEA 2V4QA 2RNEA 1O8BA 4I2PA 4ERDA 3M1VB 3PV8A 2XS5A 3CWJA 2JH3A 5BYSA 4LQ3A 2G13A 4KBIA 1AFJA 2QMXA 2UVVA 2FJEB 2CQPA 4J9KA 2GW8A 4I7FB 1B0PA 2DGQA 2LYVA 4F4ZA 3ENWA 3K5MA 5FLXY 1T3OA 4FF2A 2E5JA 3GV7B 3HP6A 2XY5A 3K58A 4BDPA 4CT8A 1ZM3A 3Q24A 5EN1A 2VD3A 4C0BA 3FVYA 3VAFA 1P8GA 1YJUA 2V5HG 4O4GA 2EK6A 3TVKA 5A8WA 1T3NA 3KG0A 1TL3A 3G6VA 3KLFA 2AGOA 2BOPA 3CC7S 1HWIA 3HHLA 4CO5A 5K14B 5BR8F 5L38A 2VA3A 3H2VE 4X4VA 1R8BA 2QA1A 3RR8A 3R5AA 2DGTA 4I6YA 1LFWA 2V8VA 4OX6A 2HNZA 5GADU 2A18A 5CH7B 3VAIA 2DTJA 2MQNA 5E3PA 3GIMA 3QWUA 1S9GA 2Y1JA 2JEIA 3OQ2A 3PJWA 4OX7A 5GVQA 1U1NA 2V4RA 1YIJS 2YKAA 1V6HA 2ILZA 2HGNA 2ZBCA 1RTDA 2FLNA 5CQGA 4ZA1A 2DNKA 5IT0A 4RUAA 2ZH3A 3K59A 2Z8QA 3UI3A 1HNWF 2DH9A 3CULA 3W7BA 1XBWA 3FNNA 2KXNB 4H4MA 1SIZA 3SQGA 2JWNA 4O44B 1Q78A 1N8RT 1S0VA 2R7UA 3J80Y 2VPYB 2W4DA 5A6WA 3JB9k 2RU3A 4GKKF 3JTPA 1C1CB 1YSJA 2IBOA 5CYJA 5E3CA 2NUHA 2ASLA 4GC6A 4FS2A 4IR9A 3BM7A 4K5SA 2EBGA 4KKOB 2PD1A 1VI7A 4ETXA 2P6TA 3PM9A 1ZH5A 2J9DE 1M5VC 1F5BA 4WFXA 3VWSA 3CVKA 5DO2A 2MZSA 1HQEB 1SC6A 2E44A 1DJ0A 4G1QB 4IO9Q 4O4GB 3BB5A 1X8DA 3KG4A 5GAHI 2Z4PA 1DURA 2VKRA 2HMIA 4N41A 4QYRA 1TL4A 4NXNF 4ES2A 2H5EA 2E1CA 4DLGA 1FTCA 4I4BA 1Q1KA 2C42A 3RR7A 2OMOA 2P5VA 2ZBIA 2YKMB 1N54B 2VBWA 5G0RB 2DNNA 5T7LA 2VQEF 4KQZA 3B4DA 2KM8B 1Q86T 1S10A 2D3ZA 1QTMA 2WONB 2YH0A 3UFCX 3ISND 5KFIA 2JLEA 3M32A 5IS2A 3OTBA 1HBNA 4C8NA 4YB1P 2VA2A 4FF3A 3MOJB 4O3SA 3QJPA 4QYZJ 1FXRA 4IFYB 3C46A 2IC3A 1L5UA 5M2UA 5JVGQ 2PT0A 4MFBB 3NG8A 2ZH8A 4OJGA 5IQQA 1LW2B 3M1VA 4L3NA 3DLGA 3SCIE 3OVSA 2R8IA 4ECXA 2DO4A 3D28A 4U7UK 4WYLA 2WSFC 3IS9B 5F0WA 4ZVEA 3RAMA 4F25A 4LVNP 3V5RA 1JLBA 3RW6A 2ZD1A 1S97A 1RT4B 4CTAA 1TV6B 5B0DA 3DLGB 4CO3A 1P9QC 4EO8A 4DV0F 4MFBA 2KDOA 4ILRA 4YB5A 2W9AA 2N4DA 2XZWA 2ZC3A 2KH9A 4I0WA 4X4TA 2RDIA 2X1AA 4X84A 5KFPA 4B08A 4WFZA 3HHLD 4OX9F 2FHJD 3HT3A 2LQ9A 1U09A 2I38A 1JLFA 5DQGA 3KLGA 3H25A 3WX4A 3KMQA 4B9MA 1YJWS 2UV8A 1RT7A 2XMVA 2YTCA 1M5HA 5HLFA 3MPWA 1S1UA 4L6V3 3IO1A 5F9LA 2F8HA 2YWFA 3CJ0A 3CCES 1X5TA 4RW8A 2HGMA 1RT2B 2WTFA 2BQRA 3UD3P 3B78A 2VG7A 3LAMA 1N5YB 4RNFA 2B9YA 5F8GA 3TQ1A 4AXIA 2CQDA 5IWAF 5U47A 4PG8A 3NP5A 1HBNB 4ILLA 3H20A 2LXUA 2ZC4A 4HT7A 4KO0B 2YKPA 2V9WA 1R8PA 1AROP 5GADI 1SJ4P 4ECSA 2GIQA 2C3MA 1X4DA 3HX9A 4G1IA 3BSAA 4USIA 1JLCA 1S6UA 1S0OA 3GSDA 2RQ4A 3MR6A 3E51A 1XNQF 3SV4A 4YR0A 4G6VB 4WFYA 3WC0A 1BQNB 1NZAA 4WKYA 1Y3KA 2V2KA 5EWFA 3LGNA 4JI4F 1VLYA 2HS4A 4TQRA 3FMBA 2OFHX 3EX7B 3M8RA 2YKNA 4PQUB 3TP2A 1Y7PA 2JFDA 1CG2A 2DNQA 2ZUGA 3FDSA 3OBIA 3PHEA 2N7CA 1SKSA 1VQ6S 2MY7A 3BSNA 4IOCQ 4K50A 3ZZOA 1HWLA 3IGVA 4ZCIA 3OL6A 4KKOA 1WHXA 4IDKB 1U1RA 4B3TF 3LOUA 1TAQA 2J9EA 4DQQA 2RUGA 2VBZA 4IOBA 3M6UA 3NGKA 3R27A 4DL3A 1KOOA 3BGRB 5CYQA 3PW4A 4Q0BA 3EZ5A 1HA1A 2POKA 2RF2B 3KK2A 3PW2A 2MZ1A 3MCSA 5L1KA 4FN5A 4JI8F 1WEYA 3THPA 2HNYA 3KFWX 3PJXA 2AJ4A 4RNHA 4RW7A 5C24A 5GAHU 1VBZA 2RS2A 5HROA 5A8WB 2R8JA 3R1HA 1TL3B 2CQCA 4NLDA 3F56A 2IVFB 1HBMB 4ED2A 4IH7A 3UW1A 4DG1A 4KHMA 1Q82T 2FHJA 3DRYA 2QZ8A 2W25A 4LIWA 4RW4B 5L39A 2XMMA 3POTB 1VJWA 2KXFA 2CDQA 2PO4A 4DBQA 1TL1A 1IKVA 2MJUA 1H3DA 2UXBF 3KLFB 3MM5A 3AJ1A 4R25A 5GAEI 2RDJA 1UVJA 3O1LA 4RW4A 4B02A 2VOOA 3DYAA 1TL5A 4B9TA 2XB2D 4TU9A 2HFZA 1DFDA 2LEAA 5DM6Q 3QJLA 3FQLA 2G0CA 4EEYA 1T95A 2VQFF 1QSLA 1KC8T 1S9EA 2B6AA 3BREA 5KG0A 5E41A 4J9QA 1IUJA 1WHVA 2VL1A 4B9SA 2K3KA 1YRTA 4W90B 3CJ4A 3V4IA 4KT0C 1N0VC 4EZ6A 2LEBA 2X3GA 2K7KA 4DR7F 1RTHB 4OX8A 4FYDA 1N0UA 2MHEA 3RTVA 2J5AA 2D9PA 3KK1A 2PI4A 2XNQA 5IM0B 3PX6A 2CJ9A 3QIDA 4TY8B 2CQ3A 2GQQA 4ZPBA 3OTCA 1JLGB 1HR0F 1MMNA 4LT6A 4O44A 4XO0A 4IH5A 2UUCF 3DXBA 1LWFA 4P2SA 4WE1A 2CPEA 5KFXA 3E01A 4XPCA 1MWZA 4RBTA 3W2WA 3DLHA 2XMTA 2HLUA 5B0CA 4JV2A 1X0FA 2VPXB 2FJVA 4NRUA 3CMES 4CNYA 3PW7A 3LP0A 5K8PA 3MUTP 3CJ5A 2F40A 2R2UA 4DF4A 4KAIA 2GMHA 2FJXA 4OJ1A 3OJUA 5LMNF 4DSLA 2F4VF 1GXTA 3M6WA 3MPVA 4Y6IA 2B51A 3T6BA 1I94F 3AHPA 3H4BA 1X5SA 4JI7F 1KVIA 2GQCA 3EXYA 3PRBA 4P6QA 1LKZA 4ZPDA 3HPOA 3TYTA 1JLEA