3CPWR

The structure of the antibiotic linezolid bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
81
structure length
81
Chain Sequence
SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RIBOSOMAL RNA
publication title Crystal Structure of the Oxazolidinone Antibiotic Linezolid Bound to the 50S Ribosomal Subunit
pubmed doi rcsb
total genus 21
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2008-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3cpwR00
2CQ4A 2X1FA 4CH1A 2DHXA 1WHYA 3MUMP 2E5HA 3MD3A 1OO0B 1HL6A 4ZKAA 2EK1A 1VQ4S 3NMRA 2LCWA 2DNRA 3G9CA 1NO8A 2KU7A 4TLQA 1WF1A 5DDOC 3EGZA 3S7RA 2DO0A 3IWNC 1H6KX 3UCGA 3CTRA 2DH7A 4A8XA 2DISA 3MDFA 4Y0FA 2M8DB 2KRRA 1Q7YT 4U67Q 5GMKa 3PIPQ 2KXFA 3VF0B 2CQHA 5MLCV 2JX2A 2CQDA 2YWKA 5GADU 1YHQS 2YTCA 2HVZA 5LJ3Y 2CPIA 5HL7Q 1X4BA 5GAHU 2X1AA 1YWXA 3US5A 3CCUS 2M7SA 2CQ1A 2VODA 1G2EA 1FNXH 2DNMA 3SMZA 1FXLA 2RUGA 1OWXA 5GAEU 4CQ1A 3V4MA 2EVZA 3ZZZA 2QFJA 1DHMA 2OTLS 3DXBA 4FXVA 2LYVA 2KI2A 5GVQA 1YJNS 2MGZA 2E5JA 1OIAA 2MYFA 3UD3P 2CPDA 1WWHA 1WTBA 3MI7X 2KHCA 3TO8A 3K0JA 4YOEA 2DGOA 3CCJS 2F3JA 1UFWA 1N54B 1S79A 3R1LA 4FXWA 1WG5A 4PR6A 1VQPS 1YJWS 2MY8A 5JVGQ 1X4FA 1M5KC 3BO2A 1N88A 2AYBA 2DH9A 3FEXB 4LJMA 1VQMS 3P49B 2LXUA 2CPYA 3BEGB 3G71S 3ZZYA 3G6ES 2Q79A 3LPYA 4PRFA 2V94A 3SDEB 2DIVA 4M5DB 3EGNA 3CCES 1VQ9S 2MXYA 1BY9A 2MQPA 1U6FA 2ZJQQ 1YIJS 2MZ1A 2MQQA 2DNZA 3G96A 4UY8T 3EX7B 4F25A 2AD9A 3H2VE 2D9PA 5LXYA 4W92B 4YB1P 2N3OA 1ZZFA 1X4HA 1X5OA 1U6BA 2U1AA 4OZ1A 3CMES 1Q81T 3VAMA 2RT3A 3THTA 2M9KA 1VC0A 2DGQA 1M90T 3SDEA 5HO4A 1UAWA 2KM8C 3UCUP 3UD4P 4W90B 3Q2TC 2MJNA 1VBYA 4J5OA 1WEZA 1X5SA 2LMIA 2M2BA 2WBRA 3J7ZT 3NS5A 2FY1A 3MD1A 2G4BA 2CQIA 3MXHP 1WEYA 1FO1A 3THPA 3NNCA 1KD1T 3CC7S 2CQ0A 2ZJRQ 5IQQA 5CA5A 2I38A 2M8HA 2G1DA 4UQTA 2J0SD 2OSQA 4QPTA 1HD1A 2MZRA 2CJKA 1WHVA 1UW4A 1FT8A 3CCLS 1N8RT 1YJ9S 2DHSA 2MJUA 2VOPA 3CF5Q 1U1NA 4TU7A 4QQBA 1FJEB 2MB0B 2PE8A 2L41A 4F02A 1U2FA 2GO9A 2KG0A 3CC2S 1NJIT 2MQNA 2VOOA 5EN1A 2E5IA 3P5TL 2DHAA 3CXCR 1M5PC 3VAIA 1U1OA 4WIIA 2CPFA 4TU9A 3RW6A 1WF0A 3H2UB 2M0GB 2MQMA 1KC8T 3U1LA 2MKSA 2KH9A 2CPEA 2MSTA 3PIOQ 1PO6A 1N52B 2K3KA 2OJ3A 2DGUA 1SJ4P 2LEBA 5D77A 1YI2S 1K9MT 1R8HA 2MKKA 3G4SS 2MKJA 2OSRA 2EK6A 2KXHA 2MKCA 4ED5A 5BJRA 1WG4A 2FC8A 4C7QA 3BO4A 2JVRA 2ADCA 1VQNS 1H2VZ 3P6YC 2XS2A 1L3KA 4BS2A 4QU6A 2DNOA 5D78A 1NU4A 2YKAA 5DDQC 2JRSA 4C0OC 1VQOS 2DIUA 1YTYA 2GHPA 1RK8A 2DHGA 2XNRA 2HZCA 1WG1A 2SXLA 1WEXA 2MZSA 1ZH5A 3CCQS 2J8AA 2AYEA 2MHNA 1U1RA 2VONA 3VAHA 3BS9A 4EGLA 3VAKA 1VBXA 3NS6A 1X5TA 4CH0S 2M88A 2MMYA 5LJ5Y 4IOCQ 2RQ4A 1X4AA 2J0QD 3CCVS 2MKHA 3N9UC 2ADBA 1O0PA 1CVJA 3VAGA 1X5PA 2XNQA 1H2TZ 2FC9A 2I2YA 3SXLA 1A7GE 3L3CA 2LEAA 2MQOA 1WI8A 1X4GA 1WF2A 2MY7A 2JWNA 1FJ7A 2KRBA 3MURP 3VAJA 1FJCA 3MOJB 2RNEA 2CQPA 2E44A 3S01A 2RRAA 5DDRC 3I56S 2YH0A 3UWTA 2MQLA 3CD6S 5IM0B 1UP1A 2DNNA 5CXTA 3I55S 3JB9k 2KG1A 2X1GA 1DZ5A 1XN9A 2DNHA 3CCMS 2MZQA 2KYXA 2KVIA 2E5GA 4YUDA 1U1MA 1DRZA 4LMZA 5LXRA 3DLLQ 2ZJPQ 2QEXS 2BZ2A 1D8ZA 2LKZA 1Q82T 1QM9A 3RW7A 4QU7A 1JJ2R 2N3LA 1WHWA 1AUDA 2CQ3A 3B4DA 1IQTA 2ERRA 2B0GA 5IM0A 4WFNQ 2LA4A 2YH1A 1FHTA 4LIRA 1X4EA 5LSLA 1JJHA 4WFBQ 2DB1A 1OPIA 2O3DA 2D3OR 2MPUA 3CUNA 5DETA 3HHNB 2RRBA 5DM6Q 1HA1A 1U1LA 1VQ8S 2M52A 3B4MA 5CYJA 1P27B 3CMAS 2QA4S 4V19X 2HGNA 1K73T 1VQLS 2DNYA 2LECA 2KT5A 2XSFA 2PEHA 1SJQA 2CPXA 2DO4A 1M5VC 1U1KA 1W2BR 2A3JA 2KFYA 1B7FA 3TP2A 2XS7A 2D9OA 1P1TA 2DGSA 3U1MA 2DNLA 1VC5A 1D9AA 2DITA 2OTJS 1URNA 2CQBA 5FJ4A 2BOPA 2MGZB 1ZZNA 3S6EA 3G8SA 1U1PA 2RS8A 2UP1A 2F9DA 2DNKA 1VQ6S 4Y00A 1A9NB 1QVFR 2CQ2A 4IO9Q 3CC4S 2L9WA 2CQGA 3HI9A 2AYMA 2U2FA 1X0FA 2DK2A 5DM7Q 2CPZA 2DNQA 2MSSA 3P3DA 2DNGA 4WF9Q 2CQCA 1H2UX 2FHOB 2N7CA 3ULHA 3G8TA 1X4CA 2DNPA 2N82B 3TYTA 2RQCA 3VAFA 4TU8A 2M4MA 3J7YU 1K8AT 1QVGR 1R8PA 3S8SA 1JJ4A 1Q86T 2HGLA 3LQVA 1WELA 1WHXA 2F9JA 2JVOA 2LQ5A 5ITHA 4WCEQ 4P6QA 3R27A 1DBDA 2CPJA 4RU2A 4OZ0A 2X1BA 2MKIA 2XB2D 4IUFA 3UE2A 1HD0A 2RU3A 2FPHX 1M5OC 1KQSR 2KXNB 2LA6A 1VBZA 4CIOA 1S72S 1M1KT 2HGMA 3NNAA 4WFAQ 3IRWP 2KN4A 2RVJA 2DH8A 1SXLA 5DDPC 1WI6A 1SJRA 5H1SV 2K8GA 1KOHA 2XS5A 2AYGA 4F26A 3UCZP 2J76E 2DGWA 2RS2A 3D2WA 3VALA 2L08A 1F9FA 1X4DA 5LSOA 1PGZA 2NZ4A 3CULA 2MZTA 2M70A 3BO3A 1JMTA 2DGVA 2G0CA 2NLWA 4PKDB 1RKJA 5JVHQ 3Q2SC 1KOOA 2LXIA 4WKRA 3MUTP 3MUVP 2DGTA 3FEYB 3NNHA 4ERDA 4IOAQ 1U1QA 1VC6A 3R1HA 2DGXA 4C4WA 1VQ7S 1VQ5S 3CPWR 3OW2R 3CCRS 1VQKS 5GAGU 2MZJA 4Z2XA 2OIHA 1YITS 2HYIB 2CPHA 5IFMA 3CCSS 1SJFA 1SJ3P 2KM8B
chains in the Genus database with same CATH superfamily
2CQ4A 4CH1A 4RBUA 4I64A 4J9VA 1YK9A 4C0BA 1KQGB 2OPQB 3BGRB 3TOQA 4CNYA 2CJYB 3KDNA 3M9MB 2MLXA 2RE1A 2Y8WA 2R8GA 3VV2B 2JLFA 1HQUB 3CO9A 4DN9A 4KQZA 4YDXA 3HHLC 2CVEA 2R42A 4KO0A 2CPIA 4OX6A 4QOTA 3PX6A 4UW2A 3HXMA 3BSOA 1R0AB 5DGBA 2KI2A 5KFGA 4A8QA 1Q8BA 2HHSA 3MI7X 3R1LA 1TVRB 3MPUB 4F0HA 1JLGA 2BW7A 3K17A 4XO0A 4PPZA 4OYIA 4ZN1A 3HO1A 1APSA 1IBKJ 2MQQA 1FWPA 2KTQA 4P2MA 3TR5A 2HRUA 4UY8T 1FKPB 4D3GA 4RWWA 3ZZRA 3D3BJ 3H59A 2DR9A 2U1AA 3BH6B 4OV6A 5LMNF 1F0XA 2AEMA 1B0TA 1AYEA 2D7SA 2I0XA 3KNAA 4HTIA 3Q2TC 2VASA 2GVZB 2LMIA 5A0YB 3THPA 3T9NA 1RT4A 4CO0A 5IXUA 2KDOA 4ZP7A 1HD1A 1UJ5A 2GGPA 4YS2A 5EN1A 1L3SA 1MN7A 4TY8A 4ER8A 4RU9A 2KH9A 3I5CA 2R2SA 1UVIA 4J9SA 3A8JA 5D77A 4I2PB 3JSRA 1JNRB 2AW0A 1LK5A 3QGGA 2R9LA 2YWEA 2VV5A 1ZAVA 1H3DA 3G82A 3K5PA 4JI8J 4K4YA 2ZUGA 3OR2B 4DL3A 1T05A 2FVQA 1RT1A 2HZCA 2GZOA 3J7AN 3DRYA 3IA0A 2XLIA 1MMDA 1VCTA 1T7PA 1VRUA 4EGLA 1K47A 2EFVA 3N5FA 2HRTA 4EEYA 3QT7A 1KRPA 3DCAA 4N56A 4PQUA 4C8NA 3ENQA 2R7OA 5A6PA 2MY7A 2YBVA 2C3PA 4Q2MA 2XI3A 3MR6A 1Y5NB 3I6PA 2FLOA 2UU9J 5HK4A 4DL2A 2ZHAA 5KFQA 1FERA 3OR1A 5IWAF 4C97A 1IKVB 1WHWA 2QL7B 4DR7F 2R7VA 2X7IA 4L74A 1K44A 1NXIA 2JH3A 4F2RA 5HMWA 4ZS6A 4Y2IA 1P27B 4J7CA 3FC9A 4V19X 2HGNA 4N41A 3MM6A 1TL7B 3FSYA 1X7VA 2W2OP 3HT3A 1PAEX 2GHWA 2HIQA 2XSFA 2X3GA 1EIYB 1FDNA 4LF5F 1Q8KA 1RWNB 2BOPA 1M0SA 4KHMA 4MK7A 1U1PA 1AUSL 1BXNA 4EU0A 4RW6B 1PIEA 2RB7A 1Y9OA 2U2FA 2RKIB 2V50A 1RT2B 2EG2A 2QG9B 2LQBA 1CJKA 3IO1A 5HQMA 3SQOP 2L9DA 3QJPA 2VICA 2V6AA 1QDUB 4WZQA 2D41A 4LR7A 1YBUA 3QZ8A 1Q86T 1UVNA 4WYWA 1L3TA 4N8OA 1UWAA 4MKBA 2YNGA 3HCXA 5E5NA 5B0EA 3PVXA 4DV5F 4K5SA 4UOGA 5L1KA 1HD0A 1PILA 5C2GA 1S72S 1VK3A 3HHLA 2IRUA 2RAQA 4CLFA 2AYGA 1SV5A 4NLQA 2HMIB 3Q22A 2YWWA 2L08A 4E2FB 4DR5F 1XEZA 1VS3A 3DLHA 2Q1LA 4GMKA 2I1RA 2W7OA 3Q2SC 2KJWA 5A8KB 2VPXB 1GXUA 3MUTP 4DJBA 2LQJA 5KOWA 3EPGA 1RAGB 4J9UE 3OJUA 1YJ7A 1SJFA 4I4BA 4QR0A 1F9HA 1NRKA 2ZM6F 2PFDA 1J27A 4QR2A 3PKMA 3A8KA 1HKAA 3E3XA 1EQMA 4P2XA 3D6HB 1JLAB 5DDOC 4LF8J 2IJFA 3QBCA 3UCGA 2C1EB 4TN2A 3GYXB 5GMKa 4ZLLA 2CJQA 1F5BA 1TL3A 1MU2A 3UN5A 3ZZTA 2YWKA 2Q66A 1VIOA 4PG5A 1IR0A 4LR9A 2UVRA 1TFYA 5ETKA 3GIKA 2OEKA 2UZAA 2PN6A 2JFKA 5ETTA 3SBMA 3SZ2A 1RBLA 5SZTA 2ASLA 1S0VA 2R8KA 2FJAB 2E9TA 1PJ6A 1Z2LA 3RJMB 4EWTA 1C1CB 1R0CB 3M2UA 4WE1B 3BYPA 3GCXP 3KUHA 1AROP 5CYQA 3KLFA 3K8WA 4DI6A 4PWUA 2PT0A 2ZBCA 4W92B 2N3OA 4LF7F 1U26A 5KFMA 1CULB 2C2RA 1SH0A 4MTPA 1PYOB 2NCKL 2DRAA 2W25A 4DU7A 4E8UA 5CAAA 4B9TA 3J81j 3TUZC 1JB0C 1WEYA 1FO1A 4HDHA 3C6UA 3C16A 4ZCMA 5F41A 1KLNA 2PA8D 3TX0A 1HI8A 1JXLA 2XTJP 2Z2LA 1Y11A 2HBRB 2RRNA 4TU7A 1NJYA 4ANEA 1B7YB 1ZAWA 1F60B 2P6SA 2A10A 3GIJA 3EYZA 5C7PA 4W98A 3CDEA 2E5IA 2XM3A 4OX7A 2VFVA 3LP2A 2MQMA 4OZ2A 2FGOA 3M9OB 3AOCA 3RBZA 2JL9A 1FVSA 3TANA 3IM8A 3W2VB 4TKTA 2BKOA 3P96A 3KKFA 4WKYA 3T5HA 2J7WA 1YBAA 1RT3B 2HQCA 3HKWA 4DG1A 4CLUA 2NUHA 1HBMA 4URQU 3ZTSA 1FKAF 1VRTB 5GMDA 2QRRA 3IR6B 3EMTA 1G1XA 1YLXA 1G3OA 3PYDA 3BJYA 2R4FA 2YKQA 5LSRA 3WQPA 4L72B 2VKZG 2YQ0A 3CCVS 1CVJA 4A8FA 3ILJA 2B9EA 5DLGA 1S4FA 1S9FA 3L3CA 4WP8A 2LQ8A 3QO9A 3BV8A 4OI1A 1RTHB 4RNNA 4K2XA 3MOJB 2RRAA 1SVDA 3DM2B 3HPOA 3MPVA 2FVSA 1KVIA 2NUUG 2OFHX 2FHMA 2VG7B 5HANA 4Y34A 4C8OA 1DZ5A 2VUGA 3CCMS 4USIA 2MZQA 2KVIA 2XZWA 2AEJA 2YNFA 4NZ0A 3C15B 3GE9A 5CCLA 4DR7J 3NGUA 3TQ1A 5H9EK 4LQ3A 1FFSB 4B3MF 5F8IA 2F8MA 2E5LF 2CFXA 5FD1A 5IC4B 5E2QA 1OMSA 2QA4S 4WYLA 4LF5J 1SJQA 1FF2A 4TLRA 2CPXA 4RR5A 4ZPCA 1JQGA 1A0OB 2QTWA 3QT5A 2RQMA 3U1MA 2E9RX 2FHJA 1R0BG 1FEHA 4N76A 4LQ9A 1ZZNA 3JTOA 3M6UA 4ZP9A 5T7LB 2YQ3A 2L9WA 1K1SA 2JOQA 1UEKA 3HX9A 1ULRA 3KLVA 1BUXA 4WU2A 1X4CA 2HAIA 4C11B 2XY5A 3Q8SB 3ILIA 2HFSA 3C6TB 4WCEQ 2DR6A 4P6QA 2E1AA 3M2RA 3DOLB 1KS2A 3RB3A 4DV5J 1PG5B 1LW0A 2L3MA 1TL1A 2I5JA 5HSPA 4OV1A 4DV6F 2NPIA 3NNAA 5KG7A 2AV5A 4CH7A 1V3ZA 2HRYA 2W2PP 3MMAA 1ELOA 3ISND 3QT6A 4USMA 5K8MA 3JSMA 4DR5J 3R6LB 3CULA 3GZ7A 1RA7A 4O4GB 2BQ3A 3JQKA 1TKZB 2OUGA 1WORA 1SI9A 2WONA 3FVYA 3TAQA 2IMWP 3HD1A 2PEBA 3PM9A 2H3EB 1YJTA 2P6TA 1T8EA 2WVDA 3CCSS 1RTDA 4JI0F 2ZM6J 1S1XB 4K4WA 2LCWA 5IZHA 1AB8A 4TQRA 3EGZA 3MEEA 3Q0AA 2HNDB 1S6OA 3H20A 4ZVQB 2V2KA 3LALA 4PG6A 3BKFA 3NLCA 1QSSA 1T9YA 3DYAA 3FMBA 4DV1J 2IM0A 4OHZA 4GKJF 1R43A 1NK4A 4FXVA 3UR0A 1Z2ZA 3E01B 4OYBA 3GIIA 2ZZTA 2H1YA 3CCJS 1UFWA 1S79A 2OAUA 4UT4A 1K0TA 5EDWA 1X4FA 3BO2A 2DH9A 3CD7A 3KK1B 2E7XA 1IR1A 3N4WA 1CJVA 5E0OA 2ZHBA 5KFTA 3TAPA 4A4JA 1T9UA 4X65F 2FLNA 1FDBA 1S48A 2Y8YA 2HNZA 2W9BA 3EX7B 4I7FB 4LF7J 4OQJA 1ZZFA 1HNVA 4R5PB 4IFYB 3TZYA 4GC6A 1KONA 3SDEA 1NPKA 2XEXA 1H7XA 2IDLA 3OL8A 4ECRA 3PG9A 4GVLA 4PG4A 2BJ9A 2VJVA 1JK9B 3MAAB 1N33J 5B0DA 2RUSA 1Z1ZA 4OYMA 4ZLJA 3BQ0A 3NAHA 3WC0A 1HHSA 4MFBA 3RB6A 3W9IA 2VOPA 3D7SB 2VFSA 1NSKL 1REVB 2IM1A 3CJRA 2GO9A 3S1TA 4USWA 4IR9A 4EYIB 2C3OA 4CCHA 1WF0A 2QJ3A 4Q8EA 3DU6A 2DRDA 1LWFA 4C0HA 4QJVA 5DZ7A 3V6DB 3NEKA 1N5YA 2YNHB 3KG4A 2HQFA 3I87A 4P10A 1SQGA 2EXUA 3EZOA 4B3TF 1ITPA 3DRRB 1NHUA 2F8HA 3EDQB 1WG1A 5D6GA 2O66A 3LGNA 1KEKA 1TR0A 3RR8A 3VAHA 4RW8A 2BE2A 4CH0S 1X4AA 2CNNB 3TUIC 4LRCA 3DMJB 3DXSX 5KOXA 1MROA 3M8QB 2VDIA 2GQ2A 4DPOA 1LWEA 2WVCA 3DLKB 1JLFA 4E0DA 3JB9k 1LQ9A 4AE5A 2NSBA 4NYZA 2BJDA 2POKA 5F9LA 4F67A 2V8VA 1QAYA 2QEXS 1S59A 1RCOB 3JTPA 1IBCB 2BQRA 3QMQA 4B3MJ 2E5LJ 1FHTA 5KT3A 2F5GA 2DB1A 1ZA2B 2HVIA 3RG6A 3PW7A 2WSEC 2EC2A 5CYJA 4Q5VA 3DOMB 4K4ZA 4ID5A 3KUEA 1WKLA 1NK8A 4DQRA 1L3UA 2Q43A 1C1BA 2RU9A 2A3JA 1KBRA 1V3SA 1SPBP 4TY9A 1B3TA 2BANA 3BGUA 3DLEA 2JLGA 2HHXA 3QWPA 2BYCA 1S10A 5FDLA 1UA0A 1S1WB 3MCMA 1CC7A 3W2WA 1DTTB 5HVHA 1H2UX 4AYBD 2DNPA 4ECQA 2GMHA 4MK8A 3VAFA 2KHDA 1K8AT 3OFFA 3BKUA 3GMGA 2V4RA 4L3KA 1WKKA 4ED6A 1C0TA 2RU3A 4DV6J 4DX8H 3A12A 1VBZA 2JSXA 1KP6A 2CG8A 2HFOA 2W4PA 1P9QC 3MR5A 4NXNF 5KFUA 1HQEB 1FI4A 1WACA 2O01C 1WUUA 5CZVA 1I6JA 4ED2A 1QTNB 2DGWA 3WIUA 4F7VA 1U0SA 2DT9A 1AW0A 1F3VA 3V4IA 3T9ZA 3W64A 4ZPDA 5AE1A 3CDAA 1RTZA 5AXMA 4H4MB 2YX4A 1VGYA 3CPWR 2B56A 4DPTA 4JI4F 2IC3A 1OSDA 3HK2A 2IRYA 1BQNA 2E5HA 3RRKA 4YHHF 1YQHA 1OO0B 2AX1A 3ADAC 1NB7A 4MAKA 1UMJA 1REGX 4GKKF 3H5UA 4DV3F 4NLGA 1UTAA 4L75A 3D66A 3MPWA 1S1TA 1Q1KA 3PIPQ 3VF0B 4ZDNA 3PJWA 4K50A 2AP6A 3NMAA 4RUCA 5KFWA 1TFWA 3FFIA 4DXLA 4KGZB 3IBWA 2X1AA 1YWXA 4NOHA 3CCUS 5GAEI 3LA0A 1ZBTA 4GKJJ 4DFPA 3MR2A 4IOBA 1F2GA 4DSIA 9RUBA 3D67A 4KYZA 1QUPA 1N6QA 2HHUA 1LW2A 2E1PA 4H4OA 4N5SA 2W9CA 4X66J 5I3UB 3CDUA 3B82A 3PO5A 1CBKA 1QUVA 2MLYA 3LPYA 2HPUA 1BMQB 1U6FA 3LANA 4X65J 3LF0A 2VHGA 4O44A 1XC9A 3FUYA 3GV7B 3TJ9A 1B0PA 1XR5A 5J1EA 1LWXA 1RT5A 4RUBA 1IWGA 4NLWA 2RF2A 1BQXA 1P8GA 3M8PA 3IR5B 2G4BA 2YKMB 4S0MA 4K2JA 5KFHA 2H51B 2JDJA 4K4XA 3NXZA 2FUG9 2LDIA 1TKXA 4UQTA 2R7XA 1H72C 2N4CA 3G6VA 4DV0F 2QYCA 5AT1B 2GMLA 3SSSA 2MB0B 3GJQB 2ZC3A 4YFUA 4ZVPB 4EFAC 2QLJB 4V1Ak 2QL9B 2NYHA 1QSLA 1NSPA 2ZBIA 3NCRA 2DEJA 2QZ8A 5G0RB 5J2QA 3FBBA 5KAKA 3K59A 5HROB 3HULA 3D6TB 1D1UA 2BDPA 2WB1D 4RW4B 1B70B 4DQPA 2C2EA 5L46A 4B3TJ 4KRWA 5AE3A 2ADCA 3FNNA 4PCQA 1I51B 1L3KA 4BS2A 1NH8A 1NU4A 4ZVOB 2YNIA 2GHPA 4NPOA 2NXCA 4O4RA 1RHJB 1VBKA 1KHVA 3VCDA 1KKHA 1TK5A 4LSNB 1IUJA 3CCQS 2QSWA 4RW9A 4JV1A 3J7YI 3CNQP 1HMVB 2FLPA 3RB4A 1X5TA 2BBEA 3ITHA 3N9UC 1S4EA 1X5PA 1H2TZ 2V67A 4U8YA 2J9DE 1WI8A 2HVEA 1M5SA 1HYSB 3SCLE 2CNOB 1FJ7A 3SYZA 2WSCC 4DR1F 3I56S 4DF8A 3EVOA 4DR4F 2MLZA 1VQSA 3TAMB 3RR7A 2AEFA 3ZZPA 4DCPB 1N56A 3BDEA 1ZA1B 2WW8A 4DZDA 2YWHA 3KDOA 4YR2A 1NPRA 2F40A 4Q45A 3H98A 2JC1A 2CYYA 2GVZA 1MNEA 5DM6Q 4BCAA 1U1LA 2ZEJA 4NCGA 3QWUA 4KIAA 2Y1JA 3AODA 2Q6CA 2NXJA 3FGVA 4ECSA 5HAOA 4KAIA 3DGPB 2KFYA 4C2MA 5A8RB 2P9EA 3HSZA 2OEJA 3S6EA 1EETA 1RGVA 1FRMA 4B3OB 4OI3A 2O67A 4I2PA 3HHLD 2UUTA 1XR7A 3MR7A 2P9CA 2FHOB 5B0CA 3NWRA 4RWXA 2LP4A 1NBEB 2KT2A 3UN3A 3TW0A 3MHYA 3J7YU 3I0RA 3FBFA 4PUOA 4WXOA 4M5IA 2ZH2A 1NK9A 3C66A 4H54A 1TP7A 5HVFA 1BE4A 4AQYJ 4RJVA 4X62J 3EXYA 4MKAA 3IXQA 3JSYA 3DFEA 4NXNJ 3SSQA 3UNGC 2AWZA 3FJ2A 2K8GA 1KOHA 2J0XA 3GG1A 2GX8A 2QX0A 2E1RA 4KV8B 2CNLB 1HW8A 1PGZA 3IS9B 4KHPF 3C14B 1XIQA 4CLZA 4HACA 4CLYA 2DGXA 3OW2R 1Q16B 4JI4J 4Z2XA 5IFMA 1IKVA 4YHHJ 1MMLA 4ZP6A 1HL6A 4IG0A 2QO3A 2BJ1A 3NBPB 3QIPB 1X9WA 4K8RA 4GKKJ 1SKRA 2DO0A 4LFAJ 2DH7A 3MDFA 3A4TA 2I9SA 4CDIA 1HHTP 4FF1A 3BM7A 3UDEA 5KFJA 2F65A 2BMBA 2V4QA 5A2QY 5E33A 2HVZA 3MECB 2GNKA 3L7PA 4XIUA 1D8YA 2EVZA 3Q86A 4V19J 2QA2A 3HZGA 3CJKA 1KQKA 4QWEA 4PABA 2GVDB 2E7VA 1T3OA 4RW6A 3KMSA 3KG1A 2VBXA 4QWDA 1RT2A 2BR0A 2JHEA 2UUWA 2MXYA 2Y9HA 1BWEA 1U0HB 1SC1B 2RH3A 5LMUF 5EWGA 3A8EA 4DL5A 1SJ1A 1Y00A 1RCXB 3NGRA 3TUPA 3DGVA 1HNZF 1GT8A 2KM8C 4CNZA 3KJVA 1WC1A 3TWZA 4D3HA 1WOPA 3TJ8A 3A1YG 3BKTA 3NS5A 2QYGA 2HMIA 3CC7S 4ECTA 4KFBA 2J0SD 1BC6A 4GO7X 2CJKA 2R7QA 4C48A 4LF6F 3MEDA 3NCPA 4EO6A 5KFPA 1TKTB 2DHAA 2KL8A 3N6NA 4ZITA 3VAIA 4FYYB 3GG0A 2HWHA 3DDIA 1XR6A 4MIAA 4JV0A 5DO2A 1RQ0A 1RHKB 3OXGA 3IAM9 1TTHB 3HJVA 1V5VA 1R8HA 4HVZA 3NGSA 4JI7F 3DU5A 1RBAA 2YWGA 4HI1A 4C0OC 1XNQF 2B6AA 5IOLA 4NEZA 1NB2A 2IJNA 2ZBPA 3WX8A 2HQDA 5KFLA 1GX6A 3PFOA 5C25B 4ICLA 1UETA 5HATA 3E2EA 1X9SA 1IKWB 1X4GA 1XNRF 4KKOB 1AZSA 1FJCA 5CHCB 2E44A 3BBBA 4DR4J 2MQLA 1W7WA 2ZZMA 4RBTA 3J80Y 1RAJA 3T5KA 1VHFA 3W63A 4UQGA 3HZEA 1FDDA 1NCLA 1OY6A 4CLWA 2ROPA 4K0KF 1HPZA 3H5SA 2ZJPQ 3N28A 3N5BA 5D0EA 1KDNA 3D1OA 3SQGB 3LP1A 4CYUB 3POTB 2FHJD 1RWKB 5J2MA 5IM0A 2XYHB 3QAUA 1HW9A 3DKDA 4N77A 2Y0SD 2D3OR 2KKHA 1TUWA 4JI1F 1PJ7A 1PCAA 1HA1A 1ZM9A 2HQGA 5CZXA 4ZP8A 3HFZB 1B7FA 2D9OA 4MK9A 2XY7A 4KGVB 2BE9B 3MCNA 3OPKA 2DNKA 4LBIA 4NRTA 1F5AA 5FIIA 3OFHA 3CJSA 1U45A 4RNMA 1NJWA 3A13A 1HWIA 3ZC4A 3MM5A 3S8SA 2F9JA 1WHXA 5D0RA 2J9DA 3IMQJ 1VRTA 3MM7A 4OZ0A 5KG0A 1UWBA 2IPOB 3DRSA 1D3WA 1UPMB 3C19A 1FD8A 1M5OC 3HVTB 4U8VA 3MEGA 5D4PA 1QE1A 2A1BA 4YR3A 1DTQA 3OBIA 2JEGA 3G2XA 2RQKA 5I42B 4LR8A 2VG5B 1HNIA 2RS2A 1XJWB 3FK4A 4JBCA 1U24A 5LSOA 3PEJA 4MH8A 4IH6A 2W7AA 4FVCA 4RO0A 1HWUA 2GAHC 4ZPVR 1S6PB 3MUVP 3BR9A 3KOAA 1SKSA 2IM2A 4HKQA 3GP9A 5KG3A 1YITS 1SC4B 6FD1A 1EARA 3MUMP 4CI0B 2EK1A 3GIMA 4QIGA 2NR0A 3AXMA 3BSNA 1TV6B 1U7LA 5E3AA 4ECUA 2L9NA 5D8HB 1IQZA 1PBAA 2DISA 3DLJA 3PR4A 2IVFB 3PDNA 2ROEA 1WC4A 4ATNA 1N34J 4DDFA 1RT6B 1HBUA 1YZ7A 3BN4A 4NYPA 4OX9F 1FXLA 2BM0A 2ZD1A 1NDKA 1DLOA 3GWCA 3M1VB 1FFWB 4Q8FA 4DBQA 1WC0A 4R0JA 4AL5A 4C3KA 1G6BA 3G71S 5KFRA 2YKNA 3G6ES 4AT1B 2V94A 2GMJA 5THWA 1VQ9S 1PAUB 2HWTA 1TL4A 4LRBA 5F8JA 3ZXWA 4F25A 2AD9A 1FK9A 2JEJA 2YXLA 4KPCA 3J81U 5LMUJ 1NK7A 1EKSA 4EMDA 3W65A 5A8WA 1HNZJ 3J7Z5 3I0SA 2HBZB 5ETRA 3UCUP 3LW5C 1NZ8A 4KH1B 3T1YJ 3M30B 4J9KA 2CADA 4GVBB 4U7CA 5IC6B 2AIRB 4O3PA 4PPDA 3IG1B 2ZJRQ 2G2YA 2MDAA 1WHVA 3CCLS 4LF6J 4R8UA 1S0NA 3OVSA 1FJEB 4IG3A 2PE8A 2L41A 1NSQA 4Y65A 5L39A 1T03A 2MQNA 5HP1B 2MKSA 1K1QA 1EAYC 3CMQA 1S5ZA 1RHRB 2V4JA 2LEBA 2JFDA 3KLEA 2FHKA 5ETNA 5I3PA 1V6HA 2BABA 1P9YA 3FRZA 3R2CJ 1DQ8A 4DV2F 2R2RA 1RABB 1RP5A 2XMUA 4LF9F 4JI7J 5EWFA 4M1KA 3ILLA 4KGXB 4YY3F 5ETVA 4LSLB 2XS2A 2PMZD 3OHBA 1XNQJ 1FKOB 2DCLA 4WPAA 4JV5J 3GSIA 3DLGA 5B0BA 4NLRA 2D69A 4ED4A 1U1RA 1SQEA 2HFVA 3R5BA 2RQ4A 2J0QD 2LLZA 1EB0A 1JLBA 2VJUA 1XNRJ 3GYGA 2FJBB 2OELA 3QIDA 4I6YA 4DSLA 4B9MA 2HS3A 5IV4A 2V0NA 1V5IB 3IRXA 3DLBA 5EHHA 3X1LB 4IFYA 1IM6A 4USKA 1RUSA 2ERRA 1O6XA 1IKXB 4WFNQ 1X4EA 4Y3CA 2FVPA 4WFBQ 3OXLA 2UUBF 1OPIA 2RIJA 2HK2A 3P4UB 4JI1J 2CIMA 2ABYA 2KB2A 2F63A 5E3QA 2R7TA 4G1QB 1K73T 3PW2A 3M32A 2FD2A 1VQLS 3UFCX 2K3IA 2B4OA 1GMVA 1M5VC 1F1BB 4NMXA 2VPZB 1N4LA 1J5EJ 2DITA 2OTJS 1URNA 3ET6B 2CQBA 4LRAA 4USUA 3RYLA 3QZ7A 3QT8A 2ZKTA 2J6TA 4NLSA 3K2YA 1BQMB 1SIZA 2CVIA 4CLSA 1EX8A 2IHR1 1KFDA 3VVUA 4DOZA 2CA9A 3VZHA 3RRHA 4OJGA 3QATA 3M7VA 4PWDB 4OZLA 1N0VC 1S6QA 3DRRA 4EI2A 1FNMA 5ITHA 4O3OA 2ZVSA 5L1IA 4CLPA 4ZHRB 4C8ZA 1DBDA 1GAOA 1QD1A 5ETLA 4F0KA 1S9EB 2VBYA 2BJEA 1WSRA 4OHXA 3QLHA 2C22A 1SUQB 3B6BA 3W8GA 4KPYA 1SXLA 1LFPA 3H5YA 3CDWA 5H1SV 2CG4A 4G1PA 2WVFA 4DL7A 3QFHA 3OLBA 2EW9A 3GFZA 2F8EX 1UJ6A 5FLXU 2FVRA 2Z30B 3NP5A 4QIVA 3H4DA 4DN0A 3OT9A 2KJVA 3MD3A 2FJWA 3PYGA 3B8HA 4ANDA 4XAKA 5KFBA 4FBUA 4KT0C 4OJHA 4KO0B 4DCJB 5KG4A 2WK4A 1PBUA 4Y0FA 1FJGF 2OH2A 3HSGA 4C8KA 5KFFA 2GO8A 2KXFA 5KFEA 3DOMA 4M5MA 3K7RA 2A6MA 2YX7A 2YTCA 2QLWA 1U2RA 2FTRA 4OX9J 1JLGB 1S76D 1SBRA 2RUGA 1OWXA 2OTLS 2IBKA 3DDNA 2MYFA 4JI8F 2G0IA 1QSYA 4LF4F 4X84A 2W4CA 2XMWA 4KR0B 5KG1A 4FXWA 1N0UA 3P49B 5DG9A 1DTTA 1XTZA 3OFEA 2QLFB 2DIVA 4JYAF 1CEZA 1RADB 4Y2CA 1NSAA 3R5DA 4C3LA 2Y1IA 3OD2A 4ZVFA 4P75A 3F73A 1RT4B 5LOQA 2P9GA 1B4SA 4NEYA 1JLEA 5KT5A 4CT9A 3WC2A 4M5DA 1WC5A 1UAWA 5K14A 4Q7AA 1PC5A 3DRXA 1BHNA 4OYOA 2CUYA 2GGPB 2AJ0A 3MXHP 4FKXA 3M2VB 3TZZA 4DQIA 4ES2A 4QPTA 4DSFA 1YX2A 1UW4A 2JEFA 2FJXA 4OYPA 5DZ6A 3P5TL 4P73A 2A2CA 3G82B 3OFGA 5J2NA 1LKZA 2HWIA 4M5LA 1RT1B 1CS4A 5AJ3F 3EZUA 4IFVA 2MKJA 3RGIA 1FA0A 2EPIA 4LF9J 2KXHA 3EUNA 3T41A 2N7YA 4LRFA 1CJTA 1H2VZ 4U96A 2XO7A 3IAS9 3EVMA 2DNOA 3L7UA 2JRSA 2DIUA 4J9RA 4PQUB 5KFXA 4OLPA 2DPJA 2AKWB 1Y5LB 3UQSA 4BC7A 1RZMA 2Y0BB 3I5BA 5K8PA 3R7NB 1RTIA 2XQCA 4P74A 2ZVIA 2R8IA 3V6KA 2J0WA 1RHUB 4OJ1A 2LVWA 2XNQA 3OR1B 1E6YB 4DLGA 1HFEL 1QY7A 1IJEB 2OGUA 2IIHA 3TUJC 4MMOA 5CABA 3UWTA 3D6MB 2ZWOA 4OI0A 4NZ6A 3N79A 1WC6A 4YUDA 5LXRA 1F5CA 2BZ2A 4IKAA 1BWVA 1N5QA 1OY8A 5KFYA 2F4FA 2UUBJ 3R2DJ 2ASDA 2MPUA 2EI5A 3JYTA 3B4MA 5HJXA 2NSCA 2IY5B 4DFMA 1Y4ZB 4U95A 2KT5A 2HBQB 4QYRA 2R7RA 4USVA 2Q3PA 1GEHA 3PCOB 4LF8F 2FY8A 1CJKB 1HBNB 1NEEA 1ZS6A 5K20B 5HN0A 5C24A 5GADI 3KLIB 5G0RA 1VQ6S 1IN0A 3R97A 2QC3A 4IO9Q 1RACB 1MWQA 5HROA 4A46A 2YNGB 4DSEA 4CT8A 2KFNA 2LQ9A 3AD8C 2COLA 1F3FA 4HH1A 3NL0A 5IQ6A 2IFXA 1RWPB 2AGOA 1CJUA 2N82B 5KT4A 2C3YA 1LV5A 1RYSA 3HHLB 3LQVA 4OHYA 4LF1A 4OJ3A 1SV5B 3PW5A 1WKJA 3IGNA 3R6GB 3LP0A 5JMNA 3FDSA 2BJ3A 4UUWA 4URSA 3W7BA 4PWWA 2ZH4A 5CCMA 4MKYA 2HGMA 5ADZA 2R2UA 2JLEA 1WTFA 4QW9A 3D2WA 1VLOA 2CWKA 3AA9A 1IKYA 1R8AA 4WKRA 3CJ5A 4DX5A 3TI0A 2F4VF 1C4AA 3I31A 2GAGC 3TAMA 3FCHA 3AQOA 4HR2A 3KNGA 3OUYA 4LUBA 1TL3B 1MU2B 4WU3A 1WHYA 1HR0J 3BN7A 1OPZA 3HDSA 3GTYX 3HHEA 4BHQA 3PKYA 4C6AA 1TAUA 4MKVA 5F3TA 2M3DA 1D09B 2PGCA 3AOBA 2FIUA 4WFZA 4IR1A 1FJGJ 3UVJB 3OXFA 4A47A 1EKRA 3UPFA 3KLHA 3EGVA 3QGIA 4G3IA 5GADU 3NG8A 2IJRA 3VGVA 1G2EA 1X0PA 3DGPA 2GHVC 4CQ1A 3ZZZA 1WDDA 5A8RA 3P5BP 3LGHA 3M2UB 4X64J 3DXBA 4JI5F 4EBDA 5HMXA 1X60A 1OIAA 2NXUA 3KLFB 4LF4J 3PEHA 2ZWPA 3CDBA 4B17A 5CH7B 3ENAA 3BGLA 4B3OA 1VQMS 3ZZYA 4JYAJ 1F6TA 5D3GA 4DF4A 2HS0A 3GONA 4WK1A 2EC0A 1ACMB 3O5TB 5IT9Y 4C8MA 3C16B 2AGPA 1DARA 5K8NA 1M90T 3OTDA 2CZ4A 5HO4A 3AHPA 3G6XA 2UXDJ 1RWOB 1T9WA 2GJFA 2IA0A 2BXJA 2UV8A 1VBYA 1RAEB 3I32A 2XZTB 4F4YA 1OJ4A 4KV8A 3NNCA 3LP2B 3FRYA 4DV4F 1GMWA 3IS9A 5CA5A 2ZH9A 1C0UA 4Z7YA 3ONQA 1YRXA 5ETOA 3CEDA 2DYAA 1FT8A 5KFKA 2MJUA 3CF5Q 3W8PA 4MT1A 4P2SA 1RDRA 1NJIT 3M9NB 2JJ4D 5F8HA 1BLUA 3K8VA 2B8PA 4DG1B 2MSTA 1HBMB 1YRUA 1IM4A 4X4RA 2K7JA 2OJ3A 2CJXB 2FDNA 4W4MA 5E41A 2AJFE 2XZDB 4ZCKA 5AJ3J 3NBPA 2FGCA 5L1LA 4RZRA 2P2CB 2VL1A 2FLLA 1WSVA 3M05A 3ICLA 4ZOSA 4ZVSB 3PX0A 2K2PA 4C7QA 1MLAA 1X8DA 3MMBB 1TKDA 1RU1A 4OI2A 2FJVA 3CWJA 2YKAA 1YTYA 2GS8A 3N6MA 3PYFA 4ILRA 3QO9B 2XMJA 2WOMA 2CRLA 3NRBA 5ETSA 4BLGA 4DUYF 2XHWA 8RUCA 3K5MA 2YNFB 1MG7A 1A7GE 2LEAA 2LEPA 1U8SA 3PX4A 3A3NB 1O8BA 3OTEA 3CCZA 2VFTA 1JLCA 2CZ9A 1U0HA 5D4NA 3I4HX 1YSJA 2DR7A 3TNVA 2B9YA 3NCQA 2WBMA 2ACMA 1SB6A 4L76A 2BJ8A 3TVKA 3VGTA 2HHHJ 4KTQA 1SL0A 3HHNB 2RRBA 3R7SB 1LK7A 1SL1A 1J2VA 4OZ5A 2BE7D 2MKYA 4DSJA 2NREA 1RA6A 1UFLA 4CM2A 3MMCA 2LFVA 3IWLA 4HI2A 3M6XA 3ZZOA 4B3RJ 2ZDPA 2WVBA 1P1TA 2DKOB 4H4KC 2HBYB 3HFKA 1KLMA 3VQTA 3NS7B 2ZHOA 1EP4A 3DNCA 3KLGA 2CQ2A 2BACA 1QVFR 3OLAA 1G7CB 1GTEA 3M2RB 2HHPA 1X0FA 1RT7A 2FZCB 3AXKA 3P3DA 5JXSA 2MTLA 4DV1F 1LW0B 1RTJB 2CQCA 1TL1B 2N7CA 4IRKA 2XMAA 5KT6A 2RQCA 1S12A 1SC6A 3EPIA 3EE3A 2HGLA 1WELA 5IV3A 4JI6F 3KUGA 3R27A 1UVLA 1U49A 3MMAB 2X1BA 3JSMB 2VIHA 1JKHA 4K5RA 1BD6A 3MGJA 2LDYA 2HQIA 4C98A 2WONB 3MFIA 4DLEA 3F41A 4F26A 4PG7A 4XPEA 4NMLA 3HKZD 2WRMA 2K06A 4UOFA 1OY9A 2F4VJ 2C2DA 4L73A 1UZDA 1N33F 1Q7LB 4IDKA 3MEEB 1C2PA 2OPRA 1VQKS 3QYYA 4NRUA 1YJRA 5CYMA 4N8NA 2HHTA 2HK3A 3SQGA 3BDPA 2OPSB 3MOZA 1QLNA 4M5GA 3NMRA 3MCSA 4FS2A 2IAJA 5AE2A 3VR1A 2RJZA 3DYAB 4DZ6A 2AZ3A 4O23A 3QRRA 4UOCA 2CQHA 4DS4A 2PIIA 2XG8A 1R27B 3DI6A 3BYRA 2EFGA 4DR2F 2V69A 1DHMA 4JI5J 1CJVB 1J5OA 3DHXA 1YZ6A 1WTBA 3D54A 2HNZB 2W9BB 1ZPVA 1N54B 4FP9A 4DCOB 5JVGQ 1HNVB 2CAJA 1VK8A 3UN2A 3BEGB 4RX6A 1RWUA 2V2QA 4A8MP 3SDEB 1YDLA 3V81A 4BWMA 4DQQA 3G96A 1ZTTA 2HHQA 4DHVA 1U2CA 3RRGA 4N7TA 2OFGX 3D68A 3KHGA 1R6VA 4MFBB 3QPIA 4LBPA 2Z0GA 4OL8A 1RHQB 4FYWB 3Q89A 1JXEA 1CSJA 1VR6A 4J91A 2FY1A 3NKYA 3U7JA 1N32J 3UDLA 2WHOA 4DV4J 2RILA 2B4VA 1DQAA 1TUVA 1LWFB 1GX5A 1RISA 2APOA 5K9FA 1S1VA 1N5YB 4IRCA 1FCAA 2EG1A 4WIIA 2QLBB 3K5NA 2V8PA 3L7OA 3ZTQA 3MM9A 3W9HA 1RB0A 2FC8A 2H9ZA 1R3NA 3P6YC 4RW8B 4FF4A 2BE2B 3T6JA 2GQCA 4OFZA 4XTTA 1RHMB 1MROB 3O44A 1RT6A 1NJZA 1LWCA 1ZH5A 3AAWB 4YP3A 3FBEA 3AJ2A 2AT1B 4DUYJ 2HFUA 1JLFB 2VDHA 2M88A 2KT3A 1DFDA 3VAGA 4PEOA 3EWGA 2FC9A 3CD0A 4H4KA 2YKOA 4Y2AA 3TEHB 2JWNA 1Y7PA 4FXDA 2KRBA 4TYBA 3KK3A 1RAFB 4DUTA 1JLQA 3FKBA 5ETQA 3FSIA 3MZIA 2LKZA 2CJ9A 2EKYA 4ID5B 2B0GA 4ZK7M 1T95A 2C3MA 1C1BB 3W61A 2NPFA 2LU1A 1S9GA 4DS5A 2BA9A 1SKUB 3IBCB 1D0EA 2BANB 4LRDA 3DLEB 3IG1A 1Q95G 1VISA 3EDRB 1FX4A 2XMTA 3DOKA 4AD6A 2ATLA 4WIQA 3WDOA 5FDLB 3W60A 4AL7A 1GH8A 3W2WB 4U9RA 2XS7A 1NHKL 5F3ZA 2XWYA 2UP1A 2F9DA 3A3OB 4F4XA 2PI4A 1Q8LA 2VQFF 2OP5A 3T1AA 1HBOB 3MTJA 1C0TB 3JS9A 1UVJA 4LSLA 2HURA 2VB6A 1R8PA 3HJFA 1HARA 3KXDA 4JI6J 4CO1A 2CPJA 1UA1A 2DXFA 1RJJA 1XQIA 4RU2A 3RBXA 2MKIA 4X66F 3QAEA 2IRXA 1UVKA 2FPHX 1Y3KA 2H54B 1P1LA 4OZJA 4PXDA 1IBLF 3D0GE 4A8OA 1NK5A 1HI1A 4IQMA 5DDPC 2HZAA 5KFSA 4YN3B 4AXIA 4ZLNA 2XS5A 3UCZP 2K1RA 1FRIA 5C42A 2NZ4A 2AX0A 1HNXF 3PFEA 4I0WA 1BQNB 4CWBA 1RKJA 3BF4A 1Q4RA 4I68A 3Q8PB 4G1IA 5KFOA 5KFNA 3NNHA 3IC1A 3D9BA 3CJQA 3R1HA 2C28A 1C4CA 3B54A 4DQSA 1RAAB 1URRA 4JV2A 4CTAB 4ZKAA 1NLKL 3G9CA 1NKCA 4A48A 2V2VA 3CTRA 3KHLA 1YVFA 1PSDA 3QGPA 1IJFB 4G1QA 2BRKA 1N6QB 1LW2B 2B8QA 1RWVB 1T9TA 3O8WA 5LJ3Y 3CW2C 1X4BA 4H4OB 3UDVA 3RTVA 1FNXH 2W9CB 2GV1A 4DR2J 2DY9A 3W1YC 4RW7A 2LYVA 1LFWA 2E5JA 3UD3P 2W24A 1WWHA 4I69A 2Z56B 1BQMA 3K0JA 1AXQA 4O44B 1VQPS 3FZ2A 4YB5A 1FNOA 2V2ZA 4LJMA 2CPYA 2Z57B 3HVRA 1IBMF 5J1EB 1S1UA 1RT5B 3EGNA 4YQWA 5GMEA 2ZJQQ 4P71A 2RF2B 3T5LA 4YB1P 4MIWA 2G9OA 5EX3A 1S9EA 1ZM3A 1RAHB 3CMES 1AT1B 1B64A 1R31A 5L1JA 2DBBA 2YPYA 1LEOA 1S57A 4ECZA 1FTRA 2CQIA 1QAIA 4NI2A 2XMVA 2XMMA 2G13A 5J2QB 4TVAB 5M2UA 2LU2A 1X31C 4NCBA 1M5PC 2CPFA 1I94F 1Y0HA 3LO3A 1TMJA 2YNIB 4IRDA 3GU0A 2UVVA 4XK8C 1R7IA 4P2FA 3CGIA 1DY3A 1W26A 3GFXA 2DR8A 1FRXA 4RW9B 1JNZB 3A3PB 5B08A 1M1HA 2OD4A 4QU6A 2X51A 1XERA 3BSCA 2HNYA 3ITHB 3AT1B 1TAQA 3PJ9A 2DHGA 3BGFA 4JOUA 3PRVA 1LXNA 3OQ2A 4FPRA 3T5JA 2HEKA 2V5HG 3BGOP 3AD9C 4KGKA 3FZBA 2ILZA 4I2QA 2HLUA 5B09A 4IOCQ 2ZBQA 2MKHA 3MFHA 1FEEA 1U8WA 2OEMA 5J1NA 3SXLA 4NZ7A 5F0WA 4PYDA 4P7TA 4AQYF 1WF2A 4X62F 2FVCA 4WK3A 5HI7A 3IR7B 3NOCA 5DDRC 4J9PA 3MEKA 1UP1A 1NDPA 3TRGA 1R89A 1N36F 3VWSA 4UOHA 3W5ZA 4AL6A 4J9QA 5D15A 5HQLA 4B3SF 1I3OB 3DN9A 4NCGB 3MM8B 3UI3A 3HLUA 1T9VA 2LA4A 3HSDA 2YH1A 2ZNZA 3F0NA 3HD2A 2FZKB 1DQ9A 2O3DA 2RHSB 3GFYA 2H5IB 4DPWA 1F9EB 4HH0A 3M2VA 2B5JA 4UTGA 1EETB 2XCPA 4MIBA 2VBZA 5I4MA 1U1KA 1W2BR 4WZMA 4I6WA 4LFAF 5HQ8A 2DGSA 3KHRA 2QA4G 3CJ0A 1Q79A 3CT9A 5L8RC 1GMUA 4DFJA 2JEIA 5BYRA 2PA3A 3I0RB 2XCAA 4Q0BA 2ZH7A 4Y00A 2CNKB 4PUOB 3LAKA 4DR3F 2JC0A 1O5JA 2VQFJ 2DK2A 2VPYB 2DNGA 4WF9Q 3IBFB 3DRPB 2VG6A 1CPZA 1U47A 5SUHA 2C3UA 4AXJA 1KVJA 3V6HA 2ZC4A 2V8DA 2GIFA 1YRTA 3H7HB 3N6LA 2B7BB 4QWBA 2OD6A 1IBLJ 1TQLA 4ALZA 3JSBA 2KN4A 4HACB 3AQPA 2RSQA 2P8IA 4Y2MA 3D3CJ 5BYQA 3FQLA 1E6YA 1HNXJ 2G0CA 4IG0B 3B78A 3GLJA 4HT5A 4F04B 3HT0A 3FEYB 2XSJA 2C2MB 3GILA 3UW1A 1U6ZA 2KVQE 1WJ9A 2I8EA 1OSCA 3K5LA 1UEUA 2VFRA 2E7WA 2QIFA 2ROGA 1KQFB 1BGXT 2BKPA 1NNDA 1RWXB 2KYZA 4ZVRB 1Q7YT 4ETXA 3CJKB 1EJ7L 1PYTA 3HMJG 4O0IA 5MLCV 2OPQA 2XWXA 1MSWD 1Y3JA 3BGRA 2GIRA 3PZPA 5GAEU 4F3OA 1HBNA 2EFNA 2DR5A 3QJLA 5DG7A 4EO8A 4A8YA 3MWBA 2V68A 4PYAA 1HQUA 3KLIA 2OPPB 2KHCA 2F3JA 1WG5A 2ZKUA 5ETPA 1RSCA 3I82A 1IBMJ 2WCXA 2DTJA 1R0AA 3CCES 4FNIA 3KJVB 1R6YA 1AFJA 1GMWD 2I6WA 4EUVA 1TVRA 4TYAA 3OTCA 2GCFA 4OZ1A 4KFBB 1VYAA 3T3FA 1M5HA 5L9XA 3MEDB 4W90B 2O5DA 3ZO7A 2CDQA 1AFIA 4YMEA 2DXEA 1FKPA 3J7ZT 3OL9A 3E51A 4LREA 1O51A 4QW8A 2FJDB 2FZGB 2F1FA 5B7WA 4LFBF 3R5GA 3PW4A 2KG0A 5A0YA 1U1OA 1I94J 2M0GB 1G4CA 2CPEA 1N52B 2DVIA 2RD5C 3BZQA 4ED1A 2B6AB 3PHEA 2Y3YA 5J2PB 4J9OA 4RKUC 3CJ8A 3BH7B 3TA2A 3R5JB 4WFXA 3BO4A 3UVJA 2GC8A 4ICLB 4YDDB 3GB0A 5AXKA 1RK8A 3QSIA 1NMEB 3CCWA 1AZSB 2MZSA 5F0UA 1XWLA 4QIWD 3K5OA 1HWLA 3AH6A 2QSFA 4DX6A 1P6TA 2OMOA 5LJ5Y 3OR2A 2LXFA 2ADBA 4O3SA 2XBPA 2PMWA 5IT0A 4HDGA 1Q53A 3OTOF 1HPZB 2I2YA 2C2ZB 2UVWA 1S99A 5LMNJ 4MYUA 3PV8A 3LP1B 1RI7A 4NLYA 3CVKA 1Z4UA 4EBCA 5J2MB 5IM0B 4Y2KA 3MF5A 1N36J 2X1GA 2DNHA 4LMZA 4B3SJ 1FE0A 4P7VA 1QM9A 3RW7A 1JJ2R 1OYEA 4LIRA 1JJHA 4HLBA 3CSKA 2C42A 4ZVHA 3T1HF 3D1QA 2J7UA 5BYSA 1T0TV 3CMAS 5MAOA 1IWAA 2DNYA 4LT6A 2UXCF 2PEHA 2DO4A 4ZJQA 5HBMB 3EVWA 3OHAA 3OV7A 1TU0B 2ZOMA 3M8SA 2L48A 3ETOA 2WTFA 3MM5B 1LOUA 2OLWA 1TL7A 4IQXA 1H38A 2E1MC 1N34F 4DR3J 1VFJA 4P52A 3MM7B 2MSSA 1VRQC 3CJ2A 1UWBB 3DRSB 2AQ4A 5KFDA 7FDRA 3GYNA 4Q43A 4PZVA 4B9SA 4J9MA 3MEGB 1QE1B 3MMBA 1DTQB 2VD3A 1QVGR 4USHA 1JJ4A 2LQ5A 5KFAA 2ZE2B 1S0MA 1CG2A 3RB0A 1RWMB 4J37A 2RKIA 1HNIB 3W5YA 2X3DA 3PY8A 2XB2D 3G87A 1SCJB 1B99A 2BX6A 2CDRB 3UO0A 4KHRA 5K5MA 1SJRA 1KN6A 5T41A 5C5JA 5IWAJ 3TZXA 4CRJA 4KBIA 2HVHA 4I6AA 2NS1B 2MZTA 3O3LA 2HLTA 1KWMA 3T1YF 3U1NA 4R0EA 2RDDA 4OYWA 3CCTA 2ASYA 2KM8B 4A8SA 2IVYA 4ELUA 4ZIWA 2XC9A 1S7HA 3D0IE 5A8KA 2H4YB 3CE8A 1HBUB 5EWEA 1UVMA 3BSAA 2ZD1B 3SI8A 1N5TA 4ZVEA 1FRJA 2M8DB 2C2KB 5EGYA 1DLOB 2W8LA 1SQFA 3TA1A 2CQDA 5HMZA 5F8MA 2RDIA 5DRKA 2NXNA 2ZZNA 1JLAA 1SIWB 2DNMA 2YKNB 4EZ6A 1HI0P 4OLOA 3PTWA 5L9NA 2HVDA 1HLWA 1YJVA 3OSPA 3LPEA 4NE9C 4J9NA 2CPDA 3U02A 4ZN3A 4EYHB 2KZMA 1E6VB 4YOEA 1FK9B 4JV5F 4A8KA 3MAHA 3HP6A 1M5KC 1DURA 1N88A 3FEXB 5A8WB 3K89A 4UY85 1RTJA 3WHIA 1U48A 2W1BA 3I0SB 3CO0P 2Q79A 4HL9A 2ZH6A 1YIJS 2G0JA 1UPPA 3ISZA 3U27A 3L4BC 1X4HA 1XK8A 4WBFA 3AJ1A 2BKNA 4MYTA 1C1CA 1Q81T 1TL5A 1RWWB 5HLFB 2EEYA 4X4SA 2GW8A 4WE1A 4R8UB 1T11A 4IG3B 2YX1A 4ES3A 3SV4A 1T03B 4ANCA 1X5SA 4ECWA 2H5EA 3VQSA 1CULA 3P45B 3ZZ0A 1KD1T 4M63A 3W3SA 2G1DA 2V4JB 2MZRA 3G6YA 3KLEB 3QNWB 1VOMA 5RUBA 2VBWA 4LFBJ 1N5SA 1UCNA 4F02A 3CB4A 1D9FA 1A6LA 1HWJA 4JI2F 3RW6A 3O2IA 3U1LA 4RLEA 3PIOQ 1PO6A 2VA2A 1WOOA 2K3KA 2WZ1A 4KY3A 2OPSA 4U7UK 1K9MT 3GIRA 1GTHA 3DLGB 2EFOA 3A8IA 3TVZA 1HQ2A 2OSRA 2IBOA 1J5EF 5BJRA 5H9FJ 1LNQA 5J1PA 3GJSB 1KFSA 2OKQA 2XGQA 4EBEA 3M8RA 4FBTA 1JLBB 4DV7F 4IO1A 3W2VA 3AB4B 3BQ2A 2QGFB 1RT3A 1RE1B 1XMBA 2CXEA 2MMYA 3HSJA 4CZCA 4B9UA 1OYDA 3LOUA 5E7OB 3OTOJ 2XI2A 4ELVA 3IRXB 3TQEA 2DXDA 1S49A 4ECXA 2QE5A 2B4PA 3MURP 1UEVA 4F50A 2YH0A 2VKRA 3CD6S 4LFCF 4KC5A 2R8JA 2VPWB 1UJ4A 6FDRA 2Z4PA 1RTHA 4QPXA 4WWSA 3TEGA 5JJBA 1AUDA 4U6PA 3M32B 3DM2A 2QMXA 2VG7A 3C8YA 4O0NA 3KMQA 4F3MA 3SIPB 3T1HJ 1KTQA 3HF5A 3C15A 5F9NA 2DD8S 2B51A 5I3QA 4LBHA 4C9DA 3H0PA 3RUBL 2CZVC 4ZJLA 3LTOA 2R8HA 4I56A 1UZHA 3W66A 4F8RA 2UXCJ 2UUCF 5G4DA 3I9V9 3HVWA 4N47A 4Q44A 4WP3A 2DNLA 5FJ4A 2MGZB 2EFQA 1S6QB 2DPIA 1A9NB 4L3NA 2YWFA 5GAHI 4NL5A 1FRKA 4QIEA 2UXBF 3GCWP 2NZCA 3BBCA 1JXVA 2DNQA 2IM3A 2EBEA 3SEOA 2VA3A 3ULHA 2PSZA 1XMOF 3QLHB 2WW4A 3CD5A 3KK2B 1ZTWA 1S7IA 2JVOA 5T7LA 1FFGB 2GJ2A 4IUFA 4CP5A 4C11A 2HQ3A 1M1KT 4WFAQ 4X2BA 4FS1A 1JIHA 3AOAA 4NYOA 1WI6A 5DQHA 3C6TA 4X4OA 2H48B 5DQIA 3DOLA 1U25A 1VDHA 4FYVB 1NH7A 4HYKA 2DGVA 3N01A 4NWBA 3ENWA 5JVHQ 2LXIA 2XMKA 3DHWC 1NKEA 4PXBA 1U1QA 4XDDA 4C4WA 1VQ7S 4ED7A 2MZJA 4FDFA 2HYIB 2FYXA 4IYQA 2X1FA 2NQPA 4WFYA 4O4GA 2ZOFA 1KNZA 5F8NA 4ZPTR 1TKZA 4DR6F 1NHVA 2ILYA 2W01A 2KU7A 1NJXA 1WF1A 3CJTA 3GJTB 1VIXA 4YR0A 4FF2A 1H6KX 3K57A 2YKPA 2KRRA 3EJMA 1I5OB 1S1XA 5C2CA 2JX2A 2ZOGA 2V9KA 1T02A 3IFEA 5GAHU 1ROFA 3US5A 2CQ1A 1YBTA 2B3TB 2K7KA 3EXCX 2E1CA 3F44A 2ACYA 2CJBA 3Q83A 2HNDA 1SL2A 1RBOB 2HHWA 1PJ5A 2DEIA 3ETMA 4R25A 3K58A 2J6UA 3QFWA 3TO8A 1QTMA 2DGOA 5A2QU 4QWAA 3VZIA 5KT2A 2JZ5A 1F2HA 2AYBA 4ILMA 2LXUA 2A2DA 1HBOA 4F0MA 1JLEB 2A0FB 4M5DB 3HHDA 1DAXA 3AD7C 5K14B 1XBWA 3E01A 1H73A 4ZPWR 4X4UA 2QFIA 1NAQA 2VQEF 3SFUA 5HMYA 5CD4H 3H4BA 2ZFHA 5ETMA 1MWZA 4DL0C 1U6BA 4AFFA 3KK1A 3VAMA 4UUXA 2IDEA 1ZOTA 1EZZB 3RBEA 2ALZA 2WVEA 3Q8YA 4I7FA 3M6WA 4RNFA 1MWYA 4R5PA 4JI0J 1S0OA 5IQQA 1YKWA 5J2NB 2OSQA 2DHSA 3Q24A 1U1NA 1CS4B 4IFVB 2ATCB 3BBFA 1U2FA 3FCVA 3MAAA 2VOOA 5E3PA 4M5HA 4JI2J 1CJTB 2HAFA 4WP9A 4FPIA 1MW7A 1KR4A 5M2PA 5IS2A 1W25A 2B9XA 1SJ4P 2M5YA 4JP8A 4CTAA 3VGUA 4ES1A 4ENOA 4XDCA 3G4SS 4NLUA 4FZVA 1REVA 2VC0A 2HW3A 3VTIA 5F8LA 3PRBA 3SV3A 3LWLA 2Z8QA 4YEAA 2EFPA 1RTIB 3SSRA 3N0VA 3AB2B 5JUMA 2AF6A 5U47A 4QYZJ 2HHVA 1VQOS 3EM1A 4DV7J 4NA1A 4DEZA 2DCUB 3V2UC 3V6DA 2YNHA 4PG8A 2VONA 1VHIA 2QL5B 3SFGA 3TVYA 1H98A 3I5AA 2V9WA 4OYXA 4KH0B 2W4DA 2MQOA 3H8YA 4HEA9 4OYAA 2PI5A 2Q6BA 4F4WA 2V8HA 2RNEA 1NKBA 3S01A 4FKYA 3LWMA 2DNNA 3IM9A 3GSDA 3I55S 3PO4A 4KE5A 4LFCJ 4QZVB 5E3CA 3DMJA 2FB0A 3O6QA 3M8QA 3H40A 3P8BB 4OIXA 2ZITA 3JYTB 1Q82T 3MCOA 1Y10A 1YJUA 3T6BA 2P5VA 3DLKA 2CQ3A 2B4UA 5LSLA 5B0FA 3J80U 2F7VA 3GV8B 1NUEA 5GAGI 3PXGa 2KO1A 3CUNA 1CLFA 3LUYA 2M52A 5C24B 1HR0F 1EQ0A 3MMJA 4M8LA 2UUCJ 4LVOP 4LIWA 3TP2A 2AJ1A 1RU2A 1CJUB 4ITSA 3H5XA 4FYDA 5KT7A 4F2SA 2RS8A 3VVTA 1ICEB 2BOAA 2CQGA 2UXBJ 4OZNA 3G8QA 1FWKA 4RNHA 3LP0B 1FRHA 1Q5YA 4X64F 1XMOJ 3TYTA 2Z2YB 2PO4A 4TU8A 4OX8A 3MR3A 3TZWA 4BDPA 4ED3A 3GR0A 4K7QA 3M8ZA 1V3RA 1S1WA 2W7PA 1KTVA 3MPDA 4X4TA 3BQ1A 3NAIA 2KXNB 4NLDA 1IKYB 4NASA 1T94A 3IRWP 3LAMA 3FSXA 3OUYB 4Z37A 1X4DA 3KTQA 2BM1A 2YQ1A 3HM9A 4PKDB 2R7UA 2UXDF 4NXMF 1HQEA 3T19A 3R8YA 4F4KA 4TY8B 3BPDA 3IWXA 5GAGU 3BR8A 3AY0A 3KHHA 3EICA 3KLHB 4DR6J 3MM8A 1FXRA 1VQ4S 2D3UA 4B9LA 1TMMA 5D0GA 1NO8A 4TLQA 3L9ZA 4O3NA 3HFVA 3S7RA 4H4MA 2R7SA 2DY1A 2D3O1 4A8XA 4WXWA 4BC9A 4M94A 3CIMA 4PQAA 1B0VA 1T05B 4ECVA 3WX4A 2XY6A 1TZ0A 2WSFC 3V4MA 4C8YA 1NZAA 3THVA 3JQJA 2YPZA 1VRUB 4DX7A 3H90A 5D3GB 4QWCA 4OZ3A 2DRBA 4K59A 3H25A 2W8KA 4ZLPA 2B43A 4NX9A 2MY8A 3J81Y 1ZPWX 1MN9A 2ZUAA 1ZAXA 4M5NA 3DRPA 1X9MA 2V34A 1M1GA 1CQMA 2MZ1A 2JNJA 3DC2A 2VQEJ 1GXTA 2D9PA 1FTCA 2AGQA 3FQKA 5I3UA 2EKNA 2RT3A 4LF2A 3THTA 2DGQA 1C0UB 2QLXA 4M5JA 5D0HA 1ZYQA 3IN5A 2VF3A 1HWKA 2M2BA 3KJNB 1XMQF 4RNOA 4DSKA 3ZNJ1 3MM6B 2N4DA 2I38A 1H0HB 4L6V3 4WJBA 3TX8A 4QQBA 5HJYA 4K4SA 4DV3J 4XPCA 2HHHF 2HIYA 3GQCA 2YKMA 1KC8T 2HKEA 2BVZA 2DGUA 2J5AA 4B3RF 3IP0A 1OQ3A 2MKCA 5DGAA 2WOMB 1NK0A 2HS4A 1WG4A 2MHEA 1VQNS 3C46A 4K4UA 2R7WA 4RUAA 4RW4A 3Q8QB 1SH2A 5AXLA 4I67A 2HG4A 3BS9A 3VAKA 3NS6A 3QJJA 2XGPA 1TK8A 1JLCB 2OPPA 4ZPBA 4ZMMA 1Q78A 2ZDOA 4LSNA 1S97A 2GFFA 2GA7A 1AA1B 2DJWA 3RU0A 4OYZA 1HMVA 2VH7A 3M6VA 5CXTA 3IGVA 1ZM4A 4HTJA 1ZM2A 2AJQA 4UZBA 2E5GA 2AJ4A 4F4ZA 3W9JA 3JTNA 1GNKA 1FESA 1HYSA 2ASJA 1LXJA 3PRDA 3MMCB 4HHHA 3ZTRA 4NLPA 4DV0J 2Z2MA 4ZCLA 2AU0A 5KG5A 2WB4A 3ZZUA 4TXSA 2BRLA 4JI3F 2W9AA 1VQ8S 1KLMB 4JUZA 5T14A 1SC3B 3WBZA 1EP4B 1V9OA 4ZVTB 3KLGB 5H9FK 1RT7B 2QV6A 2D74B 2CKWA 1Q5VA 1FX2A 3JAMY 4K4TA 2YVSA 4WTOB 4QBUA 3PJXA 3CC4S 2AZ1A 2AYMA 1Y5IB 2YY3A 1JX4A 5J2PA 1JKHB 2IMOA 1RXOB 4AUKA 3BB5A 5CYQB 2M4MA 3GV5B 1VMBA 3M8WA 3FMWA 4B9NA 2H4WB 4DFKA 3HVAA 6AT1B 2GJIA 4OMFG 3SCIE 4DR1J 5LT5A 2Z58B 2G1HA 1FRLA 5FLXY 4IDKB 2J76E 2OPRB 4DPXA 3D1HA 2C2NA 3C6UB 1F9FA 5KFVA 5CYMB 2M70A 3BO3A 1NM2A 3GPAA 9ATCB 4DU8A 4NXMJ 2R2TA 2IAJB 3R7BB 4ERDA 4NLXA 2QMUB 4URGA 4QIFA 3CCRS 4OI4A 2ZH1A 1N32F 1UW9A 2E9ZA 1EHWA 4TNOA 3C14A 4WTYA 4GO5X 5DLFA 2OMLA 1WD6A 4UZCA 3NGDA 2HFZA 2BJ7A 2DNRA 3KJFB 3DI6B 1U02A 1IVZA 3IWNC 1NDLA 1RAIB 1KVKA 5A76A 4NLOA 1J5OB 3D5MA 3C2PA 4U67Q 2VZ9A 3H42A 2EWHA 1U09A 3QIPA 5HL7Q 4M5KA 3PW0A 5HBMA 2VODA 2M7SA 4EK2A 3SMZA 2ZH3A 5M2RA 3NGTA 4DWIA 4FNHA 5CQGA 3JXOA 3V81B 1W2IA 1H74A 4Q2LA 2D3ZA 4PR6A 2C2OB 3MECA 2OO4A 4KB7A 3WIVA 3AJDA 4CO3A 1MMNA 1UFKA 2RDJA 5D4OA 1BY9A 1KHWA 2GQQA 2PMHA 2MQPA 5KFZA 2GVDA 5CD4A 2DNZA 4DUZF 4CO2A 1JJCB 3ISNC 2ZE2A 4U7UD 4PAAA 1X5OA 4ELTA 1HHQA 3FCWA 4KHPJ 4HHJA 3HHKA 3RAMA 2VU5A 3UD4P 4J5OA 1S1VB 1WEZA 2BEFA 3MD1A 1XMQJ 3RBDA 2AHOB 2D1CA 3EZ5A 4X4NA 1FXDA 2M8HA 4B9VA 4F4AA 1N8RT 4ZCIA 4ZIVA 2UV8G 3TARA 3MTKA 2W2QP 1R8BA 1QAXA 3MM9B 5IT4A 3OTBA 4TU9A 3H2UB 2J6SA 1TK0A 1CQNA 4NLVA 4M95A 2MKKA 2EK6A 1VJQA 1LWCB 4ED5A 1TKTA 2HFNA 2JVRA 2Y1RI 4RL1A 4CO4A 2VFUA 1RAOA 3QRQA 3BREA 3D4JA 5D78A 5DDQC 1WDTA 1UL3A 2A18A 4O3QA 3PHTA 2I5JB 1SKWA 2J8AA 5D4LA 3QGHA 1TELA 3KK3B 1TUGB 1VBXA 2ALYB 1HIYA 3NGKA 1JLQB 8AT1B 1E6VA 1YG0A 4E98A 3VAJA 4KJIA 2BW2A 5C25A 3H2LA 2KG1A 1S9GB 4B02A 3NWGA 8ATCB 1HNWF 1DRZA 2GIQA 1RTDB 1IKWA 1D8ZA 3V5RA 4KKOA 4QU7A 7AT1B 2N3LA 1L3VA 5DJBA 3FEZA 3UD5A 2UVUA 1IQTA 1NK6A 3DOKB 2QN6B 5HLFA 2AMCB 3W5XA 3NY0A 3OL7A 1VLYA 2H5JB 3GFHA 2QMWA 4JI3J 4IH5A 4EZ9A 4CLTA 2J8SA 3KJQB 5A6WA 1UKUA 5LM7E 4O3RA 4PXCA 4CYUA 3POTA 2LECA 1NDCA 4TQSA 1S77D 5K8OA 1WOSA 4J9LA 5DG8A 3CJ3A 2V63A 2RHQB 4FF3A 3KG0A 5F8GA 2O1PA 3GJRB 1WC3A 4QYZK 4K4VA 4GRSA 3G86A 4X4VA 2IYGA 2NYIA 5KTQA 3HI9A 4HHUA 3C3LA 5KFCA 5DM7Q 2CPZA 4USTA 3GR1A 3L95X 4QR1A 3G8TA 2J7KA 4X4PA 3WZ0A 4ZVUB 1S6UA 2CWXA 2K1RB 4RUHA 5C42B 4OHWA 5AXNA 1KQSR 2B7CB 2LA6A 1FE4A 1Q0NA 3QQCD 4CIOA 2RVJA 2DH8A 4CLKA 4NA3A 2XLKA 3NOGA 4C8LA 1K0VA 3OJSA 4K0KJ 4DPUA 5BR8F 3VALA 3PYEA 3OL6A 5B0AA 3UNYA 2ZBRA 2PFFB 2UUAF 3AA8A 2NLWA 3FBCA 3HVTA 4ZPAA 5I42A 4Z7CA 1RKIA 4Y28C 2VG5A 2OIHA 3PACA 2CPHA 4NLTA 4NA2A 2DHXA 2E66A 3D0HE 1I1GA 1S6PA 3ZFVA 3PR5B 4C3MA 1SH3A 4X4QA 3CJ4A 4RW7B 1L5UA 3KWMA 1T9XA 2G2OA 1NPPA 1YHQS 2PDAA 5KG2A 1CC8A 4QCLA 1TV6A 3KFWX 4ID8A 3R3TA 1N5VA 1N48A 3JQMA 2QFJA 3JAMU 1S1UB 2IA6A 4ZA1A 5GVQA 1YJNS 3RAQA 2MGZA 2B9WA 5L38A 3BPSP 1WNEA 1RLDA 5E3RA 4P72A 4DMZA 4BWJA 4DPYA 1GQEA 3I9ZA 1YJWS 1KSPA 3V6JA 3ENVA 2NXEA 2ZH8A 1LWEB 3OSNA 4PRFA 2CJAA 4JB8B 2OHDA 3M1VA 3KK2A 1IBKF 4DUZJ 3KYLA 3H2VE 4UF4A 5LXYA 5HVGA 3D6FB 1QAJA 4A8WA 3CIZA 4NI2B 2DHHA 1VC0A 2M9KA 4ZVGA 3X3UA 3MAQA 2MJNA 4CM0A 1YGYA 1Q8IA 2WBRA 1D9DA 3R9LA 5IT9U 2XLJA 2CQ0A 5DS7A 7FD1A 1VQYA 3MPYA 4DL4A 2PD1A 4ED0A 3ZNUA 1YJ9S 1GK8A 3UR3C 3W62A 5H9EJ 2XYPB 3TJAA 3M30A 3SCJE 3CC2S 1RYRA 4GVBA 3CXCR 1OS5A 4OHVA 4ECYA 5KFIA 3AFGA 2WAQD 2XYGB 2HNYB 4RPFA 2IYIA 1YI2S 5B0GA 3E8OA 1H7WA 2FQQB 2XHCA 3I4PA 5HP1A 3DDKA 4J90A 1QJHA 4RBVA 1PYSB 4I2QB 3I96A 3R5CA 2ZNYA 2ZH5A 3M4XA 4CLLA 1PC4A 2XNRA 2IVMA 4G6VB 2SXLA 2J9EA 1WEXA 2OI2A 3ZTPA 3PNIA 2AYEA 2MHNA 4ETZA 1GXLA 2BQUA 2H65B 4NCAA 3UDCA 1O0PA 1FKOA 2QA1A 4DL6A 2W2NP 4YB7A 2W2MP 3TA0A 2KZZA 2E29A 3V4IB 3ZTOA 3Q8RB 1FVQA 2CQPA 1JWWA 2HZVA 4GC7A 2VC1A 4KSEB 4MJKA 2J9CA 2UU9F 1XN9A 3ILOA 1HNWJ 2XO6A 2KYXA 1U1MA 3DLLQ 3O1LA 2IC3B 4KGMA 1RLCL 4F3QA 3R5AA 3QRPA 2BV3A 2B5JB 3B4DA 3F56A 1T3NA 1R8CA 2MQ8A 5DETA 1S1TB 3Q8VA 4F36A 4ED8A 2BUNA 1VJWA 2Z2ZA 4OI6A 2R3VA 4Q0BB 4IH7A 2G2ZA 4PXEA 3RAXA 2MEWA 2XULA 3FFIB 1IKXA 5LL6d 5KG6A 3OVBA 5BXIA 2HSEB 4DV2J 4G65A 5EUHA 1VC5A 1D9AA 1FWLA 4FN5A 4LSZB 2VG6B 4YY3J 1GFWB 3G8SA 4B08A 4Y6IA 4I1TA 2Y1LB 4BBYA 3Q23A 3ET6A 1FD2A 2FJEB 5DQGA 4ZJOA 2RMLA 1PKUA 4LVNP 4FVMA 5EX0A 3LGMA 1DJ0A 2QT7A 2V8GA 3EGWB 2KFZA 3UE2A 3M8YA 4CO5A 4ILLA 3RZAA 1FDAA 3D28A 4PWDA 1VI7A 1U4BA 4P9SA 2XSJB 3M8PB 1IXKA 4ZHRA 5BR8J 3LH2S 3Q8UA 1ZETA 4HT7A 3SCKE 1TKXB 2UUAJ 1JMTA 2A6OA 3VHQA 1KOOA 4USJC 1SUQA 1IR2A 3ELHA 1OQ6A 2DGTA 4IOAQ 3VGSA 4YB6A 2PC6A 3QSYB 1VC6A 1VQ5S 2EBGA 2AJ2A 3J7A1 3OVAA 4FYXB 1SJ3P 3L09A
chains in the Genus database with same CATH topology
2CQ4A 2X1FA 4N8NA 4WFYA 2NQPA 4CH1A 2HHTA 4RBUA 3SQGA 3BDPA 1MMLA 2OPSB 3MOZA 1QLNA 4O4GA 2ZOFA 1KNZA 4ZP6A 5F8NA 4ZPTR 1HL6A 4I64A 1TKZA 4DR6F 1NHVA 4C0BA 4IG0A 3NMRA 3MCSA 2QO3A 1KQGB 2ILYA 3NBPB 3QIPB 2OPQB 4FS2A 1X9WA 2KU7A 3BGRB 1WF1A 3TOQA 1NJXA 2IAJA 5AE2A 1VIXA 4CNYA 4YR0A 3VR1A 1SKRA 2DO0A 4FF2A 1H6KX 2RJZA 3K57A 3DYAB 2YKPA 2DH7A 3MDFA 3M9MB 2I9SA 2KRRA 2RE1A 1S1XA 4O23A 2R8GA 4UOCA 2JLFA 2CQHA 4DS4A 2PIIA 1HHTP 4FF1A 1HQUB 2XG8A 3BM7A 2JX2A 5KFJA 2ZOGA 2V4QA 3CO9A 5A2QY 4DN9A 4KQZA 5E33A 1R27B 3DI6A 2HVZA 4YDXA 2V9KA 2GNKA 2CVEA 1T02A 2EFGA 2CPIA 3HHLC 3IFEA 1ROFA 3MECB 4KO0A 4OX6A 3L7PA 3US5A 5GAHU 4QOTA 3PX6A 2CQ1A 4XIUA 4UW2A 1D8YA 2B3TB 2EVZA 2K7KA 3EXCX 4DR2F 1DHMA 2E1CA 4V19J 3HXMA 2QA2A 3F44A 3BSOA 1R0AB 5DGBA 1J5OA 2ACYA 2CJBA 2KI2A 5KFGA 3HZGA 2HNDA 3CJKA 1SL2A 3DHXA 1KQKA 4A8QA 1WTBA 1Q8BA 2HHSA 2HHWA 3MI7X 4R25A 4QWEA 3K58A 2J6UA 3TO8A 3D54A 1QTMA 2HNZB 2DGOA 1T3OA 1ZPVA 4RW6A 3KMSA 4QWAA 2W9BB 3KG1A 1N54B 4FP9A 3VZIA 3R1LA 5KT2A 1TVRB 5JVGQ 1HNVB 2JZ5A 1JLGA 2AYBA 1VK8A 4ILMA 2VBXA 2LXUA 2A2DA 1HBOA 4XO0A 1RT2A 3BEGB 4RX6A 4QWDA 1RWUA 1CEZA 4PPZA 2BR0A 4A8MP 1JLEB 2JHEA 2UUWA 3SDEB 4M5DB 3HHDA 1DAXA 2MXYA 5K14B 1XBWA 3E01A 3V81A 4ZPWR 4BWMA 3HO1A 1APSA 1BWEA 2MQQA 4DQQA 4X4UA 2KTQA 3G96A 3TR5A 2HRUA 4UY8T 1FKPB 1ZTTA 2HHQA 1NAQA 4DHVA 2VQEF 3SFUA 4D3GA 5HMYA 2RH3A 5CD4H 4RWWA 3H4BA 3RRGA 2ZFHA 3ZZRA 5LMUF 3H59A 1MWZA 4DL0C 5EWGA 1U6BA 4AFFA 2DR9A 2U1AA 2OFGX 3A8EA 4DL5A 5LMNF 1SJ1A 3KK1A 1Y00A 4UUXA 1F0XA 3VAMA 3KHGA 4MFBB 3QPIA 1B0TA 1HNZF 2Z0GA 1GT8A 2D7SA 2I0XA 4OL8A 3KNAA 1ZOTA 2KM8C 4CNZA 3KJVA 3RBEA 4HTIA 2ALZA 3Q2TC 2VASA 1JXEA 4D3HA 1CSJA 3A1YG 2LMIA 4I7FA 3NS5A 2FY1A 3NKYA 3M6WA 3U7JA 4RNFA 5A0YB 1MWYA 3UDLA 3THPA 2WHOA 2HMIA 3T9NA 4R5PA 3CC7S 1RT4A 4CO0A 4ECTA 1S0OA 2RILA 4KFBA 5IXUA 5IQQA 2KDOA 5J2NB 4ZP7A 2J0SD 2OSQA 1HD1A 1BC6A 4GO7X 2CJKA 2B4VA 1DQAA 2R7QA 1TUVA 2DHSA 1LWFB 4LF6F 1GX5A 1RISA 3MEDA 3Q24A 1U1NA 2APOA 4IFVB 5K9FA 1S1VA 1N5YB 1UJ5A 4IRCA 1U2FA 2GGPA 3NCPA 4EO6A 2VOOA 5EN1A 5KFPA 1TKTB 1L3SA 4TY8A 5E3PA 1FCAA 2DHAA 2EG1A 3N6NA 3VAIA 4WIIA 4RU9A 3GG0A 2HWHA 1XR6A 1MW7A 4MIAA 1KR4A 5M2PA 2KH9A 4JV0A 5DO2A 5IS2A 1RQ0A 3I5CA 1W25A 3OXGA 3IAM9 2R2SA 1UVIA 2B9XA 1SJ4P 4J9SA 2M5YA 5D77A 4CTAA 4ES1A 1R8HA 4XDCA 3K5NA 3G4SS 4NLUA 4I2PB 4FZVA 1REVA 3L7OA 2VC0A 2HW3A 4HVZA 3VTIA 3JSRA 5F8LA 3PRBA 1JNRB 3MM9A 2AW0A 1LK5A 3SV3A 3QGGA 3LWLA 2Z8QA 2R9LA 4JI7F 2FC8A 2H9ZA 4YEAA 2EFPA 1R3NA 2YWEA 3P6YC 1RTIB 2VV5A 3DU5A 1ZAVA 3N0VA 3AB2B 1H3DA 4RW8B 3SSRA 4FF4A 5JUMA 3K5PA 1KVIA 2AF6A 2BE2B 2YWGA 3T6JA 4K4YA 2GQCA 2ZUGA 3OR2B 4OFZA 4DL3A 5U47A 4HI1A 4QYZJ 2HHVA 1VQOS 4C0OC 1XNQF 2B6AA 1T05A 1MROB 3O44A 2FVQA 1RT1A 4NA1A 4DEZA 2HZCA 1RT6A 2DCUB 3V2UC 3V6DA 1NJZA 2YNHA 4PG8A 2IJNA 3DRYA 1LWCA 3IA0A 1ZH5A 3AAWB 4YP3A 1MMDA 2XLIA 1T7PA 2VONA 3AJ2A 3TVYA 3SFGA 1VRUA 5KFLA 1JLFB 1H98A 1GX6A 3PFOA 4EGLA 2EFVA 3N5FA 5C25B 3I5AA 2M88A 4ICLA 2V9WA 1UETA 4EEYA 2KT3A 1KRPA 1DFDA 3DCAA 3VAGA 4N56A 2W4DA 4PQUA 2FC9A 3CD0A 4H4KA 2YKOA 3E2EA 4C8NA 3ENQA 2MQOA 1X9SA 1IKWB 2R7OA 3H8YA 4HEA9 5A6PA 1X4GA 4Y2AA 2MY7A 1XNRF 2C3PA 4KKOB 2PI5A 2JWNA 1Y7PA 2Q6BA 4FXDA 2KRBA 4F4WA 2V8HA 1FJCA 2RNEA 5CHCB 1NKBA 2E44A 4Q2MA 3S01A 2XI3A 4TYBA 2MQLA 3MR6A 1Y5NB 3KK3A 2ZZMA 3LWMA 2DNNA 3I6PA 3GSDA 4RBTA 3I55S 3PO4A 4KE5A 2FLOA 3J80Y 1RAJA 3T5KA 4QZVB 1VHFA 4DL2A 5E3CA 4UQGA 1JLQA 3HZEA 2ZHAA 3DMJA 1FERA 1FDDA 5KFQA 3FSIA 3OR1A 2FB0A 3O6QA 2ROPA 3M8QA 4K0KF 1HPZA 3H5SA 5IWAF 3H40A 2ZJPQ 4C97A 3N28A 3N5BA 3MZIA 2ZITA 1IKVB 4OIXA 3JYTB 2LKZA 1Q82T 3D1OA 2CJ9A 3SQGB 1WHWA 4DR7F 2R7VA 1YJUA 3LP1A 3T6BA 2P5VA 3POTB 2EKYA 2CQ3A 2FHJD 3DLKA 4ID5B 2B4UA 2B0GA 5J2MA 5IM0A 4ZK7M 1T95A 5LSLA 2C3MA 1C1BB 5B0FA 3QAUA 2NPFA 2F7VA 3GV8B 1HW9A 2LU1A 1S9GA 4N77A 2BA9A 4DS5A 2Y0SD 2JH3A 5GAGI 2D3OR 2KKHA 3PXGa 4F2RA 4JI1F 2KO1A 3CUNA 1D0EA 5HMWA 1HA1A 2BANB 1CLFA 3LUYA 4ZS6A 3DLEB 4Y2IA 2M52A 3IG1A 5C24B 1P27B 1ZM9A 4V19X 1HR0F 2HGNA 4N41A 2XMTA 3MMJA 3MM6A 3FSYA 1X7VA 5CZXA 4M8LA 3DOKA 3HT3A 2ATLA 3WDOA 2GHWA 2HIQA 2XSFA 4LVOP 5FDLB 2X3GA 1FDNA 4LIWA 4ZP8A 4LF5F 4AL7A 1GH8A 3W2WB 4U9RA 1B7FA 3TP2A 2XS7A 2AJ1A 2D9OA 4MK9A 2XY7A 5F3ZA 2BOPA 2XWYA 1M0SA 4ITSA 4KHMA 3OPKA 3H5XA 4MK7A 4FYDA 5KT7A 4F2SA 1U1PA 2RS8A 4EU0A 2UP1A 2F9DA 2DNKA 4NRTA 4RW6B 2RB7A 1F5AA 2CQGA 1Y9OA 2U2FA 5FIIA 4OZNA 4F4XA 1Q8LA 2PI4A 2RKIB 3G8QA 4RNHA 2VQFF 2OP5A 3OFHA 3LP0B 1FRHA 3T1AA 1HBOB 1RT2B 2EG2A 3MTJA 2LQBA 1C0TB 1U45A 3IO1A 4RNMA 1NJWA 4X64F 3TYTA 2L9DA 3QJPA 1UVJA 2PO4A 1HWIA 4TU8A 4WZQA 2D41A 3ZC4A 4LSLA 4OX8A 3MR3A 3QZ8A 3MM5A 2VB6A 1R8PA 4BDPA 3S8SA 3HJFA 1Q86T 1UVNA 2F9JA 1WHXA 1HARA 4ED3A 3GR0A 4WYWA 1L3TA 4CO1A 4N8OA