2H5IB

Crystal structure of caspase-3 with inhibitor ac-devd-cho
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
94
structure length
94
Chain Sequence
HKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and kinetic analysis of caspase-3 reveals role for s5 binding site in substrate recognition
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords caspase-3, p17 subunit
total genus 18
structure length 94
sequence length 94
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2006-05-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 2h5iB00
2P2CB 4DCJB 1RE1B 3IBFB 2XYPB 1I3OB 2CDRB 1RWXB 2QLBB 3D6HB 2H5IB 1GFWB 2XYGB 4ZVOB 2CJXB 3R7BB 1RWMB 3GJTB 2HBRB 4ZVQB 4ZVPB 3QNWB 2DKOB 2XZDB 3GJSB 3KJNB 1F9EB 4LSZB 3R6LB 2CNLB 2Y1LB 4DCOB 4JB8B 1RWVB 1RHQB 3EDRB 2C1EB 2H5JB 2CNKB 2H51B 4DCPB 3R5JB 2QLFB 3P45B 1RWPB 2H65B 5K20B 2CNNB 3D6MB 2C2MB 3EDQB 2XYHB 2FQQB 5IC6B 4ZVSB 3R6GB 5IC4B 3GJRB 1PYOB 1RHMB 3SIPB 1RHKB 1SC3B 2H48B 2XZTB 3GJQB 1PAUB 3D6FB 2HBZB 2C2KB 3P4UB 3NS7B 4ZVTB 3RJMB 2CNOB 2Y0BB 1BMQB 3R7NB 2C2OB 1SC4B 1RWOB 1RWKB 1SC1B 2H4WB 1RWNB 2QL5B 2HBYB 4ZVRB 3KJQB 1RHRB 1QDUB 1RHJB 2HBQB 1I51B 2QL7B 3R7SB 2H54B 2C2ZB 1NMEB 2QLJB 3IBCB 1ICEB 1RWWB 1RHUB 2H4YB 2QL9B 1QTNB 4ZVUB 3KJFB 2CJYB 1IBCB
chains in the Genus database with same CATH superfamily
3MPUB 4CM2A 3A3PB 3CMAS 4DF8A 4L73A 3PIOQ 2YWWA 4HH0A 4RW4B 2IC3B 5A8WB 1NB7A 1N5YA 3PEJA 1HMVB 5H9FJ 4DPUA 2FLNA 3N79A 3FEYB 5A8RA 4EZ6A 3J81j 4A8OA 2QE5A 2E5GA 4KY3A 4CLPA 2RVJA 1JLAA 3L4BC 3CF5Q 1VHFA 1R8HA 3DMJA 1QAIA 1IBMF 1WHXA 3D6HB 5C2CA 4PWUA 2I8EA 2NXEA 4RW8B 1KBRA 2POKA 4A46A 1VOMA 1HI8A 4J9NA 1RZMA 4ZLLA 2VBZA 2WAQD 3N28A 5AXLA 4X4NA 3T9ZA 4QYZJ 3DFEA 3TJ8A 3CVKA 4CO4A 3OTOJ 1TMJA 2HBRB 2RKIA 2VU5A 3L7OA 3UCGA 2D3O1 1YSJA 1IBKF 3UVJA 4HACA 2Y1JA 1S1TB 4QWEA 3BDEA 1WORA 3NEKA 3VHQA 3LP0A 2V67A 5HQLA 3M2UA 1YHQS 5ETMA 3VTIA 2WCXA 2KRRA 1RJJA 4OZLA 4OYOA 3F73A 1VQ5S 2ZUAA 4KGKA 5B7WA 4Q45A 2LXFA 3H8YA 4C98A 3LWLA 4C6AA 4FXVA 3DRSB 1EJ7L 1DQ8A 4FYDA 2CQCA 2XEXA 5T7LA 3J7Z5 1LW2A 1U7LA 2AGQA 4O3PA 4W92B 5E3QA 1U45A 2CNKB 4BCAA 2XSJA 5T41A 2HVZA 3AJDA 3EZ5A 1XMQF 1RAOA 1HFEL 2MYFA 2NXJA 1M0SA 4K4YA 2C2MB 4G6VB 4Q2LA 4DV0J 4W4MA 3HHLD 4MAKA 2RHSB 4H54A 3BN4A 4NLRA 4AQYJ 2BKNA 1ZTTA 2UUAJ 2LDIA 1HI0P 2GC8A 3Q8UA 3PR4A 1HR0J 3KTQA 3KG4A 2KN4A 1HQEA 2QG9B 4TKTA 2IM2A 2C2DA 3U27A 4ZLPA 2BACA 3T5LA 1O6XA 5KTQA 3PIPQ 1FXDA 1IR2A 4TXSA 1NAQA 5KFKA 3OFFA 2KH9A 4DQQA 2HMIB 3SV4A 2MKSA 5HMXA 1CS4B 3VGSA 4NWBA 4NYZA 1NLKL 4I68A 5FDLB 5K5MA 2GQQA 2MHEA 5IOLA 4ED0A 1CVJA 3M7VA 3O44A 1Q8IA 1S9GB 1WEXA 1OJ4A 1P1TA 4DSIA 4OIXA 3DLJA 3PX4A 4OV1A 2BE2A 2YVSA 4DR4F 2CIMA 1RWKB 1CJTB 1SC1B 2A10A 2KXFA 2J9EA 1IM6A 1DLOB 4NCGB 4ECVA 3MURP 2PC6A 2ZVIA 1N5VA 2NYIA 3U7JA 1FRLA 2WVFA 4CO2A 3AODA 2IFXA 2JFKA 2DVIA 4IRKA 4B3RJ 1EKSA 4NA2A 4RL1A 4TNOA 1FX2A 1ZOTA 5K14A 5DG8A 1M1GA 2OMLA 3O3LA 1WG4A 3DDIA 1VK3A 4C3MA 3DI6A 2PGCA 3I5AA 4TVAB 1NMEB 5BJRA 3A12A 1SXLA 4FVCA 4DSFA 1K73T 1WF2A 4WTYA 2QEXS 4PG6A 1G6BA 2BJEA 4QIGA 3SXLA 4J9UE 4M5MA 3TJAA 2OPSB 1NJWA 2NREA 4CO5A 2FDNA 4JI6F 2V63A 1UP1A 4IO1A 4AFFA 4RJVA 4C3KA 3BSNA 1TFYA 3MZIA 1SBRA 2AF6A 2H4YB 2K1RB 3HT0A 4E8UA 1LXNA 4I4BA 4KR0B 1TVRB 2BDPA 4NPOA 2OPRA 4JYAF 2XS5A 5KFQA 5D0RA 2AJ4A 1AA1B 3CMQA 3QJLA 1U1NA 5IWAJ 3M8QB 5ETRA 2LEPA 1T3NA 5CYMB 2ZITA 1FRMA 2B6AA 3OHBA 5I42A 4PEOA 2VJUA 1FWLA 1HW8A 1P1LA 4DR5F 4DQSA 2HQGA 3GONA 2BM0A 3H4BA 5DM7Q 3BGFA 3OTBA 1FJEB 3NAHA 3DYAB 1ITPA 3GG1A 2WONB 1DJ0A 4BDPA 4WYWA 4RUCA 1A7GE 4ZPWR 1C0TB 3BEGB 5RUBA 4OX7A 2VQFJ 3VAKA 3I9ZA 4OHZA 4ZPVR 1IR1A 1H0HB 1K1QA 3C6TB 2RNEA 2BM1A 1T11A 2JL9A 2MQMA 2DYAA 3N0VA 4C0OC 2ZWOA 3VQSA 3A3OB 4KIAA 1Q82T 2V8HA 3T6BA 3QGGA 4NMXA 4QIEA 2MGZA 2RF2B 1ZBTA 2F8EX 3ET6B 5LMNJ 1U1QA 2NR0A 1RT3A 5GAEU 2BXJA 4QWBA 3M2UB 2EKNA 3TNVA 3MEEB 2WW4A 2GHVC 3JS9A 1PC4A 2MTLA 1JLGB 4B3SF 3NMRA 2ZEJA 2E7XA 2EI5A 2JDJA 2CYYA 2LU2A 4Q5VA 2FY1A 2BX6A 2HVDA 4UZBA 5KT5A 2NQPA 1KKHA 2F65A 1EAYC 4OJHA 2DNOA 1NUEA 1S76D 1R3NA 1GH8A 4RW8A 5K20B 4M5LA 3HDSA 4LFAJ 5KG5A 2HLTA 2M8HA 2AU0A 2AJFE 1U6FA 2ZBRA 3UN2A 1B99A 3OXGA 3R6GB 4UTGA 1TAUA 1WKLA 2BQ3A 4R25A 1LWCB 1N36J 1NSAA 3W5ZA 3J81Y 4JI0J 3BZQA 3SBMA 2KDOA 4Q2MA 1R27B 4PABA 3MCMA 1D3WA 1SH2A 2W9BB 1RACB 3BGRB 4CYUA 4OMFG 2MQOA 5F8LA 5D15A 1LW0B 4DSJA 1NXIA 2GGPB 1WKKA 2C2KB 2OFGX 3CDEA 3AD9C 3ITHA 3PXGa 2FC8A 3UNYA 4ENOA 4UOGA 2ZH7A 4DR2F 2K1RA 5HQ8A 4WP8A 1N6QB 3W1YC 2KZZA 4UW2A 2IA0A 3K89A 3M6XA 4I7FA 1CJUA 2VBWA 3M6VA 2HNDA 5KFVA 5KOWA 5KFNA 2RS8A 1YRTA 1S0VA 3M2VA 4CLSA 2OPSA 4ED8A 3TJ9A 1Q8KA 3Q0AA 2ZBPA 2B43A 3BR9A 3FJ2A 1KN6A 1IBMJ 4F7VA 1SQGA 5EHHA 5C24B 2OP5A 5B0AA 5DZ6A 3G8SA 3P8BB 1AFJA 1QVGR 4URGA 5EN1A 4ZJQA 4Q43A 2HGNA 1J5OB 1HQ2A 2KJWA 3NG8A 4PKDB 4CNZA 3EPIA 1RHRB 4J37A 2VG6B 3M9OB 2DNLA 4LSNA 3GIKA 4F2SA 3M8QA 1RLDA 2NXCA 2D3OR 4FF3A 3PJXA 3FNNA 3U1NA 3ISZA 2KKHA 3CIZA 5ETVA 2PFFB 1P6TA 2YPZA 4F3MA 4LQ9A 3IBCB 4ZPAA 2B7BB 1HNVA 1H2TZ 1IKYA 3QT6A 3BDPA 2RRBA 2VV5A 1SCJB 3ISND 3DRRB 3KG1A 4QIVA 4IYQA 3BBBA 1T9TA 1U2FA 2NYHA 3HI9A 2ZBQA 3HJVA 3KDOA 4M5JA 4J9RA 1WD6A 4DUYJ 4GC6A 5A8KB 3R2CJ 5EGYA 2AHOB 4B9TA 5L8RC 3MCOA 8ATCB 1S0MA 5DDQC 1S49A 1Q78A 1TL1A 2CQ2A 2U1AA 4NOHA 4J9SA 1MWQA 3IRWP 2WK4A 4ZS6A 3QO9B 4WFAQ 3OL9A 3PX6A 4DQIA 1QSSA 2GMJA 1J5OA 1WC4A 3HHKA 4B02A 1VI7A 5H9EK 2HRYA 1S99A 4Q8FA 4P7VA 3QT7A 4Y34A 3K59A 2MLXA 4LF1A 2BRLA 3NCQA 2JEJA 3N9UC 2CVEA 3HVTB 2M2BA 3W5XA 1IUJA 2X1FA 2XCAA 2XGQA 3EWGA 3NBPA 2OLWA 1AT1B 3I4HX 5DDPC 1UWAA 3LH2S 5J2QB 1CJVB 2ZJRQ 2ASJA 3K8WA 1HYSB 1RU1A 3D28A 1Y0HA 2KRBA 2ROEA 1GX5A 1HNIB 4WP9A 3QRQA 2CPYA 3QYYA 3OR1B 1WF0A 4DV6J 1S9EB 1OPIA 3J7ZT 4OYMA 2DR7A 1VK8A 4ES2A 4WFBQ 4F4KA 3IS9A 3L95X 1Y7PA 3A8EA 4EGLA 1S6QB 4UUXA 1JXEA 5ETSA 2EFGA 2EW9A 2IIHA 3HSZA 4X66F 3WDOA 1HQEB 1D8ZA 4O44B 3I31A 4ZIWA 2R9LA 5KT2A 3KJNB 1F9EB 2V68A 2B5JA 3B6BA 3LP0B 5KAKA 1HHQA 3OL7A 4MK7A 4NA1A 5U47A 1H98A 4DCOB 1J5EF 3TX8A 4FXDA 2ROGA 3FMWA 2YKMB 3G87A 3NGKA 4YB7A 5D4NA 3TZWA 3I0SA 1TR0A 2R3VA 2B51A 5EWFA 2G2YA 3R5CA 4OL8A 3KK2A 1A0OB 1B0PA 4QR0A 4DF4A 4NXMJ 3IM8A 2CQHA 4JOUA 1ZS6A 4TY9A 3S01A 3UR0A 2V2KA 3AOAA 3CJ4A 2BE7D 3W2WB 2R8HA 1FFSB 1NK8A 1WWHA 3DMJB 2OGUA 3TUIC 5A6WA 1UA1A 1XK8A 1LV5A 4KGVB 2MZQA 1QE1B 2HPUA 2EKYA 2ZKUA 4DI6A 1RT4B 4DFMA 2YWGA 2OTLS 2RF2A 3ILOA 2EFVA 3MPYA 4Z37A 1HMVA 1H6KX 1JJ2R 4RW4A 2Z58B 1YIJS 4P2SA 3BQ2A 3OTCA 3BS9A 2OPPB 1HKAA 1U24A 1SJ1A 2XI2A 3D54A 2CDQA 2FLLA 4DLEA 4PQUB 3C6TA 4BC7A 4ECZA 3DM2A 3KYLA 3TUPA 2AQ4A 3M8PA 4RR5A 4ZCKA 5D0GA 3I5BA 3MMAB 2J76E 4FYWB 1WOPA 4PZVA 3R97A 1U6BA 2WONA 4LFBJ 1LWFA 4USJC 1SI9A 3S7RA 5L1KA 2C2OB 1S79A 2RDDA 4KKOA 2A2DA 5KFUA 7FD1A 4ZITA 2E9RX 1NK9A 1JLAB 2DXDA 2KVIA 2O3DA 2HQDA 3MGJA 2V4QA 4BWMA 4TY8A 3IWXA 3ILIA 2ALYB 2YKAA 4NLUA 1T0TV 3BR8A 4LR8A 2XLIA 3HHDA 4DEZA 2DHSA 2I0XA 2VQFF 1OY9A 1VR6A 4K59A 5GAGI 4M5NA 1S7HA 5B0BA 4RZRA 4FF2A 2VG7B 4K7QA 4EYIB 1Y3KA 1YK9A 3UN3A 1U0HB 2AGPA 3I6PA 4WJBA 2QA2A 4IR1A 5HO4A 3MF5A 2QA4G 1S9FA 4JI5J 3D5MA 5CYQA 1QVFR 4I2PA 3R3TA 1Y5NB 2CKWA 4RBVA 4DLGA 2BANA 1R89A 4F4XA 2LECA 1L3KA 2BQRA 2QL9B 3CJ0A 3D3CJ 3OFGA 1HPZB 4ILLA 3IA0A 3ZZRA 4DFKA 4WFZA 1ZAWA 3QIPA 1FEHA 3KMSA 1Q95G 4I1TA 4WTOB 4FPIA 1Q4RA 3NRBA 4DBQA 4LR9A 3GV7B 4OX9J 4ANDA 1N0UA 1RE1B 3LP2A 3M8ZA 3OFEA 2GHPA 2ALZA 4QU7A 1SKWA 2AWZA 2W2MP 4WE1A 1BQMA 3V4IA 3GFHA 1T05A 8RUCA 2HWTA 1SIZA 4LIRA 4OYWA 3MM9B 3PRDA 3TZZA 3OJUA 2HNZB 4ID5A 2HHHJ 1ZAXA 2OJ3A 4N76A 4FF1A 4X4VA 1ULRA 2FVRA 4Z2XA 5F0WA 2PI4A 2E5LF 1PJ7A 3BREA 5EDWA 3DLLQ 3CJQA 1XR7A 2AYBA 2A1BA 4QOTA 4R0EA 2VICA 2J9DE 4X4TA 1L3UA 2NXNA 3PRVA 4DV5J 3KLVA 1JXLA 1V9OA 3NNAA 5IV4A 3EGVA 3CEDA 5DRKA 2HFNA 3AD8C 4F26A 1UAWA 4P2XA 2PMZD 3WX4A 4OZ3A 5K8OA 5FLXU 2AGOA 1S10A 5IT9U 3HHLA 1EB0A 1N36F 5J1EA 1MWZA 4H4OA 3NMAA 2HS4A 2I38A 4IOBA 3SFGA 1YJTA 3SSRA 3W2VA 2J6UA 3NL0A 2J0XA 2BE9B 1UVKA 2XSJB 2HW3A 1RUSA 2GV1A 5DM6Q 3W66A 2DNZA 1AUDA 1XR6A 4X4UA 4KHRA 1LW2B 3HCXA 1AZSB 1IWAA 1PILA 2WVDA 3EVWA 3P45B 1FK9A 5FJ4A 2DISA 2UXCF 1X5SA 2K7KA 2R7RA 2MQNA 5MLCV 5L1LA 4OX8A 5LJ3Y 1TAQA 4PXBA 3BO3A 1HNZF 4ZVSB 3SCLE 1T9VA 2BOAA 2OELA 3CXCR 4EBDA 3GJRB 2RAQA 3S1TA 1RB0A 3HXMA 4ZN3A 4OYXA 3C19A 1YJUA 3GV5B 1RHMB 3FRYA 2HVIA 1CEZA 1RTJA 2ZDPA 2UUCF 4DUZJ 3ZTSA 3LOUA 2Y8WA 5ETKA 3RYLA 3ZZTA 2HWIA 2IMOA 3UCUP 4R8UB 2YKMA 3SCJE 1T8EA 2UXDF 3OVBA 2WHOA 2HHXA 3BQ1A 3QJJA 1QLNA 3DXSX 1QUPA 1C0UA 4ZJLA 3RBZA 2APOA 1HWJA 2L9NA 4DUTA 1U47A 2CJAA 3KK1A 4ICLA 4CO1A 1WHWA 4JI7J 2VA3A 1WI8A 2J5AA 2CWKA 2BVZA 2WRMA 2HHTA 1EETA 4NZ6A 2YKNA 1NNDA 4LF7J 5KFEA 1S77D 3OJSA 1NK5A 5AXKA 1TKTA 2YX1A 3ZXWA 3FSIA 1W25A 1WJ9A 1EETB 2MDAA 3X3UA 3W9JA 4AXIA 1UZDA 1U26A 2G0JA 4F04B 4YMEA 4FN5A 2EBGA 3J80Y 1N5YB 3IRXB 2FJWA 4ICLB 1RU2A 4LF2A 4MIBA 2HBYB 3MR2A 2UUCJ 1CLFA 1JWWA 2WVBA 1VGYA 1IKXA 1EARA 1PG5B 2R7OA 4KH0B 5AE2A 2MKYA 4K4UA 1KP6A 1IKWB 3DRPA 2GJFA 1D09B 2P8IA 3R7SB 3GQCA 3QGHA 3DLHA 4R8UA 2FJAB 4PG4A 4Y00A 3CJ2A 3LPEA 3GZ7A 1NB2A 3D1QA 3KWMA 4OHXA 5J1EB 1FRIA 3HVTA 1AW0A 1M5HA 1WC6A 4F0HA 2CPIA 3KK3B 1XR5A 2M0GB 2L3MA 3GB0A 2VFSA 4I2QB 4USIA 3RB0A 4AT1B 2EG2A 3TVKA 2COLA 3M8RA 3FQKA 3QO9A 4FXWA 1B4SA 2HURA 1UA0A 1FK9B 2IJFA 1B3TA 5H1SV 1X4HA 1X4DA 4HHHA 4WBFA 2DRBA 2C2NA 1IXKA 3HSDA 4RBUA 2WVEA 1HHSA 3TVYA 1RDRA 4NA3A 1KFSA 1G2EA 2FGCA 2YWKA 5J2QA 1WI6A 3DRRA 2B4UA 2PMHA 1HBOA 3MEDB 2E5IA 2MKKA 5CCMA 2E44A 3TQ1A 4ZP8A 4GVBA 3SCIE 3EJMA 5HJYA 4F50A 4QQBA 3T5KA 1MU2B 4J9QA 4O3RA 3JSYA 4LRDA 5ETQA 3CD0A 4WCEQ 1AB8A 4KRWA 4DSKA 4LF5F 4K4WA 4GKKF 3TEGA 3GFYA 2XYGB 2ZBIA 4TN2A 3GV8B 1YX2A 1I1GA 2WB1D 1XBWA 3OTEA 2C22A 2CQ4A 1R6YA 4LBHA 1F5AA 3HP6A 5LT5A 4LR7A 3Q86A 3EPGA 3C15B 1C1BB 2CQIA 2DHGA 4X2BA 4M1KA 4CCHA 3IR5B 4P74A 3M2VB 3J80U 2HRTA 3K58A 4IG0A 4DV7F 1TK8A 1RKIA 4LUBA 2AEMA 2B56A 1SH3A 5D0HA 4YDXA 1NJZA 4FYYB 1IKYB 5CD4A 1Q16B 1T05B 4YFUA 4NYPA 2QMWA 4MIAA 1BQMB 1YKWA 4KSEB 2IYGA 2V50A 3O2IA 1RHQB 2ZNYA 2C1EB 3TAQA 2QC3A 3M6WA 1M5VC 4IH6A 1Y3JA 5L39A 1LWEB 1S6PB 2H5JB 3SDEB 2DT9A 3W64A 2F4VF 4ETXA 1P27B 1X9MA 3TAPA 3QIPB 1FVSA 1S6OA 3R5AA 1B70B 2ERRA 2Z2ZA 2NSBA 4EZ9A 3NKYA 5EWGA 1YJ7A 1VC6A 2BJ8A 3J7YU 3HK2A 3LP1B 4C9DA 4A8WA 3DLEB 3KUGA 5BR8F 1CQMA 1RA7A 2Z4PA 3OD2A 3MCSA 4V1Ak 2H48B 2HKEA 4C8MA 2BJ3A 2ZOMA 4CT9A 3UI3A 2RDIA 2VZ9A 4OJ1A 5HROA 4NRUA 5HLFB 5DETA 3H25A 4IOCQ 5E33A 4RW7A 4ITSA 4PQUA 5DLGA 4Q0BA 3GLJA 1PBAA 1GMVA 1CC7A 3GSDA 2VQEF 4CYUB 1M1KT 3CDUA 3V2UC 1VQ6S 3IFEA 1SQFA 4CNYA 3CIMA 3K5OA 3L9ZA 3N6LA 3HSGA 3NOGA 3US5A 1PCAA 4JV2A 4MFBB 2KXHA 1YJRA 4M5KA 2A6MA 4M5DA 3RRKA 3JYTA 4JI2F 1SJ4P 5LXYA 3OL6A 2IRUA 3H98A 4OZ2A 3HVRA 2RS2A 1X9WA 3I56S 4HLBA 2FVPA 4JI8J 2HHHF 1EZZB 2CRLA 3N5BA 1WC1A 2YKQA 3D3BJ 3MEGA 1K1SA 5CHCB 4CO0A 2ZZMA 2UZAA 4ZVRB 1GNKA 3KJQB 3C16A 4PR6A 2DGUA 4I64A 3QGIA 4HL9A 2XHWA 4WIQA 3PZPA 1RABB 2IRXA 1I51B 1Z2ZA 2CQBA 3I0RA 4DJBA 3OLAA 3L3CA 5F3ZA 2XNQA 4XDCA 2MZTA 1O8BA 5D8HB 3OVSA 2G1HA 2HAIA 3CJ8A 4OI3A 3UR3C 3VAFA 2GS8A 1U1KA 2LP4A 3TA1A 3BKFA 3V81A 2IBKA 4DX5A 1HR0F 5KFFA 1HA1A 1OYEA 4U6PA 3KFWX 4J9VA 1NKEA 4B3MJ 2EC2A 2AZ3A 5ETNA 4ANEA 5AJ3F 1WDTA 1YBTA 4ZVHA 1IBCB 1BQXA 3S6EA 4ZP7A 4DL3A 1VC0A 4ALZA 3H59A 5CZVA 4TU9A 2UVVA 2NSCA 1BUXA 2GQCA 1Y5LB 5H9EJ 2W2NP 1I6JA 3OUYA 1IBLJ 3MMCA 3SI8A 1ZM4A 2BZ2A 3EYZA 3PO5A 3GYNA 4DMZA 2AP6A 1WF1A 3M05A 3Q8YA 3NBPB 4ED6A 4A8FA 3FBFA 1KEKA 1CBKA 3HSJA 3HFZB 2XGPA 4A8SA 4CLFA 4C8KA 3J7AN 2BW2A 2JFDA 3O6QA 3DI6B 3OBIA 1JKHB 2F9DA 3U1LA 2PA8D 4EWTA 1BC6A 3MR6A 3H5UA 3CCES 2EC0A 4JI1J 2X1GA 1F1BB 2AYGA 5KFLA 2ZH1A 2CQ0A 2J8SA 1APSA 5KOXA 1M5OC 5KG7A 1VBYA 4P73A 3T19A 1NDLA 4LFCJ 2O67A 3BYRA 4YDDB 4ELUA 1UVNA 2ZZNA 3W9IA 4TYBA 2F40A 1JIHA 4QR1A 3I55S 2L08A 2Q1LA 4A47A 4KGZB 4CH0S 2FGOA 1YJVA 3GJSB 5F0UA 4QR2A 5JUMA 3HHEA 2MXYA 2G2OA 1KDNA 4O4RA 4LSZB 5FIIA 1S0NA 1YJWS 5D78A 2ZNZA 1LXJA 2VUGA 2LCWA 4IH5A 1W2IA 4K0KJ 5GMDA 4F0MA 1CS4A 2HZCA 1IR0A 3U02A 2HS3A 4ZPTR 2PN6A 1SV5B 1ZPWX 3NGTA 2MJUA 2WBMA 5KFAA 1JB0C 5I4MA 2CPXA 2QLFB 3ADAC 2DR5A 5DZ7A 1NSQA 3KHRA 2ZZTA 2WTFA 1X9SA 1M1HA 3AXKA 4GVBB 2OEKA 2I2YA 1CJTA 4DPOA 2DGVA 5HVGA 2P9CA 3MEDA 2A2CA 3EZUA 4BBYA 3A3NB 1T03A 1S6UA 3CNQP 1JLFA 1BGXT 1E6VA 1G4CA 3WX8A 1C4CA 3MMCB 1S4EA 1V6HA 3AH6A 3NOCA 1HNVB 4I0WA 4PUOB 3VQTA 2FZCB 1PAUB 1Z4UA 2HBZB 2RQMA 2J8AA 4HTJA 2MQ8A 1GTHA 4U7UK 2DNGA 1JLBA 3PTWA 4DS4A 2FLPA 2HMIA 1TUGB 3PHTA 4RUBA 1NJXA 3RR7A 5IV3A 2MSTA 5GVQA 4F36A 1R0AA 2YTCA 2GIFA 1BMQB 5KFSA 3R7NB 3KK3A 5M2RA 5C24A 4BS2A 5IT4A 1SC4B 2DNPA 3G8QA 1GK8A 1I5OB 1T9UA 3UDVA 4M5GA 2Q79A 3OSNA 1SL2A 2GO8A 2J7WA 3DU6A 4RW6A 3ZZ0A 3JQMA 3VF0B 3C6UB 4GKKJ 1F3FA 4IFVA 4USHA 4UY8T 1IKWA 3CDWA 3DRPB 3ENVA 2ZH8A 4HI2A 5CQGA 3T1HF 1LFPA 1UETA 4RU2A 2BBEA 2M52A 3D0IE 4LVNP 4ZP6A 5F8GA 4ECQA 1ROFA 1RHJB 5E0OA 2XMUA 2QN6B 1TTHB 4DN0A 2A6OA 2GGPA 3ITHB 2HS0A 1URNA 2OHDA 4WYLA 4YB1P 4ZPCA 2OO4A 4WWSA 3DOLA 2VHGA 2BRKA 1F2GA 1HBMB 1RTDB 1HW9A 2CQDA 1Z2LA 4YR3A 1JLCB 2DCLA 4Z7YA 2PE8A 1JLCA 4B3OA 4MFBA 2CADA 5GAHU 4CLKA 4LF5J 2QA1A 1FJGJ 2HHSA 3FZBA 4L76A 5I3PA 4OYIA 1SVDA 1IWGA 1S1TA 3DOLB 5JXSA 4EK2A 2AIRB 1FE4A 2JVOA 4PXDA 5IM0A 1UWBB 3KLHA 3MCNA 3PW0A 1GQEA 3MMJA 2M88A 2WOMB 3OT9A 1N4LA 4XO0A 4EYHB 4DL2A 3C16B 4CLTA 4DCJB 2J6TA 1TELA 3IBFB 4IFVB 2XY6A 4B9MA 3BPDA 3DLEA 4YP3A 1JLGA 1XN9A 1H7XA 2F5GA 5CYJA 4DV7J 4RUAA 4UOFA 1RT2B 3MXHP 3TEHB 1UW4A 2N4CA 3JQKA 4URQU 1XC9A 2EFPA 3LGMA 2EFNA 4FVMA 5HANA 4FF4A 2YKPA 3DDKA 4M5DB 4PQAA 2ZHBA 4RW9A 4EMDA 3TP2A 1SQEA 4ZK7M 4IFYB 4ZVOB 3ZZZA 1X0FA 1JLBB 2VODA 2GA7A 1JXVA 1BLUA 1UJ6A 1YBAA 3C66A 3TI0A 1OY8A 4LRFA 3IM9A 3CCZA 4KHMA 1JJ4A 4LRBA 2IVYA 2ASYA 1WC0A 2QRRA 2W01A 4ECTA 3TA0A 1MMDA 1KS2A 2PT0A 4FNIA 4N56A 2OUGA 1BWVA 1P9QC 3M30A 2JSXA 3FQLA 2ZOFA 1FI4A 2DY1A 3BB5A 3UWTA 3WIVA 2K3KA 2ZH5A 2E66A 1YTYA 1FKPA 3QBCA 1U09A 2IAJA 3ULHA 3CCSS 1RP5A 4K4SA 4RBTA 3ILJA 1R31A 4H4MB 2L41A 2IM3A 2DK2A 3FVYA 4ER8A 2JC1A 4ECYA 3V6DA 1HARA 1S6PA 1RA6A 3D7SB 1V3SA 1Y00A 2FJBB 3D67A 1ACMB 3RAXA 1YI2S 2VASA 3G6XA 4IOAQ 5E7OB 3EVMA 2VOOA 4G1PA 3MI7X 1DTQA 4LMZA 1RTIB 1S1XA 1NM2A 3TOQA 4ED5A 1VC5A 4B3TF 3AXMA 1WSRA 3KJVB 3LAMA 4NRTA 1RBAA 5CH7B 2DXFA 1UFLA 2MKCA 1S9GA 5BYQA 4BWJA 5SZTA 3D66A 5KT3A 1RTZA 1UFKA 5LMUF 4FS2A 4JV5J 4RNNA 2DH9A 2LQBA 4DHVA 2D41A 1NBEB 1WG1A 1RTHB 3TAMA 3W65A 1U8SA 2QIFA 2QFJA 2EK1A 4CLLA 4RNOA 2G2ZA 3HZEA 5CD4H 3MR3A 3P5BP 1NZAA 4D3HA 2IMWP 1HPZA 1R8BA 2CPZA 2MHNA 4XDDA 2HK3A 3LGNA 2DBBA 4IG3B 2Y0BB 3J81U 3MD3A 4PWDB 1DQAA 4CO3A 4I2PB 2UUAF 1YDLA 3JSBA 2OIHA 2ZHAA 2FVSA 3RRGA 1HWUA 2NUUG 4JI4F 4WFNQ 2ZE2B 3F0NA 5HMZA 3VALA 2C28A 1U2CA 1IM4A 4I6AA 1KQSR 2LVWA 4RX6A 3SQGA 1G1XA 3IP0A 3C46A 1R6VA 2NLWA 4U96A 2XMWA 4YUDA 2PSZA 2VKRA 2DGSA 1YBUA 1S97A 4HDGA 2QLWA 1W2BR 1RCXB 4LFCF 5DGAA 2RU3A 4B9NA 2DXEA 1FJ7A 4O23A 1NK0A 2ADBA 1WELA 3G2XA 2E9ZA 3EE3A 4R0JA 2KM8B 3QJPA 2DPJA 1KHVA 1V5IB 4DX6A 1QAJA 3KK1B 1C1CB 5A6PA 2IDLA 2FJVA 2OI2A 2OSRA 1WDDA 2AJ2A 5K9FA 3MM6A 4KPYA 1TL5A 1RT1B 2M9KA 2Y3YA 4DSEA 3DM2B 5LM7E 3DGPA 2RUSA 4USWA 3LWMA 5J2NB 4CM0A 3G8TA 1UZHA 2RU9A 2W1BA 3QT5A 5KG3A 4B3RF 3G4SS 1YG0A 2IJRA 2BV3A 1UTAA 2GFFA 1QSLA 1VQ7S 1U02A 4CQ1A 1VRTB 4UZCA 4ZIVA 1M90T 1KONA 2P2CB 1DHMA 4P7TA 3PY8A 1W26A 3CJRA 3KNGA 1I3OB 2CDRB 2EK6A 1O0PA 4DR4J 2N7CA 4C11B 1JMTA 4NE9C 5I3QA 1WEZA 5F9NA 3AB2B 3K5PA 2RRAA 5D6GA 3MPVA 3VR1A 5JMNA 1O51A 2MSSA 2X51A 4OYPA 5L38A 1YGYA 2E7WA 2OD4A 2BJ9A 4E2FB 1B0VA 4FYXB 1BD6A 2GMHA 4OX6A 3UD4P 2KG0A 2KT5A 2DITA 3LW5C 5I3UB 4DDFA 4OV6A 3R27A 1HBNB 3ENWA 3MUVP 1MROB 2FIUA 4QJVA 3MM5B 3NWGA 2NPIA 5ETTA 3LANA 1RAFB 4DR5J 2XZDB 3CUNA 1D1UA 3QFWA 4O44A 4P72A 2VKZG 1DTTA 4FKXA 2BJ7A 4L6V3 4X4RA 3R6LB 2C3MA 4B9VA 3M32B 4IKAA 5EX3A 2F4FA 4UOCA 3DKDA 4OJGA 3NNHA 2R7SA 4WFYA 5J2MB 2DTJA 3BV8A 4OYZA 4PYAA 7FDRA 1NPPA 2OMOA 1ZPVA 4MK9A 3I96A 3KXDA 1HNIA 4WXWA 5B0GA 5IWAF 3KHLA 2DEIA 3Q83A 2MZRA 4N77A 1L5UA 3UO0A 4NCBA 1HYSA 1S1VB 3OVAA 1UMJA 2GJ2A 3HMJG 1VQPS 4NI2A 4FBTA 3CO0P 3CD7A 2LQ9A 3D6MB 5AXNA 3KJVA 2YKOA 4EFAC 4KT0C 1B7YB 2V2ZA 3FZ2A 1VQ4S 4KYZA 4RWWA 3GSIA 3I32A 3MAAB 1RWUA 2K06A 1WACA 3JSMB 3RRHA 3WC0A 4ZVFA 5K8NA 3RTVA 4C7QA 2HHQA 2XNRA 2QSWA 1TUWA 4E98A 5DDRC 1X8DA 5D3GB 3L7UA 4LF9J 4B3SJ 2KT2A 3LTOA 4H4MA 4CDIA 3ILLA 2XZWA 3B8HA 3SCKE 2VJVA 1N34F 2EXUA 4IRDA 4ECSA 1H74A 4KAIA 1K47A 1OYDA 5HMYA 1FKPB 1OPZA 2OSQA 1REVB 3GP9A 3L7PA 3QT8A 4ZMMA 1HD0A 3UQSA 4QWDA 4JI3F 2RIJA 1FHTA 2G0CA 4RNFA 1MW7A 2P6TA 3JSMA 3CPWR 2NXUA 3MTJA 2R4FA 2RD5C 2HNYB 3PFOA 1U8WA 5E3PA 1BHNA 5ETOA 1RWOB 4Y0FA 2AX0A 1TMMA 2Z0GA 2C42A 4NI2B 1JX4A 1XTZA 3AD7C 3M4XA 3OXLA 1PAEX 3VWSA 4RNMA 3D68A 4N7TA 4F0KA 5EWEA 1LEOA 3PW2A 4AL7A 1PJ6A 5A2QY 4V19J 1CG2A 4AD6A 3DGVA 4TQSA 3CJ3A 2EWHA 2J0WA 3Q22A 5LSLA 1ZAVA 5CXTA 2P9GA 3Q8SB 2E29A 4EO6A 1QAYA 1RYRA 3DLBA 4DS5A 5D3GA 4OLOA 4C0HA 2XO7A 2MB0B 1FRHA 2Y1RI 5E3CA 2B9EA 3H5YA 3WC2A 4KKOB 1KFDA 1RBLA 1O5JA 3EXYA 1FNOA 3RGIA 5HBMB 4X4QA 2CPEA 3B54A 3M1VA 2HHVA 3GCXP 2HNDB 3KMQA 1UKUA 4J9PA 2MLZA 3VAHA 2WOMA 4G1QB 1S57A 1CPZA 5HATA 1MN7A 3C14A 3MTKA 2W9CB 4Q44A 5IM0B 2CPDA 3NXZA 3PCOB 1TFWA 3FFIB 3CCRS 2L48A 2E5JA 3DHXA 1Q86T 1KOHA 2HGMA 2W4DA 2JLEA 3HFVA 2UU9J 1KOOA 2WSEC 4IDKB 4ES3A 4RW9B 3AB4B 2GVDB 3F44A 3GE9A 3QSIA 4ZDNA 1FWKA 1TL7A 2EG1A 5HSPA 4DX8H 2HQFA 2N3OA 1NZ8A 1U2RA 2PD1A 2W24A 4LRAA 4S0MA 1YITS 1HBMA 1TKDA 1BQNB 5K8PA 3JXOA 2QLBB 5HQMA 1DTTB 4O0NA 1HNXF 1B0TA 1FDBA 4HT5A 1VQYA 2BJDA 2HIQA 4OLPA 2DH7A 1VRUA 1N5QA 2MZ1A 1C0UB 2GAHC 2GJIA 1KRPA 2JEIA 3MAQA 4EBCA 1MROA 2W25A 5KFXA 3T6JA 1SL1A 3GU0A 1D0EA 3ZNJ1 1X4GA 3ZFVA 3ZTQA 1NCLA 1UWBA 2DNYA 1QJHA 2F3JA 3PJWA 4R5PB 3KLHB 2IPOB 4C3LA 4DV1F 5DLFA 4G3IA 4O3SA 2UU9F 4ATNA 4ZVPB 4CIOA 1DBDA 3R5GA 4A48A 4RUHA 4FP9A 4UQGA 4TQRA 1UEKA 1Q7YT 2DKOB 2R7QA 3ET6A 3V6JA 4KTQA 3IR6B 3HKWA 5IQQA 4EI2A 2DHXA 2E9TA 4DFPA 3BSCA 4KHPJ 1NJIT 2CNLB 3LAKA 1FXRA 3OL8A 2Y1LB 3D1HA 4X4SA 4F02A 3BSOA 1J2VA 4USUA 3HM9A 2HAFA 5KFOA 3G71S 1PKUA 5DO2A 1LKZA 3HVAA 4K4ZA 1RAIB 3G6VA 1N8RT 1CJVA 2FPHX 1H2UX 1Q53A 2FZGB 4B17A 4MH8A 2B4VA 1WTFA 4GO5X 4DV1J 4ED1A 3PKYA 1R0BG 2LYVA 5J2NA 1OY6A 2BABA 3CC7S 1RT1A 3GWCA 2UXBJ 4WFXA 2ZKTA 3H90A 2J0QD 5L9XA 4RO0A 4DZ6A 2SXLA 4DSLA 4JI4J 4JV1A 4FDFA 4Y2MA 1S6QA 2LEAA 3D0HE 3MOJB 2KT3A 4HHJA 1A6LA 1S7IA 1NHKL 2XZTB 5DJBA 3WIUA 4X65F 5AJ3J 4PAAA 3CJKA 3IXQA 1VQNS 2XMAA 3HULA 3TAMB 4UOHA 5C25B 2OPRB 4DV6F 1F9HA 3GILA 2DIUA 5J1PA 1XMQJ 2MJNA 3Q24A 3H7HB 3MWBA 1KSPA 4ZVTB 3AFGA 1TL3A 5GAHI 1QY7A 3FBCA 3ISNC 2HSEB 3AA9A 3BSAA 3PYGA 1S59A 3ETOA 1XWLA 3PM9A 5HL7Q 3M8SA 2R7UA 1RT5B 1FTRA 2K2PA 4AQYF 3TRGA 4F8RA 1T9YA 4PG7A 1YVFA 2JVRA 2XMVA 4GKJF 3CJ5A 4GC7A 2O5DA 1OSDA 4DG1B 1VQ9S 2VG5A 2XBPA 4O4GB 2B9YA 1L3VA 1Q5VA 1KD1T 4Q8EA 1UVIA 2CVIA 2FHKA 2QL5B 4J5OA 1UVJA 3QWUA 2YNHB 2UUTA 4A8YA 3D0GE 4NLDA 3EGZA 4DR6J 3H0PA 4URSA 1NDPA 4BLGA 2V9KA 3FCHA 1FX4A 1UJ5A 1JKHA 2M7SA 4DPXA 4Z7CA 4YY3F 2VG5B 1OQ6A 2ATCB 2CJQA 3HZGA 5F3TA 2VPWB 3IG1A 2F8HA 4LBIA 5KFYA 2B0GA 3VVUA 4F4AA 1T9XA 2V69A 4X62F 3RAMA 3ENQA 3ZZPA 1CJUB 2MKIA 5L1JA 1TL3B 4J91A 2X1BA 4AE5A 5E3RA 3DNCA 3DLKA 3GPAA 1GMWD 2IRYA 2Z2MA 2X3GA 3CSKA 4NX9A 2QMUB 2QMXA 3H5SA 3JTPA 5IXUA 2KG1A 1QSYA 4P71A 5FDLA 2EEYA 3OR2A 5IQ6A 4DL4A 3H4DA 1FTCA 4BHQA 1OIAA 2W8LA 2I6WA 5A0YA 4BC9A 4LSNB 4DXLA 2CA9A 4OQJA 9ATCB 5L1IA 4DR6F 3CMES 4QZVB 2MZJA 1CC8A 4CLYA 4OZJA 5L46A 2VPXB 4NXNF 4NLWA 1JJCB 2XYPB 2MLYA 4G1IA 3AY0A 4GVLA 4ZPBA 2AD9A 1JNRB 1K0TA 3AOCA 2JHEA 2DGOA 2IAJB 3RZAA 2AZ1A 2JC0A 1FNMA 4X64F 1RT2A 1VCTA 1EKRA 2LDYA 3CE8A 4U8YA 5G4DA 3CCQS 4JI2J 4JI8F 2B3TB 1NDKA 2G0IA 5GAGU 4NLXA 4QIFA 3MEKA 4I7FB 3IO1A 2CZ9A 1IN0A 2PA3A 1UFWA 2CJXB 3G82A 4C2MA 2VFVA 3UD3P 1FRKA 1Q1KA 1M5PC 2GHWA 4NLQA 5SUHA 3V4MA 4OZ5A 3VZHA 4PG8A 1N52B 1TKZA 3T1AA 3EX7B 3WZ0A 2HYIB 1KQFB 2OPQA 5LOQA 1QTMA 3JAMY 3QNWB 3KLEB 1X5PA 2QLXA 2C2RA 2VFRA 1CULB 4KO0A 2FHJA 4LF6J 2LKZA 3QAUA 4B3OB 4K4VA 2KZMA 1RT4A 4P10A 3V5RA 4ED2A 2VA2A 2RE1A 2ACMA 3LO3A 4WP3A 4DPWA 2CFXA 4QW8A 3TANA 1XIQA 2F8MA 4F2RA 2MEWA 4LF9F 2AX1A 4Q0BB 3NGRA 3R5BA 1RWVB 5HLFA 3F56A 1Q8LA 3JB9k 2AV5A 4K50A 3GCWP 2FJDB 3EUNA 2XY7A 1U49A 3MFIA 1JLEB 1ZA1B 3C6UA 2OEMA 1AROP 1XMBA 3W8GA 1IKVA 3GIIA 1G3OA 1M5SA 2WBRA 3B4MA 4EBEA 3EDQB 3BN7A 2FQQB 2MPUA 4NMLA 5C2GA 3PR5B 1TK0A 3H2VE 4LF8F 3P6YC 1YRXA 4LF4J 1OQ3A 1RT3B 3UN5A 3JYTB 1TL7B 1HWLA 1F5BA 4DOZA 1RHKB 2Z8QA 4DFJA 1TK5A 4ILMA 3ZO7A 2Y9HA 1LFWA 3KDNA 3MMBB 3KHHA 1HNWJ 2H1YA 1N56A 1S9EA 4P52A 4AL5A 4I56A 4CTAA 1D9FA 3DOMB 1BWEA 3DU5A 5KFDA 1TVRA 1UL3A 2FYXA 3HPOA 4C8OA 4P2MA 2Y8YA 2VOPA 1Y4ZB 4V19X 2HQIA 1WSVA 3NS7B 4WIIA 1F5CA 3CGIA 2V6AA 1MMNA 1RK8A 1DFDA 3DDNA 4IQMA 2ZH6A 4X84A 3A8KA 5IZHA 2AEJA 4ZKAA 3FBBA 1F3VA 3UDEA 4QW9A 2W4PA 4DR1F 2C3UA 3SSQA 2PEHA 3RB4A 2XB2D 3G9CA 2DNNA 3KUEA 4M5HA 4HDHA 1R0AB 2OH2A 1BY9A 5DS7A 5KT4A 3P5TL 2KM8C 5CYMA 1NK4A 1SV5A 3QZ7A 1SH0A 4DR3J 1FF2A 2GAGC 1NH7A 2XMTA 1PO6A 3HKZD 2QL7B 4MYUA 1IBKJ 4DG1A 1Q8BA 3SEOA 4OHVA 4OYAA 3MECB 4J9MA 4OI4A 2KFZA 2YQ0A 3M2RB 4CZCA 1XMOF 3SQOP 2GCFA 3DLKB 3C2PA 1ICEB 1L3SA 2VL1A 3MM8B 4QPXA 3MM8A 3PX0A 1JLFB 2NZCA 2VDHA 2UP1A 1RADB 2FY8A 2XG8A 2ZC4A 3NAIA 1HHTP 4DR1J 5AXMA 3VAMA 4CH1A 1ZTWA 3IG1B 3IGVA 4DUZF 4LIWA 3A1YG 3CDAA 1X0PA 3OXFA 1GXTA 2KFNA 4D3GA 2RQKA 2MZSA 3CD6S 3AAWB 1QUVA 2RILA 2ZWPA 5HP1B 3R9LA 3H40A 4NLOA 5G0RA 1EHWA 1VJQA 2ZD1A 4U9RA 3JQJA 5A2QU 2CZ4A 5FLXY 5IT9Y 3AA8A 3JTNA 4NLVA 4JV0A 5BXIA 1X31C 4KGMA 3I4PA 1XMOJ 4GMKA 2MY8A 3K8VA 3N01A 2Q43A 3QZ8A 4LF7F 1NPKA 3PEHA 5HMWA 2G13A 3QLHA 1J5EJ 1H38A 1GFWB 2EPIA 4EUVA 7AT1B 2FVCA 2AT1B 3R7BB 2J0SD 1FKOA 3ZZUA 3HD1A 1YRUA 2CG4A 2JEFA 3BGRA 4PWWA 3OTDA 3CJKB 1PJ5A 2W2OP 1P9YA 2D7SA 3T1YJ 3MMBA 1OS5A 2RH3A 5E41A 2DR8A 4IH7A 2BQUA 3O8WA 4OYBA 2ZH2A 2UXBF 3EZOA 2XI3A 3Q89A 2BMBA 1BXNA 1K44A 4WK3A 3VVTA 3KLGA 2BYCA 1RISA 1LWCA 1TUVA 2J6SA 1PGZA 2VFUA 4NEYA 4OJ3A 1AYEA 2LA4A 1I94F 3UDCA 1QM9A 2HGLA 2LXIA 3PJ9A 3UVJB 3UNGC 2E7VA 5LSRA 5GMKa 3SYZA 1IJFB 1S0OA 3N5FA 2RKIB 4OI0A 1URRA 1JLEA 1R43A 1YLXA 1KHWA 2KTQA 1DARA 3QIDA 2V8DA 2GIQA 2PO4A 5B0CA 4A8MP 4KFBB 1G7CB 4YY3J 3Q8RB 3FCVA 3PYEA 5DGBA 1FCAA 5CCLA 4ED3A 4IUFA 4K4XA 3P3DA 2D74B 3HHNB 2J7KA 1V5VA 1FJCA 4YOEA 5A8RB 5GADI 6AT1B 1WTBA 2M5YA 5H9FK 1VMBA 2YKNB 5M2PA 2QZ8A 4ZCIA 3UW1A 1ZM9A 4KO0B 2L9DA 1NEEA 2ZM6F 2MQLA 2D3UA 3FDSA 4HTIA 2ZJQQ 3M6UA 1RT6A 4WXOA 3VV2B 2C2EA 1GX6A 3D6FB 2V8VA 3W60A 2HZVA 4RW7B 4YR0A 1EP4B 1KVKA 1R7IA 1Y5IB 2DNHA 3BGUA 2AKWB 2KB2A 5B09A 3DLGA 4ELTA 1QAXA 1H3DA 2K3IA 4NXMF 3W7BA 1NDCA 4N8NA 3NY0A 5D4PA 2V94A 4ILRA 1RTJB 4C48A 4ZCMA 3CTRA 2PI5A 1CJKB 4NLTA 4PPDA 3JTOA 3MFHA 1MNEA 2KHCA 4X62J 4PUOA 3IN5A 4O3NA 1IVZA 1REGX 1BQNA 2DNQA 3QQCD 1JLQA 3ZTOA 1FA0A 3PNIA 2AYEA 5L9NA 4FBUA 2Z2LA 5KFBA 5I42B 3OLBA 2XS2A 5KG1A 1IJEB 2YNIB 4K5RA 5KG4A 2HG4A 6FD1A 3ZTRA 1X4AA 3NGUA 3TZXA 3T41A 2KI2A 3OFHA 1KQGB 1E6YB 2QJ3A 4DU8A 5F8HA 2N7YA 2VQEJ 3RBDA 4NLGA 2YNFA 2HIYA 2QLJB 2G9OA 3IAS9 4G1QA 2R8JA 1RAEB 1NSPA 3KNAA 4WZMA 4NYOA 2ILYA 2Q66A 3A4TA 5B0FA 4LF6F 1WNEA 3QAEA 4CLWA 3CCUS 4PWDA 2OTJS 2Z56B 1TU0B 4KH1B 4IG3A 4NLPA 2HK2A 1RHUB 2AJ0A 2UUWA 2N3LA 2VD3A 3N6NA 4XAKA 4ZN1A 3KLFA 5LMUJ 4LSLA 3C15A 3R1LA 2H9ZA 3AOBA 5HVFA 3G6YA 2DRAA 1ZETA 4J9LA 3POTA 2L9WA 5KFMA 1FFGB 2B8QA 3E3XA 4CLUA 2C3OA 2D1CA 2XM3A 2M4MA 3FBEA 1RLCL 2HHUA 3CJSA 3KG0A 1RI7A 4L75A 3KLFB 1S48A 2H5EA 4O4GA 1X60A 3TVZA 1F6TA 4LFAF 3MM9A 2IYIA 3OV7A 1AXQA 2DRDA 2V9WA 4LF8J 2FTRA 2BE2B 1GXLA 2Z2YB 1DTQB 1DQ9A 1X7VA 2Y1IA 1DY3A 2HVEA 5LSOA 4MJKA 4HYKA 1KTVA 2BUNA 4NZ7A 5IFMA 1RCOB 1MLAA 2VBXA 3RB3A 3F41A 2XSFA 2LLZA 1LNQA 5ADZA 4RU9A 2RDJA 3R8YA 3M9MB 1WOOA 1RWMB 2UUBJ 4L3NA 3GJTB 3PVXA 1NJYA 5F8JA 3DC2A 3FCWA 5KFPA 1JLQB 1RQ0A 1XERA 5FD1A 3CWJA 2D9PA 2U2FA 4PCQA 4OZ1A 1HL6A 1OSCA 1WHYA 1PYTA 1ZM3A 2LQ8A 3GR1A 4NCAA 1XNQJ 3CO9A 4ED7A 5C7PA 4CP5A 2LXUA 3MMAA 1FRXA 4MKBA 4N5SA 1PC5A 4C0BA 3WBZA 1HBOB 3M8PB 5E3AA 1XNRJ 2CPJA 2R7WA 4B3MF 2CPHA 4QWCA 3NGDA 2YNFB 2R8KA 4DPYA 2UXDJ 3QRPA 1H73A 4EO8A 4YR2A 4NASA 1W7WA 1VYAA 1YJNS 2E1PA 2UUBF 4DL5A 1GAOA 1IBLF 2KYXA 3FMBA 3PYFA 3LA0A 3UDLA 4B3TJ 2BOPA 3BM7A 4JI7F 1PYSB 4TY8B 1TKTB 2CQPA 2HFVA 1UCNA 1N32J 1XNQF 3TARA 5F8MA 4QIWD 4QYRA 5CZXA 4WKYA 4K5SA 1LWFB 3E51A 3GYGA 2XY5A 3SIPB 1VQLS 4C97A 1RYSA 3NS5A 3KK2B 2IVMA 5KFRA 2R7XA 2E1AA 5F8IA 3IWNC 1YWXA 1HBNA 4W98A 1EP4A 5I3UA 2YWHA 1YJ9S 4ECWA 2WB4A 2AJ1A 2M70A 4EU0A 5BYSA 1KNZA 4F4ZA 2Q3PA 2BJ1A 2P9EA 4DWIA 1FD2A 3GFXA 4P9SA 1U1PA 1KVJA 3O5TB 2ZBCA 3IBWA 2FJEB 2HZAA 2JZ5A 3QMQA 8AT1B 2ZFHA 3KKFA 3M8YA 5E2QA 3I5CA 2LQJA 2ROPA 4GRSA 5LXRA 4C11A 4X4PA 2GVDA 1Q7LB 2CQ1A 2IC3A 2VF3A 4H4KA 4F3QA 3SSSA 4KFBA 2J9CA 1U1MA 2IM0A 2R2UA 4NL5A 3NGSA 2MQPA 2R2RA 1GEHA 4IO9Q 2CJ9A 5E5NA 5C42A 2IVFB 3C14B 2FVQA 4TYAA 4FS1A 2JRSA 2X7IA 2V4RA 1TQLA 4YEAA 3KHGA 4H4OB 1C2PA 2DEJA 4Y6IA 2GO9A 3EICA 1R0CB 3C3LA 3VGUA 3GYXB 3W62A 5F9LA 2DO0A 4AYBD 3RB6A 3N4WA 4LQ3A 4TU8A 2V0NA 3H42A 1FNXH 1KR4A 1X5TA 1HWIA 2A18A 1SKUB 2CZVC 5G0RB 4C8LA 4KJIA 4N41A 2BW7A 2KU7A 2Z57B 5BYRA 1K9MT 5HI7A 2DNRA 2XLJA 2GVZB 3EGWB 2ZHOA 1TKXB 3GG0A 4KQZA 4MIWA 3W9HA 2YX7A 4K8RA 2NZ4A 1DAXA 5D0EA 4MMOA 4KPCA 3TWZA 4I67A 1K0VA 2CWXA 2YWEA 4MKAA 3ELHA 3GTYX 1VLOA 2YQ3A 3SQGB 5A8KA 1Q81T 3MR5A 4JI3J 3WQPA 3P96A 5EX0A 3D1OA 1P8GA 4WK1A 5KG0A 2ZH4A 4RWXA 3MECA 4HT7A 1B64A 2FHJD 2V2VA 5JVHQ 2HWHA 2H5IB 1N33J 1WOSA 3RW7A 2R7VA 1FEEA 4XPEA 3SZ2A 1SUQA 4WZQA 4X65J 2ZVSA 3MPDA 2HQ3A 1REVA 3H5XA 1U6ZA 1XJWB 4MTPA 3BH7B 3A8IA 2YH0A 2CJKA 2QYGA 2F4VJ 1Q0NA 1Y9OA 2AW0A 4M8LA 1K8AT 5K8MA 1TL1B 5AE3A 4DV2J 4UF4A 4EEYA 2V5HG 2XTJP 2LU1A 3OSPA 2C3YA 4HH1A 2W7OA 3V6HA 3PV8A 4LT6A 4N47A 5KFHA 4M63A 3VGTA 4F4YA 2H3EB 1B7FA 1HQUA 1S5ZA 2YQ1A 4O3OA 2DJWA 5BR8J 1C4AA 1JJHA 4GKJJ 4PG5A 3QPIA 1FJGF 3TZYA 3V4IB 3E8OA 5AT1B 1UVLA 2NCKL 4DQPA 1LW0A 2VG7A 2OKQA 4CTAB 3OW2R 2ABYA 2F63A 3GFZA 1LOUA 4WKRA 1TL4A 2H51B 2YNIA 4B9LA 2H65B 2EFQA 2HHPA 1H72C 2JLFA 2CNNB 2EFOA 2JJ4D 4PYDA 3VAGA 2J9DA 4QCLA 3GIJA 2E1CA 1X5OA 4ERDA 4CH7A 3BGLA 3AQPA 3Q8QB 1F60B 2JOQA 2DHHA 3O1LA 1PIEA 5KT7A 1HI1A 3M8WA 3NCRA 1N0VC 3PKMA 5KFTA 4JP8A 1EQ0A 3AJ1A 2R2TA 1VHIA 1VDHA 2CG8A 1SC3B 2QGFB 3I82A 4DV3F 2HHWA 3VGVA 4YS2A 4A8XA 3DLGB 3OUYB 4N8OA 3CCTA 4QBUA 2DH8A 3IMQJ 5J2PA 3L09A 3DOMA 4A8QA 1E6YA 2FLOA 1FERA 4DZDA 2V34A 3P4UB 1RT6B 2RMLA 1U1LA 1FWPA 2UVWA 3CULA 5HN0A 2YNGB 2W9AA 4NXNJ 3E01A 1S12A 2QX0A 4YHHJ 2GZOA 4ZP9A 3CJTA 4USKA 1T3OA 4U8VA 2YXLA 2CNOB 4KV8B 1CULA 1RT7A 2XWXA 5KG2A 2HQCA 1X4BA 3MHYA 3VAIA 2VB6A 1QE1A 2OPQB 5JVGQ 1GXUA 2B7CB 2W4CA 4NLYA 2WVCA 4ZCLA 1KLMB 5THWA 5HVHA 5DQGA 2HFZA 2VC0A 2X1AA 2H4WB 2RRNA 2V4JB 3Q23A 2W8KA 1IKVB 2DNKA 2HLUA 5D4LA 5GAEI 1VS3A 4I6YA 4LVOP 1S1WA 3BBCA 4IRCA 3I0RB 4JV5F 1VRTA 4NZ0A 4ZHRB 1R8AA 4XIUA 1UPMB 3DRXA 3CB4A 4OX9F 2DPIA 3ZTPA 5M2UA 3FGVA 1EQMA 4ZHRA 1NK6A 3T3FA 1VIOA 3ONQA 3DGPB 1LK7A 2M3DA 2C2ZB 3W63A 2P6SA 3R2DJ 2OPPA 4YHHF 1KLMA 1C1CA 1Z1ZA 2O66A 3BBFA 2WSCC 1HBUA 1KVIA 3LQVA 4UUWA 4USTA 3PACA 2DHAA 1TV6B 4Y65A 2XO6A 2EBEA 3IS9B 4L72B 2NS1B 4B08A 5A0YB 3CC4S 1JNZB 3TW0A 3PW5A 1TKZB 3OR1A 2QA4S 2DO4A 3NCPA 2KVQE 4RLEA 1FDAA 3D4JA 2RB7A 2JX2A 3LPYA 2KHDA 2Z30B 4FYVB 3PHEA 1S4FA 5HROB 3G82B 3I0SB 3U1MA 5DQIA 4LJMA 4J90A 1E6VB 2GNKA 4UQTA 1TZ0A 5JJBA 1HNZJ 1S1UB 4KE5A 4XTTA 4RW6B 3V6KA 3UPFA 2DD8S 3X1LB 3THVA 3QATA 4LF4F 1SKSA 4DV4J 2VDIA 1XNRF 2FC9A 3LUYA 1NKCA 2GIRA 1VLYA 2YBVA 3FKBA 4JI0F 2KXNB 3KLGB 3JSRA 1HWKA 2DGWA 2K7JA 3HD2A 1GTEA 3KLIB 4RKUC 4CI0B 2JWNA 3T5JA 1FO1A 2YNHA 2W2QP 1VQMS 4YB5A 1LWEA 3HF5A 1UVMA 3J7YI 3RW6A 1IQTA 5T14A 3QFHA 1DLOA 4NCGA 2UXCJ 1FKOB 1MMLA 4H4KC 4DPTA 2B8PA 5A76A 2JEGA 3SFUA 1X4EA 4B9UA 4MKYA 3SV3A 4ECXA 3SMZA 3Q2TC 2DGTA 3QLHB 1HQUB 2QYCA 4DN9A 2VIHA 2KL8A 1RKJA 1MSWD 4JI6J 1T03B 1F2HA 1FRJA 3M2RA 1RTIA 4OZ0A 1YZ6A 2CUYA 2BR0A 1NRKA 2FUG9 5F41A 2FZKB 3AQOA 4WPAA 4ECRA 3RBXA 4X4OA 3PW4A 2ADCA 1T7PA 2NPFA 1WKJA 4F67A 2VG6A 1SIWB 1UPPA 2A3JA 3LALA 5K14B 2C3PA 2Y0SD 2MMYA 3CCJS 3CC2S 4DR3F 5HP1A 3KOAA 4W90B 3R5JB 2HFOA 4FKYA 5J2PB 3PRBA 3TYTA 1SUQB 2M8DB 2I1RA 5CABA 5IT0A 1MG7A 3T9NA 2DNMA 4IQXA 2UVRA 1JQGA 2XYHB 3TUZC 3OHAA 3VAJA 1EX8A 2IDEA 3BO2A 4ZVGA 2UVUA 2XWYA 1RT5A 3M30B 3H2LA 3R5DA 3QSYB 3CD5A 1OWXA 1ZZFA 4ZLNA 1D9DA 1RAAB 1MWYA 5DDOC 5CA5A 1R8PA 1KWMA 3NWRA 3DRSA 4ZLJA 2FHOB 1QD1A 2PFDA 1T95A 1IQZA 1NSKL 3W5YA 2W9BA 3Q8PB 2G1DA 2GVZA 3FSXA 4IFYA 2AYMA 1WEYA 4L74A 2JH3A 1NPRA 4KC5A 4WU2A 3RU0A 4Y28C 1T9WA 3RJMB 5AE1A 4I2QA 4F25A 4XK8C 2A0FB 2OD6A 2X3DA 2VBYA 3OQ2A 3AJ2A 3HHLC 4HEA9 1HIYA 2B4PA 1MN9A 4ZPDA 2D9OA 2XMJA 3IC1A 1WC3A 1XQIA 3FRZA 1VQ8S 2F1FA 1Y10A 3A8JA 1VIXA 2V8GA 1RWNB 4DU7A 4YQWA 3ZNUA 2XC9A 4OHYA 3ZZYA 5C42B 4ECUA 1NK7A 1EIYB 2QV6A 3A13A 5J1NA 1N6QA 4KBIA 3CCMS 3IGNA 1GMUA 1RAGB 2HBQB 3ENAA 1U25A 1S1WB 3MR7A 1RAHB 3ICLA 2RHQB 4PPZA 4AUKA 4ES1A 5GADU 3TO8A 4TU7A 2Q6CA 1UW9A 2H54B 2V4JA 3BF4A 3MEEA 4DV2F 2WZ1A 4Y2AA 5KFJA 4C4WA 3D2WA 2HFSA 2DR6A 3IR7B 2B9XA 4X66J 1H2VZ 1TV6A 1ZM2A 2IBOA 3PG9A 3RAQA 2ZC3A 1RT7B 1VBKA 2K8GA 3B78A 4Q7AA 3JAMU 3MUTP 4ELVA 3K0JA 3V81B 4PRFA 1RWWB 1U0SA 3KLEA 3UCZP 1Y11A 3P49B 2NUHA 3CCVS 3E01B 2KYZA 3MPWA 1QTNB 3THTA 3NNCA 2YWFA 3CDBA 2VH7A 9RUBA 5C5JA 3FFIA 4CWBA 4AL6A 3HJFA 2LMIA 2W9CA 2LEBA 3T1HJ 3K2YA 2ACYA 3M9NB 3VZIA 2ZH3A 1C0TA 4DR7J 2HVHA 5ETLA 2DR9A 1YZ7A 3M1VB 3MEGB 2CAJA 1GT8A 3LP1A 4MYTA 5LMNF 3S8SA 3BGOP 1KC8T 1HD1A 2F7VA 4KGXB 4USMA 3DYAA 1NU4A 1RWXB 4FNHA 1CQNA 1GMWA 2LFVA 4DR7F 3PDNA 2RUGA 4AXJA 1M5KC 4KV8A 2MGZB 2FB0A 2ZM6J 2B6AB 2DIVA 4HI1A 2CQ3A 5A8WA 4DV3J 3B4DA 2KFYA 3RBEA 2GX8A 3MAHA 2YNGA 3MOZA 4HR2A 4UT4A 3KUHA 5D4OA 1SJFA 5ETPA 3ETMA 3K5MA 4NLSA 5EUHA 2HRUA 2O1PA 3MM7B 1WC5A 4LRCA 2LA6A 2W2PP 2BKPA 4WF9Q 2G4BA 1N48A 1N5SA 3MUMP 1RSCA 1D9AA 4IG0B 2BEFA 4DX7A 3ZC4A 1RXOB 2ZH9A 5HBMA 3T5HA 2YY3A 3HVWA 3G96A 3EMTA 1T94A 4QWAA 3HFKA 2OEJA 1AFIA 1U1RA 4OI6A 3Q8VA 1NHVA 5DG9A 4JB8B 4B9SA 3TX0A 3EDRB 4J7CA 4YB6A 4O3QA 4ETZA 2PMWA 1N88A 2HEKA 2J7UA 1KTQA 1RGVA 3H2UB 4XPCA 1SKRA 2ASDA 2BKOA 1RTDA 1RWPB 5F8NA 3UD5A 2XMMA 3OR2B 4OFZA 3HO1A 2XHCA 1AUSL 3MAAA 1VFJA 4DL6A 2FJXA 1VRQC 2W7AA 4K2JA 3DRYA 1VBZA 5MAOA 4MK8A 2LQ5A 4P2FA 1F0XA 3I87A 4TLQA 3RG6A 3FSYA 3WHIA 4C8ZA 2UV8A 3IWLA 3GJQB 5C25A 2OFHX 1HLWA 2I9SA 4HHUA 4L3KA 1ZYQA 3OTOF 3DCAA 1NHUA 3EM1A 5J2MA 1N54B 1FE0A 4G65A 2MKHA 4JBCA 3FK4A 2QSFA 1X4CA 2AJQA 4CT8A 4ZOSA 1FDDA 3BH6B 3FEXB 3AHPA 1R8CA 3KLIA 3T1YF 1VISA 5CAAA 5KFIA 1JK9B 1SJQA 1H7WA 1TP7A 1UEVA 2WSFC 3NS6A 4U7CA 3GIMA 4F4WA 3BO4A 2YH1A 4ED4A 3HT3A 4F3OA 2QO3A 5LJ5Y 3C8YA 3MM5A 2D69A 5LL6d 1S1UA 2I5JB 3AT1B 1I94J 4KHPF 3CT9A 2OAUA 1U0HA 5DG7A 1FESA 1VJWA 2W7PA 2FHMA 4OZNA 4ANCA 2IA6A 2R2SA 1S1VA 2AEFA 3GMGA 1FD8A 4LREA 4M5IA 1QDUB 2R8IA 4U7UD 4NEZA 3W8PA 3IRXA 1UEUA 2QFIA 4K2XA 2PDAA 4K4TA 4DV5F 5DQHA 2E1MC 3QRRA 3FC9A 2YPYA 3BPSP 3M32A 4DV0F 1WUUA 2VPZB 1YQHA 4FZVA 2RT3A 1Q79A 1XEZA 2E5HA 2V8PA 5HJXA 1FFWB 1HBUB 5KFCA 4P75A 2RQ4A 4DV4F 3W61A 3PYDA 4LBPA 2ZJPQ 2XQCA 2ASLA 2GQ2A 4HACB 1U1OA 4K0KF 4ZVUB 3KJFB 4JI1F 3MDFA 3DHWC 3EVOA 4P6QA 4M94A 3E2EA 1LK5A 1SC6A 2QT7A 3NLCA 3MM6B 4A4JA 2MQQA 4QU6A 1VQOS 1VQKS 2XMKA 5T7LB 1F9FA 4PXEA 4LFBF 3D6TB 4OI1A 2RQCA 1N32F 3RR8A 4RPFA 3GIRA 1BE4A 4JUZA 4USVA 3UFCX 1ZA2B 2IHR1 3CCWA 2DGXA 3HLUA 4J9KA 4IDKA 1T02A 3TA2A 1AZSA 3GR0A 5ITHA 4JYAJ 4MT1A 3W2WA 4R5PA 1J27A 3THPA 2ZE2A 1Q5YA 2GMLA 3DN9A 3CCLS 2I5JA 3W2VB 4A8KA 1ELOA 4DL7A 2DY9A 3DOKB 2XLKA 4ZVQB 1NKBA 2N82B 1VRUB 2XULA 3BKTA 4I6WA 1KLNA 2B5JB 4IR9A 5KT6A 2IM1A 4JI5F 3LGHA 2FD2A 2MY7A 6FDRA 2ZOGA 1N5TA 4OHWA 1U48A 1SJ3P 1VBXA 2D3ZA 4Y3CA 1FXLA 1OMSA 2CXEA 2ZUGA 3QWPA 4O0IA 2CJBA 1LWXA 3Q2SC 3LF0A 4FPRA 5KFWA 2YX4A 1UJ4A 1ZZNA 2P5VA 1RBOB 2E1RA 3MD1A 3SDEA 2JLGA 3BJYA 3W3SA 5KG6A 1SPBP 2RSQA 4DCPB 3I9V9 5KFZA 2R8GA 2HNZA 4ID5B 3K7RA 3RUBL 4U67Q 2QTWA 2CPFA 2KJVA 2MKJA 4ZJOA 4Y2IA 1OO0B 2IJNA 5IC6B 3VCDA 4HVZA 4GO7X 1S1XB 4X64J 2ZDOA 1D8YA 1WHVA 2HNYA 1VQSA 4QPTA 5IC4B 3HHLB 2ATLA 4WE1B 1NO8A 1PYOB 2DB1A 3PO4A 4M95A 2B4OA 3B82A 3LP2B 3TUJC 5HK4A 2ZD1B 3K5NA 2WW8A 1KQKA 1C1BA 2XCPA 3V6DB 2VPYB 2VONA 3FEZA 2VFTA 3J7A1 1S72S 3K17A 5D77A 4HKQA 1SJRA 2E5LJ 1ZH5A 2DGQA 2JNJA 4I69A 4PXCA 3POTB 5HAOA 4UY85 2R7TA 1RTHA 1A9NB 4LSLB 5IS2A 4QYZK 3OPKA 4Y2CA 4J9OA 4CLZA 1DRZA 1MU2A 4MKVA 3TQEA 1LQ9A 2O01C 2Q6BA 3N6MA 2KO1A 5KFGA 2ILZA 3R1HA 1FT8A 3MM7A 1CSJA 2GW8A 1N33F 2VC1A 3FUYA 4KB7A 1FVQA 3BQ0A 1DURA 4OI2A 3UE2A 4C8NA 2AMCB 1PBUA 3HX9A 2B9WA 1X4FA 4DQRA 1U4BA 1FKAF 4U95A 2R42A 4ID8A 3K5LA 1TKXA 2XS7A 2N4DA 3ZZOA 2PIIA 3IAM9 4Y2KA 4DR2J 4CRJA 3BKUA 4ZVEA 1L3TA 3DXBA 1WG5A 4ZA1A 2EVZA 4DUYF 2PEBA 1FDNA 3TR5A 3QGPA 4C8YA 3H20A 2BANB 3BYPA 4YN3B 1CJKA 4RNHA 1RAJA 1HNXJ 2HFUA 2IY5B 2RJZA 2CQGA 3D9BA 4WU3A 5CYQB 1DZ5A 2F9JA 1V3ZA 3DOKA 5B0EA 3K57A 1SL0A 1NH8A 3G6ES 5B0DA 1HNWF 4DL0C 1V3RA 3EXCX 2BA9A 2CJYB 5GMEA 3PFEA 3NP5A 3G86A 1N34J 3PW7A 4E0DA 5B08A 3CW2C 2UV8G 1PSDA 1IKXB 2DCUB 4TLRA 1SB6A 3EGNA 2V2QA
chains in the Genus database with same CATH topology
2P2CB 4DCJB 1RE1B 3IBFB 2XYPB 1I3OB 2CDRB 1RWXB 2QLBB 3D6HB 2H5IB 1GFWB 2XYGB 4ZVOB 2CJXB 3R7BB 1RWMB 3GJTB 2HBRB 4ZVQB 4ZVPB 3QNWB 2DKOB 2XZDB 3GJSB 3KJNB 1F9EB 4LSZB 3R6LB 2CNLB 2Y1LB 4DCOB 4JB8B 1RWVB 1RHQB 3EDRB 2C1EB 2H5JB 2CNKB 2H51B 4DCPB 3R5JB 2QLFB 3P45B 1RWPB 2H65B 5K20B 2CNNB 3D6MB 2C2MB 3EDQB 2XYHB 2FQQB 5IC6B 4ZVSB 3R6GB 5IC4B 3GJRB 1PYOB 1RHMB 3SIPB 1RHKB 1SC3B 2H48B 2XZTB 3GJQB 1PAUB 3D6FB 2HBZB 2C2KB 3P4UB 3NS7B 4ZVTB 3RJMB 2CNOB 2Y0BB 1BMQB 3R7NB 2C2OB 1SC4B 1RWOB 1RWKB 1SC1B 2H4WB 1RWNB 2QL5B 2HBYB 4ZVRB 3KJQB 1RHRB 1QDUB 1RHJB 2HBQB 1I51B 2QL7B 3R7SB 2H54B 2C2ZB 1NMEB 2QLJB 3IBCB 1ICEB 1RWWB 1RHUB 2H4YB 2QL9B 1QTNB 4ZVUB 3KJFB 2CJYB 1IBCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P2C B;  4DCJ B;  1RE1 B;  3IBF B;  2XYP B;  1I3O B;  2CDR B;  1RWX B;  2QLB B;  3D6H B;  2H5I B;  1GFW B;  2XYG B;  4ZVO B;  2CJX B;  3R7B B;  1RWM B;  3GJT B;  2HBR B;  4ZVQ B;  4ZVP B;  3QNW B;  2DKO B;  2XZD B;  3GJS B;  3KJN B;  1F9E B;  4LSZ B;  3R6L B;  2CNL B;  2Y1L B;  4DCO B;  4JB8 B;  1RWV B;  1RHQ B;  3EDR B;  2C1E B;  2H5J B;  2CNK B;  2H51 B;  4DCP B;  3R5J B;  2QLF B;  3P45 B;  1RWP B;  2H65 B;  5K20 B;  2CNN B;  3D6M B;  2C2M B;  3EDQ B;  2XYH B;  2FQQ B;  5IC6 B;  4ZVS B;  3R6G B;  5IC4 B;  3GJR B;  1PYO B;  1RHM B;  3SIP B;  1RHK B;  1SC3 B;  2H48 B;  2XZT B;  3GJQ B;  1PAU B;  3D6F B;  2HBZ B;  2C2K B;  3P4U B;  3NS7 B;  4ZVT B;  3RJM B;  2CNO B;  2Y0B B;  1BMQ B;  3R7N B;  2C2O B;  1SC4 B;  1RWO B;  1RWK B;  1SC1 B;  2H4W B;  1RWN B;  2QL5 B;  2HBY B;  4ZVR B;  3KJQ B;  1RHR B;  1QDU B;  1RHJ B;  2HBQ B;  1I51 B;  2QL7 B;  3R7S B;  2H54 B;  2C2Z B;  1NME B;  2QLJ B;  3IBC B;  1ICE B;  1RWW B;  1RHU B;  2H4Y B;  2QL9 B;  1QTN B;  4ZVU B;  3KJF B;  2CJY B;  1IBC B; 
#chains in the Genus database with same CATH topology
 3MPU B;  4CM2 A;  3A3P B;  3CMA S;  4DF8 A;  4L73 A;  3PIO Q;  2YWW A;  4HH0 A;  4RW4 B;  2IC3 B;  5A8W B;  1NB7 A;  1N5Y A;  3PEJ A;  1HMV B;  5H9F J;  4DPU A;  2FLN A;  3N79 A;  3FEY B;  5A8R A;  4EZ6 A;  3J81 j;  4A8O A;  2QE5 A;  2E5G A;  4KY3 A;  4CLP A;  2RVJ A;  1JLA A;  3L4B C;  3CF5 Q;  1VHF A;  1R8H A;  3DMJ A;  1QAI A;  1IBM F;  1WHX A;  3D6H B;  5C2C A;  4PWU A;  2I8E A;  2NXE A;  4RW8 B;  1KBR A;  2POK A;  4A46 A;  1VOM A;  1HI8 A;  4J9N A;  1RZM A;  4ZLL A;  2VBZ A;  2WAQ D;  3N28 A;  5AXL A;  4X4N A;  3T9Z A;  4QYZ J;  3DFE A;  3TJ8 A;  3CVK A;  4CO4 A;  3OTO J;  1TMJ A;  2HBR B;  2RKI A;  2VU5 A;  3L7O A;  3UCG A;  2D3O 1;  1YSJ A;  1IBK F;  3UVJ A;  4HAC A;  2Y1J A;  1S1T B;  4QWE A;  3BDE A;  1WOR A;  3NEK A;  3VHQ A;  3LP0 A;  2V67 A;  5HQL A;  3M2U A;  1YHQ S;  5ETM A;  3VTI A;  2WCX A;  2KRR A;  1RJJ A;  4OZL A;  4OYO A;  3F73 A;  1VQ5 S;  2ZUA A;  4KGK A;  5B7W A;  4Q45 A;  2LXF A;  3H8Y A;  4C98 A;  3LWL A;  4C6A A;  4FXV A;  3DRS B;  1EJ7 L;  1DQ8 A;  4FYD A;  2CQC A;  2XEX A;  5T7L A;  3J7Z 5;  1LW2 A;  1U7L A;  2AGQ A;  4O3P A;  4W92 B;  5E3Q A;  1U45 A;  2CNK B;  4BCA A;  2XSJ A;  5T41 A;  2HVZ A;  3AJD A;  3EZ5 A;  1XMQ F;  1RAO A;  1HFE L;  2MYF A;  2NXJ A;  1M0S A;  4K4Y A;  2C2M B;  4G6V B;  4Q2L A;  4DV0 J;  4W4M A;  3HHL D;  4MAK A;  2RHS B;  4H54 A;  3BN4 A;  4NLR A;  4AQY J;  2BKN A;  1ZTT A;  2UUA J;  2LDI A;  1HI0 P;  2GC8 A;  3Q8U A;  3PR4 A;  1HR0 J;  3KTQ A;  3KG4 A;  2KN4 A;  1HQE A;  2QG9 B;  4TKT A;  2IM2 A;  2C2D A;  3U27 A;  4ZLP A;  2BAC A;  3T5L A;  1O6X A;  5KTQ A;  3PIP Q;  1FXD A;  1IR2 A;  4TXS A;  1NAQ A;  5KFK A;  3OFF A;  2KH9 A;  4DQQ A;  2HMI B;  3SV4 A;  2MKS A;  5HMX A;  1CS4 B;  3VGS A;  4NWB A;  4NYZ A;  1NLK L;  4I68 A;  5FDL B;  5K5M A;  2GQQ A;  2MHE A;  5IOL A;  4ED0 A;  1CVJ A;  3M7V A;  3O44 A;  1Q8I A;  1S9G B;  1WEX A;  1OJ4 A;  1P1T A;  4DSI A;  4OIX A;  3DLJ A;  3PX4 A;  4OV1 A;  2BE2 A;  2YVS A;  4DR4 F;  2CIM A;  1RWK B;  1CJT B;  1SC1 B;  2A10 A;  2KXF A;  2J9E A;  1IM6 A;  1DLO B;  4NCG B;  4ECV A;  3MUR P;  2PC6 A;  2ZVI A;  1N5V A;  2NYI A;  3U7J A;  1FRL A;  2WVF A;  4CO2 A;  3AOD A;  2IFX A;  2JFK A;  2DVI A;  4IRK A;  4B3R J;  1EKS A;  4NA2 A;  4RL1 A;  4TNO A;  1FX2 A;  1ZOT A;  5K14 A;  5DG8 A;  1M1G A;  2OML A;  3O3L A;  1WG4 A;  3DDI A;  1VK3 A;  4C3M A;  3DI6 A;  2PGC A;  3I5A A;  4TVA B;  1NME B;  5BJR A;  3A12 A;  1SXL A;  4FVC A;  4DSF A;  1K73 T;  1WF2 A;  4WTY A;  2QEX S;  4PG6 A;  1G6B A;  2BJE A;  4QIG A;  3SXL A;  4J9U E;  4M5M A;  3TJA A;  2OPS B;  1NJW A;  2NRE A;  4CO5 A;  2FDN A;  4JI6 F;  2V63 A;  1UP1 A;  4IO1 A;  4AFF A;  4RJV A;  4C3K A;  3BSN A;  1TFY A;  3MZI A;  1SBR A;  2AF6 A;  2H4Y B;  2K1R B;  3HT0 A;  4E8U A;  1LXN A;  4I4B A;  4KR0 B;  1TVR B;  2BDP A;  4NPO A;  2OPR A;  4JYA F;  2XS5 A;  5KFQ A;  5D0R A;  2AJ4 A;  1AA1 B;  3CMQ A;  3QJL A;  1U1N A;  5IWA J;  3M8Q B;  5ETR A;  2LEP A;  1T3N A;  5CYM B;  2ZIT A;  1FRM A;  2B6A A;  3OHB A;  5I42 A;  4PEO A;  2VJU A;  1FWL A;  1HW8 A;  1P1L A;  4DR5 F;  4DQS A;  2HQG A;  3GON A;  2BM0 A;  3H4B A;  5DM7 Q;  3BGF A;  3OTB A;  1FJE B;  3NAH A;  3DYA B;  1ITP A;  3GG1 A;  2WON B;  1DJ0 A;  4BDP A;  4WYW A;  4RUC A;  1A7G E;  4ZPW R;  1C0T B;  3BEG B;  5RUB A;  4OX7 A;  2VQF J;  3VAK A;  3I9Z A;  4OHZ A;  4ZPV R;  1IR1 A;  1H0H B;  1K1Q A;  3C6T B;  2RNE A;  2BM1 A;  1T11 A;  2JL9 A;  2MQM A;  2DYA A;  3N0V A;  4C0O C;  2ZWO A;  3VQS A;  3A3O B;  4KIA A;  1Q82 T;  2V8H A;  3T6B A;  3QGG A;  4NMX A;  4QIE A;  2MGZ A;  2RF2 B;  1ZBT A;  2F8E X;  3ET6 B;  5LMN J;  1U1Q A;  2NR0 A;  1RT3 A;  5GAE U;  2BXJ A;  4QWB A;  3M2U B;  2EKN A;  3TNV A;  3MEE B;  2WW4 A;  2GHV C;  3JS9 A;  1PC4 A;  2MTL A;  1JLG B;  4B3S F;  3NMR A;  2ZEJ A;  2E7X A;  2EI5 A;  2JDJ A;  2CYY A;  2LU2 A;  4Q5V A;  2FY1 A;  2BX6 A;  2HVD A;  4UZB A;  5KT5 A;  2NQP A;  1KKH A;  2F65 A;  1EAY C;  4OJH A;  2DNO A;  1NUE A;  1S76 D;  1R3N A;  1GH8 A;  4RW8 A;  5K20 B;  4M5L A;  3HDS A;  4LFA J;  5KG5 A;  2HLT A;  2M8H A;  2AU0 A;  2AJF E;  1U6F A;  2ZBR A;  3UN2 A;  1B99 A;  3OXG A;  3R6G B;  4UTG A;  1TAU A;  1WKL A;  2BQ3 A;  4R25 A;  1LWC B;  1N36 J;  1NSA A;  3W5Z A;  3J81 Y;  4JI0 J;  3BZQ A;  3SBM A;  2KDO A;  4Q2M A;  1R27 B;  4PAB A;  3MCM A;  1D3W A;  1SH2 A;  2W9B B;  1RAC B;  3BGR B;  4CYU A;  4OMF G;  2MQO A;  5F8L A;  5D15 A;  1LW0 B;  4DSJ A;  1NXI A;  2GGP B;  1WKK A;  2C2K B;  2OFG X;  3CDE A;  3AD9 C;  3ITH A;  3PXG a;  2FC8 A;  3UNY A;  4ENO A;  4UOG A;  2ZH7 A;  4DR2 F;  2K1R A;  5HQ8 A;  4WP8 A;  1N6Q B;  3W1Y C;  2KZZ A;  4UW2 A;  2IA0 A;  3K89 A;  3M6X A;  4I7F A;  1CJU A;  2VBW A;  3M6V A;  2HND A;  5KFV A;  5KOW A;  5KFN A;  2RS8 A;  1YRT A;  1S0V A;  3M2V A;  4CLS A;  2OPS A;  4ED8 A;  3TJ9 A;  1Q8K A;  3Q0A A;  2ZBP A;  2B43 A;  3BR9 A;  3FJ2 A;  1KN6 A;  1IBM J;  4F7V A;  1SQG A;  5EHH A;  5C24 B;  2OP5 A;  5B0A A;  5DZ6 A;  3G8S A;  3P8B B;  1AFJ A;  1QVG R;  4URG A;  5EN1 A;  4ZJQ A;  4Q43 A;  2HGN A;  1J5O B;  1HQ2 A;  2KJW A;  3NG8 A;  4PKD B;  4CNZ A;  3EPI A;  1RHR B;  4J37 A;  2VG6 B;  3M9O B;  2DNL A;  4LSN A;  3GIK A;  4F2S A;  3M8Q A;  1RLD A;  2NXC A;  2D3O R;  4FF3 A;  3PJX A;  3FNN A;  3U1N A;  3ISZ A;  2KKH A;  3CIZ A;  5ETV A;  2PFF B;  1P6T A;  2YPZ A;  4F3M A;  4LQ9 A;  3IBC B;  4ZPA A;  2B7B B;  1HNV A;  1H2T Z;  1IKY A;  3QT6 A;  3BDP A;  2RRB A;  2VV5 A;  1SCJ B;  3ISN D;  3DRR B;  3KG1 A;  4QIV A;  4IYQ A;  3BBB A;  1T9T A;  1U2F A;  2NYH A;  3HI9 A;  2ZBQ A;  3HJV A;  3KDO A;  4M5J A;  4J9R A;  1WD6 A;  4DUY J;  4GC6 A;  5A8K B;  3R2C J;  5EGY A;  2AHO B;  4B9T A;  5L8R C;  3MCO A;  8ATC B;  1S0M A;  5DDQ C;  1S49 A;  1Q78 A;  1TL1 A;  2CQ2 A;  2U1A A;  4NOH A;  4J9S A;  1MWQ A;  3IRW P;  2WK4 A;  4ZS6 A;  3QO9 B;  4WFA Q;  3OL9 A;  3PX6 A;  4DQI A;  1QSS A;  2GMJ A;  1J5O A;  1WC4 A;  3HHK A;  4B02 A;  1VI7 A;  5H9E K;  2HRY A;  1S99 A;  4Q8F A;  4P7V A;  3QT7 A;  4Y34 A;  3K59 A;  2MLX A;  4LF1 A;  2BRL A;  3NCQ A;  2JEJ A;  3N9U C;  2CVE A;  3HVT B;  2M2B A;  3W5X A;  1IUJ A;  2X1F A;  2XCA A;  2XGQ A;  3EWG A;  3NBP A;  2OLW A;  1AT1 B;  3I4H X;  5DDP C;  1UWA A;  3LH2 S;  5J2Q B;  1CJV B;  2ZJR Q;  2ASJ A;  3K8W A;  1HYS B;  1RU1 A;  3D28 A;  1Y0H A;  2KRB A;  2ROE A;  1GX5 A;  1HNI B;  4WP9 A;  3QRQ A;  2CPY A;  3QYY A;  3OR1 B;  1WF0 A;  4DV6 J;  1S9E B;  1OPI A;  3J7Z T;  4OYM A;  2DR7 A;  1VK8 A;  4ES2 A;  4WFB Q;  4F4K A;  3IS9 A;  3L95 X;  1Y7P A;  3A8E A;  4EGL A;  1S6Q B;  4UUX A;  1JXE A;  5ETS A;  2EFG A;  2EW9 A;  2IIH A;  3HSZ A;  4X66 F;  3WDO A;  1HQE B;  1D8Z A;  4O44 B;  3I31 A;  4ZIW A;  2R9L A;  5KT2 A;  3KJN B;  1F9E B;  2V68 A;  2B5J A;  3B6B A;  3LP0 B;  5KAK A;  1HHQ A;  3OL7 A;  4MK7 A;  4NA1 A;  5U47 A;  1H98 A;  4DCO B;  1J5E F;  3TX8 A;  4FXD A;  2ROG A;  3FMW A;  2YKM B;  3G87 A;  3NGK A;  4YB7 A;  5D4N A;  3TZW A;  3I0S A;  1TR0 A;  2R3V A;  2B51 A;  5EWF A;  2G2Y A;  3R5C A;  4OL8 A;  3KK2 A;  1A0O B;  1B0P A;  4QR0 A;  4DF4 A;  4NXM J;  3IM8 A;  2CQH A;  4JOU A;  1ZS6 A;  4TY9 A;  3S01 A;  3UR0 A;  2V2K A;  3AOA A;  3CJ4 A;  2BE7 D;  3W2W B;  2R8H A;  1FFS B;  1NK8 A;  1WWH A;  3DMJ B;  2OGU A;  3TUI C;  5A6W A;  1UA1 A;  1XK8 A;  1LV5 A;  4KGV B;  2MZQ A;  1QE1 B;  2HPU A;  2EKY A;  2ZKU A;  4DI6 A;  1RT4 B;  4DFM A;  2YWG A;  2OTL S;  2RF2 A;  3ILO A;  2EFV A;  3MPY A;  4Z37 A;  1HMV A;  1H6K X;  1JJ2 R;  4RW4 A;  2Z58 B;  1YIJ S;  4P2S A;  3BQ2 A;  3OTC A;  3BS9 A;  2OPP B;  1HKA A;  1U24 A;  1SJ1 A;  2XI2 A;  3D54 A;  2CDQ A;  2FLL A;  4DLE A;  4PQU B;  3C6T A;  4BC7 A;  4ECZ A;  3DM2 A;  3KYL A;  3TUP A;  2AQ4 A;  3M8P A;  4RR5 A;  4ZCK A;  5D0G A;  3I5B A;  3MMA B;  2J76 E;  4FYW B;  1WOP A;  4PZV A;  3R97 A;  1U6B A;  2WON A;  4LFB J;  1LWF A;  4USJ C;  1SI9 A;  3S7R A;  5L1K A;  2C2O B;  1S79 A;  2RDD A;  4KKO A;  2A2D A;  5KFU A;  7FD1 A;  4ZIT A;  2E9R X;  1NK9 A;  1JLA B;  2DXD A;  2KVI A;  2O3D A;  2HQD A;  3MGJ A;  2V4Q A;  4BWM A;  4TY8 A;  3IWX A;  3ILI A;  2ALY B;  2YKA A;  4NLU A;  1T0T V;  3BR8 A;  4LR8 A;  2XLI A;  3HHD A;  4DEZ A;  2DHS A;  2I0X A;  2VQF F;  1OY9 A;  1VR6 A;  4K59 A;  5GAG I;  4M5N A;  1S7H A;  5B0B A;  4RZR A;  4FF2 A;  2VG7 B;  4K7Q A;  4EYI B;  1Y3K A;  1YK9 A;  3UN3 A;  1U0H B;  2AGP A;  3I6P A;  4WJB A;  2QA2 A;  4IR1 A;  5HO4 A;  3MF5 A;  2QA4 G;  1S9F A;  4JI5 J;  3D5M A;  5CYQ A;  1QVF R;  4I2P A;  3R3T A;  1Y5N B;  2CKW A;  4RBV A;  4DLG A;  2BAN A;  1R89 A;  4F4X A;  2LEC A;  1L3K A;  2BQR A;  2QL9 B;  3CJ0 A;  3D3C J;  3OFG A;  1HPZ B;  4ILL A;  3IA0 A;  3ZZR A;  4DFK A;  4WFZ A;  1ZAW A;  3QIP A;  1FEH A;  3KMS A;  1Q95 G;  4I1T A;  4WTO B;  4FPI A;  1Q4R A;  3NRB A;  4DBQ A;  4LR9 A;  3GV7 B;  4OX9 J;  4AND A;  1N0U A;  1RE1 B;  3LP2 A;  3M8Z A;  3OFE A;  2GHP A;  2ALZ A;  4QU7 A;  1SKW A;  2AWZ A;  2W2M P;  4WE1 A;  1BQM A;  3V4I A;  3GFH A;  1T05 A;  8RUC A;  2HWT A;  1SIZ A;  4LIR A;  4OYW A;  3MM9 B;  3PRD A;  3TZZ A;  3OJU A;  2HNZ B;  4ID5 A;  2HHH J;  1ZAX A;  2OJ3 A;  4N76 A;  4FF1 A;  4X4V A;  1ULR A;  2FVR A;  4Z2X A;  5F0W A;  2PI4 A;  2E5L F;  1PJ7 A;  3BRE A;  5EDW A;  3DLL Q;  3CJQ A;  1XR7 A;  2AYB A;  2A1B A;  4QOT A;  4R0E A;  2VIC A;  2J9D E;  4X4T A;  1L3U A;  2NXN A;  3PRV A;  4DV5 J;  3KLV A;  1JXL A;  1V9O A;  3NNA A;  5IV4 A;  3EGV A;  3CED A;  5DRK A;  2HFN A;  3AD8 C;  4F26 A;  1UAW A;  4P2X A;  2PMZ D;  3WX4 A;  4OZ3 A;  5K8O A;  5FLX U;  2AGO A;  1S10 A;  5IT9 U;  3HHL A;  1EB0 A;  1N36 F;  5J1E A;  1MWZ A;  4H4O A;  3NMA A;  2HS4 A;  2I38 A;  4IOB A;  3SFG A;  1YJT A;  3SSR A;  3W2V A;  2J6U A;  3NL0 A;  2J0X A;  2BE9 B;  1UVK A;  2XSJ B;  2HW3 A;  1RUS A;  2GV1 A;  5DM6 Q;  3W66 A;  2DNZ A;  1AUD A;  1XR6 A;  4X4U A;  4KHR A;  1LW2 B;  3HCX A;  1AZS B;  1IWA A;  1PIL A;  2WVD A;  3EVW A;  3P45 B;  1FK9 A;  5FJ4 A;  2DIS A;  2UXC F;  1X5S A;  2K7K A;  2R7R A;  2MQN A;  5MLC V;  5L1L A;  4OX8 A;  5LJ3 Y;  1TAQ A;  4PXB A;  3BO3 A;  1HNZ F;  4ZVS B;  3SCL E;  1T9V A;  2BOA A;  2OEL A;  3CXC R;  4EBD A;  3GJR B;  2RAQ A;  3S1T A;  1RB0 A;  3HXM A;  4ZN3 A;  4OYX A;  3C19 A;  1YJU A;  3GV5 B;  1RHM B;  3FRY A;  2HVI A;  1CEZ A;  1RTJ A;  2ZDP A;  2UUC F;  4DUZ J;  3ZTS A;  3LOU A;  2Y8W A;  5ETK A;  3RYL A;  3ZZT A;  2HWI A;  2IMO A;  3UCU P;  4R8U B;  2YKM A;  3SCJ E;  1T8E A;  2UXD F;  3OVB A;  2WHO A;  2HHX A;  3BQ1 A;  3QJJ A;  1QLN A;  3DXS X;  1QUP A;  1C0U A;  4ZJL A;  3RBZ A;  2APO A;  1HWJ A;  2L9N A;  4DUT A;  1U47 A;  2CJA A;  3KK1 A;  4ICL A;  4CO1 A;  1WHW A;  4JI7 J;  2VA3 A;  1WI8 A;  2J5A A;  2CWK A;  2BVZ A;  2WRM A;  2HHT A;  1EET A;  4NZ6 A;  2YKN A;  1NND A;  4LF7 J;  5KFE A;  1S77 D;  3OJS A;  1NK5 A;  5AXK A;  1TKT A;  2YX1 A;  3ZXW A;  3FSI A;  1W25 A;  1WJ9 A;  1EET B;  2MDA A;  3X3U A;  3W9J A;  4AXI A;  1UZD A;  1U26 A;  2G0J A;  4F04 B;  4YME A;  4FN5 A;  2EBG A;  3J80 Y;  1N5Y B;  3IRX B;  2FJW A;  4ICL B;  1RU2 A;  4LF2 A;  4MIB A;  2HBY B;  3MR2 A;  2UUC J;  1CLF A;  1JWW A;  2WVB A;  1VGY A;  1IKX A;  1EAR A;  1PG5 B;  2R7O A;  4KH0 B;  5AE2 A;  2MKY A;  4K4U A;  1KP6 A;  1IKW B;  3DRP A;  2GJF A;  1D09 B;  2P8I A;  3R7S B;  3GQC A;  3QGH A;  3DLH A;  4R8U A;  2FJA B;  4PG4 A;  4Y00 A;  3CJ2 A;  3LPE A;  3GZ7 A;  1NB2 A;  3D1Q A;  3KWM A;  4OHX A;  5J1E B;  1FRI A;  3HVT A;  1AW0 A;  1M5H A;  1WC6 A;  4F0H A;  2CPI A;  3KK3 B;  1XR5 A;  2M0G B;  2L3M A;  3GB0 A;  2VFS A;  4I2Q B;  4USI A;  3RB0 A;  4AT1 B;  2EG2 A;  3TVK A;  2COL A;  3M8R A;  3FQK A;  3QO9 A;  4FXW A;  1B4S A;  2HUR A;  1UA0 A;  1FK9 B;  2IJF A;  1B3T A;  5H1S V;  1X4H A;  1X4D A;  4HHH A;  4WBF A;  2DRB A;  2C2N A;  1IXK A;  3HSD A;  4RBU A;  2WVE A;  1HHS A;  3TVY A;  1RDR A;  4NA3 A;  1KFS A;  1G2E A;  2FGC A;  2YWK A;  5J2Q A;  1WI6 A;  3DRR A;  2B4U A;  2PMH A;  1HBO A;  3MED B;  2E5I A;  2MKK A;  5CCM A;  2E44 A;  3TQ1 A;  4ZP8 A;  4GVB A;  3SCI E;  3EJM A;  5HJY A;  4F50 A;  4QQB A;  3T5K A;  1MU2 B;  4J9Q A;  4O3R A;  3JSY A;  4LRD A;  5ETQ A;  3CD0 A;  4WCE Q;  1AB8 A;  4KRW A;  4DSK A;  4LF5 F;  4K4W A;  4GKK F;  3TEG A;  3GFY A;  2XYG B;  2ZBI A;  4TN2 A;  3GV8 B;  1YX2 A;  1I1G A;  2WB1 D;  1XBW A;  3OTE A;  2C22 A;  2CQ4 A;  1R6Y A;  4LBH A;  1F5A A;  3HP6 A;  5LT5 A;  4LR7 A;  3Q86 A;  3EPG A;  3C15 B;  1C1B B;  2CQI A;  2DHG A;  4X2B A;  4M1K A;  4CCH A;  3IR5 B;  4P74 A;  3M2V B;  3J80 U;  2HRT A;  3K58 A;  4IG0 A;  4DV7 F;  1TK8 A;  1RKI A;  4LUB A;  2AEM A;  2B56 A;  1SH3 A;  5D0H A;  4YDX A;  1NJZ A;  4FYY B;  1IKY B;  5CD4 A;  1Q16 B;  1T05 B;  4YFU A;  4NYP A;  2QMW A;  4MIA A;  1BQM B;  1YKW A;  4KSE B;  2IYG A;  2V50 A;  3O2I A;  1RHQ B;  2ZNY A;  2C1E B;  3TAQ A;  2QC3 A;  3M6W A;  1M5V C;  4IH6 A;  1Y3J A;  5L39 A;  1LWE B;  1S6P B;  2H5J B;  3SDE B;  2DT9 A;  3W64 A;  2F4V F;  4ETX A;  1P27 B;  1X9M A;  3TAP A;  3QIP B;  1FVS A;  1S6O A;  3R5A A;  1B70 B;  2ERR A;  2Z2Z A;  2NSB A;  4EZ9 A;  3NKY A;  5EWG A;  1YJ7 A;  1VC6 A;  2BJ8 A;  3J7Y U;  3HK2 A;  3LP1 B;  4C9D A;  4A8W A;  3DLE B;  3KUG A;  5BR8 F;  1CQM A;  1RA7 A;  2Z4P A;  3OD2 A;  3MCS A;  4V1A k;  2H48 B;  2HKE A;  4C8M A;  2BJ3 A;  2ZOM A;  4CT9 A;  3UI3 A;  2RDI A;  2VZ9 A;  4OJ1 A;  5HRO A;  4NRU A;  5HLF B;  5DET A;  3H25 A;  4IOC Q;  5E33 A;  4RW7 A;  4ITS A;  4PQU A;  5DLG A;  4Q0B A;  3GLJ A;  1PBA A;  1GMV A;  1CC7 A;  3GSD A;  2VQE F;  4CYU B;  1M1K T;  3CDU A;  3V2U C;  1VQ6 S;  3IFE A;  1SQF A;  4CNY A;  3CIM A;  3K5O A;  3L9Z A;  3N6L A;  3HSG A;  3NOG A;  3US5 A;  1PCA A;  4JV2 A;  4MFB B;  2KXH A;  1YJR A;  4M5K A;  2A6M A;  4M5D A;  3RRK A;  3JYT A;  4JI2 F;  1SJ4 P;  5LXY A;  3OL6 A;  2IRU A;  3H98 A;  4OZ2 A;  3HVR A;  2RS2 A;  1X9W A;  3I56 S;  4HLB A;  2FVP A;  4JI8 J;  2HHH F;  1EZZ B;  2CRL A;  3N5B A;  1WC1 A;  2YKQ A;  3D3B J;  3MEG A;  1K1S A;  5CHC B;  4CO0 A;  2ZZM A;  2UZA A;  4ZVR B;  1GNK A;  3KJQ B;  3C16 A;  4PR6 A;  2DGU A;  4I64 A;  3QGI A;  4HL9 A;  2XHW A;  4WIQ A;  3PZP A;  1RAB B;  2IRX A;  1I51 B;  1Z2Z A;  2CQB A;  3I0R A;  4DJB A;  3OLA A;  3L3C A;  5F3Z A;  2XNQ A;  4XDC A;  2MZT A;  1O8B A;  5D8H B;  3OVS A;  2G1H A;  2HAI A;  3CJ8 A;  4OI3 A;  3UR3 C;  3VAF A;  2GS8 A;  1U1K A;  2LP4 A;  3TA1 A;  3BKF A;  3V81 A;  2IBK A;  4DX5 A;  1HR0 F;  5KFF A;  1HA1 A;  1OYE A;  4U6P A;  3KFW X;  4J9V A;  1NKE A;  4B3M J;  2EC2 A;  2AZ3 A;  5ETN A;  4ANE A;  5AJ3 F;  1WDT A;  1YBT A;  4ZVH A;  1IBC B;  1BQX A;  3S6E A;  4ZP7 A;  4DL3 A;  1VC0 A;  4ALZ A;  3H59 A;  5CZV A;  4TU9 A;  2UVV A;  2NSC A;  1BUX A;  2GQC A;  1Y5L B;  5H9E J;  2W2N P;  1I6J A;  3OUY A;  1IBL J;  3MMC A;  3SI8 A;  1ZM4 A;  2BZ2 A;  3EYZ A;  3PO5 A;  3GYN A;  4DMZ A;  2AP6 A;  1WF1 A;  3M05 A;  3Q8Y A;  3NBP B;  4ED6 A;  4A8F A;  3FBF A;  1KEK A;  1CBK A;  3HSJ A;  3HFZ B;  2XGP A;  4A8S A;  4CLF A;  4C8K A;  3J7A N;  2BW2 A;  2JFD A;  3O6Q A;  3DI6 B;  3OBI A;  1JKH B;  2F9D A;  3U1L A;  2PA8 D;  4EWT A;  1BC6 A;  3MR6 A;  3H5U A;  3CCE S;  2EC0 A;  4JI1 J;  2X1G A;  1F1B B;  2AYG A;  5KFL A;  2ZH1 A;  2CQ0 A;  2J8S A;  1APS A;  5KOX A;  1M5O C;  5KG7 A;  1VBY A;  4P73 A;  3T19 A;  1NDL A;  4LFC J;  2O67 A;  3BYR A;  4YDD B;  4ELU A;  1UVN A;  2ZZN A;  3W9I A;  4TYB A;  2F40 A;  1JIH A;  4QR1 A;  3I55 S;  2L08 A;  2Q1L A;  4A47 A;  4KGZ B;  4CH0 S;  2FGO A;  1YJV A;  3GJS B;  5F0U A;  4QR2 A;  5JUM A;  3HHE A;  2MXY A;  2G2O A;  1KDN A;  4O4R A;  4LSZ B;  5FII A;  1S0N A;  1YJW S;  5D78 A;  2ZNZ A;  1LXJ A;  2VUG A;  2LCW A;  4IH5 A;  1W2I A;  4K0K J;  5GMD A;  4F0M A;  1CS4 A;  2HZC A;  1IR0 A;  3U02 A;  2HS3 A;  4ZPT R;  2PN6 A;  1SV5 B;  1ZPW X;  3NGT A;  2MJU A;  2WBM A;  5KFA A;  1JB0 C;  5I4M A;  2CPX A;  2QLF B;  3ADA C;  2DR5 A;  5DZ7 A;  1NSQ A;  3KHR A;  2ZZT A;  2WTF A;  1X9S A;  1M1H A;  3AXK A;  4GVB B;  2OEK A;  2I2Y A;  1CJT A;  4DPO A;  2DGV A;  5HVG A;  2P9C A;  3MED A;  2A2C A;  3EZU A;  4BBY A;  3A3N B;  1T03 A;  1S6U A;  3CNQ P;  1JLF A;  1BGX T;  1E6V A;  1G4C A;  3WX8 A;  1C4C A;  3MMC B;  1S4E A;  1V6H A;  3AH6 A;  3NOC A;  1HNV B;  4I0W A;  4PUO B;  3VQT A;  2FZC B;  1PAU B;  1Z4U A;  2HBZ B;  2RQM A;  2J8A A;  4HTJ A;  2MQ8 A;  1GTH A;  4U7U K;  2DNG A;  1JLB A;  3PTW A;  4DS4 A;  2FLP A;  2HMI A;  1TUG B;  3PHT A;  4RUB A;  1NJX A;  3RR7 A;  5IV3 A;  2MST A;  5GVQ A;  4F36 A;  1R0A A;  2YTC A;  2GIF A;  1BMQ B;  5KFS A;  3R7N B;  3KK3 A;  5M2R A;  5C24 A;  4BS2 A;  5IT4 A;  1SC4 B;  2DNP A;  3G8Q A;  1GK8 A;  1I5O B;  1T9U A;  3UDV A;  4M5G A;  2Q79 A;  3OSN A;  1SL2 A;  2GO8 A;  2J7W A;  3DU6 A;  4RW6 A;  3ZZ0 A;  3JQM A;  3VF0 B;  3C6U B;  4GKK J;  1F3F A;  4IFV A;  4USH A;  4UY8 T;  1IKW A;  3CDW A;  3DRP B;  3ENV A;  2ZH8 A;  4HI2 A;  5CQG A;  3T1H F;  1LFP A;  1UET A;  4RU2 A;  2BBE A;  2M52 A;  3D0I E;  4LVN P;  4ZP6 A;  5F8G A;  4ECQ A;  1ROF A;  1RHJ B;  5E0O A;  2XMU A;  2QN6 B;  1TTH B;  4DN0 A;  2A6O A;  2GGP A;  3ITH B;  2HS0 A;  1URN A;  2OHD A;  4WYL A;  4YB1 P;  4ZPC A;  2OO4 A;  4WWS A;  3DOL A;  2VHG A;  2BRK A;  1F2G A;  1HBM B;  1RTD B;  1HW9 A;  2CQD A;  1Z2L A;  4YR3 A;  1JLC B;  2DCL A;  4Z7Y A;  2PE8 A;  1JLC A;  4B3O A;  4MFB A;  2CAD A;  5GAH U;  4CLK A;  4LF5 J;  2QA1 A;  1FJG J;  2HHS A;  3FZB A;  4L76 A;  5I3P A;  4OYI A;  1SVD A;  1IWG A;  1S1T A;  3DOL B;  5JXS A;  4EK2 A;  2AIR B;  1FE4 A;  2JVO A;  4PXD A;  5IM0 A;  1UWB B;  3KLH A;  3MCN A;  3PW0 A;  1GQE A;  3MMJ A;  2M88 A;  2WOM B;  3OT9 A;  1N4L A;  4XO0 A;  4EYH B;  4DL2 A;  3C16 B;  4CLT A;  4DCJ B;  2J6T A;  1TEL A;  3IBF B;  4IFV B;  2XY6 A;  4B9M A;  3BPD A;  3DLE A;  4YP3 A;  1JLG A;  1XN9 A;  1H7X A;  2F5G A;  5CYJ A;  4DV7 J;  4RUA A;  4UOF A;  1RT2 B;  3MXH P;  3TEH B;  1UW4 A;  2N4C A;  3JQK A;  4URQ U;  1XC9 A;  2EFP A;  3LGM A;  2EFN A;  4FVM A;  5HAN A;  4FF4 A;  2YKP A;  3DDK A;  4M5D B;  4PQA A;  2ZHB A;  4RW9 A;  4EMD A;  3TP2 A;  1SQE A;  4ZK7 M;  4IFY B;  4ZVO B;  3ZZZ A;  1X0F A;  1JLB B;  2VOD A;  2GA7 A;  1JXV A;  1BLU A;  1UJ6 A;  1YBA A;  3C66 A;  3TI0 A;  1OY8 A;  4LRF A;  3IM9 A;  3CCZ A;  4KHM A;  1JJ4 A;  4LRB A;  2IVY A;  2ASY A;  1WC0 A;  2QRR A;  2W01 A;  4ECT A;  3TA0 A;  1MMD A;  1KS2 A;  2PT0 A;  4FNI A;  4N56 A;  2OUG A;  1BWV A;  1P9Q C;  3M30 A;  2JSX A;  3FQL A;  2ZOF A;  1FI4 A;  2DY1 A;  3BB5 A;  3UWT A;  3WIV A;  2K3K A;  2ZH5 A;  2E66 A;  1YTY A;  1FKP A;  3QBC A;  1U09 A;  2IAJ A;  3ULH A;  3CCS S;  1RP5 A;  4K4S A;  4RBT A;  3ILJ A;  1R31 A;  4H4M B;  2L41 A;  2IM3 A;  2DK2 A;  3FVY A;  4ER8 A;  2JC1 A;  4ECY A;  3V6D A;  1HAR A;  1S6P A;  1RA6 A;  3D7S B;  1V3S A;  1Y00 A;  2FJB B;  3D67 A;  1ACM B;  3RAX A;  1YI2 S;  2VAS A;  3G6X A;  4IOA Q;  5E7O B;  3EVM A;  2VOO A;  4G1P A;  3MI7 X;  1DTQ A;  4LMZ A;  1RTI B;  1S1X A;  1NM2 A;  3TOQ A;  4ED5 A;  1VC5 A;  4B3T F;  3AXM A;  1WSR A;  3KJV B;  3LAM A;  4NRT A;  1RBA A;  5CH7 B;  2DXF A;  1UFL A;  2MKC A;  1S9G A;  5BYQ A;  4BWJ A;  5SZT A;  3D66 A;  5KT3 A;  1RTZ A;  1UFK A;  5LMU F;  4FS2 A;  4JV5 J;  4RNN A;  2DH9 A;  2LQB A;  4DHV A;  2D41 A;  1NBE B;  1WG1 A;  1RTH B;  3TAM A;  3W65 A;  1U8S A;  2QIF A;  2QFJ A;  2EK1 A;  4CLL A;  4RNO A;  2G2Z A;  3HZE A;  5CD4 H;  3MR3 A;  3P5B P;  1NZA A;  4D3H A;  2IMW P;  1HPZ A;  1R8B A;  2CPZ A;  2MHN A;  4XDD A;  2HK3 A;  3LGN A;  2DBB A;  4IG3 B;  2Y0B B;  3J81 U;  3MD3 A;  4PWD B;  1DQA A;  4CO3 A;  4I2P B;  2UUA F;  1YDL A;  3JSB A;  2OIH A;  2ZHA A;  2FVS A;  3RRG A;  1HWU A;  2NUU G;  4JI4 F;  4WFN Q;  2ZE2 B;  3F0N A;  5HMZ A;  3VAL A;  2C28 A;  1U2C A;  1IM4 A;  4I6A A;  1KQS R;  2LVW A;  4RX6 A;  3SQG A;  1G1X A;  3IP0 A;  3C46 A;  1R6V A;  2NLW A;  4U96 A;  2XMW A;  4YUD A;  2PSZ A;  2VKR A;  2DGS A;  1YBU A;  1S97 A;  4HDG A;  2QLW A;  1W2B R;  1RCX B;  4LFC F;  5DGA A;  2RU3 A;  4B9N A;  2DXE A;  1FJ7 A;  4O23 A;  1NK0 A;  2ADB A;  1WEL A;  3G2X A;  2E9Z A;  3EE3 A;  4R0J A;  2KM8 B;  3QJP A;  2DPJ A;  1KHV A;  1V5I B;  4DX6 A;  1QAJ A;  3KK1 B;  1C1C B;  5A6P A;  2IDL A;  2FJV A;  2OI2 A;  2OSR A;  1WDD A;  2AJ2 A;  5K9F A;  3MM6 A;  4KPY A;  1TL5 A;  1RT1 B;  2M9K A;  2Y3Y A;  4DSE A;  3DM2 B;  5LM7 E;  3DGP A;  2RUS A;  4USW A;  3LWM A;  5J2N B;  4CM0 A;  3G8T A;  1UZH A;  2RU9 A;  2W1B A;  3QT5 A;  5KG3 A;  4B3R F;  3G4S S;  1YG0 A;  2IJR A;  2BV3 A;  1UTA A;  2GFF A;  1QSL A;  1VQ7 S;  1U02 A;  4CQ1 A;  1VRT B;  4UZC A;  4ZIV A;  1M90 T;  1KON A;  2P2C B;  1DHM A;  4P7T A;  3PY8 A;  1W26 A;  3CJR A;  3KNG A;  1I3O B;  2CDR B;  2EK6 A;  1O0P A;  4DR4 J;  2N7C A;  4C11 B;  1JMT A;  4NE9 C;  5I3Q A;  1WEZ A;  5F9N A;  3AB2 B;  3K5P A;  2RRA A;  5D6G A;  3MPV A;  3VR1 A;  5JMN A;  1O51 A;  2MSS A;  2X51 A;  4OYP A;  5L38 A;  1YGY A;  2E7W A;  2OD4 A;  2BJ9 A;  4E2F B;  1B0V A;  4FYX B;  1BD6 A;  2GMH A;  4OX6 A;  3UD4 P;  2KG0 A;  2KT5 A;  2DIT A;  3LW5 C;  5I3U B;  4DDF A;  4OV6 A;  3R27 A;  1HBN B;  3ENW A;  3MUV P;  1MRO B;  2FIU A;  4QJV A;  3MM5 B;  3NWG A;  2NPI A;  5ETT A;  3LAN A;  1RAF B;  4DR5 J;  2XZD B;  3CUN A;  1D1U A;  3QFW A;  4O44 A;  4P72 A;  2VKZ G;  1DTT A;  4FKX A;  2BJ7 A;  4L6V 3;  4X4R A;  3R6L B;  2C3M A;  4B9V A;  3M32 B;  4IKA A;  5EX3 A;  2F4F A;  4UOC A;  3DKD A;  4OJG A;  3NNH A;  2R7S A;  4WFY A;  5J2M B;  2DTJ A;  3BV8 A;  4OYZ A;  4PYA A;  7FDR A;  1NPP A;  2OMO A;  1ZPV A;  4MK9 A;  3I96 A;  3KXD A;  1HNI A;  4WXW A;  5B0G A;  5IWA F;  3KHL A;  2DEI A;  3Q83 A;  2MZR A;  4N77 A;  1L5U A;  3UO0 A;  4NCB A;  1HYS A;  1S1V B;  3OVA A;  1UMJ A;  2GJ2 A;  3HMJ G;  1VQP S;  4NI2 A;  4FBT A;  3CO0 P;  3CD7 A;  2LQ9 A;  3D6M B;  5AXN A;  3KJV A;  2YKO A;  4EFA C;  4KT0 C;  1B7Y B;  2V2Z A;  3FZ2 A;  1VQ4 S;  4KYZ A;  4RWW A;  3GSI A;  3I32 A;  3MAA B;  1RWU A;  2K06 A;  1WAC A;  3JSM B;  3RRH A;  3WC0 A;  4ZVF A;  5K8N A;  3RTV A;  4C7Q A;  2HHQ A;  2XNR A;  2QSW A;  1TUW A;  4E98 A;  5DDR C;  1X8D A;  5D3G B;  3L7U A;  4LF9 J;  4B3S J;  2KT2 A;  3LTO A;  4H4M A;  4CDI A;  3ILL A;  2XZW A;  3B8H A;  3SCK E;  2VJV A;  1N34 F;  2EXU A;  4IRD A;  4ECS A;  1H74 A;  4KAI A;  1K47 A;  1OYD A;  5HMY A;  1FKP B;  1OPZ A;  2OSQ A;  1REV B;  3GP9 A;  3L7P A;  3QT8 A;  4ZMM A;  1HD0 A;  3UQS A;  4QWD A;  4JI3 F;  2RIJ A;  1FHT A;  2G0C A;  4RNF A;  1MW7 A;  2P6T A;  3JSM A;  3CPW R;  2NXU A;  3MTJ A;  2R4F A;  2RD5 C;  2HNY B;  3PFO A;  1U8W A;  5E3P A;  1BHN A;  5ETO A;  1RWO B;  4Y0F A;  2AX0 A;  1TMM A;  2Z0G A;  2C42 A;  4NI2 B;  1JX4 A;  1XTZ A;  3AD7 C;  3M4X A;  3OXL A;  1PAE X;  3VWS A;  4RNM A;  3D68 A;  4N7T A;  4F0K A;  5EWE A;  1LEO A;  3PW2 A;  4AL7 A;  1PJ6 A;  5A2Q Y;  4V19 J;  1CG2 A;  4AD6 A;  3DGV A;  4TQS A;  3CJ3 A;  2EWH A;  2J0W A;  3Q22 A;  5LSL A;  1ZAV A;  5CXT A;  2P9G A;  3Q8S B;  2E29 A;  4EO6 A;  1QAY A;  1RYR A;  3DLB A;  4DS5 A;  5D3G A;  4OLO A;  4C0H A;  2XO7 A;  2MB0 B;  1FRH A;  2Y1R I;  5E3C A;  2B9E A;  3H5Y A;  3WC2 A;  4KKO B;  1KFD A;  1RBL A;  1O5J A;  3EXY A;  1FNO A;  3RGI A;  5HBM B;  4X4Q A;  2CPE A;  3B54 A;  3M1V A;  2HHV A;  3GCX P;  2HND B;  3KMQ A;  1UKU A;  4J9P A;  2MLZ A;  3VAH A;  2WOM A;  4G1Q B;  1S57 A;  1CPZ A;  5HAT A;  1MN7 A;  3C14 A;  3MTK A;  2W9C B;  4Q44 A;  5IM0 B;  2CPD A;  3NXZ A;  3PCO B;  1TFW A;  3FFI B;  3CCR S;  2L48 A;  2E5J A;  3DHX A;  1Q86 T;  1KOH A;  2HGM A;  2W4D A;  2JLE A;  3HFV A;  2UU9 J;  1KOO A;  2WSE C;  4IDK B;  4ES3 A;  4RW9 B;  3AB4 B;  2GVD B;  3F44 A;  3GE9 A;  3QSI A;  4ZDN A;  1FWK A;  1TL7 A;  2EG1 A;  5HSP A;  4DX8 H;  2HQF A;  2N3O A;  1NZ8 A;  1U2R A;  2PD1 A;  2W24 A;  4LRA A;  4S0M A;  1YIT S;  1HBM A;  1TKD A;  1BQN B;  5K8P A;  3JXO A;  2QLB B;  5HQM A;  1DTT B;  4O0N A;  1HNX F;  1B0T A;  1FDB A;  4HT5 A;  1VQY A;  2BJD A;  2HIQ A;  4OLP A;  2DH7 A;  1VRU A;  1N5Q A;  2MZ1 A;  1C0U B;  2GAH C;  2GJI A;  1KRP A;  2JEI A;  3MAQ A;  4EBC A;  1MRO A;  2W25 A;  5KFX A;  3T6J A;  1SL1 A;  3GU0 A;  1D0E A;  3ZNJ 1;  1X4G A;  3ZFV A;  3ZTQ A;  1NCL A;  1UWB A;  2DNY A;  1QJH A;  2F3J A;  3PJW A;  4R5P B;  3KLH B;  2IPO B;  4C3L A;  4DV1 F;  5DLF A;  4G3I A;  4O3S A;  2UU9 F;  4ATN A;  4ZVP B;  4CIO A;  1DBD A;  3R5G A;  4A48 A;  4RUH A;  4FP9 A;  4UQG A;  4TQR A;  1UEK A;  1Q7Y T;  2DKO B;  2R7Q A;  3ET6 A;  3V6J A;  4KTQ A;  3IR6 B;  3HKW A;  5IQQ A;  4EI2 A;  2DHX A;  2E9T A;  4DFP A;  3BSC A;  4KHP J;  1NJI T;  2CNL B;  3LAK A;  1FXR A;  3OL8 A;  2Y1L B;  3D1H A;  4X4S A;  4F02 A;  3BSO A;  1J2V A;  4USU A;  3HM9 A;  2HAF A;  5KFO A;  3G71 S;  1PKU A;  5DO2 A;  1LKZ A;  3HVA A;  4K4Z A;  1RAI B;  3G6V A;  1N8R T;  1CJV A;  2FPH X;  1H2U X;  1Q53 A;  2FZG B;  4B17 A;  4MH8 A;  2B4V A;  1WTF A;  4GO5 X;  4DV1 J;  4ED1 A;  3PKY A;  1R0B G;  2LYV A;  5J2N A;  1OY6 A;  2BAB A;  3CC7 S;  1RT1 A;  3GWC A;  2UXB J;  4WFX A;  2ZKT A;  3H90 A;  2J0Q D;  5L9X A;  4RO0 A;  4DZ6 A;  2SXL A;  4DSL A;  4JI4 J;  4JV1 A;  4FDF A;  4Y2M A;  1S6Q A;  2LEA A;  3D0H E;  3MOJ B;  2KT3 A;  4HHJ A;  1A6L A;  1S7I A;  1NHK L;  2XZT B;  5DJB A;  3WIU A;  4X65 F;  5AJ3 J;  4PAA A;  3CJK A;  3IXQ A;  1VQN S;  2XMA A;  3HUL A;  3TAM B;  4UOH A;  5C25 B;  2OPR B;  4DV6 F;  1F9H A;  3GIL A;  2DIU A;  5J1P A;  1XMQ J;  2MJN A;  3Q24 A;  3H7H B;  3MWB A;  1KSP A;  4ZVT B;  3AFG A;  1TL3 A;  5GAH I;  1QY7 A;  3FBC A;  3ISN C;  2HSE B;  3AA9 A;  3BSA A;  3PYG A;  1S59 A;  3ETO A;  1XWL A;  3PM9 A;  5HL7 Q;  3M8S A;  2R7U A;  1RT5 B;  1FTR A;  2K2P A;  4AQY F;  3TRG A;  4F8R A;  1T9Y A;  4PG7 A;  1YVF A;  2JVR A;  2XMV A;  4GKJ F;  3CJ5 A;  4GC7 A;  2O5D A;  1OSD A;  4DG1 B;  1VQ9 S;  2VG5 A;  2XBP A;  4O4G B;  2B9Y A;  1L3V A;  1Q5V A;  1KD1 T;  4Q8E A;  1UVI A;  2CVI A;  2FHK A;  2QL5 B;  4J5O A;  1UVJ A;  3QWU A;  2YNH B;  2UUT A;  4A8Y A;  3D0G E;  4NLD A;  3EGZ A;  4DR6 J;  3H0P A;  4URS A;  1NDP A;  4BLG A;  2V9K A;  3FCH A;  1FX4 A;  1UJ5 A;  1JKH A;  2M7S A;  4DPX A;  4Z7C A;  4YY3 F;  2VG5 B;  1OQ6 A;  2ATC B;  2CJQ A;  3HZG A;  5F3T A;  2VPW B;  3IG1 A;  2F8H A;  4LBI A;  5KFY A;  2B0G A;  3VVU A;  4F4A A;  1T9X A;  2V69 A;  4X62 F;  3RAM A;  3ENQ A;  3ZZP A;  1CJU B;  2MKI A;  5L1J A;  1TL3 B;  4J91 A;  2X1B A;  4AE5 A;  5E3R A;  3DNC A;  3DLK A;  3GPA A;  1GMW D;  2IRY A;  2Z2M A;  2X3G A;  3CSK A;  4NX9 A;  2QMU B;  2QMX A;  3H5S A;  3JTP A;  5IXU A;  2KG1 A;  1QSY A;  4P71 A;  5FDL A;  2EEY A;  3OR2 A;  5IQ6 A;  4DL4 A;  3H4D A;  1FTC A;  4BHQ A;  1OIA A;  2W8L A;  2I6W A;  5A0Y A;  4BC9 A;  4LSN B;  4DXL A;  2CA9 A;  4OQJ A;  9ATC B;  5L1I A;  4DR6 F;  3CME S;  4QZV B;  2MZJ A;  1CC8 A;  4CLY A;  4OZJ A;  5L46 A;  2VPX B;  4NXN F;  4NLW A;  1JJC B;  2XYP B;  2MLY A;  4G1I A;  3AY0 A;  4GVL A;  4ZPB A;  2AD9 A;  1JNR B;  1K0T A;  3AOC A;  2JHE A;  2DGO A;  2IAJ B;  3RZA A;  2AZ1 A;  2JC0 A;  1FNM A;  4X64 F;  1RT2 A;  1VCT A;  1EKR A;  2LDY A;  3CE8 A;  4U8Y A;  5G4D A;  3CCQ S;  4JI2 J;  4JI8 F;  2B3T B;  1NDK A;  2G0I A;  5GAG U;  4NLX A;  4QIF A;  3MEK A;  4I7F B;  3IO1 A;  2CZ9 A;  1IN0 A;  2PA3 A;  1UFW A;  2CJX B;  3G82 A;  4C2M A;  2VFV A;  3UD3 P;  1FRK A;  1Q1K A;  1M5P C;  2GHW A;  4NLQ A;  5SUH A;  3V4M A;  4OZ5 A;  3VZH A;  4PG8 A;  1N52 B;  1TKZ A;  3T1A A;  3EX7 B;  3WZ0 A;  2HYI B;  1KQF B;  2OPQ A;  5LOQ A;  1QTM A;  3JAM Y;  3QNW B;  3KLE B;  1X5P A;  2QLX A;  2C2R A;  2VFR A;  1CUL B;  4KO0 A;  2FHJ A;  4LF6 J;  2LKZ A;  3QAU A;  4B3O B;  4K4V A;  2KZM A;  1RT4 A;  4P10 A;  3V5R A;  4ED2 A;  2VA2 A;  2RE1 A;  2ACM A;  3LO3 A;  4WP3 A;  4DPW A;  2CFX A;  4QW8 A;  3TAN A;  1XIQ A;  2F8M A;  4F2R A;  2MEW A;  4LF9 F;  2AX1 A;  4Q0B B;  3NGR A;  3R5B A;  1RWV B;  5HLF A;  3F56 A;  1Q8L A;  3JB9 k;  2AV5 A;  4K50 A;  3GCW P;  2FJD B;  3EUN A;  2XY7 A;  1U49 A;  3MFI A;  1JLE B;  1ZA1 B;  3C6U A;  2OEM A;  1ARO P;  1XMB A;  3W8G A;  1IKV A;  3GII A;  1G3O A;  1M5S A;  2WBR A;  3B4M A;  4EBE A;  3EDQ B;  3BN7 A;  2FQQ B;  2MPU A;  4NML A;  5C2G A;  3PR5 B;  1TK0 A;  3H2V E;  4LF8 F;  3P6Y C;  1YRX A;  4LF4 J;  1OQ3 A;  1RT3 B;  3UN5 A;  3JYT B;  1TL7 B;  1HWL A;  1F5B A;  4DOZ A;  1RHK B;  2Z8Q A;  4DFJ A;  1TK5 A;  4ILM A;  3ZO7 A;  2Y9H A;  1LFW A;  3KDN A;  3MMB B;  3KHH A;  1HNW J;  2H1Y A;  1N56 A;  1S9E A;  4P52 A;  4AL5 A;  4I56 A;  4CTA A;  1D9F A;  3DOM B;  1BWE A;  3DU5 A;  5KFD A;  1TVR A;  1UL3 A;  2FYX A;  3HPO A;  4C8O A;  4P2M A;  2Y8Y A;  2VOP A;  1Y4Z B;  4V19 X;  2HQI A;  1WSV A;  3NS7 B;  4WII A;  1F5C A;  3CGI A;  2V6A A;  1MMN A;  1RK8 A;  1DFD A;  3DDN A;  4IQM A;  2ZH6 A;  4X84 A;  3A8K A;  5IZH A;  2AEJ A;  4ZKA A;  3FBB A;  1F3V A;  3UDE A;  4QW9 A;  2W4P A;  4DR1 F;  2C3U A;  3SSQ A;  2PEH A;  3RB4 A;  2XB2 D;  3G9C A;  2DNN A;  3KUE A;  4M5H A;  4HDH A;  1R0A B;  2OH2 A;  1BY9 A;  5DS7 A;  5KT4 A;  3P5T L;  2KM8 C;  5CYM A;  1NK4 A;  1SV5 A;  3QZ7 A;  1SH0 A;  4DR3 J;  1FF2 A;  2GAG C;  1NH7 A;  2XMT A;  1PO6 A;  3HKZ D;  2QL7 B;  4MYU A;  1IBK J;  4DG1 A;  1Q8B A;  3SEO A;  4OHV A;  4OYA A;  3MEC B;  4J9M A;  4OI4 A;  2KFZ A;  2YQ0 A;  3M2R B;  4CZC A;  1XMO F;  3SQO P;  2GCF A;  3DLK B;  3C2P A;  1ICE B;  1L3S A;  2VL1 A;  3MM8 B;  4QPX A;  3MM8 A;  3PX0 A;  1JLF B;  2NZC A;  2VDH A;  2UP1 A;  1RAD B;  2FY8 A;  2XG8 A;  2ZC4 A;  3NAI A;  1HHT P;  4DR1 J;  5AXM A;  3VAM A;  4CH1 A;  1ZTW A;  3IG1 B;  3IGV A;  4DUZ F;  4LIW A;  3A1Y G;  3CDA A;  1X0P A;  3OXF A;  1GXT A;  2KFN A;  4D3G A;  2RQK A;  2MZS A;  3CD6 S;  3AAW B;  1QUV A;  2RIL A;  2ZWP A;  5HP1 B;  3R9L A;  3H40 A;  4NLO A;  5G0R A;  1EHW A;  1VJQ A;  2ZD1 A;  4U9R A;  3JQJ A;  5A2Q U;  2CZ4 A;  5FLX Y;  5IT9 Y;  3AA8 A;  3JTN A;  4NLV A;  4JV0 A;  5BXI A;  1X31 C;  4KGM A;  3I4P A;  1XMO J;  4GMK A;  2MY8 A;  3K8V A;  3N01 A;  2Q43 A;  3QZ8 A;  4LF7 F;  1NPK A;  3PEH A;  5HMW A;  2G13 A;  3QLH A;  1J5E J;  1H38 A;  1GFW B;  2EPI A;  4EUV A;  7AT1 B;  2FVC A;  2AT1 B;  3R7B B;  2J0S D;  1FKO A;  3ZZU A;  3HD1 A;  1YRU A;  2CG4 A;  2JEF A;  3BGR A;  4PWW A;  3OTD A;  3CJK B;  1PJ5 A;  2W2O P;  1P9Y A;  2D7S A;  3T1Y J;  3MMB A;  1OS5 A;  2RH3 A;  5E41 A;  2DR8 A;  4IH7 A;  2BQU A;  3O8W A;  4OYB A;  2ZH2 A;  2UXB F;  3EZO A;  2XI3 A;  3Q89 A;  2BMB A;  1BXN A;  1K44 A;  4WK3 A;  3VVT A;  3KLG A;  2BYC A;  1RIS A;  1LWC A;  1TUV A;  2J6S A;  1PGZ A;  2VFU A;  4NEY A;  4OJ3 A;  1AYE A;  2LA4 A;  1I94 F;  3UDC A;  1QM9 A;  2HGL A;  2LXI A;  3PJ9 A;  3UVJ B;  3UNG C;  2E7V A;  5LSR A;  5GMK a;  3SYZ A;  1IJF B;  1S0O A;  3N5F A;  2RKI B;  4OI0 A;  1URR A;  1JLE A;  1R43 A;  1YLX A;  1KHW A;  2KTQ A;  1DAR A;  3QID A;  2V8D A;  2GIQ A;  2PO4 A;  5B0C A;  4A8M P;  4KFB B;  1G7C B;  4YY3 J;  3Q8R B;  3FCV A;  3PYE A;  5DGB A;  1FCA A;  5CCL A;  4ED3 A;  4IUF A;  4K4X A;  3P3D A;  2D74 B;  3HHN B;  2J7K A;  1V5V A;  1FJC A;  4YOE A;  5A8R B;  5GAD I;  6AT1 B;  1WTB A;  2M5Y A;  5H9F K;  1VMB A;  2YKN B;  5M2P A;  2QZ8 A;  4ZCI A;  3UW1 A;  1ZM9 A;  4KO0 B;  2L9D A;  1NEE A;  2ZM6 F;  2MQL A;  2D3U A;  3FDS A;  4HTI A;  2ZJQ Q;  3M6U A;  1RT6 A;  4WXO A;  3VV2 B;  2C2E A;  1GX6 A;  3D6F B;  2V8V A;  3W60 A;  2HZV A;  4RW7 B;  4YR0 A;  1EP4 B;  1KVK A;  1R7I A;  1Y5I B;  2DNH A;  3BGU A;  2AKW B;  2KB2 A;  5B09 A;  3DLG A;  4ELT A;  1QAX A;  1H3D A;  2K3I A;  4NXM F;  3W7B A;  1NDC A;  4N8N A;  3NY0 A;  5D4P A;  2V94 A;  4ILR A;  1RTJ B;  4C48 A;  4ZCM A;  3CTR A;  2PI5 A;  1CJK B;  4NLT A;  4PPD A;  3JTO A;  3MFH A;  1MNE A;  2KHC A;  4X62 J;  4PUO A;  3IN5 A;  4O3N A;  1IVZ A;  1REG X;  1BQN A;  2DNQ A;  3QQC D;  1JLQ A;  3ZTO A;  1FA0 A;  3PNI A;  2AYE A;  5L9N A;  4FBU A;  2Z2L A;  5KFB A;  5I42 B;  3OLB A;  2XS2 A;  5KG1 A;  1IJE B;  2YNI B;  4K5R A;  5KG4 A;  2HG4 A;  6FD1 A;  3ZTR A;  1X4A A;  3NGU A;  3TZX A;  3T41 A;  2KI2 A;  3OFH A;  1KQG B;  1E6Y B;  2QJ3 A;  4DU8 A;  5F8H A;  2N7Y A;  2VQE J;  3RBD A;  4NLG A;  2YNF A;  2HIY A;  2QLJ B;  2G9O A;  3IAS 9;  4G1Q A;  2R8J A;  1RAE B;  1NSP A;  3KNA A;  4WZM A;  4NYO A;  2ILY A;  2Q66 A;  3A4T A;  5B0F A;  4LF6 F;  1WNE A;  3QAE A;  4CLW A;  3CCU S;  4PWD A;  2OTJ S;  2Z56 B;  1TU0 B;  4KH1 B;  4IG3 A;  4NLP A;  2HK2 A;  1RHU B;  2AJ0 A;  2UUW A;  2N3L A;  2VD3 A;  3N6N A;  4XAK A;  4ZN1 A;  3KLF A;  5LMU J;  4LSL A;  3C15 A;  3R1L A;  2H9Z A;  3AOB A;  5HVF A;  3G6Y A;  2DRA A;  1ZET A;  4J9L A;  3POT A;  2L9W A;  5KFM A;  1FFG B;  2B8Q A;  3E3X A;  4CLU A;  2C3O A;  2D1C A;  2XM3 A;  2M4M A;  3FBE A;  1RLC L;  2HHU A;  3CJS A;  3KG0 A;  1RI7 A;  4L75 A;  3KLF B;  1S48 A;  2H5E A;  4O4G A;  1X60 A;  3TVZ A;  1F6T A;  4LFA F;  3MM9 A;  2IYI A;  3OV7 A;  1AXQ A;  2DRD A;  2V9W A;  4LF8 J;  2FTR A;  2BE2 B;  1GXL A;  2Z2Y B;  1DTQ B;  1DQ9 A;  1X7V A;  2Y1I A;  1DY3 A;  2HVE A;  5LSO A;  4MJK A;  4HYK A;  1KTV A;  2BUN A;  4NZ7 A;  5IFM A;  1RCO B;  1MLA A;  2VBX A;  3RB3 A;  3F41 A;  2XSF A;  2LLZ A;  1LNQ A;  5ADZ A;  4RU9 A;  2RDJ A;  3R8Y A;  3M9M B;  1WOO A;  1RWM B;  2UUB J;  4L3N A;  3GJT B;  3PVX A;  1NJY A;  5F8J A;  3DC2 A;  3FCW A;  5KFP A;  1JLQ B;  1RQ0 A;  1XER A;  5FD1 A;  3CWJ A;  2D9P A;  2U2F A;  4PCQ A;  4OZ1 A;  1HL6 A;  1OSC A;  1WHY A;  1PYT A;  1ZM3 A;  2LQ8 A;  3GR1 A;  4NCA A;  1XNQ J;  3CO9 A;  4ED7 A;  5C7P A;  4CP5 A;  2LXU A;  3MMA A;  1FRX A;  4MKB A;  4N5S A;  1PC5 A;  4C0B A;  3WBZ A;  1HBO B;  3M8P B;  5E3A A;  1XNR J;  2CPJ A;  2R7W A;  4B3M F;  2CPH A;  4QWC A;  3NGD A;  2YNF B;  2R8K A;  4DPY A;  2UXD J;  3QRP A;  1H73 A;  4EO8 A;  4YR2 A;  4NAS A;  1W7W A;  1VYA A;  1YJN S;  2E1P A;  2UUB F;  4DL5 A;  1GAO A;  1IBL F;  2KYX A;  3FMB A;  3PYF A;  3LA0 A;  3UDL A;  4B3T J;  2BOP A;  3BM7 A;  4JI7 F;  1PYS B;  4TY8 B;  1TKT B;  2CQP A;  2HFV A;  1UCN A;  1N32 J;  1XNQ F;  3TAR A;  5F8M A;  4QIW D;  4QYR A;  5CZX A;  4WKY A;  4K5S A;  1LWF B;  3E51 A;  3GYG A;  2XY5 A;  3SIP B;  1VQL S;  4C97 A;  1RYS A;  3NS5 A;  3KK2 B;  2IVM A;  5KFR A;  2R7X A;  2E1A A;  5F8I A;  3IWN C;  1YWX A;  1HBN A;  4W98 A;  1EP4 A;  5I3U A;  2YWH A;  1YJ9 S;  4ECW A;  2WB4 A;  2AJ1 A;  2M70 A;  4EU0 A;  5BYS A;  1KNZ A;  4F4Z A;  2Q3P A;  2BJ1 A;  2P9E A;  4DWI A;  1FD2 A;  3GFX A;  4P9S A;  1U1P A;  1KVJ A;  3O5T B;  2ZBC A;  3IBW A;  2FJE B;  2HZA A;  2JZ5 A;  3QMQ A;  8AT1 B;  2ZFH A;  3KKF A;  3M8Y A;  5E2Q A;  3I5C A;  2LQJ A;  2ROP A;  4GRS A;  5LXR A;  4C11 A;  4X4P A;  2GVD A;  1Q7L B;  2CQ1 A;  2IC3 A;  2VF3 A;  4H4K A;  4F3Q A;  3SSS A;  4KFB A;  2J9C A;  1U1M A;  2IM0 A;  2R2U A;  4NL5 A;  3NGS A;  2MQP A;  2R2R A;  1GEH A;  4IO9 Q;  2CJ9 A;  5E5N A;  5C42 A;  2IVF B;  3C14 B;  2FVQ A;  4TYA A;  4FS1 A;  2JRS A;  2X7I A;  2V4R A;  1TQL A;  4YEA A;  3KHG A;  4H4O B;  1C2P A;  2DEJ A;  4Y6I A;  2GO9 A;  3EIC A;  1R0C B;  3C3L A;  3VGU A;  3GYX B;  3W62 A;  5F9L A;  2DO0 A;  4AYB D;  3RB6 A;  3N4W A;  4LQ3 A;  4TU8 A;  2V0N A;  3H42 A;  1FNX H;  1KR4 A;  1X5T A;  1HWI A;  2A18 A;  1SKU B;  2CZV C;  5G0R B;  4C8L A;  4KJI A;  4N41 A;  2BW7 A;  2KU7 A;  2Z57 B;  5BYR A;  1K9M T;  5HI7 A;  2DNR A;  2XLJ A;  2GVZ B;  3EGW B;  2ZHO A;  1TKX B;  3GG0 A;  4KQZ A;  4MIW A;  3W9H A;  2YX7 A;  4K8R A;  2NZ4 A;  1DAX A;  5D0E A;  4MMO A;  4KPC A;  3TWZ A;  4I67 A;  1K0V A;  2CWX A;  2YWE A;  4MKA A;  3ELH A;  3GTY X;  1VLO A;  2YQ3 A;  3SQG B;  5A8K A;  1Q81 T;  3MR5 A;  4JI3 J;  3WQP A;  3P96 A;  5EX0 A;  3D1O A;  1P8G A;  4WK1 A;  5KG0 A;  2ZH4 A;  4RWX A;  3MEC A;  4HT7 A;  1B64 A;  2FHJ D;  2V2V A;  5JVH Q;  2HWH A;  2H5I B;  1N33 J;  1WOS A;  3RW7 A;  2R7V A;  1FEE A;  4XPE A;  3SZ2 A;  1SUQ A;  4WZQ A;  4X65 J;  2ZVS A;  3MPD A;  2HQ3 A;  1REV A;  3H5X A;  1U6Z A;  1XJW B;  4MTP A;  3BH7 B;  3A8I A;  2YH0 A;  2CJK A;  2QYG A;  2F4V J;  1Q0N A;  1Y9O A;  2AW0 A;  4M8L A;  1K8A T;  5K8M A;  1TL1 B;  5AE3 A;  4DV2 J;  4UF4 A;  4EEY A;  2V5H G;  2XTJ P;  2LU1 A;  3OSP A;  2C3Y A;  4HH1 A;  2W7O A;  3V6H A;  3PV8 A;  4LT6 A;  4N47 A;  5KFH A;  4M63 A;  3VGT A;  4F4Y A;  2H3E B;  1B7F A;  1HQU A;  1S5Z A;  2YQ1 A;  4O3O A;  2DJW A;  5BR8 J;  1C4A A;  1JJH A;  4GKJ J;  4PG5 A;  3QPI A;  1FJG F;  3TZY A;  3V4I B;  3E8O A;  5AT1 B;  1UVL A;  2NCK L;  4DQP A;  1LW0 A;  2VG7 A;  2OKQ A;  4CTA B;  3OW2 R;  2ABY A;  2F63 A;  3GFZ A;  1LOU A;  4WKR A;  1TL4 A;  2H51 B;  2YNI A;  4B9L A;  2H65 B;  2EFQ A;  2HHP A;  1H72 C;  2JLF A;  2CNN B;  2EFO A;  2JJ4 D;  4PYD A;  3VAG A;  2J9D A;  4QCL A;  3GIJ A;  2E1C A;  1X5O A;  4ERD A;  4CH7 A;  3BGL A;  3AQP A;  3Q8Q B;  1F60 B;  2JOQ A;  2DHH A;  3O1L A;  1PIE A;  5KT7 A;  1HI1 A;  3M8W A;  3NCR A;  1N0V C;  3PKM A;  5KFT A;  4JP8 A;  1EQ0 A;  3AJ1 A;  2R2T A;  1VHI A;  1VDH A;  2CG8 A;  1SC3 B;  2QGF B;  3I82 A;  4DV3 F;  2HHW A;  3VGV A;  4YS2 A;  4A8X A;  3DLG B;  3OUY B;  4N8O A;  3CCT A;  4QBU A;  2DH8 A;  3IMQ J;  5J2P A;  3L09 A;  3DOM A;  4A8Q A;  1E6Y A;  2FLO A;  1FER A;  4DZD A;  2V34 A;  3P4U B;  1RT6 B;  2RML A;  1U1L A;  1FWP A;  2UVW A;  3CUL A;  5HN0 A;  2YNG B;  2W9A A;  4NXN J;  3E01 A;  1S12 A;  2QX0 A;  4YHH J;  2GZO A;  4ZP9 A;  3CJT A;  4USK A;  1T3O A;  4U8V A;  2YXL A;  2CNO B;  4KV8 B;  1CUL A;  1RT7 A;  2XWX A;  5KG2 A;  2HQC A;  1X4B A;  3MHY A;  3VAI A;  2VB6 A;  1QE1 A;  2OPQ B;  5JVG Q;  1GXU A;  2B7C B;  2W4C A;  4NLY A;  2WVC A;  4ZCL A;  1KLM B;  5THW A;  5HVH A;  5DQG A;  2HFZ A;  2VC0 A;  2X1A A;  2H4W B;  2RRN A;  2V4J B;  3Q23 A;  2W8K A;  1IKV B;  2DNK A;  2HLU A;  5D4L A;  5GAE I;  1VS3 A;  4I6Y A;  4LVO P;  1S1W A;  3BBC A;  4IRC A;  3I0R B;  4JV5 F;  1VRT A;  4NZ0 A;  4ZHR B;  1R8A A;  4XIU A;  1UPM B;  3DRX A;  3CB4 A;  4OX9 F;  2DPI A;  3ZTP A;  5M2U A;  3FGV A;  1EQM A;  4ZHR A;  1NK6 A;  3T3F A;  1VIO A;  3ONQ A;  3DGP B;  1LK7 A;  2M3D A;  2C2Z B;  3W63 A;  2P6S A;  3R2D J;  2OPP A;  4YHH F;  1KLM A;  1C1C A;  1Z1Z A;  2O66 A;  3BBF A;  2WSC C;  1HBU A;  1KVI A;  3LQV A;  4UUW A;  4UST A;  3PAC A;  2DHA A;  1TV6 B;  4Y65 A;  2XO6 A;  2EBE A;  3IS9 B;  4L72 B;  2NS1 B;  4B08 A;  5A0Y B;  3CC4 S;  1JNZ B;  3TW0 A;  3PW5 A;  1TKZ B;  3OR1 A;  2QA4 S;  2DO4 A;  3NCP A;  2KVQ E;  4RLE A;  1FDA A;  3D4J A;  2RB7 A;  2JX2 A;  3LPY A;  2KHD A;  2Z30 B;  4FYV B;  3PHE A;  1S4F A;  5HRO B;  3G82 B;  3I0S B;  3U1M A;  5DQI A;  4LJM A;  4J90 A;  1E6V B;  2GNK A;  4UQT A;  1TZ0 A;  5JJB A;  1HNZ J;  1S1U B;  4KE5 A;  4XTT A;  4RW6 B;  3V6K A;  3UPF A;  2DD8 S;  3X1L B;  3THV A;  3QAT A;  4LF4 F;  1SKS A;  4DV4 J;  2VDI A;  1XNR F;  2FC9 A;  3LUY A;  1NKC A;  2GIR A;  1VLY A;  2YBV A;  3FKB A;  4JI0 F;  2KXN B;  3KLG B;  3JSR A;  1HWK A;  2DGW A;  2K7J A;  3HD2 A;  1GTE A;  3KLI B;  4RKU C;  4CI0 B;  2JWN A;  3T5J A;  1FO1 A;  2YNH A;  2W2Q P;  1VQM S;  4YB5 A;  1LWE A;  3HF5 A;  1UVM A;  3J7Y I;  3RW6 A;  1IQT A;  5T14 A;  3QFH A;  1DLO A;  4NCG A;  2UXC J;  1FKO B;  1MML A;  4H4K C;  4DPT A;  2B8P A;  5A76 A;  2JEG A;  3SFU A;  1X4E A;  4B9U A;  4MKY A;  3SV3 A;  4ECX A;  3SMZ A;  3Q2T C;  2DGT A;  3QLH B;  1HQU B;  2QYC A;  4DN9 A;  2VIH A;  2KL8 A;  1RKJ A;  1MSW D;  4JI6 J;  1T03 B;  1F2H A;  1FRJ A;  3M2R A;  1RTI A;  4OZ0 A;  1YZ6 A;  2CUY A;  2BR0 A;  1NRK A;  2FUG 9;  5F41 A;  2FZK B;  3AQO A;  4WPA A;  4ECR A;  3RBX A;  4X4O A;  3PW4 A;  2ADC A;  1T7P A;  2NPF A;  1WKJ A;  4F67 A;  2VG6 A;  1SIW B;  1UPP A;  2A3J A;  3LAL A;  5K14 B;  2C3P A;  2Y0S D;  2MMY A;  3CCJ S;  3CC2 S;  4DR3 F;  5HP1 A;  3KOA A;  4W90 B;  3R5J B;  2HFO A;  4FKY A;  5J2P B;  3PRB A;  3TYT A;  1SUQ B;  2M8D B;  2I1R A;  5CAB A;  5IT0 A;  1MG7 A;  3T9N A;  2DNM A;  4IQX A;  2UVR A;  1JQG A;  2XYH B;  3TUZ C;  3OHA A;  3VAJ A;  1EX8 A;  2IDE A;  3BO2 A;  4ZVG A;  2UVU A;  2XWY A;  1RT5 A;  3M30 B;  3H2L A;  3R5D A;  3QSY B;  3CD5 A;  1OWX A;  1ZZF A;  4ZLN A;  1D9D A;  1RAA B;  1MWY A;  5DDO C;  5CA5 A;  1R8P A;  1KWM A;  3NWR A;  3DRS A;  4ZLJ A;  2FHO B;  1QD1 A;  2PFD A;  1T95 A;  1IQZ A;  1NSK L;  3W5Y A;  2W9B A;  3Q8P B;  2G1D A;  2GVZ A;  3FSX A;  4IFY A;  2AYM A;  1WEY A;  4L74 A;  2JH3 A;  1NPR A;  4KC5 A;  4WU2 A;  3RU0 A;  4Y28 C;  1T9W A;  3RJM B;  5AE1 A;  4I2Q A;  4F25 A;  4XK8 C;  2A0F B;  2OD6 A;  2X3D A;  2VBY A;  3OQ2 A;  3AJ2 A;  3HHL C;  4HEA 9;  1HIY A;  2B4P A;  1MN9 A;  4ZPD A;  2D9O A;  2XMJ A;  3IC1 A;  1WC3 A;  1XQI A;  3FRZ A;  1VQ8 S;  2F1F A;  1Y10 A;  3A8J A;  1VIX A;  2V8G A;  1RWN B;  4DU7 A;  4YQW A;  3ZNU A;  2XC9 A;  4OHY A;  3ZZY A;  5C42 B;  4ECU A;  1NK7 A;  1EIY B;  2QV6 A;  3A13 A;  5J1N A;  1N6Q A;  4KBI A;  3CCM S;  3IGN A;  1GMU A;  1RAG B;  2HBQ B;  3ENA A;  1U25 A;  1S1W B;  3MR7 A;  1RAH B;  3ICL A;  2RHQ B;  4PPZ A;  4AUK A;  4ES1 A;  5GAD U;  3TO8 A;  4TU7 A;  2Q6C A;  1UW9 A;  2H54 B;  2V4J A;  3BF4 A;  3MEE A;  4DV2 F;  2WZ1 A;  4Y2A A;  5KFJ A;  4C4W A;  3D2W A;  2HFS A;  2DR6 A;  3IR7 B;  2B9X A;  4X66 J;  1H2V Z;  1TV6 A;  1ZM2 A;  2IBO A;  3PG9 A;  3RAQ A;  2ZC3 A;  1RT7 B;  1VBK A;  2K8G A;  3B78 A;  4Q7A A;  3JAM U;  3MUT P;  4ELV A;  3K0J A;  3V81 B;  4PRF A;  1RWW B;  1U0S A;  3KLE A;  3UCZ P;  1Y11 A;  3P49 B;  2NUH A;  3CCV S;  3E01 B;  2KYZ A;  3MPW A;  1QTN B;  3THT A;  3NNC A;  2YWF A;  3CDB A;  2VH7 A;  9RUB A;  5C5J A;  3FFI A;  4CWB A;  4AL6 A;  3HJF A;  2LMI A;  2W9C A;  2LEB A;  3T1H J;  3K2Y A;  2ACY A;  3M9N B;  3VZI A;  2ZH3 A;  1C0T A;  4DR7 J;  2HVH A;  5ETL A;  2DR9 A;  1YZ7 A;  3M1V B;  3MEG B;  2CAJ A;  1GT8 A;  3LP1 A;  4MYT A;  5LMN F;  3S8S A;  3BGO P;  1KC8 T;  1HD1 A;  2F7V A;  4KGX B;  4USM A;  3DYA A;  1NU4 A;  1RWX B;  4FNH A;  1CQN A;  1GMW A;  2LFV A;  4DR7 F;  3PDN A;  2RUG A;  4AXJ A;  1M5K C;  4KV8 A;  2MGZ B;  2FB0 A;  2ZM6 J;  2B6A B;  2DIV A;  4HI1 A;  2CQ3 A;  5A8W A;  4DV3 J;  3B4D A;  2KFY A;  3RBE A;  2GX8 A;  3MAH A;  2YNG A;  3MOZ A;  4HR2 A;  4UT4 A;  3KUH A;  5D4O A;  1SJF A;  5ETP A;  3ETM A;  3K5M A;  4NLS A;  5EUH A;  2HRU A;  2O1P A;  3MM7 B;  1WC5 A;  4LRC A;  2LA6 A;  2W2P P;  2BKP A;  4WF9 Q;  2G4B A;  1N48 A;  1N5S A;  3MUM P;  1RSC A;  1D9A A;  4IG0 B;  2BEF A;  4DX7 A;  3ZC4 A;  1RXO B;  2ZH9 A;  5HBM A;  3T5H A;  2YY3 A;  3HVW A;  3G96 A;  3EMT A;  1T94 A;  4QWA A;  3HFK A;  2OEJ A;  1AFI A;  1U1R A;  4OI6 A;  3Q8V A;  1NHV A;  5DG9 A;  4JB8 B;  4B9S A;  3TX0 A;  3EDR B;  4J7C A;  4YB6 A;  4O3Q A;  4ETZ A;  2PMW A;  1N88 A;  2HEK A;  2J7U A;  1KTQ A;  1RGV A;  3H2U B;  4XPC A;  1SKR A;  2ASD A;  2BKO A;  1RTD A;  1RWP B;  5F8N A;  3UD5 A;  2XMM A;  3OR2 B;  4OFZ A;  3HO1 A;  2XHC A;  1AUS L;  3MAA A;  1VFJ A;  4DL6 A;  2FJX A;  1VRQ C;  2W7A A;  4K2J A;  3DRY A;  1VBZ A;  5MAO A;  4MK8 A;  2LQ5 A;  4P2F A;  1F0X A;  3I87 A;  4TLQ A;  3RG6 A;  3FSY A;  3WHI A;  4C8Z A;  2UV8 A;  3IWL A;  3GJQ B;  5C25 A;  2OFH X;  1HLW A;  2I9S A;  4HHU A;  4L3K A;  1ZYQ A;  3OTO F;  3DCA A;  1NHU A;  3EM1 A;  5J2M A;  1N54 B;  1FE0 A;  4G65 A;  2MKH A;  4JBC A;  3FK4 A;  2QSF A;  1X4C A;  2AJQ A;  4CT8 A;  4ZOS A;  1FDD A;  3BH6 B;  3FEX B;  3AHP A;  1R8C A;  3KLI A;  3T1Y F;  1VIS A;  5CAA A;  5KFI A;  1JK9 B;  1SJQ A;  1H7W A;  1TP7 A;  1UEV A;  2WSF C;  3NS6 A;  4U7C A;  3GIM A;  4F4W A;  3BO4 A;  2YH1 A;  4ED4 A;  3HT3 A;  4F3O A;  2QO3 A;  5LJ5 Y;  3C8Y A;  3MM5 A;  2D69 A;  5LL6 d;  1S1U A;  2I5J B;  3AT1 B;  1I94 J;  4KHP F;  3CT9 A;  2OAU A;  1U0H A;  5DG7 A;  1FES A;  1VJW A;  2W7P A;  2FHM A;  4OZN A;  4ANC A;  2IA6 A;  2R2S A;  1S1V A;  2AEF A;  3GMG A;  1FD8 A;  4LRE A;  4M5I A;  1QDU B;  2R8I A;  4U7U D;  4NEZ A;  3W8P A;  3IRX A;  1UEU A;  2QFI A;  4K2X A;  2PDA A;  4K4T A;  4DV5 F;  5DQH A;  2E1M C;  3QRR A;  3FC9 A;  2YPY A;  3BPS P;  3M32 A;  4DV0 F;  1WUU A;  2VPZ B;  1YQH A;  4FZV A;  2RT3 A;  1Q79 A;  1XEZ A;  2E5H A;  2V8P A;  5HJX A;  1FFW B;  1HBU B;  5KFC A;  4P75 A;  2RQ4 A;  4DV4 F;  3W61 A;  3PYD A;  4LBP A;  2ZJP Q;  2XQC A;  2ASL A;  2GQ2 A;  4HAC B;  1U1O A;  4K0K F;  4ZVU B;  3KJF B;  4JI1 F;  3MDF A;  3DHW C;  3EVO A;  4P6Q A;  4M94 A;  3E2E A;  1LK5 A;  1SC6 A;  2QT7 A;  3NLC A;  3MM6 B;  4A4J A;  2MQQ A;  4QU6 A;  1VQO S;  1VQK S;  2XMK A;  5T7L B;  1F9F A;  4PXE A;  4LFB F;  3D6T B;  4OI1 A;  2RQC A;  1N32 F;  3RR8 A;  4RPF A;  3GIR A;  1BE4 A;  4JUZ A;  4USV A;  3UFC X;  1ZA2 B;  2IHR 1;  3CCW A;  2DGX A;  3HLU A;  4J9K A;  4IDK A;  1T02 A;  3TA2 A;  1AZS A;  3GR0 A;  5ITH A;  4JYA J;  4MT1 A;  3W2W A;  4R5P A;  1J27 A;  3THP A;  2ZE2 A;  1Q5Y A;  2GML A;  3DN9 A;  3CCL S;  2I5J A;  3W2V B;  4A8K A;  1ELO A;  4DL7 A;  2DY9 A;  3DOK B;  2XLK A;  4ZVQ B;  1NKB A;  2N82 B;  1VRU B;  2XUL A;  3BKT A;  4I6W A;  1KLN A;  2B5J B;  4IR9 A;  5KT6 A;  2IM1 A;  4JI5 F;  3LGH A;  2FD2 A;  2MY7 A;  6FDR A;  2ZOG A;  1N5T A;  4OHW A;  1U48 A;  1SJ3 P;  1VBX A;  2D3Z A;  4Y3C A;  1FXL A;  1OMS A;  2CXE A;  2ZUG A;  3QWP A;  4O0I A;  2CJB A;  1LWX A;  3Q2S C;  3LF0 A;  4FPR A;  5KFW A;  2YX4 A;  1UJ4 A;  1ZZN A;  2P5V A;  1RBO B;  2E1R A;  3MD1 A;  3SDE A;  2JLG A;  3BJY A;  3W3S A;  5KG6 A;  1SPB P;  2RSQ A;  4DCP B;  3I9V 9;  5KFZ A;  2R8G A;  2HNZ A;  4ID5 B;  3K7R A;  3RUB L;  4U67 Q;  2QTW A;  2CPF A;  2KJV A;  2MKJ A;  4ZJO A;  4Y2I A;  1OO0 B;  2IJN A;  5IC6 B;  3VCD A;  4HVZ A;  4GO7 X;  1S1X B;  4X64 J;  2ZDO A;  1D8Y A;  1WHV A;  2HNY A;  1VQS A;  4QPT A;  5IC4 B;  3HHL B;  2ATL A;  4WE1 B;  1NO8 A;  1PYO B;  2DB1 A;  3PO4 A;  4M95 A;  2B4O A;  3B82 A;  3LP2 B;  3TUJ C;  5HK4 A;  2ZD1 B;  3K5N A;  2WW8 A;  1KQK A;  1C1B A;  2XCP A;  3V6D B;  2VPY B;  2VON A;  3FEZ A;  2VFT A;  3J7A 1;  1S72 S;  3K17 A;  5D77 A;  4HKQ A;  1SJR A;  2E5L J;  1ZH5 A;  2DGQ A;  2JNJ A;  4I69 A;  4PXC A;  3POT B;  5HAO A;  4UY8 5;  2R7T A;  1RTH A;  1A9N B;  4LSL B;  5IS2 A;  4QYZ K;  3OPK A;  4Y2C A;  4J9O A;  4CLZ A;  1DRZ A;  1MU2 A;  4MKV A;  3TQE A;  1LQ9 A;  2O01 C;  2Q6B A;  3N6M A;  2KO1 A;  5KFG A;  2ILZ A;  3R1H A;  1FT8 A;  3MM7 A;  1CSJ A;  2GW8 A;  1N33 F;  2VC1 A;  3FUY A;  4KB7 A;  1FVQ A;  3BQ0 A;  1DUR A;  4OI2 A;  3UE2 A;  4C8N A;  2AMC B;  1PBU A;  3HX9 A;  2B9W A;  1X4F A;  4DQR A;  1U4B A;  1FKA F;  4U95 A;  2R42 A;  4ID8 A;  3K5L A;  1TKX A;  2XS7 A;  2N4D A;  3ZZO A;  2PII A;  3IAM 9;  4Y2K A;  4DR2 J;  4CRJ A;  3BKU A;  4ZVE A;  1L3T A;  3DXB A;  1WG5 A;  4ZA1 A;  2EVZ A;  4DUY F;  2PEB A;  1FDN A;  3TR5 A;  3QGP A;  4C8Y A;  3H20 A;  2BAN B;  3BYP A;  4YN3 B;  1CJK A;  4RNH A;  1RAJ A;  1HNX J;  2HFU A;  2IY5 B;  2RJZ A;  2CQG A;  3D9B A;  4WU3 A;  5CYQ B;  1DZ5 A;  2F9J A;  1V3Z A;  3DOK A;  5B0E A;  3K57 A;  1SL0 A;  1NH8 A;  3G6E S;  5B0D A;  1HNW F;  4DL0 C;  1V3R A;  3EXC X;  2BA9 A;  2CJY B;  5GME A;  3PFE A;  3NP5 A;  3G86 A;  1N34 J;  3PW7 A;  4E0D A;  5B08 A;  3CW2 C;  2UV8 G;  1PSD A;  1IKX B;  2DCU B;  4TLR A;  1SB6 A;  3EGN A;  2V2Q A; 
#chains in the Genus database with same CATH homology
 2P2C B;  4DCJ B;  1RE1 B;  3IBF B;  2XYP B;  1I3O B;  2CDR B;  1RWX B;  2QLB B;  3D6H B;  2H5I B;  1GFW B;  2XYG B;  4ZVO B;  2CJX B;  3R7B B;  1RWM B;  3GJT B;  2HBR B;  4ZVQ B;  4ZVP B;  3QNW B;  2DKO B;  2XZD B;  3GJS B;  3KJN B;  1F9E B;  4LSZ B;  3R6L B;  2CNL B;  2Y1L B;  4DCO B;  4JB8 B;  1RWV B;  1RHQ B;  3EDR B;  2C1E B;  2H5J B;  2CNK B;  2H51 B;  4DCP B;  3R5J B;  2QLF B;  3P45 B;  1RWP B;  2H65 B;  5K20 B;  2CNN B;  3D6M B;  2C2M B;  3EDQ B;  2XYH B;  2FQQ B;  5IC6 B;  4ZVS B;  3R6G B;  5IC4 B;  3GJR B;  1PYO B;  1RHM B;  3SIP B;  1RHK B;  1SC3 B;  2H48 B;  2XZT B;  3GJQ B;  1PAU B;  3D6F B;  2HBZ B;  2C2K B;  3P4U B;  3NS7 B;  4ZVT B;  3RJM B;  2CNO B;  2Y0B B;  1BMQ B;  3R7N B;  2C2O B;  1SC4 B;  1RWO B;  1RWK B;  1SC1 B;  2H4W B;  1RWN B;  2QL5 B;  2HBY B;  4ZVR B;  3KJQ B;  1RHR B;  1QDU B;  1RHJ B;  2HBQ B;  1I51 B;  2QL7 B;  3R7S B;  2H54 B;  2C2Z B;  1NME B;  2QLJ B;  3IBC B;  1ICE B;  1RWW B;  1RHU B;  2H4Y B;  2QL9 B;  1QTN B;  4ZVU B;  3KJF B;  2CJY B;  1IBC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...