3P49B

Crystal structure of a glycine riboswitch from fusobacterium nucleatum
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
92
structure length
92
Chain Sequence
TRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCINE RIBOSWITCH
publication title Structural basis of cooperative ligand binding by the glycine riboswitch.
pubmed doi rcsb
source organism Fusobacterium nucleatum subsp. polymorphum
molecule tags Rna binding protein/rna
total genus 17
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2010-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3p49B00
3CCRS 3G96A 1WG1A 2E5GA 1YI2S 1VQ5S 1ZZNA 1URNA 2D3OR 2M52A 1R8PA 2ADCA 2ZJRQ 2CQPA 4FXWA 1K8AT 2VOOA 1X4DA 1Q81T 2CJKA 5DM6Q 5DDOC 3HHNB 2ZJQQ 2D9OA 2E5HA 2ADBA 3RW7A 1X5PA 4A8XA 3TYTA 1X4FA 1H2UX 2MKJA 2RRAA 1XN9A 2CPJA 2HYIB 1X4GA 2JWNA 2U2FA 1WHYA 2RQ4A 4M5DB 5DDQC 2VONA 4BS2A 1VQLS 3MD3A 2KXNB 2ZJPQ 3MOJB 2CQ4A 1WHVA 1AUDA 2RQCA 2MHNA 2CPHA 1VC0A 3EGNA 1VQ6S 2MYFA 3THTA 3MUMP 3SMZA 2GO9A 4WFBQ 3VAHA 2KXHA 2M2BA 5DM7Q 1X4HA 1WTBA 2DNOA 2BOPA 2LYVA 1H6KX 1NU4A 2M7SA 1YIJS 2BZ2A 4YB1P 2MKSA 3B4MA 1Q82T 2DGQA 1U6BA 3MD1A 3CC7S 5CYJA 4IOAQ 3CULA 1DRZA 2G4BA 2MZJA 2MGZB 2DNLA 4WIIA 3G4SS 2MMYA 2LA4A 3NNCA 2CQBA 1M5VC 5LJ3Y 2LEBA 2XNRA 1DBDA 1H2VZ 1SJQA 3BEGB 1WI6A 3CCLS 1WWHA 1QVGR 2AYGA 2KM8B 3PIOQ 3VF0B 2E5IA 2O3DA 1OO0B 2DB1A 2I2YA 3JB9k 1VQ9S 2N82B 2YTCA 5GADU 3K0JA 2AYMA 5GVQA 3V4MA 1WHXA 2X1GA 2HGMA 1NJIT 1P1TA 2L08A 3R1HA 2KRRA 2M0GB 2YH0A 2K3KA 5IFMA 2DHAA 4LIRA 2J0SD 3VAJA 2CQHA 1WG4A 1N88A 3P49B 2MKHA 2NLWA 3BO2A 5JVGQ 2DNPA 1HD1A 2G1DA 1KD1T 3UCUP 4C0OC 1X4AA 2FC8A 4LMZA 2VOPA 2MZQA 4QQBA 5IQQA 2L41A 1FO1A 2CPFA 5HO4A 2KFYA 1U1KA 4QU6A 2U1AA 1VBXA 3CCUS 4UY8T 1IQTA 2G0CA 1NO8A 2LQ5A 3P5TL 2KM8C 1S72S 2RS8A 3BO3A 4TU8A 1WI8A 2LCWA 3G8TA 1U1RA 1U1OA 2UP1A 1SXLA 1RK8A 5EN1A 3CC2S 1VQ7S 1Q86T 1FT8A 3NS5A 1M1KT 2J8AA 5GMKa 3OW2R 2KH9A 4YUDA 3N9UC 1Q7YT 3UD4P 3ZZZA 1UP1A 2M70A 1JJHA 1S79A 2M8HA 3CCJS 2FPHX 5FJ4A 1VQ4S 4ERDA 1WELA 1KC8T 4WCEQ 1FHTA 3G6ES 2DNHA 4Z2XA 2FY1A 2KXFA 2CQCA 5IM0A 5DDRC 3J7ZT 4PKDB 4CIOA 2F3JA 3CUNA 2YKAA 4C4WA 3PIPQ 1FJCA 1WEYA 2ERRA 3CTRA 3FEYB 2YWKA 4F26A 1CVJA 3RW6A 2FHOB 1FJEB 1X0FA 2FC9A 2X1FA 4IO9Q 1DZ5A 2A3JA 2JVOA 3S8SA 2MPUA 3NNAA 1D9AA 1M5OC 2DNQA 2DO0A 3I55S 1YJWS 1X5TA 4W92B 2OJ3A 4IOCQ 3UCZP 2MSSA 2OSRA 5LSLA 2LA6A 1OIAA 2EK1A 2DITA 3HI9A 1M5PC 2OTJS 1JJ2R 2OSQA 5MLCV 3CMAS 1BY9A 2AD9A 2MQOA 2LKZA 1YJ9S 2RU3A 2CPEA 1M90T 2MQLA 3I56S 1QVFR 3ZZYA 1YWXA 2MZSA 2CPDA 2DO4A 1FJ7A 1WEXA 1K9MT 1SJRA 1SJ3P 2RNEA 2LMIA 2MJUA 2DH9A 1VQ8S 3IWNC 2CQ1A 3CCSS 2XS2A 1H2TZ 2VODA 3CCVS 1VBZA 2KHCA 2EK6A 3D2WA 4W90B 1UAWA 3US5A 4PRFA 1R8HA 3UWTA 4IUFA 3Q2SC 4F02A 2CQ2A 2KYXA 3LPYA 2XB2D 2CQGA 2DGVA 1N8RT 1YJNS 1X4BA 2RUGA 2CPYA 2MQQA 2J76E 2E5JA 1PO6A 2DNKA 1U1MA 1N54B 3BS9A 1VC6A 1O0PA 2V94A 3NS6A 1U1PA 2MZ1A 2QEXS 3CCQS 3SDEA 1RKJA 4RU2A 2DGUA 1FNXH 3IRWP 4YOEA 1OWXA 2CPXA 4U67Q 2KVIA 2N3OA 1VBYA 2K8GA 2MXYA 2MQMA 1FXLA 1VQOS 2QA4S 4OZ0A 3THPA 3G8SA 3BO4A 2DISA 4J5OA 4ZKAA 3UD3P 3TP2A 2JRSA 1VQMS 3UCGA 2HGLA 1F9FA 2DNNA 4C7QA 2L9WA 1VQPS 2KU7A 2D9PA 5JVHQ 1WEZA 5DETA 2AYEA 2MKIA 1YHQS 1KQSR 1WF0A 3MDFA 3S7RA 3SXLA 5ITHA 2SXLA 2DIUA 3VALA 2DK2A 2XNQA 5H1SV 3VAMA 1YITS 2DHGA 2DGXA 3CPWR 3EGZA 3U1MA 1PGZA 2CQ0A 2MKCA 3DXBA 5CXTA 1ZZFA 3G9CA 4V19X 3TO8A 2DH8A 1N52B 1WF2A 2RS2A 2M9KA 3LQVA 4LJMA 2N7CA 2MQPA 4P6QA 1KOOA 2KT5A 2GHPA 4FXVA 4PR6A 4OZ1A 1U1QA 2F9JA 3H2UB 5LJ5Y 1A7GE 3S6EA 2MQNA 1DHMA 1OPIA 1G2EA 2KG0A 2MY7A 5IM0B 3DLLQ 1U1NA 2DHXA 2E44A 1K73T 1U2FA 2PE8A 4CH0S 5CA5A 3CC4S 5HL7Q 5GAEU 3NMRA 1D8ZA 4Y00A 5BJRA 2YH1A 3P6YC 1WF1A 2MJNA 4TU9A 3EX7B 2DGOA 2I38A 1QM9A 4TLQA 2M88A 2PEHA 2XS5A 3MXHP 3G71S 2DH7A 1WHWA 3P3DA 2B0GA 1HD0A 2DGSA 3MURP 2DIVA 3L3CA 1X4EA 2LECA 2MZTA 3B4DA 2JX2A 2KN4A 2OTLS 2CQDA 2CPIA 2DNYA 2DNMA 4WFAQ 2DGWA 2EVZA 2F9DA 3CCMS 2CQIA 2LXIA 5GAGU 4WKRA 4WFNQ 2MGZA 2J0QD 5LXYA 4CH1A 5D77A 2DHSA 3MUTP 3CF5Q 1ZH5A 2M8DB 2CQ3A 1SJ4P 3MI7X 1VQNS 3VAFA 3UE2A 1M5KC 4TU7A 2DNZA 2CPZA 3J7YU 2QFJA 3ULHA 3R1LA 2OIHA 2KRBA 2M4MA 3FEXB 1U6FA 1X4CA 3VAKA 3CCES 3VAIA 4QPTA 3MUVP 4UQTA 1VQKS 2DGTA 1YTYA 1JMTA 4F25A 2X1BA 1P27B 2AYBA 2WBRA 5LXRA 2MY8A 2N3LA 3CXCR 1X5SA 1B7FA 4CQ1A 1UW4A 1W2BR 2MZRA 2MSTA 3CMES 4EGLA 2NZ4A 3VAGA 1HL6A 4ED5A 3Q2TC 4WF9Q 1L3KA 5D78A 3SDEB 1SJFA 2XSFA 1KOHA 2HVZA 3H2VE 3CD6S 1WG5A 1X5OA 1UFWA 2LEAA 2KI2A 2HZCA 3R27A 2RVJA 5LSOA 5GAHU 1JJ4A 3S01A 1VC5A 2JVRA 4Y0FA 1HA1A 2X1AA 1A9NB 2MKKA 1U1LA 5DDPC 2RT3A 2HGNA 2Q79A 2XS7A 2LXUA 2MB0B 4QU7A 2RRBA 3U1LA 2KG1A 2DNRA 3NNHA 2DNGA
chains in the Genus database with same CATH superfamily
1WG1A 4PYAA 2E5GA 2WOMA 3H59A 1LFPA 3W9IA 2DD8S 2M52A 1TL7A 3Q24A 3W2WA 1K8AT 3H8YA 3MMCB 2MKYA 4DZDA 4K4UA 2JL9A 3KJVA 2ZBPA 3QT8A 2OHDA 5IOLA 1VR6A 4XIUA 2IRYA 1Z2ZA 3RZAA 4WKYA 3RAQA 3RB3A 3QO9B 1VQLS 4X66J 3CO9A 1KLNA 1CSJA 3NCPA 2R8GA 1FK9A 2QSWA 1QAYA 2ROGA 1MG7A 5KFGA 2OMOA 2PI4A 3DM2B 3QMQA 4MK7A 1UEKA 4V1Ak 4IOAQ 3HJVA 1FDDA 2MZJA 3IGVA 5U47A 1RTHA 2XLKA 3RTVA 3T19A 3BM7A 2E1MC 1AUSL 2ZM6F 1IM6A 1WWHA 3I4PA 4ED1A 4DL6A 4M5JA 1LWCB 3KUGA 5KFXA 5GADU 1NK6A 3B6BA 3H5YA 1J27A 2K3KA 5H9EK 2FLNA 2OH2A 1URRA 4O4GA 1ZTWA 1ROFA 3M6WA 2XO6A 2JH3A 4YN3B 2ZH9A 1M1KT 3DFEA 1NJYA 1SB6A 1PJ5A 2Y1IA 7FDRA 2ATCB 2FUG9 3QSYB 4F3MA 2A10A 1UFKA 3IM9A 2ERRA 3GE9A 4ILLA 1DJ0A 4DF8A 2XZWA 4WE1A 4LF5J 1JLCB 3S1TA 2HFZA 3CDEA 2ZZMA 2IC3A 2MPUA 5IXUA 5A2QY 2DO0A 3D6HB 4CI0B 4CO4A 4LF4J 2G0IA 4OHZA 4GMKA 2HFVA 3RBEA 4I68A 3HI9A 4HHJA 3P96A 3CMAS 2D1CA 3I56S 2LDYA 1F5BA 2BQ3A 1ZPVA 5KFHA 3PW4A 1RT5A 3M8PA 3J80U 3CCSS 4C8KA 1HWLA 3OR2B 3OR1B 5AXLA 3CD5A 5F8IA 2ZH2A 4RWWA 1YJNS 2FB0A 4AYBD 1HBNB 3O1LA 1KKHA 1HNWF 3M8WA 4J9PA 4DX7A 3K57A 1S4EA 4YR2A 1VC6A 4DQPA 4ZHRB 2GC8A 2VC1A 1T94A 3JTNA 4O0NA 4P52A 2C2NA 3OXFA 1AW0A 4NCBA 1YX2A 2I1RA 1H98A 2SXLA 2DK2A 4JI2F 4OYPA 4X4RA 2H5JB 2EBEA 1GX5A 1IKXB 2IYIA 1RHRB 5KFDA 2AU0A 1WF2A 2ASDA 1S6QB 4LJMA 5AXNA 2K1RA 2FZCB 3CDAA 4N7TA 1OPIA 2X3GA 2KG0A 3KNAA 4ZDNA 3MFHA 1UZDA 4OIXA 4CH0S 2BUNA 4OHXA 4OFZA 3K58A 3DLJA 3BYPA 3MM5A 4WK3A 1VOMA 2MHEA 3QIPA 2GMHA 3MXHP 1KQKA 4UT4A 3E8OA 3M1VB 1JLAB 1Q5VA 4OYXA 1LWEB 2DNMA 1BQNA 1Z2LA 4ID5B 8AT1B 5LXYA 1UWAA 2VFTA 3OUYA 2V9WA 1WTFA 3GU0A 1RAGB 4KE5A 1M5KC 3I87A 1O8BA 2DNZA 1SL2A 4I56A 2AGPA 4GRSA 1BWEA 4FBUA 3I5AA 3D1QA 3VAIA 4USMA 1E6VB 5AE3A 3TVZA 1FNMA 1C4CA 5CH7B 5CAAA 3QGGA 1B7FA 2R8IA 4WFZA 2WW8A 2MQ8A 3CDUA 2RE1A 1RTJA 5D78A 2QA2A 5J2QA 3R6LB 2YX4A 3RB4A 1MWZA 2LEAA 2KI2A 4N41A 2IM3A 3R27A 3EMTA 2CNNB 1U09A 1OYEA 2NSBA 3DGPB 2AHOB 3GJSB 1FKOA 2ZD1A 4ED3A 2NYIA 3ICLA 1ZZNA 3NAIA 3PACA 2ZM6J 4B02A 2VASA 2ZJQQ 5L1IA 4NI2B 3M30B 2W8KA 3TYTA 2WVDA 1BGXT 1RWVB 2MKJA 4ELTA 2J5AA 2B6AB 1PAUB 4DHVA 2JWNA 1XMBA 2J7KA 3BGUA 3DRSB 1T02A 2GW8A 2KXNB 4S0MA 1HI8A 4FP9A 3GFHA 1K47A 1HBOB 2VG7A 2G0JA 1N5VA 4U7CA 1BHNA 4USWA 2V4QA 2Z2ZA 1S1VB 2FD2A 1NAQA 1Q82T 2DGQA 3EVMA 5CYJA 4XAKA 2B4PA 4OL8A 4JI0J 4IG3A 3AAWB 1N36J 2HZVA 2M3DA 2HEKA 3TAMA 1N56A 1H2VZ 4DUYJ 2B7CB 2RKIA 3FKBA 3VF0B 2YKQA 1NH7A 3PKMA 5GVQA 1W25A 3AOBA 4LFCF 1P1TA 4IOBA 2AJ1A 4KR0B 1WG4A 4JV1A 5LSRA 2XYPB 1PYSB 1VISA 5M2PA 3J81U 1NSAA 4X4VA 4GKJF 4JI5F 3OD2A 3PYGA 3KLGA 4PQUA 3AY0A 5EWEA 1IKWA 2JLEA 2E7VA 3EVWA 1L3VA 2YBVA 4OZLA 5H9FK 4ECTA 5F3TA 1S1UA 4JI3F 2M8HA 1NH8A 3LTOA 3FCHA 2AZ3A 4DV6F 4EYIB 4X65F 1B0TA 4NA1A 1TL3B 1HNWJ 1A0OB 2Q43A 2YWWA 1GEHA 1LKZA 3M6XA 2X1FA 2P5VA 4MIBA 3S8SA 5F3ZA 4ZPVR 3SQGB 3MHYA 2LA6A 4USJC 2VUGA 1K44A 1YRTA 3QRPA 1CBKA 4E2FB 1VCTA 5FDLA 3RYLA 3TAQA 2MQLA 4DL7A 2FGOA 1JQGA 3OFFA 1V5VA 1V6HA 4OX7A 2OPQB 1RT1A 1VRUA 3D7SB 4DPWA 1MN7A 4OV6A 1VHFA 5KG0A 4C3MA 3LGNA 1R8CA 3LPYA 1PYOB 4PWWA 2IY5B 3PKYA 2Y9HA 5FLXU 2HNDA 4EO6A 4I2PB 1REGX 2MQQA 2XQCA 2IVFB 3CMQA 3M8ZA 3EE3A 1PKUA 3D28A 5T7LA 2R7VA 2Z2YB 5CZXA 3TUPA 2IVYA 2IPOB 1LQ9A 1U25A 2ZOFA 2V4JB 3C15A 3DXSX 3R5BA 5CZVA 3DHWC 4O3SA 2GO8A 2AEMA 3JTPA 2UV8G 5A8KB 2IAJA 1UJ4A 1APSA 1D1UA 3K89A 3U1MA 2FVPA 1NHKL 2EI5A 1ZZFA 2UU9F 2W9AA 3MMCA 3TUJC 5KFZA 3IG1B 4C48A 2KDOA 3QO9A 1IQZA 3VGTA 1U48A 5KT7A 2E9TA 2B8QA 5J2PB 1NZAA 3DMJA 4ZPTR 1RAAB 1BQXA 1NB7A 3BB5A 3A12A 2Q66A 2HIYA 2JSXA 3N28A 5D6GA 1FF2A 1R43A 4NYPA 1QE1B 5ETQA 2CPIA 2EVZA 2F9DA 3NOCA 3KFWX 1IJFB 2BKOA 4NZ0A 2YXLA 4KB7A 1RHJB 2BJ1A 1VQNS 3SCJE 4BC9A 1F0XA 1OQ3A 3HHLB 3QBCA 1LWCA 3RBXA 4X4PA 1FRLA 3FSYA 4DG1B 1NDPA 3H5UA 3W61A 3CCES 4P72A 4UQTA 5A8RB 3HSJA 4OHWA 2ZH5A 2Y1JA 3BBFA 2WBRA 2VPXB 2B3TB 4J9NA 4OI1A 4NLPA 5KT2A 2V2VA 4EBCA 3H98A 4U8YA 3GZ7A 2DHHA 4WXOA 2XSFA 3T9ZA 2GZOA 2PEBA 2HBQB 4A8WA 2H9ZA 1HQUB 4M5IA 2HHQA 5HROB 1EETB 1HA1A 3SIPB 2MEWA 4DSIA 3UDLA 2QLXA 3U1LA 2KG1A 2QMWA 2W4PA 2UUWA 5LOQA 1SH3A 4HH1A 1I3OB 4QYZJ 2AJ4A 5DDOC 1N32F 4JI6J 2JZ5A 4ZPWR 1FKPB 4ITSA 2ASJA 3N0VA 3CNQP 2XWXA 1JLCA 2WVCA 1GQEA 5DDQC 1CJKB 2CZ9A 1FDNA 3THTA 3MUMP 5KFTA 2MDAA 2YY3A 2VFRA 3FBBA 4JI5J 1H6KX 4OI3A 4B3TJ 2AEJA 3AXKA 1U47A 4HI2A 3DOLB 3W3SA 1HNZJ 1Y5LB 4F4XA 4N56A 3OR2A 3OR1A 4OX6A 4FS2A 3TA1A 4ZLNA 1HBNA 3MAQA 4IH6A 2YTCA 3V4MA 2W7AA 3H90A 2QE5A 4ZHRA 1J5EJ 2D74B 4ZVPB 5ETLA 1RA7A 5J2MB 4ED8A 2FVRA 4DOZA 4HH0A 1BWVA 4CYUB 4KHMA 4U96A 5EGYA 4O0IA 4DV5F 3A8KA 2WK4A 1U1RA 1G3OA 2BDPA 3VHQA 1IKXA 5L46A 3Q8YA 3I0SB 4URQU 4G3IA 3EXCX 5B0BA 1FX2A 4ZVRB 3EYZA 3LA0A 2HNYB 3H4DA 4P10A 3C14B 4B9VA 4ZVTB 4DR2F 3J7ZT 1TFYA 1WEYA 3TJ9A 3ZZPA 2FC9A 1YDLA 3M1VA 1JLAA 3GYXB 2D7SA 4ED2A 2KYZA 2NPFA 2EK1A 2HZAA 4KTQA 1PYTA 4QCLA 2LKZA 4ID5A 1U4BA 2HLUA 5KG2A 4C0HA 3R5CA 2FLPA 2A6OA 3W64A 3AB2B 2CXEA 1H2TZ 1R8BA 1Y3KA 2BR0A 4URGA 2DRBA 1NHUA 3NCQA 1E6VA 4G6VB 2E1AA 1ZAVA 3MR3A 4D3GA 3CD7A 1RTIA 4LF9J 1ZM9A 2DGUA 2HWTA 3KLIB 3CDWA 2MXYA 3LP2A 4OZ0A 2XZTB 1ZYQA 3G8SA 2IRXA 3R97A 2XHWA 3DGPA 4C7QA 4A47A 1WF0A 1H7WA 2XMWA 3HULA 3THVA 1YITS 4N76A 3X1LB 2CQ0A 2HS0A 3PX0A 3OL8A 2E1PA 3LQVA 1FEEA 4NI2A 3LALA 1H3DA 3GYNA 1NK4A 2B7BB 1FCAA 2F9JA 2W2NP 2B6AA 5IQ6A 3DRSA 2DHXA 2PE8A 3MPWA 4MTPA 1GH8A 5HL7Q 1UA0A 3HXMA 1AFJA 3A3PB 4QPXA 3RRGA 4OYWA 1HBOA 4FVCA 3DOMB 1RP5A 2HWHA 2OKQA 1VHIA 2NQPA 5ETTA 2B0GA 2V2ZA 2VJUA 1LXNA 3MURP 2DIVA 1RISA 1S1VA 3GMGA 4KFBB 4ED6A 2OTLS 1KLMB 4J9VA 5GAGU 4WFNQ 1ZOTA 5B0DA 5HN0A 1FRMA 1AYEA 3CJSA 4YY3F 2CQ3A 1JLEB 5L39A 2HNZB 3ULHA 1LW0B 4I6WA 5D4OA 2KT3A 3QYYA 2XI2A 2M5YA 3FZ2A 2HHXA 1SC3B 3HPOA 4DLEA 4G1QB 5D8HB 3CIMA 3Q2TC 1NHVA 4H4MB 2BE7D 1XWLA 2KJWA 4P9SA 1XEZA 3BJYA 3ADAC 2JDJA 1EKRA 4WFXA 1ZM2A 2NXNA 2PO4A 2DNRA 3RRHA 1VLYA 1BE4A 3NBPB 4XO0A 3C2PA 1R8PA 2GVZB 4RUCA 1S97A 3PW0A 4FXWA 2DYAA 2ZZNA 1RXOB 1RADB 1X5PA 2UXDF 2HVHA 2F4VF 1TL3A 5GAGI 3SSQA 3G82B 1Q7LB 1X4GA 1WHYA 4EK2A 3H7HB 1I94F 3RB0A 3PTWA 2FHJD 4DN9A 3FBCA 3SQGA 3A8JA 3M2RB 3GIMA 2CPHA 3LP0B 3J7Z5 1IUJA 4WZQA 2W2PP 2CDRB 4YB1P 3NAHA 2OD4A 3CULA 4B3RJ 2J9CA 5B0CA 5I42B 2DPIA 5F8MA 5A8WB 2VG5B 1MMDA 1KTQA 3IN5A 2PI5A 3ILLA 2ROEA 4I2PA 4CO0A 3OQ2A 2WAQD 4UF4A 1TK8A 2L08A 3V6DB 3SI8A 2J0SD 4DCOB 4IRKA 4N5SA 4BDPA 2BJEA 1W7WA 2GQCA 2NS1B 2V4JA 3AA8A 4ZIVA 1NK5A 4NOHA 4RO0A 2EEYA 4BBYA 4ZVFA 2RIJA 5A8KA 5M2RA 2YQ1A 1CS4A 3WHIA 3CJRA 3MEKA 3BO3A 5C7PA 2DY1A 2AEFA 2Y3YA 3TARA 2R7XA 3EPIA 4OV1A 3M7VA 1C0UB 1B64A 5AJ3F 4Q0BB 2VBWA 1UP1A 3IBFB 2IA6A 4KYZA 5DQIA 5T41A 1QDUB 5D4NA 2APOA 2G1HA 2JFKA 5BXIA 4OX8A 4PPDA 1FERA 5J2PA 4I4BA 1FWKA 4F04B 2HS3A 4AL5A 2B9WA 4F26A 4IO9Q 2KT2A 4DR6F 1X5TA 4DR5J 2NUHA 5M2UA 1QE1A 2CFXA 1M5PC 1NKEA 5D3GB 2QMUB 4KGXB 1TK5A 2RU3A 1KEKA 3T41A 1GMWA 4ANCA 1X60A 1I5OB 2DO4A 1FJ7A 5L9XA 1EIYB 1SJRA 3RG6A 2RNEA 1RHKB 3HHLA 1J2VA 4NMXA 2VFUA 4DG1A 3N79A 1RAHB 2C2KB 4H4OB 1R8HA 4HT7A 5A8RA 2KYXA 4ZPAA 4WYLA 3QSIA 4RU9A 2V8GA 1Q79A 4LRAA 9RUBA 1MWQA 1HQ2A 1UPPA 2K06A 1B4SA 4UOCA 1VBYA 1TAQA 1GTHA 3C46A 1GAOA 3BSOA 2JLGA 4OQJA 4A8YA 5HROA 1EETA 2WSFC 2DNNA 2GS8A 2VPZB 1KBRA 2CNLB 3JYTA 2MKIA 2MLYA 5AXKA 2ACMA 1NDKA 2DHGA 2R7TA 3T1YJ 2MKCA 3Q8VA 3AXMA 2CZVC 3IM8A 1IWGA 2ZC3A 1W26A 2KT5A 1FKPA 1XK8A 2RAQA 1T03B 2UUTA 2NXJA 4GO5X 2DEJA 2E5LF 3QRRA 1DHMA 1IN0A 1YBTA 1CJKA 3PW5A 5GAEU 4PG5A 4ILRA 2VD3A 3UI3A 5B0FA 1QY7A 4Y00A 2QO3A 2MJNA 4JI8F 4TLQA 4ZPDA 3G71S 3LUYA 4DR1F 2GX8A 1HNXF 3SV4A 1MU2A 3OXGA 2KFZA 3BKFA 4LFAF 3CCMS 3DOLA 1EP4B 2J0QD 4NXMJ 5ETOA 1IBMF 3KJNB 5D77A 4CZCA 3ENWA 4KHPF 2B4UA 4F4WA 4KGKA 4WP3A 4KT0C 3W63A 4ZJOA 3ZO7A 4HTIA 4DR3F 1T9XA 5H9FJ 2F4VJ 1NZ8A 4NEZA 1VQYA 3PYFA 3ZZRA 2CUYA 1TUWA 5KFKA 3EM1A 5J2MA 2HMIB 1TKTB 2UUBJ 2MSTA 3F44A 1E6YB 3HZGA 1HL6A 4CYUA 3BGLA 4RUBA 5LSOA 5GAHU 2XSJB 1OY8A 4XTTA 1HBMB 4FPIA 3I0SA 1C0TB 3N6NA 2RRBA 1F5AA 2VV5A 2W2OP 3UN5A 3C6TB 3FZBA 1PILA 2HNYA 1FVSA 1TFWA 3C14A 4WTOB 3L4BC 3F73A 2ADBA 3DGVA 3DLEB 2BKNA 3M8YA 2HFNA 3K5OA 1DTQB 1X4FA 4ED4A 1YJVA 4X4NA 2B4OA 1XMQJ 3AD8C 5KFJA 3J7AN 2GIFA 2VONA 2KB2A 1EAYC 3NLCA 3AQPA 2XGQA 1AFIA 4LF2A 5KFVA 5T14A 1TV6A 4X4SA 2RUSA 5F8GA 2MGZB 1NJXA 2FVQA 4CM0A 2FTRA 1FXDA 1NCLA 1REVB 1LK5A 3M2VB 2QV6A 1FNOA 3ZFVA 2KRRA 1R27B 3R9LA 2R7SA 4ENOA 3KLIA 4OYBA 2DNPA 3JQMA 2O1PA 3UCUP 1X4AA 3OLAA 3E01B 4LVOP 1IBLJ 4P2MA 2I9SA 1FO1A 1RI7A 1U1KA 2RB7A 3QWPA 3OL9A 3OBIA 3P5TL 4EI2A 2DEIA 1UTAA 2GCFA 1S6UA 2VZ9A 5EUHA 4Y28C 3OVSA 1FVQA 4WXWA 2H54B 2F5GA 4USVA 1RLCL 2QJ3A 1S79A 4LR7A 1FHTA 2R2RA 4Y2CA 3GIIA 1M0SA 5HMXA 2QT7A 4PKDB 1JXVA 3AQOA 2YKAA 1LOUA 4UTGA 5DJBA 5J1NA 1JLQB 1TAUA 2RRNA 2YWKA 2UVWA 3DOMA 3R7BB 4NLGA 3HD1A 3OTOJ 4F0HA 2YWEA 1Y11A 4B3SJ 3A3OB 4A8KA 3GCWP 3GFZA 4KFBA 1KLMA 2Z0GA 4JV5F 2XCPA 3I6PA 4N8NA 4ZLPA 3BSNA 2YVSA 3W9JA 4NLDA 3OPKA 2HNZA 1LW0A 3HX9A 4TN2A 2EK6A 3FJ2A 2BVZA 1SC6A 3FEZA 1FRHA 5I3PA 3AB4B 1N5YB 3IAS9 3MEEB 4ZVUB 3CD0A 4J9OA 2CQGA 2DGVA 5K8OA 2L3MA 1ZA2B 4KPCA 3JSRA 4G1QA 3EGWB 1X31C 4K50A 4YOEA 4H4MA 2RSQA 1Y0HA 1S10A 2HG4A 5HQLA 3H2LA 5J1PA 4J5OA 4I0WA 4DR1J 1HNXJ 1JB0C 3TP2A 3N6LA 2C22A 2D9PA 1WOPA 1R0BG 4LFAJ 1LW2B 2KTQA 3VALA 3AJ1A 3MMJA 3QLHB 4X62F 2GVZA 5A2QU 2ZBRA 4RJVA 3EGVA 3VTIA 4P6QA 3JSYA 4OZ1A 2W4DA 5KAKA 4UQGA 3G82A 2EC0A 3A13A 4PAAA 4F3OA 3PRVA 3D0IE 4QJVA 2VH7A 3GLJA 1EX8A 4PUOB 4QWDA 2FDNA 3LP0A 2M88A 2DR6A 1YBUA 4TY8B 3PM9A 1S1TB 3T1AA 4B9MA 4IG0A 2IBOA 2CVIA 2QA4G 2MZTA 4DFMA 4A8MP 4KKOB 3GIJA 2EBGA 4Y2MA 1L3TA 1U24A 5I42A 3TA2A 2DHSA 2QYCA 5A8WA 2VG5A 2HQCA 3IR7B 3MFIA 3MMAB 2H4YB 2OPRB 4Y3CA 3J7YU 4KJIA 4HVZA 3R1LA 3ITHB 1X4CA 5KFPA 3V6DA 2VG6B 1YTYA 3HFKA 1WC3A 4NLVA 3RR7A 5KOWA 1X5SA 3D1OA 3UD5A 2E9RX 4QWEA 4WF9Q 5L1LA 4AUKA 4YEAA 3K5PA 1ZA1B 3SCLE 2W4CA 1Q1KA 4PG7A 1UFWA 2AF6A 4YP3A 4ICLB 2WW4A 4Q43A 5HVFA 3H20A 3IWXA 4RUHA 2JVRA 4AXJA 4IYQA 5ETPA 3PO4A 2HGNA 4C8YA 1J5OB 1SIZA 3O5TB 1Y3JA 5I3UB 2DNGA 1C0UA 3V6JA 4H4KA 3D9BA 3HHDA 4K59A 2UXCJ 3SV3A 3D3BJ 2ASYA 2OUGA 2ADCA 2V8HA 2PFDA 4LBPA 3M9NB 4P71A 1WDDA 2D9OA 4G1PA 2V9KA 2I0XA 4ES2A 4ECSA 4CTAB 3PEJA 2HIQA 4A8FA 3JQJA 1XN9A 2CPJA 2FY8A 4MKYA 4Z7CA 2ZJPQ 2CQ4A 3VWSA 4GVBB 1S7IA 2RQCA 3W2VA 4UUXA 2W9CB 1GMUA 1SIWB 4NCGB 1UVKA 1KDNA 1Q0NA 4QW9A 4FKYA 3PHEA 3IAM9 3NEKA 4LSNB 4DCJB 1RB0A 2GMLA 4H4OA 3PDNA 3W7BA 4ZN1A 4XK8C 4NZ6A 1HLWA 2YNGB 4TY9A 2VKRA 1H38A 4TKTA 3PFEA 2O3DA 1N5SA 2EKNA 2GIQA 2YH0A 2H1YA 4LSLA 4L76A 2NLWA 1NDCA 2RHSB 3TX8A 1NXIA 3TQEA 3Q8RB 2P9EA 4QQBA 4DBQA 3D66A 1WKJA 1SKWA 2G0CA 3QJPA 2Q6CA 1QSLA 1SBRA 1S72S 5HANA 4IDKB 4OJ3A 5LMNF 4NWBA 2AJQA 2N7YA 1IKVA 1VQ7S 1Q86T 3DI6B 3T6BA 5K20B 3G87A 3NWRA 3PJ9A 2W01A 4F4AA 1XNRJ 1Y5IB 3BN4A 1N34J 4IO1A 2OPSB 3KG1A 3DKDA 2HAIA 4RUAA 3NGTA 4AD6A 1NPKA 4DR7J 1UJ5A 2K7JA 2FHOB 5ETRA 1RAIB 1DZ5A 2VA3A 4DR4F 5A6PA 4KIAA 4LF6F 5HK4A 3NNAA 4BC7A 3CB4A 1RLDA 2A0FB 2PMWA 2OJ3A 4ZK7M 2VJVA 2IVMA 1PSDA 4JI1F 2WZ1A 3L09A 5FIIA 5MLCV 1FJGJ 3JSMB 2W7PA 3FC9A 3D6FB 2VL1A 3OTDA 3DLKB 4NLXA 2MLZA 3T3FA 4ZVEA 1VQ8S 4X62J 4L74A 2KHCA 3R7NB 4UZCA 1NKCA 2JEFA 2QA1A 1PBAA 4JV0A 4IUFA 5DZ6A 4B17A 1N8RT 1HWIA 5G4DA 1PIEA 1VFJA 1TL1A 3PX6A 4DL5A 3A4TA 2Q6BA 2GJIA 1TKTA 2W25A 4K4VA 4LSZB 1E6YA 3EWGA 3M05A 2PFFB 4C8NA 2MZ1A 3Q8PB 3KKFA 2ZC4A 3RB6A 3TJAA 3HVTA 2XSJA 3BDEA 3UD3P 2JRSA 1HBMA 4LF8F 4DQIA 1C0TA 3HCXA 5ITHA 3Q22A 1WC0A 4ECYA 2XNQA 3AOCA 3GJTB 3DXBA 4DV0J 2GHVC 2R7UA 2UXBF 4C98A 4IKAA 3FSIA 3W8PA 4DL3A 3DLEA 4K4YA 1LXJA 3M6VA 2DVIA 1ELOA 1XBWA 1DTQA 1UPMB 1SCJB 5E33A 5LJ5Y 4K5SA 4K4XA 1RCOB 1SVDA 2BABA 3IGNA 5HBMB 2O67A 1UVJA 3R5AA 3Q8SB 2W9BA 3W60A 4RBTA 5LM7E 4R5PB 1HD0A 2P6TA 3LPEA 1HBUB 2JJ4D 5B0GA 1BQMA 3HKZD 4JI4F 2H3EB 2MGZA 5B08A 4TYAA 4F3QA 1U8SA 2UUAF 4ZS6A 3NMAA 4WP9A 3K5LA 3FEXB 4FKXA 4RW6B 2F63A 5K9FA 3M2VA 1S0NA 2LQBA 1FKAF 2C2OB 5CCMA 4CLZA 2XY6A 3KLHA 2LXFA 4L3NA 4Y34A 4ELVA 3UFCX 1VI7A 3K2YA 3E01A 4ED0A 3TVYA 3ENQA 1FRXA 2DR7A 4U7UD 4JP8A 2HHTA 1RT4B 3BKUA 1ZAXA 3FMWA 4OHYA 3CWJA 1DLOB 3S01A 4F50A 4O3NA 2CDQA 1U1LA 1TVRB 2HHHF 2UUCJ 2LXUA 1Q78A 3NNHA 4Q2LA 4K0KF 3KG4A 1UVIA 2CJYB 3QFHA 3KHGA 2B56A 1HR0F 2YNHB 2F40A 3OSPA 2NYHA 1TU0B 1LV5A 2UZAA 4B9SA 2BM0A 1JLQA 2XMUA 1U0HB 2F4FA 5CYQB 4DLGA 3MM8B 4ECVA 4HKQA 2RMLA 2U2FA 3TOQA 2DY9A 3DN9A 4M5DB 4QIFA 3MOJB 1T3NA 4M5LA 2KL8A 1RDRA 1VQ6S 3TWZA 2GO9A 3FRZA 2PA3A 4ZVQB 2JC1A 2M7SA 3OLBA 3NGUA 1RKIA 4IQXA 1RTDB 1U6ZA 4ECZA 2K3IA 1N5YA 1Q8KA 2NPIA 3WX8A 3MEEA 1TKZB 1N5TA 5KFCA 1D9DA 3IRXB 3AODA 3MM6A 2N82B 3R8YA 1N33F 4V19J 1FTCA 1P6TA 4B3MJ 4PCQA 2YWFA 3F0NA 5B7WA 3Q23A 1QUPA 4C0OC 4OLPA 2FC8A 5EWGA 3LWMA 2J6TA 2OI2A 3SCIE 5IQQA 1T05B 2UV8A 1KSPA 5ETNA 1FI4A 3CCUS 1S7HA 3MECB 3O44A 3QLHA 2BRKA 3T5HA 4QR0A 3OT9A 4DV4J 3L9ZA 4NCAA 5GMKa 3MTKA 1ZM3A 2KH9A 5HJXA 3KMQA 5A6WA 4FDFA 2CQCA 4ECXA 2F3JA 3ZZOA 1RCXB 2D3ZA 4OI2A 4PUOA 2ATLA 4FNIA 4TY8A 4Z37A 1S1TA 3KLFB 1NEEA 3I55S 1IR1A 4NLOA 4KKOA 2XBPA 4KV8B 4DSJA 2YWHA 4GKKF 3MMAA 3EXYA 4BCAA 2OPRA 3KWMA 4ZITA 1DARA 1N6QB 4X2BA 5KFSA 2ZH7A 3RRKA 3DDIA 2LQ8A 2VG6A 5E3AA 2HBYB 2RUGA 1VIOA 2JC0A 1AZSB 2J6SA 5C2CA 2VQEJ 1EARA 1OMSA 2HRUA 3BS9A 4JI7J 2QEXS 1V9OA 3IRWP 3D54A 4LF7J 4DV7J 3C19A 1A6LA 4ICLA 1UKUA 3U7JA 4FBTA 4NXNJ 3JXOA 4G65A 4O3RA 4J7CA 2N4DA 4OX9J 1J5OA 3EZOA 1QAJA 5I3UA 4RW9A 4RBVA 3EGZA 3PYDA 4QWBA 5CXTA 4V19X 3TO8A 3T1HJ 2GGPA 4TYBA 2R8HA 4NE9C 2HVDA 5A0YB 5RUBA 3D5MA 4CTAA 1RQ0A 4NRUA 4OJ1A 4XDCA 3WIUA 4FYYB 4Y2IA 3UQSA 2ILYA 5KFAA 4I7FB 1KFSA 1D8ZA 4GVBA 4NLRA 3MOZA 2W9CA 3ETOA 4CO2A 4PWDB 3ILIA 4K7QA 2JX2A 6FDRA 2CQDA 3QIDA 4X64J 4LSNA 3D67A 5D0GA 3H42A 3NCRA 2YNGA 4DV3F 2CPZA 1ZM4A 2HLTA 2V6AA 4MKAA 2OIHA 2G13A 3DYAB 3V5RA 2QL7B 2C2MB 4LR8A 2VQFF 2C3PA 2KZZA 2BJ7A 1UW4A 5KFOA 3ZTSA 4JYAJ 2ZWOA 1YJRA 4LIWA 1SJFA 3MR7A 4LVNP 2PMZD 4R0EA 3BSCA 1V5IB 3LOUA 1P9QC 1YK9A 4IDKA 2H65B 2BW7A 2MKKA 1HWUA 3DI6A 4DUZF 1DTTB 4PG8A 3C3LA 2MLXA 2LU1A 1YI2S 1VQ5S 2OPSA 5ETVA 4ZOSA 3R2CJ 1X4DA 3QFWA 3GV7B 2OEKA 3R5JB 2LQJA 1TL4A 2VKZG 1Q8BA 4IH5A 4ETZA 2KVQE 3UN3A 1RAJA 1OPZA 5IC6B 1VYAA 5HSPA 3GQCA 2J7WA 2V2QA 4GVLA 2FHMA 1KVKA 1PBUA 2OO4A 3JSMA 3DOKB 5EDWA 1WNEA 4J9LA 3HK2A 2GVDB 3DLKA 2EW9A 2GNKA 3GR1A 1IBKJ 7AT1B 3PRBA 2HQDA 1DAXA 2BJ8A 5LJ3Y 1QAIA 1SJQA 4EMDA 3GFYA 2C2RA 1LWFB 1OS5A 3ET6B 5AT1B 2J8SA 4KO0A 2IDEA 2LLZA 4KAIA 4USKA 1MW7A 3ISNC 4MH8A 2XGPA 2LQ9A 3CJ4A 4L75A 5JJBA 1H72C 1N88A 2K2PA 1UWBA 2QMXA 3PJWA 5L1JA 1WC1A 3KLEA 2W2MP 1VBXA 4OI6A 2BQUA 1WI8A 3ZTQA 3G6VA 3CC2S 5HMWA 3LWLA 2EPIA 5IT0A 3TUIC 5LMUF 1Q7YT 3RJMB 3UD4P 2AX0A 2EG2A 1CJVB 4DSFA 3NKYA 3CCJS 5FJ4A 5IV3A 2HVIA 3TI0A 5E0OA 3Q86A 3I4HX 1TZ0A 4EBDA 3LP1B 3U27A 2FY1A 4TXSA 4DX6A 4CIOA 2YQ3A 2XTJP 2R7OA 1QSSA 1C1CB 4E98A 3GWCA 1QTMA 5ETSA 3RW6A 1S1WA 2EFQA 2A3JA 3SQOP 4R5PA 2O01C 3KOAA 1RGVA 5LSLA 4AE5A 5KFUA 4DV2F 2HHUA 1HBUA 2C3MA 4QWCA 1BY9A 4DV1F 3PR4A 3LAMA 2CPDA 1WEXA 3FFIB 2LMIA 3SZ2A 2DH9A 3ENVA 3IWNC 3D2WA 1UAWA 2EWHA 3US5A 4PRFA 3SEOA 3UWTA 4J9SA 3BGRB 2XO7A 4CLPA 4D3HA 3W5XA 1YZ6A 2AQ4A 1FX4A 5MAOA 4LUBA 1RT4A 2FQQB 2KVIA 3NS7B 1FXLA 4MFBB 2MQMA 1NNDA 2AZ1A 3BO4A 2R2SA 1DLOA 3VCDA 1F9FA 5D0EA 2OFHX 3D6MB 1TVRA 3MAHA 5DETA 3C16B 3HDSA 1R31A 2XMAA 2JLFA 1JNRB 1RYSA 3JAMU 2XCAA 1FWLA 4WWSA 3G9CA 2FJAB 3MCSA 4EFAC 1TL7B 2DJWA 4OZ3A 2N7CA 1NK8A 2AKWB 2VU5A 4W4MA 1U0HA 4I69A 2C2DA 3I9V9 3MM8A 3QJLA 3MPVA 5JXSA 4OYIA 2R4FA 1S0VA 2L9NA 1KQGB 4P2FA 2DGOA 3EX7B 3GSIA 3BH6B 2ZBCA 2IFXA 1WHWA 3DHXA 4QIVA 1TKDA 2BX6A 2WCXA 1F2HA 5BR8F 2LXIA 4OZ2A 1RTDA 2FIUA 4DUZJ 3O8WA 2FJEB 1F2GA 1TKZA 1G7CB 3TRGA 4C2MA 1UETA 1F9EB 1KR4A 3I82A 5J1EB 1GMVA 2HQGA 4PG6A 1XJWB 4GC7A 3ZC4A 2F8MA 2ZHBA 3ONQA 3TVKA 4CQ1A 4Q2MA 3GTYX 3UDCA 5KG6A 1T05A 3KTQA 1NDLA 2B9EA 4J9MA 4F0KA 1WG5A 1RWPB 3UNYA 3MECA 4ANEA 4ZJQA 4K4ZA 4ZCKA 2CJAA 1JK9B 1VC5A 2KFNA 5E3CA 3TUZC 3QT5A 2EFVA 1F3VA 2ZVIA 1HW8A 2MB0B 3GJQB 2YKNA 3CCRS 3G96A 1CQNA 1Z1ZA 3IS9B 2D3OR 5KG5A 1RWKB 2ZH4A 4I6AA 3MPYA 1UEUA 1OY6A 3RW7A 4NLYA 3NRBA 3I32A 3PW7A 2I6WA 1WKLA 2CA9A 3KLFA 4GC6A 4L3KA 5THWA 1AXQA 3QQCD 1H7XA 4KV8A 1FDAA 1R0CB 2IA0A 3VAHA 5KT4A 1P9YA 1GNKA 2YKMB 2B8PA 1BLUA 4WBFA 1SPBP 3M8PB 1TELA 3QAEA 1N6QA 2UVUA 3DC2A 4JI2J 3TJ8A 2XNRA 3FBFA 2AYGA 2OD6A 2DRDA 1KVJA 2VICA 5E5NA 4FNHA 1HHSA 1VQ9S 4ED7A 3R1HA 2G2OA 2M0GB 3MWBA 3AD7C 2CWKA 3AA9A 1MSWD 3DDKA 3KHLA 3PRDA 2L41A 4AQYF 1FRKA 2CPFA 3O6QA 3IXQA 1DQ9A 4PXCA 2QG9B 2IHR1 1GT8A 2LCWA 2UP1A 4PXEA 4OLOA 1MROB 1SUQB 2H5IB 4CO5A 2AX1A 4TVAB 1N4LA 4Q7AA 4YUDA 2X7IA 2LFVA 2M70A 5A0YA 1ZAWA 2BANB 2FPHX 2ZVSA 4LRBA 1VQ4S 1XC9A 2RDJA 1PC4A 2HVEA 3HP6A 2Z2LA 1NSPA 3PIPQ 3MPDA 1T8EA 2Y8WA 3VGUA 4CLWA 3MM7B 2HSEB 1CVJA 1EB0A 4USHA 4ILMA 2ZH3A 5G0RB 3MM5B 1RE1B 4PWDA 2YQ0A 4Y6IA 2J0XA 2BA9A 3TQ1A 1UVMA 3R3TA 3T5JA 4OZNA 1IR2A 2V4RA 2AD9A 1BQNB 3MGJA 3DM2A 1RT3B 4RX6A 3GIKA 2CRLA 4DCPB 3OUYB 4WU2A 4MAKA 5DGBA 2XS2A 1X9MA 1CULB 5D4PA 2Z4PA 4J9QA 2W2QP 3DYAA 2XYHB 5KFRA 4F4YA 2HQFA 3QGIA 2P8IA 2WVEA 1O0PA 3ZTRA 4X66F 3BF4A 3TX0A 3I0RB 1VQMS 4Y2AA 1DTTA 3H5XA 1TP7A 4Q5VA 4NLTA 4O3OA 5E2QA 2HFUA 1PGZA 4LFBF 1SV5B 4OYMA 5DG8A 4J9UE 1H0HB 4C6AA 2FJWA 1A7GE 3ZNJ1 4RBUA 2OELA 5BYSA 2E44A 1K73T 3NXZA 1EHWA 3SSRA 3D0GE 3W5ZA 5HP1B 4LFCJ 4E0DA 1QM9A 3CJ2A 5DS7A 3TZZA 1U49A 4Z7YA 2FYXA 3DOKA 3E3XA 4C11B 1FESA 2QLFB 2IM0A 4YB6A 3M8SA 4USUA 3FUYA 4NPOA 4QYZK 2O66A 4WFAQ 2E1RA 2V8PA 3KHHA 4GKJJ 1EQ0A 3HT3A 2KKHA 2J9DE 3OSNA 1SJ4P 1JNZB 5BYQA 4TU7A 3WIVA 1PC5A 1LWFA 1BD6A 3ZTOA 1KTVA 3P4UB 2CADA 1NK0A 3TANA 3M4XA 4DPTA 1X8DA 4JI3J 4M5KA 3J7A1 4FN5A 2DGTA 1JMTA 4LF5F 2AJFE 2B9YA 2AYBA 4DV6J 2YPYA 3KK1B 2N3LA 4X65J 4LF4F 1LEOA 3W66A 4XPCA 4OI0A 4USTA 3R5GA 2BEFA 2I5JB 2EFGA 2HAFA 1NUEA 1JLFB 2HK2A 2VB6A 3DRPB 5B09A 1WKKA 2Q79A 1IKWB 3JTOA 1O6XA 1RT6B 1T0TV 5HATA 1KNZA 3GONA 3VZIA 5KFLA 1S1UB 3IBWA 1S6QA 3QATA 3CEDA 4PABA 2CJKA 2FVSA 1ZS6A 1OJ4A 2C3OA 5KFIA 1B0VA 1B7YB 2A2DA 4AXIA 4NX9A 4F0MA 1VLOA 3F56A 4LF1A 4H54A 2YWGA 2OAUA 4YB5A 1V3ZA 1S9FA 5KFMA 2WSEC 5IS2A 3NGRA 3EGNA 5KG1A 3ZXWA 2M2BA 5DM7Q 2D41A 2HK3A 5FDLB 1LWEA 3FFIA 2EC2A 3A8EA 2G4BA 1N5QA 3G4SS 2MMYA 1S59A 3UR0A 3ENAA 4ZA1A 3BGRA 5KFWA 3MCNA 4DUTA 2UU9J 1OO0B 1H73A 2QRRA 1AB8A 3GV8B 2HNDB 3PW2A 3K0JA 3DRXA 2X1GA 1KHWA 5IFMA 3EZ5A 1RBLA 3VAJA 1IR0A 1ZETA 1VQSA 4LRFA 2CZ4A 4QZVB 2ZDPA 2VPYB 4FVMA 2KM8C 1G1XA 3G8TA 1QAXA 3BGOP 1WC5A 4QW8A 1MMLA 5KT6A 3PY8A 1RT7B 3NS5A 2WSCC 2J8AA 1JLGB 1RT2B 4I6YA 4KY3A 3BV8A 3GV5B 2RF2B 4ERDA 1SKRA 2VIHA 2KXFA 1YZ7A 5K8PA 3M30A 3EVOA 5IT4A 4O44B 3O2IA 4ZP6A 1KRPA 3CTRA 3MM9B 3FEYB 2V5HG 3DMJB 2H4WB 2YNIB 4EEYA 2JVOA 3X3UA 1ZPWX 1YJWS 1S9EB 2QIFA 1X9WA 4CP5A 5H9EJ 3P8BB 1YJ9S 2RH3A 4UUWA 4IH7A 4LFBJ 1IXKA 3KUHA 5J1EA 1XR5A 4BHQA 1SQGA 2GAHC 1IM4A 1N32J 4J91A 1YJTA 2E5JA 4ZPCA 5E7OB 4HDHA 2CG8A 4HLBA 4AFFA 4CWBA 2JFDA 2OGUA 2C42A 3QJJA 2QA4S 1F9HA 2B51A 4YB7A 3WC0A 3UCGA 2KU7A 5KOXA 3B78A 2QZ8A 1FEHA 1NLKL 2HS4A 2IMOA 1YLXA 3MDFA 1HQEB 4JI0F 1N36F 4M8LA 3CPWR 3IS9A 1IKYB 4IFYB 4DUYF 2NZCA 2V63A 5A76A 4K2JA 5D0RA 3QT7A 4MT1A 3SSSA 4FXVA 5F8NA 4DQRA 3S6EA 5BYRA 4K5RA 2XULA 4PWUA 1K1QA 2RILA 2XYGB 2JNJA 3KUEA 3W8GA 3CC4S 5F0WA 2XMKA 3NMRA 1HHQA 3G8QA 2C3UA 2QYGA 5DQHA 1YQHA 1WUUA 3WZ0A 2XS5A 4RNFA 4W98A 3P3DA 5GADI 2POKA 2YKMA 2ZUAA 3G86A 3KLVA 2OEMA 2CQIA 5KG4A 1U2CA 1WSRA 4O23A 3SFGA 4KH0B 2HHPA 3PR5B 1T11A 3CF5Q 1Y5NB 2C1EB 4DV5J 2OPQA 1X9SA 4PEOA 5FD1A 3IR6B 4TLRA 2QTWA 4I1TA 4OJGA 2DR8A 3PYEA 4A8QA 1M5SA 5DO2A 4KGZB 3PZPA 4PG4A 4RKUC 4QPTA 3MPUB 4DR2J 2X1BA 1YSJA 2ZEJA 1W2BR 3V4IB 4EGLA 5K5MA 4DN0A 4HHHA 3SDEB 1G4CA 2ILZA 4EYHB 1FE4A 1KOHA 1U7LA 3FGVA 4Y0FA 1XQIA 1RWMB 1MROA 1SUQA 4BLGA 2XS7A 3KDNA 1R0AB 4ECRA 4ZVGA 3HKWA 2BANA 2CG4A 2HRYA 4M5HA 1O5JA 1Q81T 3PHTA 2XG8A 1VIXA 3KJQB 3IG1A 3MM7A 4IRCA 4ECQA 1HNVB 1H74A 5G0RA 3RAMA 3E51A 2IJRA 5KT3A 3G6XA 2MYFA 2ZH6A 1T9VA 1FDBA 4ANDA 4WFBQ 1PCAA 2KXHA 1MLAA 4N47A 1RT3A 4RR5A 5IT9U 3BPDA 2BZ2A 3BR9A 1V3SA 2MKSA 1U6BA 5CYMB 4X4UA 1N48A 1CULA 2CQBA 4P75A 1M5VC 2LEBA 1FWPA 4ZMMA 1D9FA 3IFEA 1GTEA 1RTIB 2B43A 2HGMA 5DRKA 5ADZA 5KT5A 1LK7A 4M1KA 3I0RA 4MYTA 1HD1A 2ASLA 5CABA 1UEVA 3LP2B 3HF5A 4PXDA 3PV8A 2BMBA 1IQTA 1HQUA 1NO8A 4YR3A 2VDHA 2GQ2A 5F8JA 3CO0P 1N0VC 1RK8A 1GMWD 1RUSA 1SV5A 3OW2R 3HHLD 1XIQA 5KTQA 2F8EX 2Y0BB 4YY3J 5CHCB 3FNNA 1WD6A 1WDTA 1QUVA 1JLBB 3CUNA 1R8AA 1SQEA 2B5JB 1T9UA 5HP1A 4TNOA 4QYRA 4C11A 2GMJA 3TR5A 2OSRA 4CCHA 4DZ6A 3C6UB 2CNOB 4OI4A 1OIAA 4MKBA 2EFOA 4K4WA 4PPZA 3IP0A 3FK4A 4MKVA 2BM1A 4CNZA 1T9WA 1P8GA 1SJ3P 4DSLA 2JOQA 4ZP7A 2RJZA 2L48A 4EZ9A 4JI6F 2VODA 3RBDA 2V2KA 1QLNA 4K4SA 5HAOA 2XB2D 3UDVA 3PNIA 2DR9A 4CLKA 4P2SA 3KK1A 2DXFA 4FZVA 2UXDJ 4WK1A 1U1PA 1RZMA 4DU7A 4RU2A 1B3TA 1OWXA 4C3LA 3LF0A 3SFUA 4CLTA 9ATCB 1I94J 2I5JA 1S48A 4WP8A 3LGMA 1JLFA 4N8OA 2PSZA 4DFKA 2DISA 4DX8H 2CVEA 3RAXA 4B3TF 3HSZA 3DRPA 1YHQS 1Q8LA 1HNZF 3SXLA 1RT6A 3MF5A 4RNHA 5EX3A 2LP4A 1KQFB 2YX7A 3CJTA 3GB0A 2BJDA 1PJ7A 2HFOA 3FSXA 3ZZTA 5IC4B 2GHPA 3IBCB 3FMBA 1J5EF 2CKWA 4ZLLA 3GJRB 4LRDA 3AHPA 2MY7A 1UMJA 1D09B 2EG1A 1LFWA 1M5HA 5BJRA 4CT8A 3HMJG 1D0EA 4NLUA 4O3PA 2V8DA 2HW3A 1NJWA 2YPZA 1I6JA 1IVZA 2DGSA 3M9OB 1S0MA 5HI7A 3L3CA 2OLWA 3B4DA 3NG8A 4K8RA 2V69A 1HNIB 1S1XB 3MUTP 4ZIWA 1ZH5A 2M8DB 4P2XA 1TKXB 4WZMA 3UE2A 1DFDA 5I3QA 4CO3A 3NL0A 2FJDB 2KRBA 1WC4A 5AJ3J 2FGCA 1I1GA 3V6HA 4DU8A 3BN7A 3KHRA 3GFXA 2BE9B 4DPOA 4M95A 4FYWB 3KK2B 3TAPA 3A1YG 2IDLA 3O3LA 4PQAA 4M63A 4I2QB 1XMOF 2E66A 2HVZA 4C0BA 4DR6J 4DFPA 5JMNA 2HZCA 1C4AA 2RVJA 1JJ4A 2BW2A 1CS4B 1F60B 3KK3B 2AWZA 3DRRB 1A9NB 5HMYA 1RT7A 5I4MA 5HVHA 1JLGA 1RT2A 4OYZA 3OHAA 3C8YA 2RF2A 4M5MA 4RZRA 4J37A 2ZOGA 2F8HA 4O44A 5D15A 1TTHB 4LF9F 3MM9A 1QD1A 4FPRA 1WJ9A 2YNIA 4HHUA 4XDDA 4FF2A 1NB2A 3AH6A 3BQ1A 1S9EA 1AUDA 3V2UC 2XMTA 2IBKA 2COLA 5L9NA 1UZHA 2LYVA 4HEA9 3CJ0A 4HL9A 1YIJS 1PG5B 3B4MA 4J9RA 1HI0P 3CC7S 2DNLA 3HFZB 1Q95G 3R6GB 3T6JA 1JLEA 4KSEB 4UZBA 3U02A 4ES3A 3AOAA 1UVNA 1QVGR 3TZWA 4PYDA 4DX5A 2E5IA 2Z2MA 3JSBA 3I31A 2O5DA 1HARA 2AYMA 3EJMA 1AT1B 4ER8A 2DHAA 2E5LJ 4F2RA 3DNCA 2R8KA 5SZTA 3MEDB 1Y00A 1S12A 3MCMA 4I64A 2D3O1 4JI8J 4NLWA 3UW1A 2V8VA 3H4BA 3JYTB 1HQEA 2KHDA 1G6BA 4RW7B 4CO1A 1IKYA 4IFYA 1CQMA 1U1OA 2BRLA 1VS3A 2NCKL 3NBPA 1IBMJ 4FYDA 3HZEA 4OZ5A 2BV3A 3CDBA 1DQ8A 3RR8A 5KFYA 4KHPJ 5DGAA 2QFIA 2E7XA 2FVCA 2QGFB 4FYXB 1YBAA 4Z2XA 2Q1LA 1NMEB 2X51A 2ZH1A 2WB1D 1XR6A 2A1BA 5CD4H 3IA0A 4ZN3A 4XPEA 4CLSA 5EWFA 4DR3J 4YR0A 3G6YA 3EPGA 1FFGB 4EUVA 5B0EA 4HDGA 2ZE2B 1IBCB 3QWUA 3CT9A 3HHEA 3M2RA 3CJQA 3VVUA 5HJYA 2F65A 4CLLA 2DITA 2OMLA 2ZH8A 1SJ1A 1MU2B 4F2SA 3OL6A 4WFYA 3HVRA 4AL6A 1M90T 3ZZYA 3QNWB 4HACB 2JHEA 1VBZA 5IV4A 5L8RC 4W90B 4B3OB 1GXTA 3I96A 5K8NA 2V34A 2GJFA 3Q2SC 3QRQA 4IRDA 4YFUA 2QLJB 2CPYA 1RWUA 3DLBA 2J76E 1PO6A 3V4IA 1U02A 1N54B 3A8IA 4DQQA 1XERA 3VV2B 2CJBA 2ABYA 1D8YA 3SDEA 2E7WA 1Y10A 1XTZA 2HFSA 2R7QA 3THPA 4U6PA 3T5KA 4P7TA 2VBXA 2HGLA 5D4LA 4B3RF 4CT9A 5JVHQ 3L7PA 2XY5A 1K0VA 4M5GA 3S7RA 1R0AA 5H1SV 3VR1A 3MAAB 4QIEA 5KFBA 1N52B 1U26A 3DDNA 4Q0BA 2V0NA 1P1LA 2WVBA 4P7VA 1NM2A 2GAGC 4DL4A 4WTYA 2PGCA 4PR6A 3ZNUA 1OSDA 1HNVA 2LEPA 2MQNA 3Q0AA 5IM0B 3H25A 5CA5A 3V6KA 3VQSA 1XNQF 2NUUG 1U0SA 3P6YC 4NZ7A 4TU9A 5SUHA 1F6TA 4NLQA 1XMOJ 2FLOA 4QR2A 2FLLA 1TV6B 5D3GA 5CYMA 2J0WA 3K8WA 3K5MA 4ZVHA 3OXLA 5ETMA 2V68A 1JIHA 3W1YC 3POTB 4QOTA 5F9NA 4NA3A 1CG2A 2QL9B 2M4MA 5C5JA 1U6FA 5CQGA 3VAKA 2Y8YA 3K17A 4FS1A 2VPWB 1KWMA 2HRTA 3N6MA 1M1GA 1WORA 5GMDA 2MY8A 3CXCR 4FXDA 3LGHA 4EU0A 1HMVB 4DR5F 2Y0SD 1LWXA 4K4TA 1YVFA 3DLGB 1YG0A 2GHWA 4R8UB 1CJTB 2CYYA 3VGSA 1JXLA 3K5NA 3HHLC 3Q8QB 4DF4A 2V67A 2X1AA 4YS2A 5KFFA 3K8VA 2F1FA 4JV5J 1YKWA 2JEIA 2K7KA 4LRCA 4Q44A 2CQPA 3MZIA 2VOOA 4K2XA 1JLBA 1T03A 2B5JA 2YNFB 4RWXA 4A8XA 2CJ9A 5CCLA 1VJQA 4C9DA 3DLHA 3PCOB 1UL3A 1SKSA 3HJFA 3C6UA 4RL1A 3PJXA 1Q16B 4R25A 1NBEB 4DEZA 2DPJA 1B70B 2DNOA 2BOPA 3T1YF 1FE0A 4ZJLA 1EP4A 3R5DA 1DRZA 2CJXB 1RAFB 3KYLA 4J9KA 1NJZA 5L38A 2P2CB 2J9DA 3IWLA 1JKHB 3CCLS 2OEJA 3JQKA 1JWWA 3JB9k 3RU0A 1CC7A 4LIRA 2FHJA 1YJ7A 2V50A 2HMIA 4F7VA 4O3QA 2P9CA 2VF3A 3J80Y 4LMZA 4FYVB 2BBEA 3D3CJ 2C3YA 3PO5A 4U7UK 4NXMF 4UY8T 3HD2A 4Q8EA 2LQ5A 1HYSB 1T7PA 4YHHF 1F1BB 5F8HA 3QPIA 4FF3A 4C8MA 1R6YA 3C6TA 3N5BA 3HT0A 3ZZZA 4USIA 2FZGB 2ZUGA 4MK8A 1KONA 1BXNA 2XLIA 2AP6A 1KC8T 3BBCA 2AT1B 1GXUA 2CIMA 1FJCA 2UUBF 3UO0A 3VGVA 1PJ6A 3AD9C 2BQRA 4ELUA 4DMZA 2R9LA 4A46A 2DNQA 1EKSA 3GCXP 4IG0B 2MSSA 1OYDA 4Q45A 3QAUA 1HNIA 4ZVSB 1CJUB 1S1XA 1JX4A 4DDFA 1QVFR 1TKXA 4LREA 3GPAA 4RW8B 2Z30B 3V81B 1HHTP 2YKOA 3CCVS 4IQMA 3CE8A 3L95X 4EBEA 3T5LA 4HYKA 4F02A 2XLJA 2CQ2A 2CNKB 3FDSA 1WC6A 3CJ8A 1REVA 1XMQF 1X4BA 4HT5A 2VDIA 6FD1A 3KK2A 3M32B 2DNKA 2AIRB 2ZZTA 8RUCA 1Y4ZB 3A3NB 1XNQJ 1RKJA 4NRTA 1T3OA 4I2QA 3WC2A 3Q89A 2OFGX 2PD1A 1VQOS 1D3WA 1OY9A 3KK3A 2HKEA 3VZHA 3GYGA 1VGYA 2Z8QA 3DRRA 1RABB 2GV1A 2H51B 1MWYA 5DZ7A 3KXDA 1FRJA 2WB4A 4RPFA 2ZBIA 3LAKA 1WACA 2G2YA 3FQKA 2XY7A 2QL5B 3OL7A 2KZMA 3TA0A 1M1HA 2RDDA 3BQ2A 1U1QA 1KFDA 3H2UB 1B0PA 1RBAA 4JUZA 3N01A 3T9NA 1U1NA 3JAMY 3BSAA 1IBLF 4URSA 4WJBA 4MK9A 3W2VB 1Z4UA 2WONB 3NY0A 1X4EA 1RAEB 3TEHB 3WX4A 3PFOA 4WKRA 1BC6A 2BACA 2WTFA 1KS2A 5LMNJ 1FFWB 1S9GB 2HBZB 2RDIA 3SBMA 3CGIA 4KC5A 3HFVA 3N5FA 1C1BB 4MIAA 3MEDA 1ICEB 3OTOF 3GIRA 4M5NA 4LSLB 2MZRA 4YDXA 4B3SF 4CH7A 4DI6A 1S57A 2HBRB 5C42B 3VAGA 1L3KA 3BH7B 2YX1A 2IRUA 4QBUA 4DR4J 1QJHA 4UOGA 4LF6J 3CD6S 3DU5A 1VK8A 7FD1A 2OPPB 1NSQA 4RW7A 3PX4A 4BWJA 4JI1J 3LO3A 1LW2A 2RT3A 4QU7A 1IKVB 3RBZA 3HSDA 1VRTB 3OFHA 4OYAA 5DLGA 3N4WA 4UY85 3D6TB 4G1IA 3HVWA 4U95A 1VJWA 4JV2A 3J81Y 3CJKB 4ZPBA 4F4ZA 1RHQB 1Y7PA 2HYIB 4NEYA 5DQGA 2ZE2A 2Z58B 2JEGA 4C97A 1RACB 4RNNA 4QR1A 3OFEA 3EDQB 3HVAA 3TZXA 2RQMA 2ALZA 2C2ZB 1VRQC 2IYGA 3FVYA 2IIHA 4A4JA 3CJ3A 4UOFA 1UW9A 3UVJB 2Z56B 4UOHA 4YHHJ 1Q8IA 4LF8J 3BR8A 8ATCB 4HACA 1JJCB 4B3OA 2GIRA 1U45A 3OJUA 2UXBJ 4ZVOB 2PDAA 3ITHA 4OYOA 3K59A 1FTRA 1SL1A 2EFPA 3NP5A 1RHMB 1RWWB 2B9XA 5EX0A 2AJ2A 3GG0A 1TL1B 1ITPA 2VFSA 5K8MA 2CQHA 2NR0A 2G2ZA 2MKHA 3W9HA 3W65A 3DCAA 2VOPA 1Q4RA 2MZQA 4EO8A 3HVTB 2KFYA 3PG9A 5E41A 5GAEI 1R7IA 2A6MA 5FLXY 3OTEA 4IFVB 3MAAA 1RWNB 5EN1A 5LL6d 4JI4J 2ZNYA 3CIZA 1Q5YA 3N9UC 4DL0C 5IZHA 5C25B 1JJHA 3E2EA 4J90A 1WELA 2DNHA 4ZCLA 5ETKA 3M6UA 2FHKA 2R7RA 1MMNA 5IM0A 2UUAJ 4KPYA 1U8WA 1X0PA 2AJ0A 2W9BB 2CAJA 1TR0A 1M5OC 2VA2A 4A8OA 4W92B 4F8RA 4IOCQ 4F67A 3OTCA 4MIWA 2ZKUA 4AL7A 3CW2C 4NCGA 2UVVA 4H4KC 1JJ2R 2OSQA 1BQMB 2MQOA 2ROPA 1RWOB 5F9LA 2UXCF 3POTA 3MEGB 3ETMA 4OMFG 4X4QA 4ES1A 1SC1B 2HHHJ 4ECWA 3NGSA 3HO1A 2W1BA 3M9MB 5GAHI 3M2UB 4K0KJ 4E8UA 2DR5A 1HR0J 4WU3A 2H5EA 2ACYA 4DWIA 3JS9A 3WBZA 4LBIA 1HMVA 3KLHB 3BREA 3UPFA 2BJ3A 3DLGA 3NS6A 3I5BA 3TEGA 3CCQS 4WIQA 1UFLA 3C66A 4R8UA 3PXGa 1CJTA 3I5CA 2C28A 2BKPA 3CCTA 2H48B 1HPZB 1GX6A 2L9WA 4NA2A 1WEZA 2GQQA 2ZHOA 4CLYA 3QZ8A 2DIUA 2DGXA 2XWYA 2P6SA 4CRJA 4ETXA 2DT9A 5HLFB 2RS2A 1RTZA 2YNFA 2BYCA 1HWJA 2XMVA 3GG1A 3IO1A 1S76D 1G2EA 3DLLQ 1SH0A 1U2FA 1N33J 1S4FA 1MN9A 3IMQJ 2J7UA 3HM9A 5LT5A 1CC8A 3AFGA 4NMLA 1RU2A 2PEHA 5J2NB 4DSEA 2DH7A 3ILJA 4DS4A 1B99A 2LECA 1GK8A 1ZTTA 2QSFA 3IC1A 4KQZA 4CH1A 3TNVA 1XNRF 3DU6A 4C8LA 1JKHA 1N34F 2UVRA 4MYUA 3M8QB 3FCWA 2E29A 1GXLA 2DCUB 1RWXB 1TL5A 2DXDA 3BQ0A 2OP5A 2PA8D 4DR7F 4C8ZA 2CJQA 1NRKA 3OVBA 2YKPA 3MM6B 3MUVP 1VQKS 2QC3A 5LXRA 4ZCMA 2BE2B 4FF1A 4CM2A 4QWAA 2NZ4A 3MR2A 1FFSB 4ED5A 2IJNA 1FJGF 5D0HA 3W62A 1X5OA 1HYSA 4ZP9A 2HHWA 1S6PB 1DURA 5K14B 3MR5A 3FBEA 3U1NA 1K1SA 4C8OA 4B9LA 3FCVA 2EXUA 2DRAA 1URNA 4GKKJ 3LH2S 6AT1B 3HHNB 2GFFA 2E5HA 1S5ZA 4KGVB 1ACMB 3HLUA 3BBBA 1RBOB 5HVGA 5HBMA 4RW4B 2RQ4A 1WOOA 1TUGB 4IR1A 1WHVA 2MHNA 3BZQA 4ALZA 3SMZA 2RU9A 4DXLA 1CJUA 4ZCIA 1X4HA 3MMBB 1UA1A 4MMOA 4NLSA 1NU4A 2JEJA 3ZZUA 3MTJA 4JOUA 4DV0F 4B08A 4RW8A 3V81A 1ZBTA 5JUMA 2NXUA 1RSCA 4WIIA 3NOGA 1FD2A 4PXBA 2LA4A 1VK3A 2RQKA 4A8SA 4ZLJA 5GMEA 3Q8UA 1DBDA 3BEGB 2LU2A 1ULRA 1BMQB 3PIOQ 3BPSP 2FJBB 1Y9OA 3CCWA 4RW6A 2I2YA 3M32A 1RAOA 4CLFA 1PAEX 1L5UA 3OV7A 1F5CA 4YQWA 5KG3A 2F7VA 3P49B 2ZKTA 5C24B 2W8LA 4P73A 3VVTA 2AGQA 5JVGQ 4HI1A 1WSVA 2ZNZA 2G1DA 1KD1T 1NPRA 1DY3A 4BWMA 1L3SA 2EFNA 2J9EA 5F41A 4DJBA 2DBBA 5HO4A 4QU6A 1VDHA 2U1AA 2Y1LB 1S0OA 4N77A 4PZVA 1T95A 2IM2A 2RS8A 2R7WA 4B9TA 1UVLA 1HI1A 4A48A 4RW9B 3RGIA 3L7UA 1SXLA 1V3RA 1X7VA 3EZUA 5KFQA 1UCNA 2IJFA 3PVXA 3FRYA 2GGPB 2YNHA 2WOMB 1TK0A 4DV3J 1KVIA 1SQFA 3G6ES 3W2WB 1HIYA 2PIIA 5DDRC 4TQSA 2FJVA 4AT1B 5KFNA 3QGPA 4IR9A 5CYQA 3KJVB 1X0FA 4M5DA 3J7YI 2VQFJ 1YGYA 4U8VA 2WONA 3DRYA 3B82A 2PMHA 2GJ2A 4HTJA 1DQAA 5F0UA 1R3NA 3EUNA 4LR9A 5KG7A 3SCKE 4X84A 2UUCF 4I67A 1FK9B 1MNEA 2HPUA 2ALYB 2CPEA 2RHQB 2MZSA 5KFEA 1S9GA 2NREA 2MJUA 1TMMA 4WPAA 1RTHB 1NK7A 4X4TA 1IWAA 4DFJA 2AGOA 3WDOA 5E3PA 1NKBA 2HHVA 2FJXA 1C1BA 1EJ7L 3IRXA 4MJKA 3QGHA 2AV5A 2J6UA 2XZDB 5C42A 2V94A 3CCZA 1O51A 3NGDA 3G2XA 2VHGA 4U67Q 4O4GB 2OPPA 3ZZ0A 1R89A 2VFVA 2AYEA 2FZKB 1EZZB 4DL2A 3UNGC 1VRTA 3QT6A 2GA7A 3HHKA 2DH8A 4ECUA 5AXMA 2MQPA 1KOOA 3QZ7A 3D0HE 5IWAF 3CJKA 1AA1B 4B3MF 2VBYA 1FA0A 2E1CA 3FQLA 1T9TA 4CLUA 3AJ2A 2YH1A 1WF1A 2A2CA 1KHVA 2I38A 4B9NA 4WE1B 2E9ZA 4LT6A 5E3RA 2IC3B 1FD8A 2IMWP 4DQSA 1RYRA 1S49A 4P74A 5E3QA 2KN4A 4KBIA 3UVJA 2DNYA 4DV4F 5C2GA 3VQTA 2BJ9A 1RU1A 3KJFB 4QIGA 3MI7X 3GILA 3RUBL 3KG0A 5CD4A 1RT5B 2QFJA 1RJJA 1I51B 5LMUJ 3B8HA 4KO0B 3GSDA 4KHRA 4YMEA 2ZDOA 5F8LA 4F25A 1AZSA 2XM3A 1TMJA 3ILOA 1Q53A 3GR0A 3ISND 1HW9A 2HHSA 3CMES 4EWTA 3PEHA 1UWBB 3WQPA 1KP6A 4DS5A 3ZTPA 4F4KA 3D68A 4DSKA 4OJHA 4LBHA 2HQ3A 3KLEB 1C2PA 4CDIA 4IFVA 4DV2J 3ELHA 5DDPC 4ID8A 4X4OA 1CLFA 4RNOA 2LDIA 4DV1J 1NSKL 1T9YA 1OSCA 5C25A 2PC6A 2ZOMA 4ATNA 3AT1B 4TQRA 4NYOA 1S77D 2ZJRQ 5DM6Q 1JXEA 2K1RB 4WYWA 2QLBB 2VQEF 3I9ZA 4JI7F 2B4VA 1H2UX 1EQMA 2RRAA 4LF7F 3IR5B 3F41A 4I7FA 4DV7F 2W24A 1S1WB 1W2IA 4BS2A 2XEXA 2XMMA 3MD3A 2I8EA 2QN6B 2G9OA 4NXNF 1AROP 4ZP8A 1VC0A 2D3UA 4OX9F 3OFGA 1HWKA 2AMCB 3QIPB 2R8JA 3M8RA 1WTBA 4OHVA 2XMJA 3MEGA 2D69A 3KNGA 2KJVA 3TZYA 2EKYA 3MD1A 2PT0A 3CVKA 3T1HF 3OHBA 4JB8B 3NNCA 3M2UA 4FF4A 2DCLA 1VBKA 4DPXA 1WI6A 1VMBA 3H40A 1WOSA 4Y65A 2KM8B 2DB1A 1R6VA 2HURA 2P9GA 4KGMA 4L73A 5HQ8A 3BKTA 5IT9Y 1WHXA 1QSYA 1NJIT 1RHUB 1SI9A 2WRMA 3D4JA 4NL5A 3EDRB 2AW0A 3BO2A 1QTNB 3UDEA 3BYRA 2WVFA 4HR2A 1RTJB 1HPZA 4GO7X 4X64F 1S6OA 5J2QB 1HKAA 3W5YA 2MTLA 1HFEL 4TU8A 2DKOB 4F36A 3EICA 5HLFA 1FKOB 5BR8J 1FT8A 1N0UA 2R2UA 5DG7A 2ZD1B 3Q83A 4R0JA 3AJDA 2KO1A 3TW0A 4WCEQ 3H5SA 2BXJA 4C4WA 2Y1RI 3UN2A 1S99A 4JYAF 1SL0A 3MCOA 3MR6A 4Q8FA 1FJEB 5EHHA 3B54A 1SH2A 2VC0A 5J2NA 1D9AA 3GP9A 3UCZP 1F3FA 2OTJS 1NPPA 2VG7B 4Y2KA 2XHCA 4KH1B 2GVDA 4KRWA 4YDDB 1YWXA 4O4RA 5AE1A 2PN6A 1GFWB 2XI3A 1K9MT 3M8QA 2XC9A 3P45B 2CQ1A 2ZITA 2ZWPA 4IG3B 1KN6A 2HQIA 3TAMB 3ET6A 4DPYA 1NK9A 1CPZA 1YRXA 2RKIB 5IWAJ 4JBCA 3KMSA 3K7RA 2W7OA 1OQ6A 1U1MA 2BE2A 1K0TA 3SYZA 1FNXH 2CPXA 4L6V3 2ZBQA 2NXEA 2N3OA 2K8GA 1BUXA 5DLFA 4ZKAA 3OJSA 1RA6A 4C3KA 1S6PA 2A18A 5K14A 1VQPS 3H0PA 1KQSR 1IBKF 1L3UA 2NXCA 3VAMA 3BDPA 3J81j 2YKNB 1YJUA 4B9UA 3KLGB 4PQUB 1CEZA 2LVWA 3BGFA 3KDOA 4DPUA 1CJVA 2M9KA 2IM1A 3NWGA 4NASA 4LQ9A 5B0AA 2C2EA 1SC4B 2QX0A 5HQMA 2NSCA 4UW2A 3LP1A 3R7SB 3ISZA 1XR7A 2DTJA 3HSGA 2CWXA 2WHOA 4RW4A 1C1CA 3UR3C 2BOAA 2VBZA 2X3DA 4EZ6A 2R2TA 4QIWD 2ZHAA 3NGKA 3MMBA 1SKUB 4NYZA 4OZJA 4U9RA 4CNYA 4RNMA 3CSKA 2RD5C 1TQLA 4AQYJ 2DGWA 4L72B 2L9DA 5DG9A 1FRIA 3D1HA 3VAFA 1RT1B 1VRUB 2R42A 1UJ6A 3OTBA 3LW5C 3L7OA 2Q3PA 3CJ5A 4LQ3A 2Z57B 1P27B 2N4CA 5C24A 1FXRA 2WBMA 1U2RA 3OVAA 5AE2A 3R2DJ 2HWIA 4MFBA 4M94A 5T7LB 2DXEA 2QLWA 3H2VE 1TUVA 1YRUA 5L1KA 3C15B 1LNQA 2R3VA 3LANA 3P5BP 3C16A 5HMZA 1IJEB 2IAJB 2ZFHA 4RLEA
chains in the Genus database with same CATH topology
3CCRS 3C6TB 3G96A 1CQNA 1WG1A 1PILA 3FZBA 2E5GA 2WOMA 1Z1ZA 1LFPA 3H59A 2K7KA 3IS9B 2JEIA 2DD8S 2HNYA 2D3OR 1FVSA 1TFWA 2M52A 5KG5A 2ZH4A 3Q24A 4Q44A 2CQPA 3MZIA 3W2WA 1K8AT 2VOOA 4K2XA 4I6AA 3H8YA 3MPYA 3F73A 1JLBA 1UEUA 3MMCB 2ADBA 3RW7A 1T03A 2B5JA 4K4UA 2YNFB 4RWXA 4A8XA 4NLYA 2JL9A 3DLEB 3KJVA 2HFNA 3K5OA 2CJ9A 1DTQB 1X4FA 3NRBA 5CCLA 4XIUA 2IRYA 3I32A 1Z2ZA 3RZAA 3PW7A 1YJVA 4C9DA 4X4NA 2B4OA 4WKYA 3RAQA 5KFJA 3RB3A 3QO9B 3DLHA 3KLFA 4FYDA 4GC6A 2VONA 2KB2A 1UL3A 1SKSA 1VQLS 5THWA 1AXQA 3HJFA 3C6UA 3NLCA 3PJXA 1Q16B 4R25A 1H7XA 4KV8A 3CO9A 1KLNA 1CSJA 3NCPA 1FDAA 4DEZA 3AQPA 2IA0A 2R8GA 3VAHA 1FK9A 2QSWA 5KT4A 2XGQA 1QAYA 2DPJA 1AFIA 2ROGA 5KFVA 5T14A 1TV6A 2DNOA 4X4SA 2BOPA 5KFGA 1GNKA 2YKMB 2OMOA 3T1YF 2PI4A 3DM2B 1FE0A 5F8GA 1EP4A 3QMQA 4MK7A 3R5DA 4IOAQ 1DRZA 1FDDA 2MZJA 3IGVA 5U47A 2MGZB 3KYLA 1BLUA 1NJXA 4J9KA 1RTHA 1NJZA 2FVQA 2XLKA 3M8PB 3RTVA 3T19A 3QAEA 1N6QA 3BM7A 2E1MC 2UVUA 3DC2A 5L38A 2J9DA 3IWLA 2ZM6F 2XNRA 1JKHB 3CCLS 1WWHA 3I4PA 2AYGA 4ED1A 2OD6A 4DL6A 1KVJA 1JWWA 2FTRA 1FXDA 3JB9k 1LWCB 5E5NA 4FNHA 1REVB 1HHSA 1VQ9S 5KFXA 5GADU 1NK6A 1LK5A 3M2VB 2QV6A 1FNOA 3ZFVA 4ED7A 3H5YA 3RU0A 1CC7A 3R1HA 2KRRA 1R27B 2M0GB 3MWBA 2K3KA 4LIRA 2R7SA 3AA9A 1MSWD 2FHJA 3KLIA 2FLNA 3DDKA 2HMIA 2OH2A 1URRA 4O4GA 4O3QA 2P9CA 2DNPA 1ZTWA 2O1PA 3UCUP 3J80Y 1X4AA 4LMZA 3OLAA 3E01B 2BBEA 4LVOP 2I9SA 3KHLA 3PRDA 2L41A 1FO1A 1FRKA 1RI7A 1ROFA 2CPFA 3O6QA 3IXQA 1DQ9A 2C3YA 4U7UK 2RB7A 3QWPA 1U1KA 3PO5A 3OL9A 4NXMF 3OBIA 4UY8T 3M6WA 4PXCA 4Q8EA 2LQ5A 2IHR1 3P5TL 1HYSB 2JH3A 1T7PA 2GCFA 1GT8A 4YHHF 2LCWA 5F8HA 1S6UA 2VZ9A 4PXEA 4OLOA 2UP1A 1MROB 1SUQB 5EUHA 3QPIA 4Y28C 4CO5A 3OVSA 2ZH9A 1FVQA 4FF3A 4WXWA 4C8MA 1M1KT 2AX1A 1R6YA 3C6TA 3DFEA 1N4LA 3N5BA 1NJYA 4Q7AA 1SB6A 4YUDA 3ZZZA 4USIA 2ZUGA 4MK8A 2Y1IA 1KONA 2M70A 1ZAWA 5A0YA 1S79A 7FDRA 2BANB 2FPHX 2ZVSA 1VQ4S 2XLIA 1XC9A 2AP6A 2FUG9 2R2RA 1KC8T 4Y2CA 1FHTA 3GIIA 1M0SA 4F3MA 5HMXA 2QT7A 2RDJA 2A10A 4PKDB 1PC4A 3AQOA 3HP6A 2YKAA 1LOUA 2Z2LA 5DJBA 5J1NA 3PIPQ 1GXUA 2CIMA 1FJCA 2UUBF 1T8EA 2ERRA 1JLQB 1TAUA 2RRNA 3GE9A 3MM7B 4ILLA 1DJ0A 2YWKA 1CVJA 4DF8A 4USHA 2UVWA 2XZWA 4WE1A 4ILMA 2BQRA 1JLCB 3S1TA 4ELUA 2HFZA 2ZH3A 3DOMA 4DMZA 2R9LA 5G0RB 4A46A 4NLGA 3MM5B 3CDEA 2ZZMA 2IC3A 2MPUA 5IXUA 4PWDA 5A2QY 2DNQA 2DO0A 2YWEA 4CI0B 4CO4A 4OHZA 4A8KA 3GFZA 4IG0B 2MSSA 4GMKA 4Y6IA 2J0XA 4KFBA 2BA9A 4Q45A 3RBEA 3TQ1A 1UVMA 4I68A 1KLMA 3HI9A 3QAUA 3R3TA 4HHJA 3T5JA 3P96A 3CMAS 4OZNA 2Z0GA 1HNIA 2D1CA 2V4RA 2AD9A 4JV5F 1BQNB 1S1XA 1JX4A 2XCPA 4DDFA 3MGJA 3I56S 3DM2A 1RT3B 3I6PA 2LDYA 4N8NA 1F5BA 4RX6A 3GIKA 4ZLPA 3BSNA 2BQ3A 1QVFR 1TKXA 2YVSA 2CRLA 1ZPVA 5KFHA 3OUYB 4NLDA 4WU2A 4RW8B 3PW4A 3OPKA 1RT5A 2HNZA 3M8PA 3V81B 4MAKA 5DGBA 2YKOA 3CCSS 1HHTP 2XS2A 1LW0A 3CCVS 3HX9A 4TN2A 1X9MA 2EK6A 3FJ2A 2BVZA 4IQMA 5D4PA 1SC6A 2Z4PA 4J9QA 3FEZA 1FRHA 5I3PA 4C8KA 1HWLA 3CE8A 3DYAA 3AB4B 3L95X 1N5YB 4EBEA 3IAS9 3T5LA 3OR2B 3OR1B 5AXLA 4HYKA 3MEEB 2XLJA 4F02A 4J9OA 3CD5A 3CD0A 2CQ2A 5KFRA 2CQGA 2DGVA 3FDSA 5F8IA 2ZH2A 4RWWA 1YJNS 1REVA 1XMQF 1X4BA 5K8OA 2FB0A 2L3MA 4HT5A 4AYBD 1HBNB 4F4YA 6FD1A 3KK2A 3O1LA 3M32B 3JSRA 4G1QA 3EGWB 3QGIA 1HNWF 2DNKA 4J9PA 3K57A 4YR2A 1VC6A 1O0PA 1Y4ZB 4DQPA 4X66F 4ZHRB 2GC8A 1RKJA 4NRTA 1T3OA 4K50A 4YOEA 3BF4A 4H4MA 2RSQA 2VC1A 1T94A 4I2QA 3WC2A 2OFGX 1Y0HA 2PD1A 1VQOS 1S10A 2HG4A 1D3WA 3I0RB 3H2LA 3JTNA 5J1PA 4J5OA 4I0WA 3OXFA 1AW0A 1JB0C 3TP2A 3KK3A 1VQMS 3VZHA 4NCBA 3N6LA 1VGYA 2Z8QA 2C22A 3DRRA 2I1RA 2D9PA 4Y2AA 2GV1A 1H98A 1MWYA 1DTTA 3H5XA 1LW2B 2SXLA 1TP7A 2KTQA 3VALA 4Q5VA 1FRJA 2DK2A 2WB4A 4NLTA 4O3OA 3AJ1A 5E2QA 4JI2F 2ZBIA 3MMJA 3LAKA 4X4RA 3QLHB 1PGZA 2EBEA 4X62F 1GX5A 1IKXB 2IYIA 4LFBF 1SV5B 1WACA 5KFDA 2AU0A 1WF2A 3FQKA 2ASDA 2XY7A 3VTIA 1S6QB 4LJMA 3OL7A 5DG8A 5AXNA 2KZMA 2K1RA 1H0HB 3TA0A 4P6QA 3BQ2A 3JSYA 3CDAA 4OZ1A 2W4DA 1U1QA 1KFDA 5KAKA 4UQGA 2FJWA 3H2UB 1A7GE 1B0PA 4JUZA 3N01A 3T9NA 1OPIA 2X3GA 2KG0A 2EC0A 4RBUA 4F3OA 4ZDNA 3KNAA 1U1NA 3MFHA 3D0IE 2E44A 5BYSA 1K73T 4QJVA 4OIXA 4CH0S 2VH7A 2BUNA 3JAMY 4OHXA 4OFZA 3SSRA 3K58A 3D0GE 3DLJA 5HP1B 4PUOB 4E0DA 3BSAA 4QWDA 1IBLF 3MM5A 2FDNA 1QM9A 4URSA 3LP0A 4WJBA 3CJ2A 1VOMA 4MK9A 4WK3A 2M88A 2MHEA 5DS7A 4TY8B 1U49A 3W2VB 3QIPA 3DOKA 2GMHA 3PM9A 1S1TB 1Z4UA 1KQKA 3MXHP 2WONB 3E8OA 3E3XA 3T1AA 4IG0A 4B9MA 4C11B 1FESA 2IBOA 2CVIA 1JLAB 3M1VB 2IM0A 2QA4G 4YB6A 1X4EA 3M8SA 2MZTA 4NPOA 4DFMA 4A8MP 1LWEB 4KKOB 2O66A 3WX4A 2DNMA 4WFAQ 1BQNA 3GIJA 2E1RA 3PFOA 2EBGA 4Y2MA 1Z2LA 2BACA 4WKRA 1L3TA 1BC6A 1U24A 5I42A 4ID5B 5LXYA 3KHHA 3TA2A 2DHSA 2QYCA 5A8WA 2VFTA 2VG5A 3HT3A 2WTFA 1KS2A 2KKHA 1B64A 3OUYA 2J9DE 2V9WA 1WTFA 3OSNA 1SJ4P 1JNZB 3IR7B 4KE5A 5BYQA 3MFIA