3P49B

Crystal structure of a glycine riboswitch from fusobacterium nucleatum
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
92
structure length
92
Chain Sequence
TRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein/rna
molecule keywords GLYCINE RIBOSWITCH
publication title Structural basis of cooperative ligand binding by the glycine riboswitch.
pubmed doi rcsb
source organism Fusobacterium nucleatum subsp. polymorphum
total genus 17
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2010-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3p49B00
1OWXA 3CMES 1VQ4S 3UCGA 1U1NA 1VBXA 1DHMA 2LKZA 3CPWR 2YH1A 4QU6A 1RKJA 2F3JA 2DNYA 3UCUP 2LEBA 2JRSA 1O0PA 2BZ2A 3D2WA 1H2VZ 2CQ2A 4OZ0A 5LJ3Y 3N9UC 4TU9A 2GO9A 3I55S 2DHGA 1R8PA 4F25A 5EN1A 2DH9A 4Z2XA 2FC8A 3JB9k 1QVGR 2CQ0A 3SDEB 3PIPQ 2GHPA 2MKKA 2ADBA 2HVZA 2K3KA 2MY8A 2BOPA 2HGLA 2MKCA 2JX2A 2LEAA 2NZ4A 2PEHA 1JJHA 1X0FA 5DM7Q 1YIJS 1KQSR 2O3DA 4WFBQ 3SMZA 3EX7B 2MSTA 1KOHA 2DO4A 2CJKA 5DM6Q 1U1KA 4WIIA 5DDQC 1M5VC 2MZJA 4WKRA 1AUDA 1DBDA 2DIVA 2RNEA 3CMAS 4V19X 3VF0B 4PR6A 1VQ6S 4ERDA 1U6FA 2MQNA 1X4HA 2KYXA 4WCEQ 3K0JA 2HGNA 2LQ5A 1SJ3P 1VC6A 1K8AT 2XS2A 3U1MA 2ADCA 2RT3A 2FY1A 1X4CA 2MPUA 3NS6A 2EK1A 1WHXA 1U1RA 2ZJRQ 5ITHA 2RRBA 2E5IA 4P6QA 2KT5A 3SXLA 1RK8A 3S8SA 2KG1A 1WI8A 2M0GB 3BEGB 4CQ1A 5GAHU 1U6BA 4M5DB 4YUDA 2V94A 4PRFA 2X1AA 1WEYA 3J7YU 3BO4A 3TP2A 2MKJA 2F9DA 2CPYA 1VQ7S 4C4WA 4WFAQ 2DNZA 2FC9A 3VAMA 3MOJB 3OW2R 4CH1A 1WG5A 1KD1T 2HZCA 2HYIB 1U1QA 1H2UX 2DGOA 5CXTA 2KRBA 5D78A 2MQQA 1WI6A 4ED5A 2DGXA 3Q2SC 2LXUA 2G0CA 2JVRA 3THPA 5DDRC 1XN9A 1H6KX 3CTRA 2E5JA 3HI9A 2KVIA 4QPTA 2U1AA 3VAKA 3NS5A 2KG0A 5LXRA 2D9OA 2KM8B 2CPZA 2DITA 5BJRA 1SJRA 2NLWA 2E5HA 1X5OA 3EGZA 2QEXS 3NNHA 4QU7A 2YTCA 1X4DA 3S6EA 1WEZA 2D9PA 2YH0A 2X1GA 1U1LA 1FO1A 2DGTA 1VQOS 2DNGA 4C7QA 5LSOA 3MXHP 5JVHQ 3MD1A 5DDPC 2RS2A 3LPYA 2LCWA 2LMIA 4LMZA 5H1SV 2ERRA 3NMRA 3G8TA 1FNXH 3S01A 2E44A 5FJ4A 2L08A 3G6ES 2MQLA 2N3LA 5LJ5Y 2XNRA 4TLQA 2MMYA 3HHNB 3CCQS 1CVJA 3BO3A 2CQCA 2PE8A 3UD4P 5DETA 4EGLA 2LECA 1M90T 1X4EA 2MHNA 5LSLA 2CPXA 2JWNA 5IM0A 4OZ1A 3Q2TC 1VBYA 1FJ7A 2MZSA 1P27B 2OSRA 2CPEA 1BY9A 3US5A 2B0GA 2KU7A 2XNQA 5IQQA 2VODA 1SXLA 2MKIA 4Y0FA 2DH8A 1SJ4P 2RRAA 3CC4S 2M8DB 1M5OC 1YHQS 1SJFA 1KC8T 1F9FA 2DNOA 1YI2S 5GAEU 3THTA 1WG1A 3MI7X 3IWNC 1P1TA 2YKAA 4J5OA 3H2VE 4F02A 3MUTP 2MJNA 3CXCR 4W92B 2DNHA 3BO2A 1YJNS 2FHOB 2RU3A 2DIUA 3TYTA 5IM0B 1M1KT 2KXNB 3PIOQ 1N8RT 1WHVA 1X4AA 1VQ9S 1VQKS 4IUFA 2E5GA 2F9JA 1WEXA 2CPFA 1UFWA 1YTYA 3CC2S 4YOEA 3CCLS 1YITS 1X5SA 2MYFA 2CQ4A 1IQTA 2EK6A 2I38A 3G4SS 1OPIA 3U1LA 2CQDA 1N52B 1VQNS 2ZJPQ 1JMTA 1D9AA 2MXYA 2RVJA 1FT8A 2MKSA 2X1BA 1Q81T 2DK2A 3FEYB 2J0QD 3IRWP 4U67Q 3S7RA 2MZRA 3RW6A 2KFYA 2MZTA 3EGNA 3DLLQ 4RU2A 1SJQA 3ULHA 3CCVS 1U2FA 3MURP 4LJMA 2DO0A 2M88A 3I56S 4W90B 2MGZA 2DHXA 2JVOA 2LA6A 1VQ5S 1ZZFA 2M4MA 2CPHA 3CD6S 3CULA 1FHTA 2KXFA 2FPHX 3P5TL 4UY8T 1S79A 2XSFA 2DISA 2VOOA 2CQ3A 1N88A 2MKHA 2MSSA 3P3DA 4IOAQ 1K9MT 1A7GE 2OTLS 2M7SA 2X1FA 3CCES 3B4MA 3P6YC 3UD3P 1A9NB 1G2EA 2J76E 1N54B 2J0SD 3B4DA 3FEXB 2KXHA 2MGZB 3R1LA 3MDFA 2SXLA 2G4BA 2CPDA 2KRRA 2MZ1A 3NNCA 1DRZA 1Q82T 1WF2A 1WF1A 2M8HA 2I2YA 5IFMA 3CCRS 4BS2A 1WWHA 2KI2A 1URNA 1X5PA 5LXYA 3VAHA 2DNNA 1K73T 1U1OA 2OIHA 2M2BA 4CIOA 2UP1A 1HD1A 5GADU 2DNKA 4IOCQ 2A3JA 2DGQA 4CH0S 2RQ4A 2XB2D 3CF5Q 4WF9Q 2MY7A 2KHCA 2DGUA 2HGMA 1R8HA 3CUNA 5JVGQ 3VALA 1YJ9S 2RS8A 1KOOA 3L3CA 2LXIA 1S72S 2VOPA 1HA1A 3CCSS 3CCUS 1OIAA 2CQ1A 1U1PA 1WHYA 4A8XA 2CQHA 1ZH5A 1HD0A 4UQTA 2D3OR 4PKDB 2DH7A 2MQPA 3UWTA 3VAGA 5D77A 3VAJA 1VQPS 2CQGA 5GMKa 3TO8A 3ZZYA 1FXLA 1WF0A 2CPIA 2EVZA 3H2UB 1VC5A 2DNQA 1QVFR 1X4BA 3V4MA 3G8SA 1NU4A 3UCZP 2AYEA 1X4FA 1WTBA 5GVQA 2DNRA 4C0OC 3CCMS 1YJWS 4QQBA 2G1DA 2J8AA 2OTJS 3R1HA 1B7FA 3LQVA 2XS7A 4LIRA 3BS9A 1VQMS 4F26A 1VQLS 1M5PC 3MUMP 3P49B 2OSQA 3J7ZT 2U2FA 2DHAA 2MQMA 1X4GA 2KM8C 2ZJQQ 2AYGA 1X5TA 2MQOA 1W2BR 2XS5A 1UAWA 4TU8A 2Q79A 4WFNQ 4TU7A 2CQIA 2YWKA 2L9WA 1D8ZA 3MUVP 5GAGU 3G9CA 2AYBA 1PGZA 1VC0A 1JJ4A 1Q7YT 1NJIT 5HL7Q 2RUGA 3ZZZA 2DGSA 5HO4A 1WG4A 2N7CA 2DNLA 3G71S 3VAIA 2CQPA 1ZZNA 2N82B 2LA4A 2LYVA 3UE2A 1H2TZ 2MB0B 4IO9Q 1DZ5A 1OO0B 4FXWA 5CYJA 2DHSA 2RQCA 3VAFA 4Y00A 1FJCA 3CCJS 1VBZA 2DGWA 2M70A 4YB1P 1FJEB 2CQBA 2M52A 3CC7S 1NO8A 1L3KA 2K8GA 2N3OA 2L41A 2OJ3A 2DNMA 2QA4S 2DNPA 1HL6A 1QM9A 5DDOC 2QFJA 1Q86T 2WBRA 1WELA 1UP1A 2DB1A 3NNAA 1VQ8S 2MZQA 3MD3A 1PO6A 2AYMA 3RW7A 4ZKAA 5CA5A 1U1MA 2AD9A 2KN4A 1JJ2R 5MLCV 2M9KA 3DXBA 2CPJA 1YWXA 3R27A 1WHWA 2KH9A 2VONA 3G96A 3SDEA 1M5KC 2DGVA 4FXVA 2MJUA 1UW4A
chains in the Genus database with same CATH superfamily
1VQ4S 1VBXA 4GKKJ 3CPWR 2QE5A 4LFBJ 2DNYA 1UW9A 2FVCA 2XMWA 4PCQA 1PSDA 1RAGB 4J7CA 2DHGA 1R8PA 3BH7B 1EARA 5D4OA 4JI5F 4B9SA 4P73A 1T9TA 4LBHA 2MY8A 3R97A 1X0FA 1YIJS 4I2QB 1RADB 2DO4A 2R2UA 2VFVA 1DQ9A 1FX2A 5DZ7A 4OYXA 1NJYA 1UA1A 1I1GA 3VF0B 4CT9A 1U6FA 4Q2LA 4KB7A 3FCWA 3NGUA 3W2VA 3OR1A 4JB8B 1UVNA 2RMLA 1U1RA 2OFHX 3NS7B 2QGFB 2OPPA 4DL3A 3S8SA 2O67A 2WZ1A 3KUHA 1OSDA 1NK4A 1U6BA 3CW2C 4XAKA 4ZVEA 3C6TA 3GU0A 3HJFA 3OW2R 2HZCA 4DL2A 1V6HA 5CXTA 2AJ0A 1R43A 3GJTB 2CADA 3HDSA 5G0RB 3BB5A 1CJTA 2EW9A 3ZTQA 4LF4F 4CLPA 3Q8SB 2CDRB 2UUAJ 1GX6A 3DLEA 4U7CA 3VGSA 1UVLA 4C7QA 3NL0A 2RS2A 3AJDA 4RW8A 3FQKA 2HQFA 2LMIA 1X9MA 1TK8A 1KVIA 3VVUA 2GVZB 2B8PA 2F7VA 4NLOA 4PXBA 4KHPJ 3BJYA 2C3MA 3HHNB 3M9MB 4DPYA 2AJ2A 4QIEA 1PKUA 2CPXA 5AXKA 4NYPA 3Q2TC 1VS3A 3TJ8A 1T3OA 4P2SA 4KY3A 5A8KA 3CJ3A 4NLQA 3BBBA 5DS7A 2PSZA 4N47A 4DR1F 4RO0A 5GAEU 4C8OA 2ASYA 1RTJB 1RXOB 3QGIA 2DNHA 1LK5A 1UFWA 3ZZRA 3CCLS 3D5MA 4Y3CA 1REVB 5F9NA 1FJGF 2KL8A 3FEYB 3RTVA 4OI1A 1NB2A 2D7SA 1ZTWA 2KFYA 2VPZB 3AXMA 2F4VF 4W90B 1T03A 3CIZA 1VQ5S 2KHDA 2ABYA 3QGHA 4LSNB 1RYSA 1IN0A 2MSSA 4M95A 4DV6J 4KIAA 3IWLA 2J0WA 4K0KF 2BKNA 3DM2B 4DCOB 2J76E 2ZZMA 4QCLA 3R8YA 5K8NA 2CPDA 1S7IA 2KRRA 1JXVA 5DRKA 2Y0BB 3FRZA 1T94A 1U1OA 3K17A 4UUXA 3B6BA 3W64A 3ZTRA 1R8HA 5KG7A 4ILRA 4GKJF 3ISND 3NWRA 2ZH6A 1REGX 3KNGA 4QW9A 4RNNA 3MMCA 4U8YA 4DU8A 3FMBA 4DHVA 2IHR1 1X4FA 2EBGA 3KLHA 1X9SA 3BQ2A 3SQGA 4QQBA 1MLAA 4DR5F 4DF4A 3OJSA 1NK7A 3LOUA 1JKHB 2I0XA 2V4JA 4HACA 2ATLA 3OHAA 3EVMA 3S1TA 1T95A 2B4PA 2KDOA 2KM8C 3ENQA 1KQKA 1LKZA 1DY3A 1G6BA 2AYBA 1VC0A 5L8RC 3GJSB 2DNLA 3VAIA 3IN5A 2C22A 2UVWA 1H2TZ 1DZ5A 3TUIC 5KFLA 2RKIB 1QAXA 4CNZA 1HNXJ 2ZZTA 3HVTA 3R6GB 5AJ3F 1NK0A 2DGWA 3G86A 1MROB 1N32F 3MFIA 3MECA 1LV5A 3PV8A 1UJ4A 4FS1A 5BYQA 4OQJA 4ID5A 5J2PA 4JI8J 3UVJB 5JXSA 1S99A 2HVEA 3RRGA 3K59A 4HT5A 2RJZA 3FDSA 4AE5A 4NOHA 2BV3A 3PYDA 1DJ0A 4CLYA 5K9FA 3WQPA 3VQSA 5C24A 3DMJA 2DT9A 4TU9A 2HFVA 2KKHA 4DV7F 4ELTA 2V67A 1CPZA 4ZVUB 4BWJA 1HNZF 3VGUA 2FJEB 2LDYA 3PVXA 5K14B 5J2QB 3TANA 2NZ4A 2X51A 1BC6A 4HI2A 3C2PA 3D3CJ 4OJHA 4Z7CA 4FF3A 2XWXA 2R8JA 5L1JA 1RT3A 3SBMA 3AH6A 3C3LA 1Y3KA 1N5YA 2HAFA 3OVAA 3NEKA 3HSDA 5B0CA 3R5AA 4NCGB 1VR6A 1KWMA 4DUZJ 3UPFA 1Y10A 1JLBB 2MPUA 1WHXA 3FRYA 2BYCA 2DYAA 5CZVA 2DBBA 5AT1B 3MTKA 3GYGA 1WI8A 2M0GB 1QUVA 2XZDB 5JMNA 3DGPA 4M5DB 4FYYB 1IR1A 2HNDB 3ENVA 1SQEA 3J7YU 2Y1LB 2NYIA 1VQ7S 3GMGA 4CH1A 1XK8A 3J80Y 1D09B 3P8BB 2KRBA 1C4AA 1VRUB 2E5JA 4C11A 4QPTA 2CPZA 2FDNA 3QT5A 5HROB 2H4YB 2B6AA 2NSBA 5KFSA 3M2RA 5ETSA 3HULA 2QEXS 4C6AA 4FS2A 3A8JA 2X1GA 4L6V3 2DGTA 1RWOB 2RUSA 3H98A 2YQ1A 2VA2A 2W2NP 1R31A 2VJUA 3DHWC 2DXDA 4M5IA 1TUVA 1I94F 4NRTA 1TFYA 4IDKB 3TZZA 4JI3J 5LSLA 3BBCA 4QPXA 3IFEA 1YKWA 2QRRA 2RRAA 2M8DB 2POKA 4C98A 2E1RA 1SJFA 2AX1A 1GTEA 4YR0A 1BUXA 3DDKA 1G1XA 1BQNA 1HWLA 1IBKJ 2CZVC 1NK9A 4MAKA 2QYGA 1WHVA 3VZHA 3Q8RB 3MEEA 3C14A 4HL9A 5M2RA 2JSXA 3TW0A 1QD1A 4DN0A 1Q8KA 4LT6A 4USIA 4UT4A 4B3RJ 1GMWA 1NB7A 1S1UB 3TJAA 3QPIA 5I3UA 4X4RA 3M1VA 3JQKA 4JV5F 4Q43A 1FHTA 2DPIA 1HIYA 2HBZB 5A2QY 1RWNB 2AJFE 2DISA 1QAYA 2CQ3A 1FF2A 2BM0A 1Y5LB 1H0HB 2KXHA 2MGZB 3CDAA 1EB0A 4ZVPB 2X7IA 2CJYB 2FQQB 4DCJB 1B0VA 4DS5A 3W3SA 4LUBA 1NKBA 3MHYA 2VV5A 2D69A 2KI2A 2JEGA 2Q6BA 2E5LF 4LVNP 4Y2MA 4KO0A 2LP4A 2XB2D 5DQHA 5A0YB 2DGUA 4NMXA 1NSPA 5H9FK 2B9XA 2D74B 2RS8A 3IS9B 2OLWA 1NEEA 1TKDA 1E6YB 1HD0A 4DR6F 2MQPA 3ENWA 4OI2A 2LEPA 2R2TA 1HQUB 5LMNJ 3QWPA 3ZZTA 1R8CA 1S0OA 1SH3A 4ES2A 2RQMA 2HQGA 4C2MA 4ZIVA 1VQLS 4G3IA 5GAEI 3F41A 3AD9C 5IT0A 3J7ZT 1X4GA 3DRSA 2XBPA 4WFNQ 4A8OA 1C0TA 2R3VA 5M2PA 4YB6A 1XERA 1Q7YT 2E29A 3ZZZA 2JEFA 4GRSA 4DV4F 3HD1A 3EDQB 4OIXA 2RIJA 2N82B 4WZQA 2FHKA 3CWJA 3QJPA 3D6MB 3QZ7A 2FZGB 1WC6A 1WELA 1RHUB 3MCMA 1UP1A 4MIWA 3A12A 1PO6A 1HW9A 3K89A 1TKTB 2IAJB 2QJ3A 2NPFA 3MMBB 3K5LA 1KHVA 1RTHA 1WHWA 2AW0A 3RAQA 1RBLA 1OWXA 3WC0A 2YVSA 3OL9A 2BX6A 3KMSA 1XTZA 5EN1A 2DH9A 3DYAA 3BSCA 2UXCF 3SDEB 7FDRA 1IBCB 2H54B 1D0EA 1FEHA 4X4TA 3MAAB 4H4MA 1HFEL 1U0HA 4X2BA 1WKJA 4WK3A 2PI4A 4FYXB 2LQ5A 2VPXB 1HR0J 3AHPA 1LWFA 5KG4A 2EK1A 5ITHA 5T41A 2X3GA 5LT5A 2XLKA 1IKWB 1T05B 4EZ6A 1GX5A 1B0PA 4PXDA 4WYWA 1LW2B 2QX0A 4F8RA 4DR7F 3KK1A 8AT1B 2YNFA 3BO4A 4D3GA 2W9BA 4ED2A 3MOJB 2FJAB 1QDUB 3W7BA 2ZOMA 2DGOA 1V5VA 3IG1A 4MKAA 2BQRA 4J9QA 5HJXA 3QZ8A 2MTLA 2JVRA 3Q8VA 3P5BP 3W60A 5LXRA 3BGRA 3OFHA 5IWAJ 2R7RA 1VDHA 1EZZB 5B0AA 3MR2A 3QLHA 2NQPA 3PR5B 3M8YA 2NS1B 4X64J 3LPYA 3ITHA 1VGYA 1S6PB 3HFKA 2D3O1 5KG6A 5KFCA 4I6WA 4NI2B 2H5JB 1NJXA 4ZJLA 5LJ5Y 1L3VA 5CYQB 1TL3B 1CULB 2DXEA 3DLKA 1PILA 5HJYA 1M90T 2DR7A 3MR3A 3DI6B 2XM3A 2MZSA 2BJ9A 4J9NA 3PEHA 1JLGA 5K20B 4CO0A 2JDJA 2CG4A 3PW2A 2CKWA 1YHQS 4TYAA 4WP8A 2UXDJ 3THTA 3U27A 4ECXA 2E7WA 2B7CB 4ECVA 1JLCA 4E2FB 2F9JA 1WEXA 2RDDA 2CJBA 3WIUA 1SJ1A 3AY0A 3LANA 3SEOA 3QYYA 4C8NA 1XBWA 2GVDB 2X1BA 2R2RA 4K4UA 3IRWP 1F9EB 3HLUA 2J7UA 1Z1ZA 2XI3A 2KB2A 2ZBIA 2FHJD 2HFUA 2M88A 4NLSA 3TQ1A 3T6JA 3TZWA 4ZDNA 3CD6S 1M1GA 2QFIA 3BKUA 2OPSA 2YWEA 3NMAA 1PC5A 4GKKF 4M5JA 1VRTB 3AOBA 3I32A 1HPZA 3LF0A 4LFBF 4ITSA 2OTLS 3DLHA 2BJDA 3WC2A 5HK4A 3KG0A 4UTGA 2HHXA 1B99A 1NSKL 3IGNA 5KFJA 3KDNA 2AU0A 4LF7J 1OQ6A 2Z56B 3CCRS 3KLIA 1K1QA 2FJWA 4LF8J 2OIHA 2HHUA 2NZCA 2WONA 3LPEA 2EXUA 2F4FA 2P9EA 1B70B 3VALA 4KRWA 2HK3A 5D4NA 1HA1A 2EFQA 4JBCA 2ACYA 2QLFB 4UQTA 1HNVB 3C16A 4OYIA 1YJUA 2CPIA 4RW4A 5A6WA 2ZH3A 4Y2KA 4QYZK 3G8SA 3UCZP 3NBPB 3FBCA 5IV3A 3HHLB 4KPYA 2DNRA 4O44A 2G1DA 4EMDA 3KNAA 3R2CJ 2XS7A 1YDLA 2NREA 1LEOA 2W2OP 3VR1A 4LF6J 4R5PA 1UFLA 2V2QA 1PAEX 2VBXA 1VCTA 4ZLNA 1MU2B 3DNCA 5HP1A 3I0SB 2XSJB 2UUAF 2COLA 2HLTA 3W8PA 1Z4UA 2P2CB 5MAOA 3CCTA 2PT0A 2FB0A 4K4ZA 4DQIA 1OYDA 2UV8A 2W9CA 2M70A 3CJ8A 3CJRA 3MM7B 4KHPF 1QM9A 4M94A 1ZA2B 2RF2B 5FLXY 2QLWA 2AZ3A 4D3HA 4YHHJ 4Q7AA 2XLIA 3PO4A 4WXOA 3JYTB 3W2WB 3RJMB 2AD9A 1NHUA 2HZVA 4YR2A 1N4LA 1YWXA 5C5JA 5E3AA 1RHKB 3T41A 4QIWD 4F3MA 4DSKA 2LKZA 1DARA 2RDJA 2GQCA 1KQGB 4HH0A 1TELA 3UCUP 4I2QA 4QWBA 1H2VZ 2P9CA 3N9UC 1GFWB 2ZH7A 1RLDA 2FTRA 4N5SA 3RBZA 5KFTA 4IG3B 1KR4A 5DM7Q 4QZVB 1WD6A 1NAQA 1RAOA 4OV6A 1YJVA 2B4UA 2VFRA 3TNVA 2BJ3A 2RNEA 2MQNA 4DQSA 3MCNA 3P96A 1R89A 3U1MA 5E5NA 2RT3A 3N6NA 4MK7A 2RRBA 2A2DA 4LF2A 2CG8A 4HDHA 3LUYA 3UDEA 3KLFB 1HHQA 3IR6B 4LR9A 5KG0A 2KG1A 1UZDA 3AOCA 1S10A 3TWZA 4DV6F 3L7OA 5G0RA 4PRFA 4X4UA 2R4FA 3SCKE 4XDCA 4ZN3A 2YKPA 1Y3JA 2LU2A 2MLYA 4C4WA 2ZDPA 4JV0A 1KLNA 3QJJA 4ED5A 2ZD1B 3KOAA 2ROPA 4IFVB 1XN9A 2WVFA 2KVIA 4F4YA 2DITA 4PG8A 3M8PB 2GVZA 3EGZA 1VIOA 5CCMA 3Q83A 3EICA 2Z4PA 4MYUA 1NJZA 5C2GA 3MXHP 3I9V9 3QMQA 1N5TA 3MZIA 4DV0F 4GO7X 1JNRB 4DZDA 2PN6A 2AHOB 1CJKB 3D66A 4CM0A 2MMYA 4EK2A 2YPZA 1RTJA 4PZVA 4LVOP 4P2MA 2P6TA 4CLWA 5E3CA 3EWGA 4O3NA 2IM2A 2K06A 1REVA 3K58A 2BA9A 3LH2S 3RB0A 1RAHB 1HHSA 4C8ZA 2EWHA 5CYMB 3H2VE 5CH7B 4ECZA 1Q7LB 3PDNA 3AAWB 1Q95G 5J1EB 4RUCA 1I3OB 4YOEA 2HNYB 1HNXF 1I6JA 2MYFA 3SSQA 2HQCA 1LOUA 3IAM9 2HQ3A 1VQNS 2ZBRA 2RVJA 1Q53A 4LSNA 4PAAA 1DQAA 4U67Q 2VH7A 4ED3A 3PX0A 2F8HA 4WP3A 2VKRA 1SJQA 4JI8F 2XY7A 5GAGI 3DM2A 1HKAA 2FLNA 2JVOA 5EX0A 5HVFA 2DXFA 1UZHA 3P3DA 4HHHA 5D0HA 1NPKA 3UD3P 2B4VA 2J0SD 3CEDA 1Q16B 2JLGA 2B9EA 4USMA 3IP0A 2YQ0A 5A6PA 4XPEA 2VZ9A 1S0VA 3PZPA 3W66A 2UUTA 3H25A 4IH7A 4ETZA 1K73T 2BE2B 2GIRA 4IOCQ 5E3PA 5EWFA 2V34A 3Q8YA 4MH8A 1VIXA 2HGMA 4DMZA 3A8IA 5JVGQ 2KFZA 3IRXB 5E7OB 4KH0B 4HKQA 3D6HB 1JKHA 1FERA 4FF2A 4DN9A 1WC3A 3VAGA 5GMKa 4OYAA 1HHTP 4OJGA 3MCOA 1QVFR 1WJ9A 1F0XA 1KDNA 1NMEB 2YKNB 3BKTA 1K1SA 3G8QA 4IR1A 4DL4A 3RYLA 5ETRA 3LQVA 3PO5A 1EQMA 2UXBJ 3BGLA 2RKIA 2ZJQQ 2MQOA 2XS5A 4PQAA 2F40A 2L9WA 4ZPWR 2ZH5A 2OAUA 3FBFA 1MROA 3DRXA 1FWPA 1W26A 3FKBA 5HL7Q 2RUGA 2HRYA 1CSJA 1ZZNA 5D0EA 4AL5A 1RTZA 1RHQB 3DGVA 1N34J 3UVJA 4Y00A 2NSCA 3QIPB 4EO8A 1TMJA 2QSWA 3CC7S 1NO8A 1VK8A 3CB4A 2MLXA 3SV3A 1Q86T 3TUZC 4ES1A 2IC3B 3K2YA 4ZKAA 3R3TA 5KFIA 4G1PA 2P6SA 4JI3F 5MLCV 2ZVSA 3E3XA 2K3IA 2VONA 4WE1B 5ETOA 5K14A 5I3QA 1IBKF 2MKYA 4CLFA 3D9BA 3PCOB 1U6ZA 3CGIA 2DPJA 4N8OA 2BOPA 2WW4A 1JLBA 2RE1A 1NKCA 1M1HA 4B3RF 1JLFB 2RU9A 1AUDA 2DIVA 2ROGA 3HK2A 3CMAS 1X4HA 1MNEA 4M5DA 2HNDA 4QWAA 2XY6A 1RBOB 4ECTA 4QWEA 1OQ3A 3BGUA 4ECSA 2JH3A 4OL8A 4DV3F 3QFHA 4MT1A 3UN3A 1VRUA 1PG5B 3TVZA 4YUDA 1TR0A 1U0SA 5HROA 3IMQJ 4NWBA 1KD1T 1U1QA 2HAIA 4HR2A 5K5MA 4WU2A 3NXZA 3CIMA 3D1HA 1TVRB 1FRJA 2XMKA 1RJJA 1HBOB 2GV1A 1IQZA 5SUHA 4WK1A 4RWWA 2FJVA 4X4NA 5CHCB 4J9SA 1AUSL 2FY8A 4PQUB 4IDKA 1KFDA 2Q6CA 3EZOA 3PR4A 3HHDA 5LMNF 4J9LA 3MEDA 3VZIA 4ZVRB 3NGRA 1BQXA 1F2HA 4OZNA 3C46A 3D1QA 2C3OA 1RT2B 5IQQA 4DBQA 4BBYA 4DPTA 3VGTA 2V8DA 4J9OA 2VUGA 4J5OA 3VTIA 4F02A 2AMCB 1S1UA 1S49A 2X3DA 1OYEA 1X4AA 1RHRB 3DRPB 4H4KA 1VQKS 2YPYA 4Y2CA 1YTYA 3CC2S 2ZE2B 3RAMA 1UEUA 3U1LA 5KFOA 4ECRA 2EFPA 1NHKL 3OVSA 4I6YA 2O01C 2J0QD 1U09A 3JQJA 4DPUA 1RHJB 2YBVA 3T1AA 4DFJA 2MGZA 1U8WA 5KFRA 2IRXA 3CULA 2FZCB 2QL5B 4LR8A 4H4OB 1FJGJ 1N88A 2HMIB 5K8OA 1TUWA 3CNQP 1VLYA 4QOTA 2XLJA 1NHVA 1IWAA 4IO1A 3ZZUA 5A0YA 2CRLA 4KGXB 3NNCA 4O0NA 3IS9A 1WF2A 2M8HA 3MFHA 3SZ2A 4LRAA 1E6YA 3VAHA 4AQYJ 3KJVB 3HVWA 2Z0GA 4LF1A 5DZ6A 5EGYA 2RQ4A 4WF9Q 1HQUA 4ZP6A 1RE1B 2CVIA 4A46A 1HR0F 3CD7A 3WHIA 4OYZA 2V8HA 4Q2MA 2XGPA 4NASA 3UWTA 2FYXA 4RKUC 2A18A 3TO8A 4OHYA 3GFHA 4O23A 4F2SA 4A48A 4ECYA 4KTQA 2ZDOA 3MEGB 2HKEA 2XMJA 1WSRA 2KJWA 3QT7A 4IH5A 2ZWOA 4FVCA 4GKJJ 2B9WA 1A6LA 4PWUA 3DC2A 4IQXA 2VF3A 3BSOA 3IBCB 4MK9A 3ILJA 5KFNA 4CLSA 5IWAF 5F8IA 2VFTA 4MIAA 4DL0C 4WKYA 4B9UA 4FXWA 4NLXA 1RWKB 2ZC4A 1ACMB 4X64F 4C0BA 1TKTA 5L1KA 3KMQA 3GIJA 2WAQD 1KBRA 2IAJA 2YNHB 2BANB 3MMBA 2KFNA 2R8HA 2L41A 4AUKA 1SKRA 2YNIA 2QA4S 3MMJA 3H20A 4IFYB 4RPFA 4A8SA 3NNAA 3CVKA 4DWIA 5B0BA 3UN5A 1JJ2R 2OD4A 5DG7A 2IVMA 3SDEA 4PUOB 2HSEB 4P7VA 2UXDF 1VISA 4GMKA 3MAAA 3KDOA 1H38A 4DQRA 4ZPVR 3D7SB 2OH2A 1TV6B 3N4WA 4F25A 4DFPA 3E8OA 3M7VA 4IKAA 3I6PA 3JB9k 3MPVA 2ADBA 5L38A 1HWIA 1YJ7A 4USKA 2PEHA 2PO4A 2O3DA 1V3RA 4BCAA 5KG3A 1N5VA 2MHEA 3DDIA 2ZWPA 1T05A 4MJKA 4V19X 4L76A 3T1HJ 1LW2A 2KYXA 1IKXB 5E2QA 4CO5A 2DEJA 1Y9OA 5M2UA 4WP9A 3TAQA 5F8MA 3DOLB 2JC0A 5THWA 2G2YA 3CDBA 1RAAB 2IVFB 2KT5A 3BGOP 1TQLA 1KEKA 2AGPA 4G1IA 1FNOA 1NKEA 5B0DA 4RLEA 4OI6A 4QIGA 4ZCIA 4FN5A 2FC9A 5F0UA 2J7WA 2FJXA 2RD5C 4BC7A 4LF7F 1QTNB 2CNLB 3DRYA 2CIMA 4DI6A 5IOLA 2DGXA 1HQ2A 2GJFA 4X4VA 3EGWB 4LF8F 2BRLA 3CTRA 3GG1A 3M6WA 1C1BA 4WPAA 1KSPA 1S6PA 2KO1A 3FK4A 5F8JA 2KM8B 4NI2A 5BJRA 2NUHA 4TQSA 1VHIA 5T7LB 5CYQA 3PACA 4QR2A 1TL3A 4DLGA 2VBWA 1CULA 4K4YA 3DKDA 3ZTSA 2O66A 2WCXA 5LSOA 4CI0B 3KJQB 3V4IB 5IQ6A 3DI6A 1CEZA 1UVMA 1HWJA 4NZ0A 5KFAA 3G8TA 4QWCA 3G6ES 3JTPA 1VI7A 2GO8A 3MPWA 1FK9B 2W1BA 4HI1A 2QLJB 4OX9J 2GJ2A 3OLAA 1FJ7A 4LF6F 2WHOA 1HARA 3US5A 1ZA1B 3LWLA 3ZZPA 1TL4A 3K5MA 1DLOB 5E3RA 2HS4A 2GVDA 2PA3A 3EVOA 3BO2A 3FMWA 3LP1B 4J91A 2XI2A 4UZBA 1PBAA 1S1TB 1N8RT 1WUUA 2E5GA 1T9VA 2UUBJ 4AL6A 1I94J 5KOWA 4I69A 1OPIA 4K8RA 3PXGa 3SI8A 2ZJPQ 4NXNJ 1Q81T 5HMWA 3UNYA 4H54A 3WX8A 3RB3A 1VRTA 4YHHF 4I68A 4OI0A 1OMSA 3TX0A 4PWDB 5FDLB 3GTYX 2BMBA 2M4MA 3SCLE 2YX7A 2ZH1A 3KK3B 2VIHA 4K7QA 3CD5A 3CJKB 2BDPA 5K8MA 1RYRA 1FRHA 1I51B 4G1QB 4QR1A 2ILYA 1KN6A 4CTAB 1Q79A 1RT4B 2R7SA 3PKMA 3JQMA 1SH2A 4F4XA 3FCVA 3OLBA 1WF1A 1GQEA 4CO1A 3HHLD 3BH6B 2QV6A 5LXYA 1HNVA 4LBIA 2DGQA 2JOQA 3QT6A 2KHCA 3UDVA 2ASLA 3CUNA 3NBPA 3ENAA 5KFKA 2DR8A 3HHLA 1LK7A 3I9ZA 4C0HA 1RWUA 2FJDB 1MWYA 1LW0B 4A8XA 3J81U 4M5GA 2DH7A 3KHGA 1TL1B 4YMEA 2DNQA 4CLLA 2RDIA 3NWGA 3W5YA 1MU2A 2YX4A 1XMOJ 3I0SA 1DTTB 3GILA 2ASDA 3HJVA 4G6VB 2OTJS 2XSJA 3IAS9 5AXNA 1F6TA 3GV8B 4USVA 3IO1A 3AQOA 5F3TA 1YRXA 4DEZA 1D8ZA 5CAAA 3MM7A 4PG7A 3G9CA 4NLPA 2EEYA 4P52A 4DUYJ 3QRRA 2Q3PA 2IM3A 3TUJC 4KGMA 2AEFA 2OEMA 3JYTA 3BF4A 4RNOA 3W2WA 2RQCA 2DRBA 5HQ8A 2CUYA 1UJ5A 5HI7A 1FJEB 3IR5B 5EWGA 3I5AA 4ATNA 1Q78A 3OL7A 1VMBA 1OJ4A 2YKMB 1TTHB 1RKIA 3OHBA 2FVSA 4LRDA 4OZ3A 3PFEA 2J8SA 2GQ2A 2CPJA 4FDFA 2VG7B 1UL3A 4IG3A 1TFWA 4KKOB 4LRFA 1Y00A 1HI8A 2PMWA 4NA1A 2NCKL 3GPAA 2CQ2A 3OT9A 2FLOA 4DF8A 1T0TV 2K3KA 5DLGA 2V4RA 2EFVA 2AJQA 1GAOA 3KLFA 1F3FA 4X66J 1VQ6S 2PMHA 4I56A 1TAUA 4B9TA 3K0JA 1VBKA 2ZNYA 3RB4A 2XHWA 1T9UA 4RZRA 5KG1A 4ZPDA 3T9NA 2UXCJ 2W8KA 1RWWB 2G1HA 2A6MA 3HSZA 5KFPA 3HKZD 1RK8A 4DR2J 2D41A 3N01A 2ZD1A 1LXJA 4OX6A 4IFVA 4KBIA 1WEYA 3PYEA 3GIIA 2MKJA 3D54A 3M8PA 1S4EA 3RBXA 4DXLA 3IC1A 2QSFA 3D4JA 4TNOA 5E41A 2C42A 4IYQA 2HBRB 5CZXA 4ZP8A 5ETMA 3J81j 1ZM2A 1CJKA 3R5GA 9ATCB 2HNZB 1WEZA 3P45B 6AT1B 3LP0B 2ERRA 3VV2B 4MKVA 3H4DA 2L08A 3QIDA 1K0VA 2ASJA 3DLJA 3OFGA 5CYMA 1GT8A 4HTIA 1P8GA 5GADI 1R3NA 2MHNA 1ZYQA 1FE0A 1IJEB 1XR5A 1P27B 3X1LB 1BY9A 4C97A 4QYRA 5J1EA 3N6LA 4LRCA 4UF4A 2HNYA 2BJEA 4RL1A 4NEZA 3OUYB 2GW8A 2R42A 2FD2A 4IH6A 1ZOTA 2FHOB 3TYTA 2WOMB 4U7UD 2J6TA 1AFIA 4KGZB 1QUPA 1N34F 1XR6A 2GMJA 3R7NB 3RR7A 1KKHA 4NZ6A 3FQLA 2IJFA 4K2XA 1F1BB 3EZUA 2AIRB 4DL7A 3DLLQ 4W98A 8ATCB 2C2RA 2I5JB 1X60A 4F4KA 1R7IA 5F9LA 3PYGA 4ALZA 3T6BA 1IM4A 1S79A 1FVSA 4G65A 1PYOB 4TY8B 2M7SA 4NCAA 2HHHJ 1Q8BA 4KJIA 4DX6A 2BE2A 1R6YA 4RR5A 2QC3A 3K8VA 2HFOA 2V2KA 3IRXA 1ITPA 3C66A 4RNFA 1KLMB 1EJ7L 3QATA 3QQCD 1AZSB 1GMUA 2A3JA 3F0NA 4ID8A 3OQ2A 4LFCJ 1RGVA 2VPWB 3B82A 2YKNA 1TKXB 3D28A 1RAEB 1YJ9S 3QJLA 2G2ZA 4Q44A 1MSWD 3CCSS 1SIWB 4M5KA 1C1CB 2QG9B 4CM2A 1SL2A 4PKDB 4JI2J 5ETVA 3V2UC 4J9PA 4FNIA 3I96A 1TL5A 4ZPBA 1XNQF 1MG7A 1RT5B 4ETXA 5KFUA 4CCHA 3R1HA 2LVWA 1RU1A 3GIMA 2DHAA 2MQMA 3WBZA 1Q5YA 2B43A 3QIPA 5CABA 3PRVA 1UWBB 4QR0A 3I0RB 3TZYA 2DGSA 3PRBA 2IC3A 3GYNA 3LTOA 3H5SA 4I0WA 4IO9Q 1VQYA 3VAFA 3K5OA 4OYMA 5A8WB 2LQJA 4X4SA 2QL9B 4KAIA 2K8GA 4WE1A 3N6MA 5LMUJ 1QE1B 2DR9A 2VBZA 2V8GA 3MM5B 3E51A 2FGOA 2IYIA 4TN2A 1N6QB 4HYKA 2OFGX 5HATA 1AW0A 4EI2A 4OZ0A 1JLFA 2XG8A 3MOZA 2I6WA 1XEZA 2JNJA 2RSQA 4NLYA 1KRPA 1RWMB 2B5JB 3SIPB 3EJMA 1JJHA 1WDTA 1RABB 4AXIA 3SMZA 2XCPA 2CJKA 1EP4B 1U1KA 1RI7A 3X3UA 2VQFJ 2QMXA 3AA9A 4MFBB 3KG4A 2XS2A 1BWEA 3QO9B 4FPRA 2PMZD 3MR7A 3GG0A 1PCAA 2XYPB 4LF9J 2BUNA 2UU9J 2IMOA 3UW1A 2VU5A 4IRCA 4M63A 2VHGA 3T5KA 1RBAA 5A8RB 2X1AA 2MLZA 1PJ5A 3FGVA 3GFXA 3H0PA 1WG5A 4K59A 4NZ7A 3B8HA 3PRDA 4PQUA 4AQYF 3THPA 3NY0A 3O1LA 2UZAA 5JJBA 2U1AA 4EEYA 1I5OB 3TX8A 4HTJA 3KKFA 2OHDA 3NNHA 2YTCA 1D9DA 2Z8QA 3QWUA 4N77A 2HFZA 2VICA 5DDPC 1AFJA 4URQU 3FBBA 3LP2B 3UI3A 1RT2A 1IM6A 2MQLA 2N3LA 2YKQA 1XC9A 4WXWA 2BOAA 2OSRA 3DRPA 5DG8A 4DQPA 2XNQA 3IWXA 3QGPA 1S6UA 2ZE2A 4OLOA 4DSLA 4JYAJ 4Z7YA 3V6DB 3HXMA 5IS2A 3JAMY 4DV0J 2YKAA 2HRUA 4R0EA 1JJCB 4IR9A 4JI6J 2IJNA 2RU3A 4B9VA 4RNMA 1O8BA 2AEJA 1AT1B 1RWXB 3KYLA 1QAJA 4RBUA 4ENOA 2BKOA 3HD2A 1P1LA 4RJVA 4RW6B 5L1IA 4B3OB 1AROP 2HMIA 4OHVA 1RP5A 3EPGA 2AGQA 2DO0A 1O51A 2Z30B 4HHUA 1SQGA 3GLJA 2AX0A 4U8VA 4KV8B 3MTJA 4NLWA 5ADZA 2HW3A 1PYSB 2ZKUA 3HFZB 3KJVA 3P6YC 4P74A 4LSLB 3FBEA 1YJTA 4DG1B 1SKUB 1ZAXA 2Z2ZA 2MDAA 2VC1A 2W25A 2V2VA 2EPIA 4FF1A 2M2BA 3A3OB 4CH0S 3EE3A 3JSYA 3T1HF 3MM9B 1J2VA 4PPZA 1KOOA 1IBLJ 4ZPTR 1YX2A 2EG2A 3W9JA 4AFFA 3TARA 1H74A 3WIVA 2D3OR 3VAJA 1BMQB 2EVZA 3G6YA 4NLGA 5F41A 5A76A 3PW7A 1SC1B 1J5OB 1T8EA 1W7WA 4UZCA 4R25A 3TVYA 3MPYA 1KS2A 3JTOA 2FIUA 3PTWA 4A8KA 3I31A 1MMDA 4ZLJA 3UO0A 3CT9A 2CA9A 2AKWB 4ZVTB 1AYEA 1X0PA 2G0IA 3O2IA 4OYOA 2YNHA 2BANA 4DDFA 1QJHA 1WACA 2RRNA 2XO6A 1WG4A 3TEHB 4IFYA 3RUBL 3KJNB 4MKYA 2FVQA 1OO0B 2A10A 3HO1A 4ZLPA 4K4WA 4RW9B 1EKSA 4F50A 2PDAA 2ILZA 5IC4B 1V5IB 4PUOA 1GMVA 5B09A 1U49A 2BM1A 4KFBB 1RQ0A 1VQ8S 1ROFA 1GXTA 4OX9F 2DKOB 2R7WA 1TV6A 1CQNA 1RISA 1FKOB 3MM8B 3OR2B 3KLEB 4B9NA 4F7VA 1O5JA 4PABA 1U1NA 1Q1KA 2NXEA 2R7OA 3UN2A 2BZ2A 3ZNJ1 5LJ3Y 4WYLA 3H40A 1PYTA 3SSRA 1UPPA 4Z2XA 4OLPA 4WTYA 2XMVA 2UUBF 5LSRA 1QVGR 1IKXA 2R8GA 5J1PA 4MK8A 3FC9A 4ZHRB 3DOLA 4W4MA 4NXNF 1TL7B 2MSTA 3ZZ0A 1FRKA 2HBQB 2YWFA 1X9WA 2YY3A 3G2XA 1HNIB 4PR6A 2Y8WA 1PBUA 3I4HX 3R5DA 2J6UA 2IBOA 2GA7A 1SBRA 3A13A 2R7UA 1EQ0A 2E5IA 3R5JB 3M2UB 2HHSA 3TP2A 2NUUG 3KXDA 5T7LA 4ECUA 2VPYB 5D78A 4ZCMA 5KTQA 2XGQA 4EYHB 1JLEB 1H6KX 3V4IA 2ZKTA 2JFKA 3OBIA 2ALZA 4UW2A 3CJSA 4DS4A 1WKKA 2C1EB 4DV3J 3WZ0A 2E5HA 4ZS6A 1FK9A 2XHCA 4QU7A 2KTQA 3S6EA 2YH0A 2CWKA 3C6UB 2QMUB 1KFSA 2DNGA 3MWBA 3GFYA 3MD1A 2XY5A 5E33A 1L3UA 4IQMA 4LMZA 2J9DA 3NMRA 1NM2A 2E44A 3GJQB 1LFWA 4U7UK 1XMOF 2V50A 3TA0A 4CLTA 4TLQA 1DLOA 2BXJA 1PJ7A 3MR6A 4Y28C 2CQCA 1NK5A 1RDRA 3IM9A 2C3PA 1UTAA 3LP1A 1S77D 2B51A 1VBYA 3QT8A 4RWXA 2WSFC 4DX5A 1SXLA 4P71A 5KT2A 4Q8EA 2UV8G 2QO3A 3FNNA 3V81B 3V6KA 2LQ9A 1YGYA 2AJ4A 2FUG9 4DUYF 4C8KA 1BHNA 1XMBA 3JSBA 3GIKA 3AT1B 1LFPA 3I5CA 3D6FB 3A8KA 2CPFA 3W5ZA 3IR7B 3C15B 3G87A 5FDLA 1WOOA 2AJ1A 1JMTA 1KQFB 2UUCJ 3WX4A 2BVZA 1PIEA 2F5GA 3KK3A 3DRRB 2P9GA 4XIUA 2C2KB 2MZTA 5HMXA 4JI1J 4I2PB 4P2FA 3CJKA 4EFAC 4ZP9A 1BGXT 2LQBA 4G1QA 3I56S 4CTAA 1N0UA 1GNKA 1RT4A 3G82B 1S1WB 3PX6A 2XMTA 1S1XB 5DG9A 1MN9A 4OX7A 2SXLA 4U95A 1FFGB 4DJBA 2F63A 1RA7A 4ZN1A 1LW0A 4WU3A 4FYVB 2IMWP 2W24A 1TL1A 1Q4RA 3O5TB 3R5BA 1J27A 4I64A 4X66F 5L1LA 4LQ9A 2CNNB 4RU9A 3L3CA 2XMUA 4DLEA 1XNRJ 1DTTA 4DL6A 1U1PA 3GONA 1FESA 1U2RA 2CQGA 1FRIA 3DLKB 1FXRA 1FRMA 1NPRA 4DR2F 4MYTA 1X31C 4QIVA 4CT8A 1S48A 1JNZB 2KVQE 4M5HA 2WB4A 1VK3A 1QY7A 1N5SA 2K7JA 1ZAVA 4YP3A 1BD6A 4LIRA 1Y5IB 4Q0BB 1VJQA 1W25A 2V2ZA 4LFAJ 1FWLA 3QFWA 2GZOA 4FKYA 1W2BR 2YWKA 4CLZA 4ECWA 3GZ7A 5GAGU 2XULA 1JJ4A 2DCLA 5HO4A 1CJVB 3SCJE 2NXUA 1ZAWA 2LA4A 2YKMA 5GMDA 4OJ3A 4HEA9 4JP8A 2VG7A 4WBFA 4P10A 2HK2A 2OPQB 3FCHA 1SL1A 5DDOC 4ZOSA 1LWEA 4B3SF 2DY1A 4KKOA 3A8EA 3QSYB 1RCOB 4GVBB 2KN4A 3PJWA 2Q66A 2WVEA 4F36A 4L74A 1UEKA 3CJQA 5H9FJ 4WFZA 4I4BA 3PNIA 1DHMA 3UQSA 1KHWA 1TKZB 4USUA 2ALYB 3B78A 3OTOJ 4A8WA 1SCJB 3H8YA 3BR9A 1S6QB 4M8LA 1Y4ZB 2DY9A 4A47A 2HGLA 2JX2A 4WFBQ 4BWMA 3GIRA 2MZJA 2GHVC 5L9NA 3BPSP 3HM9A 2R8IA 2J7KA 3T1YJ 1VC6A 1K8AT 4B9MA 3HCXA 2ZH8A 1UA0A 2AP6A 2CZ4A 3TA1A 4R0JA 1N56A 1HMVB 1R8BA 3D67A 2XMMA 4C3LA 2RB7A 2HHHF 5GAHU 2HVDA 3BBFA 1IKYB 5IC6B 2W4CA 1NH8A 3A3PB 1IR2A 1H3DA 4OZ5A 2HNZA 2IA0A 2N7YA 4J90A 1VJWA 5GMEA 3LP0A 3TI0A 1S0NA 3SSSA 2FHJA 1HI1A 4LFCF 2XC9A 3DOKB 4DZ6A 3MMAB 4O4GB 4DSIA 3LW5C 1CC8A 3GJRB 1SVDA 5SZTA 2GQQA 3NLCA 4JI2F 3D6TB 3HSGA 1CG2A 5FJ4A 3RZAA 3KUEA 2IVYA 2GX8A 3QBCA 3PYFA 3OUYA 4IRKA 3ISNC 4E8UA 1H7WA 2BW2A 4NXMJ 4WFYA 3ZC4A 2IM0A 2HPUA 2WOMA 4R8UB 4N41A 2ZM6J 3VGVA 2VODA 2C28A 4Q45A 1GXUA 3NGKA 5KFVA 1M5OC 2J6SA 4PG6A 1IR0A 2OMOA 2QA2A 3IBWA 4GC6A 1EETA 3M8ZA 1FRXA 1P1TA 3IWNC 4CNYA 3BN7A 5IT9Y 2BE9B 2B56A 2RH3A 1FA0A 2DEIA 4E98A 2R2SA 4L73A 1DURA 3ICLA 1X5SA 5L9XA 2I5JA 3G4SS 2HVIA 3OFFA 2HWTA 5EWEA 3R9LA 5BR8F 2BQUA 5LMUF 4UY85 3GYXB 2YXLA 4OYPA 5C2CA 4HLBA 2WVBA 1U4BA 4TY8A 4F0HA 4LBPA 3MAQA 2CJXB 4CLKA 4A8MP 3A3NB 1R8AA 1AXQA 1HBNB 5J2MB 1NBEB 1WC1A 5KFXA 2QLXA 3CD0A 1KLMA 3DLGB 4XK8C 1AZSA 3B4MA 4HHJA 3HVRA 2CNKB 4DUTA 3FEZA 2R9LA 1N54B 3FSXA 5F0WA 2G9OA 2G4BA 1HBUB 5D4LA 2VD3A 2WVDA 3MM6B 1TKXA 3BKFA 2D1CA 1Q0NA 2JLFA 1C1CA 2XO7A 4AXJA 2UP1A 1TMMA 1YLXA 4RNHA 1YG0A 1SKWA 2VQFF 1IBMJ 3ZTPA 5KG2A 4JI0J 1RT5A 1Q8LA 4J37A 1ZM9A 1TU0B 1OIAA 3H5XA 2VFSA 3K5NA 4ED0A 4KGVB 4LF9F 1JLQB 2UU9F 3GR1A 3TQEA 3OXFA 1NK6A 5D0GA 5KFWA 4HT7A 4P75A 4UQGA 1UWBA 1F3VA 3I0RA 5IT4A 4WTOB 4OMFG 1Y7PA 1Z2LA 3B54A 3RB6A 4IOBA 3SV4A 5A8WA 3M8RA 2WB1D 1VYAA 3F56A 3OTDA 1QE1A 2N7CA 4FNHA 1NDKA 4K5SA 4CLUA 2LYVA 3ETMA 3MM5A 2AF6A 4YR3A 1HQEB 4J9UE 1HBMB 3CCJS 3AQPA 4BDPA 3PG9A 5EX3A 2WW8A 1N6QA 3FZBA 4NX9A 2JL9A 1BQMB 4NMLA 4ED6A 2W8LA 3KTQA 2GNKA 3UFCX 3N28A 2EKYA 1YBTA 2E9TA 2DGVA 1WOPA 4JYAF 2L9NA 4KT0C 2B5JA 3UCGA 1AA1B 3ELHA 5D3GB 4PPDA 4JI6F 4NA3A 4MMOA 4B3TJ 1EP4A 2XTJP 2GO9A 4I6AA 4QYZJ 4MFBA 2MKKA 4X65J 4AD6A 3QO9A 2RQKA 1B0TA 4LREA 1ZTTA 4YFUA 2O1PA 2WVCA 3RGIA 4PXEA 1M5VC 4PYAA 4DR4J 5I42B 4Y65A 3CO9A 4A8YA 5HANA 4P2XA 1SJ3P 5A8RA 3H7HB 3ONQA 2XWYA 1XR7A 1S1VB 3HSJA 3RRKA 4LSZB 1N36J 4RW7B 3EXYA 3JSMB 1L3TA 1LNQA 2OELA 1NZAA 2KZZA 3VAMA 3IA0A 4O3PA 2MQQA 1WI6A 5C25B 1Q8IA 2J5AA 1HI0P 3R7BB 4DX8H 3LP2A 2KG0A 3K5PA 3KFWX 3N0VA 1YZ6A 5AXLA 4YB5A 1IBLF 3GQCA 2XYHB 1U8SA 1FDNA 4KPCA 2LCWA 3W9IA 1SB6A 3V6DA 1C0UB 4FBTA 3RBEA 2R8KA 4OZLA 4OZ1A 2CPEA 1S9EB 2KU7A 3HKWA 2W9AA 3CC4S 3M8QB 1ZPVA 1F9FA 3MPUB 2DNOA 3PHTA 5G4DA 1Z2ZA 4RW6A 3JSRA 3SFGA 3CXCR 4B3OA 1YJNS 1M1KT 3PIOQ 1JLAB 1H7XA 4KC5A 4YQWA 1YITS 2FJBB 4NLTA 5IZHA 2Z2LA 4BHQA 1RT6B 1T7PA 4WIQA 1D9AA 4CO2A 2DHHA 3KLGB 4KV8A 2KT2A 4F3OA 4TXSA 2BJ7A 3NGTA 2GC8A 5F8GA 3CJ5A 1RTDB 2C3UA 3MURP 4LSLA 1RT1B 2DHXA 4DG1A 4ER8A 1W2IA 3TEGA 4P7TA 1FWKA 5GAHI 2KXFA 4C8MA 2AZ1A 4XTTA 2XSFA 2MKHA 2HQDA 4DL5A 3H4BA 2XZTB 4DU7A 3BREA 3R1LA 3CDEA 4UOCA 6FDRA 3MM9A 2MZ1A 1DRZA 1Q82T 3R5CA 5IFMA 2N4CA 2DNNA 2ZH4A 1N0VC 4CIOA 2OEKA 2J0XA 5J2QA 1C4CA 3CF5Q 1NK8A 5DGBA 1QLNA 4UOGA 1J5OA 1GTHA 4OV1A 4FBUA 1S9GB 3G6VA 4CYUB 4O3OA 3ILOA 4USWA 2PA8D 3MEDB 2CQHA 1ZH5A 2KYZA 3BYPA 1L3SA 5D77A 4K2JA 4NCGA 1XQIA 2EC0A 1YK9A 2AYEA 1GMWD 5GVQA 3R2DJ 1WTFA 2D3UA 2KT3A 3HHEA 2XCAA 2BJ8A 1TK5A 2I8EA 1FVQA 1VQMS 2ROEA 5I3PA 5F8NA 3OXLA 3P49B 1SV5B 4QJVA 3Q24A 4RW9A 3M32B 4K4VA 2ZUGA 1XNQJ 3UD5A 4FPIA 2CQPA 3NRBA 3DU6A 3J81Y 4KFBA 1TZ0A 3N5FA 1JWWA 2MB0B 1RTIB 2W7AA 5B0EA 1FKOA 3MM8A 3OR2A 3KLEA 4LF5J 2IBKA 3ET6B 2OJ3A 2C2NA 1SKSA 1IJFB 3HT0A 3PJXA 4I1TA 2E7XA 2V6AA 1RT7B 1OY8A 2MZQA 3MD3A 5J1NA 4RX6A 5I4MA 1EAYC 5ETKA 2R7VA 2YNGB 4NE9C 2BW7A 3DHXA 3IBFB 2W2PP 2CFXA 3D3BJ 1M5KC 3LGNA 3CMES 1S97A 4OFZA 4L3KA 2YH1A 4ZHRA 2DR5A 3KHRA 3GR0A 1TL7A 3QNWB 2IIHA 1X7VA 1T3NA 5C42B 2DD8S 3L9ZA 4K4XA 1UVKA 1HNIA 1CS4B 3TA2A 3PX4A 4ZJOA 3CCWA 2F65A 3OVBA 2UUCF 3ETOA 3TAMB 2HIYA 3EGVA 2ZHOA 4EWTA 1BXNA 4L72B 3ZO7A 3M2UA 4JI1F 2BQ3A 2HGNA 3HHKA 1U25A 2JEJA 5EDWA 1MMNA 1DFDA 3K57A 2BBEA 1IKVB 2ZZNA 3M2VB 3E01B 1JLEA 4JUZA 3BEGB 4CQ1A 3UR3C 3PJ9A 1T9YA 4HVZA 4F4ZA 2H1YA 4E0DA 2V94A 5CD4H 2CPYA 2E66A 2DNZA 4Q8FA 2OD6A 3VVTA 2NXJA 3C6UA 3TVKA 4V19J 2B9YA 2FHMA 1R6VA 2NXCA 4CZCA 3CDUA 2HS0A 3EZ5A 1U2CA 4O0IA 1XNRF 1IVZA 1FO1A 2YNIB 2BEFA 2NPIA 5KFDA 2AQ4A 1T9WA 3J7AN 1S6OA 1HLWA 3LWMA 1SL0A 1DTQB 2CYYA 1UWAA 1BWVA 1K44A 2DRAA 3AXKA 3J7A1 1EX8A 3V81A 2EG1A 3ZZOA 1QAIA 3NP5A 2KJVA 4ICLB 1FDAA 1CQMA 2HWIA 3U02A 1YRUA 3QRQA 4F04B 4LFAF 2YWHA 2ZNZA 2DH8A 3H59A 3C15A 5ETNA 1YI2S 3EVWA 1LWCB 2MJNA 3DRRA 5IM0B 2K2PA 4C8LA 2LXFA 4I2PA 3Q23A 2VJVA 2W4DA 1UPMB 2H4WB 2GS8A 4J9RA 1FT8A 3L95X 2GHWA 2DK2A 3NCQA 3G82A 4DR3J 4O4RA 1S1WA 1WC5A 4UUWA 3G6XA 2GMLA 3OL8A 3EGNA 1S1XA 3CCVS 1SUQB 1U24A 1ZETA 3CO0P 2AGOA 3AJ1A 3RG6A 1MWZA 2B7BB 1CC7A 3JAMU 1OSCA 1RAFB 3OV7A 4NLUA 3OTOF 2RILA 3L7PA 3FEXB 5CQGA 5H9EJ 5HLFB 3NGSA 2HHWA 1XIQA 3ZFVA 4JI7J 4KR0B 1C1BB 2B3TB 2MQ8A 1WWHA 4J9VA 4I7FB 1ZPWX 5IXUA 4NRUA 4WWSA 5GADU 2NYHA 1H98A 3GV5B 2Q1LA 2GJIA 3DN9A 5J2NB 3T1YF 2B8QA 2LXIA 1S72S 1U02A 2H5EA 1WHYA 1UKUA 3JXOA 2EKNA 3CJ4A 3RBDA 1GK8A 1VQPS 5D15A 2R7TA 4Q0BA 2AWZA 2HLUA 2WRMA 5HMZA 1X4BA 3V4MA 4F3QA 3BGFA 1A0OB 4C0OC 3CCMS 3FFIB 1IKWA 3MR5A 4YY3J 4RBTA 2HFSA 1CJVA 1NZ8A 2ZUAA 4F26A 5C7PA 1FRLA 3POTB 3HMJG 1X5TA 2A1BA 1ZM4A 2QA1A 2HHPA 1FFWB 1S12A 2OPQA 4KH1B 3HVAA 1S9FA 2WTFA 4OYBA 4DPOA 3PY8A 2CJQA 3LGHA 2DJWA 4GVBA 3J7YI 3F44A 1VBZA 2M52A 1HNWJ 4ELUA 2G2OA 1MW7A 1HWUA 2V68A 3MGJA 3M30B 1RACB 2HWHA 3BZQA 2F1FA 3MPDA 2V63A 2ZBCA 2GAGC 1TKZA 3ZNUA 2M5YA 3RAXA 3HZEA 4NXMF 3DXBA 2ZM6F 3R27A 1S6QA 3I4PA 4ILLA 2LU1A 3QAUA 1JXLA 3D2WA 3THVA 1E6VB 1B3TA 3O8WA 3W1YC 3PIPQ 2APOA 4X4PA 2MKCA 3J80U 3D0IE 5KFQA 4K5RA 1N33J 3EX7B 1KOHA 3DOMB 1NH7A 1R27B 5DM6Q 4USTA 4WIIA 3TOQA 4WKRA 4OI4A 4DSJA 1HMVA 3LGMA 2XQCA 3W5XA 4B02A 2E7VA 1IKYA 3Q89A 4FF4A 4DCPB 3NS6A 4TY9A 5HVHA 2ZJRQ 4ZVHA 2NXNA 3NOGA 3M4XA 4QW8A 4C3MA 3C19A 3L7UA 4B3MJ 2VA3A 1EKRA 4GC7A 2IRYA 3PW0A 2F9DA 3DOKA 3D0HE 3MMAA 4N56A 4O4GA 2EFGA 1ZBTA 4P9SA 1MWQA 4ZJQA 5AE1A 3M9OB 3M6VA 1FDBA 1U47A 2C3YA 5KT3A 3UR0A 3NS5A 4YS2A 1IBMF 1EHWA 4JI0F 2ZHAA 2D9PA 3QSIA 3H90A 4B08A 4YN3B 4F0KA 2PI5A 5JVHQ 1IXKA 1FKPB 2O5DA 2OGUA 4R8UA 2XZWA 3S01A 4CDIA 2BJ1A 3M6XA 2ZHBA 4FZVA 5F8LA 4OZJA 3KHHA 3CJ0A 5DETA 2LECA 4N76A 1X4EA 3RR8A 2ZOFA 1TUGB 1SJ4P 2AT1B 4DV1J 4YDXA 1N48A 5A2QU 3MI7X 1ZM3A 3W65A 3HPOA 3SCIE 3BV8A 1HWKA 2GGPB 2KXNB 4NCBA 1TAQA 1RHMB 3TRGA 2CQ4A 5DGAA 2CQDA 1HBNA 5J2MA 3RRHA 1N52B 1RZMA 1XMQJ 1R0BG 2MKSA 2OPRB 5DJBA 3M8SA 3CJ2A 4A4JA 1FX4A 2QYCA 4AT1B 2HEKA 2YX1A 4ECQA 3DLGA 3EM1A 4IG0B 2IY5B 2UVVA 3R7SB 2RF2A 1HBUA 2VFUA 4A8QA 3MM6A 4DSFA 1QTMA 2FPHX 4UY8T 3KK2B 2VOOA 2DR6A 1K9MT 2E1MC 5LOQA 2CJ9A 4B3TF 1NPPA 5KFBA 3MDFA 4F67A 1S76D 1R0AB 5ETPA 3TAPA 2OO4A 3ISZA 4X65F 2L9DA 4M5MA 1D8YA 4QBUA 3W62A 4ED7A 1XJWB 5HBMB 4F4AA 2OEJA 3BYRA 2DNKA 1WNEA 4NL5A 1JLQA 3VHQA 1NSQA 3H42A 4DR4F 1WOSA 3Q8PB 1CJUB 5F8HA 1SH0A 7AT1B 4Q5VA 3DFEA 4BLGA 5ETTA 4U96A 4X4OA 3CCUS 3T5JA 2CQ1A 4OHWA 4F4WA 3C8YA 4CH7A 5JUMA 2Y1JA 1N36F 2W2QP 5ETLA 4X4QA 1NXIA 1FNMA 3GFZA 3N5BA 1NU4A 2VDHA 2FVPA 2Z2YB 4LR7A 1FEEA 3K7RA 5LL6d 1F5AA 1HYSB 2HVHA 5T14A 3L09A 1M5PC 4YB7A 1IWGA 2LDIA 4XPCA 1FTCA 1QSLA 1HQEA 2Q79A 2CQIA 4Y2IA 2QL7B 1HBMA 2EFNA 1RB0A 1BE4A 1NJIT 2VB6A 3OXGA 5B08A 4DV5J 4ELVA 2HFNA 2VQEJ 1VQSA 1OY9A 4WZMA 2OP5A 5KT6A 1FCAA 1BQMA 1C2PA 3NAIA 2CQBA 2V8VA 3I87A 4F0MA 2N3OA 3AD8C 4ZA1A 2DNPA 1HL6A 4TYBA 1KTQA 3EDRB 4OHXA 3BN4A 1UEVA 4DSEA 5CA5A 5D3GA 2K1RB 1VLOA 2I9SA 3BPDA 1RWVB 2H65B 2CWXA 2KH9A 2W2MP 4EZ9A 3M05A 2AV5A 5KOXA 1RU2A 2VG6B 4DFKA 4QU6A 2F3JA 2JRSA 1O0PA 2VG5B 4DUZF 2E9ZA 4B3SJ 5I42A 2CQ0A 3FUYA 1GH8A 1FI4A 2Y0SD 4HDGA 4OHZA 4I67A 4H4KC 2EI5A 1S1VA 3HX9A 3KJFB 1G4CA 1RUSA 4RW7A 5HN0A 4X62J 1KNZA 1G7CB 1DBDA 1FKAF 3JSMA 5AXMA 2V4QA 2HIQA 4ERDA 4DV2J 4WCEQ 2YWGA 3M6UA 2FY1A 1MN7A 3OJUA 2G0JA 4B9LA 3NG8A 4P6QA 1TK0A 3SXLA 5EHHA 1M5HA 2QA4G 5C25A 3V6HA 4ZITA 3W2VB 2VDIA 3OR1B 9RUBA 1K47A 4C48A 4ZVFA 1NSAA 2JZ5A 3LO3A 2OPPB 3OTEA 3LA0A 2LXUA 4M5LA 4JI4J 5DDRC 1AB8A 3H2LA 3CE8A 3HI9A 3VAKA 1U7LA 3C6TB 1ZS6A 1YBAA 2WBMA 1S59A 2IDEA 4ZCLA 2NLWA 1X5OA 1C0UA 3O44A 1YJRA 5RUBA 1H72C 3GCXP 3BDPA 1CJTB 1S9EA 3HZGA 5H1SV 2N4DA 4URSA 4FVMA 3HFVA 2BABA 3SYZA 3MAHA 3DLEB 3M8QA 3GWCA 1J5EJ 3Q86A 1WC4A 2PE8A 3UD4P 3ILIA 2E1CA 4USJC 2V69A 2QTWA 4RW8B 2ZFHA 1NRKA 3CDWA 1T11A 1JLAA 4PYDA 1WC0A 1XWLA 5KT4A 2EFOA 1RT6A 3ILLA 4FYWB 5D8HB 3KLGA 2OKQA 4Z37A 1P6TA 4ZK7M 2DIUA 2V8PA 3W8GA 1TP7A 2C2EA 2RAQA 4OX8A 5A8KB 4JI5J 3TZXA 2CXEA 1RTDA 5KT7A 1CLFA 1RT1A 5HQLA 1WDDA 4LF5F 5HAOA 2XEXA 2MXYA 3L4BC 2PIIA 4NLDA 1DAXA 1D1UA 3AD7C 3DU5A 3RW6A 1P9QC 4AL7A 1T9XA 1N5QA 4MIBA 5D4PA 1U2FA 3RU0A 1ZZFA 2CPHA 2NR0A 1GEHA 1D9FA 3F73A 2HURA 3V5RA 3OL6A 4ES3A 4ED8A 1F9HA 4L75A 2HRTA 3HP6A 2WK4A 2L3MA 3GE9A 2QLBB 3CCES 5BR8J 5IT9U 1FFSB 1LQ9A 2A6OA 1T03B 1UVIA 3AOAA 2RHQB 3FJ2A 1S9GA 2LLZA 3VQTA 4CYUA 5B0FA 2ZEJA 3FSYA 3I82A 5H9EK 4ANDA 4PXCA 2GFFA 4LRBA 4KHMA 1HD1A 4LF4J 4L3NA 5DLFA 4Y6IA 1MMLA 2XYGB 3CCZA 1M5SA 5DO2A 3BDEA 4URGA 5B7WA 1FXLA 1WF0A 3ZTOA 4PWWA 2W4PA 1SV5A 4OJ1A 4ANEA 2IA6A 5FLXU 3M32A 3MMCB 1KP6A 3T5LA 1QSYA 3BQ0A 1V9OA 1SC4B 2OSQA 2E1AA 2U2FA 4KHRA 1RTIA 2PFDA 3GSIA 1JK9B 2ATCB 4P72A 1UAWA 4TU7A 4XO0A 3R6LB 3HT3A 4DR1J 5AE2A 3KLHB 3SQGB 3Q8UA 1PGZA 2BE7D 2YQ3A 3ET6A 3PW5A 2C2MB 3Q8QB 2V4JB 3G71S 4HACB 1TVRA 4LQ3A 1FXDA 2A2CA 1JX4A 1RT7A 2CZ9A 4AYBD 4USHA 1HBOA 1O6XA 3H5YA 2P5VA 2H9ZA 2R7XA 2CNOB 5D6GA 2YNGA 2ZC3A 4DFMA 1L3KA 4ANCA 2E1PA 5LM7E 3NCRA 1APSA 5HQMA 4OZ2A 2WBRA 2DB1A 4ZIWA 2VC0A 2MEWA 2AYMA 2LFVA 1FE4A 1UMJA 1Y5NB 3VCDA 5E0OA 1U1MA 3HVTB 2F4VJ 5C42A 2DCUB 2M9KA 4F2RA 1U45A 3MECB 1CS4A 3SQOP 5KFZA 2MJUA 3BSNA 2Y1IA 1FD8A 5KFYA 1YQHA 4ID5B 3OTBA 5J2PB 1U26A 3Q22A 3GCWP 4RUHA 4K0KJ 2BACA 1PC4A 2P8IA 2FZKB 5BYRA 3TAMA 1F5BA 3I55S 2FC8A 3ZXWA 3KUGA 3EYZA 2GCFA 4S0MA 1EIYB 5KFEA 3UNGC 2HVZA 1H73A 5E3QA 4K4SA 1WKLA 4QWDA 5L46A 1KQSR 1IKVA 5C24B 4DR3F 3DMJB 5DDQC 2WSCC 4HH1A 3M2VA 3E01A 3JTNA 4NPOA 2H3EB 4U6PA 2HQIA 2ZOGA 1OPZA 1X4CA 2HG4A 2M3DA 1RT3B 2HS3A 3T5HA 1N5YB 3HF5A 1L5UA 1GXLA 2Y9HA 3UDCA 1M0SA 1NDCA 1K0TA 2Z2MA 1QSSA 4DX7A 4H4OA 4NA2A 4DR5J 4WFAQ 2H5IB 4JI7F 4MKBA 2HYIB 5B0GA 1Q5VA 2DVIA 3OSPA 1S4FA 3Q2SC 2UUWA 3DGPB 2JJ4D 4TLRA 4C3KA 1V3ZA 1DTQA 4YEAA 4NEYA 2C2OB 3W61A 1SJRA 1KONA 3T3FA 4LIWA 4ZPCA 1RCXB 1X4DA 4RUAA 4NYZA 2LQ8A 4Y34A 4ICLA 3VWSA 4C11B 5AJ3J 3HHLC 2C2ZB 1N32J 1FNXH 4RBVA 3O6QA 1F60B 1HW8A 2B6AB 3AA8A 3M2RB 3TR5A 3D0GE 3CCQS 1CVJA 1UVJA 4KSEB 3BO3A 4FXDA 4YY3F 4EGLA 1LWCA 1KTVA 3PW4A 5IM0A 3MEGA 2B0GA 5KT5A 1SI9A 4EBDA 3GV7B 5EUHA 4Y0FA 1NUEA 4ZVOB 2UVUA 3BQ1A 4ED1A 4W92B 2J9EA 2FLLA 4DQQA 5AE3A 1BLUA 4DV7J 1UFKA 4IUFA 3PFOA 2HHQA 1HNZJ 1UJ6A 1SUQA 3PHEA 1IQTA 2EK6A 1FDDA 2V9KA 2I38A 1SQFA 7FD1A 1V3SA 2ZBQA 5IV4A 1S7HA 1HNWF 1BQNB 4J9MA 4ZPAA 5KFGA 2MZRA 3PKYA 2GMHA 2YWWA 3MEEB 3C14B 3FVYA 3LAMA 3ULHA 4YDDB 1IUJA 4LJMA 2HHVA 3AODA 1SIZA 4O3SA 1S57A 2OUGA 5HLFA 3OFEA 3OSNA 4EU0A 4U9RA 3I5BA 4IOAQ 2GAHC 1A7GE 5I3UB 2V0NA 4I7FA 2F8EX 4KYZA 3M1VB 1G2EA 5U47A 3TJ9A 2B4OA 2A0FB 3UDLA 1PAUB 3M9NB 4EBCA 2BRKA 4ZP7A 2CJAA 4MTPA 4WFXA 5J2NA 3FSIA 1N33F 3EPIA 3A4TA 4EO6A 5FD1A 3ADAC 4C8YA 2OI2A 2H51B 3NAHA 3NOCA 3KWMA 3O3LA 4M1KA 4FYDA 1B64A 2VOPA 3FFIA 4XDDA 4CWBA 1JIHA 2Z57B 2W7PA 4KO0B 1RSCA 3QAEA 3J7Z5 4ZVQB 4RUBA 1YBUA 1VC5A 4V1Ak 3Q0AA 4B3MF 3POTA 1WTBA 3WDOA 5K8PA 5DQIA 2VASA 4K50A 8RUCA 3DCAA 3BS9A 4JV2A 2J9DE 3QRPA 2JEIA 1F5CA 1NCLA 5KAKA 3OTCA 4N7TA 4J9KA 5KG5A 1RA6A 1SPBP 3BM7A 3IM8A 2IPOB 1FTRA 3M30A 2HZAA 1RAJA 3DRSB 1C0TB 1T02A 1FJCA 5D0RA 2K7KA 5KFHA 4ZVSB 5F3ZA 1UETA 2IRUA 4K4TA 4TVAB 1VRQC 3AB2B 4TQRA 1JXEA 1E6VA 4JV5J 2VL1A 1YZ7A 3G96A 1UW4A 4CRJA 2V5HG 4DV1F 1KVJA 1DQ8A 4UOFA 1RKJA 3D1OA 2LEBA 4IRDA 3DOMA 2QIFA 4JV1A 2VBYA 2CAJA 4FP9A 1RTHB 3GSDA 3KG1A 2GHPA 5CCLA 2IFXA 1S0MA 2IM1A 2LEAA 1ICEB 1S1TA 2HBYB 5L39A 1XMQF 4ZVGA 3NGDA 2E5LJ 4DOZA 4PEOA 3EXCX 3DYAB 4EYIB 4NYOA 3NCPA 2Q43A 2GIFA 1PJ6A 2ADCA 3P4UB 4CO4A 4DR6J 1JQGA 3BSAA 2JC1A 4H4MB 4PWDA 2QMWA 3V6JA 2JFDA 5BYSA 4NLVA 1U0HB 2Y3YA 5HSPA 4JOUA 3QGGA 4B17A 1S5ZA 2W7OA 3A1YG 2PC6A 1LWFB 2HHTA 1H2UX 3DDNA 6FD1A 3AFGA 3U1NA 2G0CA 3KK1B 1FKPA 2JHEA 2YNFB 2GIQA 2W9BB 2D9OA 2Y8YA 2CDQA 2Y1RI 4DV4J 3CSKA 1U1LA 1SC3B 3IG1B 1VQOS 2ACMA 4CP5A 4OI3A 1LWEB 4FKXA 1NNDA 4X84A 2EBEA 1NLKL 3BGRB 3EUNA 3PM9A 3IXQA 3CJTA 3N79A 3BR8A 2XNRA 1JB0C 3H5UA 1P9YA 3QLHB 2GGPA 2G13A 2JWNA 2RHSB 3GB0A 1WSVA 3ITHB 2W01A 2BR0A 2FLPA 2MKIA 3PEJA 1KC8T 1NDPA 2BKPA 1WG1A 3FZ2A 2C2DA 2VKZG 3LAKA 4DPXA 2IYGA 3K8WA 3MUTP 2OPRA 4PG5A 4DV5F 2OMLA 1SC6A 3OD2A 1FD2A 4DPWA 5KFMA 2VQEF 1Y11A 3EMTA 1VQ9S 4GVLA 4IG0A 1JLGB 4ZLLA 1B4SA 1D3WA 1U48A 1G3OA 2FGCA 3E2EA 3S7RA 3KK2A 2R7QA 2EC2A 1JLCB 1B7YB 4TKTA 4ILMA 5DQGA 4RU2A 2ZITA 5KFFA 4Y2AA 2LA6A 5CD4A 4KE5A 1R0AA 4BC9A 2V9WA 3CMQA 2ZH2A 1Y0HA 3P5TL 4GO5X 5FIIA 3JS9A 1RAIB 1LWXA 5ETQA 4UOHA 1R0CB 3U7JA 4O3RA 2XMAA 4KGKA 4OYWA 2E9RX 2X1FA 1VHFA 4M5NA 4DR7J 5HBMA 2UVRA 2QT7A 1A9NB 2D3ZA 3KHLA 4KQZA 3OPKA 3B4DA 2ZVIA 1CJUA 4EUVA 2CVEA 1LXNA 3DXSX 2OPSB 2I2YA 2PGCA 4BS2A 1HPZB 2I1RA 4O3QA 1URNA 1X5PA 2DRDA 5BXIA 1YSJA 1VFJA 4ZCKA 3NKYA 4X62F 1ULRA 3MEKA 2MY7A 2L48A 3MF5A 2FVRA 4DV2F 2UXBF 1WORA 3KLIB 2Z58B 4ZMMA 2QN6B 1HYSA 3SFUA 5HVGA 3TUPA 2WONB 3ZZYA 2ZH9A 1UCNA 2JLEA 4QIFA 3H2UB 4A8FA 2H48B 1VOMA 1YJWS 2J8AA 3W63A 1KVKA 1B7FA 4CO3A 3C16B 2QZ8A 1EETB 2IJRA 4N8NA 4RW4B 2J9CA 3MUMP 3LALA 1X8DA 2AYGA 2WSEC 4EBEA 5HMYA 4TU8A 4JI4F 1ELOA 1YVFA 3MUVP 4O44B 3M8WA 4WJBA 2AEMA 1OS5A 1NDLA 2DTJA 1YRTA 4R5PB 3UE2A 3W9HA 5CYJA 1RLCL 2DHSA 3KLVA 2K1RA 5HP1B 4YB1P 1NJWA 3T9ZA 1OY6A 2ZBPA 4PG4A 2PD1A 2DNMA 3GP9A 4C9DA 2IDLA 1F2GA 2QFJA 3AJ2A 2VG6A 3MCSA 1J5EF 3RW7A 2VG5A 1CBKA 2W9CB 4NLRA 2F8MA 2YKOA 3AB4B 1URRA 3IGVA 3T19A 3D68A 3DLBA 2PFFB 2PEBA 1RWPB 4ED4A 2KZMA 4FXVA
chains in the Genus database with same CATH topology
4ILLA 2LU1A 1VQ4S 3QAUA 1U1NA 1VBXA 1JXLA 5I3QA 3CPWR 2QE5A 1Q1KA 2DNYA 2R7OA 1IBKF 2BZ2A 2FVCA 3D2WA 2XMWA 4PCQA 1PSDA 3THVA 5LJ3Y 4WYLA 3H40A 3SSRA 1E6VB 2DHGA 1R8PA 3O8WA 1U6ZA 4Z2XA 3CGIA 4OLPA 5D4OA 4WTYA 4JI5F 2XMVA 2UUBF 2DPJA 4B9SA 5LSRA 1QVGR 3PIPQ 1IKXA 4N8OA 2APOA 2R8GA 2MY8A 2BOPA 5J1PA 4X4PA 2MKCA 4MK8A 1X0FA 1JLBA 4ZHRB 1YIJS 3D0IE 2RE1A 4K5RA 5KFQA 4I2QB 3DOLA 1NKCA 3EX7B 4NXNF 2MSTA 1KOHA 2DO4A 3ZZ0A 1NH7A 4B3RF 1R27B 5DM6Q 2R2UA 1JLFB 1FRKA 4WIIA 2RU9A 2VFVA 2YWFA 3TOQA 1DQ9A 1X9WA 4WKRA 4OI4A 1AUDA 1NJYA 4DSJA 1HMVA 2DIVA 2ROGA 1UA1A 3HK2A 2YY3A 3CMAS 1HNIB 1I1GA 3LGMA 4PR6A 3VF0B 4CT9A 1U6FA 4Q2LA 4KB7A 4B02A 1X4HA 1MNEA 4M5DA 3I4HX 1IKYA 3R5DA 3W2VA 2HNDA 2J6UA 3OR1A 1UVNA 4FF4A 4QWAA 2XY6A 2IBOA 2RMLA 2GA7A 4ECTA 3NS6A 4TY9A 1U1RA 1SBRA 2ZJRQ 2OFHX 4QWEA 4ZVHA 2R7UA 3M4XA 1OQ3A 2E5IA 4QW8A 4C3MA 3BGUA 2OPPA 4ECSA 2JH3A 4DL3A 3S8SA 2O67A 3M2UB 2HHSA 4OL8A 4DV3F 1OSDA 1NK4A 1VRUA 2VA3A 1U6BA 4GC7A 4XAKA 2IRYA 3TVZA 4YUDA 1TR0A 4ZVEA 3C6TA 3TP2A 2NUUG 3PW0A 2F9DA 3HJFA 3DOKA 5HROA 3D0HE 4NWBA 3MMAA 3OW2R 4N56A 4O4GA 1KD1T 2HZCA 5T7LA 2EFGA 4DL2A 1U1QA 4ECUA 1V6HA 2VPYB 1ZBTA 5CXTA 2AJ0A 1R43A 2HAIA 5D78A 4ZCMA 5KTQA 2XGQA 5K5MA 1JLEB 4EYHB 5AE1A 4WU2A 3M9OB 3M6VA 1FDBA 3CIMA 3D1HA 1U47A 1TVRB 1H6KX 3HDSA 2C3YA 2ZKTA 5G0RB 3BB5A 3V4IA 2JFKA 3OBIA 5KT3A 2ALZA 2EW9A 1FRJA 4UW2A 3UR0A 3NS5A 2XMKA 1RJJA 4LF4F 1HBOB 3Q8SB 2GV1A 1IQZA 5SUHA 4DS4A 4WK1A 1GX6A 4RWWA 2FJVA 3DLEA 1IBMF 4JI0F 3WZ0A 2E5HA 4ZS6A 1FK9A 4QU7A 4U7CA 4X4NA 2KTQA 5CHCB 3S6EA 2ZHAA 4J9SA 2D9PA 2YH0A 1UVLA 3C6UB 1KFSA 2DNGA 3MWBA 4B08A 4PQUB 4C7QA 2PI5A 3GFYA 4IDKA 1KFDA 5JVHQ 3NL0A 1IXKA 1FKPB 3MD1A 2O5DA 2RS2A 5E33A 2XY5A 1L3UA 4RW8A 3FQKA 4IQMA 4R8UA 2LMIA 1X9MA 1TK8A 4LMZA 2Q6CA 2J9DA 3PR4A 3NMRA 2XZWA 1KVIA 3HHDA 3S01A 2E44A 5LMNF 4J9LA 3MEDA 2F7VA 4NLOA 3M6XA 1LFWA 4PXBA 3VZIA 4U7UK 3BJYA 2C3MA 1XMOF 2ZHBA 3TA0A 4FZVA 4TLQA 5F8LA 3HHNB 4OZJA 1DLOA 3M9MB 2BXJA 3KHHA 3MR6A 4Y28C 2CQCA 3CJ0A 1NK5A 5DETA 4QIEA 1RDRA 1BQXA 2LECA 4OZNA 4N76A 1X4EA 3RR8A 2C3PA 3C46A 2CPXA 3D1QA 3LP1A 5AXKA 4NYPA 3Q2TC 1S77D 2B51A 1VBYA 2ZOFA 1VS3A 2C3OA 1RT2B 1T3OA 4P2SA 5IQQA 4RWXA 2WSFC 1SXLA 5A8KA 3CJ3A 1SJ4P 5KT2A 4NLQA 4Q8EA 5DS7A 2PSZA 2UV8G 2QO3A 4N47A 4DR1F 4DBQA 4YDXA 4BBYA 3FNNA 3V81B 5GAEU 3V6KA 1N48A 3MI7X 2LQ9A 4C8OA 2V8DA 1YGYA 1ZM3A 2AJ4A 2ASYA 4J9OA 2VUGA 2FUG9 3HPOA 3SCIE 4J5OA 4DUYF 1RTJB 1HWKA 3VTIA 4F02A 2GGPB 3QGIA 2DNHA 4C8KA 1XMBA 2KXNB 3JSBA 3GIKA 1S1UA 1S49A 1X4AA 3DRPB 4H4KA 1LK5A 1LFPA 3I5CA 1VQKS 4NCBA 1TAQA 4Y2CA 2CPFA 1UFWA 1YTYA 3CC2S 3ZZRA 3CCLS 3D5MA 3IR7B 4Y3CA 2ZE2B 1REVB 3RAMA 3TRGA 2CQ4A 5F9NA 5DGAA 5FDLA 1FJGF 1UEUA 3U1LA 2CQDA 1HBNA 5KFOA 5J2MA 2AJ1A 1N52B 4ECRA 2EFPA 3RRHA 3OVSA 1JMTA 4I6YA 1KQFB 3WX4A 2BVZA 2MKSA 2O01C 3FEYB 3RTVA 2J0QD 2OPRB 5DJBA 3KK3A 4OI1A 3DRRB 3CJ2A 3M8SA 4A4JA 1U09A 2D7SA 2P9GA 4XIUA 2QYCA 1ZTWA 2KFYA 2YX1A 2MZTA 4ECQA 2VPZB 5HMXA 3DLGA 4I2PB 4IG0B 3CJKA 4EFAC 4ZP9A 1BGXT 2LQBA 2UVVA 2F4VF 4G1QA 3I56S 3T1AA 4DFJA 4W90B 2RF2A 2MGZA 1T03A 4CTAA 1HBUA 1N0UA 3CIZA 1VQ5S 2VFUA 1GNKA 5KFRA 2KHDA 4A8QA 1RT4A 2IRXA 2ABYA 3MM6A 3QGHA 4LSNB 4DSFA 3CULA 1QTMA 2FPHX 1S1WB 1RYSA 4UY8T 3PX6A 4H4OB 3KK2B 2XMTA 1IN0A 2VOOA 1N88A 2HMIB 2MSSA 5K8OA 4M95A 1K9MT 2E1MC 1VLYA 4KIAA 3IWLA 2J0WA 1S1XB 4QOTA 2CJ9A 4K0KF 4B3TF 3DM2B 2ZZMA 2J76E 5DG9A 4QCLA 2XLJA 5KFBA 4OX7A 1NHVA 5K8NA 3MDFA 2SXLA 4IO1A 3ZZUA 2CPDA 5A0YA 4F67A 1S76D 1R0AB 2CRLA 2KRRA 3TAPA 2OO4A 3NNCA 5DRKA 4DJBA 3ISZA 3IS9A 4X65F 1RA7A 2L9DA 1WF2A 3FRZA 2M8HA 3MFHA 3SZ2A 1D8YA 4QBUA 1LW0A 1E6YA 4WU3A 4ED7A 2IMWP 3VAHA 1T94A 2W24A 3KJVB 1U1OA 3HVWA 5HBMB 2Z0GA 1TL1A 1Q4RA 3O5TB 2DNKA 3R5BA 1WNEA 4NL5A 1JLQA 4UUXA 4I64A 5EGYA 2RQ4A 4DR4F 4WF9Q 3Q8PB 4X66F 1HQUA 1R8HA 5F8HA 5KG7A 4ILRA 4LQ9A 5L1LA 4GKJF 3ISND 4ZP6A 1SH0A 4Q5VA 4RU9A 3DFEA 2ZH6A 3L3CA 2CVIA 2XMUA 4DLEA 3KNGA 1DTTA 4DL6A 4A46A 4QW9A 4X4OA 3CD7A 3CCUS 2CQ1A 3T5JA 1U1PA 4OHWA 4RNNA 4F4WA 1HR0F 3C8YA 2V8HA 4Q2MA 2XGPA 3MMCA 4CH7A 4DSIA 5JUMA 3UWTA 4RKUC 1FESA 1U2RA 2Y1JA 1N36F 2CQGA 2A18A 3TO8A 1FRIA 3DLKB 1FXRA 4OHYA 1FRMA 3FMBA 4DR2F 4MYTA 4DHVA 4X4QA 2IHR1 4QIVA 1FNMA 3GFZA 3N5BA 1S48A 3GFHA 4O23A 4CT8A 1JNZB 1NU4A 4F2SA 4A48A 1X4FA 2EBGA 2WB4A 1VK3A 2FVPA 4ECYA 4KTQA 2ZDOA 3MEGB 1FEEA 3KLHA 1X9SA 3K7RA 3BQ2A 3SQGA 5LL6d 4QQBA 1F5AA 1QY7A 1N5SA 2K7JA 4DR5F 2XMJA 4DF4A 1ZAVA 1HYSB 4YP3A 2KJWA 3OJSA 1NK7A 3LOUA 1BD6A 2HVHA 4IH5A 1JKHB 5T14A 2I0XA 4FVCA 4LIRA 3L09A 2V4JA 1Y5IB 2B9WA 1A6LA 2ATLA 4PWUA 3OHAA 4Q0BB 1M5PC 3S1TA 3DC2A 4IQXA 4YB7A 1W25A 2LDIA 4XPCA 1FTCA 1T95A 2B4PA 2KDOA 2KM8C 3BSOA 1QSLA 1W2BR 1HQEA 4MK9A 2Q79A 3ENQA 2CQIA 4Y2IA