2MZSA

Nmr structure of the rrm2 domain of hrb1
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
99
structure length
99
Chain Sequence
GSEVIVKNLPASVNWQALKDIFKECGNVAHADVELDGDGVSTGSGTVSFYDIKDLHRAIEKYNGYSIEGNVLDVKSKESVHNHSDGDDVDIPMDDSPVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Gbp2 interacts with THO/TREX through a novel type of RRM domain.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
molecule keywords Protein HRB1
total genus 15
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2015-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2mzsA00
4CH0S 4PR6A 1SJ3P 3NNCA 1YITS 2DO4A 3UWTA 2CQIA 2KVIA 3FEXB 2LA4A 1U6BA 2RU3A 1QVFR 3SMZA 2MMYA 2CQ0A 2D9OA 4OZ1A 3LQVA 3PIOQ 2KN4A 2MZRA 1PO6A 2M0GB 1N8RT 2DIVA 2DGTA 2XNQA 5GADU 4YB1P 2MSSA 2QEXS 1VC6A 4QPTA 1M90T 2ZJQQ 2CQHA 2KYXA 5IM0A 1B7FA 1FJCA 2J76E 2EVZA 3UD3P 2HZCA 5LSOA 2DNLA 2FY1A 3S6EA 2DHGA 4PKDB 5LXRA 4UY8T 3NS5A 2MQOA 1URNA 4WKRA 3CCMS 2CPFA 5MLCV 2AYGA 2CPZA 5LSLA 4IOAQ 2E5IA 1VQPS 2CPHA 4CIOA 1WG4A 3CCSS 2U1AA 1YHQS 3DLLQ 2L9WA 3MXHP 2MZQA 2KG1A 3D2WA 4OZ0A 1X5OA 1VQ7S 4YUDA 2JWNA 1JJHA 1VQ4S 3I56S 3VAMA 1U1MA 2M2BA 2MZTA 1NJIT 2DITA 4EGLA 1X0FA 2FC9A 2DHSA 1WEXA 3P49B 1K73T 3CCRS 2G1DA 3U1MA 4F26A 5GAHU 2MZSA 4ED5A 3VAJA 3VAKA 4TLQA 2LKZA 1FO1A 1Q81T 3NMRA 3RW7A 4IO9Q 1WF0A 3IWNC 2CQBA 2XS2A 2DNYA 3CTRA 3VAFA 1L3KA 5ITHA 3G6ES 2KXNB 4WIIA 3JB9k 2MGZB 1VBXA 4TU9A 2CQ1A 2NLWA 3CCUS 3CMES 2JRSA 2MB0B 4FXWA 2CQ3A 4IOCQ 3BO4A 1HD0A 1CVJA 1U1PA 3BO2A 2CPJA 1WELA 3B4DA 1NU4A 1S79A 5DETA 1D9AA 2D9PA 2MJNA 2KG0A 2CPXA 3VAHA 1VQ9S 1H2VZ 2LCWA 2LXUA 5DDPC 3MURP 4LIRA 3ZZYA 1WG1A 2X1AA 3SDEA 3EX7B 3CULA 3Q2TC 1SJ4P 2HGMA 2MJUA 2RS2A 2E5HA 4YOEA 3VAIA 2QFJA 1K8AT 2O3DA 5GAGU 1WG5A 1WF1A 4BS2A 2LYVA 1XN9A 2YH0A 2DNGA 1PGZA 3LPYA 2XSFA 4F25A 2HGLA 2OSRA 2DNNA 1JMTA 3V4MA 5CA5A 2VONA 2DNHA 2FPHX 2DB1A 2L08A 3H2UB 4WCEQ 1WHVA 2Q79A 2UP1A 1U1RA 1VQNS 3N9UC 4FXVA 1U1KA 1SXLA 4WF9Q 2MHNA 4LJMA 3J7ZT 5GVQA 2G0CA 2M7SA 1HA1A 1WWHA 2KRBA 5LJ3Y 3BEGB 1K9MT 2DIUA 1FJ7A 4QU7A 1HL6A 3CC2S 2J8AA 3CCQS 3K0JA 2DH8A 2JVOA 1X4DA 4WFBQ 2MKJA 2K3KA 3CCJS 2GHPA 3G8SA 1X4CA 2YKAA 1WI8A 2MSTA 3RW6A 2L41A 4PRFA 1YJNS 1X4AA 2XS7A 3G4SS 1VC0A 2MQQA 3P6YC 1M5OC 3THPA 1X4HA 2MKKA 2RQCA 2BZ2A 2DGQA 1VQ8S 1KOOA 1ZZFA 1OWXA 2ZJRQ 3CUNA 1SJRA 2MY7A 2X1GA 1JJ4A 3G9CA 4UQTA 1BY9A 4RU2A 2AYMA 5HL7Q 5LXYA 1WHWA 1X5TA 3CCLS 2J0QD 2KI2A 5DM6Q 2DGVA 2DGWA 3J7YU 1FHTA 2GO9A 4C7QA 2N7CA 1A9NB 2LEBA 1WHYA 2M4MA 3HHNB 2QA4S 3S8SA 2RRBA 3UD4P 2SXLA 3ULHA 2DNOA 2EK1A 4CQ1A 1M5KC 2MQLA 1X4EA 1VQMS 1NO8A 2CPEA 2KFYA 3US5A 1WF2A 2N3LA 3UCGA 2AYEA 1AUDA 3I55S 5EN1A 2I38A 2M8HA 4ZKAA 2MKCA 2CPYA 2DNKA 3MDFA 2YH1A 2U2FA 2MXYA 2DHAA 5IFMA 3S7RA 2LECA 5IM0B 2YTCA 2RUGA 1O0PA 2M52A 2LQ5A 3BO3A 1OIAA 2CQDA 2FC8A 1VQKS 1WEZA 1FXLA 1YJWS 3HI9A 2DH9A 1Q82T 3P3DA 4C0OC 2PEHA 3MD3A 4W90B 3CD6S 3CC4S 2DNZA 4M5DB 1QM9A 1VBYA 2OTLS 1N88A 2CQPA 1UP1A 1H2TZ 1F9FA 3THTA 3L3CA 3MUVP 2KRRA 1YJ9S 2MZJA 2DNMA 2CQCA 5D77A 3EGNA 3UE2A 1R8PA 1WEYA 4QQBA 2XB2D 3R27A 5DM7Q 2CJKA 1U6FA 5CXTA 3MI7X 2B0GA 2KM8B 1UAWA 2ERRA 2X1BA 2RS8A 2MYFA 1N52B 2G4BA 2DH7A 2MZ1A 2XNRA 4C4WA 2YWKA 1VQ6S 1P27B 1ZZNA 3EGZA 3B4MA 4Y00A 2KM8C 2X1FA 2OTJS 4LMZA 2BOPA 2OJ3A 4A8XA 5HO4A 1VQLS 2LXIA 2MY8A 2VOPA 1FNXH 2ADCA 1KQSR 1Q7YT 3CF5Q 5JVGQ 1X5SA 2JX2A 2K8GA 3CCVS 1VC5A 2DNQA 1OPIA 2CQGA 1ZH5A 3VALA 3BS9A 2RRAA 2I2YA 4F02A 1RKJA 2PE8A 5D78A 2DGSA 1M1KT 3Q2SC 1JJ2R 3NS6A 2M8DB 2DNPA 2CPIA 2N82B 3FEYB 2F9JA 1DZ5A 3CCES 4W92B 1U1NA 2RT3A 1D8ZA 2M70A 2HVZA 1RK8A 5DDQC 3MUMP 2CQ2A 2DGOA 3CMAS 2XS5A 3MD1A 2RVJA 1FT8A 2JVRA 3U1LA 1FJEB 2WBRA 3P5TL 1U1OA 4P6QA 1P1TA 4TU7A 1H2UX 3TO8A 2AD9A 3CC7S 2DO0A 2KHCA 2MKSA 2A3JA 3ZZZA 3PIPQ 1M5PC 2LEAA 2M88A 1QVGR 1SJFA 2KXHA 2MQNA 2HGNA 2HYIB 5FJ4A 2AYBA 3VAGA 5GAEU 4ERDA 5BJRA 2OIHA 1UFWA 3R1HA 5LJ5Y 4WFNQ 1YTYA 2CQ4A 1YI2S 1UW4A 2CPDA 2MPUA 1WI6A 3NNHA 3G71S 2E5GA 4WFAQ 3S01A 2NZ4A 4TU8A 5H1SV 4U67Q 3NNAA 4Y0FA 2VODA 5DDOC 2DGUA 2RNEA 2MKIA 2MGZA 1A7GE 3G8TA 3G96A 3OW2R 1R8HA 5JVHQ 1U2FA 1SJQA 1VBZA 1N54B 3UCUP 1M5VC 2VOOA 4QU6A 4Z2XA 1VQOS 2RQ4A 1G2EA 2DK2A 4CH1A 2E5JA 2LMIA 1DRZA 3MOJB 3IRWP 1DHMA 2MQMA 3TYTA 1H6KX 3DXBA 2F9DA 5CYJA 2ADBA 5IQQA 2LA6A 1X4BA 2DHXA 2N3OA 3CXCR 3UCZP 1X4FA 1WHXA 5DDRC 2J0SD 1IQTA 1HD1A 3CPWR 1X5PA 2F3JA 1YWXA 2KU7A 2ZJPQ 4IUFA 2D3OR 2MKHA 3TP2A 5GMKa 1U1QA 2FHOB 2E44A 1DBDA 1OO0B 2KT5A 3R1LA 1KC8T 3SDEB 1VQ5S 1W2BR 2KH9A 3VF0B 2EK6A 1Q86T 3H2VE 2V94A 2DISA 2MQPA 4J5OA 2M9KA 1KOHA 1WTBA 1X4GA 1YIJS 2DGXA 3SXLA 1U1LA 1KD1T 1S72S 2OSQA 3MUTP 2KXFA 4V19X 2DNRA
chains in the Genus database with same CATH superfamily
4CP5A 3L7PA 4PR6A 3DGVA 3FQKA 4ES2A 2UU9F 4KTQA 2IYGA 4PAAA 2OPPB 3R6LB 4Q5VA 1CJKB 4AQYF 2DPJA 3DLJA 4PYAA 5JXSA 3W2VA 4ZMMA 4DUZF 2KVIA 4DU8A 1CULB 4YB5A 3A3PB 5FLXU 1NUEA 2VIHA 4EBCA 4JV1A 1RZMA 1AYEA 3E3XA 4LBPA 1RWPB 1NRKA 2BKNA 2B56A 3N4WA 2CQ0A 2D9OA 3LANA 2ZKTA 1UEKA 2FHJD 2H5EA 3V81B 4Q44A 2CWXA 2VU5A 1O51A 3TAMA 1O6XA 4OHZA 3RB0A 3IS9A 2M0GB 3RBDA 3M30B 3IGVA 1LWFB 4K2XA 2EW9A 2J7KA 1FXDA 3MEKA 4CO0A 5KOXA 2E1CA 1ITPA 3NP5A 1VCTA 1S5ZA 2R7TA 1JLFA 4WK1A 3TZWA 3CIZA 2KVQE 2CDQA 1UW9A 3PVXA 3QRRA 4QPTA 2CQHA 1DTQA 1Y4ZB 1HWIA 1N5SA 2BANA 1CQMA 2LU1A 3D3BJ 3NY0A 4K2JA 4KHMA 5BYRA 3SSQA 3T9NA 1I94J 4UUWA 2EVZA 3DOKA 4YS2A 3NOGA 4LF4F 2XMUA 5KFHA 1SIZA 2B8PA 2BUNA 2EFQA 2WONB 4J90A 2DNLA 2PSZA 3HHLD 2HQGA 1YJRA 3B82A 4NL5A 3GILA 3FC9A 4CCHA 5AE1A 4J9KA 3VVTA 2NXNA 2XLJA 4LVNP 2W7PA 3I0RB 4L75A 3HM9A 3CDWA 4ZJOA 1GXLA 1PYTA 4BC7A 2ALZA 3FCWA 2GVZB 2RILA 3M2UA 5KFQA 4IRKA 2CRLA 3F0NA 1KR4A 4KY3A 3ELHA 2YPZA 2HVDA 2YWWA 4OI0A 1S6PA 4FPIA 4J9OA 2VFVA 2VQFJ 3UN2A 5A8WB 5JUMA 1T0TV 5A6WA 3AB4B 1XR7A 4DV2F 1F60B 2JC0A 4JI8J 3J80Y 4OZLA 4F67A 1NH7A 1T11A 2AHOB 2GW8A 3BBCA 3HSDA 4YDDB 4B3SF 4B3TF 1YHQS 5F0UA 1Y3KA 3DLLQ 2F8EX 5KOWA 3KJQB 4DPUA 2GVDA 3D2WA 4DLGA 1PAUB 1C1CB 3KUEA 3V4IA 1SKRA 1RT5B 1VQ4S 1PKUA 5LMNF 1Q78A 3KJNB 2DT9A 2ASLA 1NJIT 4RW7B 2EBGA 5ETTA 3HULA 2DITA 4YFUA 1BLUA 5CCMA 1N5YA 4WXWA 4KKOB 1T03A 4ZN1A 1F0XA 3AT1B 4KV8A 4MKVA 4DV1J 2G1DA 4OLPA 3KUGA 2J5AA 4P74A 4OYZA 1T3NA 3QGIA 5HP1A 2MZSA 3RR8A 4ED5A 1P9YA 1QTNB 2B7CB 2E9TA 4C8ZA 3M8PB 2LVWA 4JOUA 4TLQA 4JI6F 2R7XA 1FO1A 1HBMA 1RP5A 3D66A 1Q81T 3C15B 3MMAB 1RADB 2H65B 3TX0A 1MWZA 4IO9Q 4F2SA 4X62F 1C0UB 4FVMA 3IWNC 4HEA9 4U8YA 2CQBA 5EX3A 5D6GA 1HNXF 2NR0A 5K8PA 3CTRA 1SQEA 2B5JB 3DI6B 3GSDA 1PBAA 3UDVA 4X64J 2RDIA 2MLXA 3Q22A 4R8UB 2MGZB 4G3IA 4F36A 2G13A 3DM2B 2AJ1A 2QYGA 3FKBA 2NLWA 3UDLA 3KNAA 2HVHA 2D69A 2VA3A 3BYPA 6FD1A 1FTCA 3CMES 3RW6A 3JSYA 1JLBB 4NPOA 2CQ3A 5AT1B 5F8IA 4IOCQ 1T02A 3IC1A 4NE9C 3CWJA 4ZPVR 2M3DA 4U9RA 1HD0A 1CVJA 4RW9B 2MKYA 4BLGA 1LKZA 1RB0A 2GQ2A 2RRNA 1T7PA 2XWYA 4ED4A 4YQWA 5I42A 1SB6A 1RWOB 3MECB 4MH8A 1D9AA 2A2CA 2D9PA 3LW5C 2WBMA 4X4PA 1XERA 2MJNA 1SI9A 3DOLA 5B0AA 2KG0A 4A47A 4QIVA 4DCPB 2JC1A 2YX7A 2UV8G 1TL1B 3R3TA 4I6YA 1FEEA 4CM2A 3OJSA 3EWGA 1H2VZ 2GJ2A 2LCWA 3BSOA 3N6LA 4LF7F 1N0VC 4NWBA 1WC6A 2IBKA 1FNOA 3W9JA 3C46A 3SDEA 1QSSA 1KLMA 2ROGA 3EX7B 1SJ4P 2VA2A 2HMIA 2HGMA 5M2PA 1NSKL 2WVDA 2VJUA 3D3CJ 2E5HA 2EFVA 3QLHB 1E6VB 2ZFHA 4QWEA 2JEJA 3EGVA 2ZD1A 3MEDB 4DSKA 2J9EA 3PHEA 3OQ2A 5DO2A 2ZH8A 1K8AT 2CJBA 5GAGU 1E6YB 1VR6A 2LYVA 1AT1B 3A12A 4OYOA 1RHRB 2DNGA 4G65A 4R25A 2CG8A 1PGZA 5KFUA 1KHWA 3NEKA 5CHCB 3KNGA 2EFGA 1OQ6A 1Y9OA 2RDDA 3W60A 1VS3A 3MFHA 4F25A 2ZH5A 4J9PA 4B02A 4LF5J 3MMCB 4KHRA 5K8MA 5L39A 2JFDA 5CA5A 4O4GB 2BM0A 4PG4A 3KDNA 3CT9A 4OI4A 4P72A 1YDLA 3DOLB 1ZYQA 3PW0A 5HQ8A 2EPIA 1C1BA 2XTJP 3R5JB 3ZTOA 1T9VA 3H90A 3HT3A 5JJBA 3PJ9A 3IA0A 2OO4A 3RAMA 4WF9Q 4CTAA 1TFWA 4I67A 2WSEC 3KYLA 4IQMA 1U45A 3Q23A 4CO3A 3EZUA 4CRJA 3SIPB 4MIAA 2OPQB 3WIVA 5LJ3Y 4K0KF 2DVIA 2UXBF 1NH8A 3ENAA 5J1EB 2WOMA 1IR0A 4I6WA 1K9MT 3IMQJ 4DV3F 2ZOGA 3ZO7A 1Q0NA 1YVFA 4QU7A 4FVCA 4NLSA 2ZBQA 1LOUA 4WKYA 1FX2A 1HR0F 3PFOA 4PXEA 5B0FA 2RH3A 3AY0A 3BKUA 3EVMA 5C25A 2UUTA 2AJFE 4P2FA 5D0HA 1DTQB 4WFBQ 2FB0A 3BSCA 1C0UA 2PA3A 2MKJA 4QIEA 3KJVB 2XLIA 3CCJS 4KHPF 2HHTA 4TU7A 1WOSA 2JZ5A 1HBMB 4X66F 1ZTTA 4DZDA 2WRMA 3QFHA 2DRBA 4JI6J 1R6YA 3BPDA 4LFCF 5HP1B 5IQ6A 5DJBA 5ETMA 4DR5F 1C1BB 1X4AA 3GFZA 4FP9A 3SCLE 2MQQA 1P9QC 3HHLC 3G4SS 3P6YC 3K0JA 1UMJA 1LXJA 3CE8A 4EWTA 3BF4A 4E8UA 2MKKA 2BZ2A 1GMVA 2DGQA 1F9HA 4KFBB 4M1KA 3TUJC 5I3UA 4K4ZA 4YP3A 3U02A 1VHFA 2MY7A 3EGWB 5CH7B 3PYDA 2QSFA 4QWCA 3V4IB 3WC2A 3FGVA 2O5DA 1KTVA 2HHWA 2NCKL 2ZE2B 1F1BB 3CEDA 7FD1A 2FHKA 2GAGC 2ZWPA 3WX4A 1VQYA 4ZHRA 3IXQA 1C4AA 1FRIA 1U1OA 5G4DA 1FF2A 2CNOB 4C6AA 2KI2A 4C8OA 2K7JA 3I0SA 3J7YU 3EPIA 1V3RA 3BGRA 4DHVA 1RT7A 4P10A 4ED2A 1NXIA 4Q43A 3W2WB 4K5RA 4X4NA 3KDOA 1VK8A 2M4MA 1FXRA 3T5HA 3CDUA 4NLDA 3H5YA 1FCAA 1UVKA 2ZVIA 3DLGB 3SCIE 1F5AA 3TWZA 2VICA 3I87A 2Z2YB 2BYCA 1PIEA 2SXLA 4M95A 4OX8A 1M5KC 2D41A 1EX8A 1S4FA 4ZCMA 3I0RA 2FJEB 3HPOA 1VQMS 1HYSB 1FRJA 1IM6A 3KLVA 3PG9A 3JAMY 2N3LA 3NGDA 4W98A 3R5GA 3UCGA 5KG1A 4NCAA 3KLEA 4UOHA 5KFTA 1AUDA 4GKJF 4NCGA 5EN1A 1FWPA 2H51B 3OFFA 3RAXA 2CPYA 2DNKA 4C0BA 1NJZA 1FRLA 4QIWD 1RWXB 3GE9A 4BHQA 5IFMA 1Y11A 1QSLA 1Z2ZA 2YTCA 4F4KA 3T1YJ 1O0PA 5KFZA 2M52A 2GC8A 2GZOA 5HN0A 5E3RA 2OH2A 1NKCA 1FRKA 2BRKA 1VQSA 4ZVQB 1OIAA 2ZITA 2PFFB 2EWHA 1VQKS 3CVKA 3VZHA 3TOQA 2YPYA 2FY8A 2J9DE 2DH9A 3GB0A 2PEHA 1SL1A 1JLEA 1P1LA 2HRTA 4LF5F 4Q2MA 2XC9A 2HBQB 1RAOA 4X4TA 3QT6A 4JP8A 4DX5A 2R2UA 1S0VA 1NLKL 1VBYA 4HKQA 1S9GB 2YY3A 1PG5B 3T5LA 2B4UA 1CJVB 3AA8A 3Q0AA 1N88A 3GJQB 2EG2A 2AGPA 1U6ZA 1U8WA 5K5MA 4NLOA 3QRQA 3L3CA 5EX0A 1LW2B 2RMLA 2ZDPA 3DOMB 4OV6A 3JYTB 2RIJA 4LVOP 4MIBA 1YLXA 2Q3PA 2AKWB 3MMAA 2DNMA 1N34J 1XK8A 2NXCA 5D77A 1N32J 2V9KA 3D0HE 3EGNA 1R8PA 4KRWA 3NBPA 1CSJA 2XMMA 3R27A 4LSLA 4C0HA 2R9LA 1OY6A 3SYZA 1L5UA 1IBKJ 2VZ9A 4KGXB 1LNQA 3E01A 1UAWA 3FSYA 2X1BA 2KM8B 4O3PA 2IY5B 1S1TB 2CADA 4NCBA 3K8WA 1N52B 3ILJA 3W1YC 3W66A 4CI0B 1N5YB 4BWMA 3NL0A 2FHMA 2C2EA 2FVRA 1CULA 1LFPA 2Y1LB 2KM8C 2BQUA 4DMZA 4F04B 4ZIWA 3KK3A 4A8XA 2HQIA 3K57A 1VQLS 2LXIA 2IM0A 2MY8A 4Q0BA 3CIMA 4USKA 3NAIA 4CYUB 1RCOB 4NLVA 1Q7YT 4ANCA 4ETXA 2HLTA 3FDSA 4ILMA 2VFTA 1Q53A 3NWRA 2JX2A 3R2CJ 2F8HA 3AJ1A 3MM5A 5C42B 3M6XA 1FDDA 2OD6A 4OI1A 2C3YA 4NLQA 4DR1J 1PC4A 4DF8A 4LRBA 3VALA 4IFVB 3K5NA 2H48B 1AFJA 3KMQA 4LRAA 2P9CA 4E2FB 1RKJA 1T9XA 4YN3B 3BN4A 2AJQA 2ZH6A 3BB5A 4HR2A 1M1KT 4X4UA 4ZP7A 5E5NA 1WSRA 2CPIA 3HX9A 2JHEA 4N47A 3H25A 1Q8BA 3T19A 1S7HA 2K06A 2B9XA 3H8YA 3M6VA 2RKIB 3H42A 1LWCA 3LGNA 5LOQA 2J9CA 2XMWA 2M70A 3OJUA 1N56A 1RK8A 4CYUA 2CQ2A 5KG7A 1JXLA 2QLJB 4NOHA 2DCUB 2LQ9A 5KG0A 2XS5A 4X84A 5GAGI 3AODA 1PYOB 2JVRA 3U1LA 5DQHA 1N34F 1FJEB 2ABYA 2QLBB 5HBMB 2FZGB 4QOTA 2PO4A 3BQ1A 2FLNA 2V2ZA 2WZ1A 2APOA 4GRSA 4USWA 1RUSA 1P1TA 4O0NA 3LPEA 1RBAA 1U0HB 3M05A 1Y5IB 4PPZA 2C2MB 3TO8A 3CDBA 1FEHA 2DO0A 3IS9B 3ZZZA 3CC7S 2IAJB 4DV2J 2OP5A 2OEJA 5A8RB 4JI8F 4F0KA 2QMUB 2MQNA 2HFOA 3ZZRA 5C5JA 1SJFA 4F3OA 2EC0A 5FJ4A 3KLFB 1ULRA 2AYBA 2X51A 2FDNA 4ERDA 1H98A 1S4EA 2Z0GA 2B9WA 4PG7A 3KJVA 3JYTA 1LW2A 4RW4B 1QAJA 5KFOA 1LW0A 1RBLA 4TXSA 4WFNQ 1VJQA 1GXUA 4RNHA 1TELA 4M8LA 3TJAA 1WDTA 4USHA 4A46A 3H20A 4ED6A 4MYUA 2MPUA 1IUJA 1LWCB 2NXJA 3NNHA 3FZ2A 3T1YF 5IT4A 3MEEA 4NZ7A 3T41A 2W9CB 2CJAA 4ECQA 5H1SV 2VASA 4LF1A 1SL0A 2BKPA 2WOMB 4DX6A 3GYNA 3MF5A 3OR1B 4JI4F 1IKWB 1B4SA 1X0PA 2D1CA 2VFUA 4DL0C 2MKIA 3D28A 3LF0A 3NG8A 1A7GE 2ZOFA 4HTJA 4LSNB 3KKFA 3MPVA 5E3CA 4YHHF 3G8TA 5JVHQ 4ED1A 1C0TB 1GMWA 4RU9A 1U2FA 3H7HB 3I96A 4DV5F 2R42A 1OS5A 5IZHA 2VOOA 1RAIB 1FWKA 4WYWA 4UY85 4PWDB 4ID8A 5HMWA 4AL7A 3TUPA 4HL9A 2DK2A 4NRTA 3CDEA 2E5JA 1G2EA 5D8HB 2LMIA 2V4JB 3D6TB 2EKYA 2XSJB 2LDYA 4XIUA 2JFKA 2UXDJ 3U27A 4DUZJ 3GFXA 3HMJG 3IRWP 1HR0J 4OI6A 1DHMA 3UE2A 1VRUA 2P6TA 4H4KC 2W8LA 2F9DA 2FLLA 4ECYA 1B7YB 2DEJA 2BXJA 4RPFA 3CXCR 3C6UB 1X4FA 5KFVA 3M1VB 3F73A 1GAOA 4ENOA 4QJVA 5E3AA 5M2RA 1IQTA 2YNFA 3GG0A 3HHEA 1YWXA 2BW7A 3OXFA 4IUFA 1WC1A 2MKHA 2VG5B 3TP2A 1RJJA 1UPPA 4RUCA 2CZVC 2VG7A 1M1GA 1E6VA 2QN6B 1SV5B 4DI6A 1U1QA 4B3OB 3FFIA 1HW8A 1KC8T 3ENQA 1NDLA 3HFKA 4QIGA 3PFEA 4ZPAA 4NYOA 3SDEB 2QLXA 2R3VA 3CJ2A 3LAKA 2RHQB 1L3SA 3MMJA 1TKDA 1XR6A 1TL5A 4I69A 4J9QA 1BE4A 4LQ9A 4UW2A 2KFZA 4L76A 2V94A 1NB2A 3PW5A 2BACA 3LOUA 4P73A 3IWXA 1JLEB 3ETOA 3R5BA 4IH5A 5E33A 5HATA 4C11B 1KQGB 4CLYA 1WTBA 3R7BB 3TI0A 1X31C 3LALA 2C2DA 3TJ9A 1Q8KA 3N6MA 1IBLF 2Y0BB 4WTOB 1RAJA 2BMBA 1NPKA 1Y7PA 4RNNA 1UCNA 3MUTP 2PN6A 3MTKA 3MPYA 2W9AA 4CH0S 5B0EA 5C24A 1TZ0A 5LMUF 4CLUA 3NNCA 3H5UA 1WTFA 2YKOA 4RW6A 3SI8A 4IRDA 2QA4G 1D3WA 2HQDA 4ZA1A 3MCSA 1NHVA 3A8KA 1YJUA 4Y2IA 2DO4A 3UN5A 4MKYA 4CLSA 3FEXB 2UXDF 1W7WA 4DN0A 4X4QA 1FFGB 1APSA 2VJVA 4F0HA 4NA3A 2MMYA 4KGKA 3HVRA 2LU2A 4ELTA 1HW9A 4NLXA 4F3QA 3DI6A 4OZ1A 2QMXA 2RJZA 3F41A 1XNRJ 2KN4A 3CJSA 3E51A 3UDCA 1JNZB 3CJRA 4CLFA 4DR4F 2EEYA 1Q4RA 5E7OB 4ECUA 2IM2A 3IAM9 1KTQA 2MQ8A 2PIIA 4N56A 2AGOA 4DWIA 3U1NA 1JB0C 2AU0A 5G0RB 4DR2J 3OFGA 3MM6B 1T95A 1VC6A 4PUOA 1S10A 2IA6A 2OPRB 4ILRA 2HURA 2VC0A 3DLKB 2WVEA 4EZ6A 3AHPA 2AEJA 4DDFA 2NYIA 2J76E 3HHLA 4E98A 1HNXJ 3T3FA 3MTJA 2OFHX 5LSOA 2FY1A 1RT3A 2ZE2A 3S6EA 4AT1B 1B99A 1TV6B 4PKDB 1OSDA 5E0OA 3DN9A 2Y8WA 1ZAWA 2HBRB 3GCWP 4X64F 4PQUB 1NDPA 3QIPA 2CJYB 2GVDB 4YR3A 1WKLA 3NS5A 4WWSA 4N8NA 2BDPA 5IT9U 4C98A 2ATLA 2XI3A 5MLCV 3KK2A 2P2CB 2ZM6F 4PRFA 3TVYA 4WZMA 3GJTB 4LSZB 4NLUA 1RWWB 4ZLPA 2CPZA 4LF6F 2KZZA 1U0SA 2ASDA 2K1RA 2VDHA 4DG1A 4RW8A 4LRFA 1VQPS 4PXCA 2R7WA 1R89A 1WG4A 4P7VA 2MDAA 5ETSA 4ES3A 4K4YA 5EUHA 4U96A 1NK4A 3RB4A 1JWWA 4OZ0A 2VC1A 1S77D 1X5OA 3MR2A 3CD7A 3ISND 3VVUA 4YUDA 2KJVA 5M2UA 1JJHA 3DDIA 1VQ7S 3I56S 3VAMA 4RX6A 2ACYA 3PZPA 1U1MA 3PJWA 4ZS6A 2HAIA 4FYYB 3MR3A 1X0FA 4WZQA 2FC9A 2DHSA 3PM9A 1PBUA 1HFEL 2BR0A 5FD1A 2Q6BA 3U1MA 4F26A 5B0CA 1XNRF 4AYBD 5GAHU 1MMDA 1OMSA 3PR4A 2ZH7A 2HQFA 4O23A 3VQSA 4DQSA 3ICLA 3Q86A 4HI1A 1OYDA 3VCDA 2ACMA 4DPTA 1WC0A 4CLZA 1YX2A 1JLCA 2RB7A 2DYAA 4TLRA 3V5RA 1I5OB 3KK1A 2E29A 5ETVA 1KEKA 5ITHA 4YR2A 3PW2A 2DR7A 3V81A 2IMWP 2Y9HA 1AFIA 3R7SB 1RHMB 3DM2A 1GMUA 1QJHA 4WIIA 5D0EA 2ZNZA 3KWMA 2KXNB 4NYZA 1SIWB 5A8KA 3AJ2A 1NHUA 1UEUA 3HZEA 4I0WA 4F3MA 2VQEF 4M5LA 3MWBA 1RTDB 1G1XA 2GAHC 4G1QA 4FXWA 4Q8FA 2QRRA 3O2IA 1VIOA 3M8ZA 1R7IA 4M5NA 5KFLA 1IBLJ 2I5JB 3HK2A 2J8SA 4HHHA 1SQFA 4N77A 4CZCA 4RW8B 3TANA 1FI4A 1U1PA 1YZ6A 2W1BA 3ZZPA 4R5PA 1MROB 1DLOB 3M9NB 2OPRA 3T9ZA 3AA9A 1S79A 1X9MA 2XZDB 4MK7A 1HKAA 2HLUA 3HSZA 5F9NA 1R0AB 5G0RA 4JI0F 1NK0A 2IA0A 2HMIB 1CEZA 2Z2LA 3BV8A 2VKZG 4PPDA 1RU1A 3CJ5A 4JV0A 4DLEA 1T9YA 2UVRA 1NPRA 5BYQA 2BJ1A 2JLEA 1X9WA 2VG6B 4GO5X 5HQMA 5DDPC 1VRTB 5K14B 4J37A 2HNZA 4USIA 3TZXA 2XGQA 5DLFA 3AJDA 1WG1A 4KR0B 5HVHA 2X1AA 4E0DA 3G87A 3CULA 1QUPA 3QBCA 5SZTA 3CJQA 2XMJA 4AUKA 3W62A 7AT1B 2V4JA 3AQOA 3R8YA 3MECA 4ZN3A 2BQ3A 1S7IA 4OJHA 3MM8B 3NCPA 4NZ0A 3DRPB 3NGKA 1LK5A 4ZVEA 3PO4A 4L72B 4QR2A 1IKYB 3DHWC 3M2VB 3H2LA 1G7CB 4KH1B 4I2QA 3I32A 2YH0A 3OXLA 4XDDA 5C24B 3IR5B 3QAUA 3LPYA 2YKPA 5AXKA 3VGSA 4JI4J 4TVAB 4RZRA 4F50A 4TN2A 5IC6B 2E5LJ 1JLBA 2P9EA 3HVTA 3DRSB 1TVRB 3NWGA 5KFRA 2WB1D 2DNNA 1JMTA 4O3RA 2ZZNA 4RJVA 2RDJA 4DV5J 1XR5A 2GFFA 5CD4H 4DQIA 2YNGB 3CGIA 2FPHX 2FIUA 1JIHA 3DRRB 4ANEA 3RRGA 1RAHB 4PZVA 4IYQA 4P71A 3DOKB 3O1LA 5J1NA 3BGFA 1U1RA 2C42A 1LW0B 4FXVA 3A8IA 3RBXA 5IWAJ 1D1UA 1BWEA 3K89A 1HBNA 1W25A 2MHNA 2O1PA 3ISZA 1KFDA 1NZAA 2ASYA 3CJ4A 1S76D 4B3OA 4FXDA 2HW3A 4AXIA 3LGHA 4NLGA 2M7SA 4JYAF 1OYEA 2IJFA 1F2GA 3ADAC 4LIWA 2KRBA 3MCMA 5LL6d 1LWEA 2RF2B 3EDRB 5HVFA 3BEGB 5C7PA 2DIUA 2YNFB 2J6UA 1FJ7A 2MLYA 2ZHOA 4KV8B 1M1HA 1F9EB 3D0IE 3C6UA 4MKAA 4DV7J 2J8AA 4FKYA 2B4VA 4LR9A 3KLGB 3OTOJ 8AT1B 2LFVA 3KLHA 5H9EK 3PKYA 3L09A 3DGPA 4RNFA 4IR1A 1X4DA 4J91A 3G2XA 5FDLB 1FERA 2ZH3A 4NI2B 4ZLNA 1XJWB 3HSJA 3IRXA 1EAYC 4H4KA 4USMA 3G8SA 4X65J 3TNVA 4K4TA 3HZGA 1IR2A 2IJNA 2MSTA 1VRQC 2VG5A 3I6PA 4WE1A 4DV1F 3TEHB 3DLHA 1Z1ZA 3KXDA 2HHQA 3CJ3A 3JS9A 5F3TA 3IBCB 1EETA 2ZUAA 5KFCA 1VC0A 1M5OC 2IMOA 1KSPA 1KVIA 1WD6A 3B54A 3MCNA 1NSQA 4FYXB 4RUBA 3GJSB 2Q66A 2GVZA 3LP0B 1JXEA 1KOOA 1VRUB 5EWFA 4TQSA 2ZJRQ 1SJRA 1JJ4A 2X1GA 3G9CA 2V8VA 2HFUA 5DS7A 4UQTA 1XNQJ 2KTQA 5T7LB 1Y5NB 3RYLA 4RU2A 1RDRA 5HL7Q 5LXYA 1Y10A 2DR6A 3PR5B 4TYAA 3EICA 2Q6CA 5CZXA 5DM6Q 2DGVA 2HFVA 1TUWA 2V50A 1SL2A 4ZITA 2V6AA 4OZ3A 2BANB 1IKXB 3QZ8A 2FVSA 1A9NB 4MMOA 4YY3J 4QR1A 4OL8A 2F4FA 1V3ZA 2DCLA 2H3EB 1UA1A 4EMDA 1P8GA 2BV3A 2EKNA 3LP0A 4GKKF 3KLFA 4LSNA 3S8SA 1OPZA 2RRBA 1JLAB 1PC5A 3DFEA 1MWQA 4RWWA 3ULHA 2H54B 2ZBIA 4CQ1A 1U2RA 3FSIA 4TQRA 2BOAA 3N5FA 1EP4A 3NXZA 3O44A 1I3OB 3K5MA 1TR0A 1VOMA 1NO8A 1D8YA 1LWEB 4DR2F 1JX4A 1TKXB 3US5A 1NZ8A 2PI5A 2AYEA 3TUZC 4C8NA 1IKVA 1BD6A 1G4CA 4NEYA 2MKCA 1T8EA 1N5QA 3MDFA 4BC9A 1HBOB 1HBNB 1HLWA 2V5HG 3I5CA 2LQ8A 5K20B 5F8NA 3GIIA 2LECA 1C4CA 4DEZA 3KLHB 2X7IA 4EUVA 3K58A 2K7KA 2LQ5A 2OMOA 2IHR1 2VKRA 4WFXA 5LMNJ 1JKHB 2L48A 1RCXB 2VF3A 1HQUB 2R7RA 3TAPA 4C2MA 2W2PP 4K4WA 2D74B 3GONA 4F4YA 4HHJA 5DG7A 2XCAA 2WW8A 3W65A 2MHEA 3WC0A 4O3SA 3HI9A 3HVTB 4LBIA 2PMZD 1QE1A 3P3DA 1MNEA 1FRXA 2XLKA 3QWPA 2BX6A 1HWUA 4ZDNA 2IVMA 4JI1F 4WIQA 2UXCJ 2BKOA 1M5SA 1A0OB 3CC4S 3VGTA 2DNZA 2H1YA 4M5DB 5CYMB 1VBKA 5DRKA 5HJXA 2OTLS 2I0XA 2V8GA 1XNQF 2GMHA 3TA1A 3IR6B 1CG2A 1RI7A 2VH7A 3E8OA 5B08A 3NKYA 4JI3F 1F9FA 1OQ3A 2DXDA 4USJC 3THTA 4DJBA 2UUWA 3BQ0A 3UFCX 5DZ6A 1YJ9S 6FDRA 1ZS6A 2VBXA 4KE5A 3DRRA 3M4XA 4J9SA 3OR2B 2JLFA 3CJKB 2CJQA 1H74A 3GYXB 5LSRA 3W9IA 4WFZA 3EZ5A 1SC1B 1A6LA 1WEYA 2ROEA 2E1AA 2PD1A 2XMVA 3CD5A 4LUBA 2PC6A 4TY9A 4W4MA 3SBMA 3W7BA 1B70B 3SZ2A 1DQ8A 4EO8A 3GCXP 3H0PA 1GQEA 2WCXA 2DXEA 4LF8F 1YGYA 2W2NP 1HNWF 1HNZJ 2RS8A 4OIXA 3PNIA 4OJGA 1S97A 1HMVB 4I4BA 5IT0A 2YWKA 4MFBB 1P27B 2QMWA 1YKWA 4IFYB 4ZVRB 1VQ6S 1RYRA 2X1FA 3L95X 5AXLA 4LMZA 2BOPA 2OJ3A 3FRZA 5CYQB 3M6UA 5KFWA 3MM8A 2AW0A 2BBEA 4QYRA 4C3LA 2VOPA 2ADCA 3I0SB 4DV3J 3I4PA 3PKMA 5JVGQ 3EDQB 2I5JA 4Y65A 3KFWX 2NUHA 2AX1A 3IRXB 2YVSA 3KJFB 3W9HA 5LT5A 2KO1A 2V69A 3P4UB 2BQRA 3A3NB 3HVAA 2BE2A 4GMKA 2QL5B 5AJ3F 1ICEB 3HCXA 2ZWOA 4OYPA 1ZTWA 2DNQA 1CJVA 2DKOB 1EARA 2VD3A 5A2QY 1OPIA 3UVJA 3KLGA 2CQGA 2HSEB 5J1PA 2FJWA 1ZH5A 2F4VF 2ZBCA 1S6UA 1FDNA 1DTTB 3BS9A 4PG5A 3EJMA 5A8KB 5BR8F 3G82B 2RRAA 2BM1A 2E9RX 4ATNA 5J2QA 4QZVB 5E3QA 1RTHA 5KFEA 3Q2SC 4V1Ak 4ZCLA 2G2YA 3NS6A 2XGPA 2M8DB 5HROA 4DSLA 4AL5A 1TK0A 2CNNB 2ILYA 4CLPA 4R5PB 2F9JA 2N82B 3RAQA 3RRHA 3QQCD 1KWMA 1TKTA 1DZ5A 4NXMF 4W92B 1RT1B 1XBWA 4JV2A 4O44B 4WPAA 3I31A 3MPDA 1UFLA 4KB7A 3CMAS 4MTPA 5KFPA 2GNKA 2IC3B 2C2KB 3MOZA 4UOGA 3RBEA 1QAYA 4ITSA 3SQGA 2RVJA 1HWKA 2KZMA 3BSAA 4JB8B 4PEOA 1JLQB 1REVA 1AA1B 1NDKA 3R7NB 1REGX 2X3GA 3LTOA 1RWMB 2AWZA 1YRXA 5K9FA 3S1TA 1PJ7A 1ZAVA 3BBFA 3Q8UA 4GVBA 4P6QA 4UUXA 4DQPA 4M5IA 5B0DA 4JI7F 2E1RA 3FCHA 3M8RA 2JNJA 3T1HJ 3V6DB 2AIRB 4JI2F 1W26A 2GHWA 3PIPQ 4DPWA 4ICLB 3AQPA 4ZPBA 2LEAA 3W5ZA 4LF6J 3LP2B 3D54A 4FZVA 4NX9A 4UQGA 3QJJA 2OTJS 3QGHA 2KXHA 2E7XA 1VMBA 8ATCB 2LQJA 2RE1A 1UFKA 1G6BA 5A76A 4PXDA 1JLGB 3D0GE 5DGBA 1MSWD 1FNMA 4FF2A 3J7A1 2OIHA 1KNZA 1QDUB 4HT7A 3DRPA 5LJ5Y 4NLYA 1YQHA 2N4CA 4JI5F 2NQPA 1YTYA 1ZAXA 2CA9A 1CS4B 1TL3A 3GQCA 2R2SA 1Q16B 1YI2S 4NZ6A 2AZ3A 3D1QA 1UWBB 5KFYA 1J5EF 3FBFA 4OYXA 1WI6A 5HAOA 4CM0A 2XMTA 1HWJA 1RT4B 3G71S 1FRHA 4ALZA 5HMXA 3J81j 2GIRA 3IAS9 3S01A 1MU2B 2NZ4A 4K50A 4DUTA 4K4UA 2C22A 5IOLA 2FGOA 5F3ZA 3AOAA 2VODA 5DDOC 4Q45A 2RNEA 1IQZA 4OHVA 1QUVA 2E7WA 2XG8A 2XULA 4LRCA 1U02A 3G96A 2QFIA 3PRDA 2QG9B 4K8RA 3OW2R 1R0AA 1UETA 2P5VA 3GIRA 4FBTA 1GEHA 4ED8A 1FESA 1N54B 2HNDA 2W2QP 4P52A 3JSMB 4ECWA 1VBZA 4FS1A 1M5VC 4JI1J 3QAEA 4OZ5A 2DPIA 4WU3A 4LFCJ 2UUBF 4DL3A 4CH1A 1XIQA 1DQ9A 3MM6A 4MJKA 1DRZA 4NRUA 2HAFA 1CQNA 2AGQA 4ZJLA 2WB4A 2ZH9A 1CC8A 3FBCA 1TFYA 5F8LA 1URRA 4USTA 4DV7F 1YK9A 1H72C 4C9DA 1N48A 5IQQA 1TL1A 1HWLA 2CJ9A 5IS2A 2N3OA 1ZPWX 1UVNA 2IM3A 5KTQA 1UWBA 2NREA 1WHXA 2AJ2A 1AZSA 4EFAC 5DDRC 3J81U 3BYRA 2V63A 3CPWR 1KVKA 4NA2A 2F3JA 2AZ1A 3DLKA 2AQ4A 4QPXA 3HFVA 5KT7A 1GTHA 2LP4A 1KONA 3OPKA 5GMEA 3DMJB 3WX8A 2EXUA 3BKFA 2UV8A 4Y28C 1UEVA 1HPZA 2EFPA 2XM3A 3M8QA 1DBDA 2KT5A 3HXMA 3R1LA 2LQBA 2A18A 3EXYA 1V3SA 1S9FA 3A13A 2L3MA 3UNYA 2EK6A 3G8QA 5ETOA 2QO3A 4IH6A 5B7WA 3C66A 2RD5C 3CCQS 1AZSB 1YRUA 1X7VA 2W2OP 3FUYA 3LWLA 5HLFA 4N41A 1NSAA 3LP1A 5KFBA 2M9KA 3C6TA 5KG4A 1KOHA 3C19A 4MK8A 2HWHA 2H9ZA 1HIYA 2V68A 4NMLA 5EWEA 2YNIB 2DGXA 3SXLA 1YIJS 1N6QB 1TTHB 1Q8LA 4Y2AA 2OSQA 2KXFA 2OPQA 3UW1A 3H4BA 2FVQA 3VR1A 3NGSA 5DG8A 5HQLA 1U09A 2ZM6J 3DRXA 3KG0A 3ZTQA 3NCRA 1SJ3P 3IM9A 2UUAF 1LWXA 2XY6A 3GG1A 3MFIA 2NZCA 3VWSA 3TAQA 4DG1B 1TKZA 2V8PA 3PX0A 1VYAA 1YITS 1ZETA 4A8KA 4NXNF 3IP0A 4OI2A 1NK8A 2YKNB 3UWTA 2CQIA 2Z4PA 1KFSA 1RTHB 2CIMA 2LA4A 2J7WA 2QT7A 3FK4A 4DPXA 4DZ6A 5FLXY 3SMZA 2RU3A 2HNYA 2PT0A 4QWAA 1T03B 1NB7A 4J9NA 1UWAA 4P9SA 4FF1A 2QX0A 2VFSA 4DCOB 2D3UA 3MMCA 3LQVA 1PO6A 1N8RT 2ATCB 2YXLA 3MPWA 1TV6A 1YJVA 2PGCA 2POKA 4I2PA 2XNQA 1VFJA 8RUCA 4LF4J 4URSA 5H9FJ 1RA7A 4ID5A 4LQ3A 1DARA 1E6YA 3LH2S 3MMBB 3GPAA 3D7SB 3FCVA 1N32F 1M90T 3GV7B 2ZJQQ 2OMLA 2BABA 4A4JA 5IM0A 3HO1A 2B3TB 4RWXA 5A8WA 1TKZB 1B7FA 2VBYA 1FJCA 2YKQA 4IFYA 3UD3P 1U24A 4A48A 5D3GB 3SV3A 4Q8EA 1JLGA 4P2SA 2AV5A 3QT5A 1KLMB 4L73A 3PDNA 4M63A 4U8VA 5J2MB 2DHGA 1SC6A 3H59A 1UTAA 4OYBA 4JI3J 5LXRA 2HHUA 1RKIA 2Z30B 2KL8A 3SFUA 4UY8T 4IR9A 4QYZJ 1XEZA 3OL7A 4QR0A 5KFNA 2MQOA 1LV5A 4O4RA 3OUYA 3CJTA 2PMWA 3BPSP 3ZZTA 2Z58B 5K8NA 4DV4F 2J6SA 2RQMA 4J9VA 3PRVA 4K4XA 3J7YI 2E66A 3RRKA 1S1UA 3H4DA 1ZA1B 5I42B 1UZHA 1FX4A 1BGXT 5LSLA 1J2VA 4IOAQ 4PWDA 3J80U 2VFRA 3BM7A 2E5IA 1QAIA 3QSIA 2JDJA 2VPXB 1F6TA 1S1VB 3IWLA 1C0TA 4CIOA 3M9OB 3THVA 2U1AA 1GK8A 1HPZB 2ZZTA 3AXMA 4NYPA 5KAKA 2L9WA 2OI2A 1TL7A 3M8PA 4LR8A 4YHHJ 4DFPA 2MZQA 2KG1A 5L1KA 1MN7A 2CAJA 4ZP9A 4KQZA 4KBIA 1HHQA 1R43A 2JWNA 2M5YA 2JEGA 4YDXA 2OKQA 1HQEB 2LLZA 3G82A 3KHGA 2OEKA 2KT2A 1WEXA 3A3OB 1JKHA 3C14A 1UZDA 3JQMA 3P49B 3FMBA 2FYXA 4LF9J 1FJGF 4LFBJ 4F8RA 2OLWA 3VAKA 2BE2B 4OYMA 3AD9C 4DFJA 1HNVB 1Q7LB 4ZP6A 2C3MA 4KHPJ 2VB6A 1L3VA 4GKKJ 5B09A 3QT7A 2ZC4A 3RW7A 1WF0A 2F4VJ 2W4DA 9RUBA 2IDLA 2XS2A 2DNYA 3D6FB 3GV5B 3VAFA 3FVYA 4IG0B 1S99A 1RTZA 3FZBA 3G6ES 2EC2A 1QSYA 4U6PA 1SKUB 4I7FA 2AEMA 2FVPA 1HMVA 1EZZB 4H4OA 4J9RA 3M8WA 4ILLA 3R6GB 2HHPA 2CQ1A 4DBQA 1FKPB 3JSRA 1NAQA 4XPCA 2W9BA 2GIFA 4Z7CA 1RHJB 4RNOA 1QTMA 2JRSA 2V0NA 2YQ3A 2MLZA 2R7QA 5HMYA 3TJ8A 4DL2A 5J2PA 3A8EA 3L7UA 3TARA 2R8GA 1RT4A 2AX0A 1HI1A 3BN7A 3BO4A 4RO0A 2A6MA 2F7VA 5KG5A 2C2RA 3BO2A 2ASJA 9ATCB 3HD2A 1WELA 4HT5A 1J5OB 2JOQA 4OV1A 2DRAA 1NU4A 3BQ2A 4ECXA 1AROP 2CJXB 3NCQA 2Z57B 4OX9F 4ECTA 2ZBRA 2UXCF 4G1PA 1EKRA 2CPXA 4RL1A 4XAKA 3TA0A 4K4VA 1X9SA 3DC2A 1LWFA 3PCOB 2LXUA 1EETB 3MURP 1UJ4A 3NLCA 4IKAA 4NA1A 4DR7F 1N33J 3MM5B 1CJTA 2XZTB 3NBPB 1RAFB 1VLYA 2F5GA 3BH7B 1FK9A 3KLIB 4RBTA 3U7JA 4ZLLA 3Q2TC 2AF6A 2MJUA 1HQUA 2LEPA 4YB6A 4JI5J 4I6AA 1WACA 3CCTA 3CMQA 1HNVA 1Y3JA 2FJAB 2FJXA 2WTFA 1K1QA 2CG4A 4DF4A 4XK8C 4EU0A 4ZPTR 1QAXA 1V9OA 2WVBA 3ONQA 2HFSA 2FLOA 3VAIA 2YX1A 3GMGA 2QFJA 2FZKB 1S9GA 2HKEA 4XDCA 2B6AA 1JLFB 1V5VA 3OLBA 3O5TB 2JLGA 2GS8A 4BS2A 1EJ7L 4HI2A 4MYTA 4B9LA 4F2RA 2CFXA 1CJTB 4OQJA 3KUHA 1H73A 2RAQA 3E01B 4JUZA 2BRLA 4XPEA 4ER8A 3B8HA 3HKZD 1RU2A 2PFDA 5J2QB 1Z2LA 2VONA 4KH0B 2DB1A 3HFZB 3MR7A 1GT8A 5HBMA 1VIXA 2J7UA 2Q79A 3KHHA 2WSCC 1N4LA 1SCJB 3QPIA 4FNIA 4H54A 1NJWA 1LQ9A 3P96A 1QD1A 3LGMA 3N9UC 1U1KA 2OPPA 5JMNA 2QJ3A 2XQCA 5KFAA 1EHWA 3MAAB 3MAHA 4ZOSA 5CZVA 5GVQA 5CCLA 2R2RA 5THWA 4UF4A 5ETQA 5IC4B 2DXFA 3Q83A 2PI4A 3JQKA 1S9EB 1XMBA 2YX4A 3O8WA 2V2VA 1HYSA 4AXJA 4HLBA 1BWVA 2F8MA 2DHHA 1K47A 2VUGA 3N0VA 4LBHA 4MIWA 3ZZOA 2XWXA 2B7BB 5J2MA 4B9SA 4I7FB 1FKOB 2KKHA 3PX6A 4I2QB 4C8LA 3GYGA 3F44A 2DH8A 2IM1A 3MM7A 5DZ7A 5LMUJ 2F65A 3T6JA 3V6JA 4DR5J 2B8QA 4K0KJ 2HHSA 4EI2A 4WTYA 5CAAA 3IGNA 4EZ9A 4X4RA 3TX8A 2OPSA 4KGVB 2QTWA 4DX8H 2K3KA 5U47A 5EWGA 4LR7A 1X4CA 3Q8VA 3WIUA 2B4OA 2XYPB 4D3HA 1UJ6A 1WI8A 1M0SA 4NI2A 3KLEB 4ECZA 4DL4A 2D3O1 4DL7A 4JI7J 4I2PB 4A8YA 2A1BA 3VGVA 4HTIA 2W01A 2L41A 2W7OA 1KKHA 4TY8A 3MAQA 1W2IA 1EIYB 1UVMA 2XS7A 4DV0J 1SH0A 1T9TA 2FGCA 2ZVSA 2CXEA 3IBWA 3THPA 3NGUA 5I3UB 1X4HA 2HVEA 3LUYA 1D9FA 2ZHBA 3BGUA 3ENWA 1N5TA 2HWIA 5E2QA 1HNIB 3BJYA 4DQQA 1SKSA 1L3UA 2RQCA 4FNHA 1VQ8S 4ZLJA 1S1TA 4DUYF 1U4BA 1QE1B 1ZZFA 1S6QB 2F63A 2Q43A 4EYHB 4WBFA 3EPGA 3CUNA 4CLKA 1RE1B 2C1EB 5KT4A 4NASA 4RUAA 2DR9A 1BY9A 3GIJA 2F1FA 3SCJE 1NM2A 2AYMA 3CCLS 4ED0A 1X5TA 3TQEA 4NXNJ 1J27A 3KG4A 2DGWA 2FD2A 1IBMJ 2PDAA 3RB6A 1FHTA 1TMJA 4G1QB 4OYAA 2GO9A 4C7QA 4DCJB 3W5YA 2XI2A 3AD7C 1RWUA 2N7CA 1JNRB 1RHQB 3Q8QB 2XY7A 2XMAA 4RNMA 2NS1B 5BYSA 1IKVB 3OFHA 1EKSA 1MWYA 2C3OA 3BREA 1FDAA 2KDOA 3K5OA 2DNOA 2EK1A 3HP6A 4LF8J 1HNZF 2E1PA 3D6HB 3QT8A 5J1EA 3KK1B 3DRSA 2CPEA 4YMEA 2KFYA 2JEFA 3JAMU 3ZNJ1 5AXNA 3PHTA 1OY9A 4ELUA 3JTPA 1TL7B 4OZJA 3K5LA 3OHAA 2CZ4A 3MM9A 2YH1A 5A0YA 1S0MA 1S1VA 5HSPA 5DG9A 2U2FA 3M2VA 3D4JA 3PYGA 2HS3A 3SFGA 4KYZA 3ZFVA 2MXYA 2EFOA 1HI0P 1N33F 3GR0A 3JXOA 1VK3A 5IM0B 4KAIA 5GAEI 3B6BA 2RUGA 2GV1A 3TVKA 1TK8A 4DR6F 1HHTP 2GCFA 3H5XA 3EXCX 4OI3A 1T94A 1U26A 2HK2A 2V8HA 3QZ7A 3QNWB 4ZPDA 2K3IA 5AJ3J 1PILA 4Y2MA 4OHWA 2FC8A 1BXNA 1S1WA 1D9DA 1HI8A 5CABA 4RBUA 2W9BB 3C2PA 1Q82T 1FKPA 3UO0A 5CD4A 5KT6A 4WK3A 2R2TA 4G1IA 1WDDA 4C0OC 3MD3A 4QYZK 4W90B 3W5XA 1ZOTA 2YQ0A 5E41A 4TKTA 5HMZA 2CDRB 1RAEB 1DURA 3MR5A 5D3GA 4DR3F 3CO0P 4IG0A 2L9NA 2KJWA 4IOBA 5DQGA 3KHLA 3RG6A 1UP1A 5L1JA 4M5MA 3MUVP 2HNDB 1I6JA 2KRRA 4EBDA 1IBMF 1FDBA 1RSCA 2MZJA 2YKMA 1KDNA 3OL6A 3M32A 3DYAB 2EI5A 4I56A 3PW4A 1N0UA 2HFZA 1GNKA 3LA0A 4QQBA 2Y1JA 4S0MA 1U6FA 1K1SA 5HI7A 2VQEJ 4IG3A 2OELA 4OHXA 2NXEA 4ES1A 1WC3A 2VPZB 4LRDA 2Y1IA 1I94F 1RTDA 3AAWB 1MMLA 3WBZA 1H7WA 3Q8RB 4JI2J 3OL9A 3OTBA 4KPYA 3GWCA 4B3RF 1CJUB 3HHLB 4C4WA 3EGZA 2HWTA 1ZZNA 1Q79A 5I3PA 4DR7J 3EVOA 4OHYA 5GAHI 2IIHA 1IM4A 1OJ4A 1ZM9A 2I6WA 4AD6A 5HO4A 4LF9F 3CNQP 1FNXH 3CF5Q 1X5SA 3OTCA 1VHIA 2A2DA 3OTEA 4HH1A 2LXFA 1ELOA 2BJ9A 4NLTA 3KHRA 2K8GA 3EUNA 4X4SA 1Q5VA 2G0IA 1R6VA 3PEHA 4JV5J 4K59A 4YR0A 4WU2A 4OZ2A 3RTVA 4BBYA 1S1UB 2YNIA 4PG6A 1J5EJ 2Q1LA 2W2MP 2OUGA 3BDEA 2I2YA 2K2PA 4F02A 4Y3CA 2UU9J 3DCAA 5D78A 1KP6A 2DGSA 4JBCA 2HS4A 4FBUA 4GVLA 2B5JA 1JJ2R 2A6OA 3WZ0A 4GC7A 3RU0A 4A8SA 3N5BA 4DUYJ 3RZAA 2V2QA 4L74A 3CCES 3Q24A 2IBOA 1D8ZA 2G0JA 3C15A 2HVZA 2LDIA 4CTAB 4D3GA 1TKTB 2QSWA 3DMJA 4ZPCA 3I82A 2FQQB 3MD1A 2E5LF 2WAQD 5C2GA 3FBEA 2R8IA 3SV4A 4DL5A 1FT8A 3MCOA 1ZPVA 4MT1A 4V19J 4ZPWR 2CYYA 2IVFB 2WBRA 1T05B 1X60A 4KT0C 4Z7YA 4R8UA 1TP7A 3HHDA 1H2UX 5MAOA 2ZKUA 2AD9A 5IT9Y 1RT5A 3TRGA 2MKSA 4PYDA 2HNZB 5F41A 1M5PC 2E9ZA 1VRTA 5K14A 2M88A 2FUG9 3AB2B 2QIFA 3DU6A 4DSEA 1QVGR 4O3OA 4QW8A 4HDHA 3KMSA 4X4VA 2ROPA 2HGNA 4OLOA 2HYIB 4EK2A 1OSCA 4BCAA 3VAGA 1RAAB 1HQ2A 5BJRA 4JYAJ 3JSBA 3TEGA 2UUCF 2IFXA 1CC7A 1DLOA 2YWFA 2ZD1B 1R27B 2OFGX 3DU5A 3PACA 3GJRB 5CYQA 5F9LA 5L1IA 4DR4J 3JSMA 1UW4A 2N4DA 3I9ZA 4FYVB 4PWUA 1LFWA 3GLJA 2GGPB 2QL7B 3MM7B 3QLHA 5KG6A 2J0WA 4JV5F 2E5GA 2OGUA 4WFAQ 1FJGJ 4TU8A 1WJ9A 3LP2A 2GX8A 2XO6A 3LWMA 2ZDOA 4P2XA 3POTA 2V34A 1SPBP 3PJXA 5ETNA 1MU2A 3C6TB 3TVZA 1SC4B 3PW7A 4LT6A 3T5KA 3VHQA 3HKWA 4CT8A 4ZK7M 2YBVA 2RQKA 2KT3A 4WP9A 5KFGA 2VHGA 2V4RA 4L3KA 2IRXA 4C97A 5L46A 1REVB 3UCUP 2Y3YA 4C8YA 4Z2XA 4QU6A 2QV6A 1UL3A 1VQOS 2BJ8A 1MMNA 1KS2A 3C16B 4FF4A 1IVZA 2IC3A 2WVCA 4WFYA 2UUAJ 4LF2A 4RW9A 2OAUA 4M5DA 3MM9B 5KT3A 1RT1A 2NPFA 1Y0HA 1BQNA 2COLA 4ZVHA 4QWDA 3MOJB 3OR1A 1NDCA 3QWUA 4P75A 2ILZA 2C3PA 1TAQA 2B51A 4R0JA 1H6KX 3IM8A 5CYJA 5L8RC 1NEEA 3IBFB 1RLDA 5SUHA 1IJFB 4C11A 1TMMA 1KQKA 1VI7A 3UCZP 1MLAA 1YBAA 2VV5A 3ETMA 1S1XB 2J0SD 5A6PA 1X5PA 3DXSX 1BQXA 3LAMA 3W2VB 1U6BA 2ZJPQ 3M8YA 2ZZMA 2ZC3A 5GMDA 3K5PA 3M2RA 2D7SA 4DPOA 3FSXA 4B3RJ 3OSNA 3GP9A 1F5CA 4KJIA 1Q5YA 1GX6A 4B9MA 2YKMB 1OO0B 4J9MA 4DV0F 4M5KA 2HBZB 2XCPA 1R3NA 1FK9B 5F8HA 2K1RB 1W2BR 1VQ5S 3RUBL 3VQTA 1TKXA 2HQCA 3L4BC 3M30A 3UR3C 3VF0B 5KG2A 1N6QA 1AXQA 1YRTA 2IRUA 3ZC4A 1Q86T 4AE5A 1EP4B 1HHSA 1S6QA 2GA7A 2P9GA 4ED3A 1NKBA 1U0HA 2HBYB 1B0TA 2C3UA 3EVWA 1KQFB 3W63A 2DISA 1DTTA 5AXMA 1RBOB 1ZM4A 3MHYA 1G3OA 5EGYA 1X4GA 1YJTA 3VGUA 1RWVB 2GHVC 1U1LA 4BWJA 4ED7A 2HQ3A 1J5OA 1Q8IA 1F3VA 2RUSA 4DV4J 4GC6A 3HJFA 1UVIA 1SH2A 2ZH4A 4U95A 1K0TA 3P5BP 4DV6F 3HVWA 4Z37A 2B4PA 1UPMB 3BH6B 1CS4A 1TL3B 4B08A 2ZH2A 1UJ5A 1FA0A 1LXNA 3I5BA 3K17A 2C28A 3GZ7A 1CPZA 1FFWB 2QE5A 2R7OA 3QO9B 2R8JA 4PUOB 5KFDA 4MFBA 3HHNB 2O66A 3OFEA 2WW4A 2QYCA 4KIAA 3SQOP 4H4OB 3ILIA 1QVFR 3UD5A 4O0IA 3AXKA 5L38A 4M5JA 1TUVA 4WXOA 4ECRA 3PIOQ 2FHJA 2MZRA 1WKJA 2KFNA 4KO0A 2DIVA 2DGTA 2EFNA 2IPOB 2XHWA 2VBZA 5GADU 3P8BB 4WJBA 4FDFA 3WHIA 2DRDA 2WONA 4YB1P 2MSSA 4LFBF 1S59A 2QEXS 4KPCA 2R8HA 4BDPA 2P8IA 1NPPA 7FDRA 3HF5A 2KYXA 3DGPB 4RW4A 4RW6B 3VTIA 1EB0A 2WSFC 1HNWJ 1HBOA 1U48A 4O44A 3C14B 3E2EA 2B9YA 1T3OA 2HZCA 3EZOA 1PAEX 3FEZA 4UZCA 3HDSA 4DPYA 5D4LA 3T1HF 4X2BA 3W3SA 1MW7A 2XBPA 1Q1KA 3M9MB 2DY1A 3LO3A 4UOCA 1PYSB 2QZ8A 4C48A 4PCQA 3PY8A 3MZIA 5ETLA 3UI3A 4DR3J 3TR5A 3VV2B 1YJ7A 1JLAA 3QRPA 4IDKA 1RGVA 1BQMA 2NSCA 1URNA 4WKRA 1FVSA 1N5VA 2GJFA 2E7VA 5K8OA 3CCMS 2UVVA 2UXBJ 2CPFA 3ENVA 2AYGA 3H98A 3BR8A 3KG1A 1U1NA 4DN9A 4A8MP 3CO9A 4NEZA 3GV8B 2HFNA 3FMWA 4DV6J 1OY8A 4HDGA 3DDNA 2CPHA 1DQAA 3QMQA 4ELVA 3CCSS 3V6HA 2AT1B 1SV5A 2FLPA 4A8FA 2HVIA 3MXHP 1NHKL 1S57A 1U7LA 2OPSB 2W24A 4R0EA 3V2UC 3D1OA 4OX9J 2E1MC 5I4MA 4N8OA 3DRYA 1DAXA 4IRCA 2M2BA 1FKOA 2MZTA 3BDPA 4NXMJ 4ZCIA 3BBBA 4EGLA 3OVAA 1SKWA 3MPUB 2Z56B 5DQIA 4PABA 2YNHB 1K73T 3CCRS 4B3MF 2DY9A 2I9SA 2CUYA 1NSPA 3OXGA 2C2OB 1QY7A 4FN5A 4ANDA 3ZTPA 4C3MA 3R2DJ 2X3DA 5IV3A 1IKXA 1WUUA 4WE1B 3VAJA 3DLEA 1R8CA 3T1AA 2UZAA 3AFGA 3QYYA 1JXVA 4PXBA 5KFSA 2LKZA 1K0VA 4U7UD 3OD2A 2WK4A 3NMRA 3TW0A 4ID5B 3B78A 3G6VA 3AOBA 2UVUA 4DSFA 5H9EJ 5T7LA 3GR1A 1PCAA 4Q0BB 4KSEB 2QA2A 2I8EA 2OD4A 2GMLA 1F2HA 4ECVA 1L3KA 3K59A 4A8OA 5CYMA 2R7SA 1HBUA 2MEWA 2YNHA 4DSIA 2W8KA 4P7TA 4RLEA 2OHDA 4FYWB 3JB9k 4NMXA 4DS5A 1NK6A 1NBEB 1VBXA 2HNYB 2PEBA 3TUIC 1XC9A 1KLNA 4TU9A 2ZOMA 4B9UA 4B9VA 3ILOA 4K5SA 4DOZA 3CCUS 4EO6A 3EE3A 1X8DA 1B0VA 2HG4A 3T5JA 3FNNA 3A4TA 2MB0B 4LSLB 2NSBA 3BGRB 3TQ1A 5B0BA 4JI0J 3MR6A 4X4OA 4WP8A 5AE3A 1GH8A 4PWWA 3PEJA 2A0FB 4P2MA 2DJWA 3GU0A 3K7RA 1IJEB 2CPJA 5FDLA 3OSPA 3B4DA 4ZVFA 2VBWA 1D0EA 2HPUA 5DETA 1YBTA 5B0GA 2YWHA 5HANA 1S1XA 2BJEA 5D4NA 3TZZA 2FZCB 3QFWA 4F7VA 3VAHA 2NXUA 2ZUGA 3OVSA 2HHHJ 1HQEA 2F40A 4KO0B 4O3NA 2JSXA 4USVA 5E3PA 3SCKE 3NGTA 1VQ9S 4HACA 3R97A 2IAJA 3D68A 4MKBA 2BJDA 1HARA 1TL4A 4LIRA 5FIIA 3ZZYA 4QCLA 1WC5A 1JLCB 3A8JA 4MAKA 3RJMB 3J7AN 4TNOA 4Q2LA 4RUHA 4HVZA 5C2CA 2RS2A 1XMOF 3C3LA 1TAUA 1RT2A 3W8PA 3QO9A 2QLWA 5D4OA 4F4AA 5LM7E 1BHNA 3NMAA 4IO1A 4YOEA 5J2NA 3P45B 4F4ZA 4AL6A 1VDHA 3ILLA 3EYZA 2IDEA 1F5BA 2MTLA 2O3DA 4UTGA 1WG5A 1WF1A 2CNKB 1RYSA 1XN9A 3BR9A 5HK4A 3JTNA 1FTRA 4MK9A 2R4FA 5EDWA 5D15A 2XSFA 3X3UA 3L9ZA 4XTTA 5J2PB 1PJ6A 4AQYJ 2HGLA 2OSRA 2XHCA 2Y0SD 3PYEA 4HHUA 1IBCB 2FJDB 3V4MA 1SQGA 4DU7A 3QATA 1RQ0A 5L9XA 5I3QA 1UVJA 1ACMB 1FE4A 2DNHA 2L08A 2HK3A 1RXOB 2ZNYA 3H2UB 2BE9B 4WCEQ 1RTJB 1WHVA 2GGPA 1Y00A 3GFHA 2A10A 1SBRA 4ZIVA 1CBKA 2XMKA 2UP1A 3IG1B 1KHVA 1VQNS 1RT7B 3K2YA 3AD8C 3SSSA 2QL9B 2HZAA 3PXGa 1SXLA 4IH7A 5RUBA 3OV7A 1S12A 1RA6A 1GXTA 4LJMA 3D6MB 3J7ZT 2G0CA 4K4SA 4N76A 3OTOF 1IXKA 1HA1A 1WWHA 2HIQA 2Z2ZA 3AOCA 3G6YA 3OVBA 1NJYA 3M2RB 4LFAJ 1F3FA 2C2ZB 4CO4A 1S6OA 1SUQB 2IJRA 4CNYA 1QLNA 1R0CB 5D0GA 1NMEB 2VG6A 4LF7J 3D5MA 4KFBA 3BGLA 4NLWA 3HJVA 1HL6A 2JH3A 4WP3A 3CC2S 1ZM2A 5ETPA 4CH7A 3QGPA 2CZ9A 1VLOA 3C8YA 3HHKA 2EG1A 4URQU 3R9LA 5IWAF 1YSJA 4A8QA 1NK5A 2YKNA 2DEIA 2QC3A 4DSJA 4AFFA 2HHXA 2RF2A 1ZBTA 2Y8YA 2JVOA 2V8DA 5CQGA 2GQCA 3CB4A 4OYIA 1XWLA 4HH0A 1TUGB 3NS7B 3TZYA 2GHPA 4OJ1A 3V6KA 2JJ4D 2R7VA 1RWNB 1WORA 2YKAA 3DOMA 1SVDA 3ITHB 4QBUA 4B9NA 2BW2A 1JQGA 1R31A 4EBEA 3KTQA 5F8JA 1FFSB 1MN9A 5C25B 1YJNS 3CW2C 4ZCKA 3CDAA 3UQSA 4DS4A 2DBBA 1R8BA 3AH6A 2FTRA 4B3SJ 3IR7B 2GO8A 3DNCA 3LP1B 3OUYB 2J6TA 2IYIA 2RHSB 4CO2A 4CLTA 2XZWA 1RTIB 3FBBA 4X65F 1OWXA 1R8AA 4PG8A 4NLRA 1AW0A 2XY5A 1TVRA 3N6NA 4YY3F 1U49A 3FJ2A 1BMQB 2QLFB 4OX7A 3SQGB 1NNDA 5HVGA 1U47A 1BQNB 2JL9A 3WQPA 1KN6A 2WVFA 3ITHA 2NUUG 2VDIA 1WHWA 3M8QB 1T9UA 2J0QD 1RAGB 2O01C 1IKYA 1M5HA 2H5JB 2G9OA 1UA0A 3C16A 4NLPA 1RWKB 2CNLB 2H4YB 4ZVSB 1UVLA 1TQLA 2KYZA 2H4WB 3KK2B 2LEBA 1WHYA 3MMBA 3DKDA 4OMFG 5DGAA 4LFAF 4NCGB 2QA4S 1FKAF 2Z2MA 3H40A 5KFJA 3QIDA 1H7XA 3BGOP 4O4GA 1RISA 4CDIA 3UNGC 5ETKA 3UVJB 2MQLA 3POTB 2BA9A 1X4EA 4F4XA 4M94A 1SC3B 4ZVUB 1WF2A 2VL1A 3RR7A 2GIQA 1GMWD 3ISNC 5KT2A 3M32B 4Y6IA 3I55S 2I38A 3DLGA 2YWGA 2M8HA 4J7CA 4CLLA 4ZKAA 4A8WA 1T05A 2HRYA 2PMHA 2RU9A 4OJ3A 2FJVA 3M8SA 2ZHAA 2DHAA 3ET6B 1GTEA 3W2WA 2QA1A 3S7RA 5AE2A 3HLUA 1GX5A 3D9BA 4G6VB 2AP6A 1UKUA 3UN3A 1MROA 4X66J 1FVQA 5IXUA 3ET6A 1KVJA 3GFYA 1IWGA 3O6QA 4URGA 4FYDA 2Z8QA 1RTJA 3BO3A 1RLCL 3J7Z5 3I4HX 4ZHRB 2CQDA 4ZVPB 1H38A 2H5IB 4RW7A 4Y34A 2Y1RI 4YEAA 3CCWA 1WEZA 4KC5A 1JK9B 1FXLA 1C1CA 2O67A 1YJWS 2ZEJA 1NK9A 4XO0A 3QJLA 4ZP8A 1RT3B 3JTOA 2BEFA 2YWEA 1TU0B 3ZTSA 1V5IB 2ALYB 3OTDA 5HJYA 3OR2A 3CJKA 3CD6S 3T6BA 4J9UE 5HLFB 1QM9A 5T14A 4DXLA 2KHDA 2AJ0A 3CCZA 2CQPA 1H2TZ 3IG1A 3EMTA 4J9LA 4RKUC 4CNZA 2XO7A 1S6PB 5DLGA 4CO1A 4DL6A 3RBZA 1S48A 1RHUB 1XQIA 1MG7A 2CQCA 1NCLA 3PRBA 1N36F 3M2UB 2DTJA 1KRPA 2XB2D 2N7YA 3H5SA 5DM7Q 2CJKA 5CXTA 4B3TJ 2RSQA 3MI7X 1IWAA 2B0GA 4ICLA 5T41A 2ERRA 4B3MJ 1O5JA 2GQQA 2HHVA 1RTIA 1CJUA 2OEMA 1U2CA 3V6DA 1Y5LB 4USUA 2MYFA 4C8MA 4C8KA 2G4BA 2DH7A 4K7QA 2PA8D 3N28A 4F0MA 6AT1B 2MZ1A 3Q8SB 2XNRA 2FJBB 2P6SA 3IO1A 3B4MA 4I64A 4Y00A 5IV4A 1LEOA 4EYIB 4GKJJ 1JLQA 2G1HA 2UVWA 2FVCA 1SH3A 2I1RA 1ZM3A 3ZXWA 5L9NA 5KG3A 3CSKA 5BR8J 1WOOA 1KQSR 1WSVA 5D4PA 3BSNA 2HEKA 2EBEA 3GIKA 2J0XA 3PX4A 4DQRA 3WDOA 1GFWB 1PJ5A 1EQ0A 3NAHA 5A8RA 1FWLA 3CCVS 5HROB 5KT5A 1VC5A 1BC6A 1BUXA 1SJ1A 2AJ4A 3NRBA 1O8BA 3TAMB 4HACB 1D09B 5A2QU 5L1LA 3UD4P 4X62J 4B9TA 4O3QA 4N5SA 2B43A 2HIYA 1RACB 1JJCB 2PE8A 3BKTA 1WC4A 4WYLA 4Y2CA 3SEOA 3W64A 3PV8A 3IN5A 3QIPB 3EM1A 3GIMA 4PQUA 1SUQA 4L3NA 4TY8B 3OT9A 2DNPA 4IG3B 4PQAA 3FQLA 4M5GA 3ZZUA 2DR5A 2W4PA 1CJKA 2G2ZA 4YB7A 3FEYB 2HZVA 2R8KA 4ETZA 4RR5A 2JEIA 1S49A 3HD1A 3DYAA 2HHHF 3FFIB 3GSIA 3UDEA 2XSJA 2RT3A 4FKXA 1PSDA 2CVEA 4I1TA 4DX7A 5BXIA 5DDQC 1FD2A 1Q95G 2DGOA 2RKIA 2VG7B 3PYFA 5KFMA 4QW9A 3MUMP 1NK7A 4HYKA 3MEDA 5ETRA 2V9WA 1FE0A 4DFMA 3I9V9 1ROFA 4UOFA 1T9WA 3Q8YA 4F4WA 3P5TL 3OBIA 4RBVA 3M1VA 5KFFA 2DD8S 2C2NA 3L7OA 4N7TA 5EHHA 2NPIA 4DFKA 5D0RA 2VPYB 5F0WA 2BVZA 3RGIA 4U7CA 1NJXA 2ZBPA 4UZBA 2KHCA 3Q89A 3QSYB 2A3JA 1I1GA 4C3KA 4CT9A 1XMOJ 3D1HA 2W4CA 1S1WB 1YG0A 1B64A 1K44A 2B9EA 2W7AA 2BE7D 3MEEB 1XMQF 3R5CA 3OLAA 3RB3A 1DFDA 4QIFA 4GVBB 4Q7AA 5GAEU 2L9DA 5F8MA 3JQJA 4KGMA 3K8VA 1VISA 1AB8A 1UFWA 3DLEB 3KOAA 2UUCJ 4TYBA 5F8GA 3R1HA 2BJ7A 3F56A 5J2NB 3CJ0A 2AEFA 2CQ4A 1RT6A 3HT0A 2KB2A 1EQMA 2NYHA 3O3LA 4GO7X 4U7UK 1RT2B 1XTZA 2CPDA 5A0YB 3D67A 3M6WA 4EEYA 1BQMB 4DR1F 2XEXA 3R5DA 1P6TA 5ADZA 1H0HB 2AMCB 2G2OA 4M5HA 2W25A 4KGZB 4OX6A 1H3DA 4QWBA 4IQXA 3Q8PB 2UUBJ 3PTWA 4U67Q 4OYWA 3NNAA 3I5AA 2V4QA 4FS2A 4Y0FA 1I51B 4OZNA 2W9CA 1S0OA 3DLBA 2J9DA 2YQ1A 3R5AA 2DGUA 4DR6J 2MGZA 2XYGB 3NOCA 1S0NA 1IR1A 1R8HA 2B6AB 1SJQA 4LREA 1LK7A 1RABB 1NKEA 1WOPA 5KFKA 2R7UA 2GMJA 1FRMA 4FPRA 4FF3A 2RQ4A 1U8SA 1WKKA 4ZVGA 4B17A 2QGFB 3MGJA 2CVIA 2HS0A 1TK5A 3W61A 1RHKB 4UT4A 4IDKB 1YBUA 2YNGA 4ZVTB 3KLIA 4CWBA 3QGGA 4H4MA 5KFXA 3VZIA 1L3TA 3MEGB 2MQMA 4OFZA 3TYTA 1N36J 2CKWA 3DXBA 3G6XA 1WNEA 2ADBA 3CD0A 3FRYA 1VGYA 2LA6A 2CWKA 2DHXA 1VJWA 1HNIA 1X4BA 3DDKA 4KKOA 1YZ7A 3UPFA 1B3TA 3J81Y 1V6HA 1HBUB 1U25A 3IFEA 1HD1A 1XMQJ 1DJ0A 1KBRA 1RT6B 2DR8A 2KU7A 2D3OR 2V2KA 2GJIA 2IRYA 3GTYX 4CO5A 5GMKa 1B0PA 2FHOB 3HSGA 1Z4UA 2E44A 3CJ8A 3MAAA 3PO5A 1AUSL 3ZZ0A 3A1YG 3X1LB 4CLWA 2KH9A 5H9FK 5KFIA 2XYHB 2VPWB 3TA2A 3UR0A 3KK3B 4Y2KA 1FD8A 4ZJQA 1ZA2B 1CLFA 3OHBA 1DY3A 3H2VE 3ZTRA 3NGRA 1IN0A 3W8GA 4ZVOB 3SSRA 3G86A 3M7VA 1R0BG 2HRUA 2V67A 4L6V3 2MQPA 3DHXA 4IFVA 4J5OA 1C2PA 3ZNUA 1IKWA 3BZQA 5GADI 3N79A 2BJ3A 2D3ZA 2ZH1A 4ECSA 1IBKF 3N01A 2WHOA 3MEGA 5C42A 2IVYA 1KD1T 4H4MB 1S72S 2VQFF 1S9EA 3OL8A 4V19X 2DNRA 3QJPA 4I68A
chains in the Genus database with same CATH topology
3L7PA 4PR6A 3FQKA 4ES2A 2UU9F 2IYGA 2OPPB 4Q5VA 4AQYF 2DPJA 3DLJA 5JXSA 3W2VA 4ZMMA 4DUZF 2KVIA 4YB5A 4EBCA 4JV1A 3E3XA 5KAKA 1NRKA 3N4WA 2B56A 2CQ0A 2D9OA 3LANA 2ZKTA 2FHJD 2H5EA 3V81B 4Q44A 1O51A 3TAMA 3RB0A 4OHZA 3IS9A 2M0GB 3RBDA 3M30B 3IGVA 1LWFB 4K2XA 2EW9A 2J7KA 1FXDA 3MEKA 4CO0A 5KOXA 2E1CA 3NP5A 2R7TA 1JLFA 4WK1A 3CIZA 2CDQA 3PVXA 4QPTA 2CQHA 1DTQA 1Y4ZB 1HWIA 1N5SA 2BANA 1CQMA 2LU1A 4KHMA 5BYRA 5AXMA 3SSQA 4TQSA 3T9NA 2VA3A 4UUWA 2EVZA 3DOKA 4LF4F 2XMUA 5KFHA 1SIZA 2BUNA 2EFQA 2WONB 2DNLA 2PSZA 3HHLD 4NL5A 1YJRA 3B82A 3GILA 4CCHA 5AE1A 4J9KA 2XLJA 4LVNP 2W7PA 3I0RB 3HM9A 3CDWA 1GXLA 4BC7A 2ALZA 2RILA 3M2UA 5KFQA 4IRKA 2CRLA 1KR4A 4OI0A 1S6PA 4J9OA 2VFVA 5A8WB 5JUMA 5A6WA 3AB4B 1XR7A 4DV2F 1F60B 2JC0A 3J80Y 4OZLA 4F67A 1NH7A 4B3SF 2GW8A 4YDDB 4B3TF 1YHQS 5F0UA 1Y3KA 3DLLQ 2F8EX 5KOWA 3D2WA 4DLGA 3V4IA 1C1CB 1SKRA 1RT5B 1VQ4S 5LMNF 1Q78A 2ASLA 2DT9A 1NJIT 4RW7B 2EBGA 1N5YA 2DITA 4YFUA 1BLUA 5CCMA 4WXWA 4KKOB 1T03A 1F0XA 4KV8A 2G1DA 4OLPA 2J5AA 1T3NA 3QGIA 5HP1A 2MZSA 3RR8A 4ED5A 2B7CB 2E9TA 4C8ZA 3M8PB 2LVWA 4JOUA 4TLQA 4JI6F 2R7XA 1FO1A 1HBMA 1RP5A 1Q81T 3MMAB 1MWZA 4IO9Q 4F2SA 4X62F 1C0UB 4FVMA 3IWNC 4HEA9 5EX3A 2CQBA 5D6GA 1HNXF 2NR0A 5K8PA 3CTRA 1SQEA 2B5JB 3DI6B 3GSDA 2RDIA 3Q22A 4R8UB 2MGZB 4G3IA 2G13A 3DM2B 2AJ1A 3UDLA 2HVHA 2NLWA 6FD1A 1FTCA 3CMES 3JSYA 1JLBB 4NPOA 2CQ3A 5F8IA 4IOCQ 1T02A 3IC1A 4ZPVR 3CWJA 2M3DA 4U9RA 1HD0A 1CVJA 4RW9B 1LKZA 2GQ2A 2RRNA 1T7PA 2XWYA 4YQWA 5I42A 1SB6A 3MECB 4MH8A 1D9AA 2A2CA 2D9PA 3LW5C 2WBMA 4X4PA 1XERA 2MJNA 1SI9A 3DOLA 5B0AA 2KG0A 4A47A 4QIVA 2JC1A 2YX7A 2UV8G 1TL1B 3R3TA 4I6YA 1FEEA 3OJSA 3BSOA 2AGOA 1H2VZ 2GJ2A 2LCWA 4LQ3A 3N6LA 4LF7F 1N0VC 4NWBA 2IBKA 1FNOA 3C46A 3SDEA 1QSSA 1KLMA 2ROGA 3EX7B 1SJ4P 2VA2A 2HMIA 2HGMA 5M2PA 2EFVA 2E5HA 3QLHB 1E6VB 2ZFHA 4QWEA 2JEJA 2ZD1A 3MEDB 4DSKA 2J9EA 3PHEA 3OQ2A 5DO2A 2ZH8A 1K8AT 2CJBA 5GAGU 1E6YB 2LYVA 4R25A 1PGZA 2DNGA 5KFUA 1KHWA 5CHCB 3KNGA 2EFGA 1OQ6A 1Y9OA 3MFHA 1VS3A 4F25A 2ZH5A 4J9PA 4B02A 3MMCB 4KHRA 5K8MA 5L39A 2JFDA 5CA5A 4O4GB 2BM0A 4PG4A 3CT9A 4OI4A 3DOLB 3PW0A 5HQ8A 2EPIA 1C1BA 3HT3A 5JJBA 3RAMA 3IA0A 2OO4A 4WF9Q 4CTAA 1TFWA 4I67A 2WSEC 3KYLA 4IQMA 1U45A 3Q23A 4CO3A 3EZUA 4MIAA 2OPQB 5LJ3Y 4K0KF 2UXBF 2DVIA 1NH8A 5J1EB 2WOMA 1IR0A 4I6WA 1K9MT 4DV3F 2ZOGA 1YVFA 4QU7A 4FVCA 4NLSA 1LOUA 4WKYA 1HR0F 3PFOA 4PXEA 5B0FA 2RH3A 3AY0A 5C25A 2UUTA 2AJFE 1DTQB 4WFBQ 2FB0A 3BSCA 1C0UA 2PA3A 2MKJA 4QIEA 3KJVB 2XLIA 3CCJS 4KHPF 2JZ5A 1HBMB 4X66F 1ZTTA 2WRMA 2DRBA 1R6YA 4LFCF 5HP1B 5IQ6A 5DJBA 4DR5F 1C1BB 1X4AA 3GFZA 4FP9A 3SCLE 2MQQA 1P9QC 3HHLC 3G4SS 3P6YC 1UMJA 1LXJA 3CE8A 4EWTA 3BF4A 4E8UA 2MKKA 2BZ2A 2DGQA 4KFBB 3TUJC 4M1KA 5I3UA 4K4ZA 4YP3A 3U02A 1VHFA 2MY7A 3EGWB 5CH7B 3V4IB 2QSFA 4QWCA 3WC2A 2HHWA 3FGVA 2O5DA 1KTVA 2ZE2B 3CEDA 7FD1A 2FHKA 4ZHRA 3WX4A 1VQYA 3IXQA 1C4AA 1FRIA 5G4DA 1FF2A 2KI2A 2K7JA 3I0SA 3J7YU 3EPIA 1V3RA 3BGRA 4DHVA 1RT7A 4ED2A 4Q43A 3W2WB 4K5RA 4X4NA 1VK8A 2M4MA 1FXRA 3T5HA 3CDUA 4NLDA 3H5YA 1FCAA 1UVKA 3DLGB 3SCIE 3HHNB 1F5AA 3I87A 2BYCA 2SXLA 4M95A 4OX8A 1M5KC 2D41A 1S4FA 4ZCMA 3I0RA 2FJEB 3HPOA 1VQMS 1HYSB 1FRJA 3KLVA 3JAMY 2N3LA 3NGDA 4NCAA 3UCGA 5KG1A 3KLEA 5KFTA 1AUDA 4GKJF 5EN1A 4NCGA 1B64A 3RAXA 3OFFA 1NJZA 1XNRF 2CPYA 2DNKA 4C0BA 1FRLA 4QIWD 3GE9A 4BHQA 5IFMA 1QSLA 1Z2ZA 2YTCA 4F4KA 1O0PA 5KFZA 2M52A 2GC8A 5HN0A 5E3RA 2OH2A 1NKCA 1FRKA 2BRKA 1VQSA 1OIAA 2ZITA 2PFFB 2EWHA 1VQKS 3CVKA 3VZHA 3TOQA 2J9DE 2DH9A 3GB0A 2PEHA 1SL1A 1JLEA 1P1LA 4LF5F 4Q2MA 2XC9A 4X4TA 2R2UA 1S0VA 4HKQA 1VBYA 1S9GB 2YY3A 3T5LA 2B4UA 3AA8A 3Q0AA 1N88A 2EG2A 2AGPA 1U6ZA 5K5MA 4NLOA 3L3CA 5EX0A 1LW2B 2RMLA 2ZDPA 3JYTB 2RIJA 4LVOP 4MIBA 2Q3PA 3MMAA 2DNMA 1XK8A 5D77A 2V9KA 3D0HE 3EGNA 1R8PA 4KRWA 3NBPA 1CSJA 2XMMA 3R27A 4LSLA 4C0HA 2R9LA 3SYZA 1L5UA 2VZ9A 3E01A 2KM8B 1UAWA 3FSYA 2X1BA 4O3PA 1S1TB 4NCBA 3K8WA 1N52B 4CI0B 1N5YB 4BWMA 3NL0A 2FHMA 2C2EA 2FVRA 1LFPA 2KM8C 2BQUA 4DMZA 3KK3A 4A8XA 2HQIA 3K57A 1VQLS 2LXIA 2IM0A 2MY8A 4Q0BA 3CIMA 3NAIA 4NLVA 1Q7YT 4ETXA 2HLTA 3FDSA 2VFTA 1Q53A 2JX2A 2F8HA 3AJ1A 3MM5A 5C42B 3M6XA 1FDDA 2OD6A 4OI1A 2C3YA 4NLQA 4DF8A 1PC4A 3VALA 4IFVB 3K5NA 1AFJA 3KMQA 2P9CA 1RKJA 3BN4A 2ZH6A 3BB5A 1M1KT 4X4UA 4ZP7A 5E5NA 3HX9A 2CPIA 2JHEA 4N47A 3H25A 1Q8BA 3T19A 1S7HA 2B9XA 3H8YA 3M6VA 2RKIB 1LWCA 3LGNA 2J9CA 2XMWA 2M70A 3OJUA 1N56A 1RK8A 2CQ2A 5KG7A 1JXLA 4NOHA 2DCUB 2LQ9A 5KG0A 2XS5A 4X84A 5GAGI 2JVRA 3U1LA 5DQHA 1N34F 1FJEB 2ABYA 5HBMB 4QOTA 2PO4A 3BQ1A 2FLNA 2APOA 4PPZA 1P1TA 4TU7A 3TO8A 3M05A 1Y5IB 3CC7S 3CDBA 1FEHA 2DO0A 3IS9B 3ZZZA 2IAJB 2OP5A 5A8RB 4JI8F 1SJFA 3ZZRA 2MQNA 2HFOA 4F3OA 5C5JA 2EC0A 5FJ4A 3KLFB 1ULRA 2AYBA 2X51A 2FDNA 4ERDA 1H98A 2Z0GA 2B9WA 4PG7A 3KJVA 3JYTA 1LW2A 4RW4B 5KFOA 1LW0A 4TXSA 4WFNQ 1GXUA 4RNHA 4M8LA 4A46A