1U1RA

Crystal structure of up1 complexed with d(ttagggttag(2pr)g); a human telomeric repeat containing 2-aminopurine
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
183
structure length
183
Chain Sequence
KEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human UP1 as a Model for Understanding Purine Recognition in the Family of Proteins Containing the RNA Recognition Motif (RRM).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein/dna
molecule keywords 5'-D(*TP*AP*GP*GP*GP*TP*TP*AP*GP*(2PR)P*G)-3'
total genus 51
structure length 183
sequence length 183
ec nomenclature
pdb deposition date 2004-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1u1rA01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1u1rA02
2DH8A 2DNMA 1K73T 3NNAA 1H6KX 2CJKA 3FEXB 1VQPS 1FXLA 1U6BA 2MY8A 5FJ4A 2D9PA 4F25A 2X1AA 3UCZP 1X5TA 2CPEA 4J5OA 1DRZA 2VONA 1JJHA 2DO4A 1WHXA 3CMAS 4ERDA 2OSRA 1AUDA 1VQNS 3Q2TC 1A9NB 3NS5A 4YUDA 1WEYA 2DK2A 2EK6A 2CPHA 3CCJS 2AYMA 2MZJA 2NLWA 3UCGA 2CPDA 2WBRA 1DBDA 2XSFA 3THTA 1G2EA 2MZRA 2MGZA 2MZSA 1D9AA 2MHNA 2MB0B 1HA1A 5BJRA 3U1LA 4ZKAA 2XB2D 1VBZA 1VQKS 5IQQA 2JWNA 2DGQA 2MKHA 2RUGA 3G8SA 1F9FA 2CPZA 3MXHP 1NJIT 2DGWA 4W92B 4QU7A 3P3DA 3P49B 4TU9A 1WG5A 2E5GA 2J0QD 2MKIA 3UE2A 5DETA 3MUVP 2F9DA 2MXYA 1YJNS 3CULA 1K8AT 3TYTA 1WI8A 1Q86T 3MOJB 1FJCA 1HD0A 1N88A 5GAHU 1S79A 1U2FA 1U1LA 1S72S 2SXLA 3CTRA 1YITS 3P6YC 1N8RT 1U6FA 2U2FA 1B7FA 4Y0FA 2MQOA 2KXFA 5LJ5Y 3OW2R 2M4MA 2OTJS 2EVZA 5GAEU 2LEBA 1WHVA 2DGVA 3VAKA 1VBXA 1JJ4A 3UCUP 2DIVA 3MD1A 2RU3A 2CQIA 2MQQA 2HVZA 2DH9A 5HO4A 3G6ES 2HYIB 2HGMA 3US5A 3THPA 5CYJA 2YWKA 5GADU 5D77A 3BO3A 3BEGB 3N9UC 4LIRA 3CPWR 2DNLA 2CQ0A 2N3LA 3G71S 4WKRA 2LCWA 1QVGR 3JB9k 1X4CA 3TP2A 1VC6A 2DNNA 1X5SA 4WFNQ 1VC0A 2J8AA 1PO6A 1WF1A 3VAGA 2DGUA 5JVHQ 5JVGQ 1YJWS 1KQSR 2KG1A 2AYEA 1KOHA 1KC8T 2DHAA 5MLCV 3G96A 1Q81T 5DM7Q 3S8SA 3UD4P 1VQ4S 2DO0A 2KM8B 2I2YA 2FY1A 4TLQA 1WF2A 2RRAA 2CPYA 1RKJA 1M5VC 3SDEA 1ZZFA 3SMZA 2F3JA 3DXBA 3NNHA 2FC8A 4W90B 2DNOA 1FT8A 3D2WA 2JVRA 2KI2A 1M5PC 2PEHA 1K9MT 2YTCA 4UY8T 4C4WA 4YOEA 1NU4A 3VAFA 2ERRA 1ZZNA 2OIHA 2MQLA 2RT3A 3S01A 2N82B 4A8XA 2CQCA 2F9JA 2LEAA 2JX2A 2I38A 3MUMP 1XN9A 2G4BA 1UW4A 2MQMA 1KD1T 2M8HA 1JMTA 2M8DB 4IO9Q 2DHSA 1VC5A 3BS9A 1WHYA 1WF0A 1OIAA 2DITA 1NO8A 2KVIA 4CH1A 3G9CA 3P5TL 3L3CA 3IRWP 1VQ8S 2DHGA 3RW6A 4IOCQ 1JJ2R 2VOPA 3VAJA 2XS2A 5DDOC 2X1FA 2D9OA 4WF9Q 1FHTA 1Q82T 2MKSA 2M52A 2KYXA 4Z2XA 2DGOA 3I55S 2YKAA 2KRBA 1SJ3P 4WIIA 3CCRS 2MGZB 1OWXA 1Q7YT 1VQLS 2NZ4A 2FPHX 1YWXA 1WEZA 2CQ1A 1VQ7S 2RNEA 1YJ9S 3VALA 2ZJRQ 3CCMS 5D78A 1HL6A 2K8GA 2VODA 2LXIA 1UP1A 2KXNB 2LQ5A 3R1LA 2RQCA 2LECA 2YH1A 2CPIA 1X4BA 2DGTA 2HGLA 5DDQC 3RW7A 4TU7A 1IQTA 2M2BA 3B4MA 2RVJA 3HHNB 3CC4S 1ZH5A 1X0FA 2LA6A 1WELA 3SDEB 2DGSA 2MQPA 5GVQA 4OZ0A 4FXWA 1UFWA 2JVOA 2KHCA 1SJRA 2B0GA 2XS7A 5LSOA 2RS2A 1U1OA 2ADCA 2E5JA 1QM9A 1OO0B 4Y00A 4V19X 3HI9A 2CQ4A 3B4DA 1SJ4P 2CQDA 2O3DA 2MPUA 2DGXA 2Q79A 3CCUS 1FJEB 1QVFR 5GMKa 5HL7Q 4WCEQ 1SXLA 3FEYB 3K0JA 2DNRA 3TO8A 4IUFA 2OTLS 1X4GA 4BS2A 2MYFA 4U67Q 2M0GB 2GHPA 2DNHA 2LA4A 2DNGA 3CCSS 1O0PA 3S6EA 2J76E 3Q2SC 2MJUA 2DNQA 2E44A 3MI7X 1H2VZ 2CQ2A 2EK1A 2G1DA 5DM6Q 3U1MA 2OSQA 3R27A 1N52B 2LYVA 2CQGA 3CC2S 2MZ1A 4YB1P 3H2VE 2XNRA 4ED5A 2U1AA 2KFYA 4OZ1A 4CIOA 2AYBA 3J7YU 2M88A 3J7ZT 3IWNC 2RRBA 2DH7A 3V4MA 1YHQS 4EGLA 2E5HA 1YIJS 5CA5A 2E5IA 1VQMS 3VF0B 2MY7A 5LXYA 3VAIA 2QEXS 4LJMA 3G4SS 3R1HA 1WI6A 5DDRC 1CVJA 1WWHA 2RS8A 2HGNA 3VAHA 5LXRA 3CCES 2G0CA 2KT5A 3G8TA 2DB1A 5DDPC 3MUTP 1YTYA 1FNXH 1WHWA 3CMES 2UP1A 2CPXA 1FO1A 4WFAQ 2MMYA 3BO2A 2OJ3A 1URNA 3EGNA 2MKCA 4C7QA 4F26A 2DNZA 2A3JA 3LPYA 3UD3P 3CC7S 1X5PA 1N54B 2CQHA 1KOOA 1X4AA 1X4HA 2XS5A 1P27B 2KRRA 1VBYA 1VQ5S 3EGZA 4CH0S 1H2UX 1M1KT 2CPFA 2X1BA 1WTBA 1U1MA 5LJ3Y 3BO4A 1R8HA 3CCLS 1U1NA 2M7SA 1U1QA 5GAGU 1SJFA 2ZJPQ 4PR6A 3CD6S 2MSSA 2KU7A 2J0SD 2MZTA 2LKZA 2L9WA 2AYGA 1VQ6S 2L08A 2MJNA 1DZ5A 2AD9A 2LXUA 1H2TZ 1PGZA 3MDFA 3I56S 2GO9A 2DNYA 2PE8A 1VQ9S 2LMIA 2XNQA 4F02A 4PRFA 1HD1A 1W2BR 2RQ4A 1M90T 3MURP 2YH0A 2CQ3A 2K3KA 2KM8C 5H1SV 1WG1A 1SJQA 2KN4A 1X4DA 3NS6A 1X4FA 2CPJA 4RU2A 3CCQS 3UWTA 2KG0A 2DNKA 1VQOS 4LMZA 2VOOA 4WFBQ 4QPTA 1M5OC 5ITHA 2MKKA 4M5DB 4QU6A 5LSLA 1U1RA 2D3OR 2MZQA 1BY9A 1WEXA 1YI2S 2BZ2A 2QFJA 4UQTA 3PIOQ 4IOAQ 1U1PA 4TU8A 4C0OC 2X1GA 3LQVA 3MD3A 3EX7B 3NNCA 1UAWA 2M9KA 1R8PA 3VAMA 2DISA 5EN1A 2DHXA 2M70A 2ADBA 1X5OA 3CXCR 3CCVS 1P1TA 1L3KA 1X4EA 2JRSA 3ULHA 2L41A 5IM0B 2MKJA 2ZJQQ 5CXTA 2HZCA 2DIUA 4P6QA 3CUNA 5IFMA 2BOPA 1A7GE 3ZZYA 4QQBA 1OPIA 2FC9A 3H2UB 3CF5Q 3ZZZA 3SXLA 2N3OA 1FJ7A 2KH9A 4CQ1A 2QA4S 3PIPQ 3DLLQ 1U1KA 2V94A 5IM0A 4PKDB 2KXHA 3NMRA 1M5KC 2N7CA 1D8ZA 1RK8A 2FHOB 3S7RA 2CQPA 1WG4A 1DHMA 2DNPA 2MQNA 4FXVA 2CQBA 2MSTA
chains in the Genus database with same CATH superfamily
2D69A 1PJ7A 1H6KX 4K59A 3RB6A 2CJKA 1D9FA 4FYWB 3PNIA 1EETA 2BBEA 1FXLA 4LSZB 3BF4A 1RT3B 2GC8A 3N0VA 2C3YA 4O4RA 4R8UB 1U6BA 2R4FA 2YQ0A 8AT1B 2R7VA 4WZMA 5FJ4A 1PC5A 1VHIA 3UCZP 5H9EK 1S9EA 3U02A 3KMQA 5D0RA 4ECXA 2UXDJ 1S1WB 3GCWP 1FX4A 5I42B 1RAJA 3DOLA 4YHHF 4BDPA 2CUYA 2MKYA 2V4JA 1FDDA 2F8EX 3MCSA 3JSRA 4Y2IA 1VLOA 3CMAS 4R25A 2MLYA 1VYAA 3T5HA 3UQSA 3TUIC 4M5JA 3V81B 4QYZK 3Q2TC 1TMMA 4ZPBA 5HVFA 5L46A 5GAGI 1A9NB 3JSBA 2AEJA 3NS5A 5LMNF 1AA1B 5E3PA 1RACB 4YUDA 1WEYA 2DD8S 3C16B 3M8QB 4B3TF 2AYMA 4B17A 4PG8A 3W3SA 3W63A 4F4ZA 3THTA 2XSFA 1MN9A 2HQ3A 3OTDA 4ZLLA 1LXNA 1S1WA 3HMJG 1WC3A 4PXCA 5F0UA 2EG1A 2MGZA 1Z4UA 2MHNA 2V2VA 2ZH6A 2PC6A 1H0HB 1GTEA 4DG1B 5BJRA 1C1BB 1GMUA 3LO3A 3LP0B 3DU6A 2Z30B 3WDOA 1BQNB 2CFXA 2XB2D 1VBZA 4E98A 5DLFA 1RCXB 2JWNA 2MKHA 2CPZA 3VVTA 2R7WA 3R8YA 4QIGA 4WPAA 1HWJA 1FCAA 3MXHP 5HVGA 3V6HA 3NRBA 5KG5A 1WG5A 2VFVA 3HSGA 3K17A 4AQYJ 3ILIA 2ASDA 3W60A 2LQ9A 1FE0A 4CO0A 2MKIA 3QRQA 2GX8A 3AFGA 2G0IA 4GRSA 2Y0BB 4Y2CA 4CZCA 3CNQP 2MXYA 3MUVP 4BC9A 5C25B 2PO4A 1GTHA 3TYTA 4QBUA 2QLBB 3M9NB 1K8AT 5F8HA 2HFUA 1N88A 1HLWA 5J2MA 2JLGA 1K0TA 3A3PB 5KAKA 3GR1A 1XIQA 1T0TV 2PSZA 2GJIA 4TY8B 2RIJA 5KFVA 3RGIA 1DQ8A 3W5XA 4ETXA 1NHVA 4A8MP 1U6FA 4HHHA 4NYZA 2K2PA 3BGRB 4XTTA 1V9OA 2UU9J 1T9TA 2MQOA 1R0BG 3EWGA 1RTHB 3HVTA 2FVQA 2DPJA 3CULA 4RW9A 1FF2A 1S4FA 2IYIA 2ZE2B 4TYBA 4L73A 1M1HA 3QWPA 2OEKA 5EX3A 1HHTP 3BYRA 1WOPA 3EGWB 1NBEB 3MD1A 3OFFA 4ZP7A 4DUZJ 3KJNB 2VUGA 2W9AA 2C2DA 3OHBA 2HVZA 1B0VA 2ZBQA 2DH9A 1UJ5A 3ILJA 5HO4A 4EO6A 1WDDA 3THPA 2XMVA 5CYJA 3C6UA 3I31A 5GADU 2FJEB 2OO4A 3BO3A 1HFEL 1YBAA 2HIQA 3QIPA 3DLBA 4O4GB 2XYPB 1QE1A 1QUVA 2R7QA 4P75A 2OMLA 4ZIVA 5AXNA 1S7IA 1BHNA 3QLHA 2K7JA 4DI6A 3GCXP 1QVGR 3KTQA 1NJWA 2IJRA 1VHFA 3TP2A 2W7OA 4DV4F 2B8QA 4DV2F 1NH7A 2JNJA 2DNNA 3CJ2A 4KFBA 2RDJA 1SL1A 1X5SA 2WRMA 5CD4H 3CJ8A 3K7RA 3DLHA 2AIRB 3OTEA 3BB5A 4CP5A 3H5XA 3UD5A 3UR0A 5JVHQ 3R7SB 2J7UA 4TLRA 5E7OB 3QO9A 2HFSA 2LQJA 4NLQA 4G3IA 2B6AB 2CZVC 2KG1A 2FLNA 1JIHA 2AYEA 4X65F 5GADI 3OFHA 4TQRA 3FZ2A 1AFJA 1SIWB 4KKOA 2YKMB 1Q81T 3OXGA 1ICEB 2YPYA 1Y00A 4NLUA 1C4AA 3MFIA 1ZOTA 4FBTA 4N76A 1RBOB 1BWEA 3KJVA 2RRAA 4NEZA 1AFIA 4PWDA 1RKJA 1RWNB 5CD4A 5KFWA 4G1QB 3TNVA 4I7FA 2PFFB 3D4JA 2J8SA 1TP7A 4RBTA 2XQCA 4DR3F 4IR1A 4DV4J 1NNDA 1JWWA 2F3JA 2R9LA 2AJ2A 3DOKB 4C98A 1NUEA 3GYNA 3W9IA 3E2EA 3CWJA 4RL1A 4OYMA 3R6LB 3GYGA 1TK8A 2IM0A 4WBFA 1F60B 2DNOA 2JVRA 1Y3KA 2P8IA 1RA7A 3EUNA 3J7Z5 1KTVA 1NU4A 1PKUA 2OI2A 3FDSA 1HMVB 1KFDA 4USJC 5HK4A 3S1TA 3VHQA 1RU2A 3DM2B 4P7VA 4TQSA 3T41A 2OIHA 4IR9A 1RKIA 2N82B 4OYAA 3LWLA 5IT0A 2IVYA 3IN5A 3A8KA 3K8VA 5KG0A 1N36J 3NMAA 5KG7A 5D3GA 2E9RX 1RADB 2XCAA 2LEAA 1HI8A 1ZAVA 4X4NA 2UU9F 2WB1D 3A13A 1XN9A 1WC1A 3NBPA 4UOCA 1X7VA 1XMOF 3M8SA 2OD6A 2NS1B 3MMBA 4ECYA 1JMTA 5KFRA 1KN6A 1R89A 4ANDA 4EBCA 5ETLA 2HMIA 1HYSB 3KUEA 3D6HB 5J2QB 1FE4A 2YBVA 5J2NB 2QZ8A 2XI2A 2XO6A 2XYHB 1HNWF 2OPQA 2AWZA 1QSSA 2DITA 3I5CA 4OLOA 4OZNA 3P5TL 2ZH5A 1VQ8S 1I1GA 1RT2A 3L7UA 4IOCQ 4PYDA 2PT0A 5KG2A 1TKXB 4OJ1A 3KUGA 3T5JA 1XJWB 3PTWA 4H4OA 2AGQA 4WF9Q 1Q82T 1FHTA 2HQFA 2HK2A 1J2VA 3HHLC 4KT0C 4L74A 2QJ3A 2R7XA 1LWCB 1MLAA 1YBUA 4C8KA 1OYDA 1T9YA 3V2UC 3GMGA 1UZDA 3R6GB 3T1HJ 2MGZB 3M8WA 5J2NA 2NXNA 3TAQA 1ZTTA 4USVA 2E29A 1YWXA 2BJ8A 2FPHX 1WEZA 3MEEB 2VG6B 1ZBTA 4OYIA 2V2KA 4QR0A 5KFUA 4Q43A 1Q95G 5L1LA 3PW2A 3ENWA 4CLZA 1BQNA 4IRCA 2LFVA 5D78A 2LXIA 3N5FA 2DY1A 2ZZNA 1U6ZA 4PG7A 2JEJA 1XR7A 3DLGB 4OHYA 2AJFE 3BGFA 1LQ9A 2AJQA 4CT9A 3MPDA 1HNIB 4BHQA 4ECVA 2LECA 1S97A 3GG0A 2HS0A 5IC4B 1Y4ZB 4Y28C 1DQAA 1X4BA 2PIIA 3D1QA 3MM6A 3OUYA 4WE1A 5DRKA 2XZDB 4MJKA 3RW7A 5CABA 2JEIA 3HSJA 4QR1A 4K4WA 2OFHX 4HEA9 1MU2B 2CAJA 3B4MA 4HACA 3FEZA 3ENAA 2AZ1A 3HFVA 4OQJA 4DV6J 2EKNA 4J9VA 3ZZUA 4DR1J 3PV8A 1JKHA 1X0FA 1PG5B 3FCHA 2MQPA 2GQCA 4L76A 3BSOA 1H38A 1FERA 5GVQA 5J1EB 1JLEA 1TUGB 1NZAA 2K06A 2YWWA 3ISZA 3QMQA 2VHGA 3N01A 4NCAA 3UFCX 4HHUA 1GXTA 4MYTA 2FZGB 4ZCLA 3OXLA 4LBHA 1U1OA 3M1VB 4F04B 2E5JA 3KNAA 2B43A 5HROB 3NKYA 3MR7A 3TZZA 5RUBA 3QT7A 2BANB 2I5JA 1F0XA 3HJVA 2YNIA 4J9PA 1Y0HA 4J9NA 2B9YA 1VQSA 2Q79A 4OHZA 3OD2A 1QVFR 1K1QA 2LDYA 2JJ4D 4U8VA 3W2VB 4JV5J 2FYXA 5KFLA 4C8YA 4FPIA 4ZVOB 2GS8A 3QZ7A 4B3RJ 5A2QU 2CWXA 3F41A 5CQGA 3E01B 3FEYB 2DNRA 3K0JA 5A2QY 4IUFA 2APOA 3HHEA 4BS2A 2XY6A 4GKKJ 1DTTB 4C11A 2QSFA 2M0GB 2OP5A 2DNHA 5AXMA 3CCSS 1PAUB 4ED6A 2JC0A 1WC4A 3LH2S 3LPEA 1T7PA 4J9OA 1O0PA 1NK9A 1FNOA 2X51A 5BYRA 4PG4A 3LOUA 2FTRA 2ZC4A 1LEOA 2J76E 1JXEA 2MJUA 5A8RA 4ZLJA 1XC9A 3AOAA 2P2CB 1H2VZ 2DR6A 3MI7X 5IC6B 3IM8A 3W2VA 2RD5C 2E1CA 3LA0A 3OTBA 2H9ZA 1JLAA 4CLPA 2B56A 5DM6Q 5LSRA 2CDRB 1VJQA 1JLGB 1RE1B 3T1HF 3DMJA 3IR5B 3TVYA 5FD1A 3DNCA 3LGNA 4C3MA 3KG0A 1LW2B 3GTYX 5HLFA 1FJEB 2DVIA 2IY5B 3H2VE 4K50A 1SV5B 2U1AA 4KPCA 2DRBA 4DR3J 2IYGA 4UOFA 3NEKA 3CJQA 1TL3A 2IRUA 4F3MA 3IWNC 1NK5A 2B4VA 2DH7A 5ETVA 1TK0A 1S99A 3KG1A 3EGVA 3J81U 3QQCD 1YHQS 1N5YA 3OVBA 1DLOB 4N56A 3HD2A 5CA5A 2VFUA 5CAAA 2E1RA 4LRCA 3IS9A 4DPXA 3OSNA 4IDKB 5T14A 4CLLA 4Y2AA 2HKEA 4F4WA 1V6HA 3T9NA 2CG8A 3VAIA 5CZVA 3A8JA 3R1HA 5FLXY 5LT5A 5E3CA 4CH7A 1HWKA 3CDUA 2XULA 2QL7B 4YDDB 3O3LA 3T6JA 1RLCL 5LXRA 3CCES 4KGZB 3V6JA 2G0CA 2Q1LA 5HBMA 3CO0P 4KO0A 2OD4A 3SSRA 4F2RA 2B4PA 4DR7F 2FJBB 2F5GA 3K59A 3CMES 1NSAA 2OUGA 4UTGA 2IRXA 3MGJA 2ZH3A 2QYCA 1CJVA 1URNA 3EGNA 2MKCA 1S0VA 3NBPB 2A3JA 4IFVB 5G4DA 4XIUA 2QL5B 4ZPDA 1MWQA 4LRFA 2RMLA 1OQ3A 5ETQA 1N54B 1BC6A 1S49A 2ZBPA 3BN4A 5HI7A 1KOOA 2IM3A 3DLEA 2R8HA 3W65A 1Q4RA 3Q8UA 3EZUA 4NLXA 1IBCB 2CJXB 2IVMA 4CH0S 2KT3A 2FJWA 4WP9A 1GX6A 3W9JA 5L9NA 2XMKA 3GJRB 4MKAA 4JV5F 3DI6B 5B7WA 3HZEA 3OR2B 1F5AA 3SV4A 1U1NA 4LF6J 1NJZA 1RHUB 1RP5A 2M7SA 4OYXA 3V4IB 4OX9J 2H5EA 2IRYA 4HVZA 3FMWA 1HQEB 2K7KA 4X4PA 5KFFA 1NJXA 3PRVA 4JI5F 2E9ZA 4OI0A 4DQSA 3Q0AA 4DV5J 3NL0A 2R2RA 3DRYA 3AOCA 2L9WA 3D0HE 4IH6A 1Y9OA 4DUTA 1TKDA 3MMAA 4H54A 1R7IA 3F0NA 3KDOA 2AU0A 2IJNA 2ZWPA 1NDCA 1DZ5A 2HHVA 4ZHRB 2HFNA 3MDFA 2B9XA 3I56S 3KUHA 2F63A 3KJQB 2EW9A 2P6SA 2Z57B 1HBMA 4BWJA 5HMZA 5A8WA 5KFNA 1YJRA 2CVEA 2GGPB 3W62A 2GIQA 2AV5A 1WACA 2A2DA 2HRUA 4S0MA 4N5SA 1M90T 1YK9A 1S9EB 2AHOB 1SC4B 1RTJA 2F8HA 3LGHA 1FK9B 1WG1A 4O3PA 3MM5B 3MM8A 3PR5B 4MK8A 1XMQJ 4K0KJ 2HHWA 1X4DA 3O44A 3W7BA 5H9EJ 2Y8WA 3DRRB 3D67A 1RXOB 3NP5A 5JMNA 1X9WA 3E3XA 4OI2A 2QMWA 5IXUA 1FRMA 1GH8A 1FD8A 1U24A 2IJFA 1C0TB 1P9QC 4QPTA 1TV6B 3SQGA 5KG4A 5KT3A 1TKZB 2CJBA 4LFBF 1PC4A 1RT4A 2OPRB 4J9LA 3B78A 4K4VA 4M5DB 2VG7A 2VC0A 4OZ2A 5B0AA 4AD6A 1QAJA 2DXEA 4NI2A 1UCNA 2UVVA 4KYZA 2ASJA 1BMQB 4FS2A 2BQ3A 4EZ6A 2KZZA 3CCZA 1UPMB 1YSJA 1TZ0A 3DXSX 3MM5A 3VGVA 5KFZA 2HURA 2BX6A 2BZ2A 2QFJA 1NHUA 5HROA 4UQTA 4MK7A 5KFMA 3GYXB 4ZLNA 1SL0A 2I5JB 1JNZB 4DUYF 4TU8A 4TKTA 5JJBA 3T5LA 2FJDB 2IM2A 3SSSA 3ZZOA 3QAEA 4C0OC 1N32F 4MAKA 3HHLA 3NGRA 4QOTA 1R8BA 3PJ9A 3VQSA 4FYDA 4KAIA 1UAWA 1EKRA 2W2MP 2DISA 2F8MA 4RJVA 2BABA 2CZ9A 2M70A 2HLUA 1U49A 3VZHA 1T9WA 1IUJA 4O0IA 4CWBA 5F8MA 2ZOGA 1R6VA 3FFIB 3B8HA 3G87A 2MKJA 2YKPA 5DO2A 5KFAA 2G2ZA 4M5MA 4FZVA 2ZJQQ 2IMWP 1YJ7A 2HZCA 2DIUA 4P6QA 2HW3A 4ECRA 2KT2A 2YWFA 2HNYB 3R2CJ 1RAEB 2VQFF 4DR6J 1OJ4A 1MROB 1Z2LA 2AKWB 3H2UB 3KFWX 3NCQA 3V5RA 2WSCC 4XDCA 5ETRA 3ZZZA 9ATCB 3K5NA 4LF7F 1TFYA 4ZP8A 2H54B 3W61A 5DQHA 1WSRA 4DSKA 1N5TA 4LR7A 3FVYA 2J7WA 1MG7A 4MT1A 2JFKA 4RW9B 1U1KA 5K14B 3DLLQ 4IH7A 4OJHA 4WK3A 1NEEA 1M5KC 2V8HA 3FC9A 1KWMA 1RK8A 3R7BB 1RWPB 3S7RA 1WG4A 1RJJA 2E7XA 3TA2A 5KT2A 3HSZA 5A6PA 3PW7A 2VPWB 4WU3A 2VJVA 4FF4A 4FXVA 3QGHA 4IOAQ 1H7WA 2IAJB 1T3OA 1K73T 4HI1A 4I6YA 4NMXA 3T3FA 1FVQA 4R5PB 3C3LA 5EUHA 1MMLA 5SZTA 4U7UK 1IJEB 5LL6d 5DGAA 3DKDA 3IFEA 4YHHJ 1QE1B 1FRHA 2DXFA 3MPVA 4ZVFA 4QIFA 2D9PA 3W8PA 4YS2A 2YNFA 2UXCF 4QYZJ 3HHKA 2IA6A 1GK8A 1X5TA 4DU8A 5HP1B 2CPEA 3AH6A 3LTOA 4HL9A 1ZM4A 4J5OA 2Q6CA 4QIWD 3IBCB 4DX5A 5GMEA 4NX9A 3M7VA 2RSQA 1FKPB 2I0XA 2R7TA 2L3MA 5DLGA 2B5JA 2H3EB 4ERDA 4QCLA 1IXKA 1HWIA 2E1AA 2J6UA 1TVRA 4CLUA 1RBAA 2VIHA 4PQUA 2Q66A 3KG4A 4TY8A 3AJDA 1JK9B 5HBMB 1FKAF 1NSKL 2D74B 1IR2A 3CVKA 3MEDA 2AX1A 2B7CB 1KLMB 2QG9B 3HZGA 4NYPA 2ZKTA 3CCJS 2BE2A 5D15A 3GONA 4B9SA 3RG6A 2D3ZA 2AW0A 4IFYB 3MCNA 1S48A 4QIEA 2C2ZB 3K89A 2BE7D 4DQRA 2F4VF 3MOZA 3EJMA 4ZVSB 3CO9A 1NPPA 4F4KA 2MZRA 2W25A 3NXZA 1U0HB 2MZSA 1D9AA 1FRIA 1B64A 4ALZA 4ID8A 5L38A 3I0RA 3MHYA 2EPIA 3U1LA 1JQGA 1WC0A 2YQ3A 4WJBA 3C6TB 3OTCA 5IQQA 3UPFA 1WKJA 4AFFA 3FNNA 1VQYA 1MSWD 3LP1A 4DPUA 1J27A 3FCVA 2W1BA 3FSIA 1Y3JA 3DOKA 4W4MA 5LMUF 2FY8A 4J9QA 4M1KA 2BYCA 2DGWA 4W92B 2M3DA 2WVFA 2ZITA 3GIRA 1U26A 1FVSA 3P3DA 3PYEA 4EMDA 3M8PB 5C5JA 5D6GA 2E5GA 2Y3YA 3DHWC 4JV2A 1FDAA 3JSMA 3PRBA 2XY5A 2HWTA 4CLFA 5DETA 4ED3A 1CPZA 3DM2A 4USWA 4YN3B 1Q86T 1WI8A 1AB8A 1HD0A 3IBWA 4HDHA 2V4JB 4RR5A 2RE1A 3OQ2A 1U2FA 5T7LA 3H25A 2GAHC 1U1LA 3DYAA 3HHNB 1FWPA 4G6VB 3H59A 4JI4J 2WSFC 3GP9A 3QO9B 4OV6A 1LKZA 5GMDA 3P6YC 1HBMB 1FEHA 1MN7A 1B7FA 4A46A 1MWYA 3NGSA 4DPTA 1PJ6A 2KXFA 3M8PA 2M4MA 4FYYB 1N33J 4OZLA 4DX6A 3SCKE 4Q7AA 3FBFA 1HNXJ 3C15A 4ELTA 3DN9A 4C2MA 3C2PA 1VBXA 3P96A 3UCUP 1R3NA 1OPZA 4GVLA 3Q89A 4HT5A 4NLOA 3GR0A 4TN2A 2HFZA 2HQIA 5B0CA 1FWLA 4CO2A 3SI8A 1I6JA 1GEHA 1T05B 1TFWA 2YY3A 1SIZA 3DYAB 1Y10A 3BGUA 5I3PA 1Y5LB 3G6ES 1S57A 3SBMA 1XNQF 2QRRA 2ZH4A 1GXLA 1RAOA 2XEXA 3TQEA 4DSLA 4C8OA 3PDNA 2F1FA 1HQUB 2VG7B 4RW6B 3D66A 2RKIA 3AD7C 3MAAA 2JLEA 3A12A 3D7SB 4DV7F 2Y8YA 2ZD1B 3PX6A 1VC6A 1XMBA 1CEZA 4K2JA 5HJYA 3TZWA 4CYUB 4B3SJ 1TL1B 3LP2A 3W2WB 3QZ8A 1UFLA 1JLQB 3VAGA 4C4WA 3H90A 2VICA 1X0PA 4F0MA 4JI2J 2PI4A 3N4WA 3P5BP 4ID5A 5G0RB 3KKFA 4UUXA 4JB8B 2ZVIA 2ZWOA 2LVWA 3EE3A 2BXJA 4X84A 5E5NA 2AF6A 4QWBA 3PFEA 1G4CA 1KOHA 2YWEA 2ZDOA 4DPYA 5B09A 1A6LA 3F73A 2UXDF 2DHAA 2WCXA 1U25A 5DM7Q 2W4DA 3DRPA 1VGYA 3FBBA 4FVMA 1B4SA 5H9FJ 2VFSA 4WE1B 2ZE2A 3UD4P 3HKWA 1VQ4S 2DO0A 2DCLA 1WORA 1G6BA 2CJYB 2KM8B 3T1YF 4YEAA 4DG1A 4KV8B 3Q8VA 3LP0A 3Q8PB 1N6QB 4XDDA 2UUTA 4LF9J 1VR6A 4OX6A 4DSJA 4CLWA 2HAFA 3S8SA 4JI6F 4DX8H 1ZZFA 1ROFA 2ZZTA 3OV7A 4H4OB 1L5UA 1NXIA 5H9FK 2FC8A 5ETMA 1LWCA 1N56A 2LQ8A 2Z58B 3A1YG 3EICA 4ED1A 1UA1A 4CO1A 5IT9Y 2FVPA 3DRPB 1TL4A 2GVDB 2YTCA 3QLHB 3DRSA 2UUBJ 4AL7A 3DRXA 2RT3A 3NGUA 3BPSP 2HWIA 4ZVEA 5HANA 5C25A 1XNRF 2G2OA 4DPOA 3KLEB 2XGPA 1N6QA 2RHSB 5CYMA 1CG2A 1REVB 2EEYA 2F9JA 4LF2A 1IM6A 2Z8QA 2IC3A 1W26A 2HRTA 2I38A 4IKAA 2X3DA 1OQ6A 2QT7A 3DLGA 1HPZB 4U9RA 3UR3C 4EK2A 1JLFA 2A18A 2BJEA 3EDRB 3QGIA 1UW4A 3JTPA 1Q8IA 4DCOB 6FDRA 3M8RA 1Y11A 3E01A 3FKBA 2W2PP 3RBXA 2VBXA 3NGTA 1NZ8A 1IR0A 1PBAA 1FFGB 1VC5A 4NXMJ 1YBTA 2B5JB 4ILLA 3AA9A 1WF0A 3BQ1A 1U2RA 2VG5A 3CIZA 5HQMA 3UVJA 3R3TA 3KHRA 5DDOC 3VWSA 3AD8C 2D9OA 1JLFB 2MKSA 4NPOA 2M52A 2XTJP 4MKYA 4CT8A 3RRGA 1GT8A 4K5SA 3KLHA 4Z2XA 2DGOA 2WONA 4B9LA 4MKBA 3DMJB 2DKOB 3I55S 2KRBA 1HBUB 4PG6A 2J9CA 3BGOP 1LW2A 2QMXA 1HMVA 1Q7YT 3PR4A 3CSKA 1B7YB 3CJKB 2CDQA 2BOAA 2DYAA 4DV2J 3DLKB 4A8FA 1S7HA 1SPBP 1GNKA 1KFSA 3G82B 3H8YA 1OSCA 1OMSA 2NPFA 2ZJRQ 2UUCJ 4USMA 1HL6A 2K8GA 3W9HA 2NREA 4DWIA 4NE9C 2VODA 2FHJA 3QNWB 4XAKA 1E6YB 4IO1A 1JXVA 2QL9B 3QYYA 2G13A 3R1LA 3G8QA 2NYIA 2RQCA 3IXQA 3PCOB 2N7YA 1Q1KA 2FB0A 4KKOB 4U95A 4N41A 5IZHA 2PMWA 4DR4J 1S0OA 1J5EJ 4JI8F 2AEFA 2EBEA 2W9CA 4K4SA 2BW2A 2X3GA 3CJKA 1KVKA 4ZPWR 1XBWA 2HNDA 1VI7A 4PABA 1JXLA 1W7WA 1LK5A 3MWBA 1S1UB 2PI5A 1ZH5A 4ITSA 4G1QA 2YWGA 1N48A 1Q5VA 2DGSA 1UWAA 6FD1A 4CI0B 1MMDA 4URGA 4KH1B 4LF8F 3GZ7A 3NY0A 4MYUA 4PXEA 4NLYA 4FXWA 3MMCA 4WYWA 3SIPB 1P6TA 4C0HA 2JVOA 1WJ9A 2X7IA 4KIAA 4QJVA 1VFJA 2WOMB 3I96A 5K8OA 1JNRB 4DR5F 2Y1JA 3WX8A 1ZAWA 2HBQB 3SCJE 4DF8A 3HT3A 4K2XA 1QM9A 4ZVPB 2NCKL 4URQU 2LQBA 3GG1A 4CLTA 2GMHA 3POTB 3I82A 4KGXB 3V6KA 1T03A 4FYXB 5F9NA 2I9SA 1S1UA 1XR6A 3ITHA 3MEEA 3MM9B 3CIMA 4EU0A 2R2UA 2FLLA 1YZ7A 2D3UA 4DJBA 4C6AA 2BJ7A 4YR2A 3Q8QB 3J7YI 2QMUB 2QA2A 3IR6B 2LLZA 2EI5A 2W2QP 2E1MC 5HL7Q 2VA3A 1SXLA 1YRXA 2EFQA 4A47A 1B0PA 3OL8A 3FGVA 4V1Ak 2JZ5A 3I9V9 1UWBB 3CE8A 4M5LA 1S4EA 1U02A 2ILYA 2GHPA 2HWHA 2ZBRA 2DNGA 2DTJA 5KFBA 3TR5A 3MR5A 1TL5A 4EI2A 7FD1A 2FJVA 5T41A 3HVRA 1N5SA 2OPQB 3QIDA 1WOOA 5KFXA 2QX0A 2WAQD 3QSYB 3M8YA 1FRXA 1ZETA 1U47A 2VQEF 4M94A 2DNQA 3TVZA 1R8CA 4DFKA 2JHEA 3HVAA 3KLIA 5KFHA 3HXMA 3Q23A 4OV1A 1AZSB 4NLRA 5B0FA 1TKXA 2UZAA 4UY8T 1QUPA 4ID5B 4OYOA 4CM2A 2WK4A 2GNKA 2HNZB 1SH3A 2Y1RI 3JAMY 4K4ZA 1EAYC 1UWBA 2ZC3A 2LU1A 7AT1B 3G6VA 1M0SA 2OSQA 3R27A 3U1MA 2CQGA 2CVIA 1D09B 3VGUA 3C14B 4ZITA 4ED0A 3ISND 2WZ1A 3CCTA 2H51B 3DGVA 3EXYA 2PD1A 2QLWA 3W64A 3TQ1A 1UW9A 1Y7PA 3PVXA 4JI6J 4OZ1A 4CIOA 1UEKA 1CLFA 3GWCA 3GSDA 2ZH2A 1E6VA 1Q8LA 3QPIA 4EWTA 3J7ZT 1ZM3A 2RRBA 3V4MA 3KLIB 4G1PA 2G9OA 1KSPA 2UV8A 3IRXA 3N6LA 1V3ZA 1AZSA 2A6OA 2E5HA 1HI0P 3TUPA 3UI3A 4W98A 2E5IA 3WIUA 2RH3A 4C0BA 5L39A 3CDAA 1TELA 4ECQA 3I9ZA 2V4RA 1J5EF 2MY7A 2QEXS 5LMUJ 4DQQA 2C28A 5K8MA 4LJMA 1WI6A 2OKQA 3DCAA 5C42B 2XMJA 4J9MA 2DPIA 2WVCA 4LFBJ 2CKWA 2HGNA 4QPXA 3V81A 2D7SA 3H40A 4CNZA 2KT5A 1S9GA 1E6VB 2DB1A 1PIEA 5CYMB 2CXEA 3BBFA 5SUHA 4LT6A 2NZCA 4MH8A 5KFCA 1FNXH 2G1HA 3C16A 1RHRB 2JC1A 3IBFB 3M8QA 4AUKA 5HP1A 4M95A 2CPXA 1FO1A 3U7JA 2MMYA 3BO2A 2N4CA 2VV5A 2NXEA 2OJ3A 1SC6A 1BD6A 4OZ3A 3JXOA 2D41A 2DNZA 3GSIA 4NCGB 3IAS9 2V67A 5IV3A 2V9KA 1URRA 3MM8B 2GHVC 4MIBA 1X5PA 5IOLA 3RTVA 3SV3A 1TKTB 3UD3P 4IRDA 4K4UA 3CJRA 3THVA 1C1BA 4J9KA 1RWMB 2C3PA 1P27B 3A3NB 3NCPA 1F6TA 1FESA 5E3AA 2OPSA 1LK7A 4X4SA 3R5JB 5CYQA 4U7CA 1U4BA 1M1KT 2P9GA 2XC9A 3KLVA 1TV6A 2X1BA 1VISA 2MTLA 3PJWA 4O3SA 2UV8G 1U1QA 2QN6B 2W24A 3OVAA 1F2HA 2I8EA 5DG8A 4NCGA 3DHXA 4ZK7M 2KU7A 5F8LA 1EQ0A 2MZTA 3H20A 4X62J 1KBRA 1SJ1A 5K14A 1SVDA 1KDNA 2QO3A 2XHCA 4OI3A 3KHHA 3TANA 2JFDA 3BKUA 4JYAF 2L08A 5KT6A 2BDPA 2FLPA 2KFZA 2W7PA 3J81j 1ZAXA 2MJNA 2ABYA 2WHOA 3DC2A 3RYLA 4YY3F 4PEOA 1WC6A 1PGZA 4NOHA 3IWXA 3MMJA 3QJLA 3HHDA 4A8KA 4B3SF 2DNYA 2PE8A 5D4PA 1NKCA 4TXSA 1VQ9S 4ILMA 4LR8A 1W2BR 1R0AB 5CH7B 1I94F 3GV5B 2XYGB 2J9EA 2RDDA 2W2NP 4LSLA 2NR0A 5C24B 1VJWA 2HEKA 2VFRA 1S12A 1X9SA 1NSQA 2KM8C 4KGVB 3PJXA 1SJQA 1T11A 2CNNB 3ILOA 3CJ0A 2KN4A 2XMWA 4LQ3A 5B0DA 1N34J 4GVBA 4I2QA 1X4FA 1VRUA 3DGPA 3J81Y 4CTAA 5AT1B 4NWBA 2DNKA 1FRLA 3RBEA 4FNIA 2H5IB 4LMZA 2VOOA 4WFBQ 1C0UB 3SEOA 4MTPA 1F3FA 1XR5A 4NEYA 2KFNA 2CJ9A 2DXDA 2VU5A 1IQZA 1D9DA 4ZN3A 4NLVA 5ITHA 4USHA 1N4LA 4LFCJ 2ZBIA 1ZA1B 3ICLA 5LSLA 3T1AA 2V69A 4XK8C 4YB5A 3HK2A 1U1RA 3OSPA 2GFFA 2RQMA 4OX8A 2J9DE 3CDWA 1HNVA 2J6SA 3PW5A 4NASA 4LF4J 1WEXA 4KFBB 5KFOA 1M1GA 2Y1IA 2QC3A 5CCLA 1EIYB 3FBCA 5HJXA 4KE5A 3PXGa 4P2XA 2V8DA 4P2FA 1L3UA 4PUOA 3VQTA 3LANA 5I3UB 1SQGA 4B3MF 4JI3J 1V5IB 4R5PA 4RPFA 3IC1A 1ZS6A 3I32A 3LP1B 4KO0B 3TA0A 1OY8A 5IWAJ 3SYZA 1NK6A 3LWMA 1MWZA 1FNMA 1UJ6A 2X1GA 3RZAA 2C3UA 4I64A 5HQLA 5K8NA 2HHHF 4DSIA 3EX7B 3VAMA 1R8PA 1TK5A 1RGVA 2B4OA 3NOCA 4A8SA 2V8GA 5EN1A 2KTQA 2OMOA 1HNZF 1X5OA 3AXMA 3GLJA 4DL5A 1VK3A 4LQ9A 2C1EB 1X4EA 1EJ7L 1BLUA 1RWVB 1RBLA 2BKNA 2P9CA 2RB7A 2XWXA 4CLKA 2AGPA 3DLEB 5L8RC 1KVIA 1F5BA 4DN9A 3NLCA 1KQKA 1I3OB 4R0JA 3MM7A 1RHMB 3GJQB 4NLSA 4PWDB 4PQUB 3LW5C 2FIUA 4IG0A 4I6WA 3WHIA 4ZVQB 2PN6A 1JLBA 3GQCA 2QIFA 3A4TA 1KLMA 5D0EA 4EO8A 2ZZMA 2BE2B 2ZH1A 1B3TA 4B9VA 3FSXA 1XTZA 2N3OA 1X31C 3JYTA 4DZDA 1CJKA 4GC7A 1FXDA 3OXFA 4ZVHA 1Y5IB 2EWHA 1Q78A 3OR1A 3W66A 1S1VA 1NK8A 1VIXA 1WOSA 3I0RB 2N7CA 4X4QA 4LRBA 2CQPA 2ZH7A 3EPIA 3M30A 1YVFA 4GC6A 4OFZA 3AB2B 2MQNA 2HG4A 2CQBA 2P5VA 2MSTA 3H5UA 5FDLA 1NK0A 2DNMA 2NSBA 1YZ6A 3T1YJ 1NB7A 1ZTWA 3W8GA 3PYFA 3FEXB 4RNFA 4AXJA 3MAQA 1H72C 1W25A 4LF9F 3PZPA 3P4UB 2AGOA 1UA0A 3VVUA 3DLJA 1HQUA 5CHCB 5CZXA 3MMBB 4UUWA 3X1LB 1NDLA 5D4NA 1P1LA 1F1BB 4F25A 3KXDA 4KHMA 4UOHA 3ENQA 5KFYA 1JJHA 2VC1A 3C46A 1EHWA 2V2ZA 3PHEA 2HK3A 1IWAA 1WHXA 1DFDA 1OY6A 3DRRA 2MEWA 1R0CB 1H3DA 2ZFHA 3KJFB 1REGX 2XHWA 2EG2A 3V6DA 1VQNS 4NRUA 4LFCF 2AZ3A 3MTKA 5G0RA 3OTOF 2EK6A 1HWUA 1RT4B 3MPWA 2ATLA 3UCGA 2DR5A 4E0DA 2WBRA 1DBDA 1PJ5A 3A8EA 3CJSA 5KTQA 5KFQA 4H4KC 4KB7A 4KJIA 1XEZA 2CNKB 2RQKA 1XMQF 2VBWA 3E8OA 3K8WA 4N7TA 3I0SB 4RW7B 2AMCB 2HVEA 2CJQA 2MQ8A 3M8ZA 4U8YA 3KK2A 4K4TA 2FJXA 2MB0B 1HQ2A 2IM1A 1F9HA 1HW8A 2XLKA 2G0JA 3IGVA 4DL7A 3I87A 4ZKAA 2HS4A 3TAMB 1IKXA 3KLGA 1WKLA 3PX4A 3ZO7A 1VQKS 2DGQA 2AT1B 3G8SA 3T5KA 4RX6A 5I4MA 4O3NA 1CS4B 2AJ0A 4TNOA 1RTIA 4X62F 1NJIT 2WSEC 1YTYA 1L3VA 2RKIB 1HNZJ 2UXCJ 1ZPVA 5AXKA 1HBNA 4QYRA 3LGMA 3OL6A 2ZHBA 4DV0J 2UVUA 3P49B 3ZC4A 2J0QD 2QLFB 5B0GA 2QV6A 3TRGA 4RW4B 3OUYB 1QJHA 1TL7A 1S5ZA 1S1TA 1IKVB 2HQCA 3PO4A 3BBBA 1U09A 4K5RA 1IR1A 4USUA 4RUHA 3OHAA 1VOMA 5ETOA 3MOJB 1UVLA 2OELA 4ICLB 4C97A 4CLYA 2KHDA 3TAMA 4LF1A 5E41A 2GIRA 1BE4A 1TVRB 1C1CA 2EFNA 4NLDA 1S72S 1TUWA 3CTRA 3HLUA 3DDNA 4LRDA 3UN5A 1YITS 3MTJA 4J91A 1U7LA 2XBPA 1N8RT 4O44B 2MDAA 3F44A 3MEDB 3N6MA 3T9ZA 5BXIA 2NUUG 5LJ5Y 3OW2R 2VQEJ 2B7BB 2EVZA 4ZPAA 1S10A 5GAEU 3GIJA 1NM2A 2E1PA 2BM1A 4U6PA 2LEBA 2DGVA 1G1XA 1CSJA 3PEHA 3H4DA 1XNQJ 2WW8A 2DIVA 3M2RA 3RU0A 5J2MB 3Q8RB 2Z4PA 4IQMA 5F41A 1WUUA 4K8RA 2MQQA 4G1IA 1NRKA 2DY9A 2XLIA 1QTMA 3CMQA 2F4FA 3KNGA 2IAJA 2HGMA 3OFGA 4WFYA 4ZOSA 4K4YA 2VQFJ 3QRPA 3US5A 1SI9A 1CJUA 2WVDA 2Z2YB 1NAQA 3M32A 2YWKA 4NZ0A 5D77A 2KKHA 2XZTB 2YWHA 3BEGB 4BWMA 2FD2A 2YXLA 2H1YA 1LOUA 2VDHA 2ZH9A 3D6FB 1Q53A 1X8DA 4ED7A 3GB0A 4DL2A 4HH0A 1FFWB 3HVTB 2CQ0A 4D3GA 2CA9A 3CT9A 3DRSB 1V3RA 4OI6A 1UVKA 2DBBA 1HBUA 3H0PA 2XG8A 1VK8A 1RAFB 3J80U 1VRTB 1X4CA 3R5GA 4UQGA 4DFJA 4C9DA 3M2RB 2V50A 4WFNQ 1VC0A 1JLCA 3M2UB 4TYAA 3TX8A 4B9MA 4YY3J 2XZWA 1LWEA 4DV5F 3K58A 4U96A 4ZVUB 3GV8B 1O51A 5J2PA 1Q5YA 1HPZA 2VL1A 5JVGQ 4Q0BA 1KQSR 5KFSA 2RU9A 3W5ZA 3RBDA 2XMMA 2Q43A 2XWYA 5KFJA 4NLWA 2R2SA 1RHJB 2HHQA 1RT5A 1QLNA 1HNXF 3G96A 1NDPA 2E66A 3WQPA 2KDOA 3L7OA 4YB6A 4A8OA 3BR8A 1FJGF 1SKUB 3VGSA 1EKSA 1UEVA 1RLDA 1WF2A 4TLQA 4WK1A 2IMOA 1EX8A 5JXSA 2CPYA 1B99A 2C2EA 3TJ8A 1M5VC 3SDEA 4YDXA 5A0YB 2E5LJ 4M63A 1PILA 4HR2A 2GVZB 1JLBB 2EC0A 2JEGA 2HQGA 3P8BB 1DARA 3SMZA 1LWFB 4DBQA 3OVSA 1UVJA 4J37A 2BM0A 3SCLE 1PAEX 5IV4A 5DG9A 4X4RA 3NNHA 1XNRJ 3IA0A 1R27B 4W90B 2BJ1A 1SQEA 1CULB 1FT8A 3ET6A 1WC5A 4RW6A 3MR3A 3D2WA 4CO3A 1M5PC 2IBKA 1K9MT 3MPYA 4DX7A 4ZCIA 4YQWA 3VAFA 2HMIB 1HYSA 2MQLA 5KG6A 1JB0C 3DLKA 3S01A 3KJVB 1ZM9A 3IR7B 3NG8A 1IBKF 2CQCA 3ITHB 3BJYA 1D0EA 5F8JA 2DJWA 1A0OB 1XMOJ 1KP6A 1Q8KA 1TAQA 3QATA 4JYAJ 2UXBJ 4FBUA 3TEHB 2KB2A 3QFHA 4PWUA 2JX2A 4L3NA 2CADA 3FRZA 3IG1A 4ANEA 1T9XA 3UDVA 3MUMP 2YPZA 4Q8EA 2G4BA 4RNOA 1Q8BA 4PQAA 3NS7B 4R8UA 1KD1T 1NPKA 2M8HA 4DUYJ 3RBZA 5E0OA 1CJTB 1RAIB 5E3RA 1WD6A 3C15B 4IO9Q 2E9TA 3VTIA 2VH7A 2V9WA 1K0VA 1TTHB 2F40A 2NPIA 1I94J 4C3LA 4QW8A 3R5DA 2WB4A 3ZZTA 2RHQB 2E7VA 4PXDA 4DPWA 3AJ1A 1WHYA 4E2FB 5A8KA 3PX0A 4Q8FA 2YNGA 5L1KA 3LF0A 1T05A 4FDFA 3GFZA 1NO8A 2KVIA 2KVQE 4CH1A 5D3GB 4RW8A 3L3CA 3IRWP 2KJWA 1MNEA 2DHGA 2E7WA 3K57A 3IG1B 3F56A 4RUAA 3V4IA 3RW6A 3VAJA 3OJSA 2C2NA 1WNEA 3Q8SB 2X1FA 4DR2F 2VOPA 1GXUA 1WSVA 1PSDA 2L9DA 4KR0B 4OMFG 2GMLA 2LEPA 1N5QA 2OHDA 3IP0A 5D0HA 2KYXA 2CYYA 3FQLA 3ZNJ1 2YKNA 3NAHA 4F3OA 4XO0A 4LF5J 1BGXT 2VA2A 3OT9A 5M2RA 3UN3A 1SJ3P 3CCRS 2H4WB 3I0SA 4HYKA 2Z2MA 2HPUA 1OWXA 3AODA 3VGTA 5A8KB 4QW9A 4B3TJ 2NZ4A 4I6AA 2YNGB 1TL1A 3LP2B 2XMTA 4OYZA 3W2WA 5EHHA 2CQ1A 1VS3A 5F8GA 2FVSA 4X4UA 2RNEA 1YJ9S 2V5HG 1WDTA 1IKXB 5A8WB 4B3RF 3NOGA 2IC3B 2AX0A 2GGPA 3GJTB 1UP1A 5K20B 1JLEB 3GPAA 2W8LA 1N36F 1U8SA 3PYGA 2BKPA 4GKKF 1RTJB 1RT6B 2HBYB 2PMZD 2YKNB 5EX0A 1PYSB 4WFZA 5DS7A 1KQGB 4UOGA 1RU1A 2DGTA 2F65A 4PG5A 5DDQC 5L1JA 1V3SA 2EXUA 5GAHI 3PKMA 2DEIA 4QZVB 1QDUB 4LIWA 1IQTA 2M2BA 3C66A 1QSLA 4ECSA 2RVJA 1DQ9A 4P71A 3ETMA 3IM9A 3CC4S 4F4XA 3BDEA 1HI1A 1WELA 3DDIA 5IQ6A 1Q0NA 4DOZA 5HSPA 3BH6B 3D28A 2FHKA 3UVJB 5B0BA 2HHUA 2ROEA 3HFKA 5KFEA 5HVHA 3HT0A 3KYLA 2KHCA 2R8JA 1HNIA 1RAHB 3BGRA 3G2XA 2OPPA 3ZTRA 4ZN1A 1T3NA 1KRPA 9RUBA 4JV0A 2XS7A 3BM7A 3C14A 3LAKA 2AP6A 3MM6B 3OFEA 2BRLA 1TQLA 2DEJA 3SSQA 1RWOB 2ADCA 4N8NA 2NQPA 4IOBA 1OO0B 3TZYA 1FJCA 3HI9A 4EEYA 2OPSB 2KO1A 4DV3F 2Y0SD 3B4DA 3KLEA 2WW4A 4K4XA 3DOMA 2I1RA 3LUYA 1HHSA 4JI7F 2MPUA 3GJSB 4FNHA 5MAOA 3BDPA 2HIYA 2IDEA 4LVOP 2R8GA 3L9ZA 1FEEA 1CJUB 3ELHA 5GMKa 3BPDA 2GJFA 2JEFA 3WC2A 3M32B 1FRKA 5DZ6A 1IJFB 1SC3B 3QIPB 1S77D 3KWMA 2OPPB 2AEMA 5D4OA 3D6MB 3JAMU 3FSYA 1S9FA 1UETA 1UEUA 3O5TB 1X4GA 4Y65A 3UN2A 2MYFA 4ES2A 1U0SA 3PEJA 4LFAJ 5LMNJ 4ECWA 3H42A 4IG3B 1CQNA 1Z1ZA 1VRTA 3RR7A 1KR4A 1RHKB 1T8EA 2IVFB 3ENVA 3GV7B 4JI7J 2OLWA 3K2YA 1RISA 4Y3CA 4Q2MA 4OZ5A 1WTFA 3MPUB 3S6EA 4MKVA 2HNYA 3Q2SC 2ATCB 1DAXA 2HFOA 1QSYA 2E44A 3TX0A 2QE5A 4DL0C 2O01C 4L75A 1DJ0A 5J2PB 2J0WA 4DL6A 2V34A 4F67A 2CQ2A 3PKYA 3MMCB 2EK1A 5LM7E 4ECTA 4DF4A 3IS9B 3AA8A 1RT5B 3TEGA 4A4JA 3PY8A 3QGPA 4ANCA 2HHHJ 4NYOA 1N52B 4JV1A 2LYVA 4N8OA 2KZMA 3T19A 4ZDNA 1RB0A 4LBPA 3SFUA 3CDBA 3MAHA 4L6V3 6AT1B 3N28A 3OL7A 3HPOA 3CC2S 4A8YA 3NWGA 4YB1P 2XNRA 2POKA 1LXJA 2QLXA 2FVRA 3C8YA 4DDFA 5KOXA 2AYBA 4UY85 5DJBA 3DU5A 1C0UA 5F8IA 4XPEA 2IFXA 2ZM6J 2CIMA 1YRTA 1YQHA 2JSXA 1ULRA 4JI0J 1YIJS 3TWZA 4P72A 4B9UA 1R43A 2FVCA 4H4MA 4PXBA 2GHWA 1VQMS 2W2OP 3KLFA 3KK1B 4QR2A 1SH2A 4MIAA 4XPCA 5LXYA 3RRKA 1FKPA 4OI1A 2Z56B 2I6WA 4DZ6A 4X2BA 5DDRC 1CVJA 3JSYA 3U1NA 4LRAA 2RAQA 2RS8A 4QWEA 4I68A 3VAHA 4JI8J 2HHXA 2ZOFA 1TU0B 4Y34A 1TL3B 2QLJB 3G8TA 1NLKL 2QSWA 1V5VA 4DV7J 4QWDA 4OX7A 3ONQA 1XERA 2W7AA 1FTCA 3FRYA 4JUZA 1WHWA 1F9EB 2BJ9A 3CJ5A 4KRWA 1YKWA 4CO4A 4CM0A 2UP1A 3AB4B 4RWWA 1KVJA 4JBCA 1BUXA 4WFAQ 4IFYA 5C24A 1GMWA 4H4MB 3QJPA 1S1XB 4F26A 4FS1A 4DR4F 2BQUA 4I2PA 1WKKA 2ZDPA 3FUYA 1T94A 1GQEA 3HD1A 2ZM6F 4OL8A 3FZBA 1X4AA 2XS5A 2KRRA 3M2VA 1HR0F 2B8PA 3TW0A 3PACA 3C6TA 1VQ5S 3EGZA 3TVKA 4A8WA 2B4UA 2VD3A 2WTFA 4ATNA 2E5LF 2GV1A 3D1HA 1T02A 1UTAA 3MM9A 4ZPTR 2RF2A 1WTBA 2A1BA 5LJ3Y 4RW8B 1R8HA 3CCLS 3D5MA 4I1TA 4DU7A 4EUVA 2V0NA 1VLYA 1CJKB 2XMUA 4PR6A 4DR5J 4LBIA 2MSSA 3CB4A 3Q86A 1BXNA 3FJ2A 4I2PB 2LKZA 2XI3A 2BVZA 4OIXA 4ZS6A 2J0SD 3PRDA 4P9SA 3M6XA 2A0FB 4R0EA 1IKYB 1RT1B 2D1CA 4C48A 3PHTA 5DGBA 4YR3A 1VQ6S 2NYHA 3M2VB 1QAIA 4FF1A 5T7LB 1NKEA 3HKZD 1FD2A 4ZA1A 1S6PA 3HHLD 4OHXA 1J5OB 1O5JA 1S76D 1O8BA 2RF2B 3CEDA 1S9GB 4H4KA 3DI6A 2GO9A 3PYDA 5D4LA 1OSDA 3ZZRA 5HMYA 3MFHA 3PO5A 3R5CA 3HX9A 4DMZA 2ACMA 2EC2A 4F02A 2LMIA 2XNQA 1UL3A 1HD1A 2XSJA 3KOAA 1CQMA 1DURA 3PM9A 4ENOA 2Q3PA 4HH1A 4FKXA 3MURP 4UZBA 4ZPCA 1KS2A 4Z7YA 1M5SA 3O1LA 5H1SV 2ALZA 1SBRA 1FI4A 2GW8A 4ED8A 2UVRA 1HWLA 1NKBA 2EFPA 2DT9A 1I51B 3MMAB 4OJGA 4DUZF 4ETZA 4ZIWA 3AT1B 3A8IA 3NS6A 4JOUA 2ASLA 2V6AA 2PFDA 4ZHRA 3UWTA 1HBOB 1AROP 2KG0A 2K3IA 1MU2A 1PBUA 4OJ3A 1LW0A 1RWXB 4HDGA 4M8LA 4ZCMA 5KFPA 1D8YA 1FRJA 1M5OC 3AQPA 3UNGC 2NSCA 3MEKA 1RYSA 4NXNF 3D0IE 3IRXB 4KY3A 2AQ4A 4C8NA 3JYTB 1N5VA 3MEGA 1SCJB 5AE3A 3RAQA 4QU6A 2HHSA 2XO7A 4ELUA 4LSNA 3G6XA 3AD9C 3BGLA 1H73A 3OBIA 2JH3A 3W1YC 2H48B 2ZD1A 3FCWA 4DV1F 1S1VB 4JI3F 4HKQA 2LXFA 2MZQA 3IGNA 1BY9A 3M9OB 3WBZA 1RTDB 1FFSB 4CYUA 3AXKA 3TA1A 1G3OA 4KC5A 4X4VA 5C42A 1RT7A 1L3SA 3PIOQ 4RNNA 4JI4F 3OTOJ 3EYZA 2R2TA 5FDLB 4LF6F 4USIA 4NLGA 1LW0B 1RSCA 3DOMB 4CCHA 4IYQA 4ZP6A 2C2KB 1IN0A 1RT3A 2NXJA 3RAMA 3PFOA 2YNHB 3CJ4A 3NWRA 2BKOA 1F5CA 3MD3A 2N4DA 4EFAC 4K0KF 3ZZ0A 4X64F 3N79A 2ADBA 3AAWB 1YJVA 3BBCA 2B9EA 3CXCR 3EPGA 5I42A 1IKVA 4L72B 3ULHA 1L3KA 2JRSA 2UUWA 2L41A 3AOBA 3G6YA 4KSEB 5FIIA 4KV8A 4QWAA 1SC1B 1DTTA 4C11B 1RT7B 5K9FA 1YG0A 3B6BA 1Q16B 4X4TA 2HSEB 5E3QA 1VRUB 3DGPB 3CUNA 3WX4A 1EQMA 5AE1A 5IFMA 4DLEA 3HHLB 1OYEA 3K5LA 1A7GE 1GFWB 2FC9A 4QQBA 4O44A 4WFXA 2F4VJ 3IWLA 4DS4A 3WIVA 1FJ7A 2ZVSA 3D54A 2ZHOA 4F2SA 1DTQB 2DCUB 5THWA 2QA4S 3PIPQ 3CD7A 1SB6A 2HFVA 4I0WA 4PPDA 4RW7A 5D0GA 2V94A 3KK2B 3QT8A 4PKDB 2H65B 2BACA 2KXHA 3H98A 3M6VA 4OHWA 1D8ZA 4X4OA 3BQ0A 2FHOB 2HBZB 3FFIA 5HATA 2OEMA 2HHPA 2DNPA 2GIFA 3KLGB 5HLFB 5KOWA 4B3MJ 1SV5A 3BV8A 4P52A 5EGYA 2DH8A 5I3UA 2KL8A 3M4XA 3NNAA 1EP4B 1CS4A 2PDAA 5F3TA 5IWAF 3EZ5A 4N47A 4HT7A 1SUQB 1VQPS 1IVZA 3RUBL 3N6NA 4TVAB 3TJAA 2C2MB 1NDKA 4GMKA 2MY8A 1R0AA 2Y9HA 1DTQA 4LSLB 2IA0A 1N0VC 2X1AA 2HS3A 1TL7B 4DR1F 1RI7A 1RQ0A 4OLPA 2B3TB 3KLFB 3KK1A 1DRZA 2FQQB 3K5MA 4YFUA 2VONA 5L1IA 5GAEI 2CRLA 4ICLA 2DO4A 1HIYA 2MLXA 4A8QA 2OSRA 5U47A 4CTAB 2VG5B 4C8MA 1AUDA 2XGQA 3BKTA 1S0MA 5DQIA 1EP4A 1KTQA 4NXNJ 1VMBA 5CCMA 1TMJA 4AT1B 4Q5VA 2DK2A 3L7PA 4DFPA 5C2CA 1AUSL 1OS5A 2CPHA 2JLFA 3DDKA 3UO0A 4ED4A 2DR9A 2MZJA 2A10A 2NLWA 4B02A 3KLHB 2GJ2A 3N5BA 2CPDA 3A3OB 3QAUA 4HTJA 3JS9A 2UVWA 4D3HA 4EYIB 4LF7J 4BLGA 5KT7A 4RUCA 1G2EA 4WXOA 4DSFA 2NXCA 3QT5A 4ECUA 3GFHA 2ZNZA 1HA1A 2C3OA 4OI4A 1RUSA 1IBMF 3M30B 3G82A 4UT4A 1H7XA 1IBLF 2GVZA 4WXWA 2RUGA 3CW2C 3O2IA 4ZP9A 2OH2A 1NPRA 1F9FA 1SH0A 3KHGA 3M9MB 4HI2A 1RTZA 2FHMA 4JI0F 4GKJJ 4M5KA 1VCTA 1XK8A 3NAIA 4M5HA 2DR7A 4QU7A 4G65A 2BR0A 2IIHA 4L3KA 8RUCA 4TU9A 1HQEA 4KGMA 3SQOP 2W8KA 4LF8J 3EVWA 4GO5X 1U0HA 3UE2A 5JUMA 2F9DA 4AL6A 2VDIA 3TARA 1YJNS 2V68A 2CG4A 1JLCB 3M2UA 2IHR1 3DOLB 1R6YA 3VZIA 4LF5F 2HLTA 2LDIA 4Y2KA 3GIKA 1BWVA 4MK9A 5GAHU 4DV6F 1S79A 4PCQA 1PCAA 1UFKA 1ACMB 4IG0B 1YLXA 3FBEA 1KHWA 5HN0A 3CJTA 2HZVA 4DLGA 1LWXA 2SXLA 4EYHB 2GO8A 2GQQA 2YVSA 2U2FA 5AJ3J 4NCBA 4Y0FA 2C3MA 1UPPA 2GZOA 3B54A 3JTOA 2IDLA 2O66A 1TR0A 2W4PA 2OTJS 3ZXWA 4LVNP 4ILRA 3OLBA 5ETPA 3JSMB 3RAXA 1CJTA 1L3TA 1IBLJ 1WHVA 3GIMA 3OR1B 1FK9A 3POTA 2HQDA 1T03B 4KQZA 3VAKA 4RNMA 1C2PA 1JJ4A 4NMLA 4EBEA 1C4CA 2CQIA 2Z2LA 4X66J 5KT5A 4I67A 5AXLA 3SFGA 3T6BA 3ILLA 1MMNA 1JLQA 2FZKB 3ZTSA 2HYIB 2HVHA 3E51A 3H4BA 2BQRA 1RT2B 4HLBA 4RKUC 2Z0GA 4WU2A 4WKYA 4FN5A 4F8RA 3OL9A 3JQKA 3N9UC 1EETB 2PA3A 2YX1A 4LIRA 3GE9A 2GA7A 2DNLA 2FUG9 2V8PA 1RTIB 3CPWR 1ELOA 5M2PA 2BMBA 2N3LA 4KPYA 4LSNB 3G71S 4NLTA 4WKRA 2ZBCA 2BE9B 2LCWA 3R9LA 4ZPVR 3AJ2A 3CGIA 2V63A 4FXDA 3JB9k 5BR8F 4RW4A 2UUAJ 1ZPWX 3BR9A 2BA9A 1RTDA 3IMQJ 4AXIA 2O5DA 4ZJOA 5C2GA 2J8AA 1PO6A 1WF1A 1KEKA 2XMAA 2H5JB 4P74A 1D1UA 3D1OA 3D0GE 1NH8A 5KG3A 2DGUA 2ACYA 4NA3A 4MIWA 4QIVA 4I4BA 1U2CA 2VKRA 1YJWS 2LU2A 3HJFA 3L95X 1Q79A 1QAXA 2HNZA 4WIQA 2EFVA 4J9SA 3BREA 3MAAB 1KC8T 4ER8A 1DY3A 5EDWA 4IH5A 5MLCV 3PW0A 1U45A 4DL4A 5J2QA 5KFDA 4NRTA 3I4HX 4AE5A 3Q24A 2RJZA 2I2YA 2FY1A 4HACB 3DFEA 4OZJA 1GMWD 5IT9U 4ZJLA 3L4BC 1RWWB 2W9BA 4B9NA 4DQIA 5K8PA 2IPOB 3FK4A 1Z2ZA 2Y1LB 1AT1B 2WVEA 1SKSA 1EZZB 2CZ4A 1BQMB 3ZTOA 5K5MA 1HR0J 1LFWA 5F3ZA 4LF4F 3TZXA 1SKRA 3DXBA 3H7HB 4DL3A 3MZIA 5FLXU 1RHQB 2COLA 4FKYA 4KBIA 3V6DB 1HBNB 4B08A 3GIIA 4DV1J 2YX4A 3LALA 5F0WA 4C8LA 2DRAA 2KI2A 1YDLA 2PEHA 1GMVA 3H2LA 1LNQA 3M1VA 1S1TB 3RJMB 1FKOB 4DEZA 4DV0F 4AYBD 3CJ3A 4YOEA 2JL9A 3ZTPA 3QBCA 1ZZNA 1YRUA 2VG6A 2ZUGA 4NZ7A 2W9BB 1NCLA 4A8XA 2FZCB 1QTNB 4WWSA 2Z2ZA 5EWEA 3HDSA 4F50A 1BQMA 1C1CB 1NMEB 1RA6A 2PA8D 4HHJA 4M5IA 5B08A 2Q6BA 4LR9A 3EMTA 2J0XA 2KJVA 3H5YA 3EVMA 2CNLB 3TOQA 2BUNA 1SUQA 3W5YA 2HRYA 4Q0BB 2B6AA 3LAMA 2MQMA 2CNOB 4MFBB 1RTHA 1M5HA 2JDJA 4RUBA 1YX2A 3K5PA 3SZ2A 4WYLA 3HVWA 2M8DB 4FP9A 4KHRA 2RDIA 2ZOMA 2DHHA 4Z37A 5DG7A 1R31A 2KYZA 4GO7X 5CYQB 2DHSA 3BS9A 3ISNC 3OPKA 4OYPA 1JKHB 1REVA 1OIAA 1VRQC 1R8AA 1UZHA 2CWKA 2OAUA 5E2QA 1KKHA 3JQJA 2HZAA 4ZVGA 5B0EA 4YMEA 3ZTQA 5A8RB 5IS2A 3G9CA 1D3WA 2VKZG 4HTIA 1JJ2R 2XS2A 2WVBA 3C6UB 4KTQA 5KFTA 3ZFVA 3PW4A 5KFIA 3NGDA 4O4GA 3AY0A 4DQPA 1E6YA 4FVCA 2J5AA 4LREA 2YKQA 5KT4A 4TY9A 1G7CB 1RAGB 5DQGA 1CULA 2YKAA 4K7QA 4X65J 2VPZB 4WIIA 3OJUA 2BANA 1VQLS 1AW0A 2M5YA 1XQIA 3NGKA 3KK3A 4AL5A 2EBGA 2HNDB 2OGUA 2RILA 3I4PA 4PWWA 1VQ7S 2BEFA 3VALA 4LUBA 3AHPA 5F9LA 4B3OB 4Z7CA 3MR6A 3UDEA 3CCMS 1N34F 2HHTA 2P9EA 4WTYA 1QY7A 4I69A 1EARA 3CCWA 4FF2A 2C42A 4V19J 1N0UA 2VFTA 4ES1A 5BYSA 4F3QA 5ADZA 2KXNB 4WP8A 1RABB 1HHQA 1KONA 2LQ5A 2O1PA 4RNHA 3TI0A 1IKWA 3D6TB 4WTOB 4ZVTB 4P2SA 2YH1A 1EB0A 2FGCA 3C19A 2F7VA 4NA2A 1AXQA 2CPIA 2NXUA 4NA1A 4RBUA 1UKUA 2HGLA 4IG3A 3NCRA 3UDLA 4A48A 4CLSA 4CDIA 4JP8A 4TU7A 2LP4A 4PYAA 3QJJA 2ZUAA 2CJAA 3EM1A 2WBMA 1KQFB 2VPXB 3HF5A 2LA6A 1K44A 5A0YA 3SDEB 1IWGA 5KFKA 2DR8A 3WC0A 2K1RB 1CBKA 2AJ1A 4OZ0A 4DCJB 1FDNA 1NSPA 3HFZB 1JLAB 1UFWA 1LWFA 3ZZPA 2VASA 5ETKA 1B70B 3R7NB 1S1XA 1S6OA 1VBKA 1IKWB 4URSA 2ZNYA 4IFVA 3RB0A 1JLGA 1SJRA 1HARA 2B0GA 1HNVB 4ZLPA 2J6TA 2ROGA 2J9DA 4JI5J 5LSOA 2RS2A 2GCFA 2RRNA 3CDEA 3JTNA 1HW9A 2W4CA 1GX5A 5L9XA 4Y00A 4V19X 4PUOB 2CQ4A 1IBMJ 4JI1F 1SJ4P 1RWUA 2CQDA 4OYBA 5ETTA 1FJGJ 1K47A 2O3DA 2DGXA 4AQYF 3R5BA 1FTRA 3CCUS 3H5SA 1N5YB 3D3BJ 3ETOA 3M05A 1XWLA 2A6MA 3Q22A 1HNWJ 2UXBF 4YB7A 1P9YA 5ETNA 3Q8YA 4WCEQ 2MHEA 2R7UA 1I5OB 2HVDA 2HBRB 2WOMA 2O67A 3EZOA 2D3O1 3TO8A 1UMJA 1B0TA 1SQFA 2GAGC 2HAIA 3M6WA 3UW1A 3HM9A 2OTLS 4WP3A 4U67Q 3MM7B 3QSIA 2LA4A 2R7RA 4ZCKA 4NL5A 1S6PB 3KMSA 1AYEA 3Q83A 1LV5A 1J5OA 2MLZA 1APSA 2BW7A 3CD0A 3HULA 5DZ7A 2ILZA 2ROPA 3PG9A 5LOQA 3BSCA 4DR7J 4DHVA 2VZ9A 4YP3A 4WZQA 4USKA 5AJ3F 3VR1A 1RAAB 1ITPA 2V8VA 4KH0B 4EZ9A 3RR8A 2G1DA 1SL2A 1YJTA 3RB4A 2DRDA 2BJ3A 4P7TA 3D68A 1P8GA 4USTA 1FXRA 2GMJA 3P45B 1CC7A 3MECB 2MZ1A 4ED5A 2PEBA 2KFYA 2P6TA 3J7YU 2M88A 3G86A 5EWFA 2QA4G 2YNIB 4J90A 4PZVA 3SQGB 4Q45A 4C8ZA 3BQ2A 4OHVA 1N32J 2BV3A 4EGLA 4M5DA 1H98A 4OX9F 5HAOA 2ZHAA 1MW7A 4J7CA 3JQMA 2FLOA 4NI2B 1RT6A 1VDHA 3GILA 2J7KA 4FYVB 4DCPB 4FF3A 2OEJA 5ETSA 3VF0B 3J7AN 4P10A 4GKJF 5BR8J 5E33A 2FGOA 3G4SS 1TKTA 2GQ2A 2GVDA 1FKOA 3VCDA 3MECA 4B9TA 3GU0A 4KHPF 2R8IA 1WWHA 4O23A 4DFMA 2ALYB 5IT4A 3RB3A 4J9RA 2YX7A 4P73A 3UDCA 5DDPC 2AJ4A 3UNYA 5AE2A 4CNYA 4RU9A 1S59A 3MUTP 3HCXA 2NUHA 1ZYQA 3QT6A 4F4AA 5J1EA 2YNHA 2L48A 5A6WA 1FDBA 5J1NA 2BRKA 2VJUA 2V4QA 4C7QA 2JOQA 5BYQA 2VB6A 3U27A 3X3UA 3LPYA 4Q2LA 5KG1A 1FX2A 3CC7S 4MFBA 3BN7A 3WZ0A 1JX4A 2QTWA 2CQHA 2IBOA 4M5NA 3MF5A 5HQ8A 1RZMA 4EBDA 1HBOA 2QFIA 4MMOA 5HMWA 1IM4A 4RLEA 1VBYA 3SCIE 7FDRA 1H2UX 2VBYA 2B51A 4DV3J 3EXCX 2C2RA 3BYPA 2CPFA 2W01A 3QGGA 1NB2A 4FPRA 4OYWA 8ATCB 4X64J 1U1MA 2G2YA 3BO4A 1MROA 2FDNA 4X66F 1KHVA 3MEGB 4BBYA 2XM3A 1KLNA 4RWXA 4KHPJ 2VPYB 1QD1A 3QFWA 2HVIA 5GAGU 1Y5NB 1SJFA 3TUJC 2PMHA 2ZJPQ 2XY7A 1ZA2B 1X9MA 3CD6S 3I5BA 4NXMF 2R7SA 4F0KA 2R8KA 4ED2A 5HMXA 2R7OA 2WONB 1T95A 3FMBA 4O0NA 4PPZA 4F0HA 4DN0A 5A76A 3GFXA 3VV2B 2AYGA 3AQOA 3BZQA 4GVBB 5KFGA 1X60A 3O6QA 4BC7A 3HP6A 2EFGA 1CC8A 5C7PA 2AD9A 2LXUA 1SKWA 1H2TZ 1UVNA 5D8HB 4DXLA 3KK3B 4ZVRB 4CO5A 1O6XA 3GFYA 3IO1A 1UJ4A 4B3OA 4UW2A 4PRFA 4F7VA 3TAPA 3HO1A 1NK7A 1UVMA 3CD5A 2R3VA 1U48A 1IBKJ 3BSNA 2RQ4A 2YNFB 4DS5A 2R42A 1UVIA 1CJVB 2YH0A 4BCAA 1YJUA 2CQ3A 2K3KA 4ZMMA 4U7UD 4F36A 3J7A1 1BQXA 2H4YB 4LFAF 3MR2A 3BSAA 1U8WA 4ES3A 2UUCF 4F4YA 2CPJA 2W9CB 1YGYA 3BKFA 3CCQS 4RU2A 1RCOB 1LFPA 3QWUA 4UZCA 4QWCA 1VQOS 4Y6IA 5EWGA 4I56A 2RU3A 4PAAA 2YKOA 1T9VA 4RZRA 2B9WA 4DR6F 1TUVA 2K1RA 4KGKA 3OR2A 4N77A 2MKKA 1DLOA 3D9BA 1RDRA 1S6QB 5M2UA 2XCPA 4YR0A 1PYOB 2RUSA 4IDKA 2D3OR 2A2CA 4ZJQA 2C2OB 1RWKB 2QA1A 1ZM2A 4JI1J 1YI2S 4DR2J 1IKYA 4I2QB 4M5GA 1RT1A 4IRKA 4J9UE 1H74A 3L09A 1LWEB 3I6PA 1NK4A 4O3RA 4O3OA 2VF3A 4UF4A 3EDQB 1U1PA 3M6UA 3TUZC 1VIOA 2YQ1A 4JI2F 2V2QA 1HKAA 4DSEA 2EFOA 1RYRA 4ELVA 2QGFB 4P2MA 4IQXA 3LQVA 1Q7LB 1NJYA 3NNCA 1S6QA 1PYTA 1NHKL 2M9KA 3K5OA 4NLPA 2XSJB 3MCOA 1OY9A 5I3QA 2ZKUA 2YKMA 2QYGA 2DHXA 3RRHA 4RO0A 2ERRA 1JJCB 3O8WA 3CCVS 4ECZA 2FJAB 1P1TA 1FA0A 4Y2MA 5IM0B 2FHJD 3MCMA 1QAYA 3HSDA 3ZNUA 2PGCA 1K1SA 4I7FB 1GAOA 5CXTA 2UUAF 2XLJA 1S0NA 4Q44A 1KNZA 2BJDA 2ASYA 3OLAA 1TAUA 4O3QA 3KDNA 3R97A 1C0TA 1OPIA 3ZZYA 5J1PA 2BOPA 3EVOA 1TKZA 2VBZA 3ADAC 3CF5Q 3SXLA 2C22A 4E8UA 1N33F 2OPRA 5F8NA 3TJ9A 3ET6B 2EKYA 3B82A 2ZEJA 2OFGX 2KH9A 2ZH8A 3I5AA 2L9NA 4C3KA 4CQ1A 4RBVA 1W2IA 2UUBF 5IM0A 3NMRA 3R2DJ 4NZ6A 1S6UA 1FWKA 3D3CJ 3FQKA 3BH7B 3R5AA 3KHLA 3QRRA 4CRJA 1DHMA 1F2GA 1F3VA 1T9UA 3J80Y 1X4HA 3IAM9
chains in the Genus database with same CATH topology
1H6KX 4K59A 3RB6A 2CJKA 1D9FA 3PNIA 1EETA 2BBEA 1FXLA 1U6BA 3BF4A 1RT3B 2GC8A 3N0VA 2C3YA 4O4RA 4R8UB 4WZMA 2R4FA 5FJ4A 2R7VA 1PC5A 3UCZP 3KMQA 1S9EA 3U02A 4ECXA 1S1WB 5I42B 1RAJA 3DOLA 4YHHF 4BDPA 2V4JA 1FDDA 2F8EX 3MCSA 3JSRA 4Y2IA 3CMAS 4R25A 3T5HA 3UQSA 3TUIC 3V81B 3Q2TC 4ZPBA 5GAGI 1A9NB 3JSBA 3NS5A 5LMNF 5E3PA 4YUDA 1WEYA 2DD8S 3M8QB 4B3TF 2AYMA 4B17A 4PG8A 3W3SA 4F4ZA 3THTA 2XSFA 2HQ3A 3OTDA 1LXNA 1S1WA 3HMJG 4PXCA 5F0UA 2EG1A 2MGZA 1Z4UA 2MHNA 2ZH6A 2PC6A 1H0HB 1GTEA 4DG1B 5BJRA 1C1BB 3LO3A 3LP0B 3DU6A 3WDOA 1BQNB 2CFXA 2XB2D 1VBZA 4E98A 5DLFA 2JWNA 2MKHA 2CPZA 2R7WA 4QIGA 1HWJA 1FCAA 3MXHP 3V6HA 3NRBA 5KG5A 1WG5A 2VFVA 2ASDA 4CO0A 2LQ9A 1FE0A 2MKIA 2GX8A 4Y2CA 3MUVP 4ELVA 4CZCA 2MXYA 3CULA 4BC9A 5C25B 2PO4A 1GTHA 3TYTA 4QBUA 3M9NB 1K8AT 5F8HA 1N88A 5J2MA 2JLGA 1K0TA 5KAKA 3GR1A 2PSZA 5KFVA 2GJIA 4TY8B 2RIJA 1DQ8A 4A8MP 4ETXA 1NHVA 1U6FA 4NYZA 2K2PA 3BGRB 1V9OA 2MQOA 1RTHB 3HVTA 2FVQA 2DPJA 4RW9A 1FF2A 1S4FA 2IYIA 2ZE2B 4TYBA 3QWPA 1HHTP 5EX3A 3EGWB 3MD1A 3OFFA 4ZP7A 2W9AA 2VUGA 2C2DA 3OHBA 2HVZA 1B0VA 2DH9A 1UJ5A 5HO4A 4EO6A 3THPA 2XMVA 5CYJA 3C6UA 3I31A 5GADU 2FJEB 2OO4A 3BO3A 1HFEL 1YBAA 2HIQA 3QIPA 3DLBA 4O4GB 1QE1A 1QUVA 2R7QA 2OMLA 3QLHA 2K7JA 3KTQA 1QVGR 1VHFA 3TP2A 2W7OA 4DV4F 4DV2F 1NH7A 1SL1A 2DNNA 3CJ2A 4KFBA 2RDJA 1X5SA 2WRMA 5CD4H 3K7RA 3DLHA 3OTEA 3BB5A 3H5XA 3UR0A 5JVHQ 2J7UA 4TLRA 5E7OB 3QO9A 4NLQA 2LQJA 4G3IA 2B6AB 2CZVC 2KG1A 2FLNA 1JIHA 2AYEA 4X65F 5GADI 3OFHA 4TQRA 3FZ2A 1AFJA 1SIWB 4KKOA 2YKMB 1Q81T 3OXGA 4NLUA 1Y00A 1C4AA 3MFIA 1ZOTA 4FBTA 4N76A 1BWEA 3KJVA 2RRAA 1AFIA 4PWDA 1RKJA 5KFWA 4G1QB 3TNVA 4I7FA 2PFFB 4IR1A 4RBTA 1TP7A 1JWWA 4DR3F 1NNDA 2F3JA 2R9LA 3DOKB 4C98A 3GYNA 3E2EA 3CWJA 1TK8A 2IM0A 1F60B 2DNOA 2JVRA 1Y3KA 1RA7A 3EUNA 3J7Z5 1KTVA 1NU4A 3FDSA 4USJC 3S1TA 1HMVB 1KFDA 4TQSA 2ERRA 2OIHA 4IR9A 3DM2B 4JI7F 4P7VA 1RKIA 2N82B 3LWLA 5IT0A 2IVYA 3IN5A 3K8VA 5KG0A 3NMAA 5KG7A 5D3GA 2E9RX 2XCAA 2LEAA 1HI8A 1ZAVA 4X4NA 2UU9F 2WB1D 1XN9A 3NBPA 4UOCA 1X7VA 3M8SA 2OD6A 2NS1B 3MMBA 4ECYA 1JMTA 5KFRA 1R89A 4EBCA 2HMIA 1HYSB 5J2QB 1FE4A 5J2NB 2QZ8A 2XI2A 1HNWF 2OPQA 2AWZA 1QSSA 2DITA 3I5CA 4OLOA 4OZNA 3P5TL 2ZH5A 1VQ8S 1I1GA 1RT2A 4IOCQ 2PT0A 5KG2A 1TKXB 4OJ1A 3T5JA 2AGQA 4WF9Q 4H4OA 1FHTA 1Q82T 1J2VA 3HHLC 4KT0C 2R7XA 1LWCB 4C8KA 3V2UC 3GMGA 2MGZB 5J2NA 3TAQA 1ZTTA 2E29A 1YWXA 2FPHX 3MEEB 1WEZA 4QR0A 2VG6B 1ZBTA 5KFUA 2V2KA 4Q43A 5L1LA 3PW2A 3ENWA 1BQNA 4IRCA 5D78A 2LXIA 3N5FA 2ZZNA 1U6ZA 4PG7A 2JEJA 1XR7A 3DLGB 4OHYA 2AJFE 3BGFA 1LQ9A 2AJQA 4CT9A 4BHQA 1HNIB 4ECVA 2LECA 1S97A 3GG0A 2HS0A 1Y4ZB 4Y28C 1DQAA 1X4BA 2PIIA 3D1QA 3MM6A 3OUYA 4WE1A 5DRKA 4MJKA 3RW7A 2JEIA 4QR1A 4K4WA 2OFHX 4HEA9 1MU2B 3B4MA 3FEZA 4OQJA 3ZZUA 1X0FA 3PV8A 1JKHA 3FCHA 2MQPA 2GQCA 3BSOA 1H38A 1FERA 5GVQA 5J1EB 1JLEA 1NZAA 3ISZA 3QMQA 3N01A 4NCAA 3UFCX 1GXTA 4MYTA 4ZCLA 3OXLA 1U1OA 3M1VB 3KNAA 2E5JA 2B43A 5HROB 3NKYA 2BANB 2I5JA 1F0XA 4J9PA 2YNIA 1Y0HA 4J9NA 2B9YA 1VQSA 2Q79A 4OHZA 1QVFR 1K1QA 2LDYA 2JJ4D 3W2VB 5KFLA 4C8YA 3QZ7A 3F41A 5CQGA 3E01B 3FEYB 2DNRA 3K0JA 5A2QY 4IUFA 2APOA 3HHEA 4BS2A 2XY6A 1DTTB 4C11A 2QSFA 2M0GB 2OP5A 2DNHA 5AXMA 3CCSS 2JC0A 3LH2S 1T7PA 4J9OA 1O0PA 1NK9A 1FNOA 2X51A 5BYRA 4PG4A 3LOUA 2FTRA 2ZC4A 2J76E 1JXEA 2MJUA 5A8RA 1XC9A 3MI7X 1H2VZ 3W2VA 2E1CA 2RD5C 3OTBA 2H9ZA 1JLAA 2B56A 5DM6Q 5LSRA 1JLGB 3T1HF 3DMJA 3IR5B 3TVYA 5FD1A 3DNCA 3LGNA 4C3MA 3KG0A 1LW2B 5HLFA 2DVIA 3H2VE 4K50A 1SV5B 2U1AA 2DRBA 2IYGA 1TL3A 2IRUA 4F3MA 3IWNC 1NK5A 2B4VA 2DH7A 1TK0A 1S99A 3KG1A 1YHQS 1N5YA 3OVBA 1DLOB 4N56A 5CA5A 2VFUA 2E1RA 3IS9A 3OSNA 4IDKB 5T14A 4Y2AA 4F4WA 1V6HA 3T9NA 3VAIA 5CZVA 3R1HA 5FLXY 5LT5A 5E3CA 4CH7A 1HWKA 3CDUA 2XULA 4YDDB 3O3LA 3T6JA 3V6JA 5LXRA 3CCES 2G0CA 2Q1LA 5HBMA 4KO0A 2OD4A 3SSRA 4F2RA 2B4PA 4DR7F 2FJBB 3K59A 3CMES 2IRXA 3MGJA 2ZH3A 2QYCA 1URNA 3EGNA 2MKCA 1S0VA 3NBPB 2A3JA 4IFVB 5G4DA 4XIUA 4ZPDA 2RMLA 1OQ3A 1N54B 1BC6A 1S49A 3BN4A 5HI7A 1KOOA 2IM3A 3DLEA 2R8HA 1Q4RA 3EZUA 4NLXA 2IVMA 4CH0S 2KT3A 2FJWA 1GX6A 5L9NA 2XMKA 4MKAA 4JV5F 3DI6B 5B7WA 3HZEA 3OR2B 1F5AA 3SV4A 1U1NA 1NJZA 2M7SA 1RP5A 3V4IB 2H5EA 2IRYA 4HVZA 3FMWA 1HQEB 2K7KA 4X4PA 5KFFA 1NJXA 4JI5F 2E9ZA 4OI0A 4DQSA 3Q0AA 3NL0A 2R2RA 3DRYA 2L9WA 3D0HE 4IH6A 1Y9OA 1TKDA 3MMAA 4H54A 1R7IA 2AU0A 2IJNA 1DZ5A 2HHVA 4ZHRB 2HFNA 3MDFA 2B9XA 3I56S 5HMZA 3GIMA 2EW9A 2P6SA 1HBMA 4BWJA 5KFNA 5A8WA 1YJRA 2CVEA 2GGPB 2GIQA 2AV5A 1WACA 2A2DA 2HRUA 1M90T 4N5SA 1S9EB 1RTJA 2F8HA 1FK9B 1WG1A 4O3PA 3MM5B 3MM8A 3PR5B 4MK8A 2HHWA 1X4DA 3O44A 3W7BA 5H9EJ 3DRRB 1X9WA 3NP5A 3E3XA 4OI2A 2QMWA 5IXUA 1FRMA 1GH8A 1FD8A 1U24A 2IJFA 1C0TB 1P9QC 4QPTA 1TV6B 3SQGA 5KG4A 5KT3A 1TKZB 2CJBA