2YH0A

Solution structure of the closed conformation of human u2af65 tandem rrm1 and rrm2 domains
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
195
structure length
195
Chain Sequence
ARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSENPSVYVPGVVSTVVPDSAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRASVGAKNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SPLICING FACTOR U2AF 65 KDA SUBUNIT
publication title Multi-Domain Conformational Selection Underlies Pre-Mrna Splicing Regulation by U2Af
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 40
structure length 195
sequence length 195
ec nomenclature
pdb deposition date 2011-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2yh0A01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2yh0A02
1PO6A 1U1QA 4RU2A 2VONA 4CIOA 1X4GA 2E5JA 2M9KA 3UWTA 3J7ZT 1K73T 3RW7A 2LA6A 3CULA 2KG0A 2AYBA 1VBXA 2BOPA 1WG4A 2FC8A 1YWXA 2MKHA 1U1LA 3G8TA 3G96A 4PR6A 2DIVA 5IM0B 2E5HA 1H2VZ 3S7RA 3CCUS 2DHXA 1YITS 4LJMA 2J76E 5CXTA 3R1HA 2JX2A 1VC0A 1WTBA 2DNOA 2MQQA 3S6EA 2DNMA 2DNHA 1OWXA 1VQ5S 1WF0A 3NNCA 4FXWA 1K8AT 2EVZA 3CMAS 2ADBA 1X5TA 3CMES 2QEXS 2MQMA 3V4MA 2L9WA 2MQOA 1Q82T 5FJ4A 3MUMP 2KI2A 1X4HA 2ZJQQ 5JVGQ 2OIHA 2MKKA 4W90B 2MQLA 1HL6A 4WFAQ 4C7QA 1WI6A 1NO8A 1SJFA 2DNGA 2CQIA 2N3OA 3NNHA 1WHYA 2OTLS 1L3KA 1QVFR 2KHCA 1OPIA 5IQQA 1ZH5A 2JRSA 3PIOQ 2F9JA 2WBRA 2CQCA 1VBYA 2RQ4A 2VOOA 1WHWA 3TP2A 4WF9Q 2ERRA 3VF0B 5LSOA 4PRFA 2MY7A 4A8XA 4YUDA 1KD1T 3Q2TC 2GHPA 1YIJS 1QM9A 3EGZA 1WF2A 2JVRA 2M88A 2Q79A 2SXLA 2MMYA 4J5OA 3VAGA 2MKJA 1U6BA 2LA4A 1K9MT 1DHMA 5JVHQ 1U1NA 1WWHA 2RU3A 1N52B 2MJNA 2PEHA 4TU9A 3S01A 3OW2R 2MJUA 1U1PA 3B4MA 4F02A 2DGTA 1XN9A 2CPYA 3CCMS 1YHQS 1YJ9S 3H2VE 1ZZFA 2RNEA 5CYJA 2MYFA 1H2TZ 1VQNS 3DLLQ 2KXFA 2M8DB 3HHNB 2KM8B 2PE8A 2CQ3A 3IRWP 5LJ5Y 1VC6A 3CF5Q 1FJCA 2DNRA 4CH1A 1SJRA 1WEXA 2CPFA 3CCES 1VQOS 1JJ2R 2G4BA 1Q7YT 2DNPA 2G1DA 1H2UX 5CA5A 1X4AA 4Z2XA 2DNNA 1VQMS 2MSTA 3MD3A 2MPUA 1N54B 2F3JA 4F25A 4UQTA 2CPZA 5DDQC 1WHXA 2DGSA 1WELA 3FEXB 5IFMA 2MY8A 3ZZZA 4WKRA 1WI8A 2D9PA 2CPDA 3VAMA 2FPHX 2O3DA 1HD0A 1X5PA 4W92B 2X1FA 1P27B 2DB1A 2M0GB 2DGWA 4IOAQ 2HGNA 4BS2A 2M7SA 2L41A 3U1MA 2ZJPQ 2EK1A 1X4DA 1N88A 5HO4A 2K8GA 5BJRA 3BO4A 2D9OA 3G4SS 3CUNA 3VALA 4WFBQ 2DHAA 4F26A 3I55S 1DZ5A 2DHSA 1SJ4P 5HL7Q 2CPJA 2OSQA 2KFYA 1WG5A 1WG1A 1VQ4S 2DH8A 2YTCA 2XS7A 2DNLA 2KYXA 3P5TL 2OTJS 2NLWA 2CPEA 4OZ0A 2LCWA 2LYVA 3P6YC 2YKAA 2M8HA 2DGQA 2KH9A 2J0SD 1Q81T 2CQ0A 2RQCA 1AUDA 4ZKAA 2E5GA 4U67Q 2MZRA 3TYTA 2AYEA 3NS5A 2MZ1A 1U1KA 1WEZA 1BY9A 1B7FA 2X1GA 1OO0B 4P6QA 1A7GE 4IO9Q 5LSLA 5GAEU 1HD1A 2KXHA 2MGZA 1HA1A 2FC9A 2N3LA 2HGMA 5LXYA 3D2WA 1A9NB 4TU7A 3J7YU 2CQ1A 5GAGU 1S72S 4M5DB 2DO4A 2CQGA 3MDFA 2AYGA 2CPXA 1VQ9S 4ED5A 1D8ZA 1VQ6S 2FY1A 2DIUA 1PGZA 1KQSR 2K3KA 2DGVA 5DDRC 2J8AA 2HYIB 2MZSA 2RUGA 3NNAA 3ULHA 1O0PA 2LEBA 2MZJA 2KRRA 2XS2A 1X4FA 3THPA 2X1BA 1U2FA 2DGOA 4IOCQ 5LXRA 3VAFA 1N8RT 2MHNA 4ERDA 2M2BA 3EGNA 3SXLA 3DXBA 3I56S 2MKCA 4YOEA 3CC2S 3BEGB 2DISA 1X4EA 2KVIA 2QFJA 2ADCA 3CC4S 3THTA 3G8SA 4LMZA 1U1OA 3CPWR 3P49B 1U1MA 1FXLA 4TU8A 1FT8A 2MZQA 3MXHP 1WF1A 2CPHA 4PKDB 2I2YA 4YB1P 2D3OR 2OJ3A 2DITA 2A3JA 2KN4A 2XS5A 1M5VC 3SMZA 2QA4S 3CCLS 2L08A 4OZ1A 3CCRS 3UCGA 3CC7S 1SJQA 1YJNS 2MQNA 1FHTA 2HZCA 2KT5A 5EN1A 2RRBA 4Y00A 2XB2D 2KXNB 1X5OA 4FXVA 3SDEA 2EK6A 4IUFA 3K0JA 2E5IA 2LXIA 2U2FA 3LQVA 2X1AA 2RS8A 2V94A 3CXCR 1YTYA 2UP1A 2KM8C 1X4BA 4WFNQ 2F9DA 3G71S 5H1SV 2CPIA 1VQKS 4V19X 4C0OC 4QU7A 1X0FA 4CQ1A 2N7CA 5GVQA 1M5OC 3NMRA 2XNRA 4UY8T 1W2BR 2M52A 2BZ2A 2MQPA 1JMTA 3UCZP 2DH7A 5IM0A 4WCEQ 3U1LA 1VQPS 3G9CA 5DETA 1P1TA 3MI7X 2DHGA 2RVJA 3CCJS 2KU7A 2DK2A 1FNXH 2DO0A 5D78A 2NZ4A 1U6FA 2CQDA 3HI9A 2MSSA 2CQHA 5D77A 3TO8A 2LMIA 3VAKA 3BO3A 1VQ7S 2OSRA 1Q86T 3P3DA 1UAWA 1NJIT 2MXYA 3VAJA 3PIPQ 3CCQS 1UW4A 2LQ5A 2M4MA 3MURP 1OIAA 2RRAA 2DNZA 1NU4A 1UP1A 2U1AA 2HGLA 3G6ES 5DDOC 1JJHA 3UE2A 2FHOB 2MGZB 1UFWA 5ITHA 3B4DA 3R1LA 2GO9A 2JWNA 2CQPA 2E44A 5GADU 1RK8A 1M5PC 1X5SA 2DGXA 3IWNC 1ZZNA 3MUTP 2LKZA 1FO1A 1M5KC 1M90T 2M70A 2KG1A 2XNQA 5GAHU 2YH0A 1VQ8S 1WEYA 1F9FA 2ZJRQ 1KC8T 2MB0B 2RT3A 3ZZYA 2VODA 3EX7B 1R8PA 4Y0FA 3CD6S 1VC5A 3MD1A 3Q2SC 2HVZA 2XSFA 2LEAA 5DDPC 1VBZA 4WIIA 3UD3P 2LECA 5DM6Q 1H6KX 3NS6A 5GMKa 3N9UC 3UD4P 1U1RA 2CQ2A 5DM7Q 3RW6A 2KRBA 2DNQA 3CTRA 1FJ7A 1YI2S 1QVGR 2DNYA 2DH9A 3UCUP 2YH1A 3MOJB 1YJWS 3BS9A 4LIRA 4CH0S 2I38A 3BO2A 1DRZA 1G2EA 2G0CA 1D9AA 1DBDA 2AD9A 1FJEB 4QQBA 1M1KT 4QU6A 2MKIA 1X4CA 4C4WA 2B0GA 1SJ3P 2VOPA 1WHVA 3R27A 1URNA 3VAIA 3LPYA 1JJ4A 1VQLS 3JB9k 2JVOA 3FEYB 1RKJA 3VAHA 2DNKA 4TLQA 3L3CA 5LJ3Y 1R8HA 2CJKA 3H2UB 2N82B 2RS2A 2AYMA 1SXLA 2LXUA 1KOOA 2CQ4A 1KOHA 4EGLA 2J0QD 4QPTA 2DGUA 1CVJA 2CQBA 1IQTA 2MZTA 3S8SA 3CCVS 3US5A 5MLCV 3SDEB 3CCSS 3MUVP 1S79A 2MKSA 2YWKA
chains in the Genus database with same CATH superfamily
2H48B 4IG3B 2ILYA 1HBOB 3J7ZT 3T5HA 3J80U 3VVTA 2UXBJ 1EHWA 2BOPA 4O3OA 3P8BB 3DFEA 3HCXA 5GMEA 4E0DA 3GG0A 4PG6A 2BBEA 1BC6A 1NSKL 2BUNA 2D41A 1RWUA 3M05A 2AJ2A 2AEMA 1UMJA 2CA9A 3FBFA 2ADBA 3BKTA 3R5BA 3V4MA 3HMJG 2WTFA 3ETMA 1RE1B 1H0HB 2E7WA 2P9EA 3M2RB 3PR5B 2AJ1A 4LFAF 3IO1A 4WP3A 1WI6A 3BSAA 3NP5A 1LWCB 1K44A 3M4XA 2YKQA 3ZNJ1 1VJQA 4DR2F 3ZTOA 1SJ1A 3MEKA 3ENQA 2ERRA 4E2FB 1QE1B 3HP6A 1FDBA 3TVKA 4ZPVR 3O44A 1YJVA 3VWSA 4LFAJ 3IMQJ 5KFCA 3QIPA 2Q79A 5F8NA 4EMDA 2GGPA 4S0MA 2MKJA 6FD1A 4J9PA 3V6DB 1JJCB 1IUJA 1CJTA 2XHWA 3QSYB 2J0XA 1SL2A 2H9ZA 1U24A 2ILZA 3H42A 1HYSB 3AJDA 2HNZB 2GAGC 3RYLA 3DLLQ 5F8IA 7FD1A 4DX8H 2DNRA 2ZVSA 3AXMA 3KJFB 1WDDA 4ED6A 3L7UA 4KHRA 3PACA 3EZ5A 4QJVA 1NSQA 4R8UB 4M5KA 2K7JA 5E33A 4WP9A 2QV6A 4P75A 3V81B 1KLNA 1VRQC 2F4VJ 2QT7A 1VK8A 2D1CA 1LWFA 2IYGA 2X1FA 3QGGA 4ETZA 2PEBA 3IG1B 5A8KB 5L1KA 3HZEA 2D9OA 3CUNA 4CO4A 3BBFA 2YPYA 3QT7A 2HFUA 1VIXA 3QAUA 3LWLA 3M32B 4ELUA 1CSJA 2HHUA 5G0RB 3BREA 1TV6A 2LCWA 4ZN1A 4B3RF 5CQGA 2BDPA 1NB7A 2DJWA 2KH9A 1QUPA 1DTTB 1Z4UA 3QNWB 2B5JB 3MCSA 3BGRB 4XPCA 2B9WA 1A7GE 4IDKB 4K4SA 1HQ2A 4ID8A 2KXHA 4NI2A 3KLEA 4WZQA 3OFGA 1ZS6A 3PX0A 4I69A 5GAGI 5B0FA 2K7KA 4B3RJ 3CO9A 1FDNA 1VQ6S 2YQ0A 2VHGA 4X4SA 2QA2A 1U4BA 3TRGA 4ECRA 4MIBA 2GJ2A 1N8RT 1HNVB 3BF4A 3ZZUA 2F63A 3SFUA 4OI2A 1CJKA 1X4EA 4DMZA 3D1OA 2IJFA 4RW8B 2UUCF 1U1MA 3DRPA 1URRA 3S1TA 4MJKA 2BRLA 2MZQA 1L3UA 1YLXA 1YDLA 1Q16B 4E8UA 4HH0A 1DLOA 4RW4B 1M5VC 3CCLS 2WB4A 3KHLA 5EN1A 4PXEA 4I2QA 2G0IA 3JTOA 3HD1A 4Y2AA 2UUCJ 1RISA 3LQVA 4BWMA 2W9CA 1YTYA 3W8GA 4JI7F 4OYOA 1FFGB 3MCMA 3G71S 1YSJA 2ZHBA 1NM2A 1NZ8A 3W64A 2HBZB 2DTJA 4ILMA 1FDDA 4IH6A 5DS7A 3CCJS 4DF8A 3AY0A 2RDDA 3AQOA 5HK4A 4DWIA 2OSRA 5JJBA 4RW7B 1Q86T 2DPIA 2XMWA 1PG5B 2YQ1A 4RUBA 3CCQS 1S1TA 2R8KA 3IR6B 2FLNA 5H9FK 3IXQA 1MU2A 1YJRA 4LF7F 3KHGA 2HGLA 2FHOB 2MGZB 4DV4F 5GADI 3MM6B 1M5PC 3IWNC 2X51A 3LUYA 2LKZA 1RA7A 2I0XA 3ITHA 1DARA 4DV1F 3CT9A 4ZDNA 4WIQA 1IKVB 3MM7A 3V2UC 3CD6S 3RAMA 5DDPC 4L73A 1CULA 4LF7J 1P6TA 2E1MC 1IKXA 1S4EA 3GWCA 3KNAA 1I94J 1JLCB 1J5EF 2YH1A 3BS9A 3AA9A 4N5SA 3BO2A 4RLEA 4DV1J 4F7VA 4LF1A 4MFBA 3DDNA 4YP3A 4K4WA 3ZXWA 3QGHA 1FVSA 3TA1A 3QGPA 4JI0F 1NDCA 1J5EJ 3FK4A 2CJKA 2BJ1A 5AE2A 3H2UB 1N32F 3OTEA 3V6HA 4FYXB 4IYQA 5ETMA 2OD4A 4KYZA 1C0UB 4TY8B 3MPVA 3BJYA 1AXQA 3M1VA 4JI0J 4MYTA 4J9MA 2FC8A 4OZNA 4IG0A 1U0HB 5CXTA 4HHJA 1UVIA 2DHXA 2H3EB 3EDQB 3MM5B 2GHWA 2KZMA 2CIMA 2DNHA 2A2CA 2KFNA 3GYXB 1Q78A 1CQMA 4A8SA 3T19A 4QYZJ 2HURA 3UVJB 4JI2J 5EX0A 4CM2A 4EO6A 1NHKL 3EUNA 2NPFA 4C7QA 1NO8A 4NA1A 4WBFA 4RNFA 2LLZA 2GC8A 3JS9A 4K2XA 2ZVIA 1IR2A 1JIHA 1OPIA 3A1YG 4OX7A 1FXDA 2OPSB 1EX8A 3EMTA 3DHXA 1IM6A 5L1JA 1KD1T 3UNGC 3EGZA 2GMHA 1MWZA 4J5OA 3OTOJ 5D0HA 1M0SA 4OX8A 3RAQA 1X7VA 3B4MA 1HBNA 3AOAA 5FLXU 3K5PA 3MR7A 5LJ5Y 4ZCLA 2CPFA 1UA0A 1KFSA 2VPYB 3BB5A 4CO3A 2XO7A 3MPDA 1H2UX 4LBHA 4UQTA 4X4RA 2HNDB 2MQ8A 5IC6B 4DG1B 4DR4J 3IWXA 4ZVTB 1N48A 3SIPB 5A8RB 3EVWA 5J2MB 2M7SA 2K3IA 1WACA 2XG8A 3RRKA 4MH8A 3G4SS 2DRDA 4LF8J 1HNWF 1RT2A 1WG1A 3R7BB 5M2RA 2C28A 4ZVGA 2HFZA 1HARA 3I0RB 1H38A 3UN2A 1RAJA 3DU5A 3TZYA 2B7BB 1IM4A 1TL4A 1RP5A 1N6QA 3I5CA 2X1GA 4PWUA 4IO9Q 2FC9A 2IBKA 2JC1A 5DZ6A 1C1BB 5KG3A 4CWBA 2VG6A 2Z56B 3IR5B 2HFVA 4U8YA 1Q8IA 3RBZA 2DIUA 4MKBA 1K0TA 4DEZA 3J7Z5 1HW9A 1X8DA 1O0PA 4K8RA 1UEKA 4P2MA 2EFVA 1WJ9A 3R2DJ 2Y0SD 5L8RC 4TY9A 3TAMB 4G6VB 4USIA 2OPPA 1HBUB 3BGUA 2PA8D 2ROGA 3BSOA 4OLPA 1RWKB 2UVWA 4UUWA 4DFKA 2BE2B 3CC7S 2BX6A 3CCRS 2HRTA 1WC4A 2RRBA 4Y00A 1NK6A 5LMNF 4NA2A 3MMBA 1UTAA 4DBQA 2U2FA 4ZVSB 5T14A 1YBTA 4HACB 3FGVA 1JLGB 2CNKB 3M9NB 2KT3A 3NS7B 2QIFA 4DF4A 2GQQA 1YJUA 2BA9A 2OEJA 5LMNJ 1B7YB 4C3KA 3TJ8A 4P2XA 3NMAA 2CQDA 4XK8C 2MSSA 3AB4B 5D77A 3TA0A 2YKNB 4OHVA 4FS1A 1RI7A 2RSQA 3T41A 3VAJA 3PW2A 1Y11A 2LQ5A 2M4MA 4DR3F 4OYBA 4B9UA 1HW8A 2B3TB 3BGOP 3PRBA 1K47A 1ZZNA 1RT7A 4M5MA 3GIJA 3UD5A 2IFXA 2EC2A 1REVA 3WX4A 1XK8A 5D8HB 2ZHOA 4MIAA 3W9HA 2R7OA 2I5JB 3L7OA 2VQEF 3GCWP 3GJSB 4CNYA 1RTIA 2C2RA 4N41A 4B3TF 3OR1B 1Z2LA 3SQGA 5K20B 1YJWS 3O1LA 4CH0S 4YR0A 4QQBA 4KFBA 1EP4B 3M9MB 4F4KA 5C5JA 3A3NB 2Z57B 2VQEJ 4CO5A 4B3TJ 4DR6F 4ZVHA 3EE3A 4J90A 4BLGA 4RBTA 2ZBQA 1NKBA 4OI3A 2DGUA 3A8IA 2XLJA 4PQUA 3C15A 2ZBPA 1YRUA 2HW3A 4N7TA 3NOCA 1JLQA 1T95A 2OGUA 1GX5A 2ZOFA 4MKVA 1NB2A 3LGNA 2GV1A 3PV8A 4MKYA 2DIVA 1H2VZ 3CCUS 1YITS 3WIUA 3R1HA 2XULA 4Q0BB 2MQQA 4RZRA 2FTRA 1VQ5S 3R97A 3LAMA 2XWYA 4RO0A 2L9WA 2IM2A 3HO1A 2B4OA 2KI2A 3DN9A 1FRXA 3JSBA 3L9ZA 4DFJA 1TAUA 5ETKA 2HFSA 3BR8A 1XWLA 2ZD1B 1KLMB 1SL0A 5D4PA 3T1AA 2FJAB 1HMVA 4JBCA 3TJAA 4GC6A 3GPAA 2I6WA 4NXMF 4NLDA 3D1QA 4ZP8A 3KK3B 4R5PB 2GVDB 4RWWA 3OW2R 1RAFB 2ZH3A 4LQ3A 1X0PA 3CGIA 4DX7A 6AT1B 1TK8A 3EPIA 3JYTA 2RNEA 1YJ9S 3LW5C 1WSRA 5E7OB 3FCHA 2G4BA 1CC7A 2DNNA 4X66F 4WP8A 1KVKA 5C24A 3HSJA 5KT5A 1VRUB 1WHXA 1F0XA 3HT3A 1N0VC 2PDAA 5KG5A 2N7YA 5E41A 4WTOB 1NK9A 4F4WA 5HO4A 5HQMA 2KL8A 3GQCA 1M5SA 4X66J 1DFDA 2BM1A 2V4QA 4UW2A 4TN2A 3TW0A 3PNIA 4BBYA 1TKTB 4WTYA 4U7CA 2BJDA 1YZ6A 3IP0A 4F4YA 2HRUA 3T6BA 3HVTB 3W3SA 3NS5A 2IIHA 3OV7A 3CVKA 2DO4A 3MDFA 1RZMA 4ED5A 5F0UA 1RCOB 1VLOA 1RT6B 4F36A 2LEBA 2XY7A 3BBBA 2RQKA 1UVMA 5F8GA 2DR9A 4M1KA 3SXLA 1P9QC 4DQIA 2QGFB 3U1NA 3BEGB 4F4AA 5KAKA 3CPWR 3KLGB 2Y9HA 4PKDB 3GFXA 3W7BA 3H20A 4YDXA 4C6AA 4DL3A 2W9BA 3QZ7A 3FCWA 2UUBF 2BXJA 3DDIA 4F67A 4USUA 1UJ4A 4P72A 4M5IA 4QOTA 3MMAA 4KRWA 1XC9A 1X5OA 3V6JA 3E8OA 3EDRB 3U27A 2GW8A 2UP1A 1TL3A 3SV3A 3KFWX 4U96A 1WTFA 1HQEA 2CWXA 5CCLA 3KJVA 2LQBA 2GA7A 3ZC4A 2FHMA 2MQPA 1RT3B 2CWKA 2UUBJ 3VGSA 3EGVA 4DPXA 3AXKA 5IM0A 2R42A 1SV5A 3U1LA 4AFFA 1L3TA 4FYYB 1P1TA 1SPBP 1FNXH 4PXDA 4DU8A 5HATA 2AHOB 2F40A 2VA3A 2RRAA 2HNYA 3AOCA 3FQLA 1N5SA 3Q8RB 1KVJA 1XEZA 4C48A 5D0GA 1X5SA 3PJXA 4LF9F 4C8ZA 4URQU 1R8PA 3W9JA 4Y0FA 1NBEB 4DX5A 4FBTA 4FS2A 3CJSA 2YKOA 3TNVA 4Q5VA 2V9KA 1Z1ZA 2LXFA 4UY85 3MOJB 1S6OA 3I4HX 2J7UA 4LF9J 2RIJA 2HPUA 2RDIA 2IDLA 2XCAA 5J2QB 4BHQA 3KXDA 2G13A 2B0GA 3VAIA 1VQLS 4FF2A 3FMBA 2XMJA 1RKJA 4DUZF 1HNIA 3WC0A 1N34F 1NDLA 3VHQA 3V4IA 4QPTA 5I3PA 4DL6A 4K4ZA 3MPWA 4TYBA 2MQMA 1S76D 1U2RA 1DAXA 4Q44A 2M9KA 4G1IA 5KTQA 3RW7A 3CDUA 2FJDB 2LA6A 4KT0C 4LSNB 4PPDA 2ZFHA 4K5SA 5HQ8A 1AA1B 1RTDA 5IZHA 3C16B 3CDWA 1J5OA 2BW2A 1FX4A 3S6EA 1UVLA 4PCQA 3POTB 1WF0A 3CDAA 4FXWA 3Q86A 3ILLA 7FDRA 1I51B 3LP1B 2QEXS 2ASLA 4YMEA 5KT6A 3R9LA 1CJUB 3D6HB 1AFJA 3MEEA 1SJFA 2DNGA 4RU9A 4RL1A 4L74A 4Z7CA 1PAUB 2FJVA 3HFKA 4C8NA 3QBCA 2JNJA 3PVXA 1YVFA 3DM2B 2BANB 2YNFA 4OYWA 4ZPCA 2YX7A 4YHHJ 3JTPA 2M88A 2V5HG 3QO9A 4QR1A 2GCFA 3TANA 1B0TA 3OL6A 2MJNA 2C3YA 1KEKA 3HM9A 4OL8A 1FD8A 2H51B 3SZ2A 3K5NA 4RUAA 3CCMS 3QZ8A 2QLXA 3HJFA 2EFGA 1UZHA 3QLHB 1PIEA 3A3PB 5A6WA 1FJCA 2CZVC 4ZLPA 4K4TA 1JJ2R 1RBAA 2DNPA 1AT1B 1NK7A 1C4AA 2WONB 3MD3A 3G2XA 3I9ZA 4I0WA 2PI4A 2X7IA 4XDDA 2H54B 3OXGA 1V5IB 2CDQA 2OPQB 1HWLA 2UVVA 5E3PA 3PEJA 3LP2A 4A8FA 1SH2A 1FKOB 5CYMA 3WIVA 1Y5NB 1TU0B 2EFOA 3UO0A 2ZM6F 2EK1A 2M3DA 4DPTA 3Q8YA 2IA0A 2CVIA 4F26A 2R7WA 3SV4A 3ONQA 4OI4A 3L09A 3KK1A 1D9FA 3CE8A 1FKAF 4O44B 2M8HA 3MEGA 1UJ5A 2ZM6J 2KB2A 1BY9A 4RBVA 1NPPA 4B9TA 3D2WA 2CG8A 4AE5A 2NXCA 4ZVRB 4M5DA 2F8HA 3FEZA 2ZC3A 4LBPA 1YRXA 5KFLA 2J9CA 1GEHA 5ETVA 2ZDPA 3GR1A 4LFBF 1U02A 3B8HA 3H8YA 2MZJA 2D3O1 3C14B 1JXVA 1JK9B 3PHTA 4RW6A 5KG2A 5ETLA 3THTA 2W7PA 5E5NA 4ZMMA 4DOZA 3P45B 4LFBJ 3D1HA 3CJ5A 4NASA 2ZUGA 3ZTQA 3LH2S 3GCXP 2OJ3A 2CFXA 1ZM2A 2BACA 5HMYA 3OJUA 2ACMA 2RRNA 1WKLA 3PCOB 3DGPB 2WVBA 1WC0A 3HSZA 5ETOA 4U7UK 5HROA 4Q45A 4WFNQ 4HKQA 3MPYA 2NS1B 1TVRB 1AW0A 5FDLB 3NGUA 4MK7A 4D3HA 1S97A 1AUSL 1H74A 1OQ3A 2VL1A 3BDEA 2XY6A 2DO0A 2OI2A 3HI9A 3C19A 4KY3A 3TO8A 4NCBA 2Z8QA 1J2VA 2LMIA 3OPKA 3UPFA 1LWXA 4ELVA 1MWQA 3RBXA 4QBUA 4O4RA 4KGKA 3QIDA 5LOQA 2V34A 1TL7B 4LF4F 3N5FA 4RNNA 1LKZA 1RHUB 2UUWA 2PFFB 4RW9B 1S9EA 4JP8A 4DV5F 3PKMA 2YWGA 1IQZA 2XSFA 3U02A 2YKMB 4DX6A 2CJQA 5SUHA 4F4XA 2DNQA 4LF6F 1QVGR 2QRRA 1D0EA 4I2PA 3CJ2A 1KBRA 9ATCB 1DRZA 2G0CA 1KP6A 5K14A 4F0HA 3QT5A 4C4WA 4CI0B 1SH0A 1VISA 4ZCMA 2RHQB 1F3VA 3CIMA 1TMJA 4LF6J 3D0GE 2N82B 2ZBIA 3A8JA 2CQBA 1ZAXA 4RUCA 3QJJA 4FVMA 3RB0A 3W1YC 3R3TA 4EZ6A 2C2MB 4XO0A 2DRBA 2LEPA 4X84A 2IRYA 1JQGA 3GIIA 3G96A 3UR0A 4OV1A 2NUUG 2E5HA 3C6UB 4EZ9A 3E01B 1S1VB 3K8VA 3RR8A 1GK8A 3FCVA 5L1LA 1B99A 4RBUA 1K8AT 1X5TA 4OHZA 1HNZJ 3MR2A 4HT7A 1H7XA 4H4OB 1WNEA 1KR4A 3SCKE 5I42B 2R7TA 2ASYA 4GKKF 2J5AA 5KT3A 5J1PA 2YNIB 5T7LB 3NG8A 1R43A 3N28A 2V9WA 2W4CA 5F41A 2YBVA 1FDAA 2GIFA 4CLYA 2NUHA 5L38A 3HULA 4GVBB 1M1GA 3FZBA 4BWJA 1IWGA 1K9MT 2UU9F 1F2GA 4ECXA 2A1BA 2PEHA 1K1QA 1QSLA 3PHEA 2NR0A 3FKBA 3H2VE 1ZZFA 4YQWA 2DVIA 4ZJOA 3MZIA 2O1PA 1VRTA 1H2TZ 2HHWA 4IFYB 3ZZRA 2WW8A 3DHWC 3ZZPA 4ZP9A 4P2FA 2UU9J 2W2OP 2UVRA 4YN3B 3K59A 1UCNA 2GFFA 1RTJA 3FSXA 4OZ2A 4ED3A 1T9TA 1H7WA 1UZDA 1R8CA 3NKYA 4CYUA 1RUSA 1P27B 1S57A 3UQSA 3KG4A 3KJQB 2HK2A 4DZ6A 2QSWA 4A8KA 2V69A 1SJ4P 4FF1A 2CZ9A 2HQ3A 3FVYA 1R3NA 1LW0B 2NLWA 1FKPA 2C3MA 2GHVC 3IN5A 1VMBA 3F44A 3Q22A 1AUDA 2XYGB 4ZJQA 1NDKA 1HA1A 5LXYA 4ED8A 3J7YI 1A9NB 4NMLA 3C46A 2BJ7A 5EWGA 4B9LA 3PEHA 2DGVA 1IBLF 1KQKA 4I6YA 2OUGA 2HYIB 1MSWD 3QIPB 2GGPB 1UEUA 1S0MA 2E5LF 2VG5B 1RB0A 2EW9A 1CJTB 1K0VA 1VGYA 2W8LA 3WC2A 4HLBA 2XLKA 1SB6A 9RUBA 2PD1A 5IT9Y 1JXEA 2G0JA 4DN0A 1BQNA 2WW4A 3ENVA 1U1OA 2VD3A 3P49B 1FERA 2MTLA 3MM8A 2E5LJ 2FZCB 3EXCX 2XS5A 3IC1A 1YJNS 2YVSA 2POKA 2PO4A 2KT5A 1RYRA 2XB2D 2VIHA 2AZ3A 3IBWA 4IUFA 1LWFB 3EZOA 3D3CJ 2EEYA 2KKHA 3G86A 5FLXY 4DV0J 3NMRA 3W62A 2R3VA 2HFNA 2NSCA 4N8OA 4DPWA 1MWYA 3NWGA 1Y10A 2RVJA 3NBPA 4CLFA 3NY0A 1TV6B 2CQHA 2K06A 2UZAA 4TYAA 4X4QA 2DNZA 2OEKA 4WPAA 4FYVB 3Q8PB 3UE2A 1P1LA 4ZHRA 4NI2B 3KLEB 1CEZA 3UDVA 1FI4A 1D3WA 5GAHU 3PJ9A 1OQ6A 3BM7A 2FGOA 3Q2SC 3QJLA 1VBZA 2OPRA 3UD4P 3W60A 4HT5A 2OH2A 4HDHA 4QIEA 4JV1A 3X1LB 1HHTP 1FK9B 2ALZA 3M30A 1UA1A 1CJKB 1FJEB 2OAUA 1PJ5A 2DT9A 2FVRA 3DRPB 4PABA 1RWNB 2B43A 2FZGB 1NUEA 1ZAVA 4PWWA 4ZN3A 3JB9k 1UPMB 1U7LA 4Y2CA 1DLOB 3KLHA 3ISNC 3D6MB 4O3PA 2GJIA 2ZH9A 3JSRA 2H5JB 2LXUA 2R7VA 2ZWOA 4I2QB 3L7PA 2Q43A 4B9MA 1MROA 2PT0A 4JI4J 1NK8A 3T9NA 3RRHA 1CLFA 4K59A 3CULA 1IJFB 2OD6A 4NZ7A 2IRUA 2NXEA 3DLGA 4PR6A 4QIFA 1F2HA 2XBPA 2Q6CA 1HI1A 4ED4A 2H4YB 1TR0A 2C3OA 2DR8A 2JEJA 4DV6F 1OMSA 4Y28C 3BDPA 1S1TB 5FJ4A 4FF3A 1TZ0A 2MKKA 1QJHA 1LWCA 1FRKA 2XMMA 1GT8A 1LK7A 1KRPA 3ITHB 3NRBA 2HLUA 3GZ7A 2HK3A 3PX6A 5L1IA 3I0SA 2YWHA 2QA1A 1BD6A 4C8OA 1ZM4A 4A8XA 1CULB 4OX9F 3K58A 1IKXB 4DL7A 2FLOA 2BRKA 3I82A 1SL1A 3V6DA 5KG0A 4ZOSA 2IVMA 1NAQA 2EG2A 2BR0A 3IGNA 1T94A 4OX9J 3A8EA 2QTWA 2CJYB 2YWWA 3J81j 4XDCA 3MM9A 2CPZA 5KFVA 3G82A 5EDWA 1IBMF 1O51A 1NNDA 2XWXA 2F8MA 1U48A 5EWFA 1T03A 4W92B 5JUMA 1E6YB 2AGQA 2AU0A 1HR0F 2HEKA 1S49A 2XZTB 3W65A 5B0CA 4IG0B 2PA3A 3I55S 2R2UA 2E1RA 3FBBA 2ZE2B 4LRAA 1FD2A 4ZVEA 1VQ4S 5G0RA 4QWDA 4OZ0A 4DCPB 2QLBB 4ZLJA 2DGQA 3M8PA 4USMA 2VASA 2MZRA 4NZ0A 3TYTA 2XZWA 3RB6A 3TX8A 1B0PA 3MTKA 2R8IA 5LSLA 4K4VA 3Q89A 8AT1B 1Y00A 3CCTA 2B9YA 4MK8A 1SCJB 1O5JA 1GXTA 1PGZA 4LT6A 2ROPA 3JSYA 2IMOA 1RU1A 4OYXA 4CH7A 3N4WA 2CJBA 1HNVA 3Q0AA 4ERDA 3EGNA 3PR4A 4C8LA 1YX2A 2V50A 2DPJA 3CC2S 1SH3A 3BKFA 3FFIA 3QPIA 4F2SA 3DRSA 2YY3A 3M2VA 3G87A 1RWMB 1SQFA 4KSEB 1YJTA 5IT4A 2FIUA 1APSA 4YS2A 2PI5A 1VYAA 4PZVA 5DG9A 3BYRA 4A8YA 1XMQF 4OX6A 1Q5VA 4XPEA 1SKWA 1S6QB 2XGQA 4GKJF 3QRRA 4BDPA 1RT2B 3CSKA 2DH7A 3G6YA 4LF5F 2VB6A 3MI7X 4ID5B 4A46A 1VBKA 4B02A 2QE5A 2GNKA 4JB8B 5KOWA 1IKWA 1EZZB 3H5UA 3GV8B 3OVAA 1RBOB 5ETPA 4H4KC 3LGHA 3U7JA 2W4DA 4YR2A 1N6QB 3T5JA 2W7AA 3G6ES 4GKJJ 4WXWA 4LF5J 1S59A 2C2NA 3KHRA 2HHHJ 4KTQA 3GJTB 4CLKA 1RTHA 2CRLA 3LF0A 4F4ZA 1NJWA 4USHA 4NPOA 2LDYA 1TQLA 3MD1A 1MW7A 2W24A 2KZZA 2JEFA 3N9UC 4WYWA 1ZTTA 1HIYA 1SUQA 2PMHA 5A8WA 5F3TA 1MNEA 1M1KT 3DOKA 1S1XA 1UVKA 1SJ3P 1WHVA 5B0GA 1URNA 1NJZA 2LFVA 5IV3A 5LJ3Y 4A4JA 2AYMA 1PYTA 1KOOA 3EWGA 3WDOA 4I56A 4LREA 2P6SA 1ICEB 1IQTA 1C0UA 3MMBB 4N76A 1S79A 1PO6A 2I1RA 4CIOA 4P73A 1SKSA 4LR7A 4KAIA 3T3FA 4IR9A 4X4TA 1U0HA 3MM5A 5FD1A 1ITPA 2CAJA 3GIMA 1ZTWA 3CJ4A 3RB3A 4M5HA 4PYAA 2MQOA 4KKOA 4WK1A 3HVAA 3NCRA 2D69A 4LSLA 1KNZA 4DXLA 2HAFA 1RT7B 1QAIA 3T5LA 4UF4A 3ZFVA 1UW9A 3KLFA 1N33F 1G4CA 1RQ0A 4C0BA 2IVYA 1BMQB 3OSPA 4CNZA 2ZH8A 2V63A 1RTIB 1FRMA 4DV7F 4FPRA 1WWHA 2V0NA 3S01A 1T8EA 3SQOP 4M5LA 2EKNA 3F41A 4I6WA 4M95A 4KFBB 1RA6A 2CPYA 1N33J 1F1BB 1VHFA 2BKOA 4B9SA 1FWKA 1CS4B 2CQ3A 2FJEB 4KC5A 3W66A 4DV7J 1X60A 4ETXA 5LMUF 4K2JA 4PG4A 1V3SA 1U0SA 1SC4B 4LUBA 4PQUB 3BGLA 3C15B 5DLFA 2WAQD 5KFEA 2RDJA 2BMBA 1IWAA 2D9PA 2XI3A 5E0OA 3VAMA 1JLQB 1LNQA 4O0NA 5KFSA 2J7KA 4PPZA 1MLAA 3MMCA 1HI8A 3GJRB 5HL7Q 3QMQA 2DH8A 2UXCF 1OYEA 3LPEA 1VS3A 3TQ1A 1QY7A 2BABA 5DGBA 5DQIA 1Q81T 3D7SB 3MWBA 5A0YB 2RKIA 4J9NA 5KOXA 3TUIC 1TKXB 5KFKA 1F5BA 2Y8WA 5CAAA 4LF2A 3KK2A 3I9V9 1XMOF 3RZAA 2UXDF 2UXCJ 2RD5C 4O3SA 2BQ3A 3OLBA 1U2CA 4MTPA 2W25A 2QLFB 1HMVB 1FESA 4NEYA 4WFZA 1Y5IB 2YPZA 1T9VA 4K7QA 1LW2A 1W7WA 3L95X 3BBCA 4DCJB 1HWJA 3QAEA 3KNGA 1IVZA 2FB0A 2ASDA 3K89A 2UXDJ 3DLEB 2Y0BB 5D15A 1W25A 4OJ1A 3JYTB 4YOEA 2QFJA 3CC4S 1U49A 4LMZA 4CLTA 3M6WA 3KG0A 1WF1A 5EHHA 4HYKA 5J1EA 2NCKL 3W2VB 3R6GB 3W5ZA 5KFZA 3VR1A 3AB2B 3I32A 2LXIA 3QQCD 1LWEB 3J7A1 1S6PB 1JLGA 2B9EA 3LWMA 1RSCA 4J37A 3MR6A 2QG9B 4URGA 4ES2A 1DQ9A 1S5ZA 3M2UB 2NZ4A 1U09A 3DGVA 3PIPQ 1C1CA 2C22A 3I87A 2OLWA 1PYSB 1UFWA 2ZZNA 1XQIA 2C2KB 1FO1A 4IR1A 2BE9B 4A48A 2YH0A 3N5BA 2WSCC 4J9LA 2I5JA 3R5JB 4USVA 5H9EJ 1GX6A 3VGTA 2PGCA 1T3NA 4OHXA 1WC1A 5BYQA 2RHSB 3AD9C 4NLXA 3MFIA 4X64F 2F4VF 2BOAA 3RJMB 3RUBL 3VAHA 2W9BB 2RE1A 1NKCA 2B9XA 3FUYA 1KVIA 3SEOA 3CEDA 1KDNA 3NGKA 2A2DA 3EM1A 3LALA 3GSIA 4PG5A 3US5A 5LL6d 2F5GA 5JXSA 2CNLB 4X64J 1TL3B 1K1SA 2EFNA 1HQEB 3KJVB 5HMXA 1BQXA 3HHLC 1WC6A 1AZSA 2J6UA 3R5AA 2MKHA 1QSYA 4B3SF 2KVQE 2QZ8A 5IM0B 1D8YA 1SV5B 4P10A 3M8YA 1Q8LA 2CNOB 3SI8A 4FN5A 1MN7A 2Z58B 3KHHA 3HHKA 3MEDA 4NZ6A 4ZVOB 4EWTA 3JQMA 2HNYB 5JVGQ 1TL1A 4B3SJ 2HQDA 5D6GA 1S9FA 3D67A 2CKWA 4DLEA 1GMVA 1A0OB 1RAEB 2UV8A 4E98A 3C6TA 2JRSA 1X9SA 3BKUA 5ETRA 2CQCA 4RJVA 4WF9Q 4YUDA 2O5DA 4CCHA 1RHKB 4R5PA 3HVRA 4FKXA 4OZJA 4J9VA 2HHPA 2E9ZA 2DY1A 4F02A 3Q8VA 2CXEA 1YHQS 2M8DB 1OY6A 3OTCA 5AT1B 3CF5Q 1WORA 1VQOS 1HNIB 3DMJA 4TQSA 3MOZA 4F0MA 5U47A 3T5KA 1OS5A 5ETSA 4IKAA 4CP5A 3V4IB 3OL7A 2MEWA 1N54B 1FA0A 1VRUA 1IBKJ 3CMQA 1WELA 1FWPA 1SKRA 3ZTRA 1HD0A 3ZNUA 1X5PA 3FBCA 4KPCA 3U1MA 1RTDB 3ILIA 1TP7A 5BJRA 2RILA 2Z2ZA 1J5OB 1DZ5A 3MECA 3SSRA 1TKTA 3VGUA 1AROP 1VOMA 4H4MB 3AAWB 1PYOB 4A8OA 1B70B 3MEEB 3UN5A 5ADZA 1Q8BA 5F8HA 5A76A 4ZIVA 4HI2A 1I94F 3RB4A 4KO0A 5GAGU 2YNFB 2WRMA 4P2SA 3ADAC 5E3QA 3QO9B 1SQGA 3D54A 1F9EB 2KRRA 3OR2B 5J2PB 2W9AA 2RB7A 2Q3PA 3GFHA 2CJAA 3D4JA 3DKDA 4DL2A 2HS3A 4EUVA 2XHCA 5BR8F 4ES3A 2XC9A 2I2YA 4YB1P 5DQGA 2A3JA 1PJ7A 3SMZA 4RX6A 2XYPB 5D3GA 5KFPA 2HZCA 3GFYA 1Y7PA 5HJYA 2UUTA 2P5VA 1NJYA 4DL5A 5DRKA 3H90A 3LP2B 5BR8J 2KM8C 2F9DA 2CPIA 1VQKS 2R7SA 4A8QA 1X0FA 3OTBA 2FVSA 2QA4G 4KR0B 5DG7A 2PFDA 2AQ4A 4JI2F 1RTZA 3G9CA 3ZZ0A 4JUZA 1LXNA 2YKPA 3JSMA 3FMWA 3KDOA 4OZ3A 4Y2IA 5B0AA 2FQQB 4LFCJ 3MEGB 1QAYA 4NLGA 3CJKA 1WOPA 4DPUA 5DDOC 4B3MF 4X65F 3BPDA 3K57A 2CQPA 1FE0A 5GADU 3I5AA 3MUTP 2AX0A 4MIWA 3OTOF 4MKAA 2KG1A 2YNGA 2XTJP 5IT9U 2C3UA 2XGPA 5EUHA 1F9FA 2ZJRQ 4L3NA 1AB8A 2EBGA 1H72C 2JSXA 3EX7B 4ZIWA 2JFDA 3T1HJ 4UUXA 2LEAA 2HIQA 2LECA 4B3MJ 4X65J 3FDSA 4JOUA 1SC6A 2WOMA 4R25A 1N5QA 1X4CA 2WSFC 4CT8A 1TUGB 2HMIA 2AF6A 5KT7A 4DR4F 4ED0A 1TKZA 1B64A 4HHHA 4B3OB 3RBDA 1FRJA 2RS2A 3NAIA 3GB0A 2J0QD 4K4UA 2MZTA 2CDRB 4LF8F 3CCSS 4Y3CA 5HROB 4Q7AA 3K5LA 4UZCA 2VONA 2WVCA 2E5JA 3LP0A 4LSNA 3OJSA 3UWTA 4NLPA 1QAJA 4FNIA 1NK4A 4QR2A 2FY8A 2OKQA 2NYIA 5B09A 4H4KA 5KFIA 2GZOA 2KFZA 2BJ3A 2E1CA 2O66A 3V5RA 5KFNA 2WK4A 4ZVQB 1P9YA 5BXIA 2IAJA 1P8GA 3HSGA 1YKWA 2HHQA 5AJ3F 2VBYA 1N5VA 3NXZA 2AEFA 5EX3A 1CJUA 3MUMP 1FWLA 4PUOB 1NCLA 1OPZA 4M5JA 5CH7B 1S9EB 2AZ1A 1C2PA 5AJ3J 2C2DA 3DM2A 4XTTA 4ZVFA 1C0TA 1WKJA 1V3RA 3AODA 1R8AA 2OMLA 4R0JA 1QM9A 5C25A 1WF2A 2JVRA 2KT2A 1ZA1B 4EYHB 4Y34A 4DQQA 4F50A 2ACYA 2RU3A 4I2PB 1QSSA 4NCAA 1Q53A 5K14B 3OFFA 2DGTA 1VIOA 1UPPA 2P8IA 3MR3A 2XQCA 8RUCA 4C11A 4CH1A 1WEXA 5MAOA 2I9SA 4DV2F 2FLLA 1S77D 2XMTA 4CO0A 1HPZB 5CA5A 4NRTA 5CZVA 3QFWA 2QYCA 1V9OA 4OIXA 1I5OB 4DJBA 2FLPA 2ZH6A 2CPDA 2DGWA 1EAYC 4IOAQ 2P9GA 1RHJB 4BS2A 4DV2J 4NE9C 5IC4B 2BJ9A 1WC3A 4OI6A 1EIYB 4WFBQ 2VJVA 2OTJS 4J9QA 4FZVA 2NZCA 1WC5A 2LYVA 2YKAA 2HBRB 2MLYA 3AJ2A 4RNMA 1FXRA 2RQCA 1JLAA 1TUWA 1GH8A 4U6PA 4K5RA 4J9SA 1RHQB 3R8YA 4NX9A 3PTWA 2XM3A 2C2ZB 3HKZD 4LRBA 4TU7A 3NAHA 2CUYA 1NK5A 1F5AA 2HVIA 3K5MA 4DSJA 1D8ZA 1PC4A 5DDRC 1U45A 3OT9A 4YB7A 2J8AA 2PC6A 2IVFB 2BQRA 3OFHA 1XNRF 1KHVA 4GO5X 4HEA9 4JI1F 2F65A 2C2OB 3CD7A 3MHYA 2H5EA 3NLCA 2WHOA 4ZPDA 1D1UA 1VRTB 1JXLA 4L75A 4KHMA 1FT8A 3R7NB 3CB4A 2CPHA 1KQGB 1RU2A 2HRYA 2AGPA 1WD6A 1XNRJ 1RT5A 1RTJB 4EO8A 4JI1J 3DGPA 1NSPA 3HHDA 1Q4RA 1H3DA 3C66A 3C8YA 3PRDA 2KO1A 1JLEA 4CYUB 2EK6A 2X1AA 3SSSA 1X4BA 2R2SA 1UVNA 4TLRA 2H65B 6FDRA 4V19X 2NREA 2W01A 3CW2C 1C4CA 3QFHA 2B8PA 4OJGA 3D0IE 4FVCA 2KU7A 4M94A 2BEFA 5DZ7A 1RYSA 4OI0A 1NJIT 5KFOA 2CJ9A 4RWXA 1RT1A 1L3SA 4CTAA 1WOOA 3PYGA 5C2CA 2R2RA 2KDOA 3N0VA 2GO9A 4QYZK 3NEKA 4CLZA 4WK3A 2M70A 4LSZB 5HANA 4DI6A 4F3QA 3BQ0A 2UVUA 5LM7E 1CPZA 3KUEA 2HVZA 2AEJA 3BZQA 5J2NB 4WIIA 3RBEA 1U1RA 5DM7Q 4KPYA 4G3IA 4ECQA 3UCUP 3KLIA 3H4BA 2HQIA 2R8HA 1S1UB 1DBDA 1IN0A 1N5YB 1BQNB 3D9BA 2VOPA 4DR7F 3MM8B 1NK0A 4O4GA 2J7WA 1T05A 4DHVA 3JTNA 4MYUA 2IJNA 2JDJA 4ICLA 1ZOTA 1QTMA 3IM8A 3CIZA 3KKFA 2E1AA 3I31A 5MLCV 4LQ9A 4BCAA 1CC8A 5E2QA 5ETQA 4P74A 1VC6A 1CG2A 5HVFA 1I6JA 2HAIA 1DJ0A 4OFZA 3E2EA 1MMDA 4DR7J 5FIIA 2GO8A 4NCGB 1VI7A 3ET6A 3ISND 3E01A 4I7FA 5HQLA 3UFCX 3S7RA 2AJ4A 4KGZB 3BSCA 5AE1A 2FDNA 2AIRB 3NBPB 2DNOA 2DNMA 2QMXA 3FSIA 3E51A 1OWXA 1V6HA 4DSIA 2DCLA 1IR0A 5IS2A 4UOFA 1JLFB 3N6NA 3H0PA 3CMAS 2FZKB 4X4PA 3HVWA 2DXEA 1TK0A 4FBUA 1N36J 1Q5YA 2G2OA 4AL5A 4ZHRB 4JYAF 3DOLB 5T7LA 1WHYA 2HQCA 2Z2YB 2OTLS 3A8KA 2Q66A 3AT1B 3PYFA 1F3FA 3TJ9A 2WVDA 3AD7C 2VOOA 3TP2A 4QCLA 3VF0B 1YRTA 2OPRB 4CLUA 1NXIA 3OSNA 3Q2TC 4F8RA 4JYAJ 2V67A 2V2ZA 4UOHA 4PXCA 1HQUA 2B4VA 2VA2A 5CCMA 1GFWB 3M30B 3GILA 2EKYA 4PXBA 1SKUB 2PSZA 4B9NA 2X3GA 1IKYB 3Q24A 1Q79A 1BUXA 3KLHB 3HHLA 4DPYA 2Y1RI 1Y5LB 4GVLA 1VQMS 5C42A 4A47A 4C3LA 2V8DA 4ECTA 3HZGA 1MROB 1Y0HA 4UT4A 2DGSA 4I68A 2HBQB 4WKRA 2R7XA 4QWAA 1ACMB 4U8VA 2HGNA 1F5CA 3DI6B 5F3ZA 3DLGB 1N88A 4NXNF 1RXOB 3CWJA 2BJEA 4RNHA 3ELHA 1S0OA 2DHSA 1TAQA 2GVZA 2K1RA 1FRLA 2E29A 2KFYA 2FVQA 1LW0A 3GE9A 2DNLA 5RUBA 4ES1A 3CCWA 2CG4A 4ZKAA 4NXNJ 4U67Q 2R8GA 1VDHA 5DLGA 4Y6IA 2N3LA 1LFPA 4RKUC 4L6V3 1R0BG 4IQXA 3UI3A 1QD1A 3I0SB 2JOQA 2B6AA 3KJNB 4CDIA 2CPXA 3SYZA 1VQ9S 2G2ZA 3GR0A 5B08A 2K3KA 2CYYA 3H5XA 3TAPA 3H4DA 4ENOA 2RUGA 2H4WB 4B17A 3K7RA 3ULHA 3AJ1A 2VG5A 4NYOA 4AT1B 4DR2J 1LV5A 1U2FA 4QIVA 4KHPF 2DXDA 2YWEA 3VZIA 2MHNA 3PW4A 3I56S 1RHMB 3TEHB 1GMWA 3GG1A 2LU1A 1EQMA 2HQGA 5L9XA 1T9WA 2FVPA 1VQYA 1FXLA 2DEJA 4EFAC 2B8QA 2W4PA 1TFWA 2DITA 4DFMA 4DFPA 3EXYA 1EKSA 4KHPJ 3MM9B 3N6MA 1NRKA 1NLKL 2AJFE 1REGX 2J9DE 1FHTA 2OMOA 1R89A 3G82B 2AMCB 1QTNB 1JNZB 1XR7A 2D74B 3BN4A 1RGVA 3K0JA 4ZITA 1T03B 3QWPA 2E5IA 2V94A 1SVDA 3PFEA 1LFWA 2Y3YA 4C0OC 1S9GA 4LR8A 2HHXA 2M52A 4WCEQ 4RUHA 3TZZA 4OYZA 3AHPA 1RKIA 2DK2A 5D78A 4EBCA 1DURA 1SC3B 3HLUA 2ZBCA 4O3NA 3M8PB 2AJQA 3GIRA 1OIAA 2HIYA 3NGTA 1NU4A 4M5NA 2WBMA 2DEIA 2U1AA 5ETNA 4N56A 1I3OB 2VG7A 4YHHF 4NLYA 3DLBA 4NWBA 1U8SA 4PQAA 2MHEA 2ZNZA 3CJTA 2VFRA 5HLFA 4L76A 4ZLNA 4I6AA 1S1WA 1BQMA 3I4PA 3X3UA 2FJXA 4DSFA 2PMWA 3D0HE 1FK9A 2OFHX 4LIRA 3HFVA 3AQPA 3O2IA 5I3UB 2HVEA 2AV5A 2IMWP 1JNRB 1GQEA 1XR6A 1U26A 3DRRA 3FFIB 2IM0A 4C3MA 1NKEA 3DRSB 2W2MP 2C3PA 3M2VB 3FEYB 5CZXA 1NPKA 3H40A 4BC9A 1HI0P 3W9IA 1KOHA 2W2QP 2NQPA 3S8SA 2FHJA 4IRKA 4I67A 3MUVP 2MKSA 2YWKA 3NCPA 5IOLA 3EVOA 1S4FA 4KBIA 1YWXA 4LRDA 4J9RA 4WE1A 2J76E 3IFEA 4WXOA 1RAAB 4DU7A 1FFWB 4JI7J 1JKHB 4FYDA 2R2TA 4NYPA 3FZ2A 1IKWB 2HKEA 3EGWB 3GFZA 3O8WA 4YB6A 3M6UA 2Y1JA 4I1TA 3DLKA 3UW1A 2OHDA 3NNHA 2Z4PA 2FGCA 1YQHA 5KFJA 1RTHB 4AL6A 1Y9OA 3N01A 3PIOQ 3BGFA 1IBCB 4IFVB 2RQ4A 1Q7LB 3UDEA 1KWMA 2XYHB 4DV4J 4ELTA 3R5DA 5DO2A 4JI5F 2M5YA 1SUQB 3H2LA 2EFPA 4AUKA 4J9OA 1RAOA 4KV8A 4MK9A 4AD6A 4TU9A 2LVWA 5A8WB 3P5BP 2MJUA 1BHNA 4ANDA 5KFWA 3DOKB 1S1XB 4FKYA 2ATLA 1G3OA 1VQNS 2XMKA 2JLGA 2PE8A 2J0WA 4JI5J 3EZUA 1R0AB 4C9DA 1KS2A 4CZCA 1UETA 2BJ8A 1QUVA 3PW5A 4Z2XA 3JXOA 5EGYA 2MPUA 3QGIA 5CABA 4Z7YA 3CO0P 4DDFA 1T7PA 4CRJA 5LSRA 2RH3A 3KUHA 4NLVA 1RAHB 1WI8A 1E6YA 1OSDA 2QMWA 2EWHA 2M0GB 2A0FB 1N32J 2L41A 2CNNB 1Y3JA 3BO4A 2Z2MA 3FQKA 4P7TA 2ZE2A 4NOHA 3A4TA 1ZPVA 2CPJA 3GV7B 3TA2A 2GS8A 2YTCA 2DD8S 2HHTA 1BGXT 2BKPA 4Y2MA 4KKOB 2CQ0A 2L9DA 4DUYF 2DXFA 2V4JA 4LSLB 2MZ1A 2QYGA 1DTQA 4AL7A 4LR9A 1PCAA 1IJEB 1S72S 2AWZA 3KLFB 1XJWB 4DUYJ 2DKOB 2MZSA 5HBMB 2XS2A 2GAHC 2QX0A 1GTEA 2E9TA 3DXSX 4HHUA 3VAFA 1XMBA 2JLEA 2MKCA 4I64A 4O3QA 3ZZTA 2HQFA 2KVIA 1KSPA 2WSEC 2VUGA 3OBIA 3K17A 4F3OA 5AXKA 2FUG9 1RABB 1HBMB 5E3CA 2NXNA 2D7SA 1RT4A 1UJ6A 5A2QU 1CJVA 3SDEA 3DOMB 3H5YA 2AW0A 2VH7A 2ZWPA 1S6QA 1DQ8A 1TTHB 3CJ0A 4OQJA 3RG6A 2N7CA 3MMCB 2B4UA 2Z2LA 2XNRA 4UY8T 1HNZF 3BV8A 2BZ2A 2C2EA 5KFGA 1RWXB 4ID5A 4D3GA 3LAKA 3PW7A 1JB0C 2RUSA 3RR7A 1T02A 1SIZA 1U6FA 3Q8UA 3VAKA 2YNHA 3FC9A 2W1BA 2QJ3A 1HNWJ 2E1PA 3RGIA 2RKIB 5AXMA 4F0KA 5D4NA 1ZA2B 2XMUA 2YX4A 3KK2B 3B78A 1RK8A 2Q1LA 2B7CB 1BLUA 2IA6A 1EARA 2VODA 1LW2B 1Y4ZB 2IDEA 2NXUA 2JLFA 3NS6A 1OSCA 2PIIA 1TMMA 3RAXA 2AJ0A 4GO7X 3MAAA 5KFBA 2C42A 4CLLA 3TVZA 1HNXF 3SFGA 2EXUA 4ZP7A 1PKUA 1EETA 5KFFA 1UWBA 4AYBD 4YR3A 2W7OA 2JVOA 3M8ZA 2VPZB 5J1EB 3JQKA 4TLQA 3OXFA 1Q0NA 3OUYA 1HNXJ 3M8QA 3QJPA 2HBYB 2R4FA 1UVJA 4U9RA 1HHSA 2ZKUA 2QN6B 1PJ6A 2KG0A 3VTIA 2V6AA 3PYDA 1S48A 4NL5A 1WG4A 1JLBA 1YJ7A 3G8TA 4AXIA 5CYQA 5EWEA 2OO4A 1YZ7A 1MMNA 2IC3A 4G1QA 3CMES 4WFYA 1C1CB 3HHLD 3HK2A 1X4HA 5HP1A 1OY9A 4WFAQ 4CLSA 2N3OA 2DHHA 3J81U 2KHCA 5GAEI 4DV3F 3W61A 4FXDA 1ZH5A 3OVSA 4DR3J 3VV2B 3IAM9 1VQSA 3P4UB 1VBYA 5LSOA 2ROEA 3IRXA 2MMYA 3D28A 3ZO7A 1DHMA 5JVHQ 2AGOA 3W2WA 1U1NA 3W5YA 1FF2A 4DV3J 3B54A 3TVYA 3GLJA 3VGVA 2KJVA 5CYJA 1CS4A 3HHNB 3QATA 3EJMA 3Q8QB 5AXLA 1RLDA 4Y2KA 3CCES 2L9NA 4Q2LA 2G1DA 3HFZB 4DV0F 1KN6A 1ZM3A 4CLWA 2ZOMA 2VPXB 3O5TB 4PWDA 3DLJA 2XSJA 3DYAA 3BPSP 1ZAWA 2VF3A 1L5UA 4DR6J 4ZK7M 4G65A 4OLOA 1AZSB 1E6VA 2JH3A 2XY5A 1MN9A 4IH5A 4ECZA 2MKYA 4YB5A 2OSQA 1GMWD 4DS5A 2XS7A 3IS9A 3MEDB 2RF2A 4OJHA 4YY3F 4KH1B 1Z2ZA 1TL1B 5A0YA 5HVGA 3NWRA 1FNOA 1FRIA 3M8WA 1TKXA 4J7CA 3JAMU 4DS4A 2ALYB 5GAEU 5M2UA 2DRAA 1SI9A 4NRUA 2HGMA 3J7YU 4DR1F 3C6TB 5L46A 1XR5A 1VCTA 5CD4A 2QFIA 2J8SA 2CQGA 1RJJA 2QLWA 1R8BA 4YY3J 4MT1A 2HWTA 1WUUA 1SC1B 3GTYX 3HD2A 3THPA 2QMUB 5KFUA 3DLEA 4DR1J 1TUVA 2ADCA 2COLA 3G8SA 4NLUA 4RNOA 4NXMJ 1N4LA 2EC0A 4JI4F 3TARA 3DMJB 3W2VA 1T9XA 3PX4A 2KN4A 2YXLA 1SJQA 3V6KA 2QL5B 4ECVA 1PBAA 2WVFA 4K4XA 4X2BA 1F6TA 1LWEA 3WQPA 1S6PA 2N4CA 3ZZOA 4IG3A 5KG1A 1QAXA 2FVCA 2W9CB 1HBOA 4TNOA 3UDLA 4QU7A 2GMJA 3GP9A 4CQ1A 4NLWA 5GVQA 1W2BR 1ZETA 3MECB 1NHUA 3M2UA 3ICLA 2Y1IA 3WX8A 4O23A 4ZCKA 5HJXA 1EKRA 2RAQA 4C97A 3BO3A 2XI2A 5L39A 3M2RA 1PILA 1MU2B 3LOUA 4QWBA 3RU0A 3LA0A 4QWCA 1GAOA 2FHJD 5D4OA 2E44A 2J9EA 4KO0B 1U6ZA 4QR0A 2ZEJA 2G2YA 3A12A 3THVA 1VQ8S 1WEYA 2LQ9A 5E3RA 2RT3A 5K8NA 1QE1A 3MM7B 3UD3P 2A18A 1PSDA 4ILLA 1FRHA 3F0NA 3TZXA 2I38A 2ZKTA 4HVZA 2MKIA 1HYSA 4Q43A 2HNZA 2F8EX 5L9NA 4MFBB 5THWA 4YFUA 3GYGA 3CJQA 2HVHA 3MR5A 3KMSA 3MF5A 3K8WA 2ZBRA 4R8UA 5AE3A 5D3GB 4EGLA 4ED7A 4O0IA 4OZ5A 3EICA 3TUPA 3V81A 2IRXA 8ATCB 2V2QA 1I1GA 3GONA 1X4GA 2ZH1A 4NA3A 3EPGA 4WYLA 3FJ2A 3R6LB 1LQ9A 3IG1A 5A8KA 3M1VB 4EEYA 1U1LA 1KKHA 2OEMA 4KB7A 2GJFA 1R6YA 2JX2A 2P2CB 1VC0A 3JSMB 4ATNA 1FTCA 3M32A 3DU6A 2OELA 3MCNA 4WKYA 2BKNA 1OY8A 3BR9A 1FX2A 1HWUA 1H73A 3CJKB 1DTTA 4W90B 1HL6A 2B5JA 3HX9A 3BGRA 3RRGA 4ZVPB 4HTJA 4IDKA 5DQHA 3ILOA 2AP6A 2YNGB 4DQRA 1T9UA 3HHEA 2F9JA 3TUZC 1FVQA 2ZH7A 2KJWA 1WHWA 3PG9A 5HI7A 2V8GA 2MY7A 3PDNA 3M7VA 1YIJS 2CADA 2JJ4D 2SXLA 4YDDB 3OHBA 1U6BA 2XO6A 4TQRA 3SCLE 2WOMB 1YGYA 2VFTA 4HTIA 3BYPA 1FNMA 1H98A 2DR5A 4GC7A 3TQEA 3ENWA 1OJ4A 1VK3A 2NPIA 1HBNB 3IBFB 2DBBA 1VJWA 3C3LA 2HMIB 2VV5A 3O3LA 4FPIA 4YEAA 4RW8A 4PG7A 2IYIA 5B0BA 1TKZB 4AQYF 3D5MA 2ZH4A 1Q7YT 3N79A 4RW4A 4F25A 3W8PA 2VPWB 3G6VA 3ETOA 4ER8A 1CBKA 2FPHX 3LP0B 3OQ2A 4DUZJ 1KQFB 3KUGA 1FTRA 4AQYJ 4WU2A 1N34J 1IR1A 3QRPA 1RWPB 1X4DA 5KFQA 2K8GA 3N6LA 3PO4A 5KFTA 2FJWA 1BXNA 1S99A 4L72B 3JQJA 1WG5A 2IAJB 5LT5A 4H4MA 2HHHF 2E7VA 2VQFF 2CPEA 2BE7D 3GSDA 4RW7A 2J0SD 1O6XA 3R5GA 2E7XA 4XIUA 2E5GA 1TK5A 1VFJA 2AYEA 1OO0B 1FFSB 4NLTA 1HD1A 2MGZA 3MM6A 4K50A 4O3RA 2DYAA 2CQ1A 1SIWB 2VQFJ 1C0TB 2VG6B 1A6LA 1IKVA 1FJGF 1N5TA 3MGJA 2RU9A 4QZVB 5KFXA 5C25B 3OR2A 4BC7A 5J2PA 2B51A 1X4FA 2F1FA 2X1BA 4URSA 4K0KF 1JLCA 2IM1A 4KIAA 4UOCA 3FRYA 4EU0A 4Q8FA 3CDEA 1FJGJ 3MPUB 3GV5B 2JL9A 3H5SA 4C11B 3DCAA 4W98A 3FBEA 1XIQA 2OPPB 3OVBA 2CVEA 2FHKA 2VBXA 4K0KJ 2WZ1A 5IV4A 4JV0A 4JV5F 2L08A 4OZ1A 3QWUA 2KTQA 2V8HA 1G1XA 4HR2A 4CT9A 1NH7A 4TY8A 4WU3A 1S0NA 4U95A 5H1SV 4DSLA 1XNQF 2IBOA 2VFSA 3TR5A 1TFYA 3ZTSA 4JV5J 2JZ5A 1QLNA 2LQJA 1JMTA 1JX4A 4H54A 3TUJC 1X9MA 2VBWA 2L3MA 2DHGA 5K8PA 2J6TA 4ZPBA 4CLPA 4LVOP 2HLTA 2QSFA 4L3KA 5ETTA 4QIWD 5J1NA 1UAWA 1XNQJ 4EK2A 3J80Y 1JLAB 4TKTA 3G6XA 3VQTA 3UVJA 1UP1A 4NLSA 2XCPA 1R27B 3SCJE 5KFDA 4KGXB 2HS0A 4NLOA 4ECSA 4OHWA 2XNQA 5K9FA 2MB0B 4P71A 1REVB 4PG8A 2YX1A 2OPSA 2QL7B 2I8EA 3MFHA 5B0DA 3FNNA 5KG7A 5C7PA 3PYEA 2KRBA 1DQAA 4IO1A 3OL8A 1ELOA 1IXKA 2N4DA 2A6OA 2V2KA 1NH8A 3SQGB 1D9AA 1NJXA 4FYWB 2K2PA 3M6VA 3GU0A 4V19J 3D6FB 3R27A 4F04B 3CD0A 1ZBTA 2HVDA 1RT5B 4B3OA 2DNKA 3L3CA 1GXUA 4A8WA 2FD2A 2VKZG 1WSVA 2ZZTA 1RWOB 5HAOA 4KE5A 1JLEB 2ZZMA 2JFKA 2HNDA 2VKRA 5T41A 4ED2A 1U47A 3Q23A 4DG1A 5D4LA 3B6BA 1GXLA 4FDFA 4MMOA 1NHVA 5A8RA 3T9ZA 5HSPA 3L4BC 5J2MA 2VFVA 1HLWA 1NMEB 3A13A 3PFOA 3WBZA 5SZTA 1U25A 4CM0A 1R0CB 4OHYA 4IQMA 2GX8A 2HWHA 4NEZA 2EVZA 3DRYA 3OFEA 3I0RA 1F60B 1RT1B 4PUOA 4CTAB 3GMGA 4HDGA 4ANCA 4LBIA 2ZUAA 3MAQA 2F4FA 5IQQA 3A3OB 2IPOB 1C1BA 2VBZA 2VFUA 3NGSA 4LF4J 3VVUA 1KTVA 1ROFA 2ASJA 3VAGA 2RQMA 4ECWA 3KLIB 1N52B 4UQGA 2LDIA 4DV5J 5F9LA 3J7AN 1U1PA 4JV2A 1RAGB 2MYFA 3TAMA 3LGMA 1BWVA 4USWA 1YK9A 1B0VA 3ISZA 4O4GB 1T05B 1XBWA 1SJRA 1HBUA 1HPZA 4ED1A 2RMLA 1HFEL 4ICLB 3AA8A 3R5CA 2BE2A 1RDRA 2IM3A 5C24B 2R8JA 2O3DA 3QSIA 2Q6BA 4EBEA 4ZPTR 2CJXB 4EI2A 3ET6B 2ZHAA 4Z37A 1GNKA 4NMXA 4I7FB 4HACA 1YBUA 1PBUA 5CD4H 3E3XA 3TX0A 2ZDOA 1NZAA 5KG6A 2H1YA 3NGRA 4J9UE 4QW8A 2YKNA 4QYRA 3F56A 1UFLA 3R7SB 5BYRA 1D9DA 5KFHA 2HG4A 2ZNYA 3TI0A 1D09B 2LU2A 2P6TA 4C8KA 2W2PP 4TXSA 2AYGA 1S7HA 4NYZA 1KQSR 1S7IA 3BH6B 1R6VA 4GKKJ 4B9VA 2GQ2A 1HQUB 2CZ4A 2HS4A 5LXRA 3OR1A 1FE4A 1HKAA 4C98A 3Q8SB 3DXBA 2QL9B 3M8SA 3AFGA 3CJRA 1EP4A 3CDBA 3H25A 4TU8A 1UL3A 2D3ZA 3HHLB 2IJRA 4GMKA 3W5XA 5C42B 2QA4S 2MQNA 2NSBA 3UDCA 2KXNB 4FXVA 3MMAB 3NCQA 4K4YA 3K2YA 1RBLA 4JI6F 4X4UA 2NYHA 3FRZA 3BQ1A 3F73A 1FCAA 1M5OC 3DC2A 3VZHA 4I4BA 3UCZP 2V2VA 2GVZB 2APOA 2K1RB 5DETA 4Q0BA 1RHRB 3NL0A 1VQ7S 4JI6J 4ZPAA 3B82A 1NSAA 2D3UA 3CNQP 3D6TB 5C2GA 4OYAA 2AKWB 5ITHA 3B4DA 2LQ8A 3PXGa 4DSEA 1WOSA 2EPIA 1M90T 2ZD1A 1ZYQA 4DCOB 5GAHI 1SQEA 1KLMA 2B6AB 3QT8A 1N0UA 5J2NA 4OI1A 1VC5A 1L3VA 4NLRA 4DQSA 4ZVUB 5DM6Q 4HL9A 2CQ2A 2E9RX 5HVHA 1CQNA 1KTQA 1T9YA 3CTRA 1HHQA 1NDPA 2DNYA 2DH9A 4CO1A 2C1EB 3KOAA 3KK3A 1S1UA 1XTZA 5KFRA 2JEIA 2GVDA 1N5YA 3M8RA 5E3AA 1IBLJ 2EBEA 5B7WA 1IBKF 4QU6A 3ENAA 1VHIA 1U8WA 2GIRA 3OHAA 3CCZA 4F2RA 2OFGX 4IH7A 3KMQA 3GJQB 2JHEA 2HSEB 2J6SA 1SXLA 5F8MA 4X62F 2VDIA 3MCOA 1CVJA 2V8PA 1B3TA 3CCVS 4R0EA 3IM9A 3LTOA 1U1QA 2ABYA 4RU2A 3BN7A 1Q95G 4NCGA 2ZH2A 1S9GB 3OXLA 3D66A 2UV8G 4X4OA 1VBXA 4V1Ak 4JI8F 3OLAA 3PZPA 4X62J 5IXUA 3R2CJ 1WTBA 1Y3KA 1JLFA 3NNCA 2QC3A 1S10A 1HWKA 2HZAA 5A2QY 4JI8J 2ZJQQ 3DOLA 5BYSA 2MQLA 3HVTA 4J9KA 4DL0C 2VG7B 4OYPA 2CQIA 1MG7A 5HLFB 1FEEA 3PY8A 1S1WB 1BQMB 5F8JA 3VQSA 4PRFA 2QO3A 4Q8EA 4FNHA 2GHPA 2AT1B 1RT6A 3CJ8A 2EFQA 3IGVA 3GYNA 4ZS6A 2P9CA 1IKYA 3DRRB 4LVNP 1G6BA 1EQ0A 4EYIB 3AH6A 3TWZA 2KM8B 1WKKA 3KLGA 4XAKA 1PAEX 5I3QA 4USKA 4ECYA 1TKDA 3HT0A 4UZBA 3DRXA 2HWIA 2V8VA 2DCUB 2ZH5A 3C2PA 4J91A 2F3JA 2FYXA 3MTJA 1V3ZA 1J27A 1UEVA 4ECUA 5IFMA 3ZZZA 3HSDA 1HWIA 3GIKA 1XERA 3DI6A 4X4VA 2KHDA 4OV6A 5CYMB 2ZJPQ 2FJBB 4LFCF 2KYZA 3TZWA 4WE1B 1JWWA 4TVAB 1RT3A 3D3BJ 2DHAA 4UOGA 3HF5A 2NXJA 5F0WA 3EYZA 3WZ0A 3G8QA 4A8MP 3P6YC 4C8YA 3KK1B 3PO5A 2A6MA 1VR6A 3DLKB 1WEZA 1LXJA 1B7FA 3T1HF 2G1HA 4LIWA 4DV6J 2BM0A 5IQ6A 4OYIA 4QIGA 4M5DB 4WWSA 3H98A 2FY1A 5B0EA 4WJBA 3FSYA 5DJBA 3NNAA 2V68A 4KV8B 2HHVA 5H9EK 2M2BA 5HN0A 2DY9A 4PEOA 3J81Y 2DISA 4ANEA 4G1PA 4RW6B 2B56A 3PJWA 5J2QA 4KGMA 2VJUA 4DUTA 3MXHP 4ILRA 3Q83A 3BQ2A 4KGVB 3NOGA 3TEGA 3KTQA 4DN9A 2EG1A 2GQCA 1X9WA 4OMFG 4LRFA 4OJ3A 2JEGA 4B08A 1N56A 1WDTA 4KH0B 4ITSA 3HDSA 2OP5A 1IBMJ 3C16A 5KFMA 1T11A 5G4DA 4IRDA 2PN6A 1KHWA 1Q1KA 3D68A 3OL9A 1B4SA 3POTA 1HR0J 2WVEA 4ZPWR 4WZMA 1RADB 3P3DA 2IY5B 2MXYA 3LP1A 1UW4A 4DLGA 2DR7A 2V4JB 2DR6A 3M9OB 1Q8KA 3IA0A 2J9DA 5K5MA 3R1LA 2YQ3A 2JWNA 1DTQB 3SSQA 3UR3C 1RWWB 1EB0A 1T0TV 1M5KC 3IWLA 1RACB 2AX1A 4RR5A 1KONA 3NGDA 4W4MA 1KC8T 1ZPWX 4ZA1A 2Z0GA 2R7RA 2XLIA 2BANA 4CO2A 4ZCIA 4N8NA 1W2IA 1H6KX 3RW6A 4GRSA 7AT1B 3KWMA 3IBCB 1YG0A 1M1HA 1FJ7A 1YI2S 2R7QA 2MLZA 5I3UA 3JAMY 1G2EA 2GIQA 2W8KA 4KQZA 2ATCB 1FEHA 1NEEA 3M6XA 3QLHA 4DQPA 3T1YF 2V4RA 2VZ9A 1R8HA 3HJVA 5DGAA 1RCXB 2WONA 4IRCA 2CQ4A 1YBAA 3EVMA 3O6QA 1RT4B 3PKYA 3BSNA 5K8OA 1BWEA 4X4NA 1S6UA 3OD2A 4KJIA 1CJVB 3SDEB 5IT0A 1UFKA 2Y1LB 2OPQA 4RPFA 3MMJA 3T1YJ 1K73T 1FKOA 2BYCA 2AYBA 3TOQA 3CJ3A 3P96A 3T6JA 1UWAA 4LJMA 1T3OA 4DSKA 1JKHA 1XMQJ 3OTDA 1R31A 4N77A 2YNHB 5D0EA 2Y8YA 1Q82T 4O44A 2OIHA 3LANA 1L3KA 1QVFR 5KT4A 5K8MA 4IFVA 1LOUA 2WBRA 4JI3F 3BH7B 4QW9A 4EBDA 4UTGA 5F9NA 3PM9A 4M63A 2LA4A 1O8BA 2VU5A 5CHCB 3MAAB 3C14A 1UKUA 4HI1A 3IR7B 1W26A 1XN9A 4JI3J 2KXFA 1R0AA 1KFDA 1EETB 4C2MA 1UWBB 3HKWA 3IRWP 4DL4A 4QPXA 3KG1A 2A10A 2E66A 1X4AA 2MSTA 1DY3A 3OUYB 4ALZA 1V5VA 3QRQA 3ILJA 3M8QB 5DDQC 1PC5A 2BW7A 3MAHA 4M8LA 3QT6A 3FEXB 2ZITA 5AXNA 2MY8A 2XEXA 2BV3A 2ZOGA 4P52A 3RTVA 2DB1A 2HZVA 2QLJB 4F3MA 2BQUA 1LK5A 3KYLA 1JLBB 3UNYA 2GMLA 5CYQB 3VALA 3I5BA 1TVRA 2JC0A 3WHIA 5FDLA 2IC3B 3DDKA 1ZM9A 3TAQA 2KYXA 3P5TL 4G1QB 5DG8A 5KT2A 1OYDA 3I96A 3H59A 3VCDA 1M5HA 3ZTPA 1MMLA 1FKPB 5HP1B 2R9LA 5KG4A 1VLYA 1U1KA 4FF4A 4P9SA 1TL7A 4P6QA 4USJC 2XMAA 2XMVA 5HMZA 5A6PA 4RW9A 3HXMA 2W2NP 5F8LA 1QDUB 2Z30B 1GTHA 1LEOA 2ZC4A 3CD5A 5HBMA 3IRXB 4C0HA 2YKMA 3W2WB 5M2PA 2DGOA 4IOCQ 4PYDA 3PW0A 3SBMA 1SBRA 3DLHA 5IWAF 2IHR1 4M5GA 4NLQA 3UN3A 1AFIA 1RAIB 1S0VA 2UUAF 2D3OR 3LO3A 2MDAA 3PRVA 4ZLLA 1HBMA 2O67A 4Q2MA 4WFXA 3UCGA 2VICA 2VC0A 1EJ7L 5IWAJ 3AD8C 4PWDB 2L48A 3DOMA 2XSJB 3DYAB 4N47A 1R7IA 5LMUJ 3CXCR 2RS8A 4OZLA 1E6VB 5D0RA 2UUAJ 4QWEA 1RLCL 1TELA 4IOBA 4OYMA 4PAAA 1N36F 3C6UA 2B4PA 1VQPS 5HMWA 1S1VA 3K5OA 4FP9A 4MAKA 5JMNA 3IS9B 3I6PA 2RF2B 1G7CB 3AOBA 3KDNA 5H9FJ 2HFOA 4U7UD 3MURP 3DNCA 2EI5A 1F9HA 2F7VA 4H4OA 3KLVA 1BE4A 1JJHA 2YWFA 5I42A 5GMDA 2DGXA 1AYEA 1TL5A 2YNIA 4DR5F 4P7VA 1RWVB 4ZP6A 4LRCA 2MLXA 1S12A 3ZZYA 4Y65A 4DPOA 2O01C 2WB1D 2G9OA 5KFYA 2R7UA 1ULRA 5GMKa 2VDHA 1XMOJ 3IAS9 4GVBA 2WCXA 2LP4A 1GMUA 2H5IB 4DR5J 4USTA 2VC1A 2AD9A 3HPOA 5I4MA 3QYYA 4DZDA 4C8MA 3LPYA 4IFYA 3W63A 1JJ4A 2X3DA 4ZJLA 3SCIE 4HH1A 2PMZD 2UXBF 1X31C 2HHSA 2RJZA 3H7HB 1NPRA 2BVZA 4AXJA 5KFAA 2XZDB
chains in the Genus database with same CATH topology
1I1GA 2VONA 4IG3B 2ILYA 1X4GA 2E5JA 2ZH1A 3LP0A 4NA3A 4EZ6A 4LSNA 3EPGA 1HBOB 4WYLA 3UWTA 3J7ZT 3FJ2A 3OJSA 3T5HA 4NLPA 1QAJA 4FNIA 1NK4A 4QR2A 4XO0A 1LQ9A 2DRBA 2OKQA 2NYIA 5B09A 3IG1A 4H4KA 2LEPA 3M1VB 5KFIA 4X84A 5A8KA 2BOPA 4O3OA 2IRYA 3GIIA 4EEYA 1U1LA 2KFZA 3G96A 3UR0A 3DFEA 4OV1A 2NUUG 2E1CA 2E5HA 3C6UB 3GG0A 2O66A 3V5RA 4E0DA 4EZ9A 3E01B 4KB7A 4PG6A 5KFNA 1R6YA 2BBEA 2WK4A 1S1VB 2BUNA 2JX2A 1VC0A 1BC6A 2D41A 3K8VA 3RR8A 3JSMB 1RWUA 1FTCA 4ATNA 2IAJA 3M05A 3M32A 1P8GA 3DU6A 2HHQA 5L1LA 5AJ3F 2VBYA 1N5VA 1UMJA 4RBUA 1K8AT 2ADBA 1X5TA 4WKYA 5EX3A 4OHZA 3R5BA 3V4MA 3BR9A 3HMJG 2WTFA 3MUMP 1HWUA 3MR2A 1H0HB 4HT7A 3CJKB 2E7WA 2P9EA 1DTTA 1H7XA 4H4OB 1WNEA 3M2RB 4W90B 1HL6A 2B5JA 3HX9A 4PUOB 3PR5B 1KR4A 3SCKE 2AJ1A 3BGRA 4LFAF 3IO1A 5I42B 3RRGA 1WI6A 2R7TA 3BSAA 3NP5A 1LWCB 1OPZA 2ASYA 4HTJA 4IDKA 3K0JA 5DQHA 4GKKF 3M4XA 2J5AA 2YKQA 5KT3A 5J1PA 2YNIB 5CH7B 5T7LB 1S9EB 3NG8A 2AP6A 1R43A 2YNGB 3N28A 4DQRA 2V9WA 2W4CA 4DR2F 5F41A 1C2PA 2C2DA 3HHEA 1FDAA 2F9JA 1SJ1A 3DM2A 3TUZC 4ZVFA 1FVQA 2ZH7A 1C0TA 2KJWA 3ENQA 3MEKA 1WHWA 2ERRA 1V3RA 5HI7A 1QE1B 2V8GA 1FDBA 2MY7A 3HP6A 3TVKA 2NUHA 3PDNA 5L38A 1R8AA 4ZPVR 3O44A 1YJVA 2OMLA 4R0JA 3VWSA 1YIJS 1QM9A 5C25A 5KFCA 1WF2A 2JVRA 2Q79A 2JJ4D 2KT2A 2SXLA 3QIPA 4EYHB 4Y34A 3FZBA 2GGPA 4YDDB 5F8NA 4BWJA 2MKJA 3OHBA 1U6BA 1K9MT 2UU9F 6FD1A 4DQQA 4J9PA 3V6DB 4TQRA 3SCLE 2WOMB 4F50A 1YGYA 2VFTA 2ACYA 2RU3A 4I2PB 4ECXA 1QSSA 1F2GA 4HTIA 4NCAA 1IUJA 2A1BA 2PEHA 1Q53A 2XHWA 1FNMA 1H98A 1K1QA 2J0XA 2DR5A 4GC7A 3ENWA 5K14B 1SL2A 1QSLA 3OFFA 2DGTA 1VIOA 3PHEA 2NR0A 2H9ZA 1U24A 2ILZA 3H2VE 1ZZFA 1HYSB 4YQWA 1VK3A 2HNZB 2NPIA 3MZIA 3K5LA 2DVIA 3RYLA 1HBNB 1VRTA 2O1PA 1H2TZ 2DBBA 3MR3A 3DLLQ 1VJWA 2HHWA 3C3LA 2HMIB 2VV5A 3O3LA 4IFYB 5F8IA 3ZZRA 7FD1A 4YEAA 4RW8A 4DX8H 4C11A 2WW8A 3DHWC 4PG7A 2IYIA 5B0BA 2DNRA 1TKZB 2ZVSA 4ZP9A 3ZZPA 4CH1A 1WEXA 4AQYF 3D5MA 5MAOA 2I9SA 4DV2F 2ZH4A 2FLLA 1Q7YT 2XMTA 1S77D 4CO0A 1HPZB 2UVRA 4ED6A 3K59A 5CA5A 3N79A 3PACA 4KHRA 4NRTA 4QJVA 5CZVA 4R8UB 3EZ5A 4RW4A 2GFFA 1RTJA 3FSXA 4F25A 2K7JA 5E33A 2QYCA 2QV6A 1V9OA 4OIXA 4ED3A 3V81B 2VPWB 1H7WA 1KLNA 4DJBA 2QT7A 3G6VA 3ETOA 2FLPA 1R8CA 3NKYA 2ZH6A 2CPDA 2FPHX 3LP0B 3OQ2A 1VK8A 2D1CA 1LWFA 2IYGA 1P27B 2X1FA 1KQFB 2DGWA 3UQSA 3QGGA 4ETZA 1FTRA 4IOAQ 3KG4A 2P9GA 4WU2A 4BS2A 3IG1B 5A8KB 5L1KA 1X4DA 5KFQA 2QSWA 4A8KA 3HZEA 2K8GA 2D9OA 3N6LA 3PO4A 3CUNA 4OI6A 5KFTA 4CO4A 4WFBQ 1SJ4P 2FJWA 1VIXA 1S99A 3QAUA 4FF1A 4L72B 1WG5A 2IAJB 3LWLA 3M32B 2HQ3A 4ELUA 1CSJA 5LT5A 3FVYA 1R3NA 4H4MA 2OTJS 2HHUA 2HHHF 4J9QA 4FZVA 5G0RB 1LW0B 1TV6A 2NLWA 2CPEA 3BREA 2VQFF 2LCWA 2LYVA 2YKAA 1FKPA 4B3RF 5CQGA 2BDPA 3AJ2A 3GSDA 2DJWA 2C3MA 4RW7A 2KH9A 1NB7A 2J0SD 4RNMA 1QUPA 1DTTB 2GHVC 1FXRA 1VMBA 1Z4UA 3F44A 2E7XA 2RQCA 2B5JB 1JLAA 4XIUA 3Q22A 3MCSA 1AUDA 1GH8A 2E5GA 3BGRB 4U6PA 4K5RA 1TK5A 1VFJA 2AYEA 4XPCA 4J9SA 1OO0B 2B9WA 1A7GE 4IDKB 4K4SA 4ID8A 4NLTA 1HD1A 2KXHA 2MGZA 1HA1A 3KLEA 4WZQA 4NX9A 3OFGA 3MM6A 5LXYA 4K50A 4ED8A 3HKZD 3J7YI 1A9NB 4TU7A 4O3RA 4NMLA 2CQ1A 1SIWB 3PX0A 3NAHA 3C46A 4I69A 5GAGI 5B0FA 1C0TB 2K7KA 1NK5A 5EWGA 1F5AA 2VG6B 2HVIA 3K5MA 4B9LA 4DSJA 1D8ZA 1FDNA 3CO9A 1VQ6S 3PEHA 1PC4A 1A6LA 1IKVA 1FJGF 1N5TA 2DGVA 5DDRC 1U45A 1IBLF 3MGJA 2RU9A 4YB7A 2J8AA 4QZVB 1KQKA 2PC6A 5KFXA 4X4SA 5C25B 4I6YA 2HYIB 1MSWD 2QA2A 3QIPB 2IVFB 3OR2A 4BC7A 2GGPB 5J2PA 1U4BA 1UEUA 3TRGA 1S0MA 2B51A 4ECRA 2E5LF 1X4FA 2BQRA 2F1FA 2X1BA 4URSA 3OFHA 4MIBA 4K0KF 2VG5B 1XNRF 1JLCA 2IM1A 1KHVA 2EW9A 2GJ2A 1N8RT 1VGYA 1K0VA 2W8LA 4GO5X 4HEA9 4HLBA 4KIAA 4UOCA 3WC2A 1HNVB 4JI1F 3CD7A 3MHYA 3FRYA 4EU0A 3BF4A 4Q8FA 1SB6A 2XLKA 2H5EA 3ZZUA 3NLCA 3CDEA 3SFUA 2WHOA 4OI2A 2PD1A 5IT9Y 4ZPDA 1JXEA 1D1UA 1VRTB 1X4EA 4DMZA 3D1OA 4DN0A 1BQNA 3ENVA 1JXLA 1U1OA 2IJFA 3GV5B 2JL9A 3H5SA 4RW8B 2VD3A 2UUCF 4C11B 1FERA 3DCAA 1U1MA 3P49B 3DRPA 1URRA 3S1TA 4MJKA 4KHMA 1FT8A 2BRLA 2MZQA 3CB4A 1L3UA 2CPHA 1KQGB 3MM8A 2HRYA 2AGPA 2OPPB 1Q16B 3OVBA 2CVEA 2FHKA 2VBXA 1WD6A 4E8UA 1RT5A 4HH0A 1DLOA 3EXCX 4JV0A 4RW4B 1M5VC 2XS5A 4JV5F 1RTJB 4EO8A 3CCLS 2L08A 3IC1A 3DGPA 4OZ1A 1YJNS 3QWUA 2YVSA 2POKA 2PO4A 3HHDA 2WB4A 2KTQA 2KT5A 1Q4RA 3KHLA 5EN1A 1RYRA 2V8HA 4PXEA 4I2QA 1H3DA 2XB2D 3C66A 3C8YA 3PRDA 1G1XA 2KO1A 1JLEA 3IBWA 3JTOA 2EK6A 4Y2AA 4IUFA 1LWFB 4CT9A 1RISA 3LQVA 4BWMA 2X1AA 1NH7A 3SSSA 4TY8A 4WU3A 2W9CA 1YTYA 1X4BA 4JI7F 2R2SA 1S0NA 1UVNA 2KKHA 3G86A 4TLRA 3G71S 1YSJA 6FDRA 5H1SV 5FLXY 4V19X 4DSLA 1XNQF 2IBOA 2VFSA 2ZHBA 3TR5A 1TFYA 3NMRA 2JZ5A 1QLNA 2NREA 2HFNA 2DTJA 2NSCA 2LQJA 1JMTA 1JX4A 4H54A 3TUJC 4ILMA 1FDDA 4N8OA 1X9MA 1C4CA 4IH6A 1MWYA 3NWGA 2VBWA 4OJGA 2L3MA 3D0IE 4FVCA 5DS7A 2DHGA 2RVJA