2MZSA

Nmr structure of the rrm2 domain of hrb1
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
99
structure length
99
Chain Sequence
GSEVIVKNLPASVNWQALKDIFKECGNVAHADVELDGDGVSTGSGTVSFYDIKDLHRAIEKYNGYSIEGNVLDVKSKESVHNHSDGDDVDIPMDDSPVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein
molecule keywords Protein HRB1
publication title Gbp2 interacts with THO/TREX through a novel type of RRM domain.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 15
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2015-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2mzsA00
3G4SS 2ZJQQ 3LPYA 2CPDA 4TLQA 3HHNB 2MZQA 2HGNA 1IQTA 1NU4A 1Q81T 2OJ3A 2KG1A 1O0PA 2N7CA 3MUMP 3NNCA 2MQQA 3MOJB 3CPWR 1U2FA 2MGZA 3THTA 1R8HA 1XN9A 2DNHA 2DNZA 2KM8B 1X4GA 1YJNS 2YH0A 4WFAQ 3CD6S 2NZ4A 2XSFA 4FXWA 1U1RA 2MMYA 2KM8C 1KD1T 3B4MA 1YJ9S 5IM0B 5LJ5Y 2KU7A 4TU9A 2OIHA 2MSTA 2MJUA 1PGZA 3S8SA 2DNOA 4P6QA 3TYTA 3VF0B 2F9DA 2K3KA 3NMRA 2DH7A 3UCUP 4WF9Q 3TO8A 3VAJA 2OTJS 1WEYA 3MD1A 2EK6A 2X1AA 2RRAA 1QVGR 1X4DA 1AUDA 1U1LA 2FC8A 3CC7S 2M9KA 2M52A 1VQ4S 2FPHX 1WI6A 1WTBA 1FJEB 2M2BA 4QU7A 3BEGB 2DH8A 4Y0FA 3MXHP 5MLCV 4RU2A 2OSQA 4CIOA 2KRRA 2FHOB 2KFYA 2M7SA 1WEXA 3SDEB 2E5GA 2LEBA 2B0GA 5HO4A 1D9AA 2LMIA 3CMAS 3BO2A 2MZ1A 2RQCA 2RT3A 1L3KA 2D3OR 3EGZA 1VQMS 4CH0S 1SJFA 1ZZNA 1F9FA 3CCSS 2MY7A 3DXBA 4F25A 2CQHA 3PIOQ 2OSRA 1U1OA 2YWKA 3V4MA 2LXIA 2DISA 1VC0A 2MGZB 3DLLQ 4C0OC 2DB1A 3FEXB 3VAHA 1NJIT 1KOHA 2VOPA 2RUGA 2MKSA 3G71S 5LSLA 2CJKA 3UE2A 2HYIB 4C4WA 2DGTA 5IM0A 2DNLA 3K0JA 3D2WA 1YHQS 3PIPQ 1H2TZ 1DRZA 5JVHQ 2QFJA 2F3JA 3P49B 4IO9Q 2U2FA 2DNQA 3CXCR 3VAIA 2CPZA 3P5TL 1X4CA 2RNEA 5CYJA 5IQQA 4UY8T 3FEYB 1SJ3P 1WG4A 1DHMA 1U1MA 3G6ES 3H2UB 1UP1A 2KYXA 3ZZYA 4TU8A 1R8PA 5GAHU 2OTLS 3SXLA 4V19X 1FHTA 2X1FA 1VQ6S 2LA4A 1M1KT 3OW2R 3SDEA 5D77A 3US5A 1D8ZA 1FO1A 3I55S 2CQ1A 3R1HA 2VOOA 1WF1A 2X1BA 4A8XA 2AYMA 2LEAA 1H2VZ 1CVJA 1URNA 5GADU 3RW6A 4BS2A 2MZRA 5ITHA 2DNPA 1VQNS 2J0QD 1ZH5A 1SXLA 3MUTP 2DNGA 2JX2A 3CCMS 2MZSA 4YOEA 2M0GB 3Q2TC 2MKHA 2DGUA 2DGVA 2M4MA 2KN4A 2G1DA 4Y00A 2DITA 2UP1A 3Q2SC 3L3CA 2FY1A 2JWNA 2MKJA 3J7ZT 1M5OC 2MKKA 3I56S 2CQ0A 2MY8A 2MQMA 2MSSA 3VALA 2D9PA 3MI7X 2KH9A 2MZTA 2CQ3A 2EK1A 3UWTA 1FNXH 3HI9A 5DETA 2DHAA 1SJ4P 4QU6A 5LJ3Y 3THPA 3UD4P 3NNAA 1SJQA 5HL7Q 2CPYA 2RU3A 1UAWA 5DDRC 2X1GA 2YKAA 2RRBA 3CCVS 1DZ5A 2AYBA 5D78A 3BS9A 1WF2A 4PKDB 1JMTA 1OO0B 1VQ7S 2XB2D 2VONA 1JJ4A 1N88A 2DHSA 5GAEU 1H2UX 1PO6A 4YB1P 4Z2XA 2DO4A 2DGXA 5GVQA 2E5IA 3TP2A 3SMZA 3CF5Q 3P6YC 1N54B 5DM6Q 2YH1A 1U1NA 1VBYA 1KQSR 1HL6A 5LXYA 2DK2A 2MKCA 1Q82T 1VQ9S 2VODA 2M88A 1VQ8S 4W90B 1H6KX 1JJHA 1YIJS 4QPTA 1U6BA 1HA1A 2KXNB 1RK8A 2MQNA 1KC8T 2GHPA 1SJRA 1U6FA 4PRFA 3CCRS 1N52B 2A3JA 4CH1A 2CPIA 2LXUA 1KOOA 2CPXA 1FXLA 4WIIA 4ZKAA 2CQPA 1U1KA 2E5JA 2HVZA 4TU7A 1WHWA 1P27B 2CPHA 2KT5A 2LA6A 2MB0B 3U1LA 2CQ2A 4F02A 4FXVA 3CULA 2PEHA 2MYFA 2E44A 2KG0A 2DNNA 2J0SD 1VQKS 2DGOA 1X4EA 5IFMA 1U1QA 5FJ4A 2J8AA 3MUVP 3CC4S 1YI2S 1U1PA 2MQLA 4UQTA 3CCLS 2L41A 1WI8A 2CPFA 1RKJA 2AD9A 2HGMA 2DNKA 2XS5A 3UCZP 2JRSA 3CCES 1Q7YT 4LJMA 2MQOA 3N9UC 2N82B 1VQLS 1VC6A 2MHNA 1B7FA 2MZJA 1ZZFA 3VAFA 1X4BA 1NO8A 4J5OA 1G2EA 5GAGU 2NLWA 4ED5A 1OWXA 1A9NB 2KXHA 1BY9A 2CQDA 1P1TA 4WFNQ 2JVOA 1YJWS 2KHCA 2LECA 1QVFR 2MJNA 4LIRA 2DO0A 5DDPC 1FT8A 1YTYA 1HD0A 3CCJS 2MPUA 2YTCA 1S72S 4W92B 4CQ1A 4PR6A 1K73T 3ZZZA 3IRWP 2O3DA 2RS2A 3UCGA 2Q79A 2DNMA 4OZ1A 3G8SA 2WBRA 3EX7B 3BO3A 3MURP 1S79A 2SXLA 4F26A 2F9JA 2ERRA 1WELA 1UFWA 2L9WA 1OPIA 4WCEQ 4IUFA 4WKRA 4U67Q 1VC5A 2L08A 2DHGA 3J7YU 2DNRA 1X5TA 1WHYA 5GMKa 1JJ2R 2LQ5A 1FJ7A 2MXYA 1HD1A 2ADCA 4C7QA 3EGNA 3S6EA 2FC9A 4M5DB 2CQGA 2J76E 3CMES 3U1MA 3VAGA 2XS7A 2LYVA 3NS6A 1WF0A 3VAMA 2XNQA 2E5HA 1X0FA 2N3LA 2KRBA 1WHXA 1YWXA 2D9OA 1K9MT 5LXRA 2I2YA 2G4BA 1X4AA 2BOPA 1WWHA 2K8GA 2M8HA 2CQIA 2CQBA 3ULHA 1X5PA 1WHVA 2CPJA 4QQBA 1WEZA 4OZ0A 5BJRA 2KI2A 2AYGA 3NNHA 1VBXA 1A7GE 2U1AA 1M5KC 3S01A 5DDQC 1QM9A 2ZJRQ 1Q86T 1M5VC 2PE8A 5LSOA 1FJCA 2DHXA 4IOCQ 1WG5A 4LMZA 3R1LA 1K8AT 1OIAA 1X5OA 2BZ2A 2HZCA 2XNRA 5CA5A 2QA4S 2CQ4A 2DIUA 3G96A 2XS2A 3R27A 2G0CA 2V94A 3VAKA 2DIVA 4ERDA 1W2BR 2M70A 3G9CA 2RS8A 3H2VE 3P3DA 2M8DB 5CXTA 4YUDA 1VBZA 3S7RA 3BO4A 3LQVA 5JVGQ 2DH9A 1UW4A 2CQCA 5DM7Q 2LKZA 1YITS 2HGLA 1X4FA 2DGSA 3MD3A 2MKIA 2KVIA 3B4DA 4EGLA 2JVRA 1X4HA 5DDOC 1VQ5S 2EVZA 3MDFA 2KXFA 2MQPA 4WFBQ 3NS5A 2LCWA 1M90T 1VQOS 2ADBA 1WG1A 1M5PC 2AYEA 2CPEA 2DGQA 5H1SV 3UD3P 3G8TA 3JB9k 1DBDA 1X5SA 1VQPS 2DGWA 2I38A 3CCQS 3CUNA 2DNYA 3CTRA 2N3OA 2GO9A 2ZJPQ 3IWNC 4IOAQ 2RQ4A 1N8RT 3CC2S 5EN1A 3CCUS 2RVJA 2QEXS 3RW7A
chains in the Genus database with same CATH superfamily
2P2CB 1T05B 3EWGA 1PILA 1V5IB 4DJBA 1RGVA 4ZN1A 4KR0B 2MGZA 3LALA 1JNRB 1S10A 3EVMA 4L3KA 3C19A 5HROA 2GMJA 3BM7A 3OFGA 2V9KA 3ONQA 3GCWP 2DH7A 3UCUP 1TVRB 3KLEA 4HYKA 5F0UA 3FZ2A 1Y5IB 4EMDA 3CIZA 4YS2A 2Y1JA 2BVZA 3MPYA 2A6OA 2WCXA 5A8WB 2CQHA 3DRSA 4DR2J 3HULA 1JLEB 5C2GA 3FEXB 1REVA 2KDOA 1F0XA 1NJIT 1TL7A 3POTA 1FRHA 4TN2A 3FMWA 3PR4A 2BYCA 4ICLB 4NA3A 2W1BA 2UVRA 2EFVA 3OFEA 2JZ5A 4D3HA 3DXSX 4ECRA 4P52A 3FGVA 2ZFHA 3T1YF 4FNHA 4YQWA 1RHJB 2LA4A 4C11B 3H5YA 2OPPA 2PFFB 2GV1A 1WF1A 4L75A 1P9YA 1RAAB 2HWIA 4ILMA 1NSPA 3P4UB 3Q8UA 1VQNS 1ZH5A 4DV7J 4C8LA 1NKEA 1VYAA 4USWA 4KYZA 2DGUA 4K50A 1U8SA 3C14B 3B82A 2G1DA 4R8UB 4CTAA 3AHPA 3W7BA 4R5PA 2YQ3A 1S1WB 1SC3B 4C97A 2XC9A 1C1BA 3JYTA 4B3TF 1CEZA 2HNZB 3H5SA 3GYGA 1RT7A 4RW4A 3THPA 3UD4P 3QGIA 2B43A 2ZEJA 4X4PA 2F4VJ 5D78A 3GV8B 3L9ZA 1FRXA 3ETOA 1JJ4A 3MPUB 3C15B 2KHDA 1C0TA 3IR6B 2D69A 1VI7A 2H3EB 3M8PB 2N4CA 4ETZA 2YKMB 1GXLA 1HHTP 5IZHA 5E41A 1YK9A 1HNIA 1HL6A 5LXYA 1Q82T 4OI2A 3K7RA 1VRQC 4DV0J 3AXMA 1GFWB 2NYHA 4X4VA 2IJRA 2FYXA 3PX6A 1KOOA 3RRHA 3NGDA 2XM3A 2AJQA 2HURA 2QSWA 4OI0A 2DR9A 4OZJA 4WE1B 1J5OA 3MPVA 2DNNA 2ZD1B 2MQLA 1OY6A 2HIQA 2KFZA 2FVQA 3CCLS 2FUG9 1EETB 5F9NA 1RAOA 2XS5A 3GJQB 4JP8A 3J7YI 1HW9A 2G2OA 2OELA 2HVHA 2GQQA 1V3ZA 4A4JA 4DR6J 5F0WA 2DKOB 4NWBA 2ZM6J 3CJ8A 4NLOA 4WKYA 2LP4A 1N4LA 3I96A 1REGX 2OEKA 4IH5A 3O1LA 5I3PA 4F0KA 1SL0A 1EX8A 3G8SA 3EX7B 1TL3B 2Z8QA 2CJQA 1UWBB 2WTFA 4ZLJA 1UVJA 2WW4A 2DNRA 4DCPB 2G0JA 5KT6A 3MCNA 2QO3A 4KGZB 1FK9B 2BEFA 3IRXB 2M8HA 2RDDA 2VKZG 5A2QY 4MJKA 2QMUB 2RE1A 2W01A 2WVFA 5DLFA 3IBCB 6FDRA 3CO0P 2XI3A 4DMZA 4BLGA 2IHR1 5CZXA 4DZDA 2JDJA 5ETPA 2BABA 1HNZJ 3H2VE 1QAYA 2F8EX 3DKDA 5JVGQ 4MIBA 5HROB 3Q83A 5KFHA 2HGLA 3CMQA 1Q1KA 1RTDA 2XY7A 4NEZA 4ZP6A 2BJ1A 1SC6A 3KLEB 1CJUA 4HEA9 4L74A 1FKOB 2ROGA 2ZJPQ 2DVIA 1TK5A 3TEHB 1VISA 5E33A 2XHCA 4LRFA 1Q5YA 2Y8WA 4TY8A 3R7BB 2VG5A 4UT4A 2W4PA 3OLAA 3DRSB 2MQQA 2RKIA 2QLXA 1REVB 3RBZA 4M8LA 1TL7B 4KJIA 2YH0A 1KP6A 2MMYA 4GO5X 4U7CA 1YJ9S 2VASA 3T1HF 1OY8A 4GC6A 2HZVA 4G1QA 2WVEA 3WDOA 3SSRA 3PW4A 1Y7PA 1Q78A 4I7FB 4ECWA 1QTMA 1WEXA 2XMKA 2EFGA 2OPPB 1QY7A 1R6YA 5IC4B 1N0UA 5KFMA 3BH6B 3SI8A 2LMIA 4P2XA 4WFXA 1ZZNA 1FTCA 3CCSS 2XGPA 4XDCA 3RRGA 3IXQA 5AJ3J 3C66A 3QT6A 4N76A 1F5BA 2CUYA 2DBBA 4CTAB 1ICEB 3UE2A 1HNXJ 1C1BB 3JYTB 3UDVA 3K0JA 2FHJA 3EM1A 1PYOB 4IO9Q 3L7PA 4RW4B 4NLUA 3W65A 1SJ3P 3G6YA 3M8QA 1RBOB 1S1UB 3UD5A 1YBTA 2X1FA 2Z2ZA 1C0TB 2HFZA 1H0HB 1S48A 5HAOA 4C0BA 1CVJA 1XK8A 2VV5A 3BGLA 4FKXA 2AKWB 3AOAA 1RWKB 1T03B 7FDRA 1YZ7A 2DCLA 2JX2A 3CCMS 1S0MA 1NM2A 4MAKA 2ZBCA 4CLTA 1X9MA 2QA4G 1CS4A 1RBAA 2K1RB 2QLFB 2M3DA 2KZZA 5LL6d 4J9QA 2X51A 5KFUA 4NYZA 5EWFA 3DNCA 1J5OB 2CJYB 4CM2A 1S12A 4O3OA 1GH8A 4JYAF 1D9FA 5E0OA 5C25A 3CB4A 3EDRB 2HBRB 4DI6A 2W7OA 4FF1A 2Q43A 3IG1B 4YB1P 4F3MA 2DGXA 2E5IA 4CLWA 5DM6Q 4I4BA 2FHKA 1VQ9S 3RGIA 4URSA 1JJHA 1RQ0A 1FX2A 4FYVB 3OL9A 3J7Z5 4AD6A 2KKHA 2GS8A 3DLBA 4O3QA 4KPYA 4WXWA 2CQPA 2ZWOA 4TU7A 3JQJA 1T7PA 3DOMB 2PEHA 2J0SD 5CD4H 5IFMA 3KJVB 1YI2S 5L9NA 3IGNA 3OUYA 3QO9A 4X62F 4ID5A 3V6KA 1HLWA 1FJGJ 4ETXA 4JI1J 1WI8A 3FSYA 1HW8A 5JMNA 3D1HA 4DLGA 1VK8A 2BE9B 3D6HB 3B8HA 2LU2A 2LQ8A 2ZDPA 4H4KA 1HBMB 1UTAA 4XAKA 3NMAA 4NXMJ 3K58A 2AHOB 4CH7A 4OI1A 3UN5A 3J7AN 2R8KA 2OMLA 4WU2A 3F41A 4NX9A 5HMZA 3HFVA 4YB5A 1Z2LA 1IBLJ 3OPKA 3FJ2A 3HJFA 2YQ0A 4OX6A 2SXLA 4OL8A 1AUSL 1WELA 1T02A 4ER8A 4YEAA 1JJ2R 4E0DA 4PG6A 5CABA 3SV3A 1U0HA 1HKAA 3A13A 2BBEA 2DYAA 4XDDA 9RUBA 4FF4A 1WDDA 2XNQA 5HJXA 2ZKTA 2HHVA 1WHXA 1K9MT 1CJUB 2KB2A 1T9WA 2UVWA 1WEZA 4TYBA 5C42B 3Q0AA 4TY8B 1RA7A 2IAJB 4DSKA 2VG5B 3KJNB 1JLFB 3DHWC 2V2KA 3KMSA 4LBPA 5L1KA 5AXKA 4RLEA 4WWSA 3G96A 3W64A 1NK0A 1UFKA 2HLTA 4LQ9A 3HFZB 2M70A 5DG7A 1M0SA 2M8DB 1UJ4A 2F4FA 2PMHA 3S7RA 3BO4A 4WP9A 1YITS 4HT5A 4R25A 2IYGA 2AJFE 3LOUA 5H9EK 1B0PA 4JI7J 3MEDA 4ZMMA 2WVCA 2LFVA 4G1QB 2ADBA 4OLOA 1VQPS 3KG4A 3OVAA 2DNYA 4DXLA 1KKHA 3CJQA 4CLLA 3D7SB 1YKWA 3ILJA 3NY0A 2O67A 1EARA 1LV5A 4V1Ak 2JC1A 1BD6A 3DLHA 3QATA 4CLZA 4DR4J 4ES2A 4PCQA 4MKAA 2XSFA 2UUAJ 3L4BC 3GFYA 4C8OA 3BGFA 1AROP 1J2VA 3JAMY 3NMRA 2C22A 3IS9B 1GEHA 2LQJA 3CCZA 3GONA 4J9OA 3M8QB 2VQFJ 2HHUA 4RU2A 1UVKA 3TW0A 5HO4A 3K5OA 1YQHA 4ATNA 3EDQB 2ZH2A 2J8SA 4P7VA 3G6XA 4CH0S 1RADB 4CLSA 3FFIB 2IJFA 3OR1A 2OSRA 4LF4J 1LWXA 1NZ8A 2LQBA 3TOQA 4OHZA 2OLWA 2YQ1A 1PAUB 4RX6A 3Q24A 2LDYA 4B9VA 1FNMA 2HQGA 1YHQS 1LWEA 4LSNB 5LM7E 3HJVA 4O4RA 3CXCR 5CYJA 4UY8T 2ZUGA 4ZCIA 1NHVA 4LF2A 5C25B 3MECA 2QX0A 4NCAA 1U09A 3UNYA 1FERA 4H4OA 4P9SA 2NUHA 4DWIA 2C3YA 5GADU 7AT1B 1NDKA 2NUUG 4QW8A 2RDIA 4E98A 2RQKA 3Q2SC 2ATCB 3UN2A 1M5OC 2BJEA 5F3ZA 4HDGA 1JXEA 3I56S 1KHVA 4TXSA 4QWDA 3L09A 1YLXA 1BLUA 3GCXP 5DDRC 4NLGA 4ID5B 3VHQA 3GV7B 5IT9U 1NNDA 4HR2A 5B0AA 1MNEA 5LSRA 1TUWA 1FRLA 4KY3A 2ZH8A 2PFDA 4DQQA 2EFPA 1PO6A 3D0HE 1K0TA 5KG1A 3W9IA 1SQFA 1N54B 2RSQA 3FQLA 1KQSR 3GR0A 4DS5A 3PTWA 2O01C 2LXUA 4J9LA 1RHRB 1P27B 5HSPA 4F02A 3CVKA 4Y2MA 3PYDA 1CJVA 3CC4S 4DUYF 1U0HB 2XHWA 4YY3J 4NOHA 3MMAA 2CPFA 1KQKA 3GYNA 2F40A 2W9CA 3MWBA 4JV5F 3SCJE 1GMWA 3K2YA 2FGOA 3GE9A 4K2JA 3AJ2A 2XMAA 3OD2A 4QIFA 2Z2LA 3A8KA 1BQNA 1VOMA 4GMKA 2XEXA 2QLJB 4ZVHA 2PI4A 1T8EA 4G6VB 2I8EA 4QZVB 2J7UA 2HWTA 1JLAA 3K5PA 5EX0A 3AOBA 2Z56B 3RAMA 2DRDA 3BO3A 4GKJF 1QSSA 3FBFA 1F2HA 3MM8A 1OPIA 2Q66A 3D0IE 5KG2A 2MXYA 1HD1A 5KT5A 2IVMA 5AE2A 2ZZNA 3U1MA 3OHAA 2XS7A 3VAMA 4G1IA 1VGYA 4JI8J 2D9OA 5LXRA 1I94J 3IR7B 2BOPA 4FDFA 4ZVOB 2IM1A 3AD9C 1SIWB 3AJ1A 4F4ZA 3BB5A 1HQUB 4ANDA 3I4HX 5HATA 4CI0B 3CJKB 4WJBA 4OZ3A 4OHVA 3T1AA 3CDWA 5AXMA 3HZGA 3OXLA 3W8PA 2WVBA 3KMQA 5CA5A 4DX5A 4A8OA 4F04B 3PW5A 5ETQA 2RS8A 1WKJA 2AWZA 1WC5A 4ECVA 4X65J 5J1PA 1XR6A 4PWWA 4EI2A 1DTTA 2VDHA 4CLFA 2MQPA 5CAAA 2AP6A 3T41A 4L76A 3CCQS 3CUNA 3C3LA 3R6LB 4CO3A 3G4SS 1LKZA 4NLDA 2R7UA 3PX4A 1JJCB 2HQ3A 4DG1A 4QCLA 2O1PA 2JOQA 1OSDA 4Q44A 2CWKA 1VHFA 3OR1B 2OJ3A 4QIGA 2AEFA 2N4DA 3DI6A 1U1RA 5LJ5Y 1ZA2B 3H5UA 1WEYA 2Y1LB 2ZVSA 4IG3A 3V6JA 1HNVA 2M9KA 3MECB 5G0RA 4DCJB 4ZIWA 3JTOA 2IYIA 5BYQA 1S7HA 2FY8A 1G6BA 4B02A 2KRRA 5HI7A 1WDTA 4H4OB 1GT8A 3CD0A 2QSFA 5D15A 4ZPBA 2R2TA 2Y0BB 4DV3F 1FD8A 2MZ1A 2D3OR 5H9EJ 2KZMA 1WJ9A 3MMJA 3CE8A 2IPOB 1ZM9A 3OXGA 5HN0A 1TKDA 4X4RA 1RAGB 4NRTA 2YNIA 3TJAA 2DB1A 4JI1F 3BQ1A 4AYBD 3T5HA 3OSPA 1EB0A 4GO7X 4G65A 2AV5A 4DV2F 4C4WA 1Y0HA 2V9WA 2K7JA 1OYDA 3W63A 5F8GA 2E9RX 3D2WA 1SV5A 3M6UA 2F3JA 3IBFB 2V34A 2W25A 4HH1A 5IQQA 3FEYB 3TZZA 2V8DA 4NE9C 3TAMB 5HMWA 4DV1J 4PG8A 4X4OA 1SKSA 3Q22A 1L5UA 3ZNUA 3OW2R 1ZTWA 5HVGA 4EBDA 2JEIA 4A8XA 2HSEB 1H2VZ 1H7XA 2BJ9A 2LXFA 3HFKA 1T9YA 3ZO7A 2E29A 2UVUA 3EZOA 4AFFA 1SH3A 4LRCA 3BKTA 2IBOA 2ZH5A 3JQKA 2MKKA 5DGAA 2HK3A 5D0EA 5KFXA 3ILLA 3WQPA 4RZRA 1FNXH 2XZWA 1KRPA 1EQMA 4C0HA 3IP0A 3QRRA 5AE3A 4DN9A 1MROA 2E1AA 2RRBA 3MMAB 3W5ZA 3BS9A 3W2VB 1RI7A 3DN9A 4M5MA 2GZOA 1RT2A 3NAHA 4G3IA 4NA2A 2J0WA 3NGTA 3M6WA 2QLWA 2HFUA 4OLPA 2E66A 1BQNB 1H6KX 2HVDA 1RK8A 2EKYA 3P96A 2NPFA 5CQGA 3OXFA 1MMNA 3DLJA 2CPIA 4ZCKA 1AYEA 5LMNJ 5A8KB 2R9LA 5KG3A 4DL2A 2PEBA 2DRBA 1S0OA 4HVZA 3ZZOA 3MM8B 1XC9A 1J5EJ 2J8AA 5LOQA 2W2OP 1F2GA 4I2QA 2CG8A 1FE4A 1I6JA 1CULA 2CVIA 4JI6J 3QJJA 1N32F 1NZAA 3EZ5A 1UEUA 4ECSA 1SPBP 2V4RA 1N36J 1NO8A 3CJRA 3C8YA 4TKTA 5A76A 2PMZD 3DM2B 2V8HA 4QIWD 4DR7F 2GQ2A 2DO0A 2ZBPA 3V2UC 1QAXA 3BGOP 1KVKA 5DQIA 1NHKL 2GVDA 1D3WA 3C6TB 2ROPA 4P2MA 3J7YU 4DR3J 2CNNB 4YFUA 1L3SA 1DTTB 3MM9A 1Y00A 4AQYJ 4CLUA 3MEGA 3ITHA 4J9RA 4NCBA 3M2RB 4Z37A 4WP8A 3OSNA 3AA8A 4DDFA 1X5PA 3KNGA 1R8BA 2CVEA 1S6UA 4QYZJ 2PE8A 3OJSA 2YKPA 1JB0C 4DG1B 3O5TB 5KFZA 4A8WA 4ED2A 5KT3A 1OYEA 3DLGA 4IRCA 4OYXA 1ZA1B 3DI6B 4WZQA 1NDLA 3NWRA 2X3GA 3H90A 1AT1B 5DM7Q 3GSDA 2ATLA 4IDKA 5I42A 4DSJA 2KXFA 2DPJA 1PIEA 1HNVB 1ZBTA 4Q2LA 2DGQA 3D6FB 3G8TA 1DBDA 2JH3A 1NH8A 3H42A 4ECTA 2DR7A 2XO6A 1KVJA 4KO0A 2DPIA 2XWXA 4LF9J 2XTJP 1RYRA 1KHWA 3WC2A 1WKLA 1D8YA 2ZOFA 2HHHJ 4FN5A 4LBHA 1Q81T 1OS5A 2OD6A 3PR5B 3CNQP 3PYFA 3CPWR 4J7CA 2IMOA 1OSCA 4DPXA 2DNHA 4U9RA 1KD1T 2KU7A 3OFHA 3TYTA 3E01A 4WFYA 1SV5B 1RAEB 2AJ0A 3BF4A 1IVZA 4WYWA 1PJ7A 1UA1A 4JI5F 1UVLA 2M52A 3TEGA 1VQ4S 2FPHX 2ZH6A 4C48A 1H72C 2NXNA 1TUVA 2OSQA 5E3PA 3MMCA 2VG6B 4UZBA 5E5NA 3NS7B 2CNLB 2RT3A 3M8ZA 4CLYA 2QMWA 1P1LA 5ETVA 5B0GA 1VRUA 2MLXA 1ULRA 4I2PA 2ZBRA 4RL1A 2HBZB 4YY3F 5KFTA 2VOPA 1S9EA 4O44A 2OPQA 3PO4A 1FESA 5LSLA 3J81j 1HQEA 3LWMA 2DGTA 2UUBF 3HXMA 4USVA 1SQEA 2RF2A 4XPEA 3AODA 1X4CA 3K8VA 3IAM9 4PXCA 1ZM4A 1XR5A 1XJWB 3ZZYA 1MROB 4OI3A 2B6AA 1HR0F 3K5NA 4X4QA 3W3SA 3RTVA 3ZNJ1 2OPRA 2IRUA 2O66A 2VOOA 4F8RA 2WB4A 2MZRA 3T6JA 3DRRA 1NHUA 1UCNA 2YWHA 3DRPB 2V63A 1RTIB 2NR0A 4M5HA 2EFNA 2CG4A 3KK2A 4UTGA 5HP1A 2V67A 3HVRA 2CQ0A 1FDNA 4KHRA 5D4LA 1NKCA 1DQ8A 3LGMA 3W66A 2CQ3A 4UY85 4QWBA 3VGUA 4N7TA 1TQLA 2ZC4A 2J7KA 4I2QB 4OZ5A 1C4AA 5DS7A 2K3IA 2P9EA 2I6WA 2QA1A 4LQ3A 2VONA 1WNEA 2XMWA 3AB4B 3PYGA 2CIMA 2DO4A 3P6YC 3SMZA 1ZAWA 4X64J 2DK2A 2FJBB 2VODA 3IWLA 3BR9A 2UUCJ 4C9DA 4NLWA 3ADAC 3JTNA 3CCRS 1Q95G 1GXUA 2QL9B 3VQSA 1N5TA 1VLYA 3NCPA 3BH7B 4O0IA 2E5JA 5KAKA 1V6HA 4FXVA 2NSBA 4NXNF 1GK8A 2YNHA 3HPOA 1MN9A 3GMGA 2A10A 3Q23A 2YPYA 4GKKF 1XQIA 3WC0A 2VD3A 1C2PA 3MEGB 2N82B 3OQ2A 4WTYA 1X4BA 3BBBA 3ILIA 4DFJA 5KFNA 2EBEA 1G1XA 1IBKF 4DF4A 2EC0A 1JXVA 4DX8H 1RT3B 1URRA 5FIIA 3TZXA 3SZ2A 4OIXA 1HPZA 1U26A 3MOZA 1YJRA 2EWHA 4FYDA 2DNMA 1NSAA 3I9V9 3P5BP 2XQCA 2F9JA 1VLOA 3TANA 3MTJA 3G86A 4EWTA 4DSFA 4LRDA 3PEHA 2OO4A 3NXZA 4A8SA 2B5JA 3GG0A 2FJAB 2Z30B 4IDKB 5I42B 3H59A 1NBEB 1SKUB 4JI2F 3PJ9A 4LF5F 2CQBA 2DR5A 1WHVA 2CNOB 2CPJA 1YX2A 2DHHA 5L39A 2VZ9A 2V8VA 2DHXA 4N8OA 5AE1A 2VQEF 4A8MP 4O3NA 2C2RA 2B4OA 2E7XA 2UXDJ 2G0CA 3G9CA 1S1XA 1ZETA 2XZTB 4A46A 3TA1A 4KH0B 4UUWA 3QZ8A 3MR3A 8AT1B 5DDOC 1IKWB 1PG5B 4RUHA 2VFSA 2J9CA 2AYEA 2H4YB 5L8RC 1S1TB 1HNWF 3Q86A 4CYUA 5AXLA 2VDIA 3RW7A 3LPYA 5K14A 1IQTA 3EVWA 3FCHA 1SC4B 2NSCA 4K0KF 4LF8J 1R3NA 2NXEA 1FDBA 1RP5A 2AW0A 3DU5A 4OX7A 4ZVPB 2JLFA 2HVEA 1S9EB 4WFAQ 2HFNA 1HQEB 2P8IA 4C8NA 5KT7A 4Z7CA 4TU9A 2HK2A 5AXNA 3FZBA 3VAJA 3MD1A 4HHUA 3V6HA 3TNVA 4IFVA 1AUDA 3T9ZA 2B6AB 1WTBA 4I67A 1XIQA 3SQGB 1I1GA 3RZAA 2OPRB 2LLZA 4CO1A 4DPWA 4KE5A 4QOTA 2MY7A 3CJ2A 5GAHI 3NEKA 3FSXA 4DS4A 3DRRB 3AOCA 3M8YA 3E2EA 1CLFA 2CRLA 3GFHA 2UXBF 4WBFA 3KK2B 5HK4A 4NZ7A 4ZPTR 2HPUA 3AT1B 4OX8A 2HYIB 4IYQA 4Y2AA 1EAYC 1V3RA 2FZKB 4RW9A 3KK1A 5E7OB 2IM2A 5JVHQ 2U2FA 3VAIA 3QIPB 4HHJA 5KFAA 3OLBA 2NXCA 1FDAA 2A0FB 1IKVA 2ZH1A 2ZH9A 2RH3A 3SQOP 1FHTA 3M30B 3PFEA 5EWGA 3I55S 3F73A 2B4VA 1AXQA 1BQMA 4WK1A 2CDRB 2GO8A 2BQ3A 3RW6A 2E7WA 2W7AA 2J0QD 1M5SA 2ZHBA 2OPSA 1UJ5A 3MUTP 2JL9A 1CSJA 2BQRA 1Q8BA 3AD7C 2WZ1A 2VB6A 1AB8A 3OVSA 3G82A 2MSSA 4BWJA 3JSYA 3LA0A 4Q8EA 3H5XA 3C6UA 3RAQA 1T9XA 4Z7YA 3R5AA 1NCLA 4NLVA 3PRBA 2YNHB 4RNHA 1QE1B 1HWJA 2D7SA 5KFSA 1JMTA 2R42A 4QIVA 2JHEA 3HVTA 3RYLA 2IM0A 4B3TJ 1K1SA 1RUSA 1U8WA 2JSXA 3H4BA 4K4WA 4FKYA 2MKCA 3OHBA 2A2CA 3CD5A 3I5AA 5EWEA 1LFWA 1LW2A 3RB3A 2R7QA 2QL7B 2MQNA 3N79A 5L38A 2B3TB 3ZTRA 3HO1A 4ELUA 3BSCA 5HJYA 3GP9A 2ASDA 1S59A 1NJYA 1U1QA 2B5JB 2L41A 3I82A 2ZUAA 4LJMA 1N5YA 2R8JA 3RB0A 1NDCA 4USMA 2IA6A 3HZEA 4MH8A 4URGA 3JS9A 1KEKA 3PZPA 1WD6A 1WORA 4LREA 2IC3A 4MIWA 2MJNA 5DDPC 1NKBA 4ZP7A 3CCJS 5DGBA 2O3DA 2RS2A 2XY6A 1Q4RA 1S1XB 4DFKA 1JLBA 4BDPA 3N01A 4LBIA 4RBUA 4KV8A 2LQ5A 4P10A 3EGNA 5KFRA 2MHEA 4YB7A 2D3ZA 1VS3A 2N3LA 2VBWA 2RHSB 2CQIA 3OL6A 2QG9B 4JOUA 1FA0A 5ETNA 1H38A 1GTEA 3F56A 4FZVA 4KGVB 1VBXA 4LR9A 3W60A 2DXDA 1AFIA 3PYEA 3EYZA 5K14B 1NK5A 4R0JA 1K8AT 1X5OA 4RW7B 2E5LF 4QWCA 2DIUA 3F0NA 3R27A 4X66J 3VGTA 1TL4A 4ERDA 3LUYA 4DX7A 2MDAA 1JLQA 2LDIA 1VFJA 1EP4A 3KG1A 4K4YA 2D1CA 1WACA 1NPKA 4DF8A 1MU2B 2E1PA 1R89A 1ZM2A 1BGXT 2DT9A 1RA6A 4I6AA 2W2NP 4IFVB 1MG7A 1TVRA 5IT9Y 1XTZA 4BHQA 4EK2A 3JB9k 1OQ6A 4HACB 1IJEB 4ZJQA 2Y1RI 2E1CA 3TQEA 2PI5A 2AJ2A 1QLNA 1A0OB 1DJ0A 3D54A 4DSIA 4ZPWR 2JJ4D 4NZ6A 2HGNA 3WZ0A 1NU4A 4CZCA 2QJ3A 3KUGA 3NNCA 3CO9A 5A8WA 4K4SA 4OYZA 2HZAA 1RHMB 4DQRA 3PEJA 3EPGA 1KNZA 3ZZPA 3GR1A 2GIRA 4J9NA 3H7HB 4K8RA 1HBOB 2PGCA 4F3OA 3R6GB 4IRKA 4ICLA 3N6LA 2L48A 1TR0A 1FTRA 3VCDA 2M2BA 3D66A 4QU7A 1CJKA 2NZCA 1BQMB 4C11A 3T1HJ 2OPSB 3EGWB 3DLLQ 4MK7A 3VAHA 3BDPA 4F4AA 2CJKA 1XBWA 1R31A 4R8UA 1S1WA 3SV4A 1GX5A 1U02A 3C6UB 2IFXA 4USUA 2ASJA 3OR2B 2NPIA 1S6PB 2HNZA 2JFKA 3SFUA 2F7VA 5KG7A 1AFJA 4PYDA 3CGIA 4RBTA 3MR6A 1U6ZA 1K47A 2AGOA 3TX0A 1JLCA 4NYOA 2R7WA 2R8GA 2JNJA 3HVTB 4EU0A 3C15A 1FVQA 5BXIA 2MTLA 2GAHC 1URNA 5KG4A 3T5JA 2YKMA 3A3PB 2CA9A 3H40A 3UR3C 2M4MA 4NYPA 4ZN3A 2L9DA 4MIAA 2XCPA 4UZCA 3PJXA 2VBZA 3MAHA 2QMXA 2IIHA 1R6VA 4EUVA 3QWUA 4IH6A 3TUIC 5T41A 3R5BA 3MFHA 4LVNP 2ZD1A 2Y9HA 5EX3A 4JI4J 5KFVA 1DTQA 3ICLA 2X1GA 5ETMA 3CCVS 1KONA 2V5HG 3GQCA 1OO0B 2FHJD 1EETA 1N5YB 1KN6A 2A2DA 5I3UB 4ZP9A 3I5BA 5GVQA 4UUXA 5ETKA 1T0TV 2XY5A 4JYAJ 3VVUA 4XPCA 4F4WA 3SBMA 4MTPA 2GHPA 1TMMA 1ITPA 2CPXA 2B4UA 2OD4A 1FKPA 3MM5A 2H48B 1TL3A 3OV7A 1UWBA 1JLBB 2EKNA 1IWGA 3RR7A 4C98A 2BE2B 2GJ2A 2R2UA 4KV8B 2XLJA 3ENQA 1U1PA 3PRVA 3LP2A 4ECXA 2GMHA 5IWAF 1RHKB 3TA0A 4ANEA 5I4MA 3J80U 4KHMA 3N9UC 1YRXA 1VQLS 5A2QU 1GAOA 3QJLA 3QRQA 2HG4A 1LEOA 1R8AA 4ZITA 4X62J 3N4WA 4N56A 4CQ1A 3W2WB 4LFCJ 1M1GA 2C2MB 3IM8A 3MURP 1JLQB 1Y5LB 5A6PA 2D74B 4QBUA 2HHWA 1EP4B 1VC5A 1X5TA 5GMKa 4OQJA 3MCMA 4Y2KA 2LYVA 1T3NA 4XK8C 1FKAF 4KFBB 3N5FA 1WWHA 2PIIA 2P9GA 5J1EB 4M5IA 1S4EA 1FKOA 2U1AA 3J81U 2ZJRQ 2R8IA 5LSOA 2WSCC 4IOBA 4NLQA 4A8QA 3HHLC 4PG7A 3C2PA 1N34F 4YN3B 1RZMA 5KFQA 4KHPF 1UW4A 3I32A 2PMWA 5J2QA 2DGSA 2BMBA 4ELVA 2GJIA 1VQOS 1M5PC 3UD3P 4QJVA 3JXOA 3QQCD 2DGWA 3BYPA 4M63A 2VL1A 4OV1A 3TAQA 1CJKB 4NL5A 2HNYB 3ET6B 1W7WA 5EN1A 4I7FA 1NK9A 1WOOA 4TLQA 4F0HA 1MWZA 3DU6A 4CCHA 3RRKA 1ACMB 1O5JA 5H9FK 2HRUA 1WC1A 1RAJA 2PN6A 2XG8A 2EFQA 2MJUA 1TL5A 3S8SA 2C2KB 2OMOA 4N5SA 2DEJA 2CNKB 1R7IA 3AH6A 3RBEA 2GGPB 5MLCV 1S1UA 1Q79A 1JLCB 4I1TA 3NGKA 6AT1B 3V81A 1SKRA 2APOA 5D3GA 4F50A 3EGZA 1F9FA 2YNFA 1RAHB 2YWKA 1T03A 1NK4A 2XZDB 3WX8A 4F2RA 2C2ZB 4YDXA 2K1RA 5HVFA 2ZH4A 2AEMA 1DLOB 4PQAA 1WUUA 4EFAC 3SSSA 3TUPA 4K2XA 4R0EA 3OTEA 2H65B 3QRPA 1APSA 2Q1LA 1DTQB 2FJVA 3MHYA 1D0EA 1XMQF 1R8PA 4KT0C 1MN7A 3SIPB 3IMQJ 5D77A 4RNNA 4JBCA 2DR8A 3KKFA 3IG1A 1O51A 2ZZMA 2C2EA 4TQRA 2MZSA 3CJSA 2WOMA 5GAEI 2DGVA 4F4KA 1KR4A 3KLIA 3DHXA 4OHYA 1RCXB 4Y00A 3OVBA 5J2PA 2PC6A 1FKPB 2HRTA 4K4ZA 1M5HA 1Y9OA 3MM5B 1WC0A 3KJFB 3MM6B 1KQGB 3DOMA 3UWTA 1RLCL 3IC1A 2YWFA 3KJVA 1SJQA 2VG7B 2RMLA 3LP2B 4KQZA 5SZTA 1PJ5A 1UZDA 4YHHF 5THWA 4TVAB 4DR5F 4B3RF 1R8CA 2DXFA 2GIFA 4X66F 1BUXA 2CAJA 4L72B 3MR2A 3TUJC 3IN5A 3LF0A 4DHVA 1HBMA 3LTOA 3BBCA 4LFAF 2VIHA 2UV8G 4KC5A 3ISNC 2KXNB 1Y4ZB 4B9NA 3QBCA 5GAGI 2ZDOA 1X31C 2HS4A 5F8HA 3ZZTA 1N52B 5D0GA 1F3VA 1Y5NB 2ZVIA 1NMEB 2IRYA 2ABYA 3DCAA 4ZPDA 1S57A 1UETA 3X1LB 3VWSA 2AMCB 4F36A 3NL0A 3KLVA 1G2EA 3LH2S 1UFLA 1A9NB 4OJHA 3X3UA 2C42A 1HMVB 1XMOJ 5C42A 4NEYA 4DPTA 2GW8A 4DZ6A 4DUYJ 5K20B 2VHGA 3R3TA 3ZFVA 1LNQA 2IAJA 3A3OB 1JLFA 1YDLA 2Z2MA 4JV5J 2J6UA 4DL0C 3IGVA 1KFDA 4PXBA 2AU0A 1U25A 2GAGC 5FD1A 4MMOA 1X7VA 3I4PA 3V6DA 5ADZA 3ENWA 1FJ7A 1RT4B 1RBLA 1B4SA 5J2QB 2CQGA 2E7VA 3R97A 5CHCB 1RSCA 2I2YA 3W9JA 5EGYA 3ZTOA 4QR2A 4GKJJ 3TVYA 9ATCB 4I69A 4OZ0A 2FVCA 2QIFA 3NP5A 2B9WA 1C0UA 2AGQA 2ZC3A 3Q89A 2C2NA 1YJTA 1UVIA 1C1CA 1RABB 3IFEA 1GMWD 2XS2A 1LXJA 3VAKA 1GMUA 2ZBIA 1UA0A 1S9FA 4J90A 2B9YA 3T19A 5KFWA 1GTHA 1S97A 4M5DA 1RTHB 3IBWA 2CYYA 4Q0BA 5IT0A 1S0NA 1HWIA 3BKUA 4A8FA 1HIYA 3IS9A 2QE5A 4PZVA 3U1NA 4ZHRB 4KBIA 4C8YA 1H7WA 3V81B 4DFPA 4BCAA 4L3NA 5D3GB 4ZVTB 2WVDA 2KVQE 4RNMA 2BANB 3A8EA 4F0MA 2YNFB 1O0PA 3O8WA 3FFIA 4RO0A 3WBZA 3R2DJ 4JI4F 4MFBA 4D3GA 2G13A 3EJMA 5KG5A 3AB2B 4FXWA 1SL2A 5HQMA 4H54A 2KYZA 3MFIA 2NS1B 3VF0B 4M95A 4LSNA 4ED7A 4PG5A 2RRAA 3QZ7A 2BQUA 1U1LA 2BJ3A 4JV0A 5G4DA 2DH8A 4U96A 5BR8J 4CIOA 5B09A 4NLSA 4U95A 1IBMJ 4TNOA 2HQIA 5A0YA 1VQMS 4YP3A 3C16B 3MEEB 4F25A 4M5LA 4OHWA 2EEYA 4LR7A 4QPXA 5HMXA 2XSJB 4TYAA 2WOMB 3MGJA 3KLIB 1U24A 1MMLA 5IS2A 1KOHA 5J2PB 1U7LA 4MKYA 1JK9B 3RR8A 3P8BB 4CLPA 4FBTA 1RB0A 5F9LA 4WZMA 1LWFB 2Z57B 3PIPQ 1SUQB 2R2SA 1QSLA 4RR5A 1AZSB 2WAQD 1PSDA 2KT3A 3GJSB 4UOFA 2QFJA 4DV3J 3UDLA 1T11A 5FLXY 2HBYB 5K9FA 2B7CB 4NLTA 1LW0A 5H9FJ 5GAHU 1XNRF 2YX7A 1RTJA 4NMLA 4LFCF 4DV2J 4EO6A 1D8ZA 1F60B 1U45A 2LEAA 1XMBA 4FS1A 4P75A 3VGSA 2B4PA 1SXLA 3GTYX 3GWCA 2B8PA 2XYGB 1B0TA 1W26A 2FY1A 2JWNA 1HI0P 3KUEA 2Z4PA 2ZE2A 1BXNA 3MI7X 2J9DA 2GX8A 2EK1A 4FF3A 2P5VA 4QU6A 2AX0A 3HVWA 3FCWA 5EHHA 1VCTA 4PWDB 2AYBA 2E1MC 3CJ4A 3N0VA 1H2UX 3ZZ0A 2VKRA 4ZVFA 4JI0F 1YRTA 3TP2A 2C1EB 3D6MB 5DZ7A 2M88A 1SB6A 1P8GA 1U6BA 3QNWB 1TKXA 3R2CJ 4B3SF 3MTKA 2BW7A 1KLMB 2H9ZA 1DARA 2A3JA 4DU7A 2JEJA 3QSIA 4ZKAA 1WHWA 3D5MA 1VJQA 1E6YA 2WBMA 2KG0A 1WC4A 4MKBA 4PQUB 3V6DB 5CYMA 4ZPCA 2N7YA 2VFUA 4ANCA 4DQIA 3E51A 2K7KA 3ZTQA 3UVJB 4KRWA 5J1NA 3H98A 3UCZP 2AZ3A 1Q7YT 4EBCA 3PV8A 2W4DA 2I0XA 4AUKA 1ZZFA 4N8NA 1IKXA 3D67A 1NJZA 4B08A 1CG2A 4WFNQ 2PD1A 1HQUA 3GV5B 2MLZA 1YJWS 1C0UB 2XCAA 3CJKA 1NJWA 2E1RA 4XTTA 5RUBA 3D68A 1IM6A 4W92B 1N6QA 1C1CB 2IA0A 4PR6A 3TQ1A 1K73T 1L3UA 2AJ1A 1N32J 4LR8A 3UCGA 1F9EB 4B9MA 1T9VA 2QL5B 1S79A 4RNOA 1IQZA 2DJWA 4ZLLA 3H0PA 4DSEA 3PO5A 1FXDA 4DR7J 4DV5F 3PFOA 4M5DB 4DL7A 1IR2A 2J6SA 4Q0BB 1YWXA 3O44A 1D1UA 2AX1A 4OYOA 2AF6A 2BJ8A 4DQPA 3Q8RB 3P45B 3QGHA 1U0SA 4JI3F 1LXNA 1SCJB 2RILA 3MR5A 1YSJA 4MFBB 2V94A 2MKYA 4FNIA 4RJVA 2C2DA 5M2UA 3GB0A 4FYYB 3M2UA 4QR1A 1ROFA 3GJTB 2Z0GA 2O5DA 3W62A 2D3UA 4EGLA 1VQ5S 3MDFA 3NS5A 2LCWA 1IUJA 3FRZA 3HX9A 2M5YA 3JTPA 3CTRA 1UW9A 2N3OA 4C6AA 4F7VA 4DR1F 1HYSA 2ILZA 4BC7A 5A0YB 2FVRA 3R5DA 2HQFA 4Q5VA 3MOJB 4E8UA 3Q8PB 1RKIA 4DOZA 1T9TA 1R8HA 2DNZA 2FZGB 5C24B 3FKBA 2R7SA 2ROEA 3BSNA 2X7IA 4Q43A 2DNOA 5F8NA 4OJ3A 3TO8A 1TK8A 4CWBA 1FFWB 2EK6A 5B7WA 2AQ4A 3IWXA 2FC8A 1LW0B 1WI6A 3JSMB 3TAMA 3BQ0A 2CJBA 3BKFA 1RTJB 2E5GA 1EQ0A 3NOGA 3BGUA 2IDLA 2G1HA 2EC2A 4JI5J 1U1OA 4C0OC 5KFIA 4OYAA 4EBEA 3G71S 1XEZA 1Z1ZA 3UO0A 3BQ2A 3I0RB 3A12A 1YBAA 2ZE2B 1EZZB 3W8GA 4IO1A 4WTOB 2IMWP 1XMOF 1DHMA 1UP1A 4IRDA 3NG8A 4TU8A 5M2RA 2C3UA 3MM7A 2FGCA 4NMXA 1M1KT 1FRKA 3UDEA 3W2VA 2UUBJ 3R1HA 2ILYA 2HFSA 3PM9A 2Y1IA 2WONB 4U7UD 1HBNB 4NASA 3MMBB 4HL9A 2V69A 3TX8A 2YKOA 2F65A 1GXTA 1TKXB 3T3FA 3TARA 1H74A 3PHTA 2KN4A 1HR0J 2HNDA 2MKJA 4DUZJ 1OQ3A 3ILOA 3O2IA 5A8KA 3H2LA 1SI9A 1E6YB 2PO4A 1UKUA 2Q6BA 1Q8LA 5CYMB 2VU5A 2C28A 3O3LA 3R8YA 2XGQA 1VQ7S 1S1VA 3AAWB 3UW1A 5HANA 1IKXB 4J9VA 4CDIA 4J9KA 4OJGA 4NZ0A 3BN4A 4WYLA 1BE4A 3CDUA 3M6VA 1N33F 2VPZB 2CZ4A 4W90B 3DM2A 3IO1A 2YNGA 2VBXA 3O6QA 2H5IB 3AXKA 1N6QB 4PRFA 3BN7A 3PDNA 2BRKA 2HVZA 5KFEA 2ZH3A 3C6TA 2LU1A 2QRRA 5FJ4A 3QAUA 4UQTA 4J9UE 1U49A 4U7UK 4DQSA 2QC3A 1B7FA 1AW0A 3H20A 3M2RA 4X4SA 1R27B 1OWXA 1BY9A 3MEKA 4FVMA 1SL1A 2L3MA 4NXNJ 4OX9F 1BC6A 1Q53A 2XMJA 2AGPA 1RT5B 3K89A 1QVFR 4LIRA 1RAFB 1IWAA 4GKKJ 1SJ1A 4PUOA 3KNAA 4I0WA 3HHLA 3W61A 3TJ8A 1CQMA 2BKOA 3W5YA 2RD5C 4M5NA 4F26A 4Y6IA 5BR8F 1WKKA 1HARA 2L08A 1IBMF 3A8IA 3M2UB 5B0BA 1IBKJ 3SSQA 2EG1A 4LSLA 2J76E 3CMES 3TZWA 1NK6A 3D28A 5HVHA 2DCUB 1N48A 1BHNA 3UDCA 4K4VA 1BQXA 4IQXA 1PBAA 5BJRA 1HYSB 1UEVA 1PAEX 3S01A 5L1IA 2ZNYA 1WG5A 2WK4A 2XMUA 2FQQB 4YR0A 4ES3A 1P9QC 2HZCA 1RYSA 4JI2J 3HF5A 2D3O1 2FJXA 4PABA 4LF5J 4B3OB 3CDBA 4KGMA 3HSDA 3PW0A 4RPFA 2RU9A 2V4JB 3KXDA 2DH9A 2LKZA 1PKUA 4ZJLA 4OZNA 4OYIA 2KVIA 2JVRA 1X4HA 2OEJA 2VQEJ 3EGVA 4W4MA 3GFXA 3DRXA 4U6PA 3HP6A 2L9NA 2Z2YB 5FDLA 1Z4UA 3IWNC 4IOAQ 1E6VA 2VG6A 2XWYA 1N8RT 3OT9A 5MAOA 5ETTA 1NK8A 4K4XA 2J9DE 4DL6A 2K06A 3TUZC 3QGGA 3W1YC 4DV6F 3MUMP 3V5RA 1KQFB 5F8JA 2XMVA 2XYPB 1PYTA 1HNWJ 1X4GA 1YJNS 2WSFC 3AY0A 2DD8S 1TV6A 4NCGA 2JLGA 1HFEL 1PYSB 4K0KJ 3CC7S 1F5AA 3J80Y 2R7VA 1RLDA 3MM7B 2OFGX 2YKNA 5L46A 3OTBA 1W25A 1IKYA 2FDNA 2HHSA 2I1RA 3LP1A 4GC7A 3I5CA 2IY5B 2B0GA 3CMAS 3BO2A 3CJ3A 4CO2A 1UVMA 2RJZA 3OTCA 4JV1A 1IR1A 2FJEB 1QTNB 1Q8IA 2YPZA 2OEMA 2ZOGA 2MGZB 4F4YA 3N5BA 1FX4A 3DRPA 1RTIA 1Q5VA 2HNDB 2VC1A 1RHQB 2MKSA 1PBUA 3FDSA 1VBKA 1CBKA 2WRMA 4ILRA 3EICA 1FRJA 4DV4F 5DO2A 1O6XA 4IFYA 3KTQA 2DNQA 1T95A 3P5TL 3KLHA 2VBYA 4ELTA 3VQTA 2GC8A 3FBCA 2UXBJ 1FF2A 1X9SA 1S1VB 4MYTA 2QA2A 1F5CA 3SDEA 1FO1A 2X1BA 3VV2B 1FD2A 2UUWA 3J81Y 3DRYA 4BS2A 2IBKA 4MK9A 3TRGA 2M0GB 3Q2TC 2YNGB 3POTB 4A8KA 5E3RA 3HM9A 4CLKA 4Y2IA 4B17A 1K44A 1NEEA 2HW3A 5ETRA 1SQGA 1JWWA 1SC1B 3N6NA 4USHA 3OFFA 4AE5A 4I56A 5DETA 5EDWA 3NNAA 2RU3A 1T94A 2J6TA 3QT5A 1OY9A 2NXJA 4RUBA 3HKWA 3LP0A 4J37A 4ILLA 4ES1A 5GAEU 3DMJA 5E3QA 2ZH7A 2YH1A 4MYUA 3G2XA 4AL6A 1RHUB 3RAXA 1HA1A 4PUOB 3UQSA 1RT3A 4R5PB 3M05A 4P71A 3K17A 3HHLB 4FPRA 5F3TA 3M6XA 4ENOA 4TY9A 3SCIE 1ZOTA 5KG6A 2J0XA 1RJJA 3CULA 2B56A 2MYFA 1RT7B 2E44A 3FQKA 1U48A 4ED1A 4ID8A 2RB7A 4L73A 4LSLB 3CIMA 3UPFA 3QT8A 2XYHB 1CC8A 3OTOF 2MHNA 3MZIA 3B54A 4YR3A 5C5JA 5GAGU 2XMMA 5K5MA 4ZOSA 2H51B 1P1TA 1HNIB 5ETLA 1QUVA 2KHCA 2BA9A 3NCQA 1S72S 3HHKA 3ZZZA 1B7YB 5L9XA 1XNQF 2HFOA 4LF6F 5KT4A 4J91A 2KO1A 4WKRA 1RWVB 5A8RA 1ZAVA 1PC4A 4YMEA 1IKWA 1WF0A 3PY8A 1GMVA 2BW2A 3DGPA 1X0FA 4A47A 2HQCA 4P73A 1H3DA 2PT0A 2K8GA 3ULHA 4HKQA 4WP3A 2ZKUA 1S49A 2CWXA 3AFGA 5AT1B 5FDLB 1S1TA 4HLBA 3NGUA 2QYCA 1E6VB 1U47A 2A6MA 5DDQC 3TVZA 4ED0A 3R7SB 2QLBB 1OIAA 2XNRA 4MK8A 3RUBL 2QA4S 4RKUC 2CQ4A 2ZWPA 3D6TB 2QTWA 3KOAA 2DIVA 3EXCX 5IXUA 3ZTSA 3DDIA 4N47A 3WIUA 2OUGA 1VJWA 1HHQA 1TV6B 1XERA 4NCGB 2BM0A 4RUCA 2B7BB 3B4DA 1HI8A 2E5LJ 2VUGA 4ZIVA 1X5SA 1TZ0A 2E9ZA 4NRUA 2YKNB 4DL5A 1IKYB 4DUZF 3B78A 3SQGA 1TKZA 3KLGA 3LP1B 3CCUS 3KYLA 2QEXS 3I9ZA 1TFWA 3HHNB 2MZQA 1ZPVA 5T7LA 3NLCA 1R43A 3OL8A 2DXEA 4KGKA 2W4CA 1KBRA 1U2FA 3Q8SB 3EPIA 3PVXA 3KFWX 4WFZA 1SIZA 2I9SA 2K2PA 1KVIA 2OIHA 4NLXA 4P6QA 4IFYB 3HMJG 1RTDB 5KFDA 3GIIA 4DR2F 3KLHB 3QIPA 2VC0A 2HFVA 3UI3A 2H4WB 3D1OA 4G1PA 4Y0FA 2KFNA 4FF2A 2IDEA 3SDEB 3M30A 3BGRA 1HQ2A 1D9AA 2P9CA 5DJBA 2HLUA 2ZNZA 3M8SA 2QV6A 2RKIB 1YZ6A 3GIMA 1S7IA 1NAQA 1RWXB 2KL8A 1VC0A 3QPIA 1VMBA 2W9BA 4NLRA 5L1LA 2UZAA 2J9EA 3W9HA 4O3PA 1H2TZ 1W2IA 3UFCX 2P6SA 1MW7A 3T5KA 3M1VA 4USJC 4DV7F 1TKTA 5L1JA 2YVSA 3CSKA 3EXYA 3H2UB 2G0IA 4HI1A 2Q3PA 1QE1A 2ZOMA 3LP0B 1B0VA 2HS3A 3CWJA 3SXLA 4O3SA 4Q2MA 5IC6B 4KTQA 3OJUA 3DMJB 1IJFB 1FVSA 3DDNA 5E2QA 3JSRA 2G2YA 1P6TA 3MF5A 1R0BG 1UJ6A 4PXEA 4K59A 2F4VF 4LFBJ 2VA2A 4FVCA 3CDAA 2XLKA 4E2FB 4ZCLA 2MY8A 2MQMA 4OZLA 2FJDB 1FE0A 2MZTA 3QGPA 2B9EA 3HI9A 2DHAA 1RWNB 1R0CB 4DV0F 1G3OA 1F3FA 3GIRA 3KHGA 4ZS6A 2XB2D 1FRMA 1EHWA 2DHSA 5A6WA 4ED8A 1QDUB 4FYXB 1QAIA 5KFPA 1VBYA 5D4OA 2H54B 1SVDA 3PCOB 4HDHA 3R5CA 1CS4B 3FVYA 1S99A 1U6FA 3QSYB 4KKOA 5F8MA 1LK5A 4NA1A 4RW8A 2KT5A 2GHWA 4DR6F 2ZM6F 1TL1A 1X4EA 3MUVP 4S0MA 1GQEA 5A8RB 3SEOA 2J5AA 1RXOB 2V50A 2ACMA 4XO0A 2DNKA 1X60A 3NKYA 3DGPB 2H5EA 3FNNA 4PAAA 3SCLE 1FEEA 3EE3A 4RBVA 1RWOB 2BUNA 1TK0A 1YJVA 3PKYA 4RWWA 2B51A 3GFZA 1QJHA 2GQCA 4K7QA 2LECA 3PKMA 5IWAJ 4N41A 5JJBA 2KTQA 4ITSA 4J9PA 4DL3A 3IRWP 2WHOA 3K8WA 4IR9A 4RW7A 2Q79A 1UPPA 4PPDA 1I5OB 5J2MA 4DUTA 4U67Q 2QZ8A 3OUYB 3QO9B 1S6QA 2A18A 2VH7A 1Q16B 1MU2A 3L95X 4NLYA 3G87A 2CZVC 5CZVA 1HNZF 3FBEA 1WOSA 4HACA 1M1HA 3AJDA 2X3DA 4H4MA 3K59A 2BR0A 1TKZB 4XIUA 1A7GE 3DFEA 3KLGB 2JEGA 1S76D 1RT6A 1N5QA 2R7TA 1EJ7L 3KG0A 4DPUA 3NGRA 1G4CA 4P74A 1N5SA 2G9OA 2GVZA 2OFHX 3QAEA 5T7LB 3BJYA 4X2BA 3Q8VA 2KT2A 2LQ9A 2HEKA 3HSJA 5BYRA 2BDPA 3LWLA 2HHTA 2EW9A 4QYZK 2MEWA 1HBOA 4I64A 4OZ2A 3D4JA 4C8KA 3MCOA 2EVZA 5HLFA 1VIOA 2BM1A 2BRLA 1IXKA 4CRJA 4ALZA 4IQMA 5GMEA 3FBBA 4AXIA 2I38A 1N34J 1U2CA 4OI4A 1YBUA 1FWKA 1T3OA 3RB6A 4KHPJ 3BGRB 3H8YA 3SYZA 3QMQA 5U47A 4HTJA 1VHIA 1CJTA 1X0PA 2B8QA 2CJXB 2HHXA 2W9BB 2RHQB 1VIXA 2KM8B 1Y3JA 3L7UA 3LAKA 1UL3A 2B9XA 4DX6A 3B4MA 3I0SA 2GJFA 3F44A 2K3KA 5HQLA 3M1VB 3MEDB 2OTJS 1TKTB 3OR2A 4UOGA 2X1AA 1S6PA 5AJ3F 1Y3KA 5HQ8A 3D1QA 1HNXF 1A6LA 2R7OA 2YY3A 3L7OA 2H5JB 4P72A 1TELA 2FZCB 1ZAXA 2NREA 1SJFA 4AL5A 5IQ6A 4C3LA 2OGUA 4ZDNA 1NXIA 1JKHA 2PDAA 3V4MA 2LXIA 4KB7A 5IOLA 3Q8YA 3PJWA 3R7NB 4OMFG 1DFDA 2JFDA 2ACYA 4B9TA 4MKVA 4QWEA 3B6BA 4ECUA 2CJAA 3FUYA 1ZYQA 2CPZA 1U1MA 2V8GA 4I6YA 2EG2A 2KYXA 2OP5A 1NB7A 1VQYA 1BWVA 4CT8A 3T6BA 3A3NB 5I3UA 3KUHA 2HRYA 3WHIA 3QIDA 1RDRA 3RJMB 2FLOA 5KFGA 3RBDA 1DURA 2DNGA 1RWPB 2C3MA 2YBVA 1XMQJ 2WB1D 4KKOB 1LWEB 4RW8B 4C2MA 5K8NA 2HWHA 1TL1B 4OFZA 2BE2A 3QT7A 4USIA 3VZIA 1DZ5A 3DGVA 1WF2A 2BJ7A 3CW2C 1S9GA 1TAUA 4WIQA 4IG0A 2ZHOA 2CADA 3K5MA 4QIEA 4LUBA 4IR1A 1WTFA 4Y34A 1FJGF 1V9OA 2FHMA 1KC8T 2CKWA 2OI2A 4NLPA 3UN3A 5HMYA 4YHHJ 3NBPA 3W2WA 4DR5J 4B3RJ 3UR0A 2LA6A 2MB0B 4JB8B 5J2MB 2W8LA 4NXMF 4X4UA 3BR8A 1S6QB 4LFAJ 2UUTA 2ALYB 5B0DA 1Q8KA 2HVIA 2V0NA 1KTVA 4LRAA 4CO4A 4UOCA 2IVFB 1IBLF 2MZJA 5IV4A 1PJ6A 1NSKL 4UW2A 2F8HA 3HSZA 1WC6A 4KFBA 3WX4A 5F8IA 4ED5A 1JX4A 1YJ7A 5J1EA 2KXHA 4H4MB 3A4TA 3RB4A 2CDQA 1RT6B 2ZBQA 1ZPWX 2GVZB 4LRBA 1NLKL 4NI2A 3N6MA 2COLA 3M4XA 1S5ZA 2F5GA 1CJVB 1UFWA 2DHGA 1RISA 4ZVGA 4FXDA 3R5JB 3MR7A 2W9CB 1TP7A 5HLFB 4HI2A 3CDEA 3VVTA 3ZZRA 1LOUA 4OYPA 2AIRB 1X4AA 1FWLA 1Q7LB 3OTDA 2HAIA 3BBFA 2GA7A 1VK3A 4K4TA 2MQ8A 1QM9A 2HNYA 1M5VC 1ZS6A 2Z58B 3ET6A 1MWYA 1D9DA 3D9BA 2V8PA 5KTQA 3R9LA 4JI7F 5DQGA 1CJTB 2YX1A 3J7A1 1JLAB 5CD4A 3KDOA 2VJUA 4LF7J 1B64A 1FDDA 3TWZA 3I0SB 4YB6A 3MPDA 3MD3A 3D3CJ 1L3VA 3EZUA 4DR4F 1AA1B 3FK4A 4I68A 1K0VA 2OH2A 4LFBF 2GGPA 2Y8YA 2I5JA 2H1YA 3M9MB 5F8LA 5HBMA 4AT1B 4CP5A 5DRKA 2UUAF 3GILA 4FBUA 3ISZA 4OYMA 1FXRA 3TR5A 1MSWD 4GRSA 4PG4A 4DCOB 1ZTTA 2FIUA 5B0EA 6FD1A 2HHQA 1JKHB 2VQFF 4ZVEA 4A48A 5KFFA 4JV2A 2D41A 1DLOA 2MSTA 3NCRA 2F9DA 2FD2A 1V3SA 2EFOA 1F6TA 4HH0A 1WSVA 2YXLA 5B0FA 1QVGR 4DPOA 2YWWA 2JC0A 4LF4F 1UMJA 1FJEB 4ED4A 4DBQA 3BEGB 3GLJA 2W8KA 1WC3A 2VFRA 5KFOA 4DLEA 5K8OA 3NRBA 1N56A 4PWUA 1WOPA 5B0CA 2DISA 4PXDA 1RU2A 4A8YA 2AEJA 5KT2A 2BX6A 4CM0A 3KLFA 2XI2A 1H98A 1TTHB 1KS2A 3GYXB 5IM0A 1DRZA 1YG0A 4C8ZA 1OJ4A 4OI6A 1SH2A 2W2QP 4EYHB 4EO8A 1I51B 3MM6A 3LGNA 4IG3B 2GFFA 3CT9A 1WG4A 5E3AA 5G0RB 3BPSP 1FI4A 2VG7A 4NPOA 3GG1A 3DOLA 4V19X 2C3PA 5DG8A 1S9GB 2CFXA 2VPXB 2UV8A 3JQMA 1Z2ZA 3GSIA 2VPWB 3NOCA 3R5GA 3D0GE 4HTIA 4IG0B 4OJ1A 4RW6A 3QJPA 3M32A 2YNIB 1GNKA 1L3TA 3PXGa 1C4CA 4N77A 2DITA 1R0AA 2P6TA 1XNRJ 3NBPB 4ZP8A 3NGSA 2GCFA 3HT0A 3VALA 1UEKA 1ZM3A 5M2PA 5KFCA 3HVAA 5HL7Q 1HBUA 4MT1A 2YX4A 3NWGA 5SUHA 4PKDB 3IR5B 1NB2A 5D4NA 1N88A 4YR2A 2OAUA 4FYWB 3K5LA 4ZA1A 4Z2XA 4CO5A 4RU9A 3CF5Q 3M8WA 2POKA 1YGYA 4TQSA 1HMVA 2ZITA 1YIJS 5EUHA 2BACA 5I3QA 5B08A 2R4FA 4CH1A 3IA0A 1RE1B 4NI2B 4DEZA 3V4IA 4WIIA 5T14A 1U1KA 1MWQA 3KWMA 3U1LA 2CQ2A 5C7PA 2VICA 4JI0J 3HDSA 3ENAA 2V2QA 2V4QA 5D8HB 4KIAA 4B3MJ 1RT4A 4B3SJ 1RKJA 2AD9A 2HQDA 3AD8C 1FWPA 1PCAA 3OBIA 1Q0NA 3CCES 2WSEC 1RWUA 3QFHA 1RT2B 2QYGA 5JUMA 4DSLA 2F8MA 3BSAA 3LANA 1JIHA 2HMIA 4ZVUB 2W7PA 2BJDA 1YTYA 3E3XA 4EEYA 4JI8F 4M5JA 4DPYA 1I94F 2V2ZA 3DYAA 3EVOA 4OZ1A 4QWAA 3KJQB 2WBRA 4OV6A 4EYIB 2YKQA 4F67A 4DN0A 4IUFA 5KG0A 3BYRA 3KK3A 1MMDA 4ZCMA 4I6WA 5KOXA 1U4BA 3DLEA 1T9UA 1CULB 3VAGA 3IM9A 3NS6A 4WPAA 1RTHA 2E5HA 4DL4A 3GPAA 2KRBA 2UU9J 2G4BA 2I5JB 4CNZA 4ZHRA 4ZLNA 4QQBA 4O4GA 5HBMB 1VQSA 2KI2A 2AYGA 3CD7A 4M5GA 3NNHA 4X65F 1S6OA 4KPCA 5CH7B 1RAIB 1UVNA 5J2NA 4DV5J 2NYIA 4Q7AA 2DTJA 2BANA 3FMBA 2BZ2A 3HD1A 2MLYA 3FSIA 8ATCB 2E9TA 4U8VA 1B70B 2GVDB 4K4UA 1FEHA 3P3DA 2R7RA 3SFGA 2GMLA 3PNIA 4RWXA 3LQVA 3MM9B 3KHHA 3KHRA 4JI3J 3AQPA 4PPZA 4IKAA 5LMUJ 4WFBQ 4Q45A 3ITHB 1WG1A 5H1SV 1F1BB 1KDNA 3LAMA 4O23A 4ZK7M 3ZTPA 1LQ9A 2EPIA 3BDEA 4F2SA 3DDKA 4EZ6A 2GO9A 3EUNA 3U02A 2RQ4A 2UXCJ 3CC2S 1VDHA 2ZJQQ 2KJVA 1CQNA 2AT1B 2N7CA 3C16A 3DLGB 3MEEA 4V19J 5CYQA 2XSJA 1KFSA 1RWMB 1HWLA 1XN9A 5ETOA 4QR0A 3KLFB 1YJUA 2R8HA 4DR1J 1QUPA 3TJ9A 2DY1A 2OKQA 5IM0B 1PGZA 2C2OB 5FLXU 4KGXB 1LWFA 2V6AA 1SUQA 4USKA 1AZSA 1X4DA 4LSZB 1DQAA 4ZVRB 4KO0B 3DOLB 4J9SA 4YDDB 2FHOB 2R3VA 4PEOA 2KFYA 2M7SA 3G6VA 2LEBA 4IH7A 1S4FA 1JQGA 4X4TA 5D6GA 2FVPA 1L3KA 4RW6B 3M32B 3DXBA 2XULA 2Q6CA 4RNFA 3PIOQ 3BSOA 4K5RA 4ZPVR 1TMJA 3ZXWA 1HHSA 1KWMA 2VFVA 3IAS9 3VZHA 5K8PA 1QAJA 1PC5A 4DV1F 5C2CA 3MCSA 1U2RA 2RUGA 3AA9A 1F9HA 1R0AB 2EBGA 5ETSA 3NAIA 1NJXA 1LWCA 3E01B 4KAIA 4C8MA 2GHVC 3DOKA 4ED3A 3I87A 3MAQA 1UZHA 2AZ1A 2RNEA 2QFIA 3U27A 3PW2A 1HBUB 4X4NA 1TUGB 3MMCB 4PWDA 2OTLS 1GX6A 2ZZTA 1X9WA 3US5A 2ASYA 2CQ1A 1QSYA 2AYMA 4ECYA 1IBCB 3FC9A 5ITHA 2DNPA 1VRUB 3CEDA 4ZLPA 1DAXA 1KSPA 4I2PB 3BZQA 4O44B 2OPQB 1S77D 1KLMA 2Y0SD 3V4IB 2VF3A 3G8QA 2LEPA 1V5VA 2KH9A 1XWLA 2DR6A 2RF2B 2A1BA 2V68A 1SJ4P 3DLKA 4GVBA 1TFYA 2ZHAA 4PQUA 2YKAA 2VPYB 4ECQA 3UVJA 2BOAA 1K1QA 3MAAA 2ALZA 3N28A 4Y3CA 5LMNF 5KFBA 4C3MA 5DQHA 2YWEA 3HHDA 1J5EF 4LF7F 3VTIA 1OPZA 1VQ8S 2HS0A 2RIJA 4WU3A 2HMIB 4FPIA 2FLLA 3HK2A 2BV3A 3CCTA 5HP1B 4JI6F 3M8RA 1I3OB 3RU0A 1N36F 1TU0B 3DYAB 4WXOA 1ELOA 2CPHA 1KTQA 3BREA 1SKWA 2LVWA 4B9LA 2PA8D 1VQKS 2RAQA 3KK3B 2DGOA 3JAMU 1N33J 2XLIA 4Y28C 1LK7A 5JXSA 3DLEB 4K5SA 2R2RA 2DEIA 2JRSA 1QD1A 3M9OB 3W5XA 3GIKA 4OHXA 1FNOA 3HSGA 4J5OA 2NLWA 3HT3A 4O4GB 4O0NA 4ZVSB 3PW7A 2JVOA 3JSBA 4DR3F 1YVFA 5J2NB 4BWMA 1FT8A 4L6V3 4P7TA 1IR0A 2YTCA 3T1YJ 4AQYF 3QLHA 2JLEA 4CT9A 3KHLA 4FS2A 3ELHA 4M1KA 3T9NA 1VR6A 1RACB 3RBXA 2ERRA 3H25A 5IV3A 4OX9J 5DZ6A 1WHYA 4W98A 3S6EA 1N0VC 2FC9A 3DC2A 2EI5A 3QWPA 2F1FA 1RCOB 1JLGA 5D0RA 2HAFA 1N5VA 3GZ7A 3SCKE 3PACA 1G7CB 1RT1A 1WSRA 3M2VA 4QW9A 4H4KC 2FB0A 1B3TA 2XBPA 1M5KC 1Q86T 2FJWA 4IOCQ 1HPZB 4LMZA 3R1LA 2RRNA 2NXUA 1NH7A 1UPMB 3TI0A 2RDJA 2W24A 1RTZA 4AXJA 5CYQB 2FLPA 4HHHA 4B9UA 4USTA 4OYWA 5DLGA 2IRXA 3HLUA 2VA3A 5GMDA 5CXTA 5C24A 4LF9F 1HWKA 2QGFB 4KH1B 2CQCA 3TA2A 2HHHF 3HHLD 1X4FA 3QYYA 2PA3A 2BE7D 1KLNA 3WIVA 2JEFA 4CNYA 3I31A 2VJVA 5D4PA 3FCVA 4U8YA 3JSMA 1H73A 4ZPAA 1Y11A 3OL7A 2DY9A 2RVJA 4FP9A 4Y2CA 2CPDA 2RUSA 2OHDA 2KG1A 5IT4A 1CC7A 5E3CA 1FFSB 2Y3YA 1BWEA 3THTA 2C3OA 5DG9A 3CD6S 2NZ4A 3HHEA 2KM8C 1NSQA 1LWCB 3TAPA 4JUZA 3RG6A 3I0RA 4UOHA 3LO3A 3DOKB 3GIJA 4WF9Q 3LW5C 4ZJOA 1VRTA 4DV6J 2F63A 1IM4A 5CCLA 1OMSA 3KDNA 2FVSA 1FRIA 2J7WA 3MXHP 2FTRA 3FRYA 5KFYA 3S1TA 4DU8A 4LVOP 4CYUB 2G2ZA 3C46A 2RQCA 3Q8QB 1T05A 2IJNA 2WONA 3K57A 1HBNA 3MMBA 4RUAA 3A8JA 4B3MF 3TZYA 5LT5A 5K8MA 1UWAA 5GADI 3CJTA 1JNZB 2DNLA 1MLAA 3HKZD 1NUEA 3P49B 4PYAA 3CJ5A 3DLKB 4GVBB 4Q8FA 2EXUA 3G6ES 3UNGC 1SBRA 4P2FA 1HWUA 3AQOA 3MAAB 2AJ4A 3E8OA 1VQ6S 5KFLA 1B99A 2W2PP 3PRDA 3ZZUA 2ASLA 4B9SA 4DV4J 4O3RA 1LFPA 4UQGA 1O8BA 4YOEA 3D3BJ 2MKHA 1JLEA 4LIWA 4Y65A 3GJRB 1DY3A 3L3CA 2UP1A 1DQ9A 3J7ZT 3PX0A 2DRAA 3HD2A 2W9AA 2UU9F 5KFKA 4RW9B 3KK1B 4OYBA 2D9PA 4X64F 2IM3A 2XMTA 5LJ3Y 5CCMA 3BPDA 4EZ9A 1IKVB 2CPYA 1RU1A 1UAWA 2HIYA 3PHEA 2UUCF 4P2SA 3CJ0A 4LF1A 3QFWA 1EKSA 2GIQA 2HHPA 5F41A 1CPZA 1BMQB 1U1NA 1JXLA 1YRUA 1J27A 4KSEB 2VFTA 3A1YG 4QPTA 2W2MP 1RT5A 4ZVQB 3BV8A 8RUCA 3C14A 3QLHB 1SJRA 1FCAA 1NRKA 5LMUF 1IN0A 3G82B 1FXLA 1SH0A 4HT7A 4DFMA 3GU0A 2NCKL 1NPRA 3ISND 2QN6B 3ENVA 2UXCF 2HBQB 1XR7A 1JLGB 2HGMA 1TAQA 2MQOA 1VC6A 1EIYB 2GNKA 1RT1B 3VAFA 1D09B 3M2VB 3M8PA 7FD1A 4URQU 2CQDA 2BKPA 4BBYA 2HKEA 4X84A 3T5LA 4GVLA 1LW2B 1RWWB 1HD0A 1HI1A 1S0VA 2MPUA 2UVVA 1Y10A 4LT6A 2YWGA 2RQMA 3OTOJ 3M9NB 3LGHA 4F3QA 4B3OA 3VR1A 4WE1A 4J9MA 2L9WA 4WCEQ 2PSZA 2V4JA 2ADCA 5D0HA 4C7QA 2XO7A 2WW8A 2CXEA 1FFGB 1EKRA 2CJ9A 2UXDF 3TVKA 2CZ9A 1XNQJ 4AL7A 4LF6J 3FEZA 4M5KA 3CCWA 4ED6A 5KFJA 1NPPA 2NQPA 2IC3B 4TLRA 4M94A 1FJCA 3I6PA 4QYRA 3M7VA 3VGVA 3ETMA 2BKNA 4UF4A 5BYSA 4ECZA 2QT7A 4CO0A 3H4DA 1W2BR 4BC9A 2FLNA 2V2VA 3LPEA 3HCXA 4YUDA 4F4XA 1VBZA 3EMTA 3U7JA 1X8DA 2MKIA 2KJWA 1VRTB 1NDPA 1FK9A 2BXJA 1M90T 4LF8F 5KOWA 2IVYA 2CPEA 1NK7A 3IRXA 4WK3A 3THVA 3PG9A 3ZC4A 4C3KA 3MPWA 2R7XA
chains in the Genus database with same CATH topology
4RNMA 3QMQA 1D8YA 2ZOFA 2BANB 3A8EA 1T05B 5U47A 4HTJA 1PILA 4FN5A 1Q81T 4DJBA 2YNFB 1O0PA 1RGVA 1X0PA 1OS5A 3O8WA 3FFIA 2OD6A 3WBZA 4KR0B 3PR5B 3CPWR 4JI4F 4MFBA 4D3GA 2HHXA 2W9BB 2G13A 2IMOA 2MGZA 1OSCA 2DNHA 5KG5A 1VIXA 3LALA 2KM8B 1Y3JA 4U9RA 1JNRB 3AB2B 1S10A 3LAKA 4FXWA 1UL3A 1KD1T 2B9XA 1SL2A 3B4MA 2KU7A 4H54A 3OFHA 3I0SA 2KYZA 3MFIA 3F44A 2GMJA 3BM7A 2NS1B 3OFGA 2V9KA 3TYTA 3VF0B 5HROA 3E01A 4WFYA 3ONQA 1SV5B 2K3KA 4M95A 3M1VB 4LSNA 2DH7A 3UCUP 2AJ0A 4ED7A 3MEDB 2OTJS 3BF4A 4PG5A 1TKTB 4WYWA 3OR2A 2X1AA 2RRAA 1S6PA 1TVRB 1UA1A 5AJ3F 3QZ7A 4JI5F 2BQUA 1U1LA 1Y3KA 1UVLA 3KLEA 4JV0A 2M52A 1VQ4S 2FPHX 4HYKA 5G4DA 2ZH6A 5HQ8A 5F0UA 2DH8A 3D1QA 3FZ2A 1Y5IB 1TUVA 2OSQA 5E3PA 4CIOA 3MMCA 2VG6B 5B09A 1HNXF 1A6LA 2R7OA 4NLSA 5E5NA 3CIZA 4TNOA 2Y1JA 2YY3A 3L7OA 2BVZA 3MPYA 2HQIA 5A0YA 2RT3A 1ZAXA 1VQMS 2NREA 1SJFA 4YP3A 2QMWA 2WCXA 3MEEB 4F25A 1P1LA 2CQHA 3DRSA 5A8WB 4AL5A 5B0GA 1VRUA 5IQ6A 4OHWA 1ULRA 4C3LA 4ZDNA 4QPXA 1JKHA 5HMXA 2XSJB 2PDAA 3V4MA 2LXIA 4TYAA 2WOMB 3MGJA 4I2PA 3KLIB 1JLEB 1U24A 3FEXB 4KB7A 1REVA 2KDOA 1MMLA 1F0XA 5IS2A 4YY3F 5KFTA 1NJIT 1KOHA 5J2PB 2VOPA 1U7LA 1S9EA 3POTA 2OPQA 4O44A 4MKYA 1JK9B 3PO4A 1FRHA 4TN2A 1FESA 5LSLA 3RR8A 3FMWA 3PR4A 4FBTA 2BYCA 3PJWA 5F9LA 1HQEA 3LWMA 4WZMA 2DGTA 2UUBF 4OMFG 1DFDA 4ICLB 2JFDA 1LWFB 2ACYA 4B9TA 4NA3A 3PIPQ 1SUQB 2R2SA 4QWEA 1QSLA 3HXMA 2WAQD 1PSDA 2KT3A 2QFJA 2EFVA 4ECUA 2UVRA 2CJAA 1SQEA 2RF2A 4XPEA 3OFEA 1ZYQA 2CPZA 3UDLA 1X4CA 2JZ5A 4D3HA 5FLXY 3K8VA 3IAM9 4PXCA 5K9FA 1ZM4A 3DXSX 1U1MA 2V8GA 2B7CB 4NLTA 4ECRA 1XR5A 4I6YA 2EG2A 2KYXA 2OP5A 3ZZYA 1LW0A 1MROB 1NB7A 4OI3A 5H9FJ 2B6AA 1HR0F 3FGVA 2ZFHA 3K5NA 3T1YF 5GAHU 1VQYA 4FNHA 4CT8A 1XNRF 4X4QA 4YQWA 2YX7A 3T6BA 3W3SA 1RTJA 4NMLA 3RTVA 4LFCF 2LA4A 4EO6A 2OPRA 4C11B 2O66A 2IRUA 2OPPA 1D8ZA 3H5YA 2GV1A 5I3UA 2PFFB 2VOOA 1F60B 1U45A 1WF1A 4F8RA 2LEAA 2HRYA 2HWIA 1XMBA 4FS1A 4ILMA 2WB4A 2MZRA 3QIDA 1RDRA 1VQNS 2B4PA 2FLOA 5KFGA 3T6JA 1ZH5A 1SXLA 3RBDA 1DURA 3GWCA 4C8LA 1NKEA 3DRRA 2DNGA 1NHUA 2C3MA 2YWHA 3DRPB 2DGUA 1B0TA 1RTIB 2NR0A 4K50A 1U8SA 2EFNA 3B82A 2CG4A 3KK2A 2G1DA 2FY1A 4R8UB 2WB1D 2JWNA 3AHPA 3W7BA 4CTAA 4R5PA 2YQ3A 4KKOB 5HP1A 1S1WB 3HVRA 1HI0P 2CQ0A 4C97A 1FDNA 2XC9A 1C1BA 1LWEB 2Z4PA 4RW8B 4KHRA 3JYTA 4C2MA 5K8NA 5D4LA 2HWHA 2ZE2A 1NKCA 3MI7X 2J9DA 4B3TF 1DQ8A 3LGMA 2HNZB 2CQ3A 2GX8A 3H5SA 4UY85 1CEZA 2EK1A 4FF3A 2P5VA 4QWBA 1TL1B 1RT7A 4RW4A 4QU6A 4OFZA 3THPA 3UD4P 3QGIA 1TQLA 2BE2A 2ZC4A 2J7KA 4I2QB 4OZ5A 4USIA 1C4AA 2B43A 2AX0A 3HVWA 5DS7A 5EHHA 2K3IA 4X4PA 4PWDB 3VZIA 1DZ5A 2AYBA 2P9EA 5D78A 2QA1A 1WF2A 4LQ3A 3GV8B 2E1MC 1FRXA 3ETOA 3CJ4A 3N0VA 2VONA 1JJ4A 1S9GA 2KHDA 1TAUA 1WNEA 1H2UX 1C0TA 3IR6B 3ZZ0A 2XMWA 1VI7A 2VKRA 3AB4B 3M8PB 2N4CA 4ETZA 4ZVFA 2CIMA 4JI0F 1YRTA 2DO4A 1GXLA 2YKMB 3TP2A 5IZHA 3SMZA 5E41A 1HHTP 3P6YC 1ZAWA 4IG0A 2ZHOA 3K5MA 4QIEA 1HNIA 1HL6A 5LXYA 2DK2A 1Q82T 2FJBB 2VODA 4LUBA 2M88A 1SB6A 4OI2A 3K7RA 1P8GA 1WTFA 4Y34A 3IWLA 4IR1A 1U6BA 1FJGF 1TKXA 3BR9A 1V9OA 3MTKA 4B3SF 4X4VA 2FHMA 4C9DA 1KLMB 2H9ZA 1KC8T 4NLWA 1DARA 2CKWA 3JTNA 3CCRS 2A3JA 4NLPA 1GXUA 3PX6A 5HMYA 3VQSA 1KOOA 3NBPA 1N5TA 3W2WA 3RRHA 2JEJA 3NGDA 2AJQA 1VLYA 3NCPA 4ZKAA 4O0IA 2E5JA 2QSWA 5KAKA 3UR0A 4OI0A 1WHWA 3D5MA 2LA6A 1V6HA 2MB0B 2DR9A 1E6YA 2WBMA 4FXVA 4OZJA 4WE1B 1J5OA 2KG0A 4MKBA 3MPVA 5J2MB 2DNNA 2W8LA 4NXMF 2NSBA 4NXNF 4PQUB 2ZD1B 4X4UA 3V6DB 5CYMA 4ZPCA 2N7YA 2VFUA 3BR8A 2MQLA 2YNHA 1S6QB 3HPOA 2HIQA 2UUTA 2KFZA 2FVQA 4DQIA 3GMGA 5B0DA 2A10A 3E51A 3CCLS 3Q23A 2K7KA 4GKKF 2HVIA 2V0NA 2FUG9 1EETB 4KRWA 5J1NA 3WC0A 5F9NA 2XS5A 3H98A 2VD3A 1C2PA 1KTVA 4CO4A 3UCZP 4UOCA 1Q7YT 3MEGB 2IVFB 2N82B 4EBCA 3PV8A 2W4DA 1IBLF 2MZJA 2I0XA 4AUKA 3J7YI 1ZZFA 3OQ2A 4N8NA 4UW2A 1IKXA 1HW9A 1X4BA 4WTYA 2F8HA 2HVHA 4KFBA 3WX4A 2GQQA 5F8IA 4ED5A 1V3ZA 1JX4A 4A4JA 5J1EA 2KXHA 1NJZA 4B08A 1CG2A 4H4MB 5F0WA 4NWBA 4WFNQ 2PD1A 4DFJA 5KFNA 2EBEA 1HQUA 1G1XA 3RB4A 2CDQA 3GV5B 4NLOA 4WKYA 1YJWS 4DF4A 1N4LA 1IBKF 1C0UB 1RT6B 2XCAA 2EC0A 3I96A 3CJKA 1NJWA 4IH5A 2E1RA 4DX8H 1ZPWX 3O1LA 1RT3B 1URRA 5FIIA 3SZ2A 4OIXA 4W92B 1HPZA 1U26A 3MOZA 1N6QA 1YJRA 1C1CB 2IA0A 4PR6A 5I3PA 3TQ1A 1K73T 2AJ1A 1L3UA 2EWHA 3UCGA 3N6MA 1SL0A 4B9MA 4FYDA 2DNMA 3G8SA 3EX7B 3I9V9 1TL3B 2COLA 2Z8QA 2CJQA 1S79A 1UWBB 4RNOA 2WTFA 1IQZA 3M4XA 2F9JA 3TANA 1UFWA 3MTJA 2DJWA 3G86A 1UVJA 4EWTA 4DSFA 4DSEA 2DHGA 1RISA 2DNRA 3PO5A 3PEHA 2OO4A 4ZVGA 1FXDA 5KT6A 4A8SA 4FXDA 4DV5F 3PFOA 2B5JA 4M5DB 3GG0A 2FJAB 4DL7A 4IDKB 5I42B 2W9CB 3H59A 1TP7A 5HLFB 2QO3A 4HI2A 3CDEA 4JI2F 1FK9B 2J6SA 4Q0BB 3ZZRA 1LOUA 1YWXA 3O44A 4LF5F 1D1UA 1X4AA 3IRXB 2M8HA 2CQBA 2AX1A 1Q7LB 2DR5A 1WHVA 2AF6A 2CPJA 2VKZG 5A2QY 4DQPA 3OTDA 4MJKA 2HAIA 3Q8RB 2RE1A 2GA7A 1VK3A 5DLFA 4K4TA 1QM9A 2HNYA 1M5VC 6FDRA 2XI3A 5L39A 2VZ9A