2YH0A

Solution structure of the closed conformation of human u2af65 tandem rrm1 and rrm2 domains
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
195
structure length
195
Chain Sequence
ARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSENPSVYVPGVVSTVVPDSAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRASVGAKNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords SPLICING FACTOR U2AF 65 KDA SUBUNIT
publication title Multi-Domain Conformational Selection Underlies Pre-Mrna Splicing Regulation by U2Af
pubmed doi rcsb
source organism Homo sapiens
total genus 40
structure length 195
sequence length 195
ec nomenclature
pdb deposition date 2011-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2yh0A01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2yh0A02
1PO6A 1X5OA 4LIRA 1X4CA 1YHQS 1H2TZ 2M9KA 4UY8T 2L41A 3VAJA 2KI2A 2E5IA 2M8DB 2I38A 2MGZA 2DITA 1P1TA 3P3DA 2EK1A 2M0GB 3RW6A 2E5HA 3U1LA 2XB2D 3BO4A 4TU8A 4WF9Q 2K8GA 2DK2A 5JVGQ 1OPIA 3CCMS 4U67Q 1VC6A 3ULHA 2MZJA 3CC2S 4OZ0A 4V19X 3CCJS 4LJMA 2HGMA 4IUFA 4WIIA 3MOJB 1WF1A 1FJCA 1X4HA 2CPHA 2DNGA 1WG5A 2CQ2A 2XS2A 2ZJQQ 1H2UX 2OTLS 2AYMA 2F9JA 1FXLA 2CQ0A 1UFWA 2MSTA 3BO2A 2DIVA 2X1BA 1RK8A 5BJRA 2CQBA 2RQ4A 5LJ3Y 1X5TA 2X1AA 4Y00A 1VQLS 3THTA 5CYJA 2MGZB 2FY1A 1U1QA 1WI8A 4UQTA 3UE2A 3JB9k 1SJQA 2MKSA 2MY8A 2DGUA 1N54B 2U1AA 5LXRA 2N7CA 1X0FA 3G9CA 4QQBA 3US5A 2VOOA 1DZ5A 3CPWR 2OTJS 2MZQA 3B4MA 1VQ8S 2DNMA 2D9OA 2MQOA 1VQNS 3MDFA 5GAEU 1WEZA 2MMYA 2PE8A 2NZ4A 1Q7YT 1Q81T 2CQ3A 5IFMA 5IM0A 1OIAA 2QEXS 4PKDB 2ZJPQ 3CCQS 2RVJA 1VQOS 5DDOC 3N9UC 2ADCA 1VBZA 3G6ES 2KN4A 2M7SA 1ZH5A 1XN9A 2MQMA 2L9WA 3I55S 1K8AT 2BOPA 2UP1A 2BZ2A 2Q79A 2CPIA 1WEXA 2F9DA 2MJNA 1M5KC 4M5DB 1X5SA 1U1KA 2JX2A 4QU6A 2CPDA 3H2UB 1OO0B 3CXCR 3Q2SC 3R1LA 3OW2R 1WI6A 5DDQC 2MHNA 4QU7A 3CUNA 1UW4A 3P5TL 1K73T 2DNKA 5EN1A 5LJ5Y 3D2WA 5DETA 2KT5A 1KOHA 2LYVA 2YTCA 2DNYA 2RT3A 2LA4A 2KXNB 5DM7Q 2MZ1A 2LEAA 2MPUA 2MXYA 1HD0A 3MXHP 3NNHA 1FT8A 2KU7A 1QVGR 3UWTA 1YJ9S 2DGWA 2N3LA 1YJWS 1JJ4A 1X4AA 3SDEA 3CCES 1U1PA 3UD4P 1DBDA 1N88A 3NNAA 3CTRA 1OWXA 2LA6A 3SXLA 1M90T 2KXHA 1NJIT 3BS9A 4FXWA 2RU3A 2MZSA 1D8ZA 5IQQA 5GMKa 4EGLA 2CQDA 3S8SA 5D78A 2KXFA 2DIUA 4OZ1A 2MB0B 2MQNA 2AYBA 3MI7X 3VAFA 2AD9A 2AYEA 3NMRA 4WFAQ 3UCGA 1KC8T 2CQGA 5LSLA 3LPYA 2JRSA 1WF2A 2DH7A 4PR6A 4CIOA 2WBRA 5ITHA 2JVRA 1WTBA 2CPJA 3MURP 2RS8A 1Q82T 2RUGA 1IQTA 2CPZA 2CQ1A 3CD6S 3SDEB 2M8HA 2ZJRQ 2DNPA 5HL7Q 3U1MA 4CQ1A 4BS2A 2DNHA 1YIJS 1FHTA 2VOPA 2RS2A 1SJFA 2MQQA 2OSRA 3PIPQ 2DISA 2YWKA 2A3JA 4IO9Q 1U1OA 3S6EA 5CA5A 3G71S 3CCLS 4IOCQ 3EX7B 4ZKAA 1R8HA 2KRRA 2FPHX 1YTYA 3G4SS 2VONA 1CVJA 2KFYA 5GADU 3VAKA 3CF5Q 3VALA 2DNQA 1H2VZ 3K0JA 3FEYB 3CCVS 1JJHA 1N8RT 4WFBQ 2DHSA 3MD3A 1VQKS 2SXLA 1DHMA 4TU7A 2KH9A 4TLQA 2M88A 2MKIA 3UD3P 2GHPA 2M70A 1W2BR 2KYXA 4Y0FA 2PEHA 1D9AA 3PIOQ 2HVZA 1ZZFA 1M1KT 2KG0A 2B0GA 2D3OR 3CMES 2LCWA 4C4WA 1FNXH 3CMAS 5CXTA 2MSSA 2YKAA 5H1SV 3BO3A 5HO4A 1X4GA 2N3OA 3SMZA 1WELA 2MY7A 4YOEA 2O3DA 1U6FA 3CC7S 5DDPC 1K9MT 3TYTA 2DNRA 2RRBA 4A8XA 4Z2XA 3G96A 2MZTA 2DH8A 4LMZA 1P27B 2JVOA 2DGSA 5IM0B 1QM9A 2OIHA 2J8AA 1L3KA 2HYIB 4W90B 1HD1A 1URNA 4ED5A 3DXBA 2CQ4A 2XNRA 2CPEA 3J7YU 1S72S 1VQ7S 5MLCV 4C0OC 3G8SA 1Q86T 1FJEB 2E44A 2DGQA 3RW7A 2DNZA 3HHNB 2LXIA 3IWNC 2LQ5A 1WG1A 5DDRC 2LKZA 1WEYA 1SXLA 1S79A 2XSFA 3MUMP 2OSQA 4C7QA 4J5OA 3IRWP 4RU2A 2F3JA 2E5JA 3B4DA 4F25A 2J76E 3MD1A 4TU9A 2AYGA 1X4FA 3S01A 2N82B 4CH0S 1SJ3P 1M5VC 2FC8A 1A9NB 2DGOA 2I2YA 3ZZYA 4WCEQ 1A7GE 1WG4A 5LSOA 2YH0A 1YI2S 3CULA 1HL6A 2X1GA 2ADBA 1N52B 3NS6A 2L08A 3TO8A 2LEBA 5GAHU 1WHVA 2QA4S 2G4BA 3DLLQ 1PGZA 3G8TA 5GVQA 4PRFA 3H2VE 1UP1A 5GAGU 1HA1A 2M52A 1X4DA 2DNOA 3TP2A 1M5OC 2CJKA 1KQSR 4YB1P 2E5GA 5D77A 1KD1T 1JJ2R 2MYFA 2CQIA 1X5PA 2EK6A 1JMTA 2FC9A 2MZRA 3ZZZA 2DGVA 4WFNQ 2CQPA 3EGNA 3EGZA 1AUDA 2DH9A 4QPTA 1WF0A 2KRBA 4YUDA 2CQHA 3VAIA 3UCZP 1X4EA 1VC5A 2MJUA 1UAWA 3V4MA 2KM8B 2MQPA 1U1RA 3L3CA 1YITS 2DHGA 3UCUP 3CC4S 2VODA 4W92B 2CPYA 1WHYA 3VAGA 1F9FA 4ERDA 2K3KA 1NO8A 3CCUS 2HZCA 5DM6Q 2QFJA 1M5PC 2MKJA 2YH1A 1WHWA 2LXUA 1VBXA 1VQ5S 4WKRA 4CH1A 3NS5A 3NNCA 1KOOA 2M2BA 2CQCA 2LMIA 1U1MA 2EVZA 2XNQA 1FJ7A 1U6BA 2MKCA 3VAHA 4F02A 2X1FA 2HGLA 1U2FA 1U1LA 2RRAA 3R27A 1VQ9S 2J0SD 1WHXA 1G2EA 1WWHA 2DGXA 4F26A 1O0PA 2DO0A 4P6QA 1R8PA 3HI9A 2M4MA 1ZZNA 5JVHQ 2RQCA 1YWXA 3I56S 1RKJA 2OJ3A 1SJRA 2DGTA 2ERRA 1QVFR 3MUVP 3S7RA 3P49B 2U2FA 2DNNA 3FEXB 2XS5A 1YJNS 1DRZA 1X4BA 1VC0A 2DNLA 2MKHA 3MUTP 1VBYA 1VQPS 4FXVA 3BEGB 3P6YC 1H6KX 2NLWA 3VAMA 2DHXA 2G1DA 2CPFA 3CCSS 2V94A 2KG1A 2CPXA 1SJ4P 3Q2TC 1FO1A 1VQMS 2JWNA 3VF0B 2KVIA 1U1NA 5FJ4A 2G0CA 4IOAQ 2RNEA 3LQVA 2DO4A 1VQ6S 3R1HA 1BY9A 2J0QD 2D9PA 2MQLA 2DB1A 2FHOB 3THPA 5LXYA 2MKKA 2HGNA 2LECA 3J7ZT 3CCRS 2XS7A 2KM8C 1VQ4S 1B7FA 2GO9A 2KHCA 2DHAA 1NU4A
chains in the Genus database with same CATH superfamily
3MPYA 5HMYA 1W25A 3J81j 4DV3F 1RTDA 2KI2A 2RDDA 3TAMA 2ZUAA 2DK2A 3FBBA 3DLJA 3CCMS 2FB0A 4U67Q 3WQPA 3UN3A 2MZJA 1TL7B 1YKWA 3C15B 4DS4A 2BJ1A 2VH7A 4ZPCA 1BQXA 1WC4A 2ZD1A 3KLHB 4UOCA 5J2NB 3SFGA 4PQUA 4QIFA 1G6BA 3TEGA 1UZDA 3KJVA 1SJQA 3FQKA 3DC2A 3R7BB 2N7CA 5KG4A 3GILA 2VOOA 4B9MA 3O5TB 2KZMA 1NSKL 3GJTB 1VQ8S 2R7VA 2BABA 5E41A 1GTHA 2MMYA 4ECWA 1OIAA 2OUGA 3CCWA 4Q0BB 1S49A 4X4SA 3A8IA 4DZ6A 1K8AT 2UP1A 1KQKA 2Q79A 2V0NA 2MJNA 4M5DB 1X5SA 2ZKUA 4JV5J 1LK5A 3C3LA 2ZH9A 1K0TA 5I42B 3EDRB 3CUNA 2UV8G 1ZPWX 2AWZA 3AXMA 1KOHA 3TVKA 2GJ2A 3TRGA 4CO2A 3IG1B 4JV5F 4RNMA 3CCZA 5ETVA 1TU0B 1CULB 1PBUA 4XDCA 2Z57B 1M1GA 5C25A 4EBDA 1I3OB 1TKXA 3CSKA 4DUZJ 4DR5J 1BE4A 4P2MA 2A18A 1VCTA 2AGQA 3R6LB 2HHVA 1HBUA 2C2ZB 2OPSA 4DUZF 1WUUA 3M8PB 4ZLJA 3RBDA 5HP1A 6FDRA 3V6DA 1SC1B 3E8OA 4WFAQ 5B0EA 2HIYA 1D09B 3R7SB 4DG1B 2YX4A 1EARA 3V81B 1WOSA 5HL7Q 5G0RB 4IH7A 2DNHA 4OJGA 3IAM9 1YIJS 4CLUA 1LW2A 4RWXA 2EI5A 1VIXA 1T05A 4KTQA 1A0OB 4NLDA 1U2CA 1N8RT 5MAOA 4J9KA 1CJVB 4ZVSB 4WKYA 1OPZA 5DGAA 1ICEB 3E3XA 1S0MA 2V2QA 4JP8A 5LOQA 1VGYA 4CTAB 3OL7A 4IO1A 3GFXA 2W4PA 5CXTA 5DZ6A 2FLPA 1CJTA 4P7TA 3MHYA 1X4GA 1U6ZA 2V63A 1IKYA 5ETRA 2ZNZA 4ED8A 3DLGB 3IN5A 2QIFA 1P27B 3HFKA 4C48A 3EPGA 1JXVA 2E1PA 1L3KA 4K8RA 4W90B 2ZC4A 4QWBA 3OTBA 2ATCB 5F8HA 4I67A 2Y3YA 2DNZA 1FRXA 2R7WA 3GSDA 4EK2A 4C2MA 1WC6A 3IR7B 3ZNUA 3AD8C 3DGPB 3O8WA 4CLSA 1HNVB 2RF2A 4AL6A 4WZQA 2AYGA 1M5VC 4PWWA 4OYAA 5L46A 2YWWA 1U0HA 3JQKA 2J6UA 3QRQA 3EDQB 1T8EA 4FS1A 1N52B 4LFCJ 2LEBA 2QA4S 3MAHA 2LQBA 4KBIA 1CS4B 2CZVC 1AA1B 3KLIA 1S99A 2GVZA 1KQSR 5HROA 2P5VA 2CQIA 1X5PA 3CJKA 1X7VA 2YNFA 3KHLA 5A8KB 1X0PA 3TR5A 4NA2A 1TL3A 4FYWB 4G1QB 2XWXA 2UVVA 4ATNA 4EEYA 3M4XA 3UDLA 1ELOA 1NJZA 2J9EA 2K1RA 1BQMA 3WZ0A 2L48A 4DLEA 1QTMA 3PX4A 2YNIB 2C2EA 2J0SD 1Y4ZB 2IDLA 1TK0A 2F1FA 5JVHQ 1NHUA 1YWXA 3OXLA 1T0TV 2GGPA 5EGYA 3MCOA 4NLQA 1BMQB 3BYRA 2GV1A 4HT7A 1WORA 2DY9A 1TL7A 3C15A 1V3RA 3DRPA 1YJRA 3OQ2A 4LBPA 4NMLA 2DO4A 2XWYA 2DEJA 2J0QD 2XCAA 1SCJB 1SJ1A 1Q78A 3PJ9A 2LECA 3CCRS 1SIWB 3DOKB 1RT7B 5D3GA 5F8LA 3KNGA 4OX6A 3KK3B 4CT8A 4EZ6A 3KMSA 1DJ0A 3HO1A 4LSLB 3CC2S 2IRYA 4IUFA 4WIIA 1FJCA 1X4HA 2ZJQQ 1TKTB 3DDKA 4Q0BA 2CQ0A 3KLEB 4QBUA 2CXEA 4DSFA 4WXOA 2GAGC 1N0VC 2Q6BA 3MR3A 2BBEA 4I6YA 4M5DA 4DX7A 4DF8A 1RT3A 2F5GA 2OTJS 1TZ0A 4IRKA 2FHJD 4WJBA 5I42A 1FFSB 1S1UB 3EPIA 3OBIA 3BBCA 2HNYA 1KFSA 3ZZ0A 5DDOC 1F3FA 4KKOA 3TJAA 2KN4A 3EM1A 2XHWA 3KLGB 1CSJA 1XN9A 1WOOA 3BN7A 4LRDA 1IQZA 4DQSA 4DU8A 3SSSA 4O4GB 3KLVA 1NK6A 1AXQA 2F40A 3IC1A 3ISND 5KTQA 1UW4A 4LF2A 3A3PB 1KR4A 3A13A 1RP5A 2MZ1A 3D1QA 2IRUA 1RLCL 3BBFA 1U25A 1DY3A 3AB4B 1N33J 2VG5B 3MCMA 1N6QB 3PZPA 2Z2ZA 1PYTA 2XGPA 4FYVB 1Q8BA 5EWFA 4AXIA 4USVA 1N33F 4YR0A 2RIJA 3M8QB 4QWEA 4OZ1A 3HULA 5F9LA 3CIZA 3OFEA 3IRXB 4I68A 4F4WA 1S1WB 5F0UA 1EKRA 1LOUA 5B0FA 1U0SA 4BS2A 3H4DA 3PIPQ 3MPDA 4HDGA 1TL4A 2EG1A 3T9ZA 2ASYA 4ZLLA 2V67A 2DNQA 3AB2B 3FEYB 5B09A 4WFBQ 2DEIA 2XMUA 2CWKA 1K0VA 3DLGA 2KH9A 2M88A 3AXKA 1Q5VA 2G2OA 1FRIA 2VC1A 1RT5A 2B0GA 2LCWA 2W9CA 4IR1A 2CIMA 1W26A 2ZUGA 2YKAA 2HWIA 1HMVB 1NXIA 2IVMA 1WELA 1K9MT 2CZ9A 5A6PA 2JZ5A 2FVCA 3DGPA 1B7YB 1IM4A 3QRRA 2OIHA 4YMEA 4UZBA 2ROPA 1S0VA 1XJWB 4K59A 3SQGB 1HHQA 2PGCA 1UA1A 3BSAA 2NXCA 3RB6A 4DS5A 1S72S 2BANA 3MM9B 1RT4B 3MAQA 2VPWB 2YY3A 2VICA 2LXIA 2IYIA 1X9WA 1CS4A 3R5CA 4PG6A 1RWVB 4J5OA 1NH7A 4ZPVR 1MLAA 1X4FA 5A8KA 5EDWA 1RWUA 2BXJA 4YEAA 2FGCA 3POTB 3BGUA 4NCBA 2V4QA 3DLKA 4G1QA 4DFJA 1PGZA 3QGGA 4M5HA 1Z2ZA 3BB5A 2CJKA 1ACMB 2FZGB 5IC4B 4LRFA 5CYMA 3ZZZA 2YNIA 2CNOB 4H4OB 4X4VA 1T11A 3BJYA 2EFOA 3AQPA 1OSCA 3C16A 1WD6A 1FDBA 3I9V9 1VBXA 1VQ5S 4RWWA 1YZ7A 2C28A 3UN2A 3NNCA 1EP4B 4MKAA 1F60B 1NNDA 2F8HA 1IKXA 4CH7A 5AXNA 4L75A 2ZM6J 1RKJA 2OJ3A 2QJ3A 1HQ2A 3DOKA 1JWWA 4WU3A 1RT7A 3ZZTA 2ZM6F 4PZVA 3BQ1A 2WCXA 3BEGB 4FF3A 1GQEA 3FK4A 2YQ3A 2LDYA 1F3VA 2E1MC 3VF0B 1BLUA 5HATA 3NAHA 1NKEA 3KHHA 3MOZA 1TKTA 3KLEA 5KFQA 1HBOA 3O3LA 2E5IA 1PBAA 2NREA 1U8SA 4KGKA 2FLNA 3BO4A 3I4PA 1JX4A 3DLEA 4LJMA 3VR1A 3ENWA 3TX8A 1S1UA 3GIRA 3Q8RB 3CW2C 3BO2A 2CJ9A 3UVJB 2IIHA 2XMWA 4MIWA 4QCLA 2MGZB 4ZLPA 2V4JB 4KV8A 2JEIA 2HRTA 4F0MA 4J9LA 4HH0A 1R6VA 2OEKA 3T1YJ 4G65A 3M7VA 2C3UA 4PKDB 5IOLA 1X9SA 4P2XA 5F3TA 1H7WA 1D9FA 5HLFB 2BOPA 3LP1B 3RAXA 3Q8UA 4UT4A 2ZBCA 1M5KC 2CPDA 5FIIA 1DQ8A 2W24A 4IFYA 1RBOB 2W25A 3D2WA 4RUAA 2PEBA 5KFKA 3TNVA 3AJDA 5J2MB 2UVWA 2N3LA 1YVFA 2DRBA 3PHEA 3CCES 4JI0J 2D41A 1XR5A 3CTRA 1M90T 4LQ9A 2KXHA 2WVBA 2R7OA 2BW7A 4DSEA 3NWRA 5IQQA 2QN6B 2WB4A 5E0OA 2KXFA 4JI0F 4KY3A 4FKYA 1REVA 4MAKA 5EX3A 2VDHA 1TAQA 1DTTB 3D67A 1T7PA 4PYAA 3M6XA 1N0UA 1HR0J 1JXLA 4PWUA 2R8IA 3HHLA 4NLPA 3G71S 3LP2A 4DUYJ 1HR0F 5E3QA 3G4SS 1WKLA 5GADU 3CF5Q 2Y1JA 4X62J 4L76A 2OD6A 3KFWX 4F36A 3CE8A 2ZH8A 1UTAA 3NS7B 3GSIA 4DUYF 2WVCA 1UEVA 4X62F 3KWMA 2F65A 5U47A 5KFNA 1FNXH 2R8GA 1RT4A 1UEUA 1VS3A 2IJFA 4YOEA 1UWBB 4KT0C 4A8XA 3DCAA 3TQ1A 3GTYX 3N4WA 2JVOA 1VQSA 4LIWA 4MK7A 4O0NA 4ANEA 2QT7A 3DXBA 5K8NA 1VISA 4F4XA 5MLCV 2H48B 1GMVA 3KUEA 4OX7A 2B9YA 3FGVA 2YKQA 5JXSA 1IUJA 1V5IB 2DKOB 3JTOA 3J7A1 2DXDA 1JLQA 3LUYA 1J5EJ 1V5VA 4CH0S 3HJVA 4Y65A 4QPXA 3ZZYA 1BUXA 4P74A 4QZVB 4LBIA 3DMJA 4JB8B 2XZDB 1NK8A 2ADBA 1WC5A 3NS6A 2R9LA 1RGVA 3DLLQ 3FVYA 4B3OB 4FYDA 1ZA2B 2K06A 1N5YA 2IMWP 2VHGA 3T6BA 4ED2A 2PT0A 1LXNA 2CQPA 3EGZA 3PO5A 1R27B 2W7AA 3Q22A 2KRBA 3ISNC 4CRJA 3SSRA 5KFTA 3D3BJ 3VAIA 3UCZP 3MMBB 2FIUA 3SCJE 3ENAA 1WHYA 1YJVA 4M1KA 2MKJA 2RUSA 5DLGA 5B0CA 3KUHA 1OMSA 4DPWA 3OR1A 4P9SA 4AT1B 3MM7B 1RHKB 4XPEA 5J1PA 3EZUA 3DRSA 2UUWA 3W8PA 1R8PA 2AZ3A 2H9ZA 2DPJA 3FCVA 4M5LA 3R6GB 3P49B 2KFZA 1YGYA 2Z2YB 3BN4A 1IVZA 3OVAA 4YP3A 3VAMA 2DHXA 1S1XB 2V68A 3VWSA 4F4KA 4O3PA 1NPPA 3H42A 4UOGA 1FRLA 3K5OA 4KSEB 4CO0A 1CJKA 2A10A 3V2UC 4I69A 3OLAA 1HBNB 2KM8C 2OEMA 3UVJA 3GV5B 2MGZA 3JS9A 1SQGA 1U2RA 4L3KA 3U1LA 3TI0A 4ZVRB 4QR1A 5ETKA 3NGTA 1QAYA 2BACA 4NL5A 2DTJA 5LMNJ 2FVSA 1KS2A 1WF1A 2V5HG 2DNGA 1OQ3A 4C3LA 1RJJA 3N5BA 2DIVA 5LMNF 1TVRB 1PYSB 2LLZA 3K7RA 2DVIA 3QQCD 3RU0A 3PR4A 1Q53A 4QWDA 3GU0A 3PRVA 1SC3B 1UVKA 1M0SA 5LXRA 4LSNA 6FD1A 2HEKA 1NDPA 3RTVA 5DG9A 3OSNA 4HI1A 2PC6A 4IFVB 2Z8QA 1VRQC 3W65A 5J2MA 3A8EA 2VFRA 4IG3A 5F3ZA 1VI7A 2A6MA 4N5SA 2PA3A 4QYZJ 2IM3A 4HACB 2GA7A 2MHNA 1O5JA 1K73T 5GAGI 1Q5YA 3GJSB 4CLFA 4YB6A 4JI7J 3N28A 4D3GA 3T5LA 4FPRA 4OHZA 1YJ9S 4K4WA 4NI2B 3SCKE 2W9BB 1YRTA 4K4YA 3W9HA 1DTTA 4JI7F 2QLJB 2W7OA 4OZLA 4JI4J 4P2FA 2J0WA 4RW9B 4WWSA 2VV5A 2W4CA 1R8BA 1S7IA 1IR0A 4I0WA 3T5JA 4RNFA 2ZITA 3GR1A 3WIVA 1GMUA 4RW4B 4KC5A 3NMRA 1UEKA 2XY5A 4JI4F 4YDDB 4C6AA 3AOCA 4WFZA 3OR2B 5ETOA 2M8HA 2NSCA 3U1MA 3NBPA 3QJJA 4R0EA 2FJVA 4F4YA 1FHTA 4A8QA 2RS2A 5F8IA 4K7QA 4WE1B 4BWJA 1JB0C 2CNNB 2ABYA 1PAUB 4DOZA 3OHBA 1HPZB 1HKAA 3K0JA 2V9KA 4RW8B 3TUJC 1Q95G 5C5JA 2QSFA 1OQ6A 3IS9B 3W2WB 4EMDA 3M2RA 4USWA 3W3SA 2N7YA 3SFUA 2BQRA 2B5JB 4LFBJ 3B78A 1TTHB 3ILLA 2Z4PA 2CNKB 3J81Y 5A8RB 2O3DA 4OI2A 4DFPA 1ZOTA 4LFBF 2VPZB 3G96A 2DH8A 2CAJA 5KFHA 2HVEA 2QYCA 1BQNB 2HYIB 1VDHA 4DX6A 3OJUA 2GJIA 3TA0A 4BWMA 1FRHA 2HZVA 4Y2MA 4M5IA 2RJZA 3HD2A 3EICA 5A2QY 3WIUA 4B3OA 3RAQA 2XSJA 4J91A 5GAEI 5IQ6A 2OSQA 5K20B 1YK9A 1FVQA 1KBRA 3JQJA 2GAHC 4RU2A 4IYQA 4K4ZA 4C8YA 2H1YA 4KAIA 2XQCA 5IZHA 2RD5C 2EBEA 1FTCA 4X64J 1AROP 4G6VB 2L08A 5CZVA 3GCXP 1UP1A 2ACMA 4FVCA 2M52A 4X64F 4X66J 5D77A 2MYFA 1XIQA 5F8NA 2GJFA 2LVWA 2FHKA 1L3UA 1C0UB 4X66F 2NYHA 4OV6A 1EQ0A 5FLXY 2Q6CA 5HVHA 1IM6A 2FZKB 4Y2AA 4DLGA 4U8VA 5E3CA 4GO7X 1JLEB 1HYSA 5I3QA 1S1XA 2EBGA 1RAOA 3PEJA 3KG0A 3JAMU 2LU1A 2FVRA 1WHXA 1LWFA 3MPWA 2YKOA 4N7TA 5HAOA 4ID8A 3VGVA 3OTOJ 3BKUA 4UF4A 2Y0SD 4RO0A 4GC7A 2DNNA 2BKOA 2MKHA 3OTOF 1H6KX 3PYFA 2WSCC 1JJCB 3GIJA 1V3ZA 3Q2TC 2CJAA 4Y2KA 3M6VA 1FTRA 1AT1B 2MQLA 3ILIA 1LQ9A 1F2HA 1GX5A 2R8HA 1LV5A 3TVZA 4PEOA 3MFHA 2PD1A 1NHKL 3CDAA 3MEDA 2ZH5A 4UY8T 2L41A 4B17A 2K8GA 4ZHRB 1OPIA 5HJXA 4DL7A 3VZHA 1AZSA 4ECUA 1N5TA 4O23A 2YQ0A 4ZCKA 3NLCA 2AIRB 2RRNA 2NXEA 2W2OP 3PO4A 3V6HA 4FDFA 1OYEA 1FKPA 4DQRA 2E1RA 3QGHA 1NUEA 2UUAF 4OYZA 1I6JA 1C0TA 3AH6A 3GB0A 3THTA 1MWQA 4KGVB 4HKQA 1P9YA 5BYRA 4ZIWA 2LXFA 3G9CA 5T7LA 2AMCB 3PX6A 1QE1B 2ZE2A 1N34F 3GFZA 2KTQA 4FYYB 2W8KA 2QA2A 3FFIB 2ZOFA 5ETMA 4WFXA 2V8DA 3G6ES 1HQEB 3DLBA 4CDIA 5C2GA 2B4OA 3BR9A 5HANA 1R31A 1E6YB 1LWEB 3QT8A 3J7AN 1RHUB 1WJ9A 3NKYA 3BGLA 2OPQB 3VGTA 5LJ5Y 2KT5A 3A8JA 2W2MP 2KXNB 3LGMA 2W2QP 1RTIA 3MXHP 3BDEA 3QT7A 2KU7A 4WP8A 3PFEA 5ETPA 2QZ8A 3HLUA 2C42A 1QY7A 4P7VA 5SUHA 4OLOA 4RJVA 5L9NA 3CDWA 2VBXA 3PRDA 1RWKB 4DMZA 4IR9A 4WE1A 5DQIA 2BMBA 1JXEA 4ZK7M 2X3DA 2AYEA 1KC8T 4NLSA 3DM2A 3PXGa 2JVRA 1WTBA 2GC8A 2CQ1A 3DNCA 4QW8A 3IS9A 4NCGA 3NCRA 3HKWA 4J7CA 1SKWA 4LR7A 3ZZUA 1FEHA 3T6JA 1PCAA 4LF7J 5K8OA 2FJXA 4ER8A 4IOCQ 1WKKA 1OY9A 3FBEA 2KFYA 5KFVA 2UVRA 4AL5A 4UOFA 4ELUA 4LF7F 1VQKS 2B7BB 5BXIA 1KN6A 1RT1B 1ZAWA 2VASA 2KFNA 4DPTA 1PIEA 2XMVA 5HO4A 4YY3J 2EW9A 1NB2A 2JLEA 4N8OA 5M2UA 2HNDB 1CJUB 2NYIA 2C1EB 1OSDA 5HQ8A 4QIWD 2DCUB 1FKAF 4NXMJ 2EG2A 4U96A 4ED1A 2Z2LA 1HD1A 3DOLB 2CQ4A 4ZMMA 3J7YU 4EYHB 2IBKA 2Y8WA 4NXMF 4QR2A 2YPZA 3SSQA 3VZIA 1U47A 1WG1A 2HHSA 5D4PA 3LGNA 2O5DA 1B4SA 1LWCB 4M5NA 2RDJA 4OMFG 4F25A 3T5HA 1U8WA 4DR1F 1C0UA 5CYQA 2EXUA 2BE2B 2CRLA 4FF1A 2D7SA 2H4WB 2XYGB 3TANA 5GAHU 4Y34A 1APSA 2R2SA 5GVQA 3VHQA 4PG4A 1JLEA 1M5OC 3GIKA 1S9GB 4NYPA 5F9NA 1Y0HA 4XDDA 2COLA 1UZHA 2JL9A 1BGXT 4F7VA 4PCQA 1X9MA 3NAIA 2WHOA 3BGOP 2HQ3A 4NRUA 1UAWA 3H0PA 2CPYA 1NO8A 5DM6Q 4RNNA 4KFBB 2P9EA 2JLGA 1NRKA 2KHDA 2LMIA 5LM7E 3RGIA 3HM9A 3FSYA 4J9NA 5D0GA 4F02A 3GJRB 3JSRA 5C24A 2J0XA 3R7NB 2C22A 4ITSA 2HIQA 1RISA 4TYBA 2PI5A 2B9WA 3MUVP 5D4LA 4GO5X 2XS5A 1K44A 2YVSA 5HBMB 4YN3B 2J9CA 1VQMS 2LFVA 1U49A 2G0CA 3MTJA 1KEKA 2OAUA 1VQ4S 2DHAA 4YDXA 4OI6A 5RUBA 1YHQS 4URGA 1SPBP 4RBTA 2UUCJ 3VAJA 2UV8A 2DYAA 2BA9A 3JQMA 1NAQA 2CVIA 4RW7B 4V19X 2UUCF 2XLJA 4EBEA 4URQU 2IA6A 2WB1D 3JYTB 4EI2A 2H51B 2R7TA 3HZEA 2MTLA 3UO0A 2AZ1A 4Z7YA 3FFIA 2HWHA 3H59A 1X5TA 4NLWA 3BYPA 1UCNA 3HD1A 2FY1A 3B6BA 1TFYA 4C8LA 2VB6A 3DYAB 1JLGA 2H54B 3RZAA 3S1TA 1RADB 3BSNA 2MZQA 3GV7B 1R0CB 3M30A 2V2ZA 3PY8A 3RAMA 2FYXA 3MCSA 1C1BB 4A4JA 1KLMB 2HFVA 2KO1A 2XMTA 2QL9B 2ZJPQ 4OHXA 2RVJA 3Q86A 3MM5A 2BJ3A 3MECA 5EWEA 2F9DA 3HSDA 1IR1A 2CG8A 3MMAA 3OL9A 4O3NA 1VRUB 1HBMA 2CZ4A 2Y0BB 3OVSA 1RB0A 4CO1A 4RUBA 4NA1A 1PILA 2IHR1 1PJ6A 4AUKA 5B0GA 3D1HA 2XLKA 1LXJA 1NJYA 2IJRA 1DBDA 2LA6A 3MTKA 2B56A 4XK8C 2O67A 4WFYA 4I1TA 4ICLB 2MQNA 3RB4A 4C11A 3VAFA 4OIXA 1GAOA 2DXFA 4DPXA 4QWCA 2DH7A 4PR6A 5KOXA 4OZ3A 4ZVPB 5KFUA 1H0HB 1KWMA 5IV4A 4CYUA 4L74A 3SV3A 2F63A 5AXKA 2ZZMA 2YWKA 4IO9Q 4V19J 2QGFB 4EO8A 2CJQA 2DR5A 2AX1A 2R8KA 4WBFA 1JLCB 3NXZA 3QIDA 4YFUA 4RUCA 1S6OA 1CJUA 1R6YA 3UD3P 1NPKA 2GO8A 2NUHA 2H3EB 1LW0B 2OPPA 4EUVA 2J9DA 5HN0A 3DOLA 3CT9A 4OYMA 4UUWA 5H1SV 5FD1A 4E8UA 5HMWA 4KYZA 1SH0A 3ETOA 3CC7S 3W5ZA 3TYTA 1FA0A 4GVBA 4XTTA 3HSZA 1LWCA 1RWMB 4DQQA 5DJBA 4UUXA 4IG0B 3FUYA 3DGVA 4XO0A 1ZETA 3A1YG 4DV2J 4MTPA 4QR0A 1VQ7S 2BE2A 8RUCA 4MKVA 1NHVA 2RAQA 5HMZA 1KDNA 4DV2F 1JQGA 2YQ1A 1URRA 3PKYA 5J2PA 1SXLA 1S79A 2XSFA 4ETXA 3F73A 2J76E 1Q1KA 1VHIA 1KLNA 1A9NB 2RILA 3JSMB 4CO4A 3VVTA 4WK1A 1DARA 1HL6A 3LANA 4AD6A 3OHAA 1EJ7L 4OHVA 3L4BC 4ZVHA 2MQ8A 2HMIB 4J90A 2XTJP 2VUGA 3JTPA 4C3KA 2FC9A 3MAAB 2A2CA 4IH6A 2FHJA 5D8HB 3PW7A 4UTGA 1D8YA 1L3SA 1ZM4A 2GZOA 2K3KA 3FSXA 2HZCA 4OFZA 1T3NA 2B7CB 1FNMA 2E5LJ 2EVZA 3C6TA 2RKIB 5FDLA 1MU2B 2HK3A 4WYLA 3MM6A 2R2TA 5DQGA 1U2FA 1U1LA 2E5LF 2QX0A 4YS2A 2DGXA 1ZZNA 2VZ9A 2HHPA 5HJYA 3MR7A 1DQ9A 3M32B 3FEXB 4IQXA 2DNLA 3TJ9A 2NLWA 4C8ZA 2CPFA 2CPXA 3JYTA 4DL2A 4ILMA 2R2RA 3KYLA 4JI6J 1R8CA 2OH2A 2FHOB 3BKTA 5LXYA 3H2LA 3AJ1A 4I7FA 2V8GA 5K9FA 1AW0A 1S1TB 4JI6F 1U26A 3ET6A 1P1TA 3CJ3A 4GKKJ 3M8YA 1EETA 3HHLC 1NMEB 4H4MB 3DRYA 3VVUA 4DPUA 3EUNA 5B0AA 4B3RJ 2HGMA 4ZCLA 5KG5A 4TQSA 3W1YC 3OL8A 3MOJB 4GKKF 2P9GA 1WG5A 4ZVQB 4X4PA 1N56A 3P5BP 4DPYA 2IFXA 4B3RF 2MSTA 3HVAA 4B08A 2J5AA 4CWBA 1YSJA 4JV0A 2YXLA 3CJRA 3O44A 5CCMA 3RR8A 1RABB 1TP7A 4R5PB 2FY8A 1KRPA 1BC6A 2B9XA 5D4OA 2XZTB 2JC1A 2XMKA 2D9OA 4TXSA 2ZZNA 4LQ3A 4ANDA 4P72A 4FBTA 4O4RA 1Q16B 3IXQA 5IS2A 1MMNA 4X4TA 2QYGA 3EVMA 3FBFA 3PM9A 3MR5A 3I0RA 3EWGA 5G4DA 3RR7A 1IKVB 1GTEA 4I2PB 1UJ5A 2HS0A 1UW9A 1WEXA 3QATA 1Z2LA 2VFUA 5J2QB 3QNWB 1RA6A 3CXCR 2B8QA 3PTWA 4KGZB 1Q4RA 3I82A 1IBLF 1I51B 3FBCA 5DZ7A 2H5EA 2NPIA 3WX8A 4ICLA 4L72B 2YTCA 3TX0A 3PNIA 1SKSA 3NY0A 2AU0A 4RW6B 4GKJJ 1YJWS 2YBVA 4HT5A 4DSKA 4LF8J 1VK8A 1H72C 4DXLA 4HH1A 4MJKA 2IA0A 4P75A 4GKJF 2CWXA 1KHWA 3S8SA 4M63A 2AYBA 1RWWB 1IJFB 2ZBRA 4OYPA 3QIPB 2B9EA 5I4MA 2HFZA 1H73A 4DQPA 3LP0B 4QWAA 1MN9A 3LA0A 2P6TA 3JXOA 2Z0GA 1SJFA 2ZFHA 2DISA 5L39A 2A3JA 2EC2A 1MMLA 5CA5A 2WAQD 3CCLS 2XMJA 3IBWA 5C7PA 1F9EB 3IBFB 3W8GA 1NKCA 3VAKA 1SUQA 1WACA 4IRCA 3PCOB 4ZPTR 3U02A 1PJ5A 1S76D 3MEGB 2IAJA 3QAUA 3PIOQ 2IRXA 4N56A 3W64A 3DN9A 2BQUA 3DU5A 4K4SA 3TEHB 2BV3A 4ED0A 3PFOA 2CA9A 2GHVC 4CNZA 2VG7B 3EZOA 4Q44A 3FDSA 7FDRA 1FFWB 5IM0B 2W1BA 1PG5B 1FKOB 4PWDA 2HFSA 4QIGA 1VLOA 4ED5A 4Y2IA 1GT8A 1RU2A 1RE1B 4C0OC 2E44A 1IKWB 3QLHB 1SB6A 3C14B 2HFNA 3QFHA 4AE5A 1VHFA 2HLUA 2VFTA 4IDKB 8ATCB 2KB2A 2QG9B 4F3QA 4LBHA 3P8BB 2XY6A 2HBZB 2LQ8A 3GYNA 3Q23A 2W9AA 4DR2J 2FC8A 1WC1A 1YI2S 4YR2A 1DURA 1H74A 2J7KA 4U95A 4BDPA 4DR2F 1ULRA 1DFDA 4Q45A 3M2VA 1VMBA 1JK9B 3F56A 1QJHA 2DGVA 3PX0A 4JI1J 1K1QA 4I2QB 2C2KB 4KJIA 3Q8PB 2ASDA 3DOMA 1LEOA 4JYAJ 1U1RA 5J1EB 2HQFA 5L9XA 1GEHA 3M32A 3GPAA 4KE5A 4JI1F 3C6UA 5DLFA 4IH5A 4JYAF 4ELTA 2BRKA 1WTFA 5KG7A 1T95A 1FK9B 2QC3A 4DL5A 2HVDA 4W4MA 1YBAA 1S1VB 1FNOA 1G2EA 3DKDA 2VBZA 1E6VB 3WX4A 2ERRA 4ZPWR 4F2RA 3UDEA 1S1TA 2W7PA 4B9UA 3DDIA 3MUTP 4OHYA 3CJ0A 2NXJA 1QAIA 1TKZB 2JWNA 2V8VA 2KVIA 5BR8J 3OUYA 2RNEA 5CCLA 2QLBB 5GADI 2D9PA 3V4IA 2XULA 2QE5A 3MMJA 1TQLA 5BR8F 1X4CA 2FGOA 2M8DB 4WTOB 2QLWA 3WBZA 2JEFA 3RRHA 2MEWA 1ZTWA 2QRRA 3BKFA 2RE1A 5L1IA 5M2RA 4GC6A 4KPCA 2H5IB 1HFEL 3UI3A 1TK5A 2I9SA 1F1BB 2RU9A 3UFCX 1TELA 2YNGA 1Q8KA 2VJVA 3GONA 3MEEB 1UFWA 1XMBA 3AQOA 1EZZB 1VQLS 2N4DA 2VPXB 1U1QA 1IKVA 1TV6B 4G1PA 3GE9A 2U1AA 2RQKA 2FVPA 4ID5B 1DZ5A 2DT9A 1RAHB 1W7WA 3HSJA 9RUBA 3OV7A 5HSPA 4A8YA 4OYOA 4DV5J 1NSQA 4X4RA 1NK4A 2OHDA 3UR0A 2PFDA 1U09A 2AF6A 5KAKA 4DV5F 3HP6A 5I3UA 1U1KA 4E2FB 5EHHA 1RZMA 4YQWA 4ZPDA 4FNHA 4RU9A 2HVHA 3UD5A 3FRZA 2DNYA 2OI2A 2HZAA 3CDUA 3PHTA 2X3GA 4ANCA 2AV5A 4FZVA 3KLFB 1UMJA 5AXMA 1JLBA 5AJ3J 3LWLA 4KHPJ 1CBKA 4EGLA 2CQDA 1RU1A 4C8MA 1SQEA 3K5NA 3M2UB 3E51A 1HLWA 2ZOMA 5AJ3F 4V1Ak 3UCGA 4KHPF 3A4TA 1VRTB 5A76A 3ZFVA 4DFMA 5ITHA 3D9BA 4KGXB 3N01A 3I9ZA 2RUGA 2ZBIA 1HNWF 3C19A 4DL0C 3MEGA 2ZJRQ 1M5SA 1EHWA 4USMA 2XO7A 4LRAA 4WTYA 5K14B 1KONA 5GMDA 3DRRB 4WXWA 2VU5A 4TNOA 5AE3A 1DQAA 3VV2B 5KFDA 2HK2A 2VG7A 3UNGC 3MD3A 2KZZA 4CM2A 4CLYA 2DR6A 4J9RA 3W7BA 2HNZB 3NP5A 2M70A 1LFPA 3QZ7A 3KXDA 1DLOB 3IP0A 2ZH3A 4PXBA 3R97A 2HVZA 1HNIA 1B70B 4U7CA 4H4KA 3W63A 3BO3A 1XMOJ 2HQCA 4OI0A 2ZWOA 5IC6B 1EKSA 1ITPA 2E7WA 4C0BA 1ZTTA 3WC2A 5KT7A 2YWFA 1XMOF 3RB3A 2PSZA 2HBRB 2J8AA 1F6TA 2XNRA 1DTQB 3EE3A 3EXCX 5H9EK 1CQNA 2AJ0A 1JLAB 3R5BA 3KLHA 1N32J 3G82B 3W2VB 4DX5A 5J2NA 3FQLA 3H98A 2HHTA 3SV4A 2E5JA 2VF3A 2J9DE 3JAMY 1N32F 1C1CB 4X4NA 4O3SA 4KR0B 2LU2A 1RHRB 4DSJA 5M2PA 4X2BA 4A8SA 2V8HA 1GFWB 1RTJB 1AYEA 2UXDJ 2E9TA 1S1VA 1HHTP 4KO0B 2DH9A 4QPTA 2PI4A 3PJXA 2KM8B 4MK8A 1E6VA 2UXDF 3U27A 2G13A 3HSGA 3GIIA 3OXGA 2JFKA 4USJC 1N36J 3DLHA 1YJ7A 3M8ZA 3T19A 3EZ5A 1KOOA 4PXCA 5KOWA 5CD4A 4LRCA 1N36F 3IG1A 1CULA 1FX2A 1DAXA 2FJDB 3R2DJ 4P2SA 4OYWA 2HBQB 1QDUB 2DO0A 4P6QA 1IBMJ 2PN6A 2U2FA 1Y3JA 3HX9A 1DRZA 1IBMF 1J5OB 3M8PA 3NGRA 3GMGA 2V69A 2YKMB 2XI2A 3H5XA 1HNXJ 3ENQA 3KK1B 4NLVA 1S6QB 4DR6J 2IPOB 1JKHB 4DG1A 1BY9A 4PYDA 3E01B 3THPA 2LQJA 1S77D 1HNXF 5KFFA 2GO9A 3V81A 1PO6A 4DR6F 5G0RA 2AKWB 3MEKA 1VFJA 4NLRA 2B6AB 1S10A 4PXEA 4CZCA 4R25A 4EO6A 1RT6B 1VC6A 4RKUC 3RYLA 4ID5A 4OZ0A 3CCJS 4DN0A 1VK3A 3AAWB 1FX4A 3EVWA 1GX6A 1CJVA 1WC3A 2OTLS 4A46A 1QUVA 1RWPB 1VOMA 2X1BA 3OXFA 2Z58B 2NSBA 2IY5B 4CTAA 1HI1A 4WYWA 3M8WA 1WI8A 1WOPA 4USKA 3DU6A 2DGUA 2JDJA 3KG1A 4MT1A 4D3HA 3O1LA 1IXKA 4L6V3 1Q0NA 1RHMB 4W98A 5DO2A 1QUPA 3HFZB 3R5GA 2PE8A 2ROEA 1AB8A 2QEXS 4DPOA 3MGJA 4DL4A 1TAUA 3ILOA 4P52A 3TOQA 4ZA1A 2ASJA 1RAFB 4E0DA 3T1AA 2BJ9A 1NPRA 4MYUA 7FD1A 3CD7A 5DG7A 2DNKA 3PR5B 4PUOB 1HNVA 2BDPA 1SKUB 2G0IA 4F3OA 2C3PA 2Q3PA 5KFOA 3W9IA 1C4CA 2GMHA 1MWZA 3SXLA 1YZ6A 3P45B 2MZSA 2GMJA 1H3DA 3DRRA 4IKAA 2DIUA 2AT1B 4MYTA 1LK7A 2AD9A 1UFKA 3L9ZA 2B3TB 1FXRA 5LSLA 2AGOA 3QJLA 3D1OA 2VKRA 1DLOA 3F0NA 5KG0A 3LAMA 1RTDB 2ZC3A 1VQYA 4K4TA 1U48A 1WDDA 3S6EA 3MF5A 2VFSA 4HTJA 2UXBJ 1ZM2A 1T94A 3FNNA 2AX0A 4B9LA 1I5OB 2UXBF 2XEXA 4YHHJ 2I0XA 2IM0A 1XK8A 1N5SA 3D7SB 2OMLA 5KT3A 3IAS9 1XC9A 3QRPA 4YHHF 2IYGA 2HLTA 3X3UA 3G82A 2G0JA 1ZPVA 4PG8A 4B3TJ 2CG4A 3KJFB 5KFMA 4DU7A 3B54A 1SKRA 3KTQA 1NJWA 3KK3A 4B3TF 3QGIA 4DV1J 1RACB 3DHWC 4LSLA 3HHNB 2Y1IA 1X60A 2LKZA 2M3DA 1QSYA 4DV1F 2M5YA 1NK9A 4DR7J 3IRWP 2XMAA 4TU9A 4KO0A 1SJ3P 5C25B 2FTRA 2DGOA 1TKXB 4DR7F 4CM0A 3Q89A 3F41A 4WU2A 3CULA 1NLKL 2AQ4A 3AA9A 1NZAA 1HBUB 3HMJG 4CLWA 4ZITA 3D4JA 2JH3A 2OPSB 2DNOA 4NXNJ 4TKTA 5HP1B 3FC9A 4YB1P 1KD1T 1PC4A 2MZRA 3HKZD 1QLNA 2QTWA 3KLGA 3ITHB 4NXNF 2ROGA 1Z4UA 1FRKA 2QA4G 1GK8A 3V4MA 4O4GA 4ES1A 1Y3KA 2YH1A 4CH1A 2G2YA 2HAIA 1LW2B 2D3O1 1B99A 1T05B 4OX9J 2MKCA 1T9WA 2CUYA 1FD2A 2X1FA 4OI3A 2RRAA 3C46A 1VQ9S 2J7WA 1RAEB 1GXUA 3M1VB 3HVRA 4OX9F 1QAJA 2VG5A 2BJEA 1N6QA 1SJRA 4ELVA 4ALZA 1TKDA 1VIOA 3RB0A 2B6AA 3LGHA 2YWEA 1Y10A 1T3OA 2JEJA 3M8QA 5HVFA 1CJTB 4O44B 4FYXB 4BC9A 3SCIE 3SI8A 3Q0AA 3R1HA 1S9EB 2KT2A 3IRXA 4WPAA 3NGKA 1S1WA 1VJWA 3W62A 3GV8B 2M9KA 2I38A 2WSEC 2VC0A 3RW6A 4M8LA 2E5HA 1O6XA 3V5RA 1BD6A 2CPHA 1M5HA 1S6UA 4FF2A 3K17A 3SQOP 2HHXA 5T14A 3H90A 3SEOA 2E9RX 3HVWA 5F8JA 5BJRA 2IBOA 3R8YA 4B9SA 1TUWA 2WZ1A 3J7YI 1HMVA 3T5KA 1X0FA 4ZVFA 4QQBA 5E3AA 1R0BG 3OLBA 2K7JA 3B4MA 3N0VA 1VQNS 4ILRA 2FLOA 4AQYF 3KLIB 2GVZB 4X84A 2FJWA 5HROB 3TUIC 2Y8YA 4M5JA 1VQOS 2VJUA 3SQGA 3L7PA 1NCLA 1U02A 1HWLA 3MM9A 3QGPA 4DWIA 3D66A 3Q2SC 5GAHI 1XR7A 1QTNB 4N77A 3DRXA 4CLZA 1KKHA 1WI6A 4X4UA 3TW0A 5EN1A 4NYZA 3ENVA 1BQMB 2MPUA 2MXYA 3NNHA 2HFUA 4HDHA 5JMNA 1RA7A 4FKXA 3POTA 2CVEA 4KHRA 3I5BA 5HVGA 3M8SA 3NNAA 2ZNYA 2HFOA 3BS9A 4FXWA 1F5AA 3T41A 4R8UB 4LVNP 5D78A 1NK0A 1OJ4A 3M9NB 3K58A 3DRPB 4RX6A 3LPYA 5DQHA 1WF2A 5LMUJ 1FRJA 4H4OA 2BX6A 2XYHB 5T41A 5LMUF 5D3GB 2VOPA 1EP4A 1Q7LB 4Q8FA 5LL6d 3R9LA 1VR6A 3DI6B 1PKUA 1CVJA 1LFWA 3PDNA 4N8NA 3VALA 1ROFA 4EU0A 4F50A 4YR3A 2HPUA 2HVIA 4TLQA 2MKIA 3G2XA 1GXTA 2PEHA 3IR6B 2ASLA 2KG0A 3T3FA 2GNKA 3W61A 1D3WA 1KTVA 1O8BA 1B0VA 3GYGA 1RT3B 3PW5A 2L9DA 1RXOB 3AD9C 2CDRB 3LALA 2EEYA 2UVUA 3NCQA 5IT0A 3FCHA 1FJGJ 1GH8A 1RHJB 2HNYB 4KKOB 3BF4A 1FE4A 5H9EJ 1FJGF 1ZA1B 2DGQA 1KQFB 2LQ5A 4OI4A 4F3MA 3N6MA 2ZKTA 1WEYA 4DR5F 1YDLA 4CO5A 3D0HE 2EFGA 1WNEA 3MD1A 1R43A 4F2SA 3S01A 2WVDA 2YWGA 3ITHA 5L38A 2A1BA 4WK3A 2V4JA 1WG4A 3IR5B 2YH0A 2QFIA 1S57A 3TO8A 5ETQA 4OYIA 3P4UB 2BJ8A 3KJQB 2EK6A 3EGNA 3PEHA 4LR9A 1JLFB 5AXLA 1FDAA 1UWAA 5HLFA 3M1VA 4Y2CA 2CQHA 3LP1A 3UCUP 4ERDA 3CCUS 1Q8LA 2CJYB 2M2BA 1NSAA 2ZOGA 4O44A 3CIMA 1RUSA 1XERA 2V2KA 2HGLA 1S9EA 4CLLA 3HI9A 2H65B 2RQCA 3MR2A 3L95X 4FXDA 4XIUA 1S97A 2VKZG 3QO9B 2C3MA 1YJNS 1I1GA 1RT5B 3FJ2A 4LFAJ 2W9CB 3P6YC 3EGVA 4ZVTB 2KJVA 3TAPA 1R8AA 3NEKA 3ZZOA 3PV8A 3BR8A 1UETA 3OJSA 4LFAF 4DBQA 2Z30B 2MKKA 2XS7A 5KFZA 2KHCA 2JSXA 1HWJA 4K5SA 1H2TZ 2HRUA 1EIYB 4KH1B 4DV0J 2BANB 1UVIA 4MMOA 1HARA 2ZH6A 4YB5A 3TA2A 3TJ8A 4G1IA 4DV0F 4DV6J 3AJ2A 2C2NA 1H2UX 4FNIA 2AYMA 1XNRJ 4LFCF 1HHSA 5EX0A 1RK8A 2AEFA 2IJNA 4DV6F 1AUSL 2P9CA 1XNRF 4UQTA 5L1KA 1T9YA 3DLKB 1UVJA 2B8PA 3QJPA 1KQGB 3EYZA 3RJMB 2IMOA 1J27A 3QBCA 3OD2A 1UWBA 3BBBA 1EQMA 4JI2J 2CDQA 1RAJA 1IJEB 4CI0B 4X4OA 5CYMB 3H7HB 3CCQS 2XMMA 3DFEA 4JI2F 5H9FK 2K2PA 3C16B 4I56A 4NZ6A 4X65J 3RG6A 4TYAA 4R8UA 4O3QA 4KPYA 3CEDA 1YRUA 2LYVA 3OFFA 5AT1B 1XBWA 2ZVSA 5DM7Q 2EFNA 4X65F 1HD0A 1IKXB 4JI3J 3MZIA 1G4CA 1QVGR 2I8EA 1FWLA 7AT1B 5CQGA 2IM2A 1U1PA 3W5YA 4JOUA 4JI3F 1UPPA 1NEEA 1D8ZA 2RSQA 2CJXB 3C66A 2R4FA 2MB0B 1FDNA 1S59A 3NGSA 3DI6A 4RUHA 4RBUA 5BYQA 4CIOA 5DGBA 2WBRA 4CP5A 1XR6A 1SH3A 4ZVOB 1IN0A 3FCWA 3MM8B 1FEEA 1IQTA 3MMBA 4ED4A 1R0AB 4CNYA 3HHDA 2YNHB 1HBOB 2BJ7A 2FVQA 3MM7A 4ECQA 3Q8SB 3EX7B 1G3OA 1EB0A 3DLEB 1R8HA 1S5ZA 1MSWD 3ADAC 2HRYA 1B64A 2VONA 2FJAB 1H2VZ 4C9DA 5KFXA 4ZJLA 3Q8YA 2GHPA 1W2BR 3IMQJ 4QIEA 5KFCA 2DCLA 1D9AA 5CZXA 4DN9A 3V6JA 4NA3A 1ZYQA 3J80U 4ZCIA 3CMAS 4ILLA 4KV8B 4ZJQA 2WOMB 4NE9C 2QA1A 4NEYA 1TUGB 1MG7A 2R7SA 4QYZK 2ZDPA 1IWAA 1HBNA 3D0GE 3M9MB 2R7QA 3CJTA 2Q1LA 1HQUB 4HHUA 4QYRA 1URNA 4DHVA 4K5RA 4LVOP 3QWUA 1Q86T 1FFGB 1RT2B 2C2MB 4IFYB 1PYOB 5A8WB 4KH0B 5D0EA 1H7XA 4N76A 1S0NA 2E1CA 1UA0A 1WC0A 2CYYA 4C8OA 1TVRA 4OJ3A 2R2UA 1JLFA 2ZH1A 4WCEQ 1GMWA 3CJ2A 1A7GE 4CLTA 3HHKA 1WSVA 5LSOA 3UDVA 2X1GA 1WHVA 1FVSA 2OP5A 2DXEA 2UUAJ 1X4DA 5JJBA 1U7LA 4ZPAA 1T9VA 8AT1B 1JJ2R 3BSCA 3C2PA 1REVB 3IGNA 4K0KJ 3VGSA 3ZTOA 1VBKA 4IFVA 1KVIA 1RWXB 1N34J 2P6SA 3TA1A 4K0KF 3VAGA 3FMBA 3IWLA 3QO9A 4USTA 4HACA 4H54A 1RTHB 3HHLB 2CQCA 1IR2A 4LUBA 4CO3A 3VAHA 3LP2B 3H25A 1OY8A 2ZH7A 1RAGB 4NI2A 4F26A 5JUMA 2W9BA 1CQMA 4UW2A 5F41A 1QVFR 5KFGA 3J7Z5 1RAAB 1X4BA 2OMOA 4RW9A 4NLUA 2HW3A 2OKQA 4Q43A 2N4CA 2G9OA 3KHGA 4RW4A 1SJ4P 3PYDA 2IVFB 4A8FA 3P96A 1TMJA 3LQVA 3ILJA 1VQ6S 3GFYA 1KVKA 3OR2A 4Z37A 3CO0P 1X5OA 4F04B 1L5UA 4NOHA 4QW9A 2DITA 3B8HA 5CAAA 1GNKA 4NLYA 1M1HA 5JVGQ 4C8NA 4ES3A 4QOTA 1PJ7A 2PDAA 3A8KA 1T03B 1HPZA 2BKNA 3OTEA 4CCHA 3KK2B 4NZ0A 3UW1A 1H98A 4RW8A 2XS2A 2CQ2A 1JLQB 4P71A 1EX8A 3QYYA 3W2WA 1Q8IA 3MFIA 1NJXA 4A8MP 4Y00A 3K8WA 3CD0A 4JV2A 2B5JA 4H4KC 4LR8A 2MY8A 1H38A 2A6OA 3DMJB 2XCPA 4EZ9A 2AJQA 1EAYC 5IT9U 3VCDA 1MMDA 1NDCA 5A8RA 2RHQB 2DNMA 1B3TA 3B82A 1N5YB 2PMWA 1Q81T 2WK4A 2KJWA 1BQNA 5HI7A 2QMWA 5KFEA 3GFHA 3ZZPA 3KDOA 4OHWA 4DF4A 3H2UB 2ZHOA 2BJDA 1LWXA 2GVDB 3HJFA 4I6AA 3OR1B 3ZTQA 4RL1A 1RWNB 5DETA 3DRSB 5E33A 3FRYA 2NQPA 2XY7A 3TARA 3K59A 3MM8A 5IXUA 2VG6B 5ETSA 1X4AA 4RNHA 1R0AA 3GG0A 1F5CA 3ETMA 4LF1A 2YNHA 1NJIT 4DR1J 5GMKa 2XO6A 4FF4A 4DR3J 3TUZC 5K5MA 3VTIA 5KG2A 2V6AA 4PXDA 4PQAA 5D0HA 4J9OA 2CQGA 2MLYA 4QJVA 1CJKB 4DR3F 4B02A 2CPJA 4NX9A 2RS8A 1Q82T 2CPZA 5K8MA 2JJ4D 2APOA 5AE1A 2E9ZA 2FJEB 2L9NA 1VJQA 5SZTA 4K2JA 1YQHA 1U1OA 3PW0A 3N6LA 2WOMA 2R3VA 4NRTA 3QT6A 2I1RA 4UOHA 1SVDA 2P2CB 2YWHA 4E98A 1Y5LB 2HWTA 2VA2A 1WSRA 2O01C 6AT1B 3CO9A 2KYXA 4XAKA 1RBAA 3T1YF 1HQUA 3LF0A 4N47A 4K4XA 1KHVA 2MSSA 2F7VA 2ALYB 3AFGA 4P10A 4LSNB 1KTQA 4EYIB 1RT2A 2AHOB 2MY7A 2AP6A 2QV6A 2YPYA 5A8WA 4TY9A 3KKFA 5THWA 4J9UE 3BV8A 1LNQA 3NMAA 3H5YA 3T1HJ 2VPYB 4OX8A 2POKA 4J9SA 2PMZD 3THVA 2CPEA 4IG3B 4ZHRA 1R89A 1FJEB 3T1HF 3HDSA 4DQIA 3QPIA 3HXMA 5EWGA 2R7XA 2XHCA 4MH8A 3MUMP 3D0IE 1FF2A 3N6NA 3RRGA 1LKZA 2DRAA 2IVYA 2K3IA 1UJ6A 1S6PB 3MPVA 2P8IA 1QE1A 3OL6A 1UPMB 4Q2MA 1D1UA 2BRLA 4Z7CA 4A47A 3FZBA 1RTHA 3IFEA 3MCNA 2E5GA 1YJUA 4GRSA 2ZBPA 4U7UK 1HQEA 3HT3A 1NH8A 1X4EA 4F0HA 1E6YA 1LWEA 2C2DA 3L3CA 2QSWA 2DHGA 1YITS 4RNOA 2QMUB 3NBPB 2QFJA 2OFHX 1WHWA 2LXUA 2JOQA 3NS5A 2OPQA 4FPIA 4ENOA 1L3TA 4A8WA 2XNQA 4OZJA 2VL1A 2GIFA 1Y5IB 4S0MA 1T02A 3I56S 3HT0A 4OZ5A 2AJFE 3M2RB 2MKYA 4LF6J 4C0HA 4U8YA 1VBYA 2I5JB 3LAKA 2RB7A 4FXVA 4DSLA 3HVTB 1CLFA 2ZDOA 3CGIA 1BHNA 3CCSS 4LF6F 3WC0A 1FO1A 4BHQA 1T03A 5FJ4A 2WONB 3KK2A 3OTCA 5HQMA 1TFWA 4LIRA 4ETZA 2HHWA 3G6XA 4TU8A 4WF9Q 1J5EF 1S4EA 2QLFB 2XSJB 1RT1A 1IWGA 2F9JA 2RDIA 1RBLA 2RQ4A 2VBWA 5CYJA 3RBEA 2MKSA 1ZM3A 3TUPA 1HI8A 2F8EX 5KG6A 5KG3A 2GVDA 1TUVA 2MQOA 2Q43A 4HTIA 2HNDA 2D1CA 5C42B 1WEZA 2A2DA 1UVNA 1OY6A 2GW8A 1T9TA 2CQ3A 2NCKL 3K8VA 4C8KA 4MKBA 2GMLA 4IRDA 5H9FJ 2PMHA 3QT5A 1VBZA 2M7SA 4C3MA 2MQMA 5B0DA 3I55S 2YKPA 2VG6A 1KSPA 5A0YB 2OD4A 2EKNA 2JX2A 5KT4A 3V6KA 1YRXA 3U1NA 4BBYA 3E2EA 4HHJA 3I87A 1O51A 1P6TA 1HYSB 2H4YB 4A8OA 2Y1LB 3OTDA 1FT8A 1LWFB 2Q66A 1VLYA 3CB4A 2Y1RI 3G87A 5I3PA 3GZ7A 3CDBA 1NSPA 1S9GA 2XG8A 1MN7A 2IC3B 1WKJA 2BE7D 4ZDNA 1FI4A 2C2RA 2JRSA 4AL7A 3FKBA 4U9RA 4CQ1A 4KFBA 3MEDB 1RCOB 3H5SA 3I0SB 2ZBQA 2BM1A 1Y11A 1SI9A 2KRRA 1AZSB 4AYBD 5KFIA 1HWIA 2FJBB 3EJMA 4RLEA 2JHEA 3CCVS 3D54A 2JFDA 1TMMA 1DHMA 3L09A 4UQGA 1RYRA 1FKPB 4PPZA 4NASA 3QSIA 2WVEA 1C0TB 3QFWA 4J9VA 2GQ2A 1SL0A 2AW0A 5HBMA 5T7LB 3LTOA 9ATCB 2EFQA 4MK9A 2ZE2B 4TN2A 2DNRA 2OELA 2WSFC 1Z1ZA 3EGWB 1MNEA 3GCWP 1N4LA 3KHRA 4ZP9A 4HLBA 2OO4A 1SV5B 4ZPBA 2HS3A 4M5MA 1A6LA 3BH6B 2HAFA 4M5KA 3G8SA 4Y3CA 3EMTA 1S6PA 1V3SA 1XQIA 4RW7A 1HWUA 3KUGA 4F4AA 2I6WA 1HWKA 3OPKA 1IBKJ 1T9UA 5DDRC 3C8YA 2DPIA 4HEA9 3NGDA 3ISZA 3IA0A 3QAEA 2F3JA 1RTIB 4F0KA 1IBKF 4RZRA 3KMQA 2AGPA 3FEZA 4QIVA 2B4UA 5KFRA 4DR4J 3PG9A 4Q2LA 2E66A 3DYAA 4ECYA 4TQRA 2GFFA 2E7VA 2VQEJ 3R2CJ 2NXNA 3HF5A 4DR4F 3PJWA 5E7OB 1NK7A 1GMWD 4NZ7A 1FD8A 1Y9OA 2HHQA 3CJ4A 2F8MA 1C1BA 2VQEF 2NZCA 1KLMA 5B7WA 1AUDA 3DM2B 2VFVA 2J6SA 4YUDA 4A48A 1VC5A 5A6WA 3H20A 4W92B 1F9FA 4OYXA 1SQFA 3TZYA 4ZOSA 1M5PC 1NDKA 4NCGB 4ECSA 3D68A 1G1XA 1VRUA 1GXLA 2I5JA 3HVTA 4Q7AA 1U1MA 3U7JA 2OEJA 1W2IA 2FDNA 1V6HA 4NCAA 3HK2A 3OFHA 1U6BA 4ZN1A 2WONA 1Y7PA 2WRMA 1WWHA 3PRBA 4KQZA 1HNZJ 1O0PA 2ACYA 4X4QA 2CKWA 1UFLA 2RH3A 1IBLJ 4ZS6A 4B9NA 1HNZF 3LOUA 5IT4A 3BDPA 1VQPS 2F4VJ 3HHEA 4WIQA 3D6TB 1U1NA 1C2PA 4KHMA 4IOAQ 4ZVGA 3H40A 2F4VF 3MWBA 2EPIA 1XEZA 4DEZA 1NU4A 4Q8EA 1S4FA 2XLIA 2GCFA 1L3VA 2HQIA 1NM2A 3Q24A 4ECXA 2KVQE 3TWZA 3UN5A 2WBMA 1JLCA 3IM8A 2GX8A 5C42A 3GG1A 3GP9A 1FXLA 4ECRA 2O1PA 1LW0A 2CQBA 2EFPA 2C3OA 5CYQB 5A0YA 4KB7A 2BW2A 4DZDA 2EC0A 3CVKA 3ZXWA 3W60A 1TK8A 2E29A 1Q7YT 5J1NA 4IG0A 2OLWA 4ZVUB 3N9UC 1ZAXA 1ZH5A 1YBUA 2L9WA 2A0FB 2ZVIA 2CADA 4PAAA 3Q83A 1NKBA 3JSYA 3A3OB 4NLTA 3BREA 2QLXA 1TL5A 4WP9A 2V2VA 3X1LB 3LWMA 2XI3A 1U24A 3KDNA 2IC3A 2HS4A 1NZ8A 2OPRB 5CABA 2LEAA 4NWBA 5C24B 2XZWA 3ZC4A 3JSMA 3UWTA 1RTZA 2DGWA 5LSRA 2UUTA 4EFAC 3UR3C 1OWXA 5DS7A 4GVLA 2RU3A 1VYAA 1U4BA 2HMIA 2ILZA 2XGQA 3I0SA 4J37A 1BXNA 3MI7X 2KYZA 3MAAA 3MMCB 2VBYA 3PVXA 1RLDA 3SDEB 5CHCB 2HURA 3CJ8A 5KT2A 2DY1A 1RKIA 3K5PA 5CD4H 1QSSA 2ZH4A 2RKIA 2B43A 1MU2A 2V34A 3DDNA 3AY0A 1JNRB 4PG5A 1YTYA 3KNAA 2BUNA 3BQ0A 4NEZA 5KFSA 1JJHA 2ILYA 3G8QA 1MW7A 4A8KA 4Y0FA 2MHEA 2V9WA 1SV5A 1ZZFA 1M1KT 2D3OR 5B0BA 2QO3A 2R7UA 4RBVA 1YBTA 2DJWA 4NPOA 2BEFA 2HQGA 4BLGA 1JLGB 3OT9A 2ZH2A 3SMZA 1AFIA 1CPZA 2IM1A 1U6FA 3M30B 3HFVA 4Z2XA 2Z2MA 4NLGA 3CCTA 4G3IA 1QM9A 1XMQJ 1BWEA 3MM5B 4B9VA 3MECB 2XC9A 5ETLA 2ATLA 5D0RA 2BE9B 3AA8A 1FWKA 4ZP6A 4C97A 3OVBA 1B0PA 5B08A 1S9FA 3BPSP 1XMQF 3D6MB 3IM9A 4H4MA 1MWYA 3RW7A 3LW5C 4C98A 1SL1A 3MMAB 1HBMB 4U7UD 3R3TA 3W9JA 4CLKA 4F4ZA 3EXYA 4NLXA 2I2YA 5KFBA 3I5CA 4R5PA 3VQTA 3RBXA 4NLOA 5IWAJ 2G4BA 2FD2A 1HA1A 4DCOB 4IOBA 5KG1A 1ZM9A 4Q5VA 5IWAF 4C11B 3PKMA 3NL0A 1PAEX 2W4DA 4ZLNA 3HHLD 4HR2A 4I2PA 1SH2A 3CC4S 2B4VA 4Y6IA 4CYUB 1R3NA 5J2QA 2F4FA 3NWGA 3H5UA 3IO1A 4WKRA 3D28A 3RBZA 4HL9A 1FCAA 1QD1A 2L3MA 3Q8VA 5KT6A 4RW6A 3R27A 1CC7A 2CNLB 4M94A 3CDEA 4YY3F 3WHIA 3PACA 5HK4A 2W01A 2OPPB 1MROB 2GS8A 2HQDA 4MFBB 1VC0A 3QMQA 3O6QA 3M6WA 5C2CA 4CT9A 4JUZA 1REGX 2G1DA 3F44A 3K5MA 4ECVA 2R42A 4GVBB 1SL2A 3LO3A 3QIPA 2ZEJA 4PPDA 2HGNA 3W5XA 2D69A 3W66A 2HBYB 1P1LA 3HCXA 3AOAA 3M9OB 3LP0A 2GIQA 5F0WA 5D4NA 4ZCMA 3P3DA 2M0GB 2RQMA 2XB2D 3GQCA 2AEJA 1HNWJ 1JNZB 3A3NB 3CWJA 1UKUA 2NR0A 2GQCA 3NCPA 5J2PB 3AOBA 2FHMA 1I94J 3OSPA 4FBUA 3TAQA 2X1AA 1N48A 4ED7A 1PC5A 3UE2A 3JB9k 1I94F 2RHSB 3BSOA 3NGUA 3M05A 3G6VA 3US5A 3BQ2A 2HHUA 4K4VA 3BGFA 4GMKA 3I96A 2VQFJ 4LSZB 4ZVEA 2OPRA 2JEGA 5IFMA 5IM0A 1HIYA 1D9DA 1KFDA 3KG4A 1FKOA 1PSDA 2X51A 2VQFF 4HI2A 2BZ2A 2CPIA 4O0IA 4DFKA 4OV1A 4MIAA 3DXSX 4LT6A 1IKWA 4PABA 3QLHA 1OO0B 3C14A 4M5GA 3R1LA 4ED3A 4IDKA 3OW2R 5DDQC 1YG0A 4ZP7A 3SCLE 3C6TB 2NS1B 2RT3A 5FDLB 5L8RC 3ZTPA 3MM6B 4RPFA 3MMCA 5KFYA 2QL5B 2XM3A 2CFXA 1NB7A 5L1JA 4TVAB 1JJ4A 3SDEA 4J9PA 1ZS6A 2JLFA 3IGVA 3PW4A 4P73A 2FQQB 3K2YA 1T9XA 3JSBA 1BWVA 2GIRA 5KT5A 3HPOA 1NBEB 1HI0P 3NRBA 2LP4A 1Q79A 2DRDA 3J80Y 2BKPA 1V9OA 4OZ2A 4I2QA 3HZGA 1FWPA 3MURP 4R0JA 4I7FB 4B3MJ 1C4AA 5J1EA 1Y5NB 3CD5A 2DNPA 3CNQP 5DRKA 3BGRB 1RHQB 2RMLA 3ET6B 5KFPA 4AXJA 2MQQA 2OSRA 1EETB 2IDEA 4TY8B 4B3MF 4USIA 5KFLA 3ZNJ1 1FK9A 4ZKAA 1U45A 2R8JA 3NG8A 4WZMA 1HW8A 2DR8A 3K89A 1FDDA 3BM7A 5HQLA 4TU7A 3TZZA 1FXDA 4ZIVA 2KKHA 3SIPB 3RRKA 1CEZA 3CMES 4C4WA 2FLLA 3N5FA 2PIIA 2N3OA 1IBCB 1TKZA 1TR0A 5CH7B 3RUBL 1S48A 2ZHBA 1X8DA 1YJTA 5DDPC 2BR0A 2EFVA 2Z56B 2JNJA 2RRBA 2R7RA 2V8PA 2MZTA 4LMZA 1F0XA 2DGSA 5KFWA 2EWHA 4OYBA 4USHA 1SBRA 2B51A 1OS5A 3I0RB 3Q8QB 4IQMA 1UJ4A 4HVZA 2VA3A 2WW4A 3BH7B 3I4HX 3MR6A 3AD7C 5D6GA 1QSLA 4OJ1A 2YX1A 2Y9HA 1P8GA 3BPDA 3D3CJ 3IWNC 2YKNB 1RDRA 4F67A 2VIHA 1D0EA 2B4PA 4C7QA 2DR7A 2K7KA 1TL1B 3MEEA 2DR9A 5E5NA 2UUBJ 2N82B 4K2XA 2PFFB 4LF5J 3WDOA 1TV6A 2PO4A 3TVYA 3I31A 3K5LA 2UUBF 3GYXB 2JC0A 5F8GA 3R5AA 3G8TA 1SIZA 4LF5F 4LF9J 3UQSA 3LH2S 5GAGU 3QZ8A 4ED6A 4UZCA 3G6YA 3I32A 2O66A 4NYOA 3UPFA 1JMTA 4LF9F 1WF0A 4YB7A 2OGUA 2MJUA 1RAIB 2GQQA 5K8PA 1MROA 2DHHA 4MFBA 4XPCA 4DCPB 1S12A 3QWPA 3H8YA 1FJ7A 4J9MA 4FVMA 2HKEA 1SUQB 4KIAA 2DBBA 1ZAVA 3D6HB 4DI6A 2GHWA 3KLFA 2M4MA 4FN5A 2W8LA 2VDIA 3ICLA 1KP6A 1XNQJ 3S7RA 1F2GA 3MPUB 2WW8A 2IAJB 5KFAA 3TZWA 4UY85 4B9TA 3M2UA 4FS2A 1FE0A 4WP3A 1XNQF 3M6UA 2KG1A 3TZXA 3KOAA 4FP9A 1S7HA 1VRTA 5DG8A 5IT9Y 3GWCA 4U6PA 2G1HA 2J6TA 2V4RA 4L73A 2MLXA 3D6FB 4BCAA 4HYKA 4L3NA 4PWDB 5K14A 4I4BA 2EK1A 1UVMA 2C3YA 4RR5A 4OJHA 2EKYA 3ULHA 3ZO7A 1CG2A 4CLPA 2ALZA 4DDFA 1FESA 3O2IA 2ZZTA 2HNZA 1YLXA 2NXUA 5KFJA 5ADZA 3M8RA 2H5JB 3BZQA 5LJ3Y 3ONQA 2BM0A 4DV7J 2BQ3A 4DX8H 2C2OB 1X31C 2MDAA 3PYEA 3TAMB 1N54B 1K47A 1FERA 3R5DA 2E7XA 4JI5J 3GR0A 3CPWR 4DV7F 4I6WA 3MDFA 5GAEU 1OYDA 2D3ZA 3M2VB 3KJNB 4OL8A 2ZD1B 2YX7A 4JBCA 3FMWA 4DV4J 4PQUB 4JI5F 2NZ4A 5AE2A 3OFGA 2J8SA 4DJBA 3R5JB 2ADCA 3A12A 2G2ZA 3L7UA 3DOMB 1DTQA 3KJVB 4DV4F 2HHHJ 2AJ4A 2X7IA 3UDCA 1Y00A 1P9QC 5F8MA 4QU6A 3CJSA 3UNYA 3ZTSA 2W2PP 3CJ5A 1FRMA 4J9QA 3C6UB 4NMXA 1J2VA 1JLAA 4DSIA 4QU7A 2HHHF 3I6PA 2AJ1A 2FZCB 3P5TL 3IWXA 3W2VA 2OFGX 1S0OA 4HHHA 2LA4A 4LF4J 2ZWPA 2NUUG 2AJ2A 3NOGA 4LREA 2BOAA 2ZHAA 1C1CA 4LF4F 1ZBTA 3UD4P 1N88A 2MLZA 1K1SA 2LDIA 1WDTA 3BGRA 4O3OA 4TY8A 4ECZA 4MKYA 1RTJA 3OUYB 3H4BA 4URSA 3V4IB 3AHPA 5BYSA 3IBCB 2AEMA 3CD6S 3T9NA 3GLJA 3L7OA 3V6DB 5E3PA 3TQEA 2V50A 3CMQA 2FPHX 5HMXA 3PW2A 4MIBA 2D3UA 2DHSA 1N5QA 2SXLA 1RI7A 3JTNA 2YNGB 1XWLA 4ZN3A 2KT3A 2UXCJ 4EBCA 5LT5A 2PA8D 3N79A 3D5MA 2CJBA 3ZZRA 1J5OA 2YKMA 2UXCF 4BC7A 4OLPA 3KK1A 2HSEB 1S6QA 1KNZA 1RYSA 4JI8J 2YKNA 1JKHA 5D15A 5GMEA 3I5AA 3E01A 4B3SJ 2NPFA 3LPEA 4KGMA 4Y28C 1TL1A 3SZ2A 4K4UA 1RQ0A 2W2NP 4JI8F 4B3SF 4OZNA 4AFFA 1SC6A 3G86A 4USUA 1RT6A 5I3UB 3AODA 4JV1A 3GJQB 1IKYB 1RCXB 5E2QA 1QAXA 3EVOA 3NOCA 2D74B 5IV3A 1UL3A 4OQJA 4PG7A 4LF8F 5L1LA 1JIHA 3B4DA 1R7IA 4DUTA 2VD3A 3QSYB 4M95A 3AT1B 3CJQA 3J81U 2XYPB 3ZTRA 5EUHA 2WVFA 1JLBB 1SC4B 3FSIA 4PRFA 2UU9J 3H2VE 2QMXA 3TP2A 3SBMA 4OI1A 1HW9A 1XTZA 2RF2B 4WFNQ 2UU9F 1UVLA 2LQ9A 5ETTA 1CC8A 4TLRA 4KRWA 1RWOB 2WTFA 4K50A 1U0HB 4AQYJ 2MQPA 2VODA 5A2QU 1N5VA 3DHXA 1AFJA 2XBPA 4EWTA 5E3RA 4N41A 2J7UA 3GIMA 3K57A 1B0TA 3ELHA 1KVJA 5ETNA 1NK5A 4PUOA 3CJKB 3VGUA 2YNFB 4DCJB 1NDLA 3VQSA 2BYCA 2DD8S 2KL8A 2QL7B 2FUG9 2E1AA 2BVZA 1TL3B 2DGTA 4LRBA 1YX2A 3PYGA 1G7CB 1F5BA 1HNIB 2LEPA 4ES2A 1RSCA 4DL3A 3FZ2A 2K1RB 2V94A 2UZAA 4F8RA 4DV3J 4DL6A 4I64A 5FLXU 1F9HA 2KDOA 4ECTA 2DB1A 3SYZA 3J7ZT 4ZJOA 1B7FA 2HG4A 4ZP8A 4O3RA 2GGPB
chains in the Genus database with same CATH topology
1LV5A 1PO6A 3TVZA 4LIRA 3MFHA 2PD1A 3MPYA 4DR6F 5HMYA 3CDAA 1W25A 5G0RA 3MEKA 4ETZA 1VFJA 4NLRA 3MEDA 4DV3F 1RTDA 2HHWA 2B6AB 2ZH5A 1S10A 2L41A 4UY8T 2KI2A 4B17A 4PXEA 3G6XA 3TAMA 4CZCA 4R25A 4EO6A 4TU8A 4WF9Q 2K8GA 2DK2A 4ZHRB 1OPIA 1RT6B 3DLJA 2FB0A 4U67Q 3CCMS 1VC6A 1J5EF 4RKUC 4DL7A 3VZHA 2MZJA 3RYLA 4ID5A 4OZ0A 3CCJS 4ECUA 4DN0A 1N5TA 1VK3A 4DS4A 4O23A 2VH7A 3AAWB 4ZPCA 4ZCKA 1BQXA 3NLCA 2XSJB 2ZD1A 3KLHB 4UOCA 1GX6A 1RT1A 2OTLS 2RRNA 5J2NB 3SFGA 4A46A 4PQUA 2F9JA 1QUVA 4QIFA 3PO4A 3V6HA 2RDIA 4DQRA 1FKPA 1G6BA 1VOMA 2X1BA 2E1RA 3OXFA 3QGHA 2RQ4A 2NSBA 2UUAF 4CTAA 1I6JA 2VBWA 1HI1A 1C0TA 3AH6A 3GB0A 3THTA 4WYWA 5CYJA 4HKQA 3RBEA 1WI8A 3KJVA 3DU6A 1SJQA 2MKSA 3FQKA 1ZM3A 3DC2A 2DGUA 2JDJA 3KG1A 5BYRA 2LXFA 1HI8A 2N7CA 3G9CA 4D3HA 5KG4A 2F8EX 5T7LA 3O1LA 3GILA 3PX6A 5KG6A 2VOOA 4B9MA 1IXKA 1QE1B 5KG3A 3O5TB 4L6V3 2KZMA 1TUVA 2ZE2A 1VQ8S 2R7VA 1N34F 3GFZA 2MQOA 2Q43A 4HTIA 5DO2A 2BABA 5E41A 1QUPA 2HNDA 2D1CA 1GTHA 5C42B 1WEZA 2MMYA 2A2DA 1UVNA 2PE8A 2KTQA 2ROEA 4ECWA 2GW8A 3K8VA 2CQ3A 2W8KA 2QA2A 1OIAA 3CCWA 2GMLA 3FFIB 4MKBA 4C8KA 2QEXS 4IRDA 4Q0BB 1S49A 5H9FJ 4X4SA 2PMHA 2ZOFA 4WFXA 1VBZA 4DPOA 2V8DA 3G6ES 1HQEB 3MGJA 2M7SA 3DLBA 4C3MA 4DL4A 2B4OA 3BR9A 2MQMA 5B0DA 3I55S 1K8AT 2YKPA 2VG6A 1TAUA 2UP1A 1KQKA 2Q79A 2V0NA 3TOQA 1KSPA 1R31A 1E6YB 2MJNA 4ZA1A 2OD4A 5A0YB 1LWEB 2ASJA 4M5DB 1X5SA 2JX2A 2ZKUA 5KT4A 3V6KA 4E0DA 1YRXA 1LK5A 3NKYA 3U1NA 2ZH9A 3T1AA 3C3LA 1K0TA 4BBYA 4MYUA 3E2EA 3BGLA 5I42B 4HHJA 7FD1A 2OPQB 3CD7A 3CUNA 5DG7A 2UV8G 3I87A 1ZPWX 1O51A 1P6TA 2DNKA 2AWZA 5LJ5Y 1HYSB 2KT5A 1KOHA 3TVKA 2GJ2A 3PR5B 3TRGA 4CO2A 3LGMA 2KXNB 4PUOB 3IG1B 4JV5F 4RNMA 1RTIA 1HNVA 3CCZA 2BDPA 3MXHP 3BDEA 4XDCA 4A8OA 5C25A 4EBDA 3OTDA 1FT8A 1LWFB 1TKXA 2KU7A 4F3OA 2C3PA 3PFEA 2Q3PA 5KFOA 2Q66A 3CSKA 1VLYA 2QZ8A 3HLUA 2C42A 1QY7A 1C4CA 4P7VA 2GMHA 1MWZA 3CB4A 2A18A 5SUHA 3SXLA 2AGQA 4OLOA 5L9NA 2Y1RI 2MZSA 5I3PA 2HHVA 3CDWA 2VBXA 3GZ7A 1HBUA 3PRDA 4DMZA 2GMJA 3CDBA 4IR9A 1H3DA 4WE1A 2OPSA 3DRRA 5DQIA 4IKAA 4DUZF 3M8PB 2DIUA 3RBDA 1S9GA 6FDRA 2XG8A 5HP1A 1JXEA 4ZK7M 3V6DA 2IC3B 4ZDNA 3E8OA 4MYTA 1LK7A 2C2RA 2AD9A 2AYEA 2B3TB 1FXRA 4WFAQ 1KC8T 5LSLA 5B0EA 2JRSA 4NLSA 3DM2A 2AGOA 4DG1B 3PXGa 2YX4A 2JVRA 1WTBA 4AL7A 3QJLA 3D1OA 2GC8A 2CQ1A 2VKRA 1DLOA 3V81B 3DNCA 4QW8A 3IS9A 5KG0A 5HL7Q 4U9RA 4CQ1A 5G0RB 3LAMA 2DNHA 4IH7A 2ZC3A 3MEDB 3IAM9 3HKWA 3NCRA 4KFBA 1VQYA 1YIJS 1RTDB 1SKWA 3ZZUA 4K4TA 1LW2A 3H5SA 1FEHA 3I0SB 3T6JA 1U48A 4RWXA 5K8OA 2EI5A 1VIXA 2BM1A 2FJXA 1T05A 3S6EA 3MF5A 4IOCQ 4KTQA 1SI9A 2VFSA 4HTJA 2KRRA 4AYBD 5KFIA 1HWIA 2FJBB 4NLDA 2KFYA 1ZM2A 4RLEA 5KFVA 2UVRA 2JHEA 3CCVS 4ZP8A 1N8RT 4ELUA 4AL5A 4LF7F 1T94A 3D54A 5MAOA 1VQKS 2B7BB 4J9KA 2JFDA 1KN6A 1RT1B 1DHMA 3FNNA 3L09A 4WKYA 2AX0A 1OPZA 4UQGA 5DGAA 3E3XA 1RYRA 1ZAWA 4B9LA 1FKPB 4PPZA 2UXBF 2XEXA 1S0MA 2VASA 1VGYA 4CTAB 2I0XA 2KFNA 2IM0A 1C0TB 3OL7A 4IO1A 3GFXA 2W4PA 2GQ2A 1XK8A 1SL0A 1N5SA 5CXTA 2AW0A 2XMVA 2FLPA 2OMLA 5KT3A 5HO4A 4P7TA 3IAS9 3MHYA 1X4GA 2EW9A 5HBMA 1XC9A 1U6ZA 5T7LB 4YHHF 1IKYA 2EFQA 4MK9A 2ZE2B 2JLEA 2ZNZA 4TN2A 2DNRA 2WSFC 1Z1ZA 2IYGA 4N8OA 4ED8A 2HLTA 5M2UA 3X3UA 2HNDB 1ZPVA 4PG8A 3EGWB 1MNEA 3DLGB 3IN5A 2QIFA 1N4LA 3KHRA 1P27B 2NYIA 4ZP9A 2CG4A 3HFKA 1OSDA 4HLBA 2OO4A 3EPGA 5HQ8A 5KFMA 4QIWD 2DCUB 1FKAF 1L3KA 1SV5B 4ZPBA 1SKRA 2EG2A 4ED1A 2HS3A 3KTQA 4W90B 2ZC4A 1NJWA 2Z2LA 1HD1A 1A6LA 3DOLB 3KK3A 3QGIA 2CQ4A 4B3TF 4ZMMA 3J7YU 4QWBA 4EYHB 3G8SA 3OTBA 2IBKA 4Y3CA 3DHWC 4LSLA 5F8HA 1S6PA 4NXMF 1V3SA 4RW7A 4I67A 2DNZA 3HHNB 1HWUA 4QR2A 1FRXA 2R7WA 3SSQA 1HWKA 3OPKA 3VZIA 1U47A 1WG1A 3GSDA 2Y1IA 5DDRC 3C8YA 2LKZA 2M3DA 4C2MA 1QSYA 2HHSA 3IR7B 2M5YA 5D4PA 4DV1F 1NK9A 2DPIA 3LGNA 2O5DA 4HEA9 1LWCB 3NGDA 2RDJA 3ISZA 3IA0A 3O8WA 3IRWP 3QAEA 2F3JA 1RTIB 1HNVB 2RF2A 4OMFG 4F25A 4AL6A 3T5HA 4WZQA 2AYGA 4TU9A 1IBKF 4KO0A 4RZRA 1SJ3P 1M5VC 3KMQA 4DR1F 2AGPA 5C25B 3FEZA 4QIVA 2B4UA 2FTRA 2DGOA 5KFRA 1TKXB 1C0UA 4DR7F 4Q2LA 2E66A 5CYQA 3DYAA 3F41A 2J6UA 4WU2A 4ECYA 3CULA 2BE2B 2CRLA 4TQRA 4FF1A 2D7SA 1T8EA 4FS1A 1N52B 3TANA 2GFFA 2AQ4A 2LEBA 5GAHU 4Y34A 1APSA 3AA9A 2QA4S 3MAHA 4DR4F 3HF5A 2LQBA 3PJWA 4KBIA 5GVQA 5E7OB 2CZVC 2R2SA 1NK7A 1NZAA 1HBUB 3HMJG 4NZ7A 1FD8A 2JH3A 2OPSB 1Y9OA 2DNOA 2HHQA 3KLIA 1JLEA 1S99A 4PG4A 3GIKA 1S9GB 4TKTA 3CJ4A 5HP1B 1M5OC 2F8MA 4YB1P 5HROA 1C1BA 4NYPA 5F9NA 1Y0HA 2VQEF 2P5VA 1KD1T 2CQIA 1KLMA 4XDDA 1PC4A 1X5PA 2COLA 3CJKA 2JL9A 2MZRA 2YNFA 1BGXT 1X7VA 3HKZD 4PCQA 5B7WA 1X9MA 3KHLA 1QLNA 5A8KB 1AUDA 1X0PA 3NAIA 3TR5A 3DM2B 2VFVA 2J6SA 3KLGA 3ITHB 4NXNF 2WHOA 2ROGA 4YUDA 4A48A 4NA2A 1Z4UA 2KM8B 1FRKA 2HQ3A 4NRUA 2QA4G 1VC5A 1UAWA 3V4MA 5A6WA 1TL3A 3H20A