2MZSA

Nmr structure of the rrm2 domain of hrb1
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
99
structure length
99
Chain Sequence
GSEVIVKNLPASVNWQALKDIFKECGNVAHADVELDGDGVSTGSGTVSFYDIKDLHRAIEKYNGYSIEGNVLDVKSKESVHNHSDGDDVDIPMDDSPVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein HRB1
publication title Gbp2 interacts with THO/TREX through a novel type of RRM domain.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 15
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2015-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2mzsA00
3G9CA 2I2YA 1WEXA 2HGLA 3BO2A 2AYGA 4WFAQ 4PR6A 2DGVA 2CQIA 5HL7Q 5HO4A 1URNA 2MY8A 4C0OC 1WTBA 1A9NB 1G2EA 1JJ2R 3P49B 3MXHP 3CCLS 4RU2A 1WHVA 2N3LA 2EVZA 1WHYA 2K8GA 2MKJA 3FEYB 4UQTA 3P6YC 2U2FA 4IO9Q 1S79A 1U1RA 4CQ1A 3VAIA 2VONA 2SXLA 1OPIA 1QM9A 2DH9A 3ZZYA 3R1HA 2MJUA 2MQQA 2XS7A 2CPXA 2DNKA 2MQMA 2JX2A 1L3KA 2HYIB 3G4SS 1WEYA 1VBYA 4QQBA 3UCUP 1DRZA 2YH0A 2M2BA 2GHPA 1VC6A 1WG5A 2RT3A 2NZ4A 3P3DA 2X1BA 2FHOB 2YWKA 4IUFA 3HI9A 5CA5A 3VAMA 4CH1A 4P6QA 4J5OA 3CC7S 2YKAA 2G0CA 1Q7YT 2KXHA 3BO4A 2CQCA 3CF5Q 1U1KA 1N8RT 2DGOA 2KM8C 2J76E 2XB2D 2F9JA 2CPYA 3RW7A 2M4MA 2KHCA 2JRSA 2DNHA 2AYMA 1ZZFA 2VODA 1SJFA 1VQKS 1X5PA 2VOOA 2ZJQQ 1DBDA 2MKCA 3I56S 1YITS 1FHTA 1W2BR 1M90T 3LQVA 2KXFA 2OTLS 2RQ4A 1WI8A 3SXLA 5LJ5Y 5GVQA 2PEHA 5LXRA 1VQPS 4PRFA 2MZ1A 2DNLA 2F3JA 4U67Q 1M5PC 3B4DA 4Z2XA 2QEXS 1HL6A 2YTCA 1F9FA 2DGXA 3CCQS 1WI6A 2DNOA 1K73T 5GAEU 3TYTA 5DDOC 2XNRA 2MXYA 2LEBA 5D77A 1HA1A 3U1LA 2M52A 1U1LA 5IM0A 1PO6A 4CIOA 1WELA 3NNHA 2UP1A 4Y0FA 1BY9A 4ERDA 2MGZB 5ITHA 5CXTA 1U1OA 1WF0A 1YTYA 2LMIA 3V4MA 3S8SA 4F02A 2MZJA 3MI7X 1ZZNA 1X5SA 2MQPA 3IRWP 5MLCV 4F26A 3J7ZT 3MUTP 3THTA 3N9UC 5JVHQ 5DDPC 1X4GA 3VAFA 3UCZP 1UAWA 2CQPA 4FXWA 3MD1A 3CC4S 1OWXA 2QFJA 2KYXA 1H2VZ 5IQQA 1KD1T 3G96A 1FJEB 4WFNQ 2FY1A 4TU8A 1R8PA 3H2VE 2MYFA 3G6ES 1U1QA 1DHMA 3CCES 2DHXA 1IQTA 1VQ9S 5LSLA 2V94A 2HZCA 3CULA 2DHAA 1FNXH 2DNYA 3UD3P 1Q86T 2J8AA 3Q2TC 1N88A 2X1GA 3VALA 3CCSS 1K9MT 3CXCR 2OTJS 4Y00A 3MUVP 1YJWS 2MKIA 2AYBA 3K0JA 1M5KC 2BZ2A 1UW4A 2DK2A 2I38A 2JVOA 3MUMP 1OO0B 1YI2S 2OIHA 3FEXB 1VQ8S 2MJNA 2ZJPQ 2ADCA 3MOJB 2MMYA 2KG1A 2L08A 2GO9A 3NS5A 3PIOQ 2LA6A 1X4EA 3NMRA 2DIUA 3VAHA 1P1TA 2JWNA 1VQ4S 3CCRS 2L9WA 3G8TA 2MQLA 2MZTA 2FC8A 2CPJA 4EGLA 1RK8A 2J0SD 1RKJA 2AYEA 5IFMA 2CQ4A 1KOOA 2LECA 2LQ5A 5DETA 2KU7A 2MB0B 2M8DB 2CQHA 1VQ5S 1NU4A 1JJ4A 2L41A 3VAGA 4WF9Q 5DM7Q 2MQNA 2MZQA 3LPYA 3H2UB 2DO0A 2RU3A 2CPIA 2MSSA 5FJ4A 1X5OA 2B0GA 2RRAA 1XN9A 4UY8T 2ZJRQ 1WEZA 1Q82T 1U1PA 4TU9A 4V19X 1NJIT 2XSFA 2KRBA 4TU7A 2AD9A 2MSTA 1A7GE 5DDRC 3CCVS 2Q79A 4LMZA 1H2TZ 3G71S 1CVJA 1N52B 1H6KX 1VQ7S 1U1NA 2RS8A 3THPA 3CCUS 2XS5A 3BO3A 2MKSA 4F25A 2CQ3A 2RRBA 3UWTA 5GAHU 5LSOA 1M1KT 2RNEA 2KM8B 2M8HA 3R27A 5GMKa 1U6BA 1X4HA 1WHXA 3VAJA 3DLLQ 5EN1A 1PGZA 3OW2R 4WKRA 3SDEA 4BS2A 4FXVA 1FT8A 2DHSA 3EX7B 4WIIA 2EK6A 3EGNA 2DNZA 1KOHA 5CYJA 1H2UX 2KRRA 2KT5A 2DIVA 2DNQA 1UFWA 2DH8A 1JMTA 1SXLA 3DXBA 1QVGR 2E5JA 2LA4A 2EK1A 2M9KA 3P5TL 2OJ3A 4ED5A 1N54B 2DGQA 1QVFR 1D8ZA 1FXLA 1X4DA 2KG0A 2RQCA 2D9PA 1VC0A 1R8HA 2VOPA 1FO1A 2BOPA 4PKDB 2DITA 2RUGA 4IOCQ 2DH7A 2N7CA 1VBXA 1SJQA 2G1DA 2HGMA 3RW6A 4QU6A 4ZKAA 2M7SA 1X4AA 1YWXA 1X4FA 3CD6S 3I55S 2DNRA 2M0GB 1HD0A 3PIPQ 2MKHA 1VQOS 1NO8A 1Q81T 1WF2A 2CPDA 2MQOA 2QA4S 2DGSA 2LXIA 1UP1A 3ULHA 1X5TA 3BEGB 5D78A 4IOAQ 2DB1A 3IWNC 2PE8A 2N3OA 2KXNB 1ZH5A 3NS6A 2MPUA 3CUNA 2X1FA 1YJ9S 3L3CA 2CJKA 1HD1A 2DGWA 2KI2A 5GADU 1U1MA 2O3DA 3CMAS 2CQ1A 2DNNA 1YJNS 2OSQA 4OZ1A 3G8SA 2E5HA 4YOEA 1KQSR 1WF1A 3JB9k 1SJ3P 2DNGA 3S7RA 4QPTA 2YH1A 1M5VC 2N82B 3NNAA 3R1LA 4W92B 4CH0S 2CQ0A 2DO4A 2E5IA 3S01A 2RS2A 1DZ5A 2K3KA 3CMES 3CCMS 2CPHA 2MZRA 1YIJS 1VBZA 1FJCA 1VQMS 2HGNA 1X4CA 5JVGQ 1M5OC 2J0QD 3TO8A 3MD3A 2NLWA 2OSRA 3U1MA 2F9DA 2DGUA 1X0FA 2KVIA 2MKKA 1K8AT 1YHQS 3BS9A 2FPHX 3J7YU 2KH9A 1X4BA 2D9OA 4W90B 2CPZA 2CQ2A 1O0PA 5H1SV 4A8XA 2DNPA 1VQ6S 3EGZA 2CQDA 2KFYA 2DGTA 2DNMA 3SMZA 3MDFA 4QU7A 2M70A 2MZSA 3VAKA 2CQGA 3B4MA 5LJ3Y 2E44A 3D2WA 2U1AA 5DM6Q 4C7QA 4YUDA 2D3OR 3MURP 3Q2SC 2MGZA 2G4BA 5IM0B 1AUDA 4WFBQ 1WHWA 5DDQC 1U6FA 3UE2A 2LKZA 4M5DB 2A3JA 1U2FA 4YB1P 5LXYA 2HVZA 3UD4P 3S6EA 1VQNS 2MHNA 1P27B 2MY7A 3HHNB 2CPEA 2JVRA 3CC2S 2LYVA 5BJRA 1WWHA 1VC5A 3NNCA 1SJ4P 3SDEB 1SJRA 3UCGA 2KN4A 2X1AA 1OIAA 2DHGA 4C4WA 2FC9A 3ZZZA 1S72S 2E5GA 2M88A 1VQLS 4OZ0A 2XNQA 4WCEQ 2WBRA 2LXUA 1WG4A 1D9AA 1JJHA 5GAGU 3US5A 4LJMA 1WG1A 2ADBA 2LCWA 2ERRA 2CQBA 3TP2A 4LIRA 1B7FA 3CCJS 2LEAA 4TLQA 1FJ7A 2CPFA 3CPWR 2DISA 3VF0B 1KC8T 2RVJA 2XS2A 3CTRA
chains in the Genus database with same CATH superfamily
2HW3A 1JLAB 1MSWD 4X4UA 1MW7A 1WHVA 3T19A 3AXMA 3DN9A 1R0BG 2GIQA 1Y11A 2QL9B 3H5YA 4DSKA 4B3MJ 2HHHF 5THWA 3IGNA 2HYIB 2E1AA 3UCUP 1T03A 2WZ1A 2JC0A 2ZH5A 2RT3A 2AJFE 3VAMA 4A8YA 1N6QA 1YBTA 4DV1F 1CJKA 2QA2A 3KHLA 2NSCA 3DRRA 1SL2A 2FHJD 4O44A 2VOOA 4P2XA 2I6WA 4PRFA 4U67Q 2QLWA 2HBYB 4UOHA 3T1YJ 4IOBA 1UWBA 3I5CA 1WJ9A 2UP1A 4ZLLA 3H4DA 5CZXA 2GA7A 2V2QA 4RX6A 2LQ8A 1XERA 4RL1A 4YS2A 3IGVA 4F26A 1HWUA 1MMLA 1APSA 2R7XA 5F8JA 2JEFA 4V19J 2AF6A 3MCSA 3MD1A 2V8VA 4LFBF 3MR3A 2KYXA 3G96A 1FJEB 3WX8A 2C2EA 2HVDA 3G6ES 1RHMB 2JC1A 1V6HA 3GYNA 1VQ9S 3M4XA 2V94A 4NPOA 2W8LA 3CULA 1YK9A 3UD3P 4IFYB 3OVAA 4ELTA 3TNVA 4K59A 3HSZA 1S48A 2QMUB 2V8PA 1YJWS 3NY0A 4DFJA 2BZ2A 5AXMA 4Q0BB 3V6DA 2DR7A 1PSDA 2MMYA 2HMIA 2XBPA 1FKOA 2L08A 3HHEA 3K5LA 2LA6A 1X4EA 2OP5A 4LFAF 1U02A 2HQDA 2EG1A 2MLYA 3SI8A 1L3VA 2HHWA 3HF5A 3QNWB 3LPYA 2DO0A 4DPUA 4LSZB 3N28A 4DWIA 4DFKA 2W1BA 3DDIA 3W9IA 1FRMA 3MMAA 2RRAA 2AKWB 1X7VA 3D68A 1QAXA 1S10A 3DM2A 1NZ8A 3RBEA 1RWXB 4M8LA 1WKLA 3W61A 3R7NB 1XJWB 1U1NA 1VRTB 4ZOSA 3MAQA 2UUBJ 4LF2A 4B9VA 5AJ3J 3G2XA 1VQSA 1HARA 3GYXB 1M1KT 3DGPA 3BGRA 2XI3A 5KG4A 4TYBA 3EVWA 2GW8A 4R8UB 3UN2A 3ZZ0A 2CJAA 4EZ9A 1N48A 5D0GA 3CJKA 2AP6A 1KS2A 4A8FA 3GB0A 1MMNA 4DU7A 4UUWA 1FXLA 4QR1A 5DLGA 4GVBA 4WYWA 1REVA 1SC6A 4DV2J 2JEGA 4PKDB 4CDIA 1SJQA 2RUSA 4QU6A 1FEHA 2M7SA 1SIZA 3L7UA 3W2WA 5KFYA 3DYAA 3BQ1A 1NHUA 2LU1A 4LSLB 3GONA 1WOSA 5B0AA 3HDSA 1S0MA 4DLEA 1ROFA 2G0IA 1KQSR 1E6YB 3H5XA 3DLGB 1RE1B 3HX9A 4DU8A 1F5BA 3TAQA 4JI6J 1BLUA 4RBUA 2E5IA 3AJ2A 3EVOA 4DX7A 1FJCA 2CZ4A 4USVA 2HGNA 1RT7A 3LALA 1ZTTA 4WTYA 3MR5A 1CS4B 3V6JA 3TO8A 3KLHA 1X0FA 1YVFA 1Q79A 1ZTWA 3NWRA 5H1SV 2KFZA 2NXUA 1R0AB 3FMBA 3HP6A 3TR5A 2AX0A 5K8OA 4QIFA 4HHUA 1FXDA 4GC7A 4DEZA 1M1GA 3R5GA 3LP1A 3BYPA 4DN9A 3KXDA 4YB1P 1R43A 5LXYA 3DLKB 5FIIA 1DQ9A 3A3OB 3NNCA 4OLPA 3PRBA 1CJTA 2HFZA 4ZCLA 4ZPDA 1FK9A 4P7TA 3SCIE 2VPYB 4DHVA 5L8RC 3IFEA 5IT9U 4JV5F 4C2MA 2LCWA 3K89A 4Q44A 2E7WA 4LIRA 3NGDA 2GJIA 3UFCX 3BSCA 1B64A 3HVWA 1SBRA 2DGVA 4X4PA 4RU2A 4GKKF 5ETRA 1Q8BA 2V69A 5DQIA 1ZBTA 2RJZA 2SXLA 1QM9A 2Z57B 2MQQA 2IA6A 4O4RA 4NLUA 4N41A 4O0IA 1LEOA 3BGFA 4DX6A 2CFXA 1VC6A 5AXNA 1F9EB 2LFVA 4DR1F 3BO4A 3CF5Q 4KH1B 3C14B 2AMCB 2CPYA 4PG6A 1VQKS 4QWEA 4JI1J 1RP5A 2P8IA 1KLNA 5LXRA 2W25A 2DKOB 1HQ2A 1ZS6A 4Y2IA 1K73T 1PAEX 5DG7A 2CXEA 2XYHB 1XNQF 1MMDA 4K4UA 4CIOA 2NYHA 2FVRA 4NX9A 5ETTA 2QIFA 2OPQA 4N76A 3K58A 3VQSA 3IRWP 1Q95G 3J7ZT 4AQYF 3N79A 3WQPA 1HMVB 5I3PA 4FN5A 3RB6A 5F3ZA 2BEFA 5SZTA 2IJRA 2RB7A 1NSPA 2GC8A 1TUWA 3C6UB 4JI4J 3R9LA 2DYAA 1TKTA 2R2UA 1HBUB 2RD5C 1N88A 1JXLA 2JSXA 3EJMA 5HVHA 4HR2A 2ZWPA 1TUVA 1FVSA 2IAJA 3SCJE 2IFXA 2GO9A 2V50A 3CCRS 2UXBF 3OLAA 4LUBA 2FC8A 2V63A 4NZ7A 4XIUA 2K06A 4LR8A 1KOOA 4X2BA 1OYEA 5DG9A 4YB6A 1RADB 4CO1A 4AL5A 2HWHA 2QG9B 1IJEB 1R3NA 4ZPVR 3IMQJ 3TAMA 3W5XA 2NQPA 2OFGX 4QBUA 1HFEL 1RT2A 2BA9A 4EO6A 2MSTA 2H4YB 4PG5A 5DLFA 1JWWA 2BANB 2HBQB 1FDBA 2NUHA 4EBEA 1JJCB 4DPXA 3G82B 2GQQA 4WU3A 4YY3J 3D0HE 4ANEA 1DTQA 1V5VA 3UVJA 2EI5A 1JLCB 5GMKa 4YR0A 3VAJA 3PO5A 1SKWA 3K8VA 3TZWA 4FXVA 1NSAA 2R9LA 2YX1A 4OX6A 3N5BA 2R2RA 4YR3A 2KRRA 2KT5A 2AT1B 2BW2A 3TUZC 5KOWA 1AT1B 3W1YC 1R8BA 4HH1A 2O67A 1LQ9A 1Q1KA 3RW6A 2IJNA 2F63A 2BQRA 3PNIA 5IT9Y 3VZHA 2J6UA 4KTQA 1C0UB 4L72B 4DL2A 1HQUB 3H40A 2CPDA 2GIFA 3ULHA 1X5TA 2NPFA 1DTTA 3MEGB 1ZH5A 2JLEA 3SV3A 2YNFA 3PACA 1LK5A 1JX4A 1AUSL 2IDLA 1KTVA 3OJSA 2OH2A 3M6XA 5FD1A 5KFZA 3V81A 4C8KA 2YPYA 4DPTA 3ISND 4IKAA 1WNEA 5I3UA 1VBZA 2VC0A 3BH6B 4ZLNA 1X4CA 1RYSA 4DS5A 4ZPAA 4KHPF 2KJVA 3MD3A 2OSRA 1Q8LA 5AXKA 3RB3A 1HBNA 3J7YU 4V1Ak 2KH9A 3EPGA 2DNPA 4KKOB 5KFEA 4XO0A 4DR5F 2ZC4A 3IS9B 5J2MB 3PW4A 3KYLA 3D2WA 2V4JB 2ZH8A 4C7QA 3UR3C 5I42B 4KFBA 3J7A1 4WFBQ 4X4VA 4HT5A 1IKYA 3KLFA 4LIWA 4CWBA 6FDRA 5E2QA 1VRUA 3KHRA 3MTJA 1SJ4P 1BQMB 4URSA 2KN4A 3JSMA 4AD6A 5C25B 3J7YI 1FVQA 4N7TA 5B0DA 4OZ0A 2D74B 4H4MB 2IYGA 2RILA 1ZAXA 4FVCA 1VI7A 4ZVTB 1XK8A 1WG1A 2ADBA 3WIUA 4KGKA 1YDLA 3M8ZA 1QD1A 4DLGA 2ZUGA 4M5LA 4X4OA 3D66A 2PA8D 2DEJA 3KLEA 4JI3J 1WHYA 3AT1B 3P6YC 4CQ1A 1U09A 2D41A 2CPXA 2IBOA 3R5AA 3C46A 1JLQA 2I5JB 1GQEA 1WC5A 1NJZA 2YX7A 3LWMA 2W4CA 2YH0A 4LBHA 1PCAA 1Q0NA 2AU0A 3B82A 3NGTA 4NLVA 2BJEA 3DMJA 2DGOA 1GNKA 3AOBA 2G13A 1S9EA 2HSEB 3D6HB 1S4FA 2F5GA 2WSCC 4B3OA 4U8VA 2HS4A 1DBDA 4Y2MA 1YITS 4C8OA 4ES3A 2HHHJ 4A8KA 2AQ4A 2XMJA 1C1CB 1BQNB 3DHWC 2ZVIA 4P9SA 3FCHA 4DV1J 3RZAA 3M8RA 1UEUA 2O66A 4LF6F 2GFFA 1VRQC 2LMIA 4E98A 3KJFB 1HR0F 5MLCV 4X66F 3EPIA 1N32F 4NXMF 5DO2A 2PT0A 3AQOA 4X62F 4KO0A 4P2SA 1EP4A 2ZE2A 5IWAF 3FCVA 1HLWA 2NXNA 1AYEA 3MECB 3H2VE 3KMSA 1U49A 1FI4A 2XSJA 3CE8A 3SIPB 2DNYA 4DL7A 4HI1A 4B9UA 4KV8B 5IT0A 1TZ0A 1KP6A 2RQMA 3CJ8A 4IO1A 1VYAA 3MOJB 1SI9A 3QO9A 3LF0A 3ZNJ1 2JWNA 2XMUA 4KGMA 3UNGC 4G3IA 2AYEA 5IFMA 2W7AA 2HKEA 4DR4F 3CMQA 3P96A 6AT1B 3W9HA 1DJ0A 1W2IA 2RU3A 2MSSA 2FQQB 5M2UA 1AFJA 1HBMB 2EFOA 1F5AA 2UUAF 1I51B 3DRRB 2HS0A 4CO5A 4O44B 3NAIA 2AD9A 2W2PP 4LFAJ 2YKNA 3IR6B 4DSEA 4I1TA 4OZ5A 3OXLA 2ASJA 3BBCA 1IKVA 2NS1B 3N6MA 4F25A 4C11B 1U6BA 3QGGA 5KFNA 1YBAA 2VHGA 3SDEA 5HJXA 4WIIA 1HHSA 4PYAA 2D7SA 2B56A 5C2GA 5BR8F 3SFUA 2OGUA 4LBIA 4JBCA 4NRTA 3EZOA 2CJYB 1RABB 4ZCIA 2G2ZA 1NDCA 4L74A 1I1GA 3RBXA 3M6VA 2ZH6A 5A6WA 3K5NA 4PABA 3E01B 4J9RA 2B4OA 1AA1B 2VQFF 2DT9A 1VBKA 4DS4A 3BQ0A 2PDAA 4DL0C 1HNIA 4F04B 2V8GA 4AL6A 1WF2A 2MQOA 4WFZA 3DXSX 2PFFB 1RLCL 3OR1A 4K4XA 4IOAQ 2ROPA 1TFYA 3L95X 3IWNC 3NS6A 4C97A 4PQAA 3A13A 1UJ6A 4OYMA 3PX6A 2CJKA 2JJ4D 2YNIA 2CQ1A 2HMIB 3W62A 2XYPB 4YOEA 3V2UC 1PIEA 1NK9A 3BSAA 3NNAA 5J2QB 3OR2A 2BACA 4CH0S 5A8KA 3M2RB 3KJVA 5B0GA 2K3KA 3TQ1A 4HTJA 3IAS9 3TVZA 1T9TA 3W7BA 1HYSA 3AA9A 2DPJA 3RB0A 2J0WA 1RTHA 4CLYA 3O44A 3OVBA 1NNDA 1N5YB 3DM2B 2Z4PA 4M5KA 2MZSA 5AE3A 5KFPA 3B4MA 1UZDA 3UQSA 4JYAF 1X31C 3MF5A 2JHEA 2C3OA 5DZ7A 2X3GA 4EI2A 3MEDB 4CLUA 1JXEA 2F7VA 1MNEA 3M2UB 2BQ3A 3R7BB 2XEXA 3UD4P 1NLKL 3DCAA 4LF4F 4OYZA 1B4SA 5HATA 1R31A 2CPEA 2LYVA 3D1OA 2E1RA 4NA3A 4YB7A 5HQLA 4WCEQ 4IRDA 2YPZA 2FUG9 1R6VA 3BN4A 3NAHA 1BWEA 2W2NP 5HSPA 4P7VA 4ECZA 3TUJC 1GMWA 4GVBB 2NPIA 2I2YA 4E2FB 3PDNA 5HL7Q 4J9UE 4LF9J 5K8NA 3P5BP 1HWIA 3FEYB 4UQTA 4FKXA 3BGLA 3PJWA 4J9QA 1U1RA 4DQIA 1OPIA 1U4BA 2ZZNA 5HANA 2JX2A 4DV3F 3R5DA 1OYDA 4QQBA 2JLGA 1WG5A 4MKBA 2WOMA 4IUFA 3HI9A 3M05A 2HZAA 4PQUB 1O8BA 3I0SB 1U1KA 4B9SA 4GKKJ 2I8EA 4DL6A 2G2YA 2PSZA 3KK2A 1X5PA 4G1PA 1Q8KA 4ZIVA 5C42B 3ENVA 1RT7B 2QMWA 3M8SA 2ZDPA 3KLHB 3OLBA 2CNOB 1F9FA 1NXIA 2DNOA 1VGYA 5C24A 2B6AA 1J5EF 3D3BJ 3I5AA 4QWDA 4JI7J 1WC3A 3MTKA 5IM0A 3NNHA 4Y65A 2BKPA 1RHKB 3J81j 2ZC3A 3I9V9 1WF0A 1IKWA 2YQ1A 1YTYA 1KR4A 3LP1B 2FJAB 2YNGA 1Y7PA 3GR1A 1T9UA 1PAUB 3CO9A 1SH3A 3UCZP 1MN9A 4F0HA 4C0HA 2FHKA 3IRXA 5C7PA 2BV3A 4USUA 3R97A 1LWFA 4B9TA 1U24A 2D3O1 4D3GA 1LW0A 2LXFA 2MHEA 3K7RA 1XC9A 1RT1B 1S1WB 1DFDA 4C3MA 3CO0P 3CJ4A 2I0XA 4K5SA 3MUVP 2PC6A 1UVMA 3QJLA 1QE1A 1TK8A 4LFCF 2J8SA 2QYCA 3JYTA 4X4NA 3JQKA 4FP9A 3PIOQ 3OTBA 1S1TB 4FPRA 3JSRA 1T9WA 3LO3A 3GE9A 3CW2C 4QWAA 2O01C 4UZCA 2F8HA 5J2PB 1WTFA 2R42A 4OI2A 4OV6A 3FRYA 2UV8A 2VBWA 3OSNA 3GIIA 3H5UA 2ZJRQ 3T1HJ 4TU9A 3Q22A 1PJ5A 4OV1A 3PHEA 4RWWA 4HHHA 1FDAA 1HQEA 3CJRA 4QIVA 2XWXA 3BH7B 4R5PA 4E8UA 1CJVA 5H9EJ 5LSOA 2ZDOA 2ZH9A 2AWZA 1GXTA 4B3TF 4OZ3A 3QBCA 4WKRA 3W2VA 2QGFB 3SSRA 2R7WA 4B9MA 3EDRB 2OPQB 4K0KF 1YG0A 3TW0A 1QSYA 1R0CB 4DCJB 5ETVA 3IAM9 2IY5B 1JMTA 3PW0A 2UUWA 1QVGR 4ICLA 4ED5A 4CZCA 1X8DA 1BC6A 2WTFA 1JLBA 1GTEA 2QC3A 1Z4UA 2COLA 2ROGA 4ZJLA 3FUYA 1R8HA 2DPIA 2BRKA 1NDPA 1TL7A 3O2IA 2J7WA 4HDGA 1JQGA 1X4AA 2H5JB 1TKTB 1QTMA 2GS8A 4JV2A 2DNRA 1FFSB 4MFBA 1M1HA 3GG1A 5CHCB 2C3YA 1NO8A 3GSDA 3ZZOA 4J9PA 4CO0A 2N4DA 1VHFA 2L9DA 4F67A 4IH6A 2BJ9A 4E0DA 2VG7B 4ZPCA 2IAJB 1YJNS 4LSNB 4GMKA 4YN3B 4IDKA 1W25A 4TYAA 1Q78A 1H7XA 3LWLA 2R8IA 2ZFHA 4NL5A 4EU0A 1UPPA 3GSIA 4J7CA 2F4FA 5D4LA 3NWGA 5DGAA 1S7IA 3ETOA 3TZZA 3TAMB 3GIJA 5IT4A 3N4WA 4F3OA 2E7VA 1FD8A 3TJ8A 3DOLA 2CQDA 3HD1A 2K1RA 1QJHA 4EYHB 4H4KC 2XO6A 1FEEA 3CDEA 3RG6A 1P9YA 5BYRA 2ILZA 2LDIA 1ICEB 2BUNA 1AUDA 1ZA2B 3UE2A 2WW8A 2BKNA 3WX4A 1NHKL 2D3ZA 4ZK7M 2JVRA 3IP0A 4DR3F 3UCGA 2NR0A 1PYSB 2IM3A 2DHGA 1IM4A 3FJ2A 1VQLS 4DR5J 2VFSA 2CADA 3CD5A 3IBCB 2XNQA 4NLDA 4LF7F 3DOMB 1RTJA 3TA1A 1VS3A 3HKWA 3OXFA 4OJ3A 3NG8A 3HHLC 3VTIA 3GIRA 2E5LF 4EZ6A 1T05A 2RVJA 2QJ3A 2E66A 3GCWP 2IA0A 5L39A 2XHCA 4DSIA 2IBKA 4MYTA 4ZVHA 2R7SA 2XLJA 3V6KA 3RBZA 5KG3A 1SJ1A 1WOPA 2HAIA 2U2FA 5IQ6A 4WP3A 1TL3A 2ZOFA 3NOGA 2CWKA 2QSWA 1PKUA 2W8KA 1AFIA 2GHPA 4B3SJ 4PWDA 5KFUA 2G0CA 3M2VB 5EWEA 1QAJA 3EVMA 2L9NA 4ATNA 2XB2D 4N8NA 4MK7A 4HDHA 2C2DA 1RYRA 3QT5A 5I3UB 2ZJQQ 5E7OB 3PW2A 2VBZA 3FSYA 5LJ5Y 4IFVA 1L3SA 3AFGA 1RAIB 2YTCA 3BJYA 3CCQS 4CTAB 1SL1A 3MEKA 4O3QA 4KFBB 3QRPA 3BBBA 2PD1A 2MZJA 1WD6A 3NGSA 3PZPA 1C1BB 4UY85 3MUTP 1VRUB 1JNRB 1WKJA 2HNZB 3B78A 4OFZA 2ZH1A 3JSMB 2QFJA 5U47A 1B0PA 1KNZA 1DHMA 3CCES 3W60A 5D0RA 4LF6J 3LOUA 3PRVA 2BJ3A 1JLAA 3MM7A 3CCSS 4X66J 1H98A 2V6AA 2A6MA 1N32J 2F4VF 1FD2A 2RAQA 4YDXA 1VIOA 1VIXA 1MLAA 1J2VA 1IQZA 2JNJA 3QWPA 3CCZA 3QWUA 4DR2F 1N36F 2XG8A 2YKPA 4F4XA 5GMEA 3TVKA 1VOMA 3TEHB 4F0KA 1NKBA 4NA2A 3BDEA 2X51A 2DR6A 3GJRB 4PG8A 1ZM9A 4FYDA 3V4IB 5IC6B 3VCDA 3PYGA 1KBRA 2AIRB 1KSPA 1VISA 2B8PA 2PFDA 5DDRC 4MIBA 1HI1A 2B5JA 4I2QA 4XDDA 1RHJB 1VQ7S 2BDPA 3MMCB 3QGIA 3ISZA 2XS5A 4DR4J 1V3RA 4OHZA 2ZBCA 4PXEA 1VK8A 1OY6A 1HWJA 1RAGB 2IPOB 5J1EA 3MM5B 1K1QA 3EGNA 1XMBA 1NH7A 5L1IA 3N6LA 2GVZA 2GZOA 1ZA1B 1AW0A 4RJVA 3GR0A 4JI8F 2EK1A 4ECUA 1X4DA 2IM0A 2V67A 2ASYA 2Q43A 2G1HA 2ZZTA 4RUAA 1NAQA 3TZYA 2G1DA 4ZVRB 4FYVB 3OV7A 1UFKA 3UDEA 4IFYA 3RR7A 3AOAA 1GH8A 5BR8J 2QA4S 2HQIA 4PZVA 5KG5A 3MM8A 4LR7A 2HK2A 4DMZA 1HD1A 4FF2A 3B6BA 3G8SA 4J9NA 2E7XA 3QO9B 1SJ3P 4USTA 4NCBA 1WC1A 1I5OB 3BDPA 1RBAA 4Y3CA 2KYZA 3LGNA 5GMDA 1TKZA 4O3PA 4JB8B 3GFXA 2DVIA 3KK1A 2MZRA 1YIJS 1R8AA 1M5OC 4U6PA 1T94A 4L75A 1U48A 2ATLA 3LUYA 2BOAA 3RRHA 1VLYA 5D0EA 3C3LA 2MEWA 3W3SA 3BREA 3EGZA 5HMWA 5K8PA 4LRAA 4TQRA 1YZ7A 5I3QA 4CI0B 2HHQA 4QOTA 4ZIWA 2QE5A 4XDCA 4DV0J 1WWHA 4QR2A 3SDEB 2R3VA 4DG1B 3B54A 2XI2A 3OTOJ 2FC9A 4F4YA 4RUBA 1Y0HA 1DURA 2E5GA 1RWVB 4NYOA 4PXCA 3A3NB 1VJQA 3TUPA 1RT3B 2C3UA 4JYAJ 5GAGU 4LJMA 1JLFB 4AT1B 5C2CA 3EZ5A 1RWKB 2AEFA 1RZMA 2ZKUA 1FJ7A 4LF4J 3GTYX 2XS2A 4X65F 1E6VA 1FTCA 1UZHA 2N4CA 3PFEA 4C0OC 3P49B 4LSLA 2XGQA 1FKAF 3RTVA 3BQ2A 2EVZA 3GPAA 2DH9A 3ZZYA 2Z2LA 4FKYA 4YP3A 3GQCA 3G4SS 5GAGI 1U6ZA 2YNIB 2HWTA 4DPYA 2AW0A 5ETQA 1S9GB 5KFTA 3R3TA 3SYZA 1KONA 4CH1A 4P6QA 2BE7D 2CQCA 2Z0GA 2WVDA 4A8QA 3OR2B 1NDKA 5A8KB 2KHCA 2JEJA 1QTNB 3HSGA 2W01A 4N56A 1XQIA 2RQ4A 4DV3J 1WI8A 3I82A 5HMYA 5ETNA 5JJBA 1R0AA 2QA1A 3AH6A 2W2MP 2YQ0A 2XM3A 2V2ZA 4ZVGA 5GAEU 3CDBA 4CLTA 2HNYB 3MCMA 2XMAA 3DRSB 2FVCA 1YJVA 2B4PA 3K5OA 2FLPA 1BMQB 3MI7X 1YRTA 3CJ3A 3N9UC 1QLNA 3WIVA 3VVUA 3M32B 1VHIA 2UVWA 2FGCA 1KD1T 5GAEI 4MMOA 1XMQF 4TU8A 1EJ7L 2QLJB 3D5MA 3TQEA 1CULB 2AJ1A 5IS2A 1NK7A 2DHAA 3H5SA 4KQZA 1UKUA 2OPRB 4HACB 3QFWA 3Q86A 5MAOA 4ED1A 3GCXP 2MKIA 1HNXF 4GC6A 1NZAA 1S0VA 2IC3A 1KWMA 3GV5B 3NMRA 4ED3A 2DIUA 3VAHA 1P1TA 1B70B 3UPFA 1UVIA 2KU7A 4QYRA 1RT5A 2L41A 2DY9A 3C14A 3LGMA 2YQ3A 4YFUA 2K2PA 1TFWA 1XMOJ 2CJBA 3T5LA 3ITHA 1BD6A 2CVIA 3H59A 2DR9A 3FMWA 5A0YA 2LQJA 2M8HA 3S1TA 2M3DA 1PGZA 3OW2R 4LF5F 4UOCA 4QWBA 3M9NB 1KEKA 1KOHA 5LMUF 1HMVA 2YNGB 2GVDB 2JL9A 2A6OA 1HWKA 5J1NA 4DUYF 3C6UA 4OYWA 5KAKA 4F3QA 3DU5A 3M8QA 3CT9A 2OMLA 2QYGA 1LWCB 3IRXB 3AJDA 1GEHA 1HBUA 3BGOP 1LWFB 3CD6S 2UXCF 3KDOA 4KJIA 5KFBA 1K44A 3A3PB 2Z8QA 2JFKA 4NWBA 3LP0B 2ATCB 1CSJA 2CJXB 2J0XA 2EEYA 3OTCA 4DCOB 4RW8A 2MPUA 4DN0A 1SB6A 2DGWA 3HVTA 2V4RA 2DNNA 2OSQA 4IG3B 4QPTA 3RGIA 3LGHA 2Z2YB 1RWNB 1IR1A 3T5JA 2KDOA 5KG0A 4KGZB 3KG1A 2LQBA 4TKTA 4AE5A 1LXJA 4NLYA 2BVZA 1NB2A 4KGXB 2X3DA 2IRUA 4PG4A 1UW9A 1RHQB 1U8WA 3SMZA 3G82A 2IDEA 3OBIA 3K2YA 4PYDA 1V3ZA 4R5PB 2J7KA 4OX9J 2CRLA 4C8NA 2F40A 4ZP8A 4JI0F 4EMDA 2E1CA 2E9TA 4M5HA 3MR7A 1FRLA 1UCNA 1Y5LB 3DHXA 2MY7A 5D4NA 5BJRA 1S1XB 5HBMB 2VJUA 5AE2A 4DZDA 3KLGB 3O6QA 3IR5B 5F8IA 4OYOA 3NCRA 3TP2A 2BR0A 2H1YA 3H7HB 4TY8B 3VF0B 1FDNA 1WEXA 2HGLA 3BO2A 4DR3J 4ZVSB 4OJHA 1IBMF 1HQUA 4PR6A 5AE1A 1JJ2R 1S6PB 3CGIA 1XR5A 2Y9HA 1FKPB 4IRCA 2F8MA 4DBQA 3CVKA 2VPZB 3MPVA 3GV7B 4CO4A 2J6SA 4DV7F 3P3DA 4J9LA 2RU9A 3HVAA 3FSIA 1AXQA 3U7JA 2CNKB 1LK7A 2DNHA 3SXLA 1C4AA 4M5JA 2WVEA 2R7TA 4OL8A 5KT6A 2V4QA 5M2RA 4IQXA 4R0EA 3TVYA 4I64A 3IS9A 2C2OB 3DOLB 5DDOC 1NUEA 2XNRA 2V4JA 2ASLA 4D3HA 1NKCA 2K1RB 2HZVA 5I42A 1PO6A 1RLDA 2UUCF 2H9ZA 3TWZA 1BY9A 4C8LA 1S6UA 4ELVA 5F0WA 1BQMA 4CP5A 3DDNA 5C25A 2E9RX 2XTJP 1UAWA 3G86A 2KKHA 2AV5A 2XZDB 5DZ6A 3AB4B 3G6XA 1ELOA 1Q16B 2VD3A 2V34A 3KUEA 1TQLA 3N5FA 2H48B 1N33F 2C2MB 2DHXA 2V9KA 1RTJB 4OI0A 4I6YA 1FNXH 1CQNA 5IC4B 3FBCA 2RSQA 4CYUB 4K4WA 4F3MA 1T05B 3NGRA 3CJ0A 2ZOMA 4ZITA 1SH0A 1SV5A 2I38A 1S1VA 1NB7A 2OIHA 3FEXB 2FY8A 3CCTA 5LSRA 2QL7B 1S6QB 5IZHA 4MK8A 2I5JA 1RTDB 3RJMB 5EX3A 3AODA 4CLFA 4JOUA 1TL3B 1ZM4A 2DTJA 1RKJA 2XLKA 2UV8G 5F8GA 2M8DB 7AT1B 2HG4A 2DEIA 5F8HA 2YNHA 1FNMA 3VVTA 1XN9A 5DQHA 1FF2A 4N5SA 4MAKA 3CJTA 4DR2J 3FDSA 1A7GE 2P5VA 4KHMA 3ET6A 4LVNP 3TZXA 1C1CA 5EDWA 2FJBB 2CUYA 1FRKA 1EARA 5L1LA 4LBPA 4MK9A 5B08A 1TAQA 2W24A 2BM0A 1YSJA 4ZHRB 2EFNA 2XCPA 5D3GB 4G1IA 4PEOA 3QQCD 5A8WB 1O5JA 2DNQA 2DH8A 3FBEA 4H4KA 4ZP9A 1JLGB 3UI3A 1B3TA 2VL1A 3PKMA 3D4JA 1WSRA 2M9KA 1YJUA 3GFYA 2ZKTA 3KHGA 3N6NA 3MZIA 2B8QA 3MECA 4DI6A 3SCLE 4WE1A 2BOPA 1UEKA 5E41A 2J9EA 1UFLA 3Q89A 2LQ9A 3VGTA 1UVNA 4EBCA 1EKRA 4ALZA 3ZZRA 3MM7B 2GGPB 4Q43A 3QJPA 2A2CA 1TMJA 4JI8J 3T6JA 3CUNA 2X1FA 3KWMA 3K57A 1N34F 2O3DA 1RWMB 4QPXA 4BDPA 3HHLA 1Y3JA 3TARA 1WF1A 3U02A 4P72A 1SPBP 3A8IA 3S7RA 4HI2A 3GZ7A 1XBWA 2PI4A 1O6XA 4DUZJ 4WTOB 1NSKL 2RS2A 3D6TB 5E3CA 2IVYA 3CCMS 1GT8A 2B51A 3LA0A 4PXDA 1HBMA 3E8OA 2NLWA 1VFJA 4DZ6A 1IBCB 4FBTA 1RCOB 3VR1A 2DJWA 1K8AT 2C42A 3JSYA 3VGSA 4DV5J 3ZZUA 5AT1B 2OPPA 3QAUA 1HBOA 2CQGA 5M2PA 2B5JB 4I2QB 3ZNUA 3NGKA 3E3XA 4C11A 3J7AN 4M5MA 4OQJA 2HVZA 2OD6A 2NXJA 5J1EB 2VBYA 2VDIA 2XY6A 1G7CB 1BQXA 4C4WA 4DCPB 2UXDF 1S72S 1KN6A 2M88A 5LM7E 1Q4RA 2GVZB 4C98A 1IUJA 3E01A 1D9AA 2FDNA 4RW7A 5DGBA 2KVQE 3ICLA 5KFXA 2EC0A 1RWOB 3DI6A 1Q8IA 3OL9A 3IWXA 1SKRA 2RMLA 1X9SA 1FESA 3JTNA 3L9ZA 5CD4H 1VMBA 1S79A 4A47A 1KQGB 2RIJA 4L73A 2HRTA 3MM8B 1L3KA 2VA3A 1S77D 5J2QA 2ZHAA 2CYYA 2FGOA 2WVBA 5ETOA 3JTOA 3M2RA 4EWTA 3CJSA 1S4EA 1N8RT 4WKYA 1QSLA 1TKZB 4YB5A 1OQ3A 3D0IE 3KK1B 2GNKA 4DQSA 3I56S 4ZPTR 7FDRA 5KFLA 1BXNA 3F73A 4NA1A 4WXOA 4JUZA 3OPKA 1N5QA 2MZ1A 1WOOA 1FA0A 1N5YA 4XAKA 3TRGA 4ZLJA 3WDOA 1Y4ZB 1R8CA 2QX0A 1U1LA 2HVEA 3MEDA 2IIHA 1XNRF 3VZIA 3M2UA 2V68A 2VG6A 2GMLA 4ILMA 3THTA 4QZVB 2BX6A 3PVXA 3MPDA 2ZBPA 1HI0P 4B3MF 1F5CA 2ZVSA 2FY1A 4R0JA 1SVDA 2YBVA 2CIMA 8AT1B 2QV6A 2FLOA 2YWGA 4X4RA 2HNDA 4RBTA 4UTGA 3MUMP 1E6VB 4B9NA 2CZVC 3P8BB 4FS2A 5HROA 1YRUA 4K50A 1XMQJ 4BWJA 3IBFB 4QR0A 3T1YF 1F3FA 1A0OB 2MZTA 4A48A 2CPJA 1RB0A 3MHYA 1YJTA 1ZOTA 3D54A 4LRBA 2Y0BB 4DFPA 3W5ZA 4OJ1A 2BQUA 3NMAA 4PQUA 1HI8A 3I0SA 2CPIA 1HNXJ 5FJ4A 1TL1B 5T7LB 1J27A 3ILLA 5ADZA 3ONQA 4CT9A 1IBLJ 2R7RA 5KFKA 1JKHB 3EXYA 5C42A 1RAAB 2WHOA 1RHRB 2W7OA 3NLCA 4LMZA 2R7VA 4U7UD 1TELA 2Y8YA 1S57A 1FCAA 3FEZA 3IO1A 3CSKA 3R27A 2G9OA 3HFZB 1UVLA 4P74A 3ADAC 4BS2A 3DOKA 4FBUA 3CWJA 3QIPB 4TLRA 5B0CA 1F6TA 1RUSA 4K4TA 1H2UX 1XR7A 2B4UA 1K1SA 1QAIA 5D0HA 1HHQA 4QYZJ 1QVFR 2KHDA 1I6JA 5L9XA 1TU0B 1BE4A 3O3LA 1CG2A 4DJBA 4C9DA 3FVYA 1RT1A 1S1WA 4ZA1A 2M0GB 1HD0A 2B9EA 2XZWA 1TAUA 4USMA 4XPEA 1Q5VA 4P2MA 5L38A 1TVRA 5ETMA 4CM2A 4UZBA 3T5HA 2YVSA 4U95A 1JIHA 1EZZB 1S1TA 4YDDB 2UUBF 2E5HA 2IC3B 4URQU 5CCLA 5AJ3F 2XHWA 1CC8A 3O8WA 2AJ0A 3OFHA 4BLGA 3AXKA 5EHHA 5J2PA 3H20A 2B43A 4IR1A 2A10A 4FVMA 3MPUB 4ZVPB 1RT5B 1ZAWA 2J0QD 3FK4A 3LW5C 2BM1A 1TTHB 3ILJA 4YR2A 2KB2A 3NBPA 3QLHA 4MIAA 1KHVA 2WAQD 3PHTA 4K4YA 3ITHB 2M70A 4HT7A 2E44A 4DV2F 3UDVA 4IH5A 3LP2B 3KK3A 1F2GA 1H7WA 4M63A 3M8PB 4F4WA 5A0YB 2WVFA 2BJ1A 2E1MC 3WHIA 5JMNA 2MHNA 1RAOA 1YLXA 1WDDA 2J5AA 2OAUA 1OIAA 2XMKA 1ITPA 3OFEA 3BSOA 4RW9B 2YX4A 2WBRA 2CJ9A 4NLWA 3US5A 2HFVA 4ECSA 2HVIA 3TX8A 4JI0J 3M8QB 2Z30B 3CCJS 1HWLA 4JI6F 1KVJA 3CTRA 1P1LA 1RT4B 2WONA 4TQSA 4KC5A 3Q8QB 2RF2B 2W4DA 4ILLA 2BW7A 3CEDA 5B0EA 4UW2A 5F9NA 4ZCMA 2N3LA 2UU9J 2MKJA 4GKJJ 1RACB 3PV8A 2KT3A 2VG7A 2MQMA 5H9FJ 2PO4A 4RW8B 2DR5A 2ZEJA 4LSNA 1H38A 1OSCA 3MCNA 2W7PA 3HVTB 1DRZA 1R89A 5CQGA 4ANDA 2YWKA 5FDLA 2W9CA 2YKAA 2KXHA 1PC4A 1RGVA 1N5VA 3M6UA 4UF4A 4OJGA 2XC9A 3GLJA 1RU2A 2VODA 1SJFA 4RW6A 1M90T 2VG5A 4B3RJ 1TKXB 2YWFA 4MKYA 4DV7J 4L3NA 4J9SA 3T6BA 1WI6A 5IV4A 2MXYA 2DCUB 1S9FA 1EETB 5LT5A 4C8YA 3BPSP 2A0FB 2P9GA 3A1YG 5ETKA 3HULA 4XK8C 2VICA 5JVHQ 1X4GA 3W63A 5LOQA 3HSDA 3DOMA 4OZLA 2AHOB 1R8PA 1IR0A 4OLOA 1SQFA 3X1LB 3W64A 3KNGA 1EAYC 4QIEA 2HZCA 1REGX 3MMBA 3FCWA 2HFUA 1C0TB 3ELHA 1BWVA 1UW4A 2DK2A 2JVOA 1OO0B 4FF4A 1YQHA 2MJNA 2ADCA 4N8OA 5E3QA 2EWHA 1LW2B 5KG2A 3FSXA 1VQ4S 3EGVA 1T8EA 3FQKA 4EGLA 1LNQA 3G6YA 2LECA 3G87A 4PUOA 2CQHA 3HFKA 3M2VA 2CZ9A 3VAGA 4WF9Q 2MZQA 4ZVUB 4AFFA 8RUCA 4Q5VA 1FDDA 2IRXA 4P75A 4UY8T 4NCGA 4O3OA 2JFDA 2ACYA 1WC0A 2OPSB 2P6SA 2GJ2A 4FXDA 3THPA 4JI4F 3CCUS 4CTAA 3BO3A 4MT1A 3RRGA 2L3MA 3PEHA 3K17A 3GJTB 2E9ZA 1GMUA 4KHRA 1DQ8A 1TK0A 2PIIA 3AD7C 3QZ8A 2H3EB 1C1BA 3D6MB 3VGUA 2DNZA 1AZSB 4WIQA 2HNZA 5CYQB 4I6WA 1VLOA 2Y1LB 5KFQA 4FYXB 3DXBA 4OHYA 1IR2A 2DRAA 4DR7J 4A8MP 3PW5A 1VC0A 1NKEA 3I4HX 5EWGA 2DITA 3DRPB 4ZKAA 1T11A 2VPWB 2R8JA 4KY3A 2XO7A 2BABA 1U7LA 1ACMB 4KYZA 2D3UA 4MKVA 4WFYA 3QRRA 4I2PA 2W9AA 1PBUA 1SV5B 3L3CA 1S1VB 4RKUC 3R2CJ 3ZO7A 3MM9A 4X4QA 1SKSA 3BZQA 2OEJA 5DS7A 4MH8A 2YH1A 4X64J 2QSFA 3ILOA 2DO4A 4ZN1A 3C16B 3V4IA 4F4ZA 2IMOA 5JVGQ 5D6GA 4GVLA 1RCXB 2BRLA 2HIQA 3PEJA 2DGUA 3DC2A 2YNHB 2FPHX 3BS9A 3IN5A 1G4CA 3AA8A 3HJFA 2HRYA 4U9RA 1X9MA 3JAMU 3MMCA 3UW1A 4K4VA 3ET6B 4K4ZA 4KIAA 2JZ5A 3PTWA 3G6VA 1UJ4A 4QWCA 4YUDA 3MURP 3Q2SC 1TP7A 4I0WA 2Z58B 3MPWA 2EFGA 1TKDA 3MM5A 2V0NA 2MLZA 3M8YA 1UTAA 1D9FA 2HBZB 3CD0A 4AXJA 4LVOP 4DSFA 3MR6A 5HK4A 3H98A 3TANA 1NDLA 3BM7A 3A12A 2B9YA 3V5RA 4TLQA 4WE1B 5KT3A 4UOFA 2CVEA 2EC2A 4WFAQ 2CQIA 2MY8A 4B9LA 1GXUA 1LV5A 1RWPB 2UXDJ 2QRRA 3D0GE 3IM9A 1RTIB 4B02A 2XS7A 4A46A 4LFBJ 4K2JA 5D4PA 5K5MA 3NGUA 3QT7A 1KKHA 4CCHA 2M2BA 3M30B 3HHLB 4U7UK 4K7QA 1N4LA 1GFWB 4RNFA 3FRZA 4LRCA 1F9HA 4ELUA 4J9MA 5A76A 2PN6A 5HVGA 1KFSA 4F4AA 1UJ5A 4DV4F 4L76A 3RW7A 4EEYA 1UL3A 3PM9A 3HFVA 4BWMA 1NCLA 5GVQA 2QEXS 4Z2XA 4H54A 2DGXA 1FFGB 1KVKA 2HIYA 2WRMA 2OPPB 1HBOB 2C3PA 1RKIA 3RYLA 4F02A 1ZZNA 1NK5A 2VFVA 1ZM3A 2AGQA 4PWWA 4DG1A 4JI3F 2XY5A 4NLGA 2HFNA 3PJXA 5KT5A 1F1BB 4O3SA 1Z2LA 3I0RB 4G65A 2OD4A 1RT3A 2AJ2A 3OHAA 4WFNQ 3SQGB 3UD5A 1JLFA 4RW7B 5KFIA 1U26A 1S97A 1K9MT 3VQTA 3DFEA 4Y00A 3BBFA 3DI6B 4PWUA 4DL4A 2I1RA 2DR8A 1RXOB 1SQGA 4EFAC 2GX8A 1HKAA 2PMHA 4RBVA 2DCLA 4I68A 1K47A 3IR7B 4A4JA 1S9GA 1NK4A 3EUNA 4NLOA 2KJWA 4W98A 1NBEB 4J9KA 3OTDA 1S12A 1YRXA 1FJGF 3MMJA 4CH7A 4DQRA 1X5OA 2B0GA 1WSVA 4LF8F 3W65A 3CCVS 3G71S 4RLEA 3FFIB 5HI7A 2HHUA 2MKSA 2HNYA 4M5NA 4RPFA 3D28A 4ED7A 3QATA 2IRYA 3DRSA 3JAMY 3QYYA 3GJQB 3EX7B 1HNZF 1RBLA 3TUIC 4Z7YA 5BYQA 2DIVA 2VG6B 3M32A 3TA0A 2PEBA 2UVRA 3P5TL 1VQYA 1SIWB 3IBWA 1BUXA 4UT4A 2KG0A 2VFRA 2NXCA 4ZP6A 2IJFA 2ROEA 2ZNZA 2VOPA 1CULA 5F8LA 2VASA 5EUHA 2OPRA 2VFUA 4HACA 4Q8FA 4ZS6A 1YZ6A 1UPMB 2ZH4A 3KHHA 2W2QP 1T9XA 5F0UA 3ZTSA 2HNDB 2XULA 2AGPA 2BE2A 1U1MA 4OZ1A 5HROB 3O1LA 6FD1A 3R8YA 4JV5J 3D9BA 2N82B 3U27A 5KFFA 3BV8A 1WC4A 2M5YA 3FGVA 5HLFB 2LU2A 4H4OB 1QAYA 4QIGA 4DF8A 1U47A 3EZUA 3BYRA 3I9ZA 3U1MA 2KVIA 4BHQA 2MKKA 1YHQS 4BC7A 2J9DA 3F44A 2MQ8A 1D09B 3MWBA 4CRJA 1Y9OA 5LJ3Y 3QPIA 1RT6A 4OYXA 2U1AA 5H9EK 3UN5A 3BKFA 3A8KA 4RO0A 1U6FA 4DR1J 1JNZB 4EK2A 4ZVQB 1RAJA 3Q24A 4RUCA 2QZ8A 4OIXA 4OHWA 3L7PA 3RUBL 3DOKB 3TEGA 1SJRA 2Z2MA 3ZZZA 5BXIA 2GVDA 4IG0A 4AL7A 1S5ZA 2FVSA 3KOAA 3CJ2A 4LR9A 4P2FA 2JH3A 1LWCA 1UA1A 1XNQJ 1FRHA 3G9CA 2AYGA 1DLOB 4W4MA 1AROP 5D15A 2ZHOA 3DDKA 1JLEA 5E3PA 3QSYB 4Q45A 3LP0A 4AQYJ 4CLPA 1TVRB 4IO9Q 3DLJA 5FLXU 4Y2KA 2MJUA 1SUQB 4LT6A 1N0UA 4IG3A 4ZPBA 1QUPA 4B17A 2FJWA 4MIWA 1H72C 1G6BA 4P52A 1S59A 4PPDA 1OJ4A 4J5OA 2ZWOA 3MPYA 2O5DA 2ZD1A 2G0JA 2EPIA 3UDLA 2YWWA 5JXSA 2FHJA 1W2BR 3HPOA 3GILA 2YKQA 2H51B 1SC1B 4NLSA 1NH8A 2UXBJ 2BKOA 2GJFA 3NBPB 3QLHB 2XZTB 4KPYA 1PJ7A 4BBYA 2G2OA 1KRPA 3QFHA 3OHBA 3KK3B 1LFPA 5KFJA 1XEZA 4A8OA 4LF9F 3AY0A 1S1XA 1X5SA 2MQPA 5HBMA 3C8YA 2HHPA 2QT7A 3FZ2A 2VZ9A 1JB0C 1LOUA 2CQPA 3KLGA 1MWQA 2IYIA 2HFOA 2F65A 3GFZA 3MFIA 3H90A 3W9JA 4URGA 1RWUA 2B4VA 2MTLA 4TY8A 5K20B 4WP8A 4ITSA 4ECRA 3MOZA 3Q2TC 4ES2A 2DRDA 5J2NB 2ASDA 1S6PA 2AYBA 1FKPA 2WONB 2CNLB 1YI2S 2R7OA 1H0HB 1RBOB 3E2EA 4USWA 4FYYB 4HH0A 3POTA 2LLZA 2BJDA 4RR5A 3OL7A 3U1NA 4JI7F 3MAAA 2MB0B 1S1UB 5FDLB 2W9CB 3RRKA 2Z2ZA 4FS1A 1WEZA 1U1PA 4WZMA 1NJIT 2XSFA 4RW6B 1PG5B 2GHWA 1H2TZ 2HHXA 2VG5B 1CJUB 2J7UA 3EM1A 3UR0A 2JOQA 4WU2A 2RRNA 3CJQA 5K8MA 2K3IA 1NK6A 2OI2A 2VC1A 2R4FA 3MEEA 3MAHA 2Y8WA 3NCQA 3K5MA 2EK6A 4I7FB 3B8HA 2ALYB 1V3SA 4KHPJ 1P6TA 5CYJA 4A8SA 4JI5F 1UFWA 1H3DA 1HHTP 3BF4A 1QSSA 2DRBA 3C6TB 1VJWA 1D8ZA 2POKA 4EYIB 2ZH2A 1IN0A 1IBKF 5F8MA 2P9CA 2EKYA 1OPZA 3Q8VA 2QFIA 1RTZA 2FJVA 4ZJOA 4NLQA 3DLHA 1YWXA 3WC0A 1M0SA 3QT8A 4J37A 3F0NA 2H5IB 3PIPQ 4CYUA 2WK4A 1W26A 3MMBB 3T1AA 2C2NA 3KLVA 2YXLA 3LTOA 3RB4A 3T1HF 2N3OA 4AXIA 1S6QA 1RSCA 1RTDA 3GYGA 5D4OA 2H5EA 1VR6A 3AOCA 4O0NA 3FQLA 1IM6A 3ZFVA 5LL6d 1M5VC 5FLXY 1EQ0A 1SC4B 3EE3A 2PI5A 3S01A 1NK8A 1X9WA 4PUOB 3C2PA 1YJ7A 3IG1B 4ECQA 1GXLA 1Y3KA 1X4BA 4NCGB 4M5GA 4W90B 4DX5A 2KL8A 2KFYA 2DGTA 3C19A 1Q7LB 2OUGA 3MDFA 3MM6A 1NJWA 4QU7A 4TY9A 4QW8A 2V8HA 3JS9A 2MGZA 4O23A 3ZC4A 3H0PA 5F9LA 1QDUB 2ABYA 1U2FA 4ZHRA 1SC3B 3OL8A 3MFHA 5KFAA 1V9OA 4NEYA 3AHPA 3OTEA 9ATCB 5D3GA 1U2RA 5LMNF 4OMFG 4WP9A 5A8WA 5BYSA 3Q0AA 4HKQA 1JLGA 3KTQA 3DKDA 4NE9C 3KLIB 3R2DJ 3QZ7A 4ED4A 1TV6A 1R7IA 2HHVA 2R8HA 2LEAA 3VV2B 2CPFA 2EBEA 3FNNA 1WC6A 2L48A 3BR8A 2GGPA 5HMZA 1HR0J 1UETA 1KLMA 1FERA 4NXMJ 4WXWA 5G0RA 4X62J 4N47A 3VAIA 3C66A 3R1HA 5IWAJ 4IR9A 5RUBA 4I2PB 5JUMA 3PY8A 4JI2F 3D1QA 2VH7A 3HO1A 5CYMB 3EMTA 4ZVEA 2IVFB 1LFWA 1F2HA 3MM9B 4RUHA 4KRWA 3CJ5A 5CCMA 1OSDA 1Q7YT 2QLBB 4ID5A 2NREA 2RQKA 2BJ7A 7FD1A 1RAEB 3D67A 2CDRB 5KFWA 2DD8S 2MKCA 1T0TV 2APOA 2FB0A 3LQVA 5IOLA 2AZ1A 4NMXA 2PEHA 1LWEA 2CG4A 1M5PC 2FZCB 3AJ1A 2ZNYA 1I94F 5DRKA 3U1LA 4J9OA 1WELA 5KFOA 4DV4J 3ZTQA 4ERDA 1JXVA 4L3KA 3AAWB 1SL0A 1U1OA 4CNYA 4JV1A 2LVWA 2YKMB 2MKYA 4RNNA 3QGPA 2CAJA 1WKKA 1NSQA 2UUAJ 4G1QA 3FZBA 2ZHBA 1MROB 1H73A 2ZM6F 1YX2A 2MLXA 1U1QA 4B3SF 2H54B 4Y2CA 4DF4A 4NASA 1GTHA 2HHTA 4OYPA 4QIWD 4XPCA 2WCXA 2XMVA 4ILRA 2AJ4A 2C22A 3ENWA 2KG1A 4RU9A 2VKRA 3GWCA 2L9WA 1MU2B 5EX0A 3KJNB 2R7QA 3ZZTA 1TR0A 2VQFJ 4PAAA 3OVSA 5E33A 2N7YA 2QA4G 2PMZD 1T7PA 1U25A 3QRQA 1Q82T 5J1PA 3IM8A 1IKXA 4ZPWR 3R7SB 3PR4A 4BC9A 4FF1A 5HVFA 1UA0A 4NI2B 5KFGA 2KM8B 3DRXA 5B0BA 1WHXA 5EN1A 1FJGJ 5L9NA 4Q2MA 4LQ9A 3OT9A 3IC1A 2DHSA 1UVJA 4LF8J 3KNAA 1N5TA 2BBEA 1L5UA 2E29A 3A8EA 2HQFA 3OUYA 4B08A 4KGVB 5KFSA 5K14B 4MJKA 4WFXA 4NYPA 3BKUA 2VUGA 5HQMA 2W2OP 1S7HA 1VBXA 1TL4A 1D0EA 4X84A 1HNZJ 1EKSA 3BEGB 2XMTA 4M94A 1YJ9S 2P2CB 4ER8A 4WPAA 5D8HB 5KFVA 3A8JA 2OKQA 3HJVA 3BGUA 2ACMA 2UZAA 4WJBA 3JB9k 1T03B 1FRXA 5DJBA 1DARA 3ZTRA 3R1LA 4KPCA 2CQ0A 4ZVOB 1N6QB 5A8RA 3F41A 1CJKB 1T95A 4K8RA 1TL1A 1TMMA 5T7LA 2V8DA 1VK3A 5KOXA 1JKHA 1TK5A 3SZ2A 1LWXA 1N0VC 4HL9A 4OI3A 3I5BA 2DBBA 4KBIA 1LXNA 1NEEA 4NXNF 2B3TB 1S6OA 1F60B 4DSJA 1UWBB 2PMWA 1S0OA 1S49A 3GFHA 3W8PA 5DDQC 2FJEB 4DPOA 3S6EA 3QIPA 1VQNS 3Q8SB 2KZZA 3HHNB 3BPDA 2XGPA 1T02A 3FKBA 1KVIA 2VIHA 2ZOGA 2LEPA 4DQPA 1B0TA 3H2LA 3NOCA 3SSQA 2W9BA 3CD7A 5IV3A 1XTZA 4O4GA 2HHSA 2FZKB 1J5EJ 3NL0A 2DY1A 3AD9C 1B99A 3ZTPA 4P71A 1KFDA 4PXBA 3K0JA 2A1BA 1URNA 3PYFA 1G2EA 2P9EA 1D3WA 2EW9A 2D69A 2VFTA 3V6DB 3TAPA 2V5HG 1FKOB 2QN6B 2DXFA 4HVZA 2BE2B 1CEZA 4OYIA 3TOQA 1GAOA 4RWXA 1NM2A 4OYBA 3GJSB 1L3UA 4DV0F 2M4MA 2JRSA 2AYMA 3D3CJ 2ZZMA 3MMAB 4LFCJ 4C8ZA 2IVMA 3OTOF 3ZZPA 1VQPS 3IA0A 2DNLA 3HMJG 2FIUA 2F3JA 2VF3A 2FJXA 4U8YA 2NCKL 4USHA 3LH2S 2C1EB 4ECVA 3T9ZA 2LEBA 3LP2A 3DGPB 3M8PA 3BGRB 4CT8A 2FJDB 3PJ9A 1RT6B 3NEKA 2KFNA 3ENQA 1HNWF 2ZBIA 1FNOA 2H65B 4EO8A 4YHHF 5EWFA 3CJKB 2GV1A 4I56A 2B7CB 5HP1A 5DDPC 3GMGA 1Y5IB 5KT4A 3CC4S 4RW9A 4OI1A 4IG0B 4RNHA 2BJ8A 1NJYA 1R6YA 1REVB 4M95A 1U0HA 4B3TJ 4IRKA 1U45A 2J8AA 1RT4A 3W2WB 2RF2A 3DYAB 2EFVA 2IM1A 4K0KJ 2HQGA 1YBUA 4ZCKA 3QJJA 4CNZA 3BKTA 1VQ8S 1JLEB 2RKIA 5HMXA 1RA7A 2R7UA 2MQLA 3J80U 1RK8A 3SEOA 3NCPA 2LQ5A 4KSEB 1JJ4A 2AZ3A 3HVRA 4J9VA 4ENOA 2ZD1B 4OI6A 1OS5A 3KG4A 2OLWA 1ULRA 2KRBA 4DV6F 2HURA 1EX8A 4JV0A 1TKXA 1CVJA 2XMMA 4NEZA 3IXQA 2RS8A 3L09A 4RNOA 3M1VA 3PW7A 1RDRA 1YJRA 2ZUAA 2CQ3A 2RRBA 2OEMA 1XIQA 2RNEA 3I87A 4M5DA 1EETA 1TUGB 3I4PA 1FWKA 4Q2LA 2PGCA 2RH3A 3HXMA 4AYBD 3ETMA 1D8YA 2QL5B 1NK0A 5B09A 1CJTB 3R6LB 3DU6A 1SXLA 1FK9B 5E3AA 4UUXA 2OJ3A 1HNVA 2DGQA 1PBAA 3M9OB 1CLFA 2KO1A 3OL6A 4IOCQ 2HGMA 1UMJA 3TJAA 4GO7X 3J81U 2WVCA 2D1CA 3FBFA 5DG8A 1C0TA 3DLEA 1URRA 2NSBA 1W7WA 3DRYA 4JI5J 4DR6F 1XMOF 3OFFA 2AEJA 3T9NA 2FZGB 1LW2A 2KI2A 3HHLD 5SUHA 1IBKJ 1OY8A 4LF7J 5T41A 2Y3YA 1DY3A 2W4PA 4OI4A 3POTB 2C2RA 3LPEA 2OHDA 1SH2A 4ECYA 4ETZA 4W92B 2CJQA 5HN0A 2E5LJ 3HD2A 1DZ5A 3MAAB 3W8GA 1J5OA 3CMES 2CPHA 1VQMS 3EGWB 2ALZA 1QY7A 1SQEA 3GU0A 1D9DA 4DOZA 4NRUA 4KT0C 4IH7A 1BGXT 2IHR1 5E5NA 2OPSA 1S99A 1A6LA 2CPZA 2HK3A 2DNMA 1K0VA 2YWEA 4RW4A 2QO3A 2XQCA 3TI0A 1M5HA 3WC2A 4WBFA 2A3JA 3K59A 5T14A 3L4BC 3CC2S 1GK8A 3MEEB 4PPZA 4MYUA 1AZSA 2EFPA 3CCWA 5CYQA 4F0MA 1K0TA 4X4SA 2X1AA 1X0PA 2HRUA 3LAMA 3UN3A 1NRKA 4QJVA 2LXUA 1WG4A 2XWYA 4N77A 2YY3A 2DHHA 3H4BA 2GQCA 3DRPA 2C28A 2XLIA 2P6TA 3M7VA 4WYLA 1SCJB 1KC8T 3EYZA 2R8KA 5HO4A 5LMNJ 1A9NB 4ZLPA 1FWPA 2LDYA 3J7Z5 3AQPA 3JSBA 4ZN3A 2VONA 5IXUA 4Y28C 2DNKA 5KFMA 4NOHA 4PG7A 3R5CA 4OX9F 1N5SA 2BYCA 1ZPWX 3G8QA 3C16A 5C5JA 4F2RA 1V5IB 5G4DA 4Y6IA 5I4MA 4TVAB 2KM8C 5CD4A 3J80Y 2J76E 2F9JA 4WWSA 3F56A 2F4VJ 1X60A 1GMVA 2EFQA 4F4KA 1RT2B 2WB4A 3P45B 4DFMA 4JI2J 3T41A 3NXZA 1N36J 1HL6A 1C2PA 4ED6A 2OEKA 1DTQB 2B9XA 3MM6B 1EIYB 3UVJB 3RBDA 4Y0FA 2MGZB 1NPKA 5F8NA 4KR0B 2NXEA 3S8SA 4NZ0A 3TX0A 4UQGA 1FFWB 3R5JB 1P8GA 3T5KA 4ETXA 4IYQA 5IQQA 1QUVA 3CB4A 1I94J 5HJYA 3CIZA 5A6PA 4Y34A 1TV6B 4F50A 4ID8A 1VDHA 4K5RA 2VV5A 3W66A 2OTJS 2VQEF 2UVUA 3QGHA 1DTTB 2ZM6J 2F8EX 3CDUA 1RTIA 3J81Y 2YNFB 1KLMB 1S0NA 3SV4A 4O3RA 1ZYQA 5G0RB 4CLKA 4Q8EA 3M30A 1RAHB 2J0SD 5DETA 3V81B 1VQ5S 2OO4A 5DM7Q 2MQNA 3P4UB 1Z2ZA 1OY9A 4ID5B 1FX2A 3GP9A 2GIRA 3D1HA 3JQJA 5KG1A 1I3OB 1T9YA 1N56A 3OQ2A 3GG0A 2HQ3A 2KZMA 1HPZA 4YEAA 3C15A 1HBNB 3GIMA 2Z56B 3AD8C 3H42A 2Q1LA 3E51A 1N52B 1LWEB 1VCTA 4TN2A 4I69A 3CDWA 3PG9A 2ZH3A 3LAKA 3KJQB 3TA2A 2GO8A 3SFGA 1IKYB 3KLFB 3MCOA 1FT8A 4F2SA 3PX4A 1RJJA 3O5TB 2QMXA 1PYTA 3QMQA 2J9CA 3EXCX 2X7IA 4NYZA 3I0RA 3PFOA 2GAHC 4G1QB 1OQ6A 4RNMA 3BR9A 2RQCA 3SQGA 4KB7A 3K5PA 3ENAA 2ZH7A 2N7CA 1JK9B 3JXOA 2C2KB 4C3LA 3I6PA 2HPUA 2EKNA 1RU1A 2AJQA 1B7YB 1FRJA 1ZM2A 2LXIA 1UP1A 3SSSA 3QIDA 2NUUG 2DB1A 1SKUB 3KLEB 3RR8A 1C4CA 5GADU 3EWGA 2CA9A 2V2KA 3HT0A 3PRDA 1JLQB 2RDJA 3OD2A 4CM0A 2DNGA 4O3NA 3OJUA 2LP4A 2AX1A 4HTIA 2QLFB 4DPWA 4OHVA 4S0MA 4X65J 3DMJB 5EGYA 2F1FA 1S9EB 3HLUA 4F36A 3N01A 2RHSB 4B3OB 2GMJA 2F9DA 1RQ0A 5GADI 2A18A 2D9OA 4OZ2A 2CQ2A 3FFIA 1IKXB 2GCFA 3VAKA 1O51A 1FTRA 1ZAVA 4C0BA 2FHMA 1YGYA 4CO3A 2LKZA 4OX7A 4ZP7A 4DXLA 1EQMA 1P27B 2CWXA 3WZ0A 4KE5A 2J9DE 4M5IA 4NMLA 4ZJQA 4KO0B 1KQKA 2AGOA 1EP4B 3NP5A 3HM9A 2ZE2B 4NXNJ 2OMOA 2DXEA 4QYZK 3OUYB 4NLXA 3I32A 1PYOB 4EBDA 2XSJB 1PJ6A 1PILA 4DUZF 3CIMA 4FDFA 4Q0BA 3Q8PB 3X3UA 3OSPA 1MG7A 3VHQA 1XWLA 4ZMMA 4ECTA 3HCXA 4DL5A 4NLPA 4DV5F 1WEYA 1VBYA 2QLXA 3M9MB 4F8RA 3IWLA 4CLZA 1R27B 2V9WA 2X1BA 2FHOB 2HAFA 2RE1A 5CA5A 3Q23A 2EBGA 5HLFA 4XTTA 4H4OA 3D7SB 2VU5A 5A8RB 1ZZFA 3PX0A 2XCAA 3GV8B 2R2TA 1FHTA 3NS7B 5HAOA 1VRTA 4C8MA 2FLNA 3PYEA 1UWAA 5KT7A 2WBMA 2C2ZB 3GIKA 2YKNB 3B4DA 3DNCA 4DL3A 1IKVB 3TYTA 2A2DA 1KTQA 2RDDA 1RISA 1HA1A 3KFWX 2IM2A 4R8UA 2WSFC 3OXGA 2C3MA 3WBZA 3V4MA 4J91A 5E0OA 2YWHA 1WUUA 2HS3A 1ZPVA 4FNIA 4R25A 3VAFA 1OWXA 2VBXA 2CNNB 1H2VZ 5AXLA 4NLTA 1KQFB 2MYFA 3KG0A 4NLRA 1IQTA 4LF1A 5LSLA 2W9BB 4O4GB 4KAIA 2Y1RI 3KUHA 1Q86T 4ED2A 4LF5J 1HNWJ 2HVHA 1HNIB 1DLOA 2X1GA 4YHHJ 4NCAA 3RU0A 3CXCR 1BHNA 3OR1B 1MWYA 5LMUJ 4WK3A 4ZVFA 1SUQA 3HZGA 2K7JA 1E6YA 3KKFA 3DLGA 4DUYJ 5H9FK 4GRSA 2KTQA 4AUKA 3G8TA 2BMBA 1WACA 5KT2A 2XMWA 4CLSA 1HIYA 2CQ4A 4TNOA 3PO4A 1NU4A 2B7BB 2UXCJ 2GAGC 3H2UB 2H4WB 3KJVB 1CS4A 4Z7CA 9RUBA 1HYSB 4A8WA 1FRIA 1NMEB 2FVPA 1RTHB 5ETSA 5KFRA 2Q79A 1DQAA 2I9SA 1P9QC 4ECWA 1TL5A 4MTPA 2XY7A 4BCAA 3SCKE 2WB1D 1RI7A 2ZBQA 3UWTA 2Y1JA 1AB8A 2UUTA 2EG2A 1FX4A 3VWSA 4X4TA 1NJXA 3DLKA 1YKWA 1D1UA 3HHKA 4FPIA 3TJ9A 2VB6A 4DV6J 2Q3PA 4EUVA 1NHVA 2FLLA 4L6V3 4IQMA 4YMEA 4K2XA 5HP1B 1HW8A 1N54B 4KH0B 1RA6A 2D9PA 5ETPA 2RUGA 2DH7A 3QSIA 4MKAA 4HHJA 4U96A 4P10A 1X4FA 3I55S 1L3TA 2ZBRA 5J2NA 3VGVA 3HSJA 2MKHA 1F0XA 1U0HB 1LKZA 1Q81T 1G1XA 2R2SA 4QCLA 2NYIA 1IBLF 5D78A 2HLUA 4LREA 4Z37A 1U0SA 2KXNB 2Y1IA 3R6GB 1FE4A 4LRDA 3CMAS 5KFDA 2RKIB 4I4BA 3QT6A 4HEA9 5B0FA 4ZDNA 1GX6A 1S1UA 2WOMB 2J6TA 5L46A 4I67A 2FD2A 4LQ3A 4DR6J 4DDFA 1IBMJ 5KTQA 3PYDA 1KDNA 2BXJA 4ANCA 5B7WA 2JEIA 3KK2B 5DQGA 4YQWA 4DQQA 4FNHA 4FYWB 1O0PA 1CJUA 4A8XA 1VQ6S 3KUGA 4F7VA 5C24B 2B6AB 3HK2A 5DM6Q 3M1VB 1PC5A 4I6AA 2B9WA 5IM0B 1FWLA 4M1KA 4M5DB 4CLLA 2MDAA 2IMWP 3THVA 4I7FA 1IKWB 5KG7A 1GX5A 2JLFA 3CNQP 3ZXWA 2XYGB 1Q5YA 1RHUB 3PR5B 2BE9B 1UVKA 3C6TA 3RAQA 1JJHA 2FTRA 1MWZA 1HNVB 2CQBA 1MN7A 1B7FA 1LW0B 2UUCJ 3CPWR 2VDHA 4QW9A 1KHWA 2O1PA 1WTBA 3MXHP 3CCLS 3W5YA 1IJFB 1QE1B 3CDAA 3DLEB 5A2QU 2VJVA 2K8GA 1Y00A 3AB2B 3SQOP 3JYTB 4OYAA 3Q8UA 4JI1F 1ZETA 2VA2A 4FF3A 4C48A 3I96A 1N33J 2NZ4A 1CPZA 1XR6A 1IWAA 2K7KA 3MR2A 3CC7S 2HLTA 4WK1A 3JTPA 2Q6BA 1J5OB 2BANA 3IG1A 4DX8H 3UDCA 1FE0A 2KXFA 3HHDA 2OTLS 1EHWA 1CBKA 2V2VA 1Y5NB 1HQEB 3RAMA 4C3KA 3R5BA 2HWIA 2AEMA 1JLCA 1CJVB 5D77A 2M52A 4ED8A 1U8SA 1CC7A 3W2VB 4JP8A 4RW4B 5ITHA 5CXTA 3DLBA 2Q6CA 4J90A 5CH7B 3LANA 5KG6A 2RHQB 2UU9F 4WZQA 4GKJF 4HYKA 2E1PA 3NKYA 4FXWA 3BB5A 3HZEA 3KLIA 5F41A 4ICLB 5F3TA 4LRFA 1JLBB 4GO5X 2HFSA 8ATCB 4K4SA 1TL7B 1C0UA 2GMHA 4MFBB 3VALA 1EB0A 3MEGA 3MGJA 2CG8A 4FZVA 2VPXB 1M5KC 3Q83A 4USKA 2ZJPQ 4B3RF 3NS5A 3UO0A 1F3VA 2HQCA 1B0VA 3H25A 4CLWA 3PXGa 1CQMA 5CYMA 5E3RA 3OFGA 4IDKB 4YY3F 4DSLA 4RZRA 1WORA 1G3OA 2VQEJ 2UVVA 2PA3A 4CO2A 1Q53A 4ECXA 1NPRA 1T3NA 3ZTOA 4V19X 4KKOA 4TU7A 3BSNA 2R8GA 3UNYA 1N34J 5J2MA 1H6KX 3T3FA 2OFHX 5GAHU 2VKZG 1X4HA 3DLLQ 4U7CA 4USIA 3EICA 2ZITA 4UOGA 2ILYA 2YKMA 2YKOA 4Q7AA 2Q66A 4H4MA 2QTWA 1MROA 2E5JA 2LA4A 3FC9A 4ED0A 4OZNA 3M6WA 2Y0SD 3Q8YA 3RAXA 5GAHI 1WDTA 1FO1A 1IWGA 1Y10A 1UEVA 1GMWD 5CZVA 4OHXA 4DUTA 1VQOS 5L1JA 2WW4A 2DGSA 1S76D 1FXRA 1U2CA 5CAAA 2WSEC 4P73A 1IXKA 4TXSA 2CKWA 3KMQA 1T9VA 2PE8A 1RWWB 3ISNC 1DAXA 4OZJA 1MU2A 3Q8RB 4PCQA 1M5SA 5A2QY 2FYXA 3K8WA 3FBBA 2HEKA 1H74A 2GQ2A 4PWDB 4NZ6A 3A4TA 2HBRB 1IVZA 1T3OA 3SBMA 3V6HA 3BN7A 3KDNA 4ES1A 2RDIA 3DGVA 1HW9A 2FVQA 1BQNA 4USJC 4IFVB 1HPZB 3C15B 4HLBA 4DR7F 2JDJA 3H8YA 4C6AA 3QAEA 4NI2A 2D3OR 2G4BA 5K9FA 1WHWA 2DXDA 5KFHA 1NPPA 4OX8A 1VC5A 2NZCA 3ILIA 3NRBA 2OELA 3M8WA 4G6VB 1RAFB 5K14A 3HKZD 2EXUA 3D6FB 5CABA 5KFCA 2CDQA 3HT3A 3I31A 1OMSA 3PKYA 3EDQB 2GHVC 2ERRA 2KT2A 5ETLA 3JQMA 3N0VA 3L7OA 5HQ8A 4X64F 4Y2AA 4KV8A 3PCOB 5L1KA 2DISA 1Z1ZA 1XNRJ
chains in the Genus database with same CATH topology
1P1LA 2HW3A 1RT4B 2WONA 4TQSA 4KC5A 2A1BA 3Q8QB 1JLAB 2RF2B 2E66A 1URNA 2IA0A 1G2EA 2W4DA 5L39A 2P9EA 4ILLA 4DSIA 1MSWD 2IBKA 4MYTA 4ZVHA 2R7SA 4X4UA 1D3WA 3CEDA 2EW9A 5B0EA 2XLJA 1MW7A 1WHVA 4UW2A 3V6KA 5F9NA 4ZCMA 2N3LA 3T19A 5KG3A 2VFTA 1SJ1A 2MKJA 2HAIA 3DN9A 2U2FA 3V6DB 5IQ6A 3TAPA 2GIQA 3PV8A 2KT3A 2V5HG 1FKOB 3H5YA 2VG7A 4DSKA 2MQMA 1TL3A 5H9FJ 2PO4A 4RW8B 2DR5A 2ZOFA 2HHHF 4LSNA 5THWA 1H38A 1OSCA 3IGNA 2QSWA 2W7PA 2HYIB 2E1AA 3HVTB 4HVZA 2BE2B 3UCUP 1T03A 1DRZA 1R89A 2JC0A 2W8KA 1AFIA 1CEZA 2GHPA 5CQGA 2ZH5A 2RT3A 2YWKA 3TOQA 2AJFE 5FDLA 3VAMA 4A8YA 2W9CA 4PWDA 1N6QA 5KFUA 1GAOA 2YKAA 2G0CA 3M2VB 2KXHA 4RWXA 5EWEA 1PC4A 1RGVA 1N5VA 4DV1F 2QA2A 1QAJA 1L3UA 2L9NA 3M6UA 4ATNA 2XB2D 4N8NA 3KHLA 4DV0F 2NSCA 2M4MA 3DRRA 2JRSA 4MK7A 4OJGA 2XC9A 1SL2A 2AYMA 2FHJD 4HDHA 4O44A 2C2DA 1RYRA 3MMAB 1SJFA 2VODA 2ZZMA 2VOOA 4RW6A 5I3UB 2ZJQQ 5E7OB 4C8ZA 3PW2A 2IVMA 1M90T 2VG5A 2VBZA 3FSYA 3OTOF 3ZZPA 5LJ5Y 1VQPS 3IA0A 4PRFA 2DNLA 1TKXB 2FIUA 2F3JA 2YWFA 3HMJG 4IFVA 4U67Q 4MKYA 2QLWA 1L3SA 2FJXA 4L3NA 4USHA 4J9SA 2YTCA 3T6BA 3BJYA 1WI6A 3CCQS 4CTAB 3LH2S 4ECVA 2MXYA 3T9ZA 2LEBA 2DCUB 3LP2A 1UWBA 4IOBA 3M8PA 1S9FA 1EETB 3BGRB 5LT5A 4C8YA 4CT8A 2FJDB 3I5CA 1SL1A 2UP1A 1RT6B 2P9GA 3A1YG 3MEKA 3H4DA 2KFNA 5CZXA 2GA7A 3ENQA 4O3QA 4RX6A 4KFBB 2PD1A 2MZJA 1HNWF 1XERA 1WD6A 2ZBIA 1FNOA 4EO8A 3IGVA 4YHHF 3PZPA 4F26A 1C1BB 5EWFA 3CJKB 4UY85 2GV1A 4I56A 2B7CB 1HWUA 3MUTP 1MMLA 1VRUB 4XK8C 1JNRB 1APSA 2R7XA 2HNZB 5JVHQ 5HP1A 5DDPC 3GMGA 1X4GA 1Y5IB 5F8JA 2JEFA 4V19J 2AF6A 3B78A 4OFZA 3MCSA 3MD1A 2ZH1A 2V8VA 4LFBF 5KT4A 3MR3A 4RW9A 3CC4S 3JSMB 2QFJA 4OI1A 2KYXA 3DOMA 5U47A 4IG0B 3G96A 4RNHA 4OZLA 1FJEB 1B0PA 1R8PA 1NJYA 2C2EA 1KNZA 3G6ES 1IR0A 1DHMA 2JC1A 1R6YA 4OLOA 1V6HA 1REVB 3GYNA 3CCES 1VQ9S 4M95A 3X1LB 3KNGA 3M4XA 2V94A 4QIEA 4NPOA 2HZCA 2W8LA 4IRKA 3CULA 3MMBA 3UD3P 1U45A 3LOUA 2J8AA 4IFYB 1RT4A 3OVAA 4ELTA 3W2WB 1JLAA 3TNVA 2RF2A 3DYAB 3MM7A 4K59A 3CCSS 1H98A 1C0TB 1S48A 1YJWS 2EFVA 2F4VF 1FD2A 2IM1A 4DFJA 2BZ2A 1UW4A 2DK2A 2JVOA 1OO0B 5AXMA 4Q0BB 4YDXA 4FF4A 4ZCKA 3QJJA 3V6DA 4CNZA 1VIOA 1VIXA 1YQHA 2DR7A 1VQ8S 1J2VA 1PSDA 2MJNA 2ADCA 1JLEB 1IQZA 2MMYA 2RKIA 2XBPA 4N8OA 5E3QA 1FKOA 5HMXA 2HMIA 3QWPA 2L08A 3CCZA 3HHEA 1RA7A 2EWHA 1LW2B 3K5LA 3QWUA 2LA6A 1X4EA 4DR2F 2XG8A 5KG2A 2YKPA 3FSXA 1N36F 2R7UA 2OP5A 4F4XA 1VQ4S 4LFAF 3TVKA 1T8EA 2MQLA 1VOMA 1NKBA 4NA2A 3FQKA 4EGLA 1RK8A 3SEOA 2EG1A 3BDEA 3NCPA 2X51A 3G6YA 2LECA 2LQ5A 3SI8A 1L3VA 4KSEB 4PUOA 4PG8A 1ZM9A 2HHWA 2CQHA 3HFKA 3M2VA 1JJ4A 3VAGA 3HF5A 4WF9Q 2MZQA 3LPYA 2DO0A 4FYDA 4AFFA 3V4IB 3N28A 3HVRA 3VCDA 4DWIA 4DFKA 4Q5VA 1FDDA 1FRMA 3MMAA 2RRAA 2IRXA 1X7VA 2ZD1B 4OI6A 1OS5A 1KSPA 4UY8T 4NCGA 3KG4A 2OLWA 4O3OA 1QAXA 1S10A 2JFDA 2ACYA 3DM2A 3RBEA 1ULRA 2KRBA 4DV6F 5DDRC 4M8LA 2OPSB 4JV0A 1TKXA 2P6SA 2GJ2A 4FXDA 4MIBA 1HI1A 1CVJA 2B5JA 4I2QA 4XDDA 2XMMA 1VQ7S 1U1NA 1VRTB 2RS8A 3IXQA 3L09A 4ZOSA 3MMCB 4RNOA 3MAQA 4B9VA 3M1VA 3THPA 4JI4F 3CCUS 4CTAA 3PW7A 1VQSA 3QGIA 1RDRA 1YJRA 3ISZA 2XS5A 3BO3A 2CQ3A 2RRBA 1HARA 3GYXB 1M1KT 3RRGA 1V3RA 2L3MA 3DGPA 3PEHA 3I87A 2RNEA 4M5DA 4OHZA 1EETA 3BGRA 2E9ZA 2XI3A 2ZBCA 3I4PA 4PXEA 1VK8A 5KG4A 4KHRA 1DQ8A 4TYBA 4Q2LA 1TK0A 2PGCA 1HWJA 2GW8A 5J1EA 2PIIA 4R8UB 2RH3A 3HXMA 4AYBD 3QZ8A 3MM5B 3ZZ0A 1D8YA 2CJAA 4EZ9A 1N48A 1K1QA 3EGNA 1C1BA 1XMBA 1NH7A 5L1IA 3CJKA 1NK0A 2DNZA 3N6LA 2AP6A 2HNZA 5B09A 5CYQB 4I6WA 1AW0A 1KS2A 3DU6A 4A8FA 3GB0A 5KFQA 1SXLA 1MMNA 3GR0A 3DXBA 1FK9B 4JI8F 4UUWA 2EK1A 5E3AA 4UUXA 2OJ3A 4OHYA 1HNVA 4ECUA 2DGQA 1FXLA 1X4DA 2DRAA 4A8MP 3PW5A 4QR1A 5DLGA 1VC0A 3M9OB 2IM0A 1NKEA 4WYWA 1CLFA 2ASYA 2Q43A 1REVA 3I4HX 1SC6A 2JEGA 5EWGA 2KO1A 2DITA 4PKDB 3OL6A 4RUAA 4IOCQ 1NAQA 3DRPB 1SJQA 2G1DA 2HGMA 1UMJA 4QU6A 1FEHA 4ZKAA 3OV7A 2M7SA 4GO7X 4IFYA 1SIZA 2VPWB 2R8JA 3RR7A 3W2WA 5KFYA 3DYAA 2D1CA 2XO7A 5DG8A 1C0TA 3DLEA 2BABA 3BQ1A 1GH8A 1U7LA 1NHUA 1URRA 2NSBA 2LU1A 3DRYA 2QA4S 4DR6F 2HQIA 1XMOF 4LSLB 2D3UA 5KG5A 4WFYA 5B0AA 3MM8A 3OFFA 3HDSA 4I2PA 1S0MA 2W9AA 3T9NA 1SV5B 4DMZA 3L3CA 1HD1A 1LW2A 1S1VB 2KI2A 4DLEA 4RKUC 3HHLD 5SUHA 4FF2A 1ROFA 3MM9A 5T41A 3G8SA 1KQSR 1E6YB 4X4QA 4J9NA 2E7XA 1SKSA 3H5XA 3QO9B 2W4PA 4OI4A 1SJ3P 3DLGB 3POTB 3BZQA 2C2RA 5DS7A 4NCBA 3HX9A 1SH2A 3BDPA 4MH8A 2YH1A 4ECYA 4Y3CA 2KYZA 4ETZA 1F5BA 3TAQA 3LGNA 1BLUA 2QSFA 4RBUA 2CJQA 4W92B 2DO4A 5HN0A 1TKZA 2E5IA 4O3PA 3AJ2A 1DZ5A 3V4IA 1J5OA 3GFXA 4F4ZA 2DVIA 2IMOA 3KK1A 3CMES 2MZRA 2CPHA 1YIJS 1FJCA 1R8AA 2CZ4A 1VQMS 2HGNA 3EGWB 2ALZA 1QY7A 1SQEA 5JVGQ 1M5OC 1RT7A 3LALA 5D6GA 4U6PA 4WTYA 1ZTTA 1D9DA 1T94A 3MR5A 1U48A 2ATLA 4DOZA 3V6JA 3TO8A 3LUYA 3RRHA 1VLYA 2BRLA 4NRUA 4KT0C 2HIQA 4IH7A 3KLHA 3PEJA 2DGUA 3DC2A 1X0FA 3C3LA 3W3SA 1YVFA 1Q79A 2YNHB 2FPHX 1BGXT 3BS9A 2IHR1 3BREA 5E5NA 2OPSA 3IN5A