2H5IB

Crystal structure of caspase-3 with inhibitor ac-devd-cho
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
94
structure length
94
Chain Sequence
HKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and kinetic analysis of caspase-3 reveals role for s5 binding site in substrate recognition
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords caspase-3, p17 subunit
total genus 18
structure length 94
sequence length 94
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2006-05-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 2h5iB00
3R7NB 1RHJB 1QTNB 1I51B 2HBZB 3D6FB 2XYPB 2CDRB 2H4YB 2XZTB 3R7BB 2QL7B 2CNKB 2C2ZB 2CNNB 2HBRB 3IBFB 1F9EB 2CJYB 3R6LB 3RJMB 1NMEB 4ZVRB 1SC1B 1RE1B 5IC6B 2Y0BB 3KJNB 1RHMB 2H5JB 2H5IB 2XZDB 4ZVTB 1SC4B 2H48B 3R5JB 2QL5B 3GJRB 2C2OB 1PAUB 1GFWB 1RWKB 2QLFB 3P4UB 2QL9B 1RWNB 3IBCB 3P45B 2CNLB 1RWPB 2HBYB 4LSZB 2HBQB 3GJSB 1RHRB 2Y1LB 3GJQB 2H65B 5IC4B 1PYOB 1RWWB 1SC3B 1I3OB 1RWXB 3QNWB 3KJFB 1QDUB 3EDRB 2XYHB 1RWOB 3NS7B 2QLJB 3D6HB 3D6MB 4ZVSB 4ZVOB 1RHUB 1RHKB 2XYGB 3EDQB 4DCOB 2C2MB 3GJTB 2C2KB 2CJXB 4DCPB 1RWVB 1IBCB 2DKOB 4JB8B 4ZVPB 4ZVUB 1BMQB 1RHQB 1ICEB 2QLBB 3R7SB 4DCJB 4ZVQB 2FQQB 1RWMB 3SIPB 2C1EB 2H51B 2H4WB 2H54B 2P2CB 2CNOB 3KJQB 5K20B 3R6GB
chains in the Genus database with same CATH superfamily
1RTHB 1S7IA 2PEBA 3IWLA 3N6NA 4C11A 4RU9A 5DLFA 4DX5A 3W3SA 3M2RB 2ZUAA 5KFXA 1VI7A 3G71S 3ET6A 2F4FA 3QYYA 1HBMA 5F8MA 2DXDA 1SQFA 4LF2A 2K3KA 2KYZA 4DPOA 1ZZNA 4AYBD 3K5PA 4UOCA 5KFEA 3GFZA 1PJ6A 3DOMA 4DOZA 3PKYA 1FKOB 4GVLA 3HK2A 1CQNA 4TVAB 4IG0A 4WIIA 4IFVA 2YTCA 3A3OB 2D3O1 5C42A 1R89A 3I9ZA 3H2VE 3DXBA 1HARA 2DR5A 1LFWA 2RRNA 2B9WA 2RDIA 3PHEA 1T9VA 2B4PA 2MQLA 2WHOA 2C2ZB 4I2QA 2BANB 5F3TA 4O3PA 3W2VA 5DRKA 2I5JA 3S8SA 4I7FA 3UR0A 3MR6A 3JYTA 2VODA 2R7SA 3T1AA 1T3OA 1TV6B 1A7GE 4USKA 5LJ3Y 4LIWA 3QWUA 1DTTB 5J2MB 2HHPA 1HBNA 3KLEB 4DV6F 1WC1A 1X5TA 3RBDA 2HW3A 2X3DA 1YBAA 1S6UA 3OFHA 2DNZA 3LW5C 1LWCA 1RT7B 3FBFA 4B08A 5F3ZA 3D3BJ 3AODA 4ID5B 5KFFA 3LP2A 4PG4A 4ES3A 1CG2A 2CUYA 2UUAJ 2FUG9 4HACA 2HLUA 2V6AA 2VV5A 4F4ZA 4IR9A 3AB2B 2ZDPA 1PO6A 2MQPA 5HMXA 4LR8A 1X9MA 1QD1A 8RUCA 3BQ0A 1VQ9S 2B9YA 5CH7B 3MM9A 5CD4H 4ECTA 3SDEA 2XO7A 5BJRA 3HZEA 1N0UA 1UW4A 1EKRA 4OYZA 5K14B 1VQ5S 3HKWA 2DISA 2QLFB 1SVDA 3AA8A 1WKKA 2GFFA 3KLGB 2QL9B 1K8AT 1RT4B 1RTJA 1LK5A 3CGIA 3AJ1A 2XEXA 1SC6A 1F3FA 2BE9B 3DRSA 3AHPA 2CWKA 4UTGA 2CQ4A 1S97A 2E5GA 4HTIA 4P9SA 1U1QA 3W9HA 3G2XA 1HQUA 4C48A 3CMES 2XB2D 4JYAJ 1VS3A 3B4DA 1RWXB 4CLSA 2ZH4A 5CZVA 5KFCA 3MHYA 3VALA 2DGVA 2DNQA 4OX7A 1UJ5A 2FTRA 4H4OB 2EFGA 3D6MB 3HHDA 3ZTQA 2VPWB 3F44A 1XIQA 3SYZA 4CI0B 5J1EA 4UOFA 2VG5B 1FRKA 4FNIA 3ISZA 1WTBA 2JJ4D 1LWEB 1U2CA 2RILA 3K2YA 4O4RA 2R7WA 4LF8J 4Q8EA 1X4EA 2MQ8A 1HPZA 2PIIA 4RW9B 5FD1A 1F1BB 4M5DB 3HM9A 3KUEA 2ZH7A 4R8UA 2YH0A 3EGWB 1RU1A 7AT1B 1IBCB 3K5MA 4ZVPB 3RBXA 5KFGA 1ZTTA 3QAUA 4OZ3A 1MG7A 3W9IA 2C2DA 2BA9A 1SQEA 3PFEA 1U0HB 4PR6A 4MMOA 1FE0A 4B3RF 5KFAA 4ZP9A 2HNYA 2YPYA 1N33J 2JHEA 3BDEA 2UV8A 2GMHA 3VHQA 1N5VA 1UVKA 2K7JA 1C0TA 2IM1A 1ZZFA 2XHCA 3OR2A 1FXRA 3LF0A 4O4GB 3GQCA 3OXLA 4NXNJ 2X1FA 2CQ2A 1A0OB 3MPUB 4RW9A 2AYEA 4DUYF 3S1TA 2CQPA 4X4VA 2VG6A 2BJ9A 2P2CB 3S6EA 2QSWA 3PW0A 1OSCA 3CXCR 1PC5A 5BYRA 2DVIA 4F4XA 3JYTB 3TQEA 2EC2A 3L9ZA 2QO3A 1X4CA 1D8ZA 1N5QA 2CPZA 3M4XA 5A0YB 1I5OB 1WSVA 1EX8A 1HNIB 1P9YA 1R0BG 2EKYA 1HMVB 1LWFB 1B7FA 2IJNA 4WP9A 3OVAA 1FKPA 3QBCA 1XNRJ 2ZBQA 5KFHA 2Z2MA 2E29A 2NYHA 4USHA 4NA3A 4I1TA 4N77A 4ZPDA 4UT4A 2GHWA 3W5XA 4O0IA 1N56A 3P5BP 4KHMA 1NPRA 2NYIA 4G1QA 3DLLQ 1NB7A 2XGQA 5KFVA 4RKUC 1DQ9A 5IM0A 1RAEB 2R7RA 3P6YC 4FYVB 3CDAA 1RLDA 2WTFA 1QM9A 2ROGA 3EZUA 3TRGA 3QFHA 4NLRA 3TJ9A 2HQGA 5B0DA 1GXLA 1RAJA 4PG5A 3MUMP 4GC7A 4TQRA 2IBKA 5IC6B 4J9VA 1KWMA 1IWGA 2DNGA 2ZBIA 3I32A 3BSNA 3UD3P 2HVIA 2U1AA 2IDEA 1PSDA 3I0SB 2H5IB 2YWWA 2XNRA 2GGPB 4ID8A 1AFIA 2OKQA 4P73A 1FEEA 4OLPA 2AZ3A 3AT1B 4C11B 1TUGB 3UVJA 1RAOA 1IWAA 4F67A 1BQNA 2MDAA 3H8YA 1DQ8A 1E6VA 1NZAA 3K5NA 1U26A 2DIVA 3CTRA 4RNFA 1JX4A 1TFYA 2Z2ZA 3MEDB 1JNZB 2DNRA 2QL5B 1TKZA 4HL9A 4RWXA 2JFKA 1F3VA 4L3KA 1BE4A 4OX8A 3PV8A 2FLNA 2Z58B 3NNAA 1HD1A 1WEYA 3CJ0A 2P8IA 2LEPA 4LRBA 3CCLS 1UA0A 3QO9A 2FC8A 2Q1LA 3BREA 2BRLA 3SSQA 2C2RA 4X66J 4KKOA 2CPEA 5AE3A 4OYBA 4DL2A 3K5OA 2C22A 2PFFB 2W1BA 3CCJS 2JWNA 4IOCQ 1U6FA 1N6QA 3PW7A 2VH7A 4F02A 4NZ7A 3BKUA 3MMCB 1RHRB 5I3QA 5ETMA 2VG7A 4N41A 4HH1A 2XLKA 2DGXA 5CYQA 4RBUA 2YWGA 2D74B 4ZLLA 1XERA 2JDJA 4ED5A 3UI3A 3RAQA 1CVJA 5DETA 4RJVA 3BQ2A 1JWWA 3VVUA 4HTJA 2ZEJA 4ZDNA 1GMUA 1RTDA 3DDIA 1B70B 2MKYA 1X60A 5D3GA 3CDEA 3UPFA 3KK2A 1C1CA 5IT9Y 3A12A 1RTIA 2RRBA 2IVFB 3SCLE 3UN5A 1LWXA 5KOXA 2M3DA 1B3TA 2AT1B 2PEHA 4ZLNA 3T1YF 3UN3A 3HD2A 1U8WA 5EWGA 3FSXA 4NLPA 2CJXB 5FLXY 4B3TF 4L73A 4DEZA 1SUQB 4JB8B 4MK7A 4ZVUB 3UE2A 1RHQB 2CQDA 2GJIA 1I1GA 3W64A 1JXLA 1X5SA 2BXJA 2ZJRQ 2OI2A 1JLCA 2WSFC 2Q3PA 3QFWA 1XBWA 4H54A 5CYJA 3ZTSA 3VAIA 3RB6A 3FDSA 1TV6A 3I5CA 3OTDA 4IG3B 3KHLA 3BO3A 1RUSA 2V69A 4KY3A 2W4CA 4UOGA 1KVIA 2V94A 3NLCA 3C3LA 3FQKA 2HFUA 4PQUA 2GHVC 3JSBA 4H4MB 4URQU 1R43A 5KFJA 3J81U 4X62F 1VQPS 2E1AA 2HIQA 2YBVA 4CLUA 3V6JA 5EN1A 2B9EA 3HFVA 3PG9A 3LGHA 1Z2ZA 1O8BA 3D0GE 4CLYA 4ECRA 1JLCB 2YNIB 3MD1A 3UR3C 1YRUA 1U48A 3AD7C 2WAQD 1GMWA 4P72A 5JJBA 3MDFA 2Y3YA 2WVCA 5HSPA 2O3DA 3CEDA 4OX9J 1NHUA 2H3EB 2ZUGA 3HHLB 1FRHA 2XMUA 4J5OA 5B0GA 4ZLPA 3Q24A 1U6BA 3FK4A 4X66F 1Y11A 3M8SA 1Q7LB 1AUSL 2JC1A 4F0KA 3UWTA 5K8OA 1M5KC 3ENVA 3D1QA 2KKHA 2R7OA 1IKXB 4C8MA 2LQBA 4CTAB 1X5OA 1IJFB 4LSLA 2DNLA 4M5MA 1YSJA 5J1PA 1VOMA 3DOLA 1KSPA 2NZ4A 5ETKA 1NJYA 1UKUA 1IKYB 1Z4UA 2GS8A 1VYAA 3HSGA 4NPOA 5IV4A 4NLOA 4I4BA 3DRSB 3A3NB 3W5YA 4DN9A 1XMQF 1UVMA 3H59A 5F9NA 4RU2A 2DXFA 1OS5A 1X5PA 2PO4A 1SC1B 4EU0A 4Y0FA 4RPFA 5E3PA 5CHCB 2ZKTA 3KJNB 3ZNJ1 1HYSA 1IVZA 1NPPA 2V8HA 3AQPA 1VQNS 4DV4F 1X0FA 1CLFA 1OY8A 2V8PA 1F9FA 2DY1A 4LF4J 2YKNB 3NL0A 2Y1JA 1BQMB 1A9NB 4USJC 2ZHOA 2AJ4A 3U1MA 2FJAB 2VBWA 1HFEL 2UUWA 2ZVIA 3C14A 4I2QB 1SKRA 4GVBB 5LSOA 1TL3B 3MUTP 5J2QB 3IS9B 2XMJA 4ZITA 3Q2SC 2E5JA 3ITHA 1FFSB 2BV3A 3HDSA 3PY8A 3OSPA 2UXCF 2JFDA 3ADAC 5LL6d 4CO4A 4DX7A 1S0VA 3KLEA 4QJVA 4P10A 5KG1A 3IP0A 3CB4A 1S1WA 1VQYA 4LR9A 3IBCB 4M95A 1X4DA 3TAMA 1N5TA 4Z37A 2E7WA 4Y6IA 1KQSR 2CNLB 2KB2A 4JI1J 1LEOA 4C7QA 2KHCA 4DR4F 2WSEC 5KG7A 3J81Y 3MUVP 5KT4A 4HKQA 1T11A 1J2VA 1AA1B 2PGCA 3QRPA 3I9V9 2BQ3A 4HYKA 1FKAF 4DSLA 4JBCA 1S0NA 1DAXA 1WDDA 2DRBA 2IJRA 1TKTB 2IC3A 5ETPA 2JLEA 1QDUB 1PCAA 4PKDB 3W63A 4H4MA 4F4AA 1WACA 3GCWP 3LA0A 5KG2A 3OUYB 3OW2R 3D6HB 4IRDA 1OPZA 4FKYA 3G86A 1V3SA 1RT1A 2M88A 2F8HA 4QCLA 1D09B 4FS2A 4ILLA 2AIRB 3UCZP 1VBKA 2YNIA 3Q8VA 5LJ5Y 4B3OB 2G0IA 4ZVFA 2B56A 2AEJA 3KYLA 2FGOA 2B51A 2MMYA 4Y2MA 2R2UA 4USTA 4LJMA 1S1TA 1REGX 2W25A 3ENQA 3HX9A 3PJXA 3D3CJ 1HBOB 3ZC4A 1PC4A 1SB6A 3CJ4A 1N4LA 3P49B 1HR0F 3H4BA 2XMMA 1HWJA 1WF2A 4DWIA 4AXJA 5H9EK 2WONA 2DNYA 3F41A 2AWZA 3HHLA 2F8MA 4X62J 3PZPA 3D68A 4LRFA 3MMAB 4CH7A 5DDOC 2HMIA 2XBPA 1RGVA 1NK8A 1HBMB 4LFAF 3OL9A 2EWHA 3DLGA 2PMZD 3HXMA 2HFVA 3PX0A 2LA6A 3KMSA 1PBUA 1N88A 2QA4S 5JVHQ 2HFSA 2KZMA 3FMBA 5F8NA 4LF4F 1HKAA 2CQ3A 5D15A 3R6GB 4C8OA 3MXHP 2VKRA 5J1EB 3GSDA 4JV1A 5KOWA 4CLWA 1H7XA 1FK9B 3ZTOA 4Z2XA 2MEWA 3H40A 4UF4A 1SQGA 3BPDA 5HQMA 4P74A 5DG9A 3UN2A 4F3OA 1Y00A 4QBUA 2FJEB 3CJ5A 3CDWA 1HYSB 3ZFVA 2LLZA 3KDOA 4R8UB 4W90B 5J2MA 4KGZB 3JAMU 2XS2A 2BJDA 1HNXF 1MMLA 1C0TB 3RRKA 2HS3A 1NJZA 5KT7A 2KJWA 4DQQA 8AT1B 4KKOB 2YKNA 3OSNA 2LQ9A 4ZP6A 1RAFB 4Q45A 3BBBA 3PVXA 1HA1A 1PG5B 3MECB 4B17A 2ZBRA 1KQFB 3R2DJ 3KKFA 2O66A 4RZRA 4UQGA 2MYFA 4EYHB 2MHEA 3MEGA 4QPTA 1TKXA 2CJYB 1MU2B 2DB1A 1NMEB 5L9XA 4F4WA 2AD9A 2CQBA 1RABB 1FFGB 5CZXA 2ZZTA 4I67A 1HLWA 1YQHA 1FD8A 2Y0BB 3V5RA 1AFJA 2IYIA 4KBIA 4P6QA 3TUPA 1T03A 3GB0A 2OPPB 3PDNA 3VVTA 4YY3J 1XC9A 1WWHA 2G0JA 2QV6A 1RCOB 2JLFA 1VQOS 2LKZA 2HNDB 2BANA 4K2XA 4LBIA 2JLGA 2EFVA 2C2EA 1Q82T 2HWTA 1IBMJ 3HJVA 4JI7J 2MZTA 3FBCA 1R3NA 4OHWA 4OZ2A 3T41A 1RA6A 2VOOA 1ITPA 4CRJA 3HCXA 4ILMA 2UUBJ 3ZZOA 1YI2S 1LV5A 2YPZA 3DGVA 3IR5B 2PMHA 3SMZA 4DXLA 2VA3A 1TVRA 1VBYA 1HQEA 1HI0P 1OYDA 1R8AA 2E7VA 4KIAA 5CCLA 4H4OA 1QAJA 4HACB 1BC6A 4CP5A 5L1IA 4EMDA 1FNOA 3LQVA 4C2MA 4DL7A 3CCMS 3MM6A 3OXFA 4Y2AA 4DU8A 3NP5A 4JI4F 3FEXB 1X9WA 2BUNA 2H65B 1ZM4A 1S99A 2O5DA 2QE5A 4MKVA 4WJBA 3MEKA 4P2SA 3U7JA 3WC0A 4CQ1A 2RU3A 3NOCA 4A8YA 5T41A 1SJ4P 5AT1B 3U1LA 2DPJA 4B9LA 3MTJA 4ELUA 4E98A 2B3TB 1MMNA 1NU4A 3AAWB 3QGPA 2QJ3A 3RGIA 1U1PA 4K4SA 1KQGB 3GG1A 2HFZA 2CADA 5KFYA 5M2PA 1UP1A 2E7XA 1UL3A 2AZ1A 3HF5A 3DLGB 1KS2A 3IO1A 4Y28C 3RRHA 5DG7A 1M90T 2BOAA 4DR7J 5GAHU 2ZC4A 4DDFA 2M2BA 4G6VB 4KHPF 1FK9A 1R6VA 2RHQB 2ALYB 1S1UA 2GHPA 3GP9A 1L3KA 3KXDA 3QO9B 4KV8A 2GO9A 4DF4A 1ZTWA 4DQIA 3PJ9A 3F56A 1H0HB 1B99A 1T0TV 2ZNZA 3AD9C 3DGPB 4MTPA 4Q7AA 2C28A 4C3MA 2K3IA 5K5MA 1MW7A 4OHVA 3EGNA 5IFMA 4KTQA 3H2LA 1NH7A 3ET6B 2CVEA 3QT7A 3TVKA 3TAQA 3OPKA 1SH2A 3AY0A 4C3LA 1VIOA 3GTYX 5L46A 2CPDA 1AZSB 2KJVA 4HVZA 5LMUF 4IQMA 5A0YA 3E01B 4XDCA 3ILIA 1FO1A 4MYTA 3GIKA 5KFDA 5E2QA 1QJHA 4PCQA 5KFLA 2DNKA 1NEEA 1ZM2A 3EYZA 1ZPVA 3RR8A 3ILJA 3CCZA 5I3PA 2BX6A 2HVDA 2IDLA 5KFRA 4DBQA 5E41A 4WKRA 1HNWJ 3A3PB 2C3UA 1ZYQA 2DH9A 4Q0BA 2D3ZA 1S9EA 2LDYA 1RT3A 4KQZA 3ZZZA 3NGDA 4K4ZA 2QLXA 2IY5B 3MPWA 1WELA 2ASYA 2M0GB 5IM0B 2IHR1 2OPRA 3W60A 3DRYA 3DKDA 4DFJA 1HBNB 1Q5VA 4ED8A 1VJQA 4O3OA 2EBEA 2GZOA 1FWPA 2V2QA 2VUGA 1R8CA 3LP1A 4WKYA 3GIIA 3V81B 1UWBB 4PUOA 1FJGF 3MF5A 1PJ7A 3DI6A 3NGTA 3NCRA 5GADI 2ZC3A 2ZOFA 1Y0HA 3IRXA 2X1GA 4NLUA 3Q86A 3W8GA 3RB3A 1HWLA 3I5AA 3IGNA 1Q0NA 3W62A 2Q79A 2Y8YA 3D0IE 5K8PA 1NUEA 4HDGA 2R9LA 4B3MF 1JLQB 2DCLA 3AXKA 2YNFB 4K4YA 4USVA 2W8KA 1EETB 2HBRB 4PABA 3OTEA 2FHOB 4OX6A 3V4IB 1GK8A 2J6SA 2FVCA 1JB0C 3RG6A 3LANA 2CPIA 3QRQA 2MKIA 1C2PA 4ZVRB 3T1HJ 5IWAJ 5F8JA 3BSAA 1LW0A 2UVUA 5D0GA 1OPIA 2CPHA 4F2RA 1X31C 4LSNB 4AT1B 4ZIWA 3GSIA 1TKTA 2G2OA 4KHPJ 3VGSA 3J7YU 5LT5A 2CJBA 2UP1A 3TZZA 3HULA 5DO2A 5LSRA 2JEIA 1NJWA 1RJJA 2CPYA 2UV8G 4BLGA 3PW4A 3E3XA 2NZCA 2OPSA 3NS6A 1LK7A 1SJ1A 1UFLA 3K89A 4U95A 1UMJA 1VQSA 3DRRB 4FYXB 4WE1B 5C2GA 1S4EA 3N5FA 3NCPA 1T9YA 1UAWA 1HBOA 3I55S 3VR1A 1FRLA 4O3RA 3E51A 3DMJA 3SXLA 4ELTA 2WONB 1EP4B 3DGPA 2VL1A 4X4OA 3MECA 5L1JA 3H20A 3NAIA 3OHAA 4DR6J 4N56A 3LPEA 2QEXS 4OJ1A 1RAGB 2HBYB 2V34A 4I7FB 3FSIA 3R5DA 3LGNA 1G1XA 3NS5A 2Z30B 3K59A 4K5SA 1BQMA 3BDPA 4FF1A 2DPIA 4DV1F 2CRLA 2O01C 3TX0A 1V5VA 3I82A 1HI1A 3AOBA 2I6WA 1FWLA 1XWLA 2V9KA 5HMZA 1DJ0A 4DR7F 4JYAF 1WG5A 3LOUA 1N54B 4RW8A 4K4VA 5F8GA 2DH8A 2WOMA 5HANA 4N5SA 1WF1A 2MKKA 2NSCA 3G6XA 3KHHA 2XYHB 1NJXA 1ZH5A 2MSSA 4PWWA 1PJ5A 1WSRA 4CWBA 4TY8A 8ATCB 3EUNA 1X9SA 2HFOA 3BGUA 3MM7A 2E9RX 3KHGA 3QSIA 3PYEA 5A76A 1X4HA 2HQ3A 4NYOA 4ZPBA 4DCOB 4RLEA 5IXUA 3GIMA 4XPEA 1RT5A 2MGZB 4DV3F 4NLSA 1YGYA 2VFTA 4HH0A 4IR1A 5J2PA 4ZA1A 4LF5J 2FVRA 2R8GA 2JX2A 3N5BA 1GX6A 1DLOA 3GZ7A 3WZ0A 4N8NA 4N8OA 3CJQA 3O44A 4KE5A 2DHGA 3VZHA 2MXYA 4ZPCA 2ZH8A 2DIUA 2V0NA 3I96A 2VJVA 1XMQJ 2E1RA 3AFGA 3LP1B 4CYUB 4DCJB 5A8KA 2I5JB 2W7AA 1HNWF 4ZVQB 2A0FB 1VQ6S 3B4MA 1RWMB 2V2ZA 1TL1B 2A1BA 2J8AA 4YFUA 4ERDA 3D9BA 2WRMA 5D4PA 4TQSA 3MM8A 1SV5B 3MAAB 3K58A 2NXUA 5F9LA 4BWJA 2DBBA 2F3JA 2I1RA 2RSQA 2F1FA 4NEZA 3G8TA 2CNOB 4B3OA 4ES2A 1TU0B 3PACA 1SUQA 4DLGA 2E1CA 1KP6A 3PO5A 4ES1A 1EQMA 5HP1A 2GQ2A 2AJ0A 3HVTA 4FPRA 4HT5A 4KGMA 1RQ0A 5IZHA 3RRGA 1HWIA 3UDLA 1CULB 2VOPA 2RVJA 3MZIA 4J9MA 2Z57B 1FDBA 2ZE2A 4DPYA 5KFIA 2M4MA 4DZDA 4E0DA 2QIFA 3TZWA 3UNGC 1S1TB 3N01A 1S6QB 2KXHA 4LSNA 5LSLA 4DFPA 1J5EF 3DNCA 1YKWA 5EDWA 4JI5J 3D0HE 4ZJOA 5D0HA 4DLEA 4RBVA 1Q1KA 1EIYB 1VC5A 1ZETA 5GADU 2DNNA 2QYCA 1M1HA 1TUVA 5LXRA 4NA1A 1RT4A 1VISA 3IAM9 3G82A 3T9ZA 2CNKB 1VQMS 3MEDA 1T8EA 4QYZJ 1RLCL 3DMJB 4ANEA 1GH8A 2LXUA 3TVYA 2J8SA 4K0KJ 4WIQA 4IH5A 2GO8A 4K59A 2E66A 1Q4RA 2ZH3A 4M5JA 3CMAS 3V6DA 2KRBA 1M5PC 5IT9U 3FUYA 1JKHB 2FYXA 4K2JA 3RZAA 4FN5A 3S7RA 3UDEA 4BC7A 2CQGA 3BKTA 2GNKA 2H5JB 4I6AA 3UCGA 5J2PB 1M1KT 2XZDB 3PRBA 1FX4A 2UVWA 2ZH6A 2V67A 1FTRA 1T9UA 2GIRA 2WOMB 3VAGA 5HLFB 1IKYA 2ZWOA 2KDOA 2B43A 2M70A 4ETXA 4X65F 2N7CA 3QLHB 3PIPQ 3MCMA 3VGVA 4CNYA 2ZVSA 2E44A 4RW8B 4USMA 3X1LB 1NHVA 2J9EA 3DI6B 1IUJA 4QR0A 3SZ2A 1JLFA 1UW9A 3BSOA 4HHJA 4J7CA 3V6DB 2J0XA 3HVRA 1RWKB 1J27A 1MROA 5ETTA 3FFIA 3M30A 2RU9A 4NLYA 4WFYA 4DV5F 5C24A 3KNAA 1U1OA 4DL4A 5KFOA 3MD3A 2ZD1B 2XSFA 4W92B 4LVOP 3J80Y 3P45B 1RTIB 2OIHA 3OFFA 4M5GA 4K5RA 2IVYA 3Q8QB 2NQPA 4ZMMA 1HI8A 3GMGA 5ITHA 4CYUA 3BH6B 3TX8A 5A8KB 3BYPA 4DZ6A 2IIHA 2Z2YB 2BE2A 4OI6A 2CA9A 5FJ4A 5RUBA 3KUGA 2VIHA 2CFXA 3OT9A 3QIPB 4JV2A 4GKJJ 4PRFA 2YKQA 1RADB 2MKJA 3EDRB 4OI4A 1PILA 3MWBA 4CO2A 2LDIA 3UQSA 4CT9A 2P6TA 2HK3A 3Q89A 1GXTA 1S12A 2B5JA 2CWXA 4OI3A 4CH0S 2HZAA 2D1CA 3RAXA 2HYIB 1GAOA 5J1NA 3I4PA 3MEEB 4NXNF 5KFSA 4JOUA 2FVSA 4JI5F 4JI6J 3M2VA 1SV5A 3MAAA 2RQKA 5HK4A 1RYRA 1EJ7L 4RW4B 4ZS6A 2RJZA 3Q8RB 2B4OA 3G96A 5F8IA 1JLEA 4PPZA 4YEAA 2V68A 2WVFA 3BS9A 3WIVA 1L3UA 3E2EA 1NDKA 2XLJA 1YJWS 2DKOB 1BHNA 2GAGC 1BMQB 2UZAA 3R8YA 1BGXT 2XGPA 1DZ5A 4Q44A 4MIWA 3GV5B 2W9AA 1REVA 3C6TB 1S1VB 4U8VA 4F04B 1MWYA 3M8QA 2DR8A 3MEEA 4WTOB 2KFNA 1U45A 2OPQB 2J9CA 2R8IA 4QR1A 1CJVB 2RS8A 5A2QY 2DEIA 3EXCX 4FF2A 1FF2A 3CVKA 4GO5X 5H9FJ 5F8LA 3CJ2A 4C8LA 2ZJPQ 2DK2A 2FGCA 3MPYA 1WORA 4ECVA 1TL5A 2H54B 4A46A 4CZCA 4WCEQ 5GAGU 1M0SA 2XY5A 1VLOA 2BKOA 2W7PA 3R1HA 1KFSA 3K17A 3NG8A 2DGOA 5AXKA 1J5EJ 5KG4A 2XCAA 4EO6A 2G9OA 4OLOA 1V5IB 3BR8A 1K47A 2A2DA 3OBIA 2D9OA 1QLNA 1BQNB 5JMNA 3JB9k 2HMIB 1TAUA 3Q0AA 3NMRA 3M2UB 2VZ9A 1N48A 3L95X 3DHWC 2HS0A 4QZVB 3K0JA 2HBZB 3PX6A 2ZNYA 5ETSA 2GJFA 2HQCA 2MY8A 3J7ZT 3CW2C 4GKKJ 2ZHAA 2BOPA 1H2TZ 5ETNA 2ILZA 4NLQA 2XYPB 1QUPA 2VB6A 4U7UK 1S5ZA 3QLHA 2OD6A 3ELHA 2B0GA 4EWTA 1VFJA 3KLFA 5E3RA 1DHMA 5C24B 3QGHA 1TL3A 2AKWB 1U1NA 3NNHA 2BE7D 2EG1A 2RMLA 3TNVA 3W2WA 4DJBA 1P9QC 3DDNA 1LXJA 3NY0A 3R6LB 3Q8PB 2W8LA 4J9RA 4DFMA 5G0RA 5KFNA 3G6YA 4DL3A 2R8JA 4LF8F 3VZIA 2VHGA 1EB0A 1Z2LA 2GCFA 5IS2A 2XLIA 4LFBJ 2JH3A 3KJVA 3EPGA 5LMNF 1F5CA 4JI3F 2I9SA 2P5VA 4PXCA 1S49A 3NGKA 3OL6A 2KFZA 3BF4A 2CZ4A 2HAIA 2OFGX 3K7RA 4CO0A 2YX4A 4EO8A 1N33F 4ATNA 1SXLA 2KU7A 2YKMB 2BW2A 3UCUP 2DGWA 3O8WA 3W2WB 1YJ7A 3R3TA 1S57A 4HHUA 4KH1B 3W61A 4C8ZA 1BUXA 2HRTA 2MZSA 3I5BA 4JV0A 1FX2A 2HEKA 5L1LA 5B0EA 1S7HA 3POTB 2UXCJ 4PYAA 3IG1B 1DLOB 1KKHA 2QLWA 3NGRA 4RUBA 1XK8A 4E8UA 2WVDA 2YH1A 4LSLB 4NLGA 3HJFA 3BGRA 1OY6A 1YJRA 2Y0SD 3V4IA 3M9NB 1K0VA 2YKMA 3M8ZA 2APOA 1JJHA 4MH8A 3H5SA 1Y7PA 3UDCA 3M9MB 1FJ7A 4C97A 2WZ1A 3OD2A 3PTWA 4ZPVR 4PWUA 4IKAA 1N5YB 2YQ1A 4LQ9A 1XNRF 3NMAA 1H2VZ 4B9TA 3QNWB 1UFKA 3ZZRA 1XNQJ 2J6TA 5HMWA 4J37A 2DY9A 5KT5A 1WHVA 1W7WA 1UVIA 3L7PA 1SKUB 4MJKA 3MMAA 4PEOA 2F9DA 4P71A 4BWMA 3TP2A 2X7IA 5GMDA 2HVEA 3FMWA 1GT8A 2RT3A 1KFDA 1RHUB 3CD7A 1RT6A 3L09A 2CG8A 2ZOMA 2R2SA 5L1KA 1ZM3A 1VGYA 3E01A 5L9NA 2JEFA 1UCNA 3EMTA 4TU8A 2CJKA 3GR1A 3MM5A 4EYIB 2RAQA 5C5JA 5DJBA 4OZ0A 3RBEA 2K7KA 2BM0A 3GJTB 3D4JA 3C19A 3EPIA 2QSFA 4UZCA 2L08A 2OAUA 3HI9A 3L3CA 1TK0A 3J7AN 2B8PA 4F50A 4DR3F 1T7PA 1EKSA 3A8EA 4KH0B 2J0QD 5H9FK 2QLBB 3J7YI 1U1RA 9ATCB 1VC6A 3BN4A 1G2EA 1BQXA 2ZH2A 1S10A 2EG2A 1VCTA 4Y00A 1T05A 2Q6CA 2R7UA 1S1UB 2ZJQQ 1CEZA 1AYEA 5DGBA 2QA2A 3TA2A 5IT0A 4ELVA 2BQRA 4R0EA 5IOLA 1CJUA 2WCXA 2FB0A 2XI2A 5EX0A 2I2YA 1H6KX 3CF5Q 2O67A 2CQIA 4TY8B 5DM7Q 2HWHA 4ER8A 2AGPA 4DQSA 2NREA 3CD6S 3ISND 1CJTB 5JUMA 1TMJA 3A8KA 3I0RA 4FYYB 3M8RA 3WDOA 4DR5J 2VICA 1FVSA 1TUWA 4A8XA 2CJ9A 4J9PA 2AF6A 4OYIA 4GC6A 3DCAA 1NK6A 4Q2LA 3W8PA 2GIFA 4L74A 5HN0A 3P96A 1HHSA 3FEZA 4ZPTR 2OEKA 5EHHA 4Y34A 3BZQA 4ILRA 3ZZ0A 1MROB 4NRTA 4YB1P 1AB8A 2G1HA 1OQ6A 2ZH9A 1HHTP 1EAYC 4LFBF 2XZTB 4IG3A 3R7BB 1V3ZA 3M05A 3OL7A 5LMNJ 3G87A 1KEKA 4JI3J 5EWFA 1RBLA 1CBKA 4JP8A 4Y2IA 5EWEA 2FY8A 1VHIA 4DSJA 1WOOA 3RJMB 4DR2J 2Y9HA 4FZVA 3TWZA 2OFHX 1RE1B 1U09A 2KM8B 1OWXA 6AT1B 3T1YJ 3IRXB 2VFRA 1K9MT 3B8HA 3WX4A 2EW9A 4B3TJ 5EUHA 3VGTA 1NK5A 2IVMA 5DDQC 1T95A 2YKAA 1EP4A 4NLWA 4J9UE 1B0TA 2XMWA 4WPAA 4YB6A 2V63A 4EI2A 3DFEA 4XK8C 3PR5B 1IBMF 2B4VA 4X4NA 2G2ZA 4N47A 1IBKF 4KR0B 3H5XA 1RT6B 3JSMB 4WXOA 4DL6A 1FCAA 4DR3J 3C66A 3DLKB 4QIEA 4PXBA 5GVQA 2CJQA 5CYQB 4ZVGA 2IYGA 5DQIA 4BC9A 2EXUA 3KK1A 3PW5A 2VF3A 2C3YA 3OR1B 1IR0A 1MLAA 1OQ3A 5AJ3F 5THWA 5MAOA 2VPXB 1NBEB 3GU0A 4NOHA 2XY7A 1OO0B 3C6UA 3TYTA 2E9ZA 1BWEA 3BSCA 3V6KA 2Q66A 4IQXA 3TOQA 4ITSA 3PNIA 3KHRA 3D28A 1GTEA 3BPSP 3WX8A 3Q23A 4DV0F 1EHWA 1XR7A 1RISA 4LRDA 4QOTA 5E0OA 3CCSS 4J91A 2X1AA 4C0BA 1APSA 1PYTA 4DS4A 1AROP 2HVZA 1WKJA 2VFSA 2RS2A 2M8DB 3QJPA 3LO3A 2V8GA 4OL8A 1RHKB 2HVHA 4GVBA 5ETRA 2FJXA 2L9WA 4ZCKA 2VD3A 3SFUA 3CC7S 3BGOP 4L72B 4ED6A 3SI8A 2MZRA 1S72S 1SIZA 2FIUA 2YX7A 3P5TL 4QWBA 2GW8A 4K50A 1OSDA 1UTAA 1SH3A 3FCVA 1H3DA 2OPRB 3T9NA 4OZLA 1SI9A 4DR2F 4ZPAA 1FI4A 4QWCA 3KLFB 1IKWB 5G4DA 3F73A 4N76A 1TK5A 2ALZA 4BHQA 2I0XA 2M9KA 1B4SA 1QVGR 1AUDA 4IO1A 2JEJA 1T9WA 2BRKA 3TA0A 3J7A1 1Y10A 2RE1A 3HFKA 2VQFJ 3N4WA 3CCUS 2Z0GA 4FVMA 3FZ2A 4I56A 1U49A 3FCHA 1EETA 1FRMA 3GYGA 4M5IA 1ZA2B 2HKEA 1BWVA 4OIXA 3WC2A 2J5AA 1YJUA 1IKWA 1TFWA 4NYZA 2X51A 4URSA 4JI1F 4LBPA 5D4OA 3CIZA 4K8RA 3IGVA 4F0HA 2BABA 3T5HA 1N32F 2EC0A 2KYXA 3D1OA 4USWA 4KV8B 1N32J 4RNHA 2R4FA 1S1XB 3QT8A 1FRXA 4UY85 3MFHA 3C6TA 1O0PA 2H5EA 3A13A 3EGZA 4X64J 5K14A 2MJNA 1NK4A 2OPQA 1XMOJ 4M5LA 4M5HA 2V4QA 2DGTA 4ZJQA 5HLFA 1CULA 1WC4A 2MTLA 4DPUA 2IBOA 1Q79A 5A2QU 4NE9C 1R0AB 2F40A 3DRRA 2CNNB 2DGUA 4KFBB 2XNQA 1SJFA 4PXEA 4G1IA 3G9CA 5BYQA 3CCVS 5E3QA 5I3UB 2B7CB 2VFUA 2MQMA 5GAEI 2BKPA 1HBUA 2LVWA 3EZ5A 1RTHA 1CJUB 4QWDA 4P2XA 1IBKJ 3PIOQ 1HQUB 2FZCB 5A8WA 3G6ES 3THVA 2F5GA 4ZOSA 3G82B 2AGOA 3WHIA 2RQ4A 4QPXA 3QT6A 4ZVTB 4YR3A 3O2IA 5D77A 3N6MA 4DUZJ 2EVZA 2H48B 4PUOB 3ENAA 4L75A 2LU2A 2IRUA 4YDXA 3T19A 1CJKA 3CJRA 4WP8A 5AJ3J 4A8SA 5M2UA 2C2NA 1Q8BA 1UFWA 3OTOJ 3SV4A 1U1LA 1OMSA 3CT9A 4NWBA 4MYUA 1PAUB 1O5JA 4OFZA 5B7WA 4PWDA 5C2CA 1ZBTA 5HVFA 2DT9A 2YWKA 2XSJB 3DU5A 3BB5A 4QIVA 5HBMB 2OO4A 5HQLA 2RHSB 4DV0J 4DR6F 4F26A 1PAEX 3ZTRA 3CJTA 5GMKa 4LSZB 3CULA 1QE1B 3PCOB 4RW6A 3J7Z5 4MK8A 2J7WA 3GJSB 4OI1A 3UFCX 1NDPA 3BR9A 3EVOA 4UUWA 2U2FA 1Q95G 2MQNA 4YR0A 5C7PA 4O4GA 1FVQA 3MTKA 2CVIA 4ZPWR 1UPMB 3KJFB 2ASJA 3LP0B 4ZCIA 2J76E 4PXDA 3Q2TC 1RWOB 2F7VA 2BEFA 1SJ3P 2Y8WA 3EZOA 1CJTA 2HSEB 5DGAA 3I31A 1NXIA 4J9NA 4DFKA 4IOAQ 2EFQA 2DRDA 5BR8J 1SIWB 1VIXA 2BYCA 2RNEA 3LUYA 1NRKA 4KT0C 4DX8H 1RP5A 1VRUA 3PXGa 1ULRA 3AXMA 3JSMA 2Z8QA 4FF4A 3BJYA 1WEXA 1XMOF 3TA1A 4WK1A 1U4BA 4OZ5A 5HQ8A 2C2KB 3KG0A 2VA2A 1R7IA 5T7LB 2ZDOA 3TAPA 2BJ3A 3LTOA 2AYGA 1S1XA 3SQOP 3KK1B 3GG0A 2MKSA 2VDHA 3Q8SB 1IR1A 2KG1A 4LRCA 2OP5A 1FXDA 1EQ0A 2OLWA 5KT6A 1NHKL 3QAEA 2LCWA 3M2VB 3Q8YA 3DLBA 2DR6A 2FQQB 1WC3A 4UUXA 4JI7F 4GKKF 1HNVA 2MPUA 1VMBA 2GJ2A 3FQLA 5MLCV 2XC9A 4J9OA 2C1EB 1R27B 2H4WB 2PSZA 4FXVA 1WHXA 2QTWA 2XG8A 2JRSA 3KDNA 1SL0A 1NSAA 3M1VA 1Y5LB 2BKNA 3CCES 1FTCA 4WU3A 2HQIA 4K4UA 4FXDA 3MCNA 3ZZTA 1VRTB 5KFMA 3RB4A 2HHHJ 3ZZPA 3OTCA 5KFQA 3TUJC 2MJUA 1WDTA 1ZAXA 1X4BA 1WC6A 4DG1B 3W1YC 1RHJB 2CQ0A 5B0FA 1HQ2A 4RNNA 5CXTA 1G3OA 4USUA 5LM7E 5KFTA 2HHSA 3D66A 4PG7A 4ANDA 3CJKB 1H38A 1Q16B 2D3UA 1WC5A 3CCRS 4U7UD 3HVAA 3HHLC 4LF9J 3JSRA 2DGSA 1IKVB 4X4RA 1GNKA 5D6GA 1T03B 5GAGI 2QFIA 2H4YB 5HROB 4IRCA 2EFOA 3D7SB 2QL7B 1T3NA 2XSJA 3N0VA 2IMWP 5DZ7A 1F9EB 1JLFB 2HK2A 3KG4A 4IH7A 1KRPA 2FLPA 2KRRA 4KPCA 3DLHA 1XQIA 1VQ7S 3KTQA 1URRA 2DHXA 4RW6B 3MPVA 2RKIB 4KB7A 1OYEA 4F3MA 3RUBL 1RSCA 2RD5C 3I6PA 3DDKA 4I64A 4LBHA 4DUZF 1IKVA 3ZXWA 1TL7A 5HBMA 2E9TA 1WTFA 1RBAA 4N7TA 4Q2MA 3V4MA 3OTOF 2E5HA 3BBFA 4HI2A 1WOSA 3IR6B 3OXGA 3QMQA 4NEYA 1D8YA 4WWSA 2ACYA 1LFPA 4UW2A 3D1HA 3MOZA 5B0BA 5C42B 1FKPB 3O3LA 5HL7Q 1UZDA 1ZS6A 4AL5A 4X65J 1L5UA 5LMUJ 2EKNA 2ZE2B 4URGA 1RWUA 4RL1A 2NPIA 1KVKA 1Y9OA 2VBZA 3SSRA 3GIJA 1NK0A 1U6ZA 3BN7A 4HEA9 4G1QB 4NI2B 2ZBPA 3N6LA 3DU6A 4XAKA 2A10A 4AXIA 1VLYA 2HAFA 1IQZA 4I69A 3IM9A 4O3NA 4ZLJA 1WNEA 2LYVA 2QN6B 4CLKA 4P75A 1RWNB 3M9OB 4DL5A 1K1SA 3BV8A 4WF9Q 2LQ8A 3CE8A 3ENWA 3PYFA 4A48A 4XPCA 3PJWA 3VAFA 2QT7A 1LW0B 1FFWB 2Y1LB 2PA8D 4RW7A 4WXWA 1RI7A 3ZZUA 1HW8A 3MI7X 4FBTA 2LXIA 3HSJA 9RUBA 4O0NA 5BR8F 4Q0BB 1U2FA 2E1PA 4NASA 2V4RA 1CS4A 1H74A 4TKTA 1WKLA 3JTPA 3CCWA 1G7CB 1YG0A 5L8RC 5A8WB 1J5OB 4LF6J 1CJVA 3ZZYA 3R27A 1Y3JA 1VJWA 1WHWA 4FDFA 1HNVB 1NLKL 2B8QA 2BACA 2J7UA 2K1RB 2W2PP 2YNHB 3BM7A 3KWMA 3OR1A 1PYSB 1K44A 4ZVHA 4DUTA 5B0CA 1F0XA 1JJ2R 4ECUA 2QMUB 1T05B 5DDPC 2KVIA 2FJWA 2HS4A 4F2SA 3T1HF 4DSKA 3ETMA 2C2MB 2ASDA 3PEJA 4D3GA 2V2KA 4E2FB 5F41A 2J0WA 1RWVB 2F65A 5D0EA 3M8PA 4A8QA 1YK9A 2BQUA 1S9EB 2NXJA 1QUVA 4KAIA 2LXFA 1K0TA 3R7SB 4LF1A 2CPFA 2CYYA 2K1RA 2YNHA 4NCGB 3CJKA 2XO6A 4Y2KA 2HHHF 3V81A 1W2IA 1Q5YA 2HRYA 4GMKA 1SPBP 3V6HA 4XIUA 2RUGA 4RX6A 1U24A 2EK6A 4CO3A 3T5LA 3H2UB 1I94F 3KJQB 3PFOA 5K20B 2RF2A 2EFPA 1YDLA 4NL5A 2RKIA 1U8SA 2YY3A 4QU6A 1RTZA 2O1PA 3OTBA 3ULHA 1YHQS 3BQ1A 3FNNA 2BDPA 4ZJLA 4LF9F 2V4JA 2VBXA 5U47A 2KO1A 1WUUA 4EUVA 4Q5VA 3THPA 4ECQA 5G0RB 3CSKA 4DV1J 4J9KA 2HHUA 3Q8UA 2XS7A 2NCKL 3CCTA 2HNYB 4QYRA 1NSKL 1S76D 1KLNA 1TL7B 2V5HG 1JLEB 1Q86T 2HG4A 1VQLS 1S6PA 3EVWA 2ZOGA 4CM2A 2D7SA 3LH2S 4RR5A 2HZVA 2E5IA 3PO4A 1KNZA 2HNDA 3VF0B 2XI3A 3ITHB 1Q8KA 3MR2A 2VQEJ 3NXZA 2WBMA 4RO0A 3FC9A 3ISNC 2HNZB 1YVFA 3CDBA 2CDQA 3QT5A 3CNQP 3FBBA 3MFIA 4V19J 3IBFB 2IAJB 4PAAA 3LAMA 2J9DE 4PQUB 4UOHA 5F0UA 3TAMB 1TVRB 3JSYA 4OYAA 5BXIA 1LNQA 4DV3J 5F8HA 3RB0A 3DOKB 1YRTA 3I87A 4B9NA 5IT4A 7FDRA 3BGRB 3N79A 3IC1A 3IN5A 2IA0A 2WB4A 4GRSA 2LFVA 1KTVA 1RHMB 2L9DA 4OMFG 2KG0A 4C8KA 3ICLA 3TEHB 2YQ0A 6FD1A 2B5JB 2NXEA 3M6VA 4DPXA 2K8GA 4PG8A 1R6YA 5ETVA 5SUHA 1C4CA 5KG5A 2HFNA 1T9TA 2HHTA 1D1UA 4ZIVA 5FLXU 2BJEA 2BM1A 2WB1D 3M6UA 3M2UA 2GIQA 4PPDA 3HP6A 3KLHB 4V1Ak 3UW1A 3PYDA 4M5NA 2DCUB 3MMJA 2W4PA 3P3DA 3W9JA 3X3UA 5HVGA 2UVVA 2VFVA 2V50A 5T7LA 3JQKA 2YKOA 3CCQS 3OFGA 1NCLA 3N28A 3MR7A 4KO0A 3EVMA 4Y3CA 1NKBA 4PG6A 1SL2A 3DC2A 1LW2B 1F6TA 2DNOA 4L3NA 4NZ6A 3R97A 4CIOA 3H5YA 4LF5F 4BS2A 5B08A 2DITA 2GGPA 2HRUA 2GVDB 4LT6A 3B6BA 1PYOB 1P1TA 2A18A 1X4GA 4HI1A 4AD6A 3GWCA 2IM3A 3KJVB 1RU2A 4RBTA 1XNQF 1O6XA 1JLBB 1YRXA 3O5TB 4R25A 3KK3A 4K4WA 5D78A 2IM0A 3EGVA 1UPPA 2J6UA 2G1DA 4ZVSB 1X4AA 3C46A 1H98A 4DSEA 5BYSA 1ELOA 1KHVA 3NEKA 4WP3A 4Z7CA 4ED3A 1X0PA 2F63A 1NK9A 1HNZJ 2E5LF 4KYZA 3MGJA 2DNPA 2JC0A 3DXSX 3MM8B 3VAJA 1GEHA 2AP6A 4NRUA 2UUCF 1GMWD 1RT3B 1JLGB 2ZD1A 2FHJA 2DR9A 3QZ7A 3HO1A 2CQHA 2UUAF 2W01A 1FKOA 3SV3A 4OI2A 4K0KF 3HHNB 2AQ4A 2UXBJ 1P1LA 4P7TA 3KLIB 1RAAB 1B0VA 1Q8IA 3M7VA 1UWBA 3A8IA 1VRQC 4PWDB 1XEZA 3FRZA 4OHYA 3R9LA 3TARA 3B82A 3K8WA 2Z2LA 3TUIC 3UNYA 1NO8A 3AD8C 3BO2A 3SCKE 2LECA 4HR2A 1HIYA 4CT8A 1FJCA 1U2RA 4FF3A 1N5YA 1HPZB 4WYLA 4D3HA 4ICLB 3UDVA 2XMKA 2DYAA 4EK2A 1MNEA 1CS4B 2C42A 2LA4A 2MLYA 4WFXA 1SKWA 1PGZA 1VR6A 4AQYJ 2OGUA 3PHTA 3W5ZA 4ED4A 1WI8A 1J5OA 1TTHB 4DV5J 3QGIA 1HWKA 1D9FA 4MIAA 4RW4A 1Q7YT 4DQPA 4ID5A 2KT2A 1E6YB 4DR5F 1UVJA 1S0OA 2JEGA 2G13A 4CLTA 4PZVA 3MM5B 2C3MA 1KONA 3CD5A 5I3UA 1DURA 1TR0A 2KL8A 2ATCB 4ICLA 4DI6A 4A8FA 5I42A 4YOEA 3FCWA 4Y65A 4EBDA 2AJ2A 4LUBA 4GKJF 1NSQA 3SDEB 2RB7A 1ACMB 4QU7A 2Z56B 1XR5A 5KFUA 1FJEB 4LIRA 5GAEU 2OSQA 3KNGA 5E3AA 3E8OA 5A8RA 1W2BR 2AYMA 2W9CA 2F9JA 3FEYB 4O3QA 4JI6F 2F4VF 1GTHA 3F0NA 3JAMY 3TJAA 2PC6A 3JQMA 5DDRC 3NBPA 1S0MA 3A4TA 3AJ2A 2R2TA 2P6SA 3KUHA 2FJDB 1YWXA 1X7VA 2J9DA 2JZ5A 2POKA 2JVOA 4EBEA 3EE3A 1TP7A 3PRDA 5KT2A 2DJWA 2F8EX 4IYQA 4OHXA 3DN9A 2KHDA 3FFIB 2ILYA 3M30B 4JI0F 2H9ZA 2YWHA 4NMXA 5A6PA 2MQOA 5CYMA 4WFNQ 1TK8A 4NCBA 3UD5A 2HHQA 1S6OA 3OHBA 1IR2A 2IA6A 1UEKA 1KR4A 4IH6A 4ED2A 2AU0A 4B3SJ 2W9CB 2KN4A 4ETZA 3VQSA 4QQBA 4YR2A 4DV2F 4I0WA 4P52A 3NBPB 5KFZA 1GQEA 1JIHA 1R31A 1WD6A 3AB4B 3S01A 3SCJE 3FSYA 5GAHI 1WHYA 1KD1T 3NRBA 2OJ3A 2A3JA 2C2OB 4YHHF 5HROA 2D3OR 4DQRA 4QIFA 2DEJA 1D9DA 3AA9A 1VHFA 4KGVB 3OLBA 3GIRA 1NH8A 2NUUG 2CG4A 2V9WA 2XM3A 2BMBA 2NXCA 1FNXH 3FGVA 2QMWA 4J9LA 3CC4S 5ETQA 3VAKA 2ZHBA 2RRAA 2FJVA 2FJBB 2R8KA 3KLVA 1MSWD 2COLA 3QJLA 1ROFA 3T6BA 5SZTA 3FKBA 3DLEB 1WJ9A 2LU1A 2YKPA 3GJQB 4LVNP 2OTLS 3NNCA 1KOHA 1GMVA 2HGMA 1DFDA 4TYAA 1HNZF 3C16A 3OQ2A 3NOGA 1NAQA 4O23A 3CDUA 1R0CB 4CO5A 5K8NA 4O44B 3RAMA 3QIDA 4DL0C 2ADBA 2UUCJ 1UJ6A 1S1VA 3FJ2A 5KG3A 1HW9A 1V6HA 4ZVOB 5KFKA 3HSDA 3IMQJ 2MZQA 4DMZA 5FDLB 1CPZA 2AJQA 2XYGB 4EBCA 3FZBA 3OVBA 3H5UA 4CH1A 3MPDA 5AXMA 3QJJA 2MKHA 3CUNA 3C16B 4H4KA 4NLXA 2XY6A 5HP1B 2XTJP 3BH7B 2W9BA 2VPZB 3IWXA 1ZAVA 2OEMA 3LP0A 4RNOA 2EBGA 4QWAA 4ED0A 4EFAC 1YIJS 4P2MA 3RW6A 4TN2A 1UZHA 1WC0A 1RTDB 2FHKA 1B7YB 1RKIA 1BD6A 2CKWA 2QGFB 5DG8A 4B9MA 1MMDA 4CO1A 4AQYF 1C4AA 1RT2A 5T14A 2WVBA 2XMAA 2ROEA 3GFXA 5E7OB 1CSJA 2KT3A 5HAOA 1DTTA 3SCIE 2H51B 4CNZA 4UZBA 3MAQA 2MB0B 4JI0J 1FE4A 1S77D 1SJRA 4OJGA 2BVZA 1QAYA 1W25A 2VQFF 2ZBCA 1Q81T 1FT8A 5L38A 4FS1A 1R0AA 1IM6A 2QMXA 4RUAA 4DV2J 1RAIB 4MK9A 2VKZG 4R5PA 1QAIA 4M8LA 5K9FA 2FZKB 2KFYA 4DPWA 1C1BB 4IDKB 4YHHJ 2HGLA 1Y3KA 4ZP8A 3GE9A 2AEMA 1I51B 4ZP7A 5CCMA 3CPWR 4TNOA 2LP4A 5HI7A 4F3QA 3OVSA 1VBZA 4LF7F 3W7BA 4ED1A 4MFBB 4JUZA 2WW8A 2A6MA 1TKZB 2I38A 2OD4A 3M1VB 5CAAA 4EEYA 1NSPA 2OUGA 4J90A 4X64F 2MY7A 1T94A 3L7OA 1BXNA 2CXEA 2N7YA 4ECWA 2YNGA 2L3MA 4U6PA 2CZ9A 2NLWA 3HVWA 4XO0A 1Y5IB 3D5MA 4FBUA 2ZZMA 2DD8S 2QFJA 4H4KC 2W7OA 1N34J 3CWJA 4DV6J 2V2VA 3TR5A 3SFGA 3PKMA 3K57A 2FD2A 2YWFA 3M32A 5FIIA 4B3SF 4O3SA 3OJUA 3C15B 1YJVA 4MT1A 1B64A 3RTVA 1X4FA 1ZPWX 1V9OA 3CJ3A 2W2QP 2HURA 4IUFA 1YJTA 3OV7A 4YB7A 1KC8T 1DY3A 3MURP 2DHHA 2X1BA 5DLGA 3MMBA 4XDDA 4YB5A 3KMQA 1E6YA 1SC4B 3KOAA 3TJ8A 1F5AA 2BE2B 2W24A 3FVYA 2Z4PA 3QSYB 4RW7B 3RU0A 5J2NB 3DRPB 4AUKA 2IAJA 4DSFA 4LQ3A 2R7QA 1D9AA 4P2FA 5I42B 1TKXB 2CQCA 2LQ5A 1JLQA 3N9UC 4XTTA 3HMJG 2XWXA 1KVJA 5HJYA 1JJ4A 4K7QA 1HHQA 2IMOA 5JXSA 2W9BB 3OJSA 3Q83A 1S59A 2ZKUA 3R5CA 2PD1A 3ZTPA 4C0OC 3UO0A 1JMTA 1TMMA 1H7WA 3GLJA 4I68A 4KFBA 1KLMA 3HT3A 4EZ9A 4LFCF 2HBQB 3W66A 4KSEB 2BW7A 3HT0A 3GYNA 1I3OB 1TL1A 3VV2B 4ZK7M 5AXLA 4CLPA 5JVGQ 4OYMA 2B7BB 2FHMA 3DM2B 4DU7A 2HHXA 1G4CA 4NXMJ 4CLZA 3THTA 3I0SA 1YBTA 5ETOA 1U1KA 2OPSB 2DGQA 3DYAA 4TYBA 2M7SA 1NM2A 1KHWA 4NA2A 2HWIA 4S0MA 5EX3A 4JI2F 2AW0A 4FNHA 4NLDA 4DR1J 2ASLA 1S9FA 1DBDA 2VU5A 1C0UB 2JNJA 4R5PB 6FDRA 1QSLA 1TL4A 4IRKA 3MAHA 2OEJA 4A8WA 3A8JA 2AX1A 2FHJD 4KO0B 2GVDA 4IFYB 2OTJS 3O1LA 3EX7B 1LKZA 1UEVA 3B54A 4U8YA 4DCPB 4NZ0A 1T02A 4K4TA 1HD0A 3JTOA 4OZ1A 1JLAB 2YQ3A 4DV4J 4I2PB 1R8BA 3GR0A 3VTIA 3WBZA 1PIEA 3FRYA 2M5YA 1DRZA 3DYAB 4B3RJ 4C4WA 3I0RB 3W65A 1RT1B 5HMYA 2HLTA 2N4CA 1QAXA 2NSBA 4ZHRB 2XZWA 2KT5A 4AL7A 2YNGB 1HL6A 3DLEA 3A1YG 3DRXA 3SIPB 4TY9A 2R7TA 2OMOA 3TUZC 3HHEA 1NDCA 4DUYJ 4X4PA 4ECZA 4G1PA 3VAMA 2YVSA 4NCAA 1DTQB 4W4MA 5DZ6A 2XULA 1IBLJ 4NLVA 1OY9A 3LPYA 4RNMA 1RYSA 2NR0A 1CC8A 3M8YA 3GONA 1OIAA 1KDNA 5LXYA 1F2HA 4I2PA 4KC5A 4TXSA 2AGQA 4LF7J 4JV5F 1VQ8S 4X4SA 3GFHA 2VASA 2UXDJ 4C6AA 3HPOA 4DR4J 3R7NB 3HHKA 5D3GB 2ERRA 3IA0A 2PN6A 2R7XA 1XMBA 2MZ1A 1C1CB 2HGNA 1YJ9S 1SJQA 3G6VA 4EGLA 1VRUB 2KI2A 1S48A 2GVZA 2FY1A 3U02A 2DXEA 3TANA 2OELA 1XJWB 2G4BA 5J2NA 2EFNA 1FDDA 4M5KA 1RBOB 1N34F 2HPUA 4OV6A 1N36F 1WEZA 4C8NA 2JSXA 2R7VA 1IJEB 5GMEA 5EGYA 4LFCJ 2W2MP 3T3FA 4MAKA 4ECSA 3J80U 3NGUA 4BDPA 1UVLA 4UQTA 1U02A 4QIGA 4QR2A 2ZM6J 1YX2A 2OSRA 2NXNA 2ZITA 3MMCA 4FP9A 4WBFA 2GV1A 5C25B 2QX0A 3EXYA 4MIBA 3GPAA 4NXMF 3H98A 3DOMB 4LRAA 4OQJA 1V3RA 3AOAA 2RQCA 3KG1A 3HFZB 3BBCA 1QSSA 4EZ6A 4UY8T 1YZ6A 4Q43A 1HR0J 5DQHA 1YTYA 2XHWA 3PYGA 4WFZA 2GC8A 3KLGA 2IM2A 1UJ4A 1GX5A 1LW2A 2QA1A 2HQDA 2J7KA 3W2VB 4DX6A 3TW0A 2EI5A 1S6QA 4FXWA 5E3CA 3VQTA 3OUYA 3CJSA 2QYGA 2IPOB 3D67A 2BJ1A 4LFAJ 3IM8A 3ZO7A 3C2PA 3NAHA 1FRIA 1EARA 1M5HA 3QZ8A 4CM0A 3L7UA 1VQ4S 5A8RB 2GA7A 1QSYA 5CD4A 3GJRB 2Q6BA 5IQ6A 1YJNS 3PR4A 3D6TB 1BY9A 1GFWB 1TAQA 2MZJA 2AEFA 2P9EA 3HHLD 2GQQA 3PM9A 1L3TA 2ACMA 1NKEA 3KK3B 1U0SA 1Y4ZB 4ANCA 4F8RA 4TU9A 1UVNA 2W2OP 4KHRA 4HDHA 4X84A 7FD1A 4X2BA 1UEUA 1AXQA 1AT1B 1YLXA 2BBEA 3ILOA 3GILA 1REVB 3EICA 1IBLF 1WG4A 3MM9B 4GO7X 3MR5A 1MN9A 4JI2J 1HNXJ 2LQJA 4DR1F 2QC3A 1Q53A 1SC3B 1JLAA 2AJFE 2B6AB 2RIJA 2WBRA 1XTZA 3O6QA 1KN6A 1VRTA 4NMLA 2W4DA 3PW2A 3CIMA 1K1QA 2P9CA 5I4MA 1RB0A 4LF6F 2KXNB 3MMBB 4IO9Q 2CPJA 2OMLA 3SSSA 1CJKB 4DG1A 4DS5A 2GAHC 2ADCA 4WZQA 2XMVA 1XR6A 2Q43A 3OR2B 4RUCA 2L9NA 2M8HA 3NCQA 4NCGA 3T5KA 1NNDA 5J2QA 1N36J 1I6JA 3KFWX 2PFDA 4M63A 2X3GA 4C9DA 4F4KA 2B9XA 2VG6B 3B78A 1NDLA 1M5VC 2WK4A 2V4JB 4YY3F 3IRWP 5HO4A 2C3PA 1ICEB 3DOLB 1VK8A 2V8VA 4IFVB 3T6JA 4AE5A 4OV1A 2SXLA 4O44A 1JQGA 2WSCC 3GCXP 3H4DA 4M1KA 1TKDA 4ED7A 1FDAA 2L48A 1KLMB 1HNIA 2NPFA 1KOOA 1ZM9A 1NJIT 4JV5J 1PBAA 2UXDF 2DHAA 2EK1A 2IRXA 1PKUA 3M8WA 1UA1A 3GFYA 4FPIA 2K2PA 2IJFA 3MM7B 4ZVEA 3SQGB 5AXNA 5B0AA 4QW8A 4QW9A 1IXKA 3HLUA 4OYOA 2PA3A 1I94J 3QPIA 1F2GA 1RT5B 2DO4A 2MGZA 2HNZA 2QA4G 5KFWA 4F4YA 4ZKAA 1FERA 1P8GA 2VBYA 2W2NP 4F0MA 5D0RA 1GXUA 4R0JA 4OX9F 4LREA 3SBMA 1QTNB 2A6OA 1RDRA 3AQOA 1C0UA 1UETA 4JI4J 3PX4A 1QTMA 2FLLA 5HVHA 2ZWPA 2ZM6F 5KG0A 2G2YA 3IBWA 3TI0A 1TZ0A 4NI2A 4DN0A 2YWEA 3LP2B 1VC0A 2LEAA 2ATLA 5DS7A 4CCHA 1A6LA 2CDRB 2VPYB 1Y5NB 1N8RT 2LEBA 2XQCA 1Q78A 1N0VC 3UVJB 1P6TA 3WQPA 1R8PA 2V8DA 3T5JA 3OLAA 2PT0A 4KGXB 3H25A 3GYXB 2KZZA 4ECXA 4WFAQ 1FDNA 2DR7A 1G6BA 2PDAA 5IQQA 2RUSA 4B9VA 1U25A 1MWZA 4OHZA 4WZMA 1VDHA 2AJ1A 2CJAA 2KM8C 2AV5A 3H0PA 4CDIA 4B9UA 4QWEA 4MFBA 4QYZK 5KTQA 1IKXA 2CQ1A 1URNA 1EZZB 4RUHA 3G4SS 3BO4A 2ZH1A 3VWSA 1FEHA 1O51A 3OL8A 2FZGB 3VCDA 1QE1A 1UWAA 2HQFA 4JI8F 5DQGA 4AL6A 1K73T 4Q8FA 3M6XA 3JXOA 2WW4A 4L76A 4AFFA 2FDNA 4P7VA 3RBZA 5K8MA 2DHSA 2VJUA 1AW0A 1WF0A 1VK3A 4IG0B 3L4BC 4MKAA 3M32B 1FD2A 1LOUA 4I6WA 4WU2A 2JVRA 1CQMA 3LAKA 5CYMB 3EJMA 3C15A 1FNMA 1QY7A 3P4UB 4NX9A 3RW7A 5KT3A 4WFBQ 4YUDA 3HSZA 4A47A 2N3OA 1LWEA 2JOQA 2K06A 3ONQA 4IOBA 4CLFA 1SKSA 1RWPB 4L6V3 1Z1ZA 1U0HA 1IN0A 2DH7A 4B9SA 1AZSA 3FBEA 1JLGA 1MU2A 5IC4B 3D2WA 4FYWB 5CA5A 5H1SV 3R2CJ 1RK8A 3HZGA 1DTQA 4FYDA 4DV7J 1F60B 1WI6A 2RF2B 2H1YA 4HT7A 1LWCB 1RT7A 4LR7A 4WYWA 3R1LA 4MKYA 4A8OA 4B3MJ 1HWUA 2OPPA 3QWPA 3NS7B 5AE2A 2UVRA 1M5OC 2Y1IA 4NYPA 5E5NA 3BYRA 4KRWA 4OYPA 2FC9A 4ZN1A 3H90A 2A2CA 3IXQA 1SCJB 3BKFA 4YDDB 2E5LJ 3IWNC 1D0EA 2G0CA 4RWWA 2AHOB 2CIMA 2MLZA 3IG1A 1NB2A 3IAS9 5IWAF 2VC1A 1CC7A 4U7CA 2FVQA 2JL9A 3PRVA 2UU9J 2FVPA 4YS2A 3ZNUA 1MN7A 3CJ8A 2MLXA 5KG6A 2N4DA 3EWGA 4DPTA 1VQKS 3VAHA 1KTQA 2P9GA 1QVFR 3QIPA 1W26A 2ROPA 3G8SA 4ZN3A 2R8HA 2QG9B 4ECYA 2D69A 2E1MC 2EPIA 1FJGJ 2UXBF 4DF8A 4U9RA 3BGFA 5E33A 3NWGA 5D4LA 4USIA 5FDLA 1JXEA 3KK2B 3MM6B 3MEGB 2DNHA 3MCSA 5KAKA 2RQMA 1X8DA 4MKBA 3WIUA 2ZH5A 2GX8A 4KGKA 4J9SA 2RDDA 3DM2A 1TELA 1DARA 4G65A 4YMEA 4YQWA 2NUHA 2DNMA 1IQTA 1H2UX 2BR0A 2C3OA 1S9GB 4DSIA 1U1MA 1RXOB 3TVZA 1WG1A 3IFEA 4LMZA 5D4NA 2MQQA 2HIYA 1WOPA 5H9EJ 1L3VA 4G3IA 2ZZNA 3CMQA 4WTYA 1RACB 1RT2B 3HD1A 4BCAA 4V19X 1M5SA 1ZA1B 1HBUB 1KBRA 3M8QB 4IFYA 4X4QA 1E6VB 1SL1A 2VC0A 1JK9B 4J9QA 4KJIA 1Q8LA 3M8PB 4C8YA 1IM4A 5F0WA 2EEYA 5CQGA 2KXFA 3VGUA 1FWKA 1HQEB 1ZAWA 2NS1B 4WE1A 3RR7A 3QRRA 2CPXA 2CAJA 3D6FB 4FVCA 2PI4A 3DLKA 1JNRB 4OI0A 3HVTB 4YN3B 1NPKA 2GMLA 2KVQE 5ETLA 1RTJB 4A4JA 1TQLA 3RYLA 2IRYA 3KLIA 1F9HA 2XCPA 4C0HA 4W98A 3J81j 3UD4P 2RH3A 3MR3A 3US5A 3AJDA 3LALA 2FPHX 3TZYA 1N6QB 4FKXA 2F4VJ 1RAHB 4F25A 1H72C 2N3LA 2R3VA 3CO0P 2D41A 2BJ7A 2WVEA 2QRRA 3D54A 3H42A 2GMJA 1S79A 3IS9A 3JS9A 3TO8A 4A8MP 4OZJA 2B6AA 1JXVA 1NZ8A 2DTJA 4JI8J 3QATA 4ENOA 3M2RA 4TU7A 3U27A 1JLBA 1RKJA 3ILLA 5AE1A 1S1WB 5M2RA 3GV8B 1FHTA 3NKYA 2RDJA 1LXNA 3G8QA 4C98A 4X4UA 2GVZB 5D8HB 2N82B 1VBXA 2IFXA 3JTNA 1HMVA 1LWFA 3R5JB 3C8YA 2UUBF 1S6PB 5DM6Q 2AYBA 4YP3A 1N52B 1LQ9A 3IR7B 2MKCA 4NLTA 3OFEA 4CLLA 5IV3A 4A8KA 4B02A 4PYDA 2VONA 1NK7A 1JKHA 5HJXA 3K5LA 3BEGB 2YXLA 2IC3B 1RCXB 3ETOA 4KPYA 2FLOA 2XWYA 3QGGA 1FRJA 4U96A 4HLBA 2OH2A 4DV7F 2KTQA 2HHVA 3DLJA 1R8HA 2BZ2A 2Y1RI 2VDIA 5C25A 2PI5A 2GQCA 2OHDA 1N5SA 3CO9A 4ZCLA 1DQAA 3DHXA 1U7LA 3DOKA 1SH0A 3LWMA 3CD0A 1YITS 2QZ8A 3C14B 4QIWD 4K4XA 2L41A 2I8EA 2XMTA 3DRPA 3EM1A 3H7HB 4ALZA 3SEOA 3SQGA 1RWWB 3QQCD 5L39A 3P8BB 1S4FA 4M94A 2UUTA 4X4TA 1L3SA 2PE8A 2XS5A 1B0PA 3PEHA 5LOQA 2HZCA 3NWRA 3I56S 1YZ7A 3POTA 1FA0A 1H73A 1F5BA 2QLJB 3R5AA 4HHHA 5HATA 2UU9F 2R42A 2VQEF 4F36A 1OJ4A 2LMIA 2MHNA 4I6YA 4WK3A 4DHVA 3KLHA 3R5GA 2D9PA 4ZHRA 4Y2CA 4OYWA 3TZXA 5B09A 1T9XA 3TQ1A 3EDQB 3BGLA 2AX0A 3AH6A 1S9GA 5ADZA 1M1GA 3U1NA 1D3WA 5A6WA 4TLQA 4PQAA 2CZVC 2ZFHA 1ZOTA 4OZNA 3JQJA 2BJ8A 2M52A 4U67Q 2ABYA 1C1BA 3HKZD 4IDKA 2YNFA 1U47A 3C6UB 1YBUA 4CTAA 1RZMA 4F7VA 3GV7B 2J0SD 3R5BA 3I4HX 4Z7YA 3AOCA 1JJCB 1NKCA 3MOJB 3K8VA 3NGSA 3TEGA 4BBYA 4OJ3A 1BLUA 1FXLA 1P27B 1MWQA 3MCOA 2VG5A 2VG7B 5CABA 3Q22A 4ZCMA 1SBRA 3CC2S 2HHWA 1RA7A 4C3KA 1FESA 2AMCB 1KQKA 3LWLA 4OJHA 5KFPA 4TLRA 2DRAA 3V2UC 2YX1A 2B4UA 1XN9A 2PMWA 5KFBA 2MSTA 4M5DA 3LGMA 3M6WA 4OYXA 2R2RA 2KH9A 2DO0A
chains in the Genus database with same CATH topology
3R7NB 1RHJB 1QTNB 1I51B 2HBZB 3D6FB 2XYPB 2CDRB 2H4YB 2XZTB 3R7BB 2QL7B 2CNKB 2C2ZB 2CNNB 2HBRB 3IBFB 1F9EB 2CJYB 3R6LB 3RJMB 1NMEB 4ZVRB 1SC1B 1RE1B 5IC6B 2Y0BB 3KJNB 1RHMB 2H5JB 2H5IB 2XZDB 4ZVTB 1SC4B 2H48B 3R5JB 2QL5B 3GJRB 2C2OB 1PAUB 1GFWB 1RWKB 2QLFB 3P4UB 2QL9B 1RWNB 3IBCB 3P45B 2CNLB 1RWPB 2HBYB 4LSZB 2HBQB 3GJSB 1RHRB 2Y1LB 3GJQB 2H65B 5IC4B 1PYOB 1RWWB 1SC3B 1I3OB 1RWXB 3QNWB 3KJFB 1QDUB 3EDRB 2XYHB 1RWOB 3NS7B 2QLJB 3D6HB 3D6MB 4ZVSB 4ZVOB 1RHUB 1RHKB 2XYGB 3EDQB 4DCOB 2C2MB 3GJTB 2C2KB 2CJXB 4DCPB 1RWVB 1IBCB 2DKOB 4JB8B 4ZVPB 4ZVUB 1BMQB 1RHQB 1ICEB 2QLBB 3R7SB 4DCJB 4ZVQB 2FQQB 1RWMB 3SIPB 2C1EB 2H51B 2H4WB 2H54B 2P2CB 2CNOB 3KJQB 5K20B 3R6GB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R7N B;  1RHJ B;  1QTN B;  1I51 B;  2HBZ B;  3D6F B;  2XYP B;  2CDR B;  2H4Y B;  2XZT B;  3R7B B;  2QL7 B;  2CNK B;  2C2Z B;  2CNN B;  2HBR B;  3IBF B;  1F9E B;  2CJY B;  3R6L B;  3RJM B;  1NME B;  4ZVR B;  1SC1 B;  1RE1 B;  5IC6 B;  2Y0B B;  3KJN B;  1RHM B;  2H5J B;  2H5I B;  2XZD B;  4ZVT B;  1SC4 B;  2H48 B;  3R5J B;  2QL5 B;  3GJR B;  2C2O B;  1PAU B;  1GFW B;  1RWK B;  2QLF B;  3P4U B;  2QL9 B;  1RWN B;  3IBC B;  3P45 B;  2CNL B;  1RWP B;  2HBY B;  4LSZ B;  2HBQ B;  3GJS B;  1RHR B;  2Y1L B;  3GJQ B;  2H65 B;  5IC4 B;  1PYO B;  1RWW B;  1SC3 B;  1I3O B;  1RWX B;  3QNW B;  3KJF B;  1QDU B;  3EDR B;  2XYH B;  1RWO B;  3NS7 B;  2QLJ B;  3D6H B;  3D6M B;  4ZVS B;  4ZVO B;  1RHU B;  1RHK B;  2XYG B;  3EDQ B;  4DCO B;  2C2M B;  3GJT B;  2C2K B;  2CJX B;  4DCP B;  1RWV B;  1IBC B;  2DKO B;  4JB8 B;  4ZVP B;  4ZVU B;  1BMQ B;  1RHQ B;  1ICE B;  2QLB B;  3R7S B;  4DCJ B;  4ZVQ B;  2FQQ B;  1RWM B;  3SIP B;  2C1E B;  2H51 B;  2H4W B;  2H54 B;  2P2C B;  2CNO B;  3KJQ B;  5K20 B;  3R6G B; 
#chains in the Genus database with same CATH topology
 1RTH B;  1S7I A;  2PEB A;  3IWL A;  3N6N A;  4C11 A;  4RU9 A;  5DLF A;  4DX5 A;  3W3S A;  3M2R B;  2ZUA A;  5KFX A;  1VI7 A;  3G71 S;  3ET6 A;  2F4F A;  3QYY A;  1HBM A;  5F8M A;  2DXD A;  1SQF A;  4LF2 A;  2K3K A;  2KYZ A;  4DPO A;  1ZZN A;  4AYB D;  3K5P A;  4UOC A;  5KFE A;  3GFZ A;  1PJ6 A;  3DOM A;  4DOZ A;  3PKY A;  1FKO B;  4GVL A;  3HK2 A;  1CQN A;  4TVA B;  4IG0 A;  4WII A;  4IFV A;  2YTC A;  3A3O B;  2D3O 1;  5C42 A;  1R89 A;  3I9Z A;  3H2V E;  3DXB A;  1HAR A;  2DR5 A;  1LFW A;  2RRN A;  2B9W A;  2RDI A;  3PHE A;  1T9V A;  2B4P A;  2MQL A;  2WHO A;  2C2Z B;  4I2Q A;  2BAN B;  5F3T A;  4O3P A;  3W2V A;  5DRK A;  2I5J A;  3S8S A;  4I7F A;  3UR0 A;  3MR6 A;  3JYT A;  2VOD A;  2R7S A;  3T1A A;  1T3O A;  1TV6 B;  1A7G E;  4USK A;  5LJ3 Y;  4LIW A;  3QWU A;  1DTT B;  5J2M B;  2HHP A;  1HBN A;  3KLE B;  4DV6 F;  1WC1 A;  1X5T A;  3RBD A;  2HW3 A;  2X3D A;  1YBA A;  1S6U A;  3OFH A;  2DNZ A;  3LW5 C;  1LWC A;  1RT7 B;  3FBF A;  4B08 A;  5F3Z A;  3D3B J;  3AOD A;  4ID5 B;  5KFF A;  3LP2 A;  4PG4 A;  4ES3 A;  1CG2 A;  2CUY A;  2UUA J;  2FUG 9;  4HAC A;  2HLU A;  2V6A A;  2VV5 A;  4F4Z A;  4IR9 A;  3AB2 B;  2ZDP A;  1PO6 A;  2MQP A;  5HMX A;  4LR8 A;  1X9M A;  1QD1 A;  8RUC A;  3BQ0 A;  1VQ9 S;  2B9Y A;  5CH7 B;  3MM9 A;  5CD4 H;  4ECT A;  3SDE A;  2XO7 A;  5BJR A;  3HZE A;  1N0U A;  1UW4 A;  1EKR A;  4OYZ A;  5K14 B;  1VQ5 S;  3HKW A;  2DIS A;  2QLF B;  1SVD A;  3AA8 A;  1WKK A;  2GFF A;  3KLG B;  2QL9 B;  1K8A T;  1RT4 B;  1RTJ A;  1LK5 A;  3CGI A;  3AJ1 A;  2XEX A;  1SC6 A;  1F3F A;  2BE9 B;  3DRS A;  3AHP A;  2CWK A;  4UTG A;  2CQ4 A;  1S97 A;  2E5G A;  4HTI A;  4P9S A;  1U1Q A;  3W9H A;  3G2X A;  1HQU A;  4C48 A;  3CME S;  2XB2 D;  4JYA J;  1VS3 A;  3B4D A;  1RWX B;  4CLS A;  2ZH4 A;  5CZV A;  5KFC A;  3MHY A;  3VAL A;  2DGV A;  2DNQ A;  4OX7 A;  1UJ5 A;  2FTR A;  4H4O B;  2EFG A;  3D6M B;  3HHD A;  3ZTQ A;  2VPW B;  3F44 A;  1XIQ A;  3SYZ A;  4CI0 B;  5J1E A;  4UOF A;  2VG5 B;  1FRK A;  4FNI A;  3ISZ A;  1WTB A;  2JJ4 D;  1LWE B;  1U2C A;  2RIL A;  3K2Y A;  4O4R A;  2R7W A;  4LF8 J;  4Q8E A;  1X4E A;  2MQ8 A;  1HPZ A;  2PII A;  4RW9 B;  5FD1 A;  1F1B B;  4M5D B;  3HM9 A;  3KUE A;  2ZH7 A;  4R8U A;  2YH0 A;  3EGW B;  1RU1 A;  7AT1 B;  1IBC B;  3K5M A;  4ZVP B;  3RBX A;  5KFG A;  1ZTT A;  3QAU A;  4OZ3 A;  1MG7 A;  3W9I A;  2C2D A;  2BA9 A;  1SQE A;  3PFE A;  1U0H B;  4PR6 A;  4MMO A;  1FE0 A;  4B3R F;  5KFA A;  4ZP9 A;  2HNY A;  2YPY A;  1N33 J;  2JHE A;  3BDE A;  2UV8 A;  2GMH A;  3VHQ A;  1N5V A;  1UVK A;  2K7J A;  1C0T A;  2IM1 A;  1ZZF A;  2XHC A;  3OR2 A;  1FXR A;  3LF0 A;  4O4G B;  3GQC A;  3OXL A;  4NXN J;  2X1F A;  2CQ2 A;  1A0O B;  3MPU B;  4RW9 A;  2AYE A;  4DUY F;  3S1T A;  2CQP A;  4X4V A;  2VG6 A;  2BJ9 A;  2P2C B;  3S6E A;  2QSW A;  3PW0 A;  1OSC A;  3CXC R;  1PC5 A;  5BYR A;  2DVI A;  4F4X A;  3JYT B;  3TQE A;  2EC2 A;  3L9Z A;  2QO3 A;  1X4C A;  1D8Z A;  1N5Q A;  2CPZ A;  3M4X A;  5A0Y B;  1I5O B;  1WSV A;  1EX8 A;  1HNI B;  1P9Y A;  1R0B G;  2EKY A;  1HMV B;  1LWF B;  1B7F A;  2IJN A;  4WP9 A;  3OVA A;  1FKP A;  3QBC A;  1XNR J;  2ZBQ A;  5KFH A;  2Z2M A;  2E29 A;  2NYH A;  4USH A;  4NA3 A;  4I1T A;  4N77 A;  4ZPD A;  4UT4 A;  2GHW A;  3W5X A;  4O0I A;  1N56 A;  3P5B P;  4KHM A;  1NPR A;  2NYI A;  4G1Q A;  3DLL Q;  1NB7 A;  2XGQ A;  5KFV A;  4RKU C;  1DQ9 A;  5IM0 A;  1RAE B;  2R7R A;  3P6Y C;  4FYV B;  3CDA A;  1RLD A;  2WTF A;  1QM9 A;  2ROG A;  3EZU A;  3TRG A;  3QFH A;  4NLR A;  3TJ9 A;  2HQG A;  5B0D A;  1GXL A;  1RAJ A;  4PG5 A;  3MUM P;  4GC7 A;  4TQR A;  2IBK A;  5IC6 B;  4J9V A;  1KWM A;  1IWG A;  2DNG A;  2ZBI A;  3I32 A;  3BSN A;  3UD3 P;  2HVI A;  2U1A A;  2IDE A;  1PSD A;  3I0S B;  2H5I B;  2YWW A;  2XNR A;  2GGP B;  4ID8 A;  1AFI A;  2OKQ A;  4P73 A;  1FEE A;  4OLP A;  2AZ3 A;  3AT1 B;  4C11 B;  1TUG B;  3UVJ A;  1RAO A;  1IWA A;  4F67 A;  1BQN A;  2MDA A;  3H8Y A;  1DQ8 A;  1E6V A;  1NZA A;  3K5N A;  1U26 A;  2DIV A;  3CTR A;  4RNF A;  1JX4 A;  1TFY A;  2Z2Z A;  3MED B;  1JNZ B;  2DNR A;  2QL5 B;  1TKZ A;  4HL9 A;  4RWX A;  2JFK A;  1F3V A;  4L3K A;  1BE4 A;  4OX8 A;  3PV8 A;  2FLN A;  2Z58 B;  3NNA A;  1HD1 A;  1WEY A;  3CJ0 A;  2P8I A;  2LEP A;  4LRB A;  3CCL S;  1UA0 A;  3QO9 A;  2FC8 A;  2Q1L A;  3BRE A;  2BRL A;  3SSQ A;  2C2R A;  4X66 J;  4KKO A;  2CPE A;  5AE3 A;  4OYB A;  4DL2 A;  3K5O A;  2C22 A;  2PFF B;  2W1B A;  3CCJ S;  2JWN A;  4IOC Q;  1U6F A;  1N6Q A;  3PW7 A;  2VH7 A;  4F02 A;  4NZ7 A;  3BKU A;  3MMC B;  1RHR B;  5I3Q A;  5ETM A;  2VG7 A;  4N41 A;  4HH1 A;  2XLK A;  2DGX A;  5CYQ A;  4RBU A;  2YWG A;  2D74 B;  4ZLL A;  1XER A;  2JDJ A;  4ED5 A;  3UI3 A;  3RAQ A;  1CVJ A;  5DET A;  4RJV A;  3BQ2 A;  1JWW A;  3VVU A;  4HTJ A;  2ZEJ A;  4ZDN A;  1GMU A;  1RTD A;  3DDI A;  1B70 B;  2MKY A;  1X60 A;  5D3G A;  3CDE A;  3UPF A;  3KK2 A;  1C1C A;  5IT9 Y;  3A12 A;  1RTI A;  2RRB A;  2IVF B;  3SCL E;  3UN5 A;  1LWX A;  5KOX A;  2M3D A;  1B3T A;  2AT1 B;  2PEH A;  4ZLN A;  3T1Y F;  3UN3 A;  3HD2 A;  1U8W A;  5EWG A;  3FSX A;  4NLP A;  2CJX B;  5FLX Y;  4B3T F;  4L73 A;  4DEZ A;  1SUQ B;  4JB8 B;  4MK7 A;  4ZVU B;  3UE2 A;  1RHQ B;  2CQD A;  2GJI A;  1I1G A;  3W64 A;  1JXL A;  1X5S A;  2BXJ A;  2ZJR Q;  2OI2 A;  1JLC A;  2WSF C;  2Q3P A;  3QFW A;  1XBW A;  4H54 A;  5CYJ A;  3ZTS A;  3VAI A;  3RB6 A;  3FDS A;  1TV6 A;  3I5C A;  3OTD A;  4IG3 B;  3KHL A;  3BO3 A;  1RUS A;  2V69 A;  4KY3 A;  2W4C A;  4UOG A;  1KVI A;  2V94 A;  3NLC A;  3C3L A;  3FQK A;  2HFU A;  4PQU A;  2GHV C;  3JSB A;  4H4M B;  4URQ U;  1R43 A;  5KFJ A;  3J81 U;  4X62 F;  1VQP S;  2E1A A;  2HIQ A;  2YBV A;  4CLU A;  3V6J A;  5EN1 A;  2B9E A;  3HFV A;  3PG9 A;  3LGH A;  1Z2Z A;  1O8B A;  3D0G E;  4CLY A;  4ECR A;  1JLC B;  2YNI B;  3MD1 A;  3UR3 C;  1YRU A;  1U48 A;  3AD7 C;  2WAQ D;  1GMW A;  4P72 A;  5JJB A;  3MDF A;  2Y3Y A;  2WVC A;  5HSP A;  2O3D A;  3CED A;  4OX9 J;  1NHU A;  2H3E B;  2ZUG A;  3HHL B;  1FRH A;  2XMU A;  4J5O A;  5B0G A;  4ZLP A;  3Q24 A;  1U6B A;  3FK4 A;  4X66 F;  1Y11 A;  3M8S A;  1Q7L B;  1AUS L;  2JC1 A;  4F0K A;  3UWT A;  5K8O A;  1M5K C;  3ENV A;  3D1Q A;  2KKH A;  2R7O A;  1IKX B;  4C8M A;  2LQB A;  4CTA B;  1X5O A;  1IJF B;  4LSL A;  2DNL A;  4M5M A;  1YSJ A;  5J1P A;  1VOM A;  3DOL A;  1KSP A;  2NZ4 A;  5ETK A;  1NJY A;  1UKU A;  1IKY B;  1Z4U A;  2GS8 A;  1VYA A;  3HSG A;  4NPO A;  5IV4 A;  4NLO A;  4I4B A;  3DRS B;  3A3N B;  3W5Y A;  4DN9 A;  1XMQ F;  1UVM A;  3H59 A;  5F9N A;  4RU2 A;  2DXF A;  1OS5 A;  1X5P A;  2PO4 A;  1SC1 B;  4EU0 A;  4Y0F A;  4RPF A;  5E3P A;  5CHC B;  2ZKT A;  3KJN B;  3ZNJ 1;  1HYS A;  1IVZ A;  1NPP A;  2V8H A;  3AQP A;  1VQN S;  4DV4 F;  1X0F A;  1CLF A;  1OY8 A;  2V8P A;  1F9F A;  2DY1 A;  4LF4 J;  2YKN B;  3NL0 A;  2Y1J A;  1BQM B;  1A9N B;  4USJ C;  2ZHO A;  2AJ4 A;  3U1M A;  2FJA B;  2VBW A;  1HFE L;  2UUW A;  2ZVI A;  3C14 A;  4I2Q B;  1SKR A;  4GVB B;  5LSO A;  1TL3 B;  3MUT P;  5J2Q B;  3IS9 B;  2XMJ A;  4ZIT A;  3Q2S C;  2E5J A;  3ITH A;  1FFS B;  2BV3 A;  3HDS A;  3PY8 A;  3OSP A;  2UXC F;  2JFD A;  3ADA C;  5LL6 d;  4CO4 A;  4DX7 A;  1S0V A;  3KLE A;  4QJV A;  4P10 A;  5KG1 A;  3IP0 A;  3CB4 A;  1S1W A;  1VQY A;  4LR9 A;  3IBC B;  4M95 A;  1X4D A;  3TAM A;  1N5T A;  4Z37 A;  2E7W A;  4Y6I A;  1KQS R;  2CNL B;  2KB2 A;  4JI1 J;  1LEO A;  4C7Q A;  2KHC A;  4DR4 F;  2WSE C;  5KG7 A;  3J81 Y;  3MUV P;  5KT4 A;  4HKQ A;  1T11 A;  1J2V A;  1AA1 B;  2PGC A;  3QRP A;  3I9V 9;  2BQ3 A;  4HYK A;  1FKA F;  4DSL A;  4JBC A;  1S0N A;  1DAX A;  1WDD A;  2DRB A;  2IJR A;  1TKT B;  2IC3 A;  5ETP A;  2JLE A;  1QDU B;  1PCA A;  4PKD B;  3W63 A;  4H4M A;  4F4A A;  1WAC A;  3GCW P;  3LA0 A;  5KG2 A;  3OUY B;  3OW2 R;  3D6H B;  4IRD A;  1OPZ A;  4FKY A;  3G86 A;  1V3S A;  1RT1 A;  2M88 A;  2F8H A;  4QCL A;  1D09 B;  4FS2 A;  4ILL A;  2AIR B;  3UCZ P;  1VBK A;  2YNI A;  3Q8V A;  5LJ5 Y;  4B3O B;  2G0I A;  4ZVF A;  2B56 A;  2AEJ A;  3KYL A;  2FGO A;  2B51 A;  2MMY A;  4Y2M A;  2R2U A;  4UST A;  4LJM A;  1S1T A;  1REG X;  2W25 A;  3ENQ A;  3HX9 A;  3PJX A;  3D3C J;  1HBO B;  3ZC4 A;  1PC4 A;  1SB6 A;  3CJ4 A;  1N4L A;  3P49 B;  1HR0 F;  3H4B A;  2XMM A;  1HWJ A;  1WF2 A;  4DWI A;  4AXJ A;  5H9E K;  2WON A;  2DNY A;  3F41 A;  2AWZ A;  3HHL A;  2F8M A;  4X62 J;  3PZP A;  3D68 A;  4LRF A;  3MMA B;  4CH7 A;  5DDO C;  2HMI A;  2XBP A;  1RGV A;  1NK8 A;  1HBM B;  4LFA F;  3OL9 A;  2EWH A;  3DLG A;  2PMZ D;  3HXM A;  2HFV A;  3PX0 A;  2LA6 A;  3KMS A;  1PBU A;  1N88 A;  2QA4 S;  5JVH Q;  2HFS A;  2KZM A;  3FMB A;  5F8N A;  4LF4 F;  1HKA A;  2CQ3 A;  5D15 A;  3R6G B;  4C8O A;  3MXH P;  2VKR A;  5J1E B;  3GSD A;  4JV1 A;  5KOW A;  4CLW A;  1H7X A;  1FK9 B;  3ZTO A;  4Z2X A;  2MEW A;  3H40 A;  4UF4 A;  1SQG A;  3BPD A;  5HQM A;  4P74 A;  5DG9 A;  3UN2 A;  4F3O A;  1Y00 A;  4QBU A;  2FJE B;  3CJ5 A;  3CDW A;  1HYS B;  3ZFV A;  2LLZ A;  3KDO A;  4R8U B;  4W90 B;  5J2M A;  4KGZ B;  3JAM U;  2XS2 A;  2BJD A;  1HNX F;  1MML A;  1C0T B;  3RRK A;  2HS3 A;  1NJZ A;  5KT7 A;  2KJW A;  4DQQ A;  8AT1 B;  4KKO B;  2YKN A;  3OSN A;  2LQ9 A;  4ZP6 A;  1RAF B;  4Q45 A;  3BBB A;  3PVX A;  1HA1 A;  1PG5 B;  3MEC B;  4B17 A;  2ZBR A;  1KQF B;  3R2D J;  3KKF A;  2O66 A;  4RZR A;  4UQG A;  2MYF A;  4EYH B;  2MHE A;  3MEG A;  4QPT A;  1TKX A;  2CJY B;  1MU2 B;  2DB1 A;  1NME B;  5L9X A;  4F4W A;  2AD9 A;  2CQB A;  1RAB B;  1FFG B;  5CZX A;  2ZZT A;  4I67 A;  1HLW A;  1YQH A;  1FD8 A;  2Y0B B;  3V5R A;  1AFJ A;  2IYI A;  4KBI A;  4P6Q A;  3TUP A;  1T03 A;  3GB0 A;  2OPP B;  3PDN A;  3VVT A;  4YY3 J;  1XC9 A;  1WWH A;  2G0J A;  2QV6 A;  1RCO B;  2JLF A;  1VQO S;  2LKZ A;  2HND B;  2BAN A;  4K2X A;  4LBI A;  2JLG A;  2EFV A;  2C2E A;  1Q82 T;  2HWT A;  1IBM J;  3HJV A;  4JI7 J;  2MZT A;  3FBC A;  1R3N A;  4OHW A;  4OZ2 A;  3T41 A;  1RA6 A;  2VOO A;  1ITP A;  4CRJ A;  3HCX A;  4ILM A;  2UUB J;  3ZZO A;  1YI2 S;  1LV5 A;  2YPZ A;  3DGV A;  3IR5 B;  2PMH A;  3SMZ A;  4DXL A;  2VA3 A;  1TVR A;  1VBY A;  1HQE A;  1HI0 P;  1OYD A;  1R8A A;  2E7V A;  4KIA A;  5CCL A;  4H4O A;  1QAJ A;  4HAC B;  1BC6 A;  4CP5 A;  5L1I A;  4EMD A;  1FNO A;  3LQV A;  4C2M A;  4DL7 A;  3CCM S;  3MM6 A;  3OXF A;  4Y2A A;  4DU8 A;  3NP5 A;  4JI4 F;  3FEX B;  1X9W A;  2BUN A;  2H65 B;  1ZM4 A;  1S99 A;  2O5D A;  2QE5 A;  4MKV A;  4WJB A;  3MEK A;  4P2S A;  3U7J A;  3WC0 A;  4CQ1 A;  2RU3 A;  3NOC A;  4A8Y A;  5T41 A;  1SJ4 P;  5AT1 B;  3U1L A;  2DPJ A;  4B9L A;  3MTJ A;  4ELU A;  4E98 A;  2B3T B;  1MMN A;  1NU4 A;  3AAW B;  3QGP A;  2QJ3 A;  3RGI A;  1U1P A;  4K4S A;  1KQG B;  3GG1 A;  2HFZ A;  2CAD A;  5KFY A;  5M2P A;  1UP1 A;  2E7X A;  1UL3 A;  2AZ1 A;  3HF5 A;  3DLG B;  1KS2 A;  3IO1 A;  4Y28 C;  3RRH A;  5DG7 A;  1M90 T;  2BOA A;  4DR7 J;  5GAH U;  2ZC4 A;  4DDF A;  2M2B A;  4G6V B;  4KHP F;  1FK9 A;  1R6V A;  2RHQ B;  2ALY B;  1S1U A;  2GHP A;  3GP9 A;  1L3K A;  3KXD A;  3QO9 B;  4KV8 A;  2GO9 A;  4DF4 A;  1ZTW A;  4DQI A;  3PJ9 A;  3F56 A;  1H0H B;  1B99 A;  1T0T V;  2ZNZ A;  3AD9 C;  3DGP B;  4MTP A;  4Q7A A;  2C28 A;  4C3M A;  2K3I A;  5K5M A;  1MW7 A;  4OHV A;  3EGN A;  5IFM A;  4KTQ A;  3H2L A;  1NH7 A;  3ET6 B;  2CVE A;  3QT7 A;  3TVK A;  3TAQ A;  3OPK A;  1SH2 A;  3AY0 A;  4C3L A;  1VIO A;  3GTY X;  5L46 A;  2CPD A;  1AZS B;  2KJV A;  4HVZ A;  5LMU F;  4IQM A;  5A0Y A;  3E01 B;  4XDC A;  3ILI A;  1FO1 A;  4MYT A;  3GIK A;  5KFD A;  5E2Q A;  1QJH A;  4PCQ A;  5KFL A;  2DNK A;  1NEE A;  1ZM2 A;  3EYZ A;  1ZPV A;  3RR8 A;  3ILJ A;  3CCZ A;  5I3P A;  2BX6 A;  2HVD A;  2IDL A;  5KFR A;  4DBQ A;  5E41 A;  4WKR A;  1HNW J;  3A3P B;  2C3U A;  1ZYQ A;  2DH9 A;  4Q0B A;  2D3Z A;  1S9E A;  2LDY A;  1RT3 A;  4KQZ A;  3ZZZ A;  3NGD A;  4K4Z A;  2QLX A;  2IY5 B;  3MPW A;  1WEL A;  2ASY A;  2M0G B;  5IM0 B;  2IHR 1;  2OPR A;  3W60 A;  3DRY A;  3DKD A;  4DFJ A;  1HBN B;  1Q5V A;  4ED8 A;  1VJQ A;  4O3O A;  2EBE A;  2GZO A;  1FWP A;  2V2Q A;  2VUG A;  1R8C A;  3LP1 A;  4WKY A;  3GII A;  3V81 B;  1UWB B;  4PUO A;  1FJG F;  3MF5 A;  1PJ7 A;  3DI6 A;  3NGT A;  3NCR A;  5GAD I;  2ZC3 A;  2ZOF A;  1Y0H A;  3IRX A;  2X1G A;  4NLU A;  3Q86 A;  3W8G A;  3RB3 A;  1HWL A;  3I5A A;  3IGN A;  1Q0N A;  3W62 A;  2Q79 A;  2Y8Y A;  3D0I E;  5K8P A;  1NUE A;  4HDG A;  2R9L A;  4B3M F;  1JLQ B;  2DCL A;  3AXK A;  2YNF B;  4K4Y A;  4USV A;  2W8K A;  1EET B;  2HBR B;  4PAB A;  3OTE A;  2FHO B;  4OX6 A;  3V4I B;  1GK8 A;  2J6S A;  2FVC A;  1JB0 C;  3RG6 A;  3LAN A;  2CPI A;  3QRQ A;  2MKI A;  1C2P A;  4ZVR B;  3T1H J;  5IWA J;  5F8J A;  3BSA A;  1LW0 A;  2UVU A;  5D0G A;  1OPI A;  2CPH A;  4F2R A;  1X31 C;  4LSN B;  4AT1 B;  4ZIW A;  3GSI A;  1TKT A;  2G2O A;  4KHP J;  3VGS A;  3J7Y U;  5LT5 A;  2CJB A;  2UP1 A;  3TZZ A;  3HUL A;  5DO2 A;  5LSR A;  2JEI A;  1NJW A;  1RJJ A;  2CPY A;  2UV8 G;  4BLG A;  3PW4 A;  3E3X A;  2NZC A;  2OPS A;  3NS6 A;  1LK7 A;  1SJ1 A;  1UFL A;  3K89 A;  4U95 A;  1UMJ A;  1VQS A;  3DRR B;  4FYX B;  4WE1 B;  5C2G A;  1S4E A;  3N5F A;  3NCP A;  1T9Y A;  1UAW A;  1HBO A;  3I55 S;  3VR1 A;  1FRL A;  4O3R A;  3E51 A;  3DMJ A;  3SXL A;  4ELT A;  2WON B;  1EP4 B;  3DGP A;  2VL1 A;  4X4O A;  3MEC A;  5L1J A;  3H20 A;  3NAI A;  3OHA A;  4DR6 J;  4N56 A;  3LPE A;  2QEX S;  4OJ1 A;  1RAG B;  2HBY B;  2V34 A;  4I7F B;  3FSI A;  3R5D A;  3LGN A;  1G1X A;  3NS5 A;  2Z30 B;  3K59 A;  4K5S A;  1BQM A;  3BDP A;  4FF1 A;  2DPI A;  4DV1 F;  2CRL A;  2O01 C;  3TX0 A;  1V5V A;  3I82 A;  1HI1 A;  3AOB A;  2I6W A;  1FWL A;  1XWL A;  2V9K A;  5HMZ A;  1DJ0 A;  4DR7 F;  4JYA F;  1WG5 A;  3LOU A;  1N54 B;  4RW8 A;  4K4V A;  5F8G A;  2DH8 A;  2WOM A;  5HAN A;  4N5S A;  1WF1 A;  2MKK A;  2NSC A;  3G6X A;  3KHH A;  2XYH B;  1NJX A;  1ZH5 A;  2MSS A;  4PWW A;  1PJ5 A;  1WSR A;  4CWB A;  4TY8 A;  8ATC B;  3EUN A;  1X9S A;  2HFO A;  3BGU A;  3MM7 A;  2E9R X;  3KHG A;  3QSI A;  3PYE A;  5A76 A;  1X4H A;  2HQ3 A;  4NYO A;  4ZPB A;  4DCO B;  4RLE A;  5IXU A;  3GIM A;  4XPE A;  1RT5 A;  2MGZ B;  4DV3 F;  4NLS A;  1YGY A;  2VFT A;  4HH0 A;  4IR1 A;  5J2P A;  4ZA1 A;  4LF5 J;  2FVR A;  2R8G A;  2JX2 A;  3N5B A;  1GX6 A;  1DLO A;  3GZ7 A;  3WZ0 A;  4N8N A;  4N8O A;  3CJQ A;  3O44 A;  4KE5 A;  2DHG A;  3VZH A;  2MXY A;  4ZPC A;  2ZH8 A;  2DIU A;  2V0N A;  3I96 A;  2VJV A;  1XMQ J;  2E1R A;  3AFG A;  3LP1 B;  4CYU B;  4DCJ B;  5A8K A;  2I5J B;  2W7A A;  1HNW F;  4ZVQ B;  2A0F B;  1VQ6 S;  3B4M A;  1RWM B;  2V2Z A;  1TL1 B;  2A1B A;  2J8A A;  4YFU A;  4ERD A;  3D9B A;  2WRM A;  5D4P A;  4TQS A;  3MM8 A;  1SV5 B;  3MAA B;  3K58 A;  2NXU A;  5F9L A;  4BWJ A;  2DBB A;  2F3J A;  2I1R A;  2RSQ A;  2F1F A;  4NEZ A;  3G8T A;  2CNO B;  4B3O A;  4ES2 A;  1TU0 B;  3PAC A;  1SUQ A;  4DLG A;  2E1C A;  1KP6 A;  3PO5 A;  4ES1 A;  1EQM A;  5HP1 A;  2GQ2 A;  2AJ0 A;  3HVT A;  4FPR A;  4HT5 A;  4KGM A;  1RQ0 A;  5IZH A;  3RRG A;  1HWI A;  3UDL A;  1CUL B;  2VOP A;  2RVJ A;  3MZI A;  4J9M A;  2Z57 B;  1FDB A;  2ZE2 A;  4DPY A;  5KFI A;  2M4M A;  4DZD A;  4E0D A;  2QIF A;  3TZW A;  3UNG C;  1S1T B;  3N01 A;  1S6Q B;  2KXH A;  4LSN A;  5LSL A;  4DFP A;  1J5E F;  3DNC A;  1YKW A;  5EDW A;  4JI5 J;  3D0H E;  4ZJO A;  5D0H A;  4DLE A;  4RBV A;  1Q1K A;  1EIY B;  1VC5 A;  1ZET A;  5GAD U;  2DNN A;  2QYC A;  1M1H A;  1TUV A;  5LXR A;  4NA1 A;  1RT4 A;  1VIS A;  3IAM 9;  3G82 A;  3T9Z A;  2CNK B;  1VQM S;  3MED A;  1T8E A;  4QYZ J;  1RLC L;  3DMJ B;  4ANE A;  1GH8 A;  2LXU A;  3TVY A;  2J8S A;  4K0K J;  4WIQ A;  4IH5 A;  2GO8 A;  4K59 A;  2E66 A;  1Q4R A;  2ZH3 A;  4M5J A;  3CMA S;  3V6D A;  2KRB A;  1M5P C;  5IT9 U;  3FUY A;  1JKH B;  2FYX A;  4K2J A;  3RZA A;  4FN5 A;  3S7R A;  3UDE A;  4BC7 A;  2CQG A;  3BKT A;  2GNK A;  2H5J B;  4I6A A;  3UCG A;  5J2P B;  1M1K T;  2XZD B;  3PRB A;  1FX4 A;  2UVW A;  2ZH6 A;  2V67 A;  1FTR A;  1T9U A;  2GIR A;  2WOM B;  3VAG A;  5HLF B;  1IKY A;  2ZWO A;  2KDO A;  2B43 A;  2M70 A;  4ETX A;  4X65 F;  2N7C A;  3QLH B;  3PIP Q;  3MCM A;  3VGV A;  4CNY A;  2ZVS A;  2E44 A;  4RW8 B;  4USM A;  3X1L B;  1NHV A;  2J9E A;  3DI6 B;  1IUJ A;  4QR0 A;  3SZ2 A;  1JLF A;  1UW9 A;  3BSO A;  4HHJ A;  4J7C A;  3V6D B;  2J0X A;  3HVR A;  1RWK B;  1J27 A;  1MRO A;  5ETT A;  3FFI A;  3M30 A;  2RU9 A;  4NLY A;  4WFY A;  4DV5 F;  5C24 A;  3KNA A;  1U1O A;  4DL4 A;  5KFO A;  3MD3 A;  2ZD1 B;  2XSF A;  4W92 B;  4LVO P;  3J80 Y;  3P45 B;  1RTI B;  2OIH A;  3OFF A;  4M5G A;  4K5R A;  2IVY A;  3Q8Q B;  2NQP A;  4ZMM A;  1HI8 A;  3GMG A;  5ITH A;  4CYU A;  3BH6 B;  3TX8 A;  5A8K B;  3BYP A;  4DZ6 A;  2IIH A;  2Z2Y B;  2BE2 A;  4OI6 A;  2CA9 A;  5FJ4 A;  5RUB A;  3KUG A;  2VIH A;  2CFX A;  3OT9 A;  3QIP B;  4JV2 A;  4GKJ J;  4PRF A;  2YKQ A;  1RAD B;  2MKJ A;  3EDR B;  4OI4 A;  1PIL A;  3MWB A;  4CO2 A;  2LDI A;  3UQS A;  4CT9 A;  2P6T A;  2HK3 A;  3Q89 A;  1GXT A;  1S12 A;  2B5J A;  2CWX A;  4OI3 A;  4CH0 S;  2HZA A;  2D1C A;  3RAX A;  2HYI B;  1GAO A;  5J1N A;  3I4P A;  3MEE B;  4NXN F;  5KFS A;  4JOU A;  2FVS A;  4JI5 F;  4JI6 J;  3M2V A;  1SV5 A;  3MAA A;  2RQK A;  5HK4 A;  1RYR A;  1EJ7 L;  4RW4 B;  4ZS6 A;  2RJZ A;  3Q8R B;  2B4O A;  3G96 A;  5F8I A;  1JLE A;  4PPZ A;  4YEA A;  2V68 A;  2WVF A;  3BS9 A;  3WIV A;  1L3U A;  3E2E A;  1NDK A;  2XLJ A;  1YJW S;  2DKO B;  1BHN A;  2GAG C;  1BMQ B;  2UZA A;  3R8Y A;  1BGX T;  2XGP A;  1DZ5 A;  4Q44 A;  4MIW A;  3GV5 B;  2W9A A;  1REV A;  3C6T B;  1S1V B;  4U8V A;  4F04 B;  1MWY A;  3M8Q A;  2DR8 A;  3MEE A;  4WTO B;  2KFN A;  1U45 A;  2OPQ B;  2J9C A;  2R8I A;  4QR1 A;  1CJV B;  2RS8 A;  5A2Q Y;  2DEI A;  3EXC X;  4FF2 A;  1FF2 A;  3CVK A;  4GO5 X;  5H9F J;  5F8L A;  3CJ2 A;  4C8L A;  2ZJP Q;  2DK2 A;  2FGC A;  3MPY A;  1WOR A;  4ECV A;  1TL5 A;  2H54 B;  4A46 A;  4CZC A;  4WCE Q;  5GAG U;  1M0S A;  2XY5 A;  1VLO A;  2BKO A;  2W7P A;  3R1H A;  1KFS A;  3K17 A;  3NG8 A;  2DGO A;  5AXK A;  1J5E J;  5KG4 A;  2XCA A;  4EO6 A;  2G9O A;  4OLO A;  1V5I B;  3BR8 A;  1K47 A;  2A2D A;  3OBI A;  2D9O A;  1QLN A;  1BQN B;  5JMN A;  3JB9 k;  2HMI B;  1TAU A;  3Q0A A;  3NMR A;  3M2U B;  2VZ9 A;  1N48 A;  3L95 X;  3DHW C;  2HS0 A;  4QZV B;  3K0J A;  2HBZ B;  3PX6 A;  2ZNY A;  5ETS A;  2GJF A;  2HQC A;  2MY8 A;  3J7Z T;  3CW2 C;  4GKK J;  2ZHA A;  2BOP A;  1H2T Z;  5ETN A;  2ILZ A;  4NLQ A;  2XYP B;  1QUP A;  2VB6 A;  4U7U K;  1S5Z A;  3QLH A;  2OD6 A;  3ELH A;  2B0G A;  4EWT A;  1VFJ A;  3KLF A;  5E3R A;  1DHM A;  5C24 B;  3QGH A;  1TL3 A;  2AKW B;  1U1N A;  3NNH A;  2BE7 D;  2EG1 A;  2RML A;  3TNV A;  3W2W A;  4DJB A;  1P9Q C;  3DDN A;  1LXJ A;  3NY0 A;  3R6L B;  3Q8P B;  2W8L A;  4J9R A;  4DFM A;  5G0R A;  5KFN A;  3G6Y A;  4DL3 A;  2R8J A;  4LF8 F;  3VZI A;  2VHG A;  1EB0 A;  1Z2L A;  2GCF A;  5IS2 A;  2XLI A;  4LFB J;  2JH3 A;  3KJV A;  3EPG A;  5LMN F;  1F5C A;  4JI3 F;  2I9S A;  2P5V A;  4PXC A;  1S49 A;  3NGK A;  3OL6 A;  2KFZ A;  3BF4 A;  2CZ4 A;  2HAI A;  2OFG X;  3K7R A;  4CO0 A;  2YX4 A;  4EO8 A;  1N33 F;  4ATN A;  1SXL A;  2KU7 A;  2YKM B;  2BW2 A;  3UCU P;  2DGW A;  3O8W A;  3W2W B;  1YJ7 A;  3R3T A;  1S57 A;  4HHU A;  4KH1 B;  3W61 A;  4C8Z A;  1BUX A;  2HRT A;  2MZS A;  3I5B A;  4JV0 A;  1FX2 A;  2HEK A;  5L1L A;  5B0E A;  1S7H A;  3POT B;  2UXC J;  4PYA A;  3IG1 B;  1DLO B;  1KKH A;  2QLW A;  3NGR A;  4RUB A;  1XK8 A;  4E8U A;  2WVD A;  2YH1 A;  4LSL B;  4NLG A;  3HJF A;  3BGR A;  1OY6 A;  1YJR A;  2Y0S D;  3V4I A;  3M9N B;  1K0V A;  2YKM A;  3M8Z A;  2APO A;  1JJH A;  4MH8 A;  3H5S A;  1Y7P A;  3UDC A;  3M9M B;  1FJ7 A;  4C97 A;  2WZ1 A;  3OD2 A;  3PTW A;  4ZPV R;  4PWU A;  4IKA A;  1N5Y B;  2YQ1 A;  4LQ9 A;  1XNR F;  3NMA A;  1H2V Z;  4B9T A;  3QNW B;  1UFK A;  3ZZR A;  1XNQ J;  2J6T A;  5HMW A;  4J37 A;  2DY9 A;  5KT5 A;  1WHV A;  1W7W A;  1UVI A;  3L7P A;  1SKU B;  4MJK A;  3MMA A;  4PEO A;  2F9D A;  4P71 A;  4BWM A;  3TP2 A;  2X7I A;  5GMD A;  2HVE A;  3FMW A;  1GT8 A;  2RT3 A;  1KFD A;  1RHU B;  3CD7 A;  1RT6 A;  3L09 A;  2CG8 A;  2ZOM A;  2R2S A;  5L1K A;  1ZM3 A;  1VGY A;  3E01 A;  5L9N A;  2JEF A;  1UCN A;  3EMT A;  4TU8 A;  2CJK A;  3GR1 A;  3MM5 A;  4EYI B;  2RAQ A;  5C5J A;  5DJB A;  4OZ0 A;  3RBE A;  2K7K A;  2BM0 A;  3GJT B;  3D4J A;  3C19 A;  3EPI A;  2QSF A;  4UZC A;  2L08 A;  2OAU A;  3HI9 A;  3L3C A;  1TK0 A;  3J7A N;  2B8P A;  4F50 A;  4DR3 F;  1T7P A;  1EKS A;  3A8E A;  4KH0 B;  2J0Q D;  5H9F K;  2QLB B;  3J7Y I;  1U1R A;  9ATC B;  1VC6 A;  3BN4 A;  1G2E A;  1BQX A;  2ZH2 A;  1S10 A;  2EG2 A;  1VCT A;  4Y00 A;  1T05 A;  2Q6C A;  2R7U A;  1S1U B;  2ZJQ Q;  1CEZ A;  1AYE A;  5DGB A;  2QA2 A;  3TA2 A;  5IT0 A;  4ELV A;  2BQR A;  4R0E A;  5IOL A;  1CJU A;  2WCX A;  2FB0 A;  2XI2 A;  5EX0 A;  2I2Y A;  1H6K X;  3CF5 Q;  2O67 A;  2CQI A;  4TY8 B;  5DM7 Q;  2HWH A;  4ER8 A;  2AGP A;  4DQS A;  2NRE A;  3CD6 S;  3ISN D;  1CJT B;  5JUM A;  1TMJ A;  3A8K A;  3I0R A;  4FYY B;  3M8R A;  3WDO A;  4DR5 J;  2VIC A;  1FVS A;  1TUW A;  4A8X A;  2CJ9 A;  4J9P A;  2AF6 A;  4OYI A;  4GC6 A;  3DCA A;  1NK6 A;  4Q2L A;  3W8P A;  2GIF A;  4L74 A;  5HN0 A;  3P96 A;  1HHS A;  3FEZ A;  4ZPT R;  2OEK A;  5EHH A;  4Y34 A;  3BZQ A;  4ILR A;  3ZZ0 A;  1MRO B;  4NRT A;  4YB1 P;  1AB8 A;  2G1H A;  1OQ6 A;  2ZH9 A;  1HHT P;  1EAY C;  4LFB F;  2XZT B;  4IG3 A;  3R7B B;  1V3Z A;  3M05 A;  3OL7 A;  5LMN J;  3G87 A;  1KEK A;  4JI3 J;  5EWF A;  1RBL A;  1CBK A;  4JP8 A;  4Y2I A;  5EWE A;  2FY8 A;  1VHI A;  4DSJ A;  1WOO A;  3RJM B;  4DR2 J;  2Y9H A;  4FZV A;  3TWZ A;  2OFH X;  1RE1 B;  1U09 A;  2KM8 B;  1OWX A;  6AT1 B;  3T1Y J;  3IRX B;  2VFR A;  1K9M T;  3B8H A;  3WX4 A;  2EW9 A;  4B3T J;  5EUH A;  3VGT A;  1NK5 A;  2IVM A;  5DDQ C;  1T95 A;  2YKA A;  1EP4 A;  4NLW A;  4J9U E;  1B0T A;  2XMW A;  4WPA A;  4YB6 A;  2V63 A;  4EI2 A;  3DFE A;  4XK8 C;  3PR5 B;  1IBM F;  2B4V A;  4X4N A;  2G2Z A;  4N47 A;  1IBK F;  4KR0 B;  3H5X A;  1RT6 B;  3JSM B;  4WXO A;  4DL6 A;  1FCA A;  4DR3 J;  3C66 A;  3DLK B;  4QIE A;  4PXB A;  5GVQ A;  2CJQ A;  5CYQ B;  4ZVG A;  2IYG A;  5DQI A;  4BC9 A;  2EXU A;  3KK1 A;  3PW5 A;  2VF3 A;  2C3Y A;  3OR1 B;  1IR0 A;  1MLA A;  1OQ3 A;  5AJ3 F;  5THW A;  5MAO A;  2VPX B;  1NBE B;  3GU0 A;  4NOH A;  2XY7 A;  1OO0 B;  3C6U A;  3TYT A;  2E9Z A;  1BWE A;  3BSC A;  3V6K A;  2Q66 A;  4IQX A;  3TOQ A;  4ITS A;  3PNI A;  3KHR A;  3D28 A;  1GTE A;  3BPS P;  3WX8 A;  3Q23 A;  4DV0 F;  1EHW A;  1XR7 A;  1RIS A;  4LRD A;  4QOT A;  5E0O A;  3CCS S;  4J91 A;  2X1A A;  4C0B A;  1APS A;  1PYT A;  4DS4 A;  1ARO P;  2HVZ A;  1WKJ A;  2VFS A;  2RS2 A;  2M8D B;  3QJP A;  3LO3 A;  2V8G A;  4OL8 A;  1RHK B;  2HVH A;  4GVB A;  5ETR A;  2FJX A;  2L9W A;  4ZCK A;  2VD3 A;  3SFU A;  3CC7 S;  3BGO P;  4L72 B;  4ED6 A;  3SI8 A;  2MZR A;  1S72 S;  1SIZ A;  2FIU A;  2YX7 A;  3P5T L;  4QWB A;  2GW8 A;  4K50 A;  1OSD A;  1UTA A;  1SH3 A;  3FCV A;  1H3D A;  2OPR B;  3T9N A;  4OZL A;  1SI9 A;  4DR2 F;  4ZPA A;  1FI4 A;  4QWC A;  3KLF B;  1IKW B;  5G4D A;  3F73 A;  4N76 A;  1TK5 A;  2ALZ A;  4BHQ A;  2I0X A;  2M9K A;  1B4S A;  1QVG R;  1AUD A;  4IO1 A;  2JEJ A;  1T9W A;  2BRK A;  3TA0 A;  3J7A 1;  1Y10 A;  2RE1 A;  3HFK A;  2VQF J;  3N4W A;  3CCU S;  2Z0G A;  4FVM A;  3FZ2 A;  4I56 A;  1U49 A;  3FCH A;  1EET A;  1FRM A;  3GYG A;  4M5I A;  1ZA2 B;  2HKE A;  1BWV A;  4OIX A;  3WC2 A;  2J5A A;  1YJU A;  1IKW A;  1TFW A;  4NYZ A;  2X51 A;  4URS A;  4JI1 F;  4LBP A;  5D4O A;  3CIZ A;  4K8R A;  3IGV A;  4F0H A;  2BAB A;  3T5H A;  1N32 F;  2EC0 A;  2KYX A;  3D1O A;  4USW A;  4KV8 B;  1N32 J;  4RNH A;  2R4F A;  1S1X B;  3QT8 A;  1FRX A;  4UY8 5;  3MFH A;  3C6T A;  1O0P A;  2H5E A;  3A13 A;  3EGZ A;  4X64 J;  5K14 A;  2MJN A;  1NK4 A;  2OPQ A;  1XMO J;  4M5L A;  4M5H A;  2V4Q A;  2DGT A;  4ZJQ A;  5HLF A;  1CUL A;  1WC4 A;  2MTL A;  4DPU A;  2IBO A;  1Q79 A;  5A2Q U;  4NE9 C;  1R0A B;  2F40 A;  3DRR A;  2CNN B;  2DGU A;  4KFB B;  2XNQ A;  1SJF A;  4PXE A;  4G1I A;  3G9C A;  5BYQ A;  3CCV S;  5E3Q A;  5I3U B;  2B7C B;  2VFU A;  2MQM A;  5GAE I;  2BKP A;  1HBU A;  2LVW A;  3EZ5 A;  1RTH A;  1CJU B;  4QWD A;  4P2X A;  1IBK J;  3PIO Q;  1HQU B;  2FZC B;  5A8W A;  3G6E S;  3THV A;  2F5G A;  4ZOS A;  3G82 B;  2AGO A;  3WHI A;  2RQ4 A;  4QPX A;  3QT6 A;  4ZVT B;  4YR3 A;  3O2I A;  5D77 A;  3N6M A;  4DUZ J;  2EVZ A;  2H48 B;  4PUO B;  3ENA A;  4L75 A;  2LU2 A;  2IRU A;  4YDX A;  3T19 A;  1CJK A;  3CJR A;  4WP8 A;  5AJ3 J;  4A8S A;  5M2U A;  2C2N A;  1Q8B A;  1UFW A;  3OTO J;  3SV4 A;  1U1L A;  1OMS A;  3CT9 A;  4NWB A;  4MYU A;  1PAU B;  1O5J A;  4OFZ A;  5B7W A;  4PWD A;  5C2C A;  1ZBT A;  5HVF A;  2DT9 A;  2YWK A;  2XSJ B;  3DU5 A;  3BB5 A;  4QIV A;  5HBM B;  2OO4 A;  5HQL A;  2RHS B;  4DV0 J;  4DR6 F;  4F26 A;  1PAE X;  3ZTR A;  3CJT A;  5GMK a;  4LSZ B;  3CUL A;  1QE1 B;  3PCO B;  4RW6 A;  3J7Z 5;  4MK8 A;  2J7W A;  3GJS B;  4OI1 A;  3UFC X;  1NDP A;  3BR9 A;  3EVO A;  4UUW A;  2U2F A;  1Q95 G;  2MQN A;  4YR0 A;  5C7P A;  4O4G A;  1FVQ A;  3MTK A;  2CVI A;  4ZPW R;  1UPM B;  3KJF B;  2ASJ A;  3LP0 B;  4ZCI A;  2J76 E;  4PXD A;  3Q2T C;  1RWO B;  2F7V A;  2BEF A;  1SJ3 P;  2Y8W A;  3EZO A;  1CJT A;  2HSE B;  5DGA A;  3I31 A;  1NXI A;  4J9N A;  4DFK A;  4IOA Q;  2EFQ A;  2DRD A;  5BR8 J;  1SIW B;  1VIX A;  2BYC A;  2RNE A;  3LUY A;  1NRK A;  4KT0 C;  4DX8 H;  1RP5 A;  1VRU A;  3PXG a;  1ULR A;  3AXM A;  3JSM A;  2Z8Q A;  4FF4 A;  3BJY A;  1WEX A;  1XMO F;  3TA1 A;  4WK1 A;  1U4B A;  4OZ5 A;  5HQ8 A;  2C2K B;  3KG0 A;  2VA2 A;  1R7I A;  5T7L B;  2ZDO A;  3TAP A;  2BJ3 A;  3LTO A;  2AYG A;  1S1X A;  3SQO P;  3KK1 B;  3GG0 A;  2MKS A;  2VDH A;  3Q8S B;  1IR1 A;  2KG1 A;  4LRC A;  2OP5 A;  1FXD A;  1EQ0 A;  2OLW A;  5KT6 A;  1NHK L;  3QAE A;  2LCW A;  3M2V B;  3Q8Y A;  3DLB A;  2DR6 A;  2FQQ B;  1WC3 A;  4UUX A;  4JI7 F;  4GKK F;  1HNV A;  2MPU A;  1VMB A;  2GJ2 A;  3FQL A;  5MLC V;  2XC9 A;  4J9O A;  2C1E B;  1R27 B;  2H4W B;  2PSZ A;  4FXV A;  1WHX A;  2QTW A;  2XG8 A;  2JRS A;  3KDN A;  1SL0 A;  1NSA A;  3M1V A;  1Y5L B;  2BKN A;  3CCE S;  1FTC A;  4WU3 A;  2HQI A;  4K4U A;  4FXD A;  3MCN A;  3ZZT A;  1VRT B;  5KFM A;  3RB4 A;  2HHH J;  3ZZP A;  3OTC A;  5KFQ A;  3TUJ C;  2MJU A;  1WDT A;  1ZAX A;  1X4B A;  1WC6 A;  4DG1 B;  3W1Y C;  1RHJ B;  2CQ0 A;  5B0F A;  1HQ2 A;  4RNN A;  5CXT A;  1G3O A;  4USU A;  5LM7 E;  5KFT A;  2HHS A;  3D66 A;  4PG7 A;  4AND A;  3CJK B;  1H38 A;  1Q16 B;  2D3U A;  1WC5 A;  3CCR S;  4U7U D;  3HVA A;  3HHL C;  4LF9 J;  3JSR A;  2DGS A;  1IKV B;  4X4R A;  1GNK A;  5D6G A;  1T03 B;  5GAG I;  2QFI A;  2H4Y B;  5HRO B;  4IRC A;  2EFO A;  3D7S B;  2QL7 B;  1T3N A;  2XSJ A;  3N0V A;  2IMW P;  5DZ7 A;  1F9E B;  1JLF B;  2HK2 A;  3KG4 A;  4IH7 A;  1KRP A;  2FLP A;  2KRR A;  4KPC A;  3DLH A;  1XQI A;  1VQ7 S;  3KTQ A;  1URR A;  2DHX A;  4RW6 B;  3MPV A;  2RKI B;  4KB7 A;  1OYE A;  4F3M A;  3RUB L;  1RSC A;  2RD5 C;  3I6P A;  3DDK A;  4I64 A;  4LBH A;  4DUZ F;  1IKV A;  3ZXW A;  1TL7 A;  5HBM A;  2E9T A;  1WTF A;  1RBA A;  4N7T A;  4Q2M A;  3V4M A;  3OTO F;  2E5H A;  3BBF A;  4HI2 A;  1WOS A;  3IR6 B;  3OXG A;  3QMQ A;  4NEY A;  1D8Y A;  4WWS A;  2ACY A;  1LFP A;  4UW2 A;  3D1H A;  3MOZ A;  5B0B A;  5C42 B;  1FKP B;  3O3L A;  5HL7 Q;  1UZD A;  1ZS6 A;  4AL5 A;  4X65 J;  1L5U A;  5LMU J;  2EKN A;  2ZE2 B;  4URG A;  1RWU A;  4RL1 A;  2NPI A;  1KVK A;  1Y9O A;  2VBZ A;  3SSR A;  3GIJ A;  1NK0 A;  1U6Z A;  3BN7 A;  4HEA 9;  4G1Q B;  4NI2 B;  2ZBP A;  3N6L A;  3DU6 A;  4XAK A;  2A10 A;  4AXI A;  1VLY A;  2HAF A;  1IQZ A;  4I69 A;  3IM9 A;  4O3N A;  4ZLJ A;  1WNE A;  2LYV A;  2QN6 B;  4CLK A;  4P75 A;  1RWN B;  3M9O B;  4DL5 A;  1K1S A;  3BV8 A;  4WF9 Q;  2LQ8 A;  3CE8 A;  3ENW A;  3PYF A;  4A48 A;  4XPC A;  3PJW A;  3VAF A;  2QT7 A;  1LW0 B;  1FFW B;  2Y1L B;  2PA8 D;  4RW7 A;  4WXW A;  1RI7 A;  3ZZU A;  1HW8 A;  3MI7 X;  4FBT A;  2LXI A;  3HSJ A;  9RUB A;  4O0N A;  5BR8 F;  4Q0B B;  1U2F A;  2E1P A;  4NAS A;  2V4R A;  1CS4 A;  1H74 A;  4TKT A;  1WKL A;  3JTP A;  3CCW A;  1G7C B;  1YG0 A;  5L8R C;  5A8W B;  1J5O B;  4LF6 J;  1CJV A;  3ZZY A;  3R27 A;  1Y3J A;  1VJW A;  1WHW A;  4FDF A;  1HNV B;  1NLK L;  2B8Q A;  2BAC A;  2J7U A;  2K1R B;  2W2P P;  2YNH B;  3BM7 A;  3KWM A;  3OR1 A;  1PYS B;  1K44 A;  4ZVH A;  4DUT A;  5B0C A;  1F0X A;  1JJ2 R;  4ECU A;  2QMU B;  1T05 B;  5DDP C;  2KVI A;  2FJW A;  2HS4 A;  4F2S A;  3T1H F;  4DSK A;  3ETM A;  2C2M B;  2ASD A;  3PEJ A;  4D3G A;  2V2K A;  4E2F B;  5F41 A;  2J0W A;  1RWV B;  2F65 A;  5D0E A;  3M8P A;  4A8Q A;  1YK9 A;  2BQU A;  1S9E B;  2NXJ A;  1QUV A;  4KAI A;  2LXF A;  1K0T A;  3R7S B;  4LF1 A;  2CPF A;  2CYY A;  2K1R A;  2YNH A;  4NCG B;  3CJK A;  2XO6 A;  4Y2K A;  2HHH F;  3V81 A;  1W2I A;  1Q5Y A;  2HRY A;  4GMK A;  1SPB P;  3V6H A;  4XIU A;  2RUG A;  4RX6 A;  1U24 A;  2EK6 A;  4CO3 A;  3T5L A;  3H2U B;  1I94 F;  3KJQ B;  3PFO A;  5K20 B;  2RF2 A;  2EFP A;  1YDL A;  4NL5 A;  2RKI A;  1U8S A;  2YY3 A;  4QU6 A;  1RTZ A;  2O1P A;  3OTB A;  3ULH A;  1YHQ S;  3BQ1 A;  3FNN A;  2BDP A;  4ZJL A;  4LF9 F;  2V4J A;  2VBX A;  5U47 A;  2KO1 A;  1WUU A;  4EUV A;  4Q5V A;  3THP A;  4ECQ A;  5G0R B;  3CSK A;  4DV1 J;  4J9K A;  2HHU A;  3Q8U A;  2XS7 A;  2NCK L;  3CCT A;  2HNY B;  4QYR A;  1NSK L;  1S76 D;  1KLN A;  1TL7 B;  2V5H G;  1JLE B;  1Q86 T;  2HG4 A;  1VQL S;  1S6P A;  3EVW A;  2ZOG A;  4CM2 A;  2D7S A;  3LH2 S;  4RR5 A;  2HZV A;  2E5I A;  3PO4 A;  1KNZ A;  2HND A;  3VF0 B;  2XI3 A;  3ITH B;  1Q8K A;  3MR2 A;  2VQE J;  3NXZ A;  2WBM A;  4RO0 A;  3FC9 A;  3ISN C;  2HNZ B;  1YVF A;  3CDB A;  2CDQ A;  3QT5 A;  3CNQ P;  3FBB A;  3MFI A;  4V19 J;  3IBF B;  2IAJ B;  4PAA A;  3LAM A;  2J9D E;  4PQU B;  4UOH A;  5F0U A;  3TAM B;  1TVR B;  3JSY A;  4OYA A;  5BXI A;  1LNQ A;  4DV3 J;  5F8H A;  3RB0 A;  3DOK B;  1YRT A;  3I87 A;  4B9N A;  5IT4 A;  7FDR A;  3BGR B;  3N79 A;  3IC1 A;  3IN5 A;  2IA0 A;  2WB4 A;  4GRS A;  2LFV A;  1KTV A;  1RHM B;  2L9D A;  4OMF G;  2KG0 A;  4C8K A;  3ICL A;  3TEH B;  2YQ0 A;  6FD1 A;  2B5J B;  2NXE A;  3M6V A;  4DPX A;  2K8G A;  4PG8 A;  1R6Y A;  5ETV A;  5SUH A;  1C4C A;  5KG5 A;  2HFN A;  1T9T A;  2HHT A;  1D1U A;  4ZIV A;  5FLX U;  2BJE A;  2BM1 A;  2WB1 D;  3M6U A;  3M2U A;  2GIQ A;  4PPD A;  3HP6 A;  3KLH B;  4V1A k;  3UW1 A;  3PYD A;  4M5N A;  2DCU B;  3MMJ A;  2W4P A;  3P3D A;  3W9J A;  3X3U A;  5HVG A;  2UVV A;  2VFV A;  2V50 A;  5T7L A;  3JQK A;  2YKO A;  3CCQ S;  3OFG A;  1NCL A;  3N28 A;  3MR7 A;  4KO0 A;  3EVM A;  4Y3C A;  1NKB A;  4PG6 A;  1SL2 A;  3DC2 A;  1LW2 B;  1F6T A;  2DNO A;  4L3N A;  4NZ6 A;  3R97 A;  4CIO A;  3H5Y A;  4LF5 F;  4BS2 A;  5B08 A;  2DIT A;  2GGP A;  2HRU A;  2GVD B;  4LT6 A;  3B6B A;  1PYO B;  1P1T A;  2A18 A;  1X4G A;  4HI1 A;  4AD6 A;  3GWC A;  2IM3 A;  3KJV B;  1RU2 A;  4RBT A;  1XNQ F;  1O6X A;  1JLB B;  1YRX A;  3O5T B;  4R25 A;  3KK3 A;  4K4W A;  5D78 A;  2IM0 A;  3EGV A;  1UPP A;  2J6U A;  2G1D A;  4ZVS B;  1X4A A;  3C46 A;  1H98 A;  4DSE A;  5BYS A;  1ELO A;  1KHV A;  3NEK A;  4WP3 A;  4Z7C A;  4ED3 A;  1X0P A;  2F63 A;  1NK9 A;  1HNZ J;  2E5L F;  4KYZ A;  3MGJ A;  2DNP A;  2JC0 A;  3DXS X;  3MM8 B;  3VAJ A;  1GEH A;  2AP6 A;  4NRU A;  2UUC F;  1GMW D;  1RT3 B;  1JLG B;  2ZD1 A;  2FHJ A;  2DR9 A;  3QZ7 A;  3HO1 A;  2CQH A;  2UUA F;  2W01 A;  1FKO A;  3SV3 A;  4OI2 A;  4K0K F;  3HHN B;  2AQ4 A;  2UXB J;  1P1L A;  4P7T A;  3KLI B;  1RAA B;  1B0V A;  1Q8I A;  3M7V A;  1UWB A;  3A8I A;  1VRQ C;  4PWD B;  1XEZ A;  3FRZ A;  4OHY A;  3R9L A;  3TAR A;  3B82 A;  3K8W A;  2Z2L A;  3TUI C;  3UNY A;  1NO8 A;  3AD8 C;  3BO2 A;  3SCK E;  2LEC A;  4HR2 A;  1HIY A;  4CT8 A;  1FJC A;  1U2R A;  4FF3 A;  1N5Y A;  1HPZ B;  4WYL A;  4D3H A;  4ICL B;  3UDV A;  2XMK A;  2DYA A;  4EK2 A;  1MNE A;  1CS4 B;  2C42 A;  2LA4 A;  2MLY A;  4WFX A;  1SKW A;  1PGZ A;  1VR6 A;  4AQY J;  2OGU A;  3PHT A;  3W5Z A;  4ED4 A;  1WI8 A;  1J5O A;  1TTH B;  4DV5 J;  3QGI A;  1HWK A;  1D9F A;  4MIA A;  4RW4 A;  1Q7Y T;  4DQP A;  4ID5 A;  2KT2 A;  1E6Y B;  4DR5 F;  1UVJ A;  1S0O A;  2JEG A;  2G13 A;  4CLT A;  4PZV A;  3MM5 B;  2C3M A;  1KON A;  3CD5 A;  5I3U A;  1DUR A;  1TR0 A;  2KL8 A;  2ATC B;  4ICL A;  4DI6 A;  4A8F A;  5I42 A;  4YOE A;  3FCW A;  4Y65 A;  4EBD A;  2AJ2 A;  4LUB A;  4GKJ F;  1NSQ A;  3SDE B;  2RB7 A;  1ACM B;  4QU7 A;  2Z56 B;  1XR5 A;  5KFU A;  1FJE B;  4LIR A;  5GAE U;  2OSQ A;  3KNG A;  5E3A A;  3E8O A;  5A8R A;  1W2B R;  2AYM A;  2W9C A;  2F9J A;  3FEY B;  4O3Q A;  4JI6 F;  2F4V F;  1GTH A;  3F0N A;  3JAM Y;  3TJA A;  2PC6 A;  3JQM A;  5DDR C;  3NBP A;  1S0M A;  3A4T A;  3AJ2 A;  2R2T A;  2P6S A;  3KUH A;  2FJD B;  1YWX A;  1X7V A;  2J9D A;  2JZ5 A;  2POK A;  2JVO A;  4EBE A;  3EE3 A;  1TP7 A;  3PRD A;  5KT2 A;  2DJW A;  2F8E X;  4IYQ A;  4OHX A;  3DN9 A;  2KHD A;  3FFI B;  2ILY A;  3M30 B;  4JI0 F;  2H9Z A;  2YWH A;  4NMX A;  5A6P A;  2MQO A;  5CYM A;  4WFN Q;  1TK8 A;  4NCB A;  3UD5 A;  2HHQ A;  1S6O A;  3OHB A;  1IR2 A;  2IA6 A;  1UEK A;  1KR4 A;  4IH6 A;  4ED2 A;  2AU0 A;  4B3S J;  2W9C B;  2KN4 A;  4ETZ A;  3VQS A;  4QQB A;  4YR2 A;  4DV2 F;  4I0W A;  4P52 A;  3NBP B;  5KFZ A;  1GQE A;  1JIH A;  1R31 A;  1WD6 A;  3AB4 B;  3S01 A;  3SCJ E;  3FSY A;  5GAH I;  1WHY A;  1KD1 T;  3NRB A;  2OJ3 A;  2A3J A;  2C2O B;  4YHH F;  5HRO A;  2D3O R;  4DQR A;  4QIF A;  2DEJ A;  1D9D A;  3AA9 A;  1VHF A;  4KGV B;  3OLB A;  3GIR A;  1NH8 A;  2NUU G;  2CG4 A;  2V9W A;  2XM3 A;  2BMB A;  2NXC A;  1FNX H;  3FGV A;  2QMW A;  4J9L A;  3CC4 S;  5ETQ A;  3VAK A;  2ZHB A;  2RRA A;  2FJV A;  2FJB B;  2R8K A;  3KLV A;  1MSW D;  2COL A;  3QJL A;  1ROF A;  3T6B A;  5SZT A;  3FKB A;  3DLE B;  1WJ9 A;  2LU1 A;  2YKP A;  3GJQ B;  4LVN P;  2OTL S;  3NNC A;  1KOH A;  1GMV A;  2HGM A;  1DFD A;  4TYA A;  1HNZ F;  3C16 A;  3OQ2 A;  3NOG A;  1NAQ A;  4O23 A;  3CDU A;  1R0C B;  4CO5 A;  5K8N A;  4O44 B;  3RAM A;  3QID A;  4DL0 C;  2ADB A;  2UUC J;  1UJ6 A;  1S1V A;  3FJ2 A;  5KG3 A;  1HW9 A;  1V6H A;  4ZVO B;  5KFK A;  3HSD A;  3IMQ J;  2MZQ A;  4DMZ A;  5FDL B;  1CPZ A;  2AJQ A;  2XYG B;  4EBC A;  3FZB A;  3OVB A;  3H5U A;  4CH1 A;  3MPD A;  5AXM A;  3QJJ A;  2MKH A;  3CUN A;  3C16 B;  4H4K A;  4NLX A;  2XY6 A;  5HP1 B;  2XTJ P;  3BH7 B;  2W9B A;  2VPZ B;  3IWX A;  1ZAV A;  2OEM A;  3LP0 A;  4RNO A;  2EBG A;  4QWA A;  4ED0 A;  4EFA C;  1YIJ S;  4P2M A;  3RW6 A;  4TN2 A;  1UZH A;  1WC0 A;  1RTD B;  2FHK A;  1B7Y B;  1RKI A;  1BD6 A;  2CKW A;  2QGF B;  5DG8 A;  4B9M A;  1MMD A;  4CO1 A;  4AQY F;  1C4A A;  1RT2 A;  5T14 A;  2WVB A;  2XMA A;  2ROE A;  3GFX A;  5E7O B;  1CSJ A;  2KT3 A;  5HAO A;  1DTT A;  3SCI E;  2H51 B;  4CNZ A;  4UZB A;  3MAQ A;  2MB0 B;  4JI0 J;  1FE4 A;  1S77 D;  1SJR A;  4OJG A;  2BVZ A;  1QAY A;  1W25 A;  2VQF F;  2ZBC A;  1Q81 T;  1FT8 A;  5L38 A;  4FS1 A;  1R0A A;  1IM6 A;  2QMX A;  4RUA A;  4DV2 J;  1RAI B;  4MK9 A;  2VKZ G;  4R5P A;  1QAI A;  4M8L A;  5K9F A;  2FZK B;  2KFY A;  4DPW A;  1C1B B;  4IDK B;  4YHH J;  2HGL A;  1Y3K A;  4ZP8 A;  3GE9 A;  2AEM A;  1I51 B;  4ZP7 A;  5CCM A;  3CPW R;  4TNO A;  2LP4 A;  5HI7 A;  4F3Q A;  3OVS A;  1VBZ A;  4LF7 F;  3W7B A;  4ED1 A;  4MFB B;  4JUZ A;  2WW8 A;  2A6M A;  1TKZ B;  2I38 A;  2OD4 A;  3M1V B;  5CAA A;  4EEY A;  1NSP A;  2OUG A;  4J90 A;  4X64 F;  2MY7 A;  1T94 A;  3L7O A;  1BXN A;  2CXE A;  2N7Y A;  4ECW A;  2YNG A;  2L3M A;  4U6P A;  2CZ9 A;  2NLW A;  3HVW A;  4XO0 A;  1Y5I B;  3D5M A;  4FBU A;  2ZZM A;  2DD8 S;  2QFJ A;  4H4K C;  2W7O A;  1N34 J;  3CWJ A;  4DV6 J;  2V2V A;  3TR5 A;  3SFG A;  3PKM A;  3K57 A;  2FD2 A;  2YWF A;  3M32 A;  5FII A;  4B3S F;  4O3S A;  3OJU A;  3C15 B;  1YJV A;  4MT1 A;  1B64 A;  3RTV A;  1X4F A;  1ZPW X;  1V9O A;  3CJ3 A;  2W2Q P;  2HUR A;  4IUF A;  1YJT A;  3OV7 A;  4YB7 A;  1KC8 T;  1DY3 A;  3MUR P;  2DHH A;  2X1B A;  5DLG A;  3MMB A;  4XDD A;  4YB5 A;  3KMQ A;  1E6Y A;  1SC4 B;  3KOA A;  3TJ8 A;  1F5A A;  2BE2 B;  2W24 A;  3FVY A;  2Z4P A;  3QSY B;  4RW7 B;  3RU0 A;  5J2N B;  3DRP B;  4AUK A;  2IAJ A;  4DSF A;  4LQ3 A;  2R7Q A;  1D9A A;  4P2F A;  5I42 B;  1TKX B;  2CQC A;  2LQ5 A;  1JLQ A;  3N9U C;  4XTT A;  3HMJ G;  2XWX A;  1KVJ A;  5HJY A;  1JJ4 A;  4K7Q A;  1HHQ A;  2IMO A;  5JXS A;  2W9B B;  3OJS A;  3Q83 A;  1S59 A;  2ZKU A;  3R5C A;  2PD1 A;  3ZTP A;  4C0O C;  3UO0 A;  1JMT A;  1TMM A;  1H7W A;  3GLJ A;  4I68 A;  4KFB A;  1KLM A;  3HT3 A;  4EZ9 A;  4LFC F;  2HBQ B;  3W66 A;  4KSE B;  2BW7 A;  3HT0 A;  3GYN A;  1I3O B;  1TL1 A;  3VV2 B;  4ZK7 M;  5AXL A;  4CLP A;  5JVG Q;  4OYM A;  2B7B B;  2FHM A;  3DM2 B;  4DU7 A;  2HHX A;  1G4C A;  4NXM J;  4CLZ A;  3THT A;  3I0S A;  1YBT A;  5ETO A;  1U1K A;  2OPS B;  2DGQ A;  3DYA A;  4TYB A;  2M7S A;  1NM2 A;  1KHW A;  4NA2 A;  2HWI A;  4S0M A;  5EX3 A;  4JI2 F;  2AW0 A;  4FNH A;  4NLD A;  4DR1 J;  2ASL A;  1S9F A;  1DBD A;  2VU5 A;  1C0U B;  2JNJ A;  4R5P B;  6FDR A;  1QSL A;  1TL4 A;  4IRK A;  3MAH A;  2OEJ A;  4A8W A;  3A8J A;  2AX1 A;  2FHJ D;  4KO0 B;  2GVD A;  4IFY B;  2OTJ S;  3O1L A;  3EX7 B;  1LKZ A;  1UEV A;  3B54 A;  4U8Y A;  4DCP B;  4NZ0 A;  1T02 A;  4K4T A;  1HD0 A;  3JTO A;  4OZ1 A;  1JLA B;  2YQ3 A;  4DV4 J;  4I2P B;  1R8B A;  3GR0 A;  3VTI A;  3WBZ A;  1PIE A;  3FRY A;  2M5Y A;  1DRZ A;  3DYA B;  4B3R J;  4C4W A;  3I0R B;  3W65 A;  1RT1 B;  5HMY A;  2HLT A;  2N4C A;  1QAX A;  2NSB A;  4ZHR B;  2XZW A;  2KT5 A;  4AL7 A;  2YNG B;  1HL6 A;  3DLE A;  3A1Y G;  3DRX A;  3SIP B;  4TY9 A;  2R7T A;  2OMO A;  3TUZ C;  3HHE A;  1NDC A;  4DUY J;  4X4P A;  4ECZ A;  4G1P A;  3VAM A;  2YVS A;  4NCA A;  1DTQ B;  4W4M A;  5DZ6 A;  2XUL A;  1IBL J;  4NLV A;  1OY9 A;  3LPY A;  4RNM A;  1RYS A;  2NR0 A;  1CC8 A;  3M8Y A;  3GON A;  1OIA A;  1KDN A;  5LXY A;  1F2H A;  4I2P A;  4KC5 A;  4TXS A;  2AGQ A;  4LF7 J;  4JV5 F;  1VQ8 S;  4X4S A;  3GFH A;  2VAS A;  2UXD J;  4C6A A;  3HPO A;  4DR4 J;  3R7N B;  3HHK A;  5D3G B;  2ERR A;  3IA0 A;  2PN6 A;  2R7X A;  1XMB A;  2MZ1 A;  1C1C B;  2HGN A;  1YJ9 S;  1SJQ A;  3G6V A;  4EGL A;  1VRU B;  2KI2 A;  1S48 A;  2GVZ A;  2FY1 A;  3U02 A;  2DXE A;  3TAN A;  2OEL A;  1XJW B;  2G4B A;  5J2N A;  2EFN A;  1FDD A;  4M5K A;  1RBO B;  1N34 F;  2HPU A;  4OV6 A;  1N36 F;  1WEZ A;  4C8N A;  2JSX A;  2R7V A;  1IJE B;  5GME A;  5EGY A;  4LFC J;  2W2M P;  3T3F A;  4MAK A;  4ECS A;  3J80 U;  3NGU A;  4BDP A;  1UVL A;  4UQT A;  1U02 A;  4QIG A;  4QR2 A;  2ZM6 J;  1YX2 A;  2OSR A;  2NXN A;  2ZIT A;  3MMC A;  4FP9 A;  4WBF A;  2GV1 A;  5C25 B;  2QX0 A;  3EXY A;  4MIB A;  3GPA A;  4NXM F;  3H98 A;  3DOM B;  4LRA A;  4OQJ A;  1V3R A;  3AOA A;  2RQC A;  3KG1 A;  3HFZ B;  3BBC A;  1QSS A;  4EZ6 A;  4UY8 T;  1YZ6 A;  4Q43 A;  1HR0 J;  5DQH A;  1YTY A;  2XHW A;  3PYG A;  4WFZ A;  2GC8 A;  3KLG A;  2IM2 A;  1UJ4 A;  1GX5 A;  1LW2 A;  2QA1 A;  2HQD A;  2J7K A;  3W2V B;  4DX6 A;  3TW0 A;  2EI5 A;  1S6Q A;  4FXW A;  5E3C A;  3VQT A;  3OUY A;  3CJS A;  2QYG A;  2IPO B;  3D67 A;  2BJ1 A;  4LFA J;  3IM8 A;  3ZO7 A;  3C2P A;  3NAH A;  1FRI A;  1EAR A;  1M5H A;  3QZ8 A;  4CM0 A;  3L7U A;  1VQ4 S;  5A8R B;  2GA7 A;  1QSY A;  5CD4 A;  3GJR B;  2Q6B A;  5IQ6 A;  1YJN S;  3PR4 A;  3D6T B;  1BY9 A;  1GFW B;  1TAQ A;  2MZJ A;  2AEF A;  2P9E A;  3HHL D;  2GQQ A;  3PM9 A;  1L3T A;  2ACM A;  1NKE A;  3KK3 B;  1U0S A;  1Y4Z B;  4ANC A;  4F8R A;  4TU9 A;  1UVN A;  2W2O P;  4KHR A;  4HDH A;  4X84 A;  7FD1 A;  4X2B A;  1UEU A;  1AXQ A;  1AT1 B;  1YLX A;  2BBE A;  3ILO A;  3GIL A;  1REV B;  3EIC A;  1IBL F;  1WG4 A;  3MM9 B;  4GO7 X;  3MR5 A;  1MN9 A;  4JI2 J;  1HNX J;  2LQJ A;  4DR1 F;  2QC3 A;  1Q53 A;  1SC3 B;  1JLA A;  2AJF E;  2B6A B;  2RIJ A;  2WBR A;  1XTZ A;  3O6Q A;  1KN6 A;  1VRT A;  4NML A;  2W4D A;  3PW2 A;  3CIM A;  1K1Q A;  2P9C A;  5I4M A;  1RB0 A;  4LF6 F;  2KXN B;  3MMB B;  4IO9 Q;  2CPJ A;  2OML A;  3SSS A;  1CJK B;  4DG1 A;  4DS5 A;  2GAH C;  2ADC A;  4WZQ A;  2XMV A;  1XR6 A;  2Q43 A;  3OR2 B;  4RUC A;  2L9N A;  2M8H A;  3NCQ A;  4NCG A;  3T5K A;  1NND A;  5J2Q A;  1N36 J;  1I6J A;  3KFW X;  2PFD A;  4M63 A;  2X3G A;  4C9D A;  4F4K A;  2B9X A;  2VG6 B;  3B78 A;  1NDL A;  1M5V C;  2WK4 A;  2V4J B;  4YY3 F;  3IRW P;  5HO4 A;  2C3P A;  1ICE B;  3DOL B;  1VK8 A;  2V8V A;  4IFV B;  3T6J A;  4AE5 A;  4OV1 A;  2SXL A;  4O44 A;  1JQG A;  2WSC C;  3GCX P;  3H4D A;  4M1K A;  1TKD A;  4ED7 A;  1FDA A;  2L48 A;  1KLM B;  1HNI A;  2NPF A;  1KOO A;  1ZM9 A;  1NJI T;  4JV5 J;  1PBA A;  2UXD F;  2DHA A;  2EK1 A;  2IRX A;  1PKU A;  3M8W A;  1UA1 A;  3GFY A;  4FPI A;  2K2P A;  2IJF A;  3MM7 B;  4ZVE A;  3SQG B;  5AXN A;  5B0A A;  4QW8 A;  4QW9 A;  1IXK A;  3HLU A;  4OYO A;  2PA3 A;  1I94 J;  3QPI A;  1F2G A;  1RT5 B;  2DO4 A;  2MGZ A;  2HNZ A;  2QA4 G;  5KFW A;  4F4Y A;  4ZKA A;  1FER A;  1P8G A;  2VBY A;  2W2N P;  4F0M A;  5D0R A;  1GXU A;  4R0J A;  4OX9 F;  4LRE A;  3SBM A;  1QTN B;  2A6O A;  1RDR A;  3AQO A;  1C0U A;  1UET A;  4JI4 J;  3PX4 A;  1QTM A;  2FLL A;  5HVH A;  2ZWP A;  2ZM6 F;  5KG0 A;  2G2Y A;  3IBW A;  3TI0 A;  1TZ0 A;  4NI2 A;  4DN0 A;  2YWE A;  3LP2 B;  1VC0 A;  2LEA A;  2ATL A;  5DS7 A;  4CCH A;  1A6L A;  2CDR B;  2VPY B;  1Y5N B;  1N8R T;  2LEB A;  2XQC A;  1Q78 A;  1N0V C;  3UVJ B;  1P6T A;  3WQP A;  1R8P A;  2V8D A;  3T5J A;  3OLA A;  2PT0 A;  4KGX B;  3H25 A;  3GYX B;  2KZZ A;  4ECX A;  4WFA Q;  1FDN A;  2DR7 A;  1G6B A;  2PDA A;  5IQQ A;  2RUS A;  4B9V A;  1U25 A;  1MWZ A;  4OHZ A;  4WZM A;  1VDH A;  2AJ1 A;  2CJA A;  2KM8 C;  2AV5 A;  3H0P A;  4CDI A;  4B9U A;  4QWE A;  4MFB A;  4QYZ K;  5KTQ A;  1IKX A;  2CQ1 A;  1URN A;  1EZZ B;  4RUH A;  3G4S S;  3BO4 A;  2ZH1 A;  3VWS A;  1FEH A;  1O51 A;  3OL8 A;  2FZG B;  3VCD A;  1QE1 A;  1UWA A;  2HQF A;  4JI8 F;  5DQG A;  4AL6 A;  1K73 T;  4Q8F A;  3M6X A;  3JXO A;  2WW4 A;  4L76 A;  4AFF A;  2FDN A;  4P7V A;  3RBZ A;  5K8M A;  2DHS A;  2VJU A;  1AW0 A;  1WF0 A;  1VK3 A;  4IG0 B;  3L4B C;  4MKA A;  3M32 B;  1FD2 A;  1LOU A;  4I6W A;  4WU2 A;  2JVR A;  1CQM A;  3LAK A;  5CYM B;  3EJM A;  3C15 A;  1FNM A;  1QY7 A;  3P4U B;  4NX9 A;  3RW7 A;  5KT3 A;  4WFB Q;  4YUD A;  3HSZ A;  4A47 A;  2N3O A;  1LWE A;  2JOQ A;  2K06 A;  3ONQ A;  4IOB A;  4CLF A;  1SKS A;  1RWP B;  4L6V 3;  1Z1Z A;  1U0H A;  1IN0 A;  2DH7 A;  4B9S A;  1AZS A;  3FBE A;  1JLG A;  1MU2 A;  5IC4 B;  3D2W A;  4FYW B;  5CA5 A;  5H1S V;  3R2C J;  1RK8 A;  3HZG A;  1DTQ A;  4FYD A;  4DV7 J;  1F60 B;  1WI6 A;  2RF2 B;  2H1Y A;  4HT7 A;  1LWC B;  1RT7 A;  4LR7 A;  4WYW A;  3R1L A;  4MKY A;  4A8O A;  4B3M J;  1HWU A;  2OPP A;  3QWP A;  3NS7 B;  5AE2 A;  2UVR A;  1M5O C;  2Y1I A;  4NYP A;  5E5N A;  3BYR A;  4KRW A;  4OYP A;  2FC9 A;  4ZN1 A;  3H90 A;  2A2C A;  3IXQ A;  1SCJ B;  3BKF A;  4YDD B;  2E5L J;  3IWN C;  1D0E A;  2G0C A;  4RWW A;  2AHO B;  2CIM A;  2MLZ A;  3IG1 A;  1NB2 A;  3IAS 9;  5IWA F;  2VC1 A;  1CC7 A;  4U7C A;  2FVQ A;  2JL9 A;  3PRV A;  2UU9 J;  2FVP A;  4YS2 A;  3ZNU A;  1MN7 A;  3CJ8 A;  2MLX A;  5KG6 A;  2N4D A;  3EWG A;  4DPT A;  1VQK S;  3VAH A;  1KTQ A;  2P9G A;  1QVF R;  3QIP A;  1W26 A;  2ROP A;  3G8S A;  4ZN3 A;  2R8H A;  2QG9 B;  4ECY A;  2D69 A;  2E1M C;  2EPI A;  1FJG J;  2UXB F;  4DF8 A;  4U9R A;  3BGF A;  5E33 A;  3NWG A;  5D4L A;  4USI A;  5FDL A;  1JXE A;  3KK2 B;  3MM6 B;  3MEG B;  2DNH A;  3MCS A;  5KAK A;  2RQM A;  1X8D A;  4MKB A;  3WIU A;  2ZH5 A;  2GX8 A;  4KGK A;  4J9S A;  2RDD A;  3DM2 A;  1TEL A;  1DAR A;  4G65 A;  4YME A;  4YQW A;  2NUH A;  2DNM A;  1IQT A;  1H2U X;  2BR0 A;  2C3O A;  1S9G B;  4DSI A;  1U1M A;  1RXO B;  3TVZ A;  1WG1 A;  3IFE A;  4LMZ A;  5D4N A;  2MQQ A;  2HIY A;  1WOP A;  5H9E J;  1L3V A;  4G3I A;  2ZZN A;  3CMQ A;  4WTY A;  1RAC B;  1RT2 B;  3HD1 A;  4BCA A;  4V19 X;  1M5S A;  1ZA1 B;  1HBU B;  1KBR A;  3M8Q B;  4IFY A;  4X4Q A;  1E6V B;  1SL1 A;  2VC0 A;  1JK9 B;  4J9Q A;  4KJI A;  1Q8L A;  3M8P B;  4C8Y A;  1IM4 A;  5F0W A;  2EEY A;  5CQG A;  2KXF A;  3VGU A;  1FWK A;  1HQE B;  1ZAW A;  2NS1 B;  4WE1 A;  3RR7 A;  3QRR A;  2CPX A;  2CAJ A;  3D6F B;  4FVC A;  2PI4 A;  3DLK A;  1JNR B;  4OI0 A;  3HVT B;  4YN3 B;  1NPK A;  2GML A;  2KVQ E;  5ETL A;  1RTJ B;  4A4J A;  1TQL A;  3RYL A;  2IRY A;  3KLI A;  1F9H A;  2XCP A;  4C0H A;  4W98 A;  3J81 j;  3UD4 P;  2RH3 A;  3MR3 A;  3US5 A;  3AJD A;  3LAL A;  2FPH X;  3TZY A;  1N6Q B;  4FKX A;  2F4V J;  1RAH B;  4F25 A;  1H72 C;  2N3L A;  2R3V A;  3CO0 P;  2D41 A;  2BJ7 A;  2WVE A;  2QRR A;  3D54 A;  3H42 A;  2GMJ A;  1S79 A;  3IS9 A;  3JS9 A;  3TO8 A;  4A8M P;  4OZJ A;  2B6A A;  1JXV A;  1NZ8 A;  2DTJ A;  4JI8 J;  3QAT A;  4ENO A;  3M2R A;  4TU7 A;  3U27 A;  1JLB A;  1RKJ A;  3ILL A;  5AE1 A;  1S1W B;  5M2R A;  3GV8 B;  1FHT A;  3NKY A;  2RDJ A;  1LXN A;  3G8Q A;  4C98 A;  4X4U A;  2GVZ B;  5D8H B;  2N82 B;  1VBX A;  2IFX A;  3JTN A;  1HMV A;  1LWF A;  3R5J B;  3C8Y A;  2UUB F;  1S6P B;  5DM6 Q;  2AYB A;  4YP3 A;  1N52 B;  1LQ9 A;  3IR7 B;  2MKC A;  4NLT A;  3OFE A;  4CLL A;  5IV3 A;  4A8K A;  4B02 A;  4PYD A;  2VON A;  1NK7 A;  1JKH A;  5HJX A;  3K5L A;  3BEG B;  2YXL A;  2IC3 B;  1RCX B;  3ETO A;  4KPY A;  2FLO A;  2XWY A;  3QGG A;  1FRJ A;  4U96 A;  4HLB A;  2OH2 A;  4DV7 F;  2KTQ A;  2HHV A;  3DLJ A;  1R8H A;  2BZ2 A;  2Y1R I;  2VDI A;  5C25 A;  2PI5 A;  2GQC A;  2OHD A;  1N5S A;  3CO9 A;  4ZCL A;  1DQA A;  3DHX A;  1U7L A;  3DOK A;  1SH0 A;  3LWM A;  3CD0 A;  1YIT S;  2QZ8 A;  3C14 B;  4QIW D;  4K4X A;  2L41 A;  2I8E A;  2XMT A;  3DRP A;  3EM1 A;  3H7H B;  4ALZ A;  3SEO A;  3SQG A;  1RWW B;  3QQC D;  5L39 A;  3P8B B;  1S4F A;  4M94 A;  2UUT A;  4X4T A;  1L3S A;  2PE8 A;  2XS5 A;  1B0P A;  3PEH A;  5LOQ A;  2HZC A;  3NWR A;  3I56 S;  1YZ7 A;  3POT A;  1FA0 A;  1H73 A;  1F5B A;  2QLJ B;  3R5A A;  4HHH A;  5HAT A;  2UU9 F;  2R42 A;  2VQE F;  4F36 A;  1OJ4 A;  2LMI A;  2MHN A;  4I6Y A;  4WK3 A;  4DHV A;  3KLH A;  3R5G A;  2D9P A;  4ZHR A;  4Y2C A;  4OYW A;  3TZX A;  5B09 A;  1T9X A;  3TQ1 A;  3EDQ B;  3BGL A;  2AX0 A;  3AH6 A;  1S9G A;  5ADZ A;  1M1G A;  3U1N A;  1D3W A;  5A6W A;  4TLQ A;  4PQA A;  2CZV C;  2ZFH A;  1ZOT A;  4OZN A;  3JQJ A;  2BJ8 A;  2M52 A;  4U67 Q;  2ABY A;  1C1B A;  3HKZ D;  4IDK A;  2YNF A;  1U47 A;  3C6U B;  1YBU A;  4CTA A;  1RZM A;  4F7V A;  3GV7 B;  2J0S D;  3R5B A;  3I4H X;  4Z7Y A;  3AOC A;  1JJC B;  1NKC A;  3MOJ B;  3K8V A;  3NGS A;  3TEG A;  4BBY A;  4OJ3 A;  1BLU A;  1FXL A;  1P27 B;  1MWQ A;  3MCO A;  2VG5 A;  2VG7 B;  5CAB A;  3Q22 A;  4ZCM A;  1SBR A;  3CC2 S;  2HHW A;  1RA7 A;  4C3K A;  1FES A;  2AMC B;  1KQK A;  3LWL A;  4OJH A;  5KFP A;  4TLR A;  2DRA A;  3V2U C;  2YX1 A;  2B4U A;  1XN9 A;  2PMW A;  5KFB A;  2MST A;  4M5D A;  3LGM A;  3M6W A;  4OYX A;  2R2R A;  2KH9 A;  2DO0 A; 
#chains in the Genus database with same CATH homology
 3R7N B;  1RHJ B;  1QTN B;  1I51 B;  2HBZ B;  3D6F B;  2XYP B;  2CDR B;  2H4Y B;  2XZT B;  3R7B B;  2QL7 B;  2CNK B;  2C2Z B;  2CNN B;  2HBR B;  3IBF B;  1F9E B;  2CJY B;  3R6L B;  3RJM B;  1NME B;  4ZVR B;  1SC1 B;  1RE1 B;  5IC6 B;  2Y0B B;  3KJN B;  1RHM B;  2H5J B;  2H5I B;  2XZD B;  4ZVT B;  1SC4 B;  2H48 B;  3R5J B;  2QL5 B;  3GJR B;  2C2O B;  1PAU B;  1GFW B;  1RWK B;  2QLF B;  3P4U B;  2QL9 B;  1RWN B;  3IBC B;  3P45 B;  2CNL B;  1RWP B;  2HBY B;  4LSZ B;  2HBQ B;  3GJS B;  1RHR B;  2Y1L B;  3GJQ B;  2H65 B;  5IC4 B;  1PYO B;  1RWW B;  1SC3 B;  1I3O B;  1RWX B;  3QNW B;  3KJF B;  1QDU B;  3EDR B;  2XYH B;  1RWO B;  3NS7 B;  2QLJ B;  3D6H B;  3D6M B;  4ZVS B;  4ZVO B;  1RHU B;  1RHK B;  2XYG B;  3EDQ B;  4DCO B;  2C2M B;  3GJT B;  2C2K B;  2CJX B;  4DCP B;  1RWV B;  1IBC B;  2DKO B;  4JB8 B;  4ZVP B;  4ZVU B;  1BMQ B;  1RHQ B;  1ICE B;  2QLB B;  3R7S B;  4DCJ B;  4ZVQ B;  2FQQ B;  1RWM B;  3SIP B;  2C1E B;  2H51 B;  2H4W B;  2H54 B;  2P2C B;  2CNO B;  3KJQ B;  5K20 B;  3R6G B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...