2H5IB

Crystal structure of caspase-3 with inhibitor ac-devd-cho
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
94
structure length
94
Chain Sequence
HKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/hydrolase inhibitor
molecule keywords caspase-3, p17 subunit
publication title Structural and kinetic analysis of caspase-3 reveals role for s5 binding site in substrate recognition
pubmed doi rcsb
source organism Homo sapiens
total genus 18
structure length 94
sequence length 94
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2006-05-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 2h5iB00
5IC6B 3P4UB 1RE1B 3KJQB 2FQQB 3R6LB 1IBCB 2C2KB 2Y1LB 1QTNB 1GFWB 4ZVRB 2H4WB 2H5IB 1PAUB 1SC1B 2HBQB 1RWXB 1BMQB 2DKOB 1RWNB 3R7BB 4LSZB 3EDRB 2H51B 2QLBB 3R6GB 2QLFB 3D6MB 2XYGB 2H4YB 2CDRB 3SIPB 5K20B 1RWMB 3NS7B 1I51B 3R7SB 4DCJB 1RWVB 2P2CB 3GJSB 2QL7B 2Y0BB 1RWOB 2CNNB 2CJXB 1RHJB 2C1EB 1RHKB 1RHQB 4DCOB 1RHUB 2H65B 2CNKB 2C2ZB 2XZDB 1F9EB 2XYHB 3IBFB 4ZVUB 2HBZB 1RHMB 2C2OB 2H54B 3P45B 1ICEB 1SC3B 4ZVTB 2XZTB 4ZVPB 3QNWB 2CJYB 4ZVOB 1SC4B 4ZVQB 3KJNB 2CNLB 1NMEB 2QLJB 1RWPB 3KJFB 2QL5B 3D6HB 4JB8B 5IC4B 1RHRB 1I3OB 2CNOB 1RWKB 3GJRB 3EDQB 3D6FB 4ZVSB 3GJTB 2HBRB 2C2MB 3R5JB 1RWWB 3RJMB 2H5JB 2QL9B 2XYPB 1QDUB 2HBYB 3IBCB 2H48B 1PYOB 4DCPB 3GJQB 3R7NB
chains in the Genus database with same CATH superfamily
3LQVA 1VQ8S 1O6XA 2FDNA 1PYTA 1V3SA 3GIIA 3Q0AA 5F8LA 1S48A 2PIIA 3IXQA 1RT3A 2YQ0A 4Q2MA 4DI6A 3I82A 1YRTA 2KRRA 2F3JA 4WKYA 5AE2A 3L7PA 4K0KJ 3J7ZT 3NBPB 3TX0A 4HVZA 4X64J 4ZLNA 3H25A 2CJXB 3DLEA 1RHKB 3PYEA 1RT3B 3PJ9A 3D1QA 3DDNA 1VLYA 3DOLA 1YBUA 1H2TZ 3UW1A 5I3PA 3HT3A 2UXBJ 1S7IA 4PYDA 1JLEA 4ZK7M 2CZ4A 3DRYA 1NSKL 3DLEB 2HHXA 2O01C 2RS8A 3IC1A 4RPFA 5AE3A 2MQLA 3DOLB 2VG6A 1NAQA 2DXDA 1Y3JA 1RTIA 2RKIA 1JLEB 1RWWB 4IKAA 4CO1A 1R0BG 2JLGA 2HHQA 3W66A 3VHQA 4NLDA 2VV5A 1NNDA 2A6MA 2VG6B 3AFGA 4J9PA 1RTIB 2K06A 2RKIB 4WTOB 2HFVA 2OGUA 4J9QA 2J5AA 2RHSB 1T9XA 2XZWA 3AJ2A 1KFSA 5HN0A 2M4MA 1BQNA 3THVA 4LT6A 2DPJA 3UN2A 1YZ6A 4HACA 5J2PB 2F63A 2W7PA 5CABA 1ZTWA 3MR6A 4UUWA 1HL6A 1BQNB 4RW9A 4HHHA 2V8GA 2M70A 2QYCA 1PG5B 4HACB 4OL8A 3D0IE 4Q43A 2E1CA 4JI6F 4PUOB 1A0OB 2WSEC 1R89A 5KFGA 4AL5A 1GX5A 3C46A 2M8HA 2HNZA 1AZSA 3SFUA 4QZVB 2XMVA 1SXLA 2F9JA 1BWEA 2XSJA 3HHNB 3BM7A 3BF4A 4OIXA 3RR8A 1FRIA 4FS2A 4RUHA 3B78A 1DHMA 4CIOA 2XSJB 4EO6A 3QT7A 1D1UA 4TU8A 4LQ3A 4L73A 2VA3A 2CJAA 1BE4A 1S0MA 3FVYA 5GMEA 3JXOA 4HHUA 2GQQA 3HSDA 2XMMA 5LMNF 4JOUA 1HBOB 4B9LA 4ZPWR 3ITHA 3Q86A 2PN6A 2V6AA 4DV6F 2QV6A 3D0HE 4I7FA 1HQEA 4B3SF 3NKYA 4E0DA 3LP0A 3VAKA 1FWKA 3UD3P 1AT1B 1HHTP 2LCWA 4U8VA 1WG4A 2ZHAA 4Y0FA 1ZETA 2YXLA 3ETOA 5C7PA 3PRBA 4RL1A 5D4PA 4I7FB 4X4RA 5L38A 1F2GA 3JTNA 1OWXA 3M8WA 3FSIA 3VZIA 2EFGA 1R43A 3GYGA 3QT5A 2R7OA 3G2XA 3PR5B 5L9NA 4ZVRB 4DR5F 3FMBA 1R6VA 3BQ2A 4DR6J 4Y2MA 1X8DA 4ECUA 1TAQA 2HQFA 3OUYA 1MSWD 2E5GA 3PYDA 2XQCA 2HIYA 2HGNA 1XMOF 3AH6A 1SJ3P 2EI5A 1NB2A 1RKJA 2KT3A 3I32A 4CLFA 2V4RA 3BN4A 4TLQA 2R8HA 4IRDA 2V5HG 4YB7A 3TUPA 2RQCA 1WELA 4C4WA 5LSRA 4ZP7A 3L9ZA 2P9EA 4IOCQ 3A8JA 1OPIA 2RT3A 2BDPA 2KO1A 3OR2A 4NLGA 4DV1F 3PW4A 4JI6J 5LMUF 2MXYA 3M8PA 1LWCA 1KQSR 1JLFA 4BBYA 1HBUB 5B7WA 4NLQA 5DQGA 4GKKJ 3OR2B 1YIJS 4N8OA 4JI8F 5A76A 2J0SD 3ZTPA 3M8PB 1LWCB 1JLFB 2OIHA 1R0AA 4OI1A 4OJ3A 3HSGA 2U2FA 3W62A 1P6TA 4P2SA 4USVA 3G8TA 2EKYA 3T1AA 4M95A 5HANA 5D78A 1TVRA 3GMGA 2W9CA 1ZAWA 4X4VA 4P7TA 2C2OB 3D0GE 2EWHA 1R0AB 2NS1B 2HLUA 1KOHA 2I5JA 3WC0A 3G6YA 3PJWA 1K44A 2GAHC 3VAJA 1MW7A 2YNGA 1YBAA 5LMNJ 3NNAA 3CCES 4WE1A 2DNOA 2QL5B 3KNGA 4JB8B 2Q66A 4DV6J 1VHIA 2W9CB 1EARA 4HL9A 1VC6A 4Q7AA 4C9DA 5L8RC 2I5JB 2RDDA 5HP1B 2A18A 2MQQA 3ULHA 4B3SJ 3EM1A 4FKYA 4ZMMA 1NPKA 3AY0A 1TK5A 2W24A 4F4ZA 2AZ1A 3HF5A 4Q8EA 3TA2A 4MIBA 4BHQA 1H74A 4B02A 4K4WA 3W2VB 2HNDA 2HWHA 2FC8A 2HURA 2GQCA 3GILA 2FLLA 1U1LA 2YH0A 1CS4A 4WXOA 3R2DJ 1IKYB 4WYLA 4W98A 1SC1B 4WFXA 1ZBTA 2Z0GA 3R7BB 5H9FK 1GNKA 4YR2A 5IV3A 3UI3A 2MKKA 2LMIA 1NSQA 2V9KA 2AEMA 3Q22A 2PA8D 2KXHA 2V8VA 1LK7A 2FGCA 3ET6B 4PQAA 1K1SA 4L3NA 4KSEB 2DNQA 2KB2A 2I9SA 4ZPVR 2AT1B 4F2RA 2E9RX 1TMMA 4F4WA 1IVZA 1VMBA 4PG8A 5HQMA 4LIRA 4F50A 5HJYA 2BMBA 4LF8J 1FWPA 2ERRA 2FLPA 2QLXA 1WSRA 3FZ2A 4JI5J 1X4FA 3PX4A 3PFEA 1L3KA 1T03A 4DV1J 5IT4A 2ZBRA 1DZ5A 1WHYA 4C97A 5FLXU 3MM5A 3HDSA 1IBCB 2DNKA 5DM6Q 1QM9A 4K2JA 2CIMA 1TQLA 6AT1B 3I9V9 2DHHA 4N56A 2R8IA 4JI8J 5LXYA 3HX9A 1T03B 1HWKA 3MURP 1G6BA 3MM5B 4JI0J 4IG0B 1RWVB 2AD9A 2CNNB 1VRQC 1XNRF 3A1YG 1NDLA 3PW2A 1IBKJ 2KT5A 4JI2F 3LAKA 1NHVA 2W4DA 3K5PA 1XEZA 1LWEA 4DUZF 1W26A 1U8WA 1OYDA 3CGIA 2L3MA 2ZUGA 5D0EA 1VBXA 5KG5A 2DNZA 2LXIA 3R5BA 3LGHA 4X65J 1OO0B 1SJ4P 1S97A 5B0CA 4HTIA 3HSZA 3ENAA 1YI2S 2DR8A 1U1KA 1WEYA 4YOEA 1LWEB 4QW8A 3PO5A 3UN3A 4KC5A 2CQ4A 2ZVIA 4PABA 2HBYB 4U7CA 2IFXA 1OJ4A 1Q8LA 1ZM4A 3KKFA 2KTQA 2JJ4D 2CWKA 3QWPA 1W2BR 1YSJA 4WFBQ 4UQTA 3HHDA 3QJLA 1I94J 3IRWP 2D74B 2U1AA 4NZ0A 1Y0HA 2DH8A 2AJ4A 2G9OA 3N6LA 1PJ5A 4C8NA 3OTCA 1RTJA 3K2YA 3MUVP 4C6AA 1FRHA 1VFJA 2MY8A 1HHQA 4NLSA 1HLWA 1UFKA 1EETB 1TUWA 2EFNA 2HHPA 2DHXA 2F5GA 4P10A 2A0FB 5KFVA 3NNHA 2OEMA 1FJGF 3G6XA 4M5HA 4X62F 1N0UA 1RTJB 2CJ9A 3V6JA 4JUZA 3U27A 5KFEA 1YTYA 2JOQA 2ILYA 4QIWD 5KFIA 4N47A 4BWMA 2IIHA 5IFMA 3PV8A 2QL9B 2V8PA 4KH0B 2DXEA 1WTFA 1YJNS 1LW2A 5B0DA 2MZSA 5KT7A 1ACMB 1G1XA 1URRA 5T41A 5IQ6A 4Y28C 5F8IA 4AL6A 4ELUA 4FXDA 2CQCA 4D3HA 3NWRA 4A8XA 2QGFB 5CXTA 1EAYC 3G8SA 1QE1A 3N6NA 2AJQA 4DCOB 3CB4A 3IO1A 2E1PA 4XPCA 5SUHA 4M5IA 2B7BB 4JV0A 4WU2A 2D3OR 1PJ6A 2XNQA 1U0HA 4JI2J 1BHNA 1QE1B 3GFZA 3OLAA 2ZH6A 2LYVA 3NS6A 2ROGA 4OX6A 1QY7A 1U4BA 5LL6d 3FBFA 2KH9A 4C8YA 4YHHJ 2EFVA 4X4PA 3VQTA 4HTJA 1S9EA 1U0HB 1FKOA 4DV3F 1TL5A 2ZZTA 1IKXA 4J9VA 5IT0A 1FVSA 2RDJA 5BJRA 5L1LA 2MZJA 2GGPA 2DISA 4ELVA 2Y1LB 2OH2A 3H2UB 4A8OA 5F8NA 1FKOB 5LSOA 2OFHX 1HNXF 1B4SA 2YNFA 5J2NA 4ZCKA 3TR5A 3THTA 4ED3A 2JWNA 1IKXB 4OI2A 2GAGC 4EUVA 2WW8A 2BEFA 2BBEA 5EN1A 3V6DA 3OTBA 4QQBA 2DCLA 3VAHA 1VRTA 2LQ8A 2OUGA 1FXDA 1RAIB 3NG8A 4RWWA 1VCTA 2YNFB 5J2NB 4LF6J 3CCWA 4WBFA 2Y3YA 1X4CA 1S1UA 4P73A 2BE7D 2OD6A 3I4HX 3V6DB 1HQUA 1HR0F 4NEZA 4P2XA 1VRTB 2E66A 3PNIA 1YJTA 2R7QA 1Z2LA 3V4MA 1FDDA 3V6KA 4EEYA 3W65A 2VG5A 2KFNA 3C16A 1S1UB 5I42A 2HBRB 1HQUB 4DL6A 1QSLA 4CLUA 4ZP9A 1RCXB 4RU2A 4NYOA 2CPDA 1JJCB 2Q3PA 3DOKA 3PCOB 3Q8QB 4K4SA 1DAXA 4B3TF 3CW2C 3OL7A 2RRAA 2V2QA 2VG5B 4MIWA 5KFBA 3C16B 5I42B 4PYAA 4V19J 4QR2A 3IA0A 4CCHA 4WK1A 2GVDA 1NU4A 1Y5LB 4MK9A 3A8IA 3DOKB 3HVRA 3VZHA 1X5PA 1WC1A 2RMLA 3EVMA 1S0OA 1NDKA 3N0VA 3LUYA 3UE2A 2FGOA 3T1HJ 4O4RA 4B9VA 5DETA 4ED7A 2GVDB 1GTEA 2X1BA 2C3PA 2RILA 3UQSA 3Q24A 5IOLA 3TZWA 1ZA2B 3KHGA 4ILLA 2JZ5A 4NPOA 2XMWA 2HYIB 4QYZJ 3DGPA 3EGNA 1R0CB 1RBOB 2KT2A 1N6QA 4O3NA 1RQ0A 2HQCA 1TK8A 2HFOA 1VDHA 3MXHP 1AFJA 4DQPA 3PW5A 4DV3J 3DGPB 1G3OA 4KE5A 4MT1A 3KLHA 1S1VA 4LF2A 1N6QB 4I6AA 1T9VA 2VBWA 1C4AA 1ZM3A 5BYSA 3TEHB 3M9OB 1HWJA 3GYNA 4ZVGA 4USJC 3I55S 3TEGA 2P2CB 3CO0P 1HFEL 3NY0A 1NB7A 5GMKa 1M5SA 4ZDNA 3HJVA 2R7SA 1K9MT 1GT8A 2D3UA 3DXBA 4F67A 4HT5A 3MMAA 1XN9A 4TY8B 2XZTB 4FKXA 1Z1ZA 2XI3A 4TU9A 3HVAA 2HVEA 2UUWA 1Q86T 2RB7A 2HAIA 5A6WA 4DFKA 4X66F 4H4KA 1HR0J 3B82A 1VQOS 3MECA 4LBIA 2GMJA 3KUGA 4IG3A 2DH7A 3MMAB 2ZJPQ 2OAUA 5E3CA 1JLQB 4NLOA 1P1LA 2B0GA 4DZ6A 1TFWA 2ZEJA 4CM0A 2Z2ZA 1Q4RA 3TJAA 2C22A 4R25A 4IG3B 4WK3A 3RUBL 4B3TJ 3J7A1 2W4CA 2H51B 1XIQA 3BYRA 3PW7A 3RB3A 3H59A 2VFRA 3UDVA 3N9UC 2V69A 1I51B 1SJQA 3QBCA 3CD5A 2V94A 2ZDPA 4ED8A 1CPZA 3UVJA 3RB0A 4F0MA 1UP1A 5GAGU 3OBIA 5CA5A 4FF2A 3W5YA 5DDPC 1SC3B 1VGYA 2ZNZA 3WX4A 4FYDA 2D7SA 5CH7B 1YJVA 1B0VA 3LP1A 2UVUA 2E29A 4J91A 2LVWA 4HR2A 2EC0A 2IHR1 1KFDA 4HI2A 1NH7A 3ZTRA 3KDNA 3I5CA 3W60A 1HW8A 3E51A 3LP1B 4NWBA 3DFEA 2WVFA 2R2UA 1QAXA 1DTTA 3N6MA 1VJWA 3DLKA 2CQDA 4OJ1A 4L76A 2VONA 2JFKA 3C8YA 4GVBA 1U6FA 1DQ8A 1BMQB 3BPSP 3MMBB 2DNMA 2UUBJ 1S7HA 4ENOA 4U67Q 4F04B 1HMVA 3CCRS 2CQ2A 1DTTB 5DDRC 3FBCA 3DLKB 3DRPA 3CIZA 3K89A 3SCIE 4P2FA 1T05A 3BPDA 4M63A 5HMYA 1NO8A 4GVBB 3S8SA 5DDOC 1U02A 4BDPA 3LGMA 3NAHA 1J5OA 3C14A 3SCLE 1HMVB 1D9DA 4ZOSA 4ZVTB 2HK2A 1GTHA 4PWWA 4C8LA 1N5VA 3HHLD 1T05B 3KG4A 5ETPA 4LIWA 4MYUA 3KLFA 4ZJQA 1J5OB 2QT7A 1VQ7S 2W1BA 3PHTA 2D1CA 2V63A 1N52B 2ZDOA 3HJFA 3M2UB 4DQIA 1PIEA 2Q6CA 4LR7A 3KLEA 2IMWP 1Q5VA 3H5UA 4J9KA 3CSKA 3KLFB 1LWFA 1HNIB 3MAHA 4DEZA 2H4WB 4RNOA 4CYUA 2HHTA 2MY7A 1TV6A 1Q78A 1X4EA 2DNRA 1C0TA 2B5JB 3KNAA 3KLEB 3P49B 2CDRB 3BREA 2LA4A 4R8UA 1VC5A 3DI6B 3W63A 2KI2A 4CYUB 4OZ3A 2GMHA 2BYCA 2CQGA 1TV6B 2NUUG 3G96A 2Q79A 1C0TB 2CZVC 1U1QA 2AGQA 4A8YA 1UPMB 4R8UB 3TZYA 1KWMA 2YH1A 1X9WA 3CCUS 1VQMS 4DPTA 5B09A 5HVHA 1ELOA 2XULA 3SDEB 3LH2S 1YJWS 2BJ3A 2EVZA 3D6FB 4ZCLA 4I1TA 4DL7A 1FX4A 2BE2A 2VOPA 5ETQA 4B3RJ 4UUXA 1RACB 2QX0A 1CQMA 1RTHA 4NA3A 3K57A 4JI1F 3R97A 1I6JA 3DMJA 5A2QU 4KHRA 4DPUA 2BE2B 3F44A 1HQ2A 1SI9A 3K5LA 2WB4A 3HFKA 1S57A 2C2NA 2R7VA 4RO0A 1RTHB 4ETZA 3P6YC 2PFFB 4YN3B 4IFVA 1G7CB 2LLZA 3NGKA 3BV8A 2BA9A 5ETMA 4NXNF 1DARA 3P3DA 2CUYA 2XZDB 3CCVS 2NXNA 3FEZA 1AFIA 3PKYA 5CD4A 3R27A 1VQYA 2J8AA 4PKDB 5IWAF 4P6QA 4LFCF 4IFVB 3C3LA 1X4HA 4LVOP 2GHWA 1UJ6A 1E6YA 2PI4A 2FY8A 2XGQA 2EG2A 4MJKA 1ZZFA 4NLRA 5CYMB 5F3TA 1FK9A 2CQ1A 4OYXA 5LM7E 2AZ3A 4E98A 1E6YB 2QRRA 2NSCA 2CQPA 3H4BA 2ZKTA 2ZH8A 4IR9A 1RT4A 2PDAA 1VR6A 5E41A 3GCWP 3U1MA 4P52A 2L48A 3Q8VA 4DR7F 3BJYA 2P9CA 2R42A 3FCHA 2ZD1A 3H2VE 2CYYA 2AV5A 3CJQA 4NCBA 2R3VA 4NCGA 1RT4B 5FLXY 2CQ3A 4ES3A 1HBNB 4ZPCA 3O5TB 1MN7A 2JC0A 1YLXA 3WX8A 2VZ9A 3H90A 3MR3A 4K4YA 2H9ZA 2ZD1B 1FFSB 4NCGB 4QWEA 1V5IB 5GVQA 1NMEB 3ICLA 5D6GA 5B0GA 4Y2CA 1N34F 1NH8A 1NHUA 2QC3A 2RD5C 4MIAA 4F4AA 4K4VA 1Y7PA 4ED5A 1JB0C 3IG1A 4H54A 3B8HA 4ZVSB 2AYEA 3BQ0A 4DQQA 4AYBD 3HZGA 2D9PA 4C2MA 2OHDA 2PT0A 4F4KA 2B4UA 3PIOQ 2JVRA 3M9MB 1U26A 2IJFA 5KFYA 2W2NP 5MAOA 3CC7S 4EYIB 3W1YC 5KFNA 4PWDA 3AD8C 2DKOB 3J7AN 2ZH4A 4PG4A 2J9CA 4BC9A 3D9BA 4DU7A 2ALZA 1CLFA 1RHJB 5AXKA 3H5XA 2XM3A 4PWDB 1AA1B 4NZ7A 4WJBA 1YQHA 1BQMB 2ZVSA 1NLKL 2J9DE 1Q81T 4WFZA 2ZC3A 1R27B 2Y0SD 1OY6A 4OJHA 2UXDF 1OMSA 3Q8RB 2KVQE 2LEBA 4RW6A 3K0JA 3FCVA 4UF4A 3M32A 1N0VC 4LFCJ 1V3RA 5ITHA 2WOMA 3QWUA 2K3KA 1T0TV 1RAJA 4F26A 2MSSA 1OQ6A 1RLDA 3W2WA 4RW6B 3E01A 2L9WA 2LQ9A 4CRJA 2DIUA 4EBDA 3M32B 1N54B 3PR4A 3BZQA 5A8WA 2FD2A 2WOMB 1KQGB 2M9KA 1GFWB 3GE9A 2EPIA 2HEKA 3EZ5A 1TL7A 1MWQA 3NGUA 3PM9A 1PAUB 3KFWX 3W2WB 2BQRA 3E01B 4WFAQ 3D6MB 4RKUC 2E1RA 3OFEA 5K20B 2OPRA 1H2UX 3DLLQ 5A8WB 1DTQA 3HHEA 5IT9U 3KK2A 3LGNA 1TL7B 3QFHA 3SBMA 2VU5A 4B3OA 2WTFA 1PILA 4GO7X 4LF4J 1LNQA 2DGQA 2GV1A 1ICEB 4LFAJ 3KK1A 2BOPA 1N88A 2VFUA 2OPRB 3E3XA 1DTQB 4YY3F 1FE4A 3N01A 3OXLA 2WONA 3PFOA 1K0VA 3MPWA 4XK8C 4PRFA 4B3OB 5DLFA 4ZP8A 3OL9A 2BR0A 4I6WA 3KK1B 2XMTA 2IY5B 4CI0B 5EWEA 4USMA 4KKOA 3GIRA 2ZJRQ 2XNRA 2HVHA 3FZBA 1N4LA 2WONB 3R5CA 4OX8A 2YTCA 2G1DA 2AJ2A 2FZGB 2OJ3A 4TY9A 4WFNQ 4UW2A 1WI6A 2HGMA 4OYWA 3VQSA 3D1HA 4RX6A 1SQFA 2V67A 3QFWA 2GJFA 4KBIA 8ATCB 3GZ7A 1FI4A 1KHWA 2G0CA 1GMWD 2CNKB 5A8KB 1VBZA 2CG8A 2ZH5A 2V34A 3T5KA 1R8AA 5HVFA 1X7VA 2J6SA 5F8JA 3MR7A 4DL0C 2X1FA 2W4PA 2DHSA 4WCEQ 3TARA 3KJNB 3O44A 3LPEA 1NK7A 2XY5A 3MCSA 3RRGA 2YQ1A 4CNYA 3UCUP 2YWFA 2VBXA 3AQOA 2OSRA 1TU0B 3T5HA 1KTVA 3GCXP 2FJDB 4GO5X 2AQ4A 4N41A 1FXRA 2D3ZA 2GHVC 4DJBA 3PDNA 3HHKA 4KFBB 2R9LA 3H40A 3D5MA 3MGJA 4LRCA 1J5EF 6FD1A 3FBEA 2J6TA 3A8EA 5U47A 4KAIA 1PAEX 2V4JB 1U2RA 2NXCA 4CM2A 2ATLA 1Q95G 4LBPA 2GJIA 3HXMA 3T6JA 1KLNA 2HHHF 2J0WA 1N33F 3DLHA 2KG1A 2GIRA 3SXLA 1J27A 4MK8A 5BXIA 4O3SA 2DRDA 5L46A 2ZWPA 4DG1A 2EFPA 4ZN1A 2RUGA 1RISA 4OHYA 1IKVA 1WSVA 3R5DA 2L41A 3OVSA 4H4MA 4LF7F 1HNVA 2RNEA 1S4FA 2BJDA 1OS5A 4KO0B 2RQKA 3I5AA 3IBCB 1YBTA 3SQOP 2BKNA 1RT2A 2RVJA 3GV5B 5LSLA 1UKUA 4L3KA 3SMZA 1KR4A 5MLCV 4PAAA 4H4MB 2IM0A 5BR8F 3QSYB 1HNVB 3EWGA 4X4SA 5EWFA 3DRRA 1ZAVA 1GXLA 4DV2F 5HLFA 2UZAA 2R4FA 3NGSA 5ADZA 5F41A 1UEVA 4AL7A 1H38A 4TQSA 5F9LA 5CAAA 1S6QA 3B4MA 3TO8A 1IBLF 5ETSA 3DRRB 1VBYA 2G1HA 4Q8FA 1IKWA 3IBFB 1T9YA 3MUTP 1XR6A 1KP6A 2QFIA 4DFMA 1NK0A 1VQLS 2W9BA 1F60B 3QNWB 1JLGA 5K14A 3CE8A 1S6QB 1LEOA 1N5QA 3EGVA 2DNGA 3WQPA 2W2OP 4O0NA 2KU7A 1IKWB 3JSMA 3FDSA 1U0SA 4DQRA 4RUBA 5SZTA 4YUDA 2RS2A 2GS8A 2W9BB 2YNHA 3RJMB 1TKZA 2A2DA 4BWJA 1JLGB 5K14B 2UU9F 1LFPA 3JSYA 3PYFA 1FKAF 2R7UA 3GJQB 5BYRA 1SL2A 5IC6B 1FCAA 4ZVFA 3R6LB 1RP5A 1FDNA 5A6PA 1PC5A 3ETMA 5D0GA 2B8PA 2YNHB 2VH7A 1S0VA 3OLBA 4CDIA 4EMDA 2YKAA 1BGXT 1O0PA 3CCSS 3QMQA 5CZVA 2AMCB 2YWEA 3GQCA 1Y4ZB 2ZWOA 3LAMA 4BLGA 2E1AA 2HHHJ 2WCXA 1N33J 3KUHA 4DR3J 2Z58B 3DGVA 1TTHB 3JAMU 3CULA 1YVFA 4KGKA 2IYIA 3Q8UA 1ZTTA 1S59A 1NKCA 3SZ2A 2BX6A 3CJ2A 3OSPA 5KG1A 5J2QA 1BUXA 5KG6A 4PZVA 8AT1B 1S0NA 2JLEA 1P1TA 3H98A 2EKNA 1LW0A 2K1RA 1VQSA 2CPZA 2XSFA 2J76E 5J2QB 3S1TA 3UFCX 1NZAA 2BACA 1HBMA 1RAAB 4NX9A 4ITSA 3G8QA 1LW0B 2K1RB 3VAMA 1N48A 2N82B 4DR2F 3SSRA 2AYMA 1YG0A 4DV2J 4KPYA 4WKRA 1YKWA 2R8JA 4DX5A 2Z2LA 4U7UK 5E7OB 1FKPA 1L5UA 3VAIA 3TP2A 4DR4F 1RABB 1IBLJ 4U96A 3DCAA 4AXIA 4LF9F 4DV5F 2KZZA 2HS4A 2YWWA 4CT8A 3OTEA 2ZBPA 4O3RA 1SKSA 1CEZA 2XMKA 1KQFB 1FKPB 2I2YA 2XC9A 4JI7J 2BW7A 2YNIB 2MLYA 3FQKA 2B3TB 1MMDA 3U7JA 1I1GA 4GKJJ 1EX8A 4ZLLA 4DFPA 4U6PA 1FRMA 4F3OA 3CCZA 3IMQJ 4K5SA 5DZ7A 5K8NA 2B56A 3IRXA 2UU9J 4LJMA 3FBBA 1U1RA 4DV7J 4QR1A 3SSSA 5H9EJ 2OI2A 2WVBA 3DLBA 1D8YA 1IM4A 2VBZA 2VKRA 4DPOA 4ZA1A 1LQ9A 3U02A 1FRLA 4LSLA 3IRXB 4RW4A 5CZXA 2WVCA 2VOOA 1W7WA 5FD1A 3L4BC 4OZ2A 2E7VA 2CJBA 2VODA 2MQMA 4TVAB 3QT6A 4ILMA 3K5MA 4HYKA 1HNWF 4LSLB 2ASYA 2FPHX 2RH3A 4ZVOB 1WC6A 2YVSA 3MEGA 4LREA 3IBWA 2R7TA 4FYWB 2ROPA 4CO0A 3LWMA 1IBMJ 1FRXA 2XBPA 2I38A 4RWXA 3EVWA 4DS4A 2F9DA 5M2UA 2N3LA 5L9XA 2IRUA 3M6UA 4K0KF 2ZUAA 1M1HA 1WOPA 4X64F 2Y1IA 3MEGB 4N7TA 1D3WA 3M9NB 5F8GA 1YWXA 4I56A 2CPFA 1DJ0A 1L3TA 4ZIVA 3ADAC 2ZITA 4NLWA 5RUBA 1N36J 2VASA 4YFUA 2BOAA 4DLEA 3KTQA 4JP8A 4N5SA 1CBKA 2NCKL 5T14A 3FFIB 1JJHA 3RRKA 1SJ1A 2PA3A 2BV3A 1EKSA 4DN9A 3KLIB 3J7YI 4DR1J 4QPXA 2VDIA 4OX9J 1URNA 5A2QY 3LANA 1SC6A 2MB0B 2E5IA 1N5SA 3N5FA 5J2MA 2DGXA 2DHGA 2C2DA 4RNHA 3JSBA 3W5XA 4TYAA 2UVRA 1T7PA 4V19X 3UCGA 2HNYA 1ZAXA 2EC2A 1RT1A 1UL3A 2IM2A 4ID5A 2EEYA 3MUMP 1U8SA 2B9XA 2CPHA 4UQGA 3QYYA 1IR0A 3W64A 2DGWA 4DN0A 5C25A 3WIVA 1U1PA 5HJXA 2FVCA 3HSJA 5KFDA 2MDAA 4HH1A 5J1PA 4QPTA 1ZH5A 2KN4A 3N79A 4EBCA 3KXDA 1NSPA 1MU2A 2V0NA 3JQKA 1HI1A 2MTLA 1K1QA 4AQYJ 5FDLB 3QZ8A 3CXCR 7AT1B 3HKZD 2NREA 2BE9B 3SFGA 1MU2B 2OPQB 2EW9A 2BJ8A 4P7VA 4ECVA 4M5JA 2XWXA 2QE5A 1XMBA 4Q2LA 3QO9B 4ANDA 5AT1B 1NJZA 3NBPA 4CTAA 3OVBA 3AJDA 4JI4J 2AYBA 3Q8YA 1CSJA 4OYZA 3HPOA 2DNPA 2C3YA 5JJBA 3GV8B 2UUAJ 3MPDA 3R5AA 3A4TA 1QDUB 3CJSA 4OYAA 1M1KT 1RU2A 3NOCA 4EZ6A 5BYQA 1TMJA 2OPSA 5DGBA 3BSNA 2IA0A 4CTAB 4DHVA 2NXEA 2BZ2A 3FRYA 5GAEI 3CC4S 1U6BA 1HNZF 3THPA 2OPSB 2MKYA 2VJVA 1QUPA 2XY6A 1UW4A 3QRRA 3SV4A 3M30B 1Q8KA 3U1LA 1FO1A 2V2VA 1JQGA 1Q79A 1D09B 1OSDA 1RJJA 1S1XA 1DQAA 5D77A 4ZVEA 3BB5A 4OX7A 1D9FA 2UXCJ 5HAOA 3M8QA 3AHPA 3G6ES 5IC4B 4OHXA 4DR6F 2JH3A 4PG6A 2KKHA 3PEHA 3QZ7A 1U25A 4XAKA 3VGSA 4L6V3 1U45A 1S1XB 2Q43A 2M8DB 2G2YA 3TQ1A 5J2PA 3W7BA 2FYXA 1VC0A 3M8QB 3TVKA 4PEOA 3JS9A 3CJ0A 4FYYB 1JJ2R 2E5LF 3OT9A 4HHJA 1HWIA 1MN9A 2H5IB 2PI5A 3P5TL 3T6BA 4PUOA 1CC8A 4RR5A 1UAWA 2AP6A 4RW7B 3R6GB 4WU3A 3QJPA 4PQUB 4EFAC 2F8EX 3T1YJ 2QL7B 3L3CA 3DLJA 1FJEB 2NR0A 3BGRB 5CQGA 1NPPA 1RAEB 1XBWA 2MLXA 3RGIA 4ZLPA 1WI8A 1QD1A 1RLCL 1H7XA 2VD3A 4DQSA 4GKKF 2RE1A 3A3NB 4NL5A 3AT1B 2HMIA 2BM0A 5KFKA 2ATCB 4NE9C 2YKNB 4UOHA 5IT9Y 1T8EA 1DLOA 1X9SA 2DNHA 3KDOA 5KFJA 3DYAA 2ZH1A 2P9GA 3BS9A 2IMOA 1C1BA 2DNLA 2GIFA 5JMNA 4H4OA 2HMIB 1KQKA 2LEAA 4QYRA 3BDPA 2OTLS 1HBOA 1IM6A 3W5ZA 3PX0A 1DLOB 3H42A 3KOAA 3DYAB 4DV0J 4KGVB 2BQ3A 1C1BB 3FCWA 3J7YU 3EX7B 3V2UC 1Z2ZA 2N7CA 1UCNA 4H4OB 2UP1A 1RZMA 1M5PC 4M5GA 3UR0A 3HZEA 1RTZA 5THWA 4K7QA 2YKOA 2LEPA 1ULRA 4A4JA 2A10A 1IWAA 2C2EA 2JEFA 1HNZJ 3RW7A 3SCKE 1V9OA 4WP8A 5HQLA 2O5DA 2COLA 3GIKA 1JNZB 4JV5F 1PSDA 4OI6A 2WBRA 1UJ5A 3BO4A 3HT0A 1PC4A 4ES1A 4J9NA 1QUVA 1NK9A 1TL4A 3HLUA 3ILIA 2ZHBA 5KFLA 2VL1A 5IQQA 5KFTA 3CJKB 3WIUA 3RTVA 1FERA 5IXUA 5ETVA 1ZPWX 1FD2A 2MQPA 1VI7A 2ZH7A 2V2KA 1R8HA 4J9SA 3TOQA 1R31A 1UWAA 3FEYB 1S6UA 4FNIA 4DSIA 4C3LA 1T02A 2VUGA 4AUKA 1NKBA 1SJRA 4DF4A 2LXUA 3TRGA 5HK4A 1SQEA 2E5LJ 2XS7A 3H4DA 3ZTSA 4ALZA 4LMZA 4WYWA 4FN5A 2YKMA 1H0HB 3QAUA 1FNOA 4WWSA 3Q23A 3KMSA 5GAHU 4LF8F 4LSNB 7FDRA 3GR1A 1HBUA 4FNHA 4YR0A 3D68A 3GPAA 3QT8A 1WF1A 2I1RA 3HD1A 2QSWA 2WSFC 4JI5F 2F65A 5KT3A 3NCPA 4LRAA 3GFHA 2YKMB 2W2PP 4RNNA 2YQ3A 2NZ4A 5G0RB 3A8KA 3P96A 4G1IA 2GVZA 4DX8H 4CH7A 4ZKAA 2BANA 3BBFA 1SKUB 3PYGA 1NDCA 1NDPA 4U8YA 4A8KA 4ZJOA 1VJQA 4JI0F 4IH6A 2Q1LA 2RDIA 1AW0A 4NLYA 1HKAA 2LDYA 2Z2MA 2GVZB 1IBKF 1KOOA 5GAEU 2MEWA 3PW0A 3UDLA 4ELTA 2BANB 4ECYA 5E3RA 2RAQA 2DYAA 4MH8A 2NQPA 3LW5C 2QMXA 1D8ZA 3QGIA 3E2EA 2G2OA 4X65F 5HP1A 2WZ1A 1NXIA 2ZKUA 3GJSB 3I6PA 1VK8A 2LECA 4XO0A 4LF5F 4FF3A 3HHLA 2PEHA 2FC9A 4MKVA 3W2VA 2YPYA 3MM8B 1FJ7A 4XPEA 4K59A 3POTA 2FHJD 4WPAA 2MJUA 1IKYA 2B7CB 4JV5J 1F9FA 3MCOA 1GEHA 3HHLB 3KLGB 1UZHA 2XMAA 1NSAA 4YB6A 2CRLA 2JLFA 3BO2A 1I94F 4CP5A 4RJVA 3POTB 4J9OA 4UT4A 3OHBA 3ONQA 2Y8YA 4Y34A 4KB7A 1XC9A 2HFUA 1N5TA 1YK9A 5B0BA 3ET6A 1OYEA 1T3OA 3CCLS 4IR1A 1RAHB 4FYXB 3KWMA 5A8RA 2AGPA 2YWKA 4QU6A 2W9AA 3PACA 1RTDA 2NSBA 2A1BA 5ETKA 1BD6A 1RT6B 4GC6A 1TELA 5K8PA 5A8RB 5DQIA 5ETOA 3DXSX 2MZRA 4K4TA 4C8OA 4TKTA 1RTDB 2RU3A 1VBKA 1X4AA 5K8MA 3UR3C 5GADI 1S1WA 4X2BA 5E3AA 4F3MA 3AA8A 8RUCA 4EGLA 2OTJS 1MWZA 1NZ8A 3MMJA 3MDFA 2ZJQQ 4OZJA 2OPPB 1GH8A 1U1OA 1AUDA 5L1IA 4DV4F 2D41A 1VK3A 4IG0A 5EDWA 1DURA 1S1WB 4YDDB 3R5JB 3JAMY 3LO3A 3VVTA 3K5OA 4UY8T 3AOBA 1KN6A 2ILZA 3KUEA 3G4SS 1YJRA 5H9FJ 4WXWA 1QTNB 3DHXA 2EFOA 4DZDA 2AKWB 5DQHA 1FA0A 1QTMA 2ZHOA 4CO5A 1QJHA 2CPIA 4C7QA 2WW4A 4YP3A 3T5JA 4G1QA 2V8DA 4C3MA 2VC1A 1FRJA 4YHHF 2XI2A 5KFFA 4FXVA 3BQ1A 2KXFA 3DRSA 1PCAA 1MNEA 2AYGA 2CFXA 4FZVA 5DZ6A 3T9NA 1PBUA 2ROEA 4LF5J 1TL1A 4USHA 1WOOA 3OJSA 2DH9A 4G1QB 2SXLA 3TI0A 3EXCX 3QAEA 3NL0A 1D0EA 4OZLA 2DHAA 2PMWA 3K7RA 3DRSB 5IZHA 4JYAJ 1A7GE 3H20A 2OP5A 2XEXA 4XDCA 2R7RA 5JVHQ 1TL1B 4OHZA 3MM9A 2N4CA 2QMWA 3WZ0A 3MM6A 1JKHA 3OXFA 3UN5A 4GVLA 3ZFVA 2FJAB 4GC7A 3CD7A 1B99A 1HI0P 4NXMJ 5E0OA 1EETA 2MKJA 5EX3A 3K8WA 2RF2A 3MM7B 4LF6F 3CWJA 3TAPA 1ZM2A 2MPUA 3VR1A 3MM9B 1R6YA 3BBBA 2HFSA 1T94A 3MM6B 1JKHB 1EJ7L 1FTRA 4DU8A 3M8RA 2PFDA 1WEXA 4IH7A 4QBUA 6FDRA 1X5OA 4JI3F 3HD2A 2RF2B 2C1EB 4O23A 3TQEA 3BO3A 3LALA 1MMNA 3KK3A 4DBQA 1NJYA 4HDHA 2FJVA 1CVJA 3A12A 2MMYA 2JEJA 1KTQA 4C48A 1SB6A 4NA1A 1APSA 2XY7A 3O3LA 4IQMA 3P5BP 4ZIWA 2ADBA 4HH0A 5G4DA 2VJUA 1VQ6S 3H7HB 2Z56B 4ZJLA 1RAGB 3BH7B 1DY3A 2D9OA 2M0GB 3KK3B 5CD4H 4IYQA 3CJ3A 3T41A 4PPDA 3I87A 4Q0BB 4DV4J 2HZVA 1UEUA 4DX6A 3AAWB 3QSIA 1VQPS 1RB0A 3PX6A 3UDEA 4QR0A 3RB4A 3C6UA 3T1HF 5KFHA 3ILJA 3AJ1A 1X4GA 3F73A 2UV8G 1S9GB 2M52A 2C42A 2YY3A 2QLBB 2E7XA 4UZCA 1VRUA 3C6UB 3CDUA 2M7SA 1LV5A 3HULA 1U1MA 4QCLA 1F9HA 3OFHA 2B51A 3O2IA 2W7OA 1PBAA 2K7KA 1GQEA 2G0JA 3CDAA 1M5OC 4MAKA 1GMVA 1S12A 1RCOB 1VRUB 3A3PB 5AXNA 4CH1A 4TQRA 4MFBA 1MLAA 2CNLB 3GSIA 4K5RA 4LVNP 2CQIA 3HHLC 3GG1A 2IRXA 1TR0A 4GMKA 2I8EA 4J7CA 1U47A 1HIYA 1EIYB 2CG4A 3TUZC 4MFBB 1OPZA 2JNJA 5AJ3J 3QJJA 1FESA 2AIRB 1KBRA 5D3GB 2XB2D 2J7WA 4Y6IA 5EGYA 1LXJA 2IAJA 4R5PA 4IRCA 4QIVA 4P75A 5A0YA 2XLIA 2K7JA 4QWAA 1KD1T 1SKWA 1Q16B 3EDRB 3G82A 3M2VA 4ED2A 5GADU 1IXKA 2IAJB 4R5PB 5A0YB 3G9CA 4NLXA 3IWLA 4JI3J 1WDTA 3F0NA 1FWLA 4HT7A 4D3GA 3G82B 4N77A 1FE0A 1NM2A 2F8MA 1E6VA 3M2VB 1WUUA 2GJ2A 5I3QA 1Q8IA 2Q6BA 2IYGA 3GB0A 1QAIA 3N5BA 3T3FA 3J81j 4Y65A 1R8CA 1RWKB 4IOBA 2GCFA 1OSCA 2EFQA 5CCLA 1F0XA 1IQZA 2YBVA 3RBZA 2PC6A 2IVMA 1E6VB 1FXLA 2VQEF 2LU2A 3Q83A 4NLPA 1UMJA 4KIAA 3IM9A 3TA0A 5D4NA 5HROA 1RXOB 5LT5A 1WC3A 4BCAA 4HEA9 2B4OA 2K2PA 2JSXA 2IC3B 2RUSA 3AOAA 2QTWA 2FVPA 1UVMA 1VQKS 2M88A 1GMWA 3UO0A 3W9JA 3HP6A 2GO8A 3EGWB 1LK5A 4OMFG 2HAFA 4I2PA 4A8MP 2HHWA 4DSLA 4KGZB 4J37A 1T3NA 1NK8A 4FBUA 1F5AA 4CLLA 4DSEA 1FTCA 5HROB 1TFYA 5C24A 2GQ2A 4ZS6A 2VIHA 4IUFA 3CMQA 2ACYA 1KLMB 3CT9A 1LFWA 2FVRA 2VA2A 3MTJA 2UUCF 1H98A 4I2PB 5LJ5Y 2V4QA 5C24B 2NYHA 1S1TA 3S01A 2R7XA 2PO4A 4USIA 1YITS 4B3MJ 2Y1RI 2AWZA 1UVLA 5ETLA 5DO2A 3NXZA 2DR9A 3CD6S 2NYIA 5B0FA 1N32J 2UUBF 5KFWA 4RW8A 3UD4P 4ER8A 4OYOA 5KFSA 1S1TB 1WC0A 2NPIA 4DUYJ 2AEJA 3WDOA 2AW0A 2LQBA 4TY8A 5JVGQ 4RW8B 5B0EA 4GRSA 1U09A 4DOZA 2G0IA 1YGYA 1YJ9S 1W25A 3D54A 4URQU 2HQGA 4PPZA 3M8SA 3MOJB 4TU7A 2GNKA 2QZ8A 5AXLA 1QVFR 1U2FA 2MGZA 4DCJB 2K8GA 2Y0BB 3JSRA 4ETXA 1JLQA 4P2MA 3EJMA 2C3MA 3MEKA 1UA1A 3ZZUA 1G2EA 5CYQA 3IAS9 2MGZB 3B6BA 2KZMA 1TK0A 2WK4A 3DDIA 3G6VA 3NGRA 2YWGA 2B6AA 3R8YA 2E1MC 3BSOA 4F4YA 2DBBA 4FP9A 3CJRA 2HVZA 3M7VA 4EU0A 4KHPJ 3TZXA 2QMUB 5F0WA 1WD6A 2DEJA 5CYQB 3QGHA 1RT7A 1PO6A 2XYPB 4RBVA 3Q8SB 2FJEB 4NRTA 4W4MA 1PYOB 2B6AB 2J0XA 3LTOA 4X4QA 2CWXA 4DL5A 3KG0A 2H1YA 2VQEJ 4WZMA 2CVEA 2P6SA 4LF1A 3OPKA 4B9TA 4F0HA 1RT7B 4RW9B 5ETRA 2MZQA 2EK6A 3X1LB 4I4BA 1N8RT 2HNZB 4ZPAA 1AZSB 1EQMA 1XJWB 4B9MA 3BKTA 4B3RF 2B4VA 2BKOA 3VTIA 4ECQA 2OO4A 5F0UA 2C2RA 4ECZA 3FKBA 2UUCJ 3MMBA 1XNQF 1X60A 2HHVA 4C98A 1AXQA 3SV3A 4PXBA 3QPIA 2HRYA 3K5NA 1SH2A 1ZM9A 3DKDA 3D6TB 3D2WA 1Y9OA 1NBEB 3IR7B 1Q53A 3G71S 3FUYA 4W92B 1VOMA 1SH3A 3U1NA 2MQOA 3GP9A 3EYZA 4MTPA 2ZM6F 2O1PA 4A47A 1IQTA 4J90A 2DVIA 2LKZA 1SIZA 1KKHA 3ITHB 2LQ5A 1S4EA 1F5CA 1WKKA 4J5OA 4UOGA 2ZH2A 5AE1A 4F3QA 1HQEB 4CLSA 3LP0B 3UWTA 3NLCA 5KG2A 2AJ1A 1P9YA 2ZOMA 2CAJA 3RB6A 2E9TA 3M2UA 5LJ3Y 3MFHA 3QIDA 2UVVA 2M5YA 1S5ZA 2CXEA 2DD8S 2QG9B 3IR5B 4K4ZA 4F02A 2JEGA 1HNIA 3TJ9A 2B43A 3EXYA 2VPXB 5L1JA 2IPOB 3V5RA 2B5JA 2CJKA 2HZCA 4UTGA 1WG1A 4L72B 2DO0A 2A3JA 1WKJA 3DI6A 1Y5IB 1A6LA 3Q2TC 1QSYA 4C0BA 3OUYB 1K47A 3TNVA 2L9NA 3I96A 1QVGR 1S6OA 1YDLA 2C3UA 1OQ3A 2FZKB 2OLWA 1SJFA 1S49A 5HATA 2QYGA 3EZOA 2QN6B 4NLVA 1TUGB 4A8WA 2E44A 3S7RA 2Y1JA 3SDEA 4E8UA 2L9DA 4DSJA 3RZAA 1KHVA 4PWUA 4B08A 1NRKA 5EWGA 2X7IA 1JXVA 4ECRA 4U95A 1TKDA 3PG9A 1FHTA 2V68A 5E3QA 1RUSA 2PMHA 1XK8A 3BSAA 4K50A 3P45B 1XERA 2KJWA 2ASDA 2QEXS 1CJTA 1S76D 4OZ1A 4NA2A 4OI3A 2IRYA 2F40A 3NOGA 3SYZA 2QO3A 2FHOB 3CDEA 2IVFB 3R1HA 1SKRA 2DY9A 3VV2B 2RIJA 1XNQJ 5ETNA 2AEFA 1ITPA 1UWBA 1CJTB 1TUVA 2NUHA 3K59A 2CA9A 1Y5NB 3C66A 1GX6A 1H72C 1TVRB 2F4VF 3KYLA 5F9NA 3HMJG 3HVWA 1KC8T 3G86A 2HRUA 1YRXA 1UWBB 2OEKA 2QA1A 3NCRA 2YNGB 5CYMA 4IOAQ 2ZM6J 4WE1B 1HYSA 1Y11A 2QSFA 1UZDA 4USUA 1LOUA 1WHXA 2N7YA 2MJNA 3ZNUA 2AU0A 5FJ4A 3QGGA 2HVIA 3IAM9 1HYSB 4DR5J 2HNDB 4YR3A 4KRWA 1VISA 2BJEA 1R8PA 3CIMA 3RG6A 1HA1A 1CS4B 2E5HA 5FIIA 2LU1A 3NGTA 2FTRA 3CMAS 4M8LA 3PZPA 4OHVA 2RQ4A 4S0MA 3NP5A 2A2CA 4H4KC 2WRMA 1XMOJ 1HBNA 3I4PA 1SV5A 1N56A 4DX7A 3FSYA 4CLZA 4TYBA 2DGOA 1BQXA 2BUNA 2Z4PA 3EICA 4CLPA 1WOSA 1FNXH 1IR1A 1U7LA 3M8ZA 1WACA 4LF4F 4A48A 4LFAF 2LXFA 1SV5B 2RRBA 1REVA 2G4BA 5KOWA 4CWBA 2VFTA 5KFPA 2XTJP 1B0TA 2VBYA 5LMUJ 1KVJA 1C0UA 3BDEA 2JHEA 1REVB 5KFCA 2OSQA 4ZN3A 2J9EA 1NK6A 3CTRA 1SH0A 3RRHA 2A6OA 3LWLA 2DGSA 4CQ1A 1C0UB 1RWPB 2CPEA 3D6HB 1NPRA 4WP9A 3GJRB 1NEEA 2KXNB 1EB0A 3VF0B 1F3VA 4OQJA 4QIEA 1BQMA 3MOZA 3IM8A 4ZITA 3R3TA 1XMQF 2FJWA 2MQ8A 5HQ8A 1U24A 2XO6A 2JEIA 3UNYA 1J2VA 1M5HA 2H5EA 2F4VJ 2FLOA 5C2GA 2RHQB 1X4DA 3OHAA 3PTWA 1VHFA 5CCMA 5DG7A 4M5NA 1YJ7A 1F6TA 1F3FA 4ECXA 4B17A 4CO4A 5IV4A 3IN5A 2KFYA 2KHDA 3ENVA 1F9EB 5JUMA 2F8HA 3PRDA 3CMES 4WTYA 1B7YB 2B4PA 2BW2A 4QOTA 4ZPDA 2LA6A 3SEOA 5KG4A 2NPFA 2JRSA 2J8SA 3GU0A 1HHSA 4ZVQB 5EHHA 2Z8QA 4M5LA 1HD1A 1G4CA 4ED0A 4KV8A 1Y00A 3L95X 2KL8A 4HI1A 3PXGa 1IUJA 4NYPA 2AX1A 2POKA 1WF2A 5D0RA 4F0KA 1RU1A 5EUHA 4DL4A 5B08A 1GXUA 2HFNA 1V5VA 3KJVA 3TJ8A 1Q8BA 2V9WA 4PXCA 3ZZZA 4KV8B 4MKAA 3UPFA 2CPJA 2QA4G 3GSDA 5K5MA 4P71A 1FT8A 4LFBF 2W8KA 3KJVB 4F25A 2N3OA 4I68A 2IJRA 3SIPB 5D8HB 1RYRA 1FX2A 1DRZA 1H6KX 2CQ0A 4FYVB 3DN9A 3GG0A 3JQJA 2CKWA 5KFOA 1VQ5S 4L75A 1CULA 3CPWR 4N76A 3FK4A 2FVSA 1LW2B 3H8YA 2DXFA 1R3NA 3M05A 2NXUA 3NWGA 1SPBP 2YKPA 1IJFB 1RADB 3IS9A 4RZRA 1L3SA 3AXMA 1CULB 1QSSA 2PGCA 1XNRJ 3EPGA 2VPZB 2XWYA 2GMLA 3AD7C 1NJXA 5K8OA 5A8KA 1S77D 5GAGI 1XR7A 5KFZA 4UY85 2VPWB 1FF2A 5HI7A 5J1NA 3RAMA 1T9WA 3IS9B 4DUZJ 2DCUB 9RUBA 4EWTA 2MYFA 3J80U 3ZZPA 2X1GA 3D28A 2VFSA 1ZOTA 3ZO7A 1XMQJ 4R0EA 2EG1A 1UFLA 3S6EA 4IH5A 1SBRA 2IM1A 2XMUA 5L1KA 1Y3KA 5F8HA 5DLGA 1S9EB 3PEJA 3FC9A 4KFBA 3ILLA 2ADCA 1N5YA 1M90T 4OZ0A 2F7VA 3PKMA 1P27B 4CZCA 3RAQA 3OJUA 3VGUA 2GGPB 2X51A 4TNOA 2X1AA 2V4JA 2DGTA 1VIOA 2VICA 5C42A 3DU5A 1N5YB 1F5BA 3OSNA 4ES2A 2V8HA 2XHCA 2BM1A 4ZVHA 4FS1A 2GO9A 1Q5YA 5C42B 2I0XA 4URGA 1D9AA 2WHOA 5I4MA 4DCPB 1DQ9A 4QYZK 1RBAA 2L08A 4DF8A 4DR3F 1K0TA 3KLVA 1FJGJ 3MZIA 4X62J 2DITA 1JMTA 4IO9Q 3N4WA 4ZP6A 2MLZA 2NXJA 4WFYA 3KG1A 2VDHA 4AE5A 1SUQA 2HHSA 1YX2A 4HDGA 2HHUA 4KO0A 4LFBJ 2DRBA 5KAKA 2GZOA 4G6VB 3MI7X 2WVDA 3VWSA 4OI4A 4NLUA 4NZ6A 2ZBCA 5DS7A 1S6PA 2KM8B 1SUQB 4LUBA 1Q0NA 3MF5A 1T9TA 3FRZA 3HCXA 1CJUA 4KTQA 3VAGA 5M2RA 4N8NA 1CJKA 4A8FA 2KJVA 4EZ9A 4LRDA 2CNOB 4M94A 2ZH9A 2DO4A 4KGMA 1FDAA 1S6PB 2N4DA 2QA4S 3GR0A 2D69A 1CJUB 3CUNA 2BJ7A 4RUCA 4KYZA 1F2HA 2FIUA 1DBDA 4ZLJA 2K3IA 1CJKB 5IS2A 1RKIA 2RU9A 4O3QA 3TX8A 5KG3A 4ICLA 1AUSL 2DR6A 2HK3A 2P6TA 2ZH3A 1WNEA 1UVJA 2OMLA 3R9LA 2LP4A 3MPUB 1RWMB 1RA7A 4QIFA 4JI7F 1X0FA 4ICLB 3C15A 5F3ZA 4GKJF 4LQ9A 4RNFA 2ZC4A 3CJ5A 3ISNC 2CPXA 3CC2S 3KHHA 4DL3A 1HNXJ 3KLHB 1S1VB 2FVQA 3HI9A 3C15B 4DV7F 3TA1A 4KH1B 3VGVA 3GYXB 1T11A 3OL6A 3L7UA 3HM9A 3BBCA 3TVYA 4CLTA 4PCQA 2MSTA 1Z4UA 5DGAA 2DGVA 3A3OB 4ZPBA 2HFZA 1B0PA 1FJCA 2FHJA 1IBMF 1R7IA 2YPZA 4NCAA 5C2CA 1UVKA 3HFZB 3MECB 2R2TA 1S10A 4X84A 1M5VC 1VQ9S 3K58A 3ENQA 3BKFA 1H73A 5M2PA 3R5GA 2RRNA 2HW3A 3T5LA 5D4OA 3WC2A 1IN0A 1KEKA 4DSKA 3PO4A 4NI2A 3Q8PB 1CJVA 1N36F 4QWDA 2QIFA 5KT2A 3M8YA 4I0WA 3RBDA 3PY8A 1IJEB 3MD3A 4ERDA 3UNGC 3D66A 1LWXA 4QW9A 4DR1F 4NI2B 4RBUA 1CJVB 2XO7A 5HVGA 1ZA1B 3BN7A 1BLUA 3M1VA 2VG7A 4OX9F 2FUG9 3UVJB 4X4UA 4I64A 1UETA 3H5SA 5HMXA 2HWTA 4U9RA 2B9YA 4O3PA 4O4GA 2XCAA 1JLBA 3NGDA 3MTKA 2DB1A 3M1VB 2VG7B 4LSZB 4URSA 2YNIA 5E2QA 4Y00A 5JXSA 2BABA 2NLWA 3MFIA 4O4GB 4I69A 1JLBB 2YWHA 1M0SA 3KHRA 4ZVUB 4USKA 3VVUA 2BJ1A 5KFUA 3RR7A 2KG0A 1PKUA 4F8RA 4OLOA 3NEKA 3J7Z5 4LBHA 3PHEA 3D7SB 1QAJA 1U2CA 2OD4A 2MKIA 4J9RA 1FFWB 5CHCB 1UA0A 4OYIA 5CYJA 2M2BA 2CVIA 4QU7A 4OI0A 3TUJC 3DRPB 2VHGA 2ZZMA 2GFFA 4RBTA 3O6QA 4AQYF 2YKQA 3MAQA 2WBMA 3LOUA 3B4DA 2PD1A 3BGUA 3C14B 4CT9A 4NRUA 3BKUA 2M3DA 4X66J 4ZCIA 3CDBA 1RWNB 1PGZA 4ECTA 4CH0S 4DPXA 2IJNA 2DNYA 1S99A 5KT5A 4QJVA 4MKYA 4V1Ak 2X3GA 2DEIA 4JI4F 5D4LA 3H5YA 3DNCA 4USTA 2YX4A 1QAYA 1U1NA 3L7OA 4M1KA 2UUAF 4Z7YA 4YEAA 2DPIA 3RU0A 2AJFE 2P5VA 3BSCA 4K2XA 5LXRA 2GIQA 1JXEA 1BWVA 2Y9HA 1LWFB 1WC5A 4G65A 1SC4B 2KM8C 3FFIA 2GC8A 4EK2A 4DXLA 2MHNA 3HKWA 3KJFB 3KLIA 5J1EA 4UOCA 1FEEA 1JWWA 1RT5A 2RSQA 3OTDA 4CLYA 5HMZA 1EZZB 2HS0A 2QA2A 4OHWA 1XWLA 1HWLA 3BH6B 5KT6A 2P8IA 4QIGA 5J1EB 3ZZOA 3CJ8A 5B0AA 1RT5B 4M5DA 2W8LA 4NYZA 2ABYA 2GA7A 3ILOA 1RDRA 4F4XA 2UXCF 3JTPA 3I31A 3OXGA 4M5DB 4DLGA 4FF1A 2PEBA 5DG8A 1RHQB 4TLRA 3D67A 2XS5A 1H3DA 3FQLA 1WHWA 3CNQP 3K17A 3FSXA 1B64A 2XG8A 1C4CA 1OY8A 1WHVA 2MKCA 3AB4B 2CJYB 2G2ZA 4QWCA 3DMJB 3DLGA 2HVDA 1RGVA 3OW2R 2VKZG 2OELA 3OQ2A 5FDLA 3CCQS 5H1SV 4DMZA 3T1YF 1H7WA 3W9IA 4ZCMA 3FJ2A 4MK7A 2OFGX 2EBEA 4J9MA 3DLGB 2PSZA 2OPQA 2FHKA 2Z57B 1JNRB 3TYTA 3J81U 4X4TA 3A13A 1A9NB 2IM3A 3QO9A 3R2CJ 2DNNA 5HBMA 1WWHA 2DIVA 2FB0A 2HBQB 4Q5VA 4OV6A 4ZHRA 2MQNA 4TN2A 3MD1A 4YS2A 4DFJA 2QLFB 4W90B 1EP4A 1FK9B 2HWIA 1FDBA 2BRKA 3GONA 4ILRA 4OYMA 4WIQA 5HBMB 1SCJB 3NMRA 4ZHRB 1RHMB 1KONA 3GWCA 2UUTA 2HPUA 4WZQA 3GIMA 2LQJA 1EP4B 2KYZA 4YDXA 4C8KA 1HI8A 2ALYB 2QLJB 4DV0F 3CCMS 2DT9A 5C5JA 5E5NA 1NK4A 1M5KC 4USWA 2HG4A 2OEJA 4RLEA 1VQNS 4DPYA 2ZZNA 4UZBA 4OYPA 3JTOA 1HWUA 2QLWA 3M30A 3JB9k 1LKZA 2CQBA 4CLWA 3TANA 1M1GA 2JVOA 2KRBA 2BRLA 1MMLA 1PYSB 4OJGA 2IBOA 3GTYX 3FEXB 1OIAA 3ISZA 2X3DA 4YB5A 2QJ3A 2J6UA 3M6VA 2Y8WA 2WVEA 3OR1A 3CO9A 3T9ZA 4JV1A 3KHLA 3DM2A 3IG1B 2XMJA 2V2ZA 1WJ9A 1UTAA 4DPWA 4AD6A 1WTBA 3QATA 1RAOA 3M2RA 4IRKA 2CJQA 2O67A 1S72S 4OYBA 4JI1J 1NHKL 3OR1B 3OL8A 3M6XA 2VPYB 3DM2B 4ECWA 1JLCA 3UCZP 3MR2A 2DGUA 2APOA 1UW9A 4RW7A 3M2RB 3IWNC 3IR6B 1X31C 2R8KA 1I3OB 4PQUA 2KDOA 4NXNJ 3RBXA 1REGX 3BGRA 4XDDA 4OV1A 4RUAA 3QRQA 3EGZA 1JLCB 3MPYA 2HIQA 2HQ3A 5IWAJ 2HQDA 4DS5A 9ATCB 1U49A 2XHWA 1FRKA 4DL2A 1VIXA 1FEHA 4UOFA 3QLHA 2YKNA 4IO1A 1H2VZ 1XR5A 3SSQA 3JQMA 3W8GA 2IDEA 3GFYA 2XYGB 3B54A 2KVIA 3ZZYA 3TW0A 3I0SA 1NKEA 3I5BA 3DOMA 3T19A 4Y3CA 4P72A 2JFDA 3QLHB 3GFXA 4P74A 4KPCA 4PXEA 4ATNA 4C0HA 1DFDA 4ED4A 5E33A 1SIWB 1L3VA 5F8MA 3SI8A 2MKSA 2YX7A 3RYLA 3I0SB 4Q45A 4DR7J 3DOMB 2DR5A 4PG5A 1VQ4S 3BR9A 2EXUA 1HPZA 3I0RA 4YB1P 3EVOA 3ENWA 4XTTA 2R2RA 2KFZA 1UVNA 1XTZA 4A8QA 1X9MA 1Q82T 2RQMA 3KK2B 2YX1A 1MG7A 3DRXA 3EPIA 1RE1B 2R7WA 2ZNYA 1HPZB 3HK2A 3I0RB 4AXJA 3MEEA 1C1CA 4F2SA 4O3OA 1X5SA 4EO8A 3CVKA 3US5A 1N34J 1U6ZA 3CJKA 2G13A 2BKPA 4FVMA 4LRFA 1JXLA 1KVIA 3X3UA 1Q7LB 2HZAA 2CQHA 2RJZA 3EUNA 3BR8A 3MEEB 3J80Y 1C1CB 3MMCA 3CD0A 2XS2A 2VF3A 2Z2YB 4J9UE 4KKOB 1TZ0A 3W9HA 4G3IA 4MMOA 4PXDA 4L74A 3NNCA 2V50A 2F4FA 1ZS6A 3QQCD 3EE3A 3MMCB 4ANEA 2WAQD 2W2MP 2OMOA 1TL3A 2VB6A 4ANCA 5DDQC 3E8OA 1B7FA 1Q1KA 2C2MB 4NOHA 4LSNA 2DTJA 3PRVA 3K8VA 4A8SA 1RSCA 4NEYA 1NCLA 1TL3B 3FMWA 1NK5A 3IFEA 2UXDJ 3OD2A 1CQNA 4AFFA 4NLTA 2FHMA 3HFVA 4I2QA 5KFQA 5G0RA 2R8GA 2JX2A 1WF0A 3EZUA 1FFGB 1HD0A 4KR0B 3TAQA 2DR7A 3NAIA 5LOQA 4ED6A 2GHPA 1WEZA 1RWOB 2CADA 4ID8A 1KDNA 4LRBA 4I2QB 1VLOA 4Z2XA 3EMTA 2EBGA 2J9DA 2XYHB 1IWGA 3V81A 3OTOF 3VGTA 4U7UD 4FXWA 4M5KA 2IVYA 1AROP 3TWZA 3FGVA 4PR6A 3TZZA 1MWYA 2DJWA 3RAXA 2C3OA 1WORA 2XCPA 3RBEA 2GX8A 2VQFF 3IWXA 3PIPQ 3V81B 1CC7A 3PJXA 3ELHA 4LR8A 4KGXB 4TXSA 1O5JA 2KHCA 3GJTB 1P8GA 2PE8A 2W2QP 3OFGA 4KQZA 1O51A 4I67A 3D3BJ 4C8MA 1WG5A 3OV7A 3MM8A 3WHIA 3P8BB 1T9UA 2H48B 3ZXWA 3Q2SC 2BJ9A 4ECSA 3AODA 3M4XA 2B8QA 3ZZTA 2FQQB 4YY3J 4DG1B 3D1OA 2LFVA 2E7WA 1MROA 1JJ4A 2BVZA 3KLGA 1FNMA 1ROFA 3M6WA 1IR2A 1RWXB 3N28A 2FLNA 2J7UA 1IKVB 4F36A 1O8BA 3F56A 1GXTA 3ZTQA 4JYAF 1BC6A 5I3UA 3OVAA 1MROB 1KS2A 4ED1A 2UV8A 3MCMA 1ZZNA 1RHUB 2IA6A 1GMUA 2CZ9A 2ZOFA 4K4XA 4XIUA 3GV7B 2ZOGA 1TP7A 4DDFA 1F1BB 1RT2B 2C28A 3C2PA 4NXMF 5I3UB 3BGOP 1B70B 2HS3A 2KYXA 3NS5A 3DDKA 1RT6A 5K9FA 1RI7A 5HLFB 3D4JA 3LPYA 4NASA 3Q89A 3EDQB 3MPVA 1U48A 3SCJE 5KFMA 3IGVA 1GAOA 4FDFA 1RBLA 2NZCA 5HMWA 2DK2A 2J0QD 7FD1A 2H3EB 3HO1A 3ZZRA 2IBKA 2HRTA 1XQIA 1HW9A 1FD8A 1TAUA 1RK8A 3CCTA 2OPPA 2VC0A 1HARA 2ASLA 3CJ4A 3DHWC 1SQGA 1UEKA 3C19A 4EI2A 4OZNA 1LXNA 2H4YB 3JSMB 3LP2A 4RNMA 2WB1D 1V3ZA 1VYAA 1WC4A 4B9NA 2ACMA 1TKZB 2C2ZB 5KFAA 2ZBIA 1X4BA 3W61A 1J5EJ 5HSPA 2BQUA 4DSFA 3ZC4A 1B3TA 4KJIA 3LP2B 4Q44A 3V4IA 3MWBA 1QLNA 1T95A 1UJ4A 3OTOJ 2ZBQA 3NMAA 2O66A 2GW8A 4BC7A 1ZPVA 5E3PA 5KG0A 2QFJA 3G87A 4NMLA 2XLKA 3BEGB 2CDQA 3UDCA 3V4IB 4KT0C 2UVWA 1K73T 1VS3A 2VQFJ 2W01A 1WDDA 3MAAA 3R7NB 4MYTA 3MHYA 4I6YA 4HKQA 3KJQB 1RAFB 5D0HA 3C6TA 1YRUA 2HGLA 1KNZA 4Z37A 5D15A 2CPYA 2E9ZA 4Z7CA 4EYHB 4OLPA 3MAAB 1RA6A 4Y2IA 3ZTOA 4LF7J 5DRKA 1V6HA 3NS7B 2R2SA 3C6TB 5HL7Q 4K4UA 5H9EK 5KFXA 4IFYA 3L09A 2H65B 3PVXA 2JDJA 2LDIA 1EQ0A 5L39A 3D3CJ 1OY9A 4K8RA 2B9EA 5BR8J 3MM7A 5AJ3F 5EX0A 2FZCB 3MR5A 4BS2A 5KT4A 1HBMB 5HO4A 4G1PA 3ZNJ1 3IP0A 1YZ7A 3AA9A 2AJ0A 1S79A 4IFYB 1BY9A 2AHOB 1ZYQA 1NJIT 3JYTA 1PJ7A 2D3O1 4DWIA 2XGPA 1RHRB 4LR9A 1UFWA 3AOCA 3NRBA 5T7LA 3TVZA 4YQWA 2XLJA 5DM7Q 3TUIC 2MZTA 3O8WA 1I5OB 1SL1A 3IGNA 2HKEA 2ZFHA 3CCJS 4X4OA 3I9ZA 1L3UA 3JYTB 2JC1A 3V6HA 3OFFA 1YHQS 3NCQA 5T7LB 4PG7A 4JV2A 3BGFA 2PMZD 2VFVA 2B9WA 1NJWA 3LA0A 4MKBA 3R7SB 4KHMA 3AB2B 4Q0BA 3CDWA 1KVKA 1KSPA 1X0PA 3GLJA 4P9SA 3WBZA 2HBZB 2W7AA 3SQGA 4YMEA 5KG7A 5GMDA 3R1LA 3W3SA 1UPPA 4JBCA 4ZVPB 2OKQA 4QWBA 1S9GA 4IQXA 4FBTA 2AF6A 2AGOA 4HLBA 3CJTA 1UVIA 2IDLA 2HLTA 3SQGB 4O44A 4OZ5A 4WIIA 5KFRA 3GIJA 4IDKA 4C8ZA 4RW4B 1AYEA 1W2IA 2H5JB 4C3KA 2E5JA 2WSCC 3BYPA 3I56S 3P4UB 1SL0A 4CLKA 2FJXA 4O44B 4E2FB 4NMXA 3VAFA 4IDKB 4Y2AA 1JX4A 3VALA 4B3MF 1FVQA 3QGPA 4C0OC 1K8AT 3UD5A 2UXBF 1N32F 5KTQA 2MZ1A 3TAMA 3RW6A 2AX0A 3VCDA 3O1LA 2Z30B 5D3GA 4FVCA 4Y2KA 4DUYF 1BXNA 3F41A 2O3DA 1RYSA 1GK8A 3CEDA 2FY1A 1Y10A 4B9SA 2DY1A 3DC2A 5DJBA 4DR2J 3TAMB 2HSEB 3HVTA 2MKHA 4CO2A 3MEDA 3BGLA 3AXKA 2FJBB 1JLAA 1JIHA 1KRPA 1R8BA 3AD9C 4DR4J 3AQPA 2BXJA 2EK1A 2HQIA 2ASJA 3HVTB 3H0PA 3ZZ0A 2W25A 4LF9J 4DV5J 1P9QC 3MEDB 5J2MB 5ETTA 2C2KB 1Q7YT 1AB8A 4DUTA 4R0JA 2DRAA 2I6WA 3DU6A 1YJUA 1JLAB 3CF5Q 4ZPTR 4FF4A 1JK9B 4J9LA 1TKXA 2HNYB 5KOXA 4FPRA 5AXMA 1WKLA 4WP3A 2ZE2A 1RT1B 4KY3A 4WF9Q 3H2LA 4AT1B 4ID5B 3QIPA 5IM0A 4EBEA 3J81Y 4X4NA 4C11A 1RWUA 1X5TA 4KHPF 1S9FA 1NUEA 3MCNA 1TKXB 4CO3A 2J7KA 1EKRA 2IC3A 5C25B 2H54B 2ZE2B 1EHWA 4F7VA 4FPIA 3QIPB 1C2PA 5IM0B 4C11B 1TKTA 3LF0A 3ISND 5DG9A 4O0IA 4CNZA 3FNNA 1CG2A 2F1FA 4RU9A 5GAHI 1KLMA 4A46A 4M5MA 2MHEA 4B9UA 3KMQA 3W8PA 1SVDA 4OFZA 1TKTB 3QRPA 2JL9A 1HNWJ
chains in the Genus database with same CATH topology
5IC6B 3P4UB 1RE1B 3KJQB 2FQQB 3R6LB 1IBCB 2C2KB 2Y1LB 1QTNB 1GFWB 4ZVRB 2H4WB 2H5IB 1PAUB 1SC1B 2HBQB 1RWXB 1BMQB 2DKOB 1RWNB 3R7BB 4LSZB 3EDRB 2H51B 2QLBB 3R6GB 2QLFB 3D6MB 2XYGB 2H4YB 2CDRB 3SIPB 5K20B 1RWMB 3NS7B 1I51B 3R7SB 4DCJB 1RWVB 2P2CB 3GJSB 2QL7B 2Y0BB 1RWOB 2CNNB 2CJXB 1RHJB 2C1EB 1RHKB 1RHQB 4DCOB 1RHUB 2H65B 2CNKB 2C2ZB 2XZDB 1F9EB 2XYHB 3IBFB 4ZVUB 2HBZB 1RHMB 2C2OB 2H54B 3P45B 1ICEB 1SC3B 4ZVTB 2XZTB 4ZVPB 3QNWB 2CJYB 4ZVOB 1SC4B 4ZVQB 3KJNB 2CNLB 1NMEB 2QLJB 1RWPB 3KJFB 2QL5B 3D6HB 4JB8B 5IC4B 1RHRB 1I3OB 2CNOB 1RWKB 3GJRB 3EDQB 3D6FB 4ZVSB 3GJTB 2HBRB 2C2MB 3R5JB 1RWWB 3RJMB 2H5JB 2QL9B 2XYPB 1QDUB 2HBYB 3IBCB 2H48B 1PYOB 4DCPB 3GJQB 3R7NB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IC6 B;  3P4U B;  1RE1 B;  3KJQ B;  2FQQ B;  3R6L B;  1IBC B;  2C2K B;  2Y1L B;  1QTN B;  1GFW B;  4ZVR B;  2H4W B;  2H5I B;  1PAU B;  1SC1 B;  2HBQ B;  1RWX B;  1BMQ B;  2DKO B;  1RWN B;  3R7B B;  4LSZ B;  3EDR B;  2H51 B;  2QLB B;  3R6G B;  2QLF B;  3D6M B;  2XYG B;  2H4Y B;  2CDR B;  3SIP B;  5K20 B;  1RWM B;  3NS7 B;  1I51 B;  3R7S B;  4DCJ B;  1RWV B;  2P2C B;  3GJS B;  2QL7 B;  2Y0B B;  1RWO B;  2CNN B;  2CJX B;  1RHJ B;  2C1E B;  1RHK B;  1RHQ B;  4DCO B;  1RHU B;  2H65 B;  2CNK B;  2C2Z B;  2XZD B;  1F9E B;  2XYH B;  3IBF B;  4ZVU B;  2HBZ B;  1RHM B;  2C2O B;  2H54 B;  3P45 B;  1ICE B;  1SC3 B;  4ZVT B;  2XZT B;  4ZVP B;  3QNW B;  2CJY B;  4ZVO B;  1SC4 B;  4ZVQ B;  3KJN B;  2CNL B;  1NME B;  2QLJ B;  1RWP B;  3KJF B;  2QL5 B;  3D6H B;  4JB8 B;  5IC4 B;  1RHR B;  1I3O B;  2CNO B;  1RWK B;  3GJR B;  3EDQ B;  3D6F B;  4ZVS B;  3GJT B;  2HBR B;  2C2M B;  3R5J B;  1RWW B;  3RJM B;  2H5J B;  2QL9 B;  2XYP B;  1QDU B;  2HBY B;  3IBC B;  2H48 B;  1PYO B;  4DCP B;  3GJQ B;  3R7N B; 
#chains in the Genus database with same CATH topology
 3LQV A;  1VQ8 S;  1O6X A;  2FDN A;  1PYT A;  1V3S A;  3GII A;  3Q0A A;  5F8L A;  1S48 A;  2PII A;  3IXQ A;  1RT3 A;  2YQ0 A;  4Q2M A;  4DI6 A;  3I82 A;  1YRT A;  2KRR A;  2F3J A;  4WKY A;  5AE2 A;  3L7P A;  4K0K J;  3J7Z T;  3NBP B;  3TX0 A;  4HVZ A;  4X64 J;  4ZLN A;  3H25 A;  2CJX B;  3DLE A;  1RHK B;  3PYE A;  1RT3 B;  3PJ9 A;  3D1Q A;  3DDN A;  1VLY A;  3DOL A;  1YBU A;  1H2T Z;  3UW1 A;  5I3P A;  3HT3 A;  2UXB J;  1S7I A;  4PYD A;  1JLE A;  4ZK7 M;  2CZ4 A;  3DRY A;  1NSK L;  3DLE B;  2HHX A;  2O01 C;  2RS8 A;  3IC1 A;  4RPF A;  5AE3 A;  2MQL A;  3DOL B;  2VG6 A;  1NAQ A;  2DXD A;  1Y3J A;  1RTI A;  2RKI A;  1JLE B;  1RWW B;  4IKA A;  4CO1 A;  1R0B G;  2JLG A;  2HHQ A;  3W66 A;  3VHQ A;  4NLD A;  2VV5 A;  1NND A;  2A6M A;  2VG6 B;  3AFG A;  4J9P A;  1RTI B;  2K06 A;  2RKI B;  4WTO B;  2HFV A;  2OGU A;  4J9Q A;  2J5A A;  2RHS B;  1T9X A;  2XZW A;  3AJ2 A;  1KFS A;  5HN0 A;  2M4M A;  1BQN A;  3THV A;  4LT6 A;  2DPJ A;  3UN2 A;  1YZ6 A;  4HAC A;  5J2P B;  2F63 A;  2W7P A;  5CAB A;  1ZTW A;  3MR6 A;  4UUW A;  1HL6 A;  1BQN B;  4RW9 A;  4HHH A;  2V8G A;  2M70 A;  2QYC A;  1PG5 B;  4HAC B;  4OL8 A;  3D0I E;  4Q43 A;  2E1C A;  4JI6 F;  4PUO B;  1A0O B;  2WSE C;  1R89 A;  5KFG A;  4AL5 A;  1GX5 A;  3C46 A;  2M8H A;  2HNZ A;  1AZS A;  3SFU A;  4QZV B;  2XMV A;  1SXL A;  2F9J A;  1BWE A;  2XSJ A;  3HHN B;  3BM7 A;  3BF4 A;  4OIX A;  3RR8 A;  1FRI A;  4FS2 A;  4RUH A;  3B78 A;  1DHM A;  4CIO A;  2XSJ B;  4EO6 A;  3QT7 A;  1D1U A;  4TU8 A;  4LQ3 A;  4L73 A;  2VA3 A;  2CJA A;  1BE4 A;  1S0M A;  3FVY A;  5GME A;  3JXO A;  4HHU A;  2GQQ A;  3HSD A;  2XMM A;  5LMN F;  4JOU A;  1HBO B;  4B9L A;  4ZPW R;  3ITH A;  3Q86 A;  2PN6 A;  2V6A A;  4DV6 F;  2QV6 A;  3D0H E;  4I7F A;  1HQE A;  4B3S F;  3NKY A;  4E0D A;  3LP0 A;  3VAK A;  1FWK A;  3UD3 P;  1AT1 B;  1HHT P;  2LCW A;  4U8V A;  1WG4 A;  2ZHA A;  4Y0F A;  1ZET A;  2YXL A;  3ETO A;  5C7P A;  3PRB A;  4RL1 A;  5D4P A;  4I7F B;  4X4R A;  5L38 A;  1F2G A;  3JTN A;  1OWX A;  3M8W A;  3FSI A;  3VZI A;  2EFG A;  1R43 A;  3GYG A;  3QT5 A;  2R7O A;  3G2X A;  3PR5 B;  5L9N A;  4ZVR B;  4DR5 F;  3FMB A;  1R6V A;  3BQ2 A;  4DR6 J;  4Y2M A;  1X8D A;  4ECU A;  1TAQ A;  2HQF A;  3OUY A;  1MSW D;  2E5G A;  3PYD A;  2XQC A;  2HIY A;  2HGN A;  1XMO F;  3AH6 A;  1SJ3 P;  2EI5 A;  1NB2 A;  1RKJ A;  2KT3 A;  3I32 A;  4CLF A;  2V4R A;  3BN4 A;  4TLQ A;  2R8H A;  4IRD A;  2V5H G;  4YB7 A;  3TUP A;  2RQC A;  1WEL A;  4C4W A;  5LSR A;  4ZP7 A;  3L9Z A;  2P9E A;  4IOC Q;  3A8J A;  1OPI A;  2RT3 A;  2BDP A;  2KO1 A;  3OR2 A;  4NLG A;  4DV1 F;  3PW4 A;  4JI6 J;  5LMU F;  2MXY A;  3M8P A;  1LWC A;  1KQS R;  1JLF A;  4BBY A;  1HBU B;  5B7W A;  4NLQ A;  5DQG A;  4GKK J;  3OR2 B;  1YIJ S;  4N8O A;  4JI8 F;  5A76 A;  2J0S D;  3ZTP A;  3M8P B;  1LWC B;  1JLF B;  2OIH A;  1R0A A;  4OI1 A;  4OJ3 A;  3HSG A;  2U2F A;  3W62 A;  1P6T A;  4P2S A;  4USV A;  3G8T A;  2EKY A;  3T1A A;  4M95 A;  5HAN A;  5D78 A;  1TVR A;  3GMG A;  2W9C A;  1ZAW A;  4X4V A;  4P7T A;  2C2O B;  3D0G E;  2EWH A;  1R0A B;  2NS1 B;  2HLU A;  1KOH A;  2I5J A;  3WC0 A;  3G6Y A;  3PJW A;  1K44 A;  2GAH C;  3VAJ A;  1MW7 A;  2YNG A;  1YBA A;  5LMN J;  3NNA A;  3CCE S;  4WE1 A;  2DNO A;  2QL5 B;  3KNG A;  4JB8 B;  2Q66 A;  4DV6 J;  1VHI A;  2W9C B;  1EAR A;  4HL9 A;  1VC6 A;  4Q7A A;  4C9D A;  5L8R C;  2I5J B;  2RDD A;  5HP1 B;  2A18 A;  2MQQ A;  3ULH A;  4B3S J;  3EM1 A;  4FKY A;  4ZMM A;  1NPK A;  3AY0 A;  1TK5 A;  2W24 A;  4F4Z A;  2AZ1 A;  3HF5 A;  4Q8E A;  3TA2 A;  4MIB A;  4BHQ A;  1H74 A;  4B02 A;  4K4W A;  3W2V B;  2HND A;  2HWH A;  2FC8 A;  2HUR A;  2GQC A;  3GIL A;  2FLL A;  1U1L A;  2YH0 A;  1CS4 A;  4WXO A;  3R2D J;  1IKY B;  4WYL A;  4W98 A;  1SC1 B;  4WFX A;  1ZBT A;  2Z0G A;  3R7B B;  5H9F K;  1GNK A;  4YR2 A;  5IV3 A;  3UI3 A;  2MKK A;  2LMI A;  1NSQ A;  2V9K A;  2AEM A;  3Q22 A;  2PA8 D;  2KXH A;  2V8V A;  1LK7 A;  2FGC A;  3ET6 B;  4PQA A;  1K1S A;  4L3N A;  4KSE B;  2DNQ A;  2KB2 A;  2I9S A;  4ZPV R;  2AT1 B;  4F2R A;  2E9R X;  1TMM A;  4F4W A;  1IVZ A;  1VMB A;  4PG8 A;  5HQM A;  4LIR A;  4F50 A;  5HJY A;  2BMB A;  4LF8 J;  1FWP A;  2ERR A;  2FLP A;  2QLX A;  1WSR A;  3FZ2 A;  4JI5 J;  1X4F A;  3PX4 A;  3PFE A;  1L3K A;  1T03 A;  4DV1 J;  5IT4 A;  2ZBR A;  1DZ5 A;  1WHY A;  4C97 A;  5FLX U;  3MM5 A;  3HDS A;  1IBC B;  2DNK A;  5DM6 Q;  1QM9 A;  4K2J A;  2CIM A;  1TQL A;  6AT1 B;  3I9V 9;  2DHH A;  4N56 A;  2R8I A;  4JI8 J;  5LXY A;  3HX9 A;  1T03 B;  1HWK A;  3MUR P;  1G6B A;  3MM5 B;  4JI0 J;  4IG0 B;  1RWV B;  2AD9 A;  2CNN B;  1VRQ C;  1XNR F;  3A1Y G;  1NDL A;  3PW2 A;  1IBK J;  2KT5 A;  4JI2 F;  3LAK A;  1NHV A;  2W4D A;  3K5P A;  1XEZ A;  1LWE A;  4DUZ F;  1W26 A;  1U8W A;  1OYD A;  3CGI A;  2L3M A;  2ZUG A;  5D0E A;  1VBX A;  5KG5 A;  2DNZ A;  2LXI A;  3R5B A;  3LGH A;  4X65 J;  1OO0 B;  1SJ4 P;  1S97 A;  5B0C A;  4HTI A;  3HSZ A;  3ENA A;  1YI2 S;  2DR8 A;  1U1K A;  1WEY A;  4YOE A;  1LWE B;  4QW8 A;  3PO5 A;  3UN3 A;  4KC5 A;  2CQ4 A;  2ZVI A;  4PAB A;  2HBY B;  4U7C A;  2IFX A;  1OJ4 A;  1Q8L A;  1ZM4 A;  3KKF A;  2KTQ A;  2JJ4 D;  2CWK A;  3QWP A;  1W2B R;  1YSJ A;  4WFB Q;  4UQT A;  3HHD A;  3QJL A;  1I94 J;  3IRW P;  2D74 B;  2U1A A;  4NZ0 A;  1Y0H A;  2DH8 A;  2AJ4 A;  2G9O A;  3N6L A;  1PJ5 A;  4C8N A;  3OTC A;  1RTJ A;  3K2Y A;  3MUV P;  4C6A A;  1FRH A;  1VFJ A;  2MY8 A;  1HHQ A;  4NLS A;  1HLW A;  1UFK A;  1EET B;  1TUW A;  2EFN A;  2HHP A;  2DHX A;  2F5G A;  4P10 A;  2A0F B;  5KFV A;  3NNH A;  2OEM A;  1FJG F;  3G6X A;  4M5H A;  4X62 F;  1N0U A;  1RTJ B;  2CJ9 A;  3V6J A;  4JUZ A;  3U27 A;  5KFE A;  1YTY A;  2JOQ A;  2ILY A;  4QIW D;  5KFI A;  4N47 A;  4BWM A;  2IIH A;  5IFM A;  3PV8 A;  2QL9 B;  2V8P A;  4KH0 B;  2DXE A;  1WTF A;  1YJN S;  1LW2 A;  5B0D A;  2MZS A;  5KT7 A;  1ACM B;  1G1X A;  1URR A;  5T41 A;  5IQ6 A;  4Y28 C;  5F8I A;  4AL6 A;  4ELU A;  4FXD A;  2CQC A;  4D3H A;  3NWR A;  4A8X A;  2QGF B;  5CXT A;  1EAY C;  3G8S A;  1QE1 A;  3N6N A;  2AJQ A;  4DCO B;  3CB4 A;  3IO1 A;  2E1P A;  4XPC A;  5SUH A;  4M5I A;  2B7B B;  4JV0 A;  4WU2 A;  2D3O R;  1PJ6 A;  2XNQ A;  1U0H A;  4JI2 J;  1BHN A;  1QE1 B;  3GFZ A;  3OLA A;  2ZH6 A;  2LYV A;  3NS6 A;  2ROG A;  4OX6 A;  1QY7 A;  1U4B A;  5LL6 d;  3FBF A;  2KH9 A;  4C8Y A;  4YHH J;  2EFV A;  4X4P A;  3VQT A;  4HTJ A;  1S9E A;  1U0H B;  1FKO A;  4DV3 F;  1TL5 A;  2ZZT A;  1IKX A;  4J9V A;  5IT0 A;  1FVS A;  2RDJ A;  5BJR A;  5L1L A;  2MZJ A;  2GGP A;  2DIS A;  4ELV A;  2Y1L B;  2OH2 A;  3H2U B;  4A8O A;  5F8N A;  1FKO B;  5LSO A;  2OFH X;  1HNX F;  1B4S A;  2YNF A;  5J2N A;  4ZCK A;  3TR5 A;  3THT A;  4ED3 A;  2JWN A;  1IKX B;  4OI2 A;  2GAG C;  4EUV A;  2WW8 A;  2BEF A;  2BBE A;  5EN1 A;  3V6D A;  3OTB A;  4QQB A;  2DCL A;  3VAH A;  1VRT A;  2LQ8 A;  2OUG A;  1FXD A;  1RAI B;  3NG8 A;  4RWW A;  1VCT A;  2YNF B;  5J2N B;  4LF6 J;  3CCW A;  4WBF A;  2Y3Y A;  1X4C A;  1S1U A;  4P73 A;  2BE7 D;  2OD6 A;  3I4H X;  3V6D B;  1HQU A;  1HR0 F;  4NEZ A;  4P2X A;  1VRT B;  2E66 A;  3PNI A;  1YJT A;  2R7Q A;  1Z2L A;  3V4M A;  1FDD A;  3V6K A;  4EEY A;  3W65 A;  2VG5 A;  2KFN A;  3C16 A;  1S1U B;  5I42 A;  2HBR B;  1HQU B;  4DL6 A;  1QSL A;  4CLU A;  4ZP9 A;  1RCX B;  4RU2 A;  4NYO A;  2CPD A;  1JJC B;  2Q3P A;  3DOK A;  3PCO B;  3Q8Q B;  4K4S A;  1DAX A;  4B3T F;  3CW2 C;  3OL7 A;  2RRA A;  2V2Q A;  2VG5 B;  4MIW A;  5KFB A;  3C16 B;  5I42 B;  4PYA A;  4V19 J;  4QR2 A;  3IA0 A;  4CCH A;  4WK1 A;  2GVD A;  1NU4 A;  1Y5L B;  4MK9 A;  3A8I A;  3DOK B;  3HVR A;  3VZH A;  1X5P A;  1WC1 A;  2RML A;  3EVM A;  1S0O A;  1NDK A;  3N0V A;  3LUY A;  3UE2 A;  2FGO A;  3T1H J;  4O4R A;  4B9V A;  5DET A;  4ED7 A;  2GVD B;  1GTE A;  2X1B A;  2C3P A;  2RIL A;  3UQS A;  3Q24 A;  5IOL A;  3TZW A;  1ZA2 B;  3KHG A;  4ILL A;  2JZ5 A;  4NPO A;  2XMW A;  2HYI B;  4QYZ J;  3DGP A;  3EGN A;  1R0C B;  1RBO B;  2KT2 A;  1N6Q A;  4O3N A;  1RQ0 A;  2HQC A;  1TK8 A;  2HFO A;  1VDH A;  3MXH P;  1AFJ A;  4DQP A;  3PW5 A;  4DV3 J;  3DGP B;  1G3O A;  4KE5 A;  4MT1 A;  3KLH A;  1S1V A;  4LF2 A;  1N6Q B;  4I6A A;  1T9V A;  2VBW A;  1C4A A;  1ZM3 A;  5BYS A;  3TEH B;  3M9O B;  1HWJ A;  3GYN A;  4ZVG A;  4USJ C;  3I55 S;  3TEG A;  2P2C B;  3CO0 P;  1HFE L;  3NY0 A;  1NB7 A;  5GMK a;  1M5S A;  4ZDN A;  3HJV A;  2R7S A;  1K9M T;  1GT8 A;  2D3U A;  3DXB A;  4F67 A;  4HT5 A;  3MMA A;  1XN9 A;  4TY8 B;  2XZT B;  4FKX A;  1Z1Z A;  2XI3 A;  4TU9 A;  3HVA A;  2HVE A;  2UUW A;  1Q86 T;  2RB7 A;  2HAI A;  5A6W A;  4DFK A;  4X66 F;  4H4K A;  1HR0 J;  3B82 A;  1VQO S;  3MEC A;  4LBI A;  2GMJ A;  3KUG A;  4IG3 A;  2DH7 A;  3MMA B;  2ZJP Q;  2OAU A;  5E3C A;  1JLQ B;  4NLO A;  1P1L A;  2B0G A;  4DZ6 A;  1TFW A;  2ZEJ A;  4CM0 A;  2Z2Z A;  1Q4R A;  3TJA A;  2C22 A;  4R25 A;  4IG3 B;  4WK3 A;  3RUB L;  4B3T J;  3J7A 1;  2W4C A;  2H51 B;  1XIQ A;  3BYR A;  3PW7 A;  3RB3 A;  3H59 A;  2VFR A;  3UDV A;  3N9U C;  2V69 A;  1I51 B;  1SJQ A;  3QBC A;  3CD5 A;  2V94 A;  2ZDP A;  4ED8 A;  1CPZ A;  3UVJ A;  3RB0 A;  4F0M A;  1UP1 A;  5GAG U;  3OBI A;  5CA5 A;  4FF2 A;  3W5Y A;  5DDP C;  1SC3 B;  1VGY A;  2ZNZ A;  3WX4 A;  4FYD A;  2D7S A;  5CH7 B;  1YJV A;  1B0V A;  3LP1 A;  2UVU A;  2E29 A;  4J91 A;  2LVW A;  4HR2 A;  2EC0 A;  2IHR 1;  1KFD A;  4HI2 A;  1NH7 A;  3ZTR A;  3KDN A;  3I5C A;  3W60 A;  1HW8 A;  3E51 A;  3LP1 B;  4NWB A;  3DFE A;  2WVF A;  2R2U A;  1QAX A;  1DTT A;  3N6M A;  1VJW A;  3DLK A;  2CQD A;  4OJ1 A;  4L76 A;  2VON A;  2JFK A;  3C8Y A;  4GVB A;  1U6F A;  1DQ8 A;  1BMQ B;  3BPS P;  3MMB B;  2DNM A;  2UUB J;  1S7H A;  4ENO A;  4U67 Q;  4F04 B;  1HMV A;  3CCR S;  2CQ2 A;  1DTT B;  5DDR C;  3FBC A;  3DLK B;  3DRP A;  3CIZ A;  3K89 A;  3SCI E;  4P2F A;  1T05 A;  3BPD A;  4M63 A;  5HMY A;  1NO8 A;  4GVB B;  3S8S A;  5DDO C;  1U02 A;  4BDP A;  3LGM A;  3NAH A;  1J5O A;  3C14 A;  3SCL E;  1HMV B;  1D9D A;  4ZOS A;  4ZVT B;  2HK2 A;  1GTH A;  4PWW A;  4C8L A;  1N5V A;  3HHL D;  1T05 B;  3KG4 A;  5ETP A;  4LIW A;  4MYU A;  3KLF A;  4ZJQ A;  1J5O B;  2QT7 A;  1VQ7 S;  2W1B A;  3PHT A;  2D1C A;  2V63 A;  1N52 B;  2ZDO A;  3HJF A;  3M2U B;  4DQI A;  1PIE A;  2Q6C A;  4LR7 A;  3KLE A;  2IMW P;  1Q5V A;  3H5U A;  4J9K A;  3CSK A;  3KLF B;  1LWF A;  1HNI B;  3MAH A;  4DEZ A;  2H4W B;  4RNO A;  4CYU A;  2HHT A;  2MY7 A;  1TV6 A;  1Q78 A;  1X4E A;  2DNR A;  1C0T A;  2B5J B;  3KNA A;  3KLE B;  3P49 B;  2CDR B;  3BRE A;  2LA4 A;  4R8U A;  1VC5 A;  3DI6 B;  3W63 A;  2KI2 A;  4CYU B;  4OZ3 A;  2GMH A;  2BYC A;  2CQG A;  1TV6 B;  2NUU G;  3G96 A;  2Q79 A;  1C0T B;  2CZV C;  1U1Q A;  2AGQ A;  4A8Y A;  1UPM B;  4R8U B;  3TZY A;  1KWM A;  2YH1 A;  1X9W A;  3CCU S;  1VQM S;  4DPT A;  5B09 A;  5HVH A;  1ELO A;  2XUL A;  3SDE B;  3LH2 S;  1YJW S;  2BJ3 A;  2EVZ A;  3D6F B;  4ZCL A;  4I1T A;  4DL7 A;  1FX4 A;  2BE2 A;  2VOP A;  5ETQ A;  4B3R J;  4UUX A;  1RAC B;  2QX0 A;  1CQM A;  1RTH A;  4NA3 A;  3K57 A;  4JI1 F;  3R97 A;  1I6J A;  3DMJ A;  5A2Q U;  4KHR A;  4DPU A;  2BE2 B;  3F44 A;  1HQ2 A;  1SI9 A;  3K5L A;  2WB4 A;  3HFK A;  1S57 A;  2C2N A;  2R7V A;  4RO0 A;  1RTH B;  4ETZ A;  3P6Y C;  2PFF B;  4YN3 B;  4IFV A;  1G7C B;  2LLZ A;  3NGK A;  3BV8 A;  2BA9 A;  5ETM A;  4NXN F;  1DAR A;  3P3D A;  2CUY A;  2XZD B;  3CCV S;  2NXN A;  3FEZ A;  1AFI A;  3PKY A;  5CD4 A;  3R27 A;  1VQY A;  2J8A A;  4PKD B;  5IWA F;  4P6Q A;  4LFC F;  4IFV B;  3C3L A;  1X4H A;  4LVO P;  2GHW A;  1UJ6 A;  1E6Y A;  2PI4 A;  2FY8 A;  2XGQ A;  2EG2 A;  4MJK A;  1ZZF A;  4NLR A;  5CYM B;  5F3T A;  1FK9 A;  2CQ1 A;  4OYX A;  5LM7 E;  2AZ3 A;  4E98 A;  1E6Y B;  2QRR A;  2NSC A;  2CQP A;  3H4B A;  2ZKT A;  2ZH8 A;  4IR9 A;  1RT4 A;  2PDA A;  1VR6 A;  5E41 A;  3GCW P;  3U1M A;  4P52 A;  2L48 A;  3Q8V A;  4DR7 F;  3BJY A;  2P9C A;  2R42 A;  3FCH A;  2ZD1 A;  3H2V E;  2CYY A;  2AV5 A;  3CJQ A;  4NCB A;  2R3V A;  4NCG A;  1RT4 B;  5FLX Y;  2CQ3 A;  4ES3 A;  1HBN B;  4ZPC A;  3O5T B;  1MN7 A;  2JC0 A;  1YLX A;  3WX8 A;  2VZ9 A;  3H90 A;  3MR3 A;  4K4Y A;  2H9Z A;  2ZD1 B;  1FFS B;  4NCG B;  4QWE A;  1V5I B;  5GVQ A;  1NME B;  3ICL A;  5D6G A;  5B0G A;  4Y2C A;  1N34 F;  1NH8 A;  1NHU A;  2QC3 A;  2RD5 C;  4MIA A;  4F4A A;  4K4V A;  1Y7P A;  4ED5 A;  1JB0 C;  3IG1 A;  4H54 A;  3B8H A;  4ZVS B;  2AYE A;  3BQ0 A;  4DQQ A;  4AYB D;  3HZG A;  2D9P A;  4C2M A;  2OHD A;  2PT0 A;  4F4K A;  2B4U A;  3PIO Q;  2JVR A;  3M9M B;  1U26 A;  2IJF A;  5KFY A;  2W2N P;  5MAO A;  3CC7 S;  4EYI B;  3W1Y C;  5KFN A;  4PWD A;  3AD8 C;  2DKO B;  3J7A N;  2ZH4 A;  4PG4 A;  2J9C A;  4BC9 A;  3D9B A;  4DU7 A;  2ALZ A;  1CLF A;  1RHJ B;  5AXK A;  3H5X A;  2XM3 A;  4PWD B;  1AA1 B;  4NZ7 A;  4WJB A;  1YQH A;  1BQM B;  2ZVS A;  1NLK L;  2J9D E;  1Q81 T;  4WFZ A;  2ZC3 A;  1R27 B;  2Y0S D;  1OY6 A;  4OJH A;  2UXD F;  1OMS A;  3Q8R B;  2KVQ E;  2LEB A;  4RW6 A;  3K0J A;  3FCV A;  4UF4 A;  3M32 A;  1N0V C;  4LFC J;  1V3R A;  5ITH A;  2WOM A;  3QWU A;  2K3K A;  1T0T V;  1RAJ A;  4F26 A;  2MSS A;  1OQ6 A;  1RLD A;  3W2W A;  4RW6 B;  3E01 A;  2L9W A;  2LQ9 A;  4CRJ A;  2DIU A;  4EBD A;  3M32 B;  1N54 B;  3PR4 A;  3BZQ A;  5A8W A;  2FD2 A;  2WOM B;  1KQG B;  2M9K A;  1GFW B;  3GE9 A;  2EPI A;  2HEK A;  3EZ5 A;  1TL7 A;  1MWQ A;  3NGU A;  3PM9 A;  1PAU B;  3KFW X;  3W2W B;  2BQR A;  3E01 B;  4WFA Q;  3D6M B;  4RKU C;  2E1R A;  3OFE A;  5K20 B;  2OPR A;  1H2U X;  3DLL Q;  5A8W B;  1DTQ A;  3HHE A;  5IT9 U;  3KK2 A;  3LGN A;  1TL7 B;  3QFH A;  3SBM A;  2VU5 A;  4B3O A;  2WTF A;  1PIL A;  4GO7 X;  4LF4 J;  1LNQ A;  2DGQ A;  2GV1 A;  1ICE B;  4LFA J;  3KK1 A;  2BOP A;  1N88 A;  2VFU A;  2OPR B;  3E3X A;  1DTQ B;  4YY3 F;  1FE4 A;  3N01 A;  3OXL A;  2WON A;  3PFO A;  1K0V A;  3MPW A;  4XK8 C;  4PRF A;  4B3O B;  5DLF A;  4ZP8 A;  3OL9 A;  2BR0 A;  4I6W A;  3KK1 B;  2XMT A;  2IY5 B;  4CI0 B;  5EWE A;  4USM A;  4KKO A;  3GIR A;  2ZJR Q;  2XNR A;  2HVH A;  3FZB A;  1N4L A;  2WON B;  3R5C A;  4OX8 A;  2YTC A;  2G1D A;  2AJ2 A;  2FZG B;  2OJ3 A;  4TY9 A;  4WFN Q;  4UW2 A;  1WI6 A;  2HGM A;  4OYW A;  3VQS A;  3D1H A;  4RX6 A;  1SQF A;  2V67 A;  3QFW A;  2GJF A;  4KBI A;  8ATC B;  3GZ7 A;  1FI4 A;  1KHW A;  2G0C A;  1GMW D;  2CNK B;  5A8K B;  1VBZ A;  2CG8 A;  2ZH5 A;  2V34 A;  3T5K A;  1R8A A;  5HVF A;  1X7V A;  2J6S A;  5F8J A;  3MR7 A;  4DL0 C;  2X1F A;  2W4P A;  2DHS A;  4WCE Q;  3TAR A;  3KJN B;  3O44 A;  3LPE A;  1NK7 A;  2XY5 A;  3MCS A;  3RRG A;  2YQ1 A;  4CNY A;  3UCU P;  2YWF A;  2VBX A;  3AQO A;  2OSR A;  1TU0 B;  3T5H A;  1KTV A;  3GCX P;  2FJD B;  4GO5 X;  2AQ4 A;  4N41 A;  1FXR A;  2D3Z A;  2GHV C;  4DJB A;  3PDN A;  3HHK A;  4KFB B;  2R9L A;  3H40 A;  3D5M A;  3MGJ A;  4LRC A;  1J5E F;  6FD1 A;  3FBE A;  2J6T A;  3A8E A;  5U47 A;  4KAI A;  1PAE X;  2V4J B;  1U2R A;  2NXC A;  4CM2 A;  2ATL A;  1Q95 G;  4LBP A;  2GJI A;  3HXM A;  3T6J A;  1KLN A;  2HHH F;  2J0W A;  1N33 F;  3DLH A;  2KG1 A;  2GIR A;  3SXL A;  1J27 A;  4MK8 A;  5BXI A;  4O3S A;  2DRD A;  5L46 A;  2ZWP A;  4DG1 A;  2EFP A;  4ZN1 A;  2RUG A;  1RIS A;  4OHY A;  1IKV A;  1WSV A;  3R5D A;  2L41 A;  3OVS A;  4H4M A;  4LF7 F;  1HNV A;  2RNE A;  1S4F A;  2BJD A;  1OS5 A;  4KO0 B;  2RQK A;  3I5A A;  3IBC B;  1YBT A;  3SQO P;  2BKN A;  1RT2 A;  2RVJ A;  3GV5 B;  5LSL A;  1UKU A;  4L3K A;  3SMZ A;  1KR4 A;  5MLC V;  4PAA A;  4H4M B;  2IM0 A;  5BR8 F;  3QSY B;  1HNV B;  3EWG A;  4X4S A;  5EWF A;  3DRR A;  1ZAV A;  1GXL A;  4DV2 F;  5HLF A;  2UZA A;  2R4F A;  3NGS A;  5ADZ A;  5F41 A;  1UEV A;  4AL7 A;  1H38 A;  4TQS A;  5F9L A;  5CAA A;  1S6Q A;  3B4M A;  3TO8 A;  1IBL F;  5ETS A;  3DRR B;  1VBY A;  2G1H A;  4Q8F A;  1IKW A;  3IBF B;  1T9Y A;  3MUT P;  1XR6 A;  1KP6 A;  2QFI A;  4DFM A;  1NK0 A;  1VQL S;  2W9B A;  1F60 B;  3QNW B;  1JLG A;  5K14 A;  3CE8 A;  1S6Q B;  1LEO A;  1N5Q A;  3EGV A;  2DNG A;  3WQP A;  2W2O P;  4O0N A;  2KU7 A;  1IKW B;  3JSM A;  3FDS A;  1U0S A;  4DQR A;  4RUB A;  5SZT A;  4YUD A;  2RS2 A;  2GS8 A;  2W9B B;  2YNH A;  3RJM B;  1TKZ A;  2A2D A;  4BWJ A;  1JLG B;  5K14 B;  2UU9 F;  1LFP A;  3JSY A;  3PYF A;  1FKA F;  2R7U A;  3GJQ B;  5BYR A;  1SL2 A;  5IC6 B;  1FCA A;  4ZVF A;  3R6L B;  1RP5 A;  1FDN A;  5A6P A;  1PC5 A;  3ETM A;  5D0G A;  2B8P A;  2YNH B;  2VH7 A;  1S0V A;  3OLB A;  4CDI A;  4EMD A;  2YKA A;  1BGX T;  1O0P A;  3CCS S;  3QMQ A;  5CZV A;  2AMC B;  2YWE A;  3GQC A;  1Y4Z B;  2ZWO A;  3LAM A;  4BLG A;  2E1A A;  2HHH J;  2WCX A;  1N33 J;  3KUH A;  4DR3 J;  2Z58 B;  3DGV A;  1TTH B;  3JAM U;  3CUL A;  1YVF A;  4KGK A;  2IYI A;  3Q8U A;  1ZTT A;  1S59 A;  1NKC A;  3SZ2 A;  2BX6 A;  3CJ2 A;  3OSP A;  5KG1 A;  5J2Q A;  1BUX A;  5KG6 A;  4PZV A;  8AT1 B;  1S0N A;  2JLE A;  1P1T A;  3H98 A;  2EKN A;  1LW0 A;  2K1R A;  1VQS A;  2CPZ A;  2XSF A;  2J76 E;  5J2Q B;  3S1T A;  3UFC X;  1NZA A;  2BAC A;  1HBM A;  1RAA B;  4NX9 A;  4ITS A;  3G8Q A;  1LW0 B;  2K1R B;  3VAM A;  1N48 A;  2N82 B;  4DR2 F;  3SSR A;  2AYM A;  1YG0 A;  4DV2 J;  4KPY A;  4WKR A;  1YKW A;  2R8J A;  4DX5 A;  2Z2L A;  4U7U K;  5E7O B;  1FKP A;  1L5U A;  3VAI A;  3TP2 A;  4DR4 F;  1RAB B;  1IBL J;  4U96 A;  3DCA A;  4AXI A;  4LF9 F;  4DV5 F;  2KZZ A;  2HS4 A;  2YWW A;  4CT8 A;  3OTE A;  2ZBP A;  4O3R A;  1SKS A;  1CEZ A;  2XMK A;  1KQF B;  1FKP B;  2I2Y A;  2XC9 A;  4JI7 J;  2BW7 A;  2YNI B;  2MLY A;  3FQK A;  2B3T B;  1MMD A;  3U7J A;  1I1G A;  4GKJ J;  1EX8 A;  4ZLL A;  4DFP A;  4U6P A;  1FRM A;  4F3O A;  3CCZ A;  3IMQ J;  4K5S A;  5DZ7 A;  5K8N A;  2B56 A;  3IRX A;  2UU9 J;  4LJM A;  3FBB A;  1U1R A;  4DV7 J;  4QR1 A;  3SSS A;  5H9E J;  2OI2 A;  2WVB A;  3DLB A;  1D8Y A;  1IM4 A;  2VBZ A;  2VKR A;  4DPO A;  4ZA1 A;  1LQ9 A;  3U02 A;  1FRL A;  4LSL A;  3IRX B;  4RW4 A;  5CZX A;  2WVC A;  2VOO A;  1W7W A;  5FD1 A;  3L4B C;  4OZ2 A;  2E7V A;  2CJB A;  2VOD A;  2MQM A;  4TVA B;  3QT6 A;  4ILM A;  3K5M A;  4HYK A;  1HNW F;  4LSL B;  2ASY A;  2FPH X;  2RH3 A;  4ZVO B;  1WC6 A;  2YVS A;  3MEG A;  4LRE A;  3IBW A;  2R7T A;  4FYW B;  2ROP A;  4CO0 A;  3LWM A;  1IBM J;  1FRX A;  2XBP A;  2I38 A;  4RWX A;  3EVW A;  4DS4 A;  2F9D A;  5M2U A;  2N3L A;  5L9X A;  2IRU A;  3M6U A;  4K0K F;  2ZUA A;  1M1H A;  1WOP A;  4X64 F;  2Y1I A;  3MEG B;  4N7T A;  1D3W A;  3M9N B;  5F8G A;  1YWX A;  4I56 A;  2CPF A;  1DJ0 A;  1L3T A;  4ZIV A;  3ADA C;  2ZIT A;  4NLW A;  5RUB A;  1N36 J;  2VAS A;  4YFU A;  2BOA A;  4DLE A;  3KTQ A;  4JP8 A;  4N5S A;  1CBK A;  2NCK L;  5T14 A;  3FFI B;  1JJH A;  3RRK A;  1SJ1 A;  2PA3 A;  2BV3 A;  1EKS A;  4DN9 A;  3KLI B;  3J7Y I;  4DR1 J;  4QPX A;  2VDI A;  4OX9 J;  1URN A;  5A2Q Y;  3LAN A;  1SC6 A;  2MB0 B;  2E5I A;  1N5S A;  3N5F A;  5J2M A;  2DGX A;  2DHG A;  2C2D A;  4RNH A;  3JSB A;  3W5X A;  4TYA A;  2UVR A;  1T7P A;  4V19 X;  3UCG A;  2HNY A;  1ZAX A;  2EC2 A;  1RT1 A;  1UL3 A;  2IM2 A;  4ID5 A;  2EEY A;  3MUM P;  1U8S A;  2B9X A;  2CPH A;  4UQG A;  3QYY A;  1IR0 A;  3W64 A;  2DGW A;  4DN0 A;  5C25 A;  3WIV A;  1U1P A;  5HJX A;  2FVC A;  3HSJ A;  5KFD A;  2MDA A;  4HH1 A;  5J1P A;  4QPT A;  1ZH5 A;  2KN4 A;  3N79 A;  4EBC A;  3KXD A;  1NSP A;  1MU2 A;  2V0N A;  3JQK A;  1HI1 A;  2MTL A;  1K1Q A;  4AQY J;  5FDL B;  3QZ8 A;  3CXC R;  7AT1 B;  3HKZ D;  2NRE A;  2BE9 B;  3SFG A;  1MU2 B;  2OPQ B;  2EW9 A;  2BJ8 A;  4P7V A;  4ECV A;  4M5J A;  2XWX A;  2QE5 A;  1XMB A;  4Q2L A;  3QO9 B;  4AND A;  5AT1 B;  1NJZ A;  3NBP A;  4CTA A;  3OVB A;  3AJD A;  4JI4 J;  2AYB A;  3Q8Y A;  1CSJ A;  4OYZ A;  3HPO A;  2DNP A;  2C3Y A;  5JJB A;  3GV8 B;  2UUA J;  3MPD A;  3R5A A;  3A4T A;  1QDU B;  3CJS A;  4OYA A;  1M1K T;  1RU2 A;  3NOC A;  4EZ6 A;  5BYQ A;  1TMJ A;  2OPS A;  5DGB A;  3BSN A;  2IA0 A;  4CTA B;  4DHV A;  2NXE A;  2BZ2 A;  3FRY A;  5GAE I;  3CC4 S;  1U6B A;  1HNZ F;  3THP A;  2OPS B;  2MKY A;  2VJV A;  1QUP A;  2XY6 A;  1UW4 A;  3QRR A;  3SV4 A;  3M30 B;  1Q8K A;  3U1L A;  1FO1 A;  2V2V A;  1JQG A;  1Q79 A;  1D09 B;  1OSD A;  1RJJ A;  1S1X A;  1DQA A;  5D77 A;  4ZVE A;  3BB5 A;  4OX7 A;  1D9F A;  2UXC J;  5HAO A;  3M8Q A;  3AHP A;  3G6E S;  5IC4 B;  4OHX A;  4DR6 F;  2JH3 A;  4PG6 A;  2KKH A;  3PEH A;  3QZ7 A;  1U25 A;  4XAK A;  3VGS A;  4L6V 3;  1U45 A;  1S1X B;  2Q43 A;  2M8D B;  2G2Y A;  3TQ1 A;  5J2P A;  3W7B A;  2FYX A;  1VC0 A;  3M8Q B;  3TVK A;  4PEO A;  3JS9 A;  3CJ0 A;  4FYY B;  1JJ2 R;  2E5L F;  3OT9 A;  4HHJ A;  1HWI A;  1MN9 A;  2H5I B;  2PI5 A;  3P5T L;  3T6B A;  4PUO A;  1CC8 A;  4RR5 A;  1UAW A;  2AP6 A;  4RW7 B;  3R6G B;  4WU3 A;  3QJP A;  4PQU B;  4EFA C;  2F8E X;  3T1Y J;  2QL7 B;  3L3C A;  3DLJ A;  1FJE B;  2NR0 A;  3BGR B;  5CQG A;  1NPP A;  1RAE B;  1XBW A;  2MLX A;  3RGI A;  4ZLP A;  1WI8 A;  1QD1 A;  1RLC L;  1H7X A;  2VD3 A;  4DQS A;  4GKK F;  2RE1 A;  3A3N B;  4NL5 A;  3AT1 B;  2HMI A;  2BM0 A;  5KFK A;  2ATC B;  4NE9 C;  2YKN B;  4UOH A;  5IT9 Y;  1T8E A;  1DLO A;  1X9S A;  2DNH A;  3KDO A;  5KFJ A;  3DYA A;  2ZH1 A;  2P9G A;  3BS9 A;  2IMO A;  1C1B A;  2DNL A;  2GIF A;  5JMN A;  4H4O A;  2HMI B;  1KQK A;  2LEA A;  4QYR A;  3BDP A;  2OTL S;  1HBO A;  1IM6 A;  3W5Z A;  3PX0 A;  1DLO B;  3H42 A;  3KOA A;  3DYA B;  4DV0 J;  4KGV B;  2BQ3 A;  1C1B B;  3FCW A;  3J7Y U;  3EX7 B;  3V2U C;  1Z2Z A;  2N7C A;  1UCN A;  4H4O B;  2UP1 A;  1RZM A;  1M5P C;  4M5G A;  3UR0 A;  3HZE A;  1RTZ A;  5THW A;  4K7Q A;  2YKO A;  2LEP A;  1ULR A;  4A4J A;  2A10 A;  1IWA A;  2C2E A;  2JEF A;  1HNZ J;  3RW7 A;  3SCK E;  1V9O A;  4WP8 A;  5HQL A;  2O5D A;  2COL A;  3GIK A;  1JNZ B;  4JV5 F;  1PSD A;  4OI6 A;  2WBR A;  1UJ5 A;  3BO4 A;  3HT0 A;  1PC4 A;  4ES1 A;  4J9N A;  1QUV A;  1NK9 A;  1TL4 A;  3HLU A;  3ILI A;  2ZHB A;  5KFL A;  2VL1 A;  5IQQ A;  5KFT A;  3CJK B;  3WIU A;  3RTV A;  1FER A;  5IXU A;  5ETV A;  1ZPW X;  1FD2 A;  2MQP A;  1VI7 A;  2ZH7 A;  2V2K A;  1R8H A;  4J9S A;  3TOQ A;  1R31 A;  1UWA A;  3FEY B;  1S6U A;  4FNI A;  4DSI A;  4C3L A;  1T02 A;  2VUG A;  4AUK A;  1NKB A;  1SJR A;  4DF4 A;  2LXU A;  3TRG A;  5HK4 A;  1SQE A;  2E5L J;  2XS7 A;  3H4D A;  3ZTS A;  4ALZ A;  4LMZ A;  4WYW A;  4FN5 A;  2YKM A;  1H0H B;  3QAU A;  1FNO A;  4WWS A;  3Q23 A;  3KMS A;  5GAH U;  4LF8 F;  4LSN B;  7FDR A;  3GR1 A;  1HBU A;  4FNH A;  4YR0 A;  3D68 A;  3GPA A;  3QT8 A;  1WF1 A;  2I1R A;  3HD1 A;  2QSW A;  2WSF C;  4JI5 F;  2F65 A;  5KT3 A;  3NCP A;  4LRA A;  3GFH A;  2YKM B;  2W2P P;  4RNN A;  2YQ3 A;  2NZ4 A;  5G0R B;  3A8K A;  3P96 A;  4G1I A;  2GVZ A;  4DX8 H;  4CH7 A;  4ZKA A;  2BAN A;  3BBF A;  1SKU B;  3PYG A;  1NDC A;  1NDP A;  4U8Y A;  4A8K A;  4ZJO A;  1VJQ A;  4JI0 F;  4IH6 A;  2Q1L A;  2RDI A;  1AW0 A;  4NLY A;  1HKA A;  2LDY A;  2Z2M A;  2GVZ B;  1IBK F;  1KOO A;  5GAE U;  2MEW A;  3PW0 A;  3UDL A;  4ELT A;  2BAN B;  4ECY A;  5E3R A;  2RAQ A;  2DYA A;  4MH8 A;  2NQP A;  3LW5 C;  2QMX A;  1D8Z A;  3QGI A;  3E2E A;  2G2O A;  4X65 F;  5HP1 A;  2WZ1 A;  1NXI A;  2ZKU A;  3GJS B;  3I6P A;  1VK8 A;  2LEC A;  4XO0 A;  4LF5 F;  4FF3 A;  3HHL A;  2PEH A;  2FC9 A;  4MKV A;  3W2V A;  2YPY A;  3MM8 B;  1FJ7 A;  4XPE A;  4K59 A;  3POT A;  2FHJ D;  4WPA A;  2MJU A;  1IKY A;  2B7C B;  4JV5 J;  1F9F A;  3MCO A;  1GEH A;  3HHL B;  3KLG B;  1UZH A;  2XMA A;  1NSA A;  4YB6 A;  2CRL A;  2JLF A;  3BO2 A;  1I94 F;  4CP5 A;  4RJV A;  3POT B;  4J9O A;  4UT4 A;  3OHB A;  3ONQ A;  2Y8Y A;  4Y34 A;  4KB7 A;  1XC9 A;  2HFU A;  1N5T A;  1YK9 A;  5B0B A;  3ET6 A;  1OYE A;  1T3O A;  3CCL S;  4IR1 A;  1RAH B;  4FYX B;  3KWM A;  5A8R A;  2AGP A;  2YWK A;  4QU6 A;  2W9A A;  3PAC A;  1RTD A;  2NSB A;  2A1B A;  5ETK A;  1BD6 A;  1RT6 B;  4GC6 A;  1TEL A;  5K8P A;  5A8R B;  5DQI A;  5ETO A;  3DXS X;  2MZR A;  4K4T A;  4C8O A;  4TKT A;  1RTD B;  2RU3 A;  1VBK A;  1X4A A;  5K8M A;  3UR3 C;  5GAD I;  1S1W A;  4X2B A;  5E3A A;  4F3M A;  3AA8 A;  8RUC A;  4EGL A;  2OTJ S;  1MWZ A;  1NZ8 A;  3MMJ A;  3MDF A;  2ZJQ Q;  4OZJ A;  2OPP B;  1GH8 A;  1U1O A;  1AUD A;  5L1I A;  4DV4 F;  2D41 A;  1VK3 A;  4IG0 A;  5EDW A;  1DUR A;  1S1W B;  4YDD B;  3R5J B;  3JAM Y;  3LO3 A;  3VVT A;  3K5O A;  4UY8 T;  3AOB A;  1KN6 A;  2ILZ A;  3KUE A;  3G4S S;  1YJR A;  5H9F J;  4WXW A;  1QTN B;  3DHX A;  2EFO A;  4DZD A;  2AKW B;  5DQH A;  1FA0 A;  1QTM A;  2ZHO A;  4CO5 A;  1QJH A;  2CPI A;  4C7Q A;  2WW4 A;  4YP3 A;  3T5J A;  4G1Q A;  2V8D A;  4C3M A;  2VC1 A;  1FRJ A;  4YHH F;  2XI2 A;  5KFF A;  4FXV A;  3BQ1 A;  2KXF A;  3DRS A;  1PCA A;  1MNE A;  2AYG A;  2CFX A;  4FZV A;  5DZ6 A;  3T9N A;  1PBU A;  2ROE A;  4LF5 J;  1TL1 A;  4USH A;  1WOO A;  3OJS A;  2DH9 A;  4G1Q B;  2SXL A;  3TI0 A;  3EXC X;  3QAE A;  3NL0 A;  1D0E A;  4OZL A;  2DHA A;  2PMW A;  3K7R A;  3DRS B;  5IZH A;  4JYA J;  1A7G E;  3H20 A;  2OP5 A;  2XEX A;  4XDC A;  2R7R A;  5JVH Q;  1TL1 B;  4OHZ A;  3MM9 A;  2N4C A;  2QMW A;  3WZ0 A;  3MM6 A;  1JKH A;  3OXF A;  3UN5 A;  4GVL A;  3ZFV A;  2FJA B;  4GC7 A;  3CD7 A;  1B99 A;  1HI0 P;  4NXM J;  5E0O A;  1EET A;  2MKJ A;  5EX3 A;  3K8W A;  2RF2 A;  3MM7 B;  4LF6 F;  3CWJ A;  3TAP A;  1ZM2 A;  2MPU A;  3VR1 A;  3MM9 B;  1R6Y A;  3BBB A;  2HFS A;  1T94 A;  3MM6 B;  1JKH B;  1EJ7 L;  1FTR A;  4DU8 A;  3M8R A;  2PFD A;  1WEX A;  4IH7 A;  4QBU A;  6FDR A;  1X5O A;  4JI3 F;  3HD2 A;  2RF2 B;  2C1E B;  4O23 A;  3TQE A;  3BO3 A;  3LAL A;  1MMN A;  3KK3 A;  4DBQ A;  1NJY A;  4HDH A;  2FJV A;  1CVJ A;  3A12 A;  2MMY A;  2JEJ A;  1KTQ A;  4C48 A;  1SB6 A;  4NA1 A;  1APS A;  2XY7 A;  3O3L A;  4IQM A;  3P5B P;  4ZIW A;  2ADB A;  4HH0 A;  5G4D A;  2VJU A;  1VQ6 S;  3H7H B;  2Z56 B;  4ZJL A;  1RAG B;  3BH7 B;  1DY3 A;  2D9O A;  2M0G B;  3KK3 B;  5CD4 H;  4IYQ A;  3CJ3 A;  3T41 A;  4PPD A;  3I87 A;  4Q0B B;  4DV4 J;  2HZV A;  1UEU A;  4DX6 A;  3AAW B;  3QSI A;  1VQP S;  1RB0 A;  3PX6 A;  3UDE A;  4QR0 A;  3RB4 A;  3C6U A;  3T1H F;  5KFH A;  3ILJ A;  3AJ1 A;  1X4G A;  3F73 A;  2UV8 G;  1S9G B;  2M52 A;  2C42 A;  2YY3 A;  2QLB B;  2E7X A;  4UZC A;  1VRU A;  3C6U B;  3CDU A;  2M7S A;  1LV5 A;  3HUL A;  1U1M A;  4QCL A;  1F9H A;  3OFH A;  2B51 A;  3O2I A;  2W7O A;  1PBA A;  2K7K A;  1GQE A;  2G0J A;  3CDA A;  1M5O C;  4MAK A;  1GMV A;  1S12 A;  1RCO B;  1VRU B;  3A3P B;  5AXN A;  4CH1 A;  4TQR A;  4MFB A;  1MLA A;  2CNL B;  3GSI A;  4K5R A;  4LVN P;  2CQI A;  3HHL C;  3GG1 A;  2IRX A;  1TR0 A;  4GMK A;  2I8E A;  4J7C A;  1U47 A;  1HIY A;  1EIY B;  2CG4 A;  3TUZ C;  4MFB B;  1OPZ A;  2JNJ A;  5AJ3 J;  3QJJ A;  1FES A;  2AIR B;  1KBR A;  5D3G B;  2XB2 D;  2J7W A;  4Y6I A;  5EGY A;  1LXJ A;  2IAJ A;  4R5P A;  4IRC A;  4QIV A;  4P75 A;  5A0Y A;  2XLI A;  2K7J A;  4QWA A;  1KD1 T;  1SKW A;  1Q16 B;  3EDR B;  3G82 A;  3M2V A;  4ED2 A;  5GAD U;  1IXK A;  2IAJ B;  4R5P B;  5A0Y B;  3G9C A;  4NLX A;  3IWL A;  4JI3 J;  1WDT A;  3F0N A;  1FWL A;  4HT7 A;  4D3G A;  3G82 B;  4N77 A;  1FE0 A;  1NM2 A;  2F8M A;  1E6V A;  3M2V B;  1WUU A;  2GJ2 A;  5I3Q A;  1Q8I A;  2Q6B A;  2IYG A;  3GB0 A;  1QAI A;  3N5B A;  3T3F A;  3J81 j;  4Y65 A;  1R8C A;  1RWK B;  4IOB A;  2GCF A;  1OSC A;  2EFQ A;  5CCL A;  1F0X A;  1IQZ A;  2YBV A;  3RBZ A;  2PC6 A;  2IVM A;  1E6V B;  1FXL A;  2VQE F;  2LU2 A;  3Q83 A;  4NLP A;  1UMJ A;  4KIA A;  3IM9 A;  3TA0 A;  5D4N A;  5HRO A;  1RXO B;  5LT5 A;  1WC3 A;  4BCA A;  4HEA 9;  2B4O A;  2K2P A;  2JSX A;  2IC3 B;  2RUS A;  3AOA A;  2QTW A;  2FVP A;  1UVM A;  1VQK S;  2M88 A;  1GMW A;  3UO0 A;  3W9J A;  3HP6 A;  2GO8 A;  3EGW B;  1LK5 A;  4OMF G;  2HAF A;  4I2P A;  4A8M P;  2HHW A;  4DSL A;  4KGZ B;  4J37 A;  1T3N A;  1NK8 A;  4FBU A;  1F5A A;  4CLL A;  4DSE A;  1FTC A;  5HRO B;  1TFY A;  5C24 A;  2GQ2 A;  4ZS6 A;  2VIH A;  4IUF A;  3CMQ A;  2ACY A;  1KLM B;  3CT9 A;  1LFW A;  2FVR A;  2VA2 A;  3MTJ A;  2UUC F;  1H98 A;  4I2P B;  5LJ5 Y;  2V4Q A;  5C24 B;  2NYH A;  1S1T A;  3S01 A;  2R7X A;  2PO4 A;  4USI A;  1YIT S;  4B3M J;  2Y1R I;  2AWZ A;  1UVL A;  5ETL A;  5DO2 A;  3NXZ A;  2DR9 A;  3CD6 S;  2NYI A;  5B0F A;  1N32 J;  2UUB F;  5KFW A;  4RW8 A;  3UD4 P;  4ER8 A;  4OYO A;  5KFS A;  1S1T B;  1WC0 A;  2NPI A;  4DUY J;  2AEJ A;  3WDO A;  2AW0 A;  2LQB A;  4TY8 A;  5JVG Q;  4RW8 B;  5B0E A;  4GRS A;  1U09 A;  4DOZ A;  2G0I A;  1YGY A;  1YJ9 S;  1W25 A;  3D54 A;  4URQ U;  2HQG A;  4PPZ A;  3M8S A;  3MOJ B;  4TU7 A;  2GNK A;  2QZ8 A;  5AXL A;  1QVF R;  1U2F A;  2MGZ A;  4DCJ B;  2K8G A;  2Y0B B;  3JSR A;  4ETX A;  1JLQ A;  4P2M A;  3EJM A;  2C3M A;  3MEK A;  1UA1 A;  3ZZU A;  1G2E A;  5CYQ A;  3IAS 9;  2MGZ B;  3B6B A;  2KZM A;  1TK0 A;  2WK4 A;  3DDI A;  3G6V A;  3NGR A;  2YWG A;  2B6A A;  3R8Y A;  2E1M C;  3BSO A;  4F4Y A;  2DBB A;  4FP9 A;  3CJR A;  2HVZ A;  3M7V A;  4EU0 A;  4KHP J;  3TZX A;  2QMU B;  5F0W A;  1WD6 A;  2DEJ A;  5CYQ B;  3QGH A;  1RT7 A;  1PO6 A;  2XYP B;  4RBV A;  3Q8S B;  2FJE B;  4NRT A;  4W4M A;  1PYO B;  2B6A B;  2J0X A;  3LTO A;  4X4Q A;  2CWX A;  4DL5 A;  3KG0 A;  2H1Y A;  2VQE J;  4WZM A;  2CVE A;  2P6S A;  4LF1 A;  3OPK A;  4B9T A;  4F0H A;  1RT7 B;  4RW9 B;  5ETR A;  2MZQ A;  2EK6 A;  3X1L B;  4I4B A;  1N8R T;  2HNZ B;  4ZPA A;  1AZS B;  1EQM A;  1XJW B;  4B9M A;  3BKT A;  4B3R F;  2B4V A;  2BKO A;  3VTI A;  4ECQ A;  2OO4 A;  5F0U A;  2C2R A;  4ECZ A;  3FKB A;  2UUC J;  3MMB A;  1XNQ F;  1X60 A;  2HHV A;  4C98 A;  1AXQ A;  3SV3 A;  4PXB A;  3QPI A;  2HRY A;  3K5N A;  1SH2 A;  1ZM9 A;  3DKD A;  3D6T B;  3D2W A;  1Y9O A;  1NBE B;  3IR7 B;  1Q53 A;  3G71 S;  3FUY A;  4W92 B;  1VOM A;  1SH3 A;  3U1N A;  2MQO A;  3GP9 A;  3EYZ A;  4MTP A;  2ZM6 F;  2O1P A;  4A47 A;  1IQT A;  4J90 A;  2DVI A;  2LKZ A;  1SIZ A;  1KKH A;  3ITH B;  2LQ5 A;  1S4E A;  1F5C A;  1WKK A;  4J5O A;  4UOG A;  2ZH2 A;  5AE1 A;  4F3Q A;  1HQE B;  4CLS A;  3LP0 B;  3UWT A;  3NLC A;  5KG2 A;  2AJ1 A;  1P9Y A;  2ZOM A;  2CAJ A;  3RB6 A;  2E9T A;  3M2U A;  5LJ3 Y;  3MFH A;  3QID A;  2UVV A;  2M5Y A;  1S5Z A;  2CXE A;  2DD8 S;  2QG9 B;  3IR5 B;  4K4Z A;  4F02 A;  2JEG A;  1HNI A;  3TJ9 A;  2B43 A;  3EXY A;  2VPX B;  5L1J A;  2IPO B;  3V5R A;  2B5J A;  2CJK A;  2HZC A;  4UTG A;  1WG1 A;  4L72 B;  2DO0 A;  2A3J A;  1WKJ A;  3DI6 A;  1Y5I B;  1A6L A;  3Q2T C;  1QSY A;  4C0B A;  3OUY B;  1K47 A;  3TNV A;  2L9N A;  3I96 A;  1QVG R;  1S6O A;  1YDL A;  2C3U A;  1OQ3 A;  2FZK B;  2OLW A;  1SJF A;  1S49 A;  5HAT A;  2QYG A;  3EZO A;  2QN6 B;  4NLV A;  1TUG B;  4A8W A;  2E44 A;  3S7R A;  2Y1J A;  3SDE A;  4E8U A;  2L9D A;  4DSJ A;  3RZA A;  1KHV A;  4PWU A;  4B08 A;  1NRK A;  5EWG A;  2X7I A;  1JXV A;  4ECR A;  4U95 A;  1TKD A;  3PG9 A;  1FHT A;  2V68 A;  5E3Q A;  1RUS A;  2PMH A;  1XK8 A;  3BSA A;  4K50 A;  3P45 B;  1XER A;  2KJW A;  2ASD A;  2QEX S;  1CJT A;  1S76 D;  4OZ1 A;  4NA2 A;  4OI3 A;  2IRY A;  2F40 A;  3NOG A;  3SYZ A;  2QO3 A;  2FHO B;  3CDE A;  2IVF B;  3R1H A;  1SKR A;  2DY9 A;  3VV2 B;  2RIJ A;  1XNQ J;  5ETN A;  2AEF A;  1ITP A;  1UWB A;  1CJT B;  1TUV A;  2NUH A;  3K59 A;  2CA9 A;  1Y5N B;  3C66 A;  1GX6 A;  1H72 C;  1TVR B;  2F4V F;  3KYL A;  5F9N A;  3HMJ G;  3HVW A;  1KC8 T;  3G86 A;  2HRU A;  1YRX A;  1UWB B;  2OEK A;  2QA1 A;  3NCR A;  2YNG B;  5CYM A;  4IOA Q;  2ZM6 J;  4WE1 B;  1HYS A;  1Y11 A;  2QSF A;  1UZD A;  4USU A;  1LOU A;  1WHX A;  2N7Y A;  2MJN A;  3ZNU A;  2AU0 A;  5FJ4 A;  3QGG A;  2HVI A;  3IAM 9;  1HYS B;  4DR5 J;  2HND B;  4YR3 A;  4KRW A;  1VIS A;  2BJE A;  1R8P A;  3CIM A;  3RG6 A;  1HA1 A;  1CS4 B;  2E5H A;  5FII A;  2LU1 A;  3NGT A;  2FTR A;  3CMA S;  4M8L A;  3PZP A;  4OHV A;  2RQ4 A;  4S0M A;  3NP5 A;  2A2C A;  4H4K C;  2WRM A;  1XMO J;  1HBN A;  3I4P A;  1SV5 A;  1N56 A;  4DX7 A;  3FSY A;  4CLZ A;  4TYB A;  2DGO A;  1BQX A;  2BUN A;  2Z4P A;  3EIC A;  4CLP A;  1WOS A;  1FNX H;  1IR1 A;  1U7L A;  3M8Z A;  1WAC A;  4LF4 F;  4A48 A;  4LFA F;  2LXF A;  1SV5 B;  2RRB A;  1REV A;  2G4B A;  5KOW A;  4CWB A;  2VFT A;  5KFP A;  2XTJ P;  1B0T A;  2VBY A;  5LMU J;  1KVJ A;  1C0U A;  3BDE A;  2JHE A;  1REV B;  5KFC A;  2OSQ A;  4ZN3 A;  2J9E A;  1NK6 A;  3CTR A;  1SH0 A;  3RRH A;  2A6O A;  3LWL A;  2DGS A;  4CQ1 A;  1C0U B;  1RWP B;  2CPE A;  3D6H B;  1NPR A;  4WP9 A;  3GJR B;  1NEE A;  2KXN B;  1EB0 A;  3VF0 B;  1F3V A;  4OQJ A;  4QIE A;  1BQM A;  3MOZ A;  3IM8 A;  4ZIT A;  3R3T A;  1XMQ F;  2FJW A;  2MQ8 A;  5HQ8 A;  1U24 A;  2XO6 A;  2JEI A;  3UNY A;  1J2V A;  1M5H A;  2H5E A;  2F4V J;  2FLO A;  5C2G A;  2RHQ B;  1X4D A;  3OHA A;  3PTW A;  1VHF A;  5CCM A;  5DG7 A;  4M5N A;  1YJ7 A;  1F6T A;  1F3F A;  4ECX A;  4B17 A;  4CO4 A;  5IV4 A;  3IN5 A;  2KFY A;  2KHD A;  3ENV A;  1F9E B;  5JUM A;  2F8H A;  3PRD A;  3CME S;  4WTY A;  1B7Y B;  2B4P A;  2BW2 A;  4QOT A;  4ZPD A;  2LA6 A;  3SEO A;  5KG4 A;  2NPF A;  2JRS A;  2J8S A;  3GU0 A;  1HHS A;  4ZVQ B;  5EHH A;  2Z8Q A;  4M5L A;  1HD1 A;  1G4C A;  4ED0 A;  4KV8 A;  1Y00 A;  3L95 X;  2KL8 A;  4HI1 A;  3PXG a;  1IUJ A;  4NYP A;  2AX1 A;  2POK A;  1WF2 A;  5D0R A;  4F0K A;  1RU1 A;  5EUH A;  4DL4 A;  5B08 A;  1GXU A;  2HFN A;  1V5V A;  3KJV A;  3TJ8 A;  1Q8B A;  2V9W A;  4PXC A;  3ZZZ A;  4KV8 B;  4MKA A;  3UPF A;  2CPJ A;  2QA4 G;  3GSD A;  5K5M A;  4P71 A;  1FT8 A;  4LFB F;  2W8K A;  3KJV B;  4F25 A;  2N3O A;  4I68 A;  2IJR A;  3SIP B;  5D8H B;  1RYR A;  1FX2 A;  1DRZ A;  1H6K X;  2CQ0 A;  4FYV B;  3DN9 A;  3GG0 A;  3JQJ A;  2CKW A;  5KFO A;  1VQ5 S;  4L75 A;  1CUL A;  3CPW R;  4N76 A;  3FK4 A;  2FVS A;  1LW2 B;  3H8Y A;  2DXF A;  1R3N A;  3M05 A;  2NXU A;  3NWG A;  1SPB P;  2YKP A;  1IJF B;  1RAD B;  3IS9 A;  4RZR A;  1L3S A;  3AXM A;  1CUL B;  1QSS A;  2PGC A;  1XNR J;  3EPG A;  2VPZ B;  2XWY A;  2GML A;  3AD7 C;  1NJX A;  5K8O A;  5A8K A;  1S77 D;  5GAG I;  1XR7 A;  5KFZ A;  4UY8 5;  2VPW B;  1FF2 A;  5HI7 A;  5J1N A;  3RAM A;  1T9W A;  3IS9 B;  4DUZ J;  2DCU B;  9RUB A;  4EWT A;  2MYF A;  3J80 U;  3ZZP A;  2X1G A;  3D28 A;  2VFS A;  1ZOT A;  3ZO7 A;  1XMQ J;  4R0E A;  2EG1 A;  1UFL A;  3S6E A;  4IH5 A;  1SBR A;  2IM1 A;  2XMU A;  5L1K A;  1Y3K A;  5F8H A;  5DLG A;  1S9E B;  3PEJ A;  3FC9 A;  4KFB A;  3ILL A;  2ADC A;  1N5Y A;  1M90 T;  4OZ0 A;  2F7V A;  3PKM A;  1P27 B;  4CZC A;  3RAQ A;  3OJU A;  3VGU A;  2GGP B;  2X51 A;  4TNO A;  2X1A A;  2V4J A;  2DGT A;  1VIO A;  2VIC A;  5C42 A;  3DU5 A;  1N5Y B;  1F5B A;  3OSN A;  4ES2 A;  2V8H A;  2XHC A;  2BM1 A;  4ZVH A;  4FS1 A;  2GO9 A;  1Q5Y A;  5C42 B;  2I0X A;  4URG A;  1D9A A;  2WHO A;  5I4M A;  4DCP B;  1DQ9 A;  4QYZ K;  1RBA A;  2L08 A;  4DF8 A;  4DR3 F;  1K0T A;  3KLV A;  1FJG J;  3MZI A;  4X62 J;  2DIT A;  1JMT A;  4IO9 Q;  3N4W A;  4ZP6 A;  2MLZ A;  2NXJ A;  4WFY A;  3KG1 A;  2VDH A;  4AE5 A;  1SUQ A;  2HHS A;  1YX2 A;  4HDG A;  2HHU A;  4KO0 A;  4LFB J;  2DRB A;  5KAK A;  2GZO A;  4G6V B;  3MI7 X;  2WVD A;  3VWS A;  4OI4 A;  4NLU A;  4NZ6 A;  2ZBC A;  5DS7 A;  1S6P A;  2KM8 B;  1SUQ B;  4LUB A;  1Q0N A;  3MF5 A;  1T9T A;  3FRZ A;  3HCX A;  1CJU A;  4KTQ A;  3VAG A;  5M2R A;  4N8N A;  1CJK A;  4A8F A;  2KJV A;  4EZ9 A;  4LRD A;  2CNO B;  4M94 A;  2ZH9 A;  2DO4 A;  4KGM A;  1FDA A;  1S6P B;  2N4D A;  2QA4 S;  3GR0 A;  2D69 A;  1CJU B;  3CUN A;  2BJ7 A;  4RUC A;  4KYZ A;  1F2H A;  2FIU A;  1DBD A;  4ZLJ A;  2K3I A;  1CJK B;  5IS2 A;  1RKI A;  2RU9 A;  4O3Q A;  3TX8 A;  5KG3 A;  4ICL A;  1AUS L;  2DR6 A;  2HK3 A;  2P6T A;  2ZH3 A;  1WNE A;  1UVJ A;  2OML A;  3R9L A;  2LP4 A;  3MPU B;  1RWM B;  1RA7 A;  4QIF A;  4JI7 F;  1X0F A;  4ICL B;  3C15 A;  5F3Z A;  4GKJ F;  4LQ9 A;  4RNF A;  2ZC4 A;  3CJ5 A;  3ISN C;  2CPX A;  3CC2 S;  3KHH A;  4DL3 A;  1HNX J;  3KLH B;  1S1V B;  2FVQ A;  3HI9 A;  3C15 B;  4DV7 F;  3TA1 A;  4KH1 B;  3VGV A;  3GYX B;  1T11 A;  3OL6 A;  3L7U A;  3HM9 A;  3BBC A;  3TVY A;  4CLT A;  4PCQ A;  2MST A;  1Z4U A;  5DGA A;  2DGV A;  3A3O B;  4ZPB A;  2HFZ A;  1B0P A;  1FJC A;  2FHJ A;  1IBM F;  1R7I A;  2YPZ A;  4NCA A;  5C2C A;  1UVK A;  3HFZ B;  3MEC B;  2R2T A;  1S10 A;  4X84 A;  1M5V C;  1VQ9 S;  3K58 A;  3ENQ A;  3BKF A;  1H73 A;  5M2P A;  3R5G A;  2RRN A;  2HW3 A;  3T5L A;  5D4O A;  3WC2 A;  1IN0 A;  1KEK A;  4DSK A;  3PO4 A;  4NI2 A;  3Q8P B;  1CJV A;  1N36 F;  4QWD A;  2QIF A;  5KT2 A;  3M8Y A;  4I0W A;  3RBD A;  3PY8 A;  1IJE B;  3MD3 A;  4ERD A;  3UNG C;  3D66 A;  1LWX A;  4QW9 A;  4DR1 F;  4NI2 B;  4RBU A;  1CJV B;  2XO7 A;  5HVG A;  1ZA1 B;  3BN7 A;  1BLU A;  3M1V A;  2VG7 A;  4OX9 F;  2FUG 9;  3UVJ B;  4X4U A;  4I64 A;  1UET A;  3H5S A;  5HMX A;  2HWT A;  4U9R A;  2B9Y A;  4O3P A;  4O4G A;  2XCA A;  1JLB A;  3NGD A;  3MTK A;  2DB1 A;  3M1V B;  2VG7 B;  4LSZ B;  4URS A;  2YNI A;  5E2Q A;  4Y00 A;  5JXS A;  2BAB A;  2NLW A;  3MFI A;  4O4G B;  4I69 A;  1JLB B;  2YWH A;  1M0S A;  3KHR A;  4ZVU B;  4USK A;  3VVU A;  2BJ1 A;  5KFU A;  3RR7 A;  2KG0 A;  1PKU A;  4F8R A;  4OLO A;  3NEK A;  3J7Z 5;  4LBH A;  3PHE A;  3D7S B;  1QAJ A;  1U2C A;  2OD4 A;  2MKI A;  4J9R A;  1FFW B;  5CHC B;  1UA0 A;  4OYI A;  5CYJ A;  2M2B A;  2CVI A;  4QU7 A;  4OI0 A;  3TUJ C;  3DRP B;  2VHG A;  2ZZM A;  2GFF A;  4RBT A;  3O6Q A;  4AQY F;  2YKQ A;  3MAQ A;  2WBM A;  3LOU A;  3B4D A;  2PD1 A;  3BGU A;  3C14 B;  4CT9 A;  4NRU A;  3BKU A;  2M3D A;  4X66 J;  4ZCI A;  3CDB A;  1RWN B;  1PGZ A;  4ECT A;  4CH0 S;  4DPX A;  2IJN A;  2DNY A;  1S99 A;  5KT5 A;  4QJV A;  4MKY A;  4V1A k;  2X3G A;  2DEI A;  4JI4 F;  5D4L A;  3H5Y A;  3DNC A;  4UST A;  2YX4 A;  1QAY A;  1U1N A;  3L7O A;  4M1K A;  2UUA F;  4Z7Y A;  4YEA A;  2DPI A;  3RU0 A;  2AJF E;  2P5V A;  3BSC A;  4K2X A;  5LXR A;  2GIQ A;  1JXE A;  1BWV A;  2Y9H A;  1LWF B;  1WC5 A;  4G65 A;  1SC4 B;  2KM8 C;  3FFI A;  2GC8 A;  4EK2 A;  4DXL A;  2MHN A;  3HKW A;  3KJF B;  3KLI A;  5J1E A;  4UOC A;  1FEE A;  1JWW A;  1RT5 A;  2RSQ A;  3OTD A;  4CLY A;  5HMZ A;  1EZZ B;  2HS0 A;  2QA2 A;  4OHW A;  1XWL A;  1HWL A;  3BH6 B;  5KT6 A;  2P8I A;  4QIG A;  5J1E B;  3ZZO A;  3CJ8 A;  5B0A A;  1RT5 B;  4M5D A;  2W8L A;  4NYZ A;  2ABY A;  2GA7 A;  3ILO A;  1RDR A;  4F4X A;  2UXC F;  3JTP A;  3I31 A;  3OXG A;  4M5D B;  4DLG A;  4FF1 A;  2PEB A;  5DG8 A;  1RHQ B;  4TLR A;  3D67 A;  2XS5 A;  1H3D A;  3FQL A;  1WHW A;  3CNQ P;  3K17 A;  3FSX A;  1B64 A;  2XG8 A;  1C4C A;  1OY8 A;  1WHV A;  2MKC A;  3AB4 B;  2CJY B;  2G2Z A;  4QWC A;  3DMJ B;  3DLG A;  2HVD A;  1RGV A;  3OW2 R;  2VKZ G;  2OEL A;  3OQ2 A;  5FDL A;  3CCQ S;  5H1S V;  4DMZ A;  3T1Y F;  1H7W A;  3W9I A;  4ZCM A;  3FJ2 A;  4MK7 A;  2OFG X;  2EBE A;  4J9M A;  3DLG B;  2PSZ A;  2OPQ A;  2FHK A;  2Z57 B;  1JNR B;  3TYT A;  3J81 U;  4X4T A;  3A13 A;  1A9N B;  2IM3 A;  3QO9 A;  3R2C J;  2DNN A;  5HBM A;  1WWH A;  2DIV A;  2FB0 A;  2HBQ B;  4Q5V A;  4OV6 A;  4ZHR A;  2MQN A;  4TN2 A;  3MD1 A;  4YS2 A;  4DFJ A;  2QLF B;  4W90 B;  1EP4 A;  1FK9 B;  2HWI A;  1FDB A;  2BRK A;  3GON A;  4ILR A;  4OYM A;  4WIQ A;  5HBM B;  1SCJ B;  3NMR A;  4ZHR B;  1RHM B;  1KON A;  3GWC A;  2UUT A;  2HPU A;  4WZQ A;  3GIM A;  2LQJ A;  1EP4 B;  2KYZ A;  4YDX A;  4C8K A;  1HI8 A;  2ALY B;  2QLJ B;  4DV0 F;  3CCM S;  2DT9 A;  5C5J A;  5E5N A;  1NK4 A;  1M5K C;  4USW A;  2HG4 A;  2OEJ A;  4RLE A;  1VQN S;  4DPY A;  2ZZN A;  4UZB A;  4OYP A;  3JTO A;  1HWU A;  2QLW A;  3M30 A;  3JB9 k;  1LKZ A;  2CQB A;  4CLW A;  3TAN A;  1M1G A;  2JVO A;  2KRB A;  2BRL A;  1MML A;  1PYS B;  4OJG A;  2IBO A;  3GTY X;  3FEX B;  1OIA A;  3ISZ A;  2X3D A;  4YB5 A;  2QJ3 A;  2J6U A;  3M6V A;  2Y8W A;  2WVE A;  3OR1 A;  3CO9 A;  3T9Z A;  4JV1 A;  3KHL A;  3DM2 A;  3IG1 B;  2XMJ A;  2V2Z A;  1WJ9 A;  1UTA A;  4DPW A;  4AD6 A;  1WTB A;  3QAT A;  1RAO A;  3M2R A;  4IRK A;  2CJQ A;  2O67 A;  1S72 S;  4OYB A;  4JI1 J;  1NHK L;  3OR1 B;  3OL8 A;  3M6X A;  2VPY B;  3DM2 B;  4ECW A;  1JLC A;  3UCZ P;  3MR2 A;  2DGU A;  2APO A;  1UW9 A;  4RW7 A;  3M2R B;  3IWN C;  3IR6 B;  1X31 C;  2R8K A;  1I3O B;  4PQU A;  2KDO A;  4NXN J;  3RBX A;  1REG X;  3BGR A;  4XDD A;  4OV1 A;  4RUA A;  3QRQ A;  3EGZ A;  1JLC B;  3MPY A;  2HIQ A;  2HQ3 A;  5IWA J;  2HQD A;  4DS5 A;  9ATC B;  1U49 A;  2XHW A;  1FRK A;  4DL2 A;  1VIX A;  1FEH A;  4UOF A;  3QLH A;  2YKN A;  4IO1 A;  1H2V Z;  1XR5 A;  3SSQ A;  3JQM A;  3W8G A;  2IDE A;  3GFY A;  2XYG B;  3B54 A;  2KVI A;  3ZZY A;  3TW0 A;  3I0S A;  1NKE A;  3I5B A;  3DOM A;  3T19 A;  4Y3C A;  4P72 A;  2JFD A;  3QLH B;  3GFX A;  4P74 A;  4KPC A;  4PXE A;  4ATN A;  4C0H A;  1DFD A;  4ED4 A;  5E33 A;  1SIW B;  1L3V A;  5F8M A;  3SI8 A;  2MKS A;  2YX7 A;  3RYL A;  3I0S B;  4Q45 A;  4DR7 J;  3DOM B;  2DR5 A;  4PG5 A;  1VQ4 S;  3BR9 A;  2EXU A;  1HPZ A;  3I0R A;  4YB1 P;  3EVO A;  3ENW A;  4XTT A;  2R2R A;  2KFZ A;  1UVN A;  1XTZ A;  4A8Q A;  1X9M A;  1Q82 T;  2RQM A;  3KK2 B;  2YX1 A;  1MG7 A;  3DRX A;  3EPI A;  1RE1 B;  2R7W A;  2ZNY A;  1HPZ B;  3HK2 A;  3I0R B;  4AXJ A;  3MEE A;  1C1C A;  4F2S A;  4O3O A;  1X5S A;  4EO8 A;  3CVK A;  3US5 A;  1N34 J;  1U6Z A;  3CJK A;  2G13 A;  2BKP A;  4FVM A;  4LRF A;  1JXL A;  1KVI A;  3X3U A;  1Q7L B;  2HZA A;  2CQH A;  2RJZ A;  3EUN A;  3BR8 A;  3MEE B;  3J80 Y;  1C1C B;  3MMC A;  3CD0 A;  2XS2 A;  2VF3 A;  2Z2Y B;  4J9U E;  4KKO B;  1TZ0 A;  3W9H A;  4G3I A;  4MMO A;  4PXD A;  4L74 A;  3NNC A;  2V50 A;  2F4F A;  1ZS6 A;  3QQC D;  3EE3 A;  3MMC B;  4ANE A;  2WAQ D;  2W2M P;  2OMO A;  1TL3 A;  2VB6 A;  4ANC A;  5DDQ C;  3E8O A;  1B7F A;  1Q1K A;  2C2M B;  4NOH A;  4LSN A;  2DTJ A;  3PRV A;  3K8V A;  4A8S A;  1RSC A;  4NEY A;  1NCL A;  1TL3 B;  3FMW A;  1NK5 A;  3IFE A;  2UXD J;  3OD2 A;  1CQN A;  4AFF A;  4NLT A;  2FHM A;  3HFV A;  4I2Q A;  5KFQ A;  5G0R A;  2R8G A;  2JX2 A;  1WF0 A;  3EZU A;  1FFG B;  1HD0 A;  4KR0 B;  3TAQ A;  2DR7 A;  3NAI A;  5LOQ A;  4ED6 A;  2GHP A;  1WEZ A;  1RWO B;  2CAD A;  4ID8 A;  1KDN A;  4LRB A;  4I2Q B;  1VLO A;  4Z2X A;  3EMT A;  2EBG A;  2J9D A;  2XYH B;  1IWG A;  3V81 A;  3OTO F;  3VGT A;  4U7U D;  4FXW A;  4M5K A;  2IVY A;  1ARO P;  3TWZ A;  3FGV A;  4PR6 A;  3TZZ A;  1MWY A;  2DJW A;  3RAX A;  2C3O A;  1WOR A;  2XCP A;  3RBE A;  2GX8 A;  2VQF F;  3IWX A;  3PIP Q;  3V81 B;  1CC7 A;  3PJX A;  3ELH A;  4LR8 A;  4KGX B;  4TXS A;  1O5J A;  2KHC A;  3GJT B;  1P8G A;  2PE8 A;  2W2Q P;  3OFG A;  4KQZ A;  1O51 A;  4I67 A;  3D3B J;  4C8M A;  1WG5 A;  3OV7 A;  3MM8 A;  3WHI A;  3P8B B;  1T9U A;  2H48 B;  3ZXW A;  3Q2S C;  2BJ9 A;  4ECS A;  3AOD A;  3M4X A;  2B8Q A;  3ZZT A;  2FQQ B;  4YY3 J;  4DG1 B;  3D1O A;  2LFV A;  2E7W A;  1MRO A;  1JJ4 A;  2BVZ A;  3KLG A;  1FNM A;  1ROF A;  3M6W A;  1IR2 A;  1RWX B;  3N28 A;  2FLN A;  2J7U A;  1IKV B;  4F36 A;  1O8B A;  3F56 A;  1GXT A;  3ZTQ A;  4JYA F;  1BC6 A;  5I3U A;  3OVA A;  1MRO B;  1KS2 A;  4ED1 A;  2UV8 A;  3MCM A;  1ZZN A;  1RHU B;  2IA6 A;  1GMU A;  2CZ9 A;  2ZOF A;  4K4X A;  4XIU A;  3GV7 B;  2ZOG A;  1TP7 A;  4DDF A;  1F1B B;  1RT2 B;  2C28 A;  3C2P A;  4NXM F;  5I3U B;  3BGO P;  1B70 B;  2HS3 A;  2KYX A;  3NS5 A;  3DDK A;  1RT6 A;  5K9F A;  1RI7 A;  5HLF B;  3D4J A;  3LPY A;  4NAS A;  3Q89 A;  3EDQ B;  3MPV A;  1U48 A;  3SCJ E;  5KFM A;  3IGV A;  1GAO A;  4FDF A;  1RBL A;  2NZC A;  5HMW A;  2DK2 A;  2J0Q D;  7FD1 A;  2H3E B;  3HO1 A;  3ZZR A;  2IBK A;  2HRT A;  1XQI A;  1HW9 A;  1FD8 A;  1TAU A;  1RK8 A;  3CCT A;  2OPP A;  2VC0 A;  1HAR A;  2ASL A;  3CJ4 A;  3DHW C;  1SQG A;  1UEK A;  3C19 A;  4EI2 A;  4OZN A;  1LXN A;  2H4Y B;  3JSM B;  3LP2 A;  4RNM A;  2WB1 D;  1V3Z A;  1VYA A;  1WC4 A;  4B9N A;  2ACM A;  1TKZ B;  2C2Z B;  5KFA A;  2ZBI A;  1X4B A;  3W61 A;  1J5E J;  5HSP A;  2BQU A;  4DSF A;  3ZC4 A;  1B3T A;  4KJI A;  3LP2 B;  4Q44 A;  3V4I A;  3MWB A;  1QLN A;  1T95 A;  1UJ4 A;  3OTO J;  2ZBQ A;  3NMA A;  2O66 A;  2GW8 A;  4BC7 A;  1ZPV A;  5E3P A;  5KG0 A;  2QFJ A;  3G87 A;  4NML A;  2XLK A;  3BEG B;  2CDQ A;  3UDC A;  3V4I B;  4KT0 C;  2UVW A;  1K73 T;  1VS3 A;  2VQF J;  2W01 A;  1WDD A;  3MAA A;  3R7N B;  4MYT A;  3MHY A;  4I6Y A;  4HKQ A;  3KJQ B;  1RAF B;  5D0H A;  3C6T A;  1YRU A;  2HGL A;  1KNZ A;  4Z37 A;  5D15 A;  2CPY A;  2E9Z A;  4Z7C A;  4EYH B;  4OLP A;  3MAA B;  1RA6 A;  4Y2I A;  3ZTO A;  4LF7 J;  5DRK A;  1V6H A;  3NS7 B;  2R2S A;  3C6T B;  5HL7 Q;  4K4U A;  5H9E K;  5KFX A;  4IFY A;  3L09 A;  2H65 B;  3PVX A;  2JDJ A;  2LDI A;  1EQ0 A;  5L39 A;  3D3C J;  1OY9 A;  4K8R A;  2B9E A;  5BR8 J;  3MM7 A;  5AJ3 F;  5EX0 A;  2FZC B;  3MR5 A;  4BS2 A;  5KT4 A;  1HBM B;  5HO4 A;  4G1P A;  3ZNJ 1;  3IP0 A;  1YZ7 A;  3AA9 A;  2AJ0 A;  1S79 A;  4IFY B;  1BY9 A;  2AHO B;  1ZYQ A;  1NJI T;  3JYT A;  1PJ7 A;  2D3O 1;  4DWI A;  2XGP A;  1RHR B;  4LR9 A;  1UFW A;  3AOC A;  3NRB A;  5T7L A;  3TVZ A;  4YQW A;  2XLJ A;  5DM7 Q;  3TUI C;  2MZT A;  3O8W A;  1I5O B;  1SL1 A;  3IGN A;  2HKE A;  2ZFH A;  3CCJ S;  4X4O A;  3I9Z A;  1L3U A;  3JYT B;  2JC1 A;  3V6H A;  3OFF A;  1YHQ S;  3NCQ A;  5T7L B;  4PG7 A;  4JV2 A;  3BGF A;  2PMZ D;  2VFV A;  2B9W A;  1NJW A;  3LA0 A;  4MKB A;  3R7S B;  4KHM A;  3AB2 B;  4Q0B A;  3CDW A;  1KVK A;  1KSP A;  1X0P A;  3GLJ A;  4P9S A;  3WBZ A;  2HBZ B;  2W7A A;  3SQG A;  4YME A;  5KG7 A;  5GMD A;  3R1L A;  3W3S A;  1UPP A;  4JBC A;  4ZVP B;  2OKQ A;  4QWB A;  1S9G A;  4IQX A;  4FBT A;  2AF6 A;  2AGO A;  4HLB A;  3CJT A;  1UVI A;  2IDL A;  2HLT A;  3SQG B;  4O44 A;  4OZ5 A;  4WII A;  5KFR A;  3GIJ A;  4IDK A;  4C8Z A;  4RW4 B;  1AYE A;  1W2I A;  2H5J B;  4C3K A;  2E5J A;  2WSC C;  3BYP A;  3I56 S;  3P4U B;  1SL0 A;  4CLK A;  2FJX A;  4O44 B;  4E2F B;  4NMX A;  3VAF A;  4IDK B;  4Y2A A;  1JX4 A;  3VAL A;  4B3M F;  1FVQ A;  3QGP A;  4C0O C;  1K8A T;  3UD5 A;  2UXB F;  1N32 F;  5KTQ A;  2MZ1 A;  3TAM A;  3RW6 A;  2AX0 A;  3VCD A;  3O1L A;  2Z30 B;  5D3G A;  4FVC A;  4Y2K A;  4DUY F;  1BXN A;  3F41 A;  2O3D A;  1RYS A;  1GK8 A;  3CED A;  2FY1 A;  1Y10 A;  4B9S A;  2DY1 A;  3DC2 A;  5DJB A;  4DR2 J;  3TAM B;  2HSE B;  3HVT A;  2MKH A;  4CO2 A;  3MED A;  3BGL A;  3AXK A;  2FJB B;  1JLA A;  1JIH A;  1KRP A;  1R8B A;  3AD9 C;  4DR4 J;  3AQP A;  2BXJ A;  2EK1 A;  2HQI A;  2ASJ A;  3HVT B;  3H0P A;  3ZZ0 A;  2W25 A;  4LF9 J;  4DV5 J;  1P9Q C;  3MED B;  5J2M B;  5ETT A;  2C2K B;  1Q7Y T;  1AB8 A;  4DUT A;  4R0J A;  2DRA A;  2I6W A;  3DU6 A;  1YJU A;  1JLA B;  3CF5 Q;  4ZPT R;  4FF4 A;  1JK9 B;  4J9L A;  1TKX A;  2HNY B;  5KOX A;  4FPR A;  5AXM A;  1WKL A;  4WP3 A;  2ZE2 A;  1RT1 B;  4KY3 A;  4WF9 Q;  3H2L A;  4AT1 B;  4ID5 B;  3QIP A;  5IM0 A;  4EBE A;  3J81 Y;  4X4N A;  4C11 A;  1RWU A;  1X5T A;  4KHP F;  1S9F A;  1NUE A;  3MCN A;  1TKX B;  4CO3 A;  2J7K A;  1EKR A;  2IC3 A;  5C25 B;  2H54 B;  2ZE2 B;  1EHW A;  4F7V A;  4FPI A;  3QIP B;  1C2P A;  5IM0 B;  4C11 B;  1TKT A;  3LF0 A;  3ISN D;  5DG9 A;  4O0I A;  4CNZ A;  3FNN A;  1CG2 A;  2F1F A;  4RU9 A;  5GAH I;  1KLM A;  4A46 A;  4M5M A;  2MHE A;  4B9U A;  3KMQ A;  3W8P A;  1SVD A;  4OFZ A;  1TKT B;  3QRP A;  2JL9 A;  1HNW J; 
#chains in the Genus database with same CATH homology
 5IC6 B;  3P4U B;  1RE1 B;  3KJQ B;  2FQQ B;  3R6L B;  1IBC B;  2C2K B;  2Y1L B;  1QTN B;  1GFW B;  4ZVR B;  2H4W B;  2H5I B;  1PAU B;  1SC1 B;  2HBQ B;  1RWX B;  1BMQ B;  2DKO B;  1RWN B;  3R7B B;  4LSZ B;  3EDR B;  2H51 B;  2QLB B;  3R6G B;  2QLF B;  3D6M B;  2XYG B;  2H4Y B;  2CDR B;  3SIP B;  5K20 B;  1RWM B;  3NS7 B;  1I51 B;  3R7S B;  4DCJ B;  1RWV B;  2P2C B;  3GJS B;  2QL7 B;  2Y0B B;  1RWO B;  2CNN B;  2CJX B;  1RHJ B;  2C1E B;  1RHK B;  1RHQ B;  4DCO B;  1RHU B;  2H65 B;  2CNK B;  2C2Z B;  2XZD B;  1F9E B;  2XYH B;  3IBF B;  4ZVU B;  2HBZ B;  1RHM B;  2C2O B;  2H54 B;  3P45 B;  1ICE B;  1SC3 B;  4ZVT B;  2XZT B;  4ZVP B;  3QNW B;  2CJY B;  4ZVO B;  1SC4 B;  4ZVQ B;  3KJN B;  2CNL B;  1NME B;  2QLJ B;  1RWP B;  3KJF B;  2QL5 B;  3D6H B;  4JB8 B;  5IC4 B;  1RHR B;  1I3O B;  2CNO B;  1RWK B;  3GJR B;  3EDQ B;  3D6F B;  4ZVS B;  3GJT B;  2HBR B;  2C2M B;  3R5J B;  1RWW B;  3RJM B;  2H5J B;  2QL9 B;  2XYP B;  1QDU B;  2HBY B;  3IBC B;  2H48 B;  1PYO B;  4DCP B;  3GJQ B;  3R7N B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...