1TZ0A

Crystal structure of putative antibiotic biosythesis monooxygenase from bacillus cereus
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
108
structure length
108
Chain Sequence
GYMFIETKTFTVKEGTSNIVVERFTGEGIIEKFEGFIDLSVLVKKVRRGDEEVVVMIRWESEEAWKNWETSEEHLAGHRAGRGKPKPDHIINVDHAVYYVKSSKAAYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein
publication title Crystal Structure of Hypothetical Protein APC24875 from Bacillus cereus
rcsb
source organism Bacillus cereus atcc 14579
total genus 20
structure length 108
sequence length 108
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2004-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03992 ABM Antibiotic biosynthesis monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tz0A00
2ACYA 2XMKA 1GXUA 1FVSA 3VTIA 4DN9A 2HLUA 1QUPA 2K7JA 4FNHA 3BB5A 1OQ6A 2AJ1A 2FB0A 3F44A 1N5QA 4ZA1A 1OQ3A 4A46A 1N5VA 2EW9A 2LQ9A 4DL0C 4Y2IA 3KKFA 5B08A 4ZOSA 2HLTA 1KVJA 2N4CA 2W4PA 1IUJA 2OP5A 2FIUA 1RJJA 5B0CA 2VV5A 3HHLC 4HH0A 4NPOA 3HDSA 1X7VA 5IXUA 4HH1A 3TRGA 2ROPA 1SB6A 1JWWA 2GA7A 5T7LB 3BF4A 1TL5A 5T7LA 3GZ7A 1YRXA 2BYCA 1N5SA 4OIXA 2AJ0A 2K1RB 1Y9OA 2GO8A 2W4CA 3KNGA 2GCFA 2RMLA 2IYIA 4EFAC 3HHLB 1ULRA 1YJRA 2OAUA 2HFNA 1Q8BA 2OKQA 1YJVA 3BR8A 2XMJA 2XMVA 1YG0A 4U9RA 3BM7A 4HI2A 1CC7A 1AW0A 4NL5A 3QGPA 5KAKA 2N7YA 2GV1A 1Y3KA 4HL9A 2GGPB 3UDCA 3HF5A 2QLXA 2K7KA 1CC8A 1Q4RA 3FGVA 2AP6A 4OJ1A 1FESA 3BDEA 3MZIA 2OFHX 3KG1A 5B0FA 2RSQA 3WDOA 3FRYA 3IWXA 2BBEA 2BJEA 1FD8A 1S6OA 4Y2KA 2KKHA 4Y2MA 4DPOA 2QLWA 4OJGA 1FE0A 2CRLA 1AFJA 1WD6A 1SQEA 2K1RA 1AFIA 1YJUA 4Q2MA 4Q2LA 5A6WA 2HFOA 4A4JA 1MWZA 3HHLA 3CJKB 2ROEA 3HHLD 1FE4A 2Q3PA 1N5TA 3KG0A 1FEEA 1S6UA 2HQIA 2VH7A 2N4DA 1V3ZA 2PGCA 5B0EA 1K0VA 1Q8LA 1CPZA 1JK9B 2K2PA 4YDXA 3T9NA 2QIFA 1U7LA 1MWYA 2JDJA 2FTRA 2OD4A 4OJHA 2ZDOA 2OFGX 3MCSA 5B0GA 2GGPA 4FNIA 3I9ZA 2BJDA 2KT3A 4YEAA 1P8GA 1GXTA 3HX9A 1TL4A 1TUVA 1Q53A 2XMTA 1SI9A 2RU9A 1Y0HA 3E8OA 2KYZA 2AW0A 2XMMA 5B0DA 1R6YA 1URRA 2XMUA 2HIQA 3TOQA 2ASYA 2QYCA 1OPZA 2XMWA 3QMQA 2PD1A 2BUNA 3CJKA 5F0UA 1XBWA 5B0AA 4A47A 2KT2A 2G9OA 3IWLA 3LGMA 2L3MA 3DXSX 5F0WA 2LDIA 2LQBA 2RILA 1OSDA 2ZDPA 3BGUA 4HI1A 3BN7A 1P6TA 1YJTA 2OD6A 1TZ0A 4A48A 1KVIA 1FVQA 3DCAA 1Y3JA 4F67A 5B09A 1W2IA 3TNVA 3LGNA 5K9FA 1X8DA 2IYGA 1LQ9A 1X0PA 2OMOA 2FHMA 1APSA 1VQSA 2LXFA 1VQYA 2IFXA 3FMBA 3HFKA 4QOTA 1KQKA 2GFFA 3K7RA 5A6PA 4OJ3A 1TR0A 3LO3A 2W4DA 5B0BA 2ROGA
chains in the Genus database with same CATH superfamily
1WF1A 3QJJA 3T5KA 5KT3A 1DURA 4TLQA 3DLJA 1WC1A 2VDIA 3HMJG 3MMCA 4WF9Q 2M0GB 4F4WA 4F4XA 1RHQB 4ZHRB 3CCLS 1R43A 3P4UB 3IM8A 4GKKF 3UD5A 1F0XA 1HNWF 3DU5A 2R7RA 5H9FJ 3CEDA 4ECVA 5AXNA 1HR0J 1S6OA 3HVRA 5D78A 5FLXU 1KHWA 1UFKA 3D9BA 3G9CA 1S12A 3UFCX 2R7SA 3IGVA 3EZ5A 3PEHA 4DF8A 2B9YA 2HHWA 1DFDA 1OS5A 2VC0A 4PWWA 1VQ8S 4TU8A 4GC7A 2QSWA 1H98A 2QL7B 1R27B 1SXLA 5IC4B 2MTLA 3LP2B 1NZAA 2AEJA 5D6GA 2F9JA 2CAJA 1LQ9A 1X0PA 1VQYA 3Q8VA 4OZ1A 2UU9F 2P6TA 3BBCA 3RB4A 4EBDA 2YKMA 3CMES 1KVJA 2AIRB 4LF4F 3V6JA 2KFYA 4QIEA 3HSJA 2J0XA 3LP2A 2ZZNA 1C2PA 3U1LA 3W7BA 4KPCA 3UDLA 4U8YA 4Y6IA 4R5PB 3TEHB 3EPGA 2RMLA 4C0OC 1HHTP 3HHDA 5KG3A 3AJDA 4ELVA 2E9RX 4O4RA 2ILZA 3BM7A 4EO6A 4ED6A 5FDLB 1JJ4A 1R0AB 5DZ6A 5CZXA 5DLFA 1NB7A 1RLCL 3LH2S 1NK8A 4QW9A 1U1QA 4BWJA 3MM5B 4R5PA 3OT9A 2UV8G 3OFEA 1UW4A 4AFFA 1CBKA 2C2DA 1R0AA 1R8BA 2XCPA 5KFYA 4X64F 3CMQA 1QM9A 5LOQA 4P71A 2UVRA 4L6V3 3MM5A 4LRAA 2YWFA 4JI3J 4LF9J 3D6HB 4JI5J 4F67A 1W2BR 3OHAA 3P6YC 3FEXB 1IWGA 5KG6A 4WYLA 2QG9B 2QL9B 4WFYA 5T14A 4WFNQ 3JS9A 2CQ4A 2VC1A 2RIJA 4Y65A 1QVGR 3W65A 1UZHA 3UD3P 1OIAA 2CNOB 2OEKA 2PC6A 1WC6A 1S76D 2DRBA 5FJ4A 4X65F 1RE1B 4EBEA 2J8SA 2OFHX 3QRRA 1Z4UA 3N9UC 4D3HA 3QLHB 4OZLA 2NUUG 2CQGA 5ETPA 4NEZA 1Q16B 2G1HA 3EGNA 4F4ZA 2GC8A 1YIJS 3TA2A 5DS7A 2OIHA 4DLEA 2DNKA 4JI1F 1FDNA 3QLHA 1PCAA 3PX0A 1Q5YA 1VQLS 2YX7A 4ER8A 1P6TA 2OD6A 2XEXA 4UY85 2HS3A 2WBMA 4NLOA 4DQPA 2HHXA 2G0JA 2BJ1A 2WB4A 2AGOA 5B08A 2C3UA 4X84A 2KTQA 3DI6B 3OQ2A 1SL0A 3BH6B 4L76A 2OHDA 5L39A 3SCKE 1X5OA 4TY9A 2V4RA 4DXLA 2CJKA 2O01C 2HK2A 1ZYQA 2WSFC 2APOA 1N33F 3TQ1A 3DI6A 1H2VZ 3N0VA 3OVAA 2Y3YA 5C25A 3TZXA 3HI9A 1CVJA 4WE1B 4GRSA 3VV2B 3SFGA 3EVMA 4S0MA 4ILMA 4UOHA 4LFCF 2I8EA 2JZ5A 1GAOA 4C3MA 2Y8WA 3IGNA 1ICEB 1ZM3A 5J2QB 4NCGB 2BOPA 3FJ2A 1IVZA 4FXVA 3CCSS 1QSYA 2V69A 3RGIA 4NLGA 1IKVB 2V8GA 4OL8A 4UF4A 4MYTA 4U7UK 2FJVA 1GQEA 5L9NA 2ZBRA 5J2QA 4NCGA 1RBAA 1KOHA 4QW8A 2KG0A 1KLNA 2AJ1A 1HBOB 1IM6A 2HK3A 2PO4A 3GJTB 3R8YA 2KHCA 5KFFA 1IKVA 1S4EA 1SC6A 4TY8B 3VAHA 4B08A 4KRWA 2K8GA 2XHCA 2VKZG 4ZVFA 4DU8A 3AA8A 1IKXB 2FLLA 4J9KA 5LMNF 4KV8B 3THVA 1AW0A 1RTHA 2LLZA 4X4NA 1X4DA 4NA1A 4PG8A 1KDNA 4TY8A 5KT7A 2HHQA 3GFYA 1B0VA 1NH8A 5LXYA 3H40A 3NGTA 1IKXA 3OW2R 3NEKA 1NPRA 4C8ZA 2G1DA 3GSIA 4KJIA 3JTOA 5GAHI 3GQCA 2RDJA 5F8NA 3PEJA 4K50A 3GR0A 3CCMS 3VAKA 2LDYA 3GJSB 2ZD1B 1RACB 4CDIA 1KD1T 4NYZA 3W5ZA 1NJZA 2E1MC 5F8HA 3AD8C 4F3OA 4YR3A 1VRTB 2KN4A 1Q7YT 3I32A 4FF1A 2KH9A 5KFEA 3W9JA 2AWZA 3JXOA 2PA8D 1F3VA 4WK1A 2HBQB 1P1TA 2WRMA 2UUBF 2YQ3A 2IRXA 4ECSA 2QA4G 4DU7A 3BREA 4X66J 4RWXA 4RUHA 2ZOMA 4I69A 3WDOA 2ILYA 1TL3B 6FD1A 3LAKA 3W8GA 3R6LB 1EIYB 3M9MB 2HMIB 3IM9A 5CH7B 5IS2A 3WX8A 2CG4A 4OHWA 1Q81T 4DCOB 4DHVA 3PYDA 5AE1A 2H48B 3VQSA 2B7CB 2OPQB 1KSPA 3CULA 1TELA 2MSTA 4KR0B 4WXOA 3A3PB 4PABA 2HMIA 3GJRB 4CLTA 3AQOA 3EDQB 3M7VA 4CT8A 3KK1B 4DR6F 2MJUA 1MN7A 5L1IA 3W1YC 2KRRA 1EKRA 4CM0A 3B4DA 1N88A 3N6MA 1FWPA 5B0CA 4URQU 4YUDA 3KK1A 4K5RA 1WELA 1UJ6A 2R7OA 3TUZC 2YKAA 4K4TA 1XR5A 3PV8A 4JI3F 4LF9F 3EX7B 4KGXB 4E2FB 3QGGA 4JI5F 1BY9A 3K5LA 2MLXA 3HT0A 5GVQA 1JQGA 1WD6A 1EQMA 3HCXA 3CTRA 1Y5NB 3TAMB 4CLFA 1YRTA 3OFFA 4H54A 3NY0A 2CVIA 2IC3B 4ES2A 2CJAA 1TUVA 5HANA 4IOCQ 3NKYA 1CJUB 3VGTA 2PEHA 1QE1B 1GX5A 4O0IA 1PAUB 2B9WA 4ZP8A 3TAMA 1DZ5A 3DCAA 1IBKJ 3OVBA 1W2IA 1U1LA 1ZAWA 5ETKA 2FGOA 5HO4A 4M1KA 4TU9A 5DO2A 3M8PB 1FVSA 2HHTA 1CJUA 5A2QY 3RAXA 1QE1A 4FPIA 4OYAA 4XDDA 4USJC 3BF4A 1OYEA 1IQZA 3TEGA 3TA1A 2HHHJ 2H51B 2Y1IA 2VQFJ 4N8OA 4DX6A 1X5PA 1J5EJ 3CO9A 3PFOA 4OJ1A 4RW8B 3OBIA 1SH0A 1RADB 4DV2J 3AD7C 4OHVA 5C2CA 2PN6A 3DHXA 3GG0A 1Y00A 3QT6A 4A4JA 9RUBA 3CJKB 4P10A 4QYRA 2OPSA 3CIMA 3EXCX 3H25A 2OFGX 4X4OA 3BKUA 5RUBA 1I94F 1PBAA 4RW8A 5G4DA 5HQLA 2EG1A 3PDNA 1FJ7A 3CJKA 3RYLA 2ZWPA 2OJ3A 4ED1A 1XNQJ 1OSDA 3Q8SB 4U7CA 1S48A 2QA1A 3KYLA 4DR2J 2RE1A 1TR0A 2MQQA 2MZTA 2HVEA 1FD2A 1S9GB 3RG6A 1VMBA 3EGVA 5EWGA 1Y11A 3OL9A 2G2YA 1TMJA 2VL1A 3KLHA 5I42A 1SPBP 2B8PA 2BE2B 3PJXA 3F0NA 5L8RC 3BQ1A 1TFYA 3CB4A 1VS3A 3A8IA 3OFGA 4BWMA 4RNOA 4WZMA 2CQ1A 1S9GA 3ILIA 3PG9A 4ZLNA 1T05B 3UCGA 4X4PA 2AP6A 5M2PA 4EK2A 5KFUA 2RT3A 3IAM9 2BE2A 4GVBB 2OPRB 3DMJB 1U7LA 1T9VA 4KHRA 1E6YB 5GADU 2M52A 2OO4A 3J80U 4PXDA 1TL1B 3T41A 1URRA 2MEWA 4C8MA 2J0SD 2R2RA 1PYTA 1FXDA 2XMWA 4KY3A 4JI0J 2MKIA 4GVBA 2OPRA 2NPFA 3CJQA 1KVIA 3GSDA 4IOAQ 4UT4A 2I1RA 2FHOB 2FHMA 4R0JA 1E6YA 1TL1A 3DU6A 3V5RA 1YHQS 1FK9B 4A8YA 3AQPA 3K5MA 4QU7A 2CQ0A 4HTIA 2AEFA 2AYMA 2E5LJ 4KGMA 3DOLB 1SC1B 4P73A 3JSBA 5C2GA 1RLDA 3VAJA 5HN0A 2O1PA 3EUNA 1FK9A 2B4UA 1RAGB 2B6AB 4M5JA 4R0EA 4X4UA 4ZVQB 3FRYA 3IWXA 2DH9A 3DOLA 4ZS6A 3OTBA 4C2MA 4NLQA 4UW2A 2VBYA 3KJFB 2OMLA 4WFAQ 3IR5B 4OYWA 1A0OB 4AQYF 2MY8A 1U0HA 3NG8A 3MEEB 5A0YB 3MUTP 4O3PA 4NXMJ 1R6YA 4RJVA 3LALA 3Q86A 3NOGA 1YK9A 4X66F 2HGMA 2B43A 2FHJA 2X3GA 1ZZFA 1RTZA 4HHJA 1TMMA 2R8GA 2BX6A 1SIWB 3ZZPA 1X60A 4OYIA 1EAYC 4FKXA 3HP6A 4W90B 1YVFA 5E3CA 3DLGA 2LECA 1HHQA 3DRYA 4ETXA 4O3QA 1R0CB 1MROB 4CLWA 3DOKB 1U45A 2ZH3A 1VK8A 3G2XA 4LREA 2KM8C 3A4TA 1K73T 4LVOP 2JNJA 5KFTA 4IDKB 3OXGA 4QWEA 4M5IA 2R7VA 1S72S 1MROA 2W24A 3DOKA 1YJWS 1RZMA 1K0VA 1H2TZ 3TVYA 3DRPB 4URSA 2A10A 2WW4A 2C2MB 1ZAVA 2VUGA 2FC8A 4IDKA 3MFIA 4O3NA 1NDKA 2MKKA 3H42A 1Y5IB 1WG4A 4FBTA 2YNHB 1LEOA 1BXNA 5IV4A 3DRPA 4FXWA 4MIWA 1OWXA 3G6XA 1R6VA 4F36A 4C98A 2W8LA 4ZVEA 2MSSA 2VPYB 1OO0B 4P2SA 2YNHA 1UMJA 2YY3A 4JI7J 1FTCA 5GAGU 2E1CA 1YSJA 4QQBA 3CJ5A 1AA1B 1AB8A 1ULRA 4NCBA 2HKEA 2RQKA 4J5OA 3ILJA 4HL9A 3EM1A 3H5XA 4PQUB 1CQNA 2B51A 3MUVP 2BRLA 4LSLB 4MYUA 4HLBA 5L1JA 2FY1A 4EUVA 4JV5J 3KNAA 3W63A 3QZ7A 1U24A 4XPEA 3GE9A 4DMZA 4ANEA 4PQUA 4OQJA 4B9VA 1NHKL 3CJ8A 3QFWA 2HQCA 4N47A 4LSLA 4KE5A 2DK2A 4QR1A 4U67Q 2YKNA 5EN1A 3BH7B 4ILLA 2OLWA 1J5EF 1IR0A 4QPTA 3GONA 2LEAA 1QSSA 1PIEA 1ZETA 4DV2F 3MPYA 3MMJA 4XAKA 2ZITA 1RKJA 3ILLA 3CC7S 2DH8A 3DM2B 4X4TA 2DXFA 2DR6A 4DR1J 3EDRB 3ONQA 3GWCA 3LF0A 2V94A 4NLTA 2ASJA 2MKCA 2Q43A 5KT2A 3DRSB 3VAFA 2VIHA 1B0TA 4W98A 5KOWA 1ACMB 2K7KA 3DM2A 2XS7A 1TK8A 1RT2B 4DR2F 4NASA 1SIZA 2L41A 2IA0A 1N5TA 5K8MA 4X62J 1S9EB 3HO1A 4BBYA 2J5AA 1C1BA 3ZTOA 4USMA 4AL7A 3N28A 2L08A 1P9YA 3FQKA 3MMAB 1RT2A 2F4VJ 2HZAA 1WHXA 2RILA 4DCJB 2MY7A 2H3EB 2BJ8A 4AD6A 2KDOA 4Z37A 5E3QA 2QE5A 4ZKAA 1RT5B 2H5EA 3QO9B 3D28A 2V8DA 3SCJE 2Y9HA 4CM2A 5LMUJ 3MAAB 4CO5A 2Y8YA 4WPAA 1U02A 2NXEA 3J7A1 4CH1A 5D8HB 1PG5B 4NLVA 1QJHA 1KC8T 3CMAS 2LCWA 2QRRA 4JI0F 2OPPB 3OXFA 3QAEA 3QO9A 1VGYA 3NGRA 2WVCA 2VG7A 1NK6A 1H7XA 3MAAA 2D41A 3N4WA 3L7OA 3RRGA 4K7QA 2LEPA 3HVTB 3BS9A 2HWIA 5KFDA 2E5LF 3LPYA 1VBYA 2VBZA 2HHVA 2EEYA 2Q79A 4OI6A 4TLRA 4YB5A 3QT7A 1AT1B 3IRXB 4YHHJ 2ZM6J 2W2NP 1XNRJ 1APSA 2IYGA 1VRUB 3H2LA 3HVTA 5L38A 1NHUA 1HWJA 3MAHA 4YY3J 1U1MA 2VASA 1ZA1B 2B4VA 3KKFA 3NNAA 3IRXA 2KJWA 1URNA 5EDWA 2QJ3A 4J90A 5L46A 2MZJA 3D6TB 4OIXA 1C4AA 4DR4J 4EFAC 2ERRA 4NXMF 1MMNA 2CJBA 3D2WA 4U9RA 4CO4A 4OYMA 1KRPA 3TANA 1FX2A 5J1NA 3DOMB 1D9DA 2XYGB 4AL5A 3CC4S 1CS4B 3VR1A 1HW8A 3MF5A 3KLFB 1M5OC 3HHLD 4JI6J 5KFPA 1QAYA 1U8WA 2DNGA 2YNGB 5ETOA 3ZTQA 4FS2A 4DBQA 2MZRA 1Z1ZA 5I3UB 4HHHA 2DYAA 3M30B 3I87A 1IR1A 4LF5J 3LTOA 3W2VA 3T5LA 4ZVUB 3KLFA 2VF3A 5HQ8A 4QU6A 4NYPA 3VALA 5D0EA 3D6MB 4RW4A 4QWBA 5I3UA 3AAWB 2KVQE 2ZH2A 3M30A 2DCUB 4DX7A 2NCKL 3AD9C 1S1TB 4OX9F 3VAMA 4DN0A 2LQ8A 1S6PB 4NLWA 1UWAA 4AT1B 2NXJA 4NXNJ 2YKOA 5DDPC 5KFBA 1Q8IA 3M8WA 3JSYA 4USVA 4AE5A 1L3VA 3FGVA 1T3OA 1RU2A 1S6PA 2PMZD 2CQBA 1TKDA 1KEKA 2UUTA 2RUGA 2P6SA 5IFMA 2Z30B 1F60B 1N48A 3D0GE 3W9HA 3TX8A 3PRDA 2QV6A 4CI0B 5F8JA 4IKAA 2UXBJ 2VH7A 4HHUA 3AODA 4YDXA 2Q1LA 1WHYA 2OEMA 4J9RA 4FP9A 4ETZA 4E8UA 4LF1A 3TA0A 5L1LA 2BUNA 5LSLA 2FLNA 3UVJB 4OMFG 5IV3A 1N8RT 2CPFA 2J76E 1V9OA 4DPXA 2V9KA 2A2DA 3GIKA 3PX4A 1X0FA 4WK3A 2XWXA 1K47A 4JI2J 2ROGA 3UN2A 1RISA 1GXUA 2K7JA 1Z2LA 2V67A 3M6WA 2HS4A 3UR3C 4YN3B 2Z56B 3N5BA 3CSKA 3QAUA 4MKAA 1G7CB 4DL2A 3OSPA 4LFAJ 4DI6A 4C4WA 1PJ6A 1LFPA 3WX4A 4FYXB 5J2MB 3I82A 2ZJPQ 2AKWB 3RR7A 2KXHA 2WOMA 3DLEA 1LFWA 5BXIA 3PRBA 3V81A 1NJYA 4Z7CA 1X9WA 4HT7A 2NYIA 5KFRA 3T9NA 4F3MA 3I9ZA 2JLFA 5J2MA 4YB1P 4DV0F 5LSRA 2DRAA 1QAJA 5A8WB 4NA3A 3NBPA 4UUWA 2QYCA 5JUMA 2NUHA 4YFUA 5F0UA 1XBWA 1YTYA 3KLVA 2DHSA 5CCMA 1H72C 1K44A 4BS2A 5A8WA 4WU2A 1VBKA 4FNHA 3M9NB 2NPIA 2AU0A 2VJVA 4OI4A 1IN0A 2BW7A 5KT5A 3G96A 3UDVA 4ED4A 2LQ5A 1RHRB 2J7KA 1SQGA 1S57A 2ZVIA 4KHPJ 3I0RB 4ERDA 4Q43A 5E5NA 2F4VF 3MTKA 3WHIA 3OUYB 3MR3A 1C0TA 1EETB 3BDEA 1C4CA 1UAWA 3LANA 5C24B 2M88A 1UVLA 5DJBA 4C3LA 3Q24A 2MQLA 3BGFA 3THPA 3I0RA 5E33A 1K1SA 5KFSA 1VOMA 4LR9A 2XYPB 3I4PA 2B0GA 4L74A 3OXLA 1WC0A 4YR2A 5C24A 2XSFA 3MR6A 2B5JB 2RS2A 3VAGA 3OR2B 3QQCD 1FEHA 1FNOA 2DNLA 4BC9A 1T9WA 1VQOS 2ZVSA 3HJFA 1LWCB 1RTDB 4NYOA 1WUUA 2VA3A 4G1IA 2B3TB 3UDEA 1IBMJ 4LRFA 3KXDA 1RYRA 3AOAA 2B5JA 2AYEA 1MU2B 3JQMA 3LQVA 4DUYJ 3VF0B 4HH0A 3HDSA 3MM6B 2W7OA 4R25A 1LWCA 4DV5J 3PR5B 4JYAJ 3C19A 1SH3A 3SSRA 3WBZA 3A8EA 3OL8A 3E01A 2N7YA 4HDGA 1S5ZA 1MU2A 4YHHF 3GIJA 4DL5A 3CJ4A 3MM6A 2M5YA 5FLXY 2HNZB 1VBXA 3D68A 4USWA 4P2FA 3FEYB 4YY3F 1WOPA 2PGCA 2EXUA 1CPZA 5J2PB 1K0TA 2JEGA 3PY8A 5KG2A 1RT1A 4LR8A 1FWLA 2FLOA 1FRIA 5F3TA 3VGSA 2D9PA 2DRDA 4FYYB 3TUPA 1XJWB 2HNZA 1N0UA 4DR4F 3VGVA 4I1TA 1JLAA 2KG1A 3HFZB 2Y0SD 1FJCA 1JIHA 4OX8A 2ZH4A 4LRDA 1ZA2B 5CCLA 2HQGA 4HDHA 5J2PA 4IO9Q 4HT5A 3HFKA 1EZZB 3TARA 4Y2IA 4JI6F 2ACMA 2XM3A 3Q83A 4YR0A 5T7LA 4ECXA 3J81U 6FDRA 3HVAA 1B99A 2UVUA 1JB0C 4LF5F 4BHQA 2H5JB 2DY9A 1WHWA 1RTIB 2J7UA 3PKYA 4ZCMA 2FGCA 1NCLA 4A8QA 3NP5A 2QN6B 1GXLA 3DC2A 5H9FK 3NCRA 1M5VC 2NXUA 1U49A 4Q2MA 5D0RA 2XZTB 3BSAA 3DGPB 2G13A 2DR8A 1RTIA 4EGLA 2FJBB 4IUFA 5EX0A 2VG6B 4PZVA 3NGUA 3MM7B 1C1CA 3P45B 4NXNF 1NHVA 3TOQA 3ZNUA 4I2PB 4N41A 2GO9A 4DS4A 3B6BA 3DGPA 1X4CA 1TP7A 4KKOB 3CDBA 2VG6A 5KG0A 2H1YA 3MM7A 1IKYA 2WAQD 5HJYA 4QBUA 2XMKA 3VQTA 3OSNA 3L3CA 2YPZA 2FZGB 1OQ3A 4I2PA 2C1EB 2UXBF 4U95A 3PJWA 2ALYB 2IMOA 2FVRA 2UXDJ 4OI0A 2HQ3A 1HARA 4PG7A 2MQOA 7FD1A 2E1RA 2NSCA 2RDDA 3ET6B 4OLPA 3ISNC 2XI3A 2QLJB 1H73A 3T19A 2HBZB 4I7FB 3NS5A 1WF2A 4C9DA 2O3DA 2RSQA 4MJKA 2IDLA 3H2UB 1V3SA 2MQ8A 1IM4A 3ET6A 5A6WA 5E2QA 2PIIA 3O3LA 1REVB 4TN2A 1XMOF 1LKZA 4ZVPB 4RW7B 5AT1B 2B7BB 2ZUAA 2AEMA 5CABA 4IR9A 2IM3A 4PRFA 2EI5A 2COLA 2DNZA 4ZN1A 3PJ9A 4DG1B 4RO0A 2PDAA 2D3UA 3BN4A 3V2UC 2H4WB 1YX2A 3ISND 4DUZJ 2WHOA 4DWIA 2W4DA 2BJ9A 3RB3A 4ZA1A 2PMHA 3E2EA 2QA2A 4Y2AA 4DG1A 3RRHA 2JC0A 2OEJA 4ANDA 3ZZOA 3TJAA 2C42A 4ZPCA 3W61A 3KHLA 3FDSA 4LIRA 3MWBA 4DFMA 3A13A 1Q82T 2AJ2A 1N6QA 1FD8A 3OTCA 2W7PA 5KFZA 2H65B 3NGSA 4ECRA 1N34F 1JLGA 3D67A 1BGXT 2HHPA 1EHWA 2MQNA 1IKWB 3PTWA 1JNRB 3HZEA 2XSJB 4ECZA 3WIUA 4C11B 2LQJA 4J9SA 3ENWA 1VQ6S 4OZ0A 2DR5A 1T03A 1NK4A 4FN5A 2W25A 1QUPA 1RT4B 1OQ6A 2XSJA 2H54B 2LVWA 1GT8A 4DSEA 1SCJB 4C11A 5AJ3J 4NCAA 3N01A 1UVIA 3OPKA 5E7OB 2CVEA 1WHVA 3O8WA 2QA4S 2W4CA 2D1CA 3WIVA 1UJ5A 2OUGA 2DR9A 2R42A 2J9CA 5GADI 1RT4A 3SZ2A 1HA1A 1VFJA 3VAIA 1I1GA 2HRYA 2Q66A 3G6ES 3KUEA 2F8MA 2KM8B 3X1LB 2CQCA 2JLEA 4H4OB 4OYBA 1IBMF 1NKEA 4ZVSB 3TW0A 4Q44A 3EJMA 5KG7A 3NLCA 3DFEA 2VPXB 1XK8A 1U1NA 4AYBD 4ELTA 5DRKA 2WVBA 2W1BA 3UNYA 3W64A 2KHDA 2F65A 3CF5Q 3KHHA 2ZOFA 3U7JA 1BQMA 4DV5F 4NLPA 2H4YB 1WJ9A 4H4OA 2EFOA 1QUVA 2DHGA 1YJTA 1KTVA 4JV0A 3L09A 4M8LA 4R8UB 5IT9Y 3RR8A 2AMCB 5CYJA 2CJ9A 5CZVA 3F56A 4F04B 4USUA 3HVWA 1VLOA 1NPKA 4ATNA 2E9TA 3SXLA 3FQLA 3PX6A 5IQ6A 4R8UA 4ZPDA 4LF4J 5H9EJ 4XPCA 3Q0AA 1P1LA 3QIDA 1RQ0A 1TKXB 1HNVB 4NRUA 1N36F 3V4IB 2J0WA 2HQFA 3FKBA 2DJWA 2ZC4A 1HNIB 1T3NA 1RHUB 3EYZA 2U2FA 1MLAA 2E7VA 2HVDA 1JKHB 1SBRA 4J9MA 1TKXA 5B0DA 1HNVA 2HZVA 3K8VA 3VHQA 3DHWC 2GJFA 1KQGB 3LWMA 2FJEB 2LMIA 1HNIA 4A48A 1RBOB 3HD1A 1Y3JA 3N5FA 4RBTA 1JKHA 3PZPA 4CO2A 4ED7A 2FLPA 3A3OB 3M8QB 4QYZK 4DX5A 1N5SA 3ZFVA 2IBKA 5CQGA 3R5AA 3GFXA 3BGRB 4KAIA 3R9LA 3HF5A 5J2NB 4K4XA 4KH0B 3M8QA 4C48A 2Z2MA 4GO5X 4G6VB 3W62A 1GMWD 1JLEA 3BV8A 1BMQB 1HI1A 4PXBA 4LBIA 1UEVA 1AFIA 2V4JB 1GMUA 1V3ZA 2LP4A 2UXDF 4DF4A 5J2NA 2GMLA 3V4MA 1NK5A 1S1VB 3ZTSA 4L75A 1TTHB 3MAQA 5GAGI 3HLUA 4PUOB 2AGPA 3RUBL 3BQ0A 3NGKA 5E41A 2V4JA 3I96A 1LWFB 3K58A 4J9VA 4AUKA 2QEXS 4MK8A 1VDHA 3T1AA 2CQ2A 3H59A 4JI1J 2PFFB 3VWSA 3LO3A 1S1VA 2MGZB 5THWA 3SYZA 1PC5A 5KFXA 1NM2A 2HZCA 4PUOA 2F5GA 1B4SA 4QIWD 4RKUC 1LWFA 1JXVA 5HVGA 3IRWP 3HJVA 2FYXA 4ED5A 4J9LA 4NWBA 1FKPB 3NWGA 5JXSA 3V6HA 1RAIB 3D3BJ 2MGZA 2D3ZA 1RT6B 4V19J 1RU1A 1FFGB 4HI2A 1FRMA 4LBHA 2N82B 2EG2A 2JEJA 2E7XA 3HULA 3TWZA 1BHNA 2KKHA 4WZQA 3NGDA 4DUZF 1FKPA 2R7UA 1FEEA 2FVSA 2KFNA 1RT6A 3ADAC 1GK8A 3C6UB 1RP5A 3CCES 4WXWA 4QWCA 3FBFA 1Q53A 1Y7PA 2AW0A 4ICLA 2BXJA 2JHEA 5E3PA 4U7UD 2RJZA 4YS2A 4LFCJ 2HFVA 2DD8S 2I0XA 2GAHC 3UR0A 3C6UA 2MYFA 5I4MA 2WZ1A 3K0JA 3SSQA 4JI4J 2W4PA 2OP5A 4WP8A 2K3IA 3FSXA 2M7SA 4EZ9A 1Q1KA 2VU5A 1PJ7A 3P8BB 4LF7F 3AT1B 4KPYA 2L9WA 2RQMA 4MAKA 4ZLJA 5C5JA 2J7WA 3LW5C 3AXKA 1NH7A 3EZOA 2GV1A 4A8OA 4W92B 4WKRA 1H7WA 2QSFA 3W3SA 1NMEB 4KHMA 2HGNA 3IA0A 1WEXA 2GJ2A 3DLLQ 4Y2CA 5IOLA 1HWLA 5LMNJ 2CPDA 1R7IA 3KJNB 4UTGA 3J80Y 3FMWA 5CYQB 2XCAA 2RKIA 2BM0A 3GTYX 3CIZA 2W9CA 1DARA 4X4RA 5IT4A 4DEZA 2PI4A 4O3SA 4RW9B 4I6WA 3T6JA 1N32F 3S7RA 4OYXA 5HMWA 2ZKUA 4O4GA 2EBGA 1I5OB 3CCZA 5CYQA 1XMQJ 2W8KA 2MXYA 3OJSA 2EKYA 4RWWA 2EW9A 4EYIB 5F41A 4F0KA 5L1KA 2BKOA 3F73A 3SDEB 2C3PA 1PYSB 5M2UA 3CCVS 3T6BA 3TQEA 4CH0S 1H0HB 2IY5B 1RTJB 3H7HB 5KT4A 3R2CJ 4ILRA 3CW2C 3AB2B 3IR7B 3UW1A 4ZHRA 4DV6F 4F0HA 2QLXA 4DV7J 4NA2A 3A12A 3SDEA 2UUBJ 3BPDA 3QBCA 3NS7B 1HBUB 2YTCA 1D0EA 3G82B 2Z0GA 1F9EB 1RTJA 4B9TA 1S7IA 2R2TA 4KH1B 4O44B 3CD5A 4RPFA 1UA1A 2DNNA 5KFNA 5KFHA 1HBUA 4CO1A 3G82A 1D8ZA 3AB4B 2Y1RI 2A1BA 2F7VA 2GIQA 3KJVB 5KFAA 1HNXF 4B3RF 2ZFHA 1X31C 3M2VB 2KXNB 2HVIA 1T95A 2PMWA 4MFBB 2P9CA 2ZBIA 1YLXA 3D5MA 3SMZA 4DR6J 5G0RB 1L3UA 3H5YA 1SKRA 3MMBB 4J9OA 3KJVA 3C2PA 3N6LA 4GMKA 1RAEB 3M2VA 1VLYA 5FDLA 4IG0B 1Y3KA 2KZZA 4WTOB 4MFBA 2V4QA 2BKNA 1NSQA 2W9AA 2BE7D 3GILA 1S99A 4J9UE 4ZPVR 4N7TA 4UQGA 2E5JA 2JDJA 1N54B 2M9KA 3LP1B 5HL7Q 2P5VA 3HFVA 1TL4A 2MQMA 1RA7A 2FHKA 1JX4A 3K5OA 2YWKA 4TXSA 1U25A 2I6WA 4KBIA 4FZVA 3TI0A 4ZLPA 2MPUA 1FFWB 2Y0BB 2FZKB 2IRYA 5B09A 2V34A 2BANB 3LP1A 2M3DA 4B3MJ 4PG6A 4OV1A 3FBBA 3BSOA 3DLHA 2QFJA 1I6JA 4I2QB 5HP1B 4NPOA 3DDKA 3JSRA 1DQ8A 5IM0B 4DX8H 2XLIA 2BANA 5KT6A 3PO5A 4ED3A 1CULB 3MFHA 5LL6d 1LOUA 2G0CA 3HSZA 3NWRA 3GR1A 5F9LA 5HP1A 5DM6Q 1S0MA 1JJ2R 2QTWA 5IM0A 4U96A 3VCDA 1VHIA 5FD1A 2NZ4A 3K2YA 2K2PA 1N52B 2GQ2A 3IBFB 1KQSR 1H74A 1QTMA 2HNYB 1FJGF 1FKOB 4LF6J 2GW8A 3J7AN 4O0NA 1BLUA 3CDEA 3MDFA 3CCQS 1Y5LB 4M94A 2C3YA 3KJQB 1I94J 3EZUA 4ZMMA 1FFSB 5KFVA 2RAQA 1FKOA 2DIUA 4DJBA 5HVFA 2ACYA 3ITHB 1UFWA 1N5VA 3WC2A 2HLTA 1HBMB 1NPPA 3KLIB 3HPOA 2RQ4A 2Z2YB 1YZ7A 1V6HA 1ZM9A 3VGUA 2E1PA 3B54A 3D54A 3MHYA 4OZ2A 5KFWA 4DS5A 3ITHA 3CD0A 2FJXA 2LU2A 3L95X 1WKLA 4TNOA 4OI3A 4GVLA 3BJYA 4NI2B 2BDPA 1X5SA 4Q2LA 2IVYA 2B9EA 4WE1A 4IRCA 4LIWA 3M6XA 1JJCB 4G1PA 2PSZA 5HBMB 2CPXA 2YKPA 4JI4F 3E51A 4M63A 1SKWA 3IMQJ 2RUSA 1RWUA 2RQCA 4DPUA 4AXIA 2RVJA 2CQPA 3ICLA 2NXNA 4NI2A 5CXTA 2NXCA 3NCPA 3CUNA 2KT2A 1BE4A 3LPEA 3EICA 2V2VA 4TQRA 5HBMA 2DNQA 4F4AA 4H4KC 4MH8A 3SEOA 1FDBA 4NZ0A 5J1PA 4EEYA 4FVMA 1S97A 3AJ2A 2JFDA 1UKUA 4DL3A 1VBZA 1SH2A 1HBOA 4OV6A 1ZOTA 2XNQA 4QJVA 4PPZA 4P6QA 2W7AA 3EE3A 3POTB 4CLKA 4LSNB 3TZYA 4LT6A 3WQPA 4F2SA 1TAQA 3JQKA 4KV8A 3A1YG 1YGYA 5D4NA 4ALZA 1J2VA 1DAXA 4OYPA 4CRJA 3EGWB 3TX0A 3M8RA 1XMQF 4C0HA 2DGOA 1R89A 4LSNA 1S6UA 1XN9A 2I38A 4C97A 4K4UA 3VVUA 3JYTB 1CLFA 5DETA 3T1HF 1GX6A 1EP4B 1Y0HA 3L9ZA 1X4BA 4P75A 5BR8F 4DV3F 1VQ5S 5D0GA 2R7QA 1U48A 4AQYJ 2ZD1A 4ZP7A 4C8NA 3RRKA 5C7PA 2HEKA 4DV7F 5K9FA 3H90A 3KDOA 3GYGA 4WJBA 1EP4A 4UQTA 1IR2A 4N56A 1VRTA 2A3JA 1AZSB 1YBUA 2HHUA 4B3SF 3QSIA 5IZHA 3UQSA 2DXEA 4I67A 4OX6A 4FS1A 1U6BA 3C46A 1VYAA 1EB0A 1AZSA 4G65A 1YQHA 1WDDA 4KGZB 2JL9A 1S1UB 3D1QA 1KVKA 4ZPBA 2FDNA 1RWVB 3RAMA 1TL3A 2YXLA 3I0SB 2R8IA 3QT5A 2P9GA 3M2UB 5KFGA 1WWHA 4ZP9A 1M5HA 4G3IA 1S1UA 3QWUA 5HAOA 3BYPA 4B3TJ 2OH2A 4M5KA 1TU0B 2OPQA 5F8IA 4DOZA 1G3OA 4EMDA 1FNMA 2ZH6A 3I0SA 1F3FA 3JTPA 3M2UA 5DDRC 4WFZA 1RBLA 4XK8C 4MIBA 2EC2A 3KLEB 3PYFA 2KO1A 4PWDB 3IP0A 3U27A 3OLAA 2V50A 2HLUA 2DNRA 1ZBTA 1HYSB 3SCIE 3KK3B 1IUJA 4DQRA 5D4PA 3OR1B 2ZHBA 1J5OB 5GMEA 2YVSA 3KWMA 4USTA 2LYVA 5D3GB 2AJ0A 2MKHA 3CCRS 1B7FA 4YOEA 2RD5C 3J7YU 1T9XA 2YX4A 4P7TA 1CC7A 3CE8A 4OFZA 1HYSA 2C28A 2DNOA 3KK3A 4C8LA 3MPWA 4X2BA 4HEA9 3OR1A 1J5OA 5LSOA 2H5IB 3CGIA 5D3GA 2UZAA 1YJUA 4LVNP 2ROEA 2YNIB 4B3MF 1VIXA 1FHTA 5A8RB 1LXJA 3CJRA 2HYIB 1YWXA 2IC3A 4YEAA 1N0VC 3D0HE 3B4MA 3NL0A 1HI0P 1K1QA 3CJ0A 3M2RB 2BM1A 4NE9C 1V5IB 1R8PA 1RXOB 1Q7LB 4YP3A 3K17A 5A8RA 4J91A 4LBPA 3CVKA 3LGNA 3MM9B 4NEYA 3BEGB 3R1HA 3M8PA 1IJFB 3NNCA 4RNFA 2FJDB 4CTAB 1S0OA 3SBMA 4F3QA 2WBRA 2KI2A 3TRGA 1BC6A 4BLGA 2OTJS 3MM9A 2GCFA 2IM1A 1KONA 4LF6F 1RABB 2R2UA 2VB6A 4ZP6A 4ED8A 2MMYA 4JI8J 3UPFA 3SCLE 4FVCA 4HACB 3QGPA 4KYZA 5ITHA 4CTAA 3G4SS 2BBEA 1KFSA 4DPOA 3T1YF 5IT0A 4HVZA 1YITS 2LU1A 2LA6A 2DIVA 3BO2A 1NK9A 1NBEB 1DTQB 4HACA 5CYMB 5IC6B 3W8PA 4LQ9A 4M95A 3QT8A 5ETMA 4ITSA 2VFUA 2HWTA 1HPZB 3JQJA 1A9NB 5DG9A 2BEFA 2ZDPA 3ZC4A 2ALZA 4K5SA 1U6FA 4DV1F 1QTNB 5T41A 2CJQA 4GO7X 2AGQA 4AXJA 5CD4A 2HHSA 2FVPA 5IWAF 1SQFA 4WP9A 1PJ5A 5AXKA 3BR9A 2ZH1A 2VV5A 3H5UA 1LV5A 1Y9OA 1UCNA 2OELA 2HVHA 3GMGA 1YJVA 4ZCIA 5LJ5Y 3C14B 2HPUA 4FYVB 2GGPB 2WCXA 1T05A 3BBBA 1BWEA 1S77D 3S1TA 1RHMB 1ZPWX 2YWHA 4LF8F 1EKSA 3C14A 3DMJA 5DLGA 1RAAB 2CPEA 1F5BA 3MCSA 2GGPA 3Q8UA 3TR5A 5MAOA 2UXCF 5ETRA 3DDNA 4IH5A 1R0BG 3PRVA 1BD6A 3DYAB 1I51B 4KC5A 2PD1A 4EI2A 5EWEA 1KFDA 1CSJA 4GC6A 1U09A 3MOZA 1NDLA 2FC9A 3I5BA 2VG5B 4DR5J 1UVNA 2C3MA 3DYAA 4A46A 3CJ3A 3MURP 3BPSP 3PW0A 2MDAA 1T0TV 3UCUP 4USHA 3QATA 2HNDB 2UUAJ 1VIOA 2AV5A 3A8JA 4NRTA 1JWWA 2BV3A 5HATA 1GMWA 4O3RA 4IQXA 2GO8A 3KNGA 3FCWA 4QIGA 5B7WA 5AE2A 3D1OA 2YBVA 2B8QA 1QVFR 1U8SA 3J7ZT 1F1BB 5GMDA 1Q4RA 2HNDA 2FD2A 2B6AA 2D69A 2BE9B 2E29A 3CCUS 4F2RA 4RW6B 2GVZB 3DN9A 4G1QB 3G71S 2I5JB 3AOBA 1D09B 1UFLA 1MW7A 2DGWA 3G8QA 3JSMB 2O5DA 1WEZA 4DUTA 3Q8YA 1RGVA 2DY1A 3EVOA 1B64A 3MEEA 5A0YA 1CQMA 4G1QA 2I5JA 3HHKA 1L3SA 4PG4A 2GS8A 3QRPA 2LXIA 2ZBPA 4JBCA 2IJFA 3JSMA 5AE3A 1VQSA 4PYAA 3QJLA 4QZVB 6AT1B 3RBZA 2QMXA 1AXQA 1WC5A 1YJ7A 3BB5A 4NLXA 5F8LA 2DT9A 4ZCLA 1OPIA 3D6FB 1RWOB 5M2RA 4XTTA 3J81Y 2F4FA 2WVEA 2DISA 4B3TF 4USKA 4OX9J 2DNMA 1YJRA 2GIRA 1BQNB 1OY9A 2GNKA 2EFGA 4UUXA 2W2OP 3M8SA 4ZN3A 2V0NA 3O6QA 2BJEA 3HXMA 2DVIA 3D4JA 1AFJA 4ZCKA 3BSNA 4KB7A 1PKUA 2KVIA 4Q8EA 3H4BA 3MEKA 2LA4A 1QY7A 1L3TA 3SFUA 1BQNA 2J8AA 2IVMA 3NNHA 1OY6A 4PYDA 2DNYA 2XB2D 4OZ3A 2E1AA 1IBLJ 5HMXA 2K06A 3KDNA 4QR2A 2VBWA 2XLJA 1M90T 1FVQA 4A8XA 2VOPA 2DPJA 3RW7A 4ZVHA 1FWKA 3FSYA 5EX3A 1UVKA 1XTZA 2OTLS 1VQKS 2RB7A 2YKMB 2CXEA 1VRQC 1OYDA 1VQ9S 4RNMA 3ZZ0A 1WTBA 9ATCB 2IDEA 2R7XA 2VFVA 3FUYA 3PFEA 1OMSA 1TUWA 5J1EB 1T9UA 3L4BC 3ZZTA 1VCTA 3I4HX 3ILOA 1ZZNA 4PQAA 2IM2A 2IPOB 2R9LA 2ZWOA 1FE0A 4M5MA 1FNXH 4MMOA 5J1EA 4W4MA 3MM8B 3FZBA 2EVZA 5HROB 1I3OB 2KT3A 2C22A 4PKDB 4E0DA 2CA9A 3F41A 4YDDB 3BZQA 2W9BB 1X4GA 4JI8F 3ZO7A 1HL6A 1NK0A 5F0WA 1NDCA 4RNHA 2IA6A 2QFIA 3MM8A 4HI1A 4DV0J 3MEGB 2HGLA 5HROA 1MWQA 2IFXA 3LP0B 3IXQA 5K14B 1KQKA 3K7RA 3CPWR 2FY8A 3BKTA 3GB0A 1NU4A 4UOGA 2W9BA 2ZUGA 1ZAXA 1SC4B 1VQ7S 1ROFA 2KL8A 2AJQA 5GAEU 2PT0A 3MEGA 3GZ7A 2O67A 3LP0A 5K14A 3I9V9 4DLGA 2UV8A 1LNQA 1Q8BA 2HBRB 3U1MA 1T8EA 4FYDA 2LKZA 4F02A 4ED2A 4WYWA 2CJXB 3DRSA 1JLQB 2IIHA 1CJKB 1HIYA 4LFBJ 1XEZA 1RSCA 1U47A 2KXFA 1JLFB 4JB8B 3R5DA 1NSAA 3IWNC 2BMBA 1P9QC 2EBEA 1Q8LA 2DEJA 2W2PP 3O44A 1SJ1A 1W25A 1S9EA 3UWTA 1U1OA 1S10A 4UOCA 1JLQA 1VJQA 2JOQA 1CJKA 2DH7A 2CQDA 3MMAA 1U1RA 1JLFA 3S01A 3UN5A 1S0VA 2JFKA 3G86A 2LDIA 4YB6A 4IH7A 1TAUA 2RH3A 4F4KA 2C3OA 1W26A 3L7PA 4IYQA 4DR3F 4MKYA 3OV7A 5BJRA 1TK0A 3F44A 1T02A 1RT5A 1OY8A 1LW2B 1MMDA 1X4HA 4LSZB 3MCMA 2ADCA 1G6BA 1SKSA 1FRKA 2UUWA 3ZTPA 3KLGB 4PAAA 2ZBCA 1H6KX 5HVHA 2M70A 2OPPA 3TO8A 2Y1LB 1NJIT 2DGTA 4DCPB 2M8HA 1LW2A 3MR7A 2ZHOA 3BO4A 1KR4A 4HTJA 4CH7A 2YWWA 5C25B 4QR0A 2GHPA 4DR5F 1GFWB 1DY3A 3KLGA 2GMJA 5LT5A 3IS9B 3MEDB 3R2DJ 4P52A 2UUAF 1L3KA 5E0OA 4QPXA 1PGZA 2JSXA 4WIIA 4IG3B 3IC1A 3BGOP 4KSEB 3MPVA 5F8GA 2ZBQA 1VC0A 3RBEA 4KO0B 3IS9A 3MEDA 4WBFA 1E6VB 2B4OA 1X9SA 1VRUA 2FJWA 3R5CA 2AD9A 4EZ6A 4OLOA 5LXRA 4UOFA 4IG3A 1N5YB 1FA0A 1B70B 4ZK7M 1UWBB 2JRSA 4CO3A 4KO0A 1E6VA 3UO0A 5AXMA 1YI2S 1SJRA 1D1UA 5CD4H 2J0QD 3VVTA 3RJMB 1YG0A 2KU7A 2IRUA 1RTHB 4Q7AA 4K4SA 3CD6S 3UDCA 4P2XA 5JVGQ 1N5YA 3MPUB 1UWBA 3DOMA 3RU0A 3D0IE 5K5MA 3GIIA 2QC3A 1LK5A 1CS4A 4J7CA 1S1WB 2R7WA 2A6MA 2YNGA 4DSLA 1IJEB 4P74A 3CC2S 3GYNA 3DRRB 5ETLA 3TZWA 2KYZA 3M6UA 3MCOA 1TFWA 2N7CA 4DR7J 1SJ4P 4K4VA 1S1WA 4NLSA 3IBCB 1HD0A 1JLBB 3QWPA 1GTHA 2YQ1A 2XLKA 2BOAA 3MECB 3DRRA 4C8YA 1U1PA 1S1TA 3WC0A 2BA9A 1F9FA 2VKRA 4OI1A 3VZIA 1WSVA 2AQ4A 1KLMB 5DG8A 4BDPA 1JLBA 2DO0A 2P2CB 1HR0F 1EX8A 3MECA 4CYUB 4ZPTR 5IT9U 1IBLF 4RUCA 1R8CA 4P2MA 2C2ZB 5H9EK 4QYZJ 3S8SA 1KLMA 2ZEJA 3M05A 3IR6B 2ZZTA 4ZJLA 1U2RA 2UP1A 4B9MA 3TJ9A 2XGPA 2J6TA 3A3NB 3FBEA 4F0MA 3K57A 3DRXA 4CYUA 2VZ9A 1WDTA 3OVSA 3RW6A 1UJ4A 3ZTRA 2RU9A 2PA3A 4KGVB 2V2KA 1RK8A 4ZLLA 1XMOJ 2L9DA 4Y00A 2EKNA 4P7VA 3UVJA 3LWLA 1H3DA 1X4FA 4QOTA 4JV1A 4I6YA 5ETVA 2AX0A 1VK3A 3MOJB 2IMWP 2X1BA 3DNCA 3R3TA 1UEKA 2V2QA 4OHYA 4CZCA 1TL5A 5DGBA 3GJQB 3H8YA 3R7SB 1F5AA 4H4KA 3FNNA 4CP5A 4LF2A 2AJ4A 3OLBA 2CPZA 2JWNA 3TUJC 1SQEA 1XIQA 2HFOA 2R3VA 1PC4A 4KIAA 1WF0A 2VD3A 3I5AA 3K8WA 1ZM2A 1XWLA 3HX9A 5DG7A 4DL4A 3I5CA 2R8HA 1N34J 4RX6A 2ATLA 3V6KA 4A47A 1NAQA 2F1FA 2A2CA 2HW3A 1X5TA 2G0IA 4LFBF 2U1AA 4M5HA 3NAIA 4XO0A 3ULHA 1ZS6A 2ABYA 1FF2A 2RHQB 5DZ7A 3NMAA 4DSFA 5DM7Q 2Z4PA 3C66A 1SUQB 1WG5A 2DBBA 3M8YA 4PR6A 2CQ3A 1DJ0A 3OTOJ 2HSEB 3KTQA 2HFNA 3RB0A 1RYSA 1T11A 2E5GA 4F8RA 1FCAA 3OUYA 4Q0BB 1FDAA 3QZ8A 1CEZA 2X1FA 1EETA 3PW5A 2F9DA 1GEHA 4QWDA 4ENOA 1LWEB 1SUQA 4Y2MA 5DGAA 2V6AA 3FRZA 2VQEJ 1NLKL 1FI4A 3P3DA 4F50A 1HQUB 2OPSB 3H5SA 2AHOB 4F26A 1FKAF 3LA0A 3QNWB 2FTRA 4P72A 4QWAA 4Q0BA 1GNKA 3AHPA 3MPDA 3OTDA 1S9FA 1FDDA 3Q8QB 1LWEA 2YWEA 1M5KC 1MMLA 2R4FA 2Z8QA 3OR2A 5MLCV 2BQ3A 1HQUA 1WC3A 5BYRA 4N5SA 5DDOC 3DDIA 2XULA 2HAFA 4JUZA 3MI7X 2GQCA 5KTQA 2MLZA 1VHFA 1RTDA 1G2EA 1FRXA 4EO8A 1UVMA 1DTTB 2CJYB 5ETQA 2P8IA 3PHTA 8ATCB 5JMNA 3CNQP 2XS2A 4PXEA 3KLHB 2HG4A 3CJSA 5I42B 4B3OB 4MT1A 1VC6A 4NLRA 2BZ2A 1DTTA 4ES1A 1WKJA 1HQEB 3PACA 1LWXA 3ENVA 1LK7A 5BYSA 4Y2KA 3K5NA 3AOCA 4OJGA 1VQPS 4B9UA 4B3OA 2XHWA 2HFZA 3O5TB 4ZVOB 4C7QA 3US5A 1MWYA 1HQEA 1P8GA 1N36J 1AYEA 1U1KA 3JAMU 1DRZA 2XMMA 2PI5A 2GQQA 2EFPA 2BVZA 4J37A 2C2RA 1NNDA 3PO4A 3TNVA 3SIPB 1UPMB 2EFVA 3FCVA 3TUIC 5KFJA 3CCJS 5K8NA 4I68A 3PNIA 2ZH5A 2I2YA 3AY0A 2VHGA 2E5IA 1YRUA 1GTEA 3GIRA 1S7HA 4U6PA 1RAHB 2ROPA 2ZHAA 2GA7A 2E9ZA 2QO3A 3QIPB 1Q86T 3GLJA 3R5JB 3IG1B 2HFUA 4KGKA 3ISZA 4O3OA 4I0WA 4DR7F 2NSBA 4CLZA 1WI6A 3CJ2A 3QIPA 4CIOA 4NLDA 3OFHA 1FE4A 3KG0A 2J9DA 3UD4P 3PW4A 3IG1A 2VA2A 2DPIA 2YX1A 1U0HB 2DCLA 5KFMA 4FNIA 2BJDA 2VFRA 1Z2ZA 2CPHA 2DR7A 3DLBA 4AL6A 3R5GA 2HFSA 4ECUA 2XY5A 4UY8T 1U4BA 3SV4A 5ETTA 3BQ2A 4UZBA 4B9SA 2G9OA 1RKIA 1FERA 2OGUA 3HT3A 2N3OA 5HJXA 3J7YI 4QIFA 1PBUA 2CFXA 2LXFA 2X51A 4KKOA 3HSDA 3HKZD 5LJ3Y 2V2ZA 5JVHQ 2EFQA 1TKZB 2R8JA 3DLGB 1M5PC 5KOXA 2LEBA 1F5CA 3LAMA 3CCTA 3PR4A 1D9FA 3M9OB 4OZ5A 4HYKA 1TKZA 4I7FA 2CG8A 2CZ9A 5DQIA 1RT3B 2XGQA 3HZGA 1VJWA 1PILA 4NMLA 2Z2LA 2J6UA 4K0KJ 4L3NA 4F25A 2JLGA 2XC9A 3OL6A 2AJFE 2QX0A 1REVA 1LXNA 1FXLA 3JB9k 2QIFA 2DHHA 3AH6A 2RRBA 3CDAA 2V8VA 3R1LA 3A8KA 4RW7A 2XMTA 1RAOA 1WNEA 3O2IA 1RT3A 3PXGa 1F6TA 3H2VE 3KUHA 3FSIA 3TYTA 3KK2B 4H4MB 1ZTTA 1KP6A 4WTYA 3N79A 3T9ZA 4WIQA 4TVAB 4DSKA 1BQXA 3ZZZA 1HMVB 3CD7A 2MB0B 3GV8B 3PYGA 2VDHA 2EK1A 1HI8A 2PFDA 2QT7A 4J9QA 3BYRA 1MN9A 3EPIA 3KK2A 4H4MA 3Q2TC 7FDRA 5IXUA 4V19X 4ID8A 2LXUA 2NS1B 5HK4A 2C2EA 1HMVA 2OSRA 4IFVB 4N8NA 2MLYA 1ITPA 2NYHA 3TAQA 3BR8A 3RBDA 5K8PA 5ETSA 1VI7A 2O66A 2GHWA 2MHEA 4LQ3A 4LF7J 4RL1A 3O1LA 4IFVA 4U8VA 2QLBB 1PAEX 5F3ZA 3JTNA 1ZM4A 1O5JA 5U47A 1NO8A 4L73A 4Y28C 4C0BA 1IBKF 3QSYB 1SJ3P 3QJPA 1HQ2A 2CPJA 4DPWA 3SI8A 1IKWA 5L9XA 2I9SA 4NX9A 1UP1A 3OTOF 2VBXA 2YKNB 2XQCA 1D8YA 3DKDA 4RU9A 3T3FA 3PW7A 1GH8A 3NXZA 1HWIA 3B8HA 2BW2A 1NJWA 1WEYA 3DLKB 2GFFA 5B0BA 2HHHF 1U2CA 3TP2A 3VTIA 3SV3A 2VQEF 2OI2A 1UVJA 2VQFF 1RWPB 1N32J 1C0UB 3OHBA 1RI7A 3CJTA 2CWKA 4HH1A 1J27A 2AT1B 4A8WA 3P5BP 3DLKA 3BO3A 4PWUA 3HHNB 1NB2A 5AXLA 4LRCA 2VPWB 2IAJB 1XQIA 3FK4A 4WKYA 5KAKA 4NZ7A 1C0UA 2V63A 4RBUA 2JH3A 2IHR1 2VICA 3AFGA 3GG1A 1RHKB 1KWMA 4DV6J 3I56S 2IAJA 2FZCB 4JOUA 3MD3A 1C1BB 3U1NA 1XNQF 4QIVA 3ZZUA 2ZC3A 1VQMS 1R8AA 1F2GA 1JLCB 3QMQA 2DTJA 4I64A 1EQ0A 2AX1A 3BGUA 4DPYA 3BN7A 1TV6B 2DGUA 4EWTA 2SXLA 2LFVA 2JC1A 1JLCA 2DHAA 4ECWA 3GV7B 2DKOB 2N4CA 3NMRA 1NRKA 1HNXJ 2YH1A 1TV6A 4B3RJ 3I6PA 2XZWA 3MTJA 4Y0FA 3UN3A 2XMAA 4A8SA 1V5VA 4ZJOA 4ZJQA 2BKPA 1CC8A 2V8PA 2KT5A 2VG7B 1KHVA 1RWKB 5D4LA 4RUAA 1HLWA 2GAGC 3PYEA 4XIUA 3V4IA 3CO0P 3E3XA 3KOAA 3I31A 1UETA 4RUBA 4V1Ak 5KG1A 5C42B 2ZDOA 3EWGA 1QSLA 1REGX 5KG4A 3C3LA 3W5YA 2GHVC 5KFQA 5D77A 3RZAA 3Q22A 3NS6A 1A6LA 3FVYA 5KG5A 4F7VA 2POKA 5C42A 1B0PA 2RRNA 4ZIWA 3PIOQ 1VR6A 4L72B 2FB0A 2Q6BA 3HHLC 1ZPVA 2XNRA 3SQGB 2DGXA 1Q5VA 3PHEA 5SUHA 5EGYA 2HWHA 2NQPA 5GMKa 1N56A 3ENAA 2VJUA 1PO6A 2ZKTA 1NUEA 2D74B 3BGRA 4JP8A 2D7SA 3BGLA 1S79A 2N3LA 2CNNB 2C2NA 3B78A 3TZZA 3SQGA 2RHSB 4OHXA 2XZDB 1UZDA 4CWBA 3HD2A 1A7GE 3TVKA 2FUG9 4OJHA 1BWVA 2EC0A 2J9DE 4CLPA 1W7WA 4DV4J 2ZH7A 3W2VB 2GZOA 1TK5A 3QGIA 3HSGA 4LUBA 4K2JA 1RCXB 3NOCA 3IWLA 3W9IA 2L3MA 2KYXA 2JJ4D 1FJGJ 4RW4B 4DQIA 2DNHA 2C2KB 2KRBA 2V8HA 5EHHA 4ZVGA 4Z2XA 4K0KF 1X4EA 3PCOB 8RUCA 3M4XA 2YWGA 3C16B 2HBYB 4M5DB 1UW9A 1NKCA 2Q6CA 3K5PA 2HVZA 4ZITA 2XMVA 2X1AA 4M5NA 1M5SA 1D9AA 5CAAA 2AZ1A 4MTPA 2HRUA 4TQSA 1KN6A 3C16A 1SJFA 4M5DA 1XR7A 1U26A 2IBOA 4ECYA 5HI7A 2ATCB 3OD2A 1UA0A 5SZTA 3LUYA 4FF2A 1WORA 1H2UX 1HBNB 4D3GA 2Z57B 4USIA 4OHZA 4LJMA 3AJ1A 1OSCA 1SI9A 2NLWA 1JMTA 4K59A 2X3DA 3IAS9 1U6ZA 3FEZA 1V3RA 5GAEI 4J9NA 4B9NA 1HBNA 4GKJJ 1Q95G 4JI7F 4TYBA 4TU7A 1H38A 3RTVA 1Y4ZB 2J9EA 5A2QU 4ZPWR 3EGZA 2RF2B 1DQ9A 4DFPA 2JEIA 1SKUB 2GVDB 4UZCA 3KHGA 1IXKA 4URGA 3GP9A 2ZH8A 2IJNA 1B3TA 2DGVA 4ZIVA 2XMJA 1QAIA 2EFNA 3R7BB 3HHEA 1Q78A 1WG1A 2FPHX 3IBWA 2JVOA 2RF2A 4JV5F 1QDUB 1QD1A 2GVDA 2WOMB 3DLEB 4KQZA 2CRLA 4ECTA 3MD1A 3V81B 1VQ4S 1MWZA 4KFBB 2N4DA 4DDFA 1VISA 4NZ6A 3BBFA 2MQPA 4EBCA 2X7IA 2GMHA 2QLFB 1NSKL 2XY7A 4NMXA 3PVXA 3PKMA 1RB0A 4M5GA 5FIIA 2IVFB 3E8OA 3NBPB 2W2QP 3IO1A 2XS5A 3G8SA 2VFSA 1CG2A 4KFBA 1S4FA 4BCAA 3T1HJ 4RW9A 2HAIA 5DQHA 3GU0A 4DR1F 2DNPA 3J81j 3CT9A 2EPIA 5BR8J 4DV3J 4OJ3A 3G8TA 3GFZA 1N5QA 4ED0A 2MZSA 1X7VA 2ASDA 2V68A 3R27A 1YDLA 2YKQA 4B3SJ 1C0TB 3W60A 3QPIA 3CDUA 4DSJA 3UI3A 4X62F 1RWNB 2OSQA 3B82A 2K3KA 2WSCC 3QYYA 3MR2A 3K59A 1IBCB 3GPAA 5ADZA 4IH6A 4ELUA 3KMSA 4B02A 2EK6A 2JVRA 1MG7A 2Z2ZA 1AUDA 1S49A 2MZQA 5I3QA 5ETNA 1KS2A 4O44A 3UCZP 2QGFB 4A8FA 4RLEA 1TUGB 4LR7A 4NOHA 2MZ1A 1RCOB 4CLSA 1F9HA 4Q8FA 2F63A 2DEIA 2QYGA 2LQBA 2ZE2B 2RU3A 4DL7A 3S6EA 2OMOA 1ZH5A 3FMBA 5LMUF 3QFHA 1SL2A 1HFEL 4TKTA 2BQUA 2F3JA 5GAHU 4DL0C 5BYQA 2BJ7A 2HS0A 1SB6A 2ZE2A 3D1HA 1S59A 5G0RA 4B17A 2ZH9A 3MMBA 3T5JA 2K1RB 2AF6A 3P5TL 2KZMA 3BDPA 2NR0A 5JJBA 3E01B 4OZNA 2JEFA 1O6XA 1NXIA 4OI2A 1YZ6A 4IG0A 4ZDNA 3C8YA 1LW0B 3MZIA 2RRAA 3KG1A 1AROP 5B0FA 4DZ6A 3R97A 5CHCB 2K1RA 1FRJA 4WWSA 4MKVA 1EJ7L 1TVRB 1TL7B 2KJVA 1WTFA 3M32B 3CDWA 3MCNA 2JX2A 1RT1B 1XC9A 2ZM6F 1FO1A 2ZNYA 1LW0A 1XMBA 1XNRF 4FPRA 1Q79A 3WZ0A 1RAFB 1JLAB 1VC5A 1FRLA 1M0SA 3LGMA 1TVRA 1TL7A 3M32A 4WFBQ 1T7PA 1P27B 4CQ1A 4Q45A 1HNZJ 3W2WB 1UL3A 5HQMA 2CQIA 4I2QA 1UPPA 2G2OA 1WI8A 2EWHA 5T7LB 5HMZA 4C8OA 4HKQA 4DV4F 2IYIA 4IRDA 1CULA 3THTA 2CADA 4A8KA 4PG5A 2M2BA 3DXBA 3W2WA 2ZZMA 4NLYA 3ETMA 4CLUA 2YNFB 1AUSL 3CCWA 3ZXWA 2WVDA 2ZNZA 5E3RA 2D9OA 3AA9A 2ZOGA 1TQLA 5A8KB 3J7Z5 2A6OA 1WKKA 2XBPA 7AT1B 4YQWA 1IWAA 4OX7A 1SL1A 1S6QB 2RS8A 1JJHA 2IM0A 2AYGA 2HNYA 2YNFA 3T1YJ 1C1CB 2BABA 3QRQA 4CT9A 5A8KA 4MIAA 2DO4A 1G4CA 3P96A 1S6QA 1NZ8A 4Z7YA 2M8DB 2D3O1 2CPYA 4C6AA 3R5BA 1IKYB 1JXEA 3KHRA 4N77A 2M4MA 1WOOA 1NK7A 4CNYA 4DV1J 1RJJA 1YJNS 1HBMA 3PW2A 3KLIA 2BR0A 3EMTA 2CNKB 1YRXA 1M1GA 5IWAJ 4TYAA 2DXDA 1UEUA 1MSWD 3MUMP 4RR5A 2A0FB 4NL5A 3G87A 1KQFB 1HKAA 3FBCA 4IO1A 5HMYA 3DGVA 4FYWB 2E5HA 2CZ4A 1T94A 3OL7A 2RDIA 4GKJF 2R8KA 2QLWA 2ZJRQ 4MKBA 2CIMA 5IQQA 3H20A 3BSCA 2CQHA 2CDRB 4YB7A 1GXTA 5K8OA 1WSRA 1SC3B 1CJVB 4LF8J 3G6YA 4JI2F 2W2MP 1RAJA 3OTEA 1HHSA 4M5LA 3PIPQ 3SQOP 2UXCJ 1UTAA 2A18A 3CWJA 1SV5B 3Q8PB 5A6PA 4I56A 1DHMA 3VZHA 4LFAF 1CJVA 2LQ9A 1YBTA 1YKWA 1DLOB 2FIUA 5F8MA 1OJ4A 2R7TA 4K2XA 1T9TA 4ECQA 1SV5A 3CXCR 2E7WA 3POTA 3LOUA 3RBXA 4NLUA 3OJUA 2E66A 3H4DA 1NDPA 2V9WA 4IRKA 1DLOA 1N6QB 3M8ZA 3QGHA 1YBAA 1WC4A 2MKJA 2WVFA 1JLGB 2ZJQQ 2VFTA 4XDCA 3U02A 1JK9B 2WW8A 1CJTB 1FX4A 3RB6A 3JYTA 2NZCA 4RNNA 4WCEQ 4K4YA 1B7YB 5I3PA 5B0AA 2WSEC 2MHNA 3DXSX 5HSPA 4DQSA 2C2OB 1CJTA 4E98A 2CPIA 3L7UA 1T9YA 2Y1JA 4N76A 1RWMB 1RDRA 1RWXB 1T03B 4L3KA 1HD1A 2FVQA 4OZJA 4C8KA 4DZDA 1KBRA 2G4BA 4KHPF 5D0HA 2F8HA 1R3NA 1ZTWA 4PPDA 2E44A 1PYOB 3NAHA 5CA5A 2P9EA 4DSIA 4WP3A 2CUYA 2XYHB 2UUCJ 1PSDA 2DGQA 4JV2A 1HW9A 2VPZB 4EYHB 5DQGA 3Q8RB 1FESA 1S1XB 4RZRA 4FKYA 2WONB 2GJIA 3ZZYA 3ELHA 2YPYA 1NJXA 1QLNA 4WU3A 5B0EA 2HIYA 3HKWA 5EWFA 2GX8A 2RNEA 3T5HA 1S1XA 2J6SA 2WB1D 4OYOA 3ZNJ1 4X4SA 1BQMB 2UVWA 2WONA 2KFZA 2ASYA 1OPZA 2QMUB 4K8RA 4GKKJ 3MXHP 1HNWJ 1TKTB 4Q5VA 1S0NA 4O23A 2CNLB 4DUYF 1X9MA 3KLEA 5DDQC 4F4YA 2HRTA 4PWDA 4ANCA 3M6VA 3C6TB 2X1GA 3X3UA 4FF3A 4JYAF 2FJAB 3C15B 5KFOA 3FFIB 8AT1B 1EARA 2MKYA 4BC7A 3HK2A 4J9PA 2ADBA 4ZPAA 1U0SA 1TKTA 3PM9A 1FXRA 2YH0A 2PEBA 3KMQA 3G6VA 4FF4A 3RAQA 3C6TA 1RA6A 4FDFA 3C15A 4RU2A 3FFIA 5H1SV 4EU0A 1NKBA 1NSPA 2CZVC 4DPTA 3ETOA 2UU9J 2QZ8A 4DQQA 4ES3A 1RHJB 2BQRA 2YNIA 5KFCA 1HNZF 4PEOA 4YMEA 5LM7E 1DQAA 3GIMA 1M1HA 3MR5A 3FZ2A 2FVCA 2W01A 3TJ8A 2HQDA 3Q23A 2B56A 2G2ZA 4B9LA 4Y3CA 3M2RA 3N6NA 4IOBA 1SVDA 1WOSA 2V5HG 3KFWX 3R6GB 1RUSA 4LMZA 4FXDA 1Q0NA 4IFYB 2DB1A 3TVZA 1K8AT 4ZOSA 2F8EX 1KKHA 2AYBA 3Q89A 3P49B 3GYXB 2F40A 4ZVRB 3SSSA 4X64J 1R8HA 1RT7B 4Y34A 4IFYA 2OAUA 2OKQA 1K9MT 1IQTA 4IQMA 4DFJA 2L9NA 4DFKA 5E3AA 3Q2SC 3IN5A 3I55S 2D3OR 4RBVA 2PE8A 4CNZA 3AXMA 1JLEB 4K4ZA 2BRKA 5F9NA 1RT7A 4HR2A 1HWKA 1RWWB 4X4VA 3V6DB 1DTQA 5CYMA 2NREA 2WK4A 4A8MP 2QL5B 2QMWA 2KB2A 2Z58B 2CKWA 2HIQA 2DHXA 3UNGC 1HPZA 1BUXA 4X65J 1L5UA 3V6DA 5HLFB 5D15A 5A76A 4KT0C 2CDQA 3GFHA 1NEEA 3GCXP 3EVWA 2L48A 3GV5B 3D66A 4DL6A 3R7NB 4DN9A 1KNZA 1FRHA 3W66A 1O0PA 2FQQB 4K4WA 3KG4A 3ZZRA 5HLFA 2FHJD 4DR3J 2HURA 2BYCA 1KOOA 2VODA 4I4BA 4C3KA 2B9XA 3ENQA 3EXYA 3HM9A 1Y10A 4MK9A 2XTJP 1QAXA 2GIFA 3KUGA 3LGHA 2R2SA 1X4AA 5EUHA 4WFXA 4ID5B 2BJ3A 3IFEA 4FBUA 2OD4A 2XWYA 4X4QA 1Q8KA 1XR6A 1O8BA 3NRBA 4ICLB 4KTQA 1GMVA 4ID5A 1FTRA 1N33J 1WACA 1G1XA 1XERA 4OYZA 1O51A 1TZ0A 2AZ3A 4CLYA 2WTFA 2ASLA 1X8DA 2XG8A 5K20B 1N4LA 2XY6A 2VONA 2VG5A 1U2FA 5D4OA 4I6AA 4PCQA 1KTQA 4CCHA 1VQNS 4CO0A 4PXCA 3FC9A 2VOOA 1YJ9S 2CYYA 4IR1A 2DITA 3FCHA 3M1VB 2MJNA 3HHLB 2BACA 1SJQA 4QCLA 2CWXA 3NCQA 2DGSA 2YQ0A 2UVVA 4ZVTB 4MK7A 4CLLA 1FJEB 1JNZB 1HWUA 3TAPA 3UE2A 2IJRA 3K89A 1JXLA 4RW6A 3GCWP 2GVZA 1ELOA 3H98A 3M1VA 3HHLA 1M1KT 2Q3PA 2XO7A 2HQIA 1F2HA 2B4PA 1DBDA 1FT8A 2XO6A 5B0GA 1MNEA 2RKIB 5KFLA 3JAMY 2XI2A 5KFKA 1R31A 2W9CB 3D3CJ 2XMUA 1D3WA 2H9ZA 3MGJA 4LRBA 2UUCF 2MKSA 5KFIA 3W5XA 4O4GB 5AJ3F 3H0PA 3BKFA 3D7SB 4P9SA 3MMCB
chains in the Genus database with same CATH topology
1WF1A 1RISA 2QT7A 1GXUA 2K7JA 1Z2LA 3M6WA 4J9QA 3QJJA 3EPIA 2HS4A 3UR3C 3T5KA 3KK2A 4H4MA 5KT3A 1DURA 4TLQA 3Q2TC 7FDRA 5IXUA 4V19X 2HHUA 3DLJA 4ID8A 4B3SF 3N5BA 3CSKA 3QAUA 2LXUA 2NS1B 4MKAA 5IZHA 1G7CB 2C2EA 1HMVA 2OSRA 4IFVB 3UQSA 4N8NA 4DL2A 3OSPA 4I67A 4OX6A 4FS1A 3TAQA 1U6BA 3C46A 4C4WA 3HMJG 3MMCA 4WF9Q 2M0GB 3BR8A 4F4WA 4F4XA 1YQHA 3RBDA 4ZHRB 5K8PA 1R43A 3CCLS 2JL9A 1S1UB 3D1QA 4GKKF 1LFPA 3WX4A 1VI7A 5J2MB 2O66A 1F0XA 2GHWA 1HNWF 3DU5A 2R7RA 2MHEA 4ZPBA 4LQ3A 5H9FJ 2FDNA 3I82A 3CEDA 2ZJPQ 4ECVA 5AXNA 3RR7A 1S6OA 3HVRA 3RAMA 5D78A 3O1LA 2KXHA 1KHWA 2WOMA 4IFVA 1TL3A 3DLEA 1LFWA 3I0SB 2R8IA 5F3ZA 2P9GA 3PRBA 3V81A 3M2UB 5KFGA 1NJYA 3JTNA 1ZM4A 1X9WA 1O5JA 1WWHA 4HT7A 2NYIA 3G9CA 4ZP9A 5KFRA 5U47A 3T9NA 3UFCX 1NO8A 4F3MA 1M5HA 4G3IA 2R7SA 1S1UA 3IGVA 4Y28C 3EZ5A 3PEHA 3I9ZA 3QWUA 2JLFA 4DF8A 2B9YA 5J2MA 4YB1P 2HHWA 1OS5A 4DV0F 5LSRA 1DFDA 2VC0A 2DRAA 4C0BA 1IBKF 1QAJA 2OH2A 1VQ8S 1SJ3P 3QJPA 5A8WB 4TU8A 2CPJA 3NBPA 4NA3A 2QSWA 1IKWA 4GC7A 3SI8A 2OPQA 5L9XA 2I9SA 4NX9A 4DOZA 5F8IA 1G3OA 1H98A 1UP1A 1FNMA 4UUWA 2QYCA 3OTOF 5JUMA 2VBXA 2YKNB 3I0SA 2ZH6A 2NUHA 1R27B 3JTPA 3M2UA 1XBWA 5F0UA 1SXLA 5DDRC 4YFUA 4WFZA 1YTYA 1D8YA 4RU9A 3T3FA 3PW7A 1GH8A 3LP2B 4XK8C 1HWIA 3B8HA 4MIBA 1NZAA 2BW2A 2DHSA 2F9JA 5CCMA 5D6GA 3KLVA 1NJWA 1WEYA 3KLEB 3DLKB 1LQ9A 1X0PA 1VQYA 2KO1A 2GFFA 4PWDB 3U27A 5B0BA 2HHHF 3OLAA 4BS2A 5A8WA 4WU2A 3TP2A 3VTIA 2HLUA 4OZ1A 2DNRA 4FNHA 3M9NB 3SV3A 2NPIA 2P6TA 1ZBTA 2VQEF 2AU0A 3RB4A 2UU9F 1HYSB 4OI4A 1UVJA 3SCIE 4EBDA 2YKMA 2VQFF 1IN0A 3CMES 1C0UB 5KT5A 3OHBA 3KK3B 3G96A 1RI7A 1KVJA 4LF4F 1IUJA 3V6JA 4DQRA 5D4PA 3OR1B 2KFYA 2ZHBA 1J5OB 2LQ5A 4HH1A 2YVSA 3KWMA 4QIEA 2J0XA 3LP2A 2ZZNA 2LYVA 1C2PA 3U1LA 3W7BA 4A8WA 3UDLA 5D3GB 3DLKA 4Y6IA 2J7KA 4R5PB 3BO3A 2AJ0A 3EPGA 2RMLA 4PWUA 4C0OC 1HHTP 3HHNB 3HHDA 2MKHA 5KG3A 3CCRS 4ELVA 2E9RX 5AXLA 1B7FA 4YOEA 2VPWB 2RD5C 2IAJB 3I0RB 4Q43A 2YX4A 3J7YU 4ERDA 4O4RA 2ILZA 3BM7A 4P7TA 1CC7A 3CE8A 4EO6A 5FDLB 4OFZA 4WKYA 4ED6A 5E5NA 1JJ4A 2F4VF 1HYSA 5KAKA 2C28A 3MTKA 2DNOA 4NZ7A 3OUYB 1C0UA 3MR3A 3KK3A 1R0AB 4RBUA 1C0TA 5CZXA 5DLFA 4C8LA 1EETB 3MPWA 4HEA9 4X2BA 3OR1A 3BDEA 2JH3A 1NB7A 1J5OA 1C4CA 5LSOA 1UAWA 3LANA 5C24B 3CGIA 3LH2S 2IHR1 1NK8A 2M88A 4QW9A 1U1QA 4BWJA 3MM5B 1UVLA 5D3GA 5DJBA 4R5PA 2UZAA 4C3LA 1YJUA 4LVNP 2UV8G 3Q24A 2ROEA 2YNIB 3OFEA 4B3MF 1UW4A 2MQLA 1VIXA 3BGFA 3GG1A 3THPA 3I56S 2IAJA 3I0RA 5E33A 1K1SA 1FHTA 5KFSA 5A8RB 1VOMA 4JOUA 1LXJA 3I4PA 3MD3A 4AFFA 1C1BB 2B0GA 2HYIB 1YWXA 2C2DA 2IC3A 3U1NA 1R0AA 1R8BA 1XNQF 4QIVA 4YEAA 2XCPA 1N0VC 3D0HE 5KFYA 3ZZUA 4X64F 3OXLA 1QM9A 4YR2A 3B4MA 5C24A 2UVRA 3NL0A 2XSFA 2ZC3A 1HI0P 1VQMS 4L6V3 3MM5A 1R8AA 1K1QA 2B5JB 3MR6A 2RS2A 1F2GA 3VAGA 1JLCB 3OR2B 2YWFA 3CJ0A 1FEHA 3M2RB 2BM1A 3QMQA 2DTJA 1FNOA 2DNLA 1R8PA 4BC9A 4I64A 1Q7LB 4YP3A 2AX1A 1VQOS 3BGUA 5A8RA 3BN7A 1TV6B 2DGUA 2ZVSA 4EWTA 4F67A 1W2BR 3OHAA 3CVKA 1LWCB 2SXLA 3LGNA 3HJFA 3P6YC 3FEXB 1RTDB 3MM9B 4NYOA 5KG6A 4WYLA 2VA3A 3BEGB 2JC1A 4G1IA 3R1HA 2B3TB 1RYRA 3M8PA 4WFYA 5T14A 1IJFB 2B5JA 3NNCA 4RNFA 1JLCA 4WFNQ 2DHAA 4ECWA 3GV7B 2AYEA 2FJDB 1MU2B 2N4CA 3NMRA 4CTAB 1S0OA 1NRKA 2CQ4A 3LQVA 3VF0B 2VC1A 4HH0A 3HDSA 4F3QA 2RIJA 2WBRA 2KI2A 3MM6B 4Y65A 3TRGA 1BC6A 2W7OA 2YH1A 1TV6A 1QVGR 4R25A 3I6PA 1LWCA 2OTJS 3MM9A 3UD3P 2GCFA 2XZWA 3PR5B 2IM1A 1KONA 1OIAA 4LF6F 2R2UA 2VB6A 4ZP6A 4ED8A 2MMYA 1SH3A 3MTJA 3SSRA 3UPFA 3SCLE 4Y0FA 2PC6A 4FVCA 3WBZA 3A8EA 3OL8A 1S76D 3QGPA 4A8SA 3E01A 2DRBA 2N7YA 4HDGA 5FJ4A 4X65F 1MU2A 4YHHF 1CC8A 5ITHA 4EBEA 4CTAA 3GIJA 2KT5A 2VG7B 2OFHX 1KHVA 3CJ4A 3MM6A 2M5YA 4DL5A 3G4SS 5FLXY 2HNZB 2BBEA 1Z4UA 5D4LA 1KFSA 1VBXA 3N9UC 4RUAA 4D3HA 4DPOA 3T1YF 3QLHB 5IT0A 3FEYB 4HVZA 4OZLA 4XIUA 3V4IA 1YITS 4YY3F 2LU1A 2NUUG 2LA6A 2DIVA 3BO2A 2CQGA 3E3XA 2PGCA 1Q16B 1NK9A 1CPZA 3KOAA 3EGNA 3I31A 5J2PB 1UETA 5KG1A 1K0TA 4F4ZA 1DTQB 2JEGA 3PY8A 5C42B 2ZDOA 5CYMB 5KG2A 1RT1A 1QSLA 5F3TA 1FRIA 2FLOA 2GC8A 1YIJS 2D9PA 5KG4A 3TA2A 5DS7A 3C3LA 4LQ9A 2OIHA 4DLEA 2HNZA 2GHVC 1N0UA 4M95A 4ITSA 2VFUA 2DNKA 4JI1F 1FDNA 4DR4F 2HWTA 3QLHA 1HPZB 4I1TA 1JLAA 2KG1A 2Y0SD 1FJCA 1JIHA 4OX8A 5KFQA 2ZH4A 1A9NB 5D77A 3RZAA 3Q22A 3PX0A 5DG9A 3NS6A 1VQLS 1A6LA 3FVYA 5CCLA 4HDHA 2YX7A 2ZDPA 5KG5A 1P6TA 2OD6A 3ZC4A 5J2PA 2XEXA 2ALZA 4K5SA 1U6FA 4DV1F 2HS3A 2POKA 5C42A 5T41A 4UY85 4IO9Q 1B0PA 2RRNA 2WBMA 4HT5A 4NLOA 3HFKA 2CJQA 4GO7X 2AGQA 4DQPA 2HHXA 4AXJA 3PIOQ 2HHSA 2FVPA 5IWAF 4L72B 3TARA 2FB0A 2WB4A 4Y2IA 2AGOA 5B08A 4JI6F 5AXKA 3BR9A 2C3UA 4X84A 2KTQA 3DI6B 2ZH1A 3OQ2A 2Q6BA 1SL0A 2VV5A 3HHLC 1ZPVA 2XNRA 4YR0A 3H5UA 5T7LA 5L39A 4ECXA 3SQGB 3SCKE 2DGXA 1X5OA 4TY9A 2V4RA 1LV5A 6FDRA 2CJKA 1Y9OA 3HVAA 3PHEA 5SUHA 5EGYA 2HWHA 2NQPA 2HVHA 2UVUA 1JB0C 4LF5F 3GMGA 5GMKa 2O01C 1N56A 1YJVA 4BHQA 4ZCIA 5LJ5Y 1ZYQA 2WSFC 1PO6A 2ZKTA 1WHWA 1RTIB 2J7UA 2HPUA 2D74B 3PKYA 3BGRA 2APOA 1N33F 2GGPB 2D7SA 3TQ1A 2WCXA 3DI6A 4ZCMA 2FGCA 1T05A 1H2VZ 4A8QA 3BGLA 1S79A 1S77D 1BWEA 3N0VA 3S1TA 3NP5A 2N3LA 1GXLA 3DC2A 3NCRA 3B78A 1M5VC 3SQGA 2NXUA 1ZPWX 3OVAA 1U49A 5C25A 2YWHA 4Q2MA 4OHXA 3HI9A 1CVJA 4WE1B 3BSAA 4LF8F 3SFGA 5DLGA 3DMJA 2G13A 1A7GE 2DR8A 1RTIA 3TVKA 2CPEA 4EGLA 2FUG9 2FJBB 4OJHA 1F5BA 3MCSA 4IUFA 4ILMA 4LFCF 2GGPA 5EX0A 2I8EA 2VG6B 2EC0A 2J9DE 3TR5A 2JZ5A 1GAOA 5MAOA 4C3MA 2ZH7A 2UXCF 3IGNA 3DDNA 3MM7B 4IH5A 1ZM3A 3W2VB 1C1CA 5J2QB 4NCGB 2BOPA 1TK5A 1BD6A 4NXNF 1NHVA 3DYAB 3FJ2A 3QGIA 3TOQA 4I2PB 4N41A 2GO9A 4LUBA 4DS4A 4KC5A 2PD1A 4FXVA 3CCSS 1QSYA 3IWLA 5EWEA 2L3MA 2KYXA 1KFDA 3DGPA 2JJ4D 4NLGA 1CSJA 1IKVB 4GC6A 1U09A 1X4CA 3MOZA 1TP7A 4RW4B 2V8GA 4DQIA 2FC9A 2DNHA 4OL8A 4KKOB 3I5BA 3CDBA 2VG6A 2VG5B 4MYTA 4U7UK 2FJVA 5KG0A 1UVNA 1GQEA 3MM7A 1IKYA 2WAQD 5L9NA 4QBUA 2KRBA 5J2QA 2V8HA 4NCGA 2XMKA 2C3MA 5EHHA 4ZVGA 3VQTA 1KOHA 4QW8A 2KG0A 3DYAA 3OSNA 1KLNA 2AJ1A 4A46A 3CJ3A 4Z2XA 4I2PA 1OQ3A 1HBOB 1X4EA 3L3CA 4K0KF 3MURP 2UXBF 2PO4A 3PJWA 2IMOA 2FVRA 3PW0A 2MDAA 3UCUP 4OI0A 2HQ3A 4USHA 2HNDB 1HARA 3M4XA 4PG7A 2MQOA 1VIOA 2AV5A 2KHCA 4NRTA 2YWGA 5KFFA 1IKVA 1JWWA 1SC6A 7FD1A 4TY8B 3VAHA 4B08A 2BV3A 2E1RA 2NSCA 4O3RA 4M5DB 4IQXA 4KRWA 2K8GA 2GO8A 3KNGA 1NKCA 2Q6CA 2VKZG 4QIGA 4ZVFA 4OLPA 3K5PA 5B7WA 5AE2A 3ISNC 2HVZA 2XI3A 3D1OA 3AA8A 2XMVA 1IKXB 2FLLA 2X1AA 4J9KA 5LMNF 1M5SA 1QVFR 3T19A 1U8SA 4KV8B 3THVA 1RTHA 1AW0A 1D9AA 2LLZA 3J7ZT 4I7FB 4X4NA 1X4DA 1Q4RA 4MTPA 2HRUA 2HNDA 3NS5A 2FD2A 1WF2A 2B6AA 4TQSA 4NA1A 2E29A 2O3DA 4C9DA 1KN6A 4PG8A 2RSQA 4MJKA 3CCUS 4F2RA 4TY8A 4RW6B 5KT7A 3H2UB 2HHQA 1V3SA 1SJFA 3DN9A 1XR7A 4G1QB 1U26A 3GFYA 4M5DA 1B0VA 1NH8A 2IBOA 3G71S 4ECYA 2I5JB 5HI7A 5LXYA 1IM4A 5A6WA 1UA0A 3H40A 5E2QA 2PIIA 3O3LA 5SZTA 1REVB 1UFLA 1IKXA 1MW7A 4TN2A 2DGWA 3LUYA 3OW2R 3G8QA 4FF2A 1XMOF 4C8ZA 1H2UX 2G1DA 1HBNB 4KJIA 4D3GA 3JSMB 1LKZA 3JTOA 4USIA 5GAHI 2O5DA 4RW7B 4LJMA 3AJ1A 4OHZA 3GQCA 1WEZA 2RDJA 2B7BB 1OSCA 5F8NA 1SI9A 2NLWA 1JMTA 3PEJA 4K59A 1RGVA 3IAS9 4K50A 1B64A 1U6ZA 3FEZA 3MEEA 4IR9A 5A0YA 1CQMA 2IM3A 1V3RA 4G1QA 3GR0A 4PRFA 5GAEI 3CCMS 3VAKA 4J9NA 2EI5A 2I5JA 2LDYA 4B9NA 3HHKA 2COLA 1L3SA