1RHMB

Crystal structure of the complex of caspase-3 with a nicotinic acid aldehyde inhibitor
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
91
structure length
91
Chain Sequence
KIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords CASP-3
publication title Reducing the Peptidyl Features of Caspase-3 Inhibitors: A Structural Analysis.
pubmed doi rcsb
source organism Homo sapiens
total genus 15
structure length 91
sequence length 91
chains with identical sequence D
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2003-11-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 1rhmB00
2H5JB 5IC6B 2CJYB 2H5IB 4ZVPB 3KJQB 4ZVOB 3NS7B 4ZVTB 2H48B 1RHKB 2HBRB 3EDQB 3SIPB 1RE1B 1SC4B 1RHJB 4ZVUB 1ICEB 2Y0BB 2CNKB 4ZVQB 3GJSB 1RHQB 5K20B 2QL9B 1F9EB 2CJXB 3R6LB 4JB8B 2HBYB 1SC3B 2HBZB 3RJMB 1RWPB 4ZVSB 2CNOB 2C1EB 2C2ZB 3D6HB 2H51B 2XYPB 1RWKB 2XYGB 4DCOB 2FQQB 2CNLB 1RHMB 2C2MB 5IC4B 4ZVRB 3R7NB 2H65B 4DCJB 4DCPB 3QNWB 3D6FB 3IBCB 2DKOB 2QLJB 2XYHB 1I3OB 2HBQB 3R6GB 3R7BB 1RHUB 2QLFB 2H4YB 2C2KB 1PYOB 2CNNB 3R5JB 1PAUB 3R7SB 1NMEB 2XZDB 1I51B 2QLBB 3GJRB 2Y1LB 4LSZB 2P2CB 3GJQB 3KJNB 3GJTB 2C2OB 3D6MB 1RHRB 1IBCB 1RWVB 2QL7B 3IBFB 3P4UB 1RWOB 1GFWB 2H54B 3P45B 3EDRB 1RWMB 1RWXB 1QTNB 2QL5B 1QDUB 1SC1B 1RWNB 1RWWB 2XZTB 3KJFB 1BMQB 2H4WB 2CDRB
chains in the Genus database with same CATH superfamily
4IDKB 4OJGA 1CULA 1AT1B 4OJHA 3KJQB 1T03A 3RW7A 2RDJA 4KRWA 1NHUA 2MZQA 2YKOA 1U6FA 1VMBA 3DRSB 4CO2A 4DQSA 2IDEA 2QL9B 2YNHB 5KFWA 3PKYA 3GB0A 3M4XA 2Y1JA 4KFBB 1GAOA 2YTCA 1MMNA 3H5XA 2CPZA 4BWJA 3H25A 1ZS6A 3DLGA 3FQLA 2UU9F 4I6WA 2OSQA 5RUBA 3NRBA 1YIJS 1VJQA 3CGIA 2PFFB 2QSWA 4OYAA 2V5HG 1R31A 2R7OA 3V2UC 4DR6J 3IRXB 4Q0BB 3DGPB 4F8RA 1T3NA 4CH7A 3UNYA 2E1AA 3BN7A 5EX3A 1UFLA 5EGYA 3Q22A 2O1PA 3VVTA 1IN0A 2PD1A 3UVJA 3NS6A 1X7VA 4K59A 4P75A 1X60A 4URSA 3O6QA 4I64A 4UZBA 2XQCA 2J8SA 3LWLA 2D3O1 4JI0J 4DV7J 1ZA2B 5DDRC 2XI3A 1DQ8A 1S7IA 2BW7A 3NS7B 2KT5A 2GIRA 1XMQF 2VU5A 1T02A 4P2FA 1HQEA 2R7WA 2R2UA 3AD8C 1GT8A 2XO6A 2YNIA 3I0SA 2JJ4D 2N4CA 4KKOB 2ZH2A 3NCQA 5I3UA 2UP1A 4JI3F 5E7OB 1OWXA 4HLBA 4I69A 4F02A 3S8SA 3MM5A 5B0BA 4AL6A 3HHEA 3OL8A 5D77A 3KNGA 5J1PA 4A8FA 2YKNB 2YVSA 2RDIA 3DOMA 5LMUJ 4LF2A 3HSZA 1SPBP 2GO8A 4K4TA 4Y2MA 4NRTA 2RNEA 4DV6F 3KLHB 4I2QA 4DPUA 5L8RC 2WW8A 2RILA 4USWA 3ZZYA 2OAUA 1S1UB 4O4GB 3I5AA 3QRPA 3M8PB 2V94A 2IM3A 4DV4F 2DH9A 3RAMA 3T1HF 3TRGA 1YRUA 2JEGA 4LSNA 1RHKB 2G1HA 1DTQA 4OHYA 2NZ4A 2R8HA 1SQFA 1ULRA 2BOPA 3CXCR 1RAGB 2AT1B 1P1TA 2BANB 3RBZA 5LXYA 3O2IA 1KTQA 2NXEA 3TAMA 5LOQA 3G9CA 3CJTA 4KO0B 2ZZTA 1F5AA 4LSLA 1LFPA 3J7YI 2DNMA 3J81j 4G1IA 1LWFB 5CZXA 2AKWB 4J9MA 4C8OA 4JYAF 3RYLA 3MUTP 4HYKA 2ZEJA 1VIXA 3EVWA 3MHYA 2VFRA 2XWXA 1NK0A 4F36A 2HQDA 2DNNA 4R5PA 5A2QY 3EM1A 5DJBA 2W4PA 1GX5A 2B4PA 3MCOA 1XMOJ 2EFOA 1H73A 3FVYA 1KQSR 4DPXA 5I42A 2QYGA 3NGDA 2OKQA 1F9HA 3VCDA 2YX7A 1NJXA 4ZCKA 3KFWX 4IDKA 1HQUB 4C3MA 4B9VA 2CJAA 2VOOA 2VQFF 1KP6A 4UOGA 1NBEB 1JLEB 3DRSA 1GH8A 4QIGA 1B70B 3ICLA 2V8VA 1RCXB 4J90A 3LP0B 2YNHA 1YZ7A 4GVBB 2ROEA 2RQCA 1YJUA 2B9XA 4OX8A 2LU2A 3CCVS 4KFBA 2V8DA 1PSDA 2UXDF 1BD6A 4JI6J 3CCZA 2EG2A 3LTOA 3OR2B 1F3VA 2A18A 2JEIA 3AXMA 4YOEA 3RW6A 2RJZA 2F4VF 1DQAA 4QWDA 1P27B 3P3DA 1IBKF 3IRXA 4J9OA 4OFZA 4Q0BA 3DGPA 3LO3A 1BGXT 3QPIA 3GPAA 3HJVA 4PQUB 2HZVA 2HGMA 2VD3A 5HMWA 4OI1A 4DSEA 2WZ1A 1Q79A 3DLKB 5LL6d 2YPYA 3SYZA 4FYYB 3CB4A 4QYZJ 4FKYA 5KAKA 4DQQA 5I4MA 4IQXA 3CJ5A 1JLCB 2EKNA 5KFKA 2VBXA 2OPRB 4OJ3A 2HHUA 5KFIA 3GIJA 2AX1A 3C8YA 2NUHA 2DHXA 1GQEA 3OSPA 3MZIA 2Z2YB 5KFAA 3I6PA 3THVA 2WHOA 3BJYA 3TX8A 3TO8A 3GIRA 4CLKA 1WSVA 4TLRA 4KKOA 3MR7A 1LK7A 2E9ZA 4TYAA 3MAAB 1RJJA 1S1VB 4RBTA 5LSRA 2E7WA 4PABA 3NGKA 3TX0A 2J0WA 1UA1A 5SZTA 2AF6A 3H90A 2J7WA 3DOLB 3B54A 2FHMA 4WE1B 5L9NA 3RBDA 5F8NA 1KLNA 3MM7B 4TNOA 2YKNA 4QQBA 4CNZA 2MQQA 2GS8A 3KLHA 3OTDA 2CQ2A 1DBDA 1X5PA 2EWHA 1U47A 3VAGA 5F8HA 2RMLA 2HMIA 1FRLA 1S1UA 3JB9k 3R5GA 4O4GA 3M8PA 4OQJA 4C98A 3VWSA 3JAMU 2AW0A 3T9ZA 2G4BA 5DZ7A 2YXLA 1UZDA 4DUTA 1H7WA 2LECA 5KG5A 4A8WA 3QJPA 3DCAA 2DCUB 2YPZA 1X5TA 3AOAA 2PA3A 4TY9A 3MR6A 2BANA 5K8MA 3US5A 1J5EJ 1Y9OA 1SC6A 1NK7A 4KO0A 5G4DA 3CC2S 2XO7A 5F3TA 4KGVB 2EC0A 3BM7A 1LWFA 3M05A 4H4KC 3EZUA 4G3IA 1XTZA 3VAKA 5KT3A 1GTHA 3U02A 4DR3F 2A2DA 5DS7A 2KJWA 2MY8A 3LA0A 4DR5J 2QTWA 2DVIA 2H4YB 2OEJA 1JLQB 3LF0A 3MM8B 1B64A 4LF6F 5D3GB 4WIIA 3EMTA 4OI0A 3ISZA 2CPIA 1WHXA 2VASA 1K1SA 2MLXA 1KQFB 4LF8J 2FJBB 3EGNA 2G0CA 4ID5B 2D3ZA 3T5HA 3HHKA 5D0EA 2OP5A 2N82B 2Y8WA 4RKUC 1W7WA 1HQUA 3FMBA 1HLWA 3FBFA 2DGWA 1AFJA 3KUGA 1JLEA 4I0WA 4IFVB 1NSKL 2BXJA 2OFGX 2BW2A 3LP0A 4GVBA 2CJXB 4RNFA 1PJ6A 1QSYA 3W60A 3MEDB 1S97A 3OR2A 2QMUB 5KFPA 2LEAA 2P6TA 4R0EA 4LRBA 1FJ7A 5GMDA 2VOPA 3ZNJ1 4DWIA 4RO0A 2HEKA 4OX9F 4EZ6A 1VQPS 4LF5F 2VG6B 2XS5A 2VH7A 1F5BA 1FDNA 4O23A 4OZ5A 4PQUA 3R1HA 4F0KA 1X5SA 5DG8A 1W2BR 1M5HA 1WF0A 2RS8A 2WVDA 3DLKA 4Y34A 3SCIE 4DL2A 1SV5A 4NLTA 3H7HB 5KOWA 1F2HA 1I5OB 4IYQA 4YR2A 1CS4B 1U6ZA 2LQBA 5A0YB 3C6UB 4A48A 3QJJA 1JLCA 4J9LA 2OPRA 2ZH6A 1C0TB 2GGPB 5GAHU 5HANA 2K7KA 1HW8A 2XS7A 4HACB 3ENWA 4QOTA 4WK3A 1F6TA 5KFYA 3PYFA 1I94J 5KG7A 3BDPA 4OYBA 1WC1A 2HWTA 2R7SA 4B9MA 2IJNA 2A2CA 5JMNA 2NCKL 3MAAA 1S1VA 4K50A 3DC2A 1FWPA 3A12A 3LP1B 1FFGB 5KG2A 2QA2A 4GO5X 4BS2A 3D3BJ 2X3GA 2XY7A 2W4CA 2ZVIA 3DOLA 4AUKA 4WE1A 1XNQJ 3MM7A 3J81Y 4DCPB 2ZZMA 2DJWA 4ECWA 4ZP8A 5EN1A 2RUSA 2ZITA 2M52A 3OTEA 1FDBA 1CLFA 4G1PA 5KFUA 5IWAJ 3K89A 3IBFB 4J9NA 2AEFA 1VQMS 1Q81T 2ZFHA 3K57A 1EX8A 2VL1A 1FRKA 1A7GE 3F44A 4OHZA 2JSXA 3FBEA 2OTLS 5SUHA 1S48A 5E3RA 4CLSA 1TAQA 3QRRA 1HI8A 2XMUA 4Y6IA 2W7OA 4P7VA 4EEYA 1RTZA 3R2DJ 3RZAA 4WXWA 1MMDA 4OYOA 3WIUA 5HVFA 4C8LA 2D9OA 1TKTB 1Y10A 1V3RA 2QC3A 3FDSA 2ZH3A 3MD1A 1RP5A 1B7FA 2QE5A 2H9ZA 1IBMJ 2AJFE 4F4XA 4TYBA 2K2PA 3HD1A 5F8GA 5J2NB 3T19A 4DU7A 4AD6A 4F2SA 2XLIA 3GIMA 5C7PA 4DMZA 1G1XA 3IWXA 4NZ6A 4Q8FA 1JLQA 3IWNC 4PRFA 4QPXA 3MM8A 4DQPA 1NHKL 5D3GA 3PW5A 4CM2A 5AE1A 3BKUA 1NK9A 2UUAF 4NYZA 2W2NP 1YBTA 3SZ2A 4ID5A 4UY8T 1KD1T 2MLYA 2MQLA 4LIRA 3M6WA 2XY5A 2J6SA 2KKHA 1LK5A 3D7SB 1VQSA 2KVIA 1CSJA 2BJ7A 1XK8A 4IFVA 2FPHX 2Q66A 1KSPA 5AXMA 3SQGB 2O5DA 1NKBA 3CCLS 3GR1A 1PAEX 3FNNA 3QT8A 3EXCX 2C2ZB 4RU9A 4ZVGA 1JJHA 5LM7E 2XYGB 2BA9A 2JH3A 4HH0A 4QW9A 3WIVA 4USJC 2CQHA 3MPWA 4C4WA 1VBXA 5DQIA 1RHUB 4TU8A 1KHWA 2ZNZA 3HZEA 2I0XA 2VG6A 2CVIA 2R7UA 4WFAQ 3ZZRA 1X4BA 5CCLA 3HM9A 2CQBA 2E5IA 2V9KA 2P2CB 3VGSA 1RU2A 2YKPA 4DV1J 5L1KA 1CS4A 2WB4A 2B51A 3BDEA 1RU1A 2HHVA 5A0YA 3C6UA 4YHHJ 4B3MF 2YQ3A 2AD9A 2Q1LA 2ZBIA 1P9QC 2Q79A 4NE9C 1C0TA 1IUJA 1YDLA 2GGPA 2F9JA 4HACA 2NQPA 3FFIB 1JMTA 4NLYA 1X0PA 4EFAC 4DHVA 2V2QA 2NSCA 4KPCA 4KE5A 3AD7C 1BY9A 4CRJA 1ZM4A 1IKXB 3D0GE 1VDHA 2R8GA 4NCBA 5AXLA 4O3OA 4WZMA 1JB0C 3BR9A 2BOAA 1RT1B 3LP1A 4N8OA 2HRTA 4OYWA 3ILJA 2HIQA 3E01B 4DUZF 1FNMA 3ISNC 3TR5A 1XN9A 4H54A 4KSEB 2ZOGA 3K0JA 3QFWA 1UZHA 2BQ3A 1RTIB 1GXLA 1ZA1B 4KIAA 4X4SA 3M32B 1JJ4A 5DLGA 5DM7Q 4PG7A 1Q78A 2DK2A 1M1HA 2ADBA 4ANDA 3MCMA 4DV2F 3VAFA 3H20A 1X9WA 4BLGA 1FO1A 2KVQE 5HP1B 2YQ1A 5D4OA 4K0KF 2K3IA 3D3CJ 1B3TA 1G7CB 4GKJF 1QDUB 2RAQA 2BMBA 1H72C 2ZH7A 3TAQA 1SUQB 4L6V3 1R6VA 5C25B 2W9CB 1Y3JA 1IWAA 2I8EA 2AIRB 3C66A 3MTJA 4DSIA 2ZOMA 5KOXA 4C8NA 4DFPA 2B9YA 3MEGB 1D9DA 1RTJB 1WG5A 3J80Y 5GAGI 1TKTA 4MIAA 3FQKA 1PO6A 4LF7F 3F73A 1KRPA 1IJFB 1SJQA 4Q8EA 1UTAA 1HWKA 1WJ9A 5J2NA 2GJIA 1QY7A 3ZZPA 2DGUA 5ETNA 1CPZA 4G1QB 2X1AA 4ECSA 2CQ4A 1NZ8A 3FEZA 3G86A 4ZPBA 4WWSA 1RAAB 4FP9A 1HNXF 1FD8A 2R3VA 4RNHA 2Z0GA 4B9LA 3D28A 1FRHA 3HHLC 1QAIA 4JI3J 2RT3A 1YK9A 3R97A 3MXHP 3GJQB 2DXEA 1SKWA 1FVQA 4EK2A 1RGVA 3DMJB 2Z58B 5CCMA 1FFSB 4P9SA 2OD6A 2RQMA 3D68A 1R0BG 1PJ7A 4DR1J 2CJKA 4IUFA 4F26A 3Q8RB 2F7VA 1HKAA 3QRQA 3SQGA 1Z2LA 4MYTA 5H9EK 3IP0A 3MMJA 4IG3B 2ZWOA 3KNAA 4PG6A 2FTRA 1SIZA 4BBYA 3TQEA 1S49A 3V6JA 4DU8A 4ED2A 2AZ1A 1RKJA 4WTYA 2KRRA 1V5IB 4KR0B 1XR7A 3MAQA 4OHXA 4KV8B 4DSLA 3ILOA 4AXIA 1N5QA 2LA4A 2GJFA 3V81B 3T5KA 4DF8A 4PEOA 3K2YA 2M0GB 5DDQC 2VDIA 3P49B 4PYDA 3JQKA 5KFVA 4ED7A 4ZN3A 4AQYF 3UO0A 2IMWP 3PFEA 3J7YU 5HQLA 5L9XA 1U48A 4DBQA 3QWPA 4DFJA 2B6AB 3ITHB 1RAHB 2CAJA 1T05B 2ZM6F 1S6PB 5T14A 2HS3A 4ES1A 3FFIA 4ZVTB 1U2RA 1Q53A 2KI2A 3VGTA 1L5UA 1IKXA 1RT3B 2IVYA 3VAIA 2CPDA 3FJ2A 3BGFA 2GZOA 1N48A 1WG4A 2KTQA 1RT1A 2LQ5A 1YTYA 4WFYA 3UWTA 1HYSB 4P2SA 2CQ3A 3E01A 1U1NA 4LF4J 2IRXA 1YBUA 2MY7A 2QA1A 2IRUA 5K5MA 2DXFA 1RTIA 4FYDA 2XG8A 4UW2A 5DGAA 4HTJA 2DB1A 4X65F 3T9NA 2DGOA 3M32A 3RG6A 3JTPA 2L9DA 3SV4A 2H3EB 3B6BA 1RT2B 4O0NA 4IR1A 1XNRJ 3O44A 1VI7A 4KTQA 5HP1A 1HNWF 2X7IA 2CZVC 4KT0C 5EX0A 5A8KB 2FZCB 2MPUA 2I6WA 2HHHJ 4HHJA 4B17A 1V6HA 1SUQA 4KHRA 4P73A 5C25A 1M5KC 3C16B 1R8CA 2CJYB 3RGIA 2CJ9A 4TY8B 3PYDA 2W9CA 1ZOTA 1G4CA 2CQIA 3MEGA 1ZZFA 1RTJA 4A8YA 1VK3A 4DR4F 1QE1B 1N33F 1W26A 1UVNA 4DL7A 1AZSB 3QBCA 4B9NA 1C1CB 3W2VB 1RZMA 1KEKA 3LGMA 3UE2A 4G1QA 3UPFA 4F3OA 4L3NA 3QGPA 4USIA 1KKHA 4QU7A 3HO1A 2U1AA 1BQNB 4QWAA 4ECRA 3DMJA 5A8WB 1RK8A 5D78A 5HI7A 5IM0B 2H5JB 4PXEA 3MMBB 1U1PA 2DT9A 4ED4A 5KFEA 2QGFB 4RX6A 3PXGa 3HD2A 3BREA 3HVWA 1D09B 3HT3A 4IG3A 1LWXA 5J1NA 2ZE2B 5DGBA 2OO4A 3CC7S 1U09A 4J91A 1M0SA 2YH0A 4KV8A 2LQ8A 1JNZB 5LSLA 1Z1ZA 4KGKA 1VQNS 3V81A 4ANCA 1LV5A 2LMIA 3FUYA 3CJ4A 2NLWA 1F0XA 2UZAA 1Q8IA 2XCPA 3CJQA 3Q0AA 2A3JA 2HQCA 2WSCC 1GFWB 2RRNA 2Z2LA 2B6AA 3PVXA 1T05A 2WCXA 2CG4A 1NU4A 3QGGA 1S6PA 3GTYX 3MFIA 2O01C 4OZ0A 3RBEA 5CHCB 1TL4A 1RT3A 2ZVSA 2LFVA 1U1QA 4P71A 3K5PA 2NXNA 4U95A 3KWMA 4ALZA 2DPIA 5KG4A 2YX4A 1FRXA 4LFBF 2JLGA 1XEZA 2R9LA 1Q8LA 1HYSA 2DBBA 3BSAA 4BC7A 4ELTA 1KNZA 3PO4A 4O0IA 3IWLA 1SKRA 2XBPA 3AOCA 2B7CB 1T9XA 1UVJA 2QLWA 3G2XA 1RT2A 4IR9A 2VICA 3R7SB 3C3LA 4FYVB 4DQRA 4B9UA 2ZHBA 4ZA1A 1WI6A 3J7AN 3OTBA 1REGX 1Q8BA 1RWVB 1FT8A 1B99A 4ICLB 2IBOA 5A8KA 1F5CA 4EU0A 1T7PA 2FLPA 3C16A 4TY8A 2FC9A 4CNYA 3CMAS 2C2RA 3AB2B 5CAAA 2DGXA 2IPOB 4F4WA 1S72S 4K5SA 2MKHA 4NA2A 3GYXB 3BZQA 4X64J 4C8YA 2DR7A 1LNQA 4EYHB 2CQPA 4QWEA 2F4FA 2C3PA 2VBWA 1QE1A 4MT1A 1L3VA 2APOA 2MKJA 2E1PA 3ADAC 3VR1A 1AZSA 1ELOA 2AJ2A 1C1CA 2YKAA 2CYYA 3W2VA 4B3SF 4ZP7A 1FRJA 1OY9A 3IGVA 2X1FA 3JSRA 3CTRA 1NO8A 1X4AA 5K8NA 1UVKA 2XZDB 3NNCA 2BJEA 3KUEA 2P8IA 3EZ5A 1HW9A 1BQNA 1P8GA 5M2UA 2YQ0A 3FBCA 3F0NA 1S99A 2I38A 4I67A 5EWFA 4F25A 3CCMS 4YN3B 3M1VB 5IM0A 1U1KA 3MMBA 3B82A 2OTJS 1WF1A 2ZH8A 2RSQA 1NCLA 2OPPB 3OVSA 2JEJA 3KG0A 1RE1B 4DV0J 2BM0A 2FY1A 2BE7D 1QLNA 3QT5A 2EKYA 4JB8B 4JI1F 2XWYA 2HQGA 3MPUB 5A2QU 5A8RB 5K14B 5DG9A 2J6UA 4Z7CA 2ZE2A 3H40A 1VQ8S 2MDAA 3JTNA 2I5JB 3WHIA 1Y4ZB 1DHMA 4OI2A 4OX7A 4JI5F 5IT9U 3A3PB 4DXLA 9ATCB 1JX4A 1TELA 1JXEA 3H5UA 2YWEA 4USVA 2E5LJ 1K1QA 3DRYA 2VC1A 5U47A 1IBLF 4FBUA 5IQ6A 4OLOA 1IVZA 2XNRA 3N5FA 3UR3C 5JVGQ 4HDGA 4QIEA 3AA9A 2W7PA 4MTPA 2V63A 1IWGA 5ITHA 1EZZB 3NGRA 4B3TJ 5ETVA 1VISA 1IM6A 3R8YA 1TQLA 4ILRA 5CZVA 1Y3KA 4WFZA 1SC4B 4WIQA 3IGNA 3Q8YA 2HLUA 2UUAJ 3UNGC 5DDOC 1YQHA 4ZHRB 2AWZA 2FUG9 1CC8A 4ILLA 3BGLA 2LA6A 2IIHA 4HVZA 1TKXB 2VC0A 3HX9A 3TVKA 3MMAA 1FJGJ 3BO2A 2E66A 1RHMB 3NAHA 4L3KA 3BBCA 4JI8F 4CO1A 4U7UK 2OPQB 1TK5A 3UFCX 2OHDA 2BEFA 3MM6B 1A0OB 4YDXA 3DHXA 3OFEA 4C2MA 2R2TA 4DX7A 4O3RA 4FVMA 3MPDA 3IXQA 2GHVC 4ICLA 3W9IA 2JLFA 1QTNB 4C0OC 3M6VA 3PEHA 1X4HA 4W98A 1CJUB 4IRKA 1KDNA 3CJ0A 4U7CA 4F50A 5HN0A 2DNZA 4ZVOB 3PG9A 2ZWPA 1HBNB 4JV0A 2IBKA 3BBFA 1OQ3A 3KJVB 4A47A 4C48A 2R4FA 4DZ6A 1UW4A 4ZJQA 4FYXB 3QAUA 3UR0A 3KK2B 2DHGA 1ZM9A 4EBCA 3LOUA 1GNKA 1LXNA 1OIAA 2XGPA 1T94A 4K7QA 4NLQA 3SCJE 2VFTA 1BWEA 3EZOA 1TV6B 2DNLA 2OEKA 2E5GA 3H5YA 4ZVEA 2MZ1A 2JVRA 5ETLA 4NZ0A 1CJVB 4WBFA 4U96A 5C42B 2KJVA 1N5VA 1QVFR 4NWBA 2D3OR 3BB5A 1SKUB 1P9YA 2DRDA 5KFFA 1NLKL 1XMBA 4U6PA 1YJWS 1XWLA 2FHKA 5LMNJ 2GMHA 2NZCA 2QA4S 1WTFA 1JIHA 2KZMA 1M1GA 3M1VA 3V6HA 4M95A 3OL9A 2HYIB 2HFVA 4LJMA 2Z57B 2OPPA 3AJDA 1HI0P 5KFTA 1U8SA 5CQGA 3TEHB 4UY85 1Y5LB 2IVFB 3TJAA 3OBIA 1NK8A 3CC4S 1KOHA 4JI7F 5A8RA 2ROGA 1DTTB 5K14A 5MAOA 4IOBA 5BR8J 2I5JA 3NMAA 1PCAA 4DDFA 3ZC4A 3M8RA 1TL3B 4XPCA 4HH1A 2MZJA 1LEOA 3KLFB 4QZVB 3O1LA 3P96A 4LF7J 4UF4A 4KQZA 3QQCD 2CPYA 4D3HA 4CLPA 1VQ5S 3SSQA 5GAGU 1HR0F 2EFPA 2UXBF 3BKFA 1PYTA 3BSOA 2DITA 1TUWA 1QM9A 2XMKA 2LXUA 5EHHA 1HWUA 2OFHX 4O3PA 4P52A 3VAHA 4OYMA 3Q8QB 2J9DA 1HNXJ 5DQHA 1YI2S 4LVOP 1PILA 4ZHRA 1X5OA 3CSKA 2R7VA 3KLIB 1FXLA 5M2PA 4NPOA 4OYIA 1TKXA 4P2XA 1VCTA 4L72B 3BS9A 3LW5C 2RDDA 1S79A 3TYTA 3EPIA 3L95X 2QIFA 1T9VA 1WEYA 1U7LA 2RB7A 2OPQA 3CDBA 4DOZA 4GC7A 3IA0A 3MM6A 3ISND 1EAYC 3OLAA 1IQTA 4B3RF 5T41A 1WHVA 4UQGA 2EFGA 1DLOB 2R7RA 1VC0A 1IR1A 4WPAA 1M5VC 1UA0A 3QSIA 1CEZA 2N7CA 2IM0A 4OI4A 3PIOQ 4DL5A 4LMZA 1CJUA 2CKWA 3FCHA 2MSTA 3MURP 3OV7A 3PDNA 1VYAA 5KFCA 4CIOA 2VKZG 2V9WA 3BSNA 1FXRA 3RB3A 4EO6A 3RAQA 4USTA 1HBNA 3J81U 2HK3A 3K5MA 1OSCA 4ZVUB 4LR9A 3QAEA 1HL6A 2DNGA 3GE9A 1NB2A 3KK2A 2E1RA 5CD4A 3W8PA 2AYGA 2D69A 5F8LA 2Z8QA 2HS0A 5D6GA 2OSRA 2H51B 2C2DA 2EXUA 1S10A 2EFVA 1TV6A 3NAIA 1E6VB 4QWBA 4CM0A 2PO4A 2FJVA 3KLEB 4FZVA 5HQMA 3GILA 4ED6A 1CJVA 3NGSA 2RHQB 3FK4A 2F40A 2V6AA 3A8KA 5C42A 1SIWB 5C2CA 3TZXA 1T95A 3ZZOA 4DV3F 1T9WA 5L38A 5EDWA 3Q8UA 1OJ4A 5HO4A 2DH7A 3HHLD 4LT6A 1RAEB 2R8JA 5JUMA 4NA1A 4X65J 4AE5A 1VQLS 5ETPA 2P5VA 2XI2A 1TMMA 4YB5A 2UXCF 2MTLA 4C11B 4UOHA 2B4UA 2BYCA 1K9MT 3ZTSA 3DI6B 1WEZA 1VLYA 4MIWA 3K5OA 3KLGB 3GQCA 2EBGA 5F9LA 1N6QB 4A46A 3BBBA 1R8AA 1IR2A 2QRRA 1DTTA 3OTOF 4R8UB 1YJVA 2BX6A 4ES2A 3N4WA 4TVAB 3A13A 3AAWB 3KG1A 2CJBA 2CIMA 2MKSA 2M4MA 4RW8B 1TL3A 7FDRA 1FDAA 3JXOA 4TXSA 2BKOA 5EUHA 2VV5A 2DYAA 1S12A 4I2PB 4BCAA 4F0MA 3KLFA 1UCNA 5HAOA 5LXRA 2V34A 1NHVA 4RZRA 1UJ5A 4CCHA 2D41A 1SL0A 4O3SA 1N33J 2V8HA 2FIUA 3N79A 3P4UB 3FGVA 1FXDA 2W8KA 1AYEA 4I7FB 2CG8A 1S0OA 4O4RA 3H0PA 3NBPB 1KHVA 3D54A 3DXBA 4A4JA 4MK8A 1BE4A 2NPIA 1N8RT 2X1GA 1Y11A 4DSFA 1NDKA 1TP7A 5ETMA 2IFXA 3V4IB 3HSGA 3GG1A 3IM9A 3PHTA 4F4YA 3PYGA 3EICA 2DIUA 3KLIA 3T6BA 2IA0A 4KBIA 4YUDA 2B9WA 1HI1A 2AJQA 3HT0A 1PYSB 4S0MA 5AJ3F 3UCUP 2MGZB 4NASA 1RTDB 4CLZA 3POTB 3VZIA 4X66J 1R6YA 2XSFA 1S9FA 4QU6A 1N5SA 1TTHB 2FVRA 4NLRA 6AT1B 3IN5A 1EARA 2ASYA 6FD1A 2WB1D 2ILYA 1NDCA 4J9UE 3UDVA 2ZH1A 1NNDA 5KFRA 4JI2F 2N3OA 3JQJA 3CO9A 4M1KA 2MQPA 4OL8A 1VJWA 4DI6A 2BDPA 4USMA 1RB0A 3TI0A 4RLEA 1DLOA 3CE8A 2F63A 1YGYA 1HNIB 3F56A 2G9OA 1RWMB 1RWXB 2EK6A 2GQ2A 1BMQB 1KN6A 5AE3A 3H8YA 5E3AA 1ZPVA 5DM6Q 2DHHA 3I9V9 4AT1B 4N77A 1PG5B 2H48B 4KHPF 2V4QA 1RADB 1ZAXA 4NOHA 3SFUA 4ZJOA 3G6YA 2ZKTA 3DU5A 4M5LA 3AOBA 2PIIA 1C0UB 5IV4A 2JFKA 2I1RA 5F41A 4LF9J 2DPJA 4QYRA 2J9DE 1E6VA 3AHPA 2RE1A 2AZ3A 1ZZNA 1VBKA 2B7BB 1F2GA 4TQRA 3KLEA 4Q2LA 1O6XA 2UUBF 2NXUA 1NPPA 5HJXA 1QUVA 4B3OB 5MLCV 4DV5J 1SJ3P 5AE2A 2V69A 1RBLA 4X2BA 3TW0A 3SI8A 4LFBJ 1QVGR 5ETSA 3MUVP 5D15A 5C5JA 1FRMA 2HAFA 3ZZ0A 2DEIA 5E2QA 4ZPAA 1F3FA 2MXYA 1SKSA 1CQMA 1X4GA 3SV3A 3C2PA 1YJRA 1VRTB 3MPVA 2KHDA 4C11A 3ILLA 1YKWA 3D1QA 3DI6A 3GYGA 1ZAVA 3KLGA 1SVDA 3SEOA 1N6QA 4K4SA 5D0RA 4Y2AA 5D4LA 1NJWA 4J9VA 4R8UA 1RAIB 3D9BA 2IA6A 2LQJA 3G6VA 3I82A 3R5BA 1PJ5A 1HHTP 2KZZA 1QSLA 4NLVA 2QA4G 4DCJB 1GEHA 1Q0NA 4HDHA 4RW8A 3DRPB 2CRLA 1SH2A 2WOMB 4NXNJ 4PXCA 5D0GA 2VJVA 4I2PA 2CWXA 3A1YG 1FVSA 4DL3A 1WC0A 4KB7A 2GCFA 4K2JA 4DV7F 4L74A 2NXCA 2PEHA 3BQ1A 4I7FA 1M5OC 3WC2A 1HHQA 4NI2B 4EBEA 4MMOA 4B3SJ 1UP1A 1XIQA 3L4BC 2J76E 4YDDB 3NBPA 1QSSA 3ENAA 5KT7A 1VQ9S 1C2PA 2QJ3A 2J5AA 4UOCA 3PY8A 3GCXP 3HHDA 5K8OA 2DH8A 5DRKA 3TA0A 3V4IA 1N36J 4F3MA 1HIYA 3MOJB 3ZNUA 2JZ5A 1H2UX 2VPYB 3FCVA 1VFJA 4PG4A 3HMJG 2MGZA 1RTDA 4M5MA 3H59A 4XDDA 3POTA 3WC0A 3IO1A 5LMUF 1N34J 4OLPA 2QZ8A 4Z2XA 2Y8YA 3I0RB 2PMWA 2COLA 2XEXA 2ZZNA 2HMIB 4HHHA 4CQ1A 4IO9Q 3E8OA 5EWEA 2YWFA 1G2EA 2JOQA 4ED1A 3T5JA 3HFVA 4QIVA 4JV5F 4UTGA 1D9FA 2XHWA 3Q8SB 4ER8A 2RRBA 1HNIA 2AEMA 2ASJA 2ZUAA 4J7CA 4AYBD 4JI5J 4AL7A 2QX0A 2BM1A 2DNRA 4OYZA 2X3DA 1R27B 3K7RA 1OQ6A 1PBAA 3TJ8A 1UPPA 4CYUB 2AQ4A 5DLFA 4DR2J 3AJ2A 5FD1A 3AFGA 4YFUA 3T5LA 4OZJA 1C0UA 2XLKA 2V2ZA 1WNEA 2HHTA 2Y1RI 3MEKA 4Y00A 2ASLA 3FEXB 3GFHA 3KOAA 2Z30B 3HSJA 2DNQA 1D8ZA 1NK5A 1YBAA 4PWWA 4NEZA 4EO8A 3MEEB 1R3NA 1RKIA 4B3OA 1MROB 1XMOF 2ACMA 2A6MA 1RT7B 3MUMP 3LANA 2PDAA 5ADZA 5ETTA 4RPFA 1SB6A 1NB7A 1JKHB 3T1YJ 3QIPB 2HRUA 2F8MA 4FXWA 1FDDA 5KFXA 3PACA 3EDRB 2M88A 3QGHA 4J9KA 3MPYA 3UN2A 3BQ2A 2DR8A 1K73T 3VALA 2AMCB 2NSBA 3Q83A 1RSCA 1FRIA 1VRTA 3UCZP 1LOUA 3OPKA 3RR8A 2HW3A 4DQIA 4QR0A 1WKKA 2MZSA 3PFOA 4EUVA 1NJZA 4CLYA 2B43A 4MK7A 3FRZA 2BJ8A 1S4EA 3GSIA 4RR5A 5KT4A 2LP4A 1IR0A 3RUBL 1T9UA 5FLXY 3EX7B 4LRFA 2ZH5A 3NNHA 2KT2A 2EI5A 1SV5B 4C6AA 4YY3J 3DRPA 1RDRA 4ZN1A 3R7BB 1IKVB 4KHMA 3MD3A 2HFSA 2IJFA 1TU0B 2WOMA 3EUNA 4ZPVR 3DN9A 3DOKB 3I31A 2G13A 2Y9HA 1JLAB 2UVUA 1AB8A 2QLBB 1OPZA 2WVCA 1O51A 1MN9A 4CZCA 1RTHB 5HMZA 3WX4A 3UN5A 1ZTTA 2I9SA 1QTMA 4H4KA 1V3SA 1QUPA 4NI2A 1D0EA 5L1LA 4F4ZA 1RYRA 2ZJRQ 4CLFA 1M5SA 3PCOB 2HVZA 3BSCA 2O67A 2WAQD 3KHRA 2R7TA 4WP8A 1X4EA 2R7XA 3OQ2A 1PIEA 1T11A 4AFFA 4UUXA 3VGVA 2V2VA 3OJUA 3OFFA 1ITPA 1L3SA 3V4MA 3H42A 2R42A 1HQ2A 1H74A 3NLCA 2R7QA 4KGXB 3K59A 2P6SA 1N32J 3M30B 1APSA 2Y0SD 1WKLA 3M8YA 1DRZA 4DX8H 3I0RA 3KK3B 4ZVRB 2EBEA 3TNVA 4C9DA 3QNWB 1H3DA 3IR7B 3CCTA 3P8BB 1UWBB 2ACYA 2ZH4A 2VHGA 4NYOA 4B9SA 1GMVA 3QZ7A 3S1TA 3KMQA 1YJTA 4QIWD 3AT1B 2BJDA 4X62F 3N5BA 2GIQA 2F65A 2IM1A 4DX5A 3MR5A 4ZLPA 1S6QB 3FSIA 1SC1B 2JL9A 4X84A 1P6TA 2MQOA 1IKWA 4K4UA 1BWVA 1Q86T 2DNPA 4CYUA 2OUGA 1YX2A 2AP6A 4LREA 1GXTA 4OX6A 4ZLLA 2OGUA 5B7WA 3KK1B 2C28A 1S77D 4Y2KA 3KUHA 2UXBJ 5E33A 4CLUA 2KM8B 4DX6A 2FYXA 1WHWA 3D6TB 4DR7F 4DPTA 4ILMA 4U67Q 1HD0A 1RA6A 4DR5F 2ALZA 1MLAA 4IKAA 5HL7Q 2O66A 1SCJB 4M5DB 3R5CA 3W9JA 4ED8A 3MEEA 4XDCA 2VBYA 3EGZA 4WU3A 1MROA 2GAHC 1OY8A 3EVOA 4RNOA 4RJVA 4RUHA 2ZBPA 5ETQA 1K8AT 4LF8F 4ED3A 1N0UA 3CIMA 1RT7A 2RS2A 4JOUA 3GR0A 2ZC4A 3AQOA 2EPIA 3DFEA 3MOZA 1JKHA 1LQ9A 3FSYA 2HURA 1IBCB 3QIPA 3GU0A 3THPA 1EETB 4OV6A 3U1MA 1WC6A 8RUCA 3HDSA 4Y2IA 2AJ4A 3VV2B 3CJKB 2W8LA 1U1MA 2M9KA 4QJVA 3O8WA 1U4BA 4ZJLA 2XC9A 2B56A 3FSXA 5IS2A 2RUGA 4LRAA 1DURA 2PI4A 3C14B 4USHA 3NGTA 5B0EA 4CO0A 2KXNB 5CXTA 3QYYA 5DQGA 2CUYA 2ZBQA 3TP2A 1M1KT 2XB2D 4Q44A 4UOFA 2VIHA 2ZDPA 3DGVA 4DCOB 2XGQA 1TK8A 2IMOA 3GYNA 4DJBA 4CT9A 3HVRA 1IKVA 1KTVA 3DOKA 3WZ0A 2FVQA 1JLAA 1VQ7S 2VZ9A 2BKNA 2KT3A 1WEXA 5BJRA 1M90T 4C3LA 1S4FA 2N4DA 1RTHA 4I4BA 4P74A 2E7VA 2W9BB 2BRKA 3NP5A 4N56A 1FA0A 1FE0A 4L73A 2HFOA 1FERA 3R3TA 3HLUA 1TK0A 3E2EA 1IQZA 1FKAF 2ZOFA 4RNMA 1I94F 2DNHA 2DHSA 4U8VA 2WBRA 2LQ9A 3ZTQA 2HBRB 3KKFA 2KXFA 2GQCA 4YR0A 5LJ5Y 2MHNA 1RHJB 1S1TB 2WVFA 4XAKA 3AODA 3F41A 3BYRA 1RCOB 1RAFB 3KHGA 1FJCA 3HHLB 5B09A 4USUA 3X3UA 3M30A 3THTA 3EWGA 3ZZTA 3BYPA 3KK3A 4HI1A 2KU7A 3O5TB 1GTEA 4FBTA 4O3QA 4ELUA 1JLFB 3PW4A 1UWBA 2H5EA 3R5JB 1KR4A 1ZAWA 2HWHA 2BE2B 4J9RA 3OTOJ 1Z2ZA 3SSSA 4GKKF 1MWYA 2P9CA 1S5ZA 1S6QA 2MHEA 5IV3A 3BR8A 1U8WA 1QAYA 2KG0A 3CDEA 2JLEA 4J37A 2XZWA 3S6EA 2R8KA 3LUYA 3OD2A 1K0TA 2NS1B 4Q7AA 4F2RA 1Y0HA 2HG4A 3PJ9A 4PR6A 3KK1A 1PGZA 3C46A 4UZCA 4DLEA 3LAKA 1YWXA 6FDRA 4WF9Q 2JNJA 2HSEB 3TOQA 3QSYB 1FK9B 2LXFA 1L3TA 4M8LA 1Q16B 1LFWA 4F67A 1ZETA 3M7VA 1FFWB 4M5DA 1N5YB 4A8KA 2VQEF 4J9SA 3TJ9A 3Q2SC 5LSOA 2DRBA 2FLOA 4LIWA 4LQ9A 4DUYF 2K1RB 4DL0C 1B0PA 4LRDA 2ZKUA 2DNYA 4PUOB 2B5JA 3M8WA 3NCRA 4ECYA 2UUCJ 4LR7A 4WP9A 4NLUA 1L3KA 4X4OA 1EETA 1T9YA 3OTCA 1NKCA 1VBYA 2FZGB 3M9NB 3IFEA 2MEWA 3CJKA 5J2MB 2NR0A 2VPXB 2WVBA 2WSFC 2GJ2A 4TU7A 4KH0B 4IFYB 1XQIA 1IKYB 2FVCA 4ECTA 4ZP9A 4IG0B 3C14A 4NMXA 5IXUA 1FNXH 3SMZA 3W9HA 4A8MP 3LAMA 1URRA 1N56A 1U45A 4EGLA 3TUIC 3HVAA 3EJMA 2YKQA 3EE3A 5C2GA 3NMRA 4PWUA 1EQMA 5I3PA 2KM8C 4X4VA 4KHPJ 1TKZB 4FYWB 2IYIA 2ZHOA 2NYIA 3BPDA 3BN4A 2RU9A 1PAUB 2YWKA 4Y2CA 3PZPA 3RTVA 2KO1A 3BQ0A 1CG2A 3CJSA 1R8PA 4RW6B 2J7UA 4A8QA 2POKA 2W9BA 4WFNQ 4J9PA 1JQGA 2D7SA 1K0VA 4IH5A 3PEJA 1J27A 1ZTWA 1HNZJ 4IOAQ 2BJ1A 3OUYB 5B08A 5ETKA 4OI3A 3DLJA 5F9NA 2IDLA 1S1TA 3NS5A 2BKPA 2HKEA 2VONA 1WOSA 3R6LB 2FZKB 3W5YA 4WP3A 1RLCL 1WC4A 2CZ9A 1HA1A 3HHLA 7AT1B 4OV1A 2JRSA 3BO3A 4YEAA 2MJNA 5KFJA 2JWNA 4WXOA 5D4NA 3W63A 1VC5A 3CJ3A 2Q6CA 3FC9A 1JLBB 4HHUA 2QFJA 1F1BB 2W01A 3A8JA 3ILIA 4GMKA 2UU9J 1JLFA 4RBUA 5C24B 3OR1A 3CMQA 3CMES 4C0BA 2BE2A 2RH3A 1VK8A 2E9RX 1NK6A 2RU3A 3HFKA 2RVJA 5D8HB 1RWNB 1AA1B 2HK2A 4YB6A 3PX4A 4CLLA 2MKKA 4FPRA 2CJQA 4WKRA 4ZVHA 1RAOA 3HK2A 4TQSA 4ECUA 5GMKa 3FBBA 3HHNB 3DNCA 1KS2A 1XMQJ 5LT5A 1FK9A 2J8AA 2KN4A 2V4JB 1M5PC 1DJ0A 2CPXA 2IM2A 3MF5A 1RBAA 4P6QA 5G0RA 3S01A 4CP5A 3PR5B 1CBKA 3FRYA 4URQU 2G2ZA 4F0HA 4RW4B 4HTIA 2HHQA 1N5YA 2Q3PA 3OL6A 1DARA 3RU0A 3I55S 1VBZA 5I3QA 2VODA 1KLMB 1L3UA 3C19A 2J7KA 2K1RA 4ZDNA 1H2TZ 3TA1A 4WKYA 2AU0A 4PUOA 4BWMA 3QZ8A 4ZVFA 1SL1A 3DLEB 2SXLA 4DV6J 2CVEA 4Z37A 1NAQA 2FD2A 1CC7A 2P9EA 1FD2A 2UVRA 1TL5A 4DR1F 1U26A 1S1XB 5J2MA 2FGCA 3D4JA 1FESA 2F9DA 4ZMMA 3NKYA 1HARA 4MJKA 4IFYA 3WX8A 1FWLA 1IKYA 3EDQB 3CW2C 4CWBA 4JV5J 4DV4J 1XR6A 4IG0A 5DZ6A 3WBZA 3T1HJ 3M6XA 1PC5A 4PXBA 4FF3A 3IG1B 2CNOB 3R5DA 2N3LA 1SQEA 1XERA 1R89A 2QO3A 3D5MA 4I1TA 1TKZA 4GO7X 3B4MA 4JYAJ 1R0AB 2QN6B 3PW7A 2GHWA 4K4ZA 4R0JA 5E5NA 1H6KX 5CD4H 4RW6A 2XMVA 4ZK7M 2W2OP 2KFYA 3UD5A 2UVVA 1BQXA 1UEVA 4CTAB 1QAJA 2DR5A 1TL1B 4MKBA 1PBUA 2OJ3A 2GA7A 4CO5A 3HCXA 3OUYA 5IC6B 4NMLA 5CA5A 2GAGC 4KC5A 3H4DA 2E1MC 4FF1A 4K2XA 2Y0BB 3LP2B 2LEPA 1R8BA 3BF4A 5IT9Y 2UV8A 4OMFG 4ZCIA 1IXKA 2VQFJ 4OZ2A 1SC3B 1WC5A 1OSDA 3ONQA 4LF4F 1UW9A 2CPEA 5BYSA 5JXSA 5B0FA 1LWCB 1Q4RA 2UXDJ 3GV7B 2BUNA 1JLBA 1XNRF 1U2CA 1UJ6A 3D6FB 1NJIT 2QLFB 1URNA 5C24A 1HBMB 4I6YA 2C3MA 2F4VJ 4W92B 3OXFA 2IAJB 3WQPA 5F0UA 1QAXA 2HHHF 2VG7B 1IBKJ 2VUGA 2A10A 5KT2A 3GZ7A 2M8HA 3RB6A 3PX6A 3PJWA 2V68A 2YNGB 3MR2A 2C2EA 4LFAF 4M94A 2ZJPQ 5T7LB 2CADA 3LQVA 4N5SA 2LXIA 3UDCA 2XSJB 3BGUA 3GFXA 3CD0A 4F04B 1N88A 3CVKA 2DR6A 4JUZA 1Z4UA 3PW0A 3R1LA 4EWTA 4K4YA 2V4JA 4X4PA 4N76A 2Z56B 1WOOA 4ZPWR 2CQCA 2QLXA 4NLWA 4RW4A 3GV8B 5IT0A 2FHJA 1Q7YT 3M2VB 1TVRB 3KHLA 3B78A 1KLMA 2HVIA 4DPYA 3TUPA 4RUBA 5FIIA 3PJXA 2UVWA 4MKYA 4HT7A 4NCGB 1P1LA 3K8WA 1FHTA 5L1IA 4G65A 2B9EA 1NK4A 3DLEA 1YITS 4DG1B 3TARA 3CCRS 4LRCA 3GCWP 3D67A 2W2MP 1OS5A 2HZCA 2PSZA 3CUNA 4DN9A 3IBWA 2FY8A 1S1XA 1LXJA 5H1SV 2EVZA 1WG1A 1VHIA 4C8KA 2E5JA 3D0HE 3NEKA 4X4TA 3VVUA 2AEJA 2GVDB 3A8IA 3W5XA 1AXQA 5KFLA 5DETA 4H4MB 4X62J 3NWGA 4NA3A 4BC9A 3I4PA 2YWGA 3IG1A 1NPRA 2ASDA 4PZVA 4NCAA 4IH6A 3CNQP 1SQGA 4TLQA 1V9OA 3IBCB 1UWAA 2QLJB 2XYHB 1I3OB 2MJUA 2XMWA 1R0AA 2ADCA 2XCAA 3R2CJ 5KFGA 4ZCMA 4DR3J 2NYHA 4QBUA 5IQQA 1KFDA 4EBDA 1XR5A 4DR7J 4OZ1A 2OI2A 1GX6A 4LF6J 3H2LA 2GHPA 2DR9A 2GNKA 1C1BB 3J7ZT 4CTAA 2W24A 3U27A 4OI6A 2ILZA 1TL1A 3SDEB 3NGUA 3ZFVA 2PN6A 3FKBA 2C3UA 4BHQA 2MQNA 3QFHA 2DISA 2HWIA 5KFBA 4B02A 4YR3A 1DY3A 2P9GA 1XC9A 3DDNA 4FXVA 2CPHA 3LP2A 3ZXWA 3Q2TC 2OMLA 4ZPCA 3GJSB 3MMAB 2ERRA 3DHWC 4CDIA 4ZLJA 2B0GA 4PPZA 1EKRA 4ECQA 5A6PA 2F5GA 4NEYA 4K4WA 5HMXA 4CT8A 2W25A 2BACA 1VR6A 1PKUA 2JFDA 4OZNA 1LWCA 2F1FA 1F60B 4IRCA 3N01A 4X4UA 1BLUA 2DGSA 1GMWD 1X9MA 3OXLA 2M7SA 4J9QA 2J0XA 3D66A 3L7PA 3EPGA 4YB7A 1HBMA 2VA3A 5F0WA 4XO0A 1BHNA 2IAJA 2DD8S 4OX9J 3R5AA 2M2BA 3GWCA 2VG7A 4LF5J 7FD1A 4W90B 1IM4A 2CQ0A 1FTCA 2WONB 1Y5IB 2FDNA 3U1NA 2DY9A 4E98A 5L46A 4OJ1A 1H98A 4DF4A 2HVDA 5KFOA 1VS3A 1VRUB 1WACA 2YNGA 3RRGA 2RD5C 4WJBA 1S0MA 5T7LA 4X64F 4QR2A 2XSJA 3MTKA 4HEA9 4NLDA 4FDFA 1WORA 1FTRA 2JEFA 3MMCB 1R8HA 3UI3A 2QMXA 4W4MA 2LLZA 2GMJA 2J9EA 2NREA 4RWWA 3JTOA 1D8YA 3GSDA 1BXNA 1LW0B 2LCWA 2GIFA 4FKXA 2IC3B 2MQMA 1IJEB 5IC4B 4Y28C 3RR7A 4FPIA 4O44B 3B4DA 3ZTPA 3P6YC 3NY0A 1FE4A 2CFXA 2PI5A 1NKEA 1TFWA 3M2VA 2DKOB 1TVRA 4JV2A 2AYEA 2BQUA 1GXUA 2WVEA 3JS9A 1AW0A 3DRXA 1RT5B 4FF4A 2A1BA 4LBIA 4NCGA 3G6XA 3HKWA 4N41A 2HVEA 2U2FA 4ECZA 4DLGA 2DO0A 4P7TA 1HPZB 4DG1A 2JX2A 3GIIA 1MW7A 2J9CA 3W64A 4LFCF 3W65A 1Q82T 3DKDA 3C6TB 5KTQA 3K8VA 3QT7A 4DV0F 2CDRB 3I56S 5IT4A 1S0NA 3MWBA 1B0TA 4P72A 1FEEA 5CYMB 2HQIA 2KG1A 3AB4B 3A8EA 2BJ3A 4IOCQ 2GVDA 1WDDA 2Y1IA 4RU2A 4H4MA 1MN7A 4GKKJ 1UPMB 3LPYA 3QGIA 3NL0A 2XULA 2KFNA 2W4DA 3MFHA 2HAIA 4JBCA 2ATLA 3KHHA 3SXLA 1LW2B 2BJ9A 4GC6A 2E5LF 2HPUA 4TU9A 3TUZC 3OVBA 2WBMA 5CYQB 2CWKA 5E0OA 3NXZA 2HHWA 3TWZA 1JXLA 1NM2A 1AUDA 2LYVA 3NNAA 5HJYA 2YWHA 4LQ3A 5FJ4A 4C3KA 2DXDA 3HPOA 2HFUA 3GJTB 4WTOB 5HROB 4B3TF 1RUSA 3W1YC 4QR1A 2GQQA 4QPTA 1C1BA 1R0CB 2MQ8A 1H0HB 1BC6A 2EC2A 4U9RA 1H38A 3SDEA 2VQEJ 3ZO7A 2MZRA 4MFBB 2HS4A 4NL5A 5FLXU 4ZVPB 3M9OB 2RKIB 4DUYJ 5AXKA 3KYLA 3ELHA 5GADI 1FKOB 3ZZZA 3NOGA 1U1RA 1FJGF 3KLVA 2RQ4A 3MCSA 1WC3A 3U7JA 2L08A 1YSJA 1UEUA 2VFSA 4E2FB 2IY5B 4ZKAA 1NRKA 4ID8A 3Q24A 2GX8A 1OY6A 1HFEL 3MEDA 3AY0A 8ATCB 4GVLA 2HNDB 3BGRB 2GV1A 3HFZB 1FCAA 1T8EA 4XK8C 3IAM9 4QWCA 1FKPB 5KFZA 2A0FB 1VLOA 2IHR1 2WONA 1X4FA 1N0VC 2FJXA 2XMTA 4PQAA 2HFZA 3CD7A 4KPYA 4P2MA 1VRUA 3EYZA 3NCPA 1VHFA 4B3MJ 2DHAA 3SIPB 4AXJA 1REVB 3CCWA 2ATCB 3MMCA 1TZ0A 1ZPWX 1Q5VA 1WTBA 2QFIA 2PE8A 1Q95G 2WSEC 3CCUS 3R27A 2C3YA 1LW0A 4OZLA 2IC3A 4LF1A 4O44A 1JJ2R 4CH0S 1Q7LB 1WOPA 1HHSA 4HL9A 4DUZJ 1U0HB 4C8ZA 4OYPA 3QMQA 4PXDA 1PYOB 1NEEA 4MKVA 4MYUA 1RT5A 3AA8A 2K8GA 5LMNF 2V8PA 2VDHA 3S7RA 3GJRB 4F3QA 3W62A 3AJ1A 4J5OA 1RHRB 1HPZA 4DSKA 5A76A 2B8PA 5KT5A 2QT7A 3W3SA 1UVIA 2VPZB 3KG4A 2VB6A 2NPFA 5JJBA 4DV2J 3C6TA 4KGMA 4N47A 2AGOA 3KDOA 4K4XA 3G6ES 3RAXA 1SJ1A 4K0KJ 4DEZA 5DO2A 4ZOSA 4GKJJ 1KWMA 1FI4A 5J1EB 5CYMA 5CABA 4ZCLA 2HHPA 2F3JA 1KC8T 3HULA 3EGWB 1N5TA 1KBRA 1JWWA 3BKTA 1D3WA 1GMUA 4UQTA 3DLBA 5BR8F 2KB2A 2NUUG 4IH7A 3CCQS 2E7XA 5GAEI 2BABA 4ERDA 2BE9B 2BRLA 2DGVA 4PAAA 2DTJA 3VTIA 2EK1A 1LW2A 2V67A 4KY3A 3CPWR 3VAMA 3CDWA 5BYQA 4F4AA 5CYQA 3UD3P 1ROFA 2C2KB 1X4CA 3T41A 4ETZA 3GFYA 3CD5A 4UT4A 2DRAA 4LSZB 1ACMB 1MWZA 2ZBCA 1YLXA 3M6UA 4A8SA 5HROA 5GVQA 2XLJA 3OL7A 1X31C 4Q2MA 1RA7A 1YZ6A 2I2YA 4KAIA 3N6NA 2JHEA 2QV6A 2LU1A 3MCNA 4PYAA 1JJCB 4UUWA 4DFKA 4MFBA 4KYZA 2KYZA 5FDLB 3K5LA 5KFHA 4LBPA 2DNKA 3PIPQ 3PYEA 4DFMA 2YBVA 2RKIA 5KG3A 4YP3A 3CEDA 5AXNA 2UUTA 1RHQB 2A6OA 1FKOA 2R8IA 1WHYA 3CCES 2BR0A 2M5YA 4PWDB 4DS5A 3TVZA 1O8BA 1RWPB 4NZ7A 3TAPA 3BO4A 2FJWA 2RQKA 2K06A 1TMJA 3DXSX 5IFMA 5ETOA 3DRRB 5L1JA 3PX0A 4OHVA 2PGCA 1NSPA 5L39A 2M8DB 4R25A 1N54B 2HNDA 3BGRA 1TL7B 1DZ5A 3K17A 1EQ0A 1HBOB 2HNYB 3CIZA 1FKPA 2FJAB 2FB0A 3RB0A 1R7IA 5F8MA 3IR6B 4A8XA 1RAJA 1S1WB 4ENOA 3M8ZA 2CPFA 2ZBRA 4Q5VA 3P45B 4JI4F 1S76D 2D1CA 4AQYJ 1W25A 1YVFA 3QT6A 2FVPA 3N6LA 2KRBA 4EI2A 4ED0A 4K5RA 1REVA 4M5NA 2G2YA 2ZM6J 3P5TL 4KGZB 3A4TA 2JC1A 2ROPA 4XPEA 1RT6B 2OPSB 4WFBQ 2CXEA 4OZ3A 3A3OB 1SH0A 3MM9B 1FNOA 1S6OA 3RJMB 5KG6A 1NSAA 4M63A 4ZVSB 5KFNA 2CDQA 3OXGA 3DLHA 2CPJA 1RBOB 1NSQA 2AGPA 1GK8A 1RWKB 3X1LB 5HSPA 2HGLA 1YJ7A 1MMLA 3CD6S 1OYDA 4B08A 1BQMB 2E29A 2CQGA 1U0HA 3UDLA 1ZH5A 1WD6A 3HF5A 3KMSA 3FMWA 3QIDA 2UV8G 1J5OB 4AL5A 4ANEA 5HATA 3TQ1A 5J2QB 2C2OB 1UVLA 2J0QD 2WTFA 4X4QA 3FZBA 2MMYA 2OLWA 3CDUA 4Y0FA 3GONA 2DEJA 3E3XA 4RL1A 1HNWJ 1N52B 1H7XA 1T9TA 3QWUA 2JC0A 5J1EA 1UJ4A 2VBZA 2VPWB 1B4SA 2L41A 2CNKB 2MB0B 1UEKA 3TA2A 1VGYA 3LALA 1AUSL 1FEHA 3SQOP 3V6KA 3OJSA 1KVIA 2KYXA 2HHSA 5DDPC 1X9SA 1DFDA 1TUVA 4MH8A 1OO0B 4V19J 3CF5Q 2WW4A 4LFAJ 3CT9A 1WI8A 1ZM3A 4DR4J 3A3NB 4G6VB 4ZPDA 2OEMA 2YNFB 2MZTA 4CLWA 2J0SD 3ET6B 4TKTA 4V19X 3CJRA 4OHWA 4KJIA 1N4LA 3M8QB 3DYAB 2CNNB 2H1YA 2G0IA 3H5SA 1RXOB 5B0AA 4LR8A 3PRVA 2Y3YA 2DCLA 1HMVB 3TZZA 3CDAA 2L9NA 3IRWP 4RUCA 1EP4B 1HBUB 5FDLA 4Y65A 1Y7PA 5BXIA 1C4AA 2VFVA 1Y00A 3HKZD 2B3TB 3M9MB 3BV8A 3OW2R 5KFSA 5KFMA 3HVTB 4K4VA 4PWDA 4X66F 1JK9B 2DY1A 1E6YB 1NJYA 4CLTA 3DDKA 4JP8A 2C22A 2AX0A 4A8OA 3Q8PB 4QCLA 2HQ3A 4PKDB 1QD1A 3DRRA 2HFNA 3ENVA 4MK9A 4K8RA 1LKZA 3L9ZA 2J6TA 3N6MA 1DQ9A 1ZM2A 3QO9B 1TKDA 4OIXA 4RBVA 1TL7A 1VQKS 3RB4A 2FGOA 5KFQA 1CVJA 1Y5NB 4NLSA 3GV5B 2G0JA 1HBOA 2HNYA 4ED5A 2HVHA 2BVZA 3SCLE 1T0TV 3VZHA 1S1WA 1WSRA 1RWOB 1RLDA 3PRDA 2DGQA 5J2PB 5D4PA 4NXMF 3OHAA 2C42A 4YS2A 1VC6A 3OVAA 2CA9A 2YH1A 4B9TA 4PPDA 2Z2MA 3OFGA 1WELA 5F3ZA 2ZJQQ 2VKRA 4ECXA 3G96A 2YKMB 1H2VZ 1WF2A 4EYIB 3ITHA 3R9LA 4LF9F 4FF2A 1RT6A 2OPSA 5JVHQ 4L76A 3N28A 3MM9A 1RT4B 5H9EJ 2RHSB 3JAMY 3DLLQ 4NLOA 2D74B 3VAJA 3MGJA 4DV5F 2KDOA 4I68A 1YJNS 1D9AA 2QMWA 4RW7B 5K9FA 2AYBA 1KONA 2ZH9A 1BQMA 3J80U 3WDOA 5KG0A 3GFZA 4JV1A 4XIUA 2VFUA 2Q43A 1MNEA 1J5OA 2VF3A 4CO4A 2Y1LB 5J2QA 4WYLA 4FS2A 1HNVB 2OH2A 2QL5B 3MDFA 1RWWB 2HQFA 1Q1KA 1KQKA 3HI9A 4N8NA 4Q45A 3IAS9 2K3KA 2XM3A 4F4KA 1NH8A 3SCKE 2PC6A 4DSJA 1A9NB 5HBMB 4DR6F 5CYJA 1FWKA 2ZDOA 1XBWA 4C7QA 1YJ9S 2HIYA 2XYPB 3W7BA 4X4RA 4RUAA 2AJ0A 3UN3A 4ELVA 3VHQA 2AV5A 4NXNF 2Z4PA 1MU2B 2RF2B 3N9UC 4DPWA 2YNFA 2V50A 4JI0F 2AHOB 1I6JA 3ET6A 2HZAA 4C0HA 1ZBTA 3M8QA 3DYAA 3M2UB 4CH1A 1J2VA 3GIKA 4X4NA 2LEBA 2B4OA 5F8JA 3M8SA 2CQDA 5HQ8A 2W2PP 5GMEA 2L9WA 5K8PA 2FHJD 1HMVA 2EFNA 1KOOA 3LPEA 3B8HA 2VA2A 1EP4A 1HBUA 1NUEA 3EXYA 4MKAA 2UUWA 2EG1A 2E1CA 2E9TA 1N36F 5EWGA 3OHBA 2MKCA 2O3DA 1RYSA 5A8WA 2LVWA 3MAHA 1F9EB 3G8SA 2E5HA 3HVTA 2XMMA 3J7Z5 4LFCJ 3QLHB 1N34F 1E6YA 3PNIA 1MG7A 5LJ3Y 1VQYA 2B8QA 3ZZUA 2DNOA 4JI1J 5BYRA 5M2RA 1JLGB 1RWUA 4WFXA 1NZAA 4CO3A 5E3PA 1U1LA 3QO9A 2DO4A 3R6GB 3LH2S 2MLZA 3SSRA 2GO9A 3U1LA 3T6JA 3MECB 2WK4A 3I87A 4HKQA 1IKWB 2AJ1A 1UKUA 1V5VA 4HT5A 2GVZB 1SJ4P 1IBLJ 1TAUA 5J2PA 1RI7A 4DR2F 3AQPA 3TVYA 1FX2A 3PRBA 3RRHA 5E3QA 4FNHA 4TN2A 2V4RA 1UFKA 1U1OA 1QJHA 2PMHA 1SBRA 1SL2A 1S7HA 2YKMA 3W2WB 1VQ6S 1RISA 3P5BP 2ZNYA 2M70A 3BH7B 2W1BA 4QW8A 1RT4A 3VQTA 4NX9A 1Q8KA 3CJ8A 4IO1A 4ECVA 2ZHAA 4RW7A 4ZITA 1TR0A 3N0VA 1S9GB 2X51A 4H4OB 2BBEA 2IVMA 1U2FA 3G82B 3W61A 4NLGA 2GW8A 3T1YF 4ATNA 4JI8J 2FJDB 2D3UA 2GMLA 3I9ZA 5GADU 3HZGA 5CH7B 4YB1P 2MKYA 2MKIA 4WZQA 4MAKA 1G3OA 1RACB 1HNVA 5ETRA 3Q8VA 3TZYA 3V5RA 4JI6F 5IOLA 1O5JA 4FS1A 1GMWA 2OD4A 5B0DA 1JNRB 2OMOA 3L7UA 2V2KA 4IQMA 1DAXA 3D2WA 2C2NA 3E51A 1B0VA 3W8GA 2KH9A 2OELA 3ENQA 3VGUA 4ZVQB 5HBMA 4RWXA 1XJWB 2PEBA 1WDTA 3IC1A 2C1EB 2G1DA 2GC8A 3CCSS 4YY3F 4ETXA 2ZD1B 2ZC3A 1PC4A 1MU2A 4IRDA 1FF2A 2RF2A 3JSMB 3G4SS 2PA8D 4EZ9A 2V8GA 1HWLA 4I6AA 3CCJS 2XNQA 2IYGA 4NRUA 3M2UA 4ZIWA 1OMSA 2VJUA 5H9FK 2Z2ZA 1D1UA 1U24A 2KL8A 2ABYA 3DDIA 2KHCA 2D9PA 3KTQA 2E44A 1HD1A 3I96A 3RRKA 4V1Ak 4L75A 3CWJA 4D3GA 3IS9B 1CJTB 3Q23A 1B7YB 2QSFA 3H2UB 2OIHA 1CJKB 2YWWA 2KFZA 1HWIA 4FVCA 5HLFB 1R43A 1N32F 4HR2A 9RUBA 5THWA 4O3NA 3QLHA 1S9EB 5AT1B 2HNZB 3ZTRA 1FJEB 3D6HB 1NPKA 5HVGA 1C4CA 4NYPA 1JLGA 4JI7J 3FZ2A 1TFYA 4M5HA 4DPOA 2ALYB 3BGOP 1EB0A 4DL6A 5KT6A 3OFHA 4USKA 1NDPA 4ZIVA 3OLBA 2K7JA 3MECA 4LVNP 3OT9A 2KXHA 2W2QP 3PKMA 1VQ4S 2GVZA 4ZS6A 1K44A 2QYCA 2YX1A 3GLJA 4DN0A 3HP6A 1J5EF 5GAEU 1U0SA 4U7UD 3AD9C 1UVMA 3VF0B 2H4WB 5A6WA 3H98A 4I56A 2RRAA 1HR0J 1MWQA 1SXLA 5KG1A 4PG8A 1UMJA 1U6BA 2PFDA 4C8MA 2FLNA 3Q86A 4RNNA 3D1HA 3DM2B 3I32A 1HWJA 3HJFA 3SFGA 1X8DA 1V3ZA 2FC8A 3W2WA 3JYTB 4Z7YA 1EKSA 5D0HA 3LGHA 2VG5B 3C15B 3IMQJ 3D0IE 2FHOB 2N7YA 1UAWA 3G8QA 2QEXS 3H2VE 3QJLA 2JVOA 1SH3A 2HGNA 2GFFA 4GRSA 2L3MA 3V6DB 5HK4A 5E3CA 1S0VA 2B5JB 2C2MB 1YHQS 3R7NB 2QG9B 3G8TA 1VOMA 4M5IA 1YRXA 1S9GA 4H4OA 3JQMA 3G82A 3VQSA 2XMAA 4URGA 4LBHA 1UETA 8AT1B 1X0FA 4WYWA 3TUJC 2F8HA 2HLTA 4QIFA 4ITSA 3PHEA 2QL7B 4B3RJ 1LWEB 4ZLNA 1X4DA 5IZHA 3M2RB 3MI7X 2BQRA 4ES3A 2AGQA 3BEGB 5HVHA 1SI9A 3KXDA 4LUBA 1YRTA 3PM9A 1T3OA 3GMGA 4N7TA 3PO5A 3L3CA 4WCEQ 2LDYA 1MSWD 4U8YA 4ZP6A 3GP9A 2HBZB 3K58A 2IRYA 4RW9B 3L09A 4JI4J 4FN5A 2FJEB 5B0GA 3NOCA 3HSDA 2V0NA 2ZD1A 3KJVA 2FQQB 3NWRA 3FCWA 1VQOS 1U49A 5GAHI 2M3DA 2W7AA 2BV3A 2MYFA 3JSMA 3G87A 1EJ7L 1TUGB 3JSYA 1S59A 3PR4A 1U02A 2F8EX 4PG5A 3RBXA 2HRYA 1UL3A 1NDLA 1KVKA 2XTJP 2NXJA 2PT0A 1VRQC 3W5ZA 2AYMA 4BDPA 3KDNA 1WUUA 2PMZD 4DV3J 4ZPTR 2H54B 1I1GA 2Q6BA 2XMJA 2XZTB 3KJFB 1AROP 1CULB 1T03B 1XNQF 3IR5B 1KVJA 2ZUGA 3UQSA 5E41A 4PCQA 3IS9A 1CJTA 3H4BA 4NLXA 3LWMA 4FNIA 1CJKA 2CQ1A 5HLFA 2UXCJ 3UCGA 4FXDA 1S9EA 2HNZA 1NXIA 3Q89A 3I5BA 3ZTOA 4P10A 2HHXA 1RABB 5IWAF 2EFQA 3D1OA 3OR1B 3DLGB 3MR3A 1KQGB 3DU6A 3PV8A 2DIVA 2LKZA 4M5KA 2X1BA 2YY3A 5H9FJ 1FX4A 4XTTA 1YG0A 3J7A1 5F8IA 3PW2A 1WKJA 1RQ0A 2L48A 2R2RA 2R2SA 2B4VA 3UVJB 1CQNA 3ETMA 3I4HX 1KFSA 3QATA 2XY6A 1IBMF 2EW9A 5G0RB 1ICEB 1HQEB 3DM2A 2XS2A 3JYTA 2YNIB 1EIYB 3I0SB 1K47A 2HBYB 2VG5A 5I3UB 4YQWA 3C15A 3I5CA 1SJRA 3T3FA 2DGTA 1WWHA 1BUXA 2FVSA 1JXVA 3MM5B 3V6DA 3T1AA 3IM8A 3UDEA 2CNLB 4CI0B 2BZ2A 5AJ3J 1OYEA 4C97A 2H65B 4E0DA 3DOMB 3G71S 3FEYB 4WK1A 2UUCF 2RIJA 4F7VA 1NMEB 4MIBA 4M5JA 1VIOA 4I2QB 2W9AA 1U25A 3GG0A 3W66A 1I51B 4DS4A 3UD4P 1ZYQA 3D6MB 4JI2J 3ULHA 2G2OA 2WRMA 2MSSA 4KH1B 1LWEA 3L7OA 3UW1A 3O3LA 4M5GA 3M2RA 3AXKA 2LDIA 3TEGA 2FLLA 2CZ4A 2H5IB 1SJFA 3CJ2A 4LSNB 1DTQB 3TZWA 3NG8A 5B0CA 5KFDA 3OSNA 1W2IA 3CO0P 1Q5YA 3EGVA 4NLPA 5K20B 2EEYA 3PTWA 3TAMB 1A6LA 4LSLB 5DG7A 1S57A 4RW9A 4DZDA 3BPSP 2JDJA 4NXMJ 4HI2A 1UFWA 1S6UA 4DV1F 3TANA 4YHHF 1NH7A 3JSBA 4WU2A 3CULA 3LGNA 3SBMA 2XHCA 4R5PB 2HBQB 2C3OA 3BH6B 3AH6A 4Y3CA 1G6BA 2UUBJ 4DL4A 3HXMA 1OPIA 3KJNB 3EVMA 1HNZF 1EHWA 3ETOA 4Q43A 1O0PA 4EMDA 5I42B 3K5NA 1F9FA 4E8UA 4YMEA 5HMYA 1AFIA 4OYXA 4QYZK 2IJRA
chains in the Genus database with same CATH topology
2H5JB 5IC6B 2CJYB 2H5IB 4ZVPB 3KJQB 4ZVOB 3NS7B 4ZVTB 2H48B 1RHKB 2HBRB 3EDQB 3SIPB 1RE1B 1SC4B 1RHJB 4ZVUB 1ICEB 2Y0BB 2CNKB 4ZVQB 3GJSB 1RHQB 5K20B 2QL9B 1F9EB 2CJXB 3R6LB 4JB8B 2HBYB 1SC3B 2HBZB 3RJMB 1RWPB 4ZVSB 2CNOB 2C1EB 2C2ZB 3D6HB 2H51B 2XYPB 1RWKB 2XYGB 4DCOB 2FQQB 2CNLB 1RHMB 2C2MB 5IC4B 4ZVRB 3R7NB 2H65B 4DCJB 4DCPB 3QNWB 3D6FB 3IBCB 2DKOB 2QLJB 2XYHB 1I3OB 2HBQB 3R6GB 3R7BB 1RHUB 2QLFB 2H4YB 2C2KB 1PYOB 2CNNB 3R5JB 1PAUB 3R7SB 1NMEB 2XZDB 1I51B 2QLBB 3GJRB 2Y1LB 4LSZB 2P2CB 3GJQB 3KJNB 3GJTB 2C2OB 3D6MB 1RHRB 1IBCB 1RWVB 2QL7B 3IBFB 3P4UB 1RWOB 1GFWB 2H54B 3P45B 3EDRB 1RWMB 1RWXB 1QTNB 2QL5B 1QDUB 1SC1B 1RWNB 1RWWB 2XZTB 3KJFB 1BMQB 2H4WB 2CDRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H5J B;  5IC6 B;  2CJY B;  2H5I B;  4ZVP B;  3KJQ B;  4ZVO B;  3NS7 B;  4ZVT B;  2H48 B;  1RHK B;  2HBR B;  3EDQ B;  3SIP B;  1RE1 B;  1SC4 B;  1RHJ B;  4ZVU B;  1ICE B;  2Y0B B;  2CNK B;  4ZVQ B;  3GJS B;  1RHQ B;  5K20 B;  2QL9 B;  1F9E B;  2CJX B;  3R6L B;  4JB8 B;  2HBY B;  1SC3 B;  2HBZ B;  3RJM B;  1RWP B;  4ZVS B;  2CNO B;  2C1E B;  2C2Z B;  3D6H B;  2H51 B;  2XYP B;  1RWK B;  2XYG B;  4DCO B;  2FQQ B;  2CNL B;  1RHM B;  2C2M B;  5IC4 B;  4ZVR B;  3R7N B;  2H65 B;  4DCJ B;  4DCP B;  3QNW B;  3D6F B;  3IBC B;  2DKO B;  2QLJ B;  2XYH B;  1I3O B;  2HBQ B;  3R6G B;  3R7B B;  1RHU B;  2QLF B;  2H4Y B;  2C2K B;  1PYO B;  2CNN B;  3R5J B;  1PAU B;  3R7S B;  1NME B;  2XZD B;  1I51 B;  2QLB B;  3GJR B;  2Y1L B;  4LSZ B;  2P2C B;  3GJQ B;  3KJN B;  3GJT B;  2C2O B;  3D6M B;  1RHR B;  1IBC B;  1RWV B;  2QL7 B;  3IBF B;  3P4U B;  1RWO B;  1GFW B;  2H54 B;  3P45 B;  3EDR B;  1RWM B;  1RWX B;  1QTN B;  2QL5 B;  1QDU B;  1SC1 B;  1RWN B;  1RWW B;  2XZT B;  3KJF B;  1BMQ B;  2H4W B;  2CDR B; 
#chains in the Genus database with same CATH topology
 4IDK B;  4OJG A;  1CUL A;  1AT1 B;  4OJH A;  3KJQ B;  1T03 A;  3RW7 A;  2RDJ A;  4KRW A;  1NHU A;  2MZQ A;  2YKO A;  1U6F A;  1VMB A;  3DRS B;  4CO2 A;  4DQS A;  2IDE A;  2QL9 B;  2YNH B;  5KFW A;  3PKY A;  3GB0 A;  3M4X A;  2Y1J A;  4KFB B;  1GAO A;  2YTC A;  1MMN A;  3H5X A;  2CPZ A;  4BWJ A;  3H25 A;  1ZS6 A;  3DLG A;  3FQL A;  2UU9 F;  4I6W A;  2OSQ A;  5RUB A;  3NRB A;  1YIJ S;  1VJQ A;  3CGI A;  2PFF B;  2QSW A;  4OYA A;  2V5H G;  1R31 A;  2R7O A;  3V2U C;  4DR6 J;  3IRX B;  4Q0B B;  3DGP B;  4F8R A;  1T3N A;  4CH7 A;  3UNY A;  2E1A A;  3BN7 A;  5EX3 A;  1UFL A;  5EGY A;  3Q22 A;  2O1P A;  3VVT A;  1IN0 A;  2PD1 A;  3UVJ A;  3NS6 A;  1X7V A;  4K59 A;  4P75 A;  1X60 A;  4URS A;  3O6Q A;  4I64 A;  4UZB A;  2XQC A;  2J8S A;  3LWL A;  2D3O 1;  4JI0 J;  4DV7 J;  1ZA2 B;  5DDR C;  2XI3 A;  1DQ8 A;  1S7I A;  2BW7 A;  3NS7 B;  2KT5 A;  2GIR A;  1XMQ F;  2VU5 A;  1T02 A;  4P2F A;  1HQE A;  2R7W A;  2R2U A;  3AD8 C;  1GT8 A;  2XO6 A;  2YNI A;  3I0S A;  2JJ4 D;  2N4C A;  4KKO B;  2ZH2 A;  3NCQ A;  5I3U A;  2UP1 A;  4JI3 F;  5E7O B;  1OWX A;  4HLB A;  4I69 A;  4F02 A;  3S8S A;  3MM5 A;  5B0B A;  4AL6 A;  3HHE A;  3OL8 A;  5D77 A;  3KNG A;  5J1P A;  4A8F A;  2YKN B;  2YVS A;  2RDI A;  3DOM A;  5LMU J;  4LF2 A;  3HSZ A;  1SPB P;  2GO8 A;  4K4T A;  4Y2M A;  4NRT A;  2RNE A;  4DV6 F;  3KLH B;  4I2Q A;  4DPU A;  5L8R C;  2WW8 A;  2RIL A;  4USW A;  3ZZY A;  2OAU A;  1S1U B;  4O4G B;  3I5A A;  3QRP A;  3M8P B;  2V94 A;  2IM3 A;  4DV4 F;  2DH9 A;  3RAM A;  3T1H F;  3TRG A;  1YRU A;  2JEG A;  4LSN A;  1RHK B;  2G1H A;  1DTQ A;  4OHY A;  2NZ4 A;  2R8H A;  1SQF A;  1ULR A;  2BOP A;  3CXC R;  1RAG B;  2AT1 B;  1P1T A;  2BAN B;  3RBZ A;  5LXY A;  3O2I A;  1KTQ A;  2NXE A;  3TAM A;  5LOQ A;  3G9C A;  3CJT A;  4KO0 B;  2ZZT A;  1F5A A;  4LSL A;  1LFP A;  3J7Y I;  2DNM A;  3J81 j;  4G1I A;  1LWF B;  5CZX A;  2AKW B;  4J9M A;  4C8O A;  4JYA F;  3RYL A;  3MUT P;  4HYK A;  2ZEJ A;  1VIX A;  3EVW A;  3MHY A;  2VFR A;  2XWX A;  1NK0 A;  4F36 A;  2HQD A;  2DNN A;  4R5P A;  5A2Q Y;  3EM1 A;  5DJB A;  2W4P A;  1GX5 A;  2B4P A;  3MCO A;  1XMO J;  2EFO A;  1H73 A;  3FVY A;  1KQS R;  4DPX A;  5I42 A;  2QYG A;  3NGD A;  2OKQ A;  1F9H A;  3VCD A;  2YX7 A;  1NJX A;  4ZCK A;  3KFW X;  4IDK A;  1HQU B;  4C3M A;  4B9V A;  2CJA A;  2VOO A;  2VQF F;  1KP6 A;  4UOG A;  1NBE B;  1JLE B;  3DRS A;  1GH8 A;  4QIG A;  1B70 B;  3ICL A;  2V8V A;  1RCX B;  4J90 A;  3LP0 B;  2YNH A;  1YZ7 A;  4GVB B;  2ROE A;  2RQC A;  1YJU A;  2B9X A;  4OX8 A;  2LU2 A;  3CCV S;  4KFB A;  2V8D A;  1PSD A;  2UXD F;  1BD6 A;  4JI6 J;  3CCZ A;  2EG2 A;  3LTO A;  3OR2 B;  1F3V A;  2A18 A;  2JEI A;  3AXM A;  4YOE A;  3RW6 A;  2RJZ A;  2F4V F;  1DQA A;  4QWD A;  1P27 B;  3P3D A;  1IBK F;  3IRX A;  4J9O A;  4OFZ A;  4Q0B A;  3DGP A;  3LO3 A;  1BGX T;  3QPI A;  3GPA A;  3HJV A;  4PQU B;  2HZV A;  2HGM A;  2VD3 A;  5HMW A;  4OI1 A;  4DSE A;  2WZ1 A;  1Q79 A;  3DLK B;  5LL6 d;  2YPY A;  3SYZ A;  4FYY B;  3CB4 A;  4QYZ J;  4FKY A;  5KAK A;  4DQQ A;  5I4M A;  4IQX A;  3CJ5 A;  1JLC B;  2EKN A;  5KFK A;  2VBX A;  2OPR B;  4OJ3 A;  2HHU A;  5KFI A;  3GIJ A;  2AX1 A;  3C8Y A;  2NUH A;  2DHX A;  1GQE A;  3OSP A;  3MZI A;  2Z2Y B;  5KFA A;  3I6P A;  3THV A;  2WHO A;  3BJY A;  3TX8 A;  3TO8 A;  3GIR A;  4CLK A;  1WSV A;  4TLR A;  4KKO A;  3MR7 A;  1LK7 A;  2E9Z A;  4TYA A;  3MAA B;  1RJJ A;  1S1V B;  4RBT A;  5LSR A;  2E7W A;  4PAB A;  3NGK A;  3TX0 A;  2J0W A;  1UA1 A;  5SZT A;  2AF6 A;  3H90 A;  2J7W A;  3DOL B;  3B54 A;  2FHM A;  4WE1 B;  5L9N A;  3RBD A;  5F8N A;  1KLN A;  3MM7 B;  4TNO A;  2YKN A;  4QQB A;  4CNZ A;  2MQQ A;  2GS8 A;  3KLH A;  3OTD A;  2CQ2 A;  1DBD A;  1X5P A;  2EWH A;  1U47 A;  3VAG A;  5F8H A;  2RML A;  2HMI A;  1FRL A;  1S1U A;  3JB9 k;  3R5G A;  4O4G A;  3M8P A;  4OQJ A;  4C98 A;  3VWS A;  3JAM U;  2AW0 A;  3T9Z A;  2G4B A;  5DZ7 A;  2YXL A;  1UZD A;  4DUT A;  1H7W A;  2LEC A;  5KG5 A;  4A8W A;  3QJP A;  3DCA A;  2DCU B;  2YPZ A;  1X5T A;  3AOA A;  2PA3 A;  4TY9 A;  3MR6 A;  2BAN A;  5K8M A;  3US5 A;  1J5E J;  1Y9O A;  1SC6 A;  1NK7 A;  4KO0 A;  5G4D A;  3CC2 S;  2XO7 A;  5F3T A;  4KGV B;  2EC0 A;  3BM7 A;  1LWF A;  3M05 A;  4H4K C;  3EZU A;  4G3I A;  1XTZ A;  3VAK A;  5KT3 A;  1GTH A;  3U02 A;  4DR3 F;  2A2D A;  5DS7 A;  2KJW A;  2MY8 A;  3LA0 A;  4DR5 J;  2QTW A;  2DVI A;  2H4Y B;  2OEJ A;  1JLQ B;  3LF0 A;  3MM8 B;  1B64 A;  4LF6 F;  5D3G B;  4WII A;  3EMT A;  4OI0 A;  3ISZ A;  2CPI A;  1WHX A;  2VAS A;  1K1S A;  2MLX A;  1KQF B;  4LF8 J;  2FJB B;  3EGN A;  2G0C A;  4ID5 B;  2D3Z A;  3T5H A;  3HHK A;  5D0E A;  2OP5 A;  2N82 B;  2Y8W A;  4RKU C;  1W7W A;  1HQU A;  3FMB A;  1HLW A;  3FBF A;  2DGW A;  1AFJ A;  3KUG A;  1JLE A;  4I0W A;  4IFV B;  1NSK L;  2BXJ A;  2OFG X;  2BW2 A;  3LP0 A;  4GVB A;  2CJX B;  4RNF A;  1PJ6 A;  1QSY A;  3W60 A;  3MED B;  1S97 A;  3OR2 A;  2QMU B;  5KFP A;  2LEA A;  2P6T A;  4R0E A;  4LRB A;  1FJ7 A;  5GMD A;  2VOP A;  3ZNJ 1;  4DWI A;  4RO0 A;  2HEK A;  4OX9 F;  4EZ6 A;  1VQP S;  4LF5 F;  2VG6 B;  2XS5 A;  2VH7 A;  1F5B A;  1FDN A;  4O23 A;  4OZ5 A;  4PQU A;  3R1H A;  4F0K A;  1X5S A;  5DG8 A;  1W2B R;  1M5H A;  1WF0 A;  2RS8 A;  2WVD A;  3DLK A;  4Y34 A;  3SCI E;  4DL2 A;  1SV5 A;  4NLT A;  3H7H B;  5KOW A;  1F2H A;  1I5O B;  4IYQ A;  4YR2 A;  1CS4 B;  1U6Z A;  2LQB A;  5A0Y B;  3C6U B;  4A48 A;  3QJJ A;  1JLC A;  4J9L A;  2OPR A;  2ZH6 A;  1C0T B;  2GGP B;  5GAH U;  5HAN A;  2K7K A;  1HW8 A;  2XS7 A;  4HAC B;  3ENW A;  4QOT A;  4WK3 A;  1F6T A;  5KFY A;  3PYF A;  1I94 J;  5KG7 A;  3BDP A;  4OYB A;  1WC1 A;  2HWT A;  2R7S A;  4B9M A;  2IJN A;  2A2C A;  5JMN A;  2NCK L;  3MAA A;  1S1V A;  4K50 A;  3DC2 A;  1FWP A;  3A12 A;  3LP1 B;  1FFG B;  5KG2 A;  2QA2 A;  4GO5 X;  4BS2 A;  3D3B J;  2X3G A;  2XY7 A;  2W4C A;  2ZVI A;  3DOL A;  4AUK A;  4WE1 A;  1XNQ J;  3MM7 A;  3J81 Y;  4DCP B;  2ZZM A;  2DJW A;  4ECW A;  4ZP8 A;  5EN1 A;  2RUS A;  2ZIT A;  2M52 A;  3OTE A;  1FDB A;  1CLF A;  4G1P A;  5KFU A;  5IWA J;  3K89 A;  3IBF B;  4J9N A;  2AEF A;  1VQM S;  1Q81 T;  2ZFH A;  3K57 A;  1EX8 A;  2VL1 A;  1FRK A;  1A7G E;  3F44 A;  4OHZ A;  2JSX A;  3FBE A;  2OTL S;  5SUH A;  1S48 A;  5E3R A;  4CLS A;  1TAQ A;  3QRR A;  1HI8 A;  2XMU A;  4Y6I A;  2W7O A;  4P7V A;  4EEY A;  1RTZ A;  3R2D J;  3RZA A;  4WXW A;  1MMD A;  4OYO A;  3WIU A;  5HVF A;  4C8L A;  2D9O A;  1TKT B;  1Y10 A;  1V3R A;  2QC3 A;  3FDS A;  2ZH3 A;  3MD1 A;  1RP5 A;  1B7F A;  2QE5 A;  2H9Z A;  1IBM J;  2AJF E;  4F4X A;  4TYB A;  2K2P A;  3HD1 A;  5F8G A;  5J2N B;  3T19 A;  4DU7 A;  4AD6 A;  4F2S A;  2XLI A;  3GIM A;  5C7P A;  4DMZ A;  1G1X A;  3IWX A;  4NZ6 A;  4Q8F A;  1JLQ A;  3IWN C;  4PRF A;  4QPX A;  3MM8 A;  4DQP A;  1NHK L;  5D3G A;  3PW5 A;  4CM2 A;  5AE1 A;  3BKU A;  1NK9 A;  2UUA F;  4NYZ A;  2W2N P;  1YBT A;  3SZ2 A;  4ID5 A;  4UY8 T;  1KD1 T;  2MLY A;  2MQL A;  4LIR A;  3M6W A;  2XY5 A;  2J6S A;  2KKH A;  1LK5 A;  3D7S B;  1VQS A;  2KVI A;  1CSJ A;  2BJ7 A;  1XK8 A;  4IFV A;  2FPH X;  2Q66 A;  1KSP A;  5AXM A;  3SQG B;  2O5D A;  1NKB A;  3CCL S;  3GR1 A;  1PAE X;  3FNN A;  3QT8 A;  3EXC X;  2C2Z B;  4RU9 A;  4ZVG A;  1JJH A;  5LM7 E;  2XYG B;  2BA9 A;  2JH3 A;  4HH0 A;  4QW9 A;  3WIV A;  4USJ C;  2CQH A;  3MPW A;  4C4W A;  1VBX A;  5DQI A;  1RHU B;  4TU8 A;  1KHW A;  2ZNZ A;  3HZE A;  2I0X A;  2VG6 A;  2CVI A;  2R7U A;  4WFA Q;  3ZZR A;  1X4B A;  5CCL A;  3HM9 A;  2CQB A;  2E5I A;  2V9K A;  2P2C B;  3VGS A;  1RU2 A;  2YKP A;  4DV1 J;  5L1K A;  1CS4 A;  2WB4 A;  2B51 A;  3BDE A;  1RU1 A;  2HHV A;  5A0Y A;  3C6U A;  4YHH J;  4B3M F;  2YQ3 A;  2AD9 A;  2Q1L A;  2ZBI A;  1P9Q C;  2Q79 A;  4NE9 C;  1C0T A;  1IUJ A;  1YDL A;  2GGP A;  2F9J A;  4HAC A;  2NQP A;  3FFI B;  1JMT A;  4NLY A;  1X0P A;  4EFA C;  4DHV A;  2V2Q A;  2NSC A;  4KPC A;  4KE5 A;  3AD7 C;  1BY9 A;  4CRJ A;  1ZM4 A;  1IKX B;  3D0G E;  1VDH A;  2R8G A;  4NCB A;  5AXL A;  4O3O A;  4WZM A;  1JB0 C;  3BR9 A;  2BOA A;  1RT1 B;  3LP1 A;  4N8O A;  2HRT A;  4OYW A;  3ILJ A;  2HIQ A;  3E01 B;  4DUZ F;  1FNM A;  3ISN C;  3TR5 A;  1XN9 A;  4H54 A;  4KSE B;  2ZOG A;  3K0J A;  3QFW A;  1UZH A;  2BQ3 A;  1RTI B;  1GXL A;  1ZA1 B;  4KIA A;  4X4S A;  3M32 B;  1JJ4 A;  5DLG A;  5DM7 Q;  4PG7 A;  1Q78 A;  2DK2 A;  1M1H A;  2ADB A;  4AND A;  3MCM A;  4DV2 F;  3VAF A;  3H20 A;  1X9W A;  4BLG A;  1FO1 A;  2KVQ E;  5HP1 B;  2YQ1 A;  5D4O A;  4K0K F;  2K3I A;  3D3C J;  1B3T A;  1G7C B;  4GKJ F;  1QDU B;  2RAQ A;  2BMB A;  1H72 C;  2ZH7 A;  3TAQ A;  1SUQ B;  4L6V 3;  1R6V A;  5C25 B;  2W9C B;  1Y3J A;  1IWA A;  2I8E A;  2AIR B;  3C66 A;  3MTJ A;  4DSI A;  2ZOM A;  5KOX A;  4C8N A;  4DFP A;  2B9Y A;  3MEG B;  1D9D A;  1RTJ B;  1WG5 A;  3J80 Y;  5GAG I;  1TKT A;  4MIA A;  3FQK A;  1PO6 A;  4LF7 F;  3F73 A;  1KRP A;  1IJF B;  1SJQ A;  4Q8E A;  1UTA A;  1HWK A;  1WJ9 A;  5J2N A;  2GJI A;  1QY7 A;  3ZZP A;  2DGU A;  5ETN A;  1CPZ A;  4G1Q B;  2X1A A;  4ECS A;  2CQ4 A;  1NZ8 A;  3FEZ A;  3G86 A;  4ZPB A;  4WWS A;  1RAA B;  4FP9 A;  1HNX F;  1FD8 A;  2R3V A;  4RNH A;  2Z0G A;  4B9L A;  3D28 A;  1FRH A;  3HHL C;  1QAI A;  4JI3 J;  2RT3 A;  1YK9 A;  3R97 A;  3MXH P;  3GJQ B;  2DXE A;  1SKW A;  1FVQ A;  4EK2 A;  1RGV A;  3DMJ B;  2Z58 B;  5CCM A;  1FFS B;  4P9S A;  2OD6 A;  2RQM A;  3D68 A;  1R0B G;  1PJ7 A;  4DR1 J;  2CJK A;  4IUF A;  4F26 A;  3Q8R B;  2F7V A;  1HKA A;  3QRQ A;  3SQG A;  1Z2L A;  4MYT A;  5H9E K;  3IP0 A;  3MMJ A;  4IG3 B;  2ZWO A;  3KNA A;  4PG6 A;  2FTR A;  1SIZ A;  4BBY A;  3TQE A;  1S49 A;  3V6J A;  4DU8 A;  4ED2 A;  2AZ1 A;  1RKJ A;  4WTY A;  2KRR A;  1V5I B;  4KR0 B;  1XR7 A;  3MAQ A;  4OHX A;  4KV8 B;  4DSL A;  3ILO A;  4AXI A;  1N5Q A;  2LA4 A;  2GJF A;  3V81 B;  3T5K A;  4DF8 A;  4PEO A;  3K2Y A;  2M0G B;  5DDQ C;  2VDI A;  3P49 B;  4PYD A;  3JQK A;  5KFV A;  4ED7 A;  4ZN3 A;  4AQY F;  3UO0 A;  2IMW P;  3PFE A;  3J7Y U;  5HQL A;  5L9X A;  1U48 A;  4DBQ A;  3QWP A;  4DFJ A;  2B6A B;  3ITH B;  1RAH B;  2CAJ A;  1T05 B;  2ZM6 F;  1S6P B;  5T14 A;  2HS3 A;  4ES1 A;  3FFI A;  4ZVT B;  1U2R A;  1Q53 A;  2KI2 A;  3VGT A;  1L5U A;  1IKX A;  1RT3 B;  2IVY A;  3VAI A;  2CPD A;  3FJ2 A;  3BGF A;  2GZO A;  1N48 A;  1WG4 A;  2KTQ A;  1RT1 A;  2LQ5 A;  1YTY A;  4WFY A;  3UWT A;  1HYS B;  4P2S A;  2CQ3 A;  3E01 A;  1U1N A;  4LF4 J;  2IRX A;  1YBU A;  2MY7 A;  2QA1 A;  2IRU A;  5K5M A;  2DXF A;  1RTI A;  4FYD A;  2XG8 A;  4UW2 A;  5DGA A;  4HTJ A;  2DB1 A;  4X65 F;  3T9N A;  2DGO A;  3M32 A;  3RG6 A;  3JTP A;  2L9D A;  3SV4 A;  2H3E B;  3B6B A;  1RT2 B;  4O0N A;  4IR1 A;  1XNR J;  3O44 A;  1VI7 A;  4KTQ A;  5HP1 A;  1HNW F;  2X7I A;  2CZV C;  4KT0 C;  5EX0 A;  5A8K B;  2FZC B;  2MPU A;  2I6W A;  2HHH J;  4HHJ A;  4B17 A;  1V6H A;  1SUQ A;  4KHR A;  4P73 A;  5C25 A;  1M5K C;  3C16 B;  1R8C A;  2CJY B;  3RGI A;  2CJ9 A;  4TY8 B;  3PYD A;  2W9C A;  1ZOT A;  1G4C A;  2CQI A;  3MEG A;  1ZZF A;  1RTJ A;  4A8Y A;  1VK3 A;  4DR4 F;  1QE1 B;  1N33 F;  1W26 A;  1UVN A;  4DL7 A;  1AZS B;  3QBC A;  4B9N A;  1C1C B;  3W2V B;  1RZM A;  1KEK A;  3LGM A;  3UE2 A;  4G1Q A;  3UPF A;  4F3O A;  4L3N A;  3QGP A;  4USI A;  1KKH A;  4QU7 A;  3HO1 A;  2U1A A;  1BQN B;  4QWA A;  4ECR A;  3DMJ A;  5A8W B;  1RK8 A;  5D78 A;  5HI7 A;  5IM0 B;  2H5J B;  4PXE A;  3MMB B;  1U1P A;  2DT9 A;  4ED4 A;  5KFE A;  2QGF B;  4RX6 A;  3PXG a;  3HD2 A;  3BRE A;  3HVW A;  1D09 B;  3HT3 A;  4IG3 A;  1LWX A;  5J1N A;  2ZE2 B;  5DGB A;  2OO4 A;  3CC7 S;  1U09 A;  4J91 A;  1M0S A;  2YH0 A;  4KV8 A;  2LQ8 A;  1JNZ B;  5LSL A;  1Z1Z A;  4KGK A;  1VQN S;  3V81 A;  4ANC A;  1LV5 A;  2LMI A;  3FUY A;  3CJ4 A;  2NLW A;  1F0X A;  2UZA A;  1Q8I A;  2XCP A;  3CJQ A;  3Q0A A;  2A3J A;  2HQC A;  2WSC C;  1GFW B;  2RRN A;  2Z2L A;  2B6A A;  3PVX A;  1T05 A;  2WCX A;  2CG4 A;  1NU4 A;  3QGG A;  1S6P A;  3GTY X;  3MFI A;  2O01 C;  4OZ0 A;  3RBE A;  5CHC B;  1TL4 A;  1RT3 A;  2ZVS A;  2LFV A;  1U1Q A;  4P71 A;  3K5P A;  2NXN A;  4U95 A;  3KWM A;  4ALZ A;  2DPI A;  5KG4 A;  2YX4 A;  1FRX A;  4LFB F;  2JLG A;  1XEZ A;  2R9L A;  1Q8L A;  1HYS A;  2DBB A;  3BSA A;  4BC7 A;  4ELT A;  1KNZ A;  3PO4 A;  4O0I A;  3IWL A;  1SKR A;  2XBP A;  3AOC A;  2B7C B;  1T9X A;  1UVJ A;  2QLW A;  3G2X A;  1RT2 A;  4IR9 A;  2VIC A;  3R7S B;  3C3L A;  4FYV B;  4DQR A;  4B9U A;  2ZHB A;  4ZA1 A;  1WI6 A;  3J7A N;  3OTB A;  1REG X;  1Q8B A;  1RWV B;  1FT8 A;  1B99 A;  4ICL B;  2IBO A;  5A8K A;  1F5C A;  4EU0 A;  1T7P A;  2FLP A;  3C16 A;  4TY8 A;  2FC9 A;  4CNY A;  3CMA S;  2C2R A;  3AB2 B;  5CAA A;  2DGX A;  2IPO B;  4F4W A;  1S72 S;  4K5S A;  2MKH A;  4NA2 A;  3GYX B;  3BZQ A;  4X64 J;  4C8Y A;  2DR7 A;  1LNQ A;  4EYH B;  2CQP A;  4QWE A;  2F4F A;  2C3P A;  2VBW A;  1QE1 A;  4MT1 A;  1L3V A;  2APO A;  2MKJ A;  2E1P A;  3ADA C;  3VR1 A;  1AZS A;  1ELO A;  2AJ2 A;  1C1C A;  2YKA A;  2CYY A;  3W2V A;  4B3S F;  4ZP7 A;  1FRJ A;  1OY9 A;  3IGV A;  2X1F A;  3JSR A;  3CTR A;  1NO8 A;  1X4A A;  5K8N A;  1UVK A;  2XZD B;  3NNC A;  2BJE A;  3KUE A;  2P8I A;  3EZ5 A;  1HW9 A;  1BQN A;  1P8G A;  5M2U A;  2YQ0 A;  3FBC A;  3F0N A;  1S99 A;  2I38 A;  4I67 A;  5EWF A;  4F25 A;  3CCM S;  4YN3 B;  3M1V B;  5IM0 A;  1U1K A;  3MMB A;  3B82 A;  2OTJ S;  1WF1 A;  2ZH8 A;  2RSQ A;  1NCL A;  2OPP B;  3OVS A;  2JEJ A;  3KG0 A;  1RE1 B;  4DV0 J;  2BM0 A;  2FY1 A;  2BE7 D;  1QLN A;  3QT5 A;  2EKY A;  4JB8 B;  4JI1 F;  2XWY A;  2HQG A;  3MPU B;  5A2Q U;  5A8R B;  5K14 B;  5DG9 A;  2J6U A;  4Z7C A;  2ZE2 A;  3H40 A;  1VQ8 S;  2MDA A;  3JTN A;  2I5J B;  3WHI A;  1Y4Z B;  1DHM A;  4OI2 A;  4OX7 A;  4JI5 F;  5IT9 U;  3A3P B;  4DXL A;  9ATC B;  1JX4 A;  1TEL A;  1JXE A;  3H5U A;  2YWE A;  4USV A;  2E5L J;  1K1Q A;  3DRY A;  2VC1 A;  5U47 A;  1IBL F;  4FBU A;  5IQ6 A;  4OLO A;  1IVZ A;  2XNR A;  3N5F A;  3UR3 C;  5JVG Q;  4HDG A;  4QIE A;  3AA9 A;  2W7P A;  4MTP A;  2V63 A;  1IWG A;  5ITH A;  1EZZ B;  3NGR A;  4B3T J;  5ETV A;  1VIS A;  1IM6 A;  3R8Y A;  1TQL A;  4ILR A;  5CZV A;  1Y3K A;  4WFZ A;  1SC4 B;  4WIQ A;  3IGN A;  3Q8Y A;  2HLU A;  2UUA J;  3UNG C;  5DDO C;  1YQH A;  4ZHR B;  2AWZ A;  2FUG 9;  1CC8 A;  4ILL A;  3BGL A;  2LA6 A;  2IIH A;  4HVZ A;  1TKX B;  2VC0 A;  3HX9 A;  3TVK A;  3MMA A;  1FJG J;  3BO2 A;  2E66 A;  1RHM B;  3NAH A;  4L3K A;  3BBC A;  4JI8 F;  4CO1 A;  4U7U K;  2OPQ B;  1TK5 A;  3UFC X;  2OHD A;  2BEF A;  3MM6 B;  1A0O B;  4YDX A;  3DHX A;  3OFE A;  4C2M A;  2R2T A;  4DX7 A;  4O3R A;  4FVM A;  3MPD A;  3IXQ A;  2GHV C;  4ICL A;  3W9I A;  2JLF A;  1QTN B;  4C0O C;  3M6V A;  3PEH A;  1X4H A;  4W98 A;  1CJU B;  4IRK A;  1KDN A;  3CJ0 A;  4U7C A;  4F50 A;  5HN0 A;  2DNZ A;  4ZVO B;  3PG9 A;  2ZWP A;  1HBN B;  4JV0 A;  2IBK A;  3BBF A;  1OQ3 A;  3KJV B;  4A47 A;  4C48 A;  2R4F A;  4DZ6 A;  1UW4 A;  4ZJQ A;  4FYX B;  3QAU A;  3UR0 A;  3KK2 B;  2DHG A;  1ZM9 A;  4EBC A;  3LOU A;  1GNK A;  1LXN A;  1OIA A;  2XGP A;  1T94 A;  4K7Q A;  4NLQ A;  3SCJ E;  2VFT A;  1BWE A;  3EZO A;  1TV6 B;  2DNL A;  2OEK A;  2E5G A;  3H5Y A;  4ZVE A;  2MZ1 A;  2JVR A;  5ETL A;  4NZ0 A;  1CJV B;  4WBF A;  4U96 A;  5C42 B;  2KJV A;  1N5V A;  1QVF R;  4NWB A;  2D3O R;  3BB5 A;  1SKU B;  1P9Y A;  2DRD A;  5KFF A;  1NLK L;  1XMB A;  4U6P A;  1YJW S;  1XWL A;  2FHK A;  5LMN J;  2GMH A;  2NZC A;  2QA4 S;  1WTF A;  1JIH A;  2KZM A;  1M1G A;  3M1V A;  3V6H A;  4M95 A;  3OL9 A;  2HYI B;  2HFV A;  4LJM A;  2Z57 B;  2OPP A;  3AJD A;  1HI0 P;  5KFT A;  1U8S A;  5CQG A;  3TEH B;  4UY8 5;  1Y5L B;  2IVF B;  3TJA A;  3OBI A;  1NK8 A;  3CC4 S;  1KOH A;  4JI7 F;  5A8R A;  2ROG A;  1DTT B;  5K14 A;  5MAO A;  4IOB A;  5BR8 J;  2I5J A;  3NMA A;  1PCA A;  4DDF A;  3ZC4 A;  3M8R A;  1TL3 B;  4XPC A;  4HH1 A;  2MZJ A;  1LEO A;  3KLF B;  4QZV B;  3O1L A;  3P96 A;  4LF7 J;  4UF4 A;  4KQZ A;  3QQC D;  2CPY A;  4D3H A;  4CLP A;  1VQ5 S;  3SSQ A;  5GAG U;  1HR0 F;  2EFP A;  2UXB F;  3BKF A;  1PYT A;  3BSO A;  2DIT A;  1TUW A;  1QM9 A;  2XMK A;  2LXU A;  5EHH A;  1HWU A;  2OFH X;  4O3P A;  4P52 A;  3VAH A;  4OYM A;  3Q8Q B;  2J9D A;  1HNX J;  5DQH A;  1YI2 S;  4LVO P;  1PIL A;  4ZHR A;  1X5O A;  3CSK A;  2R7V A;  3KLI B;  1FXL A;  5M2P A;  4NPO A;  4OYI A;  1TKX A;  4P2X A;  1VCT A;  4L72 B;  3BS9 A;  3LW5 C;  2RDD A;  1S79 A;  3TYT A;  3EPI A;  3L95 X;  2QIF A;  1T9V A;  1WEY A;  1U7L A;  2RB7 A;  2OPQ A;  3CDB A;  4DOZ A;  4GC7 A;  3IA0 A;  3MM6 A;  3ISN D;  1EAY C;  3OLA A;  1IQT A;  4B3R F;  5T41 A;  1WHV A;  4UQG A;  2EFG A;  1DLO B;  2R7R A;  1VC0 A;  1IR1 A;  4WPA A;  1M5V C;  1UA0 A;  3QSI A;  1CEZ A;  2N7C A;  2IM0 A;  4OI4 A;  3PIO Q;  4DL5 A;  4LMZ A;  1CJU A;  2CKW A;  3FCH A;  2MST A;  3MUR P;  3OV7 A;  3PDN A;  1VYA A;  5KFC A;  4CIO A;  2VKZ G;  2V9W A;  3BSN A;  1FXR A;  3RB3 A;  4EO6 A;  3RAQ A;  4UST A;  1HBN A;  3J81 U;  2HK3 A;  3K5M A;  1OSC A;  4ZVU B;  4LR9 A;  3QAE A;  1HL6 A;  2DNG A;  3GE9 A;  1NB2 A;  3KK2 A;  2E1R A;  5CD4 A;  3W8P A;  2AYG A;  2D69 A;  5F8L A;  2Z8Q A;  2HS0 A;  5D6G A;  2OSR A;  2H51 B;  2C2D A;  2EXU A;  1S10 A;  2EFV A;  1TV6 A;  3NAI A;  1E6V B;  4QWB A;  4CM0 A;  2PO4 A;  2FJV A;  3KLE B;  4FZV A;  5HQM A;  3GIL A;  4ED6 A;  1CJV A;  3NGS A;  2RHQ B;  3FK4 A;  2F40 A;  2V6A A;  3A8K A;  5C42 A;  1SIW B;  5C2C A;  3TZX A;  1T95 A;  3ZZO A;  4DV3 F;  1T9W A;  5L38 A;  5EDW A;  3Q8U A;  1OJ4 A;  5HO4 A;  2DH7 A;  3HHL D;  4LT6 A;  1RAE B;  2R8J A;  5JUM A;  4NA1 A;  4X65 J;  4AE5 A;  1VQL S;  5ETP A;  2P5V A;  2XI2 A;  1TMM A;  4YB5 A;  2UXC F;  2MTL A;  4C11 B;  4UOH A;  2B4U A;  2BYC A;  1K9M T;  3ZTS A;  3DI6 B;  1WEZ A;  1VLY A;  4MIW A;  3K5O A;  3KLG B;  3GQC A;  2EBG A;  5F9L A;  1N6Q B;  4A46 A;  3BBB A;  1R8A A;  1IR2 A;  2QRR A;  1DTT A;  3OTO F;  4R8U B;  1YJV A;  2BX6 A;  4ES2 A;  3N4W A;  4TVA B;  3A13 A;  3AAW B;  3KG1 A;  2CJB A;  2CIM A;  2MKS A;  2M4M A;  4RW8 B;  1TL3 A;  7FDR A;  1FDA A;  3JXO A;  4TXS A;  2BKO A;  5EUH A;  2VV5 A;  2DYA A;  1S12 A;  4I2P B;  4BCA A;  4F0M A;  3KLF A;  1UCN A;  5HAO A;  5LXR A;  2V34 A;  1NHV A;  4RZR A;  1UJ5 A;  4CCH A;  2D41 A;  1SL0 A;  4O3S A;  1N33 J;  2V8H A;  2FIU A;  3N79 A;  3P4U B;  3FGV A;  1FXD A;  2W8K A;  1AYE A;  4I7F B;  2CG8 A;  1S0O A;  4O4R A;  3H0P A;  3NBP B;  1KHV A;  3D54 A;  3DXB A;  4A4J A;  4MK8 A;  1BE4 A;  2NPI A;  1N8R T;  2X1G A;  1Y11 A;  4DSF A;  1NDK A;  1TP7 A;  5ETM A;  2IFX A;  3V4I B;  3HSG A;  3GG1 A;  3IM9 A;  3PHT A;  4F4Y A;  3PYG A;  3EIC A;  2DIU A;  3KLI A;  3T6B A;  2IA0 A;  4KBI A;  4YUD A;  2B9W A;  1HI1 A;  2AJQ A;  3HT0 A;  1PYS B;  4S0M A;  5AJ3 F;  3UCU P;  2MGZ B;  4NAS A;  1RTD B;  4CLZ A;  3POT B;  3VZI A;  4X66 J;  1R6Y A;  2XSF A;  1S9F A;  4QU6 A;  1N5S A;  1TTH B;  2FVR A;  4NLR A;  6AT1 B;  3IN5 A;  1EAR A;  2ASY A;  6FD1 A;  2WB1 D;  2ILY A;  1NDC A;  4J9U E;  3UDV A;  2ZH1 A;  1NND A;  5KFR A;  4JI2 F;  2N3O A;  3JQJ A;  3CO9 A;  4M1K A;  2MQP A;  4OL8 A;  1VJW A;  4DI6 A;  2BDP A;  4USM A;  1RB0 A;  3TI0 A;  4RLE A;  1DLO A;  3CE8 A;  2F63 A;  1YGY A;  1HNI B;  3F56 A;  2G9O A;  1RWM B;  1RWX B;  2EK6 A;  2GQ2 A;  1BMQ B;  1KN6 A;  5AE3 A;  3H8Y A;  5E3A A;  1ZPV A;  5DM6 Q;  2DHH A;  3I9V 9;  4AT1 B;  4N77 A;  1PG5 B;  2H48 B;  4KHP F;  2V4Q A;  1RAD B;  1ZAX A;  4NOH A;  3SFU A;  4ZJO A;  3G6Y A;  2ZKT A;  3DU5 A;  4M5L A;  3AOB A;  2PII A;  1C0U B;  5IV4 A;  2JFK A;  2I1R A;  5F41 A;  4LF9 J;  2DPJ A;  4QYR A;  2J9D E;  1E6V A;  3AHP A;  2RE1 A;  2AZ3 A;  1ZZN A;  1VBK A;  2B7B B;  1F2G A;  4TQR A;  3KLE A;  4Q2L A;  1O6X A;  2UUB F;  2NXU A;  1NPP A;  5HJX A;  1QUV A;  4B3O B;  5MLC V;  4DV5 J;  1SJ3 P;  5AE2 A;  2V69 A;  1RBL A;  4X2B A;  3TW0 A;  3SI8 A;  4LFB J;  1QVG R;  5ETS A;  3MUV P;  5D15 A;  5C5J A;  1FRM A;  2HAF A;  3ZZ0 A;  2DEI A;  5E2Q A;  4ZPA A;  1F3F A;  2MXY A;  1SKS A;  1CQM A;  1X4G A;  3SV3 A;  3C2P A;  1YJR A;  1VRT B;  3MPV A;  2KHD A;  4C11 A;  3ILL A;  1YKW A;  3D1Q A;  3DI6 A;  3GYG A;  1ZAV A;  3KLG A;  1SVD A;  3SEO A;  1N6Q A;  4K4S A;  5D0R A;  4Y2A A;  5D4L A;  1NJW A;  4J9V A;  4R8U A;  1RAI B;  3D9B A;  2IA6 A;  2LQJ A;  3G6V A;  3I82 A;  3R5B A;  1PJ5 A;  1HHT P;  2KZZ A;  1QSL A;  4NLV A;  2QA4 G;  4DCJ B;  1GEH A;  1Q0N A;  4HDH A;  4RW8 A;  3DRP B;  2CRL A;  1SH2 A;  2WOM B;  4NXN J;  4PXC A;  5D0G A;  2VJV A;  4I2P A;  2CWX A;  3A1Y G;  1FVS A;  4DL3 A;  1WC0 A;  4KB7 A;  2GCF A;  4K2J A;  4DV7 F;  4L74 A;  2NXC A;  2PEH A;  3BQ1 A;  4I7F A;  1M5O C;  3WC2 A;  1HHQ A;  4NI2 B;  4EBE A;  4MMO A;  4B3S J;  1UP1 A;  1XIQ A;  3L4B C;  2J76 E;  4YDD B;  3NBP A;  1QSS A;  3ENA A;  5KT7 A;  1VQ9 S;  1C2P A;  2QJ3 A;  2J5A A;  4UOC A;  3PY8 A;  3GCX P;  3HHD A;  5K8O A;  2DH8 A;  5DRK A;  3TA0 A;  3V4I A;  1N36 J;  4F3M A;  1HIY A;  3MOJ B;  3ZNU A;  2JZ5 A;  1H2U X;  2VPY B;  3FCV A;  1VFJ A;  4PG4 A;  3HMJ G;  2MGZ A;  1RTD A;  4M5M A;  3H59 A;  4XDD A;  3POT A;  3WC0 A;  3IO1 A;  5LMU F;  1N34 J;  4OLP A;  2QZ8 A;  4Z2X A;  2Y8Y A;  3I0R B;  2PMW A;  2COL A;  2XEX A;  2ZZN A;  2HMI B;  4HHH A;  4CQ1 A;  4IO9 Q;  3E8O A;  5EWE A;  2YWF A;  1G2E A;  2JOQ A;  4ED1 A;  3T5J A;  3HFV A;  4QIV A;  4JV5 F;  4UTG A;  1D9F A;  2XHW A;  3Q8S B;  4ER8 A;  2RRB A;  1HNI A;  2AEM A;  2ASJ A;  2ZUA A;  4J7C A;  4AYB D;  4JI5 J;  4AL7 A;  2QX0 A;  2BM1 A;  2DNR A;  4OYZ A;  2X3D A;  1R27 B;  3K7R A;  1OQ6 A;  1PBA A;  3TJ8 A;  1UPP A;  4CYU B;  2AQ4 A;  5DLF A;  4DR2 J;  3AJ2 A;  5FD1 A;  3AFG A;  4YFU A;  3T5L A;  4OZJ A;  1C0U A;  2XLK A;  2V2Z A;  1WNE A;  2HHT A;  2Y1R I;  3MEK A;  4Y00 A;  2ASL A;  3FEX B;  3GFH A;  3KOA A;  2Z30 B;  3HSJ A;  2DNQ A;  1D8Z A;  1NK5 A;  1YBA A;  4PWW A;  4NEZ A;  4EO8 A;  3MEE B;  1R3N A;  1RKI A;  4B3O A;  1MRO B;  1XMO F;  2ACM A;  2A6M A;  1RT7 B;  3MUM P;  3LAN A;  2PDA A;  5ADZ A;  5ETT A;  4RPF A;  1SB6 A;  1NB7 A;  1JKH B;  3T1Y J;  3QIP B;  2HRU A;  2F8M A;  4FXW A;  1FDD A;  5KFX A;  3PAC A;  3EDR B;  2M88 A;  3QGH A;  4J9K A;  3MPY A;  3UN2 A;  3BQ2 A;  2DR8 A;  1K73 T;  3VAL A;  2AMC B;  2NSB A;  3Q83 A;  1RSC A;  1FRI A;  1VRT A;  3UCZ P;  1LOU A;  3OPK A;  3RR8 A;  2HW3 A;  4DQI A;  4QR0 A;  1WKK A;  2MZS A;  3PFO A;  4EUV A;  1NJZ A;  4CLY A;  2B43 A;  4MK7 A;  3FRZ A;  2BJ8 A;  1S4E A;  3GSI A;  4RR5 A;  5KT4 A;  2LP4 A;  1IR0 A;  3RUB L;  1T9U A;  5FLX Y;  3EX7 B;  4LRF A;  2ZH5 A;  3NNH A;  2KT2 A;  2EI5 A;  1SV5 B;  4C6A A;  4YY3 J;  3DRP A;  1RDR A;  4ZN1 A;  3R7B B;  1IKV B;  4KHM A;  3MD3 A;  2HFS A;  2IJF A;  1TU0 B;  2WOM A;  3EUN A;  4ZPV R;  3DN9 A;  3DOK B;  3I31 A;  2G13 A;  2Y9H A;  1JLA B;  2UVU A;  1AB8 A;  2QLB B;  1OPZ A;  2WVC A;  1O51 A;  1MN9 A;  4CZC A;  1RTH B;  5HMZ A;  3WX4 A;  3UN5 A;  1ZTT A;  2I9S A;  1QTM A;  4H4K A;  1V3S A;  1QUP A;  4NI2 A;  1D0E A;  5L1L A;  4F4Z A;  1RYR A;  2ZJR Q;  4CLF A;  1M5S A;  3PCO B;  2HVZ A;  3BSC A;  2O67 A;  2WAQ D;  3KHR A;  2R7T A;  4WP8 A;  1X4E A;  2R7X A;  3OQ2 A;  1PIE A;  1T11 A;  4AFF A;  4UUX A;  3VGV A;  2V2V A;  3OJU A;  3OFF A;  1ITP A;  1L3S A;  3V4M A;  3H42 A;  2R42 A;  1HQ2 A;  1H74 A;  3NLC A;  2R7Q A;  4KGX B;  3K59 A;  2P6S A;  1N32 J;  3M30 B;  1APS A;  2Y0S D;  1WKL A;  3M8Y A;  1DRZ A;  4DX8 H;  3I0R A;  3KK3 B;  4ZVR B;  2EBE A;  3TNV A;  4C9D A;  3QNW B;  1H3D A;  3IR7 B;  3CCT A;  3P8B B;  1UWB B;  2ACY A;  2ZH4 A;  2VHG A;  4NYO A;  4B9S A;  1GMV A;  3QZ7 A;  3S1T A;  3KMQ A;  1YJT A;  4QIW D;  3AT1 B;  2BJD A;  4X62 F;  3N5B A;  2GIQ A;  2F65 A;  2IM1 A;  4DX5 A;  3MR5 A;  4ZLP A;  1S6Q B;  3FSI A;  1SC1 B;  2JL9 A;  4X84 A;  1P6T A;  2MQO A;  1IKW A;  4K4U A;  1BWV A;  1Q86 T;  2DNP A;  4CYU A;  2OUG A;  1YX2 A;  2AP6 A;  4LRE A;  1GXT A;  4OX6 A;  4ZLL A;  2OGU A;  5B7W A;  3KK1 B;  2C28 A;  1S77 D;  4Y2K A;  3KUH A;  2UXB J;  5E33 A;  4CLU A;  2KM8 B;  4DX6 A;  2FYX A;  1WHW A;  3D6T B;  4DR7 F;  4DPT A;  4ILM A;  4U67 Q;  1HD0 A;  1RA6 A;  4DR5 F;  2ALZ A;  1MLA A;  4IKA A;  5HL7 Q;  2O66 A;  1SCJ B;  4M5D B;  3R5C A;  3W9J A;  4ED8 A;  3MEE A;  4XDC A;  2VBY A;  3EGZ A;  4WU3 A;  1MRO A;  2GAH C;  1OY8 A;  3EVO A;  4RNO A;  4RJV A;  4RUH A;  2ZBP A;  5ETQ A;  1K8A T;  4LF8 F;  4ED3 A;  1N0U A;  3CIM A;  1RT7 A;  2RS2 A;  4JOU A;  3GR0 A;  2ZC4 A;  3AQO A;  2EPI A;  3DFE A;  3MOZ A;  1JKH A;  1LQ9 A;  3FSY A;  2HUR A;  1IBC B;  3QIP A;  3GU0 A;  3THP A;  1EET B;  4OV6 A;  3U1M A;  1WC6 A;  8RUC A;  3HDS A;  4Y2I A;  2AJ4 A;  3VV2 B;  3CJK B;  2W8L A;  1U1M A;  2M9K A;  4QJV A;  3O8W A;  1U4B A;  4ZJL A;  2XC9 A;  2B56 A;  3FSX A;  5IS2 A;  2RUG A;  4LRA A;  1DUR A;  2PI4 A;  3C14 B;  4USH A;  3NGT A;  5B0E A;  4CO0 A;  2KXN B;  5CXT A;  3QYY A;  5DQG A;  2CUY A;  2ZBQ A;  3TP2 A;  1M1K T;  2XB2 D;  4Q44 A;  4UOF A;  2VIH A;  2ZDP A;  3DGV A;  4DCO B;  2XGQ A;  1TK8 A;  2IMO A;  3GYN A;  4DJB A;  4CT9 A;  3HVR A;  1IKV A;  1KTV A;  3DOK A;  3WZ0 A;  2FVQ A;  1JLA A;  1VQ7 S;  2VZ9 A;  2BKN A;  2KT3 A;  1WEX A;  5BJR A;  1M90 T;  4C3L A;  1S4F A;  2N4D A;  1RTH A;  4I4B A;  4P74 A;  2E7V A;  2W9B B;  2BRK A;  3NP5 A;  4N56 A;  1FA0 A;  1FE0 A;  4L73 A;  2HFO A;  1FER A;  3R3T A;  3HLU A;  1TK0 A;  3E2E A;  1IQZ A;  1FKA F;  2ZOF A;  4RNM A;  1I94 F;  2DNH A;  2DHS A;  4U8V A;  2WBR A;  2LQ9 A;  3ZTQ A;  2HBR B;  3KKF A;  2KXF A;  2GQC A;  4YR0 A;  5LJ5 Y;  2MHN A;  1RHJ B;  1S1T B;  2WVF A;  4XAK A;  3AOD A;  3F41 A;  3BYR A;  1RCO B;  1RAF B;  3KHG A;  1FJC A;  3HHL B;  5B09 A;  4USU A;  3X3U A;  3M30 A;  3THT A;  3EWG A;  3ZZT A;  3BYP A;  3KK3 A;  4HI1 A;  2KU7 A;  3O5T B;  1GTE A;  4FBT A;  4O3Q A;  4ELU A;  1JLF B;  3PW4 A;  1UWB A;  2H5E A;  3R5J B;  1KR4 A;  1ZAW A;  2HWH A;  2BE2 B;  4J9R A;  3OTO J;  1Z2Z A;  3SSS A;  4GKK F;  1MWY A;  2P9C A;  1S5Z A;  1S6Q A;  2MHE A;  5IV3 A;  3BR8 A;  1U8W A;  1QAY A;  2KG0 A;  3CDE A;  2JLE A;  4J37 A;  2XZW A;  3S6E A;  2R8K A;  3LUY A;  3OD2 A;  1K0T A;  2NS1 B;  4Q7A A;  4F2R A;  1Y0H A;  2HG4 A;  3PJ9 A;  4PR6 A;  3KK1 A;  1PGZ A;  3C46 A;  4UZC A;  4DLE A;  3LAK A;  1YWX A;  6FDR A;  4WF9 Q;  2JNJ A;  2HSE B;  3TOQ A;  3QSY B;  1FK9 B;  2LXF A;  1L3T A;  4M8L A;  1Q16 B;  1LFW A;  4F67 A;  1ZET A;  3M7V A;  1FFW B;  4M5D A;  1N5Y B;  4A8K A;  2VQE F;  4J9S A;  3TJ9 A;  3Q2S C;  5LSO A;  2DRB A;  2FLO A;  4LIW A;  4LQ9 A;  4DUY F;  2K1R B;  4DL0 C;  1B0P A;  4LRD A;  2ZKU A;  2DNY A;  4PUO B;  2B5J A;  3M8W A;  3NCR A;  4ECY A;  2UUC J;  4LR7 A;  4WP9 A;  4NLU A;  1L3K A;  4X4O A;  1EET A;  1T9Y A;  3OTC A;  1NKC A;  1VBY A;  2FZG B;  3M9N B;  3IFE A;  2MEW A;  3CJK A;  5J2M B;  2NR0 A;  2VPX B;  2WVB A;  2WSF C;  2GJ2 A;  4TU7 A;  4KH0 B;  4IFY B;  1XQI A;  1IKY B;  2FVC A;  4ECT A;  4ZP9 A;  4IG0 B;  3C14 A;  4NMX A;  5IXU A;  1FNX H;  3SMZ A;  3W9H A;  4A8M P;  3LAM A;  1URR A;  1N56 A;  1U45 A;  4EGL A;  3TUI C;  3HVA A;  3EJM A;  2YKQ A;  3EE3 A;  5C2G A;  3NMR A;  4PWU A;  1EQM A;  5I3P A;  2KM8 C;  4X4V A;  4KHP J;  1TKZ B;  4FYW B;  2IYI A;  2ZHO A;  2NYI A;  3BPD A;  3BN4 A;  2RU9 A;  1PAU B;  2YWK A;  4Y2C A;  3PZP A;  3RTV A;  2KO1 A;  3BQ0 A;  1CG2 A;  3CJS A;  1R8P A;  4RW6 B;  2J7U A;  4A8Q A;  2POK A;  2W9B A;  4WFN Q;  4J9P A;  1JQG A;  2D7S A;  1K0V A;  4IH5 A;  3PEJ A;  1J27 A;  1ZTW A;  1HNZ J;  4IOA Q;  2BJ1 A;  3OUY B;  5B08 A;  5ETK A;  4OI3 A;  3DLJ A;  5F9N A;  2IDL A;  1S1T A;  3NS5 A;  2BKP A;  2HKE A;  2VON A;  1WOS A;  3R6L B;  2FZK B;  3W5Y A;  4WP3 A;  1RLC L;  1WC4 A;  2CZ9 A;  1HA1 A;  3HHL A;  7AT1 B;  4OV1 A;  2JRS A;  3BO3 A;  4YEA A;  2MJN A;  5KFJ A;  2JWN A;  4WXO A;  5D4N A;  3W63 A;  1VC5 A;  3CJ3 A;  2Q6C A;  3FC9 A;  1JLB B;  4HHU A;  2QFJ A;  1F1B B;  2W01 A;  3A8J A;  3ILI A;  4GMK A;  2UU9 J;  1JLF A;  4RBU A;  5C24 B;  3OR1 A;  3CMQ A;  3CME S;  4C0B A;  2BE2 A;  2RH3 A;  1VK8 A;  2E9R X;  1NK6 A;  2RU3 A;  3HFK A;  2RVJ A;  5D8H B;  1RWN B;  1AA1 B;  2HK2 A;  4YB6 A;  3PX4 A;  4CLL A;  2MKK A;  4FPR A;  2CJQ A;  4WKR A;  4ZVH A;  1RAO A;  3HK2 A;  4TQS A;  4ECU A;  5GMK a;  3FBB A;  3HHN B;  3DNC A;  1KS2 A;  1XMQ J;  5LT5 A;  1FK9 A;  2J8A A;  2KN4 A;  2V4J B;  1M5P C;  1DJ0 A;  2CPX A;  2IM2 A;  3MF5 A;  1RBA A;  4P6Q A;  5G0R A;  3S01 A;  4CP5 A;  3PR5 B;  1CBK A;  3FRY A;  4URQ U;  2G2Z A;  4F0H A;  4RW4 B;  4HTI A;  2HHQ A;  1N5Y A;  2Q3P A;  3OL6 A;  1DAR A;  3RU0 A;  3I55 S;  1VBZ A;  5I3Q A;  2VOD A;  1KLM B;  1L3U A;  3C19 A;  2J7K A;  2K1R A;  4ZDN A;  1H2T Z;  3TA1 A;  4WKY A;  2AU0 A;  4PUO A;  4BWM A;  3QZ8 A;  4ZVF A;  1SL1 A;  3DLE B;  2SXL A;  4DV6 J;  2CVE A;  4Z37 A;  1NAQ A;  2FD2 A;  1CC7 A;  2P9E A;  1FD2 A;  2UVR A;  1TL5 A;  4DR1 F;  1U26 A;  1S1X B;  5J2M A;  2FGC A;  3D4J A;  1FES A;  2F9D A;  4ZMM A;  3NKY A;  1HAR A;  4MJK A;  4IFY A;  3WX8 A;  1FWL A;  1IKY A;  3EDQ B;  3CW2 C;  4CWB A;  4JV5 J;  4DV4 J;  1XR6 A;  4IG0 A;  5DZ6 A;  3WBZ A;  3T1H J;  3M6X A;  1PC5 A;  4PXB A;  4FF3 A;  3IG1 B;  2CNO B;  3R5D A;  2N3L A;  1SQE A;  1XER A;  1R89 A;  2QO3 A;  3D5M A;  4I1T A;  1TKZ A;  4GO7 X;  3B4M A;  4JYA J;  1R0A B;  2QN6 B;  3PW7 A;  2GHW A;  4K4Z A;  4R0J A;  5E5N A;  1H6K X;  5CD4 H;  4RW6 A;  2XMV A;  4ZK7 M;  2W2O P;  2KFY A;  3UD5 A;  2UVV A;  1BQX A;  1UEV A;  4CTA B;  1QAJ A;  2DR5 A;  1TL1 B;  4MKB A;  1PBU A;  2OJ3 A;  2GA7 A;  4CO5 A;  3HCX A;  3OUY A;  5IC6 B;  4NML A;  5CA5 A;  2GAG C;  4KC5 A;  3H4D A;  2E1M C;  4FF1 A;  4K2X A;  2Y0B B;  3LP2 B;  2LEP A;  1R8B A;  3BF4 A;  5IT9 Y;  2UV8 A;  4OMF G;  4ZCI A;  1IXK A;  2VQF J;  4OZ2 A;  1SC3 B;  1WC5 A;  1OSD A;  3ONQ A;  4LF4 F;  1UW9 A;  2CPE A;  5BYS A;  5JXS A;  5B0F A;  1LWC B;  1Q4R A;  2UXD J;  3GV7 B;  2BUN A;  1JLB A;  1XNR F;  1U2C A;  1UJ6 A;  3D6F B;  1NJI T;  2QLF B;  1URN A;  5C24 A;  1HBM B;  4I6Y A;  2C3M A;  2F4V J;  4W92 B;  3OXF A;  2IAJ B;  3WQP A;  5F0U A;  1QAX A;  2HHH F;  2VG7 B;  1IBK J;  2VUG A;  2A10 A;  5KT2 A;  3GZ7 A;  2M8H A;  3RB6 A;  3PX6 A;  3PJW A;  2V68 A;  2YNG B;  3MR2 A;  2C2E A;  4LFA F;  4M94 A;  2ZJP Q;  5T7L B;  2CAD A;  3LQV A;  4N5S A;  2LXI A;  3UDC A;  2XSJ B;  3BGU A;  3GFX A;  3CD0 A;  4F04 B;  1N88 A;  3CVK A;  2DR6 A;  4JUZ A;  1Z4U A;  3PW0 A;  3R1L A;  4EWT A;  4K4Y A;  2V4J A;  4X4P A;  4N76 A;  2Z56 B;  1WOO A;  4ZPW R;  2CQC A;  2QLX A;  4NLW A;  4RW4 A;  3GV8 B;  5IT0 A;  2FHJ A;  1Q7Y T;  3M2V B;  1TVR B;  3KHL A;  3B78 A;  1KLM A;  2HVI A;  4DPY A;  3TUP A;  4RUB A;  5FII A;  3PJX A;  2UVW A;  4MKY A;  4HT7 A;  4NCG B;  1P1L A;  3K8W A;  1FHT A;  5L1I A;  4G65 A;  2B9E A;  1NK4 A;  3DLE A;  1YIT S;  4DG1 B;  3TAR A;  3CCR S;  4LRC A;  3GCW P;  3D67 A;  2W2M P;  1OS5 A;  2HZC A;  2PSZ A;  3CUN A;  4DN9 A;  3IBW A;  2FY8 A;  1S1X A;  1LXJ A;  5H1S V;  2EVZ A;  1WG1 A;  1VHI A;  4C8K A;  2E5J A;  3D0H E;  3NEK A;  4X4T A;  3VVU A;  2AEJ A;  2GVD B;  3A8I A;  3W5X A;  1AXQ A;  5KFL A;  5DET A;  4H4M B;  4X62 J;  3NWG A;  4NA3 A;  4BC9 A;  3I4P A;  2YWG A;  3IG1 A;  1NPR A;  2ASD A;  4PZV A;  4NCA A;  4IH6 A;  3CNQ P;  1SQG A;  4TLQ A;  1V9O A;  3IBC B;  1UWA A;  2QLJ B;  2XYH B;  1I3O B;  2MJU A;  2XMW A;  1R0A A;  2ADC A;  2XCA A;  3R2C J;  5KFG A;  4ZCM A;  4DR3 J;  2NYH A;  4QBU A;  5IQQ A;  1KFD A;  4EBD A;  1XR5 A;  4DR7 J;  4OZ1 A;  2OI2 A;  1GX6 A;  4LF6 J;  3H2L A;  2GHP A;  2DR9 A;  2GNK A;  1C1B B;  3J7Z T;  4CTA A;  2W24 A;  3U27 A;  4OI6 A;  2ILZ A;  1TL1 A;  3SDE B;  3NGU A;  3ZFV A;  2PN6 A;  3FKB A;  2C3U A;  4BHQ A;  2MQN A;  3QFH A;  2DIS A;  2HWI A;  5KFB A;  4B02 A;  4YR3 A;  1DY3 A;  2P9G A;  1XC9 A;  3DDN A;  4FXV A;  2CPH A;  3LP2 A;  3ZXW A;  3Q2T C;  2OML A;  4ZPC A;  3GJS B;  3MMA B;  2ERR A;  3DHW C;  4CDI A;  4ZLJ A;  2B0G A;  4PPZ A;  1EKR A;  4ECQ A;  5A6P A;  2F5G A;  4NEY A;  4K4W A;  5HMX A;  4CT8 A;  2W25 A;  2BAC A;  1VR6 A;  1PKU A;  2JFD A;  4OZN A;  1LWC A;  2F1F A;  1F60 B;  4IRC A;  3N01 A;  4X4U A;  1BLU A;  2DGS A;  1GMW D;  1X9M A;  3OXL A;  2M7S A;  4J9Q A;  2J0X A;  3D66 A;  3L7P A;  3EPG A;  4YB7 A;  1HBM A;  2VA3 A;  5F0W A;  4XO0 A;  1BHN A;  2IAJ A;  2DD8 S;  4OX9 J;  3R5A A;  2M2B A;  3GWC A;  2VG7 A;  4LF5 J;  7FD1 A;  4W90 B;  1IM4 A;  2CQ0 A;  1FTC A;  2WON B;  1Y5I B;  2FDN A;  3U1N A;  2DY9 A;  4E98 A;  5L46 A;  4OJ1 A;  1H98 A;  4DF4 A;  2HVD A;  5KFO A;  1VS3 A;  1VRU B;  1WAC A;  2YNG A;  3RRG A;  2RD5 C;  4WJB A;  1S0M A;  5T7L A;  4X64 F;  4QR2 A;  2XSJ A;  3MTK A;  4HEA 9;  4NLD A;  4FDF A;  1WOR A;  1FTR A;  2JEF A;  3MMC B;  1R8H A;  3UI3 A;  2QMX A;  4W4M A;  2LLZ A;  2GMJ A;  2J9E A;  2NRE A;  4RWW A;  3JTO A;  1D8Y A;  3GSD A;  1BXN A;  1LW0 B;  2LCW A;  2GIF A;  4FKX A;  2IC3 B;  2MQM A;  1IJE B;  5IC4 B;  4Y28 C;  3RR7 A;  4FPI A;  4O44 B;  3B4D A;  3ZTP A;  3P6Y C;  3NY0 A;  1FE4 A;  2CFX A;  2PI5 A;  1NKE A;  1TFW A;  3M2V A;  2DKO B;  1TVR A;  4JV2 A;  2AYE A;  2BQU A;  1GXU A;  2WVE A;  3JS9 A;  1AW0 A;  3DRX A;  1RT5 B;  4FF4 A;  2A1B A;  4LBI A;  4NCG A;  3G6X A;  3HKW A;  4N41 A;  2HVE A;  2U2F A;  4ECZ A;  4DLG A;  2DO0 A;  4P7T A;  1HPZ B;  4DG1 A;  2JX2 A;  3GII A;  1MW7 A;  2J9C A;  3W64 A;  4LFC F;  3W65 A;  1Q82 T;  3DKD A;  3C6T B;  5KTQ A;  3K8V A;  3QT7 A;  4DV0 F;  2CDR B;  3I56 S;  5IT4 A;  1S0N A;  3MWB A;  1B0T A;  4P72 A;  1FEE A;  5CYM B;  2HQI A;  2KG1 A;  3AB4 B;  3A8E A;  2BJ3 A;  4IOC Q;  2GVD A;  1WDD A;  2Y1I A;  4RU2 A;  4H4M A;  1MN7 A;  4GKK J;  1UPM B;  3LPY A;  3QGI A;  3NL0 A;  2XUL A;  2KFN A;  2W4D A;  3MFH A;  2HAI A;  4JBC A;  2ATL A;  3KHH A;  3SXL A;  1LW2 B;  2BJ9 A;  4GC6 A;  2E5L F;  2HPU A;  4TU9 A;  3TUZ C;  3OVB A;  2WBM A;  5CYQ B;  2CWK A;  5E0O A;  3NXZ A;  2HHW A;  3TWZ A;  1JXL A;  1NM2 A;  1AUD A;  2LYV A;  3NNA A;  5HJY A;  2YWH A;  4LQ3 A;  5FJ4 A;  4C3K A;  2DXD A;  3HPO A;  2HFU A;  3GJT B;  4WTO B;  5HRO B;  4B3T F;  1RUS A;  3W1Y C;  4QR1 A;  2GQQ A;  4QPT A;  1C1B A;  1R0C B;  2MQ8 A;  1H0H B;  1BC6 A;  2EC2 A;  4U9R A;  1H38 A;  3SDE A;  2VQE J;  3ZO7 A;  2MZR A;  4MFB B;  2HS4 A;  4NL5 A;  5FLX U;  4ZVP B;  3M9O B;  2RKI B;  4DUY J;  5AXK A;  3KYL A;  3ELH A;  5GAD I;  1FKO B;  3ZZZ A;  3NOG A;  1U1R A;  1FJG F;  3KLV A;  2RQ4 A;  3MCS A;  1WC3 A;  3U7J A;  2L08 A;  1YSJ A;  1UEU A;  2VFS A;  4E2F B;  2IY5 B;  4ZKA A;  1NRK A;  4ID8 A;  3Q24 A;  2GX8 A;  1OY6 A;  1HFE L;  3MED A;  3AY0 A;  8ATC B;  4GVL A;  2HND B;  3BGR B;  2GV1 A;  3HFZ B;  1FCA A;  1T8E A;  4XK8 C;  3IAM 9;  4QWC A;  1FKP B;  5KFZ A;  2A0F B;  1VLO A;  2IHR 1;  2WON A;  1X4F A;  1N0V C;  2FJX A;  2XMT A;  4PQA A;  2HFZ A;  3CD7 A;  4KPY A;  4P2M A;  1VRU A;  3EYZ A;  3NCP A;  1VHF A;  4B3M J;  2DHA A;  3SIP B;  4AXJ A;  1REV B;  3CCW A;  2ATC B;  3MMC A;  1TZ0 A;  1ZPW X;  1Q5V A;  1WTB A;  2QFI A;  2PE8 A;  1Q95 G;  2WSE C;  3CCU S;  3R27 A;  2C3Y A;  1LW0 A;  4OZL A;  2IC3 A;  4LF1 A;  4O44 A;  1JJ2 R;  4CH0 S;  1Q7L B;  1WOP A;  1HHS A;  4HL9 A;  4DUZ J;  1U0H B;  4C8Z A;  4OYP A;  3QMQ A;  4PXD A;  1PYO B;  1NEE A;  4MKV A;  4MYU A;  1RT5 A;  3AA8 A;  2K8G A;  5LMN F;  2V8P A;  2VDH A;  3S7R A;  3GJR B;  4F3Q A;  3W62 A;  3AJ1 A;  4J5O A;  1RHR B;  1HPZ A;  4DSK A;  5A76 A;  2B8P A;  5KT5 A;  2QT7 A;  3W3S A;  1UVI A;  2VPZ B;  3KG4 A;  2VB6 A;  2NPF A;  5JJB A;  4DV2 J;  3C6T A;  4KGM A;  4N47 A;  2AGO A;  3KDO A;  4K4X A;  3G6E S;  3RAX A;  1SJ1 A;  4K0K J;  4DEZ A;  5DO2 A;  4ZOS A;  4GKJ J;  1KWM A;  1FI4 A;  5J1E B;  5CYM A;  5CAB A;  4ZCL A;  2HHP A;  2F3J A;  1KC8 T;  3HUL A;  3EGW B;  1N5T A;  1KBR A;  1JWW A;  3BKT A;  1D3W A;  1GMU A;  4UQT A;  3DLB A;  5BR8 F;  2KB2 A;  2NUU G;  4IH7 A;  3CCQ S;  2E7X A;  5GAE I;  2BAB A;  4ERD A;  2BE9 B;  2BRL A;  2DGV A;  4PAA A;  2DTJ A;  3VTI A;  2EK1 A;  1LW2 A;  2V67 A;  4KY3 A;  3CPW R;  3VAM A;  3CDW A;  5BYQ A;  4F4A A;  5CYQ A;  3UD3 P;  1ROF A;  2C2K B;  1X4C A;  3T41 A;  4ETZ A;  3GFY A;  3CD5 A;  4UT4 A;  2DRA A;  4LSZ B;  1ACM B;  1MWZ A;  2ZBC A;  1YLX A;  3M6U A;  4A8S A;  5HRO A;  5GVQ A;  2XLJ A;  3OL7 A;  1X31 C;  4Q2M A;  1RA7 A;  1YZ6 A;  2I2Y A;  4KAI A;  3N6N A;  2JHE A;  2QV6 A;  2LU1 A;  3MCN A;  4PYA A;  1JJC B;  4UUW A;  4DFK A;  4MFB A;  4KYZ A;  2KYZ A;  5FDL B;  3K5L A;  5KFH A;  4LBP A;  2DNK A;  3PIP Q;  3PYE A;  4DFM A;  2YBV A;  2RKI A;  5KG3 A;  4YP3 A;  3CED A;  5AXN A;  2UUT A;  1RHQ B;  2A6O A;  1FKO A;  2R8I A;  1WHY A;  3CCE S;  2BR0 A;  2M5Y A;  4PWD B;  4DS5 A;  3TVZ A;  1O8B A;  1RWP B;  4NZ7 A;  3TAP A;  3BO4 A;  2FJW A;  2RQK A;  2K06 A;  1TMJ A;  3DXS X;  5IFM A;  5ETO A;  3DRR B;  5L1J A;  3PX0 A;  4OHV A;  2PGC A;  1NSP A;  5L39 A;  2M8D B;  4R25 A;  1N54 B;  2HND A;  3BGR A;  1TL7 B;  1DZ5 A;  3K17 A;  1EQ0 A;  1HBO B;  2HNY B;  3CIZ A;  1FKP A;  2FJA B;  2FB0 A;  3RB0 A;  1R7I A;  5F8M A;  3IR6 B;  4A8X A;  1RAJ A;  1S1W B;  4ENO A;  3M8Z A;  2CPF A;  2ZBR A;  4Q5V A;  3P45 B;  4JI4 F;  1S76 D;  2D1C A;  4AQY J;  1W25 A;  1YVF A;  3QT6 A;  2FVP A;  3N6L A;  2KRB A;  4EI2 A;  4ED0 A;  4K5R A;  1REV A;  4M5N A;  2G2Y A;  2ZM6 J;  3P5T L;  4KGZ B;  3A4T A;  2JC1 A;  2ROP A;  4XPE A;  1RT6 B;  2OPS B;  4WFB Q;  2CXE A;  4OZ3 A;  3A3O B;  1SH0 A;  3MM9 B;  1FNO A;  1S6O A;  3RJM B;  5KG6 A;  1NSA A;  4M63 A;  4ZVS B;  5KFN A;  2CDQ A;  3OXG A;  3DLH A;  2CPJ A;  1RBO B;  1NSQ A;  2AGP A;  1GK8 A;  1RWK B;  3X1L B;  5HSP A;  2HGL A;  1YJ7 A;  1MML A;  3CD6 S;  1OYD A;  4B08 A;  1BQM B;  2E29 A;  2CQG A;  1U0H A;  3UDL A;  1ZH5 A;  1WD6 A;  3HF5 A;  3KMS A;  3FMW A;  3QID A;  2UV8 G;  1J5O B;  4AL5 A;  4ANE A;  5HAT A;  3TQ1 A;  5J2Q B;  2C2O B;  1UVL A;  2J0Q D;  2WTF A;  4X4Q A;  3FZB A;  2MMY A;  2OLW A;  3CDU A;  4Y0F A;  3GON A;  2DEJ A;  3E3X A;  4RL1 A;  1HNW J;  1N52 B;  1H7X A;  1T9T A;  3QWU A;  2JC0 A;  5J1E A;  1UJ4 A;  2VBZ A;  2VPW B;  1B4S A;  2L41 A;  2CNK B;  2MB0 B;  1UEK A;  3TA2 A;  1VGY A;  3LAL A;  1AUS L;  1FEH A;  3SQO P;  3V6K A;  3OJS A;  1KVI A;  2KYX A;  2HHS A;  5DDP C;  1X9S A;  1DFD A;  1TUV A;  4MH8 A;  1OO0 B;  4V19 J;  3CF5 Q;  2WW4 A;  4LFA J;  3CT9 A;  1WI8 A;  1ZM3 A;  4DR4 J;  3A3N B;  4G6V B;  4ZPD A;  2OEM A;  2YNF B;  2MZT A;  4CLW A;  2J0S D;  3ET6 B;  4TKT A;  4V19 X;  3CJR A;  4OHW A;  4KJI A;  1N4L A;  3M8Q B;  3DYA B;  2CNN B;  2H1Y A;  2G0I A;  3H5S A;  1RXO B;  5B0A A;  4LR8 A;  3PRV A;  2Y3Y A;  2DCL A;  1HMV B;  3TZZ A;  3CDA A;  2L9N A;  3IRW P;  4RUC A;  1EP4 B;  1HBU B;  5FDL A;  4Y65 A;  1Y7P A;  5BXI A;  1C4A A;  2VFV A;  1Y00 A;  3HKZ D;  2B3T B;  3M9M B;  3BV8 A;  3OW2 R;  5KFS A;  5KFM A;  3HVT B;  4K4V A;  4PWD A;  4X66 F;  1JK9 B;  2DY1 A;  1E6Y B;  1NJY A;  4CLT A;  3DDK A;  4JP8 A;  2C22 A;  2AX0 A;  4A8O A;  3Q8P B;  4QCL A;  2HQ3 A;  4PKD B;  1QD1 A;  3DRR A;  2HFN A;  3ENV A;  4MK9 A;  4K8R A;  1LKZ A;  3L9Z A;  2J6T A;  3N6M A;  1DQ9 A;  1ZM2 A;  3QO9 B;  1TKD A;  4OIX A;  4RBV A;  1TL7 A;  1VQK S;  3RB4 A;  2FGO A;  5KFQ A;  1CVJ A;  1Y5N B;  4NLS A;  3GV5 B;  2G0J A;  1HBO A;  2HNY A;  4ED5 A;  2HVH A;  2BVZ A;  3SCL E;  1T0T V;  3VZH A;  1S1W A;  1WSR A;  1RWO B;  1RLD A;  3PRD A;  2DGQ A;  5J2P B;  5D4P A;  4NXM F;  3OHA A;  2C42 A;  4YS2 A;  1VC6 A;  3OVA A;  2CA9 A;  2YH1 A;  4B9T A;  4PPD A;  2Z2M A;  3OFG A;  1WEL A;  5F3Z A;  2ZJQ Q;  2VKR A;  4ECX A;  3G96 A;  2YKM B;  1H2V Z;  1WF2 A;  4EYI B;  3ITH A;  3R9L A;  4LF9 F;  4FF2 A;  1RT6 A;  2OPS A;  5JVH Q;  4L76 A;  3N28 A;  3MM9 A;  1RT4 B;  5H9E J;  2RHS B;  3JAM Y;  3DLL Q;  4NLO A;  2D74 B;  3VAJ A;  3MGJ A;  4DV5 F;  2KDO A;  4I68 A;  1YJN S;  1D9A A;  2QMW A;  4RW7 B;  5K9F A;  2AYB A;  1KON A;  2ZH9 A;  1BQM A;  3J80 U;  3WDO A;  5KG0 A;  3GFZ A;  4JV1 A;  4XIU A;  2VFU A;  2Q43 A;  1MNE A;  1J5O A;  2VF3 A;  4CO4 A;  2Y1L B;  5J2Q A;  4WYL A;  4FS2 A;  1HNV B;  2OH2 A;  2QL5 B;  3MDF A;  1RWW B;  2HQF A;  1Q1K A;  1KQK A;  3HI9 A;  4N8N A;  4Q45 A;  3IAS 9;  2K3K A;  2XM3 A;  4F4K A;  1NH8 A;  3SCK E;  2PC6 A;  4DSJ A;  1A9N B;  5HBM B;  4DR6 F;  5CYJ A;  1FWK A;  2ZDO A;  1XBW A;  4C7Q A;  1YJ9 S;  2HIY A;  2XYP B;  3W7B A;  4X4R A;  4RUA A;  2AJ0 A;  3UN3 A;  4ELV A;  3VHQ A;  2AV5 A;  4NXN F;  2Z4P A;  1MU2 B;  2RF2 B;  3N9U C;  4DPW A;  2YNF A;  2V50 A;  4JI0 F;  2AHO B;  1I6J A;  3ET6 A;  2HZA A;  4C0H A;  1ZBT A;  3M8Q A;  3DYA A;  3M2U B;  4CH1 A;  1J2V A;  3GIK A;  4X4N A;  2LEB A;  2B4O A;  5F8J A;  3M8S A;  2CQD A;  5HQ8 A;  2W2P P;  5GME A;  2L9W A;  5K8P A;  2FHJ D;  1HMV A;  2EFN A;  1KOO A;  3LPE A;  3B8H A;  2VA2 A;  1EP4 A;  1HBU A;  1NUE A;  3EXY A;  4MKA A;  2UUW A;  2EG1 A;  2E1C A;  2E9T A;  1N36 F;  5EWG A;  3OHB A;  2MKC A;  2O3D A;  1RYS A;  5A8W A;  2LVW A;  3MAH A;  1F9E B;  3G8S A;  2E5H A;  3HVT A;  2XMM A;  3J7Z 5;  4LFC J;  3QLH B;  1N34 F;  1E6Y A;  3PNI A;  1MG7 A;  5LJ3 Y;  1VQY A;  2B8Q A;  3ZZU A;  2DNO A;  4JI1 J;  5BYR A;  5M2R A;  1JLG B;  1RWU A;  4WFX A;  1NZA A;  4CO3 A;  5E3P A;  1U1L A;  3QO9 A;  2DO4 A;  3R6G B;  3LH2 S;  2MLZ A;  3SSR A;  2GO9 A;  3U1L A;  3T6J A;  3MEC B;  2WK4 A;  3I87 A;  4HKQ A;  1IKW B;  2AJ1 A;  1UKU A;  1V5V A;  4HT5 A;  2GVZ B;  1SJ4 P;  1IBL J;  1TAU A;  5J2P A;  1RI7 A;  4DR2 F;  3AQP A;  3TVY A;  1FX2 A;  3PRB A;  3RRH A;  5E3Q A;  4FNH A;  4TN2 A;  2V4R A;  1UFK A;  1U1O A;  1QJH A;  2PMH A;  1SBR A;  1SL2 A;  1S7H A;  2YKM A;  3W2W B;  1VQ6 S;  1RIS A;  3P5B P;  2ZNY A;  2M70 A;  3BH7 B;  2W1B A;  4QW8 A;  1RT4 A;  3VQT A;  4NX9 A;  1Q8K A;  3CJ8 A;  4IO1 A;  4ECV A;  2ZHA A;  4RW7 A;  4ZIT A;  1TR0 A;  3N0V A;  1S9G B;  2X51 A;  4H4O B;  2BBE A;  2IVM A;  1U2F A;  3G82 B;  3W61 A;  4NLG A;  2GW8 A;  3T1Y F;  4ATN A;  4JI8 J;  2FJD B;  2D3U A;  2GML A;  3I9Z A;  5GAD U;  3HZG A;  5CH7 B;  4YB1 P;  2MKY A;  2MKI A;  4WZQ A;  4MAK A;  1G3O A;  1RAC B;  1HNV A;  5ETR A;  3Q8V A;  3TZY A;  3V5R A;  4JI6 F;  5IOL A;  1O5J A;  4FS1 A;  1GMW A;  2OD4 A;  5B0D A;  1JNR B;  2OMO A;  3L7U A;  2V2K A;  4IQM A;  1DAX A;  3D2W A;  2C2N A;  3E51 A;  1B0V A;  3W8G A;  2KH9 A;  2OEL A;  3ENQ A;  3VGU A;  4ZVQ B;  5HBM A;  4RWX A;  1XJW B;  2PEB A;  1WDT A;  3IC1 A;  2C1E B;  2G1D A;  2GC8 A;  3CCS S;  4YY3 F;  4ETX A;  2ZD1 B;  2ZC3 A;  1PC4 A;  1MU2 A;  4IRD A;  1FF2 A;  2RF2 A;  3JSM B;  3G4S S;  2PA8 D;  4EZ9 A;  2V8G A;  1HWL A;  4I6A A;  3CCJ S;  2XNQ A;  2IYG A;  4NRU A;  3M2U A;  4ZIW A;  1OMS A;  2VJU A;  5H9F K;  2Z2Z A;  1D1U A;  1U24 A;  2KL8 A;  2ABY A;  3DDI A;  2KHC A;  2D9P A;  3KTQ A;  2E44 A;  1HD1 A;  3I96 A;  3RRK A;  4V1A k;  4L75 A;  3CWJ A;  4D3G A;  3IS9 B;  1CJT B;  3Q23 A;  1B7Y B;  2QSF A;  3H2U B;  2OIH A;  1CJK B;  2YWW A;  2KFZ A;  1HWI A;  4FVC A;  5HLF B;  1R43 A;  1N32 F;  4HR2 A;  9RUB A;  5THW A;  4O3N A;  3QLH A;  1S9E B;  5AT1 B;  2HNZ B;  3ZTR A;  1FJE B;  3D6H B;  1NPK A;  5HVG A;  1C4C A;  4NYP A;  1JLG A;  4JI7 J;  3FZ2 A;  1TFY A;  4M5H A;  4DPO A;  2ALY B;  3BGO P;  1EB0 A;  4DL6 A;  5KT6 A;  3OFH A;  4USK A;  1NDP A;  4ZIV A;  3OLB A;  2K7J A;  3MEC A;  4LVN P;  3OT9 A;  2KXH A;  2W2Q P;  3PKM A;  1VQ4 S;  2GVZ A;  4ZS6 A;  1K44 A;  2QYC A;  2YX1 A;  3GLJ A;  4DN0 A;  3HP6 A;  1J5E F;  5GAE U;  1U0S A;  4U7U D;  3AD9 C;  1UVM A;  3VF0 B;  2H4W B;  5A6W A;  3H98 A;  4I56 A;  2RRA A;  1HR0 J;  1MWQ A;  1SXL A;  5KG1 A;  4PG8 A;  1UMJ A;  1U6B A;  2PFD A;  4C8M A;  2FLN A;  3Q86 A;  4RNN A;  3D1H A;  3DM2 B;  3I32 A;  1HWJ A;  3HJF A;  3SFG A;  1X8D A;  1V3Z A;  2FC8 A;  3W2W A;  3JYT B;  4Z7Y A;  1EKS A;  5D0H A;  3LGH A;  2VG5 B;  3C15 B;  3IMQ J;  3D0I E;  2FHO B;  2N7Y A;  1UAW A;  3G8Q A;  2QEX S;  3H2V E;  3QJL A;  2JVO A;  1SH3 A;  2HGN A;  2GFF A;  4GRS A;  2L3M A;  3V6D B;  5HK4 A;  5E3C A;  1S0V A;  2B5J B;  2C2M B;  1YHQ S;  3R7N B;  2QG9 B;  3G8T A;  1VOM A;  4M5I A;  1YRX A;  1S9G A;  4H4O A;  3JQM A;  3G82 A;  3VQS A;  2XMA A;  4URG A;  4LBH A;  1UET A;  8AT1 B;  1X0F A;  4WYW A;  3TUJ C;  2F8H A;  2HLT A;  4QIF A;  4ITS A;  3PHE A;  2QL7 B;  4B3R J;  1LWE B;  4ZLN A;  1X4D A;  5IZH A;  3M2R B;  3MI7 X;  2BQR A;  4ES3 A;  2AGQ A;  3BEG B;  5HVH A;  1SI9 A;  3KXD A;  4LUB A;  1YRT A;  3PM9 A;  1T3O A;  3GMG A;  4N7T A;  3PO5 A;  3L3C A;  4WCE Q;  2LDY A;  1MSW D;  4U8Y A;  4ZP6 A;  3GP9 A;  2HBZ B;  3K58 A;  2IRY A;  4RW9 B;  3L09 A;  4JI4 J;  4FN5 A;  2FJE B;  5B0G A;  3NOC A;  3HSD A;  2V0N A;  2ZD1 A;  3KJV A;  2FQQ B;  3NWR A;  3FCW A;  1VQO S;  1U49 A;  5GAH I;  2M3D A;  2W7A A;  2BV3 A;  2MYF A;  3JSM A;  3G87 A;  1EJ7 L;  1TUG B;  3JSY A;  1S59 A;  3PR4 A;  1U02 A;  2F8E X;  4PG5 A;  3RBX A;  2HRY A;  1UL3 A;  1NDL A;  1KVK A;  2XTJ P;  2NXJ A;  2PT0 A;  1VRQ C;  3W5Z A;  2AYM A;  4BDP A;  3KDN A;  1WUU A;  2PMZ D;  4DV3 J;  4ZPT R;  2H54 B;  1I1G A;  2Q6B A;  2XMJ A;  2XZT B;  3KJF B;  1ARO P;  1CUL B;  1T03 B;  1XNQ F;  3IR5 B;  1KVJ A;  2ZUG A;  3UQS A;  5E41 A;  4PCQ A;  3IS9 A;  1CJT A;  3H4B A;  4NLX A;  3LWM A;  4FNI A;  1CJK A;  2CQ1 A;  5HLF A;  2UXC J;  3UCG A;  4FXD A;  1S9E A;  2HNZ A;  1NXI A;  3Q89 A;  3I5B A;  3ZTO A;  4P10 A;  2HHX A;  1RAB B;  5IWA F;  2EFQ A;  3D1O A;  3OR1 B;  3DLG B;  3MR3 A;  1KQG B;  3DU6 A;  3PV8 A;  2DIV A;  2LKZ A;  4M5K A;  2X1B A;  2YY3 A;  5H9F J;  1FX4 A;  4XTT A;  1YG0 A;  3J7A 1;  5F8I A;  3PW2 A;  1WKJ A;  1RQ0 A;  2L48 A;  2R2R A;  2R2S A;  2B4V A;  3UVJ B;  1CQN A;  3ETM A;  3I4H X;  1KFS A;  3QAT A;  2XY6 A;  1IBM F;  2EW9 A;  5G0R B;  1ICE B;  1HQE B;  3DM2 A;  2XS2 A;  3JYT A;  2YNI B;  1EIY B;  3I0S B;  1K47 A;  2HBY B;  2VG5 A;  5I3U B;  4YQW A;  3C15 A;  3I5C A;  1SJR A;  3T3F A;  2DGT A;  1WWH A;  1BUX A;  2FVS A;  1JXV A;  3MM5 B;  3V6D A;  3T1A A;  3IM8 A;  3UDE A;  2CNL B;  4CI0 B;  2BZ2 A;  5AJ3 J;  1OYE A;  4C97 A;  2H65 B;  4E0D A;  3DOM B;  3G71 S;  3FEY B;  4WK1 A;  2UUC F;  2RIJ A;  4F7V A;  1NME B;  4MIB A;  4M5J A;  1VIO A;  4I2Q B;  2W9A A;  1U25 A;  3GG0 A;  3W66 A;  1I51 B;  4DS4 A;  3UD4 P;  1ZYQ A;  3D6M B;  4JI2 J;  3ULH A;  2G2O A;  2WRM A;  2MSS A;  4KH1 B;  1LWE A;  3L7O A;  3UW1 A;  3O3L A;  4M5G A;  3M2R A;  3AXK A;  2LDI A;  3TEG A;  2FLL A;  2CZ4 A;  2H5I B;  1SJF A;  3CJ2 A;  4LSN B;  1DTQ B;  3TZW A;  3NG8 A;  5B0C A;  5KFD A;  3OSN A;  1W2I A;  3CO0 P;  1Q5Y A;  3EGV A;  4NLP A;  5K20 B;  2EEY A;  3PTW A;  3TAM B;  1A6L A;  4LSL B;  5DG7 A;  1S57 A;  4RW9 A;  4DZD A;  3BPS P;  2JDJ A;  4NXM J;  4HI2 A;  1UFW A;  1S6U A;  4DV1 F;  3TAN A;  4YHH F;  1NH7 A;  3JSB A;  4WU2 A;  3CUL A;  3LGN A;  3SBM A;  2XHC A;  4R5P B;  2HBQ B;  2C3O A;  3BH6 B;  3AH6 A;  4Y3C A;  1G6B A;  2UUB J;  4DL4 A;  3HXM A;  1OPI A;  3KJN B;  3EVM A;  1HNZ F;  1EHW A;  3ETO A;  4Q43 A;  1O0P A;  4EMD A;  5I42 B;  3K5N A;  1F9F A;  4E8U A;  4YME A;  5HMY A;  1AFI A;  4OYX A;  4QYZ K;  2IJR A; 
#chains in the Genus database with same CATH homology
 2H5J B;  5IC6 B;  2CJY B;  2H5I B;  4ZVP B;  3KJQ B;  4ZVO B;  3NS7 B;  4ZVT B;  2H48 B;  1RHK B;  2HBR B;  3EDQ B;  3SIP B;  1RE1 B;  1SC4 B;  1RHJ B;  4ZVU B;  1ICE B;  2Y0B B;  2CNK B;  4ZVQ B;  3GJS B;  1RHQ B;  5K20 B;  2QL9 B;  1F9E B;  2CJX B;  3R6L B;  4JB8 B;  2HBY B;  1SC3 B;  2HBZ B;  3RJM B;  1RWP B;  4ZVS B;  2CNO B;  2C1E B;  2C2Z B;  3D6H B;  2H51 B;  2XYP B;  1RWK B;  2XYG B;  4DCO B;  2FQQ B;  2CNL B;  1RHM B;  2C2M B;  5IC4 B;  4ZVR B;  3R7N B;  2H65 B;  4DCJ B;  4DCP B;  3QNW B;  3D6F B;  3IBC B;  2DKO B;  2QLJ B;  2XYH B;  1I3O B;  2HBQ B;  3R6G B;  3R7B B;  1RHU B;  2QLF B;  2H4Y B;  2C2K B;  1PYO B;  2CNN B;  3R5J B;  1PAU B;  3R7S B;  1NME B;  2XZD B;  1I51 B;  2QLB B;  3GJR B;  2Y1L B;  4LSZ B;  2P2C B;  3GJQ B;  3KJN B;  3GJT B;  2C2O B;  3D6M B;  1RHR B;  1IBC B;  1RWV B;  2QL7 B;  3IBF B;  3P4U B;  1RWO B;  1GFW B;  2H54 B;  3P45 B;  3EDR B;  1RWM B;  1RWX B;  1QTN B;  2QL5 B;  1QDU B;  1SC1 B;  1RWN B;  1RWW B;  2XZT B;  3KJF B;  1BMQ B;  2H4W B;  2CDR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...