3CPWR

The structure of the antibiotic linezolid bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
81
structure length
81
Chain Sequence
SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
publication title Crystal Structure of the Oxazolidinone Antibiotic Linezolid Bound to the 50S Ribosomal Subunit
pubmed doi rcsb
molecule tags Ribosome
total genus 21
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2008-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R PF00276 Ribosomal_L23 Ribosomal protein L23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3cpwR00
3S8SA 1VBXA 5CXTA 1W2BR 4IUFA 3VAKA 1A9NB 2M0GB 1VQPS 2MZ1A 2E5HA 2MQPA 3U1LA 5GAEU 1WG5A 1U1QA 3NNAA 2DH9A 2BOPA 1X4CA 3S7RA 4YUDA 1VC6A 5FJ4A 2L9WA 3CULA 1FHTA 3VAJA 2CQCA 2MZQA 3I56S 2XNRA 3BEGB 3NMRA 2CQ2A 2DITA 2OJ3A 2KRBA 2XSFA 2MB0B 1UAWA 4CH1A 3R1LA 3K0JA 2MGZB 3RW7A 4Y0FA 1D9AA 2DHGA 3MI7X 2N3LA 2KXFA 5LJ5Y 1YJ9S 2M8HA 2RVJA 2CQBA 4ERDA 1YITS 2MKCA 1WF2A 1S79A 1QM9A 2F3JA 2LQ5A 2AYGA 1FXLA 2MZJA 2HZCA 2G1DA 3ZZYA 2KG1A 1WI8A 1WG1A 2GO9A 2KN4A 3CC4S 1YWXA 1R8PA 1U1LA 2CQIA 5JVGQ 4WIIA 5ITHA 5GAHU 2ERRA 2KFYA 2CJKA 2ADCA 1Q7YT 2DGXA 2HVZA 2CPEA 2XS7A 2LXIA 3TYTA 2CQGA 2ZJRQ 1X0FA 3S01A 1U1MA 2F9JA 1WWHA 3P5TL 2MYFA 2AYBA 2LYVA 3THTA 3BO3A 4LMZA 2RQCA 3CUNA 2MSSA 2M9KA 2CQHA 4ZKAA 3SDEB 2KH9A 3G8TA 1WG4A 4V19X 3P3DA 2UP1A 3HHNB 3G9CA 3G96A 2DNKA 1QVFR 2AD9A 2FY1A 2CPXA 5DM6Q 4IOCQ 2OSRA 3B4DA 3MD1A 2DK2A 4QU7A 4WF9Q 2HYIB 2CQ0A 3J7ZT 3MUVP 2ZJPQ 4M5DB 2VONA 2AYMA 1U2FA 4PR6A 3JB9k 5IFMA 1WF1A 2DNGA 2WBRA 2CPIA 1WEZA 1A7GE 2LXUA 5CA5A 3UD3P 5LJ3Y 1VQ6S 3CC2S 2RRBA 1N8RT 3UD4P 1WHVA 1VQLS 1U6FA 1X4DA 2M88A 1XN9A 3U1MA 2FC8A 3G8SA 3UCZP 1FJCA 2J0SD 2RT3A 2MY7A 1VQKS 2CQ3A 4C4WA 2PEHA 2M7SA 3FEYB 2DGUA 1PGZA 2A3JA 2X1BA 4OZ1A 4IOAQ 5D77A 2CQPA 2LEAA 3TP2A 5IM0B 5GMKa 1RKJA 5DDQC 2VOPA 2M2BA 4TU7A 2HGMA 2K8GA 1KOHA 2CPFA 2MZRA 2MGZA 2M70A 3N9UC 2RNEA 3CCMS 4TLQA 2RRAA 2DGVA 4ED5A 3MUTP 4UQTA 4QPTA 3CCLS 2MZTA 2X1FA 1X4FA 3EX7B 2ADBA 3MXHP 1QVGR 2KI2A 2MQNA 4WFBQ 1FJ7A 3CCRS 5HL7Q 1H6KX 2V94A 2MQOA 3BO2A 4F02A 1SJRA 4J5OA 3Q2SC 1K8AT 1R8HA 2DNMA 4FXVA 3B4MA 3NNHA 5DETA 2YWKA 4W92B 1AUDA 1X4GA 2PE8A 3VALA 2CQDA 2DO4A 2N3OA 1Q81T 2M52A 1U1KA 1UFWA 2K3KA 1VBYA 3RW6A 2MKSA 1N52B 2E5GA 2OIHA 3D2WA 3SDEA 3MD3A 2XS5A 1NJIT 1X4BA 3VF0B 2F9DA 2MPUA 2LA4A 1S72S 2HGLA 1U1PA 1YJWS 2G4BA 4IO9Q 5GADU 4CQ1A 3NNCA 4PKDB 1KC8T 1P1TA 5IQQA 3LPYA 3L3CA 1DZ5A 1YJNS 2DNNA 3MDFA 3VAMA 2MKHA 1X4AA 2MKIA 1SJ4P 2NZ4A 2XNQA 3S6EA 2DGWA 2KVIA 4EGLA 1F9FA 2HGNA 3NS6A 1VQ4S 2MZSA 2KM8C 1JMTA 2ZJQQ 1HD1A 1UP1A 2CQ1A 2MHNA 3UE2A 1H2TZ 1HL6A 5D78A 3VAIA 2EVZA 2NLWA 3ZZZA 1DRZA 4QQBA 4YB1P 2B0GA 2E5JA 3P6YC 3PIPQ 1FJEB 1K73T 1WHXA 1SJQA 3DXBA 1OO0B 4YOEA 2KXHA 3CPWR 2MKJA 3TO8A 2FPHX 4LIRA 1VQMS 2U1AA 2JVOA 1YTYA 2J8AA 1L3KA 4QU6A 3VAHA 1VQ5S 3DLLQ 3CMES 2CPHA 2MKKA 1FNXH 1VQOS 1N54B 2D9PA 2DNQA 3G71S 2X1AA 1H2UX 1PO6A 2FHOB 1VQNS 3VAGA 2M8DB 1FT8A 2CPDA 2OTJS 3CF5Q 1M90T 1X5PA 2DO0A 1OPIA 1WEXA 5DDOC 3MOJB 2LEBA 2DGOA 3CCES 1SXLA 3IRWP 3CXCR 2LCWA 3H2UB 2LA6A 2RS2A 2KG0A 4CIOA 3LQVA 3UCUP 2CPYA 3SMZA 3CD6S 1WF0A 1X5SA 2L41A 1BY9A 2DNOA 1YI2S 1X4EA 5LXRA 5BJRA 3BO4A 1U1NA 1KD1T 1WHYA 2YH1A 4WFNQ 1CVJA 4C7QA 3R1HA 3Q2TC 1M5KC 3CCVS 2KXNB 1B7FA 3I55S 5DM7Q 2DNZA 2E44A 1D8ZA 2D9OA 2RS8A 1VQ7S 3CC7S 5GAGU 2DHSA 2OTLS 3P49B 3EGZA 1URNA 1U6BA 1VBZA 1X5OA 2DGTA 2X1GA 2MY8A 4WKRA 1FO1A 2DIVA 3UCGA 3FEXB 2DNYA 3MUMP 4Z2XA 2OSQA 2D3OR 2MQQA 1YHQS 1RK8A 3THPA 2MMYA 4F25A 3NS5A 2XB2D 1WEYA 1ZZNA 2I2YA 5H1SV 1IQTA 3IWNC 4OZ0A 1M5VC 1X5TA 2O3DA 1G2EA 4CH0S 3G4SS 2LMIA 5JVHQ 2L08A 2CPJA 2BZ2A 2GHPA 1U1RA 1M1KT 3EGNA 2DGSA 1JJ2R 2M4MA 2YTCA 1VQ9S 5LSOA 5DDPC 2RQ4A 1Q82T 1SJ3P 2EK1A 5GVQA 1OWXA 2RUGA 4BS2A 2LKZA 1JJHA 2KU7A 2MJNA 2DNHA 1NO8A 4W90B 1KOOA 2SXLA 5EN1A 2KHCA 5CYJA 3G6ES 4WFAQ 4UY8T 4WCEQ 4RU2A 2N7CA 2AYEA 2Q79A 2DHAA 4P6QA 2J0QD 1N88A 2KRRA 4Y00A 4C0OC 2LECA 3BS9A 1HD0A 3MURP 1NU4A 1Q86T 2VODA 3CCJS 4FXWA 2JWNA 2XS2A 2DIUA 4TU8A 2QFJA 1M5OC 1YIJS 3UWTA 2MQLA 3PIOQ 3VAFA 1WELA 3CMAS 3US5A 5IM0A 1WHWA 3R27A 2I38A 2KYXA 5LXYA 1UW4A 2MXYA 3J7YU 1KQSR 1DBDA 2VOOA 2U2FA 3ULHA 5HO4A 4U67Q 2CPZA 5MLCV 1VC5A 1O0PA 2YH0A 2DH8A 3HI9A 5LSLA 2KM8B 2RU3A 2JRSA 1P27B 2DGQA 1VQ8S 3CCQS 1JJ4A 2DH7A 1OIAA 2MJUA 1WI6A 5DDRC 3CCSS 2DNPA 2JX2A 3OW2R 2G0CA 1DHMA 2DB1A 2DNLA 1M5PC 2EK6A 2QEXS 2DHXA 2CQ4A 2N82B 1X4HA 3SXLA 4PRFA 2MQMA 2E5IA 3V4MA 2JVRA 4LJMA 1H2VZ 3CCUS 2QA4S 2MSTA 1U1OA 1HA1A 1K9MT 2DNRA 2YKAA 4A8XA 2DISA 3H2VE 1SJFA 4TU9A 4F26A 1ZH5A 2KT5A 1WTBA 2FC9A 1ZZFA 2J76E 1VC0A 3CTRA
chains in the Genus database with same CATH superfamily
1W2BR 5J2PA 3NP5A 1IKVB 1VJWA 1WACA 5C2GA 1FDAA 1SUQB 1NSKL 4E98A 3HVAA 1HBUA 2HS4A 5ETNA 2DITA 1HWLA 4BLGA 5L1LA 2MGZB 1VQYA 4RW7A 5C2CA 3UN2A 5KG4A 1KVJA 4KKOB 1YJ9S 2C2OB 1LWFB 2HURA 1S6PB 5D0RA 5KG7A 4ZPBA 2WW4A 2PMWA 2Z58B 1YWXA 3JSRA 4GVBB 1HWJA 3ITHB 4WIIA 2ZM6J 5HANA 3BQ1A 1WNEA 1U1MA 3P5TL 4ZJOA 3BSAA 5C42B 3BO3A 3AXMA 2XY7A 4ZKAA 2KH9A 1HQ2A 1OY6A 2G13A 2KTQA 4H4MB 1UWBB 1AA1B 1PAUB 2LQ9A 3HSZA 5HLFB 3ENAA 4A8KA 1Y11A 2XZWA 2B5JB 4RW8B 2GAHC 1UA1A 4F67A 2CVEA 4L3NA 4K4WA 2RRBA 1S76D 3M8RA 3BYRA 1IR1A 5K9FA 1XR6A 3KUGA 2BJ3A 3NOCA 2FUG9 2HKEA 2G0JA 2XMAA 3KLVA 4QOTA 4UT4A 1CJTA 2B7BB 3MPWA 1HYSB 1BHNA 2P9GA 3DXSX 3GG0A 2M70A 3N9UC 5A2QY 2DGVA 2A6MA 2QLJB 3I87A 2VC1A 4UZBA 4AE5A 3CDWA 3ZZTA 1S48A 3ENWA 3LA0A 1NKBA 1JLGA 3UDVA 4Y65A 4J90A 3FBCA 4F3QA 4NXNF 2GIRA 4R5PA 1EP4B 5LMNJ 3VF0B 1RUSA 3RTVA 2BM1A 2GJ2A 3QIDA 2VH7A 2HRYA 2JEFA 4D3GA 3A3OB 2WSCC 5JMNA 3CEDA 2HW3A 3VAIA 2J9CA 4HH1A 1XNQJ 5U47A 4ETZA 2VA2A 4R0EA 1HI0P 4ER8A 4C3KA 4LF8J 4DLGA 3PCOB 4UOFA 1S59A 2ILYA 5KFIA 2EI5A 1UZHA 5B08A 1VRTA 1FT8A 3Q8YA 2LEBA 1YSJA 3HDSA 4I6AA 2Q3PA 4TLRA 4URGA 4U9RA 3VZIA 2OPRB 3OTEA 3JQMA 4FYDA 2OPQB 3PW0A 4I7FA 4WFNQ 1CVJA 2VQEJ 2RHSB 4C8OA 1M5KC 2Z30B 3I55S 2E44A 5GAGU 1D09B 2MKYA 2VKZG 4ZP6A 4IFVA 1SC1B 4U7UK 3IWLA 5D6GA 4KFBB 4KPYA 1FESA 4F3OA 1RT1A 3M2VB 1IQTA 1QSYA 2OKQA 1J5EJ 2R2RA 3BGLA 4RUBA 2BV3A 2CZ9A 8AT1B 3ZZPA 2WSEC 3R6GB 3HFVA 2YTCA 1EB0A 1V6HA 4DV0J 1R8CA 2RUGA 7FDRA 4WTYA 1I5OB 4J91A 4X84A 1M1GA 3DGPA 4MK7A 4D3HA 1GT8A 4F50A 1C0UB 1HD0A 1BQXA 1HQUA 4DSLA 2VODA 3THVA 5KFJA 1O6XA 3CJ4A 1MLAA 4OV1A 3CMAS 2I5JB 4YS2A 4OFZA 1Y7PA 1X0PA 3PV8A 5JXSA 2ZOMA 4TQRA 3J7YU 3PY8A 3BKUA 2JL9A 1TKZA 4DR4F 3DYAA 4GKJJ 1N5YB 4JP8A 3AT1B 1WC3A 1DHMA 2XTJP 5F8GA 1FKAF 5E5NA 4CYUB 4JB8B 4WXWA 3MFIA 4DR7F 1RA6A 2YKAA 3MEGB 2YNFA 5BYSA 2QLXA 1X9MA 2M0GB 3A8EA 5DRKA 2FJWA 4R8UB 2FVSA 3EE3A 2QSFA 2E1RA 2BOPA 5T41A 3MPVA 3MPUB 1O51A 4Y0FA 1JKHA 3MEDA 2M8HA 1S79A 5HSPA 2JZ5A 2YNGA 3LGNA 1FERA 3AODA 2DGXA 4QIGA 2Q66A 2ZJRQ 4KGMA 1ZM3A 2LYVA 2W01A 2AJ1A 4CZCA 1PILA 2ZC3A 2XULA 4F4YA 3P3DA 2YBVA 5BXIA 4TN2A 3RGIA 2G2YA 1SKSA 3VZHA 4KV8B 2OSRA 4ZP8A 2ZOGA 4ECQA 4QU7A 3C15A 3DM2B 5GMEA 4KE5A 2YKNB 4O0NA 2W7AA 4PG8A 4IRCA 2E7XA 3POTB 2CPIA 1WEZA 1J27A 2VDHA 5DG8A 3QYYA 4LFCJ 1LV5A 3OL9A 4ED0A 1N5TA 1SL1A 3PEHA 4M95A 4IDKA 1R8BA 1RWMB 2H5EA 1T9XA 1S7HA 5DDQC 3ADAC 1X9WA 1TK8A 4JI3F 3M1VA 2ACMA 5SUHA 5KFBA 3MUTP 4B3MJ 4HACB 1VOMA 4DSKA 1F3VA 3MXHP 2XMTA 4J9QA 1WKJA 4MIBA 4IG3B 4OI1A 2FJBB 3HZGA 4K5SA 1C4AA 4ZVOB 5A8KB 4XPEA 2FJAB 4DHVA 1NJIT 1UVKA 2MPUA 3TX0A 2C3UA 4IO9Q 5GADU 3EPGA 3JQKA 1KC8T 3LPYA 3E3XA 1LWEB 4DN9A 4ZVPB 3AOAA 4EGLA 5H9FK 2AJ0A 5KT4A 3RB3A 4DOZA 5D78A 2JLGA 1FI4A 1DRZA 3OPKA 1EAYC 4JI8F 5AJ3F 4HTJA 1WOSA 2Q1LA 3TO8A 2R7VA 2UUCJ 1TL3B 3GJRB 2LQBA 2HQCA 1L3KA 3CJSA 3DLLQ 3CMES 2AJ4A 2Y1JA 2JLFA 2FLLA 4LRFA 3MM6A 3BN7A 5J2QA 1J2VA 3T6JA 1HBNB 4U7UD 2CPDA 2C3PA 2J7WA 4MMOA 1OPIA 3DLKB 1FEHA 5LL6d 1RTJB 1KNZA 2XHCA 4RPFA 2AJFE 3UDLA 4QWEA 4DPWA 3H4BA 5EWEA 4WE1B 3D3CJ 1RT7A 1KD1T 5L9XA 3Q2TC 3BBBA 3H2LA 2DHSA 4DX7A 3WX8A 3AXKA 1PG5B 3MUMP 3M2RA 4YB7A 1E6YB 2VFRA 4X2BA 2KYZA 1UVJA 1EX8A 3AD9C 1R0BG 2ZZMA 1NJYA 4DL3A 3W9IA 4M5MA 4HT5A 4PG5A 4OI3A 1S6QB 3KG1A 4IR1A 3MFHA 3TQ1A 2GW8A 5D4OA 5F3TA 1UW9A 1Y00A 5T7LB 5KT5A 4X64F 3QQCD 2W7PA 4LF4J 2GVDB 1IKYB 5EN1A 1ZM4A 3QATA 1SKRA 2GMHA 1S99A 1TL7A 2N7CA 2AYEA 1RT6A 3MEEB 4A48A 2FLOA 2L9NA 4ZIVA 1M5OC 2H5IB 1I3OB 4GRSA 2E1MC 2XMWA 4K4XA 1KVIA 2CPZA 4QPXA 1P27B 1UFLA 3BB5A 5KFCA 2WOMB 2VICA 2D3O1 1XC9A 2VPXB 4RW9A 2VG6A 4P7VA 4JI0J 2QX0A 3B8HA 2IVYA 1URRA 2FVCA 3V5RA 4DX6A 3K58A 4CM0A 3HSGA 4A8XA 2WW8A 3IFEA 2BANA 4FNIA 1VBXA 2XYPB 3SEOA 3C6UB 4RNHA 2EWHA 1N32J 3J7Z5 2B7CB 4K59A 4M5NA 3T3FA 3FSYA 1IBLJ 1IKWB 1UAWA 5LJ5Y 1IN0A 2Y1IA 4DL0C 5IOLA 2UXDF 2DR8A 2CJKA 3WIVA 1ZTTA 2YQ0A 3CMQA 2WVBA 1H98A 2HQIA 2RQKA 5LM7E 2A2CA 2ZBCA 4K2JA 2GAGC 4O44B 1N5VA 1WG4A 5BYRA 2UP1A 2D1CA 3V81B 3MTKA 2CWXA 6FD1A 1UVMA 1RT5A 2NR0A 4M5IA 4DMZA 2B6AB 3EWGA 2DK2A 5D4NA 2RJZA 3IRXA 1YRUA 4ED4A 2XY6A 1VK8A 3M32B 3OVBA 2IRXA 2HFSA 4DS5A 2VIHA 5CA5A 1YKWA 3GIJA 4WU3A 4DV3F 3UCZP 4DPUA 3ZZ0A 1IKVA 2MY7A 1DLOB 2KHDA 4C97A 2J6TA 1JLAA 5B0BA 3KMSA 2DGUA 4JYAJ 1OJ4A 2OELA 2YNHB 5A0YA 1RKJA 2VOPA 3GR0A 2MGZA 5B0AA 4USMA 2AW0A 3G82B 3BPSP 4KKOA 5B0FA 2R4FA 1JIHA 2JFKA 1VI7A 3PKMA 4L3KA 4KO0B 4G1QA 1PAEX 1SJRA 2YWWA 1RWOB 1HI8A 1FRLA 4KT0C 2H4WB 2B4PA 1K1QA 5C42A 1AUDA 3CJQA 2K3KA 2DVIA 3KMQA 3UNGC 2QA4G 3I32A 4DUZJ 1UWBA 3KHHA 2BKPA 5HVFA 5E2QA 3W65A 1RDRA 5B0EA 2BMBA 3ZTPA 3CIMA 4KQZA 2B5JA 1U0HB 4RW8A 3EPIA 2BUNA 4GC7A 2VDIA 4YDDB 1H2TZ 2PD1A 2CNNB 2DTJA 9RUBA 3PEJA 4E8UA 2KDOA 2HHTA 2ZH7A 2YX7A 3B54A 3CJ0A 4UQGA 3T1HJ 1EARA 1VQOS 1N54B 4DV7F 5IWAF 5HROB 1MMNA 3RUBL 1YJRA 2V2ZA 3VAGA 1HLWA 4JI1J 2VZ9A 5B0GA 3P45B 1D9FA 2NYIA 4NZ6A 4L72B 3Q83A 3PFEA 3LQVA 2QMUB 4NLYA 3SCJE 1PSDA 2L41A 2FGOA 5LXRA 1ZTWA 1KFDA 4LSNA 2V68A 4K8RA 4YP3A 3FQKA 1N4LA 3FBEA 3WDOA 2ASLA 1JLEA 3QGIA 1IM6A 3NY0A 1D8ZA 1NNDA 1MU2A 2MEWA 1HI1A 3I4PA 4NLGA 1B0TA 2NXUA 2UUAJ 3A12A 1EP4A 4WXOA 4PZVA 4DG1B 4DL4A 2FJVA 5DQGA 3KK1B 1Q0NA 3THPA 4DL6A 4KY3A 1HNVB 1T9TA 1T03A 1NHKL 2IPOB 1FD8A 3VQSA 3M4XA 2NXCA 4L76A 4ZMMA 4NLDA 3NBPB 2RQ4A 2E9ZA 1Q82T 5GVQA 2L48A 2JDJA 2XLKA 4USIA 1NJXA 3DRSA 4DN0A 4W90B 4LF5F 2SXLA 5L9NA 3D0GE 3CJ2A 1IR2A 4OYMA 2WZ1A 4N5SA 2E9RX 3R5BA 3BS9A 3FSXA 1PKUA 1TU0B 4C6AA 1NK0A 4U8VA 2VF3A 3UWTA 4B02A 2YVSA 2K1RA 2XEXA 5IM0A 3HVTB 1V9OA 4QW9A 2OLWA 4C9DA 1F60B 1HARA 2IIHA 3JSBA 4N41A 4LSLB 1L3VA 1KRPA 4DV2J 4CNYA 3OFEA 1ACMB 3TR5A 1M5PC 1U6ZA 4CI0B 2FLPA 1X4HA 2HNYA 1BQNB 2UZAA 2MQMA 3FUYA 1U45A 3HHLC 1CQNA 1HA1A 1K9MT 1TKXB 3T5LA 5HP1B 3Q8QB 2W1BA 4FYWB 3LWLA 4LF9J 2OPSA 1PIEA 1HFEL 2R7WA 1UA0A 2V6AA 3BGRB 4U7CA 4ECTA 2BQUA 4DR6J 2MB0B 4P75A 3R7SB 1CJVB 3F73A 1DTQB 1RAIB 2JSXA 1S1UA 2PFDA 2UVUA 4PYAA 2BKNA 4U8YA 3ZZYA 4OHYA 1WG1A 2CQIA 4NRTA 4JUZA 3V2UC 1FKPB 4USHA 2CPEA 3HFKA 4X4PA 5B7WA 2I5JA 2DEJA 4PPZA 5AE2A 2UXCJ 3RR8A 3HLUA 4MT1A 4X65J 3KLIB 5I3QA 3GIIA 5KFXA 3G96A 3AOCA 1N5YA 5DM6Q 3B4DA 2IDEA 4M8LA 2YWHA 2BJ8A 2AMCB 4X4NA 2AYMA 3I5CA 3NXZA 4JI5F 3ZTRA 3SFUA 2CWKA 3MEGA 1U8WA 3KWMA 1CSJA 5ETVA 2QL9B 4ZOSA 4Q0BB 2XMUA 1VQKS 4R8UA 1HNIB 3D6TB 3KOAA 2ZNYA 2PEHA 2F8EX 2M7SA 2R2TA 5GMKa 1HW9A 1MN7A 1KOHA 3BGOP 1FFWB 3VWSA 5KTQA 2IJNA 2UU9F 2AJ2A 3H0PA 2UV8G 1HPZB 5A8WA 4DPOA 2QL7B 4OI0A 1TAUA 3PRDA 5CABA 4JV1A 4F02A 4C11A 2J7UA 2HK3A 2QGFB 3MCOA 3D2WA 1IKXA 3FJ2A 3O8WA 2OO4A 4HLBA 2B9XA 2V8HA 1N0VC 4KV8A 1G4CA 4C2MA 2CJQA 5ETQA 2ZE2B 3KLEB 4O0IA 1VQ4S 3I82A 1NH7A 2ZDOA 2Z57B 5CD4H 2DXFA 1XQIA 3IM8A 2C22A 3P6YC 2JC1A 4K2XA 4YOEA 2P2CB 1HMVA 3MMBB 2HS3A 5KFLA 2ILZA 1X9SA 4C8ZA 5GAEI 2IMOA 4ZCLA 2OFGX 1VRUB 1Q1KA 2KVQE 2DNQA 2FDNA 1QTMA 1HNZJ 2C2RA 1X5PA 3OXLA 1RWXB 5KFQA 3B82A 5A8RB 3MOJB 3TEHB 2RS2A 4WWSA 1AT1B 2UXBJ 1LEOA 1XWLA 4TYBA 4OYZA 5BJRA 1QDUB 3M30A 1PYOB 3JAMY 4LF7F 4F8RA 3A1YG 1IQZA 3GQCA 4G6VB 2GV1A 4WP9A 1T0TV 3DU6A 1GTHA 3KXDA 4LF6J 2APOA 1URNA 1LFWA 1VBZA 5A8KA 2HFZA 3GFZA 1AROP 5BYQA 2W2PP 3C6TB 2HVIA 4FYVB 1ROFA 2D3OR 4ZLNA 3ONQA 2MQQA 1UFKA 3NS5A 2H1YA 1U2RA 4F4AA 2ZD1A 3IWNC 1X5TA 3LP2A 4LF2A 2PGCA 1G2EA 3PFOA 2AX0A 4DR5J 2BZ2A 2RE1A 4WFYA 4G3IA 4HR2A 3R6LB 1S1VA 4ILLA 1TL3A 1WDTA 2F4VF 3KJFB 2DNHA 2B8QA 1F2HA 2ALYB 2LP4A 4RU2A 1DQAA 4WTOB 1TKTA 3R3TA 2A18A 4AXJA 4WIQA 2PIIA 1F3FA 2EW9A 1FA0A 1RTJA 3FEZA 3KG0A 3OV7A 4Y2IA 4WE1A 1RP5A 3PYFA 4H4OB 3NAIA 2Z0GA 2J9DE 2I38A 4ZDNA 3HXMA 3K89A 4OQJA 4LRCA 3H98A 4IYQA 4C0HA 2WTFA 3VGSA 2KM8B 5IT4A 5J2NB 2QL5B 1XNRJ 3GONA 4UTGA 1E6YA 2AX1A 2MSTA 4JI4J 4ZIWA 3QNWB 4AL6A 3DLEB 3KLGA 3EM1A 4F0MA 1VC0A 4JOUA 1TMJA 4QJVA 1CLFA 1LOUA 2C3MA 1R6YA 4H4KC 2DR5A 1DJ0A 3NMRA 4ATNA 1NPKA 2GHVC 3DRPB 4KGZB 2DHGA 3L7OA 2KXFA 3X3UA 1IKYA 5K14B 1WF2A 3FK4A 4RUHA 2VFVA 3D28A 1AUSL 1Q53A 4YB5A 4BBYA 2IVFB 5AXLA 2MYFA 5KOWA 4ELVA 2BJ9A 3B78A 2RQCA 3O1LA 3TWZA 3LWMA 3SDEB 4RUAA 3SI8A 1Z1ZA 3HHNB 1RI7A 3VQTA 3G9CA 3UPFA 4ZCKA 4F0HA 2IY5B 4N47A 2WOMA 1S4FA 2ZJPQ 1Q78A 2ZM6F 1EJ7L 3I4HX 2MLYA 1RCOB 2LXUA 2CJ9A 5HAOA 2D3UA 1H72C 1S9FA 2CFXA 1RTDB 3C6UA 3RRHA 1K1SA 2OPPA 4DPTA 5IT9U 3QZ7A 1FVQA 4EEYA 1NDCA 1Y5IB 2FGCA 1Z2LA 2DXDA 2CJAA 1IKWA 1CULB 4DV4J 1BGXT 5D15A 4JI7J 3CCMS 4B3SJ 5K8MA 2ALZA 1BC6A 2FHJD 3QRRA 1VHFA 1HQEB 4CP5A 3BDEA 2POKA 3OHBA 3BO2A 2O66A 3O3LA 5ETPA 5KG0A 3FCHA 5LT5A 4FXVA 4J7CA 1GXUA 3DDIA 2LXFA 3ENVA 1Q81T 1VISA 4DQPA 2OH2A 4YHHJ 2MKSA 2E5GA 3GE9A 4EFAC 1PJ7A 1T9YA 1NDLA 4HHHA 1NKEA 1HBMA 3NNCA 2W25A 2B6AA 1S4EA 3NEKA 1SJ4P 1HBUB 4ZVEA 3NS6A 4A8QA 1HD1A 2OI2A 4B9UA 5F8NA 4RW7B 5I3UA 3HJVA 2BDPA 2BX6A 1FWKA 5LMNF 3R7NB 2J8AA 2E1CA 2ZHBA 4PQAA 3ZNUA 2XQCA 3JXOA 2X1AA 1PO6A 2M8DB 3DRYA 2YNHA 1VRQC 4HVZA 4N77A 4KYZA 3NWGA 1KLMB 5HJXA 4C8NA 3G82A 4XAKA 4CIOA 1D9DA 1LQ9A 3UCUP 1TUVA 2CPYA 1XNQF 2UUBJ 1U8SA 5GAHI 1WHYA 1BXNA 4CLWA 2MHEA 1LKZA 4LF8F 1YJVA 3QSYB 4ANDA 2R2SA 4K4YA 4JI2J 2PA8D 4CLUA 2ZWOA 4Z7YA 4EUVA 4QW8A 3EXCX 2PN6A 3GFXA 3UCGA 4CTAA 1APSA 4Y2AA 1PJ6A 4CO1A 1CJTB 2VB6A 1FE4A 2HZVA 1RWNB 1SQEA 4OYOA 1N5QA 2VQEF 2GHPA 3SCKE 2V9WA 2B51A 2VPZB 4ED7A 2I6WA 3IGVA 5G0RB 4DF4A 2EFNA 4M63A 4HDHA 3M8QB 1Q8KA 1RAHB 3G86A 4EBCA 1S0NA 2VU5A 2F7VA 7FD1A 2OGUA 1JLGB 3N79A 3PTWA 1E6VB 2VQFJ 5HROA 2GS8A 1RBAA 1NSQA 4MK8A 2HQDA 4UOCA 4R5PB 1OY9A 3X1LB 3GB0A 1G6BA 4C0OC 5AXMA 1J5EF 1HIYA 3QGPA 1VDHA 3LAKA 1Y3JA 4WU2A 4I1TA 1EKSA 4DV0F 1CC7A 3CDEA 3DRRA 1VC5A 3OUYA 3MTJA 4Q8FA 4M5JA 3OW2R 1S0MA 2FVRA 2XHWA 4RNFA 1S7IA 2CQ4A 3WX4A 1AZSA 1TVRA 1XMQJ 3BR9A 3DHXA 3L9ZA 2Y0BB 4MK9A 3KK1A 3QJJA 1U1OA 2Y0SD 2YKMB 1T3OA 3CD7A 4OZ5A 1FTRA 4K7QA 1KDNA 2ZHAA 1HNVA 1VRTB 2DRDA 4QR2A 4F26A 2CNKB 3W8GA 3DMJA 5HVHA 3IN5A 1ZYQA 1SH2A 1GK8A 5G4DA 5GAEU 3D54A 3NNAA 4GKJF 4YUDA 2ASDA 3CW2C 1RHMB 4I7FB 2XZTB 2XSFA 5ETKA 2A0FB 4OV6A 2FVQA 3HX9A 4OHXA 3ET6B 3NS7B 5KFRA 2HZCA 2J0XA 4ZCMA 4F4WA 4IFVB 3OXFA 4HL9A 2KFYA 5CH7B 2WRMA 3OLAA 4FP9A 3MR7A 1RT1B 2HZAA 3D5MA 5C7PA 3MR3A 2DEIA 3KNAA 1RAFB 1TL1B 3ISNC 2E7VA 6FDRA 1Y5LB 2A10A 3PW4A 3FVYA 3G87A 5K8PA 2H48B 1K0VA 2DNKA 3E01B 3H90A 1NSPA 2HBZB 3PYDA 4OI2A 5EHHA 3MUVP 1RAAB 1Q7LB 3PO5A 1BQNA 3I96A 5IFMA 5THWA 3HSJA 3DGVA 3C14A 5LJ3Y 3CCZA 4I56A 2VBZA 1X4DA 3DGPB 2M88A 3QSIA 3G8SA 3SYZA 4HI2A 4BDPA 2R7RA 1F5BA 1TAQA 1HQUB 3ZTSA 3TZZA 1RHJB 4IFYB 1IR0A 1G1XA 2J9EA 3TZXA 3TP2A 4Z7CA 2DD8S 4Y3CA 3TA1A 2M2BA 2EC2A 3WIUA 2K3IA 3HT0A 1CJVA 1DTQA 1FF2A 3M9OB 1TKZB 2VBWA 4R25A 4ED5A 4RNOA 4TKTA 2IDLA 3M8PA 1QVGR 4LFCF 2KB2A 2MQNA 3HD2A 3H4DA 3R9LA 4DQIA 3VALA 3R7BB 4C48A 2ZBQA 1U1KA 2YNFB 4J9KA 5H9EJ 2QT7A 3KLIA 4CQ1A 1ZOTA 3KG4A 4B3MF 2MKIA 2WVEA 2DGWA 3W3SA 1D8YA 1JMTA 2XMKA 2MHNA 4ZVGA 1HL6A 1JKHB 1ZAVA 5CAAA 5KFTA 1WC4A 1SJQA 2YNGB 3IG1A 3GSIA 1QUVA 5CYQA 3TJ9A 3VAHA 2BKOA 1LWXA 3T19A 5HMZA 4J9SA 3D1QA 3G71S 2YWEA 1FRMA 3DRXA 3N0VA 1MSWD 2FHOB 1GX5A 2XCPA 2BABA 4HTIA 3PHEA 3EVOA 2LDIA 2B4VA 3PJ9A 1WEXA 1VLOA 3HF5A 3MR5A 4DDFA 4ECZA 3SMZA 5C25A 1HPZA 1PC4A 2WVDA 2IBKA 3C15B 2FB0A 5HBMA 1CBKA 2UUCF 2LU2A 3QGHA 4IQMA 3MF5A 2X3DA 3MMJA 2RS8A 4IRDA 4CLZA 3RAXA 4O4GB 3VVUA 4DCOB 3AJ1A 1U6BA 3U27A 5CHCB 5J1EA 3JSMA 2MY8A 4NCAA 4CT8A 3GU0A 2OSQA 4IDKB 1KONA 2IJFA 1GAOA 2D7SA 2RB7A 2DKOB 1U7LA 5B0CA 4KAIA 4OZ0A 2ZE2A 2QZ8A 2GC8A 4ILRA 3M1VB 3U1NA 1WD6A 4OHVA 5LSRA 4EMDA 4ZVSB 3NGTA 3MMBA 4NLOA 1QLNA 4M5DA 5KT3A 2XGQA 1T7PA 1TQLA 1FXRA 4OI6A 4FPRA 4ZVQB 3H5YA 4DI6A 3BREA 3CJRA 1QJHA 1N36J 1JLBB 4K50A 1MWZA 4I6YA 3LALA 1T95A 2VL1A 3I6PA 2KRRA 1NU4A 1ZAXA 2DXEA 1GMVA 2AF6A 4BC7A 4DS4A 2BA9A 1B4SA 2JEGA 4NLSA 1KWMA 3K5NA 3HD1A 2DCUB 4U67Q 4LF4F 5JUMA 1SPBP 4ZJLA 2QJ3A 2Y1RI 1W2IA 3TAPA 3H5UA 4OHWA 2DHXA 4RLEA 3CVKA 1W7WA 4A4JA 2HEKA 3IXQA 2JVRA 4MFBA 3MM6B 5J2QB 3OD2A 3QRQA 1JNRB 4A8YA 4BCAA 1SJFA 4ZS6A 2VG7A 3SFGA 3TVZA 1K44A 2BACA 3F56A 4J37A 1VQPS 3I0RA 2QYCA 1UEVA 1WG5A 1U1QA 3DLHA 1FRKA 5FJ4A 2CQCA 2VC0A 5K8OA 4CH1A 1UJ5A 2OAUA 2BOAA 4OYPA 3J80U 4WZMA 2R42A 4JI0F 1UTAA 3TVKA 1GMWD 5FLXU 2QC3A 2V69A 2V2VA 1RU2A 5GAHU 2B43A 4P2SA 2VBXA 3BQ0A 2RH3A 2F65A 2HFNA 2HVZA 1ZS6A 3M2RB 4ZHRA 1N32F 3EZOA 2ZUGA 5F9NA 2ZHOA 4PXCA 2O5DA 4IKAA 1IBLF 1D1UA 2EFQA 2AD9A 2FJXA 5D0EA 5J2NA 3MD1A 1JLQA 3QJPA 3KLHA 4FXDA 3ENQA 1UVIA 1M5HA 1WF1A 2KFZA 1VQ6S 3UD4P 3IBWA 1VQLS 1TL7B 2YKOA 1XN9A 2B4OA 1RT6B 3MMCA 3N28A 4DQSA 5MAOA 4ECSA 1WKLA 5ETLA 3PR5B 4IOAQ 3GIRA 2RDJA 4ZP9A 5E3RA 2DR7A 2MZRA 4LRDA 4C3MA 4TLQA 2OFHX 1P9YA 3QLHB 3ZZUA 3NGKA 1U48A 2MZTA 3FZBA 2FIUA 2NUHA 5FD1A 3QBCA 1FFGB 4FF2A 1ZM2A 1VK3A 3QWUA 4QIFA 5DQIA 4P52A 3NWRA 2AGQA 1RYSA 2N3OA 2QA2A 4JYAF 3SDEA 2BANB 1S49A 2F9DA 4ED1A 1HWIA 2NXEA 1I1GA 1C0TB 2F63A 3W9JA 1PBAA 2XMJA 3GV5B 2NS1B 4LVOP 1F9FA 3DOKA 4TVAB 1GQEA 1RXOB 4O3SA 3ETOA 2V5HG 2V8GA 4PQUA 3KJQB 1YZ7A 2MKJA 2YXLA 1RTDA 4FZVA 1U47A 1VQ5S 1LW0A 4DUZF 3A3PB 1O8BA 5HMYA 2I1RA 4ECXA 4CLPA 3CF5Q 5DDOC 4V1Ak 3CXCR 3QAUA 4B9LA 3SQOP 3QGGA 4A46A 2J7KA 1Q8BA 3Q89A 3CT9A 1TL4A 1HQEA 3FKBA 2XO7A 2KXNB 1UJ6A 2RMLA 3T1HF 5L46A 1QAXA 3TI0A 4JI1F 4RU9A 4NLUA 4WBFA 3TZYA 4RR5A 5D3GB 3DDNA 3W1YC 4ZLJA 1V3SA 1JLAB 1WEYA 5H1SV 1UWAA 2ZH8A 5A0YB 2IJRA 2W4CA 2QTWA 3M6WA 3GLJA 4ZVFA 1KR4A 1N6QB 2DGSA 5E0OA 4QYZJ 3G6VA 1IJFB 2J6SA 2ZH3A 5F8IA 2NREA 1MN9A 1ZETA 5DDPC 4EZ6A 2UUAF 4G1QB 4A8SA 3E51A 2KJVA 4LFBJ 2OMOA 3FNNA 4UY8T 4FYXB 3M2UB 4OZLA 3F44A 1KLMA 3FBFA 1FFSB 3ZZRA 2DIUA 3VAFA 3W7BA 2VJUA 3DLBA 3HHLD 3SSQA 3GR1A 3OR2A 1AFIA 1FX4A 2AV5A 2HS0A 2MXYA 3D1HA 2WSFC 2XM3A 1WOPA 4U96A 1O0PA 3HI9A 2DH8A 4ES1A 4HDGA 4CM2A 1VQ8S 1Z2ZA 1OMSA 5F0WA 4ZLLA 4U6PA 4N8OA 3TUZC 3IWXA 4CLSA 1I94J 3MZIA 2ZEJA 3FQLA 3WQPA 5DQHA 1R3NA 2KT5A 4NA3A 4OJ1A 2OEJA 4LBIA 2C1EB 2Z2MA 4NZ7A 2ABYA 3TNVA 1YVFA 1SQFA 4MKVA 1N56A 5J1PA 2AZ1A 5G0RA 4RBTA 3W5XA 2DH9A 1NK4A 2HHHF 1X4CA 3S7RA 4DV2F 4LSNB 1IVZA 3M8QA 2D3ZA 2ATLA 1KKHA 3R1LA 1JLEB 1RT3A 4BHQA 1D9AA 2N3LA 2R8IA 1E6VA 2MKCA 3VGUA 2F3JA 4OYXA 1JXLA 1MU2B 2MZJA 2BYCA 1O5JA 1WI8A 1FRIA 2VKRA 2ERRA 1KEKA 4LF9F 2KT3A 2CRLA 1Q7YT 4ICLA 3IMQJ 4EBEA 3Q24A 1MROB 1LW2A 2DHHA 4DXLA 2V4RA 3DOMB 2L3MA 1RHRB 3G8TA 3NCPA 2R7XA 4DFPA 1T03B 4DR6F 3MCNA 3BYPA 1C4CA 1VR6A 4KPCA 5KFVA 5KG3A 2CQ0A 2ROGA 5IS2A 2R8GA 3CDBA 4USVA 1Y4ZB 3CDAA 1U2FA 3G6YA 4I2PA 1T02A 3DRSB 3L7PA 2YKMA 4DFKA 1A7GE 3CJ5A 3W2WA 4UOHA 3D4JA 2UXCF 2FC8A 4LREA 2HLUA 4J9MA 4X65F 2G1HA 5KFYA 3ISZA 5AXKA 4L75A 2CQ3A 2I8EA 1VFJA 2K1RB 2AHOB 4OZ1A 5IQ6A 2AEMA 5IM0B 1S1XB 5H9FJ 4NZ0A 1DFDA 4ETXA 2G2OA 4QWAA 2AGPA 2KKHA 4IH7A 1Z4UA 3RR7A 3D6HB 2ZH9A 4QCLA 3ET6A 1YBAA 1MNEA 1RYRA 1C1CA 2NCKL 3JTOA 2QLFB 1X4FA 3EX7B 2ADBA 1SCJB 2VPYB 3Q0AA 2EBGA 3PO4A 1S0VA 2EG2A 3JYTB 4AT1B 1EKRA 2HNYB 4WP3A 4EWTA 2HK2A 3AB2B 2XMVA 1LFPA 1K8AT 1TFYA 3H40A 2A6OA 5F3ZA 1TL1A 3MD3A 2OPSB 3OSNA 2FHMA 1JXVA 3PNIA 3E01A 3HFZB 2HMIB 1YJNS 5DO2A 3VAMA 2KVIA 2X7IA 2ZJQQ 1NB7A 1S1UB 1CJUA 2B0GA 1RAJA 1R0AA 1L5UA 1OO0B 1RT4B 2KXHA 3CPWR 1SL2A 2O01C 4AXIA 1REVA 4QU6A 3ETMA 1FNXH 4IFYA 1Q5VA 1FDNA 2E1PA 2Z2ZA 1M90T 3CE8A 1TL5A 3A3NB 2XSJA 4MIAA 2YWFA 3OQ2A 2MLXA 4QYZK 1MG7A 3O6QA 1KQKA 4FF3A 4C7QA 4NA1A 1YBUA 2DNZA 4K4UA 3HMJG 4ED8A 1LK7A 3EGZA 3K5PA 1OSDA 1HNZF 4HT7A 3LP0B 2X1GA 4PWWA 1NLKL 4UF4A 1V3ZA 4M94A 1XMBA 3MEKA 1YHQS 4A8FA 3QT8A 2UXBF 2Y8WA 1NAQA 1ZM9A 1RSCA 5ETSA 2OEKA 5E3QA 3Q8VA 1IBMJ 1ZPVA 3F0NA 2G0IA 4QWCA 1N33J 3VV2B 3TX8A 5DG7A 4RW4B 5A8WB 3I5AA 1VQ9S 4K4SA 2AQ4A 4LF6F 4C8YA 2GQ2A 1YX2A 2EK1A 2DPIA 4C11B 3QIPA 4I6WA 2GNKA 1F1BB 1B0VA 3FFIA 3G6ES 2ZH1A 2RIJA 4I68A 2PMHA 1IKXB 4DR5F 4FF1A 4FXWA 3OTOJ 3ZXWA 4LVNP 3AA9A 5I3PA 2JRSA 4O4GA 1WSVA 2HQ3A 1SI9A 1JX4A 3OFGA 3GP9A 2QEXS 1HMVB 4S0MA 3SCLE 3QPIA 2LFVA 5HQMA 5IV3A 1LXNA 1TUGB 1SJ1A 5E3PA 2HG4A 3A13A 1ZZFA 3QT7A 4QYRA 4IUFA 1CEZA 4Q2MA 4DR2J 2W9CB 5IT0A 1U49A 1T94A 3CULA 3M30B 1XNRF 1B7YB 4O4RA 5IXUA 2JEIA 4J9VA 1Q4RA 3M8WA 1FKOA 4B3TJ 1QM9A 4JI4F 1FK9A 1FXDA 3QFHA 1JLBA 2IVMA 1RJJA 4AQYJ 2ADCA 1TR0A 4DFMA 3TYTA 3V6HA 4CH7A 4KJIA 3AQPA 2ZD1B 3KYLA 3THTA 4QBUA 2KL8A 3TW0A 4ZN1A 2IM1A 3LP2B 4KC5A 2MSSA 4N8NA 4DV1J 2BRKA 1NJWA 1RKIA 1TV6B 3LPEA 4ID5A 4NASA 1S1VB 3AAWB 4OHZA 4OJ3A 4NX9A 4CO5A 3LH2S 3QAEA 3TQEA 4Q7AA 1TKTB 1HNXJ 4ZCIA 2GCFA 3FCWA 4USJC 4JBCA 4C4WA 3FEYB 1QY7A 5F8HA 3N4WA 3N5BA 2LEAA 2AWZA 4LFAJ 2YPYA 4RUCA 4NLQA 3QMQA 5F8LA 3PHTA 2RHQB 5F41A 1CPZA 1FX2A 2X1FA 3TARA 3W8PA 2ZKTA 2QLBB 4WFBQ 4DEZA 3OT9A 2GFFA 4XIUA 2J0WA 2QRRA 3B4MA 2NSCA 2W24A 2YWKA 1L3TA 4A8WA 3K5OA 2DO4A 3KLGB 2EFPA 4CNZA 9ATCB 1VBYA 3MECA 2WONA 1NBEB 4Y6IA 4B17A 4DV4F 1OY8A 1P1TA 2HBYB 4JI7F 2BW7A 1RU1A 4B3SF 3EYZA 4PAAA 3TAQA 3OJUA 2HGNA 1KN6A 1IUJA 4BWJA 3ZZZA 5J2MB 1EETA 1G7CB 2D69A 4LRAA 4HH0A 3C19A 4YHHF 2U1AA 2HNDA 2W4PA 1YTYA 3Q8PB 2MKKA 1MWYA 3MM5A 4GKKJ 4YY3J 4ALZA 5KFHA 3IS9B 4NMXA 1SXLA 3R5CA 1RBLA 3LGMA 1TK5A 5KFZA 2FVPA 3QLHA 1SC3B 5CCLA 5KOXA 3V4IA 4DUYJ 2CNOB 1IJEB 3OFFA 2F1FA 1VQ7S 3HHEA 1FJGJ 1R27B 1R6VA 1XK8A 3MAHA 1BUXA 1U09A 3CJKA 3ZFVA 3GJQB 1EHWA 5KT6A 2HHUA 3MMAA 4Z2XA 1RADB 4NRUA 3MAQA 2OPPB 4F25A 1C0TA 2XB2D 1KBRA 3EZUA 2PFFB 2UUBF 2WVCA 3IAM9 3CDUA 1B64A 5KFFA 4P72A 4CH0S 4PUOB 1AYEA 3OFHA 1RAEB 3ILOA 3UVJA 3TJAA 4MYTA 4AUKA 4JI2F 5LMUJ 4ZITA 3PVXA 2M4MA 4DU8A 3BDPA 4ES2A 2Z2YB 4B9SA 4O3RA 3EMTA 1HR0J 1YJ7A 3Q23A 3QO9A 2QFIA 5L39A 3PRBA 4IRKA 1AW0A 1NO8A 5IV4A 4YDXA 3ZTQA 1H7XA 4Y00A 3K57A 1HBMB 4USTA 5J1NA 2YKPA 5FIIA 4HHUA 4DX8H 1WELA 1RLDA 3WZ0A 2KYXA 3PYEA 3RYLA 2Z4PA 5LXYA 5I3UB 4J9RA 2CADA 5CZXA 1QSLA 1K47A 2RU3A 2DH7A 4LRBA 2VQFF 1RTHB 2G0CA 1S9GA 2Z8QA 4RNNA 1Q16B 3U7JA 5D3GA 1BE4A 2R7UA 3DN9A 2CA9A 3V4MA 1LWCA 2NPIA 2DISA 4OZ2A 1NB2A 3D7SB 4ES3A 1CC8A 2LLZA 3MGJA 1M1HA 3RAMA 2NXJA 4DZ6A 4RBVA 2J5AA 1N6QA 3VAKA 2FLNA 1R0CB 4OYAA 2H4YB 2RDIA 3KHLA 4DV5J 2BM0A 3VAJA 4PEOA 4YB6A 4V19J 2XYHB 2CQ2A 2OJ3A 2EEYA 3RW7A 1XMQF 3NGUA 1YRXA 1ELOA 3ISND 1VMBA 2LQ5A 1RE1B 2CZ4A 2KG1A 3M2UA 2GO9A 2KN4A 4CCHA 4RW6A 4TY8B 2GIQA 5JVGQ 2VD3A 4CTAB 3TUJC 4GMKA 2C2KB 3BZQA 1VJQA 5RUBA 2CQHA 4ED6A 1PYTA 4CRJA 1I6JA 2H54B 1VLYA 3NGDA 2OMLA 4GVLA 4HYKA 3PW2A 4M5GA 4ZVTB 4IOCQ 3PW5A 2CIMA 1TKDA 4HEA9 2HYIB 4X4VA 1AB8A 5D0GA 4J9PA 3R8YA 4J9NA 2ZBIA 4XTTA 3AA8A 3LANA 1F0XA 5L38A 3U02A 1N8RT 4KR0B 3CNQP 1HHTP 1U02A 1NK7A 3F41A 1B99A 1GNKA 2RT3A 4PWDA 2V34A 3NOGA 4I69A 3LW5C 3TAMB 1GEHA 3OHAA 2O67A 2QYGA 2RNEA 6AT1B 3DRRB 4NMLA 3OUYB 1S12A 2W4DA 2KI2A 2DY9A 2CKWA 1H6KX 1AZSB 1TVRB 2MQOA 3MCSA 2V4JA 1R7IA 1V5IB 4FBUA 4ECUA 3CGIA 2V9KA 1MROA 3SV4A 2PE8A 3DOMA 1ITPA 1Q8LA 1QSSA 1OSCA 2OIHA 3KNGA 2UVVA 3DMJB 2AGOA 2XS5A 4PG6A 1G3OA 1HNWJ 2ZBPA 1IWGA 1DZ5A 1N34J 3CSKA 1DURA 2CZVC 2GIFA 3OBIA 4NLXA 2WHOA 2CQ1A 4X4RA 2JNJA 4AFFA 4DU7A 3PIPQ 1DTTA 2AZ3A 1HHQA 2EFGA 2E5LJ 3CD5A 3CCWA 3C46A 2JOQA 1ZPWX 2R7TA 2JVOA 2P9EA 4NYOA 1PCAA 1IBKJ 2D9PA 1OQ6A 2I9SA 4PG4A 3SIPB 4KSEB 1S1XA 1NH8A 1S6UA 3BPDA 4H54A 2R8KA 3H2UB 3T1YJ 5F8JA 3CWJA 4ZN3A 1QAIA 1WF0A 2HHHJ 3H25A 1X4EA 4WYWA 3BKTA 3J81U 1IM4A 4NLPA 3JYTA 3R1HA 2RUSA 1OPZA 3CCVS 2RKIA 3H5XA 3FRZA 2LEPA 1HBOA 1EQ0A 4Q5VA 2B3TB 3C14B 3KJVA 3RAQA 3CJ8A 1HWUA 3BBCA 3KK2A 4WKRA 3BGFA 2DNYA 2R8HA 1VHIA 1X60A 2VG5B 1RK8A 2XYGB 2HMIA 3FBBA 1A6LA 1XR5A 3VGTA 2F4FA 2GVZA 4DWIA 2ASYA 3C16B 2W9BA 4P2FA 1NXIA 5IZHA 2HVEA 3SV3A 2ZC4A 2QLWA 3MAAA 2C28A 3EVWA 2HRTA 3C2PA 2L9DA 1RT4A 3M8PB 1JNZB 5IC4B 4C3LA 3CJTA 5KFUA 3HHKA 1YG0A 1SJ3P 2HFVA 1UZDA 4GO7X 3T9ZA 3WHIA 1KOOA 2AU0A 3RU0A 3KJNB 3HPOA 1N88A 5EX3A 2V63A 1PBUA 2JWNA 2FHKA 2DRAA 3PIOQ 2MQLA 4K5RA 1KSPA 2LVWA 4DCPB 3V6DB 5CCMA 4ECVA 4Y28C 3UR0A 2RD5C 5DS7A 3ULHA 3MM8B 4ILMA 2YH0A 5LSLA 3CJ3A 3NRBA 2V8PA 3KK3A 1N36F 3LP0A 3IG1B 3KLFB 3A4TA 5CYQB 2N82B 2R7OA 2YNIA 3A8IA 1VQSA 1B0PA 3J80Y 2QA4S 3W5YA 5F0UA 4Q45A 3OLBA 4YEAA 1S97A 5FLXY 1S1TA 4X4OA 4OZ3A 4DZDA 3MCMA 2RU9A 4X66J 1C2PA 2MZ1A 2E5HA 2MQPA 1WOOA 4F2RA 1W26A 2HIQA 2EKNA 1RTIB 5C25B 4RW4A 3A8JA 2HSEB 3DI6A 2GMJA 4CLLA 1GH8A 3W61A 2IRUA 5HBMB 1AXQA 2C3YA 5E7OB 4K0KJ 2CQBA 3SBMA 4ERDA 4A47A 3D0IE 3VGVA 4QWBA 2DJWA 3MHYA 1JXEA 1FXLA 1F6TA 1A0OB 4OLOA 1X8DA 5J1EB 1U1LA 3NGSA 3JSMB 5ITHA 2WAQD 3BN4A 2FHJA 4GC6A 1WWHA 2R7SA 3MM9B 1UPPA 1UMJA 2IRYA 1NRKA 2PC6A 3HJFA 1NJZA 2E9TA 4QIVA 1H38A 4IOBA 4MAKA 2B9EA 2FY1A 3MOZA 1FNOA 1MWQA 3KFWX 4WF9Q 2WBMA 1DARA 4M5DB 4HHJA 1VYAA 3JB9k 3R5GA 1QE1B 4HI1A 5HN0A 5HVGA 3D68A 2C2EA 4FS2A 4DQRA 3RBDA 3L95X 1FJCA 4FYYB 3OR1A 4NXMJ 4LIWA 3S1TA 4CDIA 5ETMA 3LUYA 2DR9A 2W9CA 5HQLA 1FRJA 5D77A 3AQOA 1KHVA 4F36A 4TU7A 2HGMA 5DZ6A 4ELTA 3EICA 3OTBA 2FY8A 2PDAA 4A8OA 3TUPA 2XC9A 1IXKA 4P9SA 1RA7A 2RRNA 1S77D 4MFBB 2W2OP 5DETA 3HHLB 2Y9HA 2VG7B 4N56A 2HAFA 3HKWA 3NAHA 3SQGA 1TV6A 1UVNA 2EKYA 3I0RB 4KRWA 3GSDA 3JTPA 3GJTB 4G1PA 4EU0A 2MDAA 2W8KA 5KFKA 2LDYA 1UP1A 4QQBA 1MMLA 2E5JA 2FPHX 4LIRA 3D3BJ 2IAJA 2V0NA 2VA3A 2R9LA 1CQMA 4P71A 4ZHRB 4MKAA 1SV5B 4M5LA 4P10A 3W2VA 4LR7A 2E29A 3QRPA 1L3UA 2UV8A 4X62J 1BLUA 5KFSA 1RZMA 4QR1A 3J81j 3CD6S 4EK2A 2IFXA 5KT7A 1JLQB 1F2GA 4MH8A 3KLHB 2YH1A 2ZVIA 3W62A 2WK4A 3QJLA 2Y3YA 3KKFA 2XWYA 3HT3A 2HIYA 1B7FA 4F0KA 4DL5A 4MIWA 2M3DA 2RAQA 1JLCA 3C66A 4DL2A 3N5FA 3K7RA 3MMCB 3HKZD 1KVKA 3FCVA 1KLNA 2XI3A 3RRKA 4ECYA 3I0SB 2ZZTA 5ETRA 1OYDA 4OX9J 2R8JA 2RF2A 1VCTA 1RWWB 2KZMA 5SZTA 5J2MA 3W66A 1XBWA 2P6SA 3M7VA 2W2QP 4F4KA 3HHDA 1RT2B 1PJ5A 3K2YA 1JLFA 1OS5A 5KFAA 1OWXA 1GTEA 3OVSA 4E2FB 2D41A 2AJQA 2VBYA 4MKBA 3W9HA 4B3OA 4WFAQ 1DQ8A 4PABA 3IS9A 4KGKA 1VGYA 2GGPA 1JB0C 4NCGA 1H73A 3CCJS 4QIEA 2AEFA 4LR9A 4WK1A 3PRVA 1NKCA 1FDDA 3DOKB 2JJ4D 1KQSR 2VOOA 2U2FA 4CO3A 2XO6A 2R2UA 4FS1A 4PQUB 2DGQA 4LFBF 2MJUA 3CCSS 4JV5J 1OYEA 2HHVA 4OZJA 2JHEA 2QO3A 2GQQA 1SIWB 4PRFA 3LP1A 4ZPVR 3MM7A 1LW0B 4DR1J 4ED2A 5FDLA 4CLYA 1WTBA 4DV6J 4PXDA 3D6FB 3ZTOA 4ECWA 4PUOA 4IH5A 3KUHA 4NI2B 3PACA 3GFHA 1SKWA 4JV2A 4JI6J 4MYUA 2Q43A 4WYLA 5KFEA 3N01A 3TZWA 2IM0A 4B9VA 1SB6A 3LGHA 4DR3J 1RQ0A 3GJSB 1F5AA 1I94F 1JWWA 2HHPA 4EZ9A 2AYGA 2OD6A 3MR2A 4FBTA 2BR0A 3ILJA 2UVWA 1MMDA 4DPXA 2EBEA 4G1IA 2CQGA 4RL1A 1FVSA 5KFWA 3PXGa 1RGVA 4ZVRB 2XY5A 3E8OA 3GYGA 1UVLA 2C2ZB 1QVFR 4I4BA 2NQPA 1NEEA 1RTHA 2VONA 2ZBRA 3IM9A 4XO0A 2DNGA 1T11A 2WBRA 1Y5NB 2ROEA 3BV8A 1U6FA 4LQ9A 2E1AA 4FN5A 3K17A 3H8YA 3M8YA 1BMQB 4N76A 3OL8A 1R43A 4UW2A 5KFGA 1HHSA 3ILLA 3RJMB 3OR2B 2K8GA 2CPFA 3AJ2A 4C0BA 5CYMA 3AD8C 4YN3B 3NG8A 2H9ZA 2H65B 2DPJA 2WCXA 4PYDA 1LK5A 3I9V9 1RHQB 1RWPB 4Q8EA 4TY8A 3AD7C 2K06A 4X4QA 4J5OA 3SCIE 4LBPA 2HHSA 2BE2B 4AL5A 2CQDA 4DSEA 5I42A 1KQGB 5A76A 2BXJA 1YK9A 1X4BA 4RWXA 4FVMA 1YJTA 2CDQA 5IQQA 1RB0A 4OX8A 4KHPJ 2DNNA 3MDFA 1MW7A 3FGVA 2MKHA 1Y3KA 2ROPA 4DFJA 4BC9A 2MQ8A 1RT3B 3JS9A 4F4XA 5M2UA 2XG8A 4DSJA 4HKQA 3DLGA 2P9CA 2AT1B 4PXEA 2HNZA 5ETOA 4ICLB 5EUHA 1HKAA 2B4UA 3TAMA 1T05A 1LW2B 4Y34A 1N5SA 1UEUA 3LTOA 1FWLA 2DO0A 2B8PA 1XMOJ 1SUQA 4JV0A 2B56A 4O3PA 1WC1A 3GCWP 2V67A 4I2PB 5DM7Q 1LWFA 3T5HA 3IBCB 2ATCB 3W2WB 1S6PA 2BJ1A 2W2NP 3M6VA 2ZH2A 4GVBA 3ITHA 4ANCA 2I0XA 3KHGA 3HM9A 1V3RA 4ZPWR 4K4ZA 3K5MA 3OSPA 2I2YA 1TUWA 5LOQA 1P9QC 2BQRA 2LMIA 4NE9C 3ZC4A 5KFMA 4Q44A 4NLTA 1U1RA 1M1KT 3EGNA 5BR8J 1GMUA 2CNLB 4H4MA 3T6BA 1C1CB 4J9LA 5LSOA 5HLFA 2GJIA 5IC6B 1Q95G 2KU7A 4ZLPA 4OZNA 1NDPA 4Z37A 3TANA 3I31A 1D0EA 1RHKB 2VFSA 3GYXB 1NK9A 2JLEA 3UDCA 1IBMF 2UVRA 3GYNA 1N33F 4FDFA 3KTQA 2QFJA 4B3RJ 1GMWA 4U95A 1YIJS 1SH0A 1UCNA 1ZBTA 4K4TA 1HYSA 3R27A 2F8HA 1UKUA 5KFDA 3IGNA 2W2MP 5CQGA 2HFUA 5MLCV 1CJUB 2A2DA 3SSSA 1R0AB 2DB1A 3OTCA 4YR3A 4NOHA 1REVB 2CAJA 2VG5A 4WFZA 4PXBA 1YLXA 2BVZA 3OTOF 3C16A 3H2VE 2NSBA 1TZ0A 2J76E 4J9UE 2GA7A 3CTRA 3S8SA 1VIXA 5KFOA 4O3QA 2HVHA 2XSJB 4XK8C 3JQJA 3K8VA 3ZO7A 3K5LA 2L9WA 2XCAA 2MZQA 1SKUB 3BEGB 2KRBA 2F40A 2BQ3A 3MI7X 3GTYX 4KH0B 3PKYA 5L8RC 3EJMA 2ZWPA 3DLJA 4TYAA 1SVDA 3FDSA 3I9ZA 3GPAA 3CC4S 3N6LA 4OMFG 5EWGA 1R8PA 5M2PA 3IA0A 4NA2A 2XS7A 2OUGA 4URQU 4OJHA 4MKYA 4IO1A 4DR2F 4OYWA 4I64A 5KT2A 4LMZA 2N4CA 1RAGB 3V6DA 4DLEA 4LF1A 3T1AA 2IC3B 3NCQA 4FPIA 1F9HA 3MM8A 4IH6A 3K59A 2ZVSA 1QUPA 4B3TF 1FRXA 4UOGA 4ID8A 3L09A 5KFPA 2OPRA 3BR8A 3QZ8A 2QV6A 2OPQA 4RBUA 3L4BC 1FDBA 3DHWC 4P73A 3BJYA 2D74B 1RTZA 3KLFA 3J7ZT 1Q5YA 4C8MA 4AQYF 4RO0A 4OLPA 5HK4A 3QIPB 2YWGA 2EFVA 1NHUA 3FFIB 1X31C 2C3OA 3NMAA 3DOLB 5B0DA 4CLFA 1WHVA 3FC9A 3U1MA 4DV1F 1WDDA 2XZDB 4KFBA 3SSRA 3O44A 1H7WA 3PX6A 3R2DJ 3M2VA 1RTIA 5M2RA 2X1BA 4NXNJ 2HLTA 3RB0A 1YDLA 4RZRA 3AOBA 2K7JA 4WPAA 4LT6A 4MTPA 3BSNA 2BJDA 3M6UA 4DX5A 4F3MA 3CCLS 3PM9A 3CCRS 2PI5A 2FJEB 1VS3A 2V94A 1HNXF 3P8BB 3DCAA 2PT0A 1UETA 4OJGA 2PMZD 4DUTA 3MM9A 4NLWA 4ANEA 3QFWA 4ZPTR 1OQ3A 7AT1B 1RWVB 5JJBA 4K4VA 2IA6A 4F7VA 2WB1D 1C0UA 2LA4A 4LFAF 2HGLA 2P6TA 5A2QU 4OL8A 3OL6A 3G6XA 2NZ4A 3S6EA 5KG6A 3E2EA 3T9NA 4ZVHA 3QT5A 2KM8C 1DQ9A 5C24B 2EXUA 1FKOB 4YB1P 2J9DA 1QE1A 2RSQA 3IR7B 1FK9B 2XWXA 3D0HE 1CJKB 4M5KA 5CD4A 4CYUA 2CG4A 2EC0A 1R31A 4W4MA 3M8ZA 2PO4A 4TXSA 1SQGA 3L7UA 1QAJA 4XDDA 1FNMA 2DGOA 2DR6A 2OEMA 4QIWD 2V8VA 4ID5B 1BY9A 1YBTA 4UY85 3MPYA 1TMMA 3MPDA 1P1LA 4QWDA 2D9OA 2OTLS 4DJBA 4IQXA 4GKKF 4YY3F 3HHLA 5CZVA 2K7KA 2DGTA 3HVWA 4Y2KA 3IAS9 2BW2A 2FZCB 2MMYA 2FD2A 1M5VC 3IR5B 1S9EB 2CPJA 4DUYF 1D3WA 1KTQA 3BH7B 4X4TA 4AYBD 1KP6A 2ZH5A 1FJGF 2PSZA 4TQSA 3DM2A 5B09A 1XERA 2YKNA 2H3EB 4RNMA 3PJXA 4OX7A 2YQ1A 2RQMA 2KZZA 1ZAWA 2MJNA 2FJDB 4DR4J 3POTA 3ZNJ1 2HWIA 1SV5A 2EFOA 5CYJA 2GHWA 3HSDA 2EPIA 1RBOB 2X3GA 2WONB 3MECB 2Q79A 4AD6A 2DBBA 2DHAA 1RCXB 5D8HB 2ZZNA 4DR7J 2XS2A 1U25A 4EO6A 3VR1A 1YRTA 1KFSA 3VHQA 5LMUF 3LF0A 3T5JA 5K5MA 4M1KA 1HR0F 5C5JA 3PJWA 1NM2A 1EETB 3A8KA 4HACA 3DDKA 1OIAA 5DDRC 1TK0A 2JX2A 4I2QB 2P5VA 5F9LA 3CIZA 2HNDB 1KHWA 2ZDPA 4Y2MA 5K20B 4IG3A 2HRUA 3EVMA 4P74A 2LQ8A 4LJMA 3CCUS 5DGAA 2DNRA 3H20A 3MM5B 3I0SA 3GZ7A 4TU9A 4PPDA 4G65A 3G8QA 5E33A 1UW4A 4O23A 5CXTA 5HMXA 3O2IA 1QAYA 1LWEA 1AFJA 5AT1B 2E7WA 3RZAA 2PA3A 1RT2A 1NZ8A 3I56S 1BQMB 3V4IB 2IYGA 3PX4A 3TUIC 4ZPAA 2RVJA 1YITS 3VTIA 2Q6BA 3CJKB 4IG0B 5D4LA 1RISA 3W5ZA 3MMAB 2JEJA 1K0TA 3ILIA 2F9JA 3PDNA 2JC0A 1S0OA 3UO0A 1HBNA 2B9WA 1VIOA 4DV5F 4ZJQA 4LUBA 3DLKA 3BH6B 3P5BP 3UVJB 5EX0A 4YMEA 5HJYA 2CYYA 2J8SA 4JI3J 2MTLA 4RJVA 1ZA1B 2GX8A 3J7AN 3CCTA 5DJBA 2MLZA 3QO9B 5DG9A 3UNYA 1PYSB 1S5ZA 3W60A 4NYPA 4UUWA 1J5OB 2C42A 1CS4B 3KDNA 2N4DA 5EDWA 4PWUA 4NI2A 2NYHA 4UZCA 4NLRA 1FCAA 4FVCA 1PGZA 2A3JA 3B6BA 3R5JB 1LNQA 2ASJA 2RRAA 3EZ5A 1S6QA 4UQTA 1DAXA 4KGVB 1S9GB 3M05A 1S1WB 5T7LA 1FJ7A 2VUGA 2GVDA 2VFUA 3Q2SC 4LQ3A 2AIRB 1LWCB 5AJ3J 4JI8J 3EXYA 2YQ3A 2M52A 3DFEA 1N52B 3UDEA 3MEEA 2CVIA 3TRGA 2G4BA 2XLIA 2CG8A 3NGRA 2NZCA 5DLFA 2ZKUA 3Q86A 1TELA 4I0WA 5D0HA 3HVRA 2PI4A 1EZZB 1ICEB 1JJCB 2MZSA 3GIMA 3MWBA 2EVZA 2NLWA 3EGVA 2XMMA 2HHWA 3J81Y 2QE5A 4RW6B 1FRHA 3DKDA 3VCDA 1HNWF 4OIXA 5KG5A 3BM7A 2IM3A 1VQNS 1N34F 1NSAA 3FSIA 3UQSA 2OTJS 3D9BA 1ULRA 4QZVB 1BWEA 1B3TA 2CJYB 4ITSA 2OP5A 2JFDA 4YR2A 1C1BB 5GMDA 3PZPA 1S10A 2E5LF 2QN6B 4F04B 2FZKB 4C8KA 1H3DA 3BGUA 2BE2A 2HFOA 1IBKF 3P49B 2XGPA 1WORA 1NK8A 2HWTA 4X64J 4KIAA 2NPFA 2IM2A 1FO1A 2DIVA 3R5DA 3FEXB 4PWDB 1WC6A 2N7YA 3T1YF 8RUCA 2HQFA 3HULA 1REGX 1U2CA 3AJDA 4P2MA 2FZGB 2O3DA 2W8LA 3G4SS 5JVHQ 2L08A 4O44A 3QT6A 4H4KA 2R3VA 5J2PB 3FMBA 3JSYA 3V81A 1Y9OA 1JJ2R 1U0SA 4WK3A 3WC0A 1GXTA 1N48A 1LXJA 2QMXA 1RLCL 2XLJA 4AL7A 1YZ6A 3M32A 4BS2A 2V4JB 3HO1A 4KBIA 4NPOA 2M5YA 3T41A 4DPYA 1NUEA 1NPRA 3OVAA 1PC5A 1TP7A 3Q8SB 2CJXB 1DLOA 1TFWA 1R8AA 4CWBA 1YQHA 1WHWA 1GX6A 2PEBA 4CO4A 8ATCB 1DBDA 1HW8A 5HO4A 2A1BA 4KGXB 3BBFA 4YR0A 4UUXA 4W98A 2WB4A 1JJ4A 1DTTB 2KJWA 1X7VA 4P7TA 4FKYA 2X51A 2EK6A 1NZAA 4KO0A 1NK6A 1SIZA 2E5IA 1H2VZ 4I67A 3UI3A 3H59A 4E0DA 3RBZA 2UXDJ 1ZH5A 4DSIA 1A9NB 2V50A 2ZOFA 2CDRB 4KTQA 3AB4B 3CB4A 2NXNA 1NMEB 3PW7A 1FHTA 4Q2LA 3OL7A 1T8EA 1U0HA 3K0JA 2RKIB 4FNHA 3GFYA 1HBOB 2V2QA 4EI2A 3KJVB 2HBRB 2Q6CA 2G1DA 4WJBA 4CT9A 3KK2B 5DZ7A 1JQGA 2OD4A 3AY0A 4X66F 1FD2A 4F4ZA 5E3CA 1X0FA 2BE9B 3FZ2A 3AHPA 2GVZB 3CUNA 4DV3J 2M9KA 4DQQA 2IBOA 4NEYA 2W9BB 3RB6A 3DU5A 3HCXA 3CO0P 1P8GA 1HWKA 4USKA 3MAAB 3LAMA 4KHMA 4FF4A 3NLCA 4K0KF 4EYHB 3D6MB 1QTNB 2KT2A 2CPXA 4FKXA 3BQ2A 3HZEA 2C2DA 2ACYA 4NWBA 3BKFA 2UUWA 3M6XA 1XJWB 3UD3P 3SZ2A 4RWWA 2VJVA 2HBQB 2HAIA 1M0SA 2DY1A 1RABB 4DG1A 3J7A1 4L73A 3IBFB 1KS2A 3AH6A 4NLVA 4NL5A 2CJBA 2BJ7A 1SC4B 3M8SA 2IA0A 2FQQB 4RKUC 5KG1A 3KHRA 1TTHB 1WKKA 3KK3B 3NBPA 2HVDA 1WSRA 3FMWA 5HL7Q 3I5BA 3NKYA 2YNIB 1W25A 4NXMF 1R8HA 1IBCB 4W92B 1X4GA 2ZFHA 2W9AA 1S1TB 1UFWA 3N6MA 3PG9A 3IR6B 2IC3A 4PKDB 4DV7J 5IWAJ 3V6KA 1Q79A 1YJUA 1X4AA 3DI6B 1R89A 2G2ZA 3HVTA 2P8IA 3KDOA 4NYZA 4O3NA 2VFTA 4LSLA 1VBKA 1JK9B 3DOLA 4KB7A 3C8YA 4KH1B 3W63A 3LOUA 1TKXA 1H2UX 3M9NB 1Y10A 1EIYB 3UR3C 5HP1A 3HP6A 3V6JA 3RRGA 2VV5A 3P4UB 4CLKA 2LCWA 1YGYA 2GZOA 3BGRA 3EGWB 3BO4A 3D66A 2RDDA 2O1PA 2YX4A 4ZPCA 4EYIB 1UEKA 2YPZA 2ZITA 1SBRA 4WFXA 3CC7S 3DYAB 3GMGA 5KAKA 4DBQA 1NK5A 2QA1A 2C2MB 2FTRA 2OHDA 5KG2A 4M5HA 5I4MA 2G9OA 1FKPA 3OR1B 3BSCA 4TY9A 5DGBA 4X62F 4LF5J 2DRBA 2HWHA 3EDRB 1ZZNA 1EQMA 3LO3A 3GV8B 4WZQA 2DYAA 3NCRA 1U26A 5C24A 2FYXA 5A6WA 4B9MA 4BWMA 3PX0A 3VVTA 3GV7B 4CO0A 1CJKA 4P2XA 3PYGA 1Y0HA 1RACB 1XEZA 5AXNA 2RILA 2Z56B 3MEDB 4OYBA 2WVFA 2BJEA 3GWCA 2VASA 2KO1A 5L1IA 3OJSA 4P6QA 2ZH4A 4L74A 2QMWA 2K2PA 2LECA 1T9VA 4OX9F 3MURP 1Q86T 4Q0BA 4LBHA 3SQGB 1HNIA 5HMWA 1H0HB 1UJ4A 4F2SA 4LSZB 5IT9Y 1WC0A 2AP6A 3C3LA 3R97A 3Q22A 1UPMB 5F8MA 2HPUA 1BD6A 5HATA 3CCQS 2GO8A 1WI6A 2DNPA 3EDQB 3ZZOA 3IC1A 1FTCA 2DNLA 4ZA1A 2IAJB 3G2XA 1M5SA 4EO8A 1N0UA 3UW1A 3UN5A 3TOQA 1P6TA 3CD0A 4X4SA 3W2VB 1H74A 1RHUB 4PG7A 2EG1A 1L3SA 1S9EA 2YKQA 1FEEA 1SC6A 2XNQA 3O5TB 4ECRA 3KUEA 4Q43A 4J9OA 4IR9A 2CUYA 4OYIA 3U1LA 3ELHA 1VC6A 3KLEA 2QG9B 3NL0A 4JV5F 2XNRA 3EUNA 2YY3A 1RWKB 1UL3A 2AEJA 4PCQA 1FWPA 2HQGA 4URSA 3TVYA 1JLCB 4DR1F 4B9NA 5A6PA 2IHR1 4ZK7M 4DV6F 4ELUA 3CO9A 4A8MP 1GXLA 4CO2A 3TA2A 4JI5J 2LXIA 1VRUA 4GO5X 1FE0A 3QWPA 2H5JB 4DSFA 2IYIA 4XDCA 5AE3A 3S01A 2AYBA 4OX6A 4USWA 4JI6F 1SH3A 5EGYA 2J6UA 2KFNA 1BWVA 5A8RA 3D67A 1RAOA 2ZUAA 4V19X 4DF8A 5GAGI 2RF2B 4WP8A 2Y1LB 3DNCA 4DR3F 3Q8RB 3HK2A 3MR6A 5E3AA 5D4PA 1V5VA 1NCLA 1XIQA 4I2QA 1DY3A 3H7HB 1JLFB 5L1KA 3RB4A 4OI4A 4PR6A 2UU9J 1ZA2B 1U24A 5E41A 4RX6A 1WUUA 3CC2S 4B3OB 2GQCA 5L1JA 2GMLA 2UUTA 2J0SD 2GGPB 2BEFA 3C6TA 4NCBA 3ICLA 4NCGB 4C8LA 1Q8IA 5ADZA 4USUA 5T14A 4ENOA 1F5CA 2CQPA 4TNOA 4DCJB 1BQMA 4B08A 3IP0A 2LQJA 2QSWA 1T9UA 3K8WA 3JTNA 1F9EB 3GG1A 5DLGA 4QPTA 2XBPA 4ZP7A 4IG0A 1RT7B 4KHRA 3TA0A 4CLTA 2XI2A 4R0JA 3LP1B 3MM7B 2JH3A 2DNMA 2R7QA 3NNHA 4L6V3 2BRLA 5FDLB 3RBEA 3RW6A 3J7YI 1QD1A 1NHVA 2HHXA 1S72S 1U1PA 1YJWS 2ZH6A 4O3OA 3L3CA 2IMWP 4NEZA 4XPCA 4H4OA 5EWFA 3UN3A 1XR7A 3GIKA 2Z2LA 3UE2A 2GJFA 1FJEB 1K73T 1WHXA 3DXBA 1J5OA 2AKWB 1CS4A 1S57A 4ED3A 4ZPDA 1VQMS 5K8NA 4LF7J 4X4UA 2CPHA 3WC2A 3M9MB 4KHPF 3DLEA 4B9TA 3H42A 2LU1A 4YQWA 1WTFA 3CCES 3RG6A 1GFWB 3IRWP 5H9EK 1NDKA 2LA6A 2KG0A 1RWUA 3IO1A 1X5SA 5KFNA 3GILA 2DNOA 1YI2S 1U1NA 1S1WA 4LR8A 2DCLA 3DRPA 2BBEA 1S6OA 2COLA 3P96A 2BE7D 2H51B 3DC2A 1B70B 5K14A 2V8DA 2W7OA 2V4QA 4WKYA 2DT9A 3R5AA 1X5OA 2F4VJ 2NUUG 2ZNZA 3N6NA 4RW9B 2VG6B 1WJ9A 1I51B 1KTVA 5HQ8A 3RBXA 1XMOF 5AE1A 2VPWB 1IWAA 3UFCX 3R2CJ 1U4BA 1SL0A 3JAMU 3OXGA 3W64A 4YFUA 1KQFB 5CYMB 3AFGA 4QR0A 2CXEA 3PR4A 3UD5A 3TEGA 4ZVUB 1T3NA 3FRYA 2LKZA 1JJHA 3BSOA 3GCXP 2KHCA 4MJKA 2VHGA 1WC5A 4WCEQ 5I42B 4DL7A 2E66A 2J0QD 1CG2A 3H5SA 4TU8A 4EBDA 5BR8F 3WBZA 1C1BA 5HI7A 3US5A 1T9WA 3OTDA 4C98A 2HHQA 3BF4A 3Q8UA 1CULA 3D1OA 2F8MA 4Y2CA 1XTZA 1RT5B 3DLGB 2Y8YA 5GADI 3TJ8A 2V2KA 3IRXB 4N7TA 2QIFA 3SXLA 2F5GA 2HNZB 2YX1A 1NPPA 3T5KA 4B3RF 1T05B 2C2NA 5ETTA 2B9YA 2FC9A
chains in the Genus database with same CATH topology
3S8SA 1W2BR 5J2PA 1VIXA 5KFOA 4IUFA 4JOUA 3NP5A 4O3QA 1CEZA 1IKVB 2HVHA 2XSJB 4Q2MA 4XK8C 1VJWA 4QJVA 1CLFA 1WACA 1LOUA 3K8VA 2W9CB 2C3MA 1FDAA 1R6YA 1SUQB 4H4KC 5IT0A 3K5LA 1U49A 2DR5A 1T94A 2L9WA 3CULA 4E98A 1DJ0A 2XCAA 3HVAA 1HBUA 2MZQA 3M30B 2HS4A 1XNRF 3BEGB 3NMRA 2DITA 1HWLA 4ATNA 2KRBA 2GHVC 5L1LA 3DRPB 2F40A 4O4RA 5IXUA 2MGZB 1Q4RA 1VQYA 2BQ3A 4RW7A 2JEIA 2DHGA 3L7OA 3MI7X 2KXFA 5KG4A 3X3UA 4KKOB 1KVJA 1FKOA 1YJ9S 3PKYA 1IKYA 1LWFB 5L8RC 5K14B 1WF2A 1QM9A 3DLJA 4JI4F 4TYAA 1S6PB 1FK9A 1FXDA 3FDSA 1JLBA 4ZPBA 5KG7A 3I9ZA 3CC4S 2IVMA 1YWXA 3JSRA 1RJJA 3N6LA 4OMFG 2VFVA 1R8PA 4RUHA 1HWJA 5EWGA 3ITHB 4WIIA 3D28A 5M2PA 2ADCA 1TR0A 3IA0A 1Q53A 4NA2A 4YB5A 4DFMA 4URQU 4OJHA 3TYTA 3BQ1A 2XS7A 4BBYA 3V6HA 2IVFB 4CH7A 4MKYA 1WNEA 4KJIA 4IO1A 3AQPA 4DR2F 1U1MA 3P5TL 5AXLA 3BSAA 4I64A 2MYFA 5KOWA 2ZD1B 5C42B 3THTA 5KT2A 3KYLA 3BO3A 4QBUA 4ELVA 3B78A 2RQCA 2N4CA 3O1LA 3TW0A 4LMZA 2IM1A 3LP2B 4KC5A 2XY7A 2MSSA 4N8NA 4ZKAA 3LWMA 2BRKA 3V6DA 1NJWA 1RKIA 3SDEB 4RUAA 3SI8A 2KH9A 4DLEA 3T1AA 2IC3B 1Z1ZA 3NCQA 3HHNB 2G13A 3MM8A 1RI7A 3VQTA 1TV6B 4IH6A 3K59A 3G9CA 3UPFA 2ZVSA 1QUPA 2KTQA 4B3TF 1FRXA 4H4MB 4ID5A 1UWBB 4ZCKA 4ID8A 3L09A 5KFPA 2OPRA 3BR8A 4N47A 2QV6A 2LQ9A 3QZ8A 2OPQA 4RBUA 1S1VB 2WOMA 1FDBA 3DHWC 5HLFB 3BJYA 2D74B 1S4FA 4A8KA 3KLFA 3J7ZT 2XZWA 2ZJPQ 4C8MA 4AQYF 2B5JB 1Q78A 3AAWB 4RW8B 1UA1A 4OHZA 4OJ3A 4OLPA 2ZM6F 4F67A 3QIPB 2CVEA 3I4HX 4L3NA 4NX9A 2YWGA 2LXUA 4K4WA 2EFVA 2CJ9A 1NHUA 3FFIB 2RRBA 2C3OA 3DOLB 3M8RA 1S76D 4CO5A 2D3UA 3LH2S 3QAEA 5B0DA 3NMAA 4Q7AA 1WHVA 3U1MA 1TKTB 5K9FA 4DV1F 1S9FA 1XR6A 4ZCIA 2CFXA 2GCFA 1RTDB 4KFBA 3SSRA 3C6UA 3RRHA 2FUG9 3O44A 1K1SA 4USJC 1H7WA 3PX6A 2OPPA 4QOTA 3KLVA 4JBCA 4C4WA 3M2VA 1RTIA 3FEYB 1QY7A 5F8HA 2B7BB 3N4WA 3QZ7A 5M2RA 3N5BA 2X1BA 3MPWA 1FVQA 4EEYA 2LEAA 2HLTA 3RB0A 1Y5IB 2FGCA 2P9GA 3DXSX 1WTBA 1HYSB 1Z2LA 2CJAA 2AWZA 4RZRA 1IKWA 3GG0A 2K7JA 2M70A 1BGXT 4RUCA 3N9UC 4NLQA 3QMQA 3CCMS 5A2QY 4LT6A 5K8MA 5F8LA 4MTPA 2DGVA 2ALZA 1BC6A 3BSNA 2FHJD 2BJDA 5F41A 1CPZA 3I87A 3M6UA 2VC1A 4F3MA 3CCLS 2X1FA 3TARA 1VHFA 1HQEB 2ZKTA 4AE5A 3CDWA 3ZZTA 4WFBQ 3PM9A 1S48A 3BDEA 3CCRS 2PI5A 3ENWA 2FJEB 1VS3A 2POKA 2V94A 4DEZA 1HNXF 3OHBA 3BO2A 2O66A 3O3LA 3DCAA 2GFFA 2PT0A 1UETA 4XIUA 1NKBA 4OJGA 2J0WA 2PMZD 1JLGA 3FCHA 5KG0A 5LT5A 4FXVA 1GXUA 2QRRA 3B4MA 2NSCA 3MM9A 2W24A 4NLWA 4Y65A 2YWKA 2LXFA 4ZPTR 1OQ3A 2DO4A 3ENVA 3K5OA 3KLGB 2EFPA 4CNZA 4F3QA 4A8WA 1Q81T 2OH2A 1VBYA 4DQPA 2GIRA 2E5GA 2MKSA 2WONA 3MECA 5JJBA 4R5PA 4NXNF 1EP4B 3GE9A 4K4VA 4EFAC 2IA6A 2WB1D 4Y6IA 3VF0B 4B17A 1C0UA 2LA4A 3RTVA 2HGLA 2BM1A 2P6TA 4LFAF 4OL8A 2GJ2A 4DV4F 1NKEA 1HBMA 3NNCA 2W25A 3QIDA 2VH7A 1P1TA 4JI7F 4B3SF 3OL6A 3G6XA 3EYZA 2HRYA 2B6AA 2JEFA 3TAQA 3OJUA 1SJ4P 2NZ4A 3S6EA 1HBUB 4ZVEA 5KG6A 2HGNA 3NS6A 3E2EA 1KN6A 3T9NA 4ZVHA 4D3GA 2KM8C 1IUJA 1DQ9A 4BWJA 2WSCC 4A8QA 1HD1A 3CEDA 5C24B 4B9UA 2HW3A 4RW7B 5I3UA 5F8NA 3VAIA 1FKOB 2J9CA 3ZZZA 5J2MB 4HH1A 4YB1P 2J9DA 1QE1A 2RSQA 1EETA 1G7CB 5U47A 4ETZA 2VA2A 4R0EA 2BDPA 1HI0P 3IR7B 1FK9B 2XWXA 3D0HE 4HH0A 2CG4A 4C3KA 4YHHF 2EC0A 2U1AA 2HNDA 5LMNF 2W4PA 1R31A 1YTYA 2J8AA 3Q8PB 2E1CA 4DLGA 2ZHBA 4PQAA 1MWYA 2MKKA 2X1AA 2ILYA 3MM5A 2PO4A 5KFIA 4TXSA 1PO6A 2EI5A 1QAJA 2M8DB 4ALZA 3DRYA 5B08A 2YNHA 1VRTA 5KFHA 1FT8A 4HVZA 4N77A 4XDDA 3NWGA 3IS9B 1KLMB 2LEBA 1FNMA 2DGOA 1YSJA 1SXLA 3R5CA 3LGMA 4C8NA 1TK5A 5KFZA 2FVPA 3HDSA 4QIWD 4XAKA 4CIOA 1D9DA 1LQ9A 4I6AA 2Q3PA 3QLHA 4TLRA 1TUVA 3UCUP 2CPYA 2V8VA 4URGA 4U9RA 4ID5B 1XNQF 3VZIA 2OPRB 1BY9A 1U8SA 3OTEA 4FYDA 2OPQB 5GAHI 5CCLA 3PW0A 5KOXA 4I7FA 1WHYA 3V4IA 4WFNQ 1CVJA 4C8OA 4UY85 3MPYA 1IJEB 2MHEA 1LKZA 1M5KC 4LF8F 1P1LA 3OFFA 1YJVA 2F1FA 4QWDA 3I55S 2E44A 1VQ7S 2D9OA 3HHEA 2R2SA 5GAGU 4K4YA 1R27B 2PA8D 1XK8A 2OTLS 3MAHA 4DJBA 4IQXA 1U09A 4GKKF 4YY3F 2VKZG 3HHLA 5CZVA 3CJKA 4EUVA 4QW8A 2K7KA 3ZFVA 2DGTA 4IFVA 3EXCX 4ZP6A 5KT6A 4U7UK 2PN6A 3HVWA 2HHUA 3IWLA 5D6GA 3GFXA 4KFBB 3UCGA 4Y2KA 4CTAA 1APSA 3MMAA 4Y2AA 4Z2XA 4KPYA 4NRUA 3IAS9 1FESA 2BW2A 2OPPB 3MAQA 2MMYA 4CO1A 1RT1A 4F25A 4F3OA 1C0TA 2XB2D 3M2VB 1IQTA 2VB6A 1FE4A 3EZUA 2PFFB 2FD2A 1M5VC 2UUBF 3IAM9 3CDUA 1B64A 1SQEA 5KFFA 1QSYA 4CH0S 3IR5B 1S9EB 4PUOB 2CPJA 4DUYF 1N5QA 3OFHA 2OKQA 2VQEF 2GHPA 2R2RA 3SCKE 1KTQA 1D3WA 3BGLA 4X4TA 2V9WA 2B51A 2VPZB 2BV3A 4ED7A 4AYBD 3ZZPA 3IGVA 5G0RB 4DF4A 2EFNA 2WSEC 4M63A 2ZH5A 1FJGF 4MYTA 4AUKA 4HDHA 4JI2F 2PSZA 3PVXA 2M4MA 2YTCA 4TQSA 3DM2A 3BDPA 4ES2A 5B09A 4B9SA 1XERA 1V6HA 2YKNA 4O3RA 3M8QB 4RNMA 1R8CA 3Q23A 3G86A 3PJXA 4OX7A 4EBCA 1S0NA 2RUGA 2RQMA 7FDRA 3QO9A 2KZZA 2F7VA 5L39A 3PRBA 7FD1A 4IRKA 1ZAWA 2MJNA 2FJDB 4WTYA 3POTA 1AW0A 1JLGB 3N79A 1NO8A 1E6VB 2HWIA 1SV5A 2EFOA 5HROA 5CYJA 2GHWA