2H5IB

Crystal structure of caspase-3 with inhibitor ac-devd-cho
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
94
structure length
94
Chain Sequence
HKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and kinetic analysis of caspase-3 reveals role for s5 binding site in substrate recognition
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords caspase-3, p17 subunit
total genus 18
structure length 94
sequence length 94
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2006-05-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 2h5iB00
1BMQB 2QLBB 1SC1B 1NMEB 3RJMB 1QDUB 2H48B 2HBRB 1GFWB 2XYHB 3R7BB 4DCOB 2XZTB 5K20B 3EDRB 2Y0BB 2CNKB 1I3OB 3IBCB 1RWVB 2H5IB 2QL5B 1RHQB 3GJSB 2H4WB 3D6MB 3EDQB 3QNWB 1ICEB 3P4UB 3KJQB 1SC4B 1IBCB 4DCPB 1RWXB 1PYOB 1RE1B 2H65B 2XYGB 2H5JB 4DCJB 3R6LB 2C2KB 3D6FB 4ZVSB 3SIPB 1RHJB 1F9EB 4ZVUB 2CJXB 2CNLB 2HBQB 2QLJB 2XYPB 2C1EB 2QLFB 4ZVTB 3R7SB 2HBYB 1RHMB 5IC6B 2CDRB 3P45B 3GJTB 2P2CB 2DKOB 3R6GB 3IBFB 2XZDB 1SC3B 3KJNB 2CNNB 3KJFB 1RHUB 2CJYB 2QL9B 2QL7B 3R5JB 2CNOB 2HBZB 4ZVQB 1RWMB 4LSZB 3GJQB 1RWPB 1PAUB 3GJRB 4ZVOB 2C2ZB 2H54B 3R7NB 1RWNB 1QTNB 1RWOB 2Y1LB 3NS7B 1RHKB 1I51B 2FQQB 4ZVPB 5IC4B 2H51B 1RWWB 2H4YB 3D6HB 4JB8B 1RHRB 2C2OB 1RWKB 4ZVRB 2C2MB
chains in the Genus database with same CATH superfamily
2R7OA 3DI6B 4QBUA 1R43A 2QLBB 2DYAA 4R25A 3GYNA 1WF0A 2EFPA 4M5HA 3CIMA 1NJZA 1JLGB 1YLXA 1M1HA 3ELHA 2VBXA 2MQMA 3HPOA 1M5OC 1NSQA 1BWVA 3HZGA 1FDDA 2V8VA 5D0EA 4IRKA 3EZ5A 2AIRB 4LSLA 4NX9A 4DV2F 1J5EF 2G0JA 2ABYA 2R8JA 4WP8A 4EBEA 1TFWA 1XERA 2YKAA 1EETA 4IFYA 1GMWA 1WI6A 2GVZB 3NCRA 3TAMB 2G13A 4M5GA 2AJ4A 2V5HG 2ZDPA 2PO4A 4LFBF 2J7UA 3VGTA 1NZAA 3TVKA 3W2VB 5E3PA 2OELA 2BR0A 1WTBA 5KT6A 4J9SA 1UEUA 3PDNA 4EK2A 1LXNA 3HT3A 1HBOB 2CUYA 2ZFHA 2ADBA 3QMQA 1W26A 3GSIA 2PFFB 4O23A 4LF6F 3HK2A 2QIFA 4WE1A 2ZHBA 2W7PA 4XDDA 4X62J 2ZVIA 2QV6A 4F3MA 3SYZA 5KAKA 4N5SA 1Y5LB 3TA2A 1EZZB 2E66A 4MAKA 3SV4A 1B0TA 4PG5A 4EGLA 5KTQA 1NDKA 1RSCA 1V9OA 2VG5A 2Z8QA 4KIAA 1FE4A 3BO3A 2M3DA 2C28A 2KB2A 3IR5B 5J1EB 1X9WA 3UVJA 3JB9k 4AL5A 3QRPA 2HHHF 1Q7YT 2CQ2A 2X1AA 3PHTA 4GO7X 4E0DA 3J7AN 3ENQA 3CDBA 2J8SA 4RNMA 1XBWA 2EFOA 4NZ6A 2WTFA 2DNZA 3GU0A 5C25A 1S7IA 2J9EA 4FYWB 3MM9A 3OV7A 4B3SJ 4IR9A 3J7A1 2RU3A 2R42A 4ECRA 3T6BA 2DB1A 1GX5A 2E1MC 1PBAA 4L3NA 2B9XA 2BJ7A 1LK7A 4OLOA 1HBUB 2F65A 2HS0A 4LJMA 2P2CB 1VBZA 5G4DA 1OY9A 1UZDA 1R8BA 3I31A 1P6TA 5JXSA 1E6YB 3VCDA 2WSFC 3AHPA 3Q2TC 3G2XA 3FK4A 3P8BB 2XB2D 3QT7A 3GMGA 1R0AB 1B7FA 3JSRA 1RP5A 4AL7A 5J2MB 4CZCA 3G6ES 1HWJA 1SBRA 4CLZA 4OI3A 5EWGA 4PRFA 2NYIA 3TUIC 3OVSA 1Y10A 1OYEA 2AZ1A 2VG5B 5C2GA 3C6UB 5GMEA 4A8XA 4CLFA 4QYZK 2J9DE 1QAJA 2BKPA 3D54A 1R89A 2P9GA 2XLIA 4B3TF 4I6WA 1FA0A 2BW2A 5D6GA 3HVTB 1SJRA 4J37A 2B4VA 3VVUA 4ZLPA 5B0EA 3KK3B 2KG1A 4Z7CA 3D0IE 5M2RA 4DF8A 1NZ8A 1PSDA 3DDIA 1T8EA 1B3TA 4F4WA 1GTEA 2AKWB 5M2PA 2Q79A 4CWBA 4J9QA 3T5JA 3SEOA 2W9BA 4RX6A 2KU7A 4GKJJ 2W2MP 4DG1A 5DG7A 2O01C 3LOUA 4M5KA 4KHPJ 1CPZA 5E3CA 2XI3A 1IBKJ 3MR5A 1RADB 1M5KC 1SJ1A 5A8WA 1RT4B 1IXKA 3NG8A 6FDRA 2A2DA 2C2DA 2CQBA 5K9FA 1R0BG 3NY0A 3C15B 4L74A 1URNA 4LMZA 1X60A 4DEZA 4TN2A 2B43A 4UW2A 3V6KA 3HHEA 1S1UA 3W2WA 5L1LA 2WAQD 1VQLS 1YRUA 4IG0A 2FDNA 4Q2MA 4IO9Q 3AD9C 2ZBQA 3V81B 2L3MA 1T3NA 3G82A 3DRRB 4P2SA 4RUBA 4Y34A 4ZP7A 2YNGB 5L38A 5IQ6A 3DRYA 2B9EA 4P7TA 3HKZD 4ECYA 1I6JA 1S0VA 4MIWA 3W63A 3E01B 1R7IA 3GV8B 4OIXA 4FF1A 2N3OA 5ETPA 4HHUA 4KV8A 1MMNA 4UUXA 3W5ZA 4EZ9A 2DNRA 3F44A 2L9WA 5J2QB 1OWXA 4U96A 3LWLA 2DXEA 1YBTA 2YPYA 5AXKA 1Q78A 3AJ1A 3FBBA 3MEEB 3KUEA 4M94A 4G3IA 3H25A 1U26A 1WDTA 2UV8A 3IFEA 3BKFA 3K57A 4I7FA 3RBDA 1PJ7A 1IR2A 2QYCA 4O3NA 4P10A 2V4QA 1BXNA 4U7UK 1N54B 1XNRJ 3OLAA 2BJ3A 2MTLA 5HP1A 1NK9A 1LWXA 2BE7D 3MTKA 4F7VA 2DNMA 5C24B 1RTDB 4B3RJ 1RHQB 4F50A 3NS5A 5THWA 5HVGA 4O44B 2JRSA 4KGZB 5LM7E 4M63A 1H73A 3MURP 2LLZA 3BPSP 3OJUA 2QFIA 1RU2A 5ETMA 3DHWC 1VHIA 5KFKA 3DM2B 4KHPF 2WOMB 1IBCB 3NNAA 5D4OA 1SL0A 4TKTA 5DZ6A 3NWGA 2Q1LA 1R27B 1RT3A 1FXLA 5LL6d 2R7VA 5HANA 3GR1A 1YBAA 2D9OA 3CD7A 1WC4A 2Z57B 3UN3A 1M5VC 1D9DA 1CJKB 1R3NA 1YRXA 1TL3A 4CRJA 3CMAS 2CQCA 1REGX 1RCOB 2HFNA 4BCAA 4GC6A 4IFVB 3ZZZA 4JV1A 2DCUB 3EGVA 2RVJA 4WFXA 4X65F 3JYTA 1YJWS 5E5NA 2KFYA 4M95A 1X5SA 2V8PA 3J81U 3CJ5A 2HEKA 3PJXA 2CG4A 1HWUA 3SFUA 1YG0A 4HACA 2D3O1 3NBPA 3T1HF 1Y5NB 2N82B 4MKBA 5CH7B 5D3GB 2LQBA 1Y3KA 2C1EB 2CYYA 1Q8IA 4OHWA 2AX1A 2M0GB 4X84A 5KFLA 4F67A 3Q8SB 3PVXA 3I0SB 3GCXP 4Y00A 5EUHA 4LIRA 2VA2A 3VV2B 1TELA 1FDBA 2HGLA 1R31A 1EP4A 4JI5F 1VQSA 3V6DA 1SC3B 3GIRA 2V8HA 4ELVA 4ES1A 4ELTA 1GTHA 1FNOA 1HWLA 1S1VB 2H1YA 2NYHA 4USWA 3VGVA 2BOAA 2B56A 2FGCA 2H5EA 3EZOA 4KT0C 3W9HA 4WCEQ 3NWRA 3DOMA 1SKRA 2HRTA 3AB4B 1ZM4A 3HT0A 1YJNS 1IUJA 1NEEA 2DT9A 4B9SA 5JVGQ 4ECTA 1RTIB 4ZPDA 1ZM3A 3ENWA 3JSMA 2WRMA 1KTVA 4Y6IA 4A8KA 4ZVQB 4ECQA 4HI2A 4N8OA 4E8UA 2CPJA 3IGNA 3MMJA 3MPWA 4WU3A 4PR6A 4CH0S 4DL2A 2XHCA 3PCOB 5F9NA 5CYMB 3UNGC 3NGTA 3AOBA 2XWYA 1TKDA 1OSDA 4ETZA 1MROB 1RT7B 1HL6A 2YNHA 1HKAA 3DLKB 3I56S 1ACMB 1K1QA 3M8QA 2VBYA 2YQ3A 1C1BB 3EE3A 1U2CA 1ROFA 2FJDB 2PMWA 1RT5A 4OYIA 1P9QC 5JVHQ 1MG7A 3RBEA 1FJGJ 1HNXJ 3MEDA 5D0GA 1FTCA 2RNEA 3KNGA 1L3UA 4JI4J 4WTOB 4Y65A 3CDAA 3HFZB 3MTJA 1YJ9S 3H2LA 4DL0C 4DN9A 1Q7LB 4ZIVA 1X0PA 4OYAA 1EP4B 3CJRA 1XMQJ 1VRUB 3FCHA 5DS7A 4ZN3A 5DG9A 2J5AA 4A8SA 1UPPA 1F9HA 1RBOB 2QYGA 3RRGA 3D9BA 1FERA 2UXCJ 8RUCA 4OZ1A 1JNRB 1LV5A 1JLCB 3N0VA 1X8DA 4CO0A 1IKVA 1NMEB 3S8SA 2PE8A 3LQVA 1MMLA 1MN9A 4K5RA 4ECZA 1D1UA 4ZA1A 2Q66A 1RLCL 1NNDA 4ED4A 3JSMB 1TV6A 2K3KA 4DV4J 3UCZP 3ICLA 2UXBF 1TKZB 2EI5A 2GJIA 2MJNA 3JTPA 4YEAA 1UJ4A 3JAMY 5HBMA 1N4LA 1SQFA 4F4XA 4HTIA 1DLOA 3IR6B 3HHLA 4KTQA 1UW9A 4LF2A 5KFDA 3UWTA 3RZAA 1B4SA 2IAJA 1Y00A 1DZ5A 2JWNA 2M7SA 2HHHJ 3ETMA 2QA4G 4EU0A 4Q44A 1I3OB 2RRNA 1ZOTA 1YJVA 1IVZA 4YFUA 1D8YA 2C3YA 2A3JA 5L1IA 1URRA 4B3SF 3ADAC 1PC4A 1K0VA 2BDPA 4IFYB 4DUZJ 3H8YA 4L3KA 3OJSA 3KLIA 2UZAA 1P9YA 3M8RA 4DV1J 1AB8A 1ULRA 3QSYB 2BE2A 4IOAQ 2VV5A 4DQPA 1FFWB 4CP5A 5HMZA 4JP8A 2OFHX 2EC0A 2H4WB 2CJBA 4J9NA 4WBFA 2B6AA 5DQGA 5AE3A 3PEHA 3QNWB 5EWFA 1ICEB 3QGIA 4MK7A 3CCQS 1DARA 1QE1B 2Z30B 2BJ1A 2KT2A 3PJWA 1HQEB 1OS5A 2E5GA 4YR0A 2JVRA 1MWQA 1JLCA 2R7XA 3TEHB 4RKUC 1S7HA 3BQ1A 1T7PA 3OXFA 3RAQA 2QTWA 2HNZA 4ED8A 4DR3F 4LFBJ 2K7JA 2YKMB 2XZWA 1U6BA 2YKOA 2DH9A 2C2KB 3IMQJ 4NWBA 4DSEA 4EYHB 1WDDA 3C19A 4WKYA 2V34A 3KDOA 1BHNA 2CNLB 3JSYA 2QLFB 3TQEA 5DDRC 1KTQA 2HHSA 1WD6A 2AQ4A 1DFDA 1VOMA 2Z2LA 3HM9A 2VA3A 2QMXA 1T05B 4DPOA 5T7LA 3GZ7A 3BH7B 4X4PA 1RAEB 1UKUA 3Q8QB 4NLOA 1S9EB 3TP2A 5AJ3J 2RS8A 1NUEA 4B08A 3BH6B 2ILZA 5FJ4A 2DNOA 4NLXA 3DOKB 4FYDA 2D69A 3TNVA 4TU7A 2RKIA 5D4LA 1UJ5A 3NNCA 4ANCA 4ENOA 1UVLA 4OI0A 1REVA 1T9TA 5D0RA 2FLPA 3D7SB 3CC4S 2F8HA 1N56A 5A6PA 4ZLLA 2XY5A 3P49B 2GO8A 2YTCA 4AXIA 2VIHA 3ISZA 1DTTA 1Q79A 5CYJA 3R5JB 4IOBA 1S6OA 4JI0J 2V2ZA 5KG6A 2ZBCA 1S76D 4ZIWA 3CTRA 3QSIA 2IVYA 1E6VA 4V19J 2GMLA 2LDIA 3AFGA 3OQ2A 4ILRA 3H7HB 3JSBA 3THPA 3P5BP 1BGXT 3I82A 4YB7A 1DRZA 1LFWA 2IBOA 1IM4A 1KDNA 2MZJA 4I2PB 2VG7A 4X4VA 5ETSA 1JLAA 2AEJA 2E9ZA 4YR3A 1I94J 1HW8A 3KLHB 2FQQB 2W1BA 4FDFA 3UR3C 4ELUA 3TW0A 4KJIA 1VQOS 3CD0A 3FBFA 2P6SA 4Q8EA 1NSKL 4U8YA 2P9CA 2XQCA 4RUAA 4WWSA 3JQKA 3IRXA 2O66A 4XPCA 4C3KA 2E7VA 3O2IA 2IMOA 3TEGA 1RWKB 3CF5Q 3DYAB 3LGNA 3CCES 3DLHA 2ZH5A 3D6TB 2WHOA 3WIVA 4AQYF 4YB1P 1GMUA 5I3PA 3LUYA 3LTOA 4DI6A 3MOJB 1CQNA 1DTTB 2OP5A 1C0UB 1FWPA 1GXLA 4FXVA 4ZOSA 1S1UB 2B51A 4J9LA 3E2EA 4ZVFA 4RUHA 2BQ3A 3O44A 2GA7A 2XYHB 3H4BA 2ZM6F 1S57A 2OAUA 4HT5A 4NEYA 2CQ3A 3ENAA 3LAMA 1VGYA 2EVZA 1HNWF 3DDKA 2ZC4A 5B0BA 2RDJA 1NM2A 4AXJA 4RBUA 3M1VA 3H4DA 1Q82T 1HBNB 4LF7F 1U09A 1U7LA 1JLAB 4I2QA 5J1NA 1HNZJ 5CD4H 4O3OA 1FJGF 5DGAA 2W8KA 4K4ZA 3CJ8A 1KQGB 4QZVB 1O6XA 4NYZA 5E3RA 5BYQA 3FSIA 3P96A 2KKHA 4HACB 1HIYA 2WBRA 3GJSB 4K5SA 4TY8B 3EZUA 3D0HE 3MAQA 1NDLA 1RTJA 2HZAA 1JLQB 2PEBA 3B4MA 1F5AA 2J0SD 3HHDA 2AJFE 2B5JB 3QBCA 4OZ2A 4F3OA 3DGPA 2GQQA 3OTBA 2Z2MA 4CDIA 4PYAA 3CNQP 4EYIB 1TMJA 3O6QA 1VBYA 3K2YA 3R2DJ 5AT1B 4B3TJ 1EETB 3EXYA 5IT9Y 2F1FA 1OY8A 4NOHA 2N4CA 3TAMA 3K89A 4Q7AA 1L3KA 2E5LF 4J7CA 3SIPB 4LFCJ 1H7WA 2LDYA 4O4GA 2DY9A 4KE5A 5HVHA 3RB4A 2XYPB 1FKPA 4Y2AA 1TL4A 4U67Q 1KD1T 4WFYA 4C8LA 2RMLA 2KTQA 1RUSA 2ALYB 3HHLC 1HBNA 4WE1B 2A6OA 2FVRA 3CE8A 1UVIA 2XS2A 4CLTA 4I6YA 1HQ2A 2AJQA 1WSVA 2ZJPQ 2KL8A 3HHNB 3B6BA 4IH6A 3T1YJ 2WONB 3Q23A 4NXNJ 2ZH6A 1FWKA 3MECA 1BUXA 1DQ8A 5E41A 4EI2A 4LF7J 1ZM9A 1T11A 1VC6A 1AXQA 2DIVA 3MM5A 1BWEA 5BR8J 1TFYA 3QJJA 4K4XA 3DU5A 2CPDA 1PCAA 5L9NA 4ZJQA 4QWAA 5CZXA 3I0RB 5DETA 4OHXA 2VOPA 3CO9A 3NAHA 2XO7A 5IT4A 4YQWA 1WACA 1ZBTA 2LA6A 3AA8A 4ZVHA 5KG3A 2MXYA 1J27A 4JI6J 3NGSA 2JX2A 4ID8A 4DV4F 1UA1A 3F41A 5EX0A 4PWDB 2UXBJ 1NDCA 2D74B 2KVIA 4KRWA 4O4GB 5GADI 2LEAA 1FFGB 3GCWP 4NZ0A 2BQRA 4TNOA 3W66A 3BM7A 5HATA 1X5PA 4PUOA 3NMAA 2G2OA 5H9EK 1B7YB 3P6YC 2M52A 4TLQA 2FZCB 1LK5A 1BQMB 2VKZG 3UFCX 4J5OA 2ZBPA 3UN5A 2V68A 3W5YA 3BJYA 1WC6A 2KXFA 1ZA2B 4HL9A 2DGTA 4C11A 1K9MT 4ZK7M 4YN3B 2UUBF 4DV1F 2HZCA 3IWXA 3QAUA 2VASA 4C0OC 5HROB 2HNDB 4EUVA 5GADU 1TQLA 3EPIA 3Q22A 3PW4A 4B9NA 2NZCA 2YWGA 5T41A 4DV5J 2PIIA 2GAGC 3GTYX 5B0CA 2ASDA 1EX8A 3HSGA 2OPSB 4P7VA 3TZXA 2K8GA 2R3VA 4G65A 2ZH7A 1HNZF 3MZIA 5ETLA 1O8BA 5KFUA 4WF9Q 1X4EA 3VAJA 3IO1A 1YTYA 3M2VA 1RT6A 1HD1A 4J9VA 4ZJLA 4ZPAA 1YDLA 5KFHA 3IA0A 4J9RA 2BW7A 1AZSB 4O3SA 4OZ5A 2DGVA 2RS2A 4U7CA 5KG0A 4IRDA 4PWDA 2HHXA 2MQPA 2RIJA 1ZAVA 5L1KA 4DR2F 4QR2A 4QR0A 2IM1A 4CNYA 1KONA 3CO0P 4ED2A 2OHDA 2XMUA 1BQXA 3R1HA 5F8JA 1H72C 1Q95G 1IKWA 5HMYA 2N3LA 2NS1B 2EBEA 2HVEA 2XMKA 2PDAA 3HHLB 1VIOA 4CO3A 2HQ3A 3EGWB 3QJLA 1IBLJ 2QC3A 1S1WB 2CJQA 3LP0B 1F5CA 4DUYF 3TZWA 4GO5X 3RU0A 3PYFA 2E5LJ 5DDPC 3CMQA 1VLOA 5G0RA 4ED7A 2UVRA 1KLMB 2WSCC 2IVMA 3NGKA 3EDQB 4C11B 1NHUA 2R2TA 2UUWA 3EICA 2UVUA 3S1TA 1FXDA 4NLTA 3Q24A 4KC5A 4KV8B 3MM7B 1UA0A 4K2XA 2DCLA 2O3DA 3M32B 3MPUB 3CJKB 4DFJA 1PAEX 2GVZA 2FYXA 1UFKA 4C48A 1HMVB 1IBKF 2J9DA 2H9ZA 2BKOA 2CFXA 2Y0SD 3W2VA 3KUGA 5KFSA 2ZITA 4FP9A 4JI0F 3QLHA 3DRPA 4X4OA 3B82A 4P2MA 9RUBA 1HBOA 4KR0B 5DZ7A 2CPZA 1VFJA 1NH7A 1UFWA 3QWPA 4OHZA 1TAUA 4ZP9A 1Q1KA 1YQHA 5HP1B 3AAWB 5LXRA 2HGNA 4PZVA 1KSPA 3QRRA 4O3PA 1W2IA 4OX7A 3ZTQA 5DDQC 5K8MA 1QAXA 1UVKA 1U1KA 2OPPB 1LEOA 4MKVA 3EPGA 2DH7A 1NJXA 5A8RA 3PTWA 3VF0B 4URGA 5HMXA 3UDEA 1S1WA 1MW7A 2FHKA 4DPYA 3M4XA 3QGPA 3EGNA 3E51A 3T5HA 5GAHI 1U8WA 3FKBA 2HQCA 1U1PA 4J9OA 2HMIA 4MYTA 1IWGA 1RYRA 1BC6A 2DGQA 2AT1B 2X1FA 1LKZA 3BV8A 2NUHA 6AT1B 3KJFB 3R5AA 2GNKA 3S01A 1CC8A 3OR1A 2CPHA 2C3PA 4A8WA 2MZRA 3D3CJ 3M32A 3WC0A 3CJ4A 4F0KA 4F3QA 2MY8A 2EPIA 2HNYB 4H4KC 3GJQB 3ISND 2JZ5A 4F36A 1M5PC 2G1DA 3FBEA 3AQPA 3LPEA 4J90A 4LF8J 2MZQA 4K0KF 3HZEA 3NS6A 2C2EA 5BYSA 1T9UA 2RQKA 2JDJA 4FS1A 2ZD1A 2DNLA 4R0JA 4Q43A 5KFNA 2I5JA 2W9CB 1NKCA 2F8EX 1PC5A 1E6VB 3CCTA 4H4MA 4CTAA 2HVDA 4KY3A 5F8LA 3HF5A 2KZZA 4P6QA 2FTRA 2KJVA 3C6TB 3GWCA 4UZCA 1TR0A 1QM9A 2A10A 3M8ZA 1PGZA 4JV5J 2FJVA 4X64F 3EVOA 1CG2A 1FX4A 1MU2A 3TVYA 4K2JA 1T0TV 4M5DB 4USIA 2GIRA 3KHHA 4BHQA 4EBCA 4EEYA 3TANA 1SJQA 2B3TB 2CQGA 2HAFA 4ID5B 2NXUA 2W2OP 4NRTA 4C3MA 4CIOA 1CQMA 3RTVA 2XY7A 1U49A 4I56A 1C2PA 4U8VA 1R8HA 2WVEA 2BXJA 3WX8A 4IH5A 4CT8A 1UMJA 5C7PA 4Y0FA 1P8GA 4LF6J 1MROA 1IR1A 1RT7A 3MM6A 3UDCA 1H6KX 3UQSA 5CYQB 2FB0A 2YX4A 3PX0A 5DQHA 3I9V9 1VQ7S 4RW7A 3PKYA 1C1BA 4DLEA 3M6VA 4JI5J 1OO0B 4F4ZA 1F60B 3MEDB 3KHGA 5I3UA 1FO1A 2IRXA 1N32F 3RBZA 5DM7Q 2HHUA 2JEIA 2W24A 1D0EA 2GJFA 4M5JA 5HK4A 3R8YA 1C4AA 2VPXB 5LMUF 4NI2B 2MZ1A 4ZP6A 1JJ2R 3BDPA 2R7TA 4NCAA 2AJ1A 2NCKL 1JXVA 2ZWPA 4CLLA 5ETKA 2P5VA 3D0GE 4JI7F 4IG3A 3G82B 2E1AA 3BQ2A 4X66J 3M1VB 4DS5A 4JI8J 4OLPA 4EBDA 1DAXA 1TL7A 4RNFA 1IJEB 2GW8A 3CCSS 3KJQB 4C98A 4H4OB 3TJ9A 4YDDB 1GH8A 1T3OA 3ET6B 3TX0A 8ATCB 1NJIT 4LBHA 3GE9A 4HH1A 1F9FA 1YKWA 4DFMA 2AEFA 3M6WA 2OEMA 4B9LA 1ZAWA 3FBCA 3I5CA 3MEEA 4YDXA 1JLQA 3MD3A 4RL1A 3H42A 3M9NB 1RKIA 4X64J 5IV3A 1FRXA 1ZZNA 2F9DA 4KHMA 2ROPA 1P1TA 3ITHA 3KDNA 3BGOP 2W7OA 3I32A 4I69A 2FLOA 2VJVA 5HLFB 5LJ5Y 5A6WA 4A48A 4CH7A 1QUPA 4Q5VA 4QPXA 4CLUA 2IYGA 1IBLF 3LA0A 4B3OB 1V6HA 2JFKA 3M7VA 4CI0B 5C42B 1APSA 4TY9A 2BM0A 2QN6B 4PG6A 4UOFA 5CCMA 3TQ1A 1I94F 1U0HA 4DBQA 2DPIA 4ER8A 1VQ9S 2ZC3A 1F1BB 1H98A 2GAHC 2HURA 4OZLA 2V63A 2OMOA 3IGVA 4PABA 2J0QD 3DLJA 3GILA 3N01A 4NI2A 3G96A 1FRIA 1RISA 4FKYA 3C16B 4HHHA 1FKAF 1TU0B 4LF9F 4O3RA 1YSJA 3ENVA 2FJAB 2YWWA 4DUYJ 2K3IA 1FT8A 2B7CB 3JTNA 1AROP 3NAIA 4KH0B 2ZJRQ 4YR2A 5J2PA 4WZMA 3AA9A 1TL7B 5B0AA 1KVKA 3W64A 1A6LA 2CNNB 2GVDB 4DV0F 2V50A 1OJ4A 2RB7A 3MM8B 4M5MA 3FVYA 2CJYB 2RT3A 3ET6A 4KPCA 3LPYA 4Y28C 1VC0A 5ETVA 1N33F 5A2QY 1C1CA 2CNOB 4TYBA 1WORA 2E29A 4I64A 2FLNA 3KMQA 3NGUA 5CABA 1XNQJ 3PRVA 1UW4A 3BGLA 2B9YA 4XTTA 3R5CA 4E98A 1HNVB 1EKRA 1DQAA 2MB0B 4RBTA 2YKNB 5ETTA 1TK8A 4B3OA 5LSLA 1MN7A 2ZOMA 3CIZA 3ZTOA 2IIHA 4CM2A 2XMWA 3LO3A 4RW6A 2VBWA 1NDPA 2DHXA 1I51B 4KKOA 1D9FA 1BQNA 2VICA 4BLGA 2JH3A 2IJRA 3MF5A 5AE1A 4A8YA 4MMOA 2J6SA 2BX6A 3V2UC 1HQUA 1TZ0A 5IQQA 4QWBA 3PW5A 2IMWP 5GAHU 4IH7A 2Z2ZA 2D3ZA 5I4MA 2DNKA 3FSXA 3FFIA 3BGRB 5KFRA 4PKDB 4F25A 4USJC 1N5QA 3RB3A 2WVCA 4OMFG 1KBRA 1KQKA 3KK2B 2AWZA 4PG4A 7AT1B 3HDSA 3MM8A 4I1TA 4NE9C 2IJFA 4JI6F 2OTJS 4RW8A 5DG8A 1T9WA 2C42A 4Z7YA 4CYUB 4P75A 2YNHB 3DLKA 5IWAF 4MT1A 3HFVA 3BKUA 1JJCB 3QWUA 4M5NA 4CLSA 2AYGA 2DK2A 4X66F 1S77D 5A8KA 2IA0A 2NXJA 2XZTB 4ANDA 2B0GA 2HS3A 3RW6A 3WIUA 4FXDA 2ADCA 3OSNA 4DR1F 3C2PA 3OR2A 3RYLA 1UZHA 4ZP8A 1RT6B 2N7CA 4AD6A 1ZPWX 4CLYA 2YNFA 1F5BA 1VJQA 3OFHA 1KFDA 4WIQA 5FLXU 2PI5A 1YWXA 2MPUA 1VQYA 3H5YA 1JXLA 4K4SA 1KOOA 2BANB 1K47A 3BN7A 4DPTA 2EG1A 3FMWA 3QT5A 1OYDA 2Q43A 4EFAC 2R9LA 4PQUB 1OQ6A 2WB1D 1KVJA 2LXUA 4HI1A 4K4WA 3QIPB 3HHKA 2FY1A 3UI3A 2LXFA 2OLWA 3L7UA 2RQ4A 1QSYA 1HI1A 3NXZA 3GG0A 4QYRA 3OFEA 2YWEA 3BGRA 3BYRA 3I87A 4DCPB 3WC2A 4OX8A 4X4TA 2SXLA 1RE1B 4USVA 5GVQA 5M2UA 4FBUA 1QLNA 1D8ZA 2V94A 2G2ZA 3BPDA 1VQ6S 2YWFA 3BKTA 3M6XA 4YHHJ 2H5JB 2ASJA 3N5FA 1H74A 4BWMA 2KT5A 4CYUA 4F04B 4ECSA 2UVWA 1TTHB 1JB0C 2V8DA 5HSPA 3R6LB 3ETOA 3KK3A 3IM8A 5LXYA 2MQOA 2DHSA 1RLDA 3G9CA 3OFFA 2XMVA 4DQSA 2LMIA 1VQ5S 2PI4A 3GFZA 4CM0A 2QLJB 3IRWP 3PO5A 4A8FA 1VI7A 1RBAA 2PMZD 1SH2A 3VVTA 4MTPA 1RKJA 3A3OB 3OR2B 3MDFA 3HFKA 5K14A 3SFGA 4CLKA 3N4WA 3J80Y 2V4RA 1HMVA 3BSNA 2ZEJA 3LP1A 3CGIA 4FKXA 5SUHA 3T19A 2J6UA 4C8KA 1YHQS 2B6AB 1RK8A 2YY3A 4Q0BA 2QA4S 3DRPB 3U7JA 3MR2A 1WI8A 2J6TA 1N52B 2KG0A 5DJBA 4Z2XA 4K4TA 4U95A 4YP3A 2ACMA 1CJVA 2EFVA 4OYWA 3D67A 3DLGA 2X3DA 3V81A 2HYIB 1EB0A 1QVFR 3K0JA 4YB5A 1XR5A 3N6LA 1RABB 3U1NA 4JV5F 1OPZA 4HVZA 4N41A 1UL3A 1RAHB 3JQMA 4KBIA 1YZ6A 5A8RB 1XN9A 5FDLB 1YBUA 1NHKL 3BGFA 4B3MF 2FZKB 2HQFA 3E01A 2FHMA 2BKNA 5D4NA 1PIEA 3T3FA 2M8HA 2KI2A 2XSJA 3P3DA 1WOOA 3V4IB 1S0OA 1S6QA 3CDWA 2CQIA 1RU1A 1KWMA 2V2KA 3DXSX 2XS5A 2DR7A 1U0SA 1PAUB 2UU9F 4CO2A 1R6VA 3SSSA 3D5MA 2JLGA 2DXDA 4DN0A 1HI8A 3GFXA 3EGZA 2MDAA 2QGFB 4KGKA 5IFMA 2BUNA 3CSKA 3Q8YA 1AFIA 1WC1A 1EQMA 1WKJA 4FNIA 5IC4B 1RAFB 4CQ1A 2R2RA 3MFHA 4FS2A 1REVB 4F0MA 2OEJA 1N32J 3A8IA 4O44A 1ZM2A 3MM5B 4Y2CA 3UD5A 4ED0A 2EBGA 3QGGA 2JEFA 3CCZA 1CJVB 2ALZA 3A8KA 2DR6A 3DM2A 3EMTA 3D68A 2FJBB 2AHOB 4Y2IA 2E7XA 3CCVS 1KVIA 3PX6A 4C8NA 2FHJD 4UUWA 5E3QA 2ZH3A 2VQFF 4LR9A 3HSDA 3WZ0A 4RU9A 2H48B 3KJVA 3GIMA 4DL7A 1H38A 5KT5A 2JLFA 4ECWA 3UN2A 2VQEF 2RSQA 2IRUA 5AE2A 3K5MA 2FVPA 4HDGA 3R7BB 4U7UD 2CPYA 2VG7B 2BYCA 3QYYA 2R7RA 1N5YB 2YX1A 1TL3B 2VC0A 3THTA 3OL7A 1GNKA 1HYSB 4O3QA 2RRAA 3GYXB 2Y8YA 1U1OA 2W4PA 2LQ5A 2CNKB 1NK5A 3UR0A 2HQGA 3M30B 4DV5F 3ILLA 5F3TA 2A6MA 2W2QP 3NBPB 5DDOC 4HKQA 2QFJA 1RI7A 2G9OA 1VMBA 2ZBIA 1G4CA 4HT7A 2EXUA 1FKOB 1GK8A 2HFUA 4BC7A 4DPXA 4DR6J 3W3SA 5HROA 3NL0A 3MAAB 4IKAA 1HD0A 3POTB 2R7WA 1S0MA 4R0EA 4XAKA 4ANEA 4K4VA 3CCUS 2HLTA 2OPSA 5EWEA 2I6WA 2KM8B 1CULB 4DSJA 4LF9J 5IM0B 3DRSA 4DL5A 1S10A 4PG7A 4X4NA 1KN6A 1UVNA 2Y9HA 2KRRA 1SCJB 2OKQA 3MPVA 5AJ3F 1T03A 2XYGB 5U47A 1LQ9A 3VZIA 4X2BA 3BSAA 1JWWA 2DR9A 4WP9A 4JBCA 1NPRA 4C7QA 4LT6A 3VZHA 4RUCA 3O8WA 4ZVEA 3BZQA 3US5A 4DPUA 3AXKA 2B8QA 3A4TA 1F6TA 3OTCA 4NLDA 2E1PA 5KG2A 3KOAA 2MSTA 4PQAA 5EN1A 2HVZA 1KQSR 3KG4A 5CYMA 2HRUA 3DOLB 1C4CA 2G1HA 1RHMB 3I5AA 3R7SB 3UD4P 2CDRB 2CRLA 2BM1A 1BY9A 1HARA 1HBMA 1YJRA 4YS2A 7FDRA 4DQQA 4G1QA 1SUQA 2Z2YB 2RH3A 4X4SA 2CZ9A 3W9JA 1LXJA 2R2SA 1S72S 2FVSA 3QO9A 4LRDA 3V5RA 2KN4A 5C42A 4DWIA 2HRYA 3OXLA 3UE2A 2UU9J 3M8PA 4A47A 2CAJA 2UXDJ 1WG5A 3Q8VA 4G1IA 5HN0A 2NSBA 4ILLA 1SQEA 2VG6A 1VRUA 3G8SA 1GMWD 4A8MP 4XO0A 1FJ7A 1KOHA 2JLEA 2XTJP 4TLRA 3O1LA 5MAOA 1N6QB 1YJUA 1K8AT 2MJUA 3G86A 3HVAA 3UCGA 3G6YA 1HHTP 1VRTB 1SVDA 1Q8BA 3QQCD 4YHHF 3T1HJ 5HBMB 1RB0A 2NXCA 3ZZTA 1NK4A 1FKPB 2E9RX 4WXOA 1RWPB 3B78A 3T1AA 4DPWA 2W8LA 4M5LA 1M90T 3F56A 3Q8RB 2NPFA 2V2VA 3PXGa 1EIYB 1C1CB 4NEZA 5L9XA 1JLBA 2LU2A 1DLOB 4KHRA 4CLPA 3WX4A 1WHVA 2A18A 3QZ8A 1FRHA 1U1MA 5F8MA 3GFHA 1RAGB 3VGSA 3MEKA 2H51B 3OL6A 2DNHA 3SXLA 3FNNA 3QFHA 1HNIA 1TUVA 1S1XA 1SPBP 2JJ4D 1YGYA 2QSFA 4DJBA 4UQGA 1U48A 3HO1A 1Z2LA 4NASA 1RTDA 5B08A 1H3DA 2MKIA 3KLFA 1SIZA 2CPXA 3H5SA 4ZCIA 2PEHA 2XS7A 1MWYA 2JHEA 3KUHA 5KG4A 5H9EJ 5E3AA 1AYEA 1QDUB 3OT9A 1Y5IB 2WVBA 5ETOA 3KLGA 3SSQA 1DBDA 1X4DA 5DO2A 4ETXA 4DV6F 4DLGA 2CPEA 2XMJA 3DU6A 3SBMA 3KK2A 3DKDA 4JI1J 1X4CA 3CT9A 5F8HA 3GONA 5C5JA 1CVJA 5K20B 2E5IA 1LW0B 1N5TA 1XMBA 4Q2LA 4N47A 2LU1A 1FI4A 3MUMP 2M8DB 3H2UB 5LOQA 1T05A 5KG7A 1JLBB 2MZTA 1FX2A 3D66A 3GPAA 3IBCB 1S9EA 3KLEB 3CD6S 3LAKA 2IHR1 2KJWA 1S0NA 2Y1IA 1Q5YA 5IOLA 4M8LA 5GMKa 9ATCB 2X1GA 1WEXA 3I0SA 4DV7J 3B8HA 4A46A 1RTZA 4NLRA 3KLVA 1W25A 2F40A 2RDIA 2F9JA 1CJTB 3SQGB 5KFZA 1F2GA 2AV5A 1R6YA 3NCQA 1WF1A 1XJWB 2C3UA 1VHFA 2VPYB 3C14B 4NLSA 3UDLA 1X5OA 3MM6B 1S79A 2YPZA 3RBXA 2DRBA 4NXMJ 3DOMB 1WG1A 5EX3A 3AOAA 4JYAF 3M05A 2XLJA 2YXLA 1DHMA 2XM3A 3K5PA 3KLGB 5KFPA 4XIUA 1N88A 4CO5A 3I9ZA 4DCJB 3BEGB 3M6UA 3LP2B 4B3RF 5I3UB 1GAOA 1KS2A 3IM9A 3T5LA 1VBKA 1K73T 4GKKF 5I3QA 4ZVUB 2D3OR 1L3SA 1E6YA 2WVDA 4DX7A 2UV8G 5KFWA 3DLBA 3OXGA 2DGSA 3SDEA 5JMNA 4DV3J 2E9TA 3OL9A 4ERDA 1HLWA 1FK9B 1WHXA 2V4JA 6FD1A 5T14A 3LP0A 3DDNA 2DITA 3U02A 2P6TA 3K5NA 4LF4J 4ECVA 4J91A 2DR8A 2O5DA 2HK3A 4CLWA 3ZC4A 3DLEA 1HHQA 3MI7X 4IYQA 2W2NP 2XLKA 2DNNA 2GIFA 3BF4A 4QCLA 2FC8A 1HHSA 2E44A 3DYAA 1RDRA 2ZWOA 3LP1B 1X0FA 1ZA1B 1SQGA 4KSEB 4DR4F 2WZ1A 3C66A 1X4FA 2BV3A 3GYGA 2R8KA 1T02A 1RHUB 1NH8A 2LKZA 3M8SA 4XDCA 1SKWA 3W8GA 1ZZFA 1TK0A 3JXOA 4GVBA 4QWCA 2COLA 1JNZB 5L8RC 4DG1B 1IKYA 1G6BA 3CUNA 2QRRA 4OJ1A 3TJ8A 2BABA 3FEXB 3UO0A 4C3LA 2CQ4A 4KPYA 5H1SV 4C9DA 2QG9B 5CD4A 3PFEA 1UPMB 4EO6A 2EFNA 4LF5J 2M70A 3JAMU 1GT8A 4QIWD 2GMHA 5FDLA 2J0XA 4DR1J 1FJCA 2W25A 2CQDA 4LBPA 5SZTA 1IKXA 3PX4A 2JNJA 3I4HX 4JI8F 3RG6A 2BVZA 2XNQA 3SCKE 4PWUA 4ITSA 2V4JB 4KAIA 3K59A 4QYZJ 1G1XA 2IAJB 4DHVA 2QA1A 4LF1A 1U45A 1SL1A 1JJ4A 4C2MA 1VQ4S 3HJFA 2BA9A 2LA4A 3AJDA 3GB0A 2HMIB 1IQTA 2VFVA 5J2PB 2CWXA 4K8RA 3RR7A 3UPFA 1YZ7A 4JB8B 4LRFA 3Q83A 2DBBA 2OUGA 1S9GB 2IDEA 3H0PA 2XC9A 4NXNF 2JOQA 5B0FA 2CIMA 3A8JA 4TU8A 2VONA 3IG1A 1RCXB 3M2UA 2YKPA 4A8OA 1SC1B 2APOA 4B9TA 4C8OA 4QU7A 2OJ3A 1RTJB 1JKHB 2CPFA 3FZBA 3RJMB 5GAGU 2QSWA 3CC7S 4OI6A 2V2QA 2ZOGA 2EW9A 5J1PA 1VQPS 2UUCF 2B5JA 3Q86A 4QWDA 4Q0BB 1RAJA 3IS9B 2HBRB 3Q2SC 4DSLA 3ZNUA 1Z4UA 1I1GA 4IG0B 2RF2B 4KO0B 1UJ6A 2PT0A 2XMTA 3M2RA 2GHWA 4QIGA 2YKQA 2VPZB 2MEWA 5E33A 5BXIA 4RW4A 1P27B 5E0OA 1KFSA 2KFZA 2YH0A 3ONQA 2YKMA 4H4MB 4N56A 1RWUA 5B0GA 2CJKA 3EDRB 2IFXA 1QSLA 5CHCB 4ZCKA 2LVWA 1NBEB 3MGJA 1FEEA 3Q89A 3C6TA 4RWWA 3ZTRA 3QAEA 1WC5A 4Y2KA 3PR5B 3LF0A 3AODA 2H5IB 3TARA 3QGHA 1PYTA 1F3FA 1RT3B 4WTYA 3D4JA 4K0KJ 2UVVA 5J2NB 1MNEA 4I7FB 1FRJA 3DI6A 2B4PA 3M30A 4WIIA 2AGPA 1RT1B 1TL5A 4KYZA 4B9MA 1MWZA 3JYTB 3BN4A 4WK1A 4TQSA 3G71S 2R2UA 2ROGA 3GG1A 1PYOB 5CAAA 1XR6A 4WKRA 1FHTA 2WB4A 4LSLB 1J2VA 3I0RA 2PA3A 2RUGA 4JUZA 3VAHA 3UDVA 4U6PA 1JJHA 4G6VB 2QLXA 4ZDNA 4QIFA 1LWCA 2OMLA 5IM0A 3DRSB 1GXTA 3PO4A 2ZDOA 3RW7A 3TYTA 4JV2A 4OL8A 1D9AA 3UW1A 2CZ4A 3BREA 4RW4B 3ZZYA 4TU9A 4USTA 1CJKA 2ZZNA 1LWEB 3PIOQ 1SI9A 2AW0A 1RA6A 1MMDA 1B99A 4JI2J 1R8PA 3VQSA 3P5TL 4FF3A 5ETNA 3M8YA 3SCIE 1OMSA 3P45B 3CC2S 2DTJA 3GJTB 4ZHRB 3IBFB 2MMYA 3QIPA 2XZDB 3MMCB 3GIIA 3D2WA 2DRAA 4U9RA 4OI1A 1N36J 4MIAA 1RTIA 4FZVA 3WQPA 4YUDA 2ZHOA 4BS2A 2V8GA 4X62F 2BOPA 1H7XA 2X51A 4PPZA 1NHVA 1NLKL 2BBEA 3PFOA 5BJRA 1QVGR 1AUDA 2Y1JA 2VJUA 4L6V3 2W7AA 4UT4A 2LQ8A 4MH8A 2QL9B 3EM1A 3M9MB 1AUSL 4BDPA 3X3UA 2KT3A 2IM0A 5D15A 5F3ZA 1V5VA 4C8YA 4F8RA 3M8PB 1RWMB 1U1RA 3FZ2A 1WWHA 4QIEA 3VTIA 1KRPA 1W7WA 1WC3A 1XEZA 4I6AA 3N5BA 3I96A 2HFSA 4NLYA 4W4MA 3GJRB 1NSAA 4QQBA 5LSRA 4OX9F 3V4MA 2NQPA 3R5GA 2HHTA 1AFJA 2DEJA 4TVAB 3KTQA 3AT1B 1NRKA 4RW9B 1N6QA 3THVA 5KFFA 1XMOF 1QTNB 8AT1B 2DD8S 1RHKB 2QZ8A 4KGMA 1Z1ZA 4OYOA 4MFBB 1PJ6A 4WYWA 4X65J 2NXNA 4ZPTR 4J9UE 4UOGA 1VJWA 2F4VF 3RAMA 1TUGB 3HVWA 1ZETA 4LF4F 4DX5A 3NOGA 1IKVB 2ATCB 1HFEL 2EK6A 3MMCA 4I2QB 2D41A 3RR8A 5L46A 2MSSA 5J2MA 4LSNA 1IBMF 2ZE2A 1RYSA 1WC0A 3W1YC 1ZTTA 2FLLA 4L76A 1B64A 3E8OA 1GX6A 2UUAJ 2IY5B 2XMMA 2O67A 2HQDA 2CPIA 3K8WA 4TY8A 5F0WA 3KHLA 1CSJA 2HGMA 4F0HA 5EDWA 1AT1B 2BQUA 1S6QB 3BO2A 3TA1A 3OTOF 3HVTA 2MQ8A 2W4CA 4WXWA 2EK1A 2PSZA 4LFAJ 3W61A 2R8HA 2YKNA 4P52A 3MMAB 2VUGA 3D1OA 2IDLA 3TWZA 4DR7F 4OI2A 3G87A 2YBVA 1ZPVA 2QX0A 4ED6A 4DSKA 1BLUA 2G0IA 1RAAB 1VK3A 3HD2A 2EEYA 5IZHA 3LANA 3HXMA 1VQ8S 4KKOB 3CJSA 4K4YA 3IR7B 3GIJA 2UUTA 2VKRA 3FQLA 3KXDA 4GKKJ 1LNQA 1YK9A 1GMVA 1TKTB 2L48A 1XK8A 1SJ3P 1WSRA 3TI0A 1V5IB 2AYMA 4LR7A 4MFBA 4RO0A 3W5XA 4ZKAA 5FLXY 4QW9A 3RAXA 2RAQA 5KOWA 3H40A 3SV3A 5ETQA 3IN5A 1LFPA 3I5BA 2HWIA 2HK2A 1UVJA 4YY3F 2MQQA 4M5IA 1OQ3A 5A0YA 5B09A 2MHEA 2V67A 1R8CA 5KFAA 2PN6A 4DR5F 1X7VA 3H5XA 3OHAA 4UY85 3EUNA 4LQ3A 2GQCA 2ZH8A 2HG4A 3H98A 1S4EA 3MECB 4K59A 4X4QA 1JK9B 3EYZA 2DVIA 3K58A 2H65B 4OJ3A 2BE2B 4WFZA 5GAGI 1XNRF 3IAS9 5KFTA 4FYXB 3TA0A 4ES3A 1N5YA 1WHWA 2DRDA 3BQ0A 3D6FB 1HQEA 4AYBD 3N9UC 2W4DA 4J9MA 2W2PP 3RGIA 1N0VC 4EZ6A 2BMBA 1NB2A 2PA8D 2CJAA 2RKIB 3NLCA 2I5JB 1UWAA 4FNHA 2H3EB 2CDQA 2BANA 1NXIA 5C24A 1FTRA 1PKUA 4YMEA 1U25A 3CCRS 4DFKA 4RZRA 2DGOA 1HA1A 2DJWA 3A12A 3QT8A 4DL3A 3OVBA 1HR0F 2FPHX 5KOXA 1WNEA 2WOMA 3NNHA 3KWMA 2DGWA 2G0CA 2F4FA 2DHGA 3D3BJ 3TAQA 1Y4ZB 2OEKA 3OTEA 3L95X 1VK8A 4M5DA 5D0HA 5KFBA 1H2VZ 1T03B 5DRKA 4J9KA 4OYBA 4PCQA 3W60A 5IS2A 4OZ0A 4IOCQ 1NJYA 4DR6F 4NZ7A 4KQZA 3GSDA 1CLFA 3DCAA 2F4VJ 4F4AA 2L41A 2XGPA 2KH9A 4QR1A 4W98A 3PW0A 1Z2ZA 2YNIB 2FJWA 1U24A 1EQ0A 4P2FA 4RW7B 4TXSA 5D3GA 5HJYA 3AH6A 1IBMJ 1IWAA 2XEXA 3N79A 5AXMA 1YI2S 2ATLA 3GFYA 4CT9A 1YVFA 3AY0A 4BC9A 4DR2J 3EXCX 5C25B 4ZMMA 2LECA 3C46A 1HW9A 2UXDF 2UXCF 1K44A 2CXEA 1SKUB 4L72B 4IQXA 1FEHA 4L75A 5CCLA 1H2UX 2GS8A 2Y1LB 2JVOA 1LWFB 2YQ0A 4OV1A 5KT2A 3V6DB 5KFGA 1CJUB 5I42B 3K5LA 1ZAXA 4H4KA 3GLJA 2I38A 2M9KA 1WHYA 4LVOP 1YRTA 2L9DA 3PACA 4IG3B 1WG4A 4IDKA 3KNAA 4DR4J 1KEKA 1RWWB 1G2EA 2H4YB 1VYAA 4V19X 4OZ3A 3CULA 2MYFA 3OD2A 5E2QA 1JLFA 4N77A 3R1LA 2UP1A 1QD1A 1R0AA 4B9UA 4N76A 1F2HA 3BSOA 5G0RB 4DF4A 1GEHA 1JXEA 1XMOJ 5IT9U 1VRTA 3AJ2A 4RBVA 4A4JA 3A3NB 2OIHA 4LQ9A 1X4BA 5CXTA 2DH8A 2XGQA 3TAPA 2HVHA 3NEKA 1GFWB 1S9GA 1S1TA 1Y11A 2AMCB 3ZZPA 3H90A 5K5MA 3E3XA 2AU0A 2CG8A 2W9BB 4ILMA 2VDHA 2XI2A 1VIXA 3ZTPA 4ED5A 2ERRA 3G8QA 2K1RB 3MCSA 4NCGA 2JFDA 4USHA 3OUYA 2DNGA 2FJEB 1Q5VA 1RT5B 1TVRA 1NJWA 1SJFA 2X3GA 1A7GE 4MK8A 2MKJA 2ZNYA 4HDHA 5EHHA 1BD6A 5HL7Q 4Q45A 3SQOP 2EC2A 2YWKA 1FDNA 2ZJQQ 3CCMS 2BJDA 5LJ3Y 3PHEA 3LGHA 2EFGA 2JC0A 3PJ9A 3U1LA 3VHQA 3W2WB 3FEYB 3W7BA 3OLBA 3KK1B 3FGVA 3T6JA 4CO1A 1HNXF 1MSWD 1U0HB 1PYSB 2QL5B 1KLNA 5HQMA 1UVMA 3KYLA 1RTHB 1WTFA 2YNGA 2DIUA 1D09B 4W92B 2R7UA 2CQ0A 3L7OA 3WHIA 4B9VA 2ZOFA 2VFRA 3CVKA 4DQRA 2RILA 1C0TB 3AB2B 2W9AA 1SIWB 4LUBA 1Q53A 4OYMA 4RJVA 4HHJA 5F41A 3DGVA 5J2QA 3TRGA 3BBCA 4ZPVR 1FF2A 1RT2A 3Q8UA 5EGYA 4DV0J 1SKSA 3IP0A 3OR1B 1SXLA 2ZNZA 2ZKTA 2AF6A 1SH3A 3CCWA 4O0IA 2VODA 2IM2A 2KM8C 1HNVA 2NSCA 3CJ3A 4DMZA 5A76A 4X4UA 4QIVA 4R5PB 1UEVA 2VHGA 1RHJB 1F9EB 4NA2A 2K1RA 3BGUA 2VB6A 3CEDA 4CNZA 1IQZA 4CH1A 4GKJF 2IC3B 1BE4A 1GQEA 1IR0A 2AYEA 2OPRA 3LH2S 3OVAA 5IC6B 3U1MA 1RZMA 2BRLA 3NP5A 3AD8C 3OSPA 1YJTA 2GIQA 1UAWA 5HO4A 1KKHA 2HHPA 1NKEA 4FVCA 4XPEA 3NMRA 2KFNA 2Z56B 2IBKA 2ZUAA 4IR1A 3L3CA 2A1BA 4OHYA 2BEFA 1X4HA 3FDSA 1QTMA 2C2NA 1TKXB 3VGUA 4ALZA 2M88A 2MQLA 1VRQC 4ZJOA 3TZZA 4F26A 1K0TA 4OV6A 1N33J 4PXEA 5KT7A 3C3LA 2MKCA 2KXHA 2N4DA 1C0TA 3BDEA 4IFVA 3SSRA 2UUCJ 2EG2A 3ILIA 2CA9A 2NXEA 3FFIB 2J0WA 2Q6BA 2WVFA 3U27A 2R8GA 3WDOA 3IC1A 3MCMA 5KFEA 4LSZB 4OFZA 3BSCA 3GV5B 5GAEI 2V6AA 3CCJS 3FQKA 4DZDA 3SZ2A 1J5OB 4K4UA 3SDEB 4FF2A 2DHHA 3DOLA 3DHXA 4RNOA 1Q8KA 3ZXWA 1EKSA 4LFAF 2VOOA 5D8HB 1HBMB 5T7LB 2H54B 1SV5A 1Y9OA 5D78A 2IPOB 4K7QA 4G1PA 4CO4A 1EHWA 4PEOA 2IC3A 3LGMA 5A8KB 3MCOA 2XNRA 4PPDA 1RWOB 4KGVB 3DLEB 1NPPA 1XIQA 2HS4A 3H20A 1WEYA 4UZBA 1NK0A 5MLCV 2DR5A 5GMDA 3GR0A 4JV0A 2F3JA 2LP4A 3D1QA 3FC9A 2Q6CA 1M5SA 5HAOA 5K8PA 2C2RA 1SJ4P 3HI9A 1V3ZA 3R3TA 4RR5A 5KG5A 2HVIA 2HZVA 4LRCA 1X5TA 2V9WA 3MCNA 4MJKA 2X1BA 5CA5A 1VQNS 2IYIA 3ZO7A 3R7NB 4DFPA 2AP6A 1BMQB 5D77A 4KFBA 1FJEB 1YX2A 1RXOB 1BQMA 3MUTP 1S6PB 3R5BA 4LSNB 3OPKA 3PZPA 4OX9J 4RPFA 2I0XA 3KFWX 3KG1A 2HNDA 3ZZOA 5IV4A 1J5OA 1QJHA 4JI3F 4I67A 5J1EA 3PR4A 2MGZB 3CPWR 2ASLA 3KLHA 2ASYA 2Y0BB 3W9IA 4NRUA 1KC8T 2JL9A 2YX7A 4ICLB 4R8UA 3QFWA 4LRBA 4XK8C 4FXWA 4WP3A 3MM9B 3VAMA 1ELOA 1CEZA 3NKYA 3IRXB 4OYXA 1AZSA 3HSJA 4V1Ak 4I4BA 2M5YA 5DLFA 4IO1A 2AX0A 2R4FA 5H9FK 3M2UB 1IM6A 2F8MA 3R97A 1EARA 4NLVA 3ZFVA 2IRYA 4PXCA 1FRMA 3ILJA 4B17A 2OPQA 4DU7A 2QJ3A 2CWKA 2VBZA 2CADA 2C3OA 3FJ2A 4C0HA 3HVRA 3VAGA 1N34J 1P1LA 2HIYA 2F5GA 4PXBA 1TMMA 4S0MA 5AXNA 4AL6A 1RWXB 4LF8F 1L3TA 2ZZMA 2HPUA 3J80U 1NK6A 4FVMA 3CXCR 4NLPA 4NA1A 3M9OB 5LMUJ 1KLMA 4UTGA 3DLLQ 4PYDA 3DRXA 2KYZA 4WJBA 1TKZA 1CC7A 3D28A 4HTJA 1Q86T 3JQJA 2QO3A 2OPPA 3MAHA 2ZM6J 4TYAA 4DSIA 2CJXB 2R8IA 2M2BA 4MKYA 1UP1A 2HBQB 4ZVTB 5KFQA 2RUSA 4WU2A 1Q0NA 2PGCA 3MMBA 3T9ZA 4ICLA 2MHNA 3O5TB 2OD4A 5RUBA 1X9SA 4YY3J 1J5EJ 1U2RA 3CD5A 4DDFA 3R6GB 1XMQF 4JI3J 5L1JA 1HPZB 3QATA 2C22A 1TK5A 4UY8T 1TP7A 4O4RA 1BQNB 3TX8A 3CMES 4RWXA 2XWXA 4DX8H 4PG8A 5A8WB 2JEJA 3KJNB 1M5HA 3TOQA 3PG9A 4MK9A 1HQUB 3C15A 4UF4A 1RA7A 3EVMA 5B7WA 1FESA 1FVSA 1WELA 2GC8A 3FRYA 3OW2R 1HI0P 2I1RA 1ZH5A 4JI2F 3HCXA 2B4OA 2HBZB 1G7CB 3KJVB 1FD8A 1S59A 1O5JA 2LEBA 1LOUA 1L5UA 3R5DA 2G4BA 3DRRA 1JLGA 1VLYA 2VDIA 2AZ3A 2XSFA 1VS3A 1S9FA 5F8NA 4RW8B 4GC7A 3B54A 1OIAA 1LWEA 2VD3A 4WFAQ 1T9XA 3M8WA 4ZVOB 2PC6A 3TUJC 2CVEA 3HD1A 1OY6A 1U6ZA 3MPYA 4HEA9 5LSOA 2J8AA 3MMBB 3DFEA 2FJXA 4FPIA 5DM6Q 4ZVPB 3W65A 1ZTWA 2QA2A 2RJZA 3DXBA 5KFJA 3DOKA 1XNQF 4OJHA 3POTA 1HPZA 2JSXA 2WW4A 4OHVA 1K1SA 3J7Z5 4DS4A 4NL5A 3CJ2A 4QPTA 1G3OA 4JI1F 2HWTA 2Z0GA 4IRCA 2LEPA 4CTAB 1CULA 4P74A 5LT5A 1ZYQA 1UWBB 3ZZ0A 4N7TA 4LIWA 2B4UA 3TVZA 2B7BB 5HJXA 1HWIA 2J9CA 3L7PA 2KHCA 2HFOA 4NYPA 1KP6A 2RDDA 2A0FB 3MEGA 2CQPA 3UNYA 1QAYA 2RHSB 1MU2B 2GQ2A 2R7SA 2LQ9A 2FUG9 1HWKA 1SL2A 4KH1B 1IN0A 4PWWA 4TQRA 3KKFA 1FVQA 1EAYC 1UTAA 3IWLA 3DC2A 4FYYB 2HFZA 4H54A 2E7WA 3UVJB 3VWSA 4DU8A 1N34F 3OBIA 4QWEA 3HLUA 1JQGA 2F63A 3BYPA 2MLXA 1F3VA 4NLQA 1DTQA 1S1TB 3ZZRA 5LMNF 2J76E 2Y3YA 4HH0A 2W01A 1SC6A 2GHPA 4I2PA 5CYQA 1WKLA 2GGPB 2IVFB 2KHDA 3B4DA 2WBMA 3OTOJ 2ZKUA 4M1KA 4GRSA 5CZVA 4H4OA 1N8RT 2ACYA 2ZE2B 3IXQA 1HR0J 1RBLA 1RQ0A 4OQJA 3J7YU 3AXMA 4L73A 1HBUA 5HI7A 1B70B 4C6AA 1FCAA 2LYVA 3H5UA 2BACA 2XMAA 2VU5A 3MR7A 3CJTA 1QAIA 1NAQA 3ITHB 5FD1A 5HLFA 2YWHA 2KO1A 2OFGX 4ECXA 4MIBA 1TUWA 2AYBA 3MPDA 2RF2A 4KO0A 4Y2MA 4J9PA 2KYXA 1R0CB 1MLAA 4JOUA 1YITS 2GJ2A 3MFIA 4NMLA 3RB6A 3UCUP 1S5ZA 3PYEA 2VG6B 4ZPWR 4HYKA 2DNYA 2XCPA 1F0XA 2ZUGA 1FXRA 5DGBA 3CW2C 3HP6A 4ED1A 1M1KT 2GV1A 1FDAA 2XSJB 3V4IA 2A2CA 1PBUA 2WW8A 3RRKA 7FD1A 1VQMS 2VC1A 3PNIA 4IQMA 3L4BC 1N0UA 2E1RA 2WCXA 2X7IA 2PMHA 1XQIA 4P72A 1YIJS 2HBYB 1WOSA 1KQFB 1NK8A 1Y0HA 3PEJA 2MKKA 5IXUA 4IUFA 3Q0AA 3X1LB 2LXIA 2Y8WA 1DJ0A 2GGPA 4D3HA 3DN9A 4R5PA 2DKOB 2VPWB 2ZBRA 1IJFB 1GXUA 3I4PA 2MLYA 1TL1B 5FIIA 4DR3J 2CZVC 1S1XB 4USKA 1JLEA 4NMXA 3HMJG 2OPRB 3L9ZA 4K50A 5IWAJ 1VDHA 3BO4A 2NPIA 2XBPA 4ZCLA 3GP9A 3MM7A 4F4YA 4OYPA 3CWJA 1FFSB 1HNIB 2E5JA 1T95A 2QMWA 3DGPB 2XO6A 2HHQA 3IAM9 3PYGA 3FRZA 3R9LA 3KHRA 4OX6A 3VALA 3S6EA 1DQ9A 1H2TZ 3OFGA 1PJ5A 2MQNA 3PY8A 4Q8FA 3KLFB 1RAIB 2NZ4A 5KFIA 2F7VA 2KVQE 3RB0A 2U2FA 1RJJA 3QIDA 4LBIA 4LR8A 3N28A 4FYVB 2E1CA 4NCBA 4RW6B 2GX8A 3PV8A 2QEXS 2OD6A 4N8NA 3BBBA 2AEMA 4QW8A 4BWJA 3J81j 2OGUA 3CJ0A 1XR7A 2WK4A 1S4FA 3NOCA 1RAOA 2XHWA 3W8PA 3JTOA 2KDOA 1VISA 3CDUA 3CJQA 4C8MA 1N48A 2RHQB 2DGUA 2HHWA 2KXNB 1DY3A 1RWNB 1CBKA 5ETRA 3TO8A 3KLEA 4DV3F 3NS7B 3T1YF 4URQU 3IWNC 4PAAA 1B0PA 4MYUA 2HQIA 3G4SS 1T9VA 2EKYA 1S49A 3H59A 2PD1A 2FZGB 2WSEC 1O51A 1V3RA 3A8EA 3JS9A 1TL1A 1WOPA 3QPIA 1SV5B 3T9NA 4D3GA 2BRKA 2WONA 4GVLA 2MKHA 1JLEB 4UQTA 2YQ1A 1WEZA 2ZH9A 1CJTA 1Q4RA 3KLIB 3SQGA 2C2OB 2FY8A 1NK7A 4ZVRB 2C2MB 2N7YA 2QMUB 1T94A 1Y3JA 1FNMA 3C14A 5K8OA 2R7QA 3OTDA 2Y1RI 1U6FA 5KFVA 3N6NA 3ZNJ1 2YNIA 1FRLA 4QU6A 2VZ9A 3W62A 1U02A 2CJ9A 1QE1A 1NU4A 2KRBA 4KB7A 4FN5A 5F9LA 2NR0A 1WJ9A 3HULA 4KGXB 1HYSA 3PM9A 1TAQA 3IBWA 2ZH2A 3VAIA 1OSCA 3K7RA 5HQLA 1B0VA 1WF2A 5JUMA 1DURA 4B02A 1LWFA 4WFNQ 1XWLA 4PUOB 4WYLA 3N6MA 4NLUA 3LP2A 3BS9A 4AT1B 2IA6A 1S99A 2ZVSA 4W90B 1XC9A 2HFVA 1FD2A 3NRBA 4PXDA 1RWVB 2OI2A 4OYZA 4USMA 3EX7B 2L08A 2VL1A 3FMBA 1S6UA 5ITHA 3MR6A 3PW2A 2VH7A 1FK9A 1JLFB 3T5KA 3OHBA 3A3PB 2DPJA 2FVQA 1H0HB 4FBTA 4ID5A 4G1QB 3D6MB 3F73A 2E5HA 1X31C 1A0OB 2HIQA 1U1LA 2YVSA 3KG0A 5BR8F 3MUVP 1U4BA 3R27A 4LREA 3T41A 3MXHP 1SC4B 4YB6A 2DISA 5F8IA 4DV2J 1O0PA 1NO8A 3CDEA 2OO4A 3VR1A 2DO4A 4RLEA 5KT4A 3LW5C 1Q81T 4NCGB 3PIPQ 3OUYB 2HSEB 2OPQB 1U1NA 4WZQA 5K14B 2FD2A 3M2VB 3NGDA 3D1HA 2XG8A 3FSYA 2D3UA 4P9SA 1Q16B 5KFXA 3K8VA 3I55S 2FIUA 2LCWA 1T9YA 4ZVSB 5HMWA 4GMKA 4ZPBA 3R2CJ 3TJAA 4DUTA 1IKXB 4DXLA 4USUA 4E2FB 2JEGA 3UD3P 1WKKA 2B9WA 2EKNA 1LW2A 2RRBA 4C97A 2CKWA 1PILA 2NUUG 3VAFA 2NREA 3M8QB 1IKWB 1M0SA 2VFSA 5A0YB 1RTHA 2D1CA 3FUYA 2FHJA 3PYDA 3J7YI 3SMZA 1KHWA 3DMJB 2RD5C 3C6UA 4HR2A 3H2VE 4C0BA 2AD9A 4JI7J 2POKA 2C3MA 3EVWA 1YJ7A 4LFCF 2K06A 2MLZA 5CQGA 2VFTA 2EWHA 4UOCA 3CJKA 3GV7B 4ZPCA 3J7ZT 4C4WA 1VCTA 4DSFA 4NA3A 3WBZA 2V9KA 5E7OB 1UFLA 4LVNP 2I2YA 1JMTA 2D9PA 2GHVC 4OI4A 3RRHA 2QL7B 3TZYA 1KNZA 4F2SA 3IS9A 3QLHB 4YOEA 2BJ9A 3DLGB 1U8SA 3GQCA 4ZLJA 2P8IA 1JKHA 4Z37A 1NKBA 2FHOB 1C0UA 1VBXA 5DLGA 5KFMA 1RT4A 2C2ZB 2DHAA 2G2YA 3CB4A 5HQ8A 4DV6J 2QLWA 2OSRA 3ZZUA 3NGRA 2J7KA 3M2RB 1ZS6A 4NLGA 1PO6A 3QRQA 1LW2B 3RUBL 2GFFA 1XTZA 1WUUA 1W2BR 3PKMA 1LW0A 4F2RA 3TUPA 4DOZA 1R8AA 3PRBA 4O0NA 3G6XA 5LMNJ 3K5OA 3TUZC 4DV7F 1TKXA 1A9NB 5H9FJ 4NPOA 5J2NA 5AXLA 5KT3A 1FWLA 2DY1A 3DMJA 3D6HB 3HHLD 4EMDA 1RT1A 2ZHAA 3NCPA 1OPIA 2OTLS 3AQOA 4F4KA 2ROEA 3BBFA 1QY7A 3J81Y 5KFOA 5HVFA 4Y3CA 4ZCMA 4RU2A 4P71A 4NXMF 2AJ2A 4ZLNA 5JJBA 2LQJA 1NPKA 4URSA 3AOCA 3C8YA 3G8TA 3V6HA 3MHYA 2ZH4A 2AGOA 1KR4A 4NYOA 3O3LA 1LWCB 2IM3A 5F0UA 1RACB 1UCNA 1UWBA 2HNYA 2ZD1B 2RQCA 2W9CA 2HW3A 4DCOB 3SCJE 2HNZB 2AGQA 2I8EA 3SCLE 3G6VA 1S97A 2UUBJ 5K8NA 1CJUA 5I42A 4B3MJ 5F8GA 1EJ7L 2U1AA 3MEGB 3MAAA 3S7RA 4ZN1A 5A2QU 2MKSA 4C8ZA 4QJVA 3BR9A 1S12A 3MD1A 4IDKB 4I68A 4AUKA 2M4MA 4HLBA 4EO8A 2DGXA 4MKAA 2JC1A 5D4PA 1CS4B 1L3VA 3OL8A 1VC5A 5KFYA 4JI4F 1Y7PA 2EFQA 2HKEA 2BZ2A 2CQ1A 3SI8A 4KFBB 1DTQB 2QT7A 4ZHRA 3FEZA 2I9SA 2K2PA 4AE5A 3Q8PB 5L39A 1S6PA 3LWMA 4DQIA 2AJ0A 2LFVA 3P4UB 4RNHA 5BYRA 2D7SA 4ECUA 3GIKA 3HKWA 1NSPA 3A13A 2UUAF 2GCFA 1FKOA 4NLWA 3HJVA 1NCLA 2GMJA 2QE5A 4ZVGA 4P2XA 4BBYA 4ZITA 4A8QA 1U1QA 1JX4A 2CQHA 5ADZA 2L9NA 4DL6A 2Z4PA 3PW7A 1TVRB 3I6PA 1UETA 2MGZA 2ZZTA 2YH1A 2Q3PA 4EWTA 2RQMA 1KHVA 2VF3A 2GO9A 1VR6A 1UEKA 2PFDA 2BJ8A 1N5SA 4LRAA 4GVBB 4R8UB 2DO0A 2KZMA 1SUQB 2V0NA 1IKYB 4OZNA 2B8PA 2J7WA 4RNNA 3AD7C 4DZ6A 2DXFA 2YNFB 1QUVA 1N5VA 3K17A 3KK1A 2FGOA 1S48A 4I0WA 1VQKS 2RE1A 1S1VA 3VQTA 1D3WA 5IT0A 1X4GA 4UOHA 4ATNA 1X4AA 4FPRA 3FCVA 4WK3A 5KFCA 2MKYA 5B0DA 5GAEU 4PQUA 2DNQA 2HLUA 4RW9A 4AFFA 4X4RA 3HSZA 2MY7A 2VFUA 2XY6A 2K7KA 3ISNC 1CS4A 2O1PA 2HWHA 2HHVA 4QOTA 1ITPA 5KG1A 2P9EA 4ZS6A 1PG5B 1I5OB 2ZH1A 2IJNA 2HAIA 3EWGA 3BB5A 1RT2B 3MWBA 3DNCA 2DEIA 2FC9A 2MZSA 3BR8A 3HX9A 5DQIA 3CCLS 1SH0A 4DR5J 4ED3A 1QSSA 1Q8LA 3LALA 4FF4A 2BJEA 3IG1B 3QO9B 3MR3A 3VAKA 4OZJA 1SB6A 2OH2A 3MMAA 4WFBQ 3MOZA 4WPAA 3ZTSA 3ULHA 4CCHA 3PRDA 2RU9A 2Z58B 2BE9B 3A1YG 3QJPA 2XULA 1NB7A 3V6JA 1M1GA 2OSQA 3F0NA 2V69A 4P73A 1AA1B 4DR7J 4OJGA 1FRKA 5C2CA 1FE0A 4AQYJ 1TKTA 2VQFJ 1N36F 1U2FA 3KMSA 3EJMA 2ILYA 3ILOA 4F02A 3L09A 3FCWA 2VQEJ 1V3SA 1JIHA 4DL4A 2GZOA 3QZ7A 2FVCA 3QT6A 1FNXH 2GVDA 1RGVA 3C16A 2XCAA 4JYAJ 1AW0A 3TR5A 2DNPA 4DX6A 4ES2A 1X9MA 1TV6B 1RHRB 4LF5F 1U47A 4DUZF 1HNWJ 2CVIA 2NLWA
chains in the Genus database with same CATH topology
1BMQB 2QLBB 1SC1B 1NMEB 3RJMB 1QDUB 2H48B 2HBRB 1GFWB 2XYHB 3R7BB 4DCOB 2XZTB 5K20B 3EDRB 2Y0BB 2CNKB 1I3OB 3IBCB 1RWVB 2H5IB 2QL5B 1RHQB 3GJSB 2H4WB 3D6MB 3EDQB 3QNWB 1ICEB 3P4UB 3KJQB 1SC4B 1IBCB 4DCPB 1RWXB 1PYOB 1RE1B 2H65B 2XYGB 2H5JB 4DCJB 3R6LB 2C2KB 3D6FB 4ZVSB 3SIPB 1RHJB 1F9EB 4ZVUB 2CJXB 2CNLB 2HBQB 2QLJB 2XYPB 2C1EB 2QLFB 4ZVTB 3R7SB 2HBYB 1RHMB 5IC6B 2CDRB 3P45B 3GJTB 2P2CB 2DKOB 3R6GB 3IBFB 2XZDB 1SC3B 3KJNB 2CNNB 3KJFB 1RHUB 2CJYB 2QL9B 2QL7B 3R5JB 2CNOB 2HBZB 4ZVQB 1RWMB 4LSZB 3GJQB 1RWPB 1PAUB 3GJRB 4ZVOB 2C2ZB 2H54B 3R7NB 1RWNB 1QTNB 1RWOB 2Y1LB 3NS7B 1RHKB 1I51B 2FQQB 4ZVPB 5IC4B 2H51B 1RWWB 2H4YB 3D6HB 4JB8B 1RHRB 2C2OB 1RWKB 4ZVRB 2C2MB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BMQ B;  2QLB B;  1SC1 B;  1NME B;  3RJM B;  1QDU B;  2H48 B;  2HBR B;  1GFW B;  2XYH B;  3R7B B;  4DCO B;  2XZT B;  5K20 B;  3EDR B;  2Y0B B;  2CNK B;  1I3O B;  3IBC B;  1RWV B;  2H5I B;  2QL5 B;  1RHQ B;  3GJS B;  2H4W B;  3D6M B;  3EDQ B;  3QNW B;  1ICE B;  3P4U B;  3KJQ B;  1SC4 B;  1IBC B;  4DCP B;  1RWX B;  1PYO B;  1RE1 B;  2H65 B;  2XYG B;  2H5J B;  4DCJ B;  3R6L B;  2C2K B;  3D6F B;  4ZVS B;  3SIP B;  1RHJ B;  1F9E B;  4ZVU B;  2CJX B;  2CNL B;  2HBQ B;  2QLJ B;  2XYP B;  2C1E B;  2QLF B;  4ZVT B;  3R7S B;  2HBY B;  1RHM B;  5IC6 B;  2CDR B;  3P45 B;  3GJT B;  2P2C B;  2DKO B;  3R6G B;  3IBF B;  2XZD B;  1SC3 B;  3KJN B;  2CNN B;  3KJF B;  1RHU B;  2CJY B;  2QL9 B;  2QL7 B;  3R5J B;  2CNO B;  2HBZ B;  4ZVQ B;  1RWM B;  4LSZ B;  3GJQ B;  1RWP B;  1PAU B;  3GJR B;  4ZVO B;  2C2Z B;  2H54 B;  3R7N B;  1RWN B;  1QTN B;  1RWO B;  2Y1L B;  3NS7 B;  1RHK B;  1I51 B;  2FQQ B;  4ZVP B;  5IC4 B;  2H51 B;  1RWW B;  2H4Y B;  3D6H B;  4JB8 B;  1RHR B;  2C2O B;  1RWK B;  4ZVR B;  2C2M B; 
#chains in the Genus database with same CATH topology
 2R7O A;  3DI6 B;  4QBU A;  1R43 A;  2QLB B;  2DYA A;  4R25 A;  3GYN A;  1WF0 A;  2EFP A;  4M5H A;  3CIM A;  1NJZ A;  1JLG B;  1YLX A;  1M1H A;  3ELH A;  2VBX A;  2MQM A;  3HPO A;  1M5O C;  1NSQ A;  1BWV A;  3HZG A;  1FDD A;  2V8V A;  5D0E A;  4IRK A;  3EZ5 A;  2AIR B;  4LSL A;  4NX9 A;  4DV2 F;  1J5E F;  2G0J A;  2ABY A;  2R8J A;  4WP8 A;  4EBE A;  1TFW A;  1XER A;  2YKA A;  1EET A;  4IFY A;  1GMW A;  1WI6 A;  2GVZ B;  3NCR A;  3TAM B;  2G13 A;  4M5G A;  2AJ4 A;  2V5H G;  2ZDP A;  2PO4 A;  4LFB F;  2J7U A;  3VGT A;  1NZA A;  3TVK A;  3W2V B;  5E3P A;  2OEL A;  2BR0 A;  1WTB A;  5KT6 A;  4J9S A;  1UEU A;  3PDN A;  4EK2 A;  1LXN A;  3HT3 A;  1HBO B;  2CUY A;  2ZFH A;  2ADB A;  3QMQ A;  1W26 A;  3GSI A;  2PFF B;  4O23 A;  4LF6 F;  3HK2 A;  2QIF A;  4WE1 A;  2ZHB A;  2W7P A;  4XDD A;  4X62 J;  2ZVI A;  2QV6 A;  4F3M A;  3SYZ A;  5KAK A;  4N5S A;  1Y5L B;  3TA2 A;  1EZZ B;  2E66 A;  4MAK A;  3SV4 A;  1B0T A;  4PG5 A;  4EGL A;  5KTQ A;  1NDK A;  1RSC A;  1V9O A;  2VG5 A;  2Z8Q A;  4KIA A;  1FE4 A;  3BO3 A;  2M3D A;  2C28 A;  2KB2 A;  3IR5 B;  5J1E B;  1X9W A;  3UVJ A;  3JB9 k;  4AL5 A;  3QRP A;  2HHH F;  1Q7Y T;  2CQ2 A;  2X1A A;  3PHT A;  4GO7 X;  4E0D A;  3J7A N;  3ENQ A;  3CDB A;  2J8S A;  4RNM A;  1XBW A;  2EFO A;  4NZ6 A;  2WTF A;  2DNZ A;  3GU0 A;  5C25 A;  1S7I A;  2J9E A;  4FYW B;  3MM9 A;  3OV7 A;  4B3S J;  4IR9 A;  3J7A 1;  2RU3 A;  2R42 A;  4ECR A;  3T6B A;  2DB1 A;  1GX5 A;  2E1M C;  1PBA A;  4L3N A;  2B9X A;  2BJ7 A;  1LK7 A;  4OLO A;  1HBU B;  2F65 A;  2HS0 A;  4LJM A;  2P2C B;  1VBZ A;  5G4D A;  1OY9 A;  1UZD A;  1R8B A;  3I31 A;  1P6T A;  5JXS A;  1E6Y B;  3VCD A;  2WSF C;  3AHP A;  3Q2T C;  3G2X A;  3FK4 A;  3P8B B;  2XB2 D;  3QT7 A;  3GMG A;  1R0A B;  1B7F A;  3JSR A;  1RP5 A;  4AL7 A;  5J2M B;  4CZC A;  3G6E S;  1HWJ A;  1SBR A;  4CLZ A;  4OI3 A;  5EWG A;  4PRF A;  2NYI A;  3TUI C;  3OVS A;  1Y10 A;  1OYE A;  2AZ1 A;  2VG5 B;  5C2G A;  3C6U B;  5GME A;  4A8X A;  4CLF A;  4QYZ K;  2J9D E;  1QAJ A;  2BKP A;  3D54 A;  1R89 A;  2P9G A;  2XLI A;  4B3T F;  4I6W A;  1FA0 A;  2BW2 A;  5D6G A;  3HVT B;  1SJR A;  4J37 A;  2B4V A;  3VVU A;  4ZLP A;  5B0E A;  3KK3 B;  2KG1 A;  4Z7C A;  3D0I E;  5M2R A;  4DF8 A;  1NZ8 A;  1PSD A;  3DDI A;  1T8E A;  1B3T A;  4F4W A;  1GTE A;  2AKW B;  5M2P A;  2Q79 A;  4CWB A;  4J9Q A;  3T5J A;  3SEO A;  2W9B A;  4RX6 A;  2KU7 A;  4GKJ J;  2W2M P;  4DG1 A;  5DG7 A;  2O01 C;  3LOU A;  4M5K A;  4KHP J;  1CPZ A;  5E3C A;  2XI3 A;  1IBK J;  3MR5 A;  1RAD B;  1M5K C;  1SJ1 A;  5A8W A;  1RT4 B;  1IXK A;  3NG8 A;  6FDR A;  2A2D A;  2C2D A;  2CQB A;  5K9F A;  1R0B G;  3NY0 A;  3C15 B;  4L74 A;  1URN A;  4LMZ A;  1X60 A;  4DEZ A;  4TN2 A;  2B43 A;  4UW2 A;  3V6K A;  3HHE A;  1S1U A;  3W2W A;  5L1L A;  2WAQ D;  1VQL S;  1YRU A;  4IG0 A;  2FDN A;  4Q2M A;  4IO9 Q;  3AD9 C;  2ZBQ A;  3V81 B;  2L3M A;  1T3N A;  3G82 A;  3DRR B;  4P2S A;  4RUB A;  4Y34 A;  4ZP7 A;  2YNG B;  5L38 A;  5IQ6 A;  3DRY A;  2B9E A;  4P7T A;  3HKZ D;  4ECY A;  1I6J A;  1S0V A;  4MIW A;  3W63 A;  3E01 B;  1R7I A;  3GV8 B;  4OIX A;  4FF1 A;  2N3O A;  5ETP A;  4HHU A;  4KV8 A;  1MMN A;  4UUX A;  3W5Z A;  4EZ9 A;  2DNR A;  3F44 A;  2L9W A;  5J2Q B;  1OWX A;  4U96 A;  3LWL A;  2DXE A;  1YBT A;  2YPY A;  5AXK A;  1Q78 A;  3AJ1 A;  3FBB A;  3MEE B;  3KUE A;  4M94 A;  4G3I A;  3H25 A;  1U26 A;  1WDT A;  2UV8 A;  3IFE A;  3BKF A;  3K57 A;  4I7F A;  3RBD A;  1PJ7 A;  1IR2 A;  2QYC A;  4O3N A;  4P10 A;  2V4Q A;  1BXN A;  4U7U K;  1N54 B;  1XNR J;  3OLA A;  2BJ3 A;  2MTL A;  5HP1 A;  1NK9 A;  1LWX A;  2BE7 D;  3MTK A;  4F7V A;  2DNM A;  5C24 B;  1RTD B;  4B3R J;  1RHQ B;  4F50 A;  3NS5 A;  5THW A;  5HVG A;  4O44 B;  2JRS A;  4KGZ B;  5LM7 E;  4M63 A;  1H73 A;  3MUR P;  2LLZ A;  3BPS P;  3OJU A;  2QFI A;  1RU2 A;  5ETM A;  3DHW C;  1VHI A;  5KFK A;  3DM2 B;  4KHP F;  2WOM B;  1IBC B;  3NNA A;  5D4O A;  1SL0 A;  4TKT A;  5DZ6 A;  3NWG A;  2Q1L A;  1R27 B;  1RT3 A;  1FXL A;  5LL6 d;  2R7V A;  5HAN A;  3GR1 A;  1YBA A;  2D9O A;  3CD7 A;  1WC4 A;  2Z57 B;  3UN3 A;  1M5V C;  1D9D A;  1CJK B;  1R3N A;  1YRX A;  1TL3 A;  4CRJ A;  3CMA S;  2CQC A;  1REG X;  1RCO B;  2HFN A;  4BCA A;  4GC6 A;  4IFV B;  3ZZZ A;  4JV1 A;  2DCU B;  3EGV A;  2RVJ A;  4WFX A;  4X65 F;  3JYT A;  1YJW S;  5E5N A;  2KFY A;  4M95 A;  1X5S A;  2V8P A;  3J81 U;  3CJ5 A;  2HEK A;  3PJX A;  2CG4 A;  1HWU A;  3SFU A;  1YG0 A;  4HAC A;  2D3O 1;  3NBP A;  3T1H F;  1Y5N B;  2N82 B;  4MKB A;  5CH7 B;  5D3G B;  2LQB A;  1Y3K A;  2C1E B;  2CYY A;  1Q8I A;  4OHW A;  2AX1 A;  2M0G B;  4X84 A;  5KFL A;  4F67 A;  3Q8S B;  3PVX A;  3I0S B;  3GCX P;  4Y00 A;  5EUH A;  4LIR A;  2VA2 A;  3VV2 B;  1TEL A;  1FDB A;  2HGL A;  1R31 A;  1EP4 A;  4JI5 F;  1VQS A;  3V6D A;  1SC3 B;  3GIR A;  2V8H A;  4ELV A;  4ES1 A;  4ELT A;  1GTH A;  1FNO A;  1HWL A;  1S1V B;  2H1Y A;  2NYH A;  4USW A;  3VGV A;  2BOA A;  2B56 A;  2FGC A;  2H5E A;  3EZO A;  4KT0 C;  3W9H A;  4WCE Q;  3NWR A;  3DOM A;  1SKR A;  2HRT A;  3AB4 B;  1ZM4 A;  3HT0 A;  1YJN S;  1IUJ A;  1NEE A;  2DT9 A;  4B9S A;  5JVG Q;  4ECT A;  1RTI B;  4ZPD A;  1ZM3 A;  3ENW A;  3JSM A;  2WRM A;  1KTV A;  4Y6I A;  4A8K A;  4ZVQ B;  4ECQ A;  4HI2 A;  4N8O A;  4E8U A;  2CPJ A;  3IGN A;  3MMJ A;  3MPW A;  4WU3 A;  4PR6 A;  4CH0 S;  4DL2 A;  2XHC A;  3PCO B;  5F9N A;  5CYM B;  3UNG C;  3NGT A;  3AOB A;  2XWY A;  1TKD A;  1OSD A;  4ETZ A;  1MRO B;  1RT7 B;  1HL6 A;  2YNH A;  1HKA A;  3DLK B;  3I56 S;  1ACM B;  1K1Q A;  3M8Q A;  2VBY A;  2YQ3 A;  1C1B B;  3EE3 A;  1U2C A;  1ROF A;  2FJD B;  2PMW A;  1RT5 A;  4OYI A;  1P9Q C;  5JVH Q;  1MG7 A;  3RBE A;  1FJG J;  1HNX J;  3MED A;  5D0G A;  1FTC A;  2RNE A;  3KNG A;  1L3U A;  4JI4 J;  4WTO B;  4Y65 A;  3CDA A;  3HFZ B;  3MTJ A;  1YJ9 S;  3H2L A;  4DL0 C;  4DN9 A;  1Q7L B;  4ZIV A;  1X0P A;  4OYA A;  1EP4 B;  3CJR A;  1XMQ J;  1VRU B;  3FCH A;  5DS7 A;  4ZN3 A;  5DG9 A;  2J5A A;  4A8S A;  1UPP A;  1F9H A;  1RBO B;  2QYG A;  3RRG A;  3D9B A;  1FER A;  2UXC J;  8RUC A;  4OZ1 A;  1JNR B;  1LV5 A;  1JLC B;  3N0V A;  1X8D A;  4CO0 A;  1IKV A;  1NME B;  3S8S A;  2PE8 A;  3LQV A;  1MML A;  1MN9 A;  4K5R A;  4ECZ A;  1D1U A;  4ZA1 A;  2Q66 A;  1RLC L;  1NND A;  4ED4 A;  3JSM B;  1TV6 A;  2K3K A;  4DV4 J;  3UCZ P;  3ICL A;  2UXB F;  1TKZ B;  2EI5 A;  2GJI A;  2MJN A;  3JTP A;  4YEA A;  1UJ4 A;  3JAM Y;  5HBM A;  1N4L A;  1SQF A;  4F4X A;  4HTI A;  1DLO A;  3IR6 B;  3HHL A;  4KTQ A;  1UW9 A;  4LF2 A;  5KFD A;  3UWT A;  3RZA A;  1B4S A;  2IAJ A;  1Y00 A;  1DZ5 A;  2JWN A;  2M7S A;  2HHH J;  3ETM A;  2QA4 G;  4EU0 A;  4Q44 A;  1I3O B;  2RRN A;  1ZOT A;  1YJV A;  1IVZ A;  4YFU A;  1D8Y A;  2C3Y A;  2A3J A;  5L1I A;  1URR A;  4B3S F;  3ADA C;  1PC4 A;  1K0V A;  2BDP A;  4IFY B;  4DUZ J;  3H8Y A;  4L3K A;  3OJS A;  3KLI A;  2UZA A;  1P9Y A;  3M8R A;  4DV1 J;  1AB8 A;  1ULR A;  3QSY B;  2BE2 A;  4IOA Q;  2VV5 A;  4DQP A;  1FFW B;  4CP5 A;  5HMZ A;  4JP8 A;  2OFH X;  2EC0 A;  2H4W B;  2CJB A;  4J9N A;  4WBF A;  2B6A A;  5DQG A;  5AE3 A;  3PEH A;  3QNW B;  5EWF A;  1ICE B;  3QGI A;  4MK7 A;  3CCQ S;  1DAR A;  1QE1 B;  2Z30 B;  2BJ1 A;  2KT2 A;  3PJW A;  1HQE B;  1OS5 A;  2E5G A;  4YR0 A;  2JVR A;  1MWQ A;  1JLC A;  2R7X A;  3TEH B;  4RKU C;  1S7H A;  3BQ1 A;  1T7P A;  3OXF A;  3RAQ A;  2QTW A;  2HNZ A;  4ED8 A;  4DR3 F;  4LFB J;  2K7J A;  2YKM B;  2XZW A;  1U6B A;  2YKO A;  2DH9 A;  2C2K B;  3IMQ J;  4NWB A;  4DSE A;  4EYH B;  1WDD A;  3C19 A;  4WKY A;  2V34 A;  3KDO A;  1BHN A;  2CNL B;  3JSY A;  2QLF B;  3TQE A;  5DDR C;  1KTQ A;  2HHS A;  1WD6 A;  2AQ4 A;  1DFD A;  1VOM A;  2Z2L A;  3HM9 A;  2VA3 A;  2QMX A;  1T05 B;  4DPO A;  5T7L A;  3GZ7 A;  3BH7 B;  4X4P A;  1RAE B;  1UKU A;  3Q8Q B;  4NLO A;  1S9E B;  3TP2 A;  5AJ3 J;  2RS8 A;  1NUE A;  4B08 A;  3BH6 B;  2ILZ A;  5FJ4 A;  2DNO A;  4NLX A;  3DOK B;  4FYD A;  2D69 A;  3TNV A;  4TU7 A;  2RKI A;  5D4L A;  1UJ5 A;  3NNC A;  4ANC A;  4ENO A;  1UVL A;  4OI0 A;  1REV A;  1T9T A;  5D0R A;  2FLP A;  3D7S B;  3CC4 S;  2F8H A;  1N56 A;  5A6P A;  4ZLL A;  2XY5 A;  3P49 B;  2GO8 A;  2YTC A;  4AXI A;  2VIH A;  3ISZ A;  1DTT A;  1Q79 A;  5CYJ A;  3R5J B;  4IOB A;  1S6O A;  4JI0 J;  2V2Z A;  5KG6 A;  2ZBC A;  1S76 D;  4ZIW A;  3CTR A;  3QSI A;  2IVY A;  1E6V A;  4V19 J;  2GML A;  2LDI A;  3AFG A;  3OQ2 A;  4ILR A;  3H7H B;  3JSB A;  3THP A;  3P5B P;  1BGX T;  3I82 A;  4YB7 A;  1DRZ A;  1LFW A;  2IBO A;  1IM4 A;  1KDN A;  2MZJ A;  4I2P B;  2VG7 A;  4X4V A;  5ETS A;  1JLA A;  2AEJ A;  2E9Z A;  4YR3 A;  1I94 J;  1HW8 A;  3KLH B;  2FQQ B;  2W1B A;  4FDF A;  3UR3 C;  4ELU A;  3TW0 A;  4KJI A;  1VQO S;  3CD0 A;  3FBF A;  2P6S A;  4Q8E A;  1NSK L;  4U8Y A;  2P9C A;  2XQC A;  4RUA A;  4WWS A;  3JQK A;  3IRX A;  2O66 A;  4XPC A;  4C3K A;  2E7V A;  3O2I A;  2IMO A;  3TEG A;  1RWK B;  3CF5 Q;  3DYA B;  3LGN A;  3CCE S;  3DLH A;  2ZH5 A;  3D6T B;  2WHO A;  3WIV A;  4AQY F;  4YB1 P;  1GMU A;  5I3P A;  3LUY A;  3LTO A;  4DI6 A;  3MOJ B;  1CQN A;  1DTT B;  2OP5 A;  1C0U B;  1FWP A;  1GXL A;  4FXV A;  4ZOS A;  1S1U B;  2B51 A;  4J9L A;  3E2E A;  4ZVF A;  4RUH A;  2BQ3 A;  3O44 A;  2GA7 A;  2XYH B;  3H4B A;  2ZM6 F;  1S57 A;  2OAU A;  4HT5 A;  4NEY A;  2CQ3 A;  3ENA A;  3LAM A;  1VGY A;  2EVZ A;  1HNW F;  3DDK A;  2ZC4 A;  5B0B A;  2RDJ A;  1NM2 A;  4AXJ A;  4RBU A;  3M1V A;  3H4D A;  1Q82 T;  1HBN B;  4LF7 F;  1U09 A;  1U7L A;  1JLA B;  4I2Q A;  5J1N A;  1HNZ J;  5CD4 H;  4O3O A;  1FJG F;  5DGA A;  2W8K A;  4K4Z A;  3CJ8 A;  1KQG B;  4QZV B;  1O6X A;  4NYZ A;  5E3R A;  5BYQ A;  3FSI A;  3P96 A;  2KKH A;  4HAC B;  1HIY A;  2WBR A;  3GJS B;  4K5S A;  4TY8 B;  3EZU A;  3D0H E;  3MAQ A;  1NDL A;  1RTJ A;  2HZA A;  1JLQ B;  2PEB A;  3B4M A;  1F5A A;  2J0S D;  3HHD A;  2AJF E;  2B5J B;  3QBC A;  4OZ2 A;  4F3O A;  3DGP A;  2GQQ A;  3OTB A;  2Z2M A;  4CDI A;  4PYA A;  3CNQ P;  4EYI B;  1TMJ A;  3O6Q A;  1VBY A;  3K2Y A;  3R2D J;  5AT1 B;  4B3T J;  1EET B;  3EXY A;  5IT9 Y;  2F1F A;  1OY8 A;  4NOH A;  2N4C A;  3TAM A;  3K89 A;  4Q7A A;  1L3K A;  2E5L F;  4J7C A;  3SIP B;  4LFC J;  1H7W A;  2LDY A;  4O4G A;  2DY9 A;  4KE5 A;  5HVH A;  3RB4 A;  2XYP B;  1FKP A;  4Y2A A;  1TL4 A;  4U67 Q;  1KD1 T;  4WFY A;  4C8L A;  2RML A;  2KTQ A;  1RUS A;  2ALY B;  3HHL C;  1HBN A;  4WE1 B;  2A6O A;  2FVR A;  3CE8 A;  1UVI A;  2XS2 A;  4CLT A;  4I6Y A;  1HQ2 A;  2AJQ A;  1WSV A;  2ZJP Q;  2KL8 A;  3HHN B;  3B6B A;  4IH6 A;  3T1Y J;  2WON B;  3Q23 A;  4NXN J;  2ZH6 A;  1FWK A;  3MEC A;  1BUX A;  1DQ8 A;  5E41 A;  4EI2 A;  4LF7 J;  1ZM9 A;  1T11 A;  1VC6 A;  1AXQ A;  2DIV A;  3MM5 A;  1BWE A;  5BR8 J;  1TFY A;  3QJJ A;  4K4X A;  3DU5 A;  2CPD A;  1PCA A;  5L9N A;  4ZJQ A;  4QWA A;  5CZX A;  3I0R B;  5DET A;  4OHX A;  2VOP A;  3CO9 A;  3NAH A;  2XO7 A;  5IT4 A;  4YQW A;  1WAC A;  1ZBT A;  2LA6 A;  3AA8 A;  4ZVH A;  5KG3 A;  2MXY A;  1J27 A;  4JI6 J;  3NGS A;  2JX2 A;  4ID8 A;  4DV4 F;  1UA1 A;  3F41 A;  5EX0 A;  4PWD B;  2UXB J;  1NDC A;  2D74 B;  2KVI A;  4KRW A;  4O4G B;  5GAD I;  2LEA A;  1FFG B;  3GCW P;  4NZ0 A;  2BQR A;  4TNO A;  3W66 A;  3BM7 A;  5HAT A;  1X5P A;  4PUO A;  3NMA A;  2G2O A;  5H9E K;  1B7Y B;  3P6Y C;  2M52 A;  4TLQ A;  2FZC B;  1LK5 A;  1BQM B;  2VKZ G;  3UFC X;  4J5O A;  2ZBP A;  3UN5 A;  2V68 A;  3W5Y A;  3BJY A;  1WC6 A;  2KXF A;  1ZA2 B;  4HL9 A;  2DGT A;  4C11 A;  1K9M T;  4ZK7 M;  4YN3 B;  2UUB F;  4DV1 F;  2HZC A;  3IWX A;  3QAU A;  2VAS A;  4C0O C;  5HRO B;  2HND B;  4EUV A;  5GAD U;  1TQL A;  3EPI A;  3Q22 A;  3PW4 A;  4B9N A;  2NZC A;  2YWG A;  5T41 A;  4DV5 J;  2PII A;  2GAG C;  3GTY X;  5B0C A;  2ASD A;  1EX8 A;  3HSG A;  2OPS B;  4P7V A;  3TZX A;  2K8G A;  2R3V A;  4G65 A;  2ZH7 A;  1HNZ F;  3MZI A;  5ETL A;  1O8B A;  5KFU A;  4WF9 Q;  1X4E A;  3VAJ A;  3IO1 A;  1YTY A;  3M2V A;  1RT6 A;  1HD1 A;  4J9V A;  4ZJL A;  4ZPA A;  1YDL A;  5KFH A;  3IA0 A;  4J9R A;  2BW7 A;  1AZS B;  4O3S A;  4OZ5 A;  2DGV A;  2RS2 A;  4U7C A;  5KG0 A;  4IRD A;  4PWD A;  2HHX A;  2MQP A;  2RIJ A;  1ZAV A;  5L1K A;  4DR2 F;  4QR2 A;  4QR0 A;  2IM1 A;  4CNY A;  1KON A;  3CO0 P;  4ED2 A;  2OHD A;  2XMU A;  1BQX A;  3R1H A;  5F8J A;  1H72 C;  1Q95 G;  1IKW A;  5HMY A;  2N3L A;  2NS1 B;  2EBE A;  2HVE A;  2XMK A;  2PDA A;  3HHL B;  1VIO A;  4CO3 A;  2HQ3 A;  3EGW B;  3QJL A;  1IBL J;  2QC3 A;  1S1W B;  2CJQ A;  3LP0 B;  1F5C A;  4DUY F;  3TZW A;  4GO5 X;  3RU0 A;  3PYF A;  2E5L J;  5DDP C;  3CMQ A;  1VLO A;  5G0R A;  4ED7 A;  2UVR A;  1KLM B;  2WSC C;  2IVM A;  3NGK A;  3EDQ B;  4C11 B;  1NHU A;  2R2T A;  2UUW A;  3EIC A;  2UVU A;  3S1T A;  1FXD A;  4NLT A;  3Q24 A;  4KC5 A;  4KV8 B;  3MM7 B;  1UA0 A;  4K2X A;  2DCL A;  2O3D A;  3M32 B;  3MPU B;  3CJK B;  4DFJ A;  1PAE X;  2GVZ A;  2FYX A;  1UFK A;  4C48 A;  1HMV B;  1IBK F;  2J9D A;  2H9Z A;  2BKO A;  2CFX A;  2Y0S D;  3W2V A;  3KUG A;  5KFS A;  2ZIT A;  4FP9 A;  4JI0 F;  3QLH A;  3DRP A;  4X4O A;  3B82 A;  4P2M A;  9RUB A;  1HBO A;  4KR0 B;  5DZ7 A;  2CPZ A;  1VFJ A;  1NH7 A;  1UFW A;  3QWP A;  4OHZ A;  1TAU A;  4ZP9 A;  1Q1K A;  1YQH A;  5HP1 B;  3AAW B;  5LXR A;  2HGN A;  4PZV A;  1KSP A;  3QRR A;  4O3P A;  1W2I A;  4OX7 A;  3ZTQ A;  5DDQ C;  5K8M A;  1QAX A;  1UVK A;  1U1K A;  2OPP B;  1LEO A;  4MKV A;  3EPG A;  2DH7 A;  1NJX A;  5A8R A;  3PTW A;  3VF0 B;  4URG A;  5HMX A;  3UDE A;  1S1W A;  1MW7 A;  2FHK A;  4DPY A;  3M4X A;  3QGP A;  3EGN A;  3E51 A;  3T5H A;  5GAH I;  1U8W A;  3FKB A;  2HQC A;  1U1P A;  4J9O A;  2HMI A;  4MYT A;  1IWG A;  1RYR A;  1BC6 A;  2DGQ A;  2AT1 B;  2X1F A;  1LKZ A;  3BV8 A;  2NUH A;  6AT1 B;  3KJF B;  3R5A A;  2GNK A;  3S01 A;  1CC8 A;  3OR1 A;  2CPH A;  2C3P A;  4A8W A;  2MZR A;  3D3C J;  3M32 A;  3WC0 A;  3CJ4 A;  4F0K A;  4F3Q A;  2MY8 A;  2EPI A;  2HNY B;  4H4K C;  3GJQ B;  3ISN D;  2JZ5 A;  4F36 A;  1M5P C;  2G1D A;  3FBE A;  3AQP A;  3LPE A;  4J90 A;  4LF8 J;  2MZQ A;  4K0K F;  3HZE A;  3NS6 A;  2C2E A;  5BYS A;  1T9U A;  2RQK A;  2JDJ A;  4FS1 A;  2ZD1 A;  2DNL A;  4R0J A;  4Q43 A;  5KFN A;  2I5J A;  2W9C B;  1NKC A;  2F8E X;  1PC5 A;  1E6V B;  3CCT A;  4H4M A;  4CTA A;  2HVD A;  4KY3 A;  5F8L A;  3HF5 A;  2KZZ A;  4P6Q A;  2FTR A;  2KJV A;  3C6T B;  3GWC A;  4UZC A;  1TR0 A;  1QM9 A;  2A10 A;  3M8Z A;  1PGZ A;  4JV5 J;  2FJV A;  4X64 F;  3EVO A;  1CG2 A;  1FX4 A;  1MU2 A;  3TVY A;  4K2J A;  1T0T V;  4M5D B;  4USI A;  2GIR A;  3KHH A;  4BHQ A;  4EBC A;  4EEY A;  3TAN A;  1SJQ A;  2B3T B;  2CQG A;  2HAF A;  4ID5 B;  2NXU A;  2W2O P;  4NRT A;  4C3M A;  4CIO A;  1CQM A;  3RTV A;  2XY7 A;  1U49 A;  4I56 A;  1C2P A;  4U8V A;  1R8H A;  2WVE A;  2BXJ A;  3WX8 A;  4IH5 A;  4CT8 A;  1UMJ A;  5C7P A;  4Y0F A;  1P8G A;  4LF6 J;  1MRO A;  1IR1 A;  1RT7 A;  3MM6 A;  3UDC A;  1H6K X;  3UQS A;  5CYQ B;  2FB0 A;  2YX4 A;  3PX0 A;  5DQH A;  3I9V 9;  1VQ7 S;  4RW7 A;  3PKY A;  1C1B A;  4DLE A;  3M6V A;  4JI5 J;  1OO0 B;  4F4Z A;  1F60 B;  3MED B;  3KHG A;  5I3U A;  1FO1 A;  2IRX A;  1N32 F;  3RBZ A;  5DM7 Q;  2HHU A;  2JEI A;  2W24 A;  1D0E A;  2GJF A;  4M5J A;  5HK4 A;  3R8Y A;  1C4A A;  2VPX B;  5LMU F;  4NI2 B;  2MZ1 A;  4ZP6 A;  1JJ2 R;  3BDP A;  2R7T A;  4NCA A;  2AJ1 A;  2NCK L;  1JXV A;  2ZWP A;  4CLL A;  5ETK A;  2P5V A;  3D0G E;  4JI7 F;  4IG3 A;  3G82 B;  2E1A A;  3BQ2 A;  4X66 J;  3M1V B;  4DS5 A;  4JI8 J;  4OLP A;  4EBD A;  1DAX A;  1TL7 A;  4RNF A;  1IJE B;  2GW8 A;  3CCS S;  3KJQ B;  4C98 A;  4H4O B;  3TJ9 A;  4YDD B;  1GH8 A;  1T3O A;  3ET6 B;  3TX0 A;  8ATC B;  1NJI T;  4LBH A;  3GE9 A;  4HH1 A;  1F9F A;  1YKW A;  4DFM A;  2AEF A;  3M6W A;  2OEM A;  4B9L A;  1ZAW A;  3FBC A;  3I5C A;  3MEE A;  4YDX A;  1JLQ A;  3MD3 A;  4RL1 A;  3H42 A;  3M9N B;  1RKI A;  4X64 J;  5IV3 A;  1FRX A;  1ZZN A;  2F9D A;  4KHM A;  2ROP A;  1P1T A;  3ITH A;  3KDN A;  3BGO P;  2W7O A;  3I32 A;  4I69 A;  2FLO A;  2VJV A;  5HLF B;  5LJ5 Y;  5A6W A;  4A48 A;  4CH7 A;  1QUP A;  4Q5V A;  4QPX A;  4CLU A;  2IYG A;  1IBL F;  3LA0 A;  4B3O B;  1V6H A;  2JFK A;  3M7V A;  4CI0 B;  5C42 B;  1APS A;  4TY9 A;  2BM0 A;  2QN6 B;  4PG6 A;  4UOF A;  5CCM A;  3TQ1 A;  1I94 F;  1U0H A;  4DBQ A;  2DPI A;  4ER8 A;  1VQ9 S;  2ZC3 A;  1F1B B;  1H98 A;  2GAH C;  2HUR A;  4OZL A;  2V63 A;  2OMO A;  3IGV A;  4PAB A;  2J0Q D;  3DLJ A;  3GIL A;  3N01 A;  4NI2 A;  3G96 A;  1FRI A;  1RIS A;  4FKY A;  3C16 B;  4HHH A;  1FKA F;  1TU0 B;  4LF9 F;  4O3R A;  1YSJ A;  3ENV A;  2FJA B;  2YWW A;  4DUY J;  2K3I A;  1FT8 A;  2B7C B;  3JTN A;  1ARO P;  3NAI A;  4KH0 B;  2ZJR Q;  4YR2 A;  5J2P A;  4WZM A;  3AA9 A;  1TL7 B;  5B0A A;  1KVK A;  3W64 A;  1A6L A;  2CNN B;  2GVD B;  4DV0 F;  2V50 A;  1OJ4 A;  2RB7 A;  3MM8 B;  4M5M A;  3FVY A;  2CJY B;  2RT3 A;  3ET6 A;  4KPC A;  3LPY A;  4Y28 C;  1VC0 A;  5ETV A;  1N33 F;  5A2Q Y;  1C1C A;  2CNO B;  4TYB A;  1WOR A;  2E29 A;  4I64 A;  2FLN A;  3KMQ A;  3NGU A;  5CAB A;  1XNQ J;  3PRV A;  1UW4 A;  3BGL A;  2B9Y A;  4XTT A;  3R5C A;  4E98 A;  1HNV B;  1EKR A;  1DQA A;  2MB0 B;  4RBT A;  2YKN B;  5ETT A;  1TK8 A;  4B3O A;  5LSL A;  1MN7 A;  2ZOM A;  3CIZ A;  3ZTO A;  2IIH A;  4CM2 A;  2XMW A;  3LO3 A;  4RW6 A;  2VBW A;  1NDP A;  2DHX A;  1I51 B;  4KKO A;  1D9F A;  1BQN A;  2VIC A;  4BLG A;  2JH3 A;  2IJR A;  3MF5 A;  5AE1 A;  4A8Y A;  4MMO A;  2J6S A;  2BX6 A;  3V2U C;  1HQU A;  1TZ0 A;  5IQQ A;  4QWB A;  3PW5 A;  2IMW P;  5GAH U;  4IH7 A;  2Z2Z A;  2D3Z A;  5I4M A;  2DNK A;  3FSX A;  3FFI A;  3BGR B;  5KFR A;  4PKD B;  4F25 A;  4USJ C;  1N5Q A;  3RB3 A;  2WVC A;  4OMF G;  1KBR A;  1KQK A;  3KK2 B;  2AWZ A;  4PG4 A;  7AT1 B;  3HDS A;  3MM8 A;  4I1T A;  4NE9 C;  2IJF A;  4JI6 F;  2OTJ S;  4RW8 A;  5DG8 A;  1T9W A;  2C42 A;  4Z7Y A;  4CYU B;  4P75 A;  2YNH B;  3DLK A;  5IWA F;  4MT1 A;  3HFV A;  3BKU A;  1JJC B;  3QWU A;  4M5N A;  4CLS A;  2AYG A;  2DK2 A;  4X66 F;  1S77 D;  5A8K A;  2IA0 A;  2NXJ A;  2XZT B;  4AND A;  2B0G A;  2HS3 A;  3RW6 A;  3WIU A;  4FXD A;  2ADC A;  3OSN A;  4DR1 F;  3C2P A;  3OR2 A;  3RYL A;  1UZH A;  4ZP8 A;  1RT6 B;  2N7C A;  4AD6 A;  1ZPW X;  4CLY A;  2YNF A;  1F5B A;  1VJQ A;  3OFH A;  1KFD A;  4WIQ A;  5FLX U;  2PI5 A;  1YWX A;  2MPU A;  1VQY A;  3H5Y A;  1JXL A;  4K4S A;  1KOO A;  2BAN B;  1K47 A;  3BN7 A;  4DPT A;  2EG1 A;  3FMW A;  3QT5 A;  1OYD A;  2Q43 A;  4EFA C;  2R9L A;  4PQU B;  1OQ6 A;  2WB1 D;  1KVJ A;  2LXU A;  4HI1 A;  4K4W A;  3QIP B;  3HHK A;  2FY1 A;  3UI3 A;  2LXF A;  2OLW A;  3L7U A;  2RQ4 A;  1QSY A;  1HI1 A;  3NXZ A;  3GG0 A;  4QYR A;  3OFE A;  2YWE A;  3BGR A;  3BYR A;  3I87 A;  4DCP B;  3WC2 A;  4OX8 A;  4X4T A;  2SXL A;  1RE1 B;  4USV A;  5GVQ A;  5M2U A;  4FBU A;  1QLN A;  1D8Z A;  2V94 A;  2G2Z A;  3BPD A;  1VQ6 S;  2YWF A;  3BKT A;  3M6X A;  4YHH J;  2H5J B;  2ASJ A;  3N5F A;  1H74 A;  4BWM A;  2KT5 A;  4CYU A;  4F04 B;  4ECS A;  2UVW A;  1TTH B;  1JB0 C;  2V8D A;  5HSP A;  3R6L B;  3ETO A;  3KK3 A;  3IM8 A;  5LXY A;  2MQO A;  2DHS A;  1RLD A;  3G9C A;  3OFF A;  2XMV A;  4DQS A;  2LMI A;  1VQ5 S;  2PI4 A;  3GFZ A;  4CM0 A;  2QLJ B;  3IRW P;  3PO5 A;  4A8F A;  1VI7 A;  1RBA A;  2PMZ D;  1SH2 A;  3VVT A;  4MTP A;  1RKJ A;  3A3O B;  3OR2 B;  3MDF A;  3HFK A;  5K14 A;  3SFG A;  4CLK A;  3N4W A;  3J80 Y;  2V4R A;  1HMV A;  3BSN A;  2ZEJ A;  3LP1 A;  3CGI A;  4FKX A;  5SUH A;  3T19 A;  2J6U A;  4C8K A;  1YHQ S;  2B6A B;  1RK8 A;  2YY3 A;  4Q0B A;  2QA4 S;  3DRP B;  3U7J A;  3MR2 A;  1WI8 A;  2J6T A;  1N52 B;  2KG0 A;  5DJB A;  4Z2X A;  4K4T A;  4U95 A;  4YP3 A;  2ACM A;  1CJV A;  2EFV A;  4OYW A;  3D67 A;  3DLG A;  2X3D A;  3V81 A;  2HYI B;  1EB0 A;  1QVF R;  3K0J A;  4YB5 A;  1XR5 A;  3N6L A;  1RAB B;  3U1N A;  4JV5 F;  1OPZ A;  4HVZ A;  4N41 A;  1UL3 A;  1RAH B;  3JQM A;  4KBI A;  1YZ6 A;  5A8R B;  1XN9 A;  5FDL B;  1YBU A;  1NHK L;  3BGF A;  4B3M F;  2FZK B;  2HQF A;  3E01 A;  2FHM A;  2BKN A;  5D4N A;  1PIE A;  3T3F A;  2M8H A;  2KI2 A;  2XSJ A;  3P3D A;  1WOO A;  3V4I B;  1S0O A;  1S6Q A;  3CDW A;  2CQI A;  1RU1 A;  1KWM A;  2V2K A;  3DXS X;  2XS5 A;  2DR7 A;  1U0S A;  1PAU B;  2UU9 F;  4CO2 A;  1R6V A;  3SSS A;  3D5M A;  2JLG A;  2DXD A;  4DN0 A;  1HI8 A;  3GFX A;  3EGZ A;  2MDA A;  2QGF B;  4KGK A;  5IFM A;  2BUN A;  3CSK A;  3Q8Y A;  1AFI A;  1WC1 A;  1EQM A;  1WKJ A;  4FNI A;  5IC4 B;  1RAF B;  4CQ1 A;  2R2R A;  3MFH A;  4FS2 A;  1REV B;  4F0M A;  2OEJ A;  1N32 J;  3A8I A;  4O44 A;  1ZM2 A;  3MM5 B;  4Y2C A;  3UD5 A;  4ED0 A;  2EBG A;  3QGG A;  2JEF A;  3CCZ A;  1CJV B;  2ALZ A;  3A8K A;  2DR6 A;  3DM2 A;  3EMT A;  3D68 A;  2FJB B;  2AHO B;  4Y2I A;  2E7X A;  3CCV S;  1KVI A;  3PX6 A;  4C8N A;  2FHJ D;  4UUW A;  5E3Q A;  2ZH3 A;  2VQF F;  4LR9 A;  3HSD A;  3WZ0 A;  4RU9 A;  2H48 B;  3KJV A;  3GIM A;  4DL7 A;  1H38 A;  5KT5 A;  2JLF A;  4ECW A;  3UN2 A;  2VQE F;  2RSQ A;  2IRU A;  5AE2 A;  3K5M A;  2FVP A;  4HDG A;  3R7B B;  4U7U D;  2CPY A;  2VG7 B;  2BYC A;  3QYY A;  2R7R A;  1N5Y B;  2YX1 A;  1TL3 B;  2VC0 A;  3THT A;  3OL7 A;  1GNK A;  1HYS B;  4O3Q A;  2RRA A;  3GYX B;  2Y8Y A;  1U1O A;  2W4P A;  2LQ5 A;  2CNK B;  1NK5 A;  3UR0 A;  2HQG A;  3M30 B;  4DV5 F;  3ILL A;  5F3T A;  2A6M A;  2W2Q P;  3NBP B;  5DDO C;  4HKQ A;  2QFJ A;  1RI7 A;  2G9O A;  1VMB A;  2ZBI A;  1G4C A;  4HT7 A;  2EXU A;  1FKO B;  1GK8 A;  2HFU A;  4BC7 A;  4DPX A;  4DR6 J;  3W3S A;  5HRO A;  3NL0 A;  3MAA B;  4IKA A;  1HD0 A;  3POT B;  2R7W A;  1S0M A;  4R0E A;  4XAK A;  4ANE A;  4K4V A;  3CCU S;  2HLT A;  2OPS A;  5EWE A;  2I6W A;  2KM8 B;  1CUL B;  4DSJ A;  4LF9 J;  5IM0 B;  3DRS A;  4DL5 A;  1S10 A;  4PG7 A;  4X4N A;  1KN6 A;  1UVN A;  2Y9H A;  2KRR A;  1SCJ B;  2OKQ A;  3MPV A;  5AJ3 F;  1T03 A;  2XYG B;  5U47 A;  1LQ9 A;  3VZI A;  4X2B A;  3BSA A;  1JWW A;  2DR9 A;  4WP9 A;  4JBC A;  1NPR A;  4C7Q A;  4LT6 A;  3VZH A;  4RUC A;  3O8W A;  4ZVE A;  3BZQ A;  3US5 A;  4DPU A;  3AXK A;  2B8Q A;  3A4T A;  1F6T A;  3OTC A;  4NLD A;  2E1P A;  5KG2 A;  3KOA A;  2MST A;  4PQA A;  5EN1 A;  2HVZ A;  1KQS R;  3KG4 A;  5CYM A;  2HRU A;  3DOL B;  1C4C A;  2G1H A;  1RHM B;  3I5A A;  3R7S B;  3UD4 P;  2CDR B;  2CRL A;  2BM1 A;  1BY9 A;  1HAR A;  1HBM A;  1YJR A;  4YS2 A;  7FDR A;  4DQQ A;  4G1Q A;  1SUQ A;  2Z2Y B;  2RH3 A;  4X4S A;  2CZ9 A;  3W9J A;  1LXJ A;  2R2S A;  1S72 S;  2FVS A;  3QO9 A;  4LRD A;  3V5R A;  2KN4 A;  5C42 A;  4DWI A;  2HRY A;  3OXL A;  3UE2 A;  2UU9 J;  3M8P A;  4A47 A;  2CAJ A;  2UXD J;  1WG5 A;  3Q8V A;  4G1I A;  5HN0 A;  2NSB A;  4ILL A;  1SQE A;  2VG6 A;  1VRU A;  3G8S A;  1GMW D;  4A8M P;  4XO0 A;  1FJ7 A;  1KOH A;  2JLE A;  2XTJ P;  4TLR A;  3O1L A;  5MAO A;  1N6Q B;  1YJU A;  1K8A T;  2MJU A;  3G86 A;  3HVA A;  3UCG A;  3G6Y A;  1HHT P;  1VRT B;  1SVD A;  1Q8B A;  3QQC D;  4YHH F;  3T1H J;  5HBM B;  1RB0 A;  2NXC A;  3ZZT A;  1NK4 A;  1FKP B;  2E9R X;  4WXO A;  1RWP B;  3B78 A;  3T1A A;  4DPW A;  2W8L A;  4M5L A;  1M90 T;  3F56 A;  3Q8R B;  2NPF A;  2V2V A;  3PXG a;  1EIY B;  1C1C B;  4NEZ A;  5L9X A;  1JLB A;  2LU2 A;  1DLO B;  4KHR A;  4CLP A;  3WX4 A;  1WHV A;  2A18 A;  3QZ8 A;  1FRH A;  1U1M A;  5F8M A;  3GFH A;  1RAG B;  3VGS A;  3MEK A;  2H51 B;  3OL6 A;  2DNH A;  3SXL A;  3FNN A;  3QFH A;  1HNI A;  1TUV A;  1S1X A;  1SPB P;  2JJ4 D;  1YGY A;  2QSF A;  4DJB A;  4UQG A;  1U48 A;  3HO1 A;  1Z2L A;  4NAS A;  1RTD A;  5B08 A;  1H3D A;  2MKI A;  3KLF A;  1SIZ A;  2CPX A;  3H5S A;  4ZCI A;  2PEH A;  2XS7 A;  1MWY A;  2JHE A;  3KUH A;  5KG4 A;  5H9E J;  5E3A A;  1AYE A;  1QDU B;  3OT9 A;  1Y5I B;  2WVB A;  5ETO A;  3KLG A;  3SSQ A;  1DBD A;  1X4D A;  5DO2 A;  4ETX A;  4DV6 F;  4DLG A;  2CPE A;  2XMJ A;  3DU6 A;  3SBM A;  3KK2 A;  3DKD A;  4JI1 J;  1X4C A;  3CT9 A;  5F8H A;  3GON A;  5C5J A;  1CVJ A;  5K20 B;  2E5I A;  1LW0 B;  1N5T A;  1XMB A;  4Q2L A;  4N47 A;  2LU1 A;  1FI4 A;  3MUM P;  2M8D B;  3H2U B;  5LOQ A;  1T05 A;  5KG7 A;  1JLB B;  2MZT A;  1FX2 A;  3D66 A;  3GPA A;  3IBC B;  1S9E A;  3KLE B;  3CD6 S;  3LAK A;  2IHR 1;  2KJW A;  1S0N A;  2Y1I A;  1Q5Y A;  5IOL A;  4M8L A;  5GMK a;  9ATC B;  2X1G A;  1WEX A;  3I0S A;  4DV7 J;  3B8H A;  4A46 A;  1RTZ A;  4NLR A;  3KLV A;  1W25 A;  2F40 A;  2RDI A;  2F9J A;  1CJT B;  3SQG B;  5KFZ A;  1F2G A;  2AV5 A;  1R6Y A;  3NCQ A;  1WF1 A;  1XJW B;  2C3U A;  1VHF A;  2VPY B;  3C14 B;  4NLS A;  3UDL A;  1X5O A;  3MM6 B;  1S79 A;  2YPZ A;  3RBX A;  2DRB A;  4NXM J;  3DOM B;  1WG1 A;  5EX3 A;  3AOA A;  4JYA F;  3M05 A;  2XLJ A;  2YXL A;  1DHM A;  2XM3 A;  3K5P A;  3KLG B;  5KFP A;  4XIU A;  1N88 A;  4CO5 A;  3I9Z A;  4DCJ B;  3BEG B;  3M6U A;  3LP2 B;  4B3R F;  5I3U B;  1GAO A;  1KS2 A;  3IM9 A;  3T5L A;  1VBK A;  1K73 T;  4GKK F;  5I3Q A;  4ZVU B;  2D3O R;  1L3S A;  1E6Y A;  2WVD A;  4DX7 A;  2UV8 G;  5KFW A;  3DLB A;  3OXG A;  2DGS A;  3SDE A;  5JMN A;  4DV3 J;  2E9T A;  3OL9 A;  4ERD A;  1HLW A;  1FK9 B;  1WHX A;  2V4J A;  6FD1 A;  5T14 A;  3LP0 A;  3DDN A;  2DIT A;  3U02 A;  2P6T A;  3K5N A;  4LF4 J;  4ECV A;  4J91 A;  2DR8 A;  2O5D A;  2HK3 A;  4CLW A;  3ZC4 A;  3DLE A;  1HHQ A;  3MI7 X;  4IYQ A;  2W2N P;  2XLK A;  2DNN A;  2GIF A;  3BF4 A;  4QCL A;  2FC8 A;  1HHS A;  2E44 A;  3DYA A;  1RDR A;  2ZWO A;  3LP1 B;  1X0F A;  1ZA1 B;  1SQG A;  4KSE B;  4DR4 F;  2WZ1 A;  3C66 A;  1X4F A;  2BV3 A;  3GYG A;  2R8K A;  1T02 A;  1RHU B;  1NH8 A;  2LKZ A;  3M8S A;  4XDC A;  1SKW A;  3W8G A;  1ZZF A;  1TK0 A;  3JXO A;  4GVB A;  4QWC A;  2COL A;  1JNZ B;  5L8R C;  4DG1 B;  1IKY A;  1G6B A;  3CUN A;  2QRR A;  4OJ1 A;  3TJ8 A;  2BAB A;  3FEX B;  3UO0 A;  4C3L A;  2CQ4 A;  4KPY A;  5H1S V;  4C9D A;  2QG9 B;  5CD4 A;  3PFE A;  1UPM B;  4EO6 A;  2EFN A;  4LF5 J;  2M70 A;  3JAM U;  1GT8 A;  4QIW D;  2GMH A;  5FDL A;  2J0X A;  4DR1 J;  1FJC A;  2W25 A;  2CQD A;  4LBP A;  5SZT A;  1IKX A;  3PX4 A;  2JNJ A;  3I4H X;  4JI8 F;  3RG6 A;  2BVZ A;  2XNQ A;  3SCK E;  4PWU A;  4ITS A;  2V4J B;  4KAI A;  3K59 A;  4QYZ J;  1G1X A;  2IAJ B;  4DHV A;  2QA1 A;  4LF1 A;  1U45 A;  1SL1 A;  1JJ4 A;  4C2M A;  1VQ4 S;  3HJF A;  2BA9 A;  2LA4 A;  3AJD A;  3GB0 A;  2HMI B;  1IQT A;  2VFV A;  5J2P B;  2CWX A;  4K8R A;  3RR7 A;  3UPF A;  1YZ7 A;  4JB8 B;  4LRF A;  3Q83 A;  2DBB A;  2OUG A;  1S9G B;  2IDE A;  3H0P A;  2XC9 A;  4NXN F;  2JOQ A;  5B0F A;  2CIM A;  3A8J A;  4TU8 A;  2VON A;  3IG1 A;  1RCX B;  3M2U A;  2YKP A;  4A8O A;  1SC1 B;  2APO A;  4B9T A;  4C8O A;  4QU7 A;  2OJ3 A;  1RTJ B;  1JKH B;  2CPF A;  3FZB A;  3RJM B;  5GAG U;  2QSW A;  3CC7 S;  4OI6 A;  2V2Q A;  2ZOG A;  2EW9 A;  5J1P A;  1VQP S;  2UUC F;  2B5J A;  3Q86 A;  4QWD A;  4Q0B B;  1RAJ A;  3IS9 B;  2HBR B;  3Q2S C;  4DSL A;  3ZNU A;  1Z4U A;  1I1G A;  4IG0 B;  2RF2 B;  4KO0 B;  1UJ6 A;  2PT0 A;  2XMT A;  3M2R A;  2GHW A;  4QIG A;  2YKQ A;  2VPZ B;  2MEW A;  5E33 A;  5BXI A;  4RW4 A;  1P27 B;  5E0O A;  1KFS A;  2KFZ A;  2YH0 A;  3ONQ A;  2YKM A;  4H4M B;  4N56 A;  1RWU A;  5B0G A;  2CJK A;  3EDR B;  2IFX A;  1QSL A;  5CHC B;  4ZCK A;  2LVW A;  1NBE B;  3MGJ A;  1FEE A;  3Q89 A;  3C6T A;  4RWW A;  3ZTR A;  3QAE A;  1WC5 A;  4Y2K A;  3PR5 B;  3LF0 A;  3AOD A;  2H5I B;  3TAR A;  3QGH A;  1PYT A;  1F3F A;  1RT3 B;  4WTY A;  3D4J A;  4K0K J;  2UVV A;  5J2N B;  1MNE A;  4I7F B;  1FRJ A;  3DI6 A;  2B4P A;  3M30 A;  4WII A;  2AGP A;  1RT1 B;  1TL5 A;  4KYZ A;  4B9M A;  1MWZ A;  3JYT B;  3BN4 A;  4WK1 A;  4TQS A;  3G71 S;  2R2U A;  2ROG A;  3GG1 A;  1PYO B;  5CAA A;  1XR6 A;  4WKR A;  1FHT A;  2WB4 A;  4LSL B;  1J2V A;  3I0R A;  2PA3 A;  2RUG A;  4JUZ A;  3VAH A;  3UDV A;  4U6P A;  1JJH A;  4G6V B;  2QLX A;  4ZDN A;  4QIF A;  1LWC A;  2OML A;  5IM0 A;  3DRS B;  1GXT A;  3PO4 A;  2ZDO A;  3RW7 A;  3TYT A;  4JV2 A;  4OL8 A;  1D9A A;  3UW1 A;  2CZ4 A;  3BRE A;  4RW4 B;  3ZZY A;  4TU9 A;  4UST A;  1CJK A;  2ZZN A;  1LWE B;  3PIO Q;  1SI9 A;  2AW0 A;  1RA6 A;  1MMD A;  1B99 A;  4JI2 J;  1R8P A;  3VQS A;  3P5T L;  4FF3 A;  5ETN A;  3M8Y A;  3SCI E;  1OMS A;  3P45 B;  3CC2 S;  2DTJ A;  3GJT B;  4ZHR B;  3IBF B;  2MMY A;  3QIP A;  2XZD B;  3MMC B;  3GII A;  3D2W A;  2DRA A;  4U9R A;  4OI1 A;  1N36 J;  4MIA A;  1RTI A;  4FZV A;  3WQP A;  4YUD A;  2ZHO A;  4BS2 A;  2V8G A;  4X62 F;  2BOP A;  1H7X A;  2X51 A;  4PPZ A;  1NHV A;  1NLK L;  2BBE A;  3PFO A;  5BJR A;  1QVG R;  1AUD A;  2Y1J A;  2VJU A;  4L6V 3;  2W7A A;  4UT4 A;  2LQ8 A;  4MH8 A;  2QL9 B;  3EM1 A;  3M9M B;  1AUS L;  4BDP A;  3X3U A;  2KT3 A;  2IM0 A;  5D15 A;  5F3Z A;  1V5V A;  4C8Y A;  4F8R A;  3M8P B;  1RWM B;  1U1R A;  3FZ2 A;  1WWH A;  4QIE A;  3VTI A;  1KRP A;  1W7W A;  1WC3 A;  1XEZ A;  4I6A A;  3N5B A;  3I96 A;  2HFS A;  4NLY A;  4W4M A;  3GJR B;  1NSA A;  4QQB A;  5LSR A;  4OX9 F;  3V4M A;  2NQP A;  3R5G A;  2HHT A;  1AFJ A;  2DEJ A;  4TVA B;  3KTQ A;  3AT1 B;  1NRK A;  4RW9 B;  1N6Q A;  3THV A;  5KFF A;  1XMO F;  1QTN B;  8AT1 B;  2DD8 S;  1RHK B;  2QZ8 A;  4KGM A;  1Z1Z A;  4OYO A;  4MFB B;  1PJ6 A;  4WYW A;  4X65 J;  2NXN A;  4ZPT R;  4J9U E;  4UOG A;  1VJW A;  2F4V F;  3RAM A;  1TUG B;  3HVW A;  1ZET A;  4LF4 F;  4DX5 A;  3NOG A;  1IKV B;  2ATC B;  1HFE L;  2EK6 A;  3MMC A;  4I2Q B;  2D41 A;  3RR8 A;  5L46 A;  2MSS A;  5J2M A;  4LSN A;  1IBM F;  2ZE2 A;  1RYS A;  1WC0 A;  3W1Y C;  1ZTT A;  2FLL A;  4L76 A;  1B64 A;  3E8O A;  1GX6 A;  2UUA J;  2IY5 B;  2XMM A;  2O67 A;  2HQD A;  2CPI A;  3K8W A;  4TY8 A;  5F0W A;  3KHL A;  1CSJ A;  2HGM A;  4F0H A;  5EDW A;  1AT1 B;  2BQU A;  1S6Q B;  3BO2 A;  3TA1 A;  3OTO F;  3HVT A;  2MQ8 A;  2W4C A;  4WXW A;  2EK1 A;  2PSZ A;  4LFA J;  3W61 A;  2R8H A;  2YKN A;  4P52 A;  3MMA B;  2VUG A;  3D1O A;  2IDL A;  3TWZ A;  4DR7 F;  4OI2 A;  3G87 A;  2YBV A;  1ZPV A;  2QX0 A;  4ED6 A;  4DSK A;  1BLU A;  2G0I A;  1RAA B;  1VK3 A;  3HD2 A;  2EEY A;  5IZH A;  3LAN A;  3HXM A;  1VQ8 S;  4KKO B;  3CJS A;  4K4Y A;  3IR7 B;  3GIJ A;  2UUT A;  2VKR A;  3FQL A;  3KXD A;  4GKK J;  1LNQ A;  1YK9 A;  1GMV A;  1TKT B;  2L48 A;  1XK8 A;  1SJ3 P;  1WSR A;  3TI0 A;  1V5I B;  2AYM A;  4LR7 A;  4MFB A;  4RO0 A;  3W5X A;  4ZKA A;  5FLX Y;  4QW9 A;  3RAX A;  2RAQ A;  5KOW A;  3H40 A;  3SV3 A;  5ETQ A;  3IN5 A;  1LFP A;  3I5B A;  2HWI A;  2HK2 A;  1UVJ A;  4YY3 F;  2MQQ A;  4M5I A;  1OQ3 A;  5A0Y A;  5B09 A;  2MHE A;  2V67 A;  1R8C A;  5KFA A;  2PN6 A;  4DR5 F;  1X7V A;  3H5X A;  3OHA A;  4UY8 5;  3EUN A;  4LQ3 A;  2GQC A;  2ZH8 A;  2HG4 A;  3H98 A;  1S4E A;  3MEC B;  4K59 A;  4X4Q A;  1JK9 B;  3EYZ A;  2DVI A;  3K58 A;  2H65 B;  4OJ3 A;  2BE2 B;  4WFZ A;  5GAG I;  1XNR F;  3IAS 9;  5KFT A;  4FYX B;  3TA0 A;  4ES3 A;  1N5Y A;  1WHW A;  2DRD A;  3BQ0 A;  3D6F B;  1HQE A;  4AYB D;  3N9U C;  2W4D A;  4J9M A;  2W2P P;  3RGI A;  1N0V C;  4EZ6 A;  2BMB A;  1NB2 A;  2PA8 D;  2CJA A;  2RKI B;  3NLC A;  2I5J B;  1UWA A;  4FNH A;  2H3E B;  2CDQ A;  2BAN A;  1NXI A;  5C24 A;  1FTR A;  1PKU A;  4YME A;  1U25 A;  3CCR S;  4DFK A;  4RZR A;  2DGO A;  1HA1 A;  2DJW A;  3A12 A;  3QT8 A;  4DL3 A;  3OVB A;  1HR0 F;  2FPH X;  5KOX A;  1WNE A;  2WOM A;  3NNH A;  3KWM A;  2DGW A;  2G0C A;  2F4F A;  2DHG A;  3D3B J;  3TAQ A;  1Y4Z B;  2OEK A;  3OTE A;  3L95 X;  1VK8 A;  4M5D A;  5D0H A;  5KFB A;  1H2V Z;  1T03 B;  5DRK A;  4J9K A;  4OYB A;  4PCQ A;  3W60 A;  5IS2 A;  4OZ0 A;  4IOC Q;  1NJY A;  4DR6 F;  4NZ7 A;  4KQZ A;  3GSD A;  1CLF A;  3DCA A;  2F4V J;  4F4A A;  2L41 A;  2XGP A;  2KH9 A;  4QR1 A;  4W98 A;  3PW0 A;  1Z2Z A;  2YNI B;  2FJW A;  1U24 A;  1EQ0 A;  4P2F A;  4RW7 B;  4TXS A;  5D3G A;  5HJY A;  3AH6 A;  1IBM J;  1IWA A;  2XEX A;  3N79 A;  5AXM A;  1YI2 S;  2ATL A;  3GFY A;  4CT9 A;  1YVF A;  3AY0 A;  4BC9 A;  4DR2 J;  3EXC X;  5C25 B;  4ZMM A;  2LEC A;  3C46 A;  1HW9 A;  2UXD F;  2UXC F;  1K44 A;  2CXE A;  1SKU B;  4L72 B;  4IQX A;  1FEH A;  4L75 A;  5CCL A;  1H2U X;  2GS8 A;  2Y1L B;  2JVO A;  1LWF B;  2YQ0 A;  4OV1 A;  5KT2 A;  3V6D B;  5KFG A;  1CJU B;  5I42 B;  3K5L A;  1ZAX A;  4H4K A;  3GLJ A;  2I38 A;  2M9K A;  1WHY A;  4LVO P;  1YRT A;  2L9D A;  3PAC A;  4IG3 B;  1WG4 A;  4IDK A;  3KNA A;  4DR4 J;  1KEK A;  1RWW B;  1G2E A;  2H4Y B;  1VYA A;  4V19 X;  4OZ3 A;  3CUL A;  2MYF A;  3OD2 A;  5E2Q A;  1JLF A;  4N77 A;  3R1L A;  2UP1 A;  1QD1 A;  1R0A A;  4B9U A;  4N76 A;  1F2H A;  3BSO A;  5G0R B;  4DF4 A;  1GEH A;  1JXE A;  1XMO J;  5IT9 U;  1VRT A;  3AJ2 A;  4RBV A;  4A4J A;  3A3N B;  2OIH A;  4LQ9 A;  1X4B A;  5CXT A;  2DH8 A;  2XGQ A;  3TAP A;  2HVH A;  3NEK A;  1GFW B;  1S9G A;  1S1T A;  1Y11 A;  2AMC B;  3ZZP A;  3H90 A;  5K5M A;  3E3X A;  2AU0 A;  2CG8 A;  2W9B B;  4ILM A;  2VDH A;  2XI2 A;  1VIX A;  3ZTP A;  4ED5 A;  2ERR A;  3G8Q A;  2K1R B;  3MCS A;  4NCG A;  2JFD A;  4USH A;  3OUY A;  2DNG A;  2FJE B;  1Q5V A;  1RT5 B;  1TVR A;  1NJW A;  1SJF A;  2X3G A;  1A7G E;  4MK8 A;  2MKJ A;  2ZNY A;  4HDH A;  5EHH A;  1BD6 A;  5HL7 Q;  4Q45 A;  3SQO P;  2EC2 A;  2YWK A;  1FDN A;  2ZJQ Q;  3CCM S;  2BJD A;  5LJ3 Y;  3PHE A;  3LGH A;  2EFG A;  2JC0 A;  3PJ9 A;  3U1L A;  3VHQ A;  3W2W B;  3FEY B;  3W7B A;  3OLB A;  3KK1 B;  3FGV A;  3T6J A;  4CO1 A;  1HNX F;  1MSW D;  1U0H B;  1PYS B;  2QL5 B;  1KLN A;  5HQM A;  1UVM A;  3KYL A;  1RTH B;  1WTF A;  2YNG A;  2DIU A;  1D09 B;  4W92 B;  2R7U A;  2CQ0 A;  3L7O A;  3WHI A;  4B9V A;  2ZOF A;  2VFR A;  3CVK A;  4DQR A;  2RIL A;  1C0T B;  3AB2 B;  2W9A A;  1SIW B;  4LUB A;  1Q53 A;  4OYM A;  4RJV A;  4HHJ A;  5F41 A;  3DGV A;  5J2Q A;  3TRG A;  3BBC A;  4ZPV R;  1FF2 A;  1RT2 A;  3Q8U A;  5EGY A;  4DV0 J;  1SKS A;  3IP0 A;  3OR1 B;  1SXL A;  2ZNZ A;  2ZKT A;  2AF6 A;  1SH3 A;  3CCW A;  4O0I A;  2VOD A;  2IM2 A;  2KM8 C;  1HNV A;  2NSC A;  3CJ3 A;  4DMZ A;  5A76 A;  4X4U A;  4QIV A;  4R5P B;  1UEV A;  2VHG A;  1RHJ B;  1F9E B;  4NA2 A;  2K1R A;  3BGU A;  2VB6 A;  3CED A;  4CNZ A;  1IQZ A;  4CH1 A;  4GKJ F;  2IC3 B;  1BE4 A;  1GQE A;  1IR0 A;  2AYE A;  2OPR A;  3LH2 S;  3OVA A;  5IC6 B;  3U1M A;  1RZM A;  2BRL A;  3NP5 A;  3AD8 C;  3OSP A;  1YJT A;  2GIQ A;  1UAW A;  5HO4 A;  1KKH A;  2HHP A;  1NKE A;  4FVC A;  4XPE A;  3NMR A;  2KFN A;  2Z56 B;  2IBK A;  2ZUA A;  4IR1 A;  3L3C A;  2A1B A;  4OHY A;  2BEF A;  1X4H A;  3FDS A;  1QTM A;  2C2N A;  1TKX B;  3VGU A;  4ALZ A;  2M88 A;  2MQL A;  1VRQ C;  4ZJO A;  3TZZ A;  4F26 A;  1K0T A;  4OV6 A;  1N33 J;  4PXE A;  5KT7 A;  3C3L A;  2MKC A;  2KXH A;  2N4D A;  1C0T A;  3BDE A;  4IFV A;  3SSR A;  2UUC J;  2EG2 A;  3ILI A;  2CA9 A;  2NXE A;  3FFI B;  2J0W A;  2Q6B A;  2WVF A;  3U27 A;  2R8G A;  3WDO A;  3IC1 A;  3MCM A;  5KFE A;  4LSZ B;  4OFZ A;  3BSC A;  3GV5 B;  5GAE I;  2V6A A;  3CCJ S;  3FQK A;  4DZD A;  3SZ2 A;  1J5O B;  4K4U A;  3SDE B;  4FF2 A;  2DHH A;  3DOL A;  3DHX A;  4RNO A;  1Q8K A;  3ZXW A;  1EKS A;  4LFA F;  2VOO A;  5D8H B;  1HBM B;  5T7L B;  2H54 B;  1SV5 A;  1Y9O A;  5D78 A;  2IPO B;  4K7Q A;  4G1P A;  4CO4 A;  1EHW A;  4PEO A;  2IC3 A;  3LGM A;  5A8K B;  3MCO A;  2XNR A;  4PPD A;  1RWO B;  4KGV B;  3DLE B;  1NPP A;  1XIQ A;  2HS4 A;  3H20 A;  1WEY A;  4UZB A;  1NK0 A;  5MLC V;  2DR5 A;  5GMD A;  3GR0 A;  4JV0 A;  2F3J A;  2LP4 A;  3D1Q A;  3FC9 A;  2Q6C A;  1M5S A;  5HAO A;  5K8P A;  2C2R A;  1SJ4 P;  3HI9 A;  1V3Z A;  3R3T A;  4RR5 A;  5KG5 A;  2HVI A;  2HZV A;  4LRC A;  1X5T A;  2V9W A;  3MCN A;  4MJK A;  2X1B A;  5CA5 A;  1VQN S;  2IYI A;  3ZO7 A;  3R7N B;  4DFP A;  2AP6 A;  1BMQ B;  5D77 A;  4KFB A;  1FJE B;  1YX2 A;  1RXO B;  1BQM A;  3MUT P;  1S6P B;  3R5B A;  4LSN B;  3OPK A;  3PZP A;  4OX9 J;  4RPF A;  2I0X A;  3KFW X;  3KG1 A;  2HND A;  3ZZO A;  5IV4 A;  1J5O A;  1QJH A;  4JI3 F;  4I67 A;  5J1E A;  3PR4 A;  2MGZ B;  3CPW R;  2ASL A;  3KLH A;  2ASY A;  2Y0B B;  3W9I A;  4NRU A;  1KC8 T;  2JL9 A;  2YX7 A;  4ICL B;  4R8U A;  3QFW A;  4LRB A;  4XK8 C;  4FXW A;  4WP3 A;  3MM9 B;  3VAM A;  1ELO A;  1CEZ A;  3NKY A;  3IRX B;  4OYX A;  1AZS A;  3HSJ A;  4V1A k;  4I4B A;  2M5Y A;  5DLF A;  4IO1 A;  2AX0 A;  2R4F A;  5H9F K;  3M2U B;  1IM6 A;  2F8M A;  3R97 A;  1EAR A;  4NLV A;  3ZFV A;  2IRY A;  4PXC A;  1FRM A;  3ILJ A;  4B17 A;  2OPQ A;  4DU7 A;  2QJ3 A;  2CWK A;  2VBZ A;  2CAD A;  2C3O A;  3FJ2 A;  4C0H A;  3HVR A;  3VAG A;  1N34 J;  1P1L A;  2HIY A;  2F5G A;  4PXB A;  1TMM A;  4S0M A;  5AXN A;  4AL6 A;  1RWX B;  4LF8 F;  1L3T A;  2ZZM A;  2HPU A;  3J80 U;  1NK6 A;  4FVM A;  3CXC R;  4NLP A;  4NA1 A;  3M9O B;  5LMU J;  1KLM A;  4UTG A;  3DLL Q;  4PYD A;  3DRX A;  2KYZ A;  4WJB A;  1TKZ A;  1CC7 A;  3D28 A;  4HTJ A;  1Q86 T;  3JQJ A;  2QO3 A;  2OPP A;  3MAH A;  2ZM6 J;  4TYA A;  4DSI A;  2CJX B;  2R8I A;  2M2B A;  4MKY A;  1UP1 A;  2HBQ B;  4ZVT B;  5KFQ A;  2RUS A;  4WU2 A;  1Q0N A;  2PGC A;  3MMB A;  3T9Z A;  4ICL A;  2MHN A;  3O5T B;  2OD4 A;  5RUB A;  1X9S A;  4YY3 J;  1J5E J;  1U2R A;  3CD5 A;  4DDF A;  3R6G B;  1XMQ F;  4JI3 J;  5L1J A;  1HPZ B;  3QAT A;  2C22 A;  1TK5 A;  4UY8 T;  1TP7 A;  4O4R A;  1BQN B;  3TX8 A;  3CME S;  4RWX A;  2XWX A;  4DX8 H;  4PG8 A;  5A8W B;  2JEJ A;  3KJN B;  1M5H A;  3TOQ A;  3PG9 A;  4MK9 A;  1HQU B;  3C15 A;  4UF4 A;  1RA7 A;  3EVM A;  5B7W A;  1FES A;  1FVS A;  1WEL A;  2GC8 A;  3FRY A;  3OW2 R;  1HI0 P;  2I1R A;  1ZH5 A;  4JI2 F;  3HCX A;  2B4O A;  2HBZ B;  1G7C B;  3KJV B;  1FD8 A;  1S59 A;  1O5J A;  2LEB A;  1LOU A;  1L5U A;  3R5D A;  2G4B A;  3DRR A;  1JLG A;  1VLY A;  2VDI A;  2AZ3 A;  2XSF A;  1VS3 A;  1S9F A;  5F8N A;  4RW8 B;  4GC7 A;  3B54 A;  1OIA A;  1LWE A;  2VD3 A;  4WFA Q;  1T9X A;  3M8W A;  4ZVO B;  2PC6 A;  3TUJ C;  2CVE A;  3HD1 A;  1OY6 A;  1U6Z A;  3MPY A;  4HEA 9;  5LSO A;  2J8A A;  3MMB B;  3DFE A;  2FJX A;  4FPI A;  5DM6 Q;  4ZVP B;  3W65 A;  1ZTW A;  2QA2 A;  2RJZ A;  3DXB A;  5KFJ A;  3DOK A;  1XNQ F;  4OJH A;  3POT A;  1HPZ A;  2JSX A;  2WW4 A;  4OHV A;  1K1S A;  3J7Z 5;  4DS4 A;  4NL5 A;  3CJ2 A;  4QPT A;  1G3O A;  4JI1 F;  2HWT A;  2Z0G A;  4IRC A;  2LEP A;  4CTA B;  1CUL A;  4P74 A;  5LT5 A;  1ZYQ A;  1UWB B;  3ZZ0 A;  4N7T A;  4LIW A;  2B4U A;  3TVZ A;  2B7B B;  5HJX A;  1HWI A;  2J9C A;  3L7P A;  2KHC A;  2HFO A;  4NYP A;  1KP6 A;  2RDD A;  2A0F B;  3MEG A;  2CQP A;  3UNY A;  1QAY A;  2RHS B;  1MU2 B;  2GQ2 A;  2R7S A;  2LQ9 A;  2FUG 9;  1HWK A;  1SL2 A;  4KH1 B;  1IN0 A;  4PWW A;  4TQR A;  3KKF A;  1FVQ A;  1EAY C;  1UTA A;  3IWL A;  3DC2 A;  4FYY B;  2HFZ A;  4H54 A;  2E7W A;  3UVJ B;  3VWS A;  4DU8 A;  1N34 F;  3OBI A;  4QWE A;  3HLU A;  1JQG A;  2F63 A;  3BYP A;  2MLX A;  1F3V A;  4NLQ A;  1DTQ A;  1S1T B;  3ZZR A;  5LMN F;  2J76 E;  2Y3Y A;  4HH0 A;  2W01 A;  1SC6 A;  2GHP A;  4I2P A;  5CYQ A;  1WKL A;  2GGP B;  2IVF B;  2KHD A;  3B4D A;  2WBM A;  3OTO J;  2ZKU A;  4M1K A;  4GRS A;  5CZV A;  4H4O A;  1N8R T;  2ACY A;  2ZE2 B;  3IXQ A;  1HR0 J;  1RBL A;  1RQ0 A;  4OQJ A;  3J7Y U;  3AXM A;  4L73 A;  1HBU A;  5HI7 A;  1B70 B;  4C6A A;  1FCA A;  2LYV A;  3H5U A;  2BAC A;  2XMA A;  2VU5 A;  3MR7 A;  3CJT A;  1QAI A;  1NAQ A;  3ITH B;  5FD1 A;  5HLF A;  2YWH A;  2KO1 A;  2OFG X;  4ECX A;  4MIB A;  1TUW A;  2AYB A;  3MPD A;  2RF2 A;  4KO0 A;  4Y2M A;  4J9P A;  2KYX A;  1R0C B;  1MLA A;  4JOU A;  1YIT S;  2GJ2 A;  3MFI A;  4NML A;  3RB6 A;  3UCU P;  1S5Z A;  3PYE A;  2VG6 B;  4ZPW R;  4HYK A;  2DNY A;  2XCP A;  1F0X A;  2ZUG A;  1FXR A;  5DGB A;  3CW2 C;  3HP6 A;  4ED1 A;  1M1K T;  2GV1 A;  1FDA A;  2XSJ B;  3V4I A;  2A2C A;  1PBU A;  2WW8 A;  3RRK A;  7FD1 A;  1VQM S;  2VC1 A;  3PNI A;  4IQM A;  3L4B C;  1N0U A;  2E1R A;  2WCX A;  2X7I A;  2PMH A;  1XQI A;  4P72 A;  1YIJ S;  2HBY B;  1WOS A;  1KQF B;  1NK8 A;  1Y0H A;  3PEJ A;  2MKK A;  5IXU A;  4IUF A;  3Q0A A;  3X1L B;  2LXI A;  2Y8W A;  1DJ0 A;  2GGP A;  4D3H A;  3DN9 A;  4R5P A;  2DKO B;  2VPW B;  2ZBR A;  1IJF B;  1GXU A;  3I4P A;  2MLY A;  1TL1 B;  5FII A;  4DR3 J;  2CZV C;  1S1X B;  4USK A;  1JLE A;  4NMX A;  3HMJ G;  2OPR B;  3L9Z A;  4K50 A;  5IWA J;  1VDH A;  3BO4 A;  2NPI A;  2XBP A;  4ZCL A;  3GP9 A;  3MM7 A;  4F4Y A;  4OYP A;  3CWJ A;  1FFS B;  1HNI B;  2E5J A;  1T95 A;  2QMW A;  3DGP B;  2XO6 A;  2HHQ A;  3IAM 9;  3PYG A;  3FRZ A;  3R9L A;  3KHR A;  4OX6 A;  3VAL A;  3S6E A;  1DQ9 A;  1H2T Z;  3OFG A;  1PJ5 A;  2MQN A;  3PY8 A;  4Q8F A;  3KLF B;  1RAI B;  2NZ4 A;  5KFI A;  2F7V A;  2KVQ E;  3RB0 A;  2U2F A;  1RJJ A;  3QID A;  4LBI A;  4LR8 A;  3N28 A;  4FYV B;  2E1C A;  4NCB A;  4RW6 B;  2GX8 A;  3PV8 A;  2QEX S;  2OD6 A;  4N8N A;  3BBB A;  2AEM A;  4QW8 A;  4BWJ A;  3J81 j;  2OGU A;  3CJ0 A;  1XR7 A;  2WK4 A;  1S4F A;  3NOC A;  1RAO A;  2XHW A;  3W8P A;  3JTO A;  2KDO A;  1VIS A;  3CDU A;  3CJQ A;  4C8M A;  1N48 A;  2RHQ B;  2DGU A;  2HHW A;  2KXN B;  1DY3 A;  1RWN B;  1CBK A;  5ETR A;  3TO8 A;  3KLE A;  4DV3 F;  3NS7 B;  3T1Y F;  4URQ U;  3IWN C;  4PAA A;  1B0P A;  4MYU A;  2HQI A;  3G4S S;  1T9V A;  2EKY A;  1S49 A;  3H59 A;  2PD1 A;  2FZG B;  2WSE C;  1O51 A;  1V3R A;  3A8E A;  3JS9 A;  1TL1 A;  1WOP A;  3QPI A;  1SV5 B;  3T9N A;  4D3G A;  2BRK A;  2WON A;  4GVL A;  2MKH A;  1JLE B;  4UQT A;  2YQ1 A;  1WEZ A;  2ZH9 A;  1CJT A;  1Q4R A;  3KLI B;  3SQG A;  2C2O B;  2FY8 A;  1NK7 A;  4ZVR B;  2C2M B;  2N7Y A;  2QMU B;  1T94 A;  1Y3J A;  1FNM A;  3C14 A;  5K8O A;  2R7Q A;  3OTD A;  2Y1R I;  1U6F A;  5KFV A;  3N6N A;  3ZNJ 1;  2YNI A;  1FRL A;  4QU6 A;  2VZ9 A;  3W62 A;  1U02 A;  2CJ9 A;  1QE1 A;  1NU4 A;  2KRB A;  4KB7 A;  4FN5 A;  5F9L A;  2NR0 A;  1WJ9 A;  3HUL A;  4KGX B;  1HYS A;  3PM9 A;  1TAQ A;  3IBW A;  2ZH2 A;  3VAI A;  1OSC A;  3K7R A;  5HQL A;  1B0V A;  1WF2 A;  5JUM A;  1DUR A;  4B02 A;  1LWF A;  4WFN Q;  1XWL A;  4PUO B;  4WYL A;  3N6M A;  4NLU A;  3LP2 A;  3BS9 A;  4AT1 B;  2IA6 A;  1S99 A;  2ZVS A;  4W90 B;  1XC9 A;  2HFV A;  1FD2 A;  3NRB A;  4PXD A;  1RWV B;  2OI2 A;  4OYZ A;  4USM A;  3EX7 B;  2L08 A;  2VL1 A;  3FMB A;  1S6U A;  5ITH A;  3MR6 A;  3PW2 A;  2VH7 A;  1FK9 A;  1JLF B;  3T5K A;  3OHB A;  3A3P B;  2DPJ A;  2FVQ A;  1H0H B;  4FBT A;  4ID5 A;  4G1Q B;  3D6M B;  3F73 A;  2E5H A;  1X31 C;  1A0O B;  2HIQ A;  1U1L A;  2YVS A;  3KG0 A;  5BR8 F;  3MUV P;  1U4B A;  3R27 A;  4LRE A;  3T41 A;  3MXH P;  1SC4 B;  4YB6 A;  2DIS A;  5F8I A;  4DV2 J;  1O0P A;  1NO8 A;  3CDE A;  2OO4 A;  3VR1 A;  2DO4 A;  4RLE A;  5KT4 A;  3LW5 C;  1Q81 T;  4NCG B;  3PIP Q;  3OUY B;  2HSE B;  2OPQ B;  1U1N A;  4WZQ A;  5K14 B;  2FD2 A;  3M2V B;  3NGD A;  3D1H A;  2XG8 A;  3FSY A;  2D3U A;  4P9S A;  1Q16 B;  5KFX A;  3K8V A;  3I55 S;  2FIU A;  2LCW A;  1T9Y A;  4ZVS B;  5HMW A;  4GMK A;  4ZPB A;  3R2C J;  3TJA A;  4DUT A;  1IKX B;  4DXL A;  4USU A;  4E2F B;  2JEG A;  3UD3 P;  1WKK A;  2B9W A;  2EKN A;  1LW2 A;  2RRB A;  4C97 A;  2CKW A;  1PIL A;  2NUU G;  3VAF A;  2NRE A;  3M8Q B;  1IKW B;  1M0S A;  2VFS A;  5A0Y B;  1RTH A;  2D1C A;  3FUY A;  2FHJ A;  3PYD A;  3J7Y I;  3SMZ A;  1KHW A;  3DMJ B;  2RD5 C;  3C6U A;  4HR2 A;  3H2V E;  4C0B A;  2AD9 A;  4JI7 J;  2POK A;  2C3M A;  3EVW A;  1YJ7 A;  4LFC F;  2K06 A;  2MLZ A;  5CQG A;  2VFT A;  2EWH A;  4UOC A;  3CJK A;  3GV7 B;  4ZPC A;  3J7Z T;  4C4W A;  1VCT A;  4DSF A;  4NA3 A;  3WBZ A;  2V9K A;  5E7O B;  1UFL A;  4LVN P;  2I2Y A;  1JMT A;  2D9P A;  2GHV C;  4OI4 A;  3RRH A;  2QL7 B;  3TZY A;  1KNZ A;  4F2S A;  3IS9 A;  3QLH B;  4YOE A;  2BJ9 A;  3DLG B;  1U8S A;  3GQC A;  4ZLJ A;  2P8I A;  1JKH A;  4Z37 A;  1NKB A;  2FHO B;  1C0U A;  1VBX A;  5DLG A;  5KFM A;  1RT4 A;  2C2Z B;  2DHA A;  2G2Y A;  3CB4 A;  5HQ8 A;  4DV6 J;  2QLW A;  2OSR A;  3ZZU A;  3NGR A;  2J7K A;  3M2R B;  1ZS6 A;  4NLG A;  1PO6 A;  3QRQ A;  1LW2 B;  3RUB L;  2GFF A;  1XTZ A;  1WUU A;  1W2B R;  3PKM A;  1LW0 A;  4F2R A;  3TUP A;  4DOZ A;  1R8A A;  3PRB A;  4O0N A;  3G6X A;  5LMN J;  3K5O A;  3TUZ C;  4DV7 F;  1TKX A;  1A9N B;  5H9F J;  4NPO A;  5J2N A;  5AXL A;  5KT3 A;  1FWL A;  2DY1 A;  3DMJ A;  3D6H B;  3HHL D;  4EMD A;  1RT1 A;  2ZHA A;  3NCP A;  1OPI A;  2OTL S;  3AQO A;  4F4K A;  2ROE A;  3BBF A;  1QY7 A;  3J81 Y;  5KFO A;  5HVF A;  4Y3C A;  4ZCM A;  4RU2 A;  4P71 A;  4NXM F;  2AJ2 A;  4ZLN A;  5JJB A;  2LQJ A;  1NPK A;  4URS A;  3AOC A;  3C8Y A;  3G8T A;  3V6H A;  3MHY A;  2ZH4 A;  2AGO A;  1KR4 A;  4NYO A;  3O3L A;  1LWC B;  2IM3 A;  5F0U A;  1RAC B;  1UCN A;  1UWB A;  2HNY A;  2ZD1 B;  2RQC A;  2W9C A;  2HW3 A;  4DCO B;  3SCJ E;  2HNZ B;  2AGQ A;  2I8E A;  3SCL E;  3G6V A;  1S97 A;  2UUB J;  5K8N A;  1CJU A;  5I42 A;  4B3M J;  5F8G A;  1EJ7 L;  2U1A A;  3MEG B;  3MAA A;  3S7R A;  4ZN1 A;  5A2Q U;  2MKS A;  4C8Z A;  4QJV A;  3BR9 A;  1S12 A;  3MD1 A;  4IDK B;  4I68 A;  4AUK A;  2M4M A;  4HLB A;  4EO8 A;  2DGX A;  4MKA A;  2JC1 A;  5D4P A;  1CS4 B;  1L3V A;  3OL8 A;  1VC5 A;  5KFY A;  4JI4 F;  1Y7P A;  2EFQ A;  2HKE A;  2BZ2 A;  2CQ1 A;  3SI8 A;  4KFB B;  1DTQ B;  2QT7 A;  4ZHR A;  3FEZ A;  2I9S A;  2K2P A;  4AE5 A;  3Q8P B;  5L39 A;  1S6P A;  3LWM A;  4DQI A;  2AJ0 A;  2LFV A;  3P4U B;  4RNH A;  5BYR A;  2D7S A;  4ECU A;  3GIK A;  3HKW A;  1NSP A;  3A13 A;  2UUA F;  2GCF A;  1FKO A;  4NLW A;  3HJV A;  1NCL A;  2GMJ A;  2QE5 A;  4ZVG A;  4P2X A;  4BBY A;  4ZIT A;  4A8Q A;  1U1Q A;  1JX4 A;  2CQH A;  5ADZ A;  2L9N A;  4DL6 A;  2Z4P A;  3PW7 A;  1TVR B;  3I6P A;  1UET A;  2MGZ A;  2ZZT A;  2YH1 A;  2Q3P A;  4EWT A;  2RQM A;  1KHV A;  2VF3 A;  2GO9 A;  1VR6 A;  1UEK A;  2PFD A;  2BJ8 A;  1N5S A;  4LRA A;  4GVB B;  4R8U B;  2DO0 A;  2KZM A;  1SUQ B;  2V0N A;  1IKY B;  4OZN A;  2B8P A;  2J7W A;  4RNN A;  3AD7 C;  4DZ6 A;  2DXF A;  2YNF B;  1QUV A;  1N5V A;  3K17 A;  3KK1 A;  2FGO A;  1S48 A;  4I0W A;  1VQK S;  2RE1 A;  1S1V A;  3VQT A;  1D3W A;  5IT0 A;  1X4G A;  4UOH A;  4ATN A;  1X4A A;  4FPR A;  3FCV A;  4WK3 A;  5KFC A;  2MKY A;  5B0D A;  5GAE U;  4PQU A;  2DNQ A;  2HLU A;  4RW9 A;  4AFF A;  4X4R A;  3HSZ A;  2MY7 A;  2VFU A;  2XY6 A;  2K7K A;  3ISN C;  1CS4 A;  2O1P A;  2HWH A;  2HHV A;  4QOT A;  1ITP A;  5KG1 A;  2P9E A;  4ZS6 A;  1PG5 B;  1I5O B;  2ZH1 A;  2IJN A;  2HAI A;  3EWG A;  3BB5 A;  1RT2 B;  3MWB A;  3DNC A;  2DEI A;  2FC9 A;  2MZS A;  3BR8 A;  3HX9 A;  5DQI A;  3CCL S;  1SH0 A;  4DR5 J;  4ED3 A;  1QSS A;  1Q8L A;  3LAL A;  4FF4 A;  2BJE A;  3IG1 B;  3QO9 B;  3MR3 A;  3VAK A;  4OZJ A;  1SB6 A;  2OH2 A;  3MMA A;  4WFB Q;  3MOZ A;  4WPA A;  3ZTS A;  3ULH A;  4CCH A;  3PRD A;  2RU9 A;  2Z58 B;  2BE9 B;  3A1Y G;  3QJP A;  2XUL A;  1NB7 A;  3V6J A;  1M1G A;  2OSQ A;  3F0N A;  2V69 A;  4P73 A;  1AA1 B;  4DR7 J;  4OJG A;  1FRK A;  5C2C A;  1FE0 A;  4AQY J;  1TKT A;  2VQF J;  1N36 F;  1U2F A;  3KMS A;  3EJM A;  2ILY A;  3ILO A;  4F02 A;  3L09 A;  3FCW A;  2VQE J;  1V3S A;  1JIH A;  4DL4 A;  2GZO A;  3QZ7 A;  2FVC A;  3QT6 A;  1FNX H;  2GVD A;  1RGV A;  3C16 A;  2XCA A;  4JYA J;  1AW0 A;  3TR5 A;  2DNP A;  4DX6 A;  4ES2 A;  1X9M A;  1TV6 B;  1RHR B;  4LF5 F;  1U47 A;  4DUZ F;  1HNW J;  2CVI A;  2NLW A; 
#chains in the Genus database with same CATH homology
 1BMQ B;  2QLB B;  1SC1 B;  1NME B;  3RJM B;  1QDU B;  2H48 B;  2HBR B;  1GFW B;  2XYH B;  3R7B B;  4DCO B;  2XZT B;  5K20 B;  3EDR B;  2Y0B B;  2CNK B;  1I3O B;  3IBC B;  1RWV B;  2H5I B;  2QL5 B;  1RHQ B;  3GJS B;  2H4W B;  3D6M B;  3EDQ B;  3QNW B;  1ICE B;  3P4U B;  3KJQ B;  1SC4 B;  1IBC B;  4DCP B;  1RWX B;  1PYO B;  1RE1 B;  2H65 B;  2XYG B;  2H5J B;  4DCJ B;  3R6L B;  2C2K B;  3D6F B;  4ZVS B;  3SIP B;  1RHJ B;  1F9E B;  4ZVU B;  2CJX B;  2CNL B;  2HBQ B;  2QLJ B;  2XYP B;  2C1E B;  2QLF B;  4ZVT B;  3R7S B;  2HBY B;  1RHM B;  5IC6 B;  2CDR B;  3P45 B;  3GJT B;  2P2C B;  2DKO B;  3R6G B;  3IBF B;  2XZD B;  1SC3 B;  3KJN B;  2CNN B;  3KJF B;  1RHU B;  2CJY B;  2QL9 B;  2QL7 B;  3R5J B;  2CNO B;  2HBZ B;  4ZVQ B;  1RWM B;  4LSZ B;  3GJQ B;  1RWP B;  1PAU B;  3GJR B;  4ZVO B;  2C2Z B;  2H54 B;  3R7N B;  1RWN B;  1QTN B;  1RWO B;  2Y1L B;  3NS7 B;  1RHK B;  1I51 B;  2FQQ B;  4ZVP B;  5IC4 B;  2H51 B;  1RWW B;  2H4Y B;  3D6H B;  4JB8 B;  1RHR B;  2C2O B;  1RWK B;  4ZVR B;  2C2M B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...