1TZ0A

Crystal structure of putative antibiotic biosythesis monooxygenase from bacillus cereus
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
108
structure length
108
Chain Sequence
GYMFIETKTFTVKEGTSNIVVERFTGEGIIEKFEGFIDLSVLVKKVRRGDEEVVVMIRWESEEAWKNWETSEEHLAGHRAGRGKPKPDHIINVDHAVYYVKSSKAAYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein
publication title Crystal Structure of Hypothetical Protein APC24875 from Bacillus cereus
rcsb
source organism Bacillus cereus atcc 14579
molecule tags Structural genomics, unknown function
total genus 20
structure length 108
sequence length 108
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2004-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03992 ABM Antibiotic biosynthesis monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1tz0A00
1FVSA 4HL9A 1GXUA 2FB0A 1WD6A 2BUNA 3TOQA 3WDOA 4U9RA 4EFAC 5KAKA 1URRA 2OP5A 3BN7A 1FEEA 3GZ7A 2ACYA 2W4CA 3IWLA 2HLTA 1YRXA 3VTIA 2HFOA 2KKHA 2LXFA 1YJRA 2OD4A 4OJGA 1KVIA 2N4CA 2VH7A 1CC8A 1P8GA 1N5TA 1OQ3A 3HDSA 5B0EA 4FNIA 4Q2MA 1S6UA 1APSA 2LDIA 1FE0A 2RU9A 4OJ3A 1TUVA 1OSDA 5F0UA 1KQKA 2N7YA 1K0VA 2W4DA 1X0PA 3FMBA 2XMMA 2GCFA 3MZIA 1Q4RA 1Q8BA 2HLUA 2EW9A 3E8OA 2XMKA 3LO3A 4DN9A 1FE4A 2KYZA 1Y0HA 1P6TA 1JK9B 2K1RA 1Y9OA 1OQ6A 1KVJA 1N5QA 2K7KA 2OAUA 2XMVA 4NL5A 1OPZA 3IWXA 2HQIA 5A6WA 4HI1A 1S6OA 2JDJA 5B0CA 4Y2KA 4DPOA 1TL5A 1U7LA 2PGCA 2XMUA 3BB5A 3LGMA 4NPOA 3KKFA 5B0AA 1VQSA 1SB6A 2ROEA 3BF4A 2N4DA 5A6PA 4Y2IA 3BR8A 2GFFA 1CC7A 4F67A 1AFJA 2XMTA 3HFKA 1FD8A 2G9OA 3BGUA 2VV5A 1TZ0A 2ROGA 5T7LB 2KT2A 2ZDPA 5T7LA 3BDEA 1MWYA 2AJ0A 2BJEA 4HH0A 4YEAA 3TNVA 1JWWA 3F44A 3DCAA 2GV1A 3HX9A 3I9ZA 3FRYA 5B0DA 3CJKB 2QLXA 2QIFA 2KT3A 1N5SA 2QLWA 4YDXA 3CJKA 1YJUA 2BJDA 3MCSA 2RSQA 4QOTA 4A47A 1TR0A 1YJVA 2PD1A 2L3MA 3HF5A 3HHLB 1FESA 1Q53A 2CRLA 2XMWA 4OJ1A 3HHLA 4ZA1A 2GGPB 1SQEA 4Y2MA 1IUJA 1R6YA 1X7VA 3QGPA 5K9FA 1QUPA 2GGPA 2K2PA 3KNGA 1CPZA 4HI2A 3TRGA 5B0BA 1AFIA 1TL4A 2AW0A 2ZDOA 2XMJA 2K7JA 2ROPA 1V3ZA 2IFXA 2LQ9A 1X8DA 2OFGX 5B0FA 5F0WA 2AJ1A 1RJJA 2ASYA 2GO8A 1AW0A 3FGVA 5IXUA 2OMOA 3DXSX 3KG0A 4ZOSA 4A48A 4A4JA 1MWZA 4Q2LA 2FHMA 1XBWA 1Y3JA 2OD6A 2FIUA 2OKQA 2RMLA 2IYGA 3HHLC 1Q8LA 2QYCA 2HFNA 2HIQA 3T9NA 2BBEA 3HHLD 2GA7A 3KG1A 2AP6A 2OFHX 4OJHA 5B08A 3QMQA 4FNHA 3UDCA 4A46A 1VQYA 1FVQA 5B09A 1N5VA 3K7RA 4OIXA 1Y3KA 1SI9A 2W4PA 4HH1A 2BYCA 1YJTA 2FTRA 2RILA 1GXTA 1LQ9A 3LGNA 2IYIA 2K1RB 2LQBA 1YG0A 2Q3PA 5B0GA 3BM7A 1ULRA 4DL0C 1W2IA
chains in the Genus database with same CATH superfamily
3B54A 4TY9A 1TAUA 5HI7A 4RW7B 4AE5A 5F3ZA 1BD6A 4OHVA 3K58A 1LFWA 2VBWA 2ZHOA 4E8UA 2XYHB 4C11B 2I0XA 5K14A 1NMEB 2XMKA 2PEBA 3CJQA 4QYRA 3QBCA 1S1XB 4DI6A 4PPZA 2D74B 3DDKA 4DL7A 4ITSA 2ZC3A 5L9NA 1GTHA 2W2MP 5KFXA 4EEYA 2IM3A 5KFKA 1RWOB 3MMCB 4FXDA 1RWNB 4WU3A 5EX0A 2PMWA 4MKVA 1BQMB 4YHHF 5ETPA 1R6YA 4J9PA 3PDNA 4GKJF 5L46A 4F4ZA 2RKIB 1L3VA 2F3JA 4JI1F 1D09B 1AZSB 3TUIC 3HHLC 4PG8A 1M5KC 2M2BA 3RU0A 1VK8A 1Q8KA 4AL6A 5E3RA 1Y3KA 2HNZA 1ZAWA 3I9V9 3WDOA 3DRRA 2IC3A 2LQ8A 5KFOA 3NMRA 4ED3A 1KDNA 3HHDA 3VHQA 3CO9A 2RB7A 2HURA 3G87A 3D7SB 2C2RA 5L1JA 1KQKA 3N5BA 2RAQA 5GADU 4DPTA 1C1BB 3CVKA 4NLDA 2W9BB 4JYAF 5BYRA 2XTJP 3FBEA 5KFMA 3CSKA 3CF5Q 2JEIA 2ZUGA 2RDJA 3BDEA 4M63A 4O3NA 3SV4A 3JTOA 1U1MA 1HD1A 5DDOC 3VZHA 1TK0A 2WB4A 4IYQA 5C25B 1RISA 1U02A 3AA8A 1TVRB 1IVZA 4NLRA 2MQNA 2I6WA 2IA0A 1MMDA 4MK8A 5CA5A 1D9FA 2VC0A 2NREA 3UN3A 3ZTPA 4MFBB 2BJ9A 3QJPA 4J91A 2RRNA 1SC4B 1EETA 4LFAF 1M5PC 2L41A 1U1PA 1MW7A 4CNYA 1XNRJ 5H9FJ 3LAMA 3HM9A 3GFHA 3VAHA 1VISA 3GR0A 4R5PA 4P72A 4JI6F 4TY8B 5KT2A 3BH6B 2ZE2B 3P49B 2GJ2A 1QSYA 1RDRA 2WRMA 3VR1A 5KFHA 5DGBA 4JI3J 4NYOA 3KOAA 1ZM9A 3D4JA 3AXMA 1AUDA 1RT5A 2HHXA 2XO7A 2Y1IA 3P96A 4L3NA 2VA2A 1X4BA 5H9EK 3A12A 2GGPA 4ZJQA 2HGMA 3TA2A 3HKZD 4I69A 2HG4A 4RO0A 2AGOA 2ABYA 4N76A 2P9CA 2EFOA 2J9EA 1JLGA 2WAQD 5LL6d 2E7WA 3LP2B 4JV5F 1QJHA 1U8WA 4R0JA 5H9FK 2BEFA 4PPDA 4FZVA 4ED2A 4LRBA 3LWMA 1FKAF 2HLTA 1T3OA 5IQ6A 1H73A 1WHXA 2RRBA 3HVRA 3EZOA 1S6UA 2ERRA 2NXUA 2M7SA 3UN2A 1AB8A 1NJYA 2W1BA 1LWCA 5HBMB 4F2SA 1XMQF 2BRLA 4C8ZA 2QG9B 4LF6J 3BF4A 4O3QA 3T1YF 1U6BA 1YBTA 4B3SF 1NJXA 1R27B 3QFHA 3OFEA 3V4IB 3MPYA 2VPWB 4NXNJ 1U1QA 1S6QA 4P2SA 4DLGA 5BYQA 2JLFA 2M5YA 3RRKA 1A0OB 3HHLB 3VGSA 4C9DA 4ZCLA 3R7BB 3AH6A 2CDRB 3CCUS 4DV6J 2AJ2A 1RHQB 1HNVA 1FWKA 2QEXS 1CULA 2YNFA 4IOAQ 3HULA 1YWXA 3NKYA 5KFIA 3US5A 3DMJB 3UWTA 4EO8A 1RACB 1H2TZ 4MK9A 5A8WA 1WOSA 3TVKA 4HT7A 4EYHB 4ECWA 3DLEA 4CH7A 1S72S 4DQQA 4N8OA 1WTBA 5GMEA 4GMKA 2VFRA 1F6TA 2OAUA 1S6PA 3T9ZA 5KFFA 3AA9A 1T03A 2FJWA 2G0CA 5FD1A 5GAHU 3SCJE 2HHPA 2FVQA 3A8KA 1X5PA 5EHHA 4DV1F 2VIHA 3C16A 1P27B 4LFBJ 4R25A 1RAHB 3H5UA 5RUBA 3NOCA 2B8QA 1SUQA 3OJSA 4LF4J 1RT6B 3DNCA 5CD4A 3RW6A 4HT5A 1N32J 2B7BB 5L38A 1B4SA 2U2FA 5F8GA 1N5YA 1KOOA 3V4MA 2B0GA 3KJQB 3BZQA 1RAFB 1RWXB 4KE5A 4HR2A 2DGUA 1GMUA 1BXNA 4UOCA 4W4MA 1VHIA 4I2PB 3LW5C 3MEGB 4KO0A 1F5CA 5I3UB 1S9EA 1A6LA 5KT7A 3OTOF 3MR6A 2X7IA 2HHQA 1QVGR 3M1VA 4G3IA 2DR5A 5I4MA 4H4MB 2C3OA 2YPZA 5E3CA 1RTHB 4GVBB 3CJ5A 3G6ES 5LSLA 3MEDB 4PXDA 4KTQA 1NJZA 1RTJA 1KHVA 2RDIA 2FJDB 2V69A 1RCOB 1WKJA 4LF2A 3TA0A 3WX4A 4F50A 4WFNQ 2ZNYA 3R8YA 1GQEA 2VF3A 1KTQA 1RT5B 5HROA 3OBIA 4IKAA 2ZH1A 3RAMA 2CJ9A 4ATNA 4OHYA 4OYBA 1DURA 5H1SV 4DSFA 1ZTTA 4JI0J 3MM7B 4DR6F 5F9LA 2DNPA 2GS8A 2OD4A 2D69A 4N41A 4DX7A 5IC4B 3UCUP 4Y28C 1IWGA 3TJ9A 1NJIT 1HNXF 4NLPA 4W98A 1Q82T 2O67A 2F4VF 1VRTA 3PRBA 1N34J 5J2QB 4GC7A 3OTBA 4CI0B 1YJ7A 2DO0A 5CCMA 1WDTA 3HSJA 2APOA 1HNWF 2XMUA 1SQGA 3J80U 3DRPA 1DZ5A 1DTQB 4USUA 2D1CA 2O66A 4HH0A 3CTRA 3O3LA 2Z56B 3F44A 4K0KF 2J0XA 2DT9A 1EQMA 3H7HB 5CYMA 2NUUG 2BJ8A 3TWZA 4QR2A 3BGFA 3QJJA 3TRGA 4NXMJ 4HHHA 1DHMA 1N0UA 2OHDA 1NSPA 4MK7A 1U49A 2XSJA 4WXWA 5LMNF 2KVIA 4LRFA 3JXOA 1TL1B 3T19A 3W5YA 2IYIA 4KHPJ 2FVCA 4OYMA 1RXOB 2HK3A 1NZ8A 2CQPA 3B82A 3CUNA 2HIYA 3TEGA 1YZ6A 3CDWA 4F8RA 1PJ5A 4HTIA 2YX7A 4OZNA 2GAGC 3KLGA 1F3VA 4UZBA 1WUUA 2CZ4A 2DNRA 2Z2ZA 2UUAF 1RTZA 5A8WB 2W9AA 1VOMA 1Q79A 3TZZA 1WSRA 2GMJA 4PWDA 2CJBA 5FDLB 4X65F 3PFEA 3P8BB 1SB6A 2Q6BA 1N36J 3PVXA 4DCOB 4OZ0A 4LF9J 4KR0B 1GNKA 1O6XA 1S0VA 4QU6A 2YTCA 2UVUA 4PQAA 2DR6A 1RLDA 3IG1B 1FRMA 2B9EA 4ECTA 3E01A 3RAXA 2KJWA 1YJVA 1N4LA 3RJMB 2FVRA 4NLYA 2VDHA 1R8PA 1R8CA 3FZ2A 3IR5B 4DV0F 4U6PA 1ZZNA 3BBBA 3GP9A 2YWFA 5CXTA 2V67A 3SQGB 1KKHA 2L08A 2DO4A 2U1AA 5CCLA 3CMES 3NG8A 4OHZA 2RF2A 5B0GA 3DLKB 1VQ9S 1YRXA 4F4WA 4GKKJ 1UFWA 4JI7J 3PRVA 2MSTA 4ZPBA 3TYTA 4ZN1A 2Y9HA 4FF3A 2D7SA 4O44A 2J6SA 4XDDA 5ETSA 4NLTA 3THTA 2KHDA 4DSKA 2JVOA 2AMCB 1T95A 4OI6A 4CQ1A 2ZBIA 4K4SA 3BH7B 1BQNB 3PR5B 1GX5A 5M2UA 4FYWB 3FRYA 1WEXA 4M5DB 1MN7A 4F4XA 1NB2A 4K50A 1DTTA 4KKOA 5FJ4A 1EAYC 2KT5A 4B9UA 3LGHA 3T9NA 3TX0A 2OJ3A 2MPUA 1MSWD 4CRJA 3DLHA 3GFXA 4FNHA 3G6XA 1HPZA 5LT5A 1WACA 5LJ5Y 2K1RB 4URSA 4IR9A 2OPPA 3CD6S 3B4MA 4OZ5A 4ICLA 3GMGA 1FF2A 2B4UA 5ETQA 1BC6A 5J2PB 4CLSA 1EJ7L 4CO0A 5GMKa 2RU9A 4LF5F 3FNNA 2YKMB 5K8NA 3BS9A 2V4JA 2JFDA 3FBCA 1LOUA 2V8PA 4ELTA 1RTIB 1Y0HA 4DPYA 4PYDA 2C2NA 5A6WA 2VOPA 1VRUA 2OPQA 4LQ3A 4DZDA 3HCXA 1MWQA 1IBCB 3H5XA 4ECSA 3HD1A 3CJKB 3BSAA 2QLXA 3NRBA 3QNWB 2CRLA 2HZCA 4X66J 3W61A 2GVDA 3OLAA 3X1LB 3KNGA 1U24A 3M2UB 1QDUB 3VQSA 3QSIA 1IBKF 5IS2A 3GIMA 2RMLA 4LR9A 1IKVA 3L4BC 1HBNA 3D6TB 1U0SA 4A46A 1XR5A 1UZDA 2RILA 2V8GA 2M8DB 1CVJA 5HK4A 2ZM6J 4DL0C 2MY8A 4DQSA 2JHEA 4CTAA 5J1EB 4Y00A 2XSJB 1SKRA 2VH7A 3Q8QB 1YHQS 3A3NB 2WVBA 4ZVFA 1YDLA 2XWXA 4ZP7A 3J7ZT 4LBPA 3KUHA 4CLUA 2FJVA 2DK2A 4P7VA 2ZC4A 1T9TA 3ISND 1SL2A 2C2KB 3GG1A 1OQ6A 4AT1B 1H7WA 2PA3A 2Y1LB 1U2RA 3KTQA 4AXJA 3IBCB 1WKKA 1FWPA 3MM6B 4A8KA 1FERA 3PM9A 4V19X 4LRCA 3AJ1A 5DDQC 4O3OA 5T7LB 3KLVA 4OX8A 2H9ZA 3LPEA 1UVNA 3TR5A 4KPYA 4J9QA 2M4MA 3LALA 4FYDA 4O0NA 2RHQB 1PAEX 1KS2A 3PW7A 1UWBA 1WTFA 2OPSA 2PI4A 1BGXT 2LXUA 2GQCA 1YLXA 5F0WA 1UVIA 4M8LA 2DPIA 4C48A 3VALA 4ECUA 1HKAA 4N47A 3TI0A 3KG1A 4F2RA 2YQ3A 3IWNC 3OL8A 1S1UA 2VKZG 1B64A 2WVDA 3BM7A 2IDEA 4L73A 4KJIA 1NLKL 5C7PA 2BX6A 1X4GA 1Q5VA 3O8WA 3LP0B 1JKHA 1T9YA 3HJFA 3I5AA 2DEIA 3K89A 1VQ5S 1V5VA 3MR2A 3ZZTA 2RF2B 4QIWD 3EDRB 2Z57B 4KGVB 5KFCA 2ILYA 3P45B 4NLVA 2FHOB 1SKUB 3VGUA 3H59A 2I8EA 2AIRB 1Y5IB 4NRTA 1SJFA 1G3OA 1J5OB 3QZ8A 2VB6A 2QIFA 1N5SA 2DPJA 2DBBA 2WSFC 4OZ2A 1YRTA 3KJVB 4QR0A 5KFRA 1OJ4A 4DV5J 3OR2A 4CWBA 2Y1JA 1AW0A 1MG7A 1UA1A 2EFPA 3SIPB 1JNRB 2X3GA 3BPSP 1F2HA 2BBEA 3EE3A 1DQAA 3RR8A 2MSSA 1JLFB 1ZS6A 3PIOQ 5A0YB 4CT8A 3L9ZA 3CCES 2YQ1A 4BC9A 1DTTB 2HZAA 5CAAA 3DOKB 4M5LA 4UOFA 3CJRA 1Y5LB 1HPZB 3RR7A 2MZ1A 5CYQB 3DRSA 1GT8A 3UFCX 2ZOGA 3A8EA 2HS0A 4RW9A 3AOAA 1C4CA 5HATA 1PCAA 1LXJA 3JQKA 2J7WA 1IKWA 3LGMA 4ZCIA 5K8PA 1BLUA 1Q7LB 1GAOA 3I4HX 2DTJA 5IT9U 2UXBJ 2P9GA 2HFSA 3OL9A 2NPFA 2JC0A 3DHXA 4EMDA 3U1NA 1NHKL 3MPVA 1HLWA 3R9LA 4DFKA 1IKXB 1P1TA 2BXJA 1RTDA 4H54A 2CQGA 2HRYA 2DNHA 3TAPA 2GVDB 4OYIA 5LM7E 5B08A 2ASDA 5AE1A 2JL9A 1SJRA 3DYAA 3U27A 3WQPA 4O3SA 4B9VA 4PWUA 4DQRA 2YKOA 2EVZA 2YNIA 4C7QA 2QYGA 2AJFE 1IJEB 5KOWA 4I6YA 1EP4B 1FKOB 2ATCB 3I0SA 2CG8A 1MROA 5C2GA 8RUCA 3ZTQA 1O0PA 4A8OA 1FJGF 1NJWA 3N01A 4URQU 1TTHB 3R5DA 2RVJA 1BWVA 2Q1LA 1CLFA 3MOZA 4HEA9 4IOBA 3BEGB 4P52A 3W8PA 4MTPA 4A8SA 3NBPA 2GQ2A 5IT0A 3T1HF 4OZ3A 3CCZA 1S9GA 4ENOA 2NXJA 1KQFB 3IS9A 3WC2A 1Z4UA 1NO8A 2R8KA 3BV8A 3N6NA 4EWTA 4CP5A 3NGRA 1S99A 3LWLA 1TKXB 4ZVQB 3OV7A 3M8SA 2HIQA 4ZN3A 4LFCF 4NEYA 4KGMA 3IBFB 2A2DA 4LSNB 2DRBA 2CWKA 1Q81T 2HRTA 3H42A 4JV1A 3CT9A 4JI4J 4M5KA 2IJFA 1ITPA 3UD4P 3PO4A 4ED0A 5KOXA 1HL6A 3DXBA 4X62J 4FN5A 3H4BA 7FD1A 2R8JA 2P6SA 2XYGB 3HSZA 4DV7F 2MJNA 2KFYA 1RT3B 2EW9A 2IMOA 2HFUA 3TQ1A 5DG7A 3C6TB 2VG7A 3QGGA 2DR9A 3OVSA 2DNMA 4ZHRB 3CCLS 2AF6A 1HWUA 3D28A 2HHUA 5M2RA 4RU2A 2F5GA 3DHWC 2B5JA 3ET6A 1KLNA 4DR5F 3QGPA 2EPIA 3TW0A 3CJ0A 3Q8SB 4J9MA 2HNYA 4J90A 1LNQA 3DLLQ 4YOEA 4LR8A 3JTPA 1C0TB 4UT4A 2G2ZA 2H4YB 3NLCA 1KLMB 4JI5F 3PJ9A 3HKWA 3L7UA 2N3OA 2BM0A 4GRSA 4H4OA 4WK1A 1U6FA 2KH9A 3I55S 4KB7A 1FKPB 3IGVA 5D4NA 2XULA 2BKPA 2CAJA 2VG5A 5DGAA 2JX2A 3D1HA 1KP6A 4RUCA 3OTCA 3NS6A 3GJRB 1GH8A 3MECB 4WZMA 3M8PB 4PKDB 1ZBTA 5L9XA 3WZ0A 2E1MC 1UFLA 5IV3A 1WF2A 2KRBA 2LCWA 2CZ9A 5K20B 4GKJJ 4Q8FA 4DV2F 2FVPA 4N5SA 4JI1J 3IGNA 2CXEA 3L95X 4HDHA 2ZJPQ 3DRSB 3PZPA 2F8EX 3LPYA 1UAWA 1PC4A 4RW9B 4NA2A 2BQ3A 2MKCA 4EO6A 3AB2B 1HBMA 2AEMA 4DF4A 2EG1A 3MFHA 1J27A 2WOMB 2J7UA 4DQIA 2BKNA 2RS8A 1GX6A 1JLEB 2HFZA 2ZOMA 5KFLA 3TJAA 1R0CB 2AW0A 1TELA 1X8DA 2J6TA 4J9RA 2DIUA 3KLEB 3B8HA 5F8IA 4M1KA 1FXLA 5DQGA 4FBTA 4RW8A 5EX3A 4JYAJ 4Q7AA 1DFDA 1MLAA 4YB6A 5DDPC 3DRYA 3I0RA 1YI2S 2RS2A 1NK7A 5IT9Y 1VHFA 4DJBA 3CW2C 1OIAA 2PO4A 3GILA 3CGIA 3KLIB 2WZ1A 2MEWA 1HI1A 4JB8B 3VVUA 1I5OB 3D0GE 4DG1A 1KTVA 1X31C 2MGZA 3UW1A 3MUTP 1AFJA 3GV7B 4HHJA 4OZ1A 4LFAJ 4ELUA 2FJXA 2NLWA 2FD2A 4IH6A 3H40A 3MCSA 4EBDA 2OELA 1NK8A 3MMBA 5K5MA 3DU6A 3MAHA 4IOCQ 3FKBA 2WK4A 2CVIA 4CO3A 2XY5A 4JI6J 1DLOB 3AD7C 2O5DA 2R9LA 2AD9A 2VBXA 1FTCA 4OJHA 3EXYA 3T5KA 3M7VA 2BYCA 1R7IA 5HVGA 4ILMA 1Y00A 4CYUB 2QV6A 1JLQA 4KFBA 2CUYA 5KFEA 2LFVA 5I3QA 2D9PA 3FMBA 1TMJA 2XMMA 3IM9A 4D3GA 1VYAA 3N9UC 2FGCA 3HXMA 4CH0S 3BYPA 1U2CA 2IRXA 2QX0A 2W8KA 2Z8QA 3QWPA 5IT4A 4CO2A 3LF0A 4JV5J 2HQFA 1QM9A 1UA0A 3VF0B 4QYZK 2KYXA 4C4WA 1SQEA 2GVZA 1HR0F 2ZH3A 2V63A 4HYKA 2M88A 3JYTA 5KG2A 5J1NA 2YNGB 2OMOA 3D54A 2V9WA 3ZC4A 6FDRA 3Q8RB 3UR0A 4ZPVR 2YKAA 4CLKA 1IR1A 3A4TA 3F56A 1XMQJ 5KFGA 5EWEA 4DPUA 4WP8A 2LQBA 1M5OC 1S97A 1FXRA 2DYAA 4USVA 3T1YJ 4PXCA 4U9RA 2BA9A 4B3SJ 1RWVB 2E5IA 1TQLA 3PKYA 2MTLA 2J5AA 2J0QD 3QGHA 4G1IA 4WZQA 2Q43A 2VG5B 4ED1A 2PT0A 4K4ZA 2GNKA 3IP0A 1P6TA 3GFYA 2MQPA 4ALZA 2XB2D 3M4XA 1R3NA 1XERA 1NBEB 3FCVA 2A10A 2QA4G 4M5MA 1UVKA 1REGX 4KAIA 4JI2F 1JJCB 2UV8A 3Q86A 2HMIB 5D4PA 3FEXB 4OYPA 1LW0B 4GO7X 3B78A 2FY8A 3KNAA 3FJ2A 1RKIA 2K7JA 3KJFB 3OT9A 3SDEA 2GO8A 5AXKA 1Q78A 4ZOSA 4QQBA 1W25A 1WF0A 2WB1D 1HMVA 4QIGA 3THVA 3PJXA 1S4EA 1UVMA 2ALYB 3TOQA 1RU2A 4DV1J 3D66A 5E0OA 3CJ4A 3W63A 2F9DA 3K57A 2ZH6A 4MKAA 2BW7A 4DFPA 5KT4A 2HHHF 3HT0A 2CQDA 3SXLA 1JK9B 1I6JA 1WG4A 3I0RB 3LQVA 1C2PA 4QWDA 3W7BA 3BREA 2MY7A 3U1MA 2H3EB 3DLGB 3H4DA 5B0AA 1Q5YA 3LA0A 2LYVA 4Y2IA 5KT5A 3QT7A 3BGUA 5CZXA 3T6BA 4IO1A 3QIPA 2JLGA 4O4GB 1SL1A 1JB0C 1PILA 5DRKA 4AQYF 1U1NA 1M5VC 3N6MA 4IFYA 4QBUA 1TL4A 5L1KA 3AQPA 2BJ7A 2F8MA 2FC8A 5LSOA 1MWZA 3KLHB 3IO1A 4NZ6A 5HVFA 1X4DA 2VG6A 4TU7A 3OTOJ 4ES1A 2HW3A 3GLJA 2RD5C 4ZMMA 3G2XA 3RBXA 4TLQA 3TUZC 2HK2A 3MHYA 3NL0A 1HD0A 4KH0B 5D78A 3MM8A 1CJTA 2GHVC 3CCVS 4RZRA 2EXUA 1F2GA 2HHVA 3FC9A 2QFJA 4WIIA 2DNZA 4P10A 1TV6B 2EKNA 3SCLE 1X5TA 5G0RA 4LF8F 1P9QC 1VIOA 1H3DA 3BQ1A 4KFBB 3GCWP 3QJLA 2PGCA 4L3KA 4DL3A 2ROEA 3DGPA 2ZWOA 1FX2A 2G9OA 3Q83A 1L3SA 4C3LA 1CG2A 1I94J 3C6UB 4LVOP 1L3KA 4NZ0A 4M5GA 1LKZA 4DR6J 4J9KA 3MTJA 1UW9A 2O1PA 2DNKA 1WHYA 2FLLA 4RR5A 4ECZA 1TL7A 2LQ9A 4F26A 1HNXJ 1QAYA 4WPAA 2F4VJ 5A8KA 3I5BA 3DC2A 4EI2A 1VQYA 2VFSA 2ZFHA 4RWWA 4WFBQ 1HNWJ 3IR7B 2HAIA 3PG9A 4NMLA 3ULHA 2WVEA 2H4WB 4DUTA 4ANEA 2K06A 7AT1B 4QIVA 1OO0B 1M0SA 1F5BA 3G6YA 4KV8B 1HNIB 3KG4A 1T7PA 4K0KJ 3ZTRA 2B9XA 4IG0B 5HQ8A 4IFVA 1I1GA 4LSLA 1QTNB 1AROP 5EWGA 2ZOFA 1H74A 5J1PA 3T5LA 3WHIA 2B56A 3HVTA 2VFUA 1JLCA 4DUYF 4I2QB 2V68A 3BBCA 3MR3A 4XPCA 3QYYA 5LMNJ 3AD8C 2QMUB 2CPFA 4DOZA 4ZPCA 2UUTA 2HQDA 3EICA 4PG7A 5A8RB 5JXSA 4FDFA 2HVZA 4IRKA 1S1TA 1T05A 3R5CA 5KFDA 1O8BA 2JFKA 4KGZB 2DY1A 4Q5VA 3A8JA 5MAOA 1FA0A 3DOLA 2UUAJ 4DWIA 3DXSX 1HIYA 4RW6A 2CJKA 4X65J 2J8AA 1SH3A 2CZVC 1S1WB 1FHTA 3TO8A 3SDEB 4MIAA 1AA1B 2E5GA 1HHSA 1LFPA 1RE1B 4USWA 1UJ6A 2Y0BB 5DO2A 4ZCMA 2POKA 1NPPA 1CSJA 2BW2A 1U0HB 4DV0J 1D3WA 1VS3A 2IPOB 3ENVA 4X4TA 3VAIA 1CJKA 1XIQA 4Y2KA 3TA1A 4DPOA 4DV3F 1S59A 2RE1A 1UZHA 1VQSA 4B9SA 3ZZ0A 3OFFA 2HQCA 3OR1A 2DR7A 3UD5A 4MIWA 3QT8A 3K5NA 4CH1A 3NXZA 3KYLA 4ZA1A 4YFUA 1BQXA 3U7JA 3MPDA 3O1LA 5A76A 2IAJA 3OVBA 1HBUA 1S4FA 4YY3F 2KDOA 4TXSA 1VQ8S 4P2MA 1SCJB 4P2XA 3POTB 4TQSA 5T14A 1RAIB 3SFGA 5HVHA 1U48A 1CS4B 3W8GA 1YIJS 4OI1A 4U67Q 5KFZA 5E3PA 3K0JA 3OL6A 2V2VA 4ZVSB 1TKZB 1T8EA 4DN9A 2AYMA 4UY85 3TAMB 4E0DA 1YSJA 3UPFA 1OMSA 4X64F 2WW8A 3M9OB 1SL0A 5EDWA 3A1YG 2DR8A 1IQTA 1ROFA 2IBKA 1N56A 4OYWA 3D6HB 3OSNA 2J6UA 2QLWA 2E7XA 4WYLA 3CCSS 1RZMA 4OJ1A 1S10A 3DN9A 1JJHA 1RT4B 2B9WA 5D8HB 1LWEB 4LF5J 1E6VA 3F73A 1RJJA 5KFSA 4NYPA 3W2VA 3M2VA 1VDHA 4ZP6A 2B9YA 5LMUF 2AX0A 3LANA 2G2YA 3SSRA 1LQ9A 4HACA 4NCGA 3RGIA 5HL7Q 3UR3C 1RT1B 1WKLA 3KK3A 1FDNA 1QSLA 1HW9A 2ZH9A 1N5TA 1FCAA 1SV5A 3I82A 2SXLA 4OJ3A 2XS7A 3ZNUA 2HWIA 5C24B 3TVZA 4DEZA 1Y9OA 2R2UA 2W7OA 4U8VA 1IBKJ 1QE1B 4RBTA 5JVGQ 4EYIB 3MOJB 2YXLA 2HGLA 5GVQA 2BRKA 2P9EA 2OEJA 3HP6A 2ROGA 1N33F 3HX9A 4USMA 3FFIB 1ZM4A 1YJUA 4C8MA 4QWCA 4JV0A 2GJIA 1Q53A 3K5MA 3MTKA 3MD3A 3L7OA 2Z4PA 5KG7A 1H72C 5F8HA 3H2UB 2AJ1A 3SZ2A 1T9VA 5B7WA 4IRCA 5KFVA 5E3AA 4M5IA 2JLEA 3V6HA 3AJ2A 1FRHA 1XNQF 1DARA 2ZHBA 2WCXA 5IV4A 1T0TV 5DG9A 2XY7A 2VPZB 3NS5A 1S1VA 1CC8A 1E6YA 2D3ZA 3PRDA 4CO5A 4IUFA 2BOAA 4YB7A 4RUAA 4ECXA 2N7CA 4OHWA 4I56A 4M5NA 4BC7A 3U02A 1U7LA 1FFSB 3I32A 5IOLA 3BGRA 4RBVA 4L6V3 1LWFA 1YRUA 4F67A 5ETMA 5HMXA 4ECRA 5HANA 4QIFA 3CD0A 1RHKB 5KG3A 3EPGA 2KT3A 3V2UC 4DL4A 3B6BA 1DAXA 2R4FA 4C0OC 1UKUA 2WW4A 1SJ1A 1TKTA 2EKYA 2DH7A 2ZD1B 3W5XA 2HVEA 3T5JA 3NNCA 5IZHA 2ASYA 1FJCA 4EGLA 4KHRA 5KG4A 4O0IA 2VL1A 2HVDA 2WONB 2EFGA 4CLYA 4WTOB 2CQ2A 2ZBRA 5BXIA 2M52A 2W2OP 1RAEB 2V50A 1JLAB 2DNNA 2ZH8A 1LW2A 1OQ3A 2MQMA 1CJUB 1FNOA 2UVVA 2AHOB 3DM2B 4KRWA 3P5TL 3NMAA 2VC1A 2ATLA 2DGOA 4O23A 2OI2A 4FS1A 1S6OA 3OUYA 4L76A 4LT6A 1RAOA 2GZOA 4P73A 2JEFA 4WU2A 3Q24A 3JSYA 1KBRA 5J2NB 2R7TA 3C15B 4QOTA 4JOUA 1VRQC 5L1LA 2ZH4A 1KHWA 4FXVA 5I42B 1NDCA 2ADBA 2W9CB 4P71A 5JMNA 3GIKA 4MIBA 3FGVA 4WWSA 4BWMA 1RSCA 1C1CB 2AJQA 2W7PA 2IM1A 2CNLB 3EVOA 4YR3A 4ZIVA 2LQJA 2EC2A 2QLJB 1C0UA 3GG0A 4UOGA 2FC9A 2M8HA 3EDQB 1P9YA 3V6JA 1K1QA 4OV1A 2B6AA 2PE8A 4OLOA 3VAJA 1X9SA 2R2RA 3TZXA 4WFZA 3KJNB 1R89A 3EYZA 5ADZA 2HNDA 2DH8A 2K7KA 3N79A 1OYEA 4ID8A 5MLCV 4OI3A 1RK8A 3BB5A 3KK2B 3FQLA 5HLFB 2N4DA 4JP8A 3MEEA 5C42A 2NPIA 1FI4A 4LVNP 4U7UK 2DY9A 1VIXA 2DH9A 3SEOA 2M9KA 5DQHA 2QA1A 4XK8C 4V1Ak 3BQ0A 4X2BA 3TANA 1HQEB 2XO6A 1WC0A 2IDLA 2NSBA 1VK3A 3OXFA 4IDKA 2FHMA 1RHMB 3JQMA 2KRRA 1GK8A 1FJGJ 3W2WB 4WKYA 1NHVA 5C5JA 3BKFA 4G1QB 1DBDA 4UY8T 2NQPA 2MB0B 1L3TA 3FCWA 2HWHA 2VQEF 3CULA 3T1HJ 4RW4B 2LVWA 2IRUA 2B43A 3D3BJ 3WIUA 2AKWB 2FJEB 2C2EA 2UUBF 3KLFB 4MH8A 3UNYA 3EWGA 3PHEA 1HHQA 2V8DA 3EUNA 3HHNB 3C14A 3IRXA 2ASLA 5DM6Q 4KHMA 1U1LA 2I5JA 1HHTP 3SYZA 4LFCJ 3P6YC 1L5UA 1Q8IA 2E44A 2CNOB 1K8AT 4PQUB 5KTQA 2H65B 3KK1B 2CQIA 4HKQA 3DI6A 2QL5B 1RT2A 2EK6A 1CJVA 1WC4A 5K9FA 2IIHA 1D1UA 1XEZA 1YVFA 7FDRA 3G96A 2Z0GA 5KFUA 4DV7J 2V6AA 5EN1A 4C2MA 4ES3A 1FJEB 2VICA 1Z2ZA 1FVQA 1YBUA 4L72B 4DUZF 4DR7F 1SI9A 1HYSA 3CNQP 2LQ5A 3QO9A 3UVJB 2VBYA 5THWA 4EFAC 3VAKA 2R7SA 4Q0BB 3ETMA 3S01A 3BR9A 3PHTA 3MMJA 3R1LA 2XG8A 4DCPB 1A7GE 3FVYA 3EX7B 1NDLA 4B3OB 4QWBA 2B7CB 4DR5J 4F3QA 1KRPA 2GCFA 2MKSA 5DLFA 2XNRA 1N6QB 4DF8A 3OW2R 3QZ7A 1LV5A 3IWXA 4TU9A 3QAUA 4JI5J 3FBFA 2CYYA 1FK9B 1VJWA 2ZH5A 3KDOA 4U95A 1FD8A 2QJ3A 1DY3A 2MQQA 3QLHB 5LJ3Y 4BWJA 1YQHA 3DCAA 1IM4A 3G6VA 5JVHQ 2KVQE 2BANA 4WE1B 1MMNA 3IAM9 2C22A 3H98A 3MAAB 4FPRA 3PKMA 5KT6A 2F7VA 5SZTA 2CQ1A 4OZLA 3J7AN 3LP1A 1TL3A 2ZHAA 3MPUB 4DV2J 2IVMA 3CJ3A 3OFHA 2NUHA 2DXEA 2AP6A 2GIQA 5HAOA 4RNNA 3S6EA 3V6DB 4PUOA 1CQMA 2IHR1 1HBOA 2YKNA 4CDIA 2ACYA 4DSJA 3R5BA 3MMAA 2PEHA 3BKTA 3PEJA 2LXFA 3QAEA 4GO5X 2DNYA 2MXYA 1FTRA 1FFWB 2HQ3A 1KNZA 5K14B 5D3GA 1S77D 1GEHA 4ECYA 3AD9C 1ZZFA 1F60B 3TQEA 5F41A 2XLKA 4NL5A 3HFZB 4NI2A 3AT1B 3CE8A 3C8YA 2ZVSA 4HHUA 4QR1A 1S7HA 1A9NB 2XMAA 3GQCA 4B9TA 2PC6A 1RP5A 2V4RA 4OX6A 1QUVA 3I9ZA 3R5AA 2CWXA 3BQ2A 4YDXA 1SC6A 4RL1A 3UD3P 2H5IB 3GSDA 3FSIA 2GW8A 2JRSA 1X9MA 3BPDA 4DL2A 2ZEJA 1V3ZA 2V5HG 1PKUA 3PIPQ 2P5VA 2OD6A 1G2EA 4NOHA 2IVFB 2NXCA 2HNZB 2YNHA 1VLOA 2OUGA 3I6PA 1HA1A 1AT1B 3DRRB 1FVSA 2IC3B 2BQRA 1SPBP 2J76E 1R43A 3PO5A 2KKHA 3I31A 4N7TA 3C3LA 3V81A 4LSZB 3E2EA 3FCHA 3IN5A 1HNZF 2MZRA 3ILOA 2J9DA 1VQOS 2MKYA 1OSCA 1U4BA 2DGXA 2HPUA 4X84A 2IA6A 3HFVA 2QO3A 4PR6A 3Q8YA 1SIWB 3M30A 3IRXB 2AU0A 5GAGU 3DDIA 3E3XA 3RZAA 1X7VA 3Q22A 1N54B 1DRZA 2K2PA 3NNAA 2ZDOA 1J5EF 3JQJA 5IM0A 2VHGA 1MU2A 3MCMA 6AT1B 3M8ZA 3DI6B 6FD1A 4ZJLA 1FFGB 5JJBA 1EETB 3EGZA 2OPRA 1WC3A 4KT0C 3MDFA 4C0HA 4TYAA 4D3HA 5IWAF 2CVEA 4AL5A 4USHA 3WBZA 4NLOA 1PG5B 4DX5A 4DR4F 2KG1A 4R5PB 2NZ4A 2LDIA 5GAEI 2OIHA 4XTTA 1F9FA 2UU9F 2HBZB 2HFVA 1K0VA 4USTA 5D0RA 3TZWA 2G13A 3QRPA 1OY8A 2KN4A 1HR0J 2HVIA 2X51A 4I7FA 3GIRA 3J7Z5 1KSPA 1TK5A 2MJUA 1RGVA 4PCQA 4BDPA 1UETA 2IVYA 1RAJA 1WHWA 4OHXA 4OI2A 4K4XA 5GMDA 3GIJA 3VZIA 1KFDA 2YX4A 3VAGA 1FJ7A 2GGPB 4NLUA 1I94F 5J2MA 2IFXA 4B08A 1RA6A 4ZVTB 3Q89A 2QLFB 4WFYA 2QYCA 1JLGB 2QL9B 3IM8A 1ZA2B 4OYAA 2OSRA 3CCJS 2XCAA 2GJFA 3HMJG 2CNNB 4RLEA 5DETA 1AUSL 4NLXA 4U8YA 1M1GA 4KYZA 3HLUA 3GE9A 1REVA 3DOMA 5ITHA 3H90A 4ZLJA 5KFWA 2VPYB 2CPXA 4JI2J 2E9RX 5D4LA 1ZYQA 2PFFB 1LWCB 2CKWA 2FY1A 1NH7A 3F41A 2XWYA 3ZTOA 3OXGA 4DS5A 5HP1A 1U26A 2MZQA 4AD6A 2ZH7A 2MZSA 3GIIA 4C3KA 2P2CB 4IQXA 3ENAA 2AV5A 1WI8A 2VDIA 1QAJA 4J9NA 1U6ZA 2CJXB 1S6QB 1YGYA 2YWEA 1F5AA 2RSQA 4NI2B 3CWJA 2QSWA 5CYJA 1QUPA 1HNVB 3H20A 3ILJA 1CULB 2YNFB 2LDYA 2FLPA 4I64A 4USIA 2YX1A 3PTWA 4CO1A 2HHHJ 3N0VA 1EKSA 2JZ5A 4AUKA 2GQQA 1RWKB 3AODA 2KFNA 2J7KA 2PFDA 2CQ0A 2KXHA 2W4PA 3UDVA 3RRGA 1S9FA 2DNLA 2W2NP 4LF1A 2XGPA 1PJ7A 5E3QA 1PAUB 3DLEB 4MMOA 4RW7A 1YJRA 2GX8A 2Q6CA 4QPTA 4CLWA 3CDEA 2CIMA 5HMZA 3D0HE 3W1YC 3MEKA 4AQYJ 5D4OA 4O4RA 4OI4A 4UOHA 2XLJA 1YJNS 3FDSA 5F3TA 2PI5A 3LAKA 3DGVA 3LO3A 3AXKA 1S6PB 1T03B 1S1XA 3KHGA 2EG2A 5D0GA 4TKTA 4K8RA 5KFYA 3NCQA 4C8NA 4LJMA 1TZ0A 2WVCA 3C16B 2X1AA 4CZCA 1Y11A 1CEZA 3SFUA 3CCRS 4I0WA 3MMCA 1SUQB 1UJ4A 1BQMA 2RRAA 2GMHA 3J7YU 2XSFA 2RKIA 3HJVA 4CM2A 4OYOA 3SI8A 1AZSA 3SV3A 3G8SA 2OEKA 2NXNA 1N5YB 2KTQA 4B3MF 4LF8J 1SQFA 5HN0A 1M5HA 4Y3CA 4Q8EA 1ZPWX 3NGDA 3EVWA 1VQ4S 3P3DA 3GPAA 3QWUA 2FLNA 2HEKA 2GIFA 4KO0B 2PMZD 2UUWA 3H5YA 1S9EB 4LQ9A 3E8OA 4Z37A 1H2UX 1C1BA 1QLNA 1TP7A 1KVJA 1N5QA 3M1VB 2W9BA 1ELOA 4EK2A 1RTJB 4XPEA 4X4SA 2BABA 3O2IA 4Z2XA 3O44A 2XS2A 3MUMP 1X4EA 4YR0A 2ZZNA 2CQBA 2FYXA 2ACMA 1LEOA 1NK9A 4CIOA 4PAAA 2C1EB 5C25A 2LEBA 1TVRA 3K59A 1IN0A 2KI2A 5HROB 4EZ9A 1XC9A 1WNEA 3AFGA 4P74A 3RB0A 4Y34A 2PSZA 2NZCA 5HJXA 4XO0A 4MFBA 2AQ4A 3C46A 4DUYJ 2ILZA 5CH7B 5KFQA 1PYOB 1JX4A 2AX1A 3BN7A 1WELA 2XHCA 1Y10A 4I6WA 1FWLA 4X4PA 3EZ5A 2CPIA 3VCDA 1APSA 2R7XA 3AAWB 4P75A 1UEVA 4N8NA 1VRTB 3GV8B 4H4KA 4RKUC 4QW9A 2ZE2A 4ZVRB 3SCKE 2RUSA 1U47A 1REVB 1WG5A 3DOMB 3HT3A 1EZZB 3DRPB 3BR8A 5DLGA 2XMTA 2AZ3A 2BJEA 2DCUB 2B4PA 1URNA 3EXCX 5CYMB 2DHGA 5BYSA 1Q86T 3BGLA 2AYBA 4X4UA 1KC8T 4WBFA 3VGVA 5AXLA 3IA0A 9ATCB 5AXMA 4QIEA 4P9SA 5BR8F 1Q0NA 3JTNA 4OZJA 2HWTA 3OHAA 3LP2A 4LIRA 4DV3J 3OSPA 3D6FB 5D0HA 3M05A 2MKHA 2YWKA 4P7TA 3CDUA 2G2OA 3KLGB 3C19A 1JIHA 1TUVA 1OSDA 4JUZA 3DU5A 1UFKA 2DHHA 2R8HA 4PWDB 2UV8G 1D9DA 5HBMA 2E29A 3CXCR 1RBOB 4YY3J 4X4OA 3M6UA 4WJBA 2RIJA 2C3YA 3E01B 3V4IA 3AOCA 3TNVA 4USJC 4A8QA 2E5JA 1T11A 3HHLA 1FNXH 3FBBA 2EFNA 1C4AA 2BE9B 4A8MP 8AT1B 2MHEA 3SSSA 3RRHA 4YB1P 2VZ9A 3VAFA 3W3SA 2UUCF 1G4CA 2LEAA 3DMJA 1N5VA 1RWWB 2FJAB 2LA6A 2MZJA 5I3PA 4X64J 2EC0A 2ZVIA 1URRA 3W60A 1HWKA 1HWJA 4F04B 1HARA 1JJ4A 4NRUA 4DZ6A 4R0EA 4GVLA 4O44B 1BWEA 2AYGA 1EX8A 5F8JA 1NZAA 2A3JA 4MYUA 3GSIA 3ISZA 1IKYA 1BHNA 4TLRA 5KFAA 2KZMA 1RWMB 1XQIA 5KG5A 2XZTB 4KQZA 2LMIA 5LMUJ 2ZDPA 1KQGB 1CQNA 3HHEA 1RYSA 2UXDF 3OPKA 4DMZA 2E9TA 2MHNA 5C2CA 3CCMS 3MR5A 4PXBA 4Y2MA 1RT7A 2V9KA 4AFFA 1RT6A 2QA2A 4J5OA 4KKOB 4RNMA 1BE4A 1EARA 2A6MA 4DN0A 1YZ7A 4A48A 5K8MA 1NKBA 3QIDA 3JAMU 5B09A 5H9EJ 2OPPB 2FHJD 4ED6A 4ICLB 4N56A 1N33J 3BO2A 5E33A 1PC5A 3UQSA 2CADA 3MAQA 5DZ6A 4I2PA 4L75A 3MEGA 2E9ZA 4MYTA 2V4JB 1RA7A 2HSEB 1FX4A 2NSCA 1RWUA 2MLYA 5I3UA 1KWMA 3QFWA 4CM0A 2EBEA 4OFZA 2PN6A 1OYDA 4NPOA 4H4MA 1KR4A 1RTHA 1VRUB 2KHCA 4GVBA 4IH7A 1RUSA 2OO4A 3MEDA 1CC7A 2OPQB 2W01A 2XI2A 3ONQA 1XNQJ 2F4FA 4DL5A 4HDGA 2XBPA 2R2SA 2VQFF 1B99A 4Y65A 4YB5A 3NAHA 2BV3A 2B8PA 2R8IA 1IWAA 3GYGA 3IC1A 2FZCB 2RNEA 3NGSA 2VA3A 2AWZA 4M94A 3V5RA 3MWBA 4DU8A 1XJWB 1NCLA 2GAHC 1IKVB 1Y3JA 4JV2A 1P1LA 4ZPDA 1HBNB 3CPWR 9RUBA 3BGOP 2EFQA 3PW0A 2HYIB 4UQGA 4BLGA 4CTAB 1SH0A 4K4TA 4MKYA 3MM7A 2IJRA 3HZEA 1YX2A 2DNOA 1KVIA 4FF2A 2FJBB 4RNFA 1RBLA 4FS2A 2ZUAA 3M8QA 2BVZA 1YKWA 4ZS6A 5J2QA 1GMWA 5D15A 1OPZA 2VJVA 5B0CA 1F0XA 4YR2A 1S76D 4PXEA 3JB9k 3MPWA 4UUXA 2GMLA 2VV5A 3W9IA 1ZM3A 3K5PA 1PIEA 1JXVA 1DTQA 4IQMA 4LRAA 2BR0A 3MR7A 1VC0A 3OXLA 3H8YA 4OYZA 3SCIE 1UWBB 5KT3A 4LBHA 2OPSB 3BSCA 4UF4A 4DR2F 4N77A 3PYEA 1UP1A 3J81U 4FKXA 4FYVB 4Y0FA 3CC7S 3FEYB 3IMQJ 4ZLNA 4K2JA 2RU3A 1WC6A 1S1UB 1TL1A 3OVAA 2A1BA 1YG0A 1FDBA 1W2IA 3N28A 2X3DA 3DKDA 1RCXB 3W66A 1XTZA 3VWSA 1PGZA 1RU1A 2FQQB 3TX8A 3K8WA 1JKHB 1GTEA 1K47A 1D9AA 1KVKA 4FNIA 4KPCA 4ED4A 1XR7A 1NXIA 4FP9A 4DSEA 2GO9A 4YDDB 5FDLA 3H25A 3PCOB 4ILRA 3WX8A 2CDQA 1HWLA 4ZLPA 1FNMA 2ZJRQ 2Z2MA 2H51B 1R8AA 2JC1A 1DJ0A 2NXEA 4WIQA 1XR6A 4YEAA 3TVYA 4G1PA 3IG1A 1IKYB 2CA9A 1NPRA 3HF5A 1XMBA 2QN6B 2VONA 1CPZA 4C97A 4HI2A 1NNDA 3OR2B 1FRJA 2BQUA 2Z2LA 4PG6A 5KG0A 1WJ9A 4FVCA 3OL7A 4OX9F 1UJ5A 2J0SD 3QQCD 2R7OA 3SQGA 1FT8A 2OFHX 1VC5A 1RT7B 4KBIA 3R6GB 2CPHA 4UW2A 1IXKA 1G1XA 2N3LA 4RPFA 1RHRB 2YQ0A 5DJBA 2HGNA 3DLKA 3ADAC 5ETNA 2ZBQA 2PIIA 4B9MA 4K59A 3B4DA 3JS9A 1FE4A 4DFJA 2YH0A 3HHKA 3PW2A 3GJSB 3NEKA 2RQKA 2HQIA 1IKWB 3I5CA 1QAXA 5A2QU 2XEXA 1BQNA 1X5SA 3JAMY 4AL7A 3GCXP 2J8SA 3TEHB 1U25A 4W90B 1VMBA 1WDDA 2VQEJ 3M9NB 4M5DA 5T41A 3R1HA 1JNZB 3N5FA 3WC0A 1RTDB 2E5LF 3UCGA 2UUBJ 2Y0SD 1HQUA 2YBVA 1SKWA 3H2LA 5E2QA 3DYAB 5AJ3F 1R6VA 2K1RA 1FDDA 4RU9A 4HTJA 5KAKA 2YNIB 3NWGA 4LUBA 4QPXA 2P6TA 2WVFA 4K4VA 5B0EA 5J2PA 4TN2A 2UZAA 3I0SB 4WP9A 4A8WA 1SJQA 5KFTA 1FRIA 2I9SA 3ZZZA 1V3SA 1B70B 1MROB 1T02A 1VBZA 2YKMA 3S8SA 3ILIA 2VASA 4ECQA 4LF7F 2F65A 3NGTA 1RTIA 1K0TA 3KHLA 3CB4A 4LR7A 3PYDA 3NBPB 3M8QB 4K4UA 4DUZJ 4DR7J 1S9GB 4YQWA 3PYFA 2R7RA 4M5HA 2YH1A 1XMOF 3IS9B 4DCJB 3CJKA 2QGFB 3ZZYA 4KH1B 3NNHA 1TUWA 3CC2S 3RAQA 2FPHX 4JI8F 3PACA 3M2UA 2KG0A 3GYNA 3GJQB 2OLWA 3NCPA 3GTYX 1JMTA 4K5SA 4YMEA 2H5JB 2HBRB 4X4QA 5M2PA 1GXTA 1RQ0A 1NRKA 1LXNA 1SC3B 3HVAA 4DV4F 2R3VA 1R8HA 4C98A 5FLXU 5J1EA 2MQ8A 3BO4A 2WSEC 4DU7A 4ERDA 3HSGA 1J2VA 2Y8YA 2XC9A 2PA8D 2MKIA 4PG4A 4MJKA 2R7UA 2VG7B 5JUMA 2HBQB 2J9CA 2W8LA 2DJWA 1RBAA 1JLBA 1NK0A 2VOOA 2ZWPA 3J81Y 1TK8A 3MM6A 2ADCA 3LH2S 5T7LA 4FYXB 2QA4S 2VD3A 2GV1A 3ENWA 2XS5A 2IRYA 3BSOA 3GR1A 3CCWA 2XCPA 2B5JB 3ET6B 5DDRC 4PYAA 4GC6A 3UNGC 4DHVA 2HNYB 3CJTA 3R5GA 4B17A 2YKPA 3X3UA 1ZH5A 1PBUA 1VLYA 2QT7A 1X4FA 4H4OB 2M3DA 3ZNJ1 1PJ6A 3BKUA 4PZVA 3OD2A 4LREA 3S7RA 3LOUA 5ETTA 3M6WA 2DD8S 3K5OA 3Q8UA 2ZKUA 4DX8H 2K3IA 3LP0A 4NCBA 4RUHA 4QZVB 5HMWA 1W2BR 1KD1T 4MKBA 1YITS 2V2ZA 4DR1F 1EQ0A 2YWWA 1PYTA 1F9EB 3MFIA 3FRZA 4ZJOA 2ZBPA 3CJSA 5E5NA 1B0TA 2LXIA 4ED7A 3OJUA 2CPDA 2LEPA 4DL6A 3M8RA 1KFSA 3CJ8A 4UQTA 1HBMB 1U1KA 1UVLA 1S7IA 3DLJA 4RNOA 1J5OA 3EGNA 2AYEA 3RBDA 3KJVA 1U2FA 1M1HA 2HKEA 4FYYB 4WK3A 1HNZJ 1VCTA 2AGPA 1WHVA 2W24A 2E1AA 3D2WA 3DFEA 4C8KA 4RW8B 3G71S 1G7CB 4U7UD 2R42A 2JNJA 2EK1A 4U7CA 2BACA 3VGTA 3W62A 1NK4A 4FBUA 1Y5NB 1JLFA 3ISNC 2C28A 3OHBA 5A0YA 2B4VA 3R2DJ 3GZ7A 4NX9A 3DOKA 3UO0A 1HQUB 1YK9A 5A2QY 1F1BB 1IBMF 4A8FA 1RKJA 5F0UA 2N7YA 2HRUA 2HS4A 4B3RF 2M0GB 5CYQA 2DNQA 3SSQA 2C2DA 1TKDA 2L9WA 2JSXA 4YS2A 2LECA 1U45A 1N0VC 1RI7A 3D1QA 1UW4A 5ETOA 1J5EJ 1B7YB 1T3NA 4DG1B 2M70A 2P8IA 2DVIA 1IR0A 1NK5A 1PYSB 2G1DA 2MGZB 2OGUA 2DKOB 4W92B 2G1HA 1NAQA 2JH3A 1YJWS 4PRFA 3ZZOA 5IWAJ 3J7A1 3GJTB 1NHUA 2DB1A 3MMBB 4DR4J 3QRQA 2XHWA 2RQCA 4M95A 4YUDA 1WG1A 2UU9J 1IKXA 4ZIWA 4ZVUB 3FEZA 2C3MA 4DXLA 2FIUA 1VBXA 4DQPA 4DR3F 1QY7A 2ZZTA 2BUNA 2UXCF 3K8VA 1KONA 1F3FA 1JLQB 3IWLA 4ETZA 3L7PA 2LA4A 4OJGA 1P8GA 1BMQB 3HDSA 1FRXA 1FE0A 1EP4A 1FKOA 5EGYA 1PBAA 1RHJB 1VFJA 4B3TF 1Y7PA 5DS7A 2E5HA 3EGWB 3J80Y 4QWAA 4F0MA 4B9LA 2F9JA 1PSDA 4DFMA 2PMHA 5GADI 2FHJA 1H6KX 3ZO7A 3CIMA 1JLBB 2GVZB 1S0NA 2UP1A 2H1YA 5FLXY 4NYZA 3JYTB 5F8NA 1R0BG 2CNKB 2OEMA 4M5JA 2V2KA 4A4JA 2N82B 2K3KA 2IBOA 1W26A 4K2XA 1OPIA 1RB0A 1TKXA 4NMXA 2DRAA 1KN6A 1VQMS 4LSNA 2DEJA 2EI5A 3LGNA 3M9MB 3GYXB 3BO3A 4P2FA 4ZCKA 3R2CJ 1Q1KA 1WOPA 3VTIA 4BS2A 4L74A 3G4SS 3NP5A 1FRKA 3P4UB 3ZFVA 3VAMA 3WIVA 4HLBA 4URGA 3ICLA 3DLBA 2V8HA 5DM7Q 1RT3A 1MNEA 3TAQA 3FSXA 4XAKA 3C6TA 1WEZA 1RLCL 3F0NA 3J81j 1NPKA 4UZCA 5A6PA 4ZHRA 3HFKA 2V8VA 2KT2A 2G0IA 1QD1A 2OMLA 2RHSB 3MI7X 3MCOA 1ZTWA 3EPIA 2H54B 2DRDA 3Q23A 2ZJQQ 1VQ7S 2AEJA 1X4CA 4Z7CA 5D77A 1EIYB 1C0TA 2KXNB 3PJWA 3IRWP 4YP3A 1XBWA 1KLMA 3LTOA 4J9SA 1X5OA 1HMVB 1HWIA 4RJVA 4NASA 1FKPA 1UPPA 2G0JA 1NSQA 4P6QA 2VODA 2N4CA 1WOOA 1NUEA 1UTAA 3KUGA 1ACMB 3MECA 3IXQA 3M8PA 4F4YA 1KEKA 1ZPVA 3MUVP 1IBLF 3R3TA 1B0PA 2MZTA 5HQMA 3PYGA 4OQJA 1Q7YT 4OMFG 1UEKA 4B3MJ 5DZ7A 3QIPB 1QTMA 2AJ0A 2QMXA 4IRDA 1DQ9A 2FUG9 2YKQA 1X4AA 1ZOTA 1UEUA 3D6MB 2WOMA 4NLSA 2PD1A 3AY0A 2KU7A 4IFYB 4ZVGA 3H0PA 1JLEA 2Q79A 3ELHA 4RBUA 2E66A 1NDPA 1S0OA 3KLEA 4I68A 2WBMA 4Y2AA 1SIZA 3IFEA 2F63A 2VG6B 2FZGB 5GAEU 4Y2CA 1EB0A 4O3PA 4RWXA 3BYRA 1B3TA 1SJ4P 4HH1A 5E41A 2FTRA 3KDNA 4QJVA 3RG6A 1HW8A 3MM8B 3Q8PB 1CJTB 2VPXB 4Q43A 5D6GA 4QCLA 2VFTA 2G4BA 2XY6A 2CPJA 4EBEA 4OL8A 1NSAA 2JJ4D 2W4DA 2QRRA 4R8UA 2HHWA 4EUVA 3KLIA 5G0RB 1TFWA 3JSBA 3PX0A 1VBYA 2XNQA 2B3TB 4WP3A 4K4WA 3QATA 3ZZUA 1TL5A 2BE2A 3DGPB 3W5ZA 2ZH2A 2J0WA 3ZTSA 3NY0A 2DGWA 3R7NB 3PV8A 2Q66A 3KMSA 2DCLA 4ZVEA 3MM5A 2RH3A 4B02A 3OTDA 4NLQA 4ELVA 3PW4A 5GAHI 4HVZA 3UI3A 5F8LA 3G8TA 1TL7B 2LKZA 2QZ8A 1HI8A 4K4YA 5A8KB 1DLOA 4NE9C 5KG6A 2BJ1A 3PX6A 1H7XA 4AXIA 3EJMA 1JQGA 2MQOA 1GMVA 1K9MT 2B51A 2CPEA 4IG3A 4HL9A 3PX4A 2DGTA 1ZM2A 3CC4S 4CYUA 1T9UA 1UWAA 2R8GA 1BUXA 2QLBB 2HBYB 2ZBCA 5GAGI 4IFVB 2OTLS 3PY8A 2YY3A 4LSLB 1X0PA 5SUHA 2FVSA 3PEHA 3NS7B 3VQTA 2BJ3A 3W64A 5KFBA 4X4NA 4KGXB 3HVTB 1JLCB 4S0MA 2YWHA 4WYWA 3JSRA 1NSKL 3C66A 1N52B 3G9CA 1XNRF 5HJYA 3FSYA 5BR8J 2HQGA 1VQLS 4KSEB 2QL7B 4PEOA 3R7SB 1JWWA 1S1TB 2BE7D 1T05B 2BJDA 1Z2LA 3OFGA 2AT1B 1R8BA 3DOLB 4JI3F 5AE3A 5E7OB 2YNGA 4RW6B 1IJFB 1H2VZ 1YTYA 3GU0A 2MLZA 2E1RA 1RAGB 1K1SA 4ZDNA 3M8YA 4C8YA 1X9WA 4ZPWR 4MAKA 3R97A 2WHOA 2RUGA 2MLXA 1VBKA 2A2CA 1I51B 3HVWA 3HZGA 2QMWA 5CQGA 2DIVA 1UVJA 2JVRA 5K8OA 2HS3A 3G86A 3NOGA 3RTVA 2CJQA 4ZPTR 1NKEA 1SBRA 4WCEQ 1Q8BA 1UMJA 3ENQA 3D9BA 1VQNS 3D3CJ 3EM1A 1CJKB 3D0IE 5ETRA 3R27A 2HZVA 2UUCJ 3OR1B 1NU4A 2GFFA 5L39A 2MKKA 4YHHJ 4I4BA 3MURP 5L1IA 2ASJA 4TNOA 1SKSA 3EZUA 2XMWA 2HMIA 2KZZA 4ES2A 2QE5A 1LW0A 4ZPAA 2IAJB 5FIIA 4UTGA 3NGUA 1HBUB 5IQQA 3HPOA 2OKQA 5EUHA 4LF6F 2R7WA 1B0VA 4WF9Q 4ID5A 3ZZRA 3MXHP 4NWBA 2W2QP 3I4PA 3W9HA 3PNIA 3ZZPA 4NXNF 2BDPA 2HAFA 1SXLA 4E2FB 4F02A 1RADB 4K5RA 3UDEA 2BMBA 4DV6F 1GFWB 2UXDJ 3FZBA 1H38A 4NA3A 3QT6A 4OYXA 3KHHA 1DQ8A 1I3OB 2Y8WA 1S5ZA 3T1AA 4AYBD 3LUYA 1PO6A 3EMTA 3Q0AA 3DLGA 4R8UB 4BBYA 4CO4A 1EKRA 4O4GA 5LSRA 4EBCA 8ATCB 3KUEA 2DGVA 5DG8A 2BE2B 2XI3A 2JOQA 4NA1A 2QFIA 1N48A 3TARA 2Z58B 4WFAQ 1E6VB 3QSYB 3W2VB 2NYIA 3ITHA 3M2VB 2VKRA 3KG0A 3MM5B 3KLHA 3D5MA 3MD1A 2H5EA 4ZP9A 2YVSA 4HACB 4NCGB 1UCNA 1XK8A 4QYZJ 2FZKB 2CQHA 4LFBF 3KK3B 2OTJS 4C0BA 2ZNZA 2HFOA 4XIUA 4F0KA 1SV5B 3BBFA 3C2PA 4LF4F 3AQOA 2FGOA 1U1RA 2VQFJ 4B9NA 4MT1A 1UPMB 4IG3B 4J7CA 2KM8C 4DSLA 4F0HA 3J7YI 1MMLA 3MZIA 1KOHA 4KC5A 1N32F 2X1BA 1TV6A 3T6JA 4I1TA 1CBKA 1AXQA 1BY9A 1FD2A 1OY6A 3IBWA 1RAAB 1AYEA 3GFZA 1XN9A 2W7AA 3C6UA 1L3UA 4XDCA 4PG5A 2IMWP 2C2MB 2RJZA 5F8MA 4V19J 2QSFA 2V0NA 1IUJA 4TU8A 3H5SA 4DPWA 2FDNA 4F25A 2LU2A 5IXUA 3CMAS 2VU5A 1WEYA 3ZXWA 4NEZA 1S48A 3QMQA 1S57A 3K7RA 2O3DA 3TJ8A 2HHSA 2Q3PA 3I87A 1WSVA 3OQ2A 4CCHA 5ETKA 5AE2A 4OV6A 1HQ2A 1S1VB 1VI7A 2BM1A 1E6YB 4Q2MA 4KV8A 1HNIA 2EBGA 4IG0A 2VBZA 3RB3A 3TUJC 1FDAA 4QU7A 2HLUA 4EU0A 2KYZA 2LU1A 2GHWA 4CNZA 3A3OB 3DRXA 4DR2J 4C8LA 1S79A 3P5BP 4I2QA 3BGRB 3JSMA 1LWFB 1TFYA 3OTEA 3M2RA 4JI0F 1Q95G 1X0FA 2Z30B 5A8RA 5HQLA 1OS5A 4F4AA 2YPYA 1TR0A 2L3MA 2LLZA 2QC3A 1LK7A 4QWEA 1NM2A 1TKTB 4WFXA 1N34F 3R6LB 1TMMA 4F3OA 4DDFA 4ZVOB 4Q2LA 3M6XA 3HHLD 2ALZA 4NLGA 4ZITA 3NGKA 4CLLA 4CLTA 1S1WA 4FF1A 2FLOA 3Q8VA 2X1GA 1LW2B 3MCNA 3EVMA 3HK2A 3HSDA 4NXMF 4X4VA 3PR4A 4ID5B 3Q2TC 1NH8A 2HHTA 4FPIA 4ZVHA 2C2OB 2D41A 3RUBL 3RBZA 3M8WA 3S1TA 1U0HA 3KXDA 2XMVA 3OUYB 4OX9J 2RT3A 4KHPF 2DHAA 3QPIA 4TQRA 5CD4H 1SVDA 4A8YA 1D8YA 3AB4B 3HD2A 5EWFA 5B0DA 3CIZA 4ETXA 2GIRA 1V6HA 4O3RA 1AFIA 2RQ4A 4UUWA 3PXGa 1N36F 4LF9F 2NCKL 1OY9A 5HO4A 4J9LA 1IM6A 1C0UB 5D0EA 2KO1A 1U09A 4J9UE 2KM8B 5HMYA 1WD6A 3POTA 4WXOA 3ITHB 3VV2B 1Q16B 4IH5A 2ZITA 3N4WA 1FO1A 3FMWA 2B6AB 1CS4A 5IC6B 2A6OA 2IM2A 4WKRA 2BKOA 4I6AA 4E98A 2HNDB 1TKZA 2CQCA 2IM0A 2NS1B 3UN5A 3TUPA 1R0AA 4LIWA 3TAMA 4HI1A 4F3MA 3W65A 2E5LJ 1RWPB 4J9OA 1VQ6S 3MEEB 4YN3B 5C42B 3KMQA 1T9XA 3CDAA 2D9OA 2DITA 4GKKF 3CJ2A 5AJ3J 4JI7F 2Z2YB 1M1KT 2W2PP 5KFPA 2EWHA 1VGYA 3SMZA 4IR1A 1WORA 1M5SA 3E51A 3HI9A 5B0BA 2DNGA 2BOPA 1RT4A 1LWEA 3G82A 2RQMA 3K5LA 4IDKB 1WF1A 2KXFA 2XYPB 4LF7J 1NEEA 1TAQA 3UDCA 5CABA 2CFXA 2WSCC 2CPYA 4CLZA 2OP5A 1FEEA 2COLA 1RT1A 2DISA 3T41A 3L3CA 3CDBA 5L8RC 1MN9A 1XMOJ 2MKJA 4QW8A 5CZVA 4Y6IA 3M32A 2XLIA 5C24A 4K7QA 4JI8J 3C14B 3FK4A 2CPZA 1EHWA 2I5JB 3UDLA 1QE1A 1IR2A 4FKYA 2LP4A 1TUGB 2MDAA 1YJ9S 4BCAA 4A8XA 4G65A 1GMWD 2I1RA 1D0EA 3GONA 4DV4J 3ILLA 3MM9A 1RT2B 3FFIA 1CJVB 4LMZA 3JSMB 3M2RB 2ROPA 3CD5A 3CMQA 4TVAB 2GC8A 2D3O1 4ECVA 2GA7A 4PWWA 1OWXA 4BHQA 1HYSB 3AHPA 2I2YA 1VR6A 3QO9B 2EFVA 2F8HA 2DHSA 3G8QA 3L09A 2W4CA 4X66F 5IFMA 1NDKA 3EGVA 2JEJA 3AOBA 2AZ1A 3A13A 4OLPA 1O51A 4ILLA 4OX7A 4C6AA 2R7VA 3CD7A 3BN4A 3RBEA 2CQ4A 1T94A 4WTYA 2JDJA 1SJ3P 2MQLA 2ZM6F 4DX6A 4OI0A 4ER8A 3HO1A 4NCAA 1W7WA 2FHKA 1MWYA 1K73T 1D8ZA 2UVWA 1RHUB 2E7VA 1WC1A 4ANCA 2BANB 3KFWX 2J9DE 5LXRA 4ZP8A 5LOQA 3D68A 4NZ7A 4ZVPB 2ZD1A 3RW7A 2OH2A 3LP1B 4DR1J 1TL3B 2F1FA 4EZ6A 1VQKS 3RB4A 4PUOB 1HBOB 2WONA 4IO9Q 1YJTA 1ZA1B 1ULRA 2K8GA 2YKNB 3MMAB 2NYHA 1LK5A 4RNHA 3NCRA 1JLAA 1VC6A 4KY3A 1CJUA 2X1FA 5D3GB 1WI6A 2DHXA 2W25A 3MGJA 3DM2A 2Y1RI 5HSPA 3TP2A 2DGQA 3M6VA 3TZYA 1Y4ZB 2RDDA 5AXNA 3FUYA 3K17A 3I96A 2F40A 4CT9A 1FXDA 1V9OA 4ANDA 3GV5B 1G6BA 3KWMA 3THPA 1B7FA 1ZAXA 5J2NA 2KFZA 3BSNA 1R0AB 3C15A 2KB2A 5KG1A 2KL8A 4NLWA 2L9NA 1QVFR 1IBMJ 2MMYA 1QAIA 1ZAVA 2A0FB 5I42A 4J37A 2C3PA 2W9CA 5B0FA 4KIAA 4B3RJ 3K2YA 3AJDA 1VQPS 1C1CA 1Q8LA 3GB0A 2BZ2A 2OSQA 2YNHB 3BJYA 4C11A 3O5TB 1JXEA 3T3FA 2QTWA 1GXUA 3G82B 2XZDB 2YWGA 2PDAA 3D67A 3SBMA 3V81B 1O5JA 3VVTA 4DV5F 2XZWA 2JWNA 3CCQS 2IY5B 3DDNA 5LXYA 2ZKTA 1K44A 4I67A 3A8IA 4TYBA 2XQCA 1YBAA 4ZLLA 4C3MA 2E1CA 3FQKA 1T9WA 4J9VA 3T5HA 3CO0P 2H48B 3KKFA 4Q45A 1H0HB 3KK2A 5HLFA 4JBCA 2O01C 3IR6B 1F9HA 3M32B 1VJQA 3A3PB 2MYFA 4DR3J 2XGQA 3I56S 3M30B 4X4RA 1V3RA 2DGSA 2UXCJ 2KJVA 3Q2SC 3IAS9 2V94A 1SC1B 4PABA 1U1OA 3QRRA 2D3UA 1S12A 2XMJA 4ED5A 5IM0B 2NR0A 1HQEA 1MU2B 1GXLA 4F7VA 4LRDA 4FVMA 4DBQA 4RX6A 4ZK7M 4LBIA 3KHRA 4B3TJ 5DQIA 3D1OA 3MM9B 2HFNA 1H98A 2AGQA 3W2WA 2OPRB 4G1QA 2UXBF 4G6VB 1WC5A 3GWCA 1JJ2R 2UVRA 1RYRA 2FB0A 1V5IB 5KFNA 3OLBA 4F4KA 2L9DA 4FF4A 4RW4A 2CJAA 3RB6A 1N88A 1ICEB 1RABB 3QT5A 5F9NA 1Q4RA 4I7FB 2JEGA 2VUGA 2HVHA 3KLFA 2V34A 1ZETA 1FRLA 5AT1B 2D3OR 1U8SA 2VFVA 4Q44A 3NWRA 2AJ4A 2CQ3A 1S0MA 5ETLA 1JXLA 3N6LA 4PQUA 3KK1A 2EEYA 1FEHA 5CHCB 4A47A 1M90T 3CEDA 2CG4A 2A18A 1R31A 2V4QA 5J2MB 3ETOA 2I38A 2OFGX 3CCTA 4ED8A 1HI0P 3SQOP 1IQZA 3UE2A 2C3UA 1TU0B 2DXDA 2IYGA 2R7QA 4C8OA 1XWLA 2V2QA 2CJYB 4Z7YA 4DSIA 4F36A 2C42A 4TY8A 3PFOA 2WBRA 4USKA 3UVJA 3W9JA 3NAIA 4FXWA 5ETVA 4Q0BA 2Y3YA 4RUBA 3UCZP 1LWXA 3QGIA 1N8RT 3MF5A 4B3OA 5KFJA 4DS4A 4U96A 1N6QA 5HP1B 1WWHA 2B4OA 2DXFA 4CLFA 3R5JB 4DLEA 4H4KC 4JI4F 2VJUA 1FK9A 1SH2A 3O6QA 4CLPA 4X62F 1X60A 5BJRA 1X4HA 5U47A 3QLHA 4KGKA 2E1PA 4ZKAA 2L48A 2GHPA 2R2TA 4WE1A 1FESA 1S49A 2IJNA 3U1LA 1HFEL 3MAAA 3RYLA 4DPXA 2C2ZB 3V6KA 2XM3A 3PW5A 1IBLJ 1UL3A 2ZZMA 1KQSR 5G4DA 1NK6A 1NB7A 1Z1ZA 4OIXA 2AEFA 3BDPA 3V6DA 1QSSA 3H2VE 2WTFA 1NKCA
chains in the Genus database with same CATH topology
4ZCKA 5IWAF 2CVEA 4AL5A 4TY9A 4USHA 1Q1KA 1TAUA 4Q7AA 1DFDA 5HI7A 4YB6A 4RW7B 4AE5A 5F3ZA 3WBZA 3VTIA 5DDPC 4NLOA 1BD6A 3DRYA 4DR4F 4BS2A 3I0RA 1YI2S 4OHVA 2KG1A 4R5PB 3K58A 3G4SS 3NP5A 2RS2A 1NK7A 2NZ4A 1LFWA 2VBWA 5IT9Y 1FRKA 3ZFVA 3VAMA 1VHFA 2LDIA 4DJBA 2ZHOA 5GAEI 2OIHA 4HLBA 4URGA 1OIAA 1F9FA 4E8UA 2UU9F 2PO4A 3GILA 1K0VA 4C11B 2G13A 2I0XA 3CGIA 3ICLA 5K14A 3DLBA 2V8HA 3KLIB 2KN4A 2HVIA 1HI1A 5DM7Q 1RT3A 1MNEA 2XMKA 2X51A 4I7FA 3TAQA 3FSXA 3J7Z5 4XAKA 1TK5A 1KSPA 4QYRA 3D0GE 1S1XB 4DG1A 2MJUA 3C6TA 1RGVA 1KTVA 1WEZA 4PCQA 4BDPA 1UETA 2MGZA 2IVYA 4PPZA 2D74B 3DDKA 3UW1A 1RAJA 1WHWA 4OHXA 4ZHRA 5A6PA 4DL7A 4ITSA 3MUTP 1AFJA 3HFKA 4OI2A 2ZC3A 2V8VA 3GV7B 2KT2A 4HHJA 4OZ1A 4K4XA 5L9NA 4ELUA 2FJXA 1GTHA 2NLWA 3GIJA 5KFXA 4EEYA 2IM3A 3VZIA 5KFKA 2FD2A 4IH6A 3MMCB 2OMLA 3H40A 4FXDA 1KFDA 3MCSA 4WU3A 5EX0A 2YX4A 3VAGA 4EBDA 1BQMB 1FJ7A 2GGPB 4YHHF 4NLUA 1R6YA 1NK8A 3MI7X 3MMBA 5K5MA 3PDNA 4J9PA 1I94F 4GKJF 3DU6A 3MAHA 4IOCQ 5J2MA 1ZTWA 3EPIA 3Q23A 4F4ZA 2WK4A 2ZJQQ 2RKIB 2CVIA 4CO3A 2F3JA 1L3VA 1VQ7S 2XY5A 2IFXA 4B08A 1RA6A 4JI1F 1X4CA 5D77A 3TUIC 1C0TA 2KXNB 1DLOB 4WFYA 3PJWA 3IRWP 2O5DA 2R9LA 4YP3A 1XBWA 1KLMA 3HHLC 2AD9A 2QYCA 1JLGB 2VBXA 4PG8A 4J9SA 1M5KC 1FTCA 2M2BA 1X5OA 1TFYA 3RU0A 4OJHA 1HMVB 1HWIA 1VK8A 3EXYA 4AL6A 5E3RA 3T5KA 1Y3KA 2BYCA 1FKPA 1R7IA 2HNZA 1ZAWA 2OSRA 3I9V9 4P6QA 3CCJS 2XCAA 4ILMA 3WDOA 3DRRA 2IC3A 1Y00A 3HMJG 5KFOA 4RLEA 5DETA 4NLXA 2QV6A 3NMRA 2VODA 1JLQA 4ED3A 3HLUA 2N4CA 3GE9A 4KFBA 1REVA 3HHDA 3CO9A 3DOMA 5KFEA 2RB7A 2C2RA 5ITHA 5L1JA 5KFWA 2VPYB 2CPXA 2E9RX 3MECA 1KQKA 3N5BA 3IXQA 3M8PA 5D4LA 5I3QA 2D9PA 4F4YA 1KEKA 1ZPVA 3MUVP 1ZYQA 3FMBA 2PFFB 2XMMA 1LWCB 4D3GA 5GADU 1IBLF 2CKWA 3R3TA 2FY1A 1NH7A 3N9UC 1B0PA 3F41A 2XWYA 1C1BB 2FGCA 2MZTA 3CVKA 3HXMA 4CH0S 4NLDA 2W9BB 3OXGA 2IRXA 2W8KA 4DS5A 2Z8QA 3QWPA 4OQJA 1Q7YT 4JYAF 5HP1A 5BYRA 1U26A 5IT4A 2MZQA 4OMFG 2ZH7A 2MZSA 4CO2A 3GIIA 3BO3A 4C3KA 5KFMA 3CSKA 4IQXA 3CF5Q 2AV5A 3LF0A 2JEIA 1WI8A 3QIPB 1QM9A 2ZUGA 2RDJA 1QAJA 1QTMA 3BDEA 2AJ0A 4J9NA 2QMXA 1U6ZA 4IRDA 4M63A 1DQ9A 1UA0A 2FUG9 3VF0B 2YKQA 1S6QB 4O3NA 3SV4A 1X4AA 3JTOA 1U1MA 1YGYA 1ZOTA 2YWEA 1HD1A 5DDOC 1UEUA 3VZHA 1F5AA 1TK0A 2WB4A 2RSQA 2WOMA 4NLSA 2PD1A 4IYQA 5C25B 2KYXA 1RISA 3CWJA 4C4WA 3AA8A 1TVRB 1SQEA 2QSWA 3AY0A 5CYJA 1HR0F 2KU7A 4NLRA 2ZH3A 1QUPA 4IFYB 4ZVGA 1HNVB 2MQNA 1JLEA 2Q79A 3H20A 4RBUA 2IA0A 4HYKA 2YNFB 2LDYA 2FLPA 4I64A 2M88A 3JYTA 4USIA 1MMDA 2E66A 5KG2A 1S0OA 5J1NA 4MK8A 5CA5A 1D9FA 3KLEA 2YNGB 2WBMA 4I68A 2OMOA 4Y2AA 3D54A 2V9WA 2YX1A 3ZC4A 4CO1A 6FDRA 3Q8RB 1SIZA 2VC0A 3IFEA 2NREA 3UR0A 3N0VA 2VG6B 4MFBB 4ZPVR 2JZ5A 2YKAA 4AUKA 3QJPA 2GQQA 3F56A 5GAEU 4Y2CA 2RRNA 5KFGA 2KFNA 2J7KA 5EWEA 1EETA 2CQ0A 4RWXA 4O3PA 4LFAF 1M5PC 2KXHA 2W4PA 4HH1A 2FTRA 5E41A 2L41A 1MW7A 1U1PA 1SJ4P 2LQBA 4CNYA 1M5OC 3RRGA 1S97A 1FXRA 1S9FA 2DNLA 2XGPA 4QJVA 4PXCA 4U9RA 5H9FJ 2BA9A 3LAMA 5E3QA 3DLEB 3HM9A 3GFHA 4MMOA 4RW7A 1HW8A 3MM8B 3Q8PB 2VPXB 1YJRA 4Q43A 2E5IA 5D6GA 3VAHA 1TQLA 3PKYA 2GX8A 2Q6CA 3GR0A 4QCLA 2J5AA 4QPTA 2VFTA 2G4BA 4R5PA 2XY6A 2J0QD 2CPJA 2CIMA 3CDEA 3QGHA 5HMZA 3D0HE 4EBEA 4OL8A 2JJ4D 4G1IA 3MEKA 4WZQA 4JI6F 5D4OA 4O4RA 4OI4A 2W4DA 2QRRA 4TY8B 4R8UA 5KT2A 2HHWA 4EUVA 2Q43A 2XLJA 1YJNS 3FDSA 2VG5B 3KLIA 4ED1A 2PT0A 5F3TA 2PI5A 4K4ZA 3LAKA 2GNKA 5G0RB 2ZE2B 3LO3A 1TFWA 3P49B 2GJ2A 3JSBA 1P6TA 1QSYA 1RDRA 1S6PB 3GFYA 2WRMA 3VR1A 2MQPA 3PX0A 4ALZA 1VBYA 5KFHA 1T03B 2XNQA 1S1XA 2B3TB 5DGBA 3KHGA 2EG2A 4TKTA 3ZZUA 4K4WA 1TL5A 2BE2A 4NYOA 3KOAA 1ZM9A 5KFYA 2XB2D 3M4XA 2J0WA 2ZH2A 3NCQA 1R3NA 1AUDA 1RT5A 1XERA 4LJMA 4C8NA 2DGWA 1TZ0A 3PV8A 2Q66A 2HHXA 3KMSA 2DCLA 2A10A 2QA4G 2XO7A 2X1AA 4CZCA 4ZVEA 2Y1IA 3P96A 1CEZA 1UVKA 4KAIA 3MM5A 2RH3A 3SFUA 3CCRS 4L3NA 4B02A 4JI2F 2UV8A 4I0WA 3OTDA 3MMCA 1X4BA 2HMIB 2VA2A 5D4PA 1SUQB 3FEXB 4NLQA 4ELVA 1LW0B 1UJ4A 4GO7X 1BQMA 3PW4A 5GAHI 3B78A 2GGPA 4HVZA 2RRAA 2GMHA 3KNAA 3UI3A 3FJ2A 5F8LA 3G8TA 3J7YU 1RKIA 2LKZA 2K7JA 2QZ8A 2XSFA 2HGMA 3TA2A 2RKIA 3HKZD 1HI8A 3SDEA 4I69A 2GO8A 5AXKA 2HG4A 1Q78A 3SI8A 4K4YA 2ABYA 4ZOSA 1DLOA 5KG6A 5A8KB 2AGOA 3SV3A 3G8SA 4N76A 2P9CA 2EFOA 4QQBA 3PX6A 1H7XA 2J9EA 4AXIA 1N5YB 1W25A 2KTQA 1JLGA 2WAQD 5LL6d 4B3MF 1WF0A 2E7WA 3LP2B 1QJHA 4JV5F 2WB1D 2MQOA 4R0JA 5HN0A 1HMVA 1M5HA 4Y3CA 1K9MT 4QIGA 3THVA 2B51A 4Q8EA 1ZPWX 2CPEA 4IG3A 3NGDA 3PJXA 4PPDA 1VQ4S 4FZVA 4HL9A 3PX4A 4ED2A 1UVMA 2DGTA 3TOQA 1ZM2A 3CC4S 3LWMA 3P3DA 1FKAF 2HLTA 1T3OA 3QWUA 5IQ6A 1WHXA 2RRBA 2R8GA 3HVRA 5E0OA 1S6UA 2ERRA 2ZBCA 5GAGI 2FLNA 3CJ4A 2NXUA 2F9DA 4IFVB 3K57A 2M7SA 2OTLS 3PY8A 2ZH6A 4KO0B 2YY3A 4LSLB 1NJYA 2PMZD 1X0PA 5SUHA 2FVSA 2UUWA 3PEHA 3H5YA 4MKAA 3VQTA 1S9EB 4DFPA 5KT4A 2HHHF 4LQ9A 1LWCA 5KFBA 2CQDA 3E8OA 3SXLA 5HBMB 4Z37A 1H2UX 4X4NA 1JK9B 4F2SA 1C1BA 1I6JA 1WG4A 3HVTB 1TP7A 3I0RB 1JLCB 1XMQF 1N5QA 1QLNA 2BRLA 3LQVA 3M1VB 2W9BA 1KVJA 2YWHA 1C2PA 4QWDA 1ELOA 4C8ZA 3W7BA 3BREA 4WYWA 3JSRA 2MY7A 3U1MA 3DLGB 3C66A 1N52B 3H4DA 5B0AA 3G9CA 3BF4A 1XNRF 4O3QA 3T1YF 2LYVA 4Y2IA 1U6BA 3FSYA 1RTJB 5KT5A 5CZXA 3BGUA 3T6BA 4B3SF 4XPEA 1VQLS 4KSEB 1NJXA 4X4SA 1R27B 2BABA 3OFEA 4IO1A 3QIPA 3O2IA 3V4IB 4Z2XA 2JLGA 4O4GB 3O44A 3MPYA 2XS2A 3MUMP 1JWWA 1S1TB 1X4EA 2VPWB 4YR0A 1SL1A 1U1QA 1JB0C 2CQBA 2ZZNA 1PILA 1S6QA 4P2SA 5DRKA 1T05B 4DLGA 2BJDA 4AQYF 5BYQA 2JLFA 2M5YA 3RRKA 3HHLB 1Z2LA 1U1NA 1NK9A 4ZCLA 4C9DA 4CIOA 3OFGA 5C25A 2LEBA 3AH6A 1TVRA 1M5VC 3K59A 3N6MA 3CCUS 1R8BA 4IFYA 4QBUA 1HNVA 1TL4A 5L1KA 3AQPA 2QEXS 1IN0A 2KI2A 2YNFA 4IOAQ 3DOLB 5HROB 2F8MA 4EZ9A 1XC9A 4JI3F 2FC8A 5AE3A 1WNEA 5E7OB 1YWXA 5LSOA 2YNGA 4RW6B 1IJFB 1H2VZ 1MWZA 3NKYA 3KLHB 1YTYA 3IO1A 4Y34A 3RB0A 4NZ6A 2PSZA 5KFIA 3US5A 1X4DA 2VG6A 3DMJB 3UWTA 2E1RA 4XO0A 1K1SA 4MFBA 4ZDNA 4EO8A 4TU7A 2AQ4A 4ES1A 4C8YA 1H2TZ 3C46A 1X9WA 2HW3A 2RD5C 4ZPWR 4ZMMA 4MAKA 2ILZA 2WHOA 5CH7B 2RUGA 5KFQA 4MK9A 5A8WA 1JX4A 4TLQA 3TVKA 2AX1A 4HT7A 3BN7A 1WELA 3TUZC 3MHYA 2A2CA 1HD0A 3NL0A 4I6WA 3HVWA 4EYHB 4ECWA 3DLEA 4X4PA 3EZ5A 3HZGA 5D78A 4CH7A 2CPIA 2QMWA 3MM8A 3VCDA 2GHVC 2DIVA 5CQGA 1UVJA 2JVRA 5K8OA 4RZRA 3CCVS 1APSA 2R7XA 3AAWB 1F2GA 1S72S 2HS3A 3G86A 2HHVA 4DQQA 3RTVA 1UEVA 4N8NA 4N8OA 2QFJA 2CJQA 4ZPTR 1WTBA 1VRTB 4H4KA 4RKUC 4WIIA 4GMKA 3GV8B 2DNZA 1SBRA 4WCEQ 1Q8BA 1TV6B 2VFRA 3SCLE 4QW9A 1NKEA 1X5TA 1UMJA 5G0RA 2ZE2A 3ENQA 4LF8F 1P9QC 1VIOA 1H3DA 3SCKE 3BQ1A 1U47A 4KFBB 2OAUA 1REVB 1S6PA 1WG5A 3T9ZA 5KFFA 1VQNS 3AA9A 3D0IE 1T03A 3QJLA 2FJWA 3R27A 2PGCA 2G0CA 5FD1A 4DL3A 3HT3A 5GAHU 3SCJE 2ROEA 3DRPB 3BR8A 3DGPA 1NU4A 2GFFA 3OR1B 5DLGA 2HHPA 2XMTA 2FVQA 5L39A 2G9OA 1X5PA 2MKKA 1L3SA 4C3LA 1CG2A 5EHHA 4I4BA 3C6UB 3MURP 5L1IA 4DV1F 2ASJA 4TNOA 2BJEA 4LVOP 1L3KA 2DCUB 4NZ0A 1SKSA 2B4PA 1P27B 1URNA 3EXCX 3EZUA 1LKZA 5CYMB 4R25A 2DHGA 4J9KA 3MTJA 2XMWA 3H5UA 2HMIA 5BYSA 1Q86T 1SUQA 2KZZA 4ES2A 2O1PA 2QE5A 3BGLA 2DNKA 1LW0A 1WHYA 3OJSA 2AYBA 4X4UA 1RT6B 3DNCA 1KC8T 4ZPAA 2FLLA 5AXLA 4ECZA 3RW6A 3IA0A 2IAJB 2LQ9A 4F26A 5FIIA 1HBUB 1QAYA 5IQQA 3HPOA 2OKQA 5A8KA 4HT5A 5EUHA 3I5BA 5AXMA 4LF6F 2B7BB 5L38A 2R7WA 4QIEA 3DC2A