1OQ3A

A core mutation affecting the folding properties of a soluble domain of the atpase protein copa from bacillus subtilis
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
76
structure length
76
Chain Sequence
MLSEQKEIAMQVSGMTCAACAARIEKGLKRMPGVTDANVNLATETVNVIYDPAETGTAAIQEKIEKLGYHVVIEGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Potential copper-transporting ATPase
publication title A core mutation affecting the folding properties of a soluble domain of the ATPase protein CopA from Bacillus subtilis
pubmed doi rcsb
source organism Bacillus subtilis
total genus 16
structure length 76
sequence length 76
ec nomenclature ec 7.2.2.8: P-type Cu(+) transporter.
pdb deposition date 2003-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1oq3A00
2RSQA 4HL9A 4ZOSA 2N7YA 1IUJA 3FRYA 2VH7A 2XMUA 2ROPA 1VQYA 2RILA 3TNVA 1R6YA 4OIXA 1SB6A 3MZIA 4HI2A 4OJ3A 1N5TA 4A4JA 2VV5A 1TR0A 2LQ9A 5A6WA 1TL4A 1OQ6A 2AW0A 2FTRA 2K1RA 2GFFA 1LQ9A 3BF4A 1WD6A 2OFGX 1OPZA 4A47A 2OKQA 5B0FA 1KQKA 1KVJA 2G9OA 5KAKA 2ZDPA 3T9NA 2CRLA 1JK9B 1N5VA 1YJRA 2QLXA 1N5SA 1CC8A 3LGNA 3KG1A 1FVSA 2N4CA 2OMOA 4Y2IA 2OD4A 3TOQA 2KT2A 5B08A 1Y3KA 3I9ZA 4Q2LA 4DPOA 1TUVA 1Q8BA 2AP6A 1Y3JA 4HI1A 2EW9A 2GGPB 4DN9A 4HH0A 4NL5A 3DXSX 3KNGA 1VQSA 2KYZA 1OSDA 2LXFA 2AJ0A 4Q2MA 4ZA1A 1FESA 1TL5A 3KG0A 2HLUA 2ROEA 2RU9A 3BDEA 1YJTA 3GZ7A 3WDOA 3HFKA 4F67A 3FGVA 5F0UA 5T7LB 5B0CA 3HHLC 1X0PA 2BYCA 2HFOA 3BN7A 1SI9A 2BUNA 1MWYA 3HHLA 5B0EA 1Y0HA 3CJKB 1GXTA 1U7LA 1RJJA 3LO3A 2LDIA 2K2PA 4Y2MA 2AJ1A 2OP5A 1YG0A 4Y2KA 1JWWA 1TZ0A 2OFHX 4FNIA 2ACYA 1W2IA 2XMWA 1YJVA 2OAUA 3BR8A 1MWZA 5IXUA 3HHLD 1X7VA 2GA7A 4FNHA 4EFAC 4OJGA 3MCSA 3K7RA 1KVIA 5A6PA 2BBEA 2PD1A 2ZDOA 1AW0A 3BGUA 2K7JA 4A46A 4OJ1A 1K0VA 2QIFA 5K9FA 1S6UA 1AFJA 4YDXA 3QGPA 2K7KA 2ROGA 2JDJA 3BM7A 2QLWA 2IYIA 2Q3PA 5F0WA 5B0DA 3E8OA 2HLTA 2W4CA 3KKFA 2K1RB 1SQEA 4QOTA 4A48A 1FVQA 1CPZA 1FEEA 2XMJA 2BJEA 1S6OA 1FE0A 2FIUA 1P6TA 5B09A 1GXUA 2OD6A 1N5QA 1ULRA 3QMQA 2GV1A 2GGPA 2L3MA 2FB0A 2W4PA 2IFXA 1FD8A 3UDCA 1XBWA 2XMTA 4HH1A 2KT3A 1YRXA 3F44A 1FE4A 3HDSA 3DCAA 2XMMA 4YEAA 2N4DA 1APSA 1AFIA 2ASYA 2GCFA 1Q8LA 5T7LA 2BJDA 4NPOA 1YJUA 5B0AA 3LGMA 3TRGA 3CJKA 2IYGA 1X8DA 3HX9A 1URRA 5B0BA 1Y9OA 3VTIA 2HQIA 1P8GA 2QYCA 3IWXA 2XMVA 4U9RA 2KKHA 2W4DA 1V3ZA 3BB5A 3FMBA 3IWLA 4DL0C 1Q4RA 3HHLB 5B0GA 4OJHA 2LQBA 2HFNA 2PGCA 2RMLA 2HIQA 1QUPA 1Q53A 2GO8A 1OQ3A 2XMKA 2FHMA 1CC7A 3HF5A
chains in the Genus database with same CATH superfamily
1WKJA 2BJ3A 4X65J 3B78A 4TYBA 4G6VB 2A2CA 1EETB 3T41A 1VQ5S 2NQPA 3O1LA 4MYTA 3QO9A 2OSRA 1R31A 2UUCJ 2DNOA 2CJQA 4DXLA 1QVFR 1IR2A 2QLFB 2I5JB 1TL5A 4RU2A 2MZ1A 1T3OA 5LSLA 2DNNA 1REVA 3BH6B 4ZK7M 4O0IA 2NXCA 4LF6F 3MR5A 1J5OA 3M8YA 5HLFA 4F4ZA 4USWA 2N3LA 1E6YA 1XMQF 3NMRA 1F2GA 4UY85 5C25B 4WFBQ 3UD4P 1FE0A 2F1FA 1D09B 4OV6A 2RNEA 3ETOA 2ZC3A 2C2EA 2BE2A 5DGAA 5K8NA 4NPOA 2X1BA 3MAQA 4RWXA 3AY0A 4DR4F 2UXDF 5BYQA 2BZ2A 4A8YA 1X4CA 5DZ6A 1Q53A 4LSLB 4XPEA 3HVTA 1FDBA 2EG1A 3V81B 2RKIA 1ZM4A 1IKYB 1AT1B 4PUOA 4BDPA 1PSDA 3G82B 5D78A 2KTQA 3ZTPA 3PW5A 4L72B 4ETZA 3MUVP 3U7JA 3OUYA 2OMOA 1BQMA 3M4XA 1HNXF 1LWCA 3ZZTA 3GSIA 2QFJA 2W2PP 4LUBA 2JEFA 5H1SV 4ID5A 4DUYF 5B0EA 5KT4A 4C11B 3Q8UA 5E2QA 3BBCA 3CJ2A 2Q66A 2Z4PA 1BMQB 3MGJA 1EETA 4N47A 3EX7B 1ZAWA 2KG0A 1HFEL 4CLWA 2CJ9A 4EI2A 2DHSA 4TU9A 2BKNA 5BXIA 3PW4A 1RB0A 4MH8A 2IAJB 2I5JA 2BQUA 2WSFC 1HD0A 2AWZA 1SJRA 3G6VA 2ZHAA 1DQAA 2QA2A 3PYGA 5CQGA 1N4LA 5F8MA 3PACA 1TAUA 1NAQA 3KLHB 4OJ3A 5C25A 1R7IA 1LK7A 1X5OA 2HK3A 4M63A 3RR7A 3OVBA 2GZOA 2VA2A 3SCKE 4DU8A 1KHVA 3W1YC 2D41A 1R6VA 2FJWA 3WDOA 3MUMP 3MMBB 3ZNUA 2DXEA 1S7IA 1R27B 4NXNJ 4LSLA 2IA0A 5IFMA 2F4VF 5SUHA 1H6KX 3V81A 1YJVA 3HHLD 3CW2C 4WIIA 3PW0A 2HFSA 3CCUS 5HATA 4WU2A 1IKYA 5D3GB 3G82A 1TK0A 4ZN1A 2C2KB 4R0JA 1IBMF 1NMEB 4MAKA 4UZCA 4GMKA 3T1HF 3CT9A 2ASYA 3FSYA 1NHUA 4C11A 4X4QA 4XIUA 3OJUA 4LF4J 1SCJB 1UWAA 1FRLA 2BXJA 2JOQA 5LSOA 4OYWA 4RW4B 1CS4B 3UR3C 4WYLA 2J0XA 1OQ6A 3C16B 2AZ1A 4HKQA 4JB8B 4M5NA 4J9KA 2IAJA 3I9ZA 4P73A 2H5JB 2GC8A 2V4QA 4LIWA 1S10A 2RHSB 3GZ7A 4B3RJ 3K5LA 1CEZA 1B70B 4PWUA 3AJDA 1GAOA 4TVAB 3AOAA 1X4DA 3KLHA 2H4YB 3QNWB 1RBLA 1IBLJ 3FSXA 3IXQA 1RGVA 1LNQA 1M0SA 2YXLA 4F8RA 1UFWA 3HKZD 3J7ZT 2R8JA 4DX8H 1FNMA 1N33F 2BM0A 3T5HA 3TUIC 1NKBA 2E66A 2GIRA 3D2WA 2FJXA 1K47A 3D0IE 2MZRA 3MMBA 4CO0A 2D1CA 3D3CJ 2VPZB 4DBQA 3KUHA 2FDNA 2FVSA 1SQFA 3EGNA 2DR7A 5D3GA 4IOBA 3MTJA 4HL9A 2IM0A 2FLNA 2DY1A 5K14B 2FY8A 5F41A 3LAKA 4DV7F 3T5KA 2DNKA 2OPQB 4G1QB 3NOGA 4RU9A 3X1LB 2CQ4A 1QUVA 1EB0A 1RE1B 2L48A 1AXQA 3UVJB 2JNJA 4LRBA 2F8HA 2HRUA 5LMUF 5K8MA 1U2FA 1WC1A 3HM9A 4RW4A 1CS4A 3MCSA 3RUBL 3AA8A 3C16A 2JRSA 3BSCA 3M2VB 2ROGA 2KVQE 3N6LA 3I5AA 3OTCA 3JB9k 1OY9A 1X4FA 3K0JA 2IM3A 1YJWS 3SIPB 2GHPA 2C3OA 4RBUA 4Z7CA 4P71A 1ZM2A 1QAXA 1NKCA 3ILOA 5LJ5Y 1G2EA 3H5UA 4M94A 3J81U 2QMUB 4U7UD 1M5VC 1JNZB 4M5DB 2VKRA 1GTEA 3PIOQ 1C2PA 3I5BA 2BRLA 4GVLA 4TU8A 2D69A 5L9XA 4E0DA 1UEUA 3BJYA 3CDAA 4HEA9 5K5MA 2AJ4A 5C24B 5ETRA 1S9FA 4P74A 5L8RC 2K8GA 2V94A 4IFYB 3DXBA 2KN4A 1SV5B 3R2CJ 1HL6A 2DYAA 2VG7B 4Y0FA 4K8RA 2CVEA 4NA1A 3CNQP 4OZ5A 3PIPQ 5K14A 2VFRA 2CPHA 3EGZA 2OPQA 2XEXA 1JLBB 4G1QA 3KHHA 1RACB 2CPDA 3KLFB 2A1BA 3TAPA 1CG2A 5FD1A 4PG4A 2H1YA 1FF2A 1XBWA 4ED7A 4JI1J 3UVJA 3CCJS 1V3RA 3K59A 4O44A 4C0OC 1FJEB 4DR1F 2UUBJ 2AHOB 4J7CA 3KLEB 5E5NA 4H54A 2V69A 4DHVA 2Y1LB 3NY0A 3GIRA 3M2VA 4HHUA 4OIXA 4ATNA 1KONA 4ENOA 2QT7A 1RWWB 2N3OA 1QY7A 3T9NA 3VAKA 3MR2A 2HBRB 1JXLA 4F4KA 1IJEB 1R8CA 2JLFA 2DGVA 2P9CA 3OR2B 4ZPDA 3L09A 4KE5A 4A8OA 2R3VA 4M5DA 4DCPB 1JLCB 3CDUA 2CPYA 2JEGA 1FNXH 2EBGA 3VVTA 3H25A 3PNIA 2YPZA 1FWLA 4IYQA 3J7YI 1WDTA 5C24A 4OYBA 1X9SA 1HI0P 2ZJPQ 4IFYA 1FE4A 1ZA1B 2DVIA 1SV5A 4AT1B 2VG7A 3DMJB 2PT0A 4J9VA 2DGTA 2QYCA 1TUGB 4RX6A 1GX5A 2QG9B 4DPTA 2HGLA 3DRSB 1HW9A 1GMUA 4U96A 3KYLA 1HR0F 1JLBA 1XIQA 4RJVA 3UCUP 4OZLA 3KLFA 3P6YC 3SSRA 3DRXA 1KQGB 2AGQA 3TOQA 2X7IA 2VOOA 4A8MP 4DUZF 5D0HA 4JI6F 1WDDA 2DRDA 1TKZB 3ZTOA 5IC4B 2AJ0A 4Q5VA 2Z8QA 5KT2A 3KLEA 4OYMA 4LBPA 4DV3J 1K9MT 3MOZA 3S6EA 1RTIB 3VGSA 2XS2A 1KC8T 3MXHP 3G9CA 1DQ9A 5CHCB 2E5HA 5L9NA 3UW1A 2FJDB 4DV5J 4JI3F 2QIFA 3AHPA 4J9UE 4I2PB 1KRPA 3SV4A 3D1QA 4FXVA 2AYBA 4QOTA 4DSLA 2KXHA 1S12A 1YLXA 1CULB 1B0PA 1WTFA 4ZCLA 4Z37A 1IKXA 6FD1A 4J9RA 4K7QA 4RW6B 3OR2A 4YEAA 1APSA 4EBDA 3DRRB 1U1MA 2CWXA 1JLCA 2EPIA 3BB5A 4ZPAA 4C2MA 1S0VA 1EQMA 5HI7A 3BREA 1ZZNA 2HHWA 2UV8A 2CPZA 4C8ZA 1SH0A 2HNZB 4L73A 3HJVA 1V6HA 4WKRA 5IT9Y 3IMQJ 3LGNA 1LKZA 4HHJA 4XO0A 3UN5A 1Q86T 5E3AA 4JP8A 3DMJA 4CWBA 2MXYA 4UOGA 3KJQB 2I38A 1KVKA 1SC6A 2VPWB 2HFOA 2Q1LA 3RB4A 5KFPA 1RJJA 3DRSA 4CNYA 3LOUA 2BA9A 1C1CB 1YIJS 4OJGA 2ADBA 1QTMA 5EGYA 1YQHA 3PKMA 3CSKA 4I67A 2FLPA 1EJ7L 2NSCA 1F9FA 2AKWB 4B9MA 5D4PA 4C8OA 1KDNA 3FZBA 2HBQB 4CLTA 1TKZA 2G0CA 1RKJA 4FF3A 3U02A 4QPXA 1SL2A 2XS5A 4UQTA 2CADA 2V8GA 3PR5B 3RR8A 2MGZA 3UDEA 2HMIA 1RTIA 3H98A 4TXSA 4WFZA 3THPA 2J6SA 2YVSA 2HHTA 2HWHA 3T5JA 4NZ6A 1ZOTA 2DT9A 3BKFA 2CPEA 2RILA 4I2PA 2DRBA 4G1PA 1N0VC 1MROB 1PBAA 1CULA 2KHDA 2QYGA 4C97A 1RUSA 1IWAA 4RW6A 4DN9A 3DRRA 2CDRB 3DC2A 1KSPA 3J80Y 4CCHA 3FQLA 2HQ3A 4ES3A 1X4EA 1U1RA 3KJNB 2FY1A 3FUYA 2CJAA 2I1RA 2EK6A 5IC6B 1X7VA 4ECVA 3JTNA 2ATCB 3ENVA 3Q24A 5KFHA 2HNZA 2EFVA 2R9LA 3M6WA 2XMAA 3MM7B 3H2VE 4WFXA 3A13A 4U7CA 3K57A 3IFEA 2PDAA 1H0HB 1B3TA 2B7BB 4PXDA 3NG8A 2IDEA 4RPFA 2AF6A 4DF4A 2XZDB 2ZOMA 4KT0C 4YB5A 4DV1F 1C1CA 3ETMA 1U6ZA 5E3RA 5IQQA 2UUAF 2CQ2A 2A6MA 3MCMA 5KOWA 3ENAA 2JVOA 4GKJJ 1SJ3P 3QIDA 3ISZA 5HN0A 3L95X 2RDIA 1VQ4S 2W7OA 2RHQB 2FHJA 2Y0SD 1S0OA 3DOKB 2QLXA 1HNZF 4OHXA 3AB4B 2CZ4A 2VA3A 4HI1A 3NAIA 1P1TA 1NK8A 2ZH1A 5EDWA 5HMYA 2BV3A 3C14B 1T3NA 5IT4A 3OQ2A 5GAHI 3PTWA 1MROA 1G3OA 1BY9A 1M1HA 4KGVB 4LF7J 2NUUG 2GQCA 3DYAB 2CQCA 2XY5A 4O4GB 4JYAJ 4CI0B 3VCDA 2NYHA 5GMDA 3IS9B 4P7VA 3N6NA 2XBPA 1SKRA 4OI0A 2CWKA 4NEYA 4QR2A 2BW7A 1UFLA 3BV8A 3A3PB 3PYEA 1RHMB 3MOJB 2WTFA 4U9RA 3THVA 4LF5F 4DZ6A 3G6YA 4K0KF 1R0CB 1DRZA 2ILZA 2WB1D 5KT5A 2DO4A 1GNKA 4X64F 1GK8A 4WKYA 2ZNZA 3KMSA 4LFCJ 2CKWA 1Z2LA 3MM7A 4DLGA 1SUQB 2DPIA 3CULA 3D1OA 3I5CA 2E44A 4PPZA 1OJ4A 3CCQS 2CAJA 4JBCA 4MK9A 1NK6A 4F50A 2IVMA 5DM6Q 4ALZA 4ZA1A 3QWUA 3KG0A 1YVFA 3BO2A 1C0TB 3SDEB 5T7LB 4CLZA 4X62F 3U27A 2P5VA 2Z2YB 4B3MF 1T9WA 2HHXA 2ZH4A 1BUXA 1MWZA 3TX8A 1QLNA 2EC2A 4A8KA 2GX8A 3DOKA 2OEJA 1P6TA 1VISA 2ERRA 3UCGA 1ZH5A 2IJFA 4FVMA 2BQRA 5ETLA 4MMOA 3LGMA 3C14A 4JV5F 3OT9A 4ZS6A 3PYFA 3T19A 1CVJA 2YX1A 2KXFA 3HSDA 2CXEA 1S6QB 1S57A 3GCXP 2JJ4D 3K8VA 1V5VA 3AXMA 3Q22A 3DYAA 1U6BA 4O4GA 2C2MB 3EVMA 4LMZA 4ECUA 3IS9A 1M5SA 2QA4S 4EK2A 1TUVA 3RRGA 2MQMA 1LXJA 1AA1B 1VQSA 2KYZA 2PC6A 1V3SA 4NLXA 1T8EA 3H90A 4A8QA 5E3CA 3GONA 5KTQA 1OY6A 2LCWA 1EP4B 3BR8A 5I3QA 2Y1RI 2IVFB 3TX0A 4GRSA 3TZZA 4I1TA 1SUQA 2E7XA 5F9NA 2Q79A 2IPOB 3QFHA 2DNHA 3KKFA 4UF4A 3UR0A 4NWBA 4K4TA 3EYZA 3RJMB 1WUUA 5AXMA 3H7HB 3GIMA 4F26A 5CYJA 4KPYA 3NEKA 1LWEB 4EYIB 1C0TA 3SDEA 5T7LA 1NRKA 3UDVA 1F6TA 2M2BA 2XO7A 4DU7A 2HEKA 2KRRA 3C8YA 4EMDA 1CC7A 3T1AA 3D6HB 1FJCA 3CJ0A 4ZVOB 3CMQA 2PA8D 3KDNA 8ATCB 3PCOB 5ADZA 3WX8A 4NXMF 3AT1B 2VBYA 5KT7A 4OV1A 1HPZB 2DGXA 2FVPA 1FRKA 1FI4A 2JHEA 1TKDA 1VQLS 2VG5B 3ZZPA 5J2NB 2F65A 2HS0A 3OTBA 4ED5A 5HMZA 1S6QA 2HWIA 2M8HA 2MKYA 4ZPCA 4RNNA 4LVNP 4CLLA 1S0MA 4CIOA 1S4FA 3I96A 1AFJA 2QE5A 2F4FA 4ZP6A 3HK2A 4UY8T 3W8GA 2B56A 2UV8G 2DEIA 1IR1A 1JJ4A 1VHIA 1Q78A 4IR1A 5ETMA 3PHEA 3CJTA 1U1OA 2EFPA 2AJ2A 2XMMA 5HROB 2ZFHA 2QGFB 2CNLB 1N54B 1RSCA 2F40A 3G96A 5KG7A 1NH8A 1EP4A 3ADAC 2HKEA 3RZAA 3L4BC 1P9QC 2IDLA 1IUJA 4X4RA 4LJMA 1QVGR 2MKJA 1WD6A 3BPDA 2LU1A 2L9NA 1N5VA 1Z2ZA 1OO0B 2J0QD 1X4AA 1LEOA 1LWEA 3B54A 1WTBA 3HKWA 2W24A 4UUXA 2XS7A 4I4BA 3VZHA 1IBKJ 4ZVEA 4NLRA 1M1KT 3R5BA 3BKUA 5K9FA 5KFSA 4EZ6A 4CLSA 1KNZA 2YKMB 3UCZP 1TQLA 1HPZA 3F73A 2KB2A 1ULRA 3OSNA 4NLPA 1VJWA 4AE5A 2AYGA 4DSJA 3KMQA 2VZ9A 2XMTA 3PW2A 1L5UA 2VG5A 4P9SA 4JI5F 3I0RA 5J2NA 3EGVA 2ZJQQ 2BJDA 5A76A 1VLOA 1LXNA 1K8AT 1WF1A 1CSJA 3VALA 3FDSA 5CXTA 4ILMA 3ELHA 3CWJA 4HTIA 1G1XA 1FJGJ 3I56S 2DNRA 1YBTA 2K06A 5KG2A 1OIAA 3DOMB 1BLUA 3GR1A 1FRMA 2U1AA 4NX9A 4IO9Q 2XYGB 4H4MB 3TAQA 4EZ9A 4LF8J 5HROA 2I6WA 2H65B 4RNMA 1HW8A 3C15B 2EKNA 3ZZRA 4O3SA 2PE8A 3A4TA 4USVA 3CJ3A 2Y3YA 1SJFA 1M5HA 3BM7A 5DS7A 1R0BG 2DR5A 1Y5NB 2UUTA 1JXVA 1RT5B 1R89A 3HI9A 5J1NA 3Q23A 2EKYA 1FD8A 4LF6J 4IRKA 1N36F 1XMQJ 1F5AA 2HW3A 4M5GA 4IH6A 2WVCA 2BR0A 4ES1A 5KFMA 4OZNA 2MLXA 3UFCX 2FLOA 4ZKAA 1RT2B 1LFWA 4ZVGA 2L08A 2D9PA 1PO6A 2YKMA 3PJ9A 4YOEA 4DR4J 3J7AN 2UXDJ 1KQSR 2J6TA 2N4CA 1IM6A 3HVWA 5HMXA 4FF1A 5HANA 2L9DA 1CJTB 2WOMB 3GCWP 5L39A 4JI0F 3W61A 2EI5A 2FC9A 4LIRA 1WEZA 2MZQA 3LQVA 1PGZA 1HNXJ 2WZ1A 4ECXA 3UD5A 1RK8A 3OL8A 3DDNA 3K7RA 1A6LA 2KFNA 3W65A 3VVUA 3N79A 1KTQA 4DUYJ 3DOMA 3M05A 4R8UB 3PRDA 4H4MA 1Z4UA 3OL9A 4H4KC 3W9IA 5ETVA 1VC6A 4C8YA 1OYDA 4ZVPB 1HNWF 2EFOA 5LXYA 4KC5A 3C15A 3ULHA 1U8WA 4URSA 4QIFA 4EEYA 2YWFA 3MMAB 4DFPA 4ED4A 5I4MA 4CZCA 2X3GA 3SBMA 3R2DJ 3FJ2A 1NPPA 3AD8C 5DDOC 1VQ8S 2CJYB 1RT5A 5ETOA 2IMOA 3OSPA 3MHYA 2UVUA 2IRXA 1NDCA 3K17A 3KUGA 3H4BA 5CYMB 2UZAA 2M4MA 2GJFA 3HHLC 2GMJA 3JS9A 3NCPA 1RT2A 2R42A 2DHGA 3IP0A 1JKHB 2E9ZA 3THTA 5HQLA 2CQDA 2D74B 4QU7A 2GMLA 5B0DA 3D4JA 1FRIA 2F4VJ 5ITHA 3EPGA 3MR7A 4QQBA 1M5KC 3Q2SC 1KKHA 4HH1A 4MIBA 1CJTA 2WOMA 4ED6A 1SJQA 5AXKA 2OH2A 1YJ7A 2VHGA 1U25A 2RD5C 4RR5A 2FVCA 1MW7A 5H9EJ 1WG1A 2VIHA 1IBMJ 3BGFA 3U1MA 2RMLA 6FDRA 4WE1B 3T1HJ 3MZIA 2HPUA 1NB2A 3DRYA 1VBYA 4R8UA 4P7TA 1LQ9A 1N32F 3DLHA 1Y10A 5AJ3F 2OPSB 4RBTA 3RYLA 4FYWB 4KHPF 4C0BA 3EZOA 3NS6A 4GVBA 2LDYA 1WF0A 4DPOA 4P10A 3PRVA 4ZLNA 2C2DA 1AROP 1NDLA 3DU6A 2RU9A 1YWXA 3J81j 2E1RA 3MMAA 5GAGU 4F3QA 3QFWA 3SFGA 3HFVA 1M5OC 2IRUA 4ZPTR 2FD2A 2Q6BA 2V6AA 3ZTSA 2JLEA 3TQEA 1YBUA 2JFKA 2AJQA 4DR7F 3CCMS 5CYMA 3I9V9 4RKUC 1SPBP 2J9CA 4ZJLA 3BR9A 3AJ1A 2ZUGA 1LOUA 1YJUA 2DXFA 4YFUA 3QWPA 4NLTA 2EK1A 1N33J 1JKHA 1ACMB 3M8RA 1Q82T 4XK8C 3RB6A 2VQEF 4ZVFA 4CO5A 1D9DA 4WWSA 1HLWA 3RBZA 4PPDA 1GMWA 1B7FA 2DNZA 4HYKA 5JVGQ 2YY3A 3T1YF 1MMNA 4K4SA 3R8YA 2YX7A 4B9LA 4HHHA 1QSLA 1N56A 4ZCIA 1ROFA 3QJPA 3PJWA 4WE1A 4LQ9A 4EFAC 4B3TF 1OY8A 4Y65A 3OL6A 2KRBA 3TA0A 1GMVA 1TAQA 4NLUA 3JSMA 2OLWA 2PEBA 4FP9A 2OPSA 3NGKA 5LMUJ 4DX5A 1JLGB 1U6FA 1GXUA 1BD6A 2X1FA 2DNYA 4WZQA 2P6TA 4K2XA 3MEKA 2GCFA 3HT3A 1UJ4A 4LRDA 2O67A 4JV1A 2FGOA 3QGHA 4OZ0A 3VGUA 2LA4A 4NOHA 4U67Q 2W2MP 2O01C 3OHAA 2D3OR 3HHEA 3NNHA 3W2WB 3SEOA 4Q43A 2J0WA 3C46A 4URQU 1JJCB 4FS2A 1ZM3A 1VJQA 1AUSL 3KLVA 5KFAA 5KFKA 1QTNB 3M8PB 1FHTA 3MR3A 5F9LA 4L3NA 1NZ8A 1Y0HA 2ZM6F 2XC9A 2CPJA 2BW2A 1HIYA 2WBMA 1FDNA 2CQBA 4F4YA 5J2QA 2G0IA 3M1VA 4ZCMA 4TY9A 5GAHU 3P49B 5J1PA 1MN7A 4CYUB 1Q8LA 4NA3A 1VQ7S 2P9EA 1O5JA 3V2UC 3PFEA 1L3KA 4F02A 3OPKA 1FX2A 4NASA 4C9DA 4NMXA 2HVDA 3IRWP 5MLCV 3TNVA 2C2OB 3G6ES 5DG7A 4DR1J 2RB7A 1JLGA 5THWA 4B9NA 1GTHA 4F36A 1VQKS 1RLCL 1FVSA 3F41A 4TLQA 2MPUA 4X4VA 3GG1A 3H0PA 1PJ5A 2J7WA 3NAHA 2VBWA 2V0NA 4F25A 2OO4A 8RUCA 1UTAA 4OHYA 4L75A 4LSZB 3KLIB 1S5ZA 3C6TB 2APOA 4JI2F 3ZZZA 3W2WA 5DQHA 2YNHA 1T9YA 3B82A 4DQQA 3CC7S 4U95A 2B0GA 1T9XA 4ERDA 2M5YA 2LP4A 2W8LA 2W2OP 2LXUA 3M8PA 4ICLB 1RISA 5L1KA 3SSQA 2CQHA 5C7PA 1A7GE 4ZJOA 2F3JA 1WF2A 1JLEB 1KN6A 5RUBA 3O44A 1PKUA 3IA0A 3M8WA 4LF7F 3T9ZA 5KFLA 1F9EB 2OFGX 1RI7A 3CDWA 4JYAF 4OFZA 1RP5A 2IM1A 2NS1B 2JC1A 4NE9C 4CYUA 4DF8A 2WRMA 4IG0B 3PV8A 3V4MA 3AOCA 3W64A 2QJ3A 4USJC 4CO2A 4ZIWA 5SZTA 1FK9B 3CO0P 1RHRB 4N77A 3W63A 3I4HX 2JEIA 1FT8A 1F2HA 4CM2A 4DUZJ 4JI6J 3DLJA 2VUGA 3CD5A 2DY9A 3O8WA 2D3O1 1CQMA 2VICA 3P3DA 4QWAA 2F5GA 4JI8F 2WONB 1HWUA 3M6VA 4CDIA 4J9MA 2LEAA 1NUEA 4O3QA 3FBEA 4JI3J 1NDKA 3RAQA 1JLAB 4Y2CA 3ZZ0A 1HBMB 5IOLA 3BQ1A 3US5A 3DLEB 2XQCA 4Q0BB 5FLXU 3D9BA 3ZZYA 5C2CA 3W5XA 4O3PA 2DPJA 3KLIA 1VBXA 2CQ0A 4I2QB 4PG6A 3C6TA 3N0VA 2XMUA 4A8FA 2KM8C 4WP9A 4J9NA 2JFDA 4URGA 3PFOA 1T02A 2XZWA 3PZPA 1I94F 4GC6A 1TL7B 1NKEA 2AX1A 4DOZA 3UN3A 1GFWB 2MKCA 4PRFA 3W8PA 1SQGA 1WACA 4ICLA 1EARA 1NJIT 3MD3A 3AQOA 1YKWA 2K2PA 4WTYA 3ZZUA 1JLEA 5CZXA 1S1VB 1RZMA 3SYZA 2RJZA 4OX9F 1KOHA 3GJRB 3SZ2A 2NLWA 3TP2A 1FERA 3GB0A 2IYIA 1FVQA 3MEDB 1RHUB 1KP6A 4LREA 4O23A 1BWVA 3L7PA 5GADI 2AGPA 1F3VA 1WI6A 1FK9A 3G4SS 3CCRS 1HBOB 3HP6A 3A3NB 1WC4A 4HACB 1RADB 3IWXA 3HVAA 1T9VA 4PXBA 3ZZOA 1RT1B 4CT9A 4DMZA 2LQ9A 2WONA 1S48A 2DNQA 2G9OA 3N28A 4P75A 1D9AA 4LF2A 3S8SA 4F2SA 3P5BP 4NLYA 1JIHA 1JLAA 1HQEB 4WBFA 3BDPA 1DLOB 1HBMA 3DLEA 4Q0BA 1S9EB 3T6BA 2LECA 5F8GA 2PFFB 2YKOA 1FKAF 5J1EB 1Y4ZB 4R25A 4NYZA 4I2QA 2BJ9A 5GMKa 1YGYA 4X84A 4ED1A 4ZP7A 1T95A 3CJ5A 2A6OA 2IJNA 2HLTA 1TL7A 1FD2A 2OTJS 3W62A 3MUTP 2ZZTA 3TA2A 3WX4A 3O5TB 2V9KA 1NBEB 2VODA 2BE7D 2R7QA 2HURA 3DHXA 2HNDB 2F7VA 3DHWC 3OVSA 2HS3A 2RRNA 2AQ4A 4ED3A 1S1VA 2DNLA 1QUPA 2CZ9A 1FTRA 5G0RB 3H40A 3I31A 1S99A 2QL9B 1KEKA 4ED8A 4W98A 3D68A 4BC7A 4FDFA 3A8JA 3H5XA 3MEDA 3VAMA 3NWGA 3ISNC 1S1WB 4DV1J 4MKAA 1U0HB 3A8KA 4PCQA 1SH2A 3LP1B 4Q2LA 5D4OA 4JI7F 3RBDA 3ENWA 4NI2B 4HACA 2WW4A 3CO9A 4BS2A 4NCAA 2O1PA 1HI8A 4Q45A 1HNZJ 4WTOB 2FHOB 4TN2A 2ASDA 1RT1A 3BGUA 3JAMU 1Q79A 5ETKA 4ELTA 1OYEA 1FDDA 1KFDA 1HQEA 1DLOA 3LTOA 1LW0B 1KOOA 2BE9B 3BKTA 2A18A 3JQMA 1S9EA 2LXIA 5J1EA 3VTIA 1NJZA 3TVKA 4BWJA 3VGVA 3TVZA 2ZH7A 2K3KA 3BQ0A 1F1BB 1G4CA 5JUMA 5D8HB 2CJXB 3HSZA 1UMJA 4HI2A 2PFDA 1NK5A 3FCVA 4ECQA 2QV6A 3QGGA 2GIFA 4K0KJ 2KT2A 1WOPA 1U1PA 4DV4F 3OTEA 4ELUA 4ZMMA 5K20B 4X64J 2RS8A 5KFWA 3EDQB 5E41A 3A1YG 2HNDA 4YQWA 4PUOB 2HVEA 2BANB 1XMOF 5G0RA 2F9DA 4KJIA 1HWKA 5A0YB 4FNHA 5LMNF 2XSFA 1TMJA 2ZHOA 4K50A 2ZH8A 2MZTA 2XLIA 1S1WA 4DI6A 4X62J 1U0HA 4B3MJ 3K5MA 3LP1A 1S6OA 4ZVQB 1QAJA 1IM4A 2XYPB 1EHWA 2AYEA 4NI2A 2MQLA 4LF8F 2ADCA 2ABYA 2NUHA 2N4DA 4TYAA 3IRXB 1SH3A 2NPIA 5H9FK 3DFEA 4E8UA 3TA1A 1GH8A 2XMKA 3M2UA 5AXNA 2MHEA 4OYPA 3GV5B 1VBZA 4JV5J 4USIA 4V19X 4MKVA 1U09A 1O6XA 2OD4A 1D9FA 1LW0A 1RU2A 2IBOA 1VOMA 4NA2A 1H2VZ 1RYRA 2M88A 2V8DA 4DQRA 1FRJA 5LXRA 4MIWA 4KAIA 1JJHA 4C3MA 4FXDA 2QL5B 3BSAA 3OJSA 5FLXY 3D54A 2AJ1A 3OTOF 1KVIA 3CIMA 5HBMB 1PCAA 4DQSA 3AD7C 4B17A 4ZJQA 3W9JA 4L74A 2QX0A 1U45A 2V67A 2VDHA 4PKDB 5EWEA 4QZVB 1T03B 1TL3B 2Y8WA 3VF0B 1MU2B 2O3DA 2B7CB 4G65A 5C5JA 3BSOA 2OUGA 2XY6A 2DB1A 1T9UA 2BANA 3UPFA 4USKA 1S49A 3M8SA 2ZE2B 5A0YA 4QYRA 2ACMA 4OJHA 2FHMA 3HF5A 3FRZA 5I42B 2ROPA 2U2FA 3CCLS 1XR5A 3VAIA 2B3TB 3PXGa 2K3IA 2FJEB 1Y3KA 4S0MA 1Q8KA 5FIIA 4ID8A 1VFJA 4KO0B 3IRXA 3E01B 3H5SA 2DHXA 1X9MA 2PMHA 5F8LA 4NXMJ 3CIZA 2EG2A 1BWEA 1F0XA 4ANEA 4I64A 1VS3A 3O6QA 2WVEA 3KJFB 1HHTP 1RT4B 4RUAA 3QLHA 4KGZB 4QU6A 1O51A 1BGXT 3IM9A 5F0WA 1FJ7A 2R7RA 2HHHF 4M5IA 4LFAF 7FD1A 1RAIB 1F9HA 2UXBF 3IBWA 4L6V3 3WIVA 3WC0A 3R1HA 3KHLA 1N34F 1TP7A 5HAOA 1HHQA 5LJ3Y 1HQUB 5M2RA 3NWRA 1HYSA 3FEXB 5KT6A 5HBMA 4TKTA 3HPOA 2V8HA 2OHDA 1Q16B 3NGTA 1TV6B 2LQ5A 2QTWA 3M8QB 2E1MC 1T03A 2XGQA 1TL3A 5KAKA 2NXUA 1MU2A 1HBUB 2XLKA 3OHBA 5CD4H 2VF3A 4LQ3A 3CF5Q 5H9EK 2GO9A 4Q8FA 2AYMA 2VB6A 2ZE2A 1SKWA 2ZKUA 2FJBB 3ZTQA 2B9XA 2J9DE 3ZTRA 2DR8A 4LF9F 5I42A 2DTJA 4KR0B 1H38A 1QM9A 3QGPA 2ZBPA 3DOLB 2QN6B 3PO4A 2HHVA 3J7A1 5F8IA 3NKYA 4JI4F 2FQQB 2L3MA 4W92B 4KO0A 3E01A 3ONQA 2B5JB 5F8JA 2FYXA 3R6GB 3EDRB 2WVDA 3TZYA 1RWKB 3FQKA 1VIXA 1RT4A 5D6GA 5HQ8A 2HRYA 5HK4A 4JI5J 5DZ7A 4BBYA 5ETQA 1H98A 1QSYA 4W4MA 2HS4A 2ZBRA 1XR7A 3Q0AA 5EHHA 4M5KA 4B3SF 3CB4A 3PW7A 4ANDA 3OFHA 2GW8A 3HZGA 4QWDA 3VZIA 4K4YA 3PX6A 3H59A 4KGXB 1HQUA 2Z56B 3VAHA 4J90A 2ASLA 1YG0A 1ZM9A 2OAUA 3KK3B 3EE3A 1ZTTA 1TV6A 2I0XA 4ECWA 1AW0A 1K0VA 4X4TA 3CD0A 2CQGA 3L9ZA 3M8QA 1EIYB 1NLKL 1VCTA 2YNGB 3RAMA 2YWEA 3IC1A 1HBUA 1TVRB 3GYGA 3M6UA 4RW7B 3MFHA 3PO5A 2M52A 2MJUA 3Q8PB 4P2XA 1VQNS 4DQIA 3D0HE 1S97A 1D3WA 4C0HA 2ASJA 1DTQB 3DCAA 2HHQA 2AEJA 3HX9A 3RU0A 2MLZA 1N88A 4RWWA 4NLWA 4UUWA 5C2GA 4K4ZA 2LQBA 2PGCA 1LFPA 1U26A 5A8RB 4OZ1A 3UWTA 3UQSA 2E7WA 3HFZB 1N36J 4F0HA 3DOLA 5HMWA 2E7VA 1XNQF 3IR6B 2WBRA 4O44B 1X4HA 2OJ3A 2DO0A 4ES2A 1UVKA 2I8EA 4RUBA 1OPZA 2MYFA 2HVIA 5CA5A 3PX4A 2ZJRQ 3IAS9 1TFYA 4WZMA 4GC7A 2B5JA 2JC0A 2GHVC 4ECZA 2B8PA 2VPYB 2PIIA 2BUNA 3HHNB 5D4LA 3TANA 2XMWA 2Z2LA 2X1AA 5HQMA 5DLFA 4JI0J 1EAYC 2LFVA 4IFVB 2HHUA 1B99A 3GTYX 2KI2A 3ILJA 4WFNQ 5MAOA 5GVQA 3RW7A 1T11A 5L38A 2DBBA 4ETXA 4C8LA 2HFVA 3MECB 2QMXA 4QIWD 4HT5A 2MLYA 2OSQA 1JJ2R 4IO1A 1F3FA 4M5HA 3KK3A 3I6PA 4KHMA 4LRFA 2E9RX 1HNWJ 2ZZNA 3GYNA 1FEHA 4ZITA 2YNGA 4C3KA 2VFTA 2BX6A 1TVRA 1QDUB 4RW7A 3BF4A 4BC9A 2V2KA 3K2YA 4MYUA 4ZIVA 2KYXA 1DTQA 1PYTA 3CDEA 1OSDA 4DX6A 2UVVA 3BDEA 3GIIA 1TELA 3ZNJ1 1R0AB 2BRKA 3H8YA 5A8RA 1YK9A 1HQ2A 1VRTB 1BXNA 1MNEA 2E1CA 3QT6A 4X2BA 2XCAA 4IOAQ 4FYYB 9ATCB 1P9YA 5ETTA 3SSSA 2BM1A 2MJNA 2HQGA 4DSEA 2C3MA 1U8SA 1VI7A 3BO4A 3FBCA 5B0AA 3G2XA 2IYGA 1LW2B 4PG5A 2J8SA 2CA9A 2KHCA 1YDLA 3HHLB 3FEZA 1HD1A 2R8KA 3GJTB 2CPXA 2JSXA 1H2TZ 1IKXB 1VQYA 1VR6A 3CCSS 5KFGA 1RYSA 5JJBA 3MTKA 2PMZD 4IFVA 4LR9A 1VK8A 5J2PB 1J5EJ 3M8ZA 4AXJA 3MECA 5IWAF 1S79A 2SXLA 4NRUA 2FLLA 1KWMA 1LWFB 2DNPA 1N32J 4A8SA 5AJ3J 1V9OA 4KHPJ 4Y2MA 1VGYA 2ZOGA 2EFQA 2R7SA 3CD7A 2C1EB 2WAQD 3G6XA 2FZCB 3HZEA 3CPWR 3NOCA 4ZPVR 4DZDA 4J91A 1JX4A 4YR2A 4Z2XA 2ZH5A 4H4KA 1U1KA 3CMES 2ALYB 4LFBF 4LSNB 4YR3A 3I55S 4X66F 4YB7A 1R0AA 3IR5B 2VDIA 2HZCA 2VD3A 5GADU 4DR7J 1VRTA 2LQJA 3G8QA 4NEZA 5CH7B 3CVKA 5F3ZA 4DR3F 4Y00A 3BGOP 4U6PA 4DFKA 1ZPVA 2GMHA 3HSJA 4FPRA 4OHZA 2RIJA 2OKQA 2FJVA 2MGZB 4UT4A 2HMIB 2FZGB 2UU9F 3FEYB 2E1AA 4OYOA 3M6XA 2AIRB 1UW9A 2GVZA 3LWMA 4O3RA 1EX8A 4RO0A 2VQEJ 1LW2A 2R8IA 2XSJB 1Q7LB 3EXCX 2XYHB 3HHLA 2HFZA 3NGDA 2WVFA 3MURP 3UNYA 1XMBA 3T1YJ 2HAFA 4OYXA 4OL8A 1XNRF 2DISA 5J2PA 3UDLA 2B6AB 4DL5A 2DR6A 5T14A 5A8KA 4B3TJ 2CVIA 4RL1A 3MI7X 1LWFA 3VAJA 5EUHA 3IGVA 4ZP8A 1TUWA 5EX3A 6AT1B 3TUPA 3FBBA 4C98A 1B7YB 1UKUA 2OELA 5GAGI 1SVDA 2YX4A 4X4PA 1NNDA 2OEKA 2CDQA 2VPXB 4RLEA 4WYWA 1FDAA 4DL3A 1ZETA 1FNOA 2RQKA 4LSNA 4GO7X 5JMNA 4WFAQ 2EW9A 4BHQA 2ATLA 2VASA 5IS2A 4YHHF 2QL7B 3R5JB 3FGVA 2W8KA 1ZAVA 3GG0A 1U47A 3SCIE 1S76D 1S1TB 4RBVA 4OX7A 4FNIA 2CG4A 2AEMA 4M5MA 3AXKA 2E5LF 4AL6A 1WELA 5KFQA 2YPYA 2QC3A 4N7TA 2ZM6J 4DG1B 3T6JA 1I51B 4RZRA 1BQNB 1VHFA 2XSJA 1U24A 4N76A 2V50A 2BKOA 4E98A 4X4UA 1WKLA 2IVYA 1YRTA 2MZSA 3NS5A 4ED2A 4K5SA 4F4AA 2KO1A 4WP8A 2LEPA 3IWNC 1HNIB 1NM2A 3J81Y 1URNA 2B6AA 4QW9A 1N5SA 3BPSP 4QWBA 2HIYA 2GGPB 3MFIA 4DS5A 3RW6A 3KOAA 3KK1B 5DM7Q 4Q8EA 1JXEA 3NLCA 4B9VA 5IV4A 3EWGA 2OP5A 3RRKA 1WG5A 2E1PA 4EYHB 3Q2TC 3MM5B 4AQYF 2Z0GA 4RW8B 4DJBA 3CEDA 4C4WA 3CCTA 3DU5A 1DZ5A 3MAAA 1NO8A 1NZAA 4Y28C 3LPEA 1RAHB 3N5BA 1D1UA 1VMBA 1Q8IA 4JI2J 1S0NA 1WNEA 4MKYA 1S1TA 5DDQC 3IGNA 2W4DA 1WSRA 7AT1B 1HWJA 1IN0A 2GO8A 1B0VA 2LVWA 2W7PA 4CP5A 4FXWA 2A3JA 3B8HA 1RCXB 3PM9A 1TKXB 2DRAA 4CQ1A 3GFHA 2IBKA 4DS4A 4DG1A 4B08A 5KFFA 4DFJA 2CQ3A 4Y2IA 1D8ZA 1BQNA 4YB6A 3ZC4A 3Q86A 1TU0B 5L46A 2CYYA 2NZ4A 3OXGA 3DNCA 1X60A 4F4WA 1X0PA 4QYZK 3R5CA 1NXIA 4ZVRB 3Q89A 3KLGA 1YHQS 3L7OA 2J5AA 4IG3B 3KFWX 5A6PA 1YJ9S 1HNIA 4OJ1A 3NS7B 5LL6d 4LR7A 1XWLA 3D6FB 4MIAA 2LEBA 2HHSA 2B4OA 1Q1KA 1RWUA 4YY3F 2LU2A 3LP0B 2HNYB 3JQJA 2FIUA 1SBRA 2GGPA 4U7UK 1XK8A 1BHNA 3V6DB 2C3UA 1YRXA 3KK1A 1R8BA 4OLOA 4I6WA 2ZZMA 2ZVIA 3B4MA 4JI8J 4DV0F 2CPFA 5GAEI 2M3DA 3DDKA 5I3PA 4OLPA 2DH7A 2MDAA 1KD1T 3MM5A 3ENQA 4CNZA 3D1HA 4RW8A 2OPRB 4ZOSA 2NXJA 2MMYA 4FVCA 3HT0A 1HARA 1EKSA 3NNAA 2G2ZA 4FBTA 3R9LA 1L3SA 2C42A 2UVRA 8AT1B 3MPYA 1X4BA 2QZ8A 2HLUA 7FDRA 3HFKA 5F3TA 4HT7A 1I94J 5AT1B 2M0GB 3HXMA 3IBCB 4BLGA 4IOCQ 4ED0A 4M95A 1TKXA 1UCNA 1PC5A 4NMLA 4D3HA 3LF0A 3ET6B 2GQ2A 2KM8B 1M1GA 3LH2S 3MM9B 4W90B 3N01A 4OX9J 1UA1A 1RA6A 2CNOB 4CH7A 1B0TA 2R2TA 2XG8A 3AA9A 3RG6A 3CE8A 4KTQA 4NZ7A 1QAYA 2V8PA 4IG3A 2RAQA 3L7UA 2D9OA 1A0OB 1DURA 3LP0A 4QJVA 2HNYA 2VONA 4RNFA 2VQFF 1JLQB 2VBXA 3K5NA 3V6DA 2B8QA 5HVHA 4PG7A 3MAHA 4Q2MA 1QSSA 5CCLA 2MQ8A 4PZVA 1S77D 2F8EX 2OPRA 3EXYA 3QAEA 3QZ7A 3W9HA 3HULA 2GAGC 1K1QA 4DSFA 2D3ZA 2VU5A 4DPYA 1GT8A 1TMMA 2YKAA 3EVWA 3WBZA 2GAHC 4CH0S 3F44A 1TTHB 5DQIA 4IDKB 2YWWA 1TK5A 5IZHA 4V19J 2HQIA 1UWBB 3CCZA 1L3TA 4U8VA 4DV6F 2IM2A 3CTRA 1DY3A 1UETA 4PQAA 4U8YA 1EZZB 2MKSA 3ET6A 3D67A 2EFNA 3I0RB 3CJSA 3TARA 4AYBD 3SI8A 3T5LA 2J9EA 3CJQA 3MM9A 1FXLA 2RVJA 1QAIA 2FZKB 2HAIA 1C0UB 2B43A 1X5SA 4USUA 4JI7J 3MMCB 2K7JA 2KU7A 3QRPA 1UL3A 2AV5A 4QWEA 3ITHB 2NXNA 1SL1A 1JLQA 1JMTA 1MN9A 4A48A 5E3QA 2BMBA 3CXCR 3TI0A 1WHYA 2XHWA 1SXLA 2XTJP 4ZLLA 4J37A 3LP2B 1U1LA 1N5YB 1KBRA 4ZVSB 4B3OB 5KFBA 4I7FB 1N0UA 1RXOB 3GFZA 4ZLJA 3TZXA 1X5TA 3FCHA 2VC1A 2A2DA 2O5DA 3IR7B 5IT9U 3NGUA 1YRUA 3E3XA 3D7SB 1Y11A 2J7UA 2VJUA 3NP5A 4KBIA 4CLKA 5DLGA 4DPUA 3GQCA 2CJKA 5L1JA 3U1NA 2VKZG 1C4CA 1VC0A 3R7SB 1RAGB 1XTZA 2UVWA 4IDKA 2DGSA 2P6SA 4AXIA 2NSBA 1UWBA 3Q8QB 3PYDA 5K8PA 3R27A 4TLRA 2UXCF 2HG4A 1ZTWA 4PXEA 4OYAA 1TZ0A 4WU3A 4DV4J 2IJRA 3VHQA 4CLUA 4WCEQ 1NB7A 2RT3A 4OI1A 5D15A 4C3LA 2VFVA 2WHOA 3FZ2A 2C2RA 5BJRA 3R6LB 3MPVA 4DN0A 2L9WA 1XMOJ 4IR9A 1VYAA 5LMNJ 1C0UA 1U48A 1IKVB 4FKXA 1NSAA 4J5OA 4L3KA 4RUCA 4DFMA 1YSJA 1Y5IB 2IRYA 4HDHA 4DV2F 2HRTA 3MMCA 5B0GA 4FF2A 3N5FA 3VWSA 2B4UA 1Q5VA 3CCVS 1RT7B 3IG1B 1NCLA 3ITHA 2VV5A 2DD8S 2QSWA 3G87A 5ETNA 3MEGB 3SV3A 3J80U 1M5PC 2KG1A 4K4VA 3VQTA 3B4DA 2HVZA 1HMVB 3LP2A 1PJ7A 3W5YA 1N5YA 2FHJD 5B7WA 5KG4A 4B3OA 3GFYA 2PSZA 2VG6B 4I7FA 3F56A 1PAUB 1J2VA 5H9FJ 4FYXB 2C2NA 2ROEA 2QFIA 2B51A 5D0RA 5FJ4A 1RU1A 3LO3A 5KT3A 4Y2KA 2RUSA 2DEJA 2JLGA 2ZD1B 4UOFA 3TR5A 4IQMA 1S7HA 3M9OB 2CQ1A 2DIVA 5HSPA 3ICLA 1FTCA 2H9ZA 2HGMA 2EEYA 2DGWA 3A8EA 1JLFB 3EMTA 1FXDA 3OTOJ 3OXFA 3QJLA 1PYSB 4Y34A 1SC4B 4Y3CA 2V2QA 2HFUA 2AU0A 3FCWA 4Y6IA 3RGIA 1R3NA 3O3LA 2RDDA 1WHXA 2QA1A 2FVRA 4HLBA 1TKTB 2N7YA 3QBCA 1S59A 4ZLPA 2I9SA 4DR2F 5A6WA 3KNAA 1UW4A 4OI4A 4WXWA 2Y1JA 3KG1A 1IKVA 2R7OA 3IO1A 2A10A 2W7AA 3BQ2A 2COLA 3OFGA 3M7VA 2ZOFA 2E9TA 3F0NA 2Q43A 2NR0A 1UVNA 2CG8A 4PYDA 3LGHA 4C6AA 1PG5B 1VLYA 4WK1A 1RT7A 2VFUA 4Y2AA 4GVBB 3IG1A 3S7RA 4LRAA 2VC0A 3W66A 3NNCA 3VV2B 4JUZA 2ZBIA 3MEGA 4ZN3A 4DPWA 2EC0A 1HMVA 4QWCA 3ILLA 2PMWA 1AUDA 1XERA 4QR1A 4DUTA 2VG6A 2X3DA 4P72A 2XO6A 4EBCA 1K0TA 3DGPB 2KJVA 1U02A 4QIVA 2ALZA 2MY7A 3GR0A 3Q8VA 2HHHJ 1R43A 3IWLA 4LFAJ 2ZD1A 4YN3B 1ZBTA 2UXBJ 2PN6A 5HJYA 2A0FB 3GP9A 1GX6A 1N34J 4QCLA 4LT6A 4O3NA 3PY8A 1JLFA 1Q95G 2F63A 3D66A 1FRHA 2JX2A 3OTDA 2DGUA 1UPPA 1VQOS 4NL5A 3RB3A 3SFUA 3VGTA 5I3UB 4LVOP 3LUYA 2ZBQA 2MKIA 4HR2A 2KL8A 1W26A 3CD6S 1Y00A 2JZ5A 2YQ0A 1TKTA 1KLNA 2BOAA 4DWIA 2XI3A 5DG8A 2MSTA 1XC9A 4IRDA 1VQMS 1J5EF 4LF9J 2AZ3A 2W4PA 3GJQB 3NCQA 4DR5F 4EU0A 4IH7A 3JSMB 1U0SA 5C42B 4NLQA 4JI4J 4B9TA 3O2IA 3M9NB 1YI2S 3R1LA 2XY7A 1S1UB 4MT1A 4EUVA 3FRYA 2FPHX 4KY3A 1SIWB 3POTB 4WP3A 4NLOA 4NLGA 3CDBA 5F8HA 2VOPA 3DGPA 4UZBA 1WC3A 1IWGA 4JV0A 2XI2A 2AMCB 5DO2A 5KFNA 3TVYA 3LA0A 4PABA 3ZO7A 2GVDB 1U7LA 2HWTA 4B3SJ 4MJKA 3HMJG 1U2RA 2DKOB 2ZWOA 3M2RB 2X51A 4ZCKA 2MKKA 3G8SA 2PA3A 2KH9A 3C2PA 4DR6F 4OYIA 1H7WA 1RDRA 2OPPB 3G86A 5BR8F 4QW8A 3EZUA 1H7XA 3D0GE 2R7VA 2BJEA 3QT8A 2JEJA 5B09A 2AT1B 4USHA 5I3UA 2M70A 2BACA 4IRCA 2ZH2A 5J2QB 3GU0A 3M1VB 3K5OA 4NZ0A 3H2UB 2OIHA 3VQSA 2ZC4A 2M9KA 3KHRA 5CZVA 3V5RA 1TR0A 4B9SA 3HD1A 1Q0NA 2R4FA 3RTVA 4C48A 4JOUA 1X5PA 4ZDNA 3UO0A 4NYOA 2H5IB 3NBPB 1L3UA 4LRCA 1Q8BA 2AP6A 5JXSA 1XNQJ 5C42A 2RRAA 1FESA 3LW5C 3CUNA 2AEFA 1AYEA 3QGIA 1H72C 3SQGB 1VRQC 4OI2A 2QMWA 2KZZA 1S1UA 2ACYA 4PG8A 1ZA2B 3AOBA 3GSDA 1NSQA 3MPWA 1X0FA 3POTA 1U2CA 1XJWB 5ETPA 1UEKA 3OFEA 2CNKB 5A8WB 3GILA 2YWGA 4YDDB 1BE4A 3PDNA 4ZHRB 2R8HA 2JH3A 5HVFA 2M8DB 3W3SA 4P52A 1B64A 2DHAA 4YB1P 1WC0A 1N5QA 2DGQA 1RBAA 2VFSA 2XM3A 4WFYA 3W7BA 1CJKB 3R7NB 3AODA 4XDCA 2EXUA 1NU4A 2WSCC 2VJVA 2GVDA 1RWMB 3G8TA 4GKKF 4ITSA 3AQPA 2YH1A 2YNHB 4XDDA 3M2RA 3DLBA 4X4SA 1BQXA 2YNIB 2FVQA 2OPPA 3DGVA 4DCJB 4USTA 2G1DA 5IT0A 2NYIA 3AD9C 1CC8A 1NJXA 2CFXA 1RTHB 1XR6A 3KG4A 3CCES 3FBFA 2HHPA 2J8AA 3UNGC 1F5BA 4FF4A 2OTLS 1H73A 2J76E 1H74A 1OPIA 4PR6A 1J27A 4F0KA 1SI9A 2LQ8A 2IMWP 2RQMA 2HK2A 1N52B 2BVZA 3ISND 3ZFVA 4KYZA 3OLAA 3TAMB 2F9JA 1PBUA 1KQFB 4DSKA 4N41A 3BBBA 3BBFA 5AE2A 3NBPA 1B4SA 1KR4A 4RUHA 1XQIA 1ZPWX 1FA0A 1T7PA 1DHMA 4USMA 3K89A 2RS2A 1WOOA 4DLEA 4ECSA 4J9SA 3SQGA 2DJWA 1URRA 2F8MA 2LYVA 3H42A 2CQPA 3AB2B 3H4DA 3PG9A 4ILLA 3BS9A 5A8WA 5JVHQ 2CIMA 2E5JA 4ZHRA 2AW0A 5GAEU 3MD1A 3NGRA 1T05B 5KG0A 5KG3A 2DH8A 4N5SA 5KFOA 2R7WA 2V2VA 1CJKA 3D6MB 5GMEA 3TWZA 4HH0A 2V8VA 5KFEA 2Z2ZA 4OYZA 3M9MB 3QJJA 3C66A 2YNIA 3FVYA 1KLMB 4PAAA 4HVZA 5IWAJ 2AD9A 1NEEA 3H20A 3TW0A 4O3OA 4M8LA 1SQEA 5CD4A 2Z30B 1RHJB 2ZNYA 1RTHA 2XWXA 5BYRA 1NK0A 1PJ6A 4A8XA 2OMLA 2MKHA 2W01A 2MQQA 4X65F 3QSIA 3RRHA 2Y8YA 5EWFA 3GPAA 4WK3A 4YUDA 3SQOP 4DL0C 5KFYA 2UUCF 1Q5YA 5KFRA 3TAMA 4LFBJ 1UA0A 4CLPA 4X66J 4ZVHA 1IXKA 3S1TA 4A47A 4CT8A 3DI6B 4AUKA 1RWVB 2OI2A 4DR3J 2MSSA 3S01A 1UZHA 3PRBA 4EO6A 1VDHA 4A8WA 4RNHA 4ECYA 1AZSB 1WEXA 3FMWA 2DK2A 2UU9J 3EJMA 1SC3B 4P2FA 1RHQB 1UEVA 1LWXA 3GJSB 1FFSB 4NRTA 2VBZA 1T05A 1Q7YT 5E33A 2YQ1A 1QJHA 4OZ2A 3HVRA 3MR6A 1HNVB 2IFXA 5U47A 4PQUB 1VQPS 1XNRJ 3QT5A 2R7TA 2HZVA 2KFYA 3HLUA 1KLMA 2GS8A 3SMZA 5IV3A 4C8MA 3UD3P 4LBIA 1SKSA 4M5LA 4OX6A 1WEYA 3Q83A 1FO1A 1DTTB 2QO3A 2Y9HA 3EICA 3GV8B 3I32A 1NJWA 1YBAA 3NMAA 1PYOB 5KG6A 2HBYB 1KVJA 4F67A 3TZWA 2HSEB 4J9PA 2CQIA 1A9NB 1Y3JA 1RTJB 5L1IA 3SCJE 3P4UB 3WHIA 4QIGA 2KDOA 5K8OA 3DLGB 4Z7YA 3V6HA 3BN7A 3VR1A 5DG9A 3BN4A 4B02A 1HKAA 2XULA 1O0PA 2H54B 2P8IA 4CO1A 4A46A 2DITA 4KRWA 4YDXA 3M30B 4YHHJ 3DI6A 1HWLA 1U4BA 2YKQA 1S9GB 5HO4A 3CC4S 3NCRA 2OD6A 1HA1A 1RWPB 2PI4A 2E5LJ 2Z57B 1AZSA 4WJBA 5LT5A 2LMIA 1AB8A 2HZAA 2XHCA 2DH9A 3GWCA 2POKA 1RAAB 3MCOA 1LK5A 2CJBA 1L3VA 1KFSA 4P6QA 4CM0A 1UJ6A 3FKBA 3GV7B 3R5GA 4NLDA 1SL0A 2YKNB 4ECRA 1HNVA 4NXNF 1YJNS 2V63A 2ILYA 4PQUA 1G7CB 1G6BA 4I0WA 1GMWD 2LXFA 2W2QP 4ZP9A 3H2LA 3PX0A 3NL0A 3CGIA 3MEEB 3QQCD 1DTTA 4UW2A 1X9WA 4PYAA 3HSGA 2KVIA 4P2MA 1RTZA 1SJ4P 4XTTA 4ILRA 3C6UB 3JSYA 1HBNB 4UQGA 1XEZA 2I2YA 3E2EA 4LF4F 1RTJA 1WSVA 1DAXA 4AQYJ 3NGSA 3VAGA 1MG7A 3MDFA 4KKOB 3DLGA 1WG4A 3CCWA 5LOQA 4KFBB 1NPKA 1WOSA 4DSIA 1EQ0A 2YH0A 3CJ4A 1JQGA 3M30A 2BOPA 1HI1A 3KDOA 3U1LA 1F60B 1FKPB 1S9GA 1NK9A 4IKAA 1Z1ZA 4B3RF 3UN2A 2D3UA 1MMDA 2V4JB 5M2UA 2Q6CA 1IBLF 3M2UB 2KZMA 2O66A 1P27B 2P9GA 5E0OA 3I87A 4KH0B 4KGKA 1QE1B 3TQ1A 4NLVA 3EGWB 2W9BB 3WQPA 2RQ4A 3N9UC 2H51B 1IBCB 4N8OA 2EWHA 1ELOA 4KGMA 4I6AA 5AE1A 2HGNA 2YKNA 3EPIA 1RWXB 2W1BA 1N48A 1CPZA 1WKKA 5KFCA 2E5IA 2MB0B 3AJ2A 3BZQA 3CJRA 4DL7A 3ILIA 2R8GA 4IH5A 2G2YA 2MTLA 1R8PA 5IQ6A 4QYZJ 4RNOA 4OZJA 3RBXA 3WZ0A 4YY3J 3MEEA 3JTPA 5L1LA 3T3FA 2V4RA 3IAM9 2V2ZA 3BH7B 5DGBA 2W4CA 2H3EB 3JTOA 3C6UA 2NREA 1HBNA 3VAFA 4DV0J 3PVXA 3JSRA 2W9CB 2FC8A 4FYVB 3KTQA 1YJRA 4M1KA 5AE3A 4KKOA 3GLJA 1Y5LB 2CNNB 3DXSX 3NRBA 2V9WA 5T41A 4ZVTB 2XNRA 4KFBA 3A8IA 2J7KA 5F0UA 3IBFB 3CC2S 3W60A 2YKPA 5DQGA 5KFDA 1VQ9S 1FKPA 4ECTA 2WVBA 5D4NA 2AX0A 3X3UA 4XPCA 2M7SA 5DRKA 4F4XA 4I56A 3Q8SB 3WC2A 2V4JA 3LWLA 2HQDA 5EN1A 2BJ1A 2DCUB 3OW2R 3QLHB 1UPMB 2HBZB 3DM2B 4DEZA 1BC6A 4YP3A 1QE1A 2W9BA 1GQEA 3KHGA 1M90T 3G71S 3OL7A 4DPXA 2RU3A 4CLFA 3BYPA 4AD6A 1R6YA 3J7YU 2RDJA 2GFFA 2P2CB 2ZUAA 2MY8A 2D7SA 4OI3A 1HYSB 1RAEB 1WHVA 1REGX 4DL6A 5KG5A 3TEGA 1RTDB 2B9WA 1RAFB 4EGLA 2DNGA 1ITPA 4NCGB 4JV2A 2XCPA 2VQFJ 2Z2MA 4KQZA 4FS1A 2R2SA 2ZWPA 1IQTA 3BYRA 4JI1F 2QRRA 3TJ9A 1RBOB 4QBUA 3J7Z5 2W9CA 5KFVA 2UUBF 4J9QA 2NXEA 1NJYA 2PI5A 1UAWA 4QIEA 3QMQA 9RUBA 3FNNA 4F7VA 4ELVA 3C19A 2B9YA 2CZVC 2H4WB 5A2QU 1IJFB 4YMEA 1NDPA 2DIUA 1MSWD 3FMBA 1Q4RA 1FWKA 2HFNA 3QAUA 4G1IA 4OX8A 5M2PA 1VK3A 1RT3B 3DLKB 4FYDA 3JSBA 5IM0B 1W25A 2YBVA 2FGCA 1GXLA 2WCXA 3AFGA 3I4PA 4H4OB 2B4VA 1YTYA 2ZHBA 2AJFE 1WJ9A 4DV6J 4RW9B 3B6BA 4IUFA 2Z58B 5KG1A 4TU7A 2WSEC 3N4WA 3DM2A 3P45B 4OHWA 2OGUA 4YR0A 4CLYA 3P5TL 4UOCA 4G3IA 2R7UA 3CJKB 1F5CA 4ZVUB 2JVRA 1TFWA 2HYIB 1NH7A 4OMFG 1T0TV 2BBEA 4R0EA 3OXLA 2WW8A 3OFFA 3LPYA 4L76A 4WPAA 1RA7A 2DNMA 1CQNA 5J2MB 5F8NA 4ZPWR 1RTDA 4AL5A 1S6PB 5KOXA 4N56A 1UZDA 2GQQA 4E2FB 4WXOA 2BEFA 2ZH9A 4NCGA 2WK4A 3RAXA 4KH1B 2XMVA 1V3ZA 3GE9A 2Y0BB 5DETA 3MCNA 1H3DA 2QSFA 1GEHA 1LV5A 1R8HA 2QLBB 1SB6A 2XWYA 3HHDA 3HO1A 1IKWB 1TL4A 2FTRA 3MPUB 2KT5A 3L3CA 4DV3F 1UVJA 4UTGA 1OS5A 2N82B 2IHR1 4TNOA 5ETSA 3N6MA 2RH3A 3MMJA 3GMGA 5HJXA 4NLSA 1RABB 3AAWB 4DV5F 1RT6B 1K44A 4K4UA 4FZVA 2IIHA 3OBIA 1T9TA 2V5HG 4YS2A 4PWDB 3EUNA 1ZS6A 3R7BB 1RT3A 3DLKA 4XAKA 4CH1A 5IM0A 5LSRA 2YNFB 2YQ3A 4H4OA 2Q3PA 2W9AA 4DV7J 3FC9A 1WWHA 4QPTA 4RW9A 2UXCJ 5CYQB 4GO5X 4F0MA 1K1SA 2GJIA 3R3TA 2FB0A 2ZITA 2C3YA 4MK7A 4DQPA 3JAMY 3D28A 1JNRB 3GYXB 1IR0A 3CJKA 3SCLE 3FK4A 3MM8B 4FBUA 2BABA 3QATA 4C8KA 4O0NA 2RSQA 4FPIA 4MFBB 4IQXA 2NZCA 2UP1A 1N5TA 2G1HA 2W2NP 3RB0A 4R5PB 4DV2J 2GHWA 1WC6A 4F3MA 4PXCA 5J2MA 2XZTB 1S6PA 1RCOB 2E29A 4TQRA 5D0GA 1D8YA 4F2RA 5CCMA 2R2RA 2LA6A 4K4WA 3OR1B 3NXZA 2V34A 1JB0C 1I5OB 2J0SD 2LDIA 2E5GA 2BDPA 1C4AA 4N8NA 1CJUB 1IKWA 4K5RA 2ZH3A 1S4EA 3K8WA 3V4IB 2K7KA 2C22A 4F04B 2VL1A 3H5YA 2MQPA 4CO3A 3KWMA 3K58A 4X4OA 1ICEB 2DGOA 1RT6A 4HTJA 1YZ6A 3HDSA 3IN5A 1S72S 2QA4G 3OLBA 3FFIB 1D0EA 3PKYA 2H5EA 1HHSA 3DDIA 2IC3B 2X1GA 5B0BA 1CBKA 4PWDA 4EWTA 3QRRA 1OMSA 2MEWA 2YNFA 4A4JA 2IA6A 2BJ8A 3V6JA 4MKBA 5CYQA 4WIQA 1VRUB 1UVIA 1RHKB 1T94A 2QLJB 5D0EA 1YZ7A 4J9OA 4DR2J 3MM8A 3C3LA 1YJTA 2BJ7A 4DDFA 1SC1B 4LR8A 3GIJA 3HD2A 1Q81T 1PAEX 4MFBA 1UFKA 1S6UA 4LBHA 3PJXA 2MQOA 1YX2A 1ZYQA 4R5PA 3E8OA 4M5JA 3GIKA 2L41A 3UI3A 1FEEA 1NHVA 1WI8A 2RE1A 4DL4A 4GKJF 4UOHA 1VBKA 2WB4A 2EFGA 3R97A 2B9EA 3QT7A 1AFIA 3OR1A 4OI6A 3A3OB 3TJAA 3CJ8A 4K4XA 1X31C 1CJUA 3V4IA 5CABA 2XLJA 2VH7A 2OEMA 4MK8A 2XB2D 4X4NA 2V68A 3MWBA 2EVZA 3DRPB 1NPRA 4DX7A 4BCAA 2BKPA 5EX0A 3BGLA 3KXDA 1WHWA 4Q44A 1I3OB 2MZJA 4KV8B 3JYTB 1K73T 2C2ZB 2PEHA 2HQCA 3FFIA 1NHKL 1N6QB 4F3OA 2H48B 3PEJA 3DN9A 2C3PA 2IC3A 5A2QY 2G2OA 5B0CA 5HP1B 1GXTA 3R5DA 1JWWA 3K5PA 2OFHX 3W2VB 5IXUA 1W2IA 3RBEA 1KS2A 4PWWA 5DDPC 2PD1A 2RUGA 1HR0J 3KK2B 2GVZB 5KFTA 3PR4A 1VRUA 1RQ0A 1PILA 3WIUA 5D77A 2GJ2A 3W5ZA 2GV1A 1PC4A 1TK8A 4B9UA 1VC5A 1I1GA 3MF5A 1PIEA 1UJ5A 2N7CA 1X8DA 4MTPA 4LFCF 1YITS 2ZVSA 2XNQA 2ZBCA 3TJ8A 5A8KB 1P1LA 2R2UA 1MWQA 4DR5J 2HQFA 4J9LA 2YTCA 4FN5A 4FKYA 5FDLB 1S1XB 2ZDPA 2CRLA 1JK9B 1WORA 1NK4A 2GIQA 3D5MA 3D6TB 2B4PA 4I69A 4OHVA 3JQKA 5AXLA 2FJAB 2DCLA 1CLFA 3OVAA 1EKRA 2BQ3A 2LLZA 5HL7Q 2IY5B 4K2JA 5KFIA 1DARA 1NSKL 1FXRA 2CPIA 1FCAA 2ZDOA 2Y1IA 1DBDA 3DRPA 2JL9A 2FUG9 4KHRA 2J6UA 2JDJA 4DL2A 3OD2A 1MLAA 1TL1B 3HCXA 2XGPA 4KV8A 4CO4A 1XN9A 1U49A 2XMJA 3JYTA 2JWNA 5LM7E 1MMLA 2UUWA 4Q7AA 5G4DA 2GNKA 4CRJA 1CJVB 1N6QA 1OSCA 1U1NA 2KT3A 4DR6J 2HVHA 5BR8J 5HP1A 4V1Ak 1FX4A 1FFWB 3TRGA 3Q8YA 1RLDA 3E51A 1FKOB 3P96A 1RWOB 3W2VA 2KKHA 3KJVB 4KIAA 4IG0A 2G4BA 5E7OB 2RQCA 3KK2A 1FFGB 1N8RT 3ZXWA 1IVZA 4ER8A 2RF2B 2QEXS 1W2BR 4KSEB 1WC5A 1E6VB 5KFXA 1UVLA 4EBEA 2G13A 3PHTA 1FWPA 2C28A 1X4GA 4CTAB 1SJ1A 2BYCA 3V6KA 3PEHA 4O4RA 2DXDA 2RRBA 3LALA 2NCKL 3CMAS 2FHKA 2NPFA 4AFFA 3P8BB 4OQJA 2GA7A 1OWXA 4TY8B 4D3GA 1KTVA 1ZAXA 3M32B 3KUEA 2MQNA 3BEGB 5FDLA 4C8NA 1S1XA 3I0SB 2K1RB 2LKZA 4NYPA 2R7XA 1H2UX 4I6YA 1VQ6S 3I82A 2G0JA 3BGRB 3LANA 3D3BJ 1DFDA 2PO4A 3QZ8A 3SXLA 3QIPB 5DDRC 4HDGA 3MAAB 4OZ3A 5DJBA 2CUYA 3R5AA 3Q8RB 1IQZA 3MPDA 1UP1A 1TL1A 4BWMA 4C7QA 3UE2A 4GKKJ 3BO3A 4WF9Q 1C1BB 1CJVA 4ZPBA 3DLLQ 2KXNB 3KNGA 3TO8A 2ZH6A 5KFZA 1FKOA 1R8AA 4I68A 5HVGA 3AH6A 4DCOB 1I6JA 3KJVA 1MWYA 3DKDA 1U1QA 1NSPA 2UUAJ 4KB7A 5E3PA 1RWNB 2YWKA 3MM6B 4ANCA 1HBOA 2KJWA 2RF2A 2DR9A 2W25A 1ZZFA 2YWHA 4TQSA 1O8BA 1RAJA 1E6VA 3QO9B 1SIZA 2KFZA 3KLGB 3FSIA 3UDCA 3TEHB 4CTAA 3HHKA 1QD1A 3QSYB 3LAMA 5KFJA 1P8GA 3GFXA 1W7WA 4NCBA 4TY8A 1KHWA 1REVB 3M32A 3QPIA 1V5IB 1UVMA 3I0SA 1J5OB 2K1RA 4P2SA 3TUZC 5HLFB 2J9DA 1E6YB 3EVOA 2DHHA 4PEOA 5B0FA 1KQKA 1DQ8A 2MHNA 3OV7A 5B08A 3BGRA 3IM8A 1RKIA 1IBKF 1SKUB 1DJ0A 3QIPA 2BE2B 3JXOA 1Y7PA 5BYSA 1HWIA 4LF5J 2ZKTA 3QYYA 4LF1A 1RAOA 1VIOA 2ZEJA 3TUJC 3EM1A 3HVTB 3EZ5A 2RKIB 2QLWA 1C1BA 4K59A 2AGOA 3QRQA 1FRXA 3OUYB 1BQMB 1LWCB 2EBEA 4EO8A 3HJFA 1FJGF 3BSNA 3TYTA 5KFUA 1NK7A 4ID5B 5CAAA 1Y9OA 3A12A 4QR0A 5EWGA 4KPCA 3MM6A 4AL7A 2HIQA 1OQ3A
chains in the Genus database with same CATH topology
1FEHA 5A8WA 2D9PA 5JVHQ 3B78A 4TYBA 2CIMA 4G6VB 2YNGA 1PO6A 2A2CA 2E5JA 4C3KA 1EETB 4ZHRA 1VQ5S 2YKMA 2NQPA 2AW0A 4YOEA 2VFTA 5GAEU 3MD1A 1TVRA 3O1LA 4RW7A 1T05B 3BF4A 4BC9A 5KG0A 4MYTA 2V2KA 3QO9A 5KG3A 2DH8A 4N5SA 3K2YA 5KFOA 4MYUA 1KQSR 2J6TA 2OSRA 1R31A 2N4CA 3HVWA 2R7WA 2DNOA 5HMXA 2KYXA 2CJQA 4FF1A 1DTQA 4HH0A 2V8VA 1QVFR 3CDEA 2L9DA 1OSDA 2UVVA 2WOMB 2I5JB 5KFEA 1TL5A 3BDEA 5L39A 4RU2A 4JI0F 3GIIA 1R0AB 2MZ1A 2BRKA 2EI5A 2FC9A 1T3OA 4LIRA 1WEZA 5LSLA 3M9MB 3QJJA 3C66A 2MZQA 3LQVA 2YNIA 2DNNA 3H8YA 5A8RA 1REVA 1PGZA 3FVYA 1KLMB 4HVZA 4ECXA 4ZK7M 1RK8A 4O0IA 1VRTB 3DDNA 3OL8A 3K7RA 1A6LA 3MR5A 4LF6F 1J5OA 5HLFA 2AD9A 1NEEA 4F4ZA 2KFNA 1MNEA 2N3LA 3H20A 2E1CA 1E6YA 3N79A 1KTQA 4O3OA 3TW0A 4M8LA 1XMQF 3NMRA 4X2BA 3DOMA 3M05A 2XCAA 4IOAQ 1F2GA 1SQEA 4R8UB 3PRDA 4UY85 5C25B 4H4MA 4WFBQ 2ZNYA 3UD4P 1RTHA 1Z4UA 2XWXA 1FE0A 2F1FA 4H4KC 3OL9A 5BYRA 1NK0A 4A8XA 2RNEA 1VC6A 4C8YA 2OMLA 3ETOA 2MKHA 2ZC3A 1HNWF 2EFOA 3SSSA 2MQQA 2BM1A 2MJNA 4DSEA 2C3MA 1U8SA 4X65F 1VI7A 2C2EA 2BE2A 3BO4A 5DGAA 5LXYA 5K8NA 4NPOA 3RRHA 5B0AA 5EWFA 2X1BA 4KC5A 3MAQA 4RWXA 2IYGA 3AY0A 4WK3A 3ULHA 1LW2B 4PG5A 4YUDA 5BYQA 2UXDF 4DR4F 4URSA 4QIFA 4EEYA 2YWFA 2BZ2A 4DL0C 4A8YA 2KHCA 3HHLB 3MMAB 5KFYA 4DFPA 2UUCF 1X4CA 3FEZA 1HD1A 5KFRA 3TAMA 5I4MA 1Q53A 4LSLB 4XPEA 4CZCA 3HVTA 2R8KA 1FDBA 2X3GA 2EG1A 3V81B 2CPXA 2JSXA 1H2TZ 3FJ2A 1IKXB 1VQYA 2RKIA 1ZM4A 3CCSS 5KFGA 1UA0A 1RYSA 5JJBA 3MTKA 1IKYB 2PMZD 5DDOC 4IFVA 1VQ8S 4PUOA 4BDPA 1PSDA 1RT5A 4ZVHA 1IXKA 3S1TA 5D78A 4A47A 2KTQA 3PW5A 4L72B 4CT8A 1VK8A 3DI6B 4ETZA 3MUVP 3U7JA 2IMOA 3OUYA 5J2PB 2OMOA 4AUKA 1BQMA 3OSPA 4AXJA 3M4XA 3MHYA 3MECA 1LWCA 1HNXF 2UVUA 3ZZTA 2IRXA 5IWAF 3H4BA 5CYMB 2MSSA 3S01A 1S79A 2SXLA 2QFJA 4LUBA 4NRUA 2JEFA 3PRBA 5H1SV 4EO6A 2FLLA 4ID5A 2UZAA 4A8WA 4RNHA 1LWFB 4ECYA 2DNPA 4DUYF 1WEXA 2M4MA 4A8SA 3FMWA 2DK2A 3HHLC 5B0EA 5KT4A 2GMJA 4C11B 3NCPA 1RT2A 5E2QA 1V9OA 4Y2MA 2DHGA 3CJ2A 1VGYA 2Q66A 1JKHB 2EFQA 2ZOGA 2E9ZA 2Z4PA 1UEVA 3THTA 2CQDA 2R7SA 3CD7A 3MGJA 1EETA 4N47A 4NRTA 2WAQD 3G6XA 3EX7B 3HZEA 2D74B 2VBZA 3CPWR 1ZAWA 2KG0A 1HFEL 1T05A 5E33A 1Q7YT 4ZPVR 4QU7A 2GMLA 5B0DA 2CJ9A 1QJHA 1JX4A 4YR2A 2DHSA 1FRIA 4TU9A 4Z2XA 3HVRA 5ITHA 3EPGA 2ZH5A 4H4KA 3MR6A 4QQBA 1HNVB 1U1KA 3CMES 1M5KC 3PW4A 2IFXA 3Q2SC 4HH1A 4MH8A 5U47A 4PQUB 2IAJB 4MIBA 2WOMA 2I5JA 4LSNB 1SJQA 4YR3A 4ED6A 3I55S 2BQUA 5AXKA 2OH2A 4X66F 4YB7A 1R0AA 2WSFC 1U25A 1VQPS 1HD0A 3IR5B 2RD5C 2R7TA 2HZCA 2AWZA 1SJRA 2KFYA 3G6VA 3HLUA 2ZHAA 1DQAA 4LFBF 1KLMA 2FVCA 2QA2A 3SMZA 1MW7A 4C8MA 5H9EJ 2VD3A 5GADU 3UD3P 1WG1A 1SKSA 5CQGA 4OX6A 1VRTA 1WEYA 3BGFA 2RMLA 3U1MA 1N4LA 1FO1A 1DTTB 6FDRA 2LQJA 2QO3A 5F8MA 3G8QA 5CH7B 4WE1B 3PACA 3CVKA 1NAQA 5F3ZA 4DR3F 1TAUA 4Y00A 4U6PA 4DFKA 3KLHB 3GV8B 3I32A 1ZPVA 2GMHA 3MZIA 4OJ3A 1NJWA 2HPUA 3DRYA 1VBYA 4R8UA 4FPRA 5C25A 4P7TA 1LQ9A 1R7IA 1YBAA 4OHZA 3NMAA 1N32F 2RIJA 1LK7A 5KG6A 3DLHA 2OKQA 1X5OA 2FJVA 1KVJA 2MGZB 4M63A 5AJ3F 2HMIB 4F67A 2UU9F 2OPSB 3RR7A 4RBTA 3OVBA 3RYLA 2VA2A 4KHPF 4C0BA 3NS6A 3SCKE 3FEYB 2E1AA 2LDYA 4J9PA 3M6XA 1WF0A 4DPOA 2CQIA 1A9NB 1Y3JA 2C2DA 1RTJB 1KHVA 5L1IA 3SCJE 3LWMA 2D41A 4O3RA 1AROP 4QIGA 3DU6A 1LW2A 2KDOA 2R8IA 2RU9A 2XSJB 5K8OA 1YWXA 2FJWA 3DLGB 3WDOA 3MUMP 3MMBB 3V6HA 1Q7LB 3BN7A 3EXCX 2E1RA 3HHLA 1R27B 2HFZA 3MMAA 3VR1A 5DG9A 3NGDA 3BN4A 5GAGU 4LSLA 4ZVGA 2IA0A 3MURP 5IFMA 2F4VF 5SUHA 1H6KX 4F3QA 1YJVA 3V81A 3HHLD 4B02A 2XULA 4WIIA 3SFGA 3PW0A 3CCUS 4WU2A 1XMBA 1O0PA 1IKYA 5D3GB 4CO1A 4A46A 2DITA 4KRWA 1M5OC 4YDXA 3M30B 2IRUA 4OL8A 1TK0A 4ZPTR 2FD2A 3DI6A 1HWLA 2Q6BA 1XNRF 2DISA 1U4BA 2JLEA 2YKQA 1S9GB 5J2PA 5HO4A 3UDLA 3CC4S 2JFKA 2B6AB 4DL5A 2AJQA 3NCRA 5T14A 4DR7F 2OD6A 3CCMS 1HA1A 4R0JA 5CYMA 5A8KA 3I9V9 1IBMF 4RKUC 2PI4A 2CVIA 2J9CA 3MI7X 3BR9A 3AJ1A 4MAKA 4GMKA 1LWFA 3T1HF 3VAJA 3CT9A 4WJBA 2ZUGA 1LOUA 2ASYA 5EUHA 5LT5A 2LMIA 3FSYA 1NHUA 1YJUA 4YFUA 3IGVA 4ZP8A 4C11A 5EX3A 2DH9A 3GWCA 3QWPA 4NLTA 4C98A 2EK1A 4X4QA 1JKHA 2POKA 4XIUA 1UKUA 3OJUA 1LK5A 2CJBA 3M8RA 1FRLA 2BXJA 2JOQA 5GAGI 1L3VA 5LSOA 1KFSA 4P6QA 4RW4B 1UJ6A 3UR3C 1Q82T 3GV7B 2YX4A 4WYLA 2J0XA 4X4PA 1NNDA 4XK8C 3RB6A 2CDQA 1OQ6A 2VPXB 4RLEA 2VQEF 4WYWA 1FDAA 4NLDA 4DL3A 4ZVFA 4CO5A 1SL0A 1ZETA 2YKNB 1D9DA 4ECRA 4HKQA 1HNVA 4NXNF 1FNOA 2RQKA 4PPDA 1YJNS 1B7FA 2ILYA 2DNZA 4PQUA 4J9KA 2IAJA 3I9ZA 1G7CB 4LSNA 4GO7X 4HYKA 1G6BA 4WFAQ 2EW9A 4I0WA 2GC8A 4BHQA 5JVGQ 2YY3A 4LIWA 2V4QA 2ATLA 1S10A 3T1YF 2VASA 1MMNA 2LXFA 5IS2A 4K4SA 4ZP9A 4YHHF 2YX7A 4B9LA 3H2LA 3GZ7A 3PX0A 1QSLA 3FGVA 3K5LA 1CEZA 2W8KA 1N56A 1ZAVA 3GG0A 1U47A 4PWUA 3SCIE 4ZCIA 3NL0A 1S76D 3CGIA 1S1TB 3MEEB 1DTTA 1ROFA 4RBVA 4UW2A 3PJWA 1X9WA 3QJPA 1GAOA 4OX7A 4WE1A 4FNIA 1X4DA 4LQ9A 2CG4A 4EFAC 3KLHA 4B3TF 4Y65A 3OL6A 2KRBA 2KVIA 2E5LF 4AL6A 3FSXA 3TA0A 1WELA 3IXQA 1RGVA 1TAQA 4NLUA 5KFQA 3JSMA 1M0SA 4F8RA 1UFWA 3HKZD 3J7ZT 2OLWA 1SJ4P 2R8JA 4ILRA 3C6UB 2OPSA 4FP9A 3NGKA 4DX8H 3JSYA 1FNMA 1HBNB 4UQGA 4DG1B 3T6JA 1JLGB 1N33F 2BM0A 1U6FA 1GXUA 1XEZA 2I2YA 3T5HA 3E2EA 1BD6A 3TUIC 4LF4F 1RTJA 1NKBA 2X1FA 2DNYA 1DAXA 2E66A 4RZRA 2GIRA 4WZQA 3VAGA 1BQNB 3D2WA 1VHFA 2FJXA 2P6TA 3MDFA 4K2XA 3MEKA 2XSJA 3D0IE 4KKOB 2MZRA 3DLGA 1U24A 2GCFA 3MMBA 3HT3A 4CO0A 4N76A 1WG4A 2D1CA 3CCWA 1UJ4A 2VPZB 4DBQA 2O67A 4JV1A 4E98A 4X4UA 4KFBB 2FDNA 4DSIA 2IVYA 2FVSA 1YRTA 3EGNA 2FGOA 2MZSA 3NS5A 4ED2A 4K5SA 2DR7A 3QGHA 5D3GA 4IOBA 2YH0A 3CJ4A 3MTJA 4OZ0A 2KO1A 2LA4A 3M30A 4HL9A 2IM0A 2FLNA 4NOHA 2BOPA 2LEPA 4U67Q 3IWNC 5K14B 1HNIB 1HI1A 3U1LA 1F60B 1FKPB 1S9GA 2O01C 5F41A 3J81Y 3OHAA 2D3OR 3LAKA 1NK9A 1URNA 4DV7F 2B6AA 4IKAA 3HHEA 3T5KA 2DNKA 1Z1ZA 3NNHA 4B3RF 2OPQB 4QW9A 4G1QB 3W2WB 3SEOA 1N5SA 4Q43A 2J0WA 2D3UA 4RU9A 3C46A 1MMDA 3X1LB 2CQ4A 1QUVA 4URQU 2V4JB 4QWBA 4FS2A 5M2UA 2L48A 1ZM3A 2GGPB 2Q6CA 1IBLF 3M2UB 3MFIA 1AXQA 4DS5A 3KLVA 5KFAA 2O66A 3KOAA 3RW6A 2KZMA 3KK1B 1P27B 2P9GA 5KFKA 5E0OA 5DM7Q 2F8HA 3I87A 1JXEA 3M8PB 3NLCA 4Q8EA 1FHTA 3MR3A 5F9LA 2HRUA 4L3NA 4B9VA 4KGKA 5LMUF 1Y0HA 5K8MA 2ZM6F 1U2FA 2XC9A 2OP5A 3RRKA 1QE1B 3TQ1A 4NLVA 1WG5A 2CPJA 3EGWB 3HM9A 4RW4A 2W9BB 2RQ4A 2BW2A 3N9UC 4EYHB 3Q2TC 3MCSA 3MM5B 4AQYF 3AA8A 2Z0GA 4N8OA 4RW8B 4DJBA 2WBMA 2EWHA 1FDNA 1ELOA 4KGMA 3CEDA 4I6AA 2JRSA 3BSCA 2CQBA 3M2VB 5AE1A 4F4YA 2ROGA 4C4WA 3N6LA 5J2QA 2HGNA 2YKNA 3CCTA 3EPIA 3I5AA 3OTCA 3DU5A 3M1VA 4ZCMA 3JB9k 1N48A 1DZ5A 1NO8A 1CPZA 1X4FA 3K0JA 1NZAA 5KFCA 2E5IA 4Y28C 4TY9A 2MB0B 2IM3A 1YJWS 5GAHU 3AJ2A 3BZQA 2GHPA 3N5BA 4DL7A 3P49B 2C3OA 4RBUA 5J1PA 2R8GA 1D1UA 1VMBA 4IH5A 1Q8IA 1ZM2A 1R8PA 5IQ6A 1QAXA 4QYZJ 1NKCA 4RNOA 1Q8LA 4OZJA 5LJ5Y 1S0NA 4NA3A 1WNEA 1G2EA 3H5UA 3WZ0A 4M94A 1VQ7S 4MKYA 2P9EA 1O5JA 1S1TA 3MEEA 3JTPA 3V2UC 5L1LA 3T3FA 2V4RA 5DDQC 3IAM9 1M5VC 3IGNA 3PFEA 1L3KA 2W4DA 4F02A 3OPKA 1JNZB 4C9DA 1HWJA 4M5DB 5DGBA 1IN0A 2VKRA 2GO8A 3IRWP 1GTEA 2W4CA 3PIOQ 1C2PA 3I5BA 1B0VA 2LVWA 2W7PA 2BRLA 5MLCV 3JTOA 3TNVA 3G6ES 4FXWA 4TU8A 5DG7A 2A3JA 3B8HA 3C6UA 3PM9A 5L9XA 1TKXB 4E0DA 2NREA 2DRAA 4CQ1A 1UEUA 3GFHA 1HBNA 2IBKA 2RB7A 3VAFA 4DS4A 4DG1A 4B08A 1JLGA 5THWA