2YH0A

Solution structure of the closed conformation of human u2af65 tandem rrm1 and rrm2 domains
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
195
structure length
195
Chain Sequence
b'ARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSENPSVYVPGVVSTVVPDSAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRASVGAKNA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SPLICING FACTOR U2AF 65 KDA SUBUNIT
publication title Multi-Domain Conformational Selection Underlies Pre-Mrna Splicing Regulation by U2Af
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 40
structure length 195
sequence length 195
ec nomenclature
pdb deposition date 2011-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2yh0A01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2yh0A02
2MQOA 1Q82T 1A7GE 1YWXA 3DXBA 2MPUA 2M9KA 1WEXA 2DH9A 3UE2A 1RKJA 1JJ4A 4CQ1A 1H2VZ 2AYGA 5DETA 2DO4A 2AYMA 2CJKA 3L3CA 2KRRA 3VAFA 5DM7Q 5FJ4A 3P5TL 1M90T 1M1KT 2DISA 2V94A 4W90B 3MI7X 4F02A 1M5VC 3MOJB 3RW6A 2OTJS 3FEXB 3Q2SC 3G4SS 3VAIA 3R1LA 5GAGU 2OSRA 1VQ6S 2OIHA 5D78A 1HL6A 3EGNA 2X1BA 2MQLA 1VQMS 1U1MA 1VQNS 3MURP 4CH0S 2CQ4A 2DGUA 1WHXA 4YB1P 3Q2TC 3PIPQ 1FT8A 5LXYA 2MB0B 1WEYA 2RQCA 2DNYA 1WHYA 2J0SD 2MJUA 2D3OR 2MQNA 2KYXA 3I55S 2M88A 2L41A 2WBRA 4EGLA 3DLLQ 3CCSS 3HHNB 2KHCA 3CCRS 1X4DA 1UW4A 1SXLA 2M0GB 3RW7A 2KU7A 3H2UB 1W2BR 1KOOA 2HGMA 3CCES 1SJ3P 1U2FA 3UCGA 2M70A 3S7RA 2MZJA 1X4BA 4OZ0A 2XSFA 3CXCR 2FY1A 2DGOA 4QU6A 2YKAA 3US5A 1VBZA 2RQ4A 3H2VE 3R1HA 4C4WA 2LA6A 1WTBA 1KQSR 3SDEA 2MY8A 2G1DA 2KM8B 1ZZFA 2HVZA 2RRBA 2CPFA 2DNOA 1U1NA 2AD9A 1WI6A 2PEHA 1H2TZ 2MQPA 2CQ3A 4LJMA 2O3DA 2Q79A 2VOPA 1ZH5A 1VQ5S 2K3KA 4UY8T 1U1PA 2XNRA 4IOAQ 2DIVA 3CCVS 5BJRA 3SMZA 2MZRA 2DIUA 2EK1A 2M4MA 2LEAA 3FEYB 4QU7A 4UQTA 2N7CA 1M5OC 1IQTA 1QM9A 5GMKa 2LYVA 2DGQA 2RU3A 2AYEA 2MMYA 3P6YC 2NLWA 1VBXA 1WF2A 5CA5A 1FJEB 2K8GA 1HD0A 2D9OA 3G8SA 2B0GA 2RS8A 2DGSA 2SXLA 5HO4A 2KG0A 2CPHA 1P1TA 3S01A 3LQVA 1U6BA 5LXRA 3BO2A 3UD3P 1VQ7S 1F9FA 1KC8T 3THTA 2PE8A 2N82B 2JVOA 3NNAA 4ERDA 2CQBA 2DNKA 2DGWA 2JVRA 5MLCV 2OJ3A 1URNA 3TP2A 2MXYA 3UD4P 3ZZYA 2CQGA 1YITS 1XN9A 1N52B 5CYJA 3G96A 3MD3A 2FHOB 2MQQA 3MXHP 2XS7A 2CPXA 2ADCA 1U1OA 1YJNS 2RVJA 1X4FA 1X5PA 2LECA 1WHVA 3B4DA 1WG1A 2MQMA 1OIAA 2CQCA 2HYIB 1OPIA 2KVIA 5DDOC 3NNHA 2QEXS 2MZQA 2MY7A 2KXFA 1HA1A 1WELA 2G0CA 4FXVA 2XS2A 1VC0A 1VQLS 3CC4S 3MDFA 4TU7A 4F25A 1UP1A 5IM0B 3SXLA 2OTLS 1N8RT 3VAJA 1SJFA 1U1RA 4IO9Q 2LXUA 2HGLA 1WHWA 3NNCA 3CCQS 2EK6A 2CPDA 2CPIA 2RUGA 2HGNA 1SJRA 2KI2A 3BO3A 4IOCQ 2RT3A 5LJ3Y 3K0JA 3J7ZT 4Z2XA 4M5DB 1FNXH 2CQ0A 3TYTA 3VAGA 2CQIA 2DGTA 2M8DB 2AYBA 3MUMP 4C0OC 1X4GA 4Y00A 1VC6A 2DNPA 3UCUP 2LMIA 3G6ES 2VONA 2VODA 3PIOQ 3N9UC 4W92B 3CCUS 2E5JA 1UAWA 2X1FA 4QQBA 3CF5Q 3I56S 2MKSA 2ZJPQ 2YWKA 2X1AA 1K8AT 2DHAA 2L9WA 4J5OA 3G71S 5DDPC 2U1AA 2CPZA 2MKIA 3VALA 4QPTA 4OZ1A 3CC7S 3JB9k 3CUNA 4LMZA 1VQ9S 2YH0A 3BO4A 2KH9A 2GO9A 1HD1A 1FO1A 4PKDB 2D9PA 5IQQA 1U1LA 4ED5A 4RU2A 2E44A 3CCJS 3ULHA 1H6KX 2DH7A 2FC8A 2DNRA 2KG1A 3CCMS 2U2FA 1VC5A 1KD1T 3VAMA 1D8ZA 1Q81T 3CD6S 1L3KA 1WF1A 1A9NB 2HZCA 4V19X 2UP1A 1X5TA 2XB2D 1YJWS 4WFNQ 3SDEB 4F26A 1X5OA 1R8PA 1K9MT 3HI9A 4LIRA 1YHQS 1FJ7A 2M7SA 1VBYA 2DHXA 2LA4A 2OSQA 4WFBQ 5GVQA 2G4BA 2CQ2A 1VQOS 4ZKAA 1BY9A 2BZ2A 3TO8A 3G8TA 2GHPA 2M2BA 5GAEU 2DNLA 5DM6Q 2CPJA 2KXHA 1X4CA 2MGZB 2KT5A 1S79A 3CC2S 3S8SA 2CQDA 5JVHQ 4PRFA 5GAHU 2ZJRQ 3NS5A 1X0FA 5IM0A 3CMAS 1DBDA 4FXWA 1FJCA 5DDRC 4BS2A 1U1QA 2KN4A 2MKCA 3P49B 2DNQA 3MD1A 1YJ9S 2DNNA 4IUFA 2NZ4A 2E5HA 1P27B 2F9DA 2JRSA 2RNEA 2E5IA 2DHSA 2DNHA 3P3DA 1VQPS 4Y0FA 4TU8A 4C7QA 2MZTA 1NO8A 2LKZA 2EVZA 1X4EA 2DB1A 2F9JA 5H1SV 3EGZA 1JJ2R 1U6FA 1SJQA 3U1MA 1OO0B 3D2WA 1DZ5A 3NS6A 4YUDA 3CPWR 2MYFA 2J0QD 1FHTA 2MJNA 3LPYA 3MUTP 1SJ4P 2FPHX 1ZZNA 3VAKA 1JMTA 2L08A 1X5SA 4WCEQ 1VQ8S 4PR6A 2RS2A 1UFWA 3IRWP 4WKRA 1WF0A 2ZJQQ 3IWNC 2QFJA 2A3JA 3EX7B 2KFYA 1PO6A 1N88A 3OW2R 2QA4S 2I2YA 2DHGA 5DDQC 1DRZA 2CPEA 2MKHA 5LSLA 2KXNB 2FC9A 3G9CA 4YOEA 2MZSA 1G2EA 2I38A 2J8AA 2DH8A 1WG5A 4WFAQ 3CULA 5ITHA 1PGZA 1O0PA 1CVJA 1X4AA 4WIIA 1QVFR 1X4HA 1WI8A 2X1GA 3CMES 3UWTA 4CH1A 2MHNA 2ERRA 1H2UX 2M8HA 2MZ1A 1RK8A 1S72S 2RRAA 4TLQA 2F3JA 2BOPA 1KOHA 2KRBA 5EN1A 2MKJA 2DO0A 2DITA 1JJHA 4A8XA 1OWXA 3MUVP 1Q86T 1D9AA 2N3OA 5JVGQ 1YTYA 1VQ4S 1M5PC 2N3LA 1DHMA 2XS5A 1VQKS 1U1KA 4TU9A 2LCWA 2DNGA 2VOOA 2ADBA 1WEZA 2J76E 3THPA 5LSOA 2M52A 2MSTA 3UCZP 1QVGR 2LEBA 1Q7YT 1WG4A 2MKKA 5LJ5Y 3CTRA 1WWHA 2KM8C 2DK2A 3CCLS 1YIJS 3B4MA 1N54B 5IFMA 2MGZA 2LQ5A 3R27A 4CIOA 3BEGB 2MSSA 3VAHA 1AUDA 1K73T 5D77A 3V4MA 3BS9A 1FXLA 2DGVA 5HL7Q 2CQHA 3U1LA 2CPYA 2DNZA 3J7YU 2CQPA 4U67Q 2DNMA 2JWNA 2YH1A 3ZZZA 5CXTA 2E5GA 3VF0B 2XNQA 1M5KC 3S6EA 1YI2S 4WF9Q 3NMRA 2LXIA 5GADU 2CQ1A 1B7FA 2JX2A 4P6QA 1NJIT 1R8HA 2DGXA 2YTCA 1NU4A
chains in the Genus database with same CATH superfamily
2IBKA 4H4KA 5ETTA 4ZPBA 1UJ6A 1H2VZ 3MPWA 2NQPA 1NEEA 1VRQC 4FYDA 2EXUA 5DZ6A 1JLFB 1JLBB 3MMAB 1Y4ZB 2ZUAA 1NPPA 4DV4F 2ZVIA 3RW6A 3EGNA 2I1RA 4DR2J 2OD4A 4DFJA 1KQKA 1FT8A 3EE3A 3K2YA 1VDHA 1ELOA 2OPQA 2IYIA 2YWGA 1Y0HA 2KHCA 3SFGA 2B7BB 4DCPB 2AQ4A 1T0TV 1RP5A 1YJRA 3QQCD 2VKZG 1YSJA 2UUAF 4H4MA 4AQYF 2COLA 1RWOB 4Y2CA 1JXLA 4DQRA 1FFGB 5GADI 4GKJJ 1UVNA 1S1VB 2W7PA 1WC4A 1RWXB 4WFYA 1VRTA 4IRCA 3L95X 1T03A 2F4VF 3MR6A 3CCVS 2PFDA 1XMQJ 4WU2A 3GIMA 2E66A 5KG7A 4KR0B 1GH8A 4Y2AA 1TK8A 1QSYA 2MMYA 2HFOA 2H5EA 2NLWA 2DXFA 3DM2A 2R7SA 1SVDA 1QSSA 4JYAF 5LXRA 3GIKA 4L6V3 3R5BA 5AE2A 4N41A 1G3OA 3PW4A 1F3FA 1JWWA 3TX8A 1GEHA 3EPGA 3TP2A 1HYSB 3A3PB 3DDNA 2HNDB 2RVJA 3NNHA 2V0NA 2MZQA 2KXFA 4M5IA 3V81B 4QR1A 5F3ZA 4JI4J 1BGXT 2PDAA 4CM0A 4CNZA 1RT3A 4FPRA 5AE1A 3M05A 2YNHB 2MLXA 1TELA 3QMQA 3OR2B 3TYTA 3MR5A 3T9NA 5C42B 1NSKL 3AJ1A 2LMIA 2RE1A 1PKUA 1GMUA 4W4MA 2QZ8A 3N9UC 4DU8A 2NREA 3CF5Q 2MKSA 3KDNA 2DEIA 4UZBA 1RABB 4JI7J 5CCLA 4Y6IA 4LMZA 1T9XA 3BO4A 2NS1B 3DOLB 1KTVA 2QN6B 4ED5A 2HPUA 4IDKA 2QO3A 3MAQA 4ZVRB 1SC1B 1XWLA 5EWEA 2VF3A 5H9EJ 2HHUA 1D8ZA 1PYSB 4WFNQ 1FJGJ 5J1PA 2DYAA 2FJEB 3W5YA 1IWGA 4EFAC 3KLFB 4RNNA 4UOFA 5IOLA 1ZS6A 1FJ7A 2BX6A 4ZVTB 3QNWB 1REVA 2B8PA 2FJAB 1NK6A 2AJFE 2RHSB 3HVWA 3NGRA 2EG2A 4K4TA 2WHOA 3AFGA 1UEVA 4CRJA 1EQ0A 1FDBA 3MEEA 1K1SA 1HI1A 1AZSA 1IBLF 4DV1J 4ED8A 1P27B 1N0UA 3VCDA 4Y0FA 4CLTA 1NO8A 1CSJA 2KJWA 4NYZA 3M8PA 2DRDA 2OPPB 4O3SA 1UEKA 5HQMA 2CWKA 3GYNA 2NYIA 3IFEA 1TL7B 3OXLA 2D3UA 3HZEA 2IA0A 3OW2R 1VQYA 1G2EA 3K5OA 1T05B 3CJ4A 2WB1D 1QE1A 1QVFR 1C0TB 2GFFA 3MMJA 3O6QA 4UOHA 3PCOB 2J7UA 5IS2A 6AT1B 1RTDB 4DR3F 5DGAA 2QLBB 1S72S 4FF1A 2G9OA 5GAEI 3EZ5A 2B8QA 2HRTA 3RBEA 4ZMMA 2MKJA 3TI0A 5A6PA 2QMWA 1NJZA 5HAOA 3SSQA 1IJFB 4RWWA 2YPZA 4KV8A 3TA1A 5B7WA 3DU6A 3KG4A 1IQZA 1RAFB 4WE1A 2ADBA 5LSOA 2M52A 3AHPA 1A0OB 1WG4A 1MMLA 2IRUA 2HFUA 2MSSA 5KFKA 5A2QU 3T5JA 1LXNA 4YP3A 4WK1A 2BW7A 4BC9A 3IA0A 1VCTA 4EYHB 1IKWA 4QJVA 4P6QA 4B9SA 1NSAA 4IFVA 2EW9A 3MEDA 1RCXB 1V3ZA 3W66A 3DXBA 1BMQB 1WOPA 3J81U 3OHAA 3WQPA 5DETA 1RTHB 3FUYA 1ZAVA 2YKNA 1HLWA 1RBAA 1WUUA 1XQIA 4F02A 3FRZA 4DXLA 4DUYJ 1RAJA 1HNWJ 1UMJA 2QGFB 3TRGA 4WU3A 2MQLA 1VQMS 2E9RX 1HQUA 3IS9A 1R89A 3ETOA 4J9SA 2JEJA 2VBZA 2B4OA 3MR2A 2BOAA 1U26A 4CZCA 2MTLA 4X65J 1OQ6A 3WIUA 4ELVA 4JP8A 3OSNA 4KHRA 1N5TA 3TOQA 3J7YI 1CQNA 2I0XA 3V6JA 4TQSA 3HVAA 4OZ0A 4CWBA 3ZTRA 3GV5B 4QU6A 2V2ZA 1WC0A 3RRHA 1RUSA 1YK9A 2MKYA 1RAEB 4XPCA 1ZPWX 2CPFA 4B9TA 4O0NA 3R5AA 5E3PA 2CQ3A 3ZTSA 3HMJG 3K5PA 3MMCA 3UN3A 3TAMB 4KY3A 2HVEA 1C4AA 3FBCA 2M4MA 3OD2A 4ZCIA 1EX8A 1GMWD 5FDLA 2N4CA 3HHEA 1RZMA 2WVCA 3F73A 4I56A 3RR8A 1HNIA 1U25A 2AMCB 3TAPA 4X4UA 2PE8A 4A8FA 4LR7A 4LVNP 3I5CA 2OJ3A 3K59A 2HNZA 3HK2A 1YQHA 3HHLB 4M5JA 3MFHA 1S10A 4CLLA 3UW1A 4IG3A 2W01A 5DDOC 3IR5B 2QEXS 2BE7D 4LFBJ 3I31A 5HJYA 1VC0A 2H5JB 1VQLS 3SXLA 1JB0C 1WC6A 1JQGA 1N8RT 2HGLA 1T3OA 3W2VA 4R5PB 1YJVA 4ECSA 2XZTB 3PG9A 1FX2A 2NXEA 4AXIA 2FZGB 1N6QA 4Y00A 3ZZTA 5SZTA 4ALZA 1CJKB 1QD1A 4AT1B 5KTQA 5HROA 2YWKA 1UPPA 2HQ3A 5CYQB 1KTQA 4AD6A 1HI0P 1WSVA 1M1GA 4FVMA 1GTHA 3CJTA 3Q22A 3J80U 1UWBA 4J9PA 2W9BB 4ICLB 5HANA 3AXKA 3TZXA 3R9LA 1KD1T 2VPXB 1Q81T 3MHYA 3KLIA 2P9EA 1YJWS 4DR5J 4QBUA 2D3O1 2GZOA 2FZCB 4DQPA 1K9MT 1IBKF 4LF4F 1T9VA 1KN6A 2CJXB 3UPFA 1RB0A 4DR7J 2IBOA 5KFSA 4M5KA 4B3MJ 2XO6A 3S8SA 4NLTA 5D4PA 3ITHA 2H1YA 2Z2ZA 2DNNA 1NK5A 2WSCC 2NZ4A 4RLEA 1NKEA 1IR2A 5T41A 1S0NA 1Q53A 5AXKA 3OJSA 3PHTA 1RTJB 3H4DA 3NAHA 1HKAA 2UV8G 4F4WA 1SJ4P 3W5ZA 1JMTA 2FVCA 4Q2LA 4WCEQ 1RKIA 4LR9A 4KH0B 4DN9A 3CT9A 3N79A 3D9BA 2KFYA 5DG8A 2QYGA 3CJKA 4LSLA 2MKHA 3G9CA 2RU9A 1HWIA 4ID5A 2XLIA 2C3OA 2EFGA 2FTRA 2IYGA 2MLZA 2VU5A 2C2NA 3KMQA 1SUQA 4BC7A 3X3UA 1JJHA 2F65A 4U7CA 2OPQB 5JVGQ 2AF6A 2AJ4A 3T3FA 3OVAA 1YGYA 2W7AA 2XI3A 4KTQA 1FNOA 2CWXA 2VOOA 4H4MB 3T6BA 2OLWA 3E8OA 4KBIA 2MSTA 1Q7YT 1FFWB 4DV7J 4EZ9A 3KWMA 2KT2A 3VAHA 1VRTB 1FXLA 3IGNA 2V4JA 3M6XA 1T03B 2OO4A 2CPYA 4ZHRA 1SQEA 3SFUA 3W5XA 1QUVA 1YI2S 1P9QC 3HSJA 1NJIT 4MFBA 4DL3A 5L46A 3GU0A 2P5VA 3DM2B 2DR7A 2CA9A 1P9YA 4M94A 3D7SB 4QPXA 1RCOB 3VAFA 1EHWA 5CD4A 1FERA 3C2PA 1FKPA 2ROPA 1T95A 3WBZA 1MROA 1D9DA 4HHHA 1OYDA 1NRKA 3ZNJ1 1S9GA 2XC9A 4F8RA 1XERA 3SBMA 4QWDA 2HNYA 1BLUA 3CJ2A 2JJ4D 3JQMA 2KFZA 3VVUA 1RT3B 2WRMA 2LVWA 2B5JA 3PYFA 2KU7A 3RW7A 1XMOF 2V68A 2XSFA 3KJQB 1NSQA 3R5JB 4Y2MA 3FCVA 4ZCLA 1SPBP 3VGSA 4D3HA 1TL3A 3T1YF 2IMOA 5K8MA 5KAKA 4IOAQ 3N4WA 3PO5A 4EI2A 4P2MA 2AU0A 2HWTA 3PX4A 4IYQA 5B0CA 5A2QY 2QLXA 2RU3A 4NCGA 3HDSA 3FK4A 2A1BA 5F0WA 2DGSA 4IDKB 4BBYA 3FBFA 3GMGA 4HT7A 2CPHA 3PYDA 1VQ7S 1T9TA 3ADAC 2OFHX 4PQUA 3FSIA 3GFXA 3TVYA 4UOCA 1FTRA 3N28A 5IT0A 3MECA 2HZVA 4IQMA 4X2BA 1REVB 2WVEA 2AJ2A 4DR6F 2C3UA 2RH3A 3B4DA 4X62J 4FBUA 4E98A 1R0AA 4FXVA 4ZJLA 4TU7A 1WNEA 1S0MA 1UJ4A 1KP6A 1AZSB 5BYSA 4IO9Q 3MWBA 4CYUA 2BBEA 2RUGA 3E51A 4V19J 3MTKA 4I6WA 4K4XA 2ZH4A 3VR1A 3M8PB 4RW6B 3MUMP 1S97A 4C0OC 4UF4A 3GJRB 2OAUA 1QAJA 3G6ES 2B4PA 1HQEA 4W92B 3CJQA 3UO0A 2LXFA 2OEJA 2VFTA 1VQSA 2MDAA 1IBMJ 4MKBA 2MKIA 4OMFG 3GR0A 1VQ9S 3EPIA 2XMMA 1QE1B 1RU1A 2KH9A 3G82A 2XGPA 4ZITA 5RUBA 4NLYA 4JI1F 1H6KX 1MN7A 2OP5A 2QL7B 2U2FA 2UVVA 4ITSA 4F0HA 4DL4A 1FRMA 3NAIA 4ZJOA 4HR2A 3HD2A 4KV8B 3SDEB 4ZVOB 3IBCB 5F8LA 5E33A 1VBYA 4WE1B 3QIPA 3CDAA 4WKYA 2ZZTA 1BY9A 5T14A 5HBMA 2FVQA 1J27A 3BR9A 3HD1A 4YDDB 1NK0A 2MQ8A 2ASJA 5L1KA 2Q66A 1K0VA 4UW2A 1FDNA 4Q2MA 2YQ3A 1DY3A 5J2PA 2XMUA 3P3DA 4X4SA 4USUA 2MZTA 4C3KA 1IKWB 4M5DA 1RT7A 1PJ7A 4PWDA 1I94J 3QZ8A 4C3LA 1N36J 5H9FK 4IFVB 3D2WA 4PEOA 3MEDB 3OFHA 2J0QD 2V9WA 3LPYA 3MUTP 3NL0A 1NPKA 3QO9A 4ED3A 2J9CA 2AJ1A 1S7IA 1HBNA 2YWWA 3D3CJ 1OJ4A 2CNOB 5ETVA 2YKNB 5IXUA 3N01A 4YOEA 2KXNB 3CMQA 1VGYA 3Q8RB 5ITHA 5BYQA 4DS5A 1WI8A 1GX6A 3PKMA 3UWTA 2IIHA 1HQUB 4HTIA 2C3YA 4KIAA 3SSSA 2W4PA 3C6UA 1KRPA 2G2OA 3LANA 1UVLA 4EBDA 3H5YA 3WX4A 4P75A 2GIRA 3ENAA 3VZIA 3ILIA 1TKTA 5EHHA 3OT9A 3I9V9 5K5MA 3D68A 3DLJA 4TY8A 2GNKA 3D1OA 1VHFA 4DV5J 3H2LA 3KUEA 4AL5A 3R27A 3BEGB 2PSZA 3JAMU 1VMBA 4LSZB 3M8ZA 3MMCB 5HL7Q 3A8JA 3I4PA 2ZNZA 3GIRA 3M7VA 4P74A 4NASA 1SL1A 3VZHA 5ADZA 1VIXA 1RDRA 5FDLB 3DYAA 3J7A1 2HQCA 4HHJA 1B7FA 2VG7A 1U4BA 1ZAXA 1HNIB 2DGXA 5KT7A 4JV0A 4P2SA 1HWKA 1KEKA 5E3QA 2IVMA 2VA3A 4RUAA 5EX3A 2HNZB 3TUZC 2B9YA 4TXSA 1M5VC 2FY8A 3M2RA 1B7YB 1CJVA 1RAAB 2R7UA 4IG3B 1ACMB 2NXUA 1ZTTA 2KVQE 2CQ4A 1FCAA 2EKNA 3W7BA 4Q8FA 2VQEJ 4B9UA 2HFVA 2HURA 3TEHB 3IWXA 2QSFA 4KJIA 4LF1A 5CZVA 4CLZA 2BKPA 3W2VB 1H38A 1YBTA 5IQ6A 4DV4J 2FY1A 1N6QB 2YKAA 2C3PA 4P7VA 2AEMA 3W3SA 1SH2A 1S9EA 3MM6A 5HQ8A 4LF5F 3PR5B 2C2KB 5HROB 4ETXA 1UVKA 3SMZA 2A10A 2FVRA 3KJVA 3MR3A 1IQTA 1QM9A 4C9DA 2ASDA 2WONA 2UUAJ 3VWSA 5LT5A 2NCKL 3HFZB 4MIBA 4O0IA 4RNMA 1UWBB 4A8WA 2FYXA 5HO4A 4N8NA 1C1CB 1U6BA 4MIWA 2AJ0A 3NNAA 3KLIB 2DNKA 2JVRA 5ETPA 1SQFA 1U0SA 3ZZYA 3TUIC 2F4VJ 2PMZD 3NBPA 2MQQA 4C48A 3FNNA 4HH0A 4QOTA 2H4YB 1OIAA 2NZCA 4HKQA 1OS5A 1RADB 4A8QA 3DGPA 1W25A 3ITHB 4RJVA 4JYAJ 4ZPCA 2W8LA 3CCWA 2AV5A 4A47A 4H4OA 3H90A 3EZOA 5GMEA 2ASYA 4XAKA 3VAGA 2CQIA 1S48A 1D1UA 3DRSA 2HWHA 4XPEA 2AZ1A 3CJKB 2XMVA 4LSLB 4PXDA 3EJMA 3R2DJ 4E0DA 4ID5B 1S99A 2EG1A 5GAHI 2QT7A 3OVSA 2H5IB 5MAOA 3ULHA 3R5GA 2HFZA 3A1YG 2E9TA 5A8WA 1VC5A 5J2MB 1RHUB 2XY6A 2UP1A 4UY85 2P8IA 4WPAA 4JV1A 4MKYA 1O5JA 2UXCF 4ECWA 2D69A 2Y0SD 1VQOS 2BZ2A 2YNGA 1FEHA 3TO8A 3BDEA 5DM6Q 1S79A 3NOGA 4DSIA 1UA0A 2ZJRQ 5IM0A 2Y0BB 3M2UA 4FXWA 3K17A 2V4JB 4DX6A 4K2XA 2MKCA 2RHQB 4DPWA 3SI8A 4ZHRB 2E5HA 2JRSA 1UCNA 4OQJA 4F67A 4KHPF 2HLUA 4RPFA 3PDNA 1GX5A 5H1SV 1U2RA 5L38A 4MFBB 4B08A 2MYFA 2FPHX 1ZZNA 5JXSA 1QJHA 2IDLA 1RXOB 1R7IA 4Z37A 1WKJA 1C2PA 2CPEA 1IBLJ 4QCLA 3NGSA 3QBCA 5LMUF 1FKPB 2GIFA 3NGDA 3G8QA 1KQGB 3K57A 1MROB 2BE9B 1S9GB 3MMBA 2M8HA 1AW0A 2B9EA 4EZ6A 4J91A 1RK8A 1S1XA 2HNYB 5KFLA 4WFXA 5DRKA 3IG1A 4FVCA 3LP0A 2ALYB 4HYKA 2LQ8A 2WCXA 3PEJA 2FJVA 3DFEA 5KT3A 4PQAA 2W4CA 1EIYB 1R31A 2Y8WA 2B5JB 2QMXA 3HO1A 1N32F 1KVJA 1CJUA 4NLXA 3OJUA 3B4MA 4OI0A 1TL3B 3UDLA 3PACA 4DR3J 3KOAA 2HHHF 2FLLA 1V3SA 2JLGA 4NLPA 5K14A 4OYOA 2E1PA 4QIWD 2RQMA 2CQPA 2DNMA 3TZWA 3HHKA 3S6EA 4DDFA 1UVMA 4QWEA 2LEPA 4NCGB 1R8HA 1RWPB 2IJNA 4DR4F 3O44A 1YWXA 4O44A 4FYVB 3MCMA 2B3TB 3L09A 2AYMA 3L3CA 2XHCA 4PQUB 4DEZA 1Z2ZA 4ER8A 4BHQA 4KGXB 3MECB 4DUZF 2ZBIA 2X1BA 2FJDB 3RBXA 1U1MA 2K3IA 3BBCA 1R0AB 1FXDA 2B6AA 5F8GA 5LXYA 3G86A 2GJIA 4J9RA 2DNYA 2RKIA 2IRXA 1SCJB 2VUGA 3V4IA 1RTZA 4CYUB 3OSPA 3CCRS 3KLGA 2LLZA 1SXLA 3H2UB 2Q3PA 2BJ7A 2YKPA 1XNQF 3FRYA 2M70A 2W2PP 1WSRA 2IPOB 2BJ1A 4ZP7A 3UNGC 1Y11A 2VQFF 1ZZFA 4EEYA 2YQ0A 1HQEB 4DL6A 1U1NA 1FRIA 4ETZA 3QPIA 3D6MB 1K44A 3DU5A 3BSNA 4O3QA 2HW3A 5I4MA 2GC8A 4U9RA 2KB2A 3ETMA 1M5OC 3QGHA 3ZC4A 3G82B 2VPYB 1U0HA 2CZVC 3HULA 4LRFA 4OI1A 1VISA 1D3WA 4EO6A 5JUMA 1KHWA 5LL6d 1Q8IA 4J9VA 4ED7A 4LRBA 3SQOP 4QW8A 4FYWB 4I4BA 4URGA 3KG0A 3I6PA 3E3XA 1XK8A 5D4LA 1HMVA 1WG1A 5HBMB 4DPXA 4PUOA 2ZBRA 4QR2A 2LU2A 1TK5A 4GKKF 3GFZA 4WFZA 2EPIA 2XS2A 2AWZA 3UVJA 2HQDA 1LK5A 1MLAA 5C25A 2F5GA 2J9DE 3HZGA 2QV6A 2RUSA 2VKRA 4F0MA 4F3OA 4M5DB 3IXQA 2Y9HA 1RT7B 2DGTA 2M8DB 4PWDB 2Z57B 2DNPA 3DN9A 2VONA 1AYEA 1JLEA 5T7LB 3FMWA 3QO9B 1HBNB 2WZ1A 3UFCX 3VVTA 1UFKA 4B9LA 3LUYA 3LWMA 4DZ6A 2CPZA 2OMLA 4OZ1A 1R3NA 2GHWA 3OHBA 3PHEA 1HD1A 4PXCA 1HR0F 1URRA 2AHOB 4Y34A 4OX9F 1JLCA 2XTJP 2VA2A 4USIA 5DGBA 3VAMA 2K2PA 3ZTQA 1X5TA 4QWBA 1X5OA 2HRUA 2ZNYA 4PXEA 4IRDA 1NJWA 3KK1A 1GNKA 4WFBQ 1TKTB 1UFLA 3N6MA 2EC0A 4IG0A 4DS4A 1C4CA 5C24A 2CPJA 2KXHA 2BR0A 3KG1A 3NKYA 2F7VA 3HF5A 4K4UA 5DDRC 3T5KA 2V63A 3D28A 4JOUA 1S0VA 4EU0A 2RNEA 2CVIA 3DYAB 1IBKJ 4LF4J 1EKSA 2VG7B 1F1BB 4HDHA 3MPYA 3K5MA 3CJSA 4NX9A 2MJNA 2R2SA 2UXDF 1FDAA 2A18A 4PYDA 2OPRA 4R25A 4LBIA 3QJPA 1S5ZA 2YWEA 1PO6A 1N88A 3ISND 5HJXA 1HBUA 2OD6A 3JSBA 4IOBA 2AZ3A 3BBBA 1S6OA 3RJMB 3M2RB 3PX0A 3DXSX 1CJVB 2X1GA 2YX7A 4DMZA 4OHXA 3D5MA 3LP1A 4C3MA 4OZNA 2B9XA 4E2FB 4ZVGA 2HEKA 1LW2A 2JHEA 3HT3A 1X31C 1KOHA 3NY0A 5EN1A 2DITA 2HQGA 2QYCA 2ZUGA 4ZPDA 3PJ9A 1YTYA 2G0JA 3N0VA 4GC6A 2XS5A 2X3DA 3HSZA 3GE9A 2YWHA 4B9VA 2PD1A 2J7KA 3THPA 1F9HA 5IV3A 1A6LA 5THWA 2PIIA 4NLUA 4J9MA 3A12A 1S9EB 3MM6B 3W65A 1HNZF 2L9DA 3K5LA 3Q24A 4ES2A 2DGVA 1RA7A 1RT2A 1U8SA 4YB5A 4DJBA 4DV0J 4U67Q 2ACYA 2E5GA 2OMOA 2XNQA 3KJVB 4F50A 3NMRA 2WONB 4ELTA 4HTJA 3ZTPA 1Q82T 3JSYA 1A7GE 2C2EA 4OIXA 1D9FA 2BM0A 5IWAF 2AYGA 1R6YA 1NK4A 2RD5C 1NDCA 1MW7A 2WOMA 4W90B 3NBPB 3VAIA 2HS3A 2MLYA 1OY9A 4P71A 2C2OB 4HL9A 3UNYA 2CKWA 1WEYA 1WHYA 2UU9F 2OPSB 3DGPB 3FC9A 5BR8F 2BQRA 5DO2A 2M88A 3RZAA 4F3QA 3V6KA 4C98A 3IBWA 5D0GA 1X4DA 1UW4A 1LV5A 1FK9A 2E1RA 2B56A 1SKSA 4OHYA 1Y5NB 3DLKA 3VQSA 1IM4A 3MM5A 1J5OA 1LWCA 3DRSB 1NZAA 1WTBA 4LR8A 1TUGB 5GMDA 2UV8A 2ZOFA 4USTA 3KLEA 1TVRA 3TUJC 4UY8T 2QTWA 4ED6A 5KFMA 2QA2A 1RHRB 3OR1A 2OGUA 3CIZA 5E0OA 5KG4A 4RR5A 3NCPA 3TQ1A 3H5SA 2K1RA 2XEXA 4C8LA 3R5CA 2R7XA 1XMOJ 4NI2A 1NB7A 3KJNB 5IT4A 5A8WB 1LWFA 4FKXA 3T1YJ 3ICLA 2N82B 2WVFA 4I6YA 1XR7A 4NYOA 5A8KA 1YITS 4ES3A 3T5LA 3NLCA 3DHXA 2LECA 2BDPA 4ZPWR 2YNGB 2HYIB 3KNGA 2VICA 2IM2A 3G6YA 1BQXA 4FYXB 1RQ0A 1VBKA 2GHVC 1XR5A 4Y3CA 5IM0B 3M2UB 4J9NA 5HK4A 4TYAA 2GX8A 2HGNA 2DPIA 3BO3A 4Z2XA 5F41A 2GA7A 4C8MA 4DR6J 3L7OA 2CZ9A 4UOGA 3Q89A 3CCUS 4YB6A 3HHLD 1O6XA 2DHAA 4RW8A 5DDPC 4X4NA 1NCLA 1S76D 5L1LA 2CDRB 2VPZB 4LFCF 4MYTA 5KFPA 5F9LA 5I3UA 4FF3A 3MMBB 1SL0A 1IWAA 2J0WA 1RHKB 1S1XB 3LP0B 1WF1A 2VD3A 2E7VA 3ONQA 3M32A 4ED2A 5HP1B 2RMLA 3KNAA 4RW7A 2X51A 2ZH9A 4PYAA 2AKWB 4ZP8A 5FLXU 1R8CA 1CQMA 4NA2A 4UT4A 1CC8A 2EBGA 1RACB 3RAXA 2GO8A 2DT9A 1CJUB 5EWFA 3JSMA 3EZUA 2HBQB 4JI1J 5KFAA 5K14B 2KN4A 1NDPA 5K8PA 4LT6A 1AT1B 2DD8S 4K50A 4P9SA 1GXTA 1RAHB 4AUKA 3T41A 4GO5X 3E2EA 3EGZA 1JJ2R 1YG0A 3BGRA 4DFPA 3CPWR 1EJ7L 4O44B 1S49A 2HS4A 2W2QP 1OSCA 4ZLLA 3UDCA 4M5HA 3IRWP 4IH7A 3NCRA 3AD7C 2V4QA 4F7VA 1H7WA 5CYMA 2G0IA 2BANA 4I64A 1BD6A 1B0PA 4ATNA 4ED4A 4CM2A 2ZH8A 3CMES 2BJ8A 1R8AA 2K06A 3DLGA 2E7XA 2ERRA 2B6AB 3LOUA 1V5VA 4X4RA 5HMWA 3QGGA 2RKIB 4ILRA 3V4IB 2DO0A 1OWXA 3B82A 5KG2A 3U27A 1WORA 2GQCA 3OTOF 3KLGB 1AB8A 2L9NA 4I68A 1P1LA 1NPRA 4ID8A 4CLWA 1PYOB 4A8SA 5LJ5Y 1YBUA 3BYPA 1CEZA 4X4PA 1TUVA 4CIOA 3WIVA 2EFOA 2CQHA 2XO7A 1TFWA 2GQ2A 5J1EA 1PYTA 3POTA 3GIIA 2HS0A 4KHMA 3BV8A 4MYUA 4C0BA 4CLSA 1U0HB 4ZVHA 3EXCX 2MPUA 3W61A 2H54B 3UE2A 1IKYA 3V5RA 2JSXA 3GONA 4RBTA 2HFSA 2AEFA 4GVBA 3GCXP 4I7FA 4KKOA 2V94A 3G2XA 3FQLA 2E29A 4OYBA 1N4LA 4LVOP 3Q2SC 4OZ5A 2OSRA 2W4DA 1HMVB 5HVGA 4PUOB 3WC2A 2AX0A 3H5XA 1HBMA 4JUZA 4YB1P 1KSPA 3UD5A 2RQCA 2CAJA 3U7JA 3UVJB 4DZDA 5C25B 2ZHBA 1I1GA 1OY6A 1L3VA 1F0XA 1Y00A 2V8HA 1MMNA 4YHHF 4AFFA 4JV5F 3C16A 3FFIA 2R7WA 3LF0A 5KFOA 2HVZA 4DV6F 1XR6A 3QRRA 2DCLA 3OL6A 1HARA 1YZ7A 1R6VA 2ZWOA 2C42A 3W2WA 4DFMA 1U1PA 3FKBA 5BJRA 1E6YA 4LSNA 2P9GA 3MFIA 4DFKA 4NLRA 3H4BA 2YWFA 3QT7A 2AYEA 3GYXB 4OYZA 4QYZK 1Q8KA 2R8KA 5CA5A 4N47A 3G8SA 1JLCB 2DBBA 4H54A 3J7AN 4LF5J 1SC6A 3THTA 1XNRF 5B0FA 4KRWA 3Q8UA 2EC2A 3X1LB 1N52B 3KK1B 2CJAA 3LGHA 4KAIA 3MD3A 3Q8QB 3K7RA 4MJKA 4IG0B 2UUBF 2NXCA 4LF6F 5C24B 2HHSA 2PFFB 4KE5A 5HLFA 3R6GB 2BQUA 2OTLS 3LH2S 2O5DA 2LXUA 3T9ZA 2EK6A 3BQ2A 3K58A 2RT3A 5LJ3Y 2XLJA 1T9WA 4N7TA 3DC2A 5ETRA 1TKXA 2BE2A 1U8WA 2Y1RI 3T1AA 2BEFA 4K2JA 1VJQA 4LF8F 1TL4A 4CI0B 3CGIA 3B8HA 3I56S 2ZJPQ 2W9AA 1K8AT 3NCQA 1VR6A 1HBUB 1NAQA 2XGQA 3K5NA 3BDPA 1ITPA 2GO9A 2DEJA 3LP1B 2E1MC 3NWGA 2O66A 3NGKA 1DJ0A 2GV1A 2JEGA 4ECUA 3M8YA 1X60A 1KONA 2NPFA 1SBRA 1UZHA 3THVA 1YHQS 2QC3A 4P10A 2DHXA 3TR5A 2BA9A 4DV3F 3JQJA 2V2KA 1SKRA 3BYRA 2JLEA 5DQIA 1ZM9A 2YKOA 2HVHA 1TR0A 3PEHA 3PZPA 1FEEA 1RT2B 4U7UD 3M30B 4JI8F 1DAXA 4IQXA 2DHSA 3QAEA 5KFEA 4KC5A 2UXCJ 2YBVA 1PIEA 3CE8A 1U6FA 2VDIA 4DLGA 4LF9F 4B9MA 1R0CB 1EZZB 2PC6A 3BGOP 1U48A 1NNDA 3GR1A 3HFKA 4NA1A 4FZVA 3IAM9 4DOZA 5DDQC 1DRZA 4KPCA 3CDBA 4UZCA 2WOMB 2MZSA 1NK7A 1PBUA 2I38A 3LGMA 1X4AA 2NXJA 4KHPJ 1HBOA 4TN2A 4Y28C 3GP9A 2QE5A 2MHNA 3R7NB 2HHXA 5B09A 3A8EA 4DSEA 3O5TB 2X3GA 3D1HA 4B3TF 5AXMA 4PG4A 2V9KA 2HVIA 3PX6A 2JEIA 1BHNA 1M5PC 3PW0A 2W7OA 5LMUJ 3DLKB 5D8HB 3MM5B 1J5OB 1LWCB 2IC3A 1GXUA 3CTRA 2NXNA 9RUBA 1SIZA 2HFNA 1BQMA 3DMJB 1S6UA 4OYXA 1IKVA 3KLEB 4OI2A 3CJ8A 2HHQA 1TK0A 1UETA 2ZHOA 5C5JA 3D3BJ 3RYLA 5KOXA 3OR1B 2YH1A 5CXTA 2V50A 4RO0A 1RLDA 4DF8A 2K1RB 2QFIA 4D3GA 2YTCA 4NI2B 4KGKA 3AD9C 2AT1B 1LWFB 4CQ1A 1RT1A 2BV3A 2HHHJ 1F3VA 3J81j 4CLUA 1OSDA 5DM7Q 2FZKB 4IFYA 5A8KB 3L9ZA 1VQNS 4NXMF 3MURP 5IV4A 1S6QA 3PR4A 4DR4J 2BVZA 2Z8QA 2MJUA 2Y3YA 4J9OA 4WZMA 4CH7A 2ZH2A 3V2UC 3M8QA 3Q8PB 5HQLA 3SIPB 3B54A 2IY5B 2OELA 1H98A 1SJ3P 5KFIA 2Z30B 2RILA 4DUZJ 3NS7B 1N5SA 4DQSA 4A8OA 3GV8B 2MY8A 4OL8A 3ZZUA 2G1DA 5E5NA 1BQNA 2JZ5A 5B0AA 3ET6A 4JB8B 2VOPA 2Q79A 4OYAA 1W7WA 3HCXA 4RW8B 4NLVA 4WK3A 3KK2B 2VPWB 2N7CA 4C97A 3MF5A 2GVZA 1NBEB 3AB4B 4Z7YA 1XNQJ 2B7CB 2DGQA 1LOUA 5I3UB 2R2RA 4ANEA 2D9OA 2AIRB 5F8IA 4K5SA 3OBIA 1I5OB 1YJUA 2C1EB 4QWAA 3BH6B 4USMA 3LQVA 2R7VA 3BO2A 3FMBA 1Y3JA 2B51A 3M32B 3ZZRA 4XDCA 2CQGA 1G7CB 3PW7A 2R8IA 1HHSA 3OXGA 1U1OA 5F8HA 1WD6A 2O67A 1SV5A 3F0NA 4X66F 2I5JB 1QAXA 3JSMB 4TLRA 4OV1A 3CC4S 4F25A 2ZZMA 4O4GA 3UN5A 4OHVA 1S1TA 1E6VA 3C3LA 3FDSA 2C2DA 2ZVSA 1SJFA 4U6PA 4GVLA 3CDUA 1SJRA 1T7PA 3J7ZT 2IVYA 3M6WA 5KFJA 3FSYA 1VC6A 4O3NA 1NSPA 2WSEC 3TJ8A 1ZA2B 1UAWA 3WDOA 4GKKJ 4DQIA 4NZ6A 4C8KA 1V5IB 2HK3A 3ZZOA 3OUYB 2Y1IA 5CYMB 4KFBB 1J2VA 3CNQP 3NGTA 2BANB 1DQ8A 1WKLA 1Y9OA 3GFHA 4L3KA 3DLGB 2E44A 2KG1A 4K8RA 2FIUA 4C8NA 1NB2A 4CO1A 3IN5A 3GG1A 3HI9A 1FA0A 2C2MB 1FDDA 2M7SA 3DOKA 4R8UA 2CQ2A 4P72A 2BJ9A 4AXJA 3NOCA 1KWMA 4NEYA 2YX1A 1HR0J 1X4CA 2KT5A 1O51A 2CQDA 4OX9J 1RU2A 4B3OA 2VG6A 3BKUA 2G2YA 2ZH1A 4J7CA 1UWAA 5J1EB 2E5IA 2DNHA 4FP9A 3POTB 2UUCF 4XTTA 1Q78A 3DCAA 4QYZJ 2XLKA 7FD1A 2BABA 3RB6A 1DZ5A 3QAUA 1WDTA 1Q7LB 1IKYB 1VQ8S 3BGLA 4GVBB 4K0KF 1FRXA 3MEGA 8RUCA 2XWXA 2I2YA 2XZDB 2V8GA 4G3IA 4KKOB 3KHLA 2YVSA 1YKWA 3CULA 2J8AA 4P2FA 1I51B 2J9EA 4K59A 4WWSA 1X9MA 1HBMB 1JKHA 4CH1A 3LWLA 3WHIA 1PJ5A 1HHTP 4B3RF 2UXDJ 4ES1A 2KRBA 1APSA 2HK2A 2F4FA 4X4OA 1Q86T 1QDUB 5L39A 4I2QA 1U1KA 2DNGA 3C16B 3FFIB 3OTDA 4ECVA 2DRAA 3AB2B 3CCLS 1RI7A 1N54B 1S59A 2PI4A 3G6XA 1AUDA 4MMOA 1K73T 5KG1A 1T9YA 4OHWA 2OHDA 3DRRA 3W2WB 3U1LA 2GJFA 5KFDA 4LSNB 3CB4A 2JOQA 5DLFA 1RJJA 2DRBA 1XIQA 1N33F 4ECQA 4IH5A 4XK8C 1MN9A 1RGVA 1HNZJ 3EGWB 5KT2A 1TP7A 4OZJA 2UVRA 4P73A 2VFVA 3P5TL 5M2UA 1M90T 5B08A 3B6BA 5K20B 2XWYA 1U7LA 3KUGA 1JIHA 3A8KA 3QJJA 2FJXA 2J0SD 5HLFB 2MQNA 2XHWA 1SJ1A 1RT6B 5IWAJ 4N5SA 3DLLQ 4EGLA 1G1XA 4JI2F 2QSWA 3VV2B 4BCAA 3NP5A 3UI3A 3CCES 4EWTA 3UCGA 3M8SA 3S7RA 1B0VA 2EFNA 1TKXB 4HACB 1KQSR 2RRBA 4F04B 1KQFB 5E41A 4NWBA 1TAUA 3MGJA 4LJMA 2UU9J 5B0BA 5BR8J 2MZRA 1S0OA 3CVKA 3JYTA 4LIWA 1ZBTA 3FEYB 4QU7A 1LNQA 3D6FB 1HPZA 1ULRA 2CUYA 1FE0A 1FWKA 4KH1B 2GQQA 1CJTA 2KG0A 2GJ2A 3A13A 3UD3P 1K0TA 3D67A 1KC8T 4RBVA 4DN0A 2DVIA 1ZYQA 1NXIA 2R8JA 3Q8VA 2CPXA 5LMNJ 1YJNS 1C0UA 3MM7B 2ALZA 2UXBF 5M2PA 3PKYA 1TUWA 2R7TA 4V1Ak 4WP8A 3EVWA 3W9HA 1T05A 2ILZA 3U02A 1Z1ZA 5D6GA 1N0VC 1P6TA 3CCZA 1Q4RA 1U1RA 1RTDA 4XDDA 5G0RA 4USHA 2CQ0A 2WTFA 2XY5A 3OFEA 3BBFA 3HHDA 4G1PA 2HAFA 2V4RA 1U02A 2X1AA 4XIUA 4QR0A 1Q5YA 4ZVEA 5KFZA 1PAUB 4L75A 2JL9A 1HBOB 4N77A 1LW0A 3CCJS 4M5NA 2XMWA 2DNRA 4ANCA 3PV8A 4YR2A 1YJTA 2KJVA 5D0EA 2R8GA 3LPEA 2VC1A 1D0EA 4IO1A 2JNJA 4WP3A 3AODA 2R7RA 4LFCJ 2IC3B 5D3GA 2EFVA 2FD2A 1BQMB 3H0PA 3MTJA 2I8EA 5GAHU 1IKVB 4DUTA 1FVSA 1RHMB 5U47A 3B78A 1RWMB 2O01C 1VQPS 5ETLA 2CFXA 4TU8A 4C7QA 2N7YA 4LQ3A 2LKZA 1B99A 3CJ5A 4I2PA 2HQFA 3OXFA 3R97A 3DLHA 3W8PA 3W9JA 1RT1B 3MAAA 4Q45A 4X64F 1WF0A 3ENWA 3PFEA 2A3JA 1X8DA 3RRKA 2V69A 1KHVA 4IFYB 1FESA 4I1TA 2NYHA 4WFAQ 3K8VA 1JJCB 1D09B 3Q86A 1N5QA 2BJEA 1KVKA 1S6QB 1IKXA 3LALA 5E3AA 2ZOMA 4ZCMA 2K7JA 4USKA 3ZXWA 3C66A 3P5BP 5EGYA 1XBWA 3BQ1A 2J76E 2MKKA 3D54A 3E01A 3LTOA 2DK2A 1JXVA 1BQNB 1PJ6A 1YIJS 3MCOA 2JFDA 3ET6B 1F5BA 3TNVA 3VGVA 1UL3A 2B4VA 2J0XA 3BR8A 2VJUA 2Q1LA 5KG5A 4EYIB 3OTOJ 2GVZB 4DU7A 4OI6A 3HKZD 1WEXA 1HNVA 3J81Y 3M9OB 1M0SA 1SKWA 1QSLA 4M1KA 5FJ4A 1YLXA 1U24A 2CZ4A 1WC3A 4NLWA 3FEXB 5KFNA 3MEEB 1SV5B 2J6SA 3N5BA 1Y5IB 3OFFA 4G65A 2CADA 3H20A 2AGOA 2LDYA 2HIYA 2VV5A 4O4GB 2LP4A 1S1TB 4YR0A 1E6VB 2IAJA 2Z0GA 4USWA 4O23A 2G13A 4ENOA 4ZVQB 4JV2A 2Y8YA 2QLWA 3QSIA 3T1HF 3TVZA 1Z4UA 1S9FA 1SKUB 3GG0A 3US5A 3D66A 4NLOA 4F0KA 4R0JA 4DBQA 3QRQA 4WZQA 1LEOA 1F5AA 4QIFA 2MQPA 2QX0A 3KHGA 1L5UA 1VQ5S 1CC7A 3TWZA 7FDRA 2DIVA 5IT9U 1N48A 3HSGA 2LEAA 4FF2A 4UQTA 1HW8A 1UPMB 3BSOA 4P7TA 3M9MB 1BC6A 2WAQD 1VBXA 4JV5J 2FDNA 2K8GA 1ZETA 1DTTA 4ZCKA 2E1CA 3OQ2A 4RU9A 1WOOA 4DV6J 1EB0A 4BWJA 3LAKA 3QFWA 3D0GE 5C2CA 3BJYA 5KFHA 5M2RA 4YY3F 1XN9A 1FE4A 1T3NA 4RUCA 2XS7A 3DOKB 4R8UB 2VBWA 4Y2IA 2R2UA 2CQCA 4FS1A 4RNOA 2V34A 3C8YA 5JMNA 1T02A 3SCLE 4B3OB 2VG6B 2H65B 4LRAA 3HVRA 4CO0A 1T94A 3VAJA 2YKQA 4C0HA 4KGMA 4TVAB 1XNRJ 2XMKA 3H42A 5ETOA 3ZNUA 5I42A 4OZ2A 4UUWA 2ZDOA 2XCPA 1X4GA 1N34F 1JLQA 2YPYA 3R8YA 5KFRA 1TTHB 2UUBJ 4LF6J 2PEBA 2YX4A 4DSJA 3MEGB 4CO5A 3V6DA 2BKNA 2HG4A 3IS9B 1GTEA 1S4FA 3I5BA 2APOA 2PA8D 3JB9k 4LBPA 4E8UA 2ZM6F 2YH0A 4OI4A 1WJ9A 2P9CA 4RU2A 5D15A 1JKHB 2D74B 5I3PA 1YJ7A 1MWZA 3J80Y 3W9IA 4LF8J 2NSBA 2HZCA 2XB2D 3JQKA 1XMBA 4OI3A 3QATA 1FWPA 4FS2A 4LIRA 4I2QB 3M4XA 4HI2A 5GVQA 4HHUA 2CRLA 3VHQA 1YBAA 3Q83A 2RDIA 2BJ3A 3I4HX 1FRKA 3H59A 3TARA 3DRRB 2YNIA 3P49B 1NK9A 3AD8C 3SEOA 4USJC 5KT5A 5CCMA 2ACMA 2ZE2A 2EFQA 3S1TA 4YB7A 4CT9A 2HWIA 3M8WA 4DV3J 2BW2A 2POKA 3EXYA 2L08A 1XC9A 4PR6A 2JLFA 5AJ3F 4PG5A 4QIVA 1UZDA 3EVOA 4IH6A 5LSLA 4NYPA 4JI8J 1O0PA 1B4SA 3KUHA 1UVJA 4NZ7A 4NMLA 4IR1A 4NXNF 1NJYA 4PG6A 5J1NA 2R3VA 1WACA 2RRAA 2BOPA 3TZZA 4LF9J 8ATCB 3QZ7A 2PMHA 2JC0A 3HT0A 4A46A 1S1WA 5F9NA 3AA8A 8AT1B 2K7KA 3MAHA 2UVUA 3T19A 2FJBB 4ZPAA 1ZM3A 4CO4A 1VLYA 2CDQA 4F2SA 5GAGI 4AQYJ 7AT1B 4J37A 3JYTB 4B3TJ 2HBRB 4DG1A 2DKOB 1HPZB 4DCOB 1YVFA 5AT1B 2MQOA 2IM1A 3RB3A 4OZLA 1CJTB 3OL9A 4C11A 3HPOA 2ZH3A 4B9NA 4EK2A 3TEGA 4DR1F 4DI6A 3PJXA 4A8MP 4NLSA 4RW6A 3ISNC 3DLBA 4EMDA 2XYPB 3MI7X 4C2MA 4URSA 1L3TA 4JI5F 3W62A 2CIMA 3Q23A 1QAYA 1C0UB 5CHCB 3K8WA 4CLKA 5I3QA 2GVDA 2ZHAA 3PIPQ 3CO0P 1S6PA 5F8MA 3HLUA 2KYXA 3I55S 1IXKA 3SV3A 3HHNB 2A6OA 2N4DA 1PCAA 2M0GB 2PGCA 4DPYA 1W2BR 5G0RB 3KDOA 3D6TB 1NHUA 4ZJQA 2Z2MA 2XM3A 3G87A 2E5LF 4HVZA 1UJ5A 3SDEA 4DSLA 1S1UA 2FJWA 4NXMJ 2DNOA 4ILLA 4WXOA 2AD9A 1WI6A 2PEHA 4XO0A 4K4SA 3GJTB 2O3DA 5HVHA 1AFIA 3CSKA 2F8EX 1T8EA 2ZH6A 1EETA 3Q0AA 2EK1A 1AXQA 2D1CA 4DX7A 4YN3B 1C1BA 1SUQB 3HXMA 4F4AA 2XULA 3QGIA 1QTMA 1FJEB 4NRTA 1HD0A 1LW0B 1P1TA 4FF4A 3FSXA 4MK9A 2VJVA 1F9FA 1MWYA 1RWUA 1U2CA 2CQBA 3HP6A 1V3RA 3EWGA 1QTNB 3K89A 2FQQB 4YMEA 2PO4A 3OL8A 1OMSA 2HBYB 1VOMA 5D0HA 5ETSA 2KVIA 1FFSB 4ZVPB 5D3GB 1PSDA 5CQGA 3IGVA 2XCAA 3MDFA 1RBOB 4FBTA 3T6JA 2RAQA 1GAOA 4NPOA 3D4JA 3I0RA 4PWWA 1WTFA 4I2PB 5KG6A 2VDHA 2R9LA 4X66J 1AROP 5J2NA 2H9ZA 2VASA 4J9QA 2CXEA 2E5JA 2AGQA 2X1FA 2RSQA 3FQKA 3MAAB 4QIEA 2L48A 2U1AA 1KS2A 2ZDPA 3MOZA 4TYBA 1RHJB 2ROGA 4QPTA 1KNZA 1GT8A 4PCQA 4LFAF 4G1IA 1FO1A 3TUPA 5IQQA 5HN0A 1NZ8A 3ILLA 3PYGA 4JI6F 1VK3A 5IT9Y 3D0IE 4GMKA 3RU0A 2J6UA 2L3MA 2DH7A 1IKXB 2VH7A 4YFUA 1L3KA 1A9NB 2HAIA 4RW4A 4RUHA 4V19X 2P6SA 3CCTA 1VFJA 2WSFC 1OY8A 2IM0A 1IN0A 2LQ9A 2NSCA 4MH8A 5HI7A 2DJWA 2BM1A 4OV6A 4FNIA 5KFTA 2V67A 3E01B 2PN6A 1SC3B 4RNFA 5JVHQ 4FYYB 3MM9A 5AXLA 1X0FA 4LF7F 1FX4A 3CMAS 1H74A 3AH6A 1FJCA 3LW5C 1IJEB 1YJ9S 3KHRA 3AQPA 4CO3A 2HBZB 2DY9A 3BH7B 1X9WA 3OV7A 4OX6A 2EVZA 3QSYB 3SCIE 2V8DA 2RDDA 3F44A 2R2TA 4WXWA 1FTCA 2AP6A 3R5DA 1HNVB 3HHLC 1LWEA 1DURA 2C2ZB 3EX7B 1NKCA 2H51B 3IBFB 4I67A 2CNLB 3TZYA 3OVBA 2OKQA 3QJLA 4WIIA 1TFYA 2ZEJA 1RT5A 4RBUA 5HATA 2PT0A 5KFQA 1YZ6A 3CD7A 2UUCJ 3ZZPA 3M6VA 3NG8A 6FDRA 2HMIA 4GRSA 2MZ1A 3N6LA 4MK8A 1RWKB 1TL1A 1RYSA 2IAJB 2N3OA 1UA1A 4K0KJ 1XJWB 3TA2A 4X4QA 1C1CA 1UVIA 4DHVA 2DXDA 4DPUA 3PVXA 2NPIA 1QVGR 2LEBA 1U45A 3I96A 1BWVA 1U47A 4NL5A 4LREA 1DQAA 2LQ5A 1F9EB 1EP4A 3JAMY 3BS9A 1H0HB 4B3RJ 1GFWB 2GW8A 3RRGA 2DXEA 3ZZZA 5DG9A 4ZPVR 2RF2A 4WF9Q 3PJWA 1KFSA 3IAS9 2JX2A 3DOMA 2XQCA 1DTTB 5DG7A 1RLCL 4ZVUB 1HNXF 4OYPA 2DO4A 3QIPB 3NEKA 3PW2A 1NKBA 3BPSP 4TQRA 3M2VA 4ZN1A 3VTIA 4PPZA 3MM8A 2DISA 1IR0A 2XG8A 5A6WA 1VQ6S 1AUSL 2FLOA 3D0HE 1HW9A 4CH0S 1N33J 3QIDA 4QWCA 5J2PB 1J5EF 4B3SF 2V2QA 5A76A 3AY0A 3M8RA 1TKZA 2L41A 4H4KC 1VJWA 4HEA9 5ETMA 3UDVA 2LDIA 5I42B 4DV0F 3LO3A 5J2MA 4N76A 1KLNA 2RQ4A 3R1HA 1JLQB 3TQEA 3C15A 2KM8B 3ZTOA 3C6TA 4DV2F 2QA1A 3H98A 2NUHA 3V6DB 2DIUA 3GSIA 4JI2J 3C6UB 3GYGA 3CDEA 3SV4A 3QFHA 2Y1JA 2F63A 4L3NA 4FXDA 2W8KA 4DCJB 3M6UA 2SXLA 2ZKTA 1CS4A 3W8GA 4DL0C 4DPOA 4TY8B 3JS9A 1Q0NA 3M1VA 2Z2YB 3SYZA 2YXLA 3GPAA 1OPZA 4G1QA 5KFCA 3PM9A 1BXNA 2QRRA 4NA3A 3OLBA 4K5RA 3I9ZA 3L4BC 4ZS6A 1GMWA 1HA1A 1MNEA 1Q1KA 3RAQA 5JJBA 3LA0A 3JTOA 2FLPA 2QLFB 2YNIB 2UVWA 3RB0A 3KKFA 3BSAA 3CCQS 3AQOA 3TVKA 1QAIA 4OLPA 2ZE2B 3N6NA 2D41A 5EWGA 4ZIWA 2C2RA 2UXBJ 2KHDA 4MK7A 3PIOQ 3O3LA 2BRKA 3UN2A 4DX5A 3AJ2A 2OI2A 5HSPA 1HWLA 2H48B 1U09A 3HJVA 3CUNA 2P6TA 1JLAA 3EGVA 3ILJA 2YNFA 2KYZA 3LGNA 3BZQA 3L7UA 3CJ0A 4DL7A 1FKOA 4OJGA 3FBEA 2J8SA 4ANDA 3DRPA 5LSRA 3LAMA 4TY9A 1MWQA 3GWCA 1YRXA 4QIGA 3BB5A 2M3DA 4OJ3A 1N56A 1S1WB 2OSQA 3BN7A 4MT1A 4Q0BA 1MG7A 3W60A 2YKMA 3SCKE 2Z2LA 4KSEB 2HHVA 3LP2A 2QG9B 3D6HB 3CC2S 3O1LA 2DR9A 4LBHA 1DBDA 1IBCB 1P8GA 1PAEX 1YX2A 2Q43A 1HWUA 4DG1B 1SI9A 1SJQA 2IRYA 2HLTA 4UQGA 3I32A 4C11B 3R7BB 3H8YA 4LRCA 4N56A 2M5YA 4ZK7M 2ZJQQ 4NEZA 2DHGA 4HI1A 3AT1B 3KJFB 4RWXA 1JLGA 5A0YA 5DJBA 3CWJA 1PGZA 3IWLA 5C2GA 3A8IA 2EKYA 3R6LB 1H73A 3DLEA 4H4OB 2GAHC 2GVDB 4CNYA 3JXOA 2W1BA 3GILA 3IR7B 1S6PB 4TKTA 1SIWB 1R27B 3GSDA 4WJBA 2BMBA 3W64A 4X64J 4PG8A 3UDEA 1YRUA 1SB6A 3TX0A 2B9WA 4TU9A 2A0FB 1ZOTA 2W9CA 2QJ3A 3RBZA 2VFRA 1FKAF 4Q5VA 1S1UB 2MHEA 2MGZA 4F4ZA 1Q16B 2PA3A 4CT8A 4CTAA 4BWMA 4ZVSB 1FRHA 2KO1A 4ZDNA 1EETB 3NRBA 4YS2A 3GV7B 1EQMA 2HHPA 2IJRA 4M8LA 4ZP9A 1C1BB 2LXIA 5GADU 3ISZA 2ZC3A 4B17A 1QLNA 5C7PA 4CP5A 1Y10A 2CJYB 4CO2A 4Q8EA 3QT6A 5J2QA 3PO4A 1W26A 3AOCA 4KPYA 4B02A 2CJKA 2KRRA 5F3TA 2FHJD 4WP9A 1WOSA 5T7LA 1YDLA 4NCBA 2OFGX 3DDIA 4JBCA 3QYYA 4J9UE 3R1LA 4ECXA 1CPZA 3OTCA 4MTPA 4PWUA 3H25A 3CJRA 4A8YA 2J6TA 3P45B 3MCNA 3BQ0A 2D3OR 2XYGB 4ZN3A 1RYRA 1N5YA 4F2RA 1JNZB 2HGMA 2VFUA 2E1AA 4AE5A 3I0RB 1Q79A 1KR4A 2B43A 2WBMA 3EVMA 5J2NB 2CJQA 3RG6A 3HVTA 1TL5A 1ZH5A 4DX8H 3C19A 3I0SA 2K3KA 2GAGC 2XNRA 4NE9C 2Z58B 1BE4A 2RQKA 5GMKa 2EI5A 2LYVA 4ELUA 3IG1B 1MU2A 3T1HJ 5EDWA 4OYMA 2V8VA 5KFGA 3CW2C 2B0GA 3ZFVA 1CULA 3ELHA 2CYYA 4RW4B 2GMJA 1UW9A 3UD4P 3RBDA 4KGZB 2FLNA 5CYJA 1JX4A 1VRUA 3JTPA 3FCWA 5E3RA 3AAWB 3FJ2A 2ZC4A 1VIOA 3V6HA 1LK7A 4M5LA 4BLGA 3P4UB 3OPKA 2KL8A 5KFBA 2MY7A 1LKZA 2VC0A 2G0CA 1JK9B 1UTAA 4A4JA 3PTWA 3HKWA 1UP1A 3H7HB 3MM9B 2OEKA 4RUBA 3IM8A 5KFVA 3GQCA 2GGPA 3QLHA 1WHWA 2VBYA 1FVQA 4YY3J 3IRXA 3K0JA 5KOWA 1LXJA 2DR6A 1NMEB 3GTYX 4UUXA 1X7VA 4GC7A 4JI0F 1ZPVA 4HH1A 1LWEB 3AA9A 4J5OA 4RL1A 3VALA 4I6AA 1KVIA 1RTIA 2KZMA 3CC7S 4Y65A 2RRNA 2NUUG 4ECRA 1HIYA 1MMDA 2VBXA 1RT5B 1DTQA 4IKAA 5L9NA 3A3NB 2HMIB 5HVFA 1N34J 3WX8A 1TKDA 2FC8A 4JI3F 1TL1B 4LQ9A 5KFYA 4F26A 5K8OA 1HI8A 5CD4H 3CDWA 2P2CB 2G4BA 2FB0A 2ZM6J 1K47A 2QL9B 3KHHA 2GHPA 5GAEU 2DNLA 4MIAA 2XYHB 1RAOA 1GXLA 1FRJA 1EP4B 4MKVA 3NS5A 4MAKA 2R42A 4F4YA 4BS2A 2RIJA 4OLOA 2DNQA 1RWVB 1OQ3A 2OPSA 2RF2B 2DB1A 5KFFA 4ECTA 3DOMB 1KLMA 1TAQA 1U6ZA 1GQEA 4WBFA 3SSRA 5D0RA 2ZZNA 1K1QA 5LM7E 1X5SA 2RS2A 4X84A 4DQQA 1UFWA 1VS3A 2D7SA 5EUHA 3DHWC 4Q7AA 3CJ3A 3M2VB 3BKTA 4U8VA 3MM8B 3DI6A 4WTOB 2UUTA 2JEFA 4ED0A 1ZM4A 4J90A 4AYBD 4KGVB 5FD1A 1FNMA 2IA6A 3QWPA 4TLQA 2F3JA 3FZ2A 5LOQA 4A8XA 1TKZB 1OYEA 2FHJA 4KT0C 5AJ3J 4K4VA 1RAGB 1JLEB 2LFVA 2N3LA 1I6JA 4RW9A 2XMJA 3C15B 2CJ9A 4NXNJ 3OL7A 3DNCA 3FEZA 2DPJA 5IFMA 2ILYA 1DARA 3C6TB 3KMSA 1SH0A 2C22A 2DNZA 3J7YU 4HDGA 1X0PA 1MSWD 3VF0B 2XY7A 3SCJE 1M5KC 4DR2F 5IC6B 1PC4A 4OYWA 3Q8SB 1NK8A 2O1PA 1CS4B 4LRDA 4PAAA 4AL6A 2VHGA 3GJSB 3M1VB 1S7HA 2CVEA 2JFKA 4G6VB 4FN5A 3AOAA 2J7WA 2JC1A 3DRYA 1PILA 4G1QB 2WK4A 2HKEA 1Y3KA 5D78A 1HL6A 4GKJF 1M5SA 1S57A 2ZWPA 4L72B 4O3OA 5AXNA 2MB0B 2D3ZA 1RWWB 3MZIA 2F8MA 3GCWP 3CO9A 4OFZA 4OYIA 4DR1J 5BYRA 1XMQF 4P52A 3OFGA 5E3CA 3I87A 3UR3C 4DSFA 2ZOGA 1KKHA 2WVDA 2OPRB 4JI5J 2MZJA 1X4BA 4DL2A 2DGOA 1DFDA 3DDKA 1VBZA 5HP1A 4GO7X 4KQZA 1H2TZ 1B0TA 4NCAA 4PABA 5AE3A 4ZLJA 2GCFA 1S4EA 3ENQA 3CD0A 2AGPA 1JLAB 4O3PA 1LW2B 2YNFB 4RX6A 2QIFA 1DLOA 1FKOB 1KBRA 2ZBPA 3RTVA 1L3SA 2ZH5A 1O8BA 4FNHA 4JI4F 2RS8A 3DRPB 2E5LJ 3CD5A 3S01A 2GMLA 1X9SA 2W25A 3VQTA 2W2OP 2DGWA 1IM6A 1NM2A 1URNA 2MXYA 1TU0B 3ZZ0A 1TQLA 3C14A 3CIMA 5DQGA 4C6AA 2IM3A 2XI2A 2QA4G 4Q0BB 4OX7A 2ZFHA 2YKMB 2Z56B 1W2IA 4WIQA 4I69A 5K9FA 4U8YA 2XSJA 2VG5A 3LP2B 2OEMA 3KXDA 1WELA 4O3RA 2WW4A 4JI7F 3T5HA 5F0UA 2CPIA 3MCSA 4IOCQ 1NH8A 1FNXH 2UZAA 4CDIA 4LUBA 3FCHA 6FD1A 4Q43A 2AYBA 1G6BA 4U96A 1EARA 4QQBA 3EICA 4F36A 5H9FJ 4L73A 2Y1LB 1FJGF 4HLBA 2G2ZA 1JLGB 5L9XA 5A0YB 2BYCA 2WB4A 3QT5A 3OTBA 2OH2A 1SQGA 3P8BB 3DLEB 2YY3A 2JDJA 1HFEL 4RKUC 1NLKL 1FXRA 4C8OA 1FK9B 4DV1F 4EO8A 4DSKA 2KKHA 1WC5A 2ATLA 2KZZA 1RT4A 4ZP6A 2LA4A 4ZKAA 2W9CB 5FLXY 1TVRB 2Q6BA 4LFAJ 1R43A 3BGUA 2XBPA 3G8TA 2G1HA 2DR5A 2BUNA 2KDOA 4JI6J 2MGZB 4URQU 4FDFA 3TJAA 4CTAB 2EBEA 2MEWA 4ECYA 4PXBA 1RHQB 4X4TA 4M63A 3MD1A 1D8YA 2F9DA 1R0BG 1B3TA 1N32J 2DCUB 1X4EA 3KLHA 2FGOA 3BREA 1IVZA 3EDQB 4ZOSA 4YUDA 5CH7B 4KO0A 5J2QB 5KFWA 3VAKA 1T11A 9ATCB 3H40A 3MPDA 1B70B 4EUVA 2HHTA 4LF7J 4MKAA 2QA4S 2DH8A 4F4XA 2CG4A 1CVJA 1ZTWA 1X4HA 3WC0A 1CG2A 2FHKA 2W2NP 4FPIA 2B4UA 3KK3A 2FVPA 5E7OB 5KT6A 2E9ZA 5FIIA 3NGUA 3H5UA 4K4WA 1AFJA 1NUEA 3I5AA 1PBAA 2ZBCA 1N5YB 5HMZA 3RUBL 2AEJA 1VQKS 4C8YA 2KTQA 5B0GA 3RAMA 1F5CA 1WWHA 2KM8C 3EYZA 3A4TA 3HVTB 5G4DA 3QRPA 3Q8YA 4ZPTR 3I0SB 4NOHA 4QYRA 3SQGA 4DUYF 1HNWF 3W1YC 1ZM2A 2VQFJ 2CG8A 2X7IA 1PC5A 2A2DA 4HT5A 1B64A 2CQ1A 1MU2B 2ZKUA 3PRDA 3HJFA 2V6AA 1FD8A 4RW7B 1CBKA 4OX8A 2C3MA 3FGVA 4KB7A 4DL5A 2DH9A 3PRBA 1CULB 4DWIA 2F1FA 1RKJA 4X65F 1V6HA 2JH3A 1G4CA 3TANA 3ZO7A 2ASLA 5A8RA 3FZBA 5ETKA 2IFXA 1TV6A 1Q8BA 3MOJB 1VRUB 3TJ9A 3G4SS 2VL1A 2F8HA 1RAIB 5KFUA 3F56A 2OIHA 1BWEA 4RNHA 1NJXA 3FVYA 3NXZA 2DGUA 1WHXA 3Q2TC 1FRLA 3EMTA 3KTQA 2ZD1A 3HFVA 5D4NA 1IR1A 1NH7A 1HNXJ 4L76A 3BKFA 1LQ9A 2WBRA 3L7PA 3BGRB 2R4FA 3TA0A 2GGPB 3QLHB 3NMAA 4NLGA 3MPUB 3IRXB 1TMMA 2ROEA 3CXCR 4OZ3A 4BDPA 2BRLA 3H2VE 4CLFA 4ZLNA 2GIQA 2WVBA 3TW0A 1SL2A 1J5EJ 4B3SJ 2V5HG 2QL5B 4YEAA 2DY1A 1R8BA 1RTIB 4S0MA 3N5FA 1F60B 1RBLA 5IZHA 4CCHA 1JXEA 1TMJA 1DTQB 3P6YC 4LFBF 3M30A 1WF2A 3O2IA 3I82A 2HQIA 4NMXA 4DV2J 3RGIA 4ERDA 4EBCA 1JLFA 3OLAA 1JLBA 3MMAA 5DZ7A 3JSRA 3G96A 2FHOB 3MXHP 2ZITA 4FKYA 2ADCA 1KDNA 1X5PA 1VK8A 3QT8A 2MQMA 1H72C 3IC1A 2UUWA 2R7QA 2HHWA 5B0EA 3AJDA 1EKRA 1YRTA 1Q8LA 3C46A 1JNRB 4Z7CA 1XEZA 4J9KA 2KI2A 4K4ZA 1Z2LA 1KLMB 3UR0A 1S1VA 4I7FB 3PNIA 5B0DA 4QZVB 2W2MP 4NRUA 1RISA 5CABA 4DR5F 2ABYA 4F4KA 3G71S 1ROFA 3HSDA 3MPVA 4L74A 3DMJA 3DI6B 1RWNB 4J9LA 3BN4A 4DR7F 2NR0A 2D9PA 3U1NA 4RZRA 4QW9A 1U1LA 4DLEA 2V2VA 2I9SA 4B3MF 2QMUB 5LMNF 2VZ9A 2HSEB 1NHVA 1N5VA 3CD6S 1WKKA 1ZA1B 4OJ1A 4YDXA 2F40A 1HYSA 1REGX 4PPDA 1R8PA 3QGPA 2AJQA 2IJFA 4N8OA 2HNDA 2ZH7A 1RSCA 1GK8A 1IUJA 4RW9B 1EAYC 1E6YB 1UEUA 3V81A 4PRFA 2R7OA 1CLFA 3IM9A 2R8HA 4M95A 2YNHA 1QY7A 5L8RC 1KFDA 1L3UA 3OR2A 2A2CA 2HRYA 2F9JA 2RJZA 4NZ0A 5C42A 1OO0B 1SH3A 5DLGA 3NS6A 2I6WA 3SZ2A 2IDEA 5KT4A 4A8KA 4WKRA 2QFJA 2H4WB 1HQ2A 2FC9A 4CLYA 4X4VA 3BGFA 2EEYA 3DOLA 4DV7F 3IMQJ 1HHQA 3KK2A 5HMXA 1QUPA 2CNNB 1FF2A 3FBBA 2J5AA 1FI4A 1D9AA 2BE2B 1VQ4S 3KLFA 1Y5LB 3AOBA 1DHMA 2HIQA 2LCWA 4U7UK 1WEZA 4AL7A 2BQ3A 2VB6A 1AA1B 4PZVA 4UTGA 1H3DA 4U95A 3GLJA 5D4OA 3WZ0A 4ZVFA 3BPDA 2AX1A 5D77A 3V4MA 1U49A 2I5JA 2CNKB 2LU1A 5IC4B 4O4RA 1BUXA 1DLOB 1NU4A 2OPPA 2V8PA 3JTNA 2M9KA 2EFPA 3PXGa 1JJ4A 5E2QA 3EUNA 1ICEB 1TL7A 3GJQB 1TZ0A 3AXMA 1NHKL 2E7WA 3R3TA 3UQSA 1M1KT 3C14B 1T9UA 2OTJS 1VI7A 5KG3A 5GAGU 5BXIA 1C0TA 2FUG9 3OUYA 2XSJB 2VG5B 4YQWA 3P96A 4KFBA 5SUHA 1NDLA 2J9DA 3J7Z5 5H9EK 1M5HA 3F41A 3CCSS 4WYWA 4IRKA 4A48A 4WYLA 4ECZA 4M5GA 1KOOA 4OJHA 2PMWA 1U2FA 3ENVA 2H3EB 1HWJA 4ZLPA 2IMWP 4C4WA 2LA6A 3VGTA 3PY8A 2LQBA 3KYLA 4W98A 2IVFB 1LFWA 4LF2A 5F8NA 2FGCA 1VHIA 1PG5B 4DPTA 4X62F 3HM9A 2ATCB 3IP0A 2WW8A 3VGUA 4M5MA 3KLVA 3RB4A 1RTHA 2JVOA 2IHR1 1F2GA 3R7SB 5MLCV 2PI5A 3PRVA 4IR9A 3KFWX 5L1IA 2A6MA 1RA6A 1RT4B 1X4FA 2XZWA 1WHVA 5L1JA 1OPIA 2DHHA 4R0EA 1M1HA 5EX0A 1IBMF 2QLJB 2HVDA 4OHZA 4K4YA 1FD2A 2DR8A 3TAQA 3W63A 3NNCA 2CPDA 2XMTA 2Z4PA 1H7XA 3O8WA 3HX9A 4YR3A 3KLHB 3IR6B 3MR7A 3UCUP 4KO0B 2VODA 4P2XA 3EM1A 3OTEA 3NWRA 4TNOA 3R2CJ 2L9WA 3TAMA 3BF4A 1VLOA 1WC1A 2BJDA 5KFXA 1LFPA 2KT3A 5ETNA 2XMAA 1F2HA 4PKDB 3ILOA 3M8QB 2LQJA 1DQ9A 3KK3B 2OUGA 2HZAA 3BSCA 3PYEA 2BXJA 3PW5A 3CCMS 2EWHA 4JI0J 5CZXA 3GIJA 5HMYA 4NLDA 4ILMA 1LWXA 4NLQA 1I3OB 5CAAA 1UKUA 1I94F 3HHLA 1N36F 5DS7A 3M9NB 2M2BA 5F8JA 2FHMA 3EDRB 1F6TA 5KG0A 1SC4B 4ED1A 4JI3J 1U1QA 4EBEA 4IUFA 3SQGB 2GMHA 4Y2KA 1Q95G 2CJBA 4CLPA 4R5PA 4C8ZA 4KYZA 1GMVA 2AW0A 4WTYA 3A3OB 1RT6A 3D1QA 2VFSA 3U1MA 3GFYA 3DRXA 1FHTA 3RR7A 4ZIVA 1V9OA 2DTJA 2VIHA 1CJKA 4DF4A 1S12A 3MEKA 3IWNC 4HACA 5CYQA 5A8RB 1NDKA 5K8NA 1TV6B 3GZ7A 3PFOA 4Q44A 1WG5A 1RE1B 3GB0A 2BKOA 2C28A 4DV5F 1H2UX 2KFNA 2W24A 1ZAWA 2W9BA 3DGVA 2ZD1B 4ICLA 2RB7A 3MUVP 2FVSA 1S77D 4ZA1A 2Q6CA 1Q5VA 4K7QA 4I0WA 3BM7A 2GS8A 3IO1A 3DKDA 3UCZP 1FWLA 5DQHA 2YQ1A 1VYAA 1XTZA 3MM7A 3QWUA 4USVA 4YHHJ 4F3MA 1Y7PA 5ETQA 3CEDA 2JWNA 2BACA 2ZBQA 4PG7A 2RDJA 1WDDA 1RTJA 3G6VA 2VQEF
chains in the Genus database with same CATH topology
1QLNA 2IJNA 4DR4F 3O44A 2IBKA 1YWXA 4ECQA 4O44A 4IH5A 4CO2A 4Q8EA 5J2QA 3PO4A 4H4KA 4XK8C 4ZPBA 1UJ6A 1H2VZ 4KPYA 3MPWA 2NQPA 4B02A 1RGVA 1NEEA 2B3TB 2AYMA 3L09A 2CJKA 3EGWB 5KT2A 4FYDA 1TP7A 3L3CA 1JLFB 2KRRA 5F3TA 2FHJD 4OZJA 4PQUB 2UVRA 1JLBB 5T7LA 3MMAB 1Y4ZB 2VFVA 3P5TL 4DEZA 5M2UA 1M90T 1Z2ZA 5B08A 4NCBA 4DV4F 2OFGX 4BHQA 3RW6A 3MECB 4JBCA 4DUZF 3QYYA 3R1LA 4ECXA 2XWYA 1CPZA 3OTCA 1U7LA 2ZBIA 3EGNA 2I1RA 2X1BA 4MTPA 2FJDB 2OD4A 4DFJA 1U1MA 2K3IA 4PWUA 3H25A 1KQKA 1R0AB 1FXDA 4A8YA 2B6AA 5F8GA 1FT8A 3G86A 5LXYA 2J6TA 2GJIA 3BQ0A 4J9RA 1JIHA 2DNYA 2FJXA 2J0SD 3QJJA 2D3OR 2RKIA 5HLFB 2MQNA 2XHWA 3K2YA 1ELOA 2IRXA 2VUGA 1SJ1A 3V4IA 1RT6B 2OPQA 2IYIA 2YWGA 4N5SA 3DLLQ 4EGLA 1G1XA 1Y0HA 3OSPA 2KHCA 4JI2F 3SFGA 3CCRS 2B7BB 2QSWA 3KLGA 1RP5A 2LLZA 1SXLA 4BCAA 2AQ4A 1YJRA 3NP5A 1JNZB 3H2UB 1RYRA 1N5YA 4F2RA 2Q3PA 2YKPA 1YSJA 2VKZG 2HGMA 2VFUA 3UI3A 2UUAF 1XNQF 3CCES 4EWTA 3FRYA 2E1AA 3UCGA 2M70A 3M8SA 4H4MA 4AE5A 3S7RA 4AQYF 1B0VA 3I0RB 1Q79A 2COLA 1KR4A 2B43A 2EFNA 4Y2CA 1JXLA 4DQRA 5GADI 2WBMA 1TKXB 1KQSR 1UVNA 3UNGC 1S1VB 4ZP7A 2W7PA 2VQFF 1ZZFA 2RRBA 4EEYA 1HQEB 1KQFB 5J2NB 5E41A 4DL6A 1FRIA 4NWBA 1U1NA 2CJQA 4ETZA 1TAUA 3HVTA 4WFYA 3MGJA 1TL5A 3QPIA 4LJMA 1VRTA 3DU5A 3BSNA 4O3QA 4IRCA 1ZH5A 5B0BA 4DX8H 3I0SA 3L95X 2K3KA 1T03A 2XNRA 2HW3A 2F4VF 3MR6A 3CCVS 2MZRA 1S0OA 3CVKA 5I4MA 3JYTA 2GC8A 4LIWA 1ZBTA 4U9RA 4WU2A 3GIMA 2RQKA 3FEYB 2KB2A 4QU7A 2E66A 1M5OC 5KG7A 5GMKa 4KR0B 3QGHA 1GH8A 1HPZA 1ULRA 2EI5A 3ZC4A 2LYVA 4Y2AA 3IG1B 1TK8A 4ELUA 1MU2A 1QSYA 5EDWA 2MMYA 2V8VA 2VPYB 2HFOA 5KFGA 1FE0A 2CZVC 2H5EA 2NLWA 4OI1A 2B0GA 3DM2A 2GQQA 1D3WA 3ZFVA 2R7SA 4EO6A 2KG0A 5JUMA 1KHWA 1QSSA 2GJ2A 4JYAF 5LL6d 5LXRA 2CYYA 1Q8IA 3UD3P 1K0TA 3GIKA 4L6V3 4ED7A 3R5BA 1KC8T 5AE2A 4N41A 1G3OA 4RW4B 2GMJA 4QW8A 3PW4A 1JWWA 3TX8A 4RBVA 3EPGA 3TP2A 4I4BA 3UD4P 4URGA 1HYSB 4DN0A 3RBDA 3KG0A 2DVIA 1ZYQA 2FLNA 5CYJA 3I6PA 3E3XA 1JX4A 2R8JA 1VRUA 3JTPA 1XK8A 3DDNA 2HNDB 5E3RA 2CPXA 3AAWB 3FJ2A 1YJNS 2RVJA 5D4LA 2ZC4A 1C0UA 1VIOA 3MM7B 2ALZA 2UXBF 5M2PA 3V6HA 3PKYA 1HMVA 1LK7A 1WG1A 5HBMB 4PUOA 2R7TA 3NNHA 3OPKA 2V0NA 2MZQA 4QR2A 5KFBA 2MY7A 2LU2A 1LKZA 2KXFA 3V81B 1TK5A 3GFZA 2VC0A 4QR1A 4WFZA 5F3ZA 2ILZA 3U02A 1T05A 4GKKF 2G0CA 2EPIA 1JK9B 4A4JA 2XS2A 1BGXT 3HKWA 1UP1A 2PDAA 2AWZA 3MM9B 1Z1ZA 4CNZA 5D6GA 1RT3A 1N0VC 1P6TA 3CCZA 1Q4RA 1U1RA 1LK5A 5C25A 5KFVA 4FPRA 5AE1A 3GQCA 1RTDA 2GGPA 3QLHA 1WHWA 2VBYA 2J9DE 1FVQA 3HZGA 4XDDA 2QV6A 3M05A 2YNHB 3IRXA 3QMQA 2VKRA 5G0RA 3OR2B 3K0JA 5KOWA 4F3OA 4USHA 4M5DB 2CQ0A 3IXQA 3TYTA 3MR5A 1LXJA 1RT7B 2DGTA 3T9NA 2WTFA 2M8DB 4PWDB 5C42B 2XY5A 3AJ1A 3OFEA 2DNPA 4UUXA 3DN9A 2LMIA 2RE1A 2VONA 1JLEA 3HHDA 5T7LB 4G1PA 3FMWA 1X7VA 3QO9B 2QZ8A 3N9UC 2V4RA 4GC7A 4JI0F 1ZPVA 2NREA 3CF5Q 1HBNB 4HH1A 3UFCX 2MKSA 1LWEB 4B9LA 3AA9A 3LUYA 2X1AA 4XIUA 3LWMA 4J5OA 4QR0A 2CPZA 3VALA 4I6AA 1KVIA 1RTIA 2OMLA 4ZVEA 4OZ1A 3CC7S 4Y65A 5KFZA 2KZMA 2RRNA 2NUUG 5CCLA 4ECRA 1R3NA 1MMDA 2GHWA 4Y6IA 4LMZA 3OHBA 2JL9A 3PHEA 2VBXA 3BO4A 2NS1B 3DOLB 1HD1A 1RT5B 4PXCA 1DTQA 1HBOB 1HR0F 4IKAA 1KTVA 1URRA 4ED5A 5L9NA 2HPUA 4N77A 4Y34A 1LW0A 4OX9F 3CCJS 1JLCA 4IDKA 2HMIB 2QO3A 2VA2A 1TKDA 2XMWA 3MAQA 4USIA 1XWLA 2FC8A 5EWEA 2DNRA 4JI3F 5H9EJ 2HHUA 5DGBA 3VAMA 1TL1B 1D8ZA 4LQ9A 2K2PA 5KFYA 1X5TA 3PV8A 4WFNQ 4YR2A 1YJTA 5J1PA 2FJEB 2KJVA 4F26A 4QWBA 1HI8A 1X5OA 5K8OA 4EFAC 5CD4H 2HRUA 2ZNYA 4PXEA 3CDWA 4RNNA 3KLFB 1NJWA 2R8GA 4IRDA 3KK1A 2VC1A 1FJ7A 1GNKA 4WFBQ 4IO1A 1D0EA 2G4BA 1TKTB 1REVA 2FB0A 2FJAB 1UFLA 3N6MA 2EC0A 4IG0A 2R7RA 1NK6A 2IC3B 4DS4A 2AJFE 1C4CA 2GHPA 5C24A 3KHHA 2EFVA 5D3GA 2FD2A 5GAEU 2DNLA 4MIAA 2CPJA 2KXHA 1BQMB 3HVWA 1GXLA 1FRJA 2EG2A 2BR0A 3MTJA 4K4TA 2I8EA 2WHOA 1EP4B 1UEVA 3KG1A 3NKYA 5GAHU 2F7VA 1IKVB 3NS5A 4MAKA 3HF5A 1FDBA 3MEEA 4K4UA 4F4YA 1K1SA 1HI1A 5DDRC 4BS2A 1IBLF 3T5KA 1FVSA 2RIJA 3D28A 4JOUA 2DNQA 4OLOA 1S0VA 5U47A 3B78A 4ED8A 4EU0A 1P27B 2RNEA 1N0UA 2CVIA 2O01C 1OQ3A 3VCDA 3DYAB 1VQPS 2OPSA 2CFXA 2RF2B 4Y0FA 4TU8A 4C7QA 2N7YA 4LQ3A 1NO8A 1CSJA 2KJWA 2LKZA 4NYZA 2VG7B 3M8PA 2DB1A 5KFFA 3CJ5A 4ECTA 1KLMA 4I2PA 1TAQA 4HDHA 3MPYA 2OPPB 3K5MA 1U6ZA 4O3SA 4NX9A 3OXFA 1GQEA 2MJNA 3DLHA 3SSRA 2R2SA 2UXDF 1FDAA 2A18A 3GYNA 2ZZNA 1K1QA 2OPRA 1X5SA 2NYIA 3IFEA 1RT1B 2RS2A 4R25A 4X84A 4Q45A 1UFWA 1VS3A 2D7SA 4DQQA 3QJPA 3OXLA 2D3UA 5EUHA 4X64F 3DHWC 1WF0A 4Q7AA 3ENWA 3CJ3A 2IA0A 2A3JA 2YWEA 3HZEA 3PFEA 1N88A 3ISND 1PO6A 3M2VB 3OW2R 1X8DA 1HBUA 3RRKA 2OD6A 1KHVA 4IFYB 1FESA 3MM8B 1VQYA 1G2EA 4I1TA 3DI6A 3K5OA 1T05B 3JSBA 3CJ4A 4IOBA 4WFAQ 2JEFA 1S6OA 2UUTA 3M2RB 3PX0A 2WB1D 3DXSX 3K8VA 1QE1A 1QVFR 2X1GA 1C0TB 2GFFA 2YX7A 1ZM4A 3MMJA 3O6QA 4OHXA