1U1RA

Crystal structure of up1 complexed with d(ttagggttag(2pr)g); a human telomeric repeat containing 2-aminopurine
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
183
structure length
183
Chain Sequence
b'KEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*TP*AP*GP*GP*GP*TP*TP*AP*GP*(2PR)P*G)-3'
publication title Human UP1 as a Model for Understanding Purine Recognition in the Family of Proteins Containing the RNA Recognition Motif (RRM).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein/dna
total genus 51
structure length 183
sequence length 183
ec nomenclature
pdb deposition date 2004-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1u1rA01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1u1rA02
1CVJA 2JX2A 4WCEQ 2FY1A 2DNOA 5D77A 5GMKa 1SJQA 4OZ1A 1VQ8S 2DNPA 2DNYA 1DBDA 1WG1A 2MSSA 3H2UB 2KT5A 3VF0B 1WI6A 3R1HA 3US5A 1WEXA 1FNXH 1U6BA 2ADBA 3VAFA 2CPJA 1Q82T 2HGMA 1WWHA 2LEAA 4Z2XA 2KU7A 2DIVA 3ZZYA 3RW6A 1X4CA 1YI2S 4QU7A 4YUDA 1VBZA 2DNRA 3TP2A 2KFYA 1FT8A 2XS2A 1M5OC 2ZJRQ 1VQNS 2F9DA 3VAHA 4WF9Q 1VQPS 2YKAA 4QQBA 1AUDA 1VQ5S 2MPUA 5BJRA 2CQPA 4UQTA 2PE8A 4ZKAA 3PIOQ 5GADU 5LXYA 3BS9A 2N7CA 2HYIB 3U1LA 3Q2TC 2J0SD 1YJNS 2RT3A 5IM0A 5DM6Q 2OJ3A 3I56S 1QM9A 2X1GA 2FPHX 2YTCA 2DB1A 2I38A 1H2UX 2Q79A 1YJ9S 3G71S 2MZJA 3UWTA 1X4EA 2M9KA 1OIAA 1NO8A 2AYBA 2DGWA 1FJ7A 3BO4A 2QA4S 1YWXA 2KI2A 2MQLA 2M88A 1N54B 2K8GA 2DNNA 2N82B 2LKZA 3MURP 1U6FA 2LECA 2F9JA 1PGZA 3CMAS 4CH0S 4V19X 5LSOA 3CUNA 4LMZA 4TU8A 2RQ4A 1UAWA 3J7YU 2MZTA 2MY8A 4YB1P 3G8SA 3P49B 3SDEA 1FHTA 4C0OC 2MKIA 2DNKA 4Y00A 1WHYA 2CQ1A 3VAIA 2KXFA 2JVRA 2D9PA 2E5JA 4WIIA 2F3JA 2V94A 5HO4A 2CPFA 2DH7A 2L08A 2DGXA 1VQ7S 3EGNA 2DGOA 1U1KA 3MUMP 2QEXS 2KHCA 2XNQA 1DZ5A 1H2VZ 3I55S 4IUFA 1M5PC 1VC0A 3G6ES 3DLLQ 2DGUA 2CQGA 3CCRS 1FJCA 3CCMS 4PKDB 3MD1A 2DGTA 4C4WA 1A9NB 2CQ3A 1H6KX 3CMES 2MQNA 2DGSA 2LA6A 5H1SV 3UCZP 2RNEA 5ITHA 1RKJA 2MZSA 1RK8A 2G0CA 1ZH5A 2MMYA 2KN4A 3VAGA 3CC2S 1ZZNA 5LJ5Y 2DHSA 2YWKA 3S01A 3MDFA 2MQOA 2CQBA 2E5IA 2XS7A 3MUTP 1NJIT 1KOOA 3THTA 1N8RT 1L3KA 3THPA 4A8XA 1G2EA 5DDQC 2DO4A 2RS8A 2LYVA 1X5OA 2DITA 2PEHA 3CCES 3V4MA 1X4DA 2JVOA 5JVHQ 3NS5A 1UW4A 1FJEB 4W90B 5CYJA 1BY9A 2K3KA 1KD1T 2AYMA 1X0FA 1YIJS 1U1PA 1M5VC 2SXLA 2E44A 2OTJS 2MQPA 2CPXA 1R8PA 3NNHA 3HI9A 3NMRA 1B7FA 1X4AA 1PO6A 2DHAA 2KRBA 5CA5A 1N88A 2FC9A 2MQMA 3MOJB 2KYXA 2RU3A 3S8SA 2KM8C 1HL6A 2DGVA 4BS2A 2DNLA 2EVZA 3K0JA 4PRFA 2MKCA 2WBRA 3BO3A 1Q81T 4F02A 1WHXA 4OZ0A 2CPEA 2MZ1A 2BZ2A 3P5TL 5GVQA 3CULA 5LJ3Y 1JJHA 4YOEA 1WELA 1R8HA 4IO9Q 2JRSA 3CCLS 2GO9A 2ADCA 2DNHA 2ERRA 3UE2A 3LQVA 2MY7A 3BEGB 2J76E 2OIHA 2M52A 3S6EA 1YHQS 1FO1A 2CPDA 4P6QA 2MZQA 1VQOS 3B4DA 1W2BR 3MI7X 1VQ9S 1VQ6S 3FEXB 2G4BA 2CPZA 1SJRA 2XSFA 3R1LA 2NLWA 1YITS 3P6YC 1QVGR 1H2TZ 3RW7A 1N52B 3MUVP 2EK1A 1Q7YT 4F26A 2CQ4A 2D9OA 2ZJPQ 3SXLA 2I2YA 2EK6A 1M5KC 1KQSR 2HGNA 4IOCQ 1VBXA 2DGQA 1VQKS 1WI8A 3TYTA 1D9AA 2L41A 2M7SA 1HD0A 2MSTA 1X5TA 2RQCA 2LQ5A 5FJ4A 2DNMA 3IRWP 4WKRA 3Q2SC 2HZCA 1JMTA 3MD3A 2UP1A 1QVFR 4ERDA 2MQQA 4TU7A 2DISA 1VQLS 2CPYA 4QU6A 1JJ4A 1YJWS 5IM0B 4M5DB 1X4GA 5DDOC 2LEBA 4LJMA 3NS6A 1U1QA 1S72S 2E5GA 3CCJS 1O0PA 2KXNB 4IOAQ 1VQMS 5EN1A 2MGZA 3VAKA 2M8DB 2LXUA 2MKSA 1U1LA 4Y0FA 5CXTA 2L9WA 4J5OA 3LPYA 2KM8B 3NNCA 5IFMA 3ULHA 2MKJA 1F9FA 4CH1A 3CCSS 1A7GE 5DDRC 2GHPA 2CPHA 3B4MA 5GAHU 2LCWA 1M90T 2LA4A 1HA1A 3CTRA 1WHWA 1U2FA 2G1DA 2E5HA 1X5PA 3MXHP 3SDEB 1X4BA 1UFWA 2XNRA 3JB9k 2N3LA 3J7ZT 3ZZZA 3CCQS 2X1AA 3CPWR 2AD9A 3CC7S 2DNGA 1U1MA 2KVIA 3G4SS 2KRRA 1JJ2R 4U67Q 1X5SA 2MJUA 2OSRA 2MYFA 2JWNA 1WF2A 1KC8T 1U1OA 1OO0B 3UCUP 5JVGQ 5DDPC 3CC4S 2RRBA 3PIPQ 2MGZB 2BOPA 2VOPA 3VAMA 2X1BA 2VOOA 1FXLA 2X1FA 4WFBQ 3FEYB 2RRAA 1WG4A 2A3JA 1WTBA 2DIUA 1OWXA 5LXRA 2CQIA 2OTLS 1P27B 1OPIA 3SMZA 1SJFA 4W92B 1WEYA 2LXIA 5D78A 1WHVA 2KH9A 2MZRA 2DHXA 2U2FA 2AYEA 4QPTA 2YH0A 3HHNB 2N3OA 2DH9A 2XB2D 1VC5A 3S7RA 2DNQA 4WFAQ 3CCUS 1K8AT 3CD6S 4RU2A 1URNA 2CQCA 2CQHA 5IQQA 1X4HA 2FHOB 2VONA 5GAEU 2RUGA 2O3DA 1WEZA 3IWNC 4LIRA 3H2VE 2CJKA 2NZ4A 3N9UC 1U1NA 2B0GA 2CQ0A 4FXVA 2HVZA 2KG0A 2M0GB 5GAGU 4CQ1A 2MB0B 3NNAA 4CIOA 2XS5A 1KOHA 4EGLA 2LMIA 2FC8A 4C7QA 1XN9A 1VQ4S 1IQTA 1Q86T 1S79A 1SXLA 2DK2A 2ZJQQ 3UCGA 3G96A 1P1TA 2MXYA 1HD1A 2DO0A 1ZZFA 1NU4A 3OW2R 1YTYA 4ED5A 1WF0A 3EGZA 1K73T 1U1RA 5MLCV 5DETA 3U1MA 3G9CA 4TU9A 3TO8A 2DHGA 4TLQA 1K9MT 3CCVS 2M4MA 2MHNA 1VC6A 1DRZA 2KG1A 2J0QD 1VBYA 2CQ2A 5LSLA 2AYGA 2DH8A 1X4FA 2CQDA 2DNZA 2RVJA 3P3DA 2QFJA 3UD3P 1SJ3P 3UD4P 4F25A 2J8AA 2RS2A 1M1KT 2MJNA 2MKHA 2KXHA 1UP1A 2M70A 3BO2A 5HL7Q 3CXCR 3D2WA 4WFNQ 3R27A 3EX7B 2M2BA 3G8TA 1SJ4P 2M8HA 3CF5Q 3L3CA 1DHMA 2MKKA 1D8ZA 2YH1A 5DM7Q 2OSQA 1WF1A 2U1AA 3VALA 2D3OR 3VAJA 4UY8T 2HGLA 3DXBA 2VODA 2CPIA 1WG5A 4FXWA 4PR6A
chains in the Genus database with same CATH superfamily
4WCEQ 5D15A 3U02A 1DBDA 3V2UC 1W26A 3M32A 3KK3B 3H2LA 2HNZA 1M0SA 1P6TA 3C14B 1LFWA 1KFSA 2B4OA 1UZHA 4RW9B 2UUAF 3H98A 4ED8A 2YKAA 4ZVRB 1HNZJ 3ELHA 1NK6A 4KO0A 4R5PB 1NK5A 2XLJA 1UCNA 3PJWA 1RU2A 1BGXT 1SV5B 3FMWA 5E41A 4OHXA 2AZ1A 5ETLA 1V3ZA 2M88A 2K8GA 1EAYC 3ENQA 5AE3A 2D3ZA 1H7WA 4TU8A 3J7YU 2CJYB 3RYLA 3W3SA 1QSLA 1KHVA 4OHZA 4JI1J 4Y2KA 2KXFA 2ZWOA 4M8LA 4DL3A 4MAKA 1U1KA 1HMVA 4EBEA 3CJ0A 1NDPA 3G6ES 5EX0A 3KHRA 3CCTA 4CLTA 1LKZA 2R7VA 4X65J 4DL0C 1QAJA 4KKOA 4PPDA 2YWKA 3I9V9 5LJ5Y 2KKHA 2HHVA 3LP2B 3KJNB 4A8XA 3CCES 3IC1A 1B70B 4J37A 2RHSB 1K0TA 4F4YA 5CYQB 1T9YA 2VPWB 4OX7A 3Q8RB 1YIJS 1M5VC 1B4SA 3M1VA 2BM0A 2Z58B 3ET6A 4DSKA 2YBVA 2JFKA 3J7YI 4K5SA 2VDHA 3S8SA 1WDDA 1ITPA 3T5LA 1N32F 2B5JB 4ZLNA 1S1WA 1YGYA 3TAMA 2FJEB 3OR1B 4QIWD 4CZCA 4X2BA 2W2QP 1FO1A 2Z2MA 4P6QA 4LF1A 3G8QA 1TUVA 2HHSA 3RB3A 3TOQA 2AEJA 2LQJA 3KNGA 2XMWA 1KQSR 2DGQA 1TVRA 3MEKA 4FYVB 3D54A 3AAWB 5JUMA 2LQ5A 4YQWA 2BM1A 2RILA 2CG4A 1RA6A 3Q2SC 4NOHA 1RGVA 2DISA 1HNXJ 3HSZA 4KQZA 4NI2A 3KLIB 1P1LA 4OYMA 2OLWA 1RZMA 2GC8A 4WK1A 3LO3A 3CD7A 2W9AA 4NLOA 3QIPB 1V6HA 2FLNA 4DS5A 2H5JB 2N4CA 3ULHA 2MKJA 4YY3J 3AJ1A 2OD6A 2LCWA 3GFZA 1ZETA 1FRJA 1JKHA 1B0VA 5K20B 1VDHA 1P9YA 4DLGA 1JJ2R 1YZ7A 4M5KA 5DZ7A 4ZP9A 4F0HA 5JVGQ 2XGPA 4LREA 4B02A 1VISA 4BBYA 4X4OA 3HSDA 3CJRA 3GJQB 4KSEB 1SJFA 3KUHA 3KLEA 3V6DB 1KR4A 1RWMB 2LU1A 1Q53A 3H0PA 3T9ZA 3BN7A 5D4OA 1X4HA 2AJ0A 1UVLA 4CO3A 4NLWA 3PW4A 1UVKA 2HIQA 1QDUB 2BXJA 3VQSA 5GAGU 4CQ1A 1S6QB 1VJQA 4B3TJ 2H54B 4RJVA 5ETNA 1IQTA 1Q86T 1KBRA 2PD1A 5KFDA 3RRGA 2NQPA 2QGFB 2X3DA 2Y1LB 1LXNA 1WF0A 1K73T 1WC4A 3TX8A 2XHWA 3TARA 2IJNA 1K9MT 5AJ3F 3EDRB 3QT7A 5D0GA 2E5LJ 4QIVA 3QPIA 2RVJA 2YXLA 3NEKA 1S0NA 3EVMA 5F3TA 2J8AA 4ECTA 1ACMB 2OMOA 5ETVA 3MZIA 2YWWA 1F1BB 2BANB 5HL7Q 1UETA 1PYTA 2QLWA 2DD8S 5C24B 3HHDA 5AXKA 1H0HB 1RUSA 4OV1A 4X66J 1CVJA 2JX2A 5D77A 1AT1B 1SJQA 5GAGI 1RDRA 2BUNA 2ADBA 3NS7B 4Y2AA 2G9OA 4CNZA 2O1PA 4C8YA 2FY8A 3RW6A 1NUEA 4ILMA 2O67A 2KFYA 1FT8A 1IKWB 2C3MA 4HL9A 3K7RA 3G6YA 4J9PA 2OPPA 5IM0A 1QM9A 2X1GA 2BE9B 3GFXA 1D0EA 3KFWX 5FDLA 4LVOP 2QA4S 5KG1A 4GC6A 2ZITA 4ECVA 2DT9A 3KG4A 1EETB 2B9WA 3CUNA 2BE2B 3CJ4A 2MZTA 3QATA 5A0YA 3P49B 3GFHA 2B6AB 1NRKA 1FWKA 4FS1A 3AOCA 1ZAXA 3EWGA 3TVYA 3NCQA 2E1CA 2KFZA 3W63A 4DV2J 3ZTQA 2AJQA 2CQGA 3SQOP 4AXIA 1A9NB 2C2OB 1UWBB 1HHQA 4NE9C 2KN4A 3M05A 2AGOA 1JWWA 2B43A 2MQOA 4O3NA 3KLVA 2XS7A 3FK4A 4J9UE 2PEHA 1GTEA 2NUHA 3OTDA 2RQKA 3T6JA 3CT9A 2GGPB 5A2QU 1SH0A 1S9EA 4IRKA 3NNHA 3TX0A 2Q43A 3UI3A 1Y9OA 2PI5A 1RQ0A 1PJ6A 4OV6A 1AW0A 1RTJB 2MKCA 2RB7A 1N5VA 1Q79A 5F8LA 3MHYA 4X64F 1HNIB 3CW2C 4ZCKA 1R8HA 3OTCA 2GO9A 2UZAA 4OZ2A 3M9NB 1MWQA 1TV6B 2IHR1 2QIFA 5ETQA 1RWVB 3T1HF 2XSFA 2IA6A 2FLOA 1U8WA 1QVGR 2VC0A 1Q7YT 3CB4A 2VZ9A 5HROA 2WBMA 2WONA 3BB5A 2I2YA 5DG8A 2H4YB 1UMJA 4EBDA 3KLHB 2JLGA 4LF6J 3IM9A 4F4ZA 3BSOA 4FDFA 3WHIA 2A1BA 3KWMA 2JHEA 2B4PA 1R6YA 1XWLA 3BYPA 4AQYJ 1J5OA 3FCVA 5CYMA 3DRYA 2DR6A 3O6QA 4J5OA 4RNFA 2RQMA 3L7OA 1YSJA 4ZLPA 4OJ1A 3LAKA 1O8BA 3Q8VA 2YQ0A 3CCSS 4JI3F 2KDOA 5I3UB 4KB7A 5F8IA 2AJ1A 1RE1B 2BKNA 1U2FA 3R3TA 4LFAJ 5DS7A 4ZJQA 1S1UA 2FZKB 4OI1A 1RT2B 2XULA 3ZZZA 1HNVA 4DSFA 2IRYA 5ETSA 1Y5LB 3O3LA 2UUTA 2VFRA 1XNRF 1TU0B 4OJHA 2WSFC 4KGZB 4HKQA 2ZH5A 4IH6A 1KTQA 4KJIA 4QCLA 4OYBA 1KN6A 2VOPA 1FRIA 3BYRA 2GJ2A 5EWEA 3VR1A 4USHA 1OYEA 2GV1A 2X1FA 1RT4B 4K2JA 3HLUA 4CLSA 2UXBJ 2HFSA 1VOMA 4HACB 1HBMA 1RP5A 1HIYA 3EICA 2VG6A 4U96A 1WC0A 1O51A 1FNMA 5AE1A 4DR7F 4OHWA 4LBIA 4P2XA 2DYAA 2BYCA 2EFGA 1AZSA 5B0EA 4GMKA 4TYAA 3DOLB 5KFNA 2HW3A 1TKXB 3MECB 1RT6B 1S79A 5CZVA 1VRQC 3R9LA 1N33J 3DRRB 3R5GA 4CLUA 1IJFB 1B0TA 2K3IA 1UWAA 2BW2A 4TU9A 4F2RA 4CLYA 3MEEA 5J1PA 3TRGA 3AA9A 2FVQA 4C8ZA 1FI4A 3GLJA 3FCWA 2MJNA 2M70A 4WFNQ 4R5PA 3MEDA 3CF5Q 2VG5A 3K59A 2WK4A 1SV5A 2EFNA 1OS5A 4ETZA 1NMEB 1VQ8S 2DNPA 5HN0A 4OHYA 1SB6A 4Q43A 4NRTA 3BN4A 1FRXA 1EKRA 2HGMA 2LEAA 1SVDA 4JV5F 2ZUAA 1VBZA 2DNRA 2XMMA 3M8PA 3UN3A 2MDAA 4DXLA 4B3OA 3K17A 4ER8A 3D67A 5IT9U 3P8BB 4DLEA 1UFLA 2FPHX 2YTCA 1YJ9S 3HHLA 2Z56B 4DOZA 4LUBA 1MG7A 2Y9HA 4JI0J 4X84A 1XQIA 4YR0A 2AIRB 4PYAA 4I1TA 3LP2A 3EVWA 4OZ3A 4CH0S 5DG9A 3JS9A 5CYQA 3Q23A 2Z30B 3MAAB 2V4QA 4DV5F 2L08A 1WC1A 4CNYA 1FE4A 3GJRB 4W98A 3EUNA 2QEXS 2H48B 1LK7A 4X62J 1H6KX 2PSZA 2LA6A 1CLFA 2Y0BB 2UUBF 3V81B 5ITHA 1RKJA 1Q8LA 2F1FA 2B5JA 4B9VA 1LWEB 4URQU 4F04B 4ZIWA 2HWTA 2D3UA 5CH7B 2OHDA 2C2NA 3W64A 4DUZJ 2ALZA 1X4DA 3IRXB 2LQBA 4ALZA 2YWEA 1CBKA 3E8OA 2VPZB 3OXLA 2Y0SD 1LNQA 2HKEA 4OYXA 5KFVA 3NGTA 4TY9A 1TMJA 3C46A 4JV1A 3DU6A 5EGYA 2DR8A 2BOAA 2HNYB 4BS2A 1Q81T 2YKQA 3CJKA 1IN0A 1UVJA 2DKOB 2XMJA 2ROEA 4L73A 4EMDA 3V4IB 4F0MA 1FCAA 3IP0A 3KMQA 2XI2A 4CWBA 2YNGB 2MY7A 4ZITA 3HKWA 2EFPA 3M8RA 3HFVA 4Y34A 2CWXA 3I5BA 2W9BB 1JXEA 1VQ9S 5D3GB 1Q8BA 1SJRA 2XCAA 3RW7A 3DLGB 1M5KC 3QSIA 1N56A 1F60B 1J2VA 4L3KA 1HD0A 4P72A 1HW9A 4OYAA 5D0RA 1JLFA 2ZVIA 1JJ4A 3DLHA 4F4KA 3G86A 1F5AA 3NOCA 3NS6A 2H1YA 2J5AA 3MCOA 3O44A 3LW5C 2MKSA 3E3XA 4Y65A 5GMDA 5HK4A 2C2MB 4A8KA 2W4CA 2G2OA 2M5YA 2OPRB 3J80Y 2LA4A 2DRDA 4CO0A 9RUBA 1WHWA 1BQNB 4OLOA 1D8YA 4DEZA 3KLFB 3OFFA 5F9LA 4NZ6A 3V6DA 1XTZA 4RW4B 1TL7B 2R7XA 2ZVSA 3QRRA 1HQ2A 4UUWA 3MMAB 5L8RC 2KRRA 1DQ8A 1UEVA 4DV3J 2HHWA 1IXKA 3GE9A 3PM9A 1WSVA 2OPSB 1RKIA 3NCRA 2XZTB 2R7QA 4I68A 4USTA 2KL8A 1VK3A 3IM8A 1FKPB 4FP9A 5D4PA 3K5LA 1S1VB 1LWCA 3SMZA 5A8KB 1RHRB 3V6JA 2R8IA 3BPSP 1Q16B 4U8VA 3S7RA 2GO8A 4CM2A 3FNNA 4RU2A 2FHOB 1PC5A 3SYZA 4DSEA 2VBZA 1DTTB 5JXSA 2K06A 5EDWA 2BANA 3H5UA 4YHHJ 4IRCA 2BJ8A 3ILJA 3UNYA 3PVXA 5C24A 3DN9A 1RTIB 1ZBTA 1SXLA 3MFIA 1ZZFA 2IC3B 4P52A 2GIQA 4CO1A 1Y5NB 4FPIA 2J0XA 4JYAF 1KS2A 3VV2B 3TO8A 2FLPA 2DHGA 4WKYA 2J7UA 2CQDA 5BYRA 2ATCB 4ED6A 2L48A 4A8QA 1S9FA 2RS2A 4KGVB 4WK3A 5A2QY 5IV3A 4ICLB 3BO2A 4E8UA 3R27A 4OLPA 2VICA 3M8QA 2U1AA 2VODA 4DL5A 4FXWA 1YBTA 3GIMA 4OZ1A 1LWXA 4DPTA 3RZAA 2HPUA 2W2PP 4ZVPB 4IR1A 1WEXA 3FBEA 3TZXA 2BE2A 3WX8A 3RR8A 2KB2A 1YI2S 3A3NB 3HHEA 1VQNS 4K4ZA 2F9DA 2NXEA 5GMEA 1AUDA 2GA7A 2CQPA 2J0SD 4B3MJ 3PYGA 5HVGA 1N5YB 5HMWA 5F0UA 4C0BA 3QT8A 2DGWA 3T1YJ 4JI7F 3FFIA 4ILLA 4QWAA 2VQEJ 1VQSA 1OY6A 3W66A 2WZ1A 3OXGA 4YB7A 1QSSA 3I31A 3Q8PB 3C15B 3OVSA 2W2MP 3CJ5A 1EQMA 5IT0A 2I1RA 2GGPA 1R0AB 1FFSB 1RT7B 3F56A 3PRDA 5A8WB 1TELA 3EGNA 4MIWA 2BQ3A 3N5BA 4C9DA 2EPIA 1RTJA 2CQ3A 2DGSA 1FDDA 1SCJB 2D74B 5L1LA 1HNIA 2IBOA 3ZZUA 4QYZJ 2WW4A 4PWDA 1HQEA 4RW7B 5KFHA 3BSAA 4CDIA 1TV6A 2HFZA 1TKZB 3SSRA 4OJ3A 2Z4PA 1RCXB 3LAMA 4OI4A 3AD9C 2FJWA 2H3EB 2C3UA 2MQPA 2CPXA 3HHLC 3CDAA 3GIRA 4ILRA 4QYRA 2DHAA 2KRBA 5CA5A 4LF9F 1KONA 4WXOA 3MOJB 1HBNB 2BQRA 3M8WA 1T0TV 4DV6F 2CJ9A 1QLNA 4OZ0A 2CPEA 3CJ8A 2V69A 4CH7A 5KFMA 2AF6A 4LF4F 3PEJA 4JUZA 3TUJC 1FVQA 1K1SA 2Y3YA 1GNKA 2HS4A 5EWGA 2F8EX 2HQIA 1NH7A 2F7VA 4ELVA 3MAQA 3P96A 5KFOA 3CNQP 3POTB 1UTAA 3TR5A 4LR7A 3P6YC 3AT1B 3PRVA 1EX8A 5B0DA 5AXMA 4C98A 1RT5A 2ATLA 1WI8A 1D9AA 2E7XA 2MSTA 3IR7B 3BREA 3DM2A 2G0JA 4A8YA 5FJ4A 4C11B 3CJ3A 4OX9F 1E6VB 2DTJA 1RT2A 3DKDA 4NCAA 5B08A 4JV0A 3CCWA 3FC9A 4OZ5A 4ZP8A 4M5DB 3FVYA 2FJBB 2UVRA 2E5GA 2B7BB 2DEIA 3RTVA 1U1LA 2V2QA 2W4PA 1VRUB 1XMOJ 2L9WA 1JIHA 1U48A 3QLHA 3DGPA 2DXDA 3ZC4A 1JLCB 2NSCA 4DL6A 4RBVA 4C97A 3MCMA 3H5SA 5B7WA 4NA1A 3VWSA 4WU3A 2E5HA 1X5PA 1NHKL 2EKYA 4YB5A 3TQ1A 1S48A 2N3LA 1X9WA 3MEGA 2DR7A 1U1MA 4AUKA 1GFWB 2EG1A 2MJUA 2C28A 1Q4RA 2QLJB 1KC8T 2CJQA 4J91A 3NGSA 3PW2A 5DDPC 1X60A 3PIPQ 1ZOTA 1RB0A 4USMA 2K1RA 1RT6A 2XYPB 4QWDA 2DVIA 4C3MA 2ZH4A 4RUBA 3RBDA 2ZEJA 3IWLA 5EWFA 2OTLS 1YDLA 1BWEA 2I9SA 3A3OB 4OZLA 4M63A 4CO2A 3KYLA 1F9HA 1MW7A 4WZMA 1KLMB 5H9FJ 3IS9A 4GRSA 2N3OA 2W25A 5IQQA 1RU1A 4OI6A 4RLEA 1SQEA 4BCAA 5G0RB 2AX0A 1U1NA 2B0GA 2MB0B 2M0GB 2QA1A 1Y0HA 4DFMA 4DR4F 3JTPA 1SL1A 1T9UA 1ZA2B 3OJSA 4OFZA 4CRJA 3UCGA 3G96A 3MPUB 2FZGB 3KHLA 1YJUA 1R6VA 2NR0A 4M5HA 4HLBA 3HSJA 4UZBA 2JEJA 2IAJB 2C1EB 1X4FA 1T05B 3RAMA 3FZ2A 1Q0NA 5FLXU 4DMZA 2HVHA 5CD4A 4BC9A 1XBWA 1UP1A 1JLQA 1NHVA 4AL7A 2J6SA 3DI6A 1EP4B 5B0FA 3WIVA 5T7LB 4CYUB 2GZOA 3GB0A 2CJAA 1NDKA 3D6HB 1G7CB 1WOOA 1JLEA 4G3IA 4LFBJ 2QV6A 1WKKA 3H5YA 1M5OC 3MAAA 4CTAA 1SL0A 2YX1A 3I0SB 5DM6Q 1RT1B 4DL2A 4CT9A 3TA1A 4DX8H 1EQ0A 3T19A 1LV5A 2XO7A 2P9CA 3AODA 3BQ1A 5KOXA 4IYQA 1TR0A 2AWZA 4HDHA 3V81A 4K4SA 4HR2A 4P10A 1N54B 3BQ2A 2BV3A 3M30A 1O5JA 2AMCB 3NRBA 1U6FA 1LWEA 2LECA 2IIHA 1H74A 2JC1A 5KG0A 4HH1A 1SIZA 2RQ4A 4FPRA 3IRXA 5IS2A 4DF8A 5BYSA 2DY1A 4Q45A 1VQ7S 1ELOA 2ZE2B 4IG0B 1T03B 2IDLA 3H59A 1F5CA 2HNYA 4KGMA 1IBMF 4LFBF 1RXOB 4J9RA 2MMYA 3VAGA 3TVKA 3MDFA 2FVSA 1RWWB 2YNGA 2WVEA 3NG8A 4PWWA 3W9HA 5KT5A 2RJZA 4RWXA 3KLGB 3J7A1 2W9BA 4IFVA 5D3GA 3KJVB 1KD1T 2AYMA 4ED4A 5IV4A 1U1PA 4F4AA 3OV7A 1FXRA 5KT6A 1I1GA 3GIKA 2E44A 3MF5A 3DLGA 1IBKJ 4DUYJ 2AEMA 4DR1J 3EXYA 2XM3A 1C1BA 4ECYA 3RUBL 4DBQA 1DQAA 5GVQA 1MN7A 1JJHA 3CCLS 1VR6A 1Q5VA 2OEKA 2JNJA 4OYWA 4ZMMA 1RAIB 4CCHA 3SI8A 4DR2J 4ED7A 4D3GA 2O5DA 2XEXA 4WU2A 3VVTA 2V8VA 4CLLA 2UUCF 3LALA 2OPRA 3SXLA 5IZHA 4ZN1A 1VIOA 1FD8A 1RLCL 1S49A 4WP9A 4IDKB 2XMVA 3MM7B 3OL8A 4UTGA 4RW4A 1TL7A 2WVDA 1T9TA 1JMTA 1X9MA 2RU9A 1U6ZA 2UXCF 1IKVA 1U26A 1YJWS 1IBKF 3MMBB 2HQ3A 3Q83A 2W7OA 1U02A 3RB6A 5I3QA 4MTPA 2KXNB 5KG5A 3R8YA 4PPZA 4Y0FA 2OPSA 3UDCA 3FDSA 4FF4A 1UJ4A 4ZCLA 2KM8B 2CADA 3QT5A 2EFVA 3NNCA 4DCJB 4CH1A 3IG1B 3BDEA 2IM0A 2CPHA 1M90T 5GAHU 3AY0A 1S1VA 5A8KA 1R89A 3GSIA 4M5IA 4ZCMA 2GCFA 2RDIA 1DTTA 1GMWA 2HBYB 1U1OA 4OYPA 3MWBA 1ZM2A 1XEZA 2GJFA 1X0PA 4H4OB 3FBCA 4TN2A 1YLXA 5M2RA 3PFEA 4FXDA 1CS4A 3PYFA 1SH3A 1P27B 4ZPVR 5AE2A 3B82A 4YR3A 5HI7A 2U2FA 4RW8B 4V1Ak 4DR3F 4IKAA 1JX4A 2XB2D 2DNQA 5KFZA 1IWGA 3W62A 2EC2A 3M9OB 4ZPDA 2VONA 5GAHI 1WEZA 3IWNC 1U2CA 4ICLA 1APSA 4IFYB 4L72B 1W2IA 2LQ8A 1YJRA 3C16B 4S0MA 1IBCB 1VQ4S 1B0PA 1KEKA 4KV8B 2DRBA 3DRSB 5AXLA 1ZM4A 2DO0A 4F4XA 1YTYA 1V5VA 5A8RB 3J81j 2OKQA 4ZA1A 2NXNA 4EUVA 3I96A 4EO8A 2VHGA 3EJMA 3CDWA 5LM7E 4EYHB 2QFJA 3QJPA 2IJRA 1HNWJ 3LP0B 2KXHA 2ZZMA 2XLIA 1N5YA 1DHMA 1FE0A 5KFKA 4DV4J 5B0GA 1WG5A 1FVSA 2RDDA 3M2UA 5GMKa 5IWAJ 4LSZB 1TK5A 4F3QA 4ECWA 1JNZB 2ZBPA 3VAFA 2LU2A 3C15A 5KAKA 4YEAA 1GXLA 4KFBA 3DLKA 1R0AA 1RWNB 1QAYA 2VF3A 5CQGA 2A10A 1RT7A 3SEOA 5A8WA 3GJTB 2C2RA 2AV5A 3CJQA 4I0WA 4K2XA 1KKHA 2OFHX 2WSEC 2I38A 1GH8A 4DQSA 5AXNA 2HHHJ 1RHMB 2VBYA 3TNVA 2DNNA 1R8BA 4RW7A 1C1CB 3CMAS 3IO1A 4H4KA 4NLYA 1IKYB 4J9NA 3I5AA 2CA9A 3HKZD 2ASLA 1N4LA 1VHIA 1BQMB 4QWEA 2HAIA 2F3JA 3U27A 3BGUA 1QD1A 1VMBA 2QT7A 3MPWA 2HWHA 1NK4A 4ANEA 1RHJB 3PX6A 1HBNA 1MROB 3MPVA 1FJCA 4X4PA 3AJ2A 2CNKB 4LR9A 4OIXA 2GVDA 1ZZNA 2ZBRA 4LF7F 5I42B 3MR3A 1RWKB 2XY5A 4EU0A 1L3KA 4OZJA 3LTOA 2JVOA 3POTA 2VFUA 3MTJA 1IR1A 4ANCA 1XK8A 1S97A 3W9JA 3DDKA 4PG6A 2IA0A 1URRA 3C8YA 4JI5F 1UW9A 3UN2A 1N88A 2DXEA 5A6WA 2R2RA 3UVJB 2Z8QA 2RHQB 4C11A 1IM4A 4ZVFA 4UUXA 4PZVA 4ZP7A 5LJ3Y 1ULRA 2GVZA 3GR1A 3EPGA 2ADCA 3KDNA 3LQVA 4WBFA 3R2CJ 3NMAA 2QL9B 3OVAA 1I5OB 5K9FA 2CPDA 3HCXA 2JEGA 3L95X 1VRUA 2G4BA 2CPZA 3A1YG 1S7HA 1JLCA 1CJKB 4AL5A 2EFOA 4DR5F 3B78A 3R5JB 1Q78A 1MN9A 1FJGF 4OZNA 2NSBA 2RKIB 3IMQJ 1S4FA 1YG0A 1TAQA 2ILZA 1GX5A 4F3MA 2CPYA 2UVWA 4ZVHA 1FFGB 1MMNA 7FDRA 4H4MB 3SSQA 2LEBA 1S72S 4QR2A 2OEJA 3FSYA 1IBLJ 3LGHA 3WBZA 1MSWD 1KDNA 1E6YB 4NLRA 5KFXA 1LK5A 2HIYA 4DZDA 4X4NA 2GHPA 2P9GA 3CD5A 1HA1A 5KFJA 3DRPA 1S1TB 3OXFA 3SDEB 1KLMA 4LSNB 2YQ1A 3HT3A 1BMQB 1UFWA 2QA4G 3OFGA 3JB9k 2R8GA 2DNGA 4UF4A 2AU0A 1W25A 2MYFA 2JWNA 1T9WA 3UCUP 4YN3B 2CZ4A 4WZQA 3KNAA 2FGCA 3JQMA 1CJVB 1WC3A 4X4QA 2UVVA 1OWXA 5LXRA 1LQ9A 2HRTA 2XZWA 1C4CA 1TUGB 3H4BA 2LXIA 2CUYA 2AJ4A 5KFGA 4DS4A 3HHNB 4N7TA 3PR4A 2UUWA 2IAJA 2ALYB 4DR6F 1URNA 2GIRA 1HKAA 4H54A 4NX9A 5CZXA 4DSLA 4C8KA 4FXVA 3OUYB 3G82A 4WTYA 3CJTA 1T3OA 3LWMA 4GKKF 1EP4A 2OPQB 4C7QA 3T41A 2W2OP 5T7LA 1GXTA 2PFFB 2DK2A 2W8LA 5ETTA 1NCLA 4CYUA 5MLCV 1S5ZA 4C8LA 1NAQA 3CO9A 2WB1D 2R2UA 3MM8B 2W7PA 2MHNA 3AD7C 3LPEA 3P3DA 3UNGC 3BGFA 5T14A 3EGVA 4LIWA 1M1KT 2ZHBA 2FJVA 2F4VJ 3I0SA 1U8SA 4BDPA 4DFKA 2M2BA 3AXMA 2YH1A 4ID8A 2BJ9A 2CRLA 1T95A 5DM7Q 1N34J 2PA3A 4UY8T 4DV7F 3NAIA 2MTLA 1H3DA 4M94A 3PTWA 4HVZA 4ITSA 1NJZA 3R1HA 1U6BA 5HP1A 4DPUA 3RBXA 3ZZYA 3A3PB 1VGYA 1PAEX 4O4RA 1CJTB 1XNQJ 5HQLA 4ZKAA 3PIOQ 1K0VA 4IG0A 1T03A 5HMYA 4IRDA 1XR7A 2DB1A 2IJFA 3PHEA 2MZJA 1H98A 2AGPA 1YZ6A 4J9LA 1PSDA 3KK1B 4ZLJA 4DV0J 4ZPWR 3KLGA 3J7AN 2MY8A 2C22A 3KJVA 4KYZA 4C0OC 5F8MA 2E5JA 4JI6J 4WIIA 4YS2A 4KIAA 2A2DA 4NXMJ 2VPXB 4DQPA 2HLTA 3HVTB 1F2HA 4I6YA 3BR8A 3Q0AA 1M5PC 1N36J 2DGUA 3T5HA 3CCMS 2JFDA 4I2PA 1J5EF 1TTHB 3R6GB 4CO5A 2RAQA 3JAMY 4QJVA 3CC2S 2O01C 4EI2A 4ED1A 1KQGB 1NJYA 4FVCA 1PAUB 2N7YA 1FX4A 2IMWP 1XMQJ 4JI8F 4KC5A 3HT0A 2A18A 3IBWA 2YNIB 3HI9A 5ADZA 1PO6A 4AYBD 4Z37A 3CEDA 3D0HE 4L76A 2AEFA 4IDKA 2RU3A 5B0AA 3DYAB 4IH5A 1HL6A 2EVZA 3MM7A 3M4XA 4H4KC 2V8GA 2FD2A 4R25A 4O3PA 1IQZA 1IVZA 4NXMF 3LP1A 3BQ0A 3UE2A 1YKWA 1YHQS 3IR6B 1WC5A 3N01A 3NWRA 3P4UB 1L5UA 1MU2A 1HPZB 1YRXA 2FHJA 3IG1A 3GP9A 3HPOA 3J7Z5 3CIMA 3WDOA 2L41A 1X5TA 3I4PA 1UVNA 4DU7A 1HBOB 1Y5IB 3GCXP 3JSBA 2YKMA 3NKYA 1OYDA 3TVZA 2HNDB 3E2EA 5G4DA 2BEFA 2Y1RI 2H65B 1YJTA 5C42B 3ETOA 2HMIB 4K4TA 1I94J 1TL4A 3LPYA 1HR0F 3MM5A 4H4OA 4K0KF 1ZPVA 1NBEB 1OSCA 1NSAA 6AT1B 2K7KA 3PRBA 3B4MA 1AROP 3RBZA 1HI0P 1GXUA 3CD0A 1V5IB 4DU8A 3WC2A 1XERA 2G2ZA 1R0BG 5BXIA 1IKXA 3CCQS 3TJ9A 7FD1A 4UZCA 3CC7S 4OJGA 1NH8A 3AFGA 3J81U 3OSPA 2CDRB 4U67Q 2FJDB 3SIPB 3UN5A 5D8HB 3EPIA 4IFYA 5CCMA 4ZHRB 2FHMA 3KKFA 3TEGA 3ZNJ1 1FKOA 1IR0A 3C16A 2AW0A 2VOOA 2CIMA 1Z1ZA 4FNIA 4N56A 3BSCA 2P6TA 1WG4A 1SIWB 4J9VA 2CQIA 2HQCA 5A8RA 2VG7B 2RH3A 4A48A 4F0KA 2HFOA 3I82A 3ADAC 1WEYA 1WHVA 2GIFA 3W2WB 4QPTA 2JLEA 1N6QA 2CQCA 3ITHB 5BR8J 2NYIA 2B8PA 2H51B 2I5JA 3D68A 2NZ4A 3JSRA 2HG4A 3LP0A 2IDEA 1NDLA 4KHPF 3DXSX 3QNWB 2H5IB 2ZHOA 4J9KA 4ECSA 3QAUA 1X7VA 1FRKA 2E66A 3EGZA 4ID5A 4V19J 3KHGA 3CCVS 4M5LA 3HZEA 1KTVA 1HYSB 4U95A 3DLJA 1RISA 1OY8A 1G6BA 2UU9J 4P74A 4NPOA 4DCOB 1HNZF 3M2RB 3AJDA 4WE1B 5IC4B 5K8NA 1SJ4P 4NLDA 1I6JA 4LF5J 5DG7A 1PJ5A 4PR6A 4K8RA 1UVMA 2DNOA 3QIDA 2XYGB 1W7WA 2DNYA 1HWKA 5DJBA 1WI6A 4J9QA 4LF2A 1FNXH 1IKYA 3EZ5A 4IG3A 3W8GA 2DCLA 4DQRA 3SQGB 1BQMA 2NZCA 3K57A 4FYYB 1EB0A 3MM9A 4JI1F 2QLBB 4TY8A 1SKUB 3R5CA 4L3NA 2VH7A 3GSDA 4C3KA 2OJ3A 2EBEA 4K4XA 2R7WA 2GQ2A 2M9KA 3T3FA 4M5JA 1YBUA 1QTNB 2LKZA 4I2QB 4X65F 1FDAA 3AHPA 3Q8SB 3RU0A 2CJXB 4RNHA 4LF8J 1K44A 2PA8D 4QBUA 2ZH8A 2CZVC 2IVFB 4Y00A 1UEKA 2AT1B 5HO4A 4GKJJ 2ZWPA 3THVA 2KHCA 4PG8A 1H2VZ 2W01A 3ZXWA 5J1EB 1L3TA 2VKRA 3MGJA 4JI4J 2ZDOA 1NM2A 1ZH5A 1RTHB 1YX2A 4QIEA 5J1NA 2W8KA 5L1IA 3TUZC 2E5IA 3ZTRA 3MUTP 1NJIT 5KFUA 3PKMA 4O4GA 1UPMB 1RBLA 1XC9A 1FERA 1N5TA 4OYIA 4QZVB 1AA1B 4RX6A 5L1JA 3O2IA 2PDAA 1NZ8A 2EI5A 1R8PA 3NMRA 3QRQA 4ZIVA 1S6PA 3BDPA 3KG0A 2RDJA 5KFRA 2G13A 4GC7A 1IUJA 3K0JA 4F02A 3KJQB 2RKIA 2BZ2A 2E9RX 1VIXA 4R0JA 2VFTA 5F41A 1QSYA 3KUGA 4YOEA 3WQPA 1HNXF 2MLZA 4QYZK 2HLUA 2VL1A 1XJWB 3FEXB 1E6YA 3WIUA 3MUVP 2EK1A 2BJ3A 3M32B 5EX3A 3DOKA 4YY3F 4WFZA 5B0BA 1S1TA 1RAJA 4LSNA 2I0XA 4WP3A 2NUUG 1VHFA 2R7UA 2UV8A 3NBPA 5IOLA 2P5VA 4N8NA 5F8JA 1O6XA 3CCJS 2XMTA 4IOAQ 2Y1IA 2DCUB 4CLFA 4K59A 4FKYA 5CXTA 1I51B 4NXNJ 3OL6A 5DGAA 1F9FA 3HHKA 4LRFA 2DBBA 1OY9A 4RUAA 3MCNA 3JSMB 2F65A 5KFQA 5CAAA 1KRPA 4NWBA 2QA2A 3NL0A 3KJFB 2WOMB 1SQFA 3M6VA 3GV8B 3LA0A 2QMXA 5HATA 4RZRA 2HSEB 1UPPA 2D3O1 1WORA 4PEOA 3OUYA 2ZC4A 3R6LB 1LXJA 1RA7A 2RRNA 2UXDJ 4B3TF 4LT6A 3VQTA 1JJCB 4PQUB 4XDDA 1DJ0A 3G87A 3MM8A 3ET6B 3Q22A 4ANDA 2L9DA 2LEPA 1UA0A 2E5LF 2RF2A 1CC7A 2RD5C 3B8HA 2QZ8A 4M5MA 2OO4A 4KH1B 4C8MA 3R7BB 3X1LB 2M3DA 1S1WB 1S0OA 4ES1A 3JQKA 3BR9A 1JK9B 2V9WA 2YNFA 4X66F 2QMUB 4UT4A 5L38A 4QOTA 1TKTA 2W9CA 4MK9A 2QO3A 3ZFVA 2KG1A 3Q24A 2VDIA 5H9FK 4EEYA 2DNZA 3NLCA 1J27A 1UFKA 1OQ3A 5HQ8A 1DLOB 2VU5A 2MKHA 4ZVOB 4NYOA 2VQFJ 3A8JA 4UOHA 4KGKA 3ONQA 1WF1A 3O5TB 4NI2B 3HJVA 2ZUGA 5KG3A 2LQ9A 1REGX 5E5NA 2BRLA 4USIA 3AB4B 2E7WA 3BKTA 4K4UA 4IH7A 3KK1A 1VBKA 2CPJA 2POKA 3K5NA 1C0TA 4ECQA 5ETMA 5HMXA 4ES3A 1X4CA 3PG9A 1Y11A 4FKXA 4KR0B 2XYHB 2GQQA 2CAJA 5IT4A 2MPUA 2PE8A 2GQCA 3OTOJ 3SSSA 4DPWA 4DV2F 1QJHA 3GPAA 3D1QA 4DSJA 1Q7LB 3JQJA 1YQHA 1S77D 4YFUA 2YQ3A 5L1KA 4MKVA 4L74A 5IXUA 1LW0A 2KVQE 4EBCA 3AQOA 3HFKA 3GYNA 2G1HA 4TNOA 4QIFA 2G0IA 2IM1A 3VAIA 4EWTA 2JVRA 2DH7A 3UR3C 1SQGA 2WSCC 1Z2LA 2GHVC 1VC0A 5LT5A 2WVCA 4C4WA 3W2VB 3CVKA 4FYWB 1KNZA 2JEIA 4XO0A 2V4JB 3H25A 3RB0A 3H8YA 5KFYA 4NLTA 1X9SA 4C8NA 5L39A 5AT1B 2RS8A 4DG1B 2D1CA 2Z2ZA 1R31A 1HPZA 5KFEA 4ZVGA 4UW2A 1EIYB 2CXEA 2EBGA 4LF6F 4DV1J 1MLAA 1WHXA 2E1PA 4WPAA 2MZ1A 2J9DE 1RHKB 5J2NB 5DLGA 3IA0A 2HNDA 4QR1A 2BJEA 2DNHA 4ECUA 4AQYF 4G1QB 2B7CB 1RBAA 2FGOA 2HMIA 3B4DA 3IGVA 2QYCA 2NLWA 4OYZA 1N0VC 1YITS 4L6V3 3BJYA 2V4RA 2ACYA 3DCAA 2EK6A 2V50A 2HGNA 1VBXA 2R8KA 2VPYB 2R7TA 4NA2A 3PKYA 2ZD1B 2DNMA 4LFAF 1WJ9A 4Y28C 1VLOA 2UP1A 4B9MA 5LSRA 5IM0B 2FQQB 4FYXB 3T5KA 5EN1A 4ZHRA 3ZO7A 3KK3A 3C14A 4ECRA 2QLXA 4DWIA 3C6UB 4RW9A 3OHBA 4L75A 3EMTA 2ZM6J 2C2KB 2UXBF 2VG7A 2PMHA 3DOMB 4KTQA 3MXHP 5A0YB 1FA0A 1X4BA 4QW8A 1VYAA 2XNRA 5E33A 3KUEA 4X4RA 2B3TB 3TI0A 1WF2A 4KE5A 5A6PA 2D7SA 1F9EB 1FFWB 5HJYA 5DQIA 2XMUA 3W5YA 4WFBQ 3FEYB 3BSNA 3DHWC 3CE8A 2FHKA 1TQLA 4WYLA 4W92B 4USJC 1N33F 2KH9A 1TK8A 4WIQA 1Y10A 1S9EB 2CG8A 4WFAQ 3CCUS 4NCBA 2VBXA 1UJ6A 2R8JA 1WD6A 5L9NA 4LIRA 2J6TA 4TVAB 4ZVUB 3N9UC 3QT6A 4Q0BB 4EYIB 3M2RA 4F67A 1FESA 2HHPA 4WE1A 1C2PA 4MIAA 2BRKA 3H20A 4RWWA 4I67A 3N5FA 2V9KA 1VLYA 2D69A 1RYRA 1IWAA 3RJMB 1U1RA 5H9EJ 2B4VA 3F0NA 2K2PA 4DZ6A 2OELA 1NKBA 3GWCA 2V8DA 2M4MA 5HBMB 1DRZA 3MM6B 4UQGA 3QQCD 2WONB 2DH8A 5LMNJ 3P45B 3NY0A 2YPZA 1QTMA 3OR1A 1KVIA 3ICLA 3VAJA 4FYDA 4Q8FA 5K8MA 2DHHA 4LRDA 4RR5A 4K4WA 3ILIA 3OTBA 4JI0F 5CYMB 1WG1A 2MSSA 3H2UB 2EXUA 2HRYA 5E2QA 1YK9A 4B3RJ 2KYZA 2GFFA 1UL3A 5SZTA 4QU7A 3PNIA 3ISND 3G6XA 2V67A 1SC6A 4FBUA 1S1UB 4F36A 2HYIB 3U1LA 3Q2TC 3KLIA 3OD2A 1UVIA 1HNVB 5J1EA 2Q79A 3G71S 3BBFA 3TZWA 1U45A 3I0RB 2ZKTA 4I4BA 4ZVTB 1NO8A 3SV4A 1WUUA 4X62F 1NJWA 3QIPA 2KI2A 3W65A 4LQ9A 1PJ7A 2HBRB 3BGRB 4I7FB 3RAQA 2KJVA 2F9JA 1YBAA 4TLRA 1X31C 4LMZA 2UUAJ 4X4UA 1ZTWA 2HZVA 1ZM3A 4DUZF 1FHTA 2CJBA 2Q6BA 3KHHA 3RGIA 2CPFA 3NWGA 5HJXA 4TQRA 2BKPA 3HFZB 3IR5B 3L7PA 1OSDA 2KT3A 3MUMP 4D3HA 1ZM9A 3FSIA 2ZH1A 3CCRS 4MFBB 4ZP6A 3MD1A 1R8CA 2I6WA 4DUTA 3UCZP 1SC3B 3D28A 2ASDA 1S4EA 3NGUA 3JXOA 1XMBA 3PFOA 3TA2A 2FUG9 3H7HB 1YJ7A 2HZAA 3M6WA 4IQXA 2H4WB 3VGVA 4HDGA 2ZBCA 3IN5A 3CCZA 1VS3A 3PYDA 1S76D 2FB0A 4C48A 4N5SA 3MEEB 1TFYA 1C0UB 3MR7A 3D3BJ 1GAOA 5D0EA 1S6QA 3A8KA 5C5JA 4OHVA 2YNHB 2VJUA 3GMGA 2ASYA 3MEDB 3RRHA 3E51A 2ERRA 2VG5B 2FJAB 4OX6A 2E9ZA 3HK2A 4DPOA 2BA9A 1VQOS 3SCJE 5HVFA 2OEMA 3N4WA 5E3AA 2OI2A 3TUIC 2ZOMA 3JSMA 3MPDA 5L46A 2A6OA 1B7YB 3LANA 2J8SA 2WOMA 1N32J 3M7VA 2WCXA 3M8PB 4WKRA 1P8GA 3MD3A 1NPRA 5KFFA 1CEZA 4ERDA 2BJDA 4KGXB 4B3OB 4QU6A 3R5BA 4ZJOA 1GMWD 5DDOC 2CNLB 3GV5B 4AE5A 3HHLB 2HFUA 3D9BA 1MWZA 2IY5B 4DV3F 1U0HB 4M95A 1FTRA 4KH0B 3I5CA 3TAPA 5IFMA 4CI0B 4AL6A 4PQUA 2B9YA 4PUOB 1HARA 3I32A 1IKWA 5U47A 4F4WA 4G1IA 2AKWB 1EHWA 5C2GA 4W4MA 3GG1A 6FDRA 4B9UA 4XPCA 2PEBA 4E98A 4CO4A 3EM1A 4QIGA 3MPYA 2C2EA 4M1KA 2RRBA 1PYSB 3DNCA 5T41A 1EETA 1SKRA 1S99A 3KDOA 3FMBA 4YHHF 4JOUA 4J9OA 1TP7A 1H38A 1NDCA 4PG7A 2A3JA 2DIUA 2AJ2A 2B6AA 3CDBA 3C3LA 5IQ6A 3PHTA 1IR2A 3GONA 3K5OA 3RBEA 2HFNA 3ZNUA 2F5GA 5CABA 1U47A 1PKUA 1UWBA 3C6TB 1DLOA 4O3QA 5HSPA 3N6MA 1KLNA 3CJKB 2VC1A 2W2NP 1OJ4A 2HURA 1KOHA 1NXIA 2WHOA 4PXDA 5D4LA 5SUHA 1CQMA 3BKFA 3MAHA 3ZTSA 4RKUC 3IAS9 3HM9A 4MKBA 3HJFA 4KPYA 1CG2A 3OSNA 4DF4A 3OBIA 2R8HA 2DJWA 5BYQA 3VGTA 2MHEA 1H72C 3GFYA 1DTQB 3HMJG 4E0DA 1LW2B 5LSLA 1T94A 3UD3P 1RHUB 3SCIE 4USWA 3M8YA 4N47A 1F2GA 2E7VA 3BKUA 5A76A 3CO0P 4URGA 3QZ7A 5KFAA 3UQSA 4HI1A 5E0OA 4J7CA 1JLFB 1Q8IA 2Y8YA 4B3MF 1S9GB 1YVFA 2D3OR 3PACA 3TANA 4U6PA 3A13A 3PW5A 1TAUA 3T1YF 1RAOA 3S1TA 3SCKE 2VQEF 1JLAB 3V6KA 2XMKA 2ZNYA 1F5BA 3VF0B 3US5A 4UOFA 4U7UK 4U7CA 2YWFA 3D6MB 2HHQA 5AJ3J 3KLHA 2BACA 1WWHA 3UFCX 2DIVA 1VRTB 4MYTA 3WZ0A 2C3OA 1BWVA 2XS2A 2DR5A 1VQPS 2OMLA 4RO0A 3KK2B 4B9SA 4ELTA 2V8HA 4C0HA 5GADU 5LXYA 2BQUA 2QL7B 1FEEA 2JOQA 3W2VA 4HI2A 2V4JA 4FVMA 3NGDA 4NEYA 2W7AA 1TUWA 2WTFA 5I3UA 4DG1A 4XDCA 1RACB 3PX0A 1ZTTA 2HQFA 2D9PA 3L4BC 1DARA 5DQHA 2V94A 1LWCB 5M2PA 2QX0A 1TKDA 2Q1LA 3DLLQ 2L3MA 2MQNA 4CLZA 4AD6A 2G0CA 2WAQD 5KG2A 1TL3B 5J2NA 5GADI 1NZAA 1RT4A 3W5XA 2R4FA 9ATCB 4ZK7M 2HHUA 4G1QA 3J80U 4HACA 1QUVA 1LOUA 4G65A 3MOZA 5D4NA 2OGUA 3VTIA 1SJ1A 1X4AA 1RWOB 1Y3KA 2OFGX 1TL5A 4RUHA 3NCPA 5MAOA 4Q44A 1HWLA 3D1HA 1XIQA 2ZD1A 2DNLA 4PRFA 3AB2B 2WB4A 3UDLA 3DOLA 4M5NA 2BVZA 1RABB 5IT9Y 1TKXA 3L9ZA 2J0WA 3MECA 4LFCJ 1RSCA 3VGUA 2XY6A 3BEGB 2J76E 2OIHA 2M52A 3S6EA 3M8QB 4PABA 3DRRA 2FTRA 1VQ6S 3RR7A 3O8WA 4AXJA 3OFEA 3PW7A 5D0HA 4B08A 1XMOF 1N52B 2JLFA 3C6UA 4DL4A 2HFVA 4HHHA 3PXGa 4CM0A 4IOCQ 4P2FA 3M2VB 1S10A 3DOMA 2F63A 1RAHB 2OH2A 1RLDA 4UOCA 4X64J 1NPKA 1GX6A 1P9QC 2MQQA 4TU7A 2EWHA 3G2XA 4LJMA 1U1QA 2IVMA 5KT4A 1MWYA 3T1HJ 3SBMA 3FFIB 2LXUA 3C19A 1HBUB 2Z2LA 2XC9A 4B9LA 4A4JA 3GV7B 3R5DA 4Q7AA 3D4JA 4PG4A 4LFCF 2ZHAA 2FVPA 2HHXA 5HVHA 1NK0A 2XG8A 2WVFA 4OL8A 1SL2A 4DPYA 3NP5A 2CVIA 1FWLA 2X1AA 2AD9A 4HHJA 3ENAA 2KVIA 3G4SS 3AQPA 1BQXA 2OSRA 3FQKA 2BJ7A 4Q0BA 4DHVA 5KT7A 2ZFHA 3HZGA 3FZBA 3TUPA 4JI3J 4PWDB 2XSJB 1HQEB 4DQIA 4QWCA 1A0OB 4ZPBA 4X4TA 1U09A 3QGGA 3GCWP 1Z4UA 1CULB 4EFAC 2B56A 1WOPA 5HBMA 3MM6A 4MYUA 1VC5A 2COLA 1Y00A 1XNRJ 2IYGA 2LFVA 2RUGA 5I3PA 3TA0A 5DRKA 1JXVA 2HVZA 3JSYA 4RNMA 3NGKA 4P73A 4Y3CA 3TZZA 5J2QB 3H40A 1XN9A 3ETMA 1P1TA 2MXYA 1GK8A 5HQMA 1UKUA 4ED5A 2HAFA 2QE5A 3SV3A 3G9CA 3N28A 3W61A 2F8MA 3LH2S 4ZN3A 4DR7J 2MQ8A 4B9NA 4YDXA 2N4DA 4KBIA 1RT5B 4YP3A 3EE3A 3W60A 3V4IA 4NA3A 3TW0A 2J9CA 3DM2B 4BLGA 1DURA 2V2KA 3D2WA 3W1YC 3PDNA 1AFJA 1TK0A 4R8UB 3I0RA 3BGRA 4I7FA 2BMBA 3PZPA 2KT5A 2AZ3A 1SC4B 3QWPA 3QLHB 1Q82T 3DGPB 3D3CJ 2BX6A 4DDFA 1Q5YA 3GYXB 4LR8A 4YUDA 5ETPA 3TP2A 3TAQA 2P9EA 4P71A 3ZTPA 1BXNA 2YKOA 2R2TA 1CQNA 4DN9A 3M9MB 6FD1A 3QO9B 4EO6A 2N7CA 1D09B 3I56S 3MEGB 3N6NA 4MFBA 3B6BA 3UWTA 4FF3A 1FJ7A 5KFTA 1NKEA 4ZVEA 1NHUA 2JJ4D 3WC0A 1QUPA 4Y6IA 4V19X 4JV5J 3M6UA 3BF4A 1UAWA 2K1RB 2H5EA 1BQNA 4XPEA 1R0CB 3KLFA 3T6BA 2E1AA 1Q95G 3KXDA 4Q5VA 2GMHA 1NB7A 4LBPA 3MMAA 4ES2A 3D66A 2PI4A 2J9EA 4LRBA 3IS9B 1DZ5A 3FJ2A 1C0UA 5KFCA 4DUYF 2R7RA 4OI2A 3CMES 4MKAA 1R27B 3Q86A 5HANA 4DR1F 2FYXA 3GR0A 2YNHA 2XTJP 2P2CB 3S01A 3F41A 4GVLA 4E2FB 2GJIA 5E3CA 2LYVA 1FKPA 3IBFB 3FBFA 4DJBA 5JVHQ 3NS5A 1KP6A 4P75A 3VZHA 1SKWA 1PYOB 4DV5J 5DZ6A 2O66A 2FHJD 4DR2F 2QFIA 4ECZA 2H9ZA 3D5MA 1L3VA 1R8AA 1IM6A 3NOGA 4KT0C 3IFEA 2UUBJ 1RHQB 3EVOA 5M2UA 4P2SA 3PV8A 1JLQB 1RTIA 3DI6B 1U4BA 1G1XA 2IC3A 4XAKA 2IM2A 2BR0A 1U0HA 4B9TA 2AP6A 4CLWA 2RMLA 4ETXA 1FNOA 4NLPA 4PQAA 3OFHA 4F26A 4HTJA 2QL5B 3G6VA 1NK7A 4PUOA 1VQKS 1JLEB 2IMOA 4HYKA 3OPKA 2RQCA 4ECXA 1DY3A 1ROFA 3NGRA 2XZDB 4CTAB 1VQLS 2ZDPA 3UDEA 2P6SA 4I64A 1X4GA 5E3PA 3GQCA 1FWPA 3VAKA 1FX2A 1AUSL 2HBQB 3BPDA 1NJXA 5C25B 2NXJA 3M30B 3QGPA 1GEHA 3HF5A 3UD5A 2JH3A 2KHDA 2V8PA 1BE4A 5DLFA 3DDNA 4MH8A 5HLFB 4OI0A 1TL1B 3IXQA 4ZLLA 4B3SJ 4RPFA 2HS0A 3I4HX 3C6TA 2V68A 4PXEA 3UR0A 1HWJA 1OO0B 2R2SA 3ENVA 4TKTA 2VD3A 1SUQB 3DLEB 3RRKA 4MK8A 2V0NA 4J9SA 5KOWA 2CVEA 1Q1KA 4A46A 1T7PA 3IWXA 4IFVB 3QMQA 1BD6A 1T9VA 1TFWA 2VIHA 2HBZB 3EDQB 1DTQA 2AX1A 2YH0A 1LW2A 1HQUB 2GS8A 4K50A 5HAOA 2HVEA 1VK8A 3HVRA 3H2VE 2RIJA 1F0XA 4EZ9A 5FIIA 2ZH7A 4CLKA 1C1BB 2C3YA 3OT9A 3MR5A 1HNWF 3R2DJ 1WDTA 4CIOA 3TJ8A 2NPIA 2NS1B 2ZZNA 2FVCA 1S9GA 2A6MA 5KTQA 1TKZA 4G6VB 2QC3A 3GIJA 4B3SF 2ZJQQ 3IBCB 4NCGB 3OW2R 2APOA 1JLAA 4DV4F 3U1NA 5DETA 5IWAF 2A2CA 2J7KA 4K4YA 4TLQA 2HHTA 2J0QD 1VRTA 1HWIA 2AYGA 1N5QA 2LDYA 8ATCB 2ZC3A 2F4FA 3KK2A 1ZAWA 4U8YA 4GO7X 3TJAA 5ETKA 1ZAVA 4YB6A 2JL9A 1IKVB 1KHWA 3K89A 2BABA 2FY1A 3IGNA 1MMLA 2HHHF 3EZUA 4N76A 4JYAJ 3NAHA 2XBPA 3OTEA 3PJ9A 2FLLA 2VASA 4BWJA 2KZZA 1WC6A 1S1XB 4EK2A 4F3OA 3GZ7A 1LFPA 2Z2YB 1KQKA 3FSXA 2VFSA 4P2MA 2R7OA 4RNOA 4O3SA 3W5ZA 4BHQA 1D1UA 3LWLA 1E6VA 1TZ0A 1WKJA 1M5SA 4M5DA 1FRHA 4ZPCA 1H2UX 1HI1A 1X4EA 2PMZD 5E3RA 3ISZA 2DR9A 1G3OA 2YKNB 2A0FB 1YWXA 1T11A 1TL3A 2Z0GA 3MURP 5J2PB 1RYSA 1PGZA 1FTCA 5CD4H 4ZS6A 4A8MP 2XI3A 4KY3A 5JMNA 1R3NA 3MTKA 1CS4B 2DNKA 4OX8A 1M5HA 2CQ1A 4DPXA 3GJSB 5KFWA 3SFUA 1IJEB 3ZZ0A 2DGXA 3QZ8A 3F44A 4Q2LA 2V2VA 2RE1A 4BWMA 2ZNZA 4KRWA 2J7WA 4NZ0A 4JI7J 1RTZA 5FLXY 1R7IA 4PKDB 4MJKA 2WRMA 2LLZA 2RNEA 4R0EA 4CT8A 4O3RA 2CQBA 2HVDA 4GO5X 1JLBB 4NLQA 3THPA 5DDQC 3BGLA 1RT3B 2DITA 3V4MA 3ZZPA 2OP5A 3EGWB 3HX9A 2OD4A 4DSIA 1X0FA 5JJBA 5FD1A 3AH6A 1FRLA 1HFEL 1FEHA 3M2VA 3UPFA 5G0RA 1T3NA 3AD8C 1CC8A 2WBRA 1REVB 2V63A 2YPYA 4LRAA 3GU0A 4DX7A 4IO9Q 1V9OA 7AT1B 2KO1A 2DEJA 1IBLF 1S12A 1SH2A 3M2UB 1HBUA 4F2SA 3JTOA 2E9TA 1PIEA 4LF9J 1WOSA 1T05A 2CYYA 2VJVA 4NMXA 3FRYA 4KFBB 3FCHA 4DV6J 3DLKB 1RBOB 1S6OA 2XWXA 2HZCA 1QVFR 4LF4J 2ROGA 3N79A 1RWPB 2G2YA 2X51A 2LDIA 3CSKA 3W8PA 4I56A 3FRZA 1BLUA 1O0PA 1VQMS 4PXBA 3VGSA 4YDDB 5K8OA 1HI8A 1HW8A 2XSJA 1DQ9A 3BZQA 1HWUA 2ZH9A 1CJUB 3C2PA 2Q6CA 1A7GE 3DLBA 1VI7A 2Y1JA 2BDPA 4OX9J 4O44B 1RTDB 1CULA 2JSXA 4WFXA 1PG5B 1NSQA 1RI7A 3J7ZT 1RT1A 1WNEA 4QW9A 5B0CA 1L3UA 2QLFB 4FN5A 4PXCA 3OL7A 5K8PA 1JLGB 2F40A 3CC4S 1B64A 3C66A 5J2QA 3RB4A 4DX6A 2X1BA 1U24A 2GMJA 2GVDB 1BHNA 2B9XA 3OQ2A 3MMCB 1WTBA 4M5GA 3HD2A 1Y7PA 2DHXA 2ZE2A 3TZYA 3QJLA 3M8SA 4LSLB 4URSA 5GAEU 1G4CA 2CJKA 1U25A 2KT2A 2CQ0A 2KG0A 2P8IA 2VV5A 2YWHA 2BW7A 5F9NA 2LXFA 4OQJA 5KFBA 2CNOB 4R8UA 2F4VF 3QBCA 2ZH3A 3EXCX 2GVZB 4F50A 1PBAA 1N34F 1HD1A 3OR2B 2FVRA 5CCLA 4JP8A 2IYIA 1VJWA 1F3VA 4ZPAA 1VC6A 4KPCA 1HHSA 1RWUA 4IR9A 1UEUA 5F3ZA 2DY9A 5KFSA 1X8DA 4FBTA 3QO9A 3F73A 4DR4J 1XNQF 2GAGC 1PILA 3EX7B 2M8HA 1D8ZA 3DC2A 3MR2A 3K5PA 1JB0C 5GAEI 2GNKA 2EEYA 4J90A 4GVBB 2IM3A 4WP8A 3SFGA 2DPJA 3HDSA 3HVAA 5H9EK 4P9SA 5LMUJ 4DV0F 2ILYA 2ZJRQ 3K8VA 1L3SA 3VAHA 2ROPA 4WF9Q 4DQQA 3DRPB 2OAUA 1WKLA 3HVWA 2YY3A 4JI6F 3NXZA 2D41A 1YJNS 3MMBA 4LVNP 3PO4A 3BH6B 1N36F 2MQLA 2N82B 4MMOA 4C2MA 3OLAA 5DQGA 3PY8A 2CZ9A 2PIIA 3ZTOA 3MR6A 1WSRA 4P7VA 4YB1P 3KOAA 1NK8A 2MKIA 8AT1B 1WHYA 1XR6A 8RUCA 3FKBA 3RAXA 1XMQF 3EZOA 2EFQA 1V3RA 2XLKA 2R3VA 3I55S 5LMUF 2I8EA 4RBTA 3D7SB 2ZOFA 1SKSA 3PCOB 1N48A 3AA8A 3EYZA 2DHSA 3G82B 2HVIA 4WXWA 1HLWA 2UVUA 1KOOA 4ZOSA 1RAGB 1B99A 4J9MA 1U0SA 1UW4A 5CYJA 2LP4A 1ZYQA 3H90A 4MK7A 4RW8A 1FK9B 2OTJS 2E1MC 1B7FA 1S0VA 2CFXA 1SPBP 2FC9A 2MQMA 3KMSA 1IBMJ 3L7UA 2LVWA 2HS3A 4USVA 4NYZA 4JI2J 2MLYA 1YRTA 3M6XA 3GTYX 2ZH6A 5RUBA 1RWXB 3BBBA 1RAEB 3QFWA 3CULA 1WELA 4KV8A 2JRSA 3DRSA 3W7BA 1QAXA 1QE1B 4HTIA 4LRCA 5KG6A 4MKYA 3K8WA 1T8EA 5LL6d 2GX8A 2MZQA 2CDQA 1V3SA 2IVYA 3FQLA 3BH7B 3R1LA 3OL9A 2V5HG 5C25A 3KG1A 1EZZB 3GIIA 4MIBA 1AB8A 1H73A 1I94F 4O0NA 3HSGA 4ED3A 2OUGA 1S57A 2CQ4A 2CKWA 4P7TA 2W1BA 4ZVQB 5HP1B 4ZDNA 3R5AA 5HLFA 2ZOGA 4F8RA 4WTOB 4NRUA 5C7PA 2NPFA 1TL1A 2MLXA 2WW8A 1ZA1B 1VQYA 3LGMA 2IBKA 1R43A 4JI2F 1SUQA 4K5RA 2JC0A 3DLEA 1Q8KA 3CDUA 2YKPA 2C3PA 2UUCJ 2BBEA 2X3GA 2V34A 4PCQA 5DDRC 5J2MB 2PC6A 2G1DA 3VZIA 4OI3A 4NMLA 1HQUA 2HK3A 2UXCJ 1SI9A 3HHLD 4PG5A 3AOAA 1S6UA 1X5SA 3FBBA 1T9XA 5BR8F 1LEOA 4XIUA 4I2PB 3HO1A 1C1CA 2ZBIA 2MGZB 1F3FA 1NK9A 3MMJA 1F6TA 2VUGA 1UZDA 1KVJA 4DL7A 4NCGA 2VA2A 4QPXA 4JV2A 3A4TA 1NKCA 5D78A 2KTQA 1FDBA 4C8OA 2DH9A 2J9DA 1MROA 3TEHB 1K8AT 3CD6S 3DMJB 3SCLE 2CQHA 1NEEA 2O3DA 1NNDA 4NYPA 3E01B 4RW6B 5I42A 3NNAA 2UU9F 2XS5A 2LMIA 4DCPB 2GMLA 3VVUA 3HP6A 3JYTB 1GMUA 3LP1B 3ZZTA 3DGVA 4ZCIA 1KWMA 1TMMA 4LF5F 1NU4A 2XWYA 4EZ6A 2XY7A 1EKSA 3T1AA 3U1MA 1S1XA 4DR3J 3QJJA 1MU2B 4QWBA 5IC6B 4PWUA 3UVJA 4K7QA 4UOGA 1LWFB 1RJJA 3V6HA 4MT1A 1Y4ZB 2HWIA 3JAMU 4HT7A 3CXCR 5KFIA 2VA3A 3G8TA 2YKMB 2MKKA 1RAAB 2JEFA 1CSJA 1QY7A 2C42A 3ILLA 3CDEA 4OYOA 2YKNA 4Y2CA 1AFIA 2K7JA 4RL1A 1K1QA 5J2PA 1K47A 3ZZRA 3T5JA 5L9XA 1CJKA 3DFEA 1JNRB 3MM5B 3BBCA 4HHUA 4Z2XA 3K58A 4LF8F 2QTWA 4WYWA 3LUYA 2W24A 3W9IA 1YJVA 1VQ5S 5BJRA 4JB8B 5B09A 4H4MA 4CLPA 5C2CA 4GKJF 1IKXB 3VCDA 2PMWA 5K14B 1GT8A 1OIAA 2AYBA 1UJ5A 3FGVA 1FRMA 4JI4F 1EJ7L 3PYEA 3D0GE 1HHTP 1FKOB 1JLBA 4N41A 2HK2A 5LSOA 3AXKA 2AJFE 2HNZB 3H42A 1RT3A 3I6PA 4C3LA 5EHHA 3SDEA 3HULA 4Z7YA 3CJSA 2B9EA 1U2RA 2GHWA 4PAAA 2ZBQA 1FKAF 1QAIA 2PN6A 1ZS6A 2DGOA 4KO0B 3PJXA 3RG6A 1N6QB 2Q3PA 4LQ3A 2DGTA 1REVA 1NSKL 5H1SV 3Q8QB 2I5JB 4YMEA 1EARA 4PYDA 2C2ZB 4LBHA 1CJVA 4O0IA 4N77A 2F8HA 2VBWA 5K5MA 3Q8UA 1N8RT 1X5OA 2J6UA 4FF1A 1FJEB 4RBUA 1GTHA 4WJBA 2UV8G 3T9NA 4ID5B 2XQCA 5DGBA 2CNNB 1S0MA 3LF0A 1B3TA 3V5RA 4JBCA 1HMVB 1RCOB 3R7NB 2KM8C 3R97A 2DGVA 1JXLA 3DU5A 3BO3A 4N8OA 4LF7J 2OPQA 2XHCA 4KKOB 3PW0A 2ACMA 2W4DA 5KT2A 1I3OB 2AQ4A 1OPZA 4QR0A 4OMFG 3QGIA 1C4AA 3GILA 4DFPA 1RAFB 2AGQA 3M1VB 1H2TZ 4JI5J 4NXNF 1CJUA 1Z2ZA 2D9OA 3GG0A 2ZJPQ 2ABYA 4TYBA 2QSWA 4IG3B 4DN0A 2NXUA 3TYTA 4C6AA 2M7SA 4O44A 1RTDA 1PCAA 1D9FA 3MM9B 1U49A 4TY8B 1U7LA 2VB6A 4NLSA 4Z7CA 4FF2A 3TAMB 2ASJA 4ZJLA 4K4VA 1OMSA 1JLGA 4XTTA 2R7SA 4DR5J 2IPOB 4A47A 4X4VA 3MMCA 3OVBA 2UXDF 1Y3JA 4I69A 1TVRB 3HD1A 3CTRA 2XO6A 4Y2IA 1CJTA 1FJGJ 4NASA 3A12A 2QG9B 3L09A 3CPWR 3A8IA 4LSLA 4ZVSB 4I6WA 2IRUA 4WFYA 5KFLA 4AT1B 3VAMA 2ZZTA 2RRAA 3OR2A 2QJ3A 2FZCB 4O4GB 2DXFA 3ISNC 2EW9A 4ZPTR 5F8GA 2WVBA 2VKZG 2MZRA 1JKHB 1SBRA 3X3UA 3HVTA 2AYEA 3B54A 4ED2A 1S6PB 1SC1B 2V2ZA 2EG2A 4Q2MA 1BC6A 3N0VA 4KHMA 4EGLA 3N6LA 2FC8A 2VQFF 3IAM9 2BJ1A 4GVBA 3MFHA 4IOBA 4YR2A 3AOBA 4B17A 2YNIA 3PEHA 3KLEB 4DR6J 2E1RA 5ETRA 3DDIA 1VBYA 2CQ2A 3DYAA 3DOKB 4F7VA 2ZH2A 2FIUA 4A8FA 1SJ3P 3UD4P 2EC0A 4F25A 5D6GA 2R9LA 4ELUA 4GKKJ 1CPZA 4FS2A 4BC7A 3J81Y 3L3CA 3NBPB 2KJWA 3OTOF 3VALA 1DFDA 4ATNA 2HGLA 3UW1A 2CPIA 4X4SA 3OHAA 4ENOA 1PBUA 5F0WA 1FD2A 3ENWA 2KFNA 3BGOP 2DPIA 2E29A 2GAHC 2KU7A 3BV8A 4KAIA 2PO4A 1HBOA 2NXCA 2PT0A 2QRRA 4QQBA 4UQTA 1D9DA 1S7IA 3BS9A 5F8HA 2RT3A 3QRPA 4DV7J 1WTFA 1ZPWX 1VFJA 1OQ6A 2GW8A 5C42A 3BO4A 2YWGA 1KFDA 4WWSA 1RADB 3QFHA 1FDNA 4FZVA 2Y8WA 3DHXA 4NLVA 3PR5B 2XGQA 4Y2MA 2QSFA 3G8SA 1T02A 2JZ5A 1NPPA 2Q66A 1FK9A 3U7JA 3KTQA 2Z57B 4CP5A 4ED0A 2BE7D 4U7UD 3MCSA 2OPPB 2XNQA 1PC4A 4IUFA 3I9ZA 4DX5A 2C2DA 5THWA 3SZ2A 5KG7A 2ZKUA 2B51A 5FDLB 5E3QA 4G1PA 4DV1F 2RF2B 2MZSA 2YX4A 4AFFA 1RK8A 4Q8EA 3QYYA 1QE1A 2QYGA 3THTA 1G2EA 2DO4A 3DRXA 2VFVA 4KHRA 4A8WA 4W90B 1BY9A 2K3KA 2PFDA 1M1GA 2YNFB 4NEZA 2SXLA 3W2WA 2DRAA 2MEWA 3LGNA 4I6AA 1KQFB 4RNNA 2B8QA 3QGHA 1JQGA 3ITHA 1TKTB 2W9CB 3UO0A 1MNEA 2KYXA 2KZMA 3JTNA 1FXDA 1J5EJ 1FF2A 2QN6B 2L9NA 2X7IA 3P5TL 5E7OB 4O23A 5KG4A 2RUSA 5LOQA 3D6FB 4NL5A 4JI8J 3ZZOA 4A8OA 2QMWA 3FEZA 3MI7X 1W2BR 3QAEA 3D0IE 2B4UA 4IQMA 2YVSA 3D1OA 2IRXA 3O1LA 5J2MA 1HYSA 1C0TB 2ZM6F 4HH0A 4USKA 3IRWP 4NLXA 1GQEA 5F8NA 3ILOA 2YX7A 5EUHA 2V6AA 4IO1A 2NCKL 2MGZA 2M8DB 3K2YA 1M1HA 2JDJA 3A8EA 3H5XA 1DAXA 4DFJA 2HQGA 3BM7A 1S59A 3P5BP 3HXMA 2FDNA 5I4MA 5HROB 1N5SA 4HT5A 1LW0B 3SQGA 1BUXA 3H4DA 1AYEA 5HMZA 4A8SA 3DMJA 2XMAA 3M8ZA 3TWZA 1ICEB 4NLGA 1GMVA 1J5OB 1H7XA 2NYHA 3Q89A 3E01A 2HRUA 4I2QA 4HEA9 4RW6A 4NZ7A 2BOPA 1HR0J 2PGCA 4K0KJ 3OJUA 5ETOA 2BKOA 3R7SB 1FXLA 2AHOB 3JYTA 3PO5A 4FNHA 3PX4A 3QWUA 4TXSA 1VCTA 1OPIA 4NLUA 4O3OA 5KFPA 1LWFA 5LMNF 3K5MA 3QSYB 2RSQA 3OLBA 1RTHA 4UY85 1YRUA 3Q8YA 1NSPA 4DI6A 5KT3A 1AXQA 4TQSA 3GYGA 3FUYA 2HEKA 1N0UA 3LOUA 2MKYA 2FJXA 1KVKA 2HQDA 1HBMB 1D3WA 3CGIA 1KSPA 3TQEA 2IFXA 3WX4A 2VG6B 3CJ2A 3CWJA 4B3RF 1NB2A 5DO2A 1XR5A 3VHQA 4RU9A 3UDVA 4KHPJ 4U9RA 2XCPA 1AZSB 4XK8C 1NLKL 3CIZA 2CWKA 4RUCA 4USUA 2NREA 1WACA 3CMQA 1A6LA 3D6TB 2OSQA 5K14A 5CHCB 2EKNA 3DXBA 1UA1A 1MMDA 2R42A 3I87A
chains in the Genus database with same CATH topology
2LQ9A 4WCEQ 2BABA 2FY1A 3IGNA 1MMLA 5E5NA 2HHHF 2BRLA 3EZUA 3U02A 4N76A 4USIA 1DBDA 3GB0A 2CJAA 3NAHA 3V2UC 2XBPA 3OTEA 3M32A 3AB4B 2E7WA 2FLLA 2VASA 4BWJA 2KZZA 4K4UA 3KK3B 1S1XB 3H2LA 4IH7A 3KK1A 2HNZA 2CPJA 2POKA 4F3OA 1M0SA 3GZ7A 1P6TA 1LFWA 1KFSA 3K5NA 1C0TA 1G7CB 4ECQA 1LFPA 2B4OA 5HMXA 1KQKA 1JLEA 4RW9B 4ES3A 1X4CA 3FSXA 2UUAF 2VFSA 4G3IA 2R7OA 4RNOA 4O3SA 4KR0B 2QV6A 2GQQA 4BHQA 3H5YA 1M5OC 3H98A 1D1UA 3LWLA 1E6VA 1TZ0A 4ED8A 2YKAA 5IT4A 4CTAA 1SL0A 2MPUA 1NK6A 2PE8A 1M5SA 4KO0A 2YX1A 2GQCA 3I0SB 4R5PB 4M5DA 5DM6Q 1FRHA 1RT1B 2XLJA 4CT9A 4DL2A 1NK5A 3SSSA 3TA1A 4ZPCA 1H2UX 3PJWA 4DV2F 4DX8H 1QJHA 3T19A 2XO7A 2P9CA 1HI1A 3D1QA 1X4EA 2PMZD 3BQ1A 5KOXA 4IYQA 1BGXT 5E3RA 1SV5B 1Q7LB 3ISZA 2DR9A 4DSJA 3FMWA 1TR0A 1YQHA 2AWZA 5E41A 4HDHA 1G3OA 3V81A 2YKNB 1S77D 4OHXA 4K4SA 1YWXA 4YFUA 1V3ZA 2M88A 2YQ3A 1N54B 2K8GA 3BQ2A 5L1KA 2BV3A 3M30A 1O5JA 1TL3A 2Z0GA 3ENQA 5J2PB 3MURP 3NRBA 1U6FA 1LWEA 5AE3A 2LECA 1RYSA 5IXUA 1PGZA 2JC1A 1FTCA 5CD4H 1LW0A 5KG0A 2D3ZA 1H7WA 4EBCA 3AQOA 4ZS6A 4A8MP 4HH1A 1SIZA 2XI3A 3HFKA 2RQ4A 3GYNA 4TU8A 3J7YU 3RYLA 3W3SA 4FPRA 4TNOA 1QSLA 1KHVA 3IRXA 5IS2A 4DF8A 4OHZA 1R3NA 5BYSA 3MTKA 2DNKA 4OX8A 4QIFA 4Y2KA 1M5HA 2CQ1A 2IM1A 3VAIA 2KXFA 4EWTA 1LV5A 2JVRA 4Q45A 4M8LA 5KFWA 2DH7A 3SFUA 1IJEB 3ZZ0A 2DGXA 3UR3C 3QZ8A 1VQ7S 3F44A 1ELOA 4DL3A 4Q2LA 4MAKA 1U1KA 1HMVA 2RE1A 4BWMA 2WSCC 2ZE2B 2ZNZA 4IG0B 4EBEA 1T03B 1Z2LA 2J7WA 4KRWA 3CJ0A 2GHVC 4NZ0A 3G6ES 5LT5A 1VC0A 3H59A 5EX0A 5FLXY 1F5CA 2HNYA 1R7IA 3KHRA 4PKDB 3CCTA 4KGMA 4MJKA 4C4WA 2WRMA 3CVKA 3W2VB 2LLZA 1IBMF 1LKZA 2R7VA 1KNZA 2JEIA 4XO0A 2RNEA 2V4JB 3H25A 4LFBF 3RB0A 4R0EA 4CT8A 1APSA 4DL0C 1QAJA 4J9RA 3H8YA 2MMYA 3VAGA 4KKOA 5KFYA 4NLTA 1X9SA 4PPDA 2YWKA 3I9V9 5LJ5Y 3TVKA 3MDFA 2FVSA 4O3RA 2CQBA 2KKHA 4GO5X 2HHVA 4C8NA 2YNGA 3LP2B 5L39A 1JLBB 3NG8A 4NLQA 3THPA 4A8XA 5DDQC 5KT5A 2RS8A 2RJZA 3BGLA 1RT3B 2DITA 4RWXA 4DG1B 3KLGB 3CCES 3IC1A 2D1CA 3V4MA 3J7A1 2W9BA 4J37A 1R31A 4IFVA 3ZZPA 2OP5A 3EGWB 5D3GA 3KJVB 1K0TA 3HX9A 2OD4A 4F4YA 1KD1T 5CYQB 4DSIA 2AYMA 5JJBA 1X0FA 2VPWB 4OX7A 5FD1A 3Q8RB 1HPZA 1YIJS 1U1PA 1M5VC 3AH6A 3M1VA 3OV7A 1FXRA 2BM0A 5KT6A 1I1GA 3GIKA 1FRLA 2E44A 3MF5A 3DLGA 5KFEA 4DSKA 1HFEL 4ZVGA 1FEHA 2JFKA 3J7YI 3M2VA 4UW2A 3UPFA 4K5SA 2EBGA 5G0RA 3EXYA 1T3NA 3S8SA 4LF6F 1C1BA 1CC8A 2WBRA 1REVB 3T5LA 1WHXA 4ECYA 4DBQA 1DQAA 1N32F 2MZ1A 2J9DE 2B5JB 5GVQA 1S1WA 1JJHA 5J2NB 1YGYA 3TAMA 2FJEB 5DLGA 4IO9Q 3IA0A 1V9OA 3OR1B 2HNDA 4QR1A 4QIWD 3CCLS 4CZCA 2BJEA 2DNHA 2KO1A 4ECUA 4AQYF 4G1QB 4X2BA 2B7CB 4ZMMA 1FO1A 2Z2MA 4P6QA 2FGOA 2HMIA 4CCHA 3B4DA 3SI8A 3G8QA 1IBLF 1SH2A 3IGVA 1TUVA 4ED7A 2QYCA 1HBUA 3M2UB 4D3GA 2NLWA 1N0VC 2O5DA 1YITS 4F2SA 2HHSA 2XEXA 4L6V3 3BJYA 4WU2A 3RB3A 2V4RA 3TOQA 3JTOA 2ACYA 2V8VA 2UUCF 2E9TA 3LALA 3DCAA 2OPRA 3SXLA 2LQJA 3KNGA 2EK6A 2XMWA 1T05A 2CYYA 1KQSR 2HGNA 5IZHA 1VBXA 2DGQA 2R8KA 1TVRA 1VIOA 1FD8A 2VPYB 2R7TA 3MEKA 3FRYA 1S49A 4NA2A 3D54A 3AAWB 4IDKB 5JUMA 3PKYA 2XMVA 4KFBB 2LQ5A 2ZD1B 3FCHA 4YQWA 2BM1A 2DNMA 3DLKB 2RILA 4LFAF 3MM7B 3OL8A 4RW4A 1S6OA 4Y28C 2CG4A 2XWXA 1RA6A 2HZCA 3Q2SC 1JMTA 1X9MA 2UP1A 1QVFR 4B9MA 2RU9A 1U6ZA 4NOHA 1RGVA 2ROGA 2DISA 3N79A 4KQZA 2UXCF 2X51A 2LDIA 1IKVA 5LSRA 3KLIB 1U26A 3CSKA 1YJWS 1IBKF 1P1LA 3MMBB 5IM0B 2HQ3A 2W7OA 4I56A 3FRZA 3RB6A 2OLWA 5I3QA 1BLUA 1O0PA 2GC8A 4MTPA 4WK1A 2KXNB 3LO3A 3T5KA 5KG5A 1VQMS 4ZHRA 5EN1A 3CD7A 4PXBA 5K8OA 4YDDB 1HI8A 4PPZA 2W9AA 4Y0FA 2OPSA 3UDCA 3FDSA 4NLOA 3QIPB 1V6HA 4FF4A 3KK3A 1HW8A 1UJ4A 2FLNA 4ZCLA 2KM8B 4DS5A 2XSJA 2EFVA 1DQ9A 3BZQA 2QLXA 2N4CA 3ULHA 1HWUA 2MKJA 4ECRA 4DWIA 3C6UB 2ZH9A 4CH1A 4RW9A 3AJ1A 2OD6A 3IG1B 3C2PA 3OHBA 3BDEA 2Q6CA 1A7GE 3DLBA 2IM0A 1VI7A 2UXBF 2CPHA 2VG7A 1M90T 5GAHU 2LCWA 2PMHA 2Y1JA 3AY0A 1S1VA 4KTQA 2BDPA 3MXHP 5A0YB 5A8KA 4O44B 1R89A 1RTDB 3GFZA 1FA0A 2JSXA 1ZETA 1FRJA 1X4BA 4WFXA 4QW8A 1JKHA 2XNRA 1RI7A 3J7ZT 5E33A 1RT1A 1B0VA 1WNEA 4QW9A 5B0CA 1L3UA 4X4RA 2B3TB 4DLGA 3TI0A 1JJ2R 4ZCMA 2GCFA 2RDIA 4FN5A 4PXCA 1WF2A 4KE5A 1DTTA 5A6PA 1U1OA 3OL7A 5K8PA 4ZP9A 5JVGQ 1JLGB 2F40A 2XGPA 3CC4S 2D7SA 3MWBA 1B64A 1ZM2A 1XEZA 4B02A 3C66A 5J2QA 3RB4A 5DQIA 2X1BA 2XMUA 4BBYA 1U24A 1X0PA 2GMJA 4X4OA 4H4OB 4WFBQ 4TN2A 3FEYB 2B9XA 3OQ2A 5M2RA 3PFEA 3MMCB 4KSEB 4FXDA 1WTBA 3BSNA 3DHWC 3CE8A 2FHKA 1TQLA 1SH3A 1P27B 4WYLA 1SJFA 4ZPVR 5AE2A 4W92B 4USJC 1N33F 3B82A 1Y7PA 2KH9A 1TK8A 3KLEA 3V6DB 2DHXA 4YR3A 5HI7A 1KR4A 2U2FA 2LU1A 1S9EB 2ZE2A 4RW8B 1Q53A 4DR3F 4IKAA 1JX4A 2XB2D 3QJLA 2DNQA 5KFZA 4WFAQ 3CCUS 3T9ZA 3M9OB 3BN7A 4ZPDA 3M8SA 4NCBA 5D4OA 2VBXA 1UJ6A 4LSLB 1X4HA 2AJ0A 2VONA 4URSA 5GAEU 2R8JA 5GAHI 1UVLA 1WD6A 4CO3A 1WEZA 5L9NA 3IWNC 4LIRA