1U1RA

Crystal structure of up1 complexed with d(ttagggttag(2pr)g); a human telomeric repeat containing 2-aminopurine
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
183
structure length
183
Chain Sequence
KEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein/dna
molecule keywords 5'-D(*TP*AP*GP*GP*GP*TP*TP*AP*GP*(2PR)P*G)-3'
publication title Human UP1 as a Model for Understanding Purine Recognition in the Family of Proteins Containing the RNA Recognition Motif (RRM).
pubmed doi rcsb
source organism Homo sapiens
total genus 51
structure length 183
sequence length 183
ec nomenclature
pdb deposition date 2004-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1u1rA01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1u1rA02
1U1RA 4Y00A 2DNZA 2MGZB 3B4MA 5IFMA 3G4SS 1M5KC 1P1TA 1Q7YT 2MB0B 3MURP 1VQNS 2YH0A 1YI2S 1X5TA 2MSSA 2QEXS 2OSQA 3CCQS 1FHTA 1YHQS 4IUFA 2JVRA 3IWNC 2YTCA 3NS6A 1VQ7S 4M5DB 3RW7A 1DHMA 1H2TZ 1XN9A 3U1MA 5GAHU 2ZJQQ 2DB1A 3S6EA 1OO0B 3BO4A 2XNRA 2LECA 2DO4A 2MKKA 3SXLA 2MZJA 5ITHA 2DNGA 1VBXA 3HHNB 1L3KA 5IM0B 2LXUA 5GAGU 2KT5A 1M5VC 1DZ5A 2RS2A 4YB1P 4LJMA 4OZ1A 2XS2A 1SJFA 2X1FA 2HGNA 1X4CA 1X4GA 3SMZA 2DNMA 3MD1A 5H1SV 3CXCR 1M90T 3CMES 1QM9A 3MUTP 2KI2A 4V19X 3G8TA 5GADU 2KRRA 5HO4A 4F02A 3Q2SC 1WG1A 3UCGA 2X1GA 4F26A 1H6KX 2CPXA 2VODA 2CQ1A 3UD3P 1FJCA 5LJ3Y 5LSOA 2AYEA 4F25A 1HL6A 4RU2A 1PGZA 2MQNA 3CC4S 4C0OC 2FHOB 3VF0B 3B4DA 2RU3A 1WEYA 2ERRA 3IRWP 1W2BR 1HD1A 2MXYA 2M70A 3BS9A 4CH1A 3EGNA 2A3JA 2RRBA 2KG1A 4OZ0A 2DNRA 1U6FA 3G96A 2N3OA 2AYBA 1WF1A 2M52A 4TU8A 3LPYA 1WTBA 2DNYA 2ZJPQ 4LIRA 4CIOA 5FJ4A 2KYXA 2DIUA 5LXYA 1KD1T 2DGOA 2FC9A 1X4EA 2HGMA 3HI9A 2KG0A 3ULHA 1G2EA 4YOEA 2CPEA 2YKAA 3VAJA 1RK8A 1UFWA 1VC0A 1U2FA 2MZRA 4WIIA 4UY8T 2X1BA 2MPUA 1WF0A 3R1LA 1U1LA 3S7RA 1M1KT 1N88A 1S72S 1SJRA 2F3JA 5DM7Q 1VQLS 1U1MA 2DISA 2EVZA 5DDQC 1JJHA 2XNQA 1FJEB 3CTRA 3CD6S 2E44A 3K0JA 2E5HA 4PR6A 2N82B 1AUDA 2RNEA 5LJ5Y 3CCRS 2F9DA 2MJUA 2QA4S 3US5A 2GO9A 5GVQA 2OSRA 3PIPQ 3NNAA 1WELA 5BJRA 1VQKS 2JX2A 1YJWS 2DGTA 2K8GA 3UD4P 3CCSS 2L08A 2XS5A 2RUGA 1N52B 3J7YU 4IOAQ 1IQTA 2N7CA 2MZ1A 3MXHP 4WCEQ 2OJ3A 1WHWA 2CPZA 2J0QD 2DHXA 2D9OA 4WFBQ 2QFJA 4ED5A 4YUDA 2M0GB 2DNNA 3ZZZA 3UE2A 2CQ3A 2MQMA 2RS8A 1F9FA 3BO2A 2EK6A 3CCMS 1WEZA 2WBRA 4BS2A 1H2UX 2MQOA 1X4HA 1R8PA 2CQIA 1FT8A 2LA4A 1X0FA 1SJ3P 1U1OA 1H2VZ 2DNKA 4U67Q 3VAIA 3EGZA 1M5PC 1SJ4P 2CPHA 2NZ4A 2XSFA 2ADBA 3EX7B 3G6ES 2XS7A 2ADCA 1QVFR 2KM8C 2DGWA 2KU7A 3SDEA 2UP1A 2AD9A 2NLWA 1NU4A 3CCUS 2F9JA 1YJNS 1OWXA 2KXNB 2RT3A 2U2FA 3VAMA 2M9KA 3MI7X 1K8AT 1X4FA 3BEGB 1U1NA 2MJNA 5CYJA 1VBYA 2RQCA 1X5SA 1UP1A 2HVZA 2CQPA 2VOOA 2RRAA 3CC7S 2CJKA 2DH7A 2LYVA 4W90B 3THPA 5JVHQ 1VC6A 2B0GA 2D3OR 2LMIA 3BO3A 1WEXA 1N8RT 2OTLS 4W92B 2HGLA 2N3LA 2JRSA 3I56S 1WHXA 4PKDB 4WFNQ 3TP2A 4IO9Q 5DM6Q 2YWKA 3N9UC 4A8XA 2HYIB 1OIAA 5DETA 3S8SA 5CXTA 4CQ1A 2MZTA 5GAEU 2HZCA 1PO6A 2SXLA 2OIHA 2CPDA 2E5IA 2MQLA 1VQMS 1WI6A 2KXFA 3I55S 1DRZA 2DNPA 2L9WA 2MGZA 2L41A 1HD0A 4WFAQ 1K9MT 3U1LA 3CCES 1U1KA 1M5OC 1X5PA 4TU9A 3MDFA 1DBDA 1WHYA 1JMTA 4UQTA 2YH1A 3CCJS 1SJQA 4Z2XA 2CQ4A 2LA6A 3R1HA 1YTYA 3NS5A 3DLLQ 2LEAA 5D78A 4TU7A 3MD3A 3UWTA 2G4BA 2M7SA 1JJ4A 1R8HA 1VQ6S 2G0CA 3OW2R 2DO0A 5IM0A 2KM8B 4ERDA 3L3CA 1U1PA 4P6QA 2BOPA 2PEHA 2DNHA 2KN4A 1CVJA 3S01A 2VOPA 3NMRA 4C4WA 1Q82T 2KXHA 4QU6A 1FNXH 1X4BA 2MKSA 2J8AA 4QQBA 1X5OA 2CQHA 2DNQA 4FXWA 3VAHA 2CQDA 3H2VE 5LXRA 1WF2A 1VQOS 5JVGQ 2E5JA 2J76E 2I2YA 5IQQA 3P49B 2MKHA 2MY8A 1VQPS 3G8SA 2RQ4A 2U1AA 2RVJA 3CF5Q 1U1QA 3P5TL 5GMKa 2O3DA 2DGUA 1KQSR 5MLCV 1QVGR 2J0SD 3ZZYA 3Q2TC 2M8HA 3R27A 4IOCQ 2DNOA 2ZJRQ 2FC8A 3H2UB 2MSTA 2BZ2A 5D77A 1ZZNA 2CPJA 2DHSA 1A7GE 2FY1A 2KFYA 3VALA 2LEBA 1D8ZA 4LMZA 1SXLA 2MZQA 1X4DA 1X4AA 1O0PA 3UCZP 2LKZA 1FXLA 2DIVA 4WF9Q 3LQVA 2AYMA 2AYGA 4WKRA 3CC2S 1RKJA 2FPHX 3VAKA 3CPWR 2VONA 1NO8A 3PIOQ 2KH9A 1UAWA 2KHCA 1B7FA 2CQ2A 3FEXB 5EN1A 1KOOA 1K73T 1NJIT 2DITA 2D9PA 2DHAA 2DNLA 3VAFA 4ZKAA 2MKIA 2PE8A 2Q79A 3CCVS 1OPIA 3CULA 3NNCA 2V94A 3FEYB 5DDOC 1VQ5S 5LSLA 1JJ2R 1UW4A 3VAGA 2M8DB 2EK1A 1P27B 2CQCA 3MOJB 5DDPC 3THTA 2JWNA 1A9NB 1VQ4S 3TYTA 4QPTA 2DHGA 3MUMP 2KRBA 2XB2D 1ZZFA 1S79A 1N54B 2I38A 1YWXA 4PRFA 3G9CA 5DDRC 2DGQA 1FJ7A 5HL7Q 2CQ0A 4FXVA 4EGLA 2CPIA 1HA1A 1VC5A 1D9AA 2M88A 2GHPA 4QU7A 2DK2A 5CA5A 2OTJS 3SDEB 2CQBA 1FO1A 1URNA 4Y0FA 2CPFA 1YJ9S 2MY7A 1Q81T 2JVOA 3JB9k 4TLQA 3NNHA 3CUNA 1WHVA 2DH9A 1WG4A 2DGSA 4CH0S 1ZH5A 4J5OA 3TO8A 2MKCA 1YITS 2M4MA 1Q86T 1VQ9S 2LQ5A 2LCWA 2MYFA 3UCUP 2DGVA 2MZSA 3DXBA 2CPYA 3CMAS 3G71S 2CQGA 2E5GA 1YIJS 2G1DA 1WI8A 2MKJA 1VBZA 3P6YC 2LXIA 2M2BA 3P3DA 1BY9A 1KOHA 2MQPA 2DGXA 1WG5A 2K3KA 1KC8T 2KVIA 3D2WA 3J7ZT 2DH8A 2X1AA 3MUVP 3V4MA 3RW6A 2MHNA 2MMYA 3CCLS 1VQ8S 2MQQA 1U6BA 1WWHA 4C7QA
chains in the Genus database with same CATH superfamily
1F60B 5AXMA 2MGZB 2BR0A 1XR7A 1WOSA 4OX8A 4LRCA 4IUFA 5E3CA 2YTCA 3MCNA 4NMLA 4QIWD 3BV8A 4NZ7A 2OD4A 3W8GA 1B99A 3JAMY 2OHDA 2UXCJ 2HGNA 1DTQA 2HFNA 1DQ8A 4PWDB 2L9DA 2YNHB 3HCXA 1I94J 5KOXA 4ZVTB 4ED7A 1Q7LB 1BUXA 4NLWA 2AJ0A 1H6KX 3M8QA 4ZK7M 4QPXA 3KLFB 1GH8A 2XLKA 3FCWA 4G6VB 1SV5B 3HPOA 1AZSA 4ELVA 1U25A 3J81Y 2BKOA 2AGPA 3AB2B 3EMTA 1JLAA 1HWUA 3O5TB 1QLNA 3A3PB 1NK9A 4TQRA 4ZP8A 3B78A 2IRXA 1VDHA 3LWMA 4LIRA 5FJ4A 3JTNA 4NMXA 4CLTA 1M1KT 4N7TA 2VG6B 1X0PA 1KVJA 1ZM9A 4JI4J 2BRLA 3NOCA 4YB7A 1IKXB 5DGAA 4JOUA 1LW2A 3FRZA 4IOAQ 3MXHP 3IMQJ 3OTEA 2OAUA 5BYQA 4CO1A 4DL0C 4HT7A 2IBOA 4JV1A 1WEZA 3BKUA 1JLEB 4H4KC 4CO0A 5HLFA 4F0MA 3E51A 7FD1A 1SJ3P 3FFIA 5CZVA 5KFHA 3G6YA 1D8YA 4Y2AA 1U45A 5K8NA 4WYLA 3LGHA 2DGWA 4P52A 4XO0A 2R7VA 1B4SA 4KSEB 2ZOFA 2V9KA 4UOGA 5D0GA 5B7WA 4KO0B 1Y4ZB 3C16B 2Q43A 4TY9A 1S77D 2GV1A 1NH7A 1WHXA 1UA1A 3MCOA 5DM6Q 4OYXA 4PG4A 1NDCA 2FZGB 1RWMB 4CQ1A 3SI8A 1U26A 2I5JA 1FDBA 2F65A 1JXVA 2ZUAA 2FJBB 4JI0J 2HLTA 3WIVA 4YR3A 1U49A 3NG8A 2GHWA 2YKNA 2VASA 3DM2B 4KTQA 1VRQC 3E01B 1JJ4A 4CO4A 3HD2A 4LQ9A 2A6MA 2Z57B 4X4RA 2PEHA 1TP7A 2IVYA 1SH0A 3NMRA 3CJRA 3W60A 4M1KA 1RAJA 3ONQA 1NB2A 4M5JA 2J8AA 3ENVA 3H2VE 4IFYB 2O3DA 3U27A 2ACYA 4U95A 1VRTB 1ZAWA 3KG0A 3SYZA 2CUYA 3DN9A 3OR2B 2NZCA 5F0WA 1WACA 3C6TB 3H42A 2ABYA 1TL4A 2K1RB 2FJEB 4C11B 3M05A 2Q66A 1WUUA 3PCOB 4RW4B 4ILRA 4IH5A 5IV4A 4OLOA 3KLHA 4KHMA 4LF6J 2R3VA 1CS4A 1F9HA 2IM1A 1U2RA 5HI7A 3OR1B 2WB1D 1VQ5S 1XNRJ 2J0WA 4PG5A 1IXKA 2A2CA 1IM4A 1WC4A 3OFEA 4G1IA 4FYDA 2R8IA 5CZXA 1HNXF 2V9WA 3TRGA 1JLQA 3GFZA 2ZITA 4RW8B 1SQGA 3W1YC 2O01C 1SB6A 3DRXA 2V4QA 3Q23A 2R7OA 4O3PA 2JNJA 1Q4RA 4ZA1A 3DHWC 1LWCB 5AT1B 1JLGA 3PW4A 3KLEB 3D3BJ 3QFWA 4KHRA 2BX6A 1IR0A 2GJIA 3WZ0A 1SC6A 2DGVA 3IGNA 3SCJE 4GC7A 1FTRA 1CJVB 4M5GA 4K4SA 1XMQJ 3NCRA 5GAHI 1BWVA 3MUVP 2CVIA 3T5HA 3PRVA 3UR0A 2CWXA 1S6PA 5E2QA 2BJ8A 3PW0A 2G2OA 3DRPB 4LSNB 2OSQA 3IWNC 2PN6A 5J2MA 4RL1A 4CLLA 3RW7A 2DO4A 3CGIA 5ITHA 3TANA 1S57A 3FVYA 4ZVSB 4DFKA 4X4VA 3OXGA 4RR5A 4IRKA 4USKA 4LJMA 2XS2A 4G3IA 1FWPA 1J5EF 1X4CA 1X4GA 2XYHB 2POKA 2HWIA 4X62J 1Z1ZA 2HHTA 1RTIA 4RUCA 2CFXA 2VU5A 2W7PA 4USTA 2AYEA 4O23A 3VGSA 3K5MA 3Q86A 2OH2A 3QJLA 2V2ZA 3SZ2A 3NGKA 2RU3A 2BDPA 4NLXA 4P2FA 2KG1A 2AT1B 3IS9A 4F50A 3GILA 1GXUA 3IG1A 3S1TA 2AGQA 1OPZA 3NRBA 1X4EA 1X9MA 4JYAJ 1TR0A 1NXIA 2XG8A 3VAJA 4DR4F 2MZRA 5L9NA 2BRKA 2MPUA 1S9GB 4X4SA 3CMQA 1U1MA 4DR1J 2FVCA 1SH2A 3ZFVA 2G0IA 5C42B 4TKTA 1MROA 1CQNA 1V9OA 4PG8A 4C8YA 1E6YB 3BR9A 4NI2A 5EWFA 2ZVSA 3K2YA 1SL1A 2MZ1A 3QRQA 1SIZA 2H5IB 4MAKA 3SQGA 5KFGA 2WBRA 3E8OA 2DR6A 5KG4A 5A8KA 1RU2A 2FYXA 1R27B 5D4LA 2H3EB 2PA3A 4ZN3A 1BXNA 3CB4A 4HTIA 2XSJB 5HN0A 2RT3A 4YFUA 2BE2B 3F73A 4ZITA 3MI7X 3SEOA 4LFBJ 2JLGA 2MJNA 3LF0A 3JYTB 1U02A 4ED4A 3EDRB 2LYVA 4DQIA 4KE5A 2JEFA 3H4BA 4RW6A 2JRSA 4QOTA 2BBEA 3PW7A 2VA2A 5DETA 2ILYA 4PG7A 2GW8A 4RW7A 1LFPA 1GXTA 4FVMA 1IKWA 2ZKUA 2YWFA 2IA6A 4GKJF 2KJVA 2F7VA 1K9MT 4HDGA 1DTQB 2ZD1A 1URRA 1GMVA 4ZP6A 1ICEB 2VQFF 1RAOA 1F5BA 2AW0A 3DLLQ 3UWTA 3KWMA 3M8QB 4OYAA 2ZH9A 2G0CA 3OW2R 4I6WA 2AU0A 3HVTA 3HX9A 4ETZA 4DUZF 4EWTA 3HSZA 1AZSB 3TUJC 1K44A 2F5GA 1EB0A 5A6WA 1S7HA 1JLAB 5J2PA 3ET6A 1DY3A 2HSEB 2CQDA 2RB7A 1Q53A 2FHKA 4FF3A 5GMKa 3GIKA 2VBZA 3B8HA 3F0NA 1UEVA 3D4JA 4ICLB 5J2NA 3QGHA 3R7BB 2YQ3A 1T0TV 2MSTA 5L38A 1W7WA 2HAIA 1PYOB 2ZWOA 3MR5A 3UR3C 1SXLA 4DCPB 4ZS6A 1HI8A 2V5HG 2FPHX 2EWHA 3VAKA 3OVAA 5L1JA 2VONA 3EYZA 1WDTA 3GR0A 3OD2A 2KH9A 5K20B 2E1CA 2D7SA 3V2UC 3C46A 1LW2B 2DHAA 2DBBA 2C3PA 3R5JB 2JSXA 2O66A 2W9CA 3ZTQA 2DD8S 3QQCD 3I87A 3W65A 3DDKA 3FUYA 3OVBA 1KDNA 4PG6A 4ZLJA 5HLFB 3A1YG 1KLMA 1D9AA 2LLZA 4EBDA 3MGJA 4P72A 2AIRB 3BB5A 1CPZA 3RTVA 2CJBA 4FPRA 4K4WA 1LEOA 2HZAA 2VJUA 5CABA 2DH9A 2ZBRA 3W5XA 2VA3A 4OQJA 2MKCA 1FX4A 2D3UA 1VQ9S 3NGTA 3IXQA 4WK1A 2DR9A 1RWOB 2CPYA 4JI2F 1TK5A 1TTHB 1VS3A 1HNZJ 2K7KA 2MTLA 7FDRA 5F41A 4FXDA 5KTQA 1VLYA 2JFDA 1KC8T 5IXUA 2I5JB 3DU5A 1FDDA 3KFWX 2XMUA 2A6OA 4KC5A 1HR0J 1PCAA 2UUCF 2VHGA 1Q8KA 2PGCA 1VQNS 3ZC4A 2B4OA 2EBEA 8RUCA 1C1CA 4ZCKA 3NAIA 3V6DA 1EJ7L 2JVRA 1MW7A 2E5LJ 2RDIA 3HD1A 3G6VA 2CADA 2YKNB 2ZJQQ 2M3DA 3OBIA 5KG2A 2YWGA 2ZBPA 1FCAA 3SV3A 3SMZA 2OPPA 2QG9B 4BDPA 3EZUA 4HDHA 1NAQA 5E7OB 3HHLC 4YHHJ 5CD4H 3CD7A 1KHWA 2MQNA 4DV3J 2VFUA 2BKNA 2RIJA 5LOQA 1Q5YA 2MXYA 2ZHOA 3EGNA 1BHNA 4JI8J 1AFJA 1KTVA 4DSJA 3HFVA 1NSAA 5LM7E 3BN4A 3AHPA 4F4AA 5A2QU 3V81B 4Q2MA 4NCBA 3KLHB 4UY8T 3CJQA 4URGA 4LF9J 1U1LA 5KT2A 3MFHA 3J7YI 1FESA 5ETPA 2XMAA 1IBMF 5LMUF 3ZZ0A 2J0XA 1S6UA 2E44A 1KKHA 3R7SB 4DR7J 3CCRS 4LF2A 1CULA 1TKXB 2GO9A 4G1PA 1JLQB 2NYHA 3FDSA 5BJRA 1VQKS 4MK8A 1HYSA 1IQTA 1MG7A 3DHXA 2R8GA 4Q0BA 3CO0P 3C14A 2Z4PA 1S1UA 4YUDA 1FFWB 4M5HA 1HW8A 4HLBA 1JLGB 1RQ0A 4U8VA 1EQ0A 2BJ3A 2QJ3A 1JQGA 2VPWB 2XWYA 3PXGa 4IYQA 2CPHA 1IUJA 3BQ2A 2LP4A 4ITSA 3QRRA 2ADCA 1QVFR 4C8ZA 3W3SA 2KU7A 4DR6J 3CCUS 1EARA 2KXNB 1YDLA 2JOQA 1U1NA 3LP1A 3R3TA 1P1LA 1UP1A 4AFFA 4OYWA 1M5SA 1T9VA 3JSYA 4X2BA 1VC6A 1IKVA 2B0GA 2KJWA 3W5YA 3DGVA 3BO3A 5F8NA 1N8RT 3DOLA 4PKDB 2R7XA 3SQOP 5J2MB 1WC3A 3GG0A 4M5NA 2MKYA 4O3QA 4E2FB 2E5IA 4F4YA 1K47A 4U7UD 1TU0B 1REGX 1IBKJ 4Q7AA 1HBMA 4P7TA 1X5PA 4HACA 2I0XA 1SH3A 2H51B 2MHEA 4WKYA 1NMEB 3R1HA 2FGCA 4F04B 1RTIB 1WC1A 2HNYA 1VQ6S 3IN5A 3PJ9A 3MM8A 3G86A 3C15A 1BD6A 1UTAA 3PHEA 3TVKA 2CJQA 2EG1A 4FXWA 3VAHA 3DLGB 2J76E 3IS9B 5IQQA 3P49B 3IG1B 1NSKL 3GYNA 4IR1A 1RHKB 3D67A 2VPXB 1UJ5A 4WF9Q 2NXEA 2AYMA 3QSIA 5G4DA 2V67A 5DQGA 4YMEA 4B3RF 1UPPA 2IYGA 2H9ZA 1T02A 4X64J 1MROB 2KHCA 5EN1A 3SIPB 4NI2B 2L9NA 4ELTA 2UXBF 2F4VJ 2DEIA 2HRUA 2VPYB 4WYWA 4MK7A 1NM2A 3O1LA 1M0SA 2JWNA 3SQGB 1WC0A 1GXLA 2HFUA 2D1CA 3MUMP 5A8KB 2KRBA 2BJ1A 2ZC4A 2MLXA 3NL0A 1SJ1A 3RZAA 4DUYJ 1ZM3A 3TQ1A 3M6UA 4HHJA 3GIMA 3EM1A 4J5OA 2ZH5A 2KVQE 1HNIA 2XMJA 2LCWA 1TAQA 5MAOA 5F8IA 1Q78A 2FVQA 2RDDA 1VK3A 4RW6B 3I9V9 1WD6A 2ZZMA 3ENQA 4BHQA 3VV2B 3HFZB 4ES1A 4RW7B 2X7IA 2J6SA 3HZEA 1IN0A 1IKWB 1U6BA 1WWHA 3OSNA 4B3MJ 2AF6A 5IFMA 1L3UA 1BLUA 2QMWA 2UVWA 2ZD1B 1ZTWA 1Q8IA 3PW2A 2IBKA 3NS6A 5M2UA 3KHHA 4TLRA 3A4TA 5GAHU 3Q8UA 1N33J 1T3OA 3HVTB 3GIIA 3OTOF 2B7CB 1D09B 2DNMA 4R0JA 2YNGA 1JXLA 1R6YA 4QBUA 5J2PB 3Q0AA 3ET6B 3QAEA 2GVZA 3QGIA 1UWBA 1Q79A 4YS2A 4NLSA 1NK0A 2B6AA 4F26A 2Y1RI 5B0FA 2B56A 3DLHA 4X84A 1O51A 5J2NB 1YRUA 2RQKA 1HQEA 1L3TA 3T5KA 3B4DA 3GLJA 1N5VA 4LF8J 2P8IA 3KK2A 5BR8F 3C8YA 3FGVA 3D5MA 4GVBA 5CD4A 5I3PA 1S10A 3HI9A 3IR5B 2CPEA 1MU2B 3GE9A 3KKFA 2XZTB 3TX0A 2XY5A 4NRUA 1RTDA 4DR2J 3IM9A 4DV0F 3KHRA 5E3AA 1PIEA 1G7CB 1TQLA 2KKHA 1RE1B 4DFMA 2RF2A 2QA1A 3NNAA 5A0YA 2XLJA 2VBYA 1SKRA 4B9UA 1KLMB 4P75A 1Q16B 3W5ZA 2X3DA 5K8PA 3GV7B 2DCLA 2GMJA 3SDEA 2F40A 2NLWA 3NEKA 4KQZA 2J6UA 4AL7A 4NYPA 1S4FA 5BXIA 2Z2MA 1YG0A 3KG1A 2VOOA 1RLDA 4A8QA 3KUEA 2DHHA 4DFJA 3I0RA 4USVA 2ZUGA 5HROA 3RJMB 2YQ0A 4AYBD 1C1CB 4AQYJ 4WFNQ 1T94A 3V6DB 4NEZA 5KOWA 1G4CA 3I55S 4Y2MA 1S1XA 4ED8A 1NJZA 5BYSA 2AEMA 2PI4A 2OPPB 4F36A 2WAQD 3PY8A 2X3GA 4KPCA 3CJ2A 4RNOA 3NS5A 2AZ3A 4B08A 4LBHA 3HFKA 3ADAC 4CO2A 1H0HB 2XHCA 4UT4A 3U7JA 2RQMA 1HI0P 3LGMA 1LXJA 1X5OA 5JVGQ 3Q83A 1R0CB 2GJ2A 2FTRA 1R7IA 3NGDA 4J9QA 1LWFA 2QSFA 2D41A 1RT3A 2VFSA 4LF4F 2FC8A 4OX9F 4ED2A 1SQEA 2F4FA 3H98A 2VKRA 4C6AA 4FF2A 1CULB 2AJQA 2GCFA 5K8OA 4DPWA 4CNZA 4IKAA 4ZCMA 4MH8A 4EYIB 1HYSB 1MWYA 3OHBA 3CULA 1T3NA 3IBCB 1JJ2R 2W4DA 1S1UB 1UW4A 3VAGA 4AE5A 1VQ4S 3RYLA 1IWAA 4PRFA 4RNMA 3X1LB 2DGQA 2W01A 5FDLA 3GPAA 3VWSA 4DU8A 1NZAA 2OD6A 2CPFA 4HH1A 3NP5A 2MDAA 2EFGA 3B82A 2F8MA 3CUNA 4QR1A 3LP1B 4CH0S 4Q8FA 3QBCA 4DCOB 4RLEA 1IKVB 2CJ9A 2ZEJA 3KMSA 4NCAA 2OEKA 3DOLB 2C3UA 3ZXWA 4DX5A 2LXIA 3CEDA 2BEFA 2DGXA 2Y9HA 1DTTA 5SUHA 3GJSB 3HULA 4XDDA 3MECA 3OTBA 1TKZA 2WW8A 1HBMB 3JQMA 4HACB 3UN3A 3BPDA 1SC4B 3H5UA 3GTYX 2DB1A 1OO0B 1PYTA 5EGYA 3HHNB 3MM8B 2LXUA 3C15B 4I69A 4F4WA 3BSAA 5EX0A 1K0VA 3BH7B 4ZPDA 3T1AA 2AKWB 5DO2A 1PJ7A 4O0IA 3R5BA 3NAHA 2VL1A 4A8FA 3H0PA 3MHYA 3UD3P 2IM3A 1ULRA 2BJ9A 4RU2A 2MEWA 1H72C 1OS5A 3P8BB 1U0HA 3CVKA 5CCLA 2PMHA 2RRBA 5H9FJ 4W4MA 2XO7A 2E7WA 2HQIA 2IJRA 4MK9A 4DV6F 4CYUA 4UZBA 3BR8A 2DIUA 4P10A 2A18A 4M95A 3H90A 1RCXB 5K9FA 2IHR1 2DY1A 3MM9A 3DNCA 2IRUA 1M1GA 1UZDA 2GGPA 3T19A 2IC3A 2E5HA 5DG8A 2N82B 5KFRA 2VUGA 1MN9A 1H7XA 3J7YU 2R4FA 5I42A 4ED6A 2DHXA 5ETMA 1HNXJ 3MMCA 4KGXB 2YNFA 1R8PA 3A8IA 5DLGA 1N6QA 1HNIB 3M2UA 4DZDA 2YX1A 5J1NA 1BE4A 5H9EJ 1PAEX 5KT3A 1LQ9A 3HVAA 1HFEL 3OT9A 3OVSA 4WIQA 2RMLA 2AHOB 1VQYA 4AL5A 5D4OA 4PUOA 3GWCA 1RTHA 1Y7PA 4XK8C 2QMXA 4J9RA 3EPGA 1FA0A 4DJBA 3PR5B 3SSQA 4U6PA 4QWAA 2MZTA 3TARA 1PO6A 2CPDA 4RBUA 2IJNA 3K58A 1WI6A 1DRZA 4N76A 3PRBA 4CM2A 3IM8A 1NDPA 2NR0A 4RW9A 2HMIA 1FE0A 1WKKA 4P74A 1QSLA 1TK8A 4KGZB 4J9KA 1R8HA 2B6AB 1IJEB 3KG4A 3VTIA 1GX6A 3EVMA 2DO0A 1J5EJ 3BGRB 1U1PA 4DSIA 4DQRA 1HQEB 1XMOF 2VOPA 1A0OB 4KB7A 3RAXA 3KK2B 2ROGA 2LQ8A 1XNQF 2E5JA 1YX2A 1VGYA 1VQPS 1YZ6A 3QYYA 2J0SD 4M8LA 4OJ3A 2ZBIA 4GVBB 2DNOA 2ZJRQ 3VGUA 2DHSA 4MYTA 1RWKB 3W2WA 2V8VA 1RTZA 4IDKA 2G0JA 3HHEA 4DMZA 2CA9A 1UAWA 1YSJA 4DR4J 2RF2B 2GO8A 4UOFA 3FC9A 5A0YB 2FJXA 4ZLNA 1RWNB 2Z0GA 3NCPA 4X4OA 1NH8A 2MKIA 3UDEA 3QWUA 5D0HA 1L5UA 5LSLA 4OV1A 3OXFA 1WJ9A 2I9SA 2OMLA 3OFFA 3I9ZA 4NASA 3K5PA 1T8EA 4BBYA 1EKRA 3KDNA 3IRXB 2RE1A 1S1TA 5DDRC 3I4PA 4DV1F 5J1PA 4Y2IA 1RT5B 2ZC3A 1FRHA 4IH6A 3SDEB 3RBEA 2BJ7A 3FQLA 3KJFB 2BM1A 4NXMF 4NWBA 2MY7A 4J9LA 5HMYA 2DGSA 5KFBA 5KFVA 5AJ3F 2GIRA 3I0RB 4F2RA 4CLSA 2IM2A 2BV3A 5HROB 3L7UA 1SUQA 4PPDA 3P6YC 3LTOA 3SFUA 4ANCA 4WK3A 3VZIA 1VRUA 2HNDB 3D3CJ 4C7QA 4C8NA 3B4MA 4ALZA 1S1XB 2HLUA 3QLHA 3GV8B 2IDLA 2ATLA 4KH0B 3SFGA 4QWEA 2O1PA 1YJVA 2BW7A 4EU0A 3BZQA 5E3PA 2QT7A 4PCQA 4GKJJ 1L3KA 1MN7A 2IMOA 4FDFA 1SJFA 1IBLF 1DQ9A 3JQKA 3BQ1A 3MD1A 4FF4A 2VQFJ 1GQEA 3KXDA 2RSQA 2AJ2A 5HO4A 2RILA 4F02A 4CM0A 4ZVPB 3QWPA 1S0VA 2HHWA 1RJJA 2CQ1A 4DUZJ 1CJUA 3P96A 3MEKA 1LWFB 4NYOA 4JI6F 2FJAB 1RT3B 4ATNA 2OGUA 1UVJA 2M70A 5IS2A 3R9LA 2UXDF 4BWJA 2CJYB 3I31A 3IAM9 4ZCLA 2O5DA 2AYBA 1UA0A 2QIFA 1FNMA 4CIOA 1P8GA 4FVCA 2R7QA 2XYPB 4RBVA 2R7TA 3ITHA 1CEZA 3VQSA 1VC0A 2HHPA 3ENWA 2BQRA 1WF0A 2JEIA 1N88A 3UDLA 3P5BP 1QD1A 5HQ8A 1U8WA 1FRXA 3IO1A 4HL9A 2NS1B 4WTYA 4MKBA 1MMLA 3BF4A 4AUKA 2PIIA 1A6LA 1AUDA 4G1QA 2MJUA 3US5A 3MWBA 5GVQA 3PX6A 3PFEA 2NUHA 1IBCB 4PWDA 2DGTA 2CIMA 3GYGA 2RUGA 1T9YA 2N7CA 2GMHA 5FDLB 4C9DA 4WXOA 3KLFA 3UE2A 3MM6A 5KFWA 4B9LA 3G6XA 2UUBF 3ZTOA 1U1OA 1H2VZ 3DC2A 3N0VA 2HS4A 4KPYA 3RAQA 4NLVA 1NJXA 1ROFA 1WKLA 2U2FA 2Y1IA 1REVB 2JH3A 1K8AT 4ZN1A 1XJWB 5L46A 1TVRA 5EDWA 2MQ8A 1DTTB 3IBFB 1HLWA 1JX4A 3MECB 1NHVA 1TKZB 1H7WA 4A8MP 2J7UA 4B3OA 2B9XA 3QAUA 2PO4A 3CIZA 1U2CA 1IM6A 3MPWA 2GIFA 2YWWA 2UUCJ 2WZ1A 2OLWA 2FVRA 4B3TF 4L3KA 5DJBA 3MDFA 3CDAA 3NWGA 3QZ7A 1J5OA 3QIPA 1XTZA 4YDDB 1SJQA 2LA6A 5KFCA 4ANEA 2H5JB 1JLEA 5BYRA 4DPUA 2DYAA 3L3CA 1SKUB 2BOPA 2BW2A 2H1YA 4RKUC 2DNHA 1U0HB 3HLUA 3J80U 4R8UA 4QU6A 1F5AA 1RU1A 5B0BA 2XZWA 4XAKA 2P5VA 2E66A 4CYUB 1RHQB 3Q8QB 3EJMA 3TUZC 1NPRA 4KJIA 3J81U 2J9CA 1W26A 3MM9B 1HI1A 3D7SB 3N6LA 4PZVA 2KT2A 2WBMA 2IC3B 2WSFC 1RKJA 5C2GA 3GFHA 4OI3A 2ZDPA 4JUZA 4YEAA 4OLPA 1YBTA 2EC2A 4ZIVA 1IBMJ 5HQLA 1S49A 3NCQA 5I42B 2C22A 2PE8A 2HRTA 4AD6A 4JI3J 3AA9A 4ILMA 3MMCB 2YNFB 1Z2ZA 3HMJG 1ZZFA 1YJTA 1HBUA 1N6QB 1KP6A 2I38A 5K8MA 4FBTA 1KN6A 3M2UB 4BWMA 3Q24A 4J37A 2FVPA 2D74B 2Z2ZA 1ZM2A 5AXKA 4YB5A 1URNA 3OHAA 2N4CA 1RP5A 1KVIA 1Q86T 3ZZUA 4ED0A 4OL8A 2B9WA 4PUOB 1W2IA 1DJ0A 1U7LA 1RTHB 1WI8A 4K59A 1FERA 3AXMA 2MQPA 3VGTA 2IMWP 1B0TA 4O3NA 3BBCA 2EFVA 3Q8VA 2F8EX 2Q1LA 5GAGI 2E9RX 1LNQA 3G4SS 1XBWA 4TYBA 4QW8A 4NE9C 3RGIA 2YH0A 4RW9B 2HMIB 1ZA2B 5GADI 4CLPA 3GSDA 2K3IA 1VISA 2KZMA 4ZPCA 4EFAC 2Y1JA 1L3SA 1LWXA 3FEZA 4U7CA 2ZM6F 3ZTSA 2R2TA 2VG5A 4MKAA 3A8JA 3POTA 4TY8A 2QA2A 2E1AA 2BQ3A 2UUWA 4JBCA 5DQHA 1LWCA 3CJ5A 2R2UA 1WG1A 2HK3A 5KG6A 2VODA 4J9PA 4X66F 2CRLA 3GONA 4OJHA 3KMQA 3F56A 2RUSA 2ERRA 4USHA 5KG3A 3W2WB 1QUVA 4OZ0A 3LGNA 1Y5LB 3LPYA 2G2ZA 5HMZA 4OI0A 2ZJPQ 3OL8A 1RWUA 4X4TA 5LXYA 1KD1T 2DGOA 1F1BB 3NKYA 3M2VA 2QRRA 3C6UB 4IFVA 3DLKA 2HHVA 2V63A 2CNNB 3W9HA 1ZBTA 2ZFHA 5IT9U 2VJVA 1S72S 2RAQA 4NXNF 4B3RJ 2XC9A 2GVDA 1X60A 1FRKA 3BGFA 1X8DA 4K4UA 4CZCA 4O44A 2UXBJ 2ZHAA 1HWLA 3LWLA 3ZZPA 1S1TB 2WVCA 3V6KA 4H4OA 1NK6A 4CO3A 3BSNA 2OJ3A 4A46A 2D9OA 2C2EA 3BH6B 3PDNA 4FNHA 1HARA 4ZJOA 5HMWA 3BO2A 1F9FA 3HT0A 2CQIA 3KOAA 2LA4A 2FVSA 4BC7A 3EGZA 5KFIA 2LVWA 5L1LA 4N8NA 1ZTTA 1NU4A 3JS9A 1YJNS 1OWXA 4QWCA 4NOHA 5EWGA 2M9KA 4Z7YA 5CCMA 2V8GA 4C3MA 2BJEA 4RJVA 4K7QA 1QAYA 4IOBA 4ECSA 5J1EA 1NRKA 2RRAA 3CC7S 1PBUA 1VRUB 4DV2F 2B43A 1NCLA 1S9GA 3WX4A 4OI2A 5D0RA 3QLHB 2PC6A 2HGLA 1PC5A 4X4UA 4DS5A 4DPOA 3S8SA 4J9MA 4F2SA 2RH3A 3PX4A 3R5CA 5HSPA 4URQU 3PX0A 4W98A 1HWJA 3U1LA 1S4EA 2JHEA 4ZPVR 4TU9A 4LRFA 3OXLA 1MWQA 1JMTA 2BANA 4EK2A 4Z2XA 2CQ4A 2V34A 4NLDA 4QWBA 2LEAA 2M7SA 3LO3A 2QL5B 2IVFB 3KJNB 1HHSA 3ILOA 3OTOJ 4C2MA 4ECUA 1KSPA 3K5NA 1KR4A 1BQXA 4OV6A 2XSJA 3VVTA 3VR1A 5B0GA 1RTJA 2WONA 4OI1A 2A0FB 2KYZA 5HBMA 3TZZA 1ZPWX 3ZZYA 1WORA 5F8HA 5L1IA 3ITHB 4WZQA 4S0MA 5BR8J 2CPJA 2XGQA 1MMNA 2PDAA 1QTNB 3F41A 2MZQA 1X4DA 4OX6A 3UCZP 1D3WA 4YY3F 3NGRA 1SKSA 2V68A 3K8WA 2P9CA 4G1QB 3EXCX 3U02A 3BREA 2CQ2A 4DV0J 4C8OA 5E33A 3J80Y 2VDHA 2D9PA 5KFQA 3IR6B 1L3VA 1MMDA 4EEYA 2JC0A 4M94A 3ILJA 3GMGA 4CLUA 2CQCA 2LQ9A 5LL6d 3WIUA 3MM6B 2V0NA 2V8DA 3QATA 2AZ1A 1C0UA 2VV5A 1YWXA 2W4CA 3RUBL 2FD2A 3AH6A 1HA1A 2GHPA 4JI1F 2OTJS 1WDDA 3WX8A 4Y2KA 1RHMB 2WCXA 1NLKL 4PWUA 4Y0FA 1YJ9S 2XM3A 3B54A 1ZETA 4ICLA 2WTFA 1TVRB 3BGOP 3NOGA 1RWVB 3CJSA 4B3OB 4K0KF 2HWHA 5C25A 1YIJS 1N36F 1VBZA 1U48A 3HHLD 1N0UA 1BY9A 1KOHA 1VK8A 1N32F 4OYPA 1RAFB 3KNAA 1KFSA 1ACMB 5HP1A 3J7ZT 2DH8A 3TW0A 2MMYA 2MQQA 2FDNA 4DPXA 2G2YA 3MURP 3C3LA 4EMDA 4J91A 1FHTA 3QIPB 1J5OB 2R8JA 3TOQA 4P2MA 2PMWA 2C2KB 3PNIA 2YVSA 2MZJA 3NWRA 7AT1B 1YBUA 2JLFA 3KDOA 2ZH7A 4NX9A 3W9JA 3AJ2A 5D3GB 3CMES 4R8UB 4GVLA 4ZJQA 1X7VA 3Q2SC 2GJFA 4LBPA 3AQPA 4Y2CA 5D6GA 4RNNA 4I64A 4QIGA 4ZHRA 4WP3A 4FF1A 3MPVA 1PGZA 1EETB 4UOCA 4L3NA 4MMOA 1HBOA 4JV0A 4RZRA 3IFEA 2NPFA 3I6PA 2V8PA 4B9VA 3VZHA 1XC9A 2M52A 1PJ6A 1WTBA 4F4XA 5D8HB 4LF4J 5F0UA 2OFGX 4OX9J 3CO9A 3M8PA 4HKQA 1F3VA 3MEEA 3R1LA 4GMKA 5IOLA 1U8SA 3M8RA 1JJHA 2QN6B 4FYYB 1KEKA 5L1KA 4F3OA 1TUVA 5ETSA 5LJ5Y 1FTCA 2L48A 3H4DA 2OSRA 1HBUB 1VYAA 4FYVB 1LKZA 3CCSS 2BMBA 3RB0A 4ZVRB 3M32A 2QFJA 3FQKA 2XQCA 1UPMB 2CQ3A 3QJPA 4BS2A 5AE3A 3HSJA 1TL3A 4QYZJ 2HIYA 3RBZA 5FIIA 5IT9Y 4KV8A 1RABB 4D3GA 2XSFA 3EZ5A 2C28A 4PYAA 2E1RA 2PFFB 2F9JA 3DOKA 2RU9A 3VHQA 3T9ZA 3QIDA 4B9TA 1AXQA 3V81A 1GMUA 4NRTA 3ZZOA 2J5AA 3MM7A 1RAIB 4W90B 3MF5A 1KONA 3PACA 3CJ8A 3D6MB 4QWDA 2GQQA 2CDRB 5KFPA 3ICLA 3SCIE 5HMXA 3MEDA 2AX1A 1TKXA 3CJKA 3SCLE 1T9UA 3G87A 3SCKE 4A8YA 4I4BA 4ID8A 2VG5B 4DQQA 1O5JA 3POTB 2QGFB 1D0EA 4TY8B 2BACA 1DBDA 4LF7F 1WHYA 2HHUA 2G9OA 2DEJA 2KT3A 4TU7A 3TAMA 2XY6A 3L95X 1V5VA 6AT1B 4DSLA 3PV8A 3D66A 2YWHA 1P9QC 4RNHA 4V19J 1Y0HA 5HAOA 1Q82T 2LU2A 1RDRA 1RADB 2U1AA 2P6TA 4C8KA 4I1TA 3TX8A 1KQSR 1QVGR 4OZLA 2AGOA 1VR6A 3ETMA 3M2VB 4O4GA 1SVDA 4IFVB 1UJ4A 3DLKB 5D77A 3N01A 3GCXP 3R5AA 4B9NA 4RWWA 1O6XA 1SKWA 4DV6J 4ECXA 2QLXA 1S97A 5F8MA 3CD0A 2LDIA 1HHTP 3AXKA 2GVDB 1T7PA 1HHQA 2HFOA 5HVFA 4ZVHA 2B5JA 1B7FA 3JTOA 1Q95G 4O44B 2HBZB 2BE9B 3DYAA 3GZ7A 2DITA 2XCAA 3HT3A 3HJVA 4H4OB 1JLCA 3D6TB 2DPJA 3NNCA 5DLFA 4HT5A 3W7BA 3N6MA 4LR9A 2EK1A 4MYUA 1YZ7A 3TWZA 2OP5A 4FYXB 1XK8A 4XTTA 3K57A 5IWAF 3LP0A 4FXVA 1VC5A 3DLGA 5FD1A 5F9LA 4R25A 2QV6A 2AX0A 1FO1A 2FY8A 3EGWB 4FS2A 2JEJA 2JVOA 3R97A 2I6WA 5J1EB 5JUMA 1UZHA 2LQ5A 2X51A 3PO5A 1HNVA 4N77A 2MZSA 3CMAS 2N4DA 4CLYA 4NLTA 3NY0A 3K8VA 1TL5A 1WG5A 2AEJA 2FGOA 3K5OA 1HBNA 1UKUA 2WHOA 2ASDA 5A6PA 5DG9A 2AJ1A 2YWEA 1TL1A 2OO4A 2BANB 3OTDA 1VHIA 1YRTA 3R2CJ 1XN9A 5I4MA 2UU9F 3BO4A 3D1HA 1RAGB 2B9EA 5GAGU 1DZ5A 2QLFB 1JLBA 3H59A 5KFJA 3FCHA 1Q1KA 4IQXA 4NLYA 3QT5A 1FVSA 1QM9A 3UW1A 4V19X 3GCWP 1BQNA 5GADU 5THWA 1HW9A 2IAJA 2HQDA 1RTJB 2WONB 1RT1B 1U09A 2CKWA 2JFKA 5EWEA 5HBMB 4Y28C 3D0HE 2KFNA 5B08A 1XMOJ 4LIWA 3VF0B 1RZMA 1F5CA 2EG2A 3IRWP 2W8LA 1XNQJ 4K4TA 4ECQA 2DNRA 3UPFA 1FNOA 1QUPA 3M8ZA 4ZP7A 1NDLA 1KS2A 2YKPA 3P45B 2BXJA 4I56A 2FHJD 2ROPA 3AY0A 1G2EA 3GV5B 2B3TB 1UFWA 1FK9A 1GAOA 4QYZK 1UWAA 5RUBA 1Q0NA 3S7RA 2WVFA 3MFIA 1LFWA 2C2ZB 2F8HA 1Y00A 3B6BA 1H73A 3W66A 3IA0A 1YGYA 1RAHB 4WXWA 2IVMA 9ATCB 2V4JA 1C0UB 4NL5A 3D1QA 4DL6A 1N52B 1C1BA 4EBCA 4WFBQ 3BBBA 3ZZZA 3MMAA 4C0HA 5C2CA 3R5GA 1X4HA 2VC0A 2Q3PA 1RKIA 4DV1J 4HTJA 3HK2A 5M2RA 4P9SA 2ADBA 2HVDA 3ZO7A 4NXMJ 1JK9B 5C25B 3VAMA 3T1HF 3PR4A 2EC0A 5M2PA 3BJYA 1FWLA 1LW0A 5HP1B 3NGSA 1VBYA 5AJ3J 1MU2A 5T14A 1RAAB 1IR2A 4MT1A 3MAAA 2RJZA 1XWLA 4Z7CA 1WEXA 1SIWB 3H25A 3H40A 2HYIB 3N4WA 5ETKA 3H2LA 4ES2A 1F2HA 3T1YF 1KWMA 2BVZA 1PJ5A 2ZH6A 1D9DA 4PAAA 5KT5A 3CCES 2DVIA 3DLBA 2OPQA 4GO7X 4UQGA 2QMUB 5DGBA 3QT6A 4ECWA 1QAIA 2R9LA 2CYYA 4L6V3 4O0NA 4M5DA 2J7KA 4F0HA 3MD3A 4ZHRB 2KM8B 1IBLJ 1HMVB 1N4LA 1UW9A 1HBOB 1TELA 2ASLA 2FLLA 4ELUA 4ID5A 4DEZA 3HHLB 4LQ3A 4QQBA 5IV3A 3OQ2A 2D3O1 1XQIA 1KRPA 4EUVA 1F0XA 5MLCV 1FKOA 3D0GE 2QE5A 2ZZTA 3MCMA 4IOCQ 1B70B 3M8PB 2CJXB 3RBDA 4K2JA 1A7GE 2IA0A 2UXDJ 3MEEB 1U24A 3RB4A 4EO6A 1M1HA 5GMDA 2DIVA 2W9BA 2HVIA 4A8KA 1K0TA 2NQPA 3M4XA 1S1VB 3RB3A 3FEXB 4FPIA 2EBGA 3GFXA 2DR7A 1V3RA 4ECRA 2W9AA 4UY85 2DNLA 4QZVB 1T05A 3FEYB 4OZJA 4WTOB 3M32B 2E9ZA 3MOJB 4YR0A 3BQ0A 1RAEB 1TL3B 1N54B 4ZVUB 1VMBA 1F9EB 4CLKA 1RB0A 3PZPA 1FDNA 4BCAA 4KV8B 2DK2A 3U1NA 3CD5A 3ENAA 3MPDA 3DOKB 1ELOA 3TEGA 2PI5A 3D1OA 3GP9A 4CH7A 2UUBJ 5HANA 1WG4A 3TO8A 3L4BC 1EQMA 3MM7B 3N28A 1VJQA 2BA9A 1KQKA 3BDEA 3QGPA 1NSPA 4MKVA 1T9WA 1O8BA 1U6ZA 3MMJA 3P3DA 4QIFA 2V2QA 4E0DA 3T6JA 1N5TA 3MEDB 5K14A 5KFLA 3CJKB 4O3SA 1HIYA 4KHPF 1VQ8S 4RUHA 4I67A 2EPIA 4MJKA 3DDNA 4A8WA 3PYGA 3GR1A 2DJWA 1AYEA 5KFTA 3PVXA 3CCQS 3K17A 2QL7B 4KGMA 3D0IE 5EX3A 1H2TZ 2PMZD 3S6EA 4B3TJ 3TAMB 1RACB 2DNGA 2KT5A 3IAS9 4OHXA 3M2RA 2X1FA 3CXCR 4HI1A 1SQFA 5ETQA 1S48A 1S6QA 4O4GB 2HBRB 1S7IA 1OY8A 1HWKA 3W61A 2H48B 2ZH4A 4LF5F 1ZOTA 2XMVA 4I0WA 4RWXA 1NK4A 3ISNC 4KY3A 3GFYA 4R5PA 4RPFA 2B5JB 3ULHA 1U0SA 4UW2A 5FLXU 3JSBA 3DYAB 3N79A 1JLCB 3LA0A 1T03A 1KTQA 2W2QP 1TV6A 2YQ1A 3LPEA 6FDRA 4MIAA 2F9DA 4OHWA 2HHQA 1NK7A 3DRSB 2HFSA 5U47A 5LSRA 3ISZA 2VFRA 1IR1A 1N0VC 3LP0B 1EIYB 4LF1A 2GMLA 2J9DE 3GB0A 4WU2A 1VOMA 2F63A 3T5LA 4LSLA 1N34F 2RS8A 2EK6A 4EYHB 2B8QA 3TA0A 2FZCB 2ROEA 1X0FA 2J6TA 1TL7A 2NZ4A 1HNVB 2VH7A 1B0VA 1Y5IB 3EX7B 3V6JA 5KG1A 3LP2A 4I7FA 4LR8A 2HEKA 2B4UA 4P71A 2W7AA 4DL5A 4ZIWA 2ZNZA 5GAEI 1HBNB 2QZ8A 2HFVA 1PKUA 1QSYA 4BC9A 2DRBA 2EFPA 2QTWA 2YKMA 1TL1B 3TQEA 4IO9Q 3H5XA 3DI6A 2YWKA 1LWEA 3N5FA 2GAHC 5B0AA 3G8QA 5CXTA 4NA2A 3UI3A 3D6HB 3KJQB 1DLOA 2GNKA 3MR3A 3Q8RB 4HI2A 2FQQB 3Q8YA 2G1HA 3OUYA 1JLBB 1IWGA 1U1KA 1AA1B 1C2PA 3AD8C 1BQNB 4X65F 4NLPA 1QDUB 1YTYA 2IAJB 2H54B 4JI5F 2ZM6J 1QY7A 2YBVA 4ERDA 4FS1A 2HQFA 3MTJA 3M9MB 4JB8B 2HKEA 2NUUG 4O3OA 1UVMA 2KXHA 2GIQA 5KT6A 2CQHA 1VQOS 5HJXA 2I2YA 2MY8A 4X66J 3G8SA 2DGUA 3CIMA 3R27A 4RU9A 3RB6A 3MAQA 3H2UB 4DU7A 1FK9B 4J90A 3QJJA 1RT6B 2R7SA 4QCLA 4LUBA 4B02A 1FXLA 3DOMA 1RISA 4N56A 4NLOA 3FBEA 1X9WA 4USWA 2GX8A 8ATCB 1V3SA 2VG7A 3OLAA 4MIWA 2VBXA 3TZWA 2V4JB 3NXZA 3BDPA 5A8RA 4NXNJ 3VAFA 1R6VA 2OPRA 1C1BB 2V94A 3CJ4A 5CHCB 5EUHA 2W25A 3MMAB 4OJGA 3THTA 3W63A 3QGGA 3V6HA 3BGRA 4A4JA 4HEA9 4AXJA 3FKBA 4M5MA 3DKDA 4LFCF 1UEUA 1JNRB 5I3UA 2H5EA 4NLRA 5ETOA 3KYLA 2DY9A 3BSOA 2I8EA 3F44A 5D15A 4B3SF 2P9EA 3W8PA 3W62A 2Q6BA 3DLJA 3WHIA 3A13A 3FBFA 2C2RA 1LW0B 1FD2A 4PPZA 4UUWA 3DRRB 3M6WA 3QMQA 3MAAB 3ILLA 2CQGA 1HQ2A 2CJAA 3M6XA 3RU0A 1GTEA 2KVIA 4EBEA 4GKKF 4USIA 4DV2J 1S0NA 3FNNA 2XMKA 2CAJA 2OPQB 2RKIA 1X5TA 1VQSA 2QEXS 2PT0A 3TAQA 1NK5A 4M5DB 4OJ1A 1DHMA 4Q45A 2LECA 2MKKA 3IRXA 4K5RA 2YPZA 2RS2A 2YKQA 1U4BA 1RT5A 2COLA 1DURA 5F8LA 4CCHA 4ID5B 4RUBA 2B9YA 1FFSB 1UJ6A 3KK3A 3AFGA 1FJCA 5LJ3Y 1FKOB 3CCZA 4ILLA 1UVIA 1RHJB 1YVFA 2VBWA 5SZTA 2FJVA 3T3FA 2UVRA 2JDJA 2A3JA 3OPKA 4ZVGA 1KVKA 4JI7F 4JP8A 2W9BB 1S99A 2R2SA 2KYXA 2HNDA 2OMOA 4YOEA 1I51B 1B0PA 1OMSA 3PTWA 4YY3J 4QIEA 1T05B 1FEHA 1S59A 1I3OB 4XDCA 3UFCX 2XNQA 2HHSA 3AJ1A 3K7RA 2ALZA 3TA1A 4TN2A 4B9SA 4ZVOB 2RNEA 2QA4S 2XLIA 1WELA 1UFKA 3UD4P 2NPIA 2XS5A 4ZPTR 2E7XA 2CPZA 5HVGA 3ZNUA 1V6HA 3HKWA 1NNDA 3CCMS 1H2UX 2MQOA 1Q5VA 2ASYA 4ECYA 5FLXY 4ZCIA 5D0EA 3AQOA 4DV5F 3HM9A 4C97A 1M5PC 4DHVA 1FI4A 4JI1J 4C8LA 2OEMA 2UP1A 4YR2A 2HZVA 4C3LA 5E3RA 3R6LB 5K14B 1EKSA 5CYJA 1PBAA 1X5SA 4I2QA 1IVZA 1VI7A 4NCGA 1K1SA 3CDBA 2UVUA 2QLWA 4K0KJ 5HATA 1N36J 2WVEA 3O44A 3OTCA 1N32J 4IO1A 3N9UC 4A8XA 1RBOB 4IRCA 1OIAA 4K4XA 5KFMA 5L9XA 3D9BA 5B0CA 4GC6A 2NXUA 1NZ8A 2ZH3A 4I2PA 3RG6A 4DOZA 4QYRA 1XR6A 3TA2A 3M2RB 4QR0A 4DF8A 1M5OC 3R2DJ 4U7UK 4USJC 3D68A 4QW9A 1FJGF 2GZOA 5HQMA 2G4BA 2BE7D 2WSCC 3W64A 1UL3A 1KQFB 1S6QB 1I5OB 4P6QA 3TJ8A 4PWWA 2VPZB 2KN4A 3HXMA 3KHLA 1X4BA 4X4QA 1TUGB 1REVA 1LOUA 3PKYA 5LXRA 1WF2A 3TZXA 3P5TL 4HYKA 4ECVA 2HRYA 1IKYA 1AUSL 1PC4A 4R5PB 3QZ8A 1JLFA 4KR0B 2R7UA 5K5MA 1QE1B 1JXEA 4UUXA 1C4CA 1RT4A 1T03B 1X4AA 4FN5A 2UUAF 3BYPA 1TV6B 5ETRA 2QL9B 4WKRA 2QX0A 2GA7A 3CPWR 3PIOQ 1PILA 1CC8A 2H65B 4N47A 3TI0A 4P2XA 5KFFA 3FCVA 4ECZA 1TUWA 4LRBA 2XMTA 2KO1A 4DSEA 4U96A 2EFOA 4LSLB 5DDPC 1A9NB 3HHDA 4EI2A 4KGKA 4DN0A 1KBRA 2HS3A 3JTPA 2QYGA 2ZH8A 2W1BA 4ER8A 1TL7B 4J7CA 2CQ0A 2C2DA 9RUBA 3H5SA 1E6VA 3LP2B 4I7FB 2CQBA 1EHWA 1Y11A 3T5JA 3TJ9A 2DR5A 4H4MA 2R7WA 3M8SA 4G65A 1HNWF 2FHMA 4PQUA 1FXDA 5JMNA 2ZOMA 4JV5F 3M9NB 1AFIA 3KLVA 1S1WA 4XPEA 4ED3A 2YKMB 1RT7A 2G1DA 5LMNF 3HHKA 4DR5F 3DI6B 1LWEB 4L72B 2ZNYA 2VFTA 2X1AA 1DLOB 3AOCA 4K4ZA 3QNWB 4Y00A 4CLWA 3UVJA 3HZGA 3VQTA 3FMWA 3OUYB 1M5KC 4PXDA 1YI2S 2QLJB 4M63A 3WBZA 3HDSA 4Q8EA 1R0BG 2XNRA 3HVWA 5JJBA 5HK4A 2HWTA 4OX7A 4YB1P 5KFUA 4NEYA 1NJWA 2AQ4A 4LF7J 3MUTP 4I68A 4EZ6A 2J9EA 1SL2A 1RGVA 1MWZA 1HL6A 3TVZA 3FFIB 1NKBA 4DI6A 1C0TA 3TZYA 3HF5A 3G96A 3DOMB 5KG0A 2EFNA 5AE1A 2K06A 2N3OA 4A47A 5KFZA 1JWWA 4DPTA 1TMMA 2FC9A 1FX2A 2J9DA 2VG7B 1YJ7A 2B7BB 3D54A 5A8RB 2IJFA 3PJWA 2CZVC 2F3JA 2OPRB 3LANA 2EVZA 1FE4A 4KBIA 1FJEB 4MFBA 4KYZA 2ZH1A 4DV4F 2VICA 2GHVC 2NREA 2CNOB 1K1QA 5KFYA 4F67A 4A8OA 2BJDA 4NA3A 2BOAA 3UNYA 2L08A 3KLIA 5I3UB 2Y0SD 1NDKA 3EE3A 1WHWA 4HHUA 2VDIA 4ZVEA 4ED5A 4J9NA 5KT4A 3OL9A 2GFFA 5L8RC 3MPYA 3HKZD 3C2PA 2MLZA 3PJXA 4TVAB 1FT8A 5IWAJ 4QIVA 2ACMA 2GQCA 4PXCA 4Q43A 2A10A 3FJ2A 2FUG9 4RBTA 2HHHF 2C2NA 2KM8C 3J7A1 3UDCA 3N6NA 2WRMA 3V5RA 1X4FA 3BEGB 4OHYA 1SL0A 2AWZA 3C6UA 2HVZA 3QT8A 3OFGA 1RHUB 5DG7A 2LU1A 2RKIB 4PEOA 3PEJA 4Y65A 5CYMA 1SPBP 2JC1A 1DARA 4A48A 3R7NB 1OY9A 5GAEU 3MMBA 2SXLA 3CCTA 1S6OA 2WOMA 1RYSA 2DNPA 2L41A 4ANDA 3EPIA 2PA8D 1BWEA 4RUAA 4DV7F 3NMAA 2RDJA 3M8WA 1CS4B 2UU9J 2VB6A 5JXSA 3KK3B 3JSMA 4Y3CA 2DTJA 1UFLA 4JI3F 2BYCA 3P4UB 3WQPA 3RAMA 3TUPA 3MEGA 2CVEA 2W24A 1QAXA 1OQ3A 2VQEF 1GFWB 4DF4A 1U1QA 4C3KA 2HW3A 2W2OP 4DS4A 1PSDA 2FY1A 3CDEA 3A3NB 3EZOA 2C3MA 3EDQB 3VALA 4C0BA 1NB7A 4LFAF 2Y8WA 8AT1B 2YKOA 4F8RA 4DN9A 2E9TA 4C8MA 4HVZA 1Y3JA 1CG2A 1FVQA 2C3YA 4P2SA 2LXFA 4PABA 1WC6A 1HKAA 2DR8A 1S6PB 1GEHA 4OHZA 2FLNA 1UCNA 1S0MA 5EHHA 4OMFG 4F4KA 4KIAA 4CLFA 2VZ9A 2Y8YA 3A12A 2DRAA 1CC7A 3DFEA 3M30A 4USUA 2AMCB 2HG4A 1FKAF 1S9EA 3A3OB 5KT7A 3G9CA 4LRAA 3KLGA 4WU3A 4AXIA 4ZMMA 2WVDA 2UV8G 1Y9OA 2FLPA 1RT2A 2GQ2A 2BM0A 3OL7A 2EKYA 2Z58B 4I2QB 1SC3B 1VBKA 5KFOA 4NCGB 1YITS 3PW5A 1NJYA 2E29A 2J7WA 3T1HJ 1WOPA 2WW4A 3Q89A 2N7YA 3LALA 3RW6A 2RRNA 1QJHA 3D28A 2V2VA 1M5HA 4I2PB 2UUTA 1YRXA 1R8BA 3NLCA 3JSRA 2XGPA 1CJTA 1SCJB 2XI2A 2ZWPA 2HVEA 1Q8BA 2FJWA 2C2MB 1CSJA 2IIHA 1VQ7S 1TKDA 3T1YJ 3O8WA 1IQZA 4F3QA 3BGLA 1SBRA 4TXSA 5LT5A 3CJ0A 2NXCA 4H4KA 3SV4A 2X1GA 2CPXA 2YPYA 1UVKA 1IKYB 1KFDA 4HR2A 4KKOA 2OPSA 3I96A 5IT0A 3CC4S 1YKWA 4JI2J 2VIHA 1JLFB 2FB0A 3I0SA 1HD1A 4CRJA 1VFJA 2XMWA 1RT4B 4Z37A 4OI6A 2P9GA 4TU8A 1EP4A 3M7VA 2HGMA 2KG0A 4WPAA 4OI4A 2XHWA 4DG1A 5G0RA 3TUIC 2XO6A 1ZA1B 1SI9A 2AV5A 4RO0A 1G6BA 5F9NA 1SJRA 4DR3F 5HVHA 4L75A 3E2EA 1UEKA 1XEZA 3PYEA 5DZ7A 3PIPQ 2LFVA 1I6JA 5D3GA 2BABA 4YQWA 1APSA 3M1VA 2KTQA 4X4NA 1E6VB 5T7LA 4CO5A 2MQMA 3MM5A 5KAKA 1EETA 4H4MB 2APOA 1AROP 3MOZA 4PQUB 3DDIA 2DNKA 2RD5C 3VAIA 4WE1A 1FEEA 3I4HX 1S1WB 3L7PA 2OELA 1RT7B 3C19A 2JZ5A 3TJAA 1AW0A 2KHDA 2ZBCA 2EFQA 2CQPA 1H38A 1RA7A 2W2MP 5LMUJ 3UVJB 5ADZA 4W92B 1HQUA 2YY3A 3PYDA 4NPOA 1N56A 5ETLA 3IWXA 3H8YA 4PXEA 4KGVB 4OZ3A 1TZ0A 4ZOSA 4KHPJ 3J7AN 3IGVA 3A8EA 2JEGA 3SBMA 2MQLA 2YX4A 1VQMS 2KXFA 3O3LA 2K2PA 3WDOA 3GJQB 2IY5B 3HSDA 3K59A 4DL4A 2R42A 2EKNA 3VVUA 1RWXB 1XIQA 2UXCF 3HJFA 3T6BA 2A1BA 1D1UA 2BKPA 2W9CB 4KH1B 2AJFE 5D78A 1I94F 3MCSA 1RA6A 1ZAVA 1YJRA 4P7VA 3THVA 3KK1A 1Y5NB 4UZCA 3GYXB 1PG5B 5KFXA 3M8YA 1YQHA 2VKZG 1C0TB 4Q2LA 3JXOA 2PFDA 2CZ4A 4CT9A 2JL9A 2IFXA 1VHFA 2V2KA 4K5SA 5A2QY 1BMQB 1YLXA 2BZ2A 1FWKA 4LF5J 4LREA 4DL3A 1TFYA 1NPKA 1R31A 3DLEA 2Q6CA 3CC2S 4MFBB 2OUGA 3ZNJ1 4JI4F 3FK4A 2Z30B 1NJIT 2H4WB 1BGXT 2XZDB 3OFHA 2XY7A 3O6QA 3KLIB 3MTKA 4ZKAA 1BC6A 3CCVS 3V4IA 1Q8LA 4FKXA 3OJSA 4ZJLA 4NZ6A 1GX5A 3M6VA 3TYTA 4QPTA 1SC1B 3AA8A 3W9IA 4WFYA 3KJVA 4ZLLA 5DZ6A 1FJ7A 4QU7A 1CLFA 1N34J 2HQCA 3ZTRA 3UD5A 2W7OA 3JB9k 3NNHA 1Z4UA 3MZIA 1X31C 3I82A 3OV7A 4L76A 1NPPA 3UN5A 4XPCA 5AXLA 3CW2C 2MKJA 4H54A 2XTJP 2EEYA 2XWXA 5CYMB 3MMBB 3T41A 2WOMB 1B64A 5F3ZA 2YXLA 3TAPA 4IQMA 1TAUA 2MB0B 4Y6IA 4JI0F 2MSSA 2HIQA 3Q8PB 1KNZA 1CQMA 1QSSA 4HHHA 3U1MA 2W8KA 3JSMB 4F0KA 3KUGA 1WNEA 4OZ2A 4U9RA 1X9SA 5ETNA 4OZ1A 3EVOA 1WSRA 4OYIA 2HBQB 4X65J 1M90T 2DXDA 4YP3A 3MEGB 2KI2A 2DRDA 5I3QA 4JI5J 4Q0BB 1OQ6A 3C14B 1JKHA 1MSWD 5DS7A 2QSWA 4WBFA 4F25A 4IG0A 1N5YA 1R8CA 3R5DA 5KG7A 1FFGB 1WEYA 5GMEA 2CG8A 2KB2A 4USMA 1BQMA 3AT1B 3CWJA 1H98A 3TNVA 5AXNA 2NXNA 4KRWA 4ES3A 3PEHA 1H3DA 1U2FA 4DDFA 2IPOB 3AAWB 4LF6F 2HURA 1NSQA 1R8AA 1DQAA 2DISA 4HH0A 3DXSX 3FBBA 1QAJA 4TQSA 4PR6A 1XNRF 4NYZA 2FIUA 3M30B 4E8UA 2HS0A 1S9EB 2D3ZA 1CJKA 1HPZA 1GTHA 3DGPA 3KLGB 1B3TA 4DSFA 1RT1A 3DCAA 2HVHA 5D4NA 4LFCJ 4OHVA 1RT2B 2HNYB 3Q8SB 4B3SJ 2XS7A 2ZE2A 1C4AA 4LVNP 2NSCA 3GIRA 1J2VA 1YBAA 3RR7A 4ZVFA 3W2VA 1XMQF 1NEEA 2RQCA 2W2NP 1R43A 3NBPA 4IRDA 3WC0A 2K7JA 2D3OR 1T11A 2LMIA 4ED1A 1R3NA 2OTLS 1NKEA 1CJTB 1VLOA 3CSKA 4QJVA 1GT8A 2WVBA 4GKKJ 3G82A 5E5NA 5IZHA 3HSGA 4MIBA 5D4PA 2HZCA 4PQAA 3J7Z5 3C66A 3FZ2A 5A76A 3ILIA 2HNZA 4TYAA 5KFNA 2YH1A 4OYMA 2XULA 2CNLB 1NBEB 2VC1A 1JNZB 3QSYB 5KFKA 4X62F 3AODA 5IM0A 2LEPA 2IDEA 4DBQA 4KKOB 2OPSB 4WJBA 2XI3A 4IR9A 3CJ3A 3I0SB 3LOUA 4D3HA 4IG3A 2RHQB 4IH7A 2MKSA 3G2XA 1HWIA 4K4YA 2RQ4A 3MAHA 5A8WA 1UETA 2DCUB 1EP4B 4F3MA 2IM0A 4UOHA 4DG1B 5G0RB 5CYQA 1T9XA 3OLBA 4JYAF 2ZKTA 3NGUA 4JI7J 3KTQA 2KFYA 1D8ZA 2QYCA 3LQVA 2AYGA 4DR1F 5DRKA 1S12A 4KFBA 1ITPA 2HPUA 2HHXA 1RBLA 3HO1A 1KOOA 1K73T 3FSXA 4F7VA 2QFIA 3M1VB 4FNIA 3FMBA 1MLAA 4BLGA 1P27B 5T7LB 3MM5B 2Y1LB 1RHRB 3WC2A 1HMVA 4URSA 2H4YB 2XB2D 1S9FA 1UVNA 4WE1B 3HHLA 4L74A 4WP9A 2YNGB 1RUSA 5CA5A 3SSSA 2W2PP 4J9VA 2GVZB 2FJDB 4B9MA 1UWBB 2EXUA 1WHVA 2EI5A 3BM7A 4DV5J 4FKYA 4LFBF 2M4MA 3DU6A 2E5GA 1HQUB 3OJUA 2PEBA 2R7RA 4YB6A 1N48A 3H20A 3DMJA 1S1VA 1OJ4A 2KZZA 3D2WA 3V4MA 2MHNA 1G3OA 4KT0C 1S5ZA 3EUNA 1LK7A 4FYWB 4L73A 1DFDA 2ZHBA 3FSIA 4DX6A 1P1TA 4XIUA 3OSPA 3QO9A 1RTDB 2G13A 5C7PA 1CBKA 1JJCB 1FD8A 3QT7A 5F3TA 3ISND 1F6TA 4LSZB 1NUEA 3BYRA 4M5LA 3PM9A 4K2XA 1RXOB 1VBXA 4M5IA 3IR7B 3KK1B 3RR8A 3UN2A 3QFHA 4F4ZA 4KAIA 4WFZA 1FJGJ 3M9OB 3GU0A 2KRRA 3ZZRA 4RX6A 2KFZA 4DSKA 3PHTA 4O4RA 3UCGA 6FD1A 1RYRA 2A2DA 4C0OC 2FHOB 1FF2A 2DXFA 1ZAXA 2ZDOA 2C42A 3BS9A 4CH1A 3K5LA 3MPUB 1OSCA 1VJWA 1U6FA 2YX7A 3DLEB 1EAYC 2B51A 3AOBA 1I1GA 5C24A 2CWKA 4QR2A 3UNGC 1R0AA 2OKQA 2UUAJ 4C48A 1Y3KA 4CI0B 4WFXA 3V4IB 3IWLA 5DDQC 4GO5X 5C5JA 4CDIA 4CTAA 2VD3A 4FP9A 3DRYA 4Q44A 2CNKB 4MTPA 4PYDA 1TKTA 2CXEA 3A8KA 1YJWS 2K8GA 4DQSA 3KJVB 4NZ0A 4WCEQ 5HJYA 2NXJA 3KHGA 2WK4A 2VF3A 4K4VA 2DNNA 4DCJB 5KFSA 2YNIA 1ZM4A 5H9FK 1N5SA 2OI2A 2O67A 3PFOA 1SJ4P 2ZOGA 3MR2A 2DT9A 1MNEA 4WWSA 3G6ES 3CDWA 1R89A 2JJ4D 2WSEC 2HQ3A 1H74A 1HNWJ 1HNZF 3R6GB 1FKPA 2XMMA 4DXLA 4JV5J 1N5QA 2P6SA 2DKOB 3RBXA 2DH7A 5KFEA 5JVHQ 1QTMA 5LMNJ 1OSDA 4DR5J 1HR0F 5B0DA 2E1MC 1NHUA 1S0OA 2UVVA 2M5YA 4EZ9A 4OIXA 2V8HA 2HK2A 3DRSA 2E5LF 2OFHX 1GNKA 5J2QA 1VIXA 5IT4A 3QRPA 2MGZA 1HD0A 1PYSB 2FZKB 4JV2A 3AD9C 3VGVA 2B8PA 4UQTA 3CCJS 4LRDA 4NA1A 4AL6A 1NKCA 2DXEA 5H9EK 1JKHB 4OYBA 2LQBA 5F8JA 4FZVA 4IG0B 1N5YB 4YHHF 3I5CA 4ECTA 3AD7C 1B7YB 1CVJA 4DV3F 2QO3A 1FNXH 2YNHA 3BSCA 2DNQA 3Q22A 1S76D 1YK9A 5DQIA 2MKHA 1BQMB 3I5AA 4R0EA 4JI8F 3CDUA 1JIHA 3EVWA 4EO8A 2HQGA 3Q2TC 2M8HA 1SV5A 4WP8A 5E3QA 4A8SA 5IQ6A 3MR6A 1T9TA 2LEBA 4LMZA 4LF9F 2LKZA 4RNFA 1AB8A 3IC1A 2B4VA 4V1Ak 2HBYB 4X4PA 4PXBA 2R2RA 4DR7F 4J9UE 4FBUA 1CJKB 3PO4A 1HPZB 2VG6A 1ZYQA 2Q79A 1OPIA 3DGPB 2Z8QA 4GRSA 4DV4J 3QPIA 4I6AA 1F2GA 1IKXA 1RWPB 3UDVA 3LUYA 1VCTA 4EGLA 3GQCA 3KNGA 4ZPAA 1KLNA 2ZE2B 2W4PA 3HVRA 4DR6F 4TLQA 3W2VB 1WOOA 4DLGA 1ZH5A 4DQPA 3FBCA 2HHHJ 1FRJA 3NBPB 4AT1B 1RT6A 3JAMU 4MKYA 3GSIA 2MYFA 2C3OA 3UCUP 4OYOA 1P6TA 3H5YA 5ETTA 2F1FA 3H7HB 3G82B 4K50A 4KO0A 3C16A 4ZVQB 4ENOA 3MR7A 1ZS6A 2XBPA 4TNOA 1U1RA 2DNZA 3E3XA 3ZZTA 4O3RA 4DL7A 2BQUA 5AE2A 1Q7YT 4NLQA 3NS7B 4OYZA 1FRLA 2HNZB 1IBKF 2V4RA 1YHQS 3N5BA 1NK8A 2GGPB 4DPYA 2V50A 1RI7A 3OL6A 2IRYA 4LR7A 4CLZA 2E1PA 3SXLA 5IM0B 3PG9A 3D6FB 1M5VC 1EX8A 4DV7J 2J8SA 1RWWB 4DX7A 3BN7A 4DUTA 1UVLA 1RLCL 5H1SV 4IG3B 5B09A 1TFWA 2ZBQA 3G8TA 4C98A 4DLEA 1OYDA 4J9SA 2FHJA 2XCPA 3DM2A 3E01A 2NCKL 5A8WB 2XEXA 4OZNA 5CH7B 2ZH2A 3EGVA 3DRRA 5LSOA 1RSCA 2AJ4A 1T95A 1RCOB 4YDXA 2B4PA 2R8HA 3SSRA 5T41A 4ETXA 5CYQB 3IBWA 1W2BR 2VQEJ 3BKFA 4UTGA 3L7OA 3BBFA 1KHVA 1RBAA 1XMBA 2C1EB 3EWGA 1EZZB 2OEJA 1Z2LA 1V3ZA 1WF1A 4IFYA 3T9NA 1FXRA 3GJRB 2DNYA 4CT8A 5KG5A 4KFBB 3PKMA 4LBIA 1VRTA 3AB4B 4X64F 2YKAA 2WB4A 1PAUB 1RK8A 5IC6B 3OR2A 4LFAJ 1NHKL 2R8KA 4WIIA 1VIOA 2X1BA 4OZ5A 4ZLPA 3TVYA 3C6TA 2RHSB 2Y3YA 4B17A 4Q5VA 2GAGC 5DM7Q 1LK5A 1VQLS 4DWIA 2F4VF 1FDAA 2K1RA 4C11A 3CTRA 3CD6S 3UQSA 3K0JA 3PYFA 4RW4A 4NLUA 1DAXA 4P73A 4N41A 2DPIA 2NSBA 4U8YA 2AP6A 5L39A 3HP6A 2JX2A 5E0OA 3CT9A 3PRDA 3IP0A 2J0QD 2MLYA 3OR1A 2M0GB 3GG1A 4JI6J 2IYIA 2XYGB 4DUYF 4WZMA 1WSVA 3AOAA 3LH2S 1P9YA 4Y34A 3BPSP 4RW8A 4U67Q 3TEHB 2GS8A 2L3MA 2UV8A 1KQGB 1U47A 4CP5A 2KDOA 2AD9A 3LAMA 4N5SA 3I5BA 3UO0A 4I6YA 2LDYA 3DMJB 3KLEA 2QC3A 4LT6A 2CJKA 2HAFA 4UF4A 4DZ6A 3THPA 4B3MF 4ZPWR 1GMWD 3QO9B 1CJVA 2N3LA 2FLOA 3I56S 2ZVIA 3TP2A 4J9OA 4IDKB 1LV5A 3JQJA 2BUNA 2OIHA 1XR5A 3ETOA 1N33F 2L9WA 2QA4G 1LXNA 4WFAQ 3EXYA 2P2CB 3L09A 3DRPA 3X3UA 4LSNA 2PSZA 1D9FA 4LVOP 4ZPBA 4DFPA 3O2IA 1FRIA 1Y10A 1XERA 2KL8A 3FRYA 1J27A 3CCWA 2CDQA 1G1XA 3S01A 1ZPVA 4C4WA 3L9ZA 4ZDNA 2ZZNA 3ELHA 2Z2YB 3KUHA 4LF8F 2C2OB 5KFAA 3FZBA 3CF5Q 2RVJA 1YJUA 2AEFA 2UZAA 1OY6A 4M5KA 1TK0A 5C24B 3R8YA 2VFVA 1GMWA 1R0AB 5B0EA 1ZZNA 3GJTB 2CZ9A 4K8RA 1JB0C 1UMJA 2D69A 5F8GA 1O0PA 4DR2F 1SUQB 1OYEA 4N8OA 2Z56B 2Z2LA 4YN3B 4CNYA 4CTAB 2CG4A 1NO8A 3LW5C 2V6AA 5IC4B 3I32A 2E7VA 3RRKA 1TKTB 1AT1B 1FRMA 2ILZA 2NYIA 1IJFB 4OFZA 3RRGA 4DR3J 1TMJA 1WC5A 2Y0BB 5DDOC 1WTFA 5CQGA 2M8DB 4E98A 5E41A 5C42A 3CE8A 2YNIB 5ETVA 3CJTA 2JLEA 2DHGA 1E6YA 1S79A 3TR5A 2HFZA 1V5IB 2EW9A 2QLBB 1F3FA 5HL7Q 2CPIA 4NLGA 2M88A 1GK8A 3J81j 3GIJA 1WKJA 2LQJA 2PD1A 1Q81T 1FKPB 2ALYB 4DL2A 1CJUB 3K89A 1QE1A 3AJDA 3RRHA 2ASJA 2I1RA 3VCDA 2GC8A 3DXBA 3EICA 3G71S 3BKTA 2V69A 1W25A 3LAKA 2BE2A 2M2BA 4CWBA 4ZP9A 4AQYF 2ATCB 2K3KA 3BGUA 3JYTA 3FSYA 3ZTPA 5KFDA 3CCLS 5CAAA 5J2QB 4DX8H 3CNQP
chains in the Genus database with same CATH topology
4I2PB 2UUTA 1F60B 3MECA 3OTBA 5AXMA 1YRXA 5A6PA 2MGZB 1TKZA 2BR0A 5DG9A 1XR7A 1R8BA 3NLCA 3JSRA 2AJ1A 2WW8A 1HBMB 2YWEA 2XGPA 1TL1A 2OO4A 2XI2A 4OX8A 2BANB 4IUFA 3OTDA 5E3CA 2YTCA 1Q8BA 2FJWA 1CSJA 1VQ7S 1TKDA 1YRTA 4NMLA 3H5UA 4QIWD 1XN9A 5I4MA 2DB1A 4NZ7A 1OO0B 3BO4A 2UU9F 3D1HA 3O8WA 3HHNB 5EGYA 2OD4A 3MM8B 1IQZA 4F3QA 2LXUA 5GAGU 1DZ5A 3BGLA 3JAMY 4I69A 4F4WA 1SBRA 4TXSA 1JLBA 5LT5A 2HGNA 3H59A 1DTQA 2HFNA 1Q1KA 3BSAA 3FCHA 5EX0A 5KFJA 4IQXA 3CJ0A 4NLYA 1K0VA 1DQ8A 4PWDB 4H4KA 1FVSA 1QM9A 4ZPDA 3T1AA 3UW1A 4V19X 2L9DA 2YNHB 1BQNA 5GADU 5THWA 5KOXA 5DO2A 4ED7A 4O0IA 3SV4A 1Q7LB 3R5BA 1HW9A 2IAJA 1RTJB 2WONB 3NAHA 1RT1B 1U09A 2CKWA 2JFKA 4NLWA 5EWEA 2AJ0A 2X1GA 2VL1A 4A8FA 1H6KX 2CPXA 3M8QA 4ZK7M 4QPXA 3KLFB 3MHYA 5HBMB 3UD3P 4Y28C 1GH8A 2IM3A 3D0HE 1ULRA 1UVKA 2XLKA 1IKYB 1KFDA 2KFNA 4RU2A 5B08A 4KKOA 2OPSA 4G6VB 1SV5B 3I96A 4LIWA 5IT0A 3CC4S 3HPOA 3VF0B 4ELVA 1JLFB 1U25A 2FB0A 3I0SA 1OS5A 3J81Y 1F5CA 3CVKA 2AGPA 2EG2A 3AB2B 3IRWP 2W8LA 1HD1A 1JLAA 5CCLA 1HWUA 1VFJA 3O5TB 2XMWA 1RT4B 4Z37A 4K4TA 2PMHA 4ECQA 2RRBA 5H9FJ 2XO7A 1QLNA 2DNRA 3UPFA 4OI6A 1FNOA 2E7WA 2HQIA 1NK9A 1QUPA 2P9GA 4ZP7A 4TQRA 4TU8A 4ZP8A 4MK9A 4DV6F 3B78A 2IRXA 3LWMA 3BR8A 4LIRA 5FJ4A 1EP4A 1KS2A 2DIUA 2YKPA 3JTNA 2BXJA 4I56A 2FHJD 2A18A 2HGMA 2ROPA 3AY0A 2KG0A 4M95A 1G2EA 3GV5B 4OI4A 5K9FA 2XHWA 4DG1A 2IHR1 2B3TB 5G0RA 3TUIC 1UFWA 1FK9A 1SI9A 1GAOA 2AV5A 3MM9A 3DNCA 2IRUA 3S7RA 1G6BA 5F9NA 1M1KT 1SJRA 2VG6B 1X0PA 2GGPA 4DR3F 1KVJA 3MFIA 1LFWA 3T19A 2IC3A 1ZM9A 2F8HA 2E5HA 1Y00A 5DG8A 2BRLA 2N82B 3E2EA 3IA0A 1YGYA 4YB7A 1XEZA 5KFRA 2VUGA 1IKXB 2IVMA 4WXWA 2V4JA 3PIPQ 1I6JA 5D3GA 1C0UB 4NL5A 5DGAA 3D1QA 2BABA 4DL6A 4JOUA 1LW2A 1H7XA 3FRZA 1N52B 4YQWA 2R4FA 3J7YU 5I42A 4IOAQ 1C1BA 3MXHP 1APSA 3M1VA 4ED6A 4EBCA 3OTEA 2KTQA 4X4NA 1E6VB 2DHXA 4WFBQ 2OAUA 5BYQA 4CO1A 4DL0C 3ZZZA 3MMAA 4C0HA 5T7LA 4CO5A 4HT7A 3MMCA 2IBOA 2MQMA 3MM5A 4JV1A 1WEZA 2YNFA 5KAKA 1EETA 4H4MB 1JLEB 2APOA 1X4HA 4H4KC 4CO0A 1R8PA 2VC0A 2Q3PA 1RKIA 5HLFA 1AROP 3MOZA 3E51A 5DLGA 1N6QA 4PQUB 7FD1A 1SJ3P 3FFIA 2DNKA 2RD5C 4HTJA 5CZVA 5KFHA 5M2RA 3HK2A 1HNIB 3M2UA 3VAIA 4WE1A 2YX1A 1FEEA 3G6YA 3I4HX 1D8YA 4Y2AA 1S1WB 5J1NA 3L7PA 1U45A 5K8NA 5H9EJ 4WYLA 2ADBA 2DGWA 4XO0A 1JK9B 5C25B 1RT7B 2R7VA 2JZ5A 5KT3A 1LQ9A 3VAMA 1AW0A 3HVAA 3T1HF 4KSEB 2ZOFA 2KHDA 3PR4A 2EC0A 2ZBCA 5M2PA 3BJYA 2V9KA 1LW0A 5HP1B 1HFEL 5B7WA 2EFQA 4KO0B 1VBYA 1Y4ZB 1MU2A 2CQPA 1H38A 2Q43A 5T14A 4TY9A 1RA7A 3OVSA 2RMLA 1VQYA 4AL5A 1S77D 5D4OA 2RJZA 4PUOA 1XWLA 5ADZA 2GV1A 1NH7A 1WEXA 1SIWB 3H25A 3GWCA 3H40A 1HQUA 4W92B 1RTHA 1Y7PA 2YY3A 4XK8C 1WHXA 2QMXA 1UA1A 4NPOA 1N56A 4J9RA 3IWXA 3H8YA 3EPGA 4PXEA 5DM6Q 2HYIB 4PG4A 1FA0A 4DJBA 3PR5B 3N4WA 1TZ0A 3SSQA 4U6PA 4QWAA 4CQ1A 3SI8A 2MZTA 1U26A 3H2LA 4ZOSA 3TARA 1PO6A 3IGVA 4ES2A 2I5JA 3A8EA 2JEGA 2CPDA 4RBUA 2IJNA 2MQLA 1FDBA 2YX4A 3K58A 1VQMS 3T1YF 1WI6A 2KXFA 3O3LA 1DRZA 2BVZA 4N76A 2K2PA 3WDOA 3PRBA 2FJBB 2ZH6A 2HLTA 3K59A 4DL4A 1D9DA 5KT5A 3CCES 2DVIA 3DLBA 2OPQA 2NR0A 4GO7X 4RW9A 2HMIA 4UQGA 1FE0A 5DGBA 4YR3A 2UXCF 3HJFA 1U49A 3T6BA 4ECWA 1QAIA 2A1BA 2R9LA 1D1UA 1QSLA 2CYYA 4L6V3 3NG8A 4M5DA 2W9CB 2GHWA 2J7KA 1TK8A 2AJFE 5D78A 1I94F 4J9KA 2YKNA 3MD3A 3MCSA 2VASA 1RA6A 1ZAVA 3DM2B 4KTQA 3E01B 1JJ4A 1R8HA 2B6AB 4CO4A 1IJEB 1YJRA 4ZHRB 4P7VA 3KG4A 3VTIA 1GX6A 3THVA 2DO0A 2KM8B 3KK1A 1Y5NB 3BGRB 1HMVB 1U1PA 1N4LA 4LQ9A 3GYXB 4DSIA 5KFXA 4DQRA 1HBOB 4X4RA 2PEHA 1TP7A 1HQEB 2IVYA 1XMOF 1SH0A 2VOPA 2ASLA 2FLLA 3NMRA 4ELUA 4KB7A 1YQHA 4M1KA 2VKZG 4ID5A 4DEZA 1C0TB 1RAJA 3KK2B 2ROGA 3ONQA 3RAXA 3HHLB 4LQ3A 4Q2LA 2J8AA 4QQBA 3ENVA 3OQ2A 3H2VE 2CZ4A 1XNQF 2E5JA 4CT9A 1VGYA 1VQPS 1KRPA 4EUVA 4IFYB 3QYYA 2JL9A 1F0XA 2O3DA 3U27A 2IFXA 5MLCV 1VHFA 2J0SD 2ACYA 2V2KA 1FKOA 4K5SA 3D0GE 2QE5A 4M8LA 2ZBIA 1VRTB 4OJ3A 4IOCQ 1ZAWA 5A2QY 2DNOA 2ZJRQ 3KG0A 3SYZA 3M8PB 3RBDA 2BZ2A 3DN9A 2DHSA 1A7GE 3OR2B 2IA0A 4MYTA 3MEEB 5F0WA 1WACA 4DL3A 1U24A 3W2WA 2V8VA 3C6TB 4IDKA 3RB4A 2ABYA 4EO6A 1TFYA 1TL4A 1R31A 3DLEA 2DIVA 2W9BA 2K1RB 2FJEB 2HVIA 4C11B 3HHEA 2Q6CA 3M05A 4DMZA 3CC2S 4A8KA 2Q66A 4MFBB 1K0TA 4RW4B 4ILRA 1UAWA 2NQPA 1YSJA 3M4XA 1S1VB 3RB3A 2RF2B 4JI4F 2GO8A 3FEXB 4IH5A 4OLOA 2EBGA 3GFXA 5A0YB 3KLHA 1NJIT 2DR7A 2FJXA 4KHMA 1BGXT 1V3RA 4ECRA 2Z0GA 2W9AA 3OFHA 2XY7A 3NCPA 2DNLA 3O6QA 4UY85 3KLIB 3MTKA 1NH8A 4QZVB 4ZKAA 4X4OA 2MKIA 1T05A 1BC6A 2IM1A 3QWUA 3CCVS 1U2RA 3FEYB 3V4IA 4OZJA 1L5UA 5HI7A 3OR1B 1Q8LA 2WB1D 3M32B 1VQ5S 5LSLA 4OV1A 2J0WA 4PG5A 3OXFA 1IXKA 3OJSA 2A2CA 4NZ6A 1IM4A 2E9ZA 3MOJB 4YR0A 1GX5A 3OFEA 2I9SA 2OMLA 3OFFA 4G1IA 4FYDA 2R8IA 5CZXA 3M6VA 3TYTA 1HNXF 4QPTA 3I9ZA 3BQ0A 2V9WA 3K5PA 1T8EA 4BBYA