3CPWR

The structure of the antibiotic linezolid bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
81
structure length
81
Chain Sequence
SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
publication title Crystal Structure of the Oxazolidinone Antibiotic Linezolid Bound to the 50S Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 21
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2008-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3cpwR00
2I38A 1SJFA 1SJ4P 2DGVA 2RNEA 3THPA 2FC8A 2RU3A 1H2UX 5DDRC 3CF5Q 2KG0A 1NO8A 2D9OA 2RUGA 2BOPA 4FXVA 1X5SA 3H2VE 5CXTA 4C4WA 4CH0S 2CQ1A 2MZTA 2M0GB 2OTJS 2OSRA 4YOEA 1RKJA 1Q82T 1SXLA 4W92B 2MQOA 3S01A 3CTRA 4F26A 2KFYA 2MGZA 2M7SA 3MD3A 5CYJA 5LXRA 4M5DB 1U1RA 1X4GA 2DNOA 2DNLA 5DM6Q 3I55S 1HD0A 3EGNA 1FJ7A 1D8ZA 1VC0A 2DB1A 2HGMA 3CCES 3G8SA 2DGOA 4ERDA 2XS5A 1K8AT 1URNA 3B4MA 5CA5A 2MKSA 3CCLS 2CQPA 2CPJA 1WEYA 2KT5A 1QM9A 4ED5A 4IOAQ 1R8HA 1WI6A 1DHMA 2DISA 1B7FA 4CQ1A 2MXYA 3MUVP 3P3DA 1BY9A 1VC5A 4C7QA 1X0FA 2MKKA 5LJ5Y 1S79A 2NLWA 3G6ES 2ADCA 2CQGA 3BS9A 3NNCA 2MQPA 4TU7A 1KOOA 4IO9Q 3VALA 1DZ5A 5JVGQ 2DNHA 1WHWA 2GO9A 2DHXA 2DHAA 2RS2A 3PIPQ 1VQMS 1M5OC 1WEZA 3G71S 4PKDB 5JVHQ 3CD6S 2Q79A 1WEXA 1PGZA 4FXWA 5HO4A 1X4FA 3IRWP 3CMAS 3BO2A 3UCGA 2CPXA 3UE2A 2M88A 2E5GA 1Q86T 3CXCR 2LEAA 2OIHA 2MMYA 4LMZA 2DNGA 2DK2A 1U1LA 2HYIB 4TU8A 3P5TL 2F3JA 2CQDA 1JMTA 3LPYA 3MXHP 2MB0B 3Q2TC 1X5OA 3VF0B 4W90B 4OZ1A 2RVJA 2A3JA 4P6QA 3VAIA 4WFNQ 2RT3A 3VAHA 2EK6A 1VQ7S 2DNKA 2XNQA 2CPYA 2YH0A 5ITHA 2J0QD 1WELA 3BO4A 1M90T 3Q2SC 2M52A 2LXIA 5LXYA 1VBZA 1YJNS 2MHNA 4IUFA 1JJ4A 1X5TA 3RW7A 2XB2D 1YJWS 1YIJS 3TYTA 2K8GA 4CH1A 3BEGB 2KG1A 4IOCQ 1KD1T 3UD4P 1WI8A 3MDFA 4CIOA 4F02A 2KM8C 1NU4A 3SXLA 5EN1A 1FJCA 5GAHU 1N54B 1UFWA 2X1GA 2MQQA 2YTCA 4TLQA 1WF2A 2ZJPQ 1WG1A 3THTA 3HHNB 1K9MT 1NJIT 2LKZA 5DM7Q 2MZJA 3IWNC 3S7RA 2X1BA 5IFMA 1SJQA 4Y0FA 1DRZA 1WF0A 1WHVA 2I2YA 2MZQA 4Z2XA 3SDEA 4TU9A 4PRFA 3BO3A 2OJ3A 2M70A 1M5KC 1VQ4S 1HD1A 2M9KA 2XS2A 2DGWA 4BS2A 3SMZA 1SJRA 2VODA 2KM8B 2HGLA 3HI9A 1M5VC 1F9FA 1WF1A 2LCWA 3CUNA 2QFJA 1YJ9S 1HL6A 1D9AA 2MZSA 2MGZB 2YH1A 2CPZA 3SDEB 3V4MA 4F25A 1M1KT 1RK8A 3UCUP 2OSQA 2LECA 1U6FA 2U1AA 1UP1A 2MKJA 2KXHA 2J8AA 2GHPA 2DNQA 4RU2A 3S8SA 2E5HA 4J5OA 3CCQS 2J76E 1P27B 1YWXA 2G0CA 3CMES 2RRAA 2CQ3A 2QEXS 1WG5A 2X1FA 2JX2A 1KOHA 2LA6A 2KHCA 2XNRA 1X4AA 2E5JA 1WWHA 1U1NA 1YITS 4UY8T 2MQLA 1FHTA 3CC7S 4Y00A 3NS6A 1VBYA 1OIAA 1DBDA 2LEBA 1UAWA 4LJMA 3CPWR 1VC6A 4WCEQ 4QPTA 1ZH5A 1X4HA 2QA4S 2PEHA 2CPEA 2O3DA 3RW6A 1VQLS 5LJ3Y 2LYVA 3FEYB 3MUMP 3TP2A 5IM0A 1A9NB 1U2FA 1VQOS 1K73T 2HGNA 5GVQA 3ULHA 1IQTA 2D3OR 2CQ2A 3CCUS 3NMRA 2U2FA 5GMKa 3G4SS 1VQPS 2KN4A 3LQVA 2D9PA 2KU7A 2MZRA 1XN9A 4WFBQ 2K3KA 2HVZA 1FNXH 2CQHA 2XSFA 2KRBA 2X1AA 1KQSR 2LQ5A 1FJEB 1S72S 5IM0B 1YTYA 1N52B 3MURP 1VQKS 2MSSA 1OO0B 1X4CA 1OPIA 4C0OC 2G4BA 3P49B 1H6KX 2DH7A 1YI2S 1KC8T 3G96A 1OWXA 1PO6A 3VAGA 2AYBA 2B0GA 2BZ2A 1A7GE 2FPHX 4OZ0A 1X4EA 2N82B 2RS8A 2N3OA 2DIVA 3UCZP 2L9WA 2F9DA 2MZ1A 3R1HA 4WF9Q 1UW4A 2JVRA 3ZZZA 2DH8A 2M4MA 1M5PC 2KRRA 2DNNA 1ZZNA 1FT8A 3CULA 1VQNS 4YUDA 3CCMS 2DH9A 3MD1A 5DDOC 3S6EA 2MJNA 2JRSA 3OW2R 2YWKA 1U6BA 2KXNB 5FJ4A 3EGZA 3UD3P 2DHGA 5GADU 1Q81T 3P6YC 2E44A 2DGXA 1FXLA 2MJUA 1L3KA 4QU7A 2G1DA 3H2UB 2CPHA 2M8HA 2MQMA 1U1PA 1CVJA 2LXUA 3R27A 2ZJRQ 2ZJQQ 2PE8A 2MYFA 2YKAA 2KYXA 4WIIA 2FHOB 5MLCV 5BJRA 1W2BR 3U1LA 3CCVS 2MQNA 3TO8A 2JVOA 2FY1A 2MSTA 5HL7Q 1WHYA 3CCJS 2MPUA 1ZZFA 4YB1P 2MKHA 3I56S 2EVZA 2DNPA 2VONA 1X4BA 2DO4A 3JB9k 3VAFA 2DHSA 2KXFA 2DNYA 2M8DB 2DNRA 2AD9A 1VBXA 2XS7A 2VOOA 2DGSA 1VQ5S 1WHXA 3G9CA 1JJ2R 5D78A 1VQ6S 4A8XA 5GAGU 5DDPC 3NS5A 4WFAQ 2CQCA 2AYGA 3EX7B 3VAJA 2SXLA 2MKIA 2M2BA 2OTLS 3CCSS 1QVGR 2F9JA 5DETA 3DLLQ 4WKRA 2DNMA 1H2VZ 4LIRA 2ERRA 2L08A 2CPDA 2WBRA 1WG4A 1U1MA 5LSOA 2MY7A 1YHQS 1SJ3P 1HA1A 2DIUA 2KH9A 3ZZYA 3FEXB 4EGLA 1VQ8S 2DGQA 2FC9A 2HZCA 2LA4A 5H1SV 3K0JA 3US5A 3MOJB 1U1KA 1R8PA 2CQIA 2N7CA 3B4DA 3N9UC 2CQ0A 2CJKA 1U1QA 3CC2S 2DNZA 5D77A 4QU6A 2VOPA 4U67Q 3MUTP 3D2WA 3CCRS 2CQ4A 3L3CA 3CC4S 1U1OA 4ZKAA 2CQBA 1G2EA 2NZ4A 2N3LA 3DXBA 2L41A 1FO1A 2DITA 2KI2A 2MKCA 4QQBA 2RQCA 3U1MA 1QVFR 2ADBA 2CPIA 2AYEA 2CPFA 1VQ9S 2V94A 4V19X 2RQ4A 1AUDA 1X4DA 3VAMA 2J0SD 5IQQA 3MI7X 3VAKA 2DGUA 3UWTA 1N8RT 3J7YU 2MY8A 1H2TZ 3J7ZT 2KVIA 5GAEU 3NNHA 3R1LA 1P1TA 1O0PA 4UQTA 2RRBA 3PIOQ 2UP1A 2DO0A 5DDQC 2JWNA 5LSLA 2E5IA 3NNAA 1JJHA 2LMIA 1WTBA 3G8TA 1Q7YT 2AYMA 1N88A 4PR6A 1X5PA 2EK1A 2DGTA
chains in the Genus database with same CATH superfamily
4C9DA 4EBCA 5HJXA 3MEDA 3MMBB 3KTQA 3PR4A 1H2UX 1V3ZA 3AOAA 3GJRB 4JI3J 2KG0A 1RGVA 2D74B 2UVUA 3OLAA 1XIQA 4JI5F 4C4WA 2QL5B 2RQKA 1RA6A 1RWPB 4FVMA 4F26A 4F2RA 2HQFA 5THWA 1ZAVA 3N28A 2DGOA 1NSKL 1RHMB 2HIQA 1URNA 3W65A 2W25A 4O4RA 1HQEB 4PPZA 1R6YA 3PYFA 4HH1A 4PWWA 3QIPB 1KDNA 1QE1B 4RR5A 1VJWA 2JH3A 4RW6B 1KOOA 4QW9A 1LW0A 2Z2LA 2DHAA 3M30A 1WOSA 1M5OC 3NAIA 2J8SA 1IWAA 2LFVA 2YX7A 4LQ9A 2HBQB 2IHR1 2FLOA 4M8LA 2BEFA 1Q95G 4JI8J 5HMYA 1CPZA 1UPMB 1MMLA 4RUHA 4NMXA 3F44A 3KLIB 5BYRA 2F3JA 2CQDA 3BYRA 3UQSA 1VQ7S 5L1KA 1JLQB 2HNYB 1F3FA 1LWFB 1HNIA 4JV5J 2I5JB 4OYXA 5B7WA 3N5FA 4LSLB 2XMVA 4URQU 1XERA 4H4OB 3M1VA 2NUHA 4I7FA 2UUBF 3EZOA 4O3PA 2HS3A 2FLLA 1DTTB 2BQUA 3BO3A 2DEIA 1ZETA 2E1CA 1NJZA 2IC3A 1S57A 1V5VA 5HK4A 4F50A 4J9QA 5DG8A 1Y3JA 2QFJA 2MGZB 3SV3A 3UPFA 2Z57B 4RW8B 3QPIA 2QMWA 2IAJA 5AXKA 5IT4A 4NCGA 1CG2A 5AE3A 1JLAA 1WSVA 3E8OA 2F63A 1YWXA 4C8KA 2XHCA 1QTMA 1JLGB 4TYBA 3RU0A 1REVA 2G2OA 2XNRA 2MTLA 3WC2A 4LRBA 2EW9A 1FKAF 2HQDA 1WOOA 1HWJA 4F7VA 3CVKA 1TFYA 4CO4A 1U2FA 2PSZA 4OYOA 4GKJF 4U8VA 2QT7A 4K2XA 3QJLA 2KKHA 2BQRA 3FSYA 1S9EB 4NI2A 2K1RB 2L3MA 4K4ZA 3AXKA 3FZ2A 2CVIA 3NOCA 2Q6CA 2GCFA 2VZ9A 3PW4A 3ZZUA 1HLWA 2DH7A 3MM6B 1YI2S 2BZ2A 3GIKA 1PC5A 2UXCF 4ES3A 1G4CA 3WQPA 2DH8A 1VFJA 2DNNA 4WU2A 4CLWA 3NGRA 4GKKJ 3DOMB 3HX9A 1QLNA 4QU7A 2V63A 2JZ5A 3QGIA 3MAAB 2BM0A 3TO8A 4YQWA 3K58A 4M63A 5DQHA 3G9CA 3W9JA 2NXUA 3EPIA 1UA1A 3DN9A 5BYSA 4USMA 5D3GA 4RJVA 1R27B 2CG4A 5D0GA 3BKUA 1L3VA 4DL3A 2KDOA 1FKOA 3NKYA 2GVDA 4KC5A 1D8YA 5T7LA 3M9NB 5KT4A 2CQIA 2N7CA 2ZH7A 3OFHA 2WOMB 4YY3F 3EXYA 1XEZA 3CJ4A 2ABYA 4K50A 4ZKAA 3CJ3A 3FZBA 4USWA 1ZM2A 2XCAA 2QZ8A 1UL3A 2KI2A 4QQBA 4FF1A 5FIIA 4NA1A 4LRCA 3DRPA 1MU2A 3OQ2A 1V5IB 1AUDA 5KG7A 3ZZPA 1E6VA 3MPUB 2AX1A 3LWLA 3A8EA 5BR8F 1O0PA 2XZWA 3D1OA 5A76A 4C3MA 2WRMA 4LF1A 2J6SA 1WTBA 3BSNA 2GMJA 3TX0A 3A3PB 1IJFB 4A8WA 5KFBA 3DC2A 3NP5A 3OD2A 5J2PA 2V4JA 3KJVB 4CCHA 1IJEB 2PA8D 1VRUB 4FXVA 1Q53A 4K0KJ 1Z2LA 1UVNA 2HBRB 2CQ1A 4CH0S 3DMJA 2CNLB 2MQOA 1S99A 3NBPA 1AFIA 3MM8A 4PXDA 1RP5A 2KT5A 3KMQA 1TAQA 1NK5A 3MMAB 3GONA 3TI0A 2JNJA 6AT1B 5KFVA 4Q44A 1I94F 4LBIA 2RKIB 4NCAA 2ZH3A 3W1YC 2ZD1A 3GWCA 3VV2B 3D66A 2R8JA 1FTRA 3RBXA 1M5HA 2HKEA 1CJVB 2HEKA 3QZ7A 5E7OB 2A0FB 2V2ZA 3M32A 1JLFB 5RUBA 4R0EA 3CD6S 3V4IA 4IH5A 5DLFA 2OPQA 3T5KA 2AJ2A 3KLFA 1Q0NA 4Z7CA 2D41A 1AFJA 2OEKA 4NXNJ 3CDBA 2HLUA 4OJ3A 1NK6A 2HRYA 4OYBA 2HBZB 4ZVPB 2E5LJ 2YX4A 2BDPA 5DGAA 1HNZF 1NEEA 3AAWB 2JFKA 2I0XA 4B3TJ 1VGYA 1I5OB 4F4AA 4IUFA 2CNNB 2XB2D 4F02A 2NYIA 5GAHU 2FLNA 5L39A 4O4GB 2YTCA 4OI3A 3GILA 4QYRA 3HHNB 4HH0A 3M6WA 1WHVA 3MEGB 4I1TA 3I32A 1XMQF 4Q8FA 1RWVB 3H5UA 3IR6B 1SCJB 1U24A 4DS5A 3IAS9 1FFGB 4ZCKA 1ZM3A 3KLGA 3FFIA 5D6GA 4MIBA 2CJQA 2VFTA 3V4MA 1TVRB 2C3OA 3L7PA 3NRBA 1U6FA 1S1VB 4ZCLA 4R8UA 4RU2A 4MAKA 1MROA 5IC4B 5IWAF 1P27B 1CC7A 2B43A 2YQ0A 4J9VA 1TL1B 5J2MA 2BJ8A 1GMWA 4P73A 4UY8T 3LO3A 4NLRA 2OELA 3BN7A 2PDAA 4FYDA 1HHSA 4DPXA 2HGNA 4L75A 4P75A 1TZ0A 5GMKa 4XO0A 1WC1A 2CRLA 3SBMA 1FNXH 1IKWB 2LQ5A 2V50A 1YTYA 4C0OC 3J81Y 2YNGB 4A8SA 4I2PA 3C19A 4HDGA 2AYBA 2GS8A 4NCBA 1NB2A 4KSEB 2MZ1A 4WFZA 2ZH2A 1M5PC 2ZVIA 4ED4A 4YMEA 1S1TB 3P6YC 3RAMA 1XNQF 4G3IA 5HLFB 3P96A 2PE8A 1NXIA 3W63A 2YKNB 3ISND 4CLLA 2MSTA 2VG7A 3KDOA 3KLVA 5HBMB 1LQ9A 5H9FK 1JNZB 2VQFJ 3BSCA 3JYTB 1SH3A 2Y3YA 2AHOB 5MAOA 1VQ5S 4DR1F 4WZQA 1WDDA 5KFDA 3VAJA 2MKIA 2PC6A 1CULB 1F3VA 3T3FA 5FDLA 3DLLQ 4WKRA 2HPUA 3W62A 4C3LA 1NK9A 5IOLA 5LT5A 5LSOA 2JL9A 3MWBA 2M3DA 2DGQA 2HZCA 3I6PA 9ATCB 3WX8A 4F8RA 5CZXA 3D6TB 4CWBA 4PWUA 3W66A 2VOPA 4RLEA 1CS4A 3TR5A 4ZJQA 1FO1A 3QSYB 1HBUB 2CYYA 2CPIA 3IA0A 1RWKB 2IM3A 4PABA 2CPFA 1PAUB 4KO0B 4NOHA 4OYZA 4IYQA 1S1WA 1LW2A 2EXUA 1IBLJ 2VG5B 4FPIA 2DRAA 4HI2A 4JI6F 2VU5A 5HQMA 3MMCB 2QC3A 3HCXA 3C15A 3GU0A 5ETNA 1QJHA 4BHQA 5IT9Y 1AROP 2HFNA 1REGX 1HFEL 2P9CA 2HRUA 4OX9F 4EO8A 3RB6A 1KEKA 2M0GB 4PAAA 4IFYA 3AHPA 2B4VA 3T5LA 4YP3A 3HPOA 1U1RA 1JXEA 2DNOA 3SFUA 3O6QA 1JWWA 2EKYA 4ZPBA 2KL8A 1DQAA 2WVCA 4BWJA 1C4AA 1VISA 4LREA 3G6VA 1NPPA 2XO7A 3W9IA 3V81A 3KNGA 1HYSB 4F04B 3HSDA 4AYBD 2H54B 4X4SA 4TQSA 3OL6A 1KLMB 4WYWA 2MDAA 1FD8A 3K5NA 2UXCJ 2VD3A 3PJXA 1DFDA 4CYUB 4KBIA 3FBBA 3D68A 4DPTA 3FVYA 1AZSA 2FJXA 5JVHQ 1SUQA 3W64A 3RUBL 3ZNJ1 1H7XA 2Z58B 4ELVA 4ELUA 4W90B 3CJ2A 4OZ1A 8ATCB 2IIHA 1FI4A 2W7PA 1JNRB 5CD4H 4GMKA 3AFGA 3PJ9A 3DDIA 3FBFA 1E6YB 2M52A 4NLWA 1TKZB 2GIFA 2POKA 1TL7A 3RW7A 3VWSA 3THVA 3M2RB 2VDHA 2R8GA 2RB7A 4B3MF 2F4VJ 1XC9A 2OD4A 3N79A 1WI8A 2KM8C 3MPYA 4JYAJ 1I6JA 4LF7F 4KH1B 4YDXA 3MFHA 4FBTA 2RILA 2QG9B 4E0DA 1A0OB 4FVCA 5DM7Q 2BRLA 4Y0FA 3EYZA 2XM3A 5K8MA 1S0OA 5LMNF 2DGWA 2KM8B 2V2VA 9RUBA 1M5VC 1X9MA 4AL6A 3OL9A 1FDNA 3CUNA 1RT3A 4DV0J 1GTHA 1T8EA 4M95A 1L3UA 2OSQA 3TW0A 1TKXB 4IO1A 3CMES 3A1YG 4U7CA 3UDVA 4CLTA 2B9WA 1LWEA 2W1BA 2HHUA 2WAQD 4WTOB 3I82A 1S49A 4NLPA 4H54A 2APOA 1F6TA 3IG1A 3C16A 4IDKB 2P5VA 1JXLA 4HACA 4B9LA 2AF6A 3MOZA 1QSLA 2GIRA 2VB6A 1TP7A 2YKMB 2EEYA 2C2DA 2HHHJ 3N6LA 2B9YA 4F4XA 5KFIA 5KG3A 2MKYA 2JDJA 1NZ8A 1S9GB 2ZZMA 4G6VB 3HHLD 3PTWA 1RWXB 2E29A 4TNOA 1I94J 2KXNB 3LF0A 2UXDJ 3DU6A 4NLOA 2IMOA 2M8HA 1FX2A 3IRXA 2ZNYA 2ASJA 3ADAC 1NDLA 1B99A 4I2QB 3KK2B 3BGUA 4WPAA 4YB1P 1EX8A 2DO4A 3UN5A 2DPJA 4ZPAA 1SQFA 4BDPA 4QIEA 4ALZA 1RAEB 1RABB 1N5VA 2AYGA 4EK2A 2SXLA 3CJKA 2M2BA 4DV2J 3DRRA 1BE4A 3MHYA 3G86A 1WKJA 4Y2AA 1HA1A 4H4MA 1ZA1B 4KGVB 1K1SA 1U1KA 4A48A 2ZE2B 2FQQB 4YHHJ 2EI5A 4WYLA 3A8KA 5D77A 1ZM9A 4DR3F 2IDLA 3L3CA 1RCXB 2BE2B 2IVYA 1HPZA 4AT1B 4L6V3 4EYIB 2YNHA 1PC4A 1KP6A 4KGMA 1SIWB 1YX2A 3DLEB 3MGJA 4X4QA 5B0GA 5AE1A 1FKPB 2XGQA 4DG1B 1DARA 4URSA 4LFCJ 3VAMA 2BRKA 4TN2A 1W7WA 4EBEA 3UWTA 1N8RT 1SC3B 3J7YU 4LF4F 4NLDA 1ZTTA 1TFWA 4HT7A 3CDWA 2QA4G 2E5IA 5KFGA 3Q0AA 1U0HB 1GXUA 5HMZA 1T95A 5E3AA 4PG4A 2FVCA 2HG4A 2XCPA 3JTPA 3THPA 3E51A 4M5MA 3V5RA 3H5SA 3T1HJ 2VBYA 2ZH8A 2OGUA 3U02A 4I6WA 4RNOA 1NMEB 4I64A 2OTJS 1RADB 4YOEA 1MN7A 3W61A 3AXMA 4PQAA 1SXLA 2Y1RI 3H42A 2B9XA 3K5LA 5K5MA 1X7VA 2F4FA 3NL0A 5DM6Q 3HD2A 4PYDA 4PG7A 2KYZA 3MCOA 4LFAF 2I8EA 5I42A 4FKYA 4K5RA 3AY0A 2HWHA 5AXLA 2CQPA 1PCAA 4M5LA 3CCTA 2XTJP 5CYQB 2XWYA 3P3DA 1DQ9A 2GC8A 4K4UA 3ZZOA 5KAKA 3ZNUA 3GYGA 3PYGA 2DVIA 4Q0BA 2DNHA 3OJUA 4F67A 1S1XA 3BGRB 1ZPVA 1TL5A 1SKRA 3O3LA 3VCDA 2C42A 4B9UA 4KV8A 2MMYA 1RT6B 3MPWA 2PFFB 3FRYA 4NLVA 3LPYA 1FWPA 3VF0B 1V9OA 3ILJA 5ETLA 2BX6A 4FNHA 1XJWB 1ITPA 5DZ6A 2HBYB 5ITHA 4X4OA 2HK2A 2NXEA 4MIWA 2WZ1A 3CW2C 1VHFA 3TVKA 2QJ3A 1C0UA 1HR0J 2Y9HA 1N54B 2OPPB 1RAGB 3MEDB 3HKWA 1H38A 3TUZC 4FYWB 4CM2A 4QWBA 1BXNA 5J2QB 1H74A 2ZBQA 3ZC4A 3G82B 3B8HA 2YPYA 1T9TA 2YNFB 5G0RA 1HNWF 4OJ1A 4L72B 3BH7B 5C25B 3BM7A 2XLKA 1B0VA 3FDSA 2CUYA 1Q4RA 2LECA 1IKYB 4ZPVR 3MF5A 4RNNA 2GHPA 1H3DA 1WKKA 3JAMY 3MECA 2ZH9A 2IA6A 1JLCA 1KOHA 4HI1A 1IBKJ 1S7IA 1MG7A 5IQ6A 3CC7S 1KQKA 2J7KA 5F8NA 1VC6A 2AT1B 3BQ0A 3RB0A 1LK5A 4PG6A 2D3OR 4ZITA 1S6QB 5E2QA 1Q16B 5JMNA 2KRBA 1TMJA 1IM4A 2HAIA 3SYZA 2P6TA 3P49B 3G96A 3VAGA 4M5IA 4N8OA 1LXNA 3BQ2A 2AU0A 2F9DA 4BC7A 2R7WA 1IKXA 1Z1ZA 1F1BB 3JS9A 5ETTA 3TQ1A 2K7KA 4Q45A 2ILYA 4NA2A 2LQJA 1S6PA 1GQEA 2CPHA 2ZZTA 1FCAA 2LXUA 2ALZA 4DV7F 1VOMA 2C2OB 3QT8A 1SQGA 4A47A 5DG7A 4ECVA 1DTQA 2C2NA 2VBXA 4HDHA 2VONA 1IR2A 2DHSA 1XMOF 3MR7A 1VMBA 2VICA 1PBAA 2CVEA 1M5SA 2IBOA 2ATCB 4N41A 3IP0A 5DGBA 2HHSA 4AQYJ 1T9UA 4ZHRB 2R7XA 3ZXWA 4FKXA 4MK8A 4CLZA 5M2PA 1G3OA 1RTJB 2J9CA 2WVEA 3D0IE 5IC6B 3FMWA 2BJ1A 2FYXA 2YNIA 2H4WB 1QY7A 3QZ8A 3D2WA 1REVB 4NLUA 1U1OA 1C0TA 4KFBA 1G2EA 4DL0C 4EZ6A 1FDDA 1AW0A 2AYEA 1Y5LB 4Y34A 1RBLA 3QRQA 4ES2A 2NXCA 4DUZJ 4ER8A 2HMIA 4QPXA 3GCWP 3LP2B 2Y8YA 2E7XA 3RZAA 3BPDA 4NLGA 1YJUA 4OLPA 1Y10A 2DGUA 4NI2B 2D1CA 3LUYA 3PFOA 3LP1B 2AGPA 4DQPA 4RUAA 1HIYA 4LUBA 1TUWA 1RXOB 2DHHA 1X5PA 5E3RA 3J81j 3ZFVA 1SJFA 3GJQB 3G6YA 3VVUA 3D67A 3ISZA 3J7AN 2RUGA 3HFVA 1FD2A 1FJGF 3M9OB 1RT7A 4W92B 4YR0A 3CTRA 2Z2YB 2LQ9A 4RBTA 3HXMA 2HFZA 1HBOB 1TV6A 3EGNA 4ERDA 1J5EF 3HM9A 1G1XA 3M2VA 3K7RA 4ED5A 1N56A 2IJRA 1TK8A 4CQ1A 3RRGA 4NMLA 5KG6A 2GQQA 1IM6A 1JKHB 1T05A 1F5CA 3SQGA 1Q8KA 2XGPA 2HVHA 4TU7A 3KUEA 3SIPB 2CJ9A 1FKOB 5L9XA 2W24A 4UZCA 1VQMS 4TVAB 4O3QA 1ZA2B 2BW7A 5ETSA 4NZ0A 4PKDB 3CJ5A 4CO1A 3DOKB 5EWFA 2CPXA 4G1QA 4KY3A 4ANEA 1VLYA 2YWFA 2J9EA 3K2YA 3DRPB 3H5YA 1MU2B 4OYPA 1SH2A 2MB0B 3K5PA 2WSEC 4ZOSA 4MK9A 2A3JA 3DLKA 4P6QA 5A0YA 3WHIA 3DYAA 3E01A 2R7UA 1M90T 3LGNA 3T19A 5LXYA 2V34A 1XK8A 4JP8A 2BW2A 2RMLA 1AYEA 4E8UA 4KKOB 1C1BB 1GXLA 1F5AA 3TUPA 2UXBF 4CH7A 5B0DA 4KT0C 4WTYA 3RBEA 2FLPA 4P10A 1HD1A 2OJ3A 2M9KA 3HVTA 3DMJB 1HI0P 3QSIA 3J80Y 1RAJA 1T03A 4ANCA 3NBPB 4FBUA 2CZ4A 4QIFA 1UVKA 1EETB 3X1LB 1LV5A 2VL1A 2QE5A 1J5OA 4LF4J 1RUSA 3KLHA 2CQ3A 4E98A 4FS2A 3OTOJ 2R4FA 1WWHA 2LEBA 2HZVA 3MFIA 4C98A 4UTGA 1R0AA 4AUKA 4DCPB 2ZZNA 3ZTSA 5KFYA 2WHOA 3AB2B 3MZIA 1S12A 2DD8S 4DR2F 3V4IB 2ASLA 3I9V9 3NMRA 2KN4A 1JJCB 1UW9A 2CQHA 1PJ5A 2OD6A 1KFDA 3FEZA 5KFOA 2PIIA 3GTYX 1LWXA 5IXUA 2B56A 3MR3A 2IM0A 4JI7F 1V3SA 2E1RA 4IFVB 2VFVA 2VPWB 2R8IA 1YVFA 4DSJA 1ZZNA 4B08A 4DLEA 2EBGA 1EARA 2BABA 2W01A 1NK4A 2DHGA 5C7PA 1FWKA 3D6FB 4K7QA 2DY9A 4X62F 5I4MA 2ZJQQ 1VK8A 4V19J 3U1LA 1RAAB 5D4NA 3M8PB 2W7OA 1TL3A 3M6XA 2Z56B 2MPUA 2VC1A 3EVMA 3RRKA 2G2YA 4TYAA 5CYMA 2KXFA 1B7YB 1XR7A 2E1AA 1VBXA 2AQ4A 5GADI 4WWSA 3CJQA 3CJTA 1H7WA 3CCSS 3B82A 4WXOA 3FFIB 2FVRA 3HJVA 3MPDA 2YKPA 4Y2IA 4EGLA 4LR7A 3WDOA 4OX8A 2KFZA 2Z4PA 4L74A 2CJYB 2DCUB 1EB0A 1WUUA 1F2GA 4DL4A 4KH0B 3HSJA 5HROB 1KTQA 3IWXA 3OR1B 2H48B 3IS9A 3J7Z5 4N5SA 1FNMA 1JQGA 2MY8A 3GIMA 1HBNA 2J0WA 3QFWA 4YN3B 2ZC3A 2IVFB 5DG9A 3LAKA 2UP1A 2Q66A 1YKWA 2L9DA 3V2UC 4KHPF 2GGPB 8AT1B 4IRDA 1RT4B 2BJEA 2E1MC 1SJ4P 2RNEA 4U96A 2QA2A 3BBBA 2NQPA 1N5YA 2EC0A 2DR9A 3DFEA 2IBKA 3V6DB 3I55S 2BBEA 2BA9A 2DB1A 2YVSA 4Q2MA 2RF2A 2JHEA 2VJVA 1RB0A 2WB1D 1RT5B 1AUSL 3QMQA 2QIFA 2HWTA 4MFBA 4RW9B 1U26A 2ASYA 4ZLLA 1YZ6A 1S79A 3BS9A 3NNCA 4OZJA 1SIZA 3FCHA 2P2CB 5IT9U 4DR6J 1VR6A 5E5NA 4DDFA 3AJ2A 1R8AA 5B0EA 1EKRA 3QGGA 3UCGA 4QBUA 4USUA 3CO9A 3DLGA 1GNKA 2ZOFA 2R3VA 2P6SA 2ZBRA 1JMTA 4DCOB 4DU7A 1TL4A 1EP4A 3L9ZA 1KVKA 4ETXA 1OYDA 2L9NA 1U45A 1RI7A 3B54A 3GB0A 5L9NA 1JJ4A 1YJWS 4OI0A 4J9KA 3RYLA 2KG1A 3JQMA 3NWRA 2R8HA 1UFWA 2DR6A 4TLQA 1F60B 1SI9A 2ZJPQ 3MPVA 3T41A 3RTVA 3POTA 3RR7A 1SKSA 4PRFA 3SDEA 3O44A 1UCNA 3VQTA 1XBWA 1BGXT 1HWKA 3DGVA 4DX6A 3BYPA 3BZQA 4RZRA 2GJ2A 1ZPWX 2MZSA 2RSQA 3HMJG 3N0VA 2V68A 4LF9F 3KLEA 2EC2A 2GVZA 2U1AA 3Q8UA 4ED2A 2J8AA 2DNQA 2VG6A 5K8NA 2E5HA 2BJ7A 2B4OA 2C2MB 3KG0A 1GT8A 1N36J 1VS3A 2A2DA 3I0SA 3M6VA 2LQ8A 2LA6A 4RW4A 3C8YA 2ZDOA 1X4AA 2E5JA 2E9ZA 4AL7A 2OMLA 3PJWA 2MQLA 1FHTA 1NB7A 3NS6A 1VBYA 3OXLA 2FY8A 1J27A 4WCEQ 4GVBA 4ANDA 2LQBA 2FVPA 4USTA 5LJ3Y 2LYVA 3HF5A 2QL9B 3ULHA 4QZVB 3PEJA 4JI0J 3MTJA 4N47A 3BPSP 3W2WB 3ICLA 5CHCB 5C2CA 3OUYB 5B0BA 1Q5VA 3FCWA 1ZBTA 2OEJA 4UT4A 2B0GA 2HHPA 1PIEA 3Q8VA 1RHJB 1RTIA 2N3OA 4OHZA 2FUG9 2HNZA 3HSZA 3EDRB 5BXIA 4KYZA 3KXDA 2DH9A 3I4HX 4NA3A 3RBZA 4FPRA 3LP0A 3H90A 2QSFA 5FJ4A 3LOUA 2G1DA 1OJ4A 4DR5F 5D4LA 3KHRA 3CD5A 2C3PA 1IKVB 2AJ4A 3CCJS 2KTQA 2MKHA 2VQEJ 4P74A 3VAFA 4PWDA 2WSFC 1N34F 1KVJA 5GAGU 2FJEB 3QIDA 1X9WA 3JXOA 4FDFA 3H25A 3D7SB 5DETA 2P9EA 4O3NA 4GO5X 4NPOA 1XNRJ 3QLHA 4TY8A 3WIUA 4LBHA 2PGCA 1YLXA 1HMVB 2NUUG 4ZVFA 1ZAXA 2DNZA 4NXMF 3VR1A 2C2EA 4U67Q 3MUTP 2CQ4A 1LWEB 2ALYB 2CQBA 1CJTA 3HHDA 3ENWA 5KT2A 5F8GA 4R0JA 3SZ2A 3IG1B 4PUOA 3C16B 4I68A 2XLIA 2JEJA 3NG8A 3EE3A 3Q8YA 4HACB 1NPKA 4F36A 2J0SD 1FXDA 2BV3A 1FE4A 2FGCA 5GAEU 2FJVA 3GFXA 3R5AA 3G2XA 3BH6B 4HL9A 3MMBA 2LEPA 1FDBA 1UZDA 4RNHA 4FS1A 5A8KB 2ZC4A 4UOHA 3TX8A 3PO4A 4PR6A 2WTFA 3L4BC 2DBBA 2PT0A 1WC3A 1J2VA 2FJWA 4DQIA 4I69A 1YJ7A 1RT2B 3GLJA 4B02A 2BANA 1VHIA 1YG0A 1K1QA 3CDUA 3H2VE 1UJ5A 4M5NA 1KBRA 2VPXB 4U7UD 1ZM4A 3PV8A 4J9SA 1SV5A 2RHSB 1HQEA 4LF6F 2HGMA 4DV4J 3AA8A 1CJUB 3OTEA 4ZS6A 5IT0A 1QM9A 2XYPB 4ECYA 3MEEA 4RW6A 1DHMA 5H9FJ 2WSCC 2V9KA 2C2ZB 5ETMA 3OTCA 3DRRB 3A3OB 2R7TA 3UR3C 4RNMA 4L3NA 2YWWA 1MNEA 3VALA 3H0PA 4J9MA 4A8OA 4GC6A 1WEZA 1BHNA 4UF4A 3QYYA 2ZM6F 3KLIA 5J1EB 4X62J 2XYGB 3H8YA 2M88A 1Q86T 1RSCA 2FHJD 1KONA 3MCNA 5KFXA 1JLQA 1SPBP 5KG5A 1SC4B 2EWHA 4RW7A 2XSJA 4RBVA 1HBMB 3CCWA 2DNKA 3TA1A 3BREA 2XNQA 4OHWA 2KO1A 4R5PA 4ZP7A 4U6PA 1D0EA 1FERA 4XTTA 3VGTA 4CO2A 4H4OA 2G0IA 4RX6A 3L09A 5DQIA 3OL8A 1S97A 2HRTA 4DJBA 4USIA 2OMOA 1DTTA 3H40A 4O23A 1W25A 1DQ8A 4O0IA 4OHYA 3DRSB 3R2DJ 2R7RA 2ZKTA 4DV6J 4C8OA 5IFMA 1NH8A 3CJ0A 4RW8A 1N32F 4ES1A 4LT6A 1Z4UA 4BS2A 2UUTA 5F0UA 4X64J 4WK1A 4N56A 1LKZA 3VQSA 2YH1A 3W3SA 1HKAA 2IFXA 4DN0A 1NHKL 3FSXA 4K4YA 4EBDA 2WVDA 4F25A 4ED0A 1JLGA 2XZTB 5KT6A 1SC1B 4B3SF 2Q1LA 2KXHA 2MLYA 3M9MB 4JOUA 3TJ9A 3Q8PB 2PN6A 2YBVA 2GX8A 4B3RJ 1VI7A 1T02A 5K20B 2BE7D 3HZEA 5IV4A 2JX2A 1HNXJ 3Q8RB 2DXFA 4K4SA 2VA2A 1UVLA 1QAJA 1S9EA 5DLGA 2K1RA 1S1XB 4ZVGA 2QGFB 2VFUA 4NEZA 2OAUA 1K73T 2ZWPA 2ZEJA 1B3TA 4WZMA 1XN9A 2XSFA 4UUXA 4X66F 5LSRA 4OFZA 2BKNA 3I5CA 4KV8B 3OHAA 1U02A 4X4RA 4DZ6A 1AXQA 3Q86A 5KFPA 4DX8H 2QTWA 1YBTA 1NAQA 1VLOA 1RA7A 2FDNA 4ILLA 2ROGA 2DIVA 5LMUF 2EPIA 1NDKA 4NX9A 3FCVA 3ZZZA 4DUYJ 5AJ3J 2KRRA 3MAAA 2FGOA 3CCMS 2MLXA 4MIAA 4WFXA 2XMTA 3AA9A 4UQGA 3BDEA 2MQMA 3IM8A 2NSBA 3OPKA 4BLGA 1F9HA 3M4XA 4JB8B 4DV1J 5MLCV 2UVVA 5HL7Q 1WC6A 1WHYA 5ETPA 2DNPA 2HFSA 1UEUA 2AD9A 3H4DA 4TQRA 5KFZA 2X51A 1IR1A 3AOBA 4QIVA 2DNMA 4QIWD 1PJ6A 2IRXA 4JI1J 3ILOA 4WP8A 2O66A 1G7CB 2WOMA 4KTQA 2BJ9A 2VH7A 3UVJB 3K0JA 3MOJB 2A6MA 4DV3J 4DV5F 5EHHA 4NWBA 1JLEB 3PW7A 4N8NA 1FK9B 4C8MA 3HP6A 3I31A 1N4LA 4C0HA 3KK1A 3SV4A 3DXBA 5CZVA 4V1Ak 1Y11A 2RQCA 2ZUGA 4RPFA 2UV8G 5LOQA 3A3NB 2F1FA 3BJYA 4ZVQB 3MI7X 1TQLA 1Q8IA 4DR4J 4J9PA 1RU2A 1S76D 4USHA 3K17A 4ZJLA 1RZMA 3PIOQ 3ELHA 2JWNA 4OMFG 5L1LA 1N33F 3KJVA 1Q7YT 2GAGC 3D54A 3CT9A 1N48A 3T9ZA 2V8PA 1VRUA 2CZVC 3OT9A 2AP6A 3R7BB 3ZZTA 4QCLA 4EUVA 4ID8A 4U95A 3BSAA 1S6PB 1TELA 2PD1A 3CD7A 2JC0A 4MKBA 4WIQA 3RBDA 4ZVRB 2B3TB 1T9VA 5A2QU 3MD3A 4MYTA 2IYIA 2D3ZA 4F4KA 3PZPA 1LWCA 4AE5A 3UW1A 3HK2A 2AW0A 2RKIA 5IS2A 4H4KC 3ET6A 4KB7A 4CLPA 1WI6A 2BOAA 4LF5J 3K59A 5F3TA 2VPZB 3IBCB 2Z2ZA 1X0FA 5I3UB 2CQGA 4OZNA 2CADA 3TRGA 2GHVC 1ZYQA 2LDYA 1TKTA 4CT8A 1VJQA 3SCLE 1GK8A 3VGVA 1RBAA 1UEVA 1UETA 3F0NA 1VIXA 2XMWA 4X2BA 1C0TB 2W9CA 2HHTA 4A4JA 2HYIB 4A8MP 1JXVA 1LNQA 3GR1A 4JI2F 4Q7AA 4UZBA 4DR7J 2DXDA 1FF2A 1FRIA 3Q23A 2HMIB 2NCKL 2IM2A 2RT3A 3VAHA 4B17A 3GV5B 1CC8A 2CXEA 2YH0A 1RCOB 2KFNA 1KSPA 4O4GA 3GR0A 1S10A 1X5TA 2K8GA 1KD1T 3BGLA 3MDFA 2ZVSA 5F8LA 4J90A 3K89A 4KGXB 3MEGA 2MQQA 4KE5A 1HHTP 4LR9A 2CKWA 3CGIA 1SJQA 1S4EA 1WJ9A 1WF0A 2KJVA 2JOQA 2ZDPA 4P2FA 1JLBB 1TVRA 1RT7B 1WSRA 3PW0A 4UOCA 1AA1B 1S1VA 1GH8A 2OPRB 3KFWX 1XR6A 3M8QA 4RKUC 1NK7A 1TV6B 2QLXA 2RE1A 1CQMA 1TL1A 3M2VB 3HHKA 5F8JA 1H73A 4KAIA 2E9TA 3PR5B 1NBEB 2WONA 2CWKA 4UY85 5I3QA 2IM1A 2X1FA 1CQNA 4WFYA 3O1LA 1UAWA 3GYXB 1VRQC 3EGWB 4QPTA 2AWZA 1VQLS 2BR0A 2WBMA 2YKQA 3NAHA 4QR2A 4PXCA 4XPEA 3J80U 2MZRA 3GIIA 3GFHA 2A6OA 5IM0B 1TR0A 1X4CA 3QQCD 3MR5A 1ICEB 1WDTA 3VTIA 2N82B 4HYKA 1R3NA 1V3RA 1S1TA 3R1HA 3TARA 3MM5A 1IUJA 5HLFA 4K8RA 5A0YB 3T6JA 3R5GA 3E3XA 3DYAB 1RTHA 3MD1A 1KVIA 3A13A 3OW2R 5A8WA 2B5JB 2IY5B 1UFLA 2D3O1 2PFDA 5HBMA 1U1PA 3ENVA 2YKAA 2W2PP 3C46A 3OFGA 3C6TB 1UPPA 2BMBA 3R6GB 4XAKA 2H1YA 3AD9C 3KG4A 5JXSA 3PW2A 3LGMA 4ECRA 2C3MA 4BBYA 2OFHX 1QSSA 2VASA 1VRTB 2V5HG 4CZCA 3Q22A 4DCJB 1T03B 3L95X 1C4CA 1H2VZ 2B6AB 2VFSA 5GMDA 4DQQA 3HFKA 3CNQP 2WBRA 1FA0A 4ECUA 3UNYA 4QWCA 2HHXA 4IG3A 1UZHA 2G2ZA 5H9EK 2LA4A 1J5OB 1QAYA 2AZ1A 3N9UC 2C3UA 5J2NA 1HBUA 2YKOA 4B9TA 4QU6A 2V69A 1NLKL 3D4JA 4KO0A 1RLCL 1O8BA 4B9MA 4X4TA 1UFKA 3U1MA 4ZA1A 3R3TA 4OJHA 2VG5A 2Y1IA 2FJDB 1WTFA 1NHUA 3MMCA 2DPIA 2GMHA 3DRXA 2FTRA 4JBCA 1H2TZ 4RU9A 1UEKA 4EEYA 2DO0A 4TY9A 5L1IA 5L1JA 1DY3A 1N88A 5EDWA 4U9RA 3DM2A 3MM9B 2QMUB 2NS1B 1PYTA 4UOGA 2QYCA 3M2UB 4JI8F 3WIVA 2W7AA 1NO8A 1U6ZA 1IBMF 3D6HB 1DJ0A 1HNVA 2MZTA 4C11B 3QRRA 1Q82T 1ZAWA 5KOWA 2DR5A 3ENQA 2KHDA 3M05A 2V6AA 1TL3B 1Q8LA 1FJ7A 3JTOA 2EG2A 3GV7B 1KLMA 3CCLS 2MKSA 4ZIWA 4JV5F 5B0CA 1NKBA 1PYOB 5AXNA 2MXYA 4WKYA 4CYUA 2XO6A 4RO0A 2CFXA 5HVHA 2MKKA 2GQ2A 4YB5A 4CO5A 1GAOA 5GAGI 3LPEA 3V6JA 3TEHB 5JVGQ 1WHWA 1NKCA 5C24B 3O8WA 2GO9A 4OLOA 1CJKA 2RDDA 3ZO7A 4OX6A 2E7WA 2ASDA 1Q78A 4C8YA 3HDSA 3BGOP 2HZAA 1H0HB 1U8SA 3OHBA 2RIJA 3D28A 4MMOA 4JI5J 3NGKA 1CBKA 3HHLC 5SUHA 1E6YA 5C42A 4KGKA 4PCQA 5E33A 1WOPA 3CEDA 3NMAA 3G6XA 3H4BA 2XY6A 4RWXA 2CPYA 1HBNB 2RAQA 2G0JA 3M8RA 3IAM9 1T9XA 2EFOA 1U7LA 2BQ3A 3EZUA 3HHLB 3UD4P 2UVWA 4RUCA 3UO0A 2C2RA 1NU4A 2GZOA 2XI3A 2X1GA 2RDJA 2ZNZA 5HI7A 3QBCA 2MZJA 4GRSA 3SI8A 2DXEA 3BBFA 3HZGA 5E0OA 4QYZJ 5F8IA 1KRPA 1S7HA 3ILIA 1M5KC 3TOQA 3SMZA 1XQIA 1RTDA 3D6MB 1S0MA 3DDKA 4HKQA 4M94A 2RUSA 3KG1A 4JV2A 1FESA 3SCKE 2J0XA 5HJYA 1PSDA 3RAQA 5KFUA 3TQEA 3LWMA 1Y9OA 2VF3A 4GKKF 2RF2B 2JC1A 5K14A 3S8SA 4ED8A 4YR2A 3G87A 1CLFA 3F41A 3OSNA 3BDPA 4IDKA 1YITS 3PX4A 3KHHA 2AZ3A 3F73A 3AB4B 1BLUA 3ENAA 2QA4S 2PEHA 2H3EB 4PPDA 1A6LA 4A8QA 4DZDA 1X9SA 2YKMA 2CQ2A 4O44B 2FHJA 1WC0A 2VDIA 3HKZD 4LSNA 4UW2A 2W9BB 3TA0A 2XI2A 5HVGA 3DLGB 3I0RA 3HVAA 3W2VB 5ADZA 2UUBJ 2KB2A 2R2RA 1OO0B 1S9GA 1OPIA 1BWEA 3TAPA 1PG5B 3CJRA 1C1CB 5B0AA 2BYCA 2AKWB 2HFOA 3IM9A 3H98A 5HP1A 3OSPA 5JJBA 5A6WA 3ITHA 3NS7B 4I0WA 3EM1A 2YWKA 4I2QA 1WORA 4JI4F 2ZH1A 4HR2A 3IGVA 3KK2A 1NPRA 3B78A 4ICLB 3QO9A 4NLQA 4M5HA 1HWLA 2GV1A 4P7VA 1T7PA 1FVSA 3DRYA 2RH3A 2XS7A 4ECSA 1JX4A 3ZTQA 4NASA 3KMSA 2LVWA 2JJ4D 4GKJJ 2NPFA 2ZBCA 1CSJA 1OPZA 2ZE2A 5KFSA 1GTEA 5KOXA 3LANA 3BGFA 2DKOB 5E3QA 3NLCA 3DOLA 4K0KF 2BE2A 2CQ0A 2CJKA 2NYHA 3AD7C 1RACB 3DLEA 1SVDA 3I0SB 4RW4B 3CC4S 4DG1A 2NZ4A 1KLNA 4ZPCA 1QVFR 3TUIC 4GVBB 4WXWA 4KHRA 3LH2S 4ITSA 1BQMB 2RJZA 2WW4A 2V94A 1RAFB 5IQQA 1QAIA 1NUEA 1XWLA 3PYDA 2B7BB 3M6UA 3CE8A 1SC6A 5DDQC 3NNAA 2EFVA 1UWBA 4BC9A 2RD5C 2OUGA 1RTIB 4RUBA 3D9BA 3NXZA 3GZ7A 1AB8A 2HNZB 3DHXA 3D3BJ 3GFYA 3PHEA 2CDQA 5DDRC 4A8KA 1O51A 4N76A 2F8MA 1RAIB 5KFRA 4IOBA 2IDEA 4LR8A 3GV8B 1WKLA 5CXTA 3FK4A 2DTJA 4NXNF 3KJNB 4NRUA 4CLSA 4YY3J 3PEHA 2KZMA 4URGA 1YJRA 2IRYA 2E5LF 1NNDA 1UVMA 3CCES 4PWDB 4B3TF 3SSQA 2HQIA 1D09B 3A8JA 2W4PA 1VC5A 3BGRA 2AIRB 2JSXA 2NLWA 1UVIA 2G1HA 4Y6IA 2ADCA 1YBUA 2MQPA 5BR8J 1EHWA 4ETZA 4A8FA 2GW8A 1M0SA 1RT6A 3G71S 1RWWB 5HO4A 1MWQA 2HIYA 3W5XA 3UE2A 4B3OB 3CXCR 4MH8A 2DK2A 1BC6A 1M1HA 1WACA 4QR1A 5A6PA 4TU8A 4D3GA 2VA3A 1N6QB 3P5TL 3JSMB 4CDIA 4Y65A 1IBCB 4ZVUB 3MM7B 2EK6A 3W8PA 4LRDA 3AD8C 5D4OA 2GJIA 5HN0A 2J0QD 2OPPA 2AMCB 1NRKA 1X0PA 1NSPA 5J2QA 5M2UA 3G82A 3DDNA 2VV5A 4CIOA 3RB3A 2Z8QA 2B4PA 3SXLA 4OZ2A 1FJCA 1R8CA 3C6UA 4PXEA 2YNFA 2HVDA 5C25A 3QJJA 2BANB 2MZQA 3D0GE 4Z2XA 2G9OA 3GIRA 3AQPA 2H9ZA 2XS2A 1IKYA 1RBOB 5KTQA 4ECXA 1VDHA 1SV5B 2VBZA 1CEZA 3RB4A 4ENOA 2GAHC 3JTNA 1UP1A 3DNCA 5KFJA 4AXJA 3MEEB 1N5QA 4DU8A 3D1HA 3BQ1A 3AH6A 3R5DA 1SBRA 1NZAA 1MSWD 2VQFF 1HNZJ 1S6QA 4U7UK 2XLJA 1FTCA 1KWMA 4X65F 2OO4A 4NEYA 1ZH5A 3GJSB 4K2JA 3FEYB 1MWYA 2XULA 1IBMJ 4AFFA 2U2FA 3CIMA 1TAUA 2KU7A 4WFBQ 3TNVA 4OYIA 3OR2B 2QMXA 2N4CA 2XMMA 4XPCA 5T14A 1RHRB 2AEJA 1KC8T 1PO6A 1XMQJ 1WC5A 1KHWA 4QW8A 4RW7B 4WF9Q 1P6TA 1UW4A 2XSJB 2M4MA 1R6VA 4ZP6A 4R5PB 5AXMA 2R7OA 2MJNA 1NH7A 3QNWB 5DZ7A 5K8OA 2CZ9A 2MJUA 2V8HA 5IWAJ 3OLBA 2KYXA 2FHOB 3RGIA 2CG8A 2FHKA 3C14B 1W2BR 2ZUAA 3IR7B 1IBLF 1OYEA 4K5SA 2FIUA 3I56S 2WK4A 1EQMA 2DNYA 2M8DB 3E2EA 5KFNA 4ZHRA 1JJ2R 2H5JB 4FZVA 2QSWA 1RTJA 2YPZA 1MMDA 1GX5A 5B08A 3QAEA 2IPOB 2Z30B 1T3OA 4DL7A 2KT3A 3AJDA 2H5EA 1VQSA 1FXRA 1PILA 2A2CA 1RAOA 5U47A 2XBPA 3JSRA 3FSIA 2FVSA 3N01A 4F0MA 1HQ2A 2W4DA 3PVXA 1L3TA 2FZKB 4LVOP 4EFAC 2W2OP 3H20A 3GCXP 2DITA 3LP2A 1XNQJ 2FJBB 2BVZA 1I3OB 1YGYA 3MEKA 3LGHA 5HATA 2NXJA 1U25A 3LP1A 4C6AA 3FGVA 4NLYA 5C5JA 2BACA 3NNHA 4ZPWR 4F0HA 2PEBA 2IMWP 2MQ8A 4DR1J 3HSGA 1D9FA 4ZLNA 3FRZA 1FEEA 4Q43A 4C8NA 3QT5A 1L5UA 4ZVOB 4PEOA 5A8RA 3CF5Q 1HQUA 3M8YA 4FNIA 4MKVA 1U8WA 1HBOA 4FYVB 5FLXY 4DOZA 3AODA 1S1UA 4C97A 3QFHA 2A10A 3EWGA 2DNLA 2XMJA 2VIHA 4DWIA 2ZH5A 1OSCA 3G8SA 1JKHA 3QJPA 2RQMA 1FDAA 2F4VF 1R8HA 2V9WA 1B7FA 2DCLA 4JYAF 3MAHA 3EZ5A 1BY9A 4ELTA 1ZTWA 4DPWA 3D0HE 2KJWA 3CB4A 4JI6J 4IO9Q 1B0PA 3DOKA 4LRAA 4KPYA 1TK0A 1PKUA 2Y0SD 2JEGA 4PG8A 4JI4J 4Q8EA 3NWGA 3IRWP 4DV0F 1LW0B 4XIUA 2E5GA 4B9VA 3KK1B 3M30B 2DNGA 2Z0GA 2NXNA 4KHMA 5D15A 3HVRA 4F4ZA 4OX9J 2F65A 4K59A 4L3KA 1NSAA 2XY7A 1T9WA 4PQUA 4J9OA 2OI2A 2A1BA 4YB7A 4KKOA 1C1BA 1U2RA 5KFKA 4JV1A 3Q2SC 2KZZA 1RYSA 4DF4A 1YJNS 2J6TA 3ETMA 3PHTA 4LF8F 1OSDA 1QUVA 1FEHA 1U09A 2HHWA 1HNIB 1K9MT 2LKZA 2V4QA 4DS4A 2DRBA 2HHHF 2XMUA 5EX0A 4HTIA 3M1VB 2VODA 1EETA 2HGLA 4ECTA 2CIMA 4I7FB 3CSKA 4X4UA 4QWAA 5GAHI 4NE9C 5SZTA 1LWCB 2I6WA 2IC3B 4OQJA 2ZBIA 4NYZA 3ET6B 2UXDF 3PCOB 4LQ3A 3TJ8A 4ZLJA 4P71A 3KNAA 3KJFB 2IAJB 3UDEA 4NCGB 5F41A 1JLAB 2OP5A 2QN6B 5KT7A 2QA1A 3HJFA 2NR0A 4B3MJ 1TKTB 3J7A1 1LK7A 1VQOS 5DS7A 4FF4A 1B70B 4LF7J 3CCUS 4DV2F 1VQPS 5K8PA 5A2QY 2X1AA 3GSIA 2W9CB 4IFVA 5CCLA 2HHVA 3R6LB 1K0VA 2LDIA 2W2MP 1TUVA 1OWXA 4KR0B 4KGZB 5LMNJ 3GMGA 4YHHF 3ZTRA 3UCZP 2RRNA 5DDOC 1U6BA 3HHEA 3M8PA 1Q81T 5L38A 1FXLA 4CI0B 2BUNA 3TUJC 3R27A 2ZH6A 1K0TA 4LFCF 4M5GA 1KQGB 3IBFB 4EMDA 1S48A 3KK3A 2QLJB 1O6XA 2QX0A 2DNRA 4RWWA 2VOOA 1N5SA 3W9HA 1RTZA 4A8XA 4NYOA 3B6BA 3OTDA 2CQCA 4TLRA 1PAEX 3V6HA 2E66A 3M8QB 2R7QA 2CPDA 4DBQA 2V8DA 2MY7A 2DIUA 3T1HF 3FEXB 5D3GB 1SL0A 4YFUA 3KOAA 2WONB 4KQZA 5HROA 2GVDB 1YRUA 5CABA 3TZWA 5T7LB 3OR1A 2R9LA 3UFCX 2CJBA 3T1AA 1VCTA 3HT3A 3VGSA 2V2QA 2CJXB 3NGTA 2XQCA 4O3SA 3P45B 4OHXA 1YRTA 2GO8A 4FP9A 2F8HA 2PMZD 1P1TA 2GGPA 4N7TA 1RT4A 1FRJA 3DI6A 1RE1B 2RHQB 1E6VB 4IG0A 2V0NA 4DFKA 2DGTA 2I38A 3R7NB 5F3ZA 3L7OA 5KFFA 2PO4A 3MM5B 2YQ3A 1RTHB 2B4UA 1ELOA 5AT1B 2PI5A 5A8WB 3V6DA 2ZHOA 1NJWA 2B7CB 1X5SA 4F3QA 5J2PB 4UUWA 2V4JB 1HHQA 4P72A 4W98A 3H7HB 4X65J 5KFCA 3S01A 3FQLA 5LXRA 4DR3J 1YJTA 4J9RA 1RT5A 2VKRA 1OS5A 4PYAA 1GFWB 1QSYA 3PXGa 2R7SA 3N6MA 4RW9A 4DHVA 3IWLA 3M7VA 2W2QP 1HR0F 3OTBA 3MM8B 4C7QA 2ZH4A 4ZN1A 1NDPA 3G6ES 2EFQA 3QWUA 1V6HA 4IG3B 3BBCA 4OV6A 1RKIA 4CO3A 2KT2A 1HWIA 2W9AA 5J2NB 2ZD1B 1PGZA 3SEOA 2J7WA 1X4FA 3BO2A 1KS2A 2AGQA 3SQOP 2OIHA 4LMZA 3M32B 4TXSA 3HVWA 4LF2A 3AQOA 3P8BB 2OPQB 2ZHBA 3MXHP 5KFAA 4JUZA 3IMQJ 2W8KA 3KLFB 3MCSA 4F0KA 4A46A 1IQZA 1IBKF 1U2CA 2J9DA 1B4SA 1HW8A 4LFAJ 1X60A 1VBZA 2LU1A 5ETKA 3TYTA 3HO1A 1YSJA 1Z2ZA 1NK8A 4IOCQ 4DXLA 3K5OA 5HQ8A 1HARA 3DM2B 2J9DE 4IR9A 4J37A 2QV6A 3GQCA 1WF2A 3CO0P 2XYHB 4NRTA 3WX4A 3LTOA 3S7RA 3NCRA 3DKDA 3I9ZA 1HNVB 2XHWA 1F9FA 2XMKA 1YJ9S 3BV8A 3EICA 5HSPA 1RT1A 2Y8WA 1TU0B 1MN9A 1Y7PA 2C3YA 2MKJA 2HNDA 3R5BA 4J5OA 3KLGB 2J76E 3IGNA 1RWOB 1DLOA 2PMWA 3PRBA 1S0VA 4R8UB 2D69A 1U1NA 1T9YA 1MROB 4Y00A 2JEIA 1FVQA 1OIAA 3FUYA 3CPWR 3CIZA 3I87A 2UZAA 2QLFB 3W2WA 3DCAA 3OUYA 5J2MB 1QAXA 3ONQA 4WP3A 1IQTA 1CJKB 1BQNA 3K8WA 5E3PA 3QGPA 4I6YA 1LFWA 3CCZA 3LQVA 3P5BP 3DLHA 3NEKA 2XEXA 4AQYF 4J9UE 3ZTPA 5KT3A 1S0NA 2PA3A 3HT0A 2JLGA 1ULRA 5C42B 3M8SA 1HNWJ 2P8IA 1KN6A 5KG4A 3IO1A 5KFEA 4I2PB 3LA0A 4CNYA 4YUDA 5T41A 2HWIA 3S6EA 4P52A 4DEZA 1IKVA 5HMWA 5GADU 2ZJRQ 1QTNB 4A8YA 4DUZF 4WIIA 3DGPA 1GX6A 5BJRA 4M5DA 2PI4A 3T9NA 3BSOA 4DL6A 4RL1A 2HHQA 2OH2A 1Y5NB 1UJ4A 2VG7B 5KFLA 2O67A 1RTDB 3HD1A 2ZOMA 3U27A 1HMVA 5E3CA 2Y0BB 4Y28C 3TAMA 1IVZA 1YZ7A 4C3KA 1U1MA 2ZKUA 5FD1A 4LFBF 4ZLPA 2KH9A 2ZWOA 2VKZG 1VQ8S 3A4TA 5FDLB 5K14B 5KFMA 4XDDA 2IJNA 1U1QA 2GQCA 2LXFA 2VC0A 4DI6A 4LF8J 4TKTA 5EGYA 5CCMA 1FE0A 4CLFA 2M5YA 3TJAA 5D4PA 2YXLA 2ZFHA 2GHWA 2AJ0A 1CS4B 1VQ9S 1PBUA 1RHUB 4DV7J 1X31C 5C2GA 2RQ4A 3R7SB 1FFSB 1OY8A 3FNNA 1XR5A 4GVLA 5A8KA 3VAKA 4LSNB 1GMVA 2NSCA 3I0RB 4YDDB 3ZTOA 5B0FA 3R1LA 4OI1A 1XMOJ 4ILRA 5DRKA 5LSLA 1S1WB 3W7BA 3G8TA 1LW2B 5HAOA 5K9FA 2AYMA 1RT2A 4N77A 2IJFA 5HP1B 3ITHB 1HW9A 4ID5A 3OL7A 4EZ9A 3VHQA 1SB6A 2FC8A 3J7YI 3C15B 2GMLA 2D9OA 2BOPA 5G4DA 1S59A 2OSRA 1CJUA 4LBPA 3QO9B 3QAUA 5CD4A 4HHHA 3OXGA 3R5JB 1RQ0A 4IFYB 3TWZA 2FHMA 1K44A 5CA5A 3PM9A 1WEYA 4ZMMA 3GYNA 3QWPA 2BJ3A 3AOCA 4JV0A 2AGOA 3DLBA 3V81B 4FYYB 5J1PA 1AT1B 5J1EA 3KJQB 2V8GA 3DOLB 3FBEA 2DHXA 2C22A 5LL6d 3OXFA 4O0NA 4ZCMA 1O5JA 4NZ7A 2Q79A 1WEXA 4CTAA 3IFEA 1S9FA 5H9EJ 3MR6A 1IWGA 1ACMB 2K2PA 1HBMA 1AZSB 2HK3A 4OV1A 1SUQB 1FJGJ 3Q2TC 2MLZA 2RVJA 1X8DA 3LALA 4WE1A 3RAXA 3QRPA 5KG1A 3OTOF 4MTPA 3K57A 2EKNA 3BF4A 4WBFA 2ZITA 1UA0A 4ZPTR 2C28A 2R2SA 1J5EJ 3TEGA 4NLTA 3R5CA 1UWBB 1ZS6A 3DRSA 5BYQA 1HWUA 3WBZA 1TL7B 1UVJA 1WG1A 4J9LA 3BB5A 2Y1JA 2X1BA 1DRZA 2I2YA 1BUXA 4XDCA 2M70A 2WCXA 2R7VA 2OFGX 4OZLA 2OPSA 3I96A 3U1NA 1SKWA 1UJ6A 1DURA 1Q79A 2DT9A 5B09A 4ZDNA 2F8EX 1QDUB 1FRLA 1RT3B 7FDRA 2BM1A 1XMBA 4DF8A 2UVRA 2G0CA 1WG5A 5KFWA 5D8HB 1Q5YA 2YY3A 1YJVA 2AX0A 3BR8A 1UKUA 1NJYA 1F2HA 2CPEA 4RBUA 2BE9B 3PRVA 3FJ2A 3PW5A 2UXBJ 3TAQA 2VFRA 2HQCA 3KDNA 1KQSR 2JLFA 1S72S 4BWMA 1N52B 1VK3A 4ECWA 1SL1A 4OZ0A 4OYWA 2PMHA 2L9WA 1EJ7L 2JVRA 4QWDA 4OJGA 3VZHA 3KKFA 3A8IA 4F2SA 3NGDA 4J7CA 1ROFA 2ZHAA 2O5DA 4NYPA 4CLYA 1I1GA 3QATA 4AL5A 4EWTA 5ETOA 2MQNA 1YDLA 4ZVEA 3C6UB 1DAXA 1N0VC 2WB4A 3IRXB 3JB9k 1R31A 1VQ6S 2GA7A 3PNIA 3EX7B 1RWMB 3H2LA 1M1GA 3UVJA 4DR2J 4LIWA 2COLA 3QIPA 2DJWA 2UU9F 4LIRA 2ERRA 1NHVA 1QE1A 1LOUA 1RWNB 2UV8A 1WG4A 1JLEA 5F0WA 1FK9A 3CJKB 4Y2MA 4DMZA 4ZK7M 5H1SV 2HS4A 2C2KB 3B4DA 3WC0A 2XC9A 4JI7J 3TZXA 3TZZA 4H4MB 2B8QA 4WP9A 1NK0A 5J1NA 1KFSA 3UNGC 1FFWB 1VIOA 3OJSA 1RYRA 1OY6A 1ZOTA 2HQGA 2LLZA 3U7JA 3N4WA 4HHJA 1BD6A 4X4PA 1HPZB 2YNHB 1LFPA 2A18A 2KVIA 2E9RX 2GJFA 4G1IA 3DHWC 2HNYA 4OZ3A 4DR6F 1LWFA 3UDLA 1U4BA 1F0XA 2EK1A 2I5JA 2CA9A 3IXQA 4LSLA 5GMEA 2OHDA 4YB6A 2DGVA 3KHGA 4MKYA 1H98A 4ED6A 4DPOA 1W26A 4M5KA 1K47A 4DUTA 4MKAA 4BCAA 4FF2A 1JIHA 4ZJOA 2KFYA 2MGZA 3PG9A 4USKA 2M7SA 2Q43A 4P2MA 2HAFA 4CO0A 1Y0HA 4DL5A 5I3UA 2XS5A 4F3MA 1LEOA 2UUAF 5KG0A 1EQ0A 2CPJA 3ZZ0A 4DL2A 4OI4A 4H4KA 1WC4A 3X3UA 4PG5A 5I42B 2Z2MA 1OQ3A 5LJ5Y 3EJMA 4MJKA 3JQJA 3PY8A 2XY5A 2YQ1A 4C2MA 4KHPJ 3TVYA 1IXKA 1KHVA 3EGVA 4Q0BB 3W5ZA 4FXWA 5FLXU 1WD6A 2HSEB 2F7VA 1NSQA 1U1LA 3MM6A 3T5HA 1TK5A 3D1QA 3NGSA 3ILLA 4OI6A 2IRUA 1TMMA 1N36F 3EMTA 4C48A 3S1TA 4QYZK 3DOMA 5KT5A 3PO5A 2MHNA 2HURA 2QL7B 4B9SA 1HI8A 1VBKA 4CH1A 3BEGB 4LFBJ 2AJQA 1D1UA 5EN1A 4JI0F 3GIJA 2HFVA 2H4YB 3IC1A 1JLBA 5F9LA 4P2SA 1C0UB 5A8RB 1HQUB 2OPRA 2WW8A 5HVFA 2BKPA 2YWEA 1F5BA 3NCQA 1VQ4S 2EFPA 3SFGA 2N4DA 4R25A 4NL5A 1S1UB 2IA0A 1MWZA 2LCWA 1APSA 1D9AA 3DLJA 3OFEA 2CPZA 3Q83A 1FX4A 5G0RB 1RLDA 4DFPA 3UCUP 1VYAA 1OQ6A 4EYHB 2HLTA 3FMBA 3GSDA 3CWJA 2VJUA 4ZP8A 1B0TA 2VQEF 3BKTA 2O3DA 3MECB 1JLCB 3FKBA 2UUWA 2V2KA 5IM0A 1KR4A 5L46A 1FNOA 1TUGB 3Q24A 5ETVA 2D9PA 2K3KA 3GFZA 4OYMA 1FJEB 1XNRF 3W60A 2MSSA 2G4BA 3D3CJ 1QD1A 3DU5A 5ETRA 2LU2A 2FPHX 2R2TA 1N5TA 1X4EA 2QLWA 2RS8A 1RHQB 4HTJA 2B5JA 4PQUB 5JUMA 4EU0A 3KHLA 3MMJA 3CULA 4FN5A 1VQNS 1RU1A 4LF9J 3O2IA 3PX6A 4O3RA 1KQFB 2FZCB 3CJ8A 2G13A 1GEHA 4CM0A 3C6TA 1CVJA 1KTVA 1IKXB 2YWHA 4ILMA 4DPUA 3K8VA 1VRTA 5M2RA 1IN0A 1X4BA 2B6AA 4EO6A 1H72C 1URRA 4DSLA 1RWUA 1NCLA 5D78A 3UR0A 3PRDA 3MMAA 1DTQB 4O3OA 1QVGR 1UMJA 2R8KA 2VHGA 1YHQS 3MCMA 3ZZYA 1RISA 2QYGA 2FC9A 1R7IA 1CJVA 1EIYB 1R8PA 2K06A 2QRRA 3OVAA 3UI3A 4CLKA 3TA2A 1JLFA 3PX0A 1BQXA 5CAAA 1UTAA 2K7JA 2DEJA 2I9SA 2N3LA 2L41A 2X7IA 3KWMA 3UN2A 2UUCF 4DV4F 4S0MA 2YNIB 1JB0C 4QWEA 2N7YA 4EI2A 4CP5A 4DR5J 4ED3A 4KFBB 4ED1A 3GG1A 3JSBA 2OEMA 2DR7A 4ZCIA 4I56A 1P9YA 3MM9A 5CH7B 1JJHA 1GXTA 3M2UA 1N34J 2D3UA 3K5MA 4IH6A 4ZIVA 1YRXA 4AD6A 1S77D 3H59A 4IRKA 3TVZA 1HI1A 1P8GA 2HW3A 4C11A 4P2XA 3ISNC 4ZVHA 3N5BA 4OI2A 2RU3A 2MHEA 2VUGA 3F56A 4F4WA 2H5IB 3V6KA 1YK9A 2GFFA 4CRJA 2W4CA 2ZBPA 4NXMJ 1NM2A 4Z7YA 4NLSA 3T1YF 2HVEA 4WK3A 1HD0A 3J81U 1D8ZA 4GO7X 3KK3B 1B64A 3CDEA 3T6BA 2F5GA 3GJTB 2BKOA 4IOAQ 2EFNA 3JSYA 4ECQA 3KUHA 4MK7A 1S6OA 5C24A 3FBCA 2YWGA 2NREA 5DO2A 2RU9A 3ETOA 5F8HA 2W8LA 1PYSB 2LP4A 3C3LA 4DV6F 1YBAA 3PACA 3VGUA 2RDIA 2RS2A 4YEAA 1T05B 4C0BA 3SQGB 2P9GA 1NDCA 1S6UA 2XWXA 4X64F 4DSEA 4L73A 3NY0A 4QJVA 1T3NA 1FRXA 2GIQA 1IKWA 2K3IA 3NOGA 2B8PA 2L48A 1TKDA 1Q8BA 2YNGA 1PJ7A 3G8QA 3HFZB 4G1QB 1X5OA 4OL8A 1Y5IB 4B3RF 1RJJA 4HHUA 4LSZB 4WFNQ 2IYGA 3AJ1A 3HHLA 1HNXF 1WELA 3WZ0A 1U0SA 3BO4A 4LF6J 2EG1A 1R43A 2LXIA 2UU9J 3DLKB 1Y4ZB 3DI6B 2FD2A 4IG0B 1YQHA 4UOFA 4WJBA 2XMAA 3OV7A 3E01B 2YKNA 5D0HA 3IN5A 3THTA 3RRHA 1NJIT 4DSKA 3JYTA 3IWNC 3D5MA 4J91A 2FB0A 2AV5A 2XG8A 3Q89A 3N6NA 4QR0A 1CULA 1WF1A 1HL6A 2ZM6J 4DUYF 5AJ3F 3QT7A 4M1KA 3EPGA 3BKFA 3HVTB 5LM7E 1RK8A 5IV3A 4CT9A 4DQRA 3PKMA 1Q7LB 4OX7A 5ETQA 3BN4A 3CCQS 3VZIA 1XTZA 4DV1F 5HQLA 2RRAA 2QEXS 3I5AA 4Z37A 4JI3F 4ZP9A 3KUGA 4FYXB 1LXJA 4O44A 4LRFA 1DBDA 3L7UA 1SKUB 3KLHB 2H65B 1P1LA 2W9BA 4J9NA 4K4WA 5KFTA 3W2VA 3MUMP 1A9NB 4NZ6A 2AEMA 1C1CA 1Y00A 3G4SS 4OZ5A 4I6AA 4U8YA 1R0AB 4HVZA 4D3HA 2F40A 3I5BA 4JI1F 2C1EB 2MEWA 5IZHA 1C2PA 3MURP 1VQKS 1RDRA 1FWLA 2D7SA 4DQSA 3R9LA 3SSRA 1N32J 3PYEA 1A7GE 3EXCX 3R97A 3M8ZA 4DV3F 2HQ3A 4ZN3A 4P9SA 2UUAJ 1S4FA 4G65A 3TZYA 3LAMA 1FT8A 4ICLA 6FD1A 2CDRB 2JRSA 2DY1A 4B3SJ 2E44A 2DGXA 1L3KA 2E7VA 3SCIE 5EUHA 2B51A 4I67A 2B9EA 4RNFA 4IQMA 3CCVS 4DSFA 4DR4F 4C8LA 3IR5B 4MT1A 2IVMA 1SL2A 2V8VA 4PZVA 2WVFA 2ILZA 2I1RA 2DGSA 3VVTA 4IH7A 1QUPA 1HYSA 2HS0A 4Y3CA 4WFAQ 4KRWA 4Y2KA 4K4XA 2F9JA 5CYMB 5KG2A 3EDQB 4F4YA 4IRCA 1FRHA 1SQEA 4X66J 3O5TB 3CD0A 1RT1B 2NPIA 3M8WA 5D0RA 4DFJA 2R2UA 2HNDB 1JK9B 1BMQB 5F8MA 3UD5A 5LMUJ 3TANA 3EVOA 1DLOB 1BQMA 4HLBA 4CNZA 3W5YA 2XZDB 1R8BA 2BJDA 2OLWA 1RAHB 1MLAA 1EKSA 4Y2CA 4LF5F 1BQNB 4G1PA 3C66A 5L8RC 4GC7A 2JEFA 1KNZA 1EAYC 3J7ZT 2AJ1A 3IS9B 2RRBA 3PFEA 1TKZA 2ZOGA 3GE9A 3M2RA 2EBEA 4MYUA 1SH0A 2J6UA 3MAQA 1UWAA 1U49A 4QIGA 5GAEI 6FDRA 2KVQE 4FF3A 4DR7F 5HMXA 7AT1B 4DV5J 1RKJA 2V4RA 3HLUA 4W4MA 3DGPB 5EWGA 5CYJA 4DSIA 4M5DB 1X4GA 1P9QC 4CLUA 1VC0A 1N5YB 1G6BA 2VBWA 2FJAB 1K8AT 7FD1A 3B4MA 3RR8A 3R8YA 2JFDA 3EVWA 1TKXA 2J7UA 4OYAA 3Q8SB 2DISA 1SJ1A 3MUVP 4X4NA 3PKYA 3TAMB 3JQKA 5EWEA 1DZ5A 5KFQA 2ACYA 4B9NA 1N33J 3C2PA 4MFBB 4B3OA 1GMWD 3PIPQ 4L76A 2J5AA 1U47A 4X84A 3NGUA 4YS2A 2CNKB 4P7TA 1N6QA 3ZZRA 3OFFA 3CMAS 2VPYB 3JSMA 2NZCA 4K4TA 4AXIA 2LEAA 3MM7A 4OHVA 1N0UA 4IKAA 3QGHA 3CJSA 3R2CJ 2QLBB 3VAIA 5F9NA 3BR9A 1EZZB 4HT5A 4LVNP 1GMUA 1S5ZA 1T11A 1YIJS 3GG0A 3UDCA 1EP4B 3OVBA 4I4BA 1NJXA 3LW5C 4ID5B 5KFHA 4WU3A 1TTHB 3H5XA 2O1PA 4TU9A 2W2NP 2BXJA 1SJRA 1OMSA 1R0BG 2UUCJ 3POTB 3HI9A 4C8ZA 4YR3A 2EFGA 3SDEB 2CAJA 3OVSA 3RG6A 4DPYA 1FRKA 1M1KT 3OBIA 3AT1B 2FZGB 4JI2J 4FXDA 3MTKA 2O01C 2HVIA 3RJMB 4QOTA 2FVQA 2OKQA 1L3SA 2R42A 3KLEB 3UN3A 2GVZB 4OIXA 2CWXA 4Q5VA 1I51B 2KHCA 2VG6B 1FRMA 4USVA 3DXSX 1NKEA 4LJMA 1MW7A 1X4HA 2YX1A 3RW6A 1D3WA 1RHKB 2ROPA 4ZPDA 3OR2A 3W8GA 3TP2A 4DX7A 3P4UB 1FKPA 1R0CB 5GVQA 3T5JA 4ZVTB 2H51B 4X4VA 4CTAB 4ECZA 4KJIA 4E2FB 1W2IA 4M5JA 2HVZA 2Q3PA 4ED7A 4USJC 2Y1LB 1VQYA 3T1YJ 1H6KX 1U0HA 1IR0A 3FC9A 5D0EA 3MR2A 3FQKA 4WE1B 4DX5A 3NCPA 1MMNA 4DLGA 4IR1A 3C14A 4XK8C 4KPCA 2DYAA 2E1PA 3EGZA 3UD3P 3GP9A 3H2UB 3PDNA 5CQGA 2CNOB 2CJAA 3HULA 2MYFA 1Y3KA 1WNEA 3LP0B 2JVOA 2FY1A 4HEA9 2HFUA 1OY9A 1ZZFA 3CDAA 1U48A 2ATLA 2EVZA 2DR8A 4Q2LA 1T0TV 2ACMA 5E41A 1WHXA 3CMQA 5DDPC 3NS5A 3EUNA 4ZVSB 5CYQA 3A12A 2OTLS 2OPSB 5AE2A 2L08A 2AJFE 1SJ3P 8RUCA 4IQXA 3US5A 3KYLA 2DRDA 4F3OA 2X3GA 4ATNA 3QT6A 3CC2S 2V67A 3QLHB 4TY8B 3CCRS 4DFMA 1BWVA 2JLEA 1D9DA 5DQGA 3SCJE 4PXBA 5DJBA 3SSSA 2MKCA 5HANA 4DN9A 4NLXA 1KKHA 2ADBA 1T94A 2GNKA 1F9EB 3IBWA 2QFIA 4V19X 2QO3A 3GPAA 1X4DA 1CJTB 3Q8QB 2AEFA 1R89A 2X3DA 4K4VA 2Q6BA 5I3PA 1Q1KA 4PUOB 2WVBA 4UQTA 3JAMU 2ROEA 5EX3A 2LMIA 3I4PA 4KIAA
chains in the Genus database with same CATH topology
5HP1B 4U9RA 4C9DA 4EBCA 3DM2A 3MM9B 3ITHB 3MEDA 2NS1B 3MMBB 3ZFVA 3KTQA 3PR4A 1HW9A 4ID5A 1SJFA 2QYCA 3M2UB 3OL7A 4EZ9A 1SB6A 2FC8A 3G6YA 3J7YI 4JI8F 1H2UX 1V3ZA 3ISZA 2KG0A 2W7AA 1NO8A 1U6ZA 1RGVA 2GMLA 1IBMF 2D74B 2D9OA 2UVUA 2RUGA 2BOPA 3OLAA 4JI5F 5G4DA 1DJ0A 1FD2A 1HNVA 4C4WA 2MZTA 1FJGF 2OSRA 2RQKA 4C11B 1Q82T 3M9OB 1ZAWA 3HJFA 1RT7A 4W92B 4YR0A 5KOWA 1RA6A 3QO9B 4FVMA 3QAUA 3CTRA 4F26A 4F2RA 2DR5A 3OXGA 3ENQA 2KHDA 3M05A 2LQ9A 4RBTA 1TL3B 3HXMA 2HFZA 1HBOB 5THWA 1Q8LA 1TV6A 3EGNA 1FJ7A 1ZAVA 3N28A 1RQ0A 3JTOA 4IFYB 2FHMA 2DGOA 4ERDA 2EG2A 1J5EF 3HM9A 3GV7B 1KLMA 2HIQA 1URNA 1G1XA 5CA5A 2MKSA 3M2VA 3K7RA 3PM9A 1WEYA 3CCLS 4ED5A 2W25A 4JV5F 5B0CA 4ZMMA 4O4RA 3GYNA 1HQEB 1N56A 1TK8A 4PPZA 1NKBA 1R6YA 3QWPA 4CQ1A 5AXNA 2MXYA 4WKYA 3RRGA 4HH1A 4NMLA 5KG6A 4JV0A 2GQQA 3QIPB 2CFXA 1JKHB 2AGOA 1QE1B 1T05A 2MKKA 1F5CA 3SQGA 2GQ2A 1VJWA 4YB5A 3DLBA 2JH3A 3V81B 4CO5A 1GAOA 2XGPA 2HVHA 5GAGI 4TU7A 4RW6B 1KOOA 5J1PA 2CJ9A 1FKOB 3V6JA 5JVGQ 5J1EA 1WHWA 2V8GA 1NKCA 5C24B 3DOLB 3O8WA 4QW9A 1LW0A 2GO9A 2DHXA 2Z2LA 5L9XA 2DHAA 2W24A 5LL6d 2C22A 3M30A 3OXFA 4OLOA 1VQMS 1M5OC 3NAIA 4O3QA 4NZ0A 1O5JA 4ZCMA 4PKDB 4NZ7A 2Q79A 1WEXA 3CJ5A 2YX7A 4CTAA 4LQ9A 4OX6A 3IFEA 2E7WA 4CO1A 3DOKB 2ASDA 1Q78A 2IHR1 4C8YA 2FLOA 5EWFA 2CPXA 4M8LA 5H9EJ 1S9FA 4G1QA 3MR6A 1VLYA 3HDSA 5HMYA 1CPZA 4RUHA 1MMLA 2YWFA 2K2PA 1HBMA 1H0HB 2J9EA 3K2YA 1U8SA 3OHBA 2RIJA 3DRPB 3D28A 4MMOA 3F44A 4OV1A 3H5YA 3KLIB 3NGKA 1SUQB 5BYRA 1MU2B 2F3JA 2CQDA 1SH2A 2MB0B 3HHLC 5SUHA 1E6YA 3K5PA 2WSEC 4ZOSA 4KGKA 5C42A 3Q2TC 4MK9A 4PCQA 2RVJA 2A3JA 3DLKA 5E33A 3CEDA 4P6QA 1X8DA 3LALA 4WE1A 3RAXA 3NMAA 3G6XA 5KG1A 3H4BA 3OTOF 3UQSA 2XY6A 1VQ7S 5L1KA 5A0YA 4RWXA 1JLQB 4MTPA 2CPYA 3DYAA 3E01A 3K57A 1HBNB 3BF4A 2R7UA 1M90T 2ZITA 1UA0A 4ZPTR 3LGNA 3T19A 2C28A 2R2SA 5LXYA 2HNYB 3M8RA 3IAM9 1LWFB 1XK8A 2EFOA 1U7LA 2BQ3A 1HNIA 2BW2A 3EZUA 4NLTA 2RMLA 3R5CA 1UWBB 3DRSA 4E8UA 3HHLB 5BYQA 4KKOB 3UD4P 2UVWA 4RUCA 2I5JB 1C1BB 1GXLA 1HWUA 5B7WA 1NU4A 2C2RA 1F5AA 2XI3A 3N5FA 4LSLB 3WBZA 2XMVA 4URQU 2UXBF 2X1GA 2RDJA 4CH7A 2ZNZA 1XERA 1UVJA 5B0DA 5HI7A 4H4OB 3M1VA 1WG1A 4KT0C 4J9LA 2NUHA 4I7FA 3BB5A 2Y1JA 4WTYA 2MZJA 2UUBF 3SI8A 3HZGA 2X1BA 1DRZA 5E0OA 2HS3A 4O3PA 3RBEA 2FLLA 2FLPA 2I2YA 4QYZJ 5F8IA 1DTTB 2BQUA 4XDCA 1KRPA 1S7HA 3BO3A 2OJ3A 2M70A 1M5KC 1HD1A 2M9KA 2WCXA 1ZETA 2E1CA 3HVTA 1NJZA 3DMJB 3TOQA 2R7VA 1HI0P 3SMZA 2IC3A 2OFGX 3J80Y 4F50A 4J9QA 1RTDA 5DG8A 1S0MA 3DDKA 4HKQA 1Y3JA 1RAJA 4OZLA 4M94A 2QFJA 1T03A 3NBPB 3KG1A 2OPSA 2MGZB 3SV3A 3I96A 3UPFA 3U1NA 4JV2A 1FESA 4RW8B 1SKWA 3SCKE 1UJ6A 2J0XA 1DURA 1Q79A 2DT9A 1PSDA 2CZ4A 5KFUA 3LWMA 5B09A 3RAQA 4QIFA 1Y9OA 4ZDNA 4GKKF 1UVKA 1EETB 2RF2B 3QPIA 2F8EX 2QMWA 3X1LB 2IAJA 1LV5A 2JC1A 5AXKA 1FRLA 2VL1A 1RT3B 4NCGA 5IT4A 5K14A 2QE5A 1J5OA 3S8SA 1CG2A 7FDRA 5AE3A 1JLAA 4ED8A 2BM1A 4YR2A 3E8OA 1XMBA 4DF8A 1YWXA 3KLHA 2G0CA 2UVRA 4C8KA 2CQ3A 4E98A 4FS2A 1WG5A 1QTMA 1JLGB 5KFWA 5D8HB 1CLFA 2YY3A 4TYBA 3RU0A 1REVA 1YJVA 3F41A 3OSNA 3BDPA 2XNRA 2R4FA 1WWHA 4IDKA 3WC2A 1YITS 3PX4A 3KHHA 3F73A 2AX0A 3BR8A 2EW9A 1UKUA 2LEBA 1FKAF 3MFIA 4C98A 1HWJA 1BLUA 3AB4B 3CVKA 1R0AA 1NJYA 4AUKA 2QA4S 2PEHA 1TFYA 2CPEA 2ZZNA 4RBUA 4PPDA 1A6LA 4A8QA 4CO4A 1X9SA 2YKMA 5KFYA 1U2FA 2WHOA 3AB2B 3MZIA 2PSZA 2DD8S 3FJ2A 2CQ2A 4O44B 4GKJF 3PW5A 4DR2F 3V4IB 2FHJA 2QT7A 3I9V9 4K2XA 2ASLA 2KKHA 3QJLA 3NMRA 2KN4A 3HKZD 4LSNA 4UW2A 2BQRA 2W9BB 3FSYA 1S9EB 3TA0A 2K1RB 2XI2A 2L3MA 3TAQA 2CQHA 2VFRA 3DLGB 3I0RA 3HVAA 4K4ZA 1KQSR 3W2VB 2JLFA 2OD6A 5ADZA 3FZ2A 1S72S 2CVIA 4BWMA 1N52B 2KB2A 1KFDA 2R2RA 3FEZA 2Q6CA 1VK3A 1OO0B 1S9GA 1OPIA 2GCFA 2VZ9A 5KFOA 3PW4A 3ZZUA 2PIIA 3TAPA 1BWEA 1C1CB 2DH7A 3MM6B 4ECWA 1YI2S 5B0AA 2BYCA 1SL1A 5IXUA 2BZ2A 3GIKA 1PC5A 2B56A 4OZ0A 2IM0A 3MR3A 2HFOA 3H98A 2PMHA 4JI7F 2L9WA 2UXCF 4ES3A 1V3SA 2E1RA 4IFVB 5HP1A 3OSPA 5JJBA 5A6WA 2VFVA 2VPWB 2JVRA 3ITHA 2DH8A 4QWDA 2R8IA 4I0WA 1YVFA 1VFJA 4OJGA 4DSJA 3VZHA 2DNNA 3KKFA 4F2SA 1ZZNA 4B08A 4DLEA 4WU2A 3NGDA 1ROFA 2EBGA 2BABA 2YWKA 4I2QA 1NK4A 2DHGA 2ZHAA 2O5DA 4JI4F 4NYPA 3HX9A 2ZH1A 1QLNA 3IGVA 4QU7A 3KK2A 4X62F 3B78A 1I1GA 5I4MA 2JZ5A 2ZJQQ 4AL5A 4ICLB 1VK8A 4V19J 3QGIA 4EWTA 2BM0A 3QO9A 3U1LA 2MQNA 4NLQA 3TO8A 1HWLA 2GV1A 4YQWA 5D4NA 3M8PB 4ZVEA 4P7VA 3C6UB 2W7OA 1TL3A 3M6XA 1T7PA 2MPUA 2VC1A 1DAXA 3RRKA 3K58A 1FVSA 1N0VC 4TYAA 2WB4A 4M63A 3IRXB 3JB9k 5CYMA 2KXFA 3DRYA 1XR7A 2E1AA 2RH3A 1R31A 1VBXA 2XS7A 4ECSA 5DQHA 3G9CA 2AQ4A 5GADI 1VQ6S 1JX4A 2GA7A 2NXUA 3EPIA 3PNIA 3EX7B 1UA1A 3KMSA 2LVWA 3DN9A 3H2LA 5BYSA 2JJ4D 4LIWA 1H7WA 3CCSS 5D3GA 2NPFA 2COLA 2ZBCA 3B82A 1CSJA 3QIPA 1R27B 2CG4A 2DJWA 2UU9F 4LIRA 2ERRA 1NHVA 1QE1A 1LOUA 1OPZA 2ZE2A 4WXOA 2UV8A 1L3VA 5KFSA