1RHMB

Crystal structure of the complex of caspase-3 with a nicotinic acid aldehyde inhibitor
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
91
structure length
91
Chain Sequence
KIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CASP-3
publication title Reducing the Peptidyl Features of Caspase-3 Inhibitors: A Structural Analysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 15
structure length 91
sequence length 91
chains with identical sequence D
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2003-11-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 1rhmB00
4ZVPB 5K20B 3R6LB 1SC1B 3D6MB 1RWNB 2XYGB 4DCJB 2C2MB 2QL7B 1RE1B 3RJMB 3IBFB 3KJNB 1RWVB 2CNKB 1RWOB 3P45B 3QNWB 3KJQB 2H65B 3R5JB 2CDRB 4DCPB 3R7SB 1PYOB 3GJQB 2CJXB 3EDQB 2CNOB 2Y1LB 1RHQB 4DCOB 2CJYB 1PAUB 2C2OB 1SC4B 3SIPB 1BMQB 2QLBB 3NS7B 4ZVUB 2QL9B 1GFWB 4ZVRB 4ZVSB 3P4UB 2C1EB 1RHRB 2CNNB 4JB8B 1RHJB 2HBYB 1SC3B 2XZTB 2XYPB 3KJFB 1QDUB 4ZVTB 2QLJB 3GJSB 3R7NB 2XYHB 3D6HB 2XZDB 1RWXB 5IC6B 2HBRB 2P2CB 3R7BB 2HBQB 2C2ZB 3IBCB 1F9EB 2H5JB 1ICEB 1RHMB 2H4WB 4LSZB 1I3OB 2Y0BB 2H5IB 2DKOB 2QL5B 1RWPB 3D6FB 2HBZB 2H4YB 2H54B 4ZVOB 3R6GB 4ZVQB 1I51B 1RWMB 3GJTB 1RHUB 2QLFB 3EDRB 2C2KB 5IC4B 1NMEB 1RHKB 2FQQB 1RWKB 1QTNB 1RWWB 2H48B 2H51B 3GJRB 1IBCB 2CNLB
chains in the Genus database with same CATH superfamily
1FKPB 2RUGA 3T3FA 3SDEA 4K5RA 3AJDA 3FCHA 2CQ1A 4B3OB 4H4OB 4F2SA 2GAHC 3HHKA 1HPZB 2B9EA 4Z37A 3UCZP 2M52A 2W4DA 4C8YA 1F60B 2YNHB 2ASYA 1PIEA 4NX9A 1Y3JA 1JLQB 4FP9A 5JMNA 1WORA 1BMQB 2DTJA 2LDIA 3E01A 4JI4F 5L8RC 3HK2A 1RYSA 2KT2A 2ASJA 2W8LA 1HBUB 1XN9A 4JI1F 3HKWA 1YG0A 2RH3A 3OQ2A 4FYYB 2E9TA 2HBQB 5DG9A 4C48A 3J81Y 4NA1A 2W24A 3SZ2A 1AROP 4ERDA 2C2NA 5ETRA 4PXEA 4C8NA 2GNKA 2AQ4A 4ED1A 4R0EA 3UVJA 3IR7B 4P2MA 2BE7D 3B82A 3CMAS 2E9RX 1R8CA 2BDPA 3ETMA 4B17A 2OD6A 4ZPVR 3IGVA 1KN6A 2RNEA 3RGIA 2IHR1 3QAEA 2XMAA 1U4BA 3HFVA 2KH9A 3I55S 5DQGA 4QWEA 2OELA 2XWXA 3SBMA 2ZOMA 2VDHA 2FZGB 4PR6A 4M5HA 4ZN3A 1QSYA 1RT3B 1FVQA 3KHLA 2VZ9A 3KLEB 2F8HA 2U2FA 3TUIC 3AJ1A 2QT7A 1G4CA 2B8PA 1QAXA 4HHUA 3IP0A 4F4YA 4Y2KA 1OIAA 2HWIA 2FJWA 4OX9F 2WSEC 3CCSS 4OZ1A 1P1TA 3DRPA 4ZCLA 4USUA 4DU8A 5IZHA 1VQSA 4KGXB 1TUWA 1FE4A 1LWEA 5B0EA 2WB1D 2JVOA 2EKNA 4NMLA 2NSCA 4H4MB 4HR2A 3TX8A 5BR8J 4UOHA 4B9MA 5ETOA 2HFOA 3O6QA 3MMBA 1WDTA 2FUG9 3ZTOA 4LFAJ 3K57A 4J91A 4EZ9A 2B5JA 4MAKA 1RCXB 2B4PA 2O5DA 5ETSA 1KLMB 2YWKA 1JJHA 1LXNA 3R5CA 4EWTA 4PXDA 2DGVA 4TU7A 3C16A 2HHQA 1RT7B 1QAYA 1CJVA 2C1EB 2WOMB 3J7ZT 5D77A 2J9DE 1RWXB 2DGQA 2XO7A 3QSIA 4KPCA 4O23A 2Q3PA 1UW4A 5EGYA 2BABA 1P1LA 4O44B 4ZLJA 3L7UA 4WCEQ 3D2WA 3DYAB 3HHLB 2QIFA 1WELA 2HQFA 2R9LA 4WYWA 1WI6A 3C3LA 3QZ8A 1V5VA 4JI4J 5DGAA 4S0MA 5K9FA 2CUYA 3GQCA 4JI1J 1CJKA 2B8QA 1RISA 1T7PA 1D09B 4XIUA 3VAJA 4EGLA 4F02A 1L3TA 4DV0F 2UP1A 2VG5A 4WTYA 3ZXWA 4DV2F 2JNJA 5I3QA 3PYGA 5LSLA 1RAIB 5AXKA 1IUJA 1FHTA 3G6VA 1KEKA 2ZHAA 2Y1RI 2FZCB 3H90A 4CI0B 2CYYA 1NLKL 3H4DA 4ZCKA 3THPA 1S6QB 3GYXB 4ECXA 3LAMA 4BDPA 3IBCB 4CIOA 4J9RA 5E0OA 1ZM2A 4QBUA 2MEWA 4O3PA 3M30A 4USVA 4OYBA 2QLWA 3KXDA 3HM9A 4O4GB 3IRXB 1A0OB 1HWUA 1L3UA 1VIOA 4HKQA 2IYGA 4JOUA 2VH7A 3AA8A 4NLQA 2RU9A 5DZ6A 1RP5A 3D66A 4CLLA 1J5OA 3FQLA 4HI1A 1VCTA 2R8HA 3G9CA 4P9SA 2BR0A 2UU9F 1X9SA 4M5IA 4J9MA 3NS5A 5J2NB 3L3CA 4OX9J 3SQGB 2JZ5A 1YJ7A 5HMXA 3ICLA 5AXLA 3OLAA 1U02A 4C0HA 4PUOA 2KRRA 4JP8A 3CCMS 5DG7A 1R89A 1KWMA 1C1CA 3P3DA 4IRKA 2MGZA 4NZ6A 5H1SV 2UV8G 2BM0A 3MAQA 5DS7A 3G96A 3CNQP 2AU0A 6AT1B 5B0DA 4V1Ak 3ONQA 3M2RA 3QPIA 2XCPA 1NHVA 4FF4A 4ZLPA 1KR4A 2EFVA 1ZTTA 3QIPB 3E2EA 3CMES 4I6YA 5KFQA 1U24A 4EO8A 4U9RA 3QLHB 3LPEA 2C2KB 4ZN1A 4KR0B 2FQQB 3M8QA 5KFAA 4B9TA 1PGZA 1IJFB 2HKEA 2KT3A 3NAIA 2AJQA 1SB6A 3H2VE 3RB0A 3C19A 1QUPA 1PO6A 2KG0A 4P2FA 4F4KA 3DCAA 3PYEA 5AE1A 4X4QA 2YKAA 1BGXT 1NK5A 4DBQA 3QSYB 3TAMB 5D0RA 4NMXA 3H20A 3HD1A 5E3CA 1LXJA 2D9OA 5HAOA 5DZ7A 3VGVA 1C2PA 2XS5A 4ED6A 2ZH9A 1LWCB 2CIMA 1JLEB 1ELOA 5SUHA 3KDNA 2AJ2A 2H5JB 2KXHA 1RHMB 5GADU 2IMOA 2IA0A 3FDSA 4H4KC 5DLGA 4DV0J 4JBCA 3G2XA 2ASLA 2CXEA 1RDRA 5FLXU 2L9DA 4QWAA 1F5AA 4NRUA 1RAOA 3GYNA 2ZUAA 1F2HA 1FK9B 2C3UA 2HNZB 2L9NA 5A76A 1NK6A 3HHEA 4PQUA 3UD3P 2HHTA 2IVFB 1BXNA 4DCJB 2B7BB 3DI6A 2KN4A 3KTQA 2NQPA 2JEFA 3H5XA 1RUSA 1SI9A 2DITA 1Q7LB 4G1QB 3T1YF 3VALA 3BGRB 3KDOA 4X65F 4DV5F 3OUYA 2F4VF 1LW2B 2BVZA 1SH3A 2UVRA 4J90A 2GZOA 3RUBL 1K1SA 4L72B 2XHCA 3DOMA 2VONA 3KLIA 2NPIA 2UU9J 3BSCA 2XYPB 3DU6A 3GPAA 1ZM4A 1HD0A 2LQ8A 1FD8A 1JIHA 3PJWA 4DPXA 1F9EB 4QW8A 4CM2A 2AJ0A 4KJIA 1TKDA 3JQJA 4W98A 4AL5A 3V4MA 2GGPB 5HO4A 2QEXS 4NLDA 2YPYA 2DGXA 2PE8A 1HPZA 3R2DJ 2ASDA 2RIJA 2YNHA 1WF1A 2HZAA 3UDVA 1JLQA 2MY7A 3OVSA 1Q81T 1NDKA 4Q45A 4F50A 3DN9A 2YKPA 2BE9B 4TY9A 1T0TV 1HBUA 4ILLA 2PN6A 1Y11A 5KOXA 2CZ4A 4RNNA 3GP9A 2JC0A 3HPOA 5FJ4A 1PJ5A 2AYBA 9ATCB 3P49B 2VA2A 2YQ0A 2FVQA 4OZ3A 2D9PA 3HHDA 2EC2A 4OZJA 2OEMA 3KLFA 2ACMA 3QIDA 2PEHA 1IM6A 3MEDB 4R8UB 2HAIA 4ATNA 3UNGC 4WFXA 2FC9A 4A46A 4A8YA 2HWTA 2D3OR 2HHPA 2DO4A 1QVGR 3JAMU 5M2UA 4N41A 1C0UA 4LF8J 4Q8FA 3PCOB 5IV3A 1IQTA 2DNZA 4X66J 1R8BA 2WTFA 3CJ8A 3KUHA 2AYEA 1VBZA 2JEJA 5AE3A 1ZAXA 3I5BA 3IN5A 1RWNB 2VHGA 3KLEA 1YJNS 1TMJA 4JV0A 3WX8A 2V4RA 3MUVP 1HA1A 1U7LA 1M5OC 1KVIA 3CJKA 3QJPA 2DEIA 3NP5A 3NOCA 3OSNA 1WI8A 3LGNA 3VCDA 2X1AA 1TK0A 3Q2SC 1NHKL 2NXUA 4NCBA 4OI4A 2MTLA 2ZOFA 2VDIA 2CPDA 3PO5A 2VIHA 4C8KA 1FERA 3JSYA 4USJC 3HZGA 3GMGA 5L9NA 2ZH4A 2HFNA 1JXLA 2BJDA 1UZDA 1HWKA 1CSJA 4QOTA 3BPSP 3IS9B 3OFHA 3KHHA 1HWIA 2ROGA 4D3GA 4A8KA 1TKTA 3T1YJ 5K8OA 5A8RB 3D3BJ 4X65J 4DV5J 1PJ7A 1SV5B 4EO6A 2AP6A 2F4VJ 3BGLA 3HVWA 4WZQA 1VLOA 4M5LA 1I51B 2D1CA 2PEBA 3AT1B 3CJ0A 1WSVA 3C66A 1WC0A 4GC6A 3M6VA 3PYDA 3SEOA 2CNLB 5BXIA 4TN2A 3JSBA 4X84A 2DGOA 1F3VA 3PFOA 1FTCA 3V81B 3AOCA 1RT7A 1U6BA 2RQ4A 2DEJA 3KMQA 5GAGU 3KK3B 5BYQA 3OV7A 1TR0A 4ZHRB 5KFSA 3UD4P 2ADBA 3PTWA 1NJXA 3PIOQ 2YWEA 1S97A 5F9LA 1N5SA 2M3DA 3DLLQ 1OSDA 4DR1F 3PM9A 3JSMB 4DU7A 5DDOC 4OZ0A 3CJ5A 2RKIB 1S76D 3HHLA 2W9CA 3J7AN 1DBDA 4P75A 2W7AA 1CJTA 5L46A 2RT3A 4IO1A 1XR7A 3CCWA 3LAKA 1ZAVA 4UZCA 1TKXA 2OPPA 8RUCA 1AFJA 2MLYA 4MK9A 2XI3A 2HMIB 1OY9A 1X5SA 2FPHX 2LEBA 1RI7A 1CG2A 2DR8A 4PAAA 4ALZA 4LUBA 2V2VA 3CO0P 4B3RF 3H42A 1JNRB 1RHKB 4OX7A 4QIFA 1FA0A 2K7KA 1IKWB 4CLSA 2BRLA 1RAGB 3ITHB 1HBMB 1UCNA 3FK4A 4U95A 3LP1A 2VFTA 2PGCA 4O3OA 1ZBTA 3AOAA 3BH7B 1S6QA 3HD2A 1X5OA 1TV6B 4XDCA 3AB4B 3FC9A 1G2EA 3Q24A 3KNAA 3DLGA 3H59A 1Z4UA 3HSZA 2YKNB 3TA1A 1E6VB 2B9XA 3OVBA 3NGRA 2IM3A 3MPDA 4DR3F 1KQKA 5HMYA 3QT5A 4ANCA 3B4DA 3U02A 3VAGA 4KV8B 1KTVA 4JV2A 5J2NA 2IM2A 3KK2A 3R6GB 3CC2S 5CD4A 3F73A 3OVAA 4NI2B 5HVGA 4C2MA 2CG8A 5EDWA 3EGZA 1MMLA 3WIVA 2RHSB 4PYAA 1UEKA 1JLAB 2NXEA 3OTBA 3LGHA 4XK8C 3GG1A 4WZMA 2YX4A 2VPYB 3DU5A 1MNEA 1S1WA 3BQ1A 1EHWA 2J8SA 3DGPB 4KE5A 1FJEB 4LBIA 4KBIA 1ZPWX 3JB9k 3MTKA 4Y34A 2M8DB 2KYXA 4MK7A 2IM1A 1SBRA 1YX2A 4FNIA 3R9LA 4I68A 4F26A 1TL4A 1WEXA 2L9WA 5IV4A 5I42B 3DLEB 1TP7A 2E5JA 2V2KA 4DPWA 5MAOA 2WSFC 2XZDB 2MZRA 3NGUA 1B0VA 2ZNYA 5GAHU 2IAJA 3OTCA 2ZH6A 1IBMF 3I0RB 3DLJA 2ZC3A 5CH7B 3TJ9A 1S0NA 2RDIA 1H38A 3FQKA 4YMEA 2C2RA 3TAMA 4DR1J 4NOHA 1VS3A 4RW8B 4DUTA 3V6JA 1TK8A 3HT0A 5KT5A 1RA6A 2ZH2A 2D3ZA 1S1VB 4A48A 2UUAF 4P7TA 2B9YA 2BKOA 2OEJA 3F56A 1SQEA 1JB0C 1RSCA 2ADCA 2P6TA 1LWCA 3W66A 1JLEA 4X62F 3IWXA 2L3MA 1RAEB 2JEGA 1XERA 2MHEA 5BYRA 2VF3A 4YB7A 2XGQA 2EKYA 1KNZA 5M2RA 4X4RA 4KHPF 1XC9A 3SSQA 4B3RJ 1W2BR 5HMZA 4DZ6A 5KFNA 2HSEB 1X5PA 2GIRA 3JQMA 4ED8A 5ETPA 2IFXA 5KFCA 5BYSA 2W9BA 1IXKA 1OY6A 3QJJA 2K1RA 4F0KA 4P71A 1FK9A 3M8PB 2ZOGA 4J9LA 2AEJA 4ES1A 3HSGA 2KU7A 3TVKA 1EP4B 5B0CA 4ZLNA 1GTEA 1HHSA 3Q8SB 1QUVA 2ZUGA 2R2SA 1ITPA 2R2RA 1XWLA 5KG7A 4NCAA 2XB2D 4B3SF 1KQSR 2BQUA 2FYXA 4K5SA 3BDPA 2AGOA 4DR3J 1Q4RA 3JYTA 2HLUA 4G1PA 2HNYB 1HHQA 1S1TB 4DL5A 4CLFA 4LF4F 1WF0A 2HZCA 4DLEA 2XWYA 4X4VA 3D1OA 2QFJA 3W8PA 1XR6A 1FXRA 3SCIE 2CQ3A 2MKIA 2MKJA 4C97A 1SJ1A 4HH1A 4M63A 4ZDNA 3DFEA 3MCMA 2GGPA 5D0GA 2RHQB 3J80U 3RB6A 1T11A 2CJ9A 3MUTP 1N0VC 4CO0A 2KZMA 1BQXA 2WW4A 3DLKB 2H4WB 2DR7A 5L1LA 3U7JA 4WFAQ 3OL9A 2V94A 3KG0A 1YJUA 3S7RA 2HURA 4TLQA 4ICLB 1OO0B 1Q53A 2MB0B 3CJ4A 1U45A 1NMEB 3TARA 1WG4A 3K8WA 1U0HA 2VOPA 2Y8YA 4A8FA 3OXFA 2VQEF 4FVCA 3TUJC 1UVJA 1FX4A 2XMVA 1AZSA 5LL6d 3TW0A 2Y8WA 4HDGA 1IQZA 3GILA 1OY8A 1RTIA 2B51A 1ZM9A 2NXCA 1WD6A 5C5JA 3P45B 4F4AA 1Z2LA 1YK9A 1N33F 4PWUA 4MJKA 4M5JA 4R8UA 4URQU 3HDSA 2LQ5A 3GJQB 1OQ6A 5T7LB 2VFSA 3R2CJ 3SIPB 3U1LA 3ISNC 2YNGB 5T14A 4QR0A 1RAHB 4DS4A 2HHVA 4WPAA 4QCLA 4I56A 4V19J 1CC7A 3PVXA 2DNMA 2OPRA 3PX4A 3W1YC 5GAEU 3BO2A 5EHHA 5ETLA 4O0IA 2YX7A 1KHWA 2UUAJ 4WTOB 2VFUA 4KKOB 4MK8A 3Q8VA 2F40A 4YR0A 2PC6A 3I0SB 3L4BC 1OYDA 3K2YA 3MFHA 1E6YB 3UDEA 1UPPA 3QAUA 3GJTB 3CUNA 5B0GA 4KHPJ 2HRUA 1X31C 1S72S 3UFCX 3ZZTA 4RUBA 4AFFA 3RAQA 3PEJA 3G82A 1DLOB 1N6QB 2JSXA 2YKOA 3A3OB 3D0IE 2E7VA 4AUKA 1U26A 3KYLA 3IS9A 3VVUA 1S6PB 2QLBB 1O5JA 4EUVA 4MKAA 5ADZA 5HMWA 3MM5B 4B3SJ 2R7TA 1UPMB 4MKBA 1VRQC 5FIIA 2W01A 3A12A 3RRHA 3HFZB 4ID8A 4Y28C 3MEGB 2XSJB 3WDOA 2RDJA 1N8RT 2Z4PA 2HGNA 1NU4A 3M05A 2AIRB 1GXUA 1H73A 4FS2A 3CMQA 4LF4J 3BBCA 3TEGA 1YIJS 3KK3A 2VBZA 1CLFA 5DGBA 3MOZA 2B9WA 1VQYA 2VC1A 4PZVA 2BANA 4ECSA 3HKZD 3M8YA 3T1HF 1FJCA 3Q8YA 5F8GA 1VYAA 3L7PA 4QIEA 1RWOB 2PI4A 2HNDA 3MD1A 1RABB 3CTRA 3PKMA 4RL1A 5LM7E 3V6KA 3G6YA 3DGVA 5J1PA 4X64J 3D3CJ 2FJDB 2P6SA 2QYCA 4NLOA 2BJEA 5F8LA 4GKJF 4TLRA 4KB7A 2QLXA 1NB7A 4IR1A 2CPEA 1MLAA 5HATA 2A3JA 3VGSA 2HQDA 2YNFB 2B43A 2ZJQQ 3BQ2A 3AQPA 3UNYA 4IFYA 5KFWA 1RBLA 4RW9B 4EEYA 4TNOA 4NZ7A 1U1QA 2GO9A 1NXIA 3MR7A 4OJ3A 1SJ3P 1VHIA 2DGWA 1VRTB 3MCOA 4PG5A 1UVLA 2VUGA 4OI3A 1FFSB 4U6PA 5F3ZA 3MPUB 2OD4A 4N5SA 4HEA9 5B09A 4DR4F 3KFWX 3FZ2A 4M5MA 1U0SA 3PIPQ 4U7UD 1WHWA 4Q44A 1E6VA 1NSAA 1WOPA 3FFIA 1AXQA 2X1BA 5JXSA 3EDQB 3R97A 1OJ4A 4U8VA 2E5GA 2DY1A 1H72C 3CIZA 2IJRA 1ZS6A 2Z58B 1SH0A 1Y5IB 3P4UB 1FF2A 1DRZA 2HPUA 2EC0A 4BLGA 3EVWA 1PSDA 4CCHA 1HQEB 1CULA 3CCES 1NK0A 3HVTA 4NI2A 3FSIA 2OO4A 3DRYA 3W2VA 2J7WA 2VFVA 3QJLA 1NK4A 1LEOA 3HULA 4DL3A 2AWZA 2M5YA 1S9EB 4HVZA 4ER8A 1UEVA 2JC1A 2YKMA 3RG6A 1JLAA 1IKXA 2Q1LA 2VB6A 3EXCX 2FGCA 4I2QB 3HVRA 2DBBA 4V19X 4OV6A 2UVVA 1UVNA 1KKHA 3TZXA 1UFWA 1J27A 2XYGB 2C2MB 4NLGA 2X51A 1RT6B 4ZCMA 2LA4A 2N7CA 4IQXA 4DSEA 2V63A 5I42A 1N4LA 3MM9A 3CCUS 1M1HA 3P5TL 9RUBA 2I2YA 1IN0A 2RU3A 2OKQA 1B7FA 4RZRA 2N3LA 4UF4A 1NBEB 3R5AA 3IC1A 3OFGA 2C2OB 4LSLB 3H0PA 3EPIA 2NREA 4I2PA 3ENQA 2NYIA 3IMQJ 3CXCR 1PBUA 3PX0A 5J1EA 4IO9Q 5A8KA 3J81j 1ROFA 3FCWA 3K58A 4LT6A 3T1HJ 1S49A 2CPXA 1N5YB 4KT0C 4Q8EA 2C3MA 4RW8A 3L9ZA 4DFMA 4TY8A 3D7SB 2H54B 2LQJA 4ZVOB 4OHZA 2OIHA 2CPFA 1C1BB 1Y0HA 2V0NA 4O0NA 2M2BA 3U1NA 2FHOB 4F2RA 4ECWA 5SZTA 4GKJJ 4LRFA 2WVDA 3OFEA 1FRIA 2Y1JA 1F6TA 3Q89A 2GJFA 4OYPA 4LF1A 2HS0A 3QWPA 1U1RA 3KJNB 2HVDA 3DOKA 2ZHBA 5HVFA 4FS1A 3V4IB 2JFKA 5KAKA 1HR0F 1T05A 1YZ7A 2ZJPQ 4B9UA 4LR7A 3F41A 2IDEA 4NASA 2LXUA 1KRPA 1NK9A 2E1CA 5A6PA 3G86A 1WOSA 2BXJA 3HP6A 3UCUP 3BO4A 3MD3A 4ZCIA 2C2EA 3BR9A 1IR2A 3BKFA 2I6WA 1FDDA 3W61A 4P74A 4DR4J 1FNXH 2YX1A 2GMHA 4UQTA 1EZZB 4NXNF 2OJ3A 4ED4A 1RAAB 2BOPA 2DRDA 4JYAF 2F8MA 2X1GA 1WC4A 4GVBA 3VGTA 1FRJA 4DN0A 3WC0A 1B7YB 5IT9Y 3U27A 4GKKF 3RZAA 2CWXA 2ABYA 2JLGA 2D3O1 2EI5A 1VQKS 4RKUC 2HNYA 4TKTA 4USIA 1S1TA 5AXNA 3WC2A 2YH1A 2WVFA 1SQGA 2RVJA 5HJXA 4DHVA 1RZMA 1KBRA 2IY5B 5KTQA 1CJUA 2JOQA 3MTJA 4KY3A 1DTQA 5IM0B 3K59A 1RGVA 1SUQB 2P5VA 4OZ2A 5KT3A 5IT0A 1HWLA 5KT7A 1UEUA 2VPWB 3LP2B 2Y0SD 2HHHF 3B8HA 4FF1A 4IFVB 2MZQA 1ZOTA 3CD7A 4P52A 2BZ2A 4EI2A 3CCRS 4LR8A 1CS4B 1R8AA 1C0TA 1H2TZ 1HI8A 2ATCB 1NSKL 2F7VA 1RJJA 2JLEA 2M70A 5B0AA 3AFGA 4C8OA 1RAJA 2MZSA 3KLGB 5KFTA 1HI1A 2DNGA 3JTPA 3MZIA 2XC9A 2G2YA 1FESA 2BA9A 5F3TA 3PX6A 1H2UX 2JHEA 1RA7A 3UWTA 1NSQA 2AEMA 5J2MA 2FB0A 3DNCA 5C2CA 2OPQB 3IBFB 5ETQA 2DXDA 3W9JA 3ZNUA 1RTDA 1V3ZA 2AT1B 4DCPB 1P8GA 3PEHA 4Q7AA 4PRFA 5F0WA 3OR1B 3DM2A 1FKOA 2FVPA 4KKOA 4ECTA 1JQGA 2FTRA 1P27B 4LQ3A 3FZBA 3I0SA 1HNVB 2HBYB 1M5SA 2HGMA 1SL0A 2KFNA 1E6YA 1HARA 3SQOP 1FO1A 3AJ2A 3CCJS 1UW9A 2W2QP 4EU0A 2G2OA 1JLBA 2HBRB 1VQ9S 3R3TA 3DRRB 2KB2A 2QSFA 1ZPVA 2YNIB 2N7YA 3GV8B 1U25A 1HR0J 1R6YA 1O0PA 1MU2B 4DV7F 1JJ2R 4LMZA 1PILA 1DLOA 5B08A 1GMVA 1JLCA 1TVRA 3T5KA 3MMAB 5D0EA 2DR9A 1RKIA 4CO2A 4NLTA 4F04B 3QFHA 5DDQC 4NXNJ 2EFNA 5GAEI 1R7IA 4JYAJ 5CQGA 3TUPA 2J8AA 5KFBA 4OI6A 3T19A 4ZP7A 3THTA 1PYOB 4OYIA 3C6UB 2IPOB 2AMCB 5KFEA 4GKKJ 3OXLA 4DX7A 4CWBA 4LREA 4RW7B 1AA1B 2ZD1B 1RT1A 4XAKA 4Y0FA 3OJSA 1YTYA 2Z30B 4NCGA 2JRSA 5EX0A 3PACA 4NE9C 3P8BB 5E2QA 1SQFA 2P2CB 4C0OC 5HBMB 3KJVB 5D8HB 4D3HA 4K4VA 1XEZA 2AV5A 3V6DB 1WKKA 4OMFG 5EWEA 4UY8T 2IC3B 1SKWA 4A47A 4KFBA 3GIRA 3M2UB 2KXFA 2UV8A 2HHXA 2JL9A 3NEKA 1WKJA 1WTBA 2HHHJ 2ZH5A 3M6WA 5KFLA 2H48B 3MI7X 2XY7A 2PMWA 4ZPCA 4RPFA 1D9DA 1RWVB 5FD1A 2ZNZA 3PW5A 2YTCA 3AD8C 1DJ0A 2A0FB 2EK1A 3CDAA 1N52B 3BN7A 2NZCA 3FNNA 1GAOA 5D0HA 4ZVUB 2FVSA 2YQ1A 3CDEA 1M5HA 2VG7A 3N01A 4CLPA 5LMUF 3W5YA 3CF5Q 1REGX 4N76A 2VPXB 2WONB 1UVKA 2XZTB 3Q83A 5KFKA 1ZM3A 4C9DA 4ZPWR 3T5HA 3BN4A 3LF0A 1VQ4S 1U09A 2KDOA 2V8DA 4RNHA 2D3UA 1RXOB 1RT2B 1MWYA 2XBPA 3GIIA 2K3KA 2OHDA 5C42A 4ECRA 3BV8A 4N56A 4R25A 5A6WA 2ALYB 4OLOA 2J76E 2POKA 3ENAA 2C22A 5F8MA 2BQ3A 4WF9Q 3RR7A 1CPZA 4ZLLA 1S4FA 4OYZA 1GEHA 1JLFB 3TQEA 4RUCA 5D3GB 4ID5B 2YWWA 1XBWA 2NS1B 2LVWA 2KG1A 2BKPA 2DHXA 1HQEA 4HYKA 1VDHA 7FDRA 4MTPA 4YS2A 2GW8A 3EGNA 1BUXA 4C7QA 2A2CA 2XZWA 3US5A 4DV7J 1SJ4P 1KVKA 1S9EA 3R5BA 1BWEA 1EQ0A 3A8JA 4FF3A 5I3PA 4AXIA 1QD1A 3I9ZA 4I2QA 4I7FB 3CJTA 4PEOA 3QQCD 4YOEA 1MSWD 3PNIA 2IBOA 5KFJA 4DG1B 3DLBA 2P9CA 1T3NA 4JI2F 2DKOB 1S10A 2VG6A 4JV1A 4CLZA 2GVDA 1YBAA 3KK1A 4ZVQB 1UJ6A 2LKZA 4ED7A 3HJVA 1RWKB 1UFLA 3M7VA 4C8MA 5CCMA 1RAFB 3HFKA 4LSLA 1VQNS 3VAFA 1KHVA 1XIQA 4K4SA 3CJSA 5ETMA 2HQIA 3TVYA 4KTQA 2YBVA 1RCOB 2MJUA 1YRXA 1L3VA 3GSIA 2XNQA 3SCJE 5G0RA 3W64A 2ZEJA 1N5YA 2R7UA 1KSPA 2CKWA 2OFHX 1IR1A 4CYUB 3WIUA 3HHLD 2QA1A 4GMKA 3OLBA 5KG6A 3P96A 3OSPA 3TR5A 1TZ0A 2V4JB 2RAQA 1C1BA 2O3DA 4PPZA 1YDLA 2AGQA 2R7RA 3TO8A 2F8EX 4IH5A 2QMXA 3B4MA 2CPIA 1U1PA 3IXQA 2HK2A 3PZPA 4ZJLA 3Q8RB 3Q23A 3VR1A 1U49A 4NLYA 3BH6B 3IWLA 1UMJA 2DNPA 3PHTA 2CQIA 3CJ2A 2XMJA 3IO1A 4DQQA 3MUMP 2V8HA 4NA3A 5LMUJ 3V4IA 3ET6A 2PO4A 2VQFF 4JI6F 3B78A 5J2PB 4ZK7M 2PSZA 5ETVA 1X60A 4K4WA 3QNWB 5I3UB 4ILMA 4CNYA 2AZ3A 2F3JA 1JJCB 1WOOA 4LVOP 5H9EJ 1GNKA 2CQ0A 2CNOB 3FBEA 2XLIA 2CFXA 1S9GB 3GCXP 4QYRA 4I1TA 5A0YB 4Z7CA 2UXBF 2DISA 1TQLA 3TP2A 1VJQA 3GJSB 4HL9A 5E5NA 1WDDA 5LOQA 2RILA 4MFBA 2ALZA 2NUHA 4EMDA 2APOA 1DQ9A 2A6OA 3GFXA 3N28A 1K0VA 4Y2AA 4EFAC 1FRMA 2PMZD 1RACB 1VQ6S 3PO4A 2ROPA 1FVSA 4RNMA 2W2MP 3MPVA 1T02A 1WC5A 4DXLA 5IM0A 4QPXA 2KVQE 1R31A 3TOQA 1SUQA 3NMRA 3DMJB 3EVMA 1IBKF 2COLA 1IBCB 3MM8B 3M6UA 2CJKA 5ETNA 3VV2B 3FRZA 4G3IA 4KC5A 5K8PA 4RW4B 1UWBB 1HBNB 3POTB 3W5ZA 4OYXA 1FFGB 2QRRA 5KFFA 4CT8A 2HVEA 4LR9A 4LF9F 2YWGA 2J6UA 1TKZB 2B4OA 4JI2J 4DPYA 4KAIA 4USMA 4KO0B 1AYEA 4XTTA 3TI0A 4W90B 1N36F 4HH0A 2FHKA 1GH8A 3ZZRA 2HWHA 3OHBA 2LEAA 2UZAA 3W60A 2C3YA 3MPWA 3KLGA 8AT1B 4ZP6A 1A9NB 2HVHA 3AODA 3J7YU 4EK2A 2HQ3A 3BEGB 4X4SA 3ZFVA 3MURP 4OHYA 1KQGB 3DXBA 3MEEA 3VQTA 2OUGA 3PDNA 3V6HA 4QWCA 2HFZA 5KG3A 3QRPA 2XMTA 2OFGX 4BC9A 1SKUB 3BPDA 3G6XA 4Q5VA 2XLJA 3FBFA 4ELUA 4KPYA 3Q8UA 2H51B 3DDIA 1FWPA 2W4CA 1YI2S 3OR1A 4NYPA 2HFUA 1VHFA 4NRTA 1UWAA 2L08A 4DV3F 2RS2A 1FKAF 2LMIA 1O8BA 1SVDA 1Y9OA 2ZBQA 3OTEA 2Y1LB 1IKYB 1RHQB 3L09A 1H0HB 4HHJA 4RX6A 3UN5A 1FRKA 1L3KA 1WC3A 4QR2A 4GO7X 4LRCA 1XMOF 4WU2A 2ROEA 2RB7A 1SC3B 4L74A 2HS3A 1P9QC 4ILRA 1BQMB 2VQFJ 4JI6J 1YBUA 1AB8A 1SC6A 2ZBRA 3ULHA 4WE1B 2KHCA 2BJ9A 1SPBP 2VBXA 3JQKA 5KFVA 1IWGA 2DT9A 3C15B 1UVIA 4KHRA 3DKDA 3MPYA 1WWHA 1K0TA 1R0AA 3NCRA 1UA1A 3MMCB 2Q6CA 4UW2A 1FWKA 3GLJA 5C24B 3M2VB 4LRDA 3X1LB 2UXBJ 3DOLB 3HJFA 4JI8F 1RT5A 1S7IA 4IH6A 4CTAB 4P2XA 2AD9A 4YR2A 3N5BA 2CJQA 4DQPA 5GVQA 1XNQF 2V8VA 4CNZA 1YGYA 2ZJRQ 1YJRA 2J9DA 3KJVA 4OJGA 4F3QA 3N0VA 2QMWA 4OJ1A 1R3NA 1GMUA 2C2DA 4FVMA 2ZBIA 1CQMA 4QR1A 4BWJA 3V6DA 2OLWA 1YJWS 1EKSA 2DNYA 4RUHA 4RBTA 1MW7A 5H9EK 1IBKJ 4PG7A 3T5LA 2DYAA 1LFPA 1WG1A 3NCPA 2J0XA 4HT5A 3NKYA 4CQ1A 2R7OA 3KMSA 4PCQA 5K14B 4LF9J 2XEXA 3GIKA 1Q16B 2GV1A 3MXHP 2SXLA 5FDLB 1KS2A 4A8XA 2HFVA 4RR5A 3NGKA 2R2TA 2H3EB 1GK8A 1N36J 1DQ8A 4NPOA 3W9HA 2BE2B 1S79A 1X4CA 1JNZB 1Q8KA 5KG0A 2CVIA 4LIRA 2HAFA 2ZKUA 3TZZA 2MHNA 4QWDA 2BJ3A 4DL7A 1YLXA 4RBUA 3HVAA 2I5JB 1TL1B 4K0KF 4IG0B 5GMDA 3RBEA 1YJTA 4WFYA 2GJIA 2CRLA 1PKUA 2Q66A 4RJVA 2MKYA 3SYZA 3SCLE 1ZZFA 2HHUA 1V3RA 1N54B 1BWVA 3GFYA 1Q8LA 1RHRB 2FHMA 2M88A 4NXMF 3PHEA 1RT2A 2QLJB 3CDBA 2GAGC 1FNOA 1S9FA 1SH2A 1HMVB 2G9OA 1R8PA 4LBHA 3SDEB 2OH2A 2WVBA 2AJFE 4LSZB 2YWFA 4DV3J 3ELHA 2EFOA 4RWWA 5DM7Q 4AYBD 2FVRA 1JLFA 1NNDA 2V5HG 5D3GA 4ID5A 2Y1IA 1QVFR 3ZZUA 2KZZA 4HTIA 4KQZA 4PWWA 3FUYA 3O8WA 1KOHA 1QTNB 1XMOJ 1QE1B 3FCVA 3E01B 1U2RA 1R0BG 4OYWA 3I82A 5A2QY 2AHOB 1NHUA 1YHQS 3SI8A 4ZJQA 2DH8A 2ZZTA 3D0HE 1XK8A 4I7FA 4J9NA 1BE4A 3GSDA 3ENVA 4CLTA 4M5DA 4DG1A 1KLNA 4X4OA 1F9HA 2MQOA 3ZTSA 4FYWB 5KT6A 3EZ5A 4JI8J 1HNIA 1HNXF 1Q7YT 2RRBA 1TU0B 3C8YA 1VQOS 3CCQS 3Q86A 4DQRA 3CD5A 4N77A 4ZOSA 1XNQJ 5HLFA 4GO5X 3M8ZA 2R8JA 5HP1A 1EQMA 5JUMA 1IWAA 2FLLA 3G71S 2W2PP 2LLZA 2XCAA 2UUBJ 4NLUA 4WFBQ 3D5MA 4PWDA 3CB4A 4LF8F 2CPZA 3CJRA 1VQMS 4Q2LA 3LP0B 4X66F 1MN9A 2K8GA 1RB0A 4HT7A 2ZH3A 1FJ7A 5CYQA 3VVTA 2MQQA 2V4JA 3DRPB 5K8MA 4JI3F 2PMHA 2ZHOA 2CJYB 3OTOF 3EZOA 5T41A 1LWEB 1ZETA 3T5JA 1HYSA 3GG0A 1HKAA 1LK7A 2DGTA 3WX4A 1FT8A 3TNVA 2HVZA 2BM1A 2Z2ZA 4GVLA 4RLEA 3MMBB 2CZ9A 2GVZA 5CYMA 4OI1A 3M8WA 1DTTB 4K0KJ 4EBEA 4DV4F 1I3OB 2FC8A 5C2GA 1VK3A 3H40A 4UQGA 2B5JB 3O2IA 2DPJA 1SJFA 2NCKL 2QSWA 4ZS6A 3S1TA 4TU9A 2XNRA 1PYSB 2K7JA 1Y7PA 4JI5J 3C16B 5HQMA 4NXMJ 1CJVB 3TWZA 1PBAA 3R5DA 5K5MA 4ANDA 4OI2A 4WFNQ 1FI4A 2JVRA 1UL3A 2MZJA 5A0YA 2B4UA 4I64A 1F2GA 1K47A 4IDKB 3UO0A 4Y65A 3CCZA 1REVB 2B7CB 2EVZA 3PXGa 5A8WA 3QT6A 2QYGA 2QL9B 4F0HA 1HL6A 4NEZA 4C3MA 3G6ES 4TVAB 5K8NA 1FKPA 1KOOA 4LIWA 2DHSA 4B3OA 4H4OA 2Z2YB 3DHXA 1F9FA 1LK5A 3D6TB 3M32B 1OS5A 3MM8A 1CJKB 1F5BA 4NLPA 4A8WA 4C8ZA 4RW4A 4A8OA 2GC8A 5FLXY 2VG5B 4G1IA 5DO2A 1RLCL 3EDRB 2G1HA 4AL7A 1M5VC 1TKZA 1CEZA 5HVHA 1JKHB 2B56A 3NGDA 3RRKA 1HNXJ 3WQPA 4RNOA 1WHYA 4N8NA 4N47A 3CULA 1T8EA 4TYAA 2J7KA 2BW2A 3TUZC 4FYVB 2FVCA 3M30B 2YKQA 5IQ6A 3PRBA 4P6QA 2DHAA 2HS4A 5DJBA 3UDCA 3EVOA 1J5OB 4BS2A 2DR6A 2VICA 3GV7B 6FD1A 2RQKA 3B54A 2PI5A 3SFUA 3R7BB 4O3QA 4DFJA 5HANA 3G8TA 3LWMA 1Y5NB 4ANEA 4JI3J 1RT3A 3FEXB 5KFOA 4F67A 1VRUB 5KG2A 2EEYA 3OTOJ 4PUOB 3K5NA 1C1CB 2CPJA 1LWFB 5CABA 2MGZB 3I4HX 2EBGA 2AEFA 1M1KT 1P6TA 3KG4A 1LOUA 1ACMB 4C3LA 2J0SD 1X5TA 3M2RB 4DF8A 2EG1A 4WYLA 2FJVA 4MT1A 4DV4J 5F9NA 2ZH7A 1JLGB 2G2ZA 1HHTP 3EX7B 3J7YI 2L48A 4DMZA 4J9KA 4H4MA 1YWXA 1K44A 2RRNA 1PCAA 4U7UK 2NUUG 1RBOB 1R0CB 5D6GA 2QZ8A 2Q43A 3ADAC 1EJ7L 2EWHA 4RU2A 3M8QB 3JSRA 1X9WA 2DIUA 5IC6B 2AW0A 2F4FA 3CIMA 4CO1A 3M2VA 3X3UA 1KLMA 4LF5F 3ZC4A 2RQMA 3W5XA 2R4FA 1WTFA 1AFIA 4CTAA 2KXNB 3EICA 2AGPA 3IM9A 4JI0F 2V4QA 2WOMA 2E1AA 5J1NA 2R7WA 4QW9A 1MWZA 2WVEA 3V2UC 5F8JA 1Q95G 3LWLA 3C14B 3IAS9 4KRWA 4FKXA 4DL6A 4O44A 2KM8C 3DYAA 7AT1B 3GCWP 5EN1A 1X4BA 4ZVGA 3IG1B 4B08A 3PW7A 3RW7A 3NS7B 2BJ8A 5CAAA 3ZTQA 4NLXA 1GX6A 2FHJA 3MGJA 3A3NB 1SCJB 4DFPA 2AF6A 2M7SA 1WC1A 3PW0A 1UA0A 4YB6A 5IS2A 3TYTA 3W62A 4PQUB 2CA9A 4L76A 1UJ5A 5F8IA 3LH2S 2ZZMA 4Q0BB 4LRAA 2OMLA 2CADA 3DI6B 3J81U 5D4NA 1XNRF 3UN3A 1BHNA 4FKYA 3CD6S 4DV6F 1DURA 4QIGA 2HLTA 5GMEA 4RBVA 3D4JA 1A6LA 3UPFA 2MSSA 1MROB 2PFDA 5LJ5Y 2MZ1A 2AYGA 1SC1B 3KLIB 2BYCA 2C42A 4XPEA 4O4GA 3IRXA 4M8LA 2IBKA 1WJ9A 1MMDA 3N6LA 1VQPS 3IWNC 1HMVA 4OX6A 3A4TA 4FBTA 2EW9A 2XO6A 2DNKA 3HHNB 2IJNA 5M2PA 3IFEA 1YJ9S 2A6MA 2DRBA 4TYBA 2W8KA 4TU8A 2XHWA 3SQGA 4K4TA 2DO0A 5HI7A 2QA4G 1AW0A 1VOMA 3HF5A 4YEAA 1HIYA 1JXEA 4ZPAA 1QE1A 3R27A 2RQCA 2W1BA 2UVWA 5EUHA 1L3SA 2ZWPA 2D69A 3D1QA 1OPIA 1DAXA 2P9GA 1FEHA 3MFIA 3B6BA 2CQ4A 4YQWA 3D9BA 1B64A 1GXTA 4DOZA 4Q2MA 4I6WA 4KGMA 1PJ6A 3I32A 3KLFB 3QWUA 4WXWA 5C25B 3QIPA 4I6AA 2XTJP 1IVZA 2MMYA 4LF5J 3UW1A 3ZZOA 1RK8A 4ZMMA 5ETKA 1LWXA 3E8OA 2GHVC 1T9YA 3QLHA 1C0UB 3L7OA 4J9PA 4JI0J 2W7OA 2V2ZA 3QRRA 4I69A 2RE1A 1ZZNA 2DCUB 4ZIVA 5BJRA 4M5GA 1S1XB 2WVCA 4BBYA 5E3QA 2QMUB 3QGGA 1MWQA 2M0GB 3NRBA 3CC4S 1PC5A 1GX5A 3CJKB 1FD2A 3LP0A 1VISA 4B9LA 4TQSA 2Z2LA 3GONA 2ZM6F 3ENWA 3LA0A 3PG9A 2LEPA 2LU1A 3HX9A 3NLCA 4ZA1A 4NLWA 2R7XA 4ETXA 3IA0A 2ZKTA 4CM0A 1RWUA 3M4XA 4OI0A 2Z57B 4LJMA 3LW5C 4USTA 2DHHA 4C98A 3MECB 2X1FA 2VBWA 4FYXB 1XNRJ 2BV3A 2VOOA 2CG4A 2QA2A 3NG8A 2GHWA 4DV6J 2BEFA 2Z56B 4DR2F 1TKTB 1VBKA 1DTTA 1NK8A 2MKSA 3CO9A 5L1IA 4ENOA 2HNZA 2IM0A 2IVYA 2LDYA 3S8SA 3CT9A 2RJZA 5L1JA 5D4LA 1K9MT 1N56A 3M8RA 3A13A 2F63A 1B0PA 4G1QA 2G0IA 4IH7A 3BGRA 5RUBA 2MQNA 3TZYA 1LW2A 1VQ8S 2KRBA 2IRYA 2MKCA 3AHPA 2HHWA 3H5YA 1EETB 2GJ2A 2XMWA 1WSRA 3BO3A 1Q1KA 4IDKA 3TX0A 1REVA 3EJMA 2RDDA 4BC7A 1ZA1B 4MYUA 4YB5A 4CO5A 3HSDA 4WIQA 4OL8A 2W9CB 2VC0A 8ATCB 1NJWA 1CJTB 3DXSX 3MAAB 2O1PA 1JWWA 1TKXB 3GU0A 4XDDA 2OPPB 3UDLA 4YHHF 1VQLS 1F1BB 1I94F 4DL4A 2IYIA 4J5OA 1CQNA 3M32A 1RQ0A 4UT4A 2CAJA 4B9SA 5A2QU 4FYDA 1U2CA 1FDNA 3TRGA 2R7VA 4P2SA 1FRHA 3W7BA 2A1BA 2PIIA 1QLNA 5F8HA 5KFDA 5AT1B 2P9EA 4X64F 2LXFA 3H98A 5F8NA 1SKSA 1JKHA 5I4MA 5IFMA 4ZP8A 1WC6A 1N88A 4BWMA 1AUDA 1FNMA 3LP1B 4MKVA 4CLYA 2V34A 2MY8A 1UZHA 1NDLA 4WJBA 1R8HA 2O01C 4IG3B 1AT1B 3H2UB 3PYFA 3MEDA 2HQGA 4FPRA 3NCQA 2E29A 4OZLA 3DLGB 4ED5A 1RTJB 4TQRA 3D0GE 3O5TB 1NKBA 4MKYA 1TMMA 3OL7A 2IRUA 1TAQA 2JX2A 4ZVEA 1PAEX 2YXLA 4ELTA 1URRA 2QJ3A 3KK2B 3O3LA 1TUGB 1TL5A 4A8SA 4UY85 3FEZA 2JEIA 2ZM6J 4HACB 2ZVIA 4DQSA 2GX8A 3J80Y 1VRUA 3MM7B 1D3WA 2D7SA 4MH8A 4WKRA 3ILJA 2ZBPA 1N5TA 1Q8IA 3R7NB 3T1AA 2XYHB 1LWFA 1DQAA 1LNQA 2DNOA 3IAM9 4DN9A 3CCVS 4X4UA 2ZITA 5CHCB 1S0OA 4R5PB 1VI7A 1NO8A 2QC3A 3NGTA 1WG5A 1S1WB 1NJYA 4DR2J 3MEKA 2O66A 1JLGA 4WK3A 2FJEB 3CC7S 5EX3A 3NNHA 2VD3A 4JI7F 3R8YA 5C7PA 2XI2A 2IIHA 3R1LA 4DL2A 2M8HA 4OHVA 1J5EF 3PR5B 1B70B 1GT8A 1S6UA 4WP3A 2BBEA 3BREA 2DY9A 2E44A 3DRXA 2J0WA 5A8RA 3MR2A 1SV5A 2IAJB 2D74B 2DNLA 1FEEA 3EGWB 3ZZZA 4MYTA 4NL5A 2W4PA 3UR3C 1BY9A 3RR8A 2PT0A 5LJ3Y 2KJVA 1KFDA 3TQ1A 3SSSA 3V81A 2I38A 2CZVC 3I9V9 5HN0A 3SMZA 1KVJA 4ZHRA 4DR7F 3SFGA 3EYZA 4C11B 4RO0A 4Y2MA 2NLWA 3T9NA 2UXDF 1S99A 3BSNA 4YHHJ 1I94J 4F7VA 3C14A 2EFPA 3M9OB 3RAXA 4QU7A 3JSMA 5HSPA 1NRKA 1YRUA 3NS6A 2RKIA 5E3RA 3LANA 2QGFB 3IG1A 2NR0A 4ZVPB 2LQBA 1UKUA 3AY0A 3C2PA 4PXCA 4DV2J 3MMJA 2HMIA 4F4ZA 2W9BB 1UFKA 2IJFA 1Q8BA 2K1RB 2MQLA 2CPHA 4QIWD 2E1PA 3E3XA 3TJ8A 4PPDA 2BW7A 2R8IA 4Q0BA 5CZXA 4DL0C 1V6HA 2LYVA 3CE8A 3O1LA 1IKWA 1Q78A 3LPYA 1YJVA 1GQEA 3PR4A 4KGZB 3ITHA 1HBMA 3VQSA 3DRSB 3TANA 2QO3A 2JFDA 2E1MC 2FGOA 3L95X 2WBMA 2C2ZB 2DR5A 4FNHA 1SIZA 4LF6F 1MROA 3S01A 2NPFA 3OR2B 4JUZA 4DQIA 3JYTB 4LRBA 2QL5B 3MM6B 4WWSA 2RMLA 1TV6A 1NPKA 3OBIA 2MKHA 1U1LA 2YY3A 2AZ1A 3S6EA 3CCTA 2YKNA 3H2LA 1S1UB 4IUFA 5F41A 1ZAWA 5K20B 2KFZA 4LVNP 4O3SA 4ZP9A 3QATA 2Z2MA 4CRJA 4ED3A 1Q79A 4KV8A 1VR6A 1T94A 1NDCA 1DY3A 1N0UA 2AX0A 1Q0NA 3AQOA 3SV3A 3CCLS 2N3OA 3LGMA 3FGVA 2HVIA 4ZVRB 4DSIA 1VC0A 2HGLA 1NDPA 1GMWA 3EE3A 4B3MF 4JI7J 1U0HB 4PKDB 4BCAA 1GXLA 4AD6A 4N7TA 1NEEA 1AZSB 3D6HB 1J5EJ 4QIVA 2A2DA 3CEDA 2MSTA 4L3NA 3BBFA 1RTIB 1ICEB 3QZ7A 3DGPA 3NGSA 2DNQA 3PFEA 3BSOA 1U1OA 1T9XA 2BRKA 4DEZA 2J5AA 2CQDA 4RWXA 5C25A 1H7WA 4AL6A 4DSKA 3UI3A 3AD9C 3DLEA 1U1KA 3RBDA 4M5KA 3AH6A 2E9ZA 4I0WA 1H3DA 3ILIA 1XR5A 3A8EA 3VTIA 4UUXA 2OPRB 1R27B 3I0RA 5THWA 3RJMB 4DR7J 3AXMA 2N82B 2H65B 4RU9A 2CDRB 4Z7YA 1NKCA 2HW3A 2UXDJ 5H9FJ 4PXBA 1S1XA 3RW6A 4FXDA 2R8GA 1JK9B 2G1DA 4Q43A 2HEKA 3WBZA 3OJUA 1D0EA 1S1VA 3VAKA 2J6TA 4ZVTB 3NOGA 2OPSB 3GR0A 3HCXA 2ZFHA 2K06A 4DSLA 4CO4A 1QAIA 3GIMA 3G82B 1W7WA 2MQMA 3DDNA 1FX2A 2V8GA 3MECA 1KP6A 1M1GA 4CT9A 1SJRA 1X8DA 3DDKA 4DV1F 2DNNA 2KYZA 3UR0A 3W9IA 2KL8A 5HROB 1OMSA 2IVMA 2RUSA 3M8PA 2UUTA 4CLKA 1DHMA 2JH3A 2WRMA 1S0MA 4L6V3 4PG4A 5DDPC 4LF6J 1EP4A 2AX1A 4ETZA 4YDDB 2CJXB 1UAWA 3PV8A 4M94A 2EFGA 1TELA 3UD5A 3T41A 4NYZA 1V5IB 4IOCQ 3FMWA 2FJXA 4OZ5A 1JXVA 3QO9B 1S7HA 5LMNF 1EETA 2BANB 1JJ4A 2XS2A 4JV5F 5B0BA 4ZJOA 3WZ0A 3MAHA 1U6ZA 3ISZA 5KFUA 4K59A 2HNDB 1WHXA 2FD2A 3KOAA 1VJWA 3LO3A 1V9OA 2DJWA 3MAAA 2R8KA 2MLZA 3IBWA 2MKKA 4U8YA 3Q8PB 1HD1A 1UVMA 4B3MJ 3GR1A 3ZTRA 2ZDOA 2YWHA 2DD8S 3DLKA 2HQCA 4RNFA 3DHWC 3EPGA 4IR9A 2OTJS 2MJNA 4IFYB 4ICLA 4YUDA 3MOJB 4DPTA 1X4HA 3KKFA 5AJ3F 2VU5A 2ZBCA 4QQBA 2J9EA 2HHSA 1ZYQA 3HSJA 3P6YC 4M95A 4OV1A 2AJ1A 5IOLA 2DRAA 4J9SA 2EPIA 4FXWA 1NZAA 2VKRA 2DHGA 3W8GA 1G1XA 4IG3A 1O6XA 3G8QA 4NLVA 1WF2A 1X7VA 1AUSL 4KH1B 3UQSA 2H5IB 5T7LA 4DZDA 5IQQA 2F9JA 2XQCA 1RTJA 2YNGA 3FFIB 1IM4A 3G8SA 1M0SA 4RW6B 2Q79A 1HBOB 1T9VA 3I87A 5DQHA 3OL6A 2K3IA 4NZ0A 4ECQA 3LUYA 4FF2A 4DFKA 2I9SA 3HMJG 4YN3B 3RU0A 1CVJA 2B6AB 1RWWB 3NBPB 2OGUA 3MF5A 4HTJA 1UETA 2HK3A 4DWIA 2AJ4A 2CPYA 3DLHA 2EG2A 1S59A 1Q5YA 1EIYB 2VPZB 1RE1B 1CULB 4HACA 4ES2A 3HVTB 3W2VB 3KJQB 3MM7A 2OAUA 3N79A 1R43A 1RU1A 5HL7Q 5G4DA 2YKMB 5KG1A 1IKXB 2NXJA 1YQHA 3EXYA 4UOFA 3MR5A 5L1KA 4R5PA 2V50A 1ULRA 3U1MA 4DX6A 3NMAA 5H9FK 4DV1J 4AQYF 5AXMA 2UUWA 4WXOA 3LQVA 1QAJA 1XMQF 2LXIA 2F9DA 1N6QA 1TL7B 2WB4A 3AOBA 2RSQA 1X0FA 1L5UA 2LU2A 1RYRA 1NH8A 3MM9B 1S6PA 1U6FA 3QRQA 3MM5A 4LSNB 4QZVB 3RB3A 3OFFA 1X4FA 4I2PB 5CXTA 5B7WA 1NSPA 4J9UE 1LFWA 5J1EB 2ZC4A 4PYDA 1Y4ZB 3HI9A 5A8KB 3MEGA 2XSJA 5LMNJ 4B02A 4UOGA 3D6MB 4Y3CA 1V3SA 4JV5J 4OYMA 3A3PB 2JDJA 1N32F 1FRXA 2E5HA 3CDUA 1FDAA 1X4EA 3BDEA 3TA2A 1ZA2B 4TY8B 3O44A 1MN7A 3OHAA 4O4RA 4J9QA 5LSOA 3RTVA 1SKRA 2NYHA 3VF0B 3ZZ0A 3RB4A 4C11A 2GMLA 1W25A 3D54A 3VGUA 1N5VA 2MDAA 5LXYA 4USKA 1VC5A 4F4WA 2XULA 5DM6Q 5ETTA 4OHXA 3OW2R 3I96A 4F3MA 3RYLA 1I5OB 1U8SA 2G0CA 4WKYA 1FXLA 2OI2A 3GE9A 3BSAA 5KOWA 2F5GA 4E8UA 5E3AA 5MLCV 2J9CA 3VZIA 2J6SA 3DOKB 1NKEA 2QN6B 2WHOA 4KIAA 4AT1B 5AJ3J 2G13A 2QLFB 1TK5A 1T05B 3N6MA 2LECA 3AA9A 4KHMA 1MG7A 4G65A 2YNFA 3QMQA 1S48A 4HI2A 4DJBA 2L41A 2CQBA 1VQ7S 2VKZG 4RW9A 4OZNA 4L73A 5LXRA 1WACA 3EMTA 2FZKB 3JXOA 1P9YA 2KJWA 4X4NA 2DB1A 3DRSA 1YITS 2IRXA 4GVBB 3KLHB 1WUUA 3ILLA 2I8EA 1SC4B 2ATLA 1PYTA 4EBCA 1RTHB 1VRTA 3OR2A 2FJAB 3FMBA 1YVFA 3MM6A 2E7WA 4OHWA 4M1KA 4P10A 3OTDA 4IRCA 5KFXA 3BYRA 4K4XA 2B3TB 5GADI 1KDNA 2QA4S 1PC4A 4UUWA 1S1UA 2WK4A 3UN2A 4IQMA 1CJUB 3JS9A 1D9FA 4USWA 1DTQB 3CWJA 1U47A 3K5LA 2Y9HA 4F25A 1KONA 4MIBA 3FEYB 3T6BA 3VWSA 3JTNA 1SXLA 3QT8A 4NEYA 4AQYJ 2H9ZA 3M9MB 3QGPA 2X3GA 2XM3A 1XMQJ 5KFHA 3GZ7A 2ERRA 3AD7C 3D68A 2IA6A 5KG5A 2WZ1A 2LA6A 5IWAF 1T3OA 1VBYA 3PRVA 4E0DA 3BS9A 2V2QA 4DS5A 1C0TB 1NK7A 4ZPDA 3TJAA 3BYPA 2KM8B 4DCOB 3N5FA 4OLPA 2XS7A 1YRTA 2DK2A 3GFZA 3OL8A 1IBMJ 2UVUA 4GRSA 3SV4A 1RT6A 3BB5A 1PG5B 3MCSA 4FBUA 3W65A 1U48A 4OYAA 1N32J 2DGSA 5J2MB 1BD6A 1NZ8A 1FRLA 3PJXA 4Y2CA 3HHLC 3BZQA 4K4ZA 4PG6A 1RTDB 2ZVSA 3PRDA 5JVHQ 2WBRA 1QJHA 4ES3A 1WEYA 4QYZJ 3QGIA 4P73A 3F0NA 3CDWA 2WSCC 2R42A 3DM2B 1FKOB 2DH9A 3PY8A 3ISND 1KQFB 4F36A 4X62J 1BQNB 1OPZA 4DPOA 5DLFA 1M5KC 2BKNA 2DGUA 1M90T 2QFIA 4DX8H 3VZHA 3CPWR 2XSFA 1JLBB 2VV5A 1K1QA 4YR3A 1K8AT 1I6JA 1U8WA 1LW0B 1F3FA 3H8YA 1TL3B 4K2JA 5HK4A 2OPSA 2FHJD 3A1YG 2G0JA 2Q6BA 3AXKA 4X2BA 4C0BA 2R3VA 2V67A 5KFPA 2XMKA 2VA3A 4URSA 1HFEL 1SL1A 4WK1A 2CNNB 2W7PA 1RHJB 2A18A 1FCAA 2V8PA 4CH7A 3NWGA 1Y10A 1JLCB 4ZPTR 1TVRB 1H2VZ 1NCLA 2JWNA 5B0FA 3M9NB 3EUNA 4E2FB 2YVSA 2WCXA 5HROA 4ZIWA 4M5NA 2N4CA 4I67A 3I5AA 2ACYA 3UE2A 3FKBA 3HT3A 3TEHB 4YFUA 1S77D 4ITSA 1EB0A 1QSLA 3I6PA 5AE2A 1RT1B 5KT2A 2LFVA 4NCGB 4C3KA 4E98A 2FDNA 1HNWF 3F44A 1JX4A 3K5MA 1B3TA 3QO9A 4WFZA 3K17A 3RBXA 2AYMA 4KFBB 3MR6A 1JMTA 5EWGA 3FBBA 5E3PA 3KUGA 2PA3A 1X4GA 2HIYA 4A4JA 1WNEA 2QG9B 5DQIA 5IWAJ 4DPUA 1RTZA 4K7QA 2NXNA 2H1YA 2CQCA 2XY6A 2VQEJ 3FBCA 1T95A 3LP2A 4Y2IA 4DUYF 2RD5C 3N4WA 3C46A 1O51A 4MIAA 4IFVA 2ILZA 3UCGA 5DG8A 4DR5F 1VLYA 3W2WB 2KFYA 2NZ4A 4LBPA 1FTRA 1N33J 1CS4A 4ZVFA 2VG7B 3K89A 5GAGI 3SCKE 3GB0A 4F8RA 3H5UA 2MXYA 3A8IA 2HRTA 2EFQA 4NA2A 3R5JB 2DXEA 3NNCA 3R7SB 4H4KA 4P72A 4X4TA 1TFWA 5JJBA 1XQIA 2KTQA 1R6VA 4CH1A 2BOAA 1CBKA 4ECVA 5C42B 4WP9A 3EM1A 3NY0A 1X4AA 2KVIA 4RW6A 3K7RA 2OPQA 4Y6IA 1HBOA 3QYYA 4HLBA 4LF7F 3GYGA 4OX8A 2VODA 1H98A 3D67A 4ELVA 2DXFA 2B6AA 1VIXA 2MYFA 3NBPA 2MLXA 4U7CA 3ZTPA 2J0QD 4CLUA 1WKLA 4J37A 2B4VA 4W4MA 3KHGA 1K73T 5KFZA 3I5CA 2WAQD 4IOBA 2RF2B 1VQ5S 3H7HB 3BKUA 1HNVA 2A10A 3KNGA 4N8OA 3H4BA 3ZO7A 2LCWA 1HQUB 1VMBA 3GJRB 3KHRA 1FDBA 1UTAA 2OTLS 1A7GE 4QYZK 3R6LB 2DIVA 1MMNA 2OSQA 3DRRA 2DVIA 3NNAA 1NAQA 5D15A 4PQAA 1OWXA 5J2QB 2YNIA 2JLFA 2C28A 1NH7A 3OPKA 2DCLA 2FY8A 4K4YA 1MU2A 3A8KA 2R7QA 1TL7A 3I31A 2VG6B 5CD4H 2DPIA 2GVDB 1GFWB 3KK1B 1DARA 3GWCA 3FSYA 3MMAA 1EX8A 2D41A 4JB8B 3CW2C 3R1HA 1U1NA 1QM9A 2F65A 1VC6A 4LSNA 4C4WA 2FLPA 3BBBA 2PDAA 2FLNA 2M9KA 3R5GA 1ZTWA 1HNWJ 2QV6A 4EZ6A 1LV5A 1IKVB 4ECUA 3C6UA 1RT4B 2XLKA 5G0RB 4RW7A 5IT9U 2ZD1A 4AXJA 3CVKA 2C3OA 1S57A 1YZ6A 2I1RA 4CO3A 1FWLA 4F0MA 2B0GA 4BHQA 3Q8QB 2UXCF 2KI2A 5HBMA 2JJ4D 1VBXA 4LQ9A 1HW9A 2MQ8A 1Y00A 2UUBF 1X9MA 1KFSA 1KC8T 4YY3F 1N5QA 3FJ2A 1EKRA 2IC3A 4KGVB 6FDRA 5KT4A 2CWKA 3M2UA 2EK6A 2BX6A 1B0TA 3IR5B 4J9OA 1S12A 4DUYJ 3T6JA 2OEKA 3BGUA 1FXDA 3GFHA 3PJ9A 5D78A 2ZZNA 3E51A 4NLSA 2BACA 2W25A 4DR5J 4EYIB 1S6OA 4IRDA 4ECYA 1FJGF 1UP1A 5GAHI 4Z2XA 3ET6B 7FD1A 3FSXA 3LOUA 2GA7A 5JVGQ 2P8IA 2HBZB 4PABA 3M1VB 5D4PA 3QBCA 3HXMA 1RU2A 2YPZA 1H74A 2CQ2A 2CJAA 3PKYA 3EGVA 2WONA 2Y3YA 5KFIA 1D9AA 2E5LF 2XMUA 1X0PA 3NAHA 2ZE2B 3KLHA 2GIFA 3H5SA 1RTHA 1KTQA 3QGHA 4LF7J 1N34F 1NB2A 2LQ9A 4MFBB 4TXSA 4JI5F 2GFFA 3C6TB 1T9UA 4CLWA 4DF4A 1TUVA 3AB2B 1F0XA 1T03B 3K8VA 5DETA 1G6BA 5F0UA 4EYHB 2WW8A 1M5PC 1HWJA 2V9WA 2GO8A 5L9XA 1DFDA 3IM8A 3OXGA 4YDXA 1APSA 2G4BA 1D8YA 2E66A 3VAHA 1N48A 2FIUA 2UUCF 2F1FA 3HLUA 1XTZA 3ILOA 3VAMA 2LP4A 2H4YB 1TAUA 4UTGA 1B4SA 3K0JA 3SSRA 3KG1A 5CYJA 1LQ9A 4O3RA 4O3NA 1TTHB 1OYEA 4C6AA 2X3DA 3H25A 1NM2A 4B9VA 4F3OA 3M8SA 4DR6F 4QPTA 2GQ2A 3JTOA 3KLVA 4NLRA 2MPUA 3BKTA 2KHDA 4IKAA 4FXVA 1NPPA 4DI6A 3P5BP 1NJIT 2IMWP 3ZZYA 5DDRC 4WP8A 3MDFA 3UVJB 5HQ8A 3GV5B 4DUZF 4K8RA 1T9TA 1RLDA 1J2VA 1T9WA 3RBZA 3MEEB 4FDFA 1WEZA 2W9AA 4CP5A 3J7Z5 2J7UA 2W2NP 2YQ3A 1KD1T 4KSEB 2BQRA 3KJFB 1BC6A 3Q0AA 1F5CA 1VFJA 3V5RA 2UXCJ 3BGOP 2ZH1A 1IJEB 4K50A 4L75A 3QT7A 5KFYA 4B3TF 4A8QA 4NWBA 2DNHA 4YY3J 2HG4A 5EWFA 4I4BA 1BQNA 2GS8A 3NWRA 4CYUA 1HW8A 3ZZPA 1ZH5A 2DNRA 2KKHA 5GMKa 2M4MA 3BGFA 4U96A 5KFGA 1RHUB 1YBTA 3Q22A 1LW0A 1TL3A 2OP5A 2OMOA 1H7XA 4K2XA 3MR3A 5E41A 3N6NA 4WIIA 1FJGJ 3ZNJ1 2V69A 2QL7B 4CH0S 1EARA 1OQ3A 4QJVA 2Z8QA 1Q86T 4ZPBA 1HNZF 4LFBF 3M6XA 3N9UC 3OT9A 2AKWB 3VAIA 3IGNA 4MIWA 5LT5A 2C3PA 1R0AB 2HZVA 2QE5A 2BJ1A 2MZTA 4FPIA 4UOCA 2PD1A 1G3OA 1RADB 4YP3A 2E5LJ 1I1GA 4OQJA 4W92B 5J2PA 3G87A 3TAPA 1SJQA 2GQCA 2HFSA 3IRWP 2XG8A 3MHYA 1DZ5A 3J7A1 1RT5B 1UJ4A 5I3UA 1N34J 2CDQA 2RRAA 5L39A 1SL2A 3GIJA 1GTHA 2KO1A 1S9GA 1D1UA 2GCFA 1XJWB 2K2PA 4LF2A 5ITHA 1B99A 1YKWA 5KFRA 5CCLA 4J7CA 4CDIA 5CA5A 4F4XA 4HHHA 2E1RA 4ED2A 1Y5LB 4MMOA 4NYOA 2VJUA 4RUAA 2UUCJ 3K5PA 1QTMA 2Z0GA 3DC2A 4FZVA 4WBFA 1S0VA 5E33A 1GMWD 3OD2A 3HZEA 3DMJA 5E7OB 5IXUA 2O67A 2RS8A 1Q82T 2VASA 4QU6A 1FFWB 4Y00A 3HO1A 2FLOA 2V6AA 3K5OA 4G6VB 1W2IA 4DR6J 1UWBA 1HBNA 1URNA 3POTA 3THVA 3W2WA 3T9ZA 2V9KA 1VK8A 4C8LA 1EAYC 3NL0A 4DUZJ 1X4DA 4KO0A 4DX5A 3D6FB 2BUNA 3PW2A 4DLGA 1G7CB 2HIQA 1RWMB 4OIXA 2VFRA 3BM7A 3TVZA 3EZUA 3BQ0A 3TA0A 2VL1A 4X4PA 4PG8A 3BJYA 2U1AA 5KFMA 3CGIA 4ZKAA 5D4OA 4LFCF 4K4UA 3QFWA 2ZH8A 2VBYA 2XGPA 2CNKB 3D28A 4B3TJ 1BLUA 1Q5VA 2GQQA 2CQGA 5CZVA 1Z2ZA 3LTOA 2H5EA 1IBLF 1U1MA 3PW4A 2GIQA 2VJVA 3RRGA 3EWGA 1CC8A 4GC7A 3TAQA 4ZVSB 1Z1ZA 4H54A 2IDLA 1C4AA 1S5ZA 1TFYA 4OJHA 1QDUB 2EXUA 2ILYA 3FVYA 1HQ2A 2BJ7A 2E5IA 2RF2A 4ED0A 4CZCA 4YB1P 5DRKA 3RAMA 2PFFB 1HQUA 1RKJA 5IT4A 3CJQA 1HNZJ 4LFBJ 1IKYA 1NJZA 3KUEA 2KT5A 5L38A 1FE0A 5J2QA 1NUEA 4M5DB 1C4CA 2I0XA 5IC4B 3WHIA 1D8ZA 3KWMA 1BQMA 3G4SS 1SIWB 4WE1A 4ECZA 1HNIB 2XY5A 4U67Q 3VHQA 4DDFA 3C15A 4ZITA 3SXLA 1W26A 4EBDA 4DSJA 3LALA 3MMCA 3W63A 4QWBA 5LSRA 5HLFB 1YSJA 5U47A 4KH0B 1PAUB 5HP1B 5C24A 3CD0A 3Q2TC 3MWBA 3I56S 3DOLA 1IKVA 1RT4A 2E7XA 3JAMY 2V68A 2R2UA 4OFZA 2ZDPA 2W2OP 1NPRA 1XMBA 4PWDB 1WHVA 2DH7A 4J9VA 2N4DA 3D1HA 1H6KX 4A8MP 4UZBA 2HRYA 3I4PA 3FRYA 2Y0BB 2HYIB 2FY1A 5HJYA 5CYQB 4USHA 1QSSA 1OSCA 4R0JA 4AE5A 2GMJA 5KG4A 2CVEA 4KYZA 4OYOA 1IR0A 2R7SA 1HYSB 2MQPA 4XO0A 2NSBA 3GTYX 4KGKA 1LKZA 3ETOA 4ZVHA 5K14A 3IR6B 4URGA 1HI0P 4IYQA 2GVZB 5CYMB 2BMBA 2X7IA 5FDLA 2QTWA 2PA8D 1U2FA 3AAWB 2OSRA 3MCNA 5HQLA 2YH0A 5BR8F 2BE2A 2XMMA 2CJBA 4WU3A 3BR8A 1Y3KA 3W3SA 4FN5A 1HLWA 3M1VA 1RBAA 4IOAQ 4B9NA 2CQHA 3BF4A 2GHPA 2I5JA 1TL1A 4IG0A 4LFAF 3OUYB 4LFCJ 2EBEA 3TZWA 1QY7A 4DSFA 4HDHA 2ZE2A 2CQPA 3CSKA 1RWPB 2QX0A 3DOMB 1IBLJ 4P7VA 3NXZA 2FJBB 3C6TA 1S4EA 2ZWOA 4L3KA 5A8WB 4XPCA 3CJ3A 1VGYA 1T03A
chains in the Genus database with same CATH topology
4ZVPB 5K20B 3R6LB 1SC1B 3D6MB 1RWNB 2XYGB 4DCJB 2C2MB 2QL7B 1RE1B 3RJMB 3IBFB 3KJNB 1RWVB 2CNKB 1RWOB 3P45B 3QNWB 3KJQB 2H65B 3R5JB 2CDRB 4DCPB 3R7SB 1PYOB 3GJQB 2CJXB 3EDQB 2CNOB 2Y1LB 1RHQB 4DCOB 2CJYB 1PAUB 2C2OB 1SC4B 3SIPB 1BMQB 2QLBB 3NS7B 4ZVUB 2QL9B 1GFWB 4ZVRB 4ZVSB 3P4UB 2C1EB 1RHRB 2CNNB 4JB8B 1RHJB 2HBYB 1SC3B 2XZTB 2XYPB 3KJFB 1QDUB 4ZVTB 2QLJB 3GJSB 3R7NB 2XYHB 3D6HB 2XZDB 1RWXB 5IC6B 2HBRB 2P2CB 3R7BB 2HBQB 2C2ZB 3IBCB 1F9EB 2H5JB 1ICEB 1RHMB 2H4WB 4LSZB 1I3OB 2Y0BB 2H5IB 2DKOB 2QL5B 1RWPB 3D6FB 2HBZB 2H4YB 2H54B 4ZVOB 3R6GB 4ZVQB 1I51B 1RWMB 3GJTB 1RHUB 2QLFB 3EDRB 2C2KB 5IC4B 1NMEB 1RHKB 2FQQB 1RWKB 1QTNB 1RWWB 2H48B 2H51B 3GJRB 1IBCB 2CNLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZVP B;  5K20 B;  3R6L B;  1SC1 B;  3D6M B;  1RWN B;  2XYG B;  4DCJ B;  2C2M B;  2QL7 B;  1RE1 B;  3RJM B;  3IBF B;  3KJN B;  1RWV B;  2CNK B;  1RWO B;  3P45 B;  3QNW B;  3KJQ B;  2H65 B;  3R5J B;  2CDR B;  4DCP B;  3R7S B;  1PYO B;  3GJQ B;  2CJX B;  3EDQ B;  2CNO B;  2Y1L B;  1RHQ B;  4DCO B;  2CJY B;  1PAU B;  2C2O B;  1SC4 B;  3SIP B;  1BMQ B;  2QLB B;  3NS7 B;  4ZVU B;  2QL9 B;  1GFW B;  4ZVR B;  4ZVS B;  3P4U B;  2C1E B;  1RHR B;  2CNN B;  4JB8 B;  1RHJ B;  2HBY B;  1SC3 B;  2XZT B;  2XYP B;  3KJF B;  1QDU B;  4ZVT B;  2QLJ B;  3GJS B;  3R7N B;  2XYH B;  3D6H B;  2XZD B;  1RWX B;  5IC6 B;  2HBR B;  2P2C B;  3R7B B;  2HBQ B;  2C2Z B;  3IBC B;  1F9E B;  2H5J B;  1ICE B;  1RHM B;  2H4W B;  4LSZ B;  1I3O B;  2Y0B B;  2H5I B;  2DKO B;  2QL5 B;  1RWP B;  3D6F B;  2HBZ B;  2H4Y B;  2H54 B;  4ZVO B;  3R6G B;  4ZVQ B;  1I51 B;  1RWM B;  3GJT B;  1RHU B;  2QLF B;  3EDR B;  2C2K B;  5IC4 B;  1NME B;  1RHK B;  2FQQ B;  1RWK B;  1QTN B;  1RWW B;  2H48 B;  2H51 B;  3GJR B;  1IBC B;  2CNL B; 
#chains in the Genus database with same CATH topology
 1FKP B;  2RUG A;  3T3F A;  3SDE A;  4K5R A;  3AJD A;  3FCH A;  2CQ1 A;  4B3O B;  4H4O B;  4F2S A;  2GAH C;  3HHK A;  1HPZ B;  2B9E A;  4Z37 A;  3UCZ P;  2M52 A;  2W4D A;  4C8Y A;  1F60 B;  2YNH B;  2ASY A;  1PIE A;  4NX9 A;  1Y3J A;  1JLQ B;  4FP9 A;  5JMN A;  1WOR A;  1BMQ B;  2DTJ A;  2LDI A;  3E01 A;  4JI4 F;  5L8R C;  3HK2 A;  1RYS A;  2KT2 A;  2ASJ A;  2W8L A;  1HBU B;  1XN9 A;  4JI1 F;  3HKW A;  1YG0 A;  2RH3 A;  3OQ2 A;  4FYY B;  2E9T A;  2HBQ B;  5DG9 A;  4C48 A;  3J81 Y;  4NA1 A;  2W24 A;  3SZ2 A;  1ARO P;  4ERD A;  2C2N A;  5ETR A;  4PXE A;  4C8N A;  2GNK A;  2AQ4 A;  4ED1 A;  4R0E A;  3UVJ A;  3IR7 B;  4P2M A;  2BE7 D;  3B82 A;  3CMA S;  2E9R X;  1R8C A;  2BDP A;  3ETM A;  4B17 A;  2OD6 A;  4ZPV R;  3IGV A;  1KN6 A;  2RNE A;  3RGI A;  2IHR 1;  3QAE A;  2XMA A;  1U4B A;  3HFV A;  2KH9 A;  3I55 S;  5DQG A;  4QWE A;  2OEL A;  2XWX A;  3SBM A;  2ZOM A;  2VDH A;  2FZG B;  4PR6 A;  4M5H A;  4ZN3 A;  1QSY A;  1RT3 B;  1FVQ A;  3KHL A;  2VZ9 A;  3KLE B;  2F8H A;  2U2F A;  3TUI C;  3AJ1 A;  2QT7 A;  1G4C A;  2B8P A;  1QAX A;  4HHU A;  3IP0 A;  4F4Y A;  4Y2K A;  1OIA A;  2HWI A;  2FJW A;  4OX9 F;  2WSE C;  3CCS S;  4OZ1 A;  1P1T A;  3DRP A;  4ZCL A;  4USU A;  4DU8 A;  5IZH A;  1VQS A;  4KGX B;  1TUW A;  1FE4 A;  1LWE A;  5B0E A;  2WB1 D;  2JVO A;  2EKN A;  4NML A;  2NSC A;  4H4M B;  4HR2 A;  3TX8 A;  5BR8 J;  4UOH A;  4B9M A;  5ETO A;  2HFO A;  3O6Q A;  3MMB A;  1WDT A;  2FUG 9;  3ZTO A;  4LFA J;  3K57 A;  4J91 A;  4EZ9 A;  2B5J A;  4MAK A;  1RCX B;  2B4P A;  2O5D A;  5ETS A;  1KLM B;  2YWK A;  1JJH A;  1LXN A;  3R5C A;  4EWT A;  4PXD A;  2DGV A;  4TU7 A;  3C16 A;  2HHQ A;  1RT7 B;  1QAY A;  1CJV A;  2C1E B;  2WOM B;  3J7Z T;  5D77 A;  2J9D E;  1RWX B;  2DGQ A;  2XO7 A;  3QSI A;  4KPC A;  4O23 A;  2Q3P A;  1UW4 A;  5EGY A;  2BAB A;  1P1L A;  4O44 B;  4ZLJ A;  3L7U A;  4WCE Q;  3D2W A;  3DYA B;  3HHL B;  2QIF A;  1WEL A;  2HQF A;  2R9L A;  4WYW A;  1WI6 A;  3C3L A;  3QZ8 A;  1V5V A;  4JI4 J;  5DGA A;  4S0M A;  5K9F A;  2CUY A;  3GQC A;  4JI1 J;  1CJK A;  2B8Q A;  1RIS A;  1T7P A;  1D09 B;  4XIU A;  3VAJ A;  4EGL A;  4F02 A;  1L3T A;  4DV0 F;  2UP1 A;  2VG5 A;  4WTY A;  3ZXW A;  4DV2 F;  2JNJ A;  5I3Q A;  3PYG A;  5LSL A;  1RAI B;  5AXK A;  1IUJ A;  1FHT A;  3G6V A;  1KEK A;  2ZHA A;  2Y1R I;  2FZC B;  3H90 A;  4CI0 B;  2CYY A;  1NLK L;  3H4D A;  4ZCK A;  3THP A;  1S6Q B;  3GYX B;  4ECX A;  3LAM A;  4BDP A;  3IBC B;  4CIO A;  4J9R A;  5E0O A;  1ZM2 A;  4QBU A;  2MEW A;  4O3P A;  3M30 A;  4USV A;  4OYB A;  2QLW A;  3KXD A;  3HM9 A;  4O4G B;  3IRX B;  1A0O B;  1HWU A;  1L3U A;  1VIO A;  4HKQ A;  2IYG A;  4JOU A;  2VH7 A;  3AA8 A;  4NLQ A;  2RU9 A;  5DZ6 A;  1RP5 A;  3D66 A;  4CLL A;  1J5O A;  3FQL A;  4HI1 A;  1VCT A;  2R8H A;  3G9C A;  4P9S A;  2BR0 A;  2UU9 F;  1X9S A;  4M5I A;  4J9M A;  3NS5 A;  5J2N B;  3L3C A;  4OX9 J;  3SQG B;  2JZ5 A;  1YJ7 A;  5HMX A;  3ICL A;  5AXL A;  3OLA A;  1U02 A;  4C0H A;  4PUO A;  2KRR A;  4JP8 A;  3CCM S;  5DG7 A;  1R89 A;  1KWM A;  1C1C A;  3P3D A;  4IRK A;  2MGZ A;  4NZ6 A;  5H1S V;  2UV8 G;  2BM0 A;  3MAQ A;  5DS7 A;  3G96 A;  3CNQ P;  2AU0 A;  6AT1 B;  5B0D A;  4V1A k;  3ONQ A;  3M2R A;  3QPI A;  2XCP A;  1NHV A;  4FF4 A;  4ZLP A;  1KR4 A;  2EFV A;  1ZTT A;  3QIP B;  3E2E A;  3CME S;  4I6Y A;  5KFQ A;  1U24 A;  4EO8 A;  4U9R A;  3QLH B;  3LPE A;  2C2K B;  4ZN1 A;  4KR0 B;  2FQQ B;  3M8Q A;  5KFA A;  4B9T A;  1PGZ A;  1IJF B;  2HKE A;  2KT3 A;  3NAI A;  2AJQ A;  1SB6 A;  3H2V E;  3RB0 A;  3C19 A;  1QUP A;  1PO6 A;  2KG0 A;  4P2F A;  4F4K A;  3DCA A;  3PYE A;  5AE1 A;  4X4Q A;  2YKA A;  1BGX T;  1NK5 A;  4DBQ A;  3QSY B;  3TAM B;  5D0R A;  4NMX A;  3H20 A;  3HD1 A;  5E3C A;  1LXJ A;  2D9O A;  5HAO A;  5DZ7 A;  3VGV A;  1C2P A;  2XS5 A;  4ED6 A;  2ZH9 A;  1LWC B;  2CIM A;  1JLE B;  1ELO A;  5SUH A;  3KDN A;  2AJ2 A;  2H5J B;  2KXH A;  1RHM B;  5GAD U;  2IMO A;  2IA0 A;  3FDS A;  4H4K C;  5DLG A;  4DV0 J;  4JBC A;  3G2X A;  2ASL A;  2CXE A;  1RDR A;  5FLX U;  2L9D A;  4QWA A;  1F5A A;  4NRU A;  1RAO A;  3GYN A;  2ZUA A;  1F2H A;  1FK9 B;  2C3U A;  2HNZ B;  2L9N A;  5A76 A;  1NK6 A;  3HHE A;  4PQU A;  3UD3 P;  2HHT A;  2IVF B;  1BXN A;  4DCJ B;  2B7B B;  3DI6 A;  2KN4 A;  3KTQ A;  2NQP A;  2JEF A;  3H5X A;  1RUS A;  1SI9 A;  2DIT A;  1Q7L B;  4G1Q B;  3T1Y F;  3VAL A;  3BGR B;  3KDO A;  4X65 F;  4DV5 F;  3OUY A;  2F4V F;  1LW2 B;  2BVZ A;  1SH3 A;  2UVR A;  4J90 A;  2GZO A;  3RUB L;  1K1S A;  4L72 B;  2XHC A;  3DOM A;  2VON A;  3KLI A;  2NPI A;  2UU9 J;  3BSC A;  2XYP B;  3DU6 A;  3GPA A;  1ZM4 A;  1HD0 A;  2LQ8 A;  1FD8 A;  1JIH A;  3PJW A;  4DPX A;  1F9E B;  4QW8 A;  4CM2 A;  2AJ0 A;  4KJI A;  1TKD A;  3JQJ A;  4W98 A;  4AL5 A;  3V4M A;  2GGP B;  5HO4 A;  2QEX S;  4NLD A;  2YPY A;  2DGX A;  2PE8 A;  1HPZ A;  3R2D J;  2ASD A;  2RIJ A;  2YNH A;  1WF1 A;  2HZA A;  3UDV A;  1JLQ A;  2MY7 A;  3OVS A;  1Q81 T;  1NDK A;  4Q45 A;  4F50 A;  3DN9 A;  2YKP A;  2BE9 B;  4TY9 A;  1T0T V;  1HBU A;  4ILL A;  2PN6 A;  1Y11 A;  5KOX A;  2CZ4 A;  4RNN A;  3GP9 A;  2JC0 A;  3HPO A;  5FJ4 A;  1PJ5 A;  2AYB A;  9ATC B;  3P49 B;  2VA2 A;  2YQ0 A;  2FVQ A;  4OZ3 A;  2D9P A;  3HHD A;  2EC2 A;  4OZJ A;  2OEM A;  3KLF A;  2ACM A;  3QID A;  2PEH A;  1IM6 A;  3MED B;  4R8U B;  2HAI A;  4ATN A;  3UNG C;  4WFX A;  2FC9 A;  4A46 A;  4A8Y A;  2HWT A;  2D3O R;  2HHP A;  2DO4 A;  1QVG R;  3JAM U;  5M2U A;  4N41 A;  1C0U A;  4LF8 J;  4Q8F A;  3PCO B;  5IV3 A;  1IQT A;  2DNZ A;  4X66 J;  1R8B A;  2WTF A;  3CJ8 A;  3KUH A;  2AYE A;  1VBZ A;  2JEJ A;  5AE3 A;  1ZAX A;  3I5B A;  3IN5 A;  1RWN B;  2VHG A;  3KLE A;  1YJN S;  1TMJ A;  4JV0 A;  3WX8 A;  2V4R A;  3MUV P;  1HA1 A;  1U7L A;  1M5O C;  1KVI A;  3CJK A;  3QJP A;  2DEI A;  3NP5 A;  3NOC A;  3OSN A;  1WI8 A;  3LGN A;  3VCD A;  2X1A A;  1TK0 A;  3Q2S C;  1NHK L;  2NXU A;  4NCB A;  4OI4 A;  2MTL A;  2ZOF A;  2VDI A;  2CPD A;  3PO5 A;  2VIH A;  4C8K A;  1FER A;  3JSY A;  4USJ C;  3HZG A;  3GMG A;  5L9N A;  2ZH4 A;  2HFN A;  1JXL A;  2BJD A;  1UZD A;  1HWK A;  1CSJ A;  4QOT A;  3BPS P;  3IS9 B;  3OFH A;  3KHH A;  1HWI A;  2ROG A;  4D3G A;  4A8K A;  1TKT A;  3T1Y J;  5K8O A;  5A8R B;  3D3B J;  4X65 J;  4DV5 J;  1PJ7 A;  1SV5 B;  4EO6 A;  2AP6 A;  2F4V J;  3BGL A;  3HVW A;  4WZQ A;  1VLO A;  4M5L A;  1I51 B;  2D1C A;  2PEB A;  3AT1 B;  3CJ0 A;  1WSV A;  3C66 A;  1WC0 A;  4GC6 A;  3M6V A;  3PYD A;  3SEO A;  2CNL B;  5BXI A;  4TN2 A;  3JSB A;  4X84 A;  2DGO A;  1F3V A;  3PFO A;  1FTC A;  3V81 B;  3AOC A;  1RT7 A;  1U6B A;  2RQ4 A;  2DEJ A;  3KMQ A;  5GAG U;  3KK3 B;  5BYQ A;  3OV7 A;  1TR0 A;  4ZHR B;  5KFS A;  3UD4 P;  2ADB A;  3PTW A;  1NJX A;  3PIO Q;  2YWE A;  1S97 A;  5F9L A;  1N5S A;  2M3D A;  3DLL Q;  1OSD A;  4DR1 F;  3PM9 A;  3JSM B;  4DU7 A;  5DDO C;  4OZ0 A;  3CJ5 A;  2RKI B;  1S76 D;  3HHL A;  2W9C A;  3J7A N;  1DBD A;  4P75 A;  2W7A A;  1CJT A;  5L46 A;  2RT3 A;  4IO1 A;  1XR7 A;  3CCW A;  3LAK A;  1ZAV A;  4UZC A;  1TKX A;  2OPP A;  8RUC A;  1AFJ A;  2MLY A;  4MK9 A;  2XI3 A;  2HMI B;  1OY9 A;  1X5S A;  2FPH X;  2LEB A;  1RI7 A;  1CG2 A;  2DR8 A;  4PAA A;  4ALZ A;  4LUB A;  2V2V A;  3CO0 P;  4B3R F;  3H42 A;  1JNR B;  1RHK B;  4OX7 A;  4QIF A;  1FA0 A;  2K7K A;  1IKW B;  4CLS A;  2BRL A;  1RAG B;  3ITH B;  1HBM B;  1UCN A;  3FK4 A;  4U95 A;  3LP1 A;  2VFT A;  2PGC A;  4O3O A;  1ZBT A;  3AOA A;  3BH7 B;  1S6Q A;  3HD2 A;  1X5O A;  1TV6 B;  4XDC A;  3AB4 B;  3FC9 A;  1G2E A;  3Q24 A;  3KNA A;  3DLG A;  3H59 A;  1Z4U A;  3HSZ A;  2YKN B;  3TA1 A;  1E6V B;  2B9X A;  3OVB A;  3NGR A;  2IM3 A;  3MPD A;  4DR3 F;  1KQK A;  5HMY A;  3QT5 A;  4ANC A;  3B4D A;  3U02 A;  3VAG A;  4KV8 B;  1KTV A;  4JV2 A;  5J2N A;  2IM2 A;  3KK2 A;  3R6G B;  3CC2 S;  5CD4 A;  3F73 A;  3OVA A;  4NI2 B;  5HVG A;  4C2M A;  2CG8 A;  5EDW A;  3EGZ A;  1MML A;  3WIV A;  2RHS B;  4PYA A;  1UEK A;  1JLA B;  2NXE A;  3OTB A;  3LGH A;  4XK8 C;  3GG1 A;  4WZM A;  2YX4 A;  2VPY B;  3DU5 A;  1MNE A;  1S1W A;  3BQ1 A;  1EHW A;  2J8S A;  3DGP B;  4KE5 A;  1FJE B;  4LBI A;  4KBI A;  1ZPW X;  3JB9 k;  3MTK A;  4Y34 A;  2M8D B;  2KYX A;  4MK7 A;  2IM1 A;  1SBR A;  1YX2 A;  4FNI A;  3R9L A;  4I68 A;  4F26 A;  1TL4 A;  1WEX A;  2L9W A;  5IV4 A;  5I42 B;  3DLE B;  1TP7 A;  2E5J A;  2V2K A;  4DPW A;  5MAO A;  2WSF C;  2XZD B;  2MZR A;  3NGU A;  1B0V A;  2ZNY A;  5GAH U;  2IAJ A;  3OTC A;  2ZH6 A;  1IBM F;  3I0R B;  3DLJ A;  2ZC3 A;  5CH7 B;  3TJ9 A;  1S0N A;  2RDI A;  1H38 A;  3FQK A;  4YME A;  2C2R A;  3TAM A;  4DR1 J;  4NOH A;  1VS3 A;  4RW8 B;  4DUT A;  3V6J A;  1TK8 A;  3HT0 A;  5KT5 A;  1RA6 A;  2ZH2 A;  2D3Z A;  1S1V B;  4A48 A;  2UUA F;  4P7T A;  2B9Y A;  2BKO A;  2OEJ A;  3F56 A;  1SQE A;  1JB0 C;  1RSC A;  2ADC A;  2P6T A;  1LWC A;  3W66 A;  1JLE A;  4X62 F;  3IWX A;  2L3M A;  1RAE B;  2JEG A;  1XER A;  2MHE A;  5BYR A;  2VF3 A;  4YB7 A;  2XGQ A;  2EKY A;  1KNZ A;  5M2R A;  4X4R A;  4KHP F;  1XC9 A;  3SSQ A;  4B3R J;  1W2B R;  5HMZ A;  4DZ6 A;  5KFN A;  2HSE B;  1X5P A;  2GIR A;  3JQM A;  4ED8 A;  5ETP A;  2IFX A;  5KFC A;  5BYS A;  2W9B A;  1IXK A;  1OY6 A;  3QJJ A;  2K1R A;  4F0K A;  4P71 A;  1FK9 A;  3M8P B;  2ZOG A;  4J9L A;  2AEJ A;  4ES1 A;  3HSG A;  2KU7 A;  3TVK A;  1EP4 B;  5B0C A;  4ZLN A;  1GTE A;  1HHS A;  3Q8S B;  1QUV A;  2ZUG A;  2R2S A;  1ITP A;  2R2R A;  1XWL A;  5KG7 A;  4NCA A;  2XB2 D;  4B3S F;  1KQS R;  2BQU A;  2FYX A;  4K5S A;  3BDP A;  2AGO A;  4DR3 J;  1Q4R A;  3JYT A;  2HLU A;  4G1P A;  2HNY B;  1HHQ A;  1S1T B;  4DL5 A;  4CLF A;  4LF4 F;  1WF0 A;  2HZC A;  4DLE A;  2XWY A;  4X4V A;  3D1O A;  2QFJ A;  3W8P A;  1XR6 A;  1FXR A;  3SCI E;  2CQ3 A;  2MKI A;  2MKJ A;  4C97 A;  1SJ1 A;  4HH1 A;  4M63 A;  4ZDN A;  3DFE A;  3MCM A;  2GGP A;  5D0G A;  2RHQ B;  3J80 U;  3RB6 A;  1T11 A;  2CJ9 A;  3MUT P;  1N0V C;  4CO0 A;  2KZM A;  1BQX A;  2WW4 A;  3DLK B;  2H4W B;  2DR7 A;  5L1L A;  3U7J A;  4WFA Q;  3OL9 A;  2V94 A;  3KG0 A;  1YJU A;  3S7R A;  2HUR A;  4TLQ A;  4ICL B;  1OO0 B;  1Q53 A;  2MB0 B;  3CJ4 A;  1U45 A;  1NME B;  3TAR A;  1WG4 A;  3K8W A;  1U0H A;  2VOP A;  2Y8Y A;  4A8F A;  3OXF A;  2VQE F;  4FVC A;  3TUJ C;  1UVJ A;  1FX4 A;  2XMV A;  1AZS A;  5LL6 d;  3TW0 A;  2Y8W A;  4HDG A;  1IQZ A;  3GIL A;  1OY8 A;  1RTI A;  2B51 A;  1ZM9 A;  2NXC A;  1WD6 A;  5C5J A;  3P45 B;  4F4A A;  1Z2L A;  1YK9 A;  1N33 F;  4PWU A;  4MJK A;  4M5J A;  4R8U A;  4URQ U;  3HDS A;  2LQ5 A;  3GJQ B;  1OQ6 A;  5T7L B;  2VFS A;  3R2C J;  3SIP B;  3U1L A;  3ISN C;  2YNG B;  5T14 A;  4QR0 A;  1RAH B;  4DS4 A;  2HHV A;  4WPA A;  4QCL A;  4I56 A;  4V19 J;  1CC7 A;  3PVX A;  2DNM A;  2OPR A;  3PX4 A;  3W1Y C;  5GAE U;  3BO2 A;  5EHH A;  5ETL A;  4O0I A;  2YX7 A;  1KHW A;  2UUA J;  4WTO B;  2VFU A;  4KKO B;  4MK8 A;  3Q8V A;  2F40 A;  4YR0 A;  2PC6 A;  3I0S B;  3L4B C;  1OYD A;  3K2Y A;  3MFH A;  1E6Y B;  3UDE A;  1UPP A;  3QAU A;  3GJT B;  3CUN A;  5B0G A;  4KHP J;  2HRU A;  1X31 C;  1S72 S;  3UFC X;  3ZZT A;  4RUB A;  4AFF A;  3RAQ A;  3PEJ A;  3G82 A;  1DLO B;  1N6Q B;  2JSX A;  2YKO A;  3A3O B;  3D0I E;  2E7V A;  4AUK A;  1U26 A;  3KYL A;  3IS9 A;  3VVU A;  1S6P B;  2QLB B;  1O5J A;  4EUV A;  4MKA A;  5ADZ A;  5HMW A;  3MM5 B;  4B3S J;  2R7T A;  1UPM B;  4MKB A;  1VRQ C;  5FII A;  2W01 A;  3A12 A;  3RRH A;  3HFZ B;  4ID8 A;  4Y28 C;  3MEG B;  2XSJ B;  3WDO A;  2RDJ A;  1N8R T;  2Z4P A;  2HGN A;  1NU4 A;  3M05 A;  2AIR B;  1GXU A;  1H73 A;  4FS2 A;  3CMQ A;  4LF4 J;  3BBC A;  3TEG A;  1YIJ S;  3KK3 A;  2VBZ A;  1CLF A;  5DGB A;  3MOZ A;  2B9W A;  1VQY A;  2VC1 A;  4PZV A;  2BAN A;  4ECS A;  3HKZ D;  3M8Y A;  3T1H F;  1FJC A;  3Q8Y A;  5F8G A;  1VYA A;  3L7P A;  4QIE A;  1RWO B;  2PI4 A;  2HND A;  3MD1 A;  1RAB B;  3CTR A;  3PKM A;  4RL1 A;  5LM7 E;  3V6K A;  3G6Y A;  3DGV A;  5J1P A;  4X64 J;  3D3C J;  2FJD B;  2P6S A;  2QYC A;  4NLO A;  2BJE A;  5F8L A;  4GKJ F;  4TLR A;  4KB7 A;  2QLX A;  1NB7 A;  4IR1 A;  2CPE A;  1MLA A;  5HAT A;  2A3J A;  3VGS A;  2HQD A;  2YNF B;  2B43 A;  2ZJQ Q;  3BQ2 A;  3AQP A;  3UNY A;  4IFY A;  5KFW A;  1RBL A;  4RW9 B;  4EEY A;  4TNO A;  4NZ7 A;  1U1Q A;  2GO9 A;  1NXI A;  3MR7 A;  4OJ3 A;  1SJ3 P;  1VHI A;  2DGW A;  1VRT B;  3MCO A;  4PG5 A;  1UVL A;  2VUG A;  4OI3 A;  1FFS B;  4U6P A;  5F3Z A;  3MPU B;  2OD4 A;  4N5S A;  4HEA 9;  5B09 A;  4DR4 F;  3KFW X;  3FZ2 A;  4M5M A;  1U0S A;  3PIP Q;  4U7U D;  1WHW A;  4Q44 A;  1E6V A;  1NSA A;  1WOP A;  3FFI A;  1AXQ A;  2X1B A;  5JXS A;  3EDQ B;  3R97 A;  1OJ4 A;  4U8V A;  2E5G A;  2DY1 A;  1H72 C;  3CIZ A;  2IJR A;  1ZS6 A;  2Z58 B;  1SH0 A;  1Y5I B;  3P4U B;  1FF2 A;  1DRZ A;  2HPU A;  2EC0 A;  4BLG A;  3EVW A;  1PSD A;  4CCH A;  1HQE B;  1CUL A;  3CCE S;  1NK0 A;  3HVT A;  4NI2 A;  3FSI A;  2OO4 A;  3DRY A;  3W2V A;  2J7W A;  2VFV A;  3QJL A;  1NK4 A;  1LEO A;  3HUL A;  4DL3 A;  2AWZ A;  2M5Y A;  1S9E B;  4HVZ A;  4ER8 A;  1UEV A;  2JC1 A;  2YKM A;  3RG6 A;  1JLA A;  1IKX A;  2Q1L A;  2VB6 A;  3EXC X;  2FGC A;  4I2Q B;  3HVR A;  2DBB A;  4V19 X;  4OV6 A;  2UVV A;  1UVN A;  1KKH A;  3TZX A;  1UFW A;  1J27 A;  2XYG B;  2C2M B;  4NLG A;  2X51 A;  1RT6 B;  4ZCM A;  2LA4 A;  2N7C A;  4IQX A;  4DSE A;  2V63 A;  5I42 A;  1N4L A;  3MM9 A;  3CCU S;  1M1H A;  3P5T L;  9RUB A;  2I2Y A;  1IN0 A;  2RU3 A;  2OKQ A;  1B7F A;  4RZR A;  2N3L A;  4UF4 A;  1NBE B;  3R5A A;  3IC1 A;  3OFG A;  2C2O B;  4LSL B;  3H0P A;  3EPI A;  2NRE A;  4I2P A;  3ENQ A;  2NYI A;  3IMQ J;  3CXC R;  1PBU A;  3PX0 A;  5J1E A;  4IO9 Q;  5A8K A;  3J81 j;  1ROF A;  3FCW A;  3K58 A;  4LT6 A;  3T1H J;  1S49 A;  2CPX A;  1N5Y B;  4KT0 C;  4Q8E A;  2C3M A;  4RW8 A;  3L9Z A;  4DFM A;  4TY8 A;  3D7S B;  2H54 B;  2LQJ A;  4ZVO B;  4OHZ A;  2OIH A;  2CPF A;  1C1B B;  1Y0H A;  2V0N A;  4O0N A;  2M2B A;  3U1N A;  2FHO B;  4F2R A;  4ECW A;  5SZT A;  4GKJ J;  4LRF A;  2WVD A;  3OFE A;  1FRI A;  2Y1J A;  1F6T A;  3Q89 A;  2GJF A;  4OYP A;  4LF1 A;  2HS0 A;  3QWP A;  1U1R A;  3KJN B;  2HVD A;  3DOK A;  2ZHB A;  5HVF A;  4FS1 A;  3V4I B;  2JFK A;  5KAK A;  1HR0 F;  1T05 A;  1YZ7 A;  2ZJP Q;  4B9U A;  4LR7 A;  3F41 A;  2IDE A;  4NAS A;  2LXU A;  1KRP A;  1NK9 A;  2E1C A;  5A6P A;  3G86 A;  1WOS A;  2BXJ A;  3HP6 A;  3UCU P;  3BO4 A;  3MD3 A;  4ZCI A;  2C2E A;  3BR9 A;  1IR2 A;  3BKF A;  2I6W A;  1FDD A;  3W61 A;  4P74 A;  4DR4 J;  1FNX H;  2YX1 A;  2GMH A;  4UQT A;  1EZZ B;  4NXN F;  2OJ3 A;  4ED4 A;  1RAA B;  2BOP A;  2DRD A;  4JYA F;  2F8M A;  2X1G A;  1WC4 A;  4GVB A;  3VGT A;  1FRJ A;  4DN0 A;  3WC0 A;  1B7Y B;  5IT9 Y;  3U27 A;  4GKK F;  3RZA A;  2CWX A;  2ABY A;  2JLG A;  2D3O 1;  2EI5 A;  1VQK S;  4RKU C;  2HNY A;  4TKT A;  4USI A;  1S1T A;  5AXN A;  3WC2 A;  2YH1 A;  2WVF A;  1SQG A;  2RVJ A;  5HJX A;  4DHV A;  1RZM A;  1KBR A;  2IY5 B;  5KTQ A;  1CJU A;  2JOQ A;  3MTJ A;  4KY3 A;  1DTQ A;  5IM0 B;  3K59 A;  1RGV A;  1SUQ B;  2P5V A;  4OZ2 A;  5KT3 A;  5IT0 A;  1HWL A;  5KT7 A;  1UEU A;  2VPW B;  3LP2 B;  2Y0S D;  2HHH F;  3B8H A;  4FF1 A;  4IFV B;  2MZQ A;  1ZOT A;  3CD7 A;  4P52 A;  2BZ2 A;  4EI2 A;  3CCR S;  4LR8 A;  1CS4 B;  1R8A A;  1C0T A;  1H2T Z;  1HI8 A;  2ATC B;  1NSK L;  2F7V A;  1RJJ A;  2JLE A;  2M70 A;  5B0A A;  3AFG A;  4C8O A;  1RAJ A;  2MZS A;  3KLG B;  5KFT A;  1HI1 A;  2DNG A;  3JTP A;  3MZI A;  2XC9 A;  2G2Y A;  1FES A;  2BA9 A;  5F3T A;  3PX6 A;  1H2U X;  2JHE A;  1RA7 A;  3UWT A;  1NSQ A;  2AEM A;  5J2M A;  2FB0 A;  3DNC A;  5C2C A;  2OPQ B;  3IBF B;  5ETQ A;  2DXD A;  3W9J A;  3ZNU A;  1RTD A;  1V3Z A;  2AT1 B;  4DCP B;  1P8G A;  3PEH A;  4Q7A A;  4PRF A;  5F0W A;  3OR1 B;  3DM2 A;  1FKO A;  2FVP A;  4KKO A;  4ECT A;  1JQG A;  2FTR A;  1P27 B;  4LQ3 A;  3FZB A;  3I0S A;  1HNV B;  2HBY B;  1M5S A;  2HGM A;  1SL0 A;  2KFN A;  1E6Y A;  1HAR A;  3SQO P;  1FO1 A;  3AJ2 A;  3CCJ S;  1UW9 A;  2W2Q P;  4EU0 A;  2G2O A;  1JLB A;  2HBR B;  1VQ9 S;  3R3T A;  3DRR B;  2KB2 A;  2QSF A;  1ZPV A;  2YNI B;  2N7Y A;  3GV8 B;  1U25 A;  1HR0 J;  1R6Y A;  1O0P A;  1MU2 B;  4DV7 F;  1JJ2 R;  4LMZ A;  1PIL A;  1DLO A;  5B08 A;  1GMV A;  1JLC A;  1TVR A;  3T5K A;  3MMA B;  5D0E A;  2DR9 A;  1RKI A;  4CO2 A;  4NLT A;  4F04 B;  3QFH A;  5DDQ C;  4NXN J;  2EFN A;  5GAE I;  1R7I A;  4JYA J;  5CQG A;  3TUP A;  2J8A A;  5KFB A;  4OI6 A;  3T19 A;  4ZP7 A;  3THT A;  1PYO B;  4OYI A;  3C6U B;  2IPO B;  2AMC B;  5KFE A;  4GKK J;  3OXL A;  4DX7 A;  4CWB A;  4LRE A;  4RW7 B;  1AA1 B;  2ZD1 B;  1RT1 A;  4XAK A;  4Y0F A;  3OJS A;  1YTY A;  2Z30 B;  4NCG A;  2JRS A;  5EX0 A;  3PAC A;  4NE9 C;  3P8B B;  5E2Q A;  1SQF A;  2P2C B;  4C0O C;  5HBM B;  3KJV B;  5D8H B;  4D3H A;  4K4V A;  1XEZ A;  2AV5 A;  3V6D B;  1WKK A;  4OMF G;  5EWE A;  4UY8 T;  2IC3 B;  1SKW A;  4A47 A;  4KFB A;  3GIR A;  3M2U B;  2KXF A;  2UV8 A;  2HHX A;  2JL9 A;  3NEK A;  1WKJ A;  1WTB A;  2HHH J;  2ZH5 A;  3M6W A;  5KFL A;  2H48 B;  3MI7 X;  2XY7 A;  2PMW A;  4ZPC A;  4RPF A;  1D9D A;  1RWV B;  5FD1 A;  2ZNZ A;  3PW5 A;  2YTC A;  3AD8 C;  1DJ0 A;  2A0F B;  2EK1 A;  3CDA A;  1N52 B;  3BN7 A;  2NZC A;  3FNN A;  1GAO A;  5D0H A;  4ZVU B;  2FVS A;  2YQ1 A;  3CDE A;  1M5H A;  2VG7 A;  3N01 A;  4CLP A;  5LMU F;  3W5Y A;  3CF5 Q;  1REG X;  4N76 A;  2VPX B;  2WON B;  1UVK A;  2XZT B;  3Q83 A;  5KFK A;  1ZM3 A;  4C9D A;  4ZPW R;  3T5H A;  3BN4 A;  3LF0 A;  1VQ4 S;  1U09 A;  2KDO A;  2V8D A;  4RNH A;  2D3U A;  1RXO B;  1RT2 B;  1MWY A;  2XBP A;  3GII A;  2K3K A;  2OHD A;  5C42 A;  4ECR A;  3BV8 A;  4N56 A;  4R25 A;  5A6W A;  2ALY B;  4OLO A;  2J76 E;  2POK A;  3ENA A;  2C22 A;  5F8M A;  2BQ3 A;  4WF9 Q;  3RR7 A;  1CPZ A;  4ZLL A;  1S4F A;  4OYZ A;  1GEH A;  1JLF B;  3TQE A;  4RUC A;  5D3G B;  4ID5 B;  2YWW A;  1XBW A;  2NS1 B;  2LVW A;  2KG1 A;  2BKP A;  2DHX A;  1HQE A;  4HYK A;  1VDH A;  7FDR A;  4MTP A;  4YS2 A;  2GW8 A;  3EGN A;  1BUX A;  4C7Q A;  2A2C A;  2XZW A;  3US5 A;  4DV7 J;  1SJ4 P;  1KVK A;  1S9E A;  3R5B A;  1BWE A;  1EQ0 A;  3A8J A;  4FF3 A;  5I3P A;  4AXI A;  1QD1 A;  3I9Z A;  4I2Q A;  4I7F B;  3CJT A;  4PEO A;  3QQC D;  4YOE A;  1MSW D;  3PNI A;  2IBO A;  5KFJ A;  4DG1 B;  3DLB A;  2P9C A;  1T3N A;  4JI2 F;  2DKO B;  1S10 A;  2VG6 A;  4JV1 A;  4CLZ A;  2GVD A;  1YBA A;  3KK1 A;  4ZVQ B;  1UJ6 A;  2LKZ A;  4ED7 A;  3HJV A;  1RWK B;  1UFL A;  3M7V A;  4C8M A;  5CCM A;  1RAF B;  3HFK A;  4LSL A;  1VQN S;  3VAF A;  1KHV A;  1XIQ A;  4K4S A;  3CJS A;  5ETM A;  2HQI A;  3TVY A;  4KTQ A;  2YBV A;  1RCO B;  2MJU A;  1YRX A;  1L3V A;  3GSI A;  2XNQ A;  3SCJ E;  5G0R A;  3W64 A;  2ZEJ A;  1N5Y A;  2R7U A;  1KSP A;  2CKW A;  2OFH X;  1IR1 A;  4CYU B;  3WIU A;  3HHL D;  2QA1 A;  4GMK A;  3OLB A;  5KG6 A;  3P96 A;  3OSP A;  3TR5 A;  1TZ0 A;  2V4J B;  2RAQ A;  1C1B A;  2O3D A;  4PPZ A;  1YDL A;  2AGQ A;  2R7R A;  3TO8 A;  2F8E X;  4IH5 A;  2QMX A;  3B4M A;  2CPI A;  1U1P A;  3IXQ A;  2HK2 A;  3PZP A;  4ZJL A;  3Q8R B;  3Q23 A;  3VR1 A;  1U49 A;  4NLY A;  3BH6 B;  3IWL A;  1UMJ A;  2DNP A;  3PHT A;  2CQI A;  3CJ2 A;  2XMJ A;  3IO1 A;  4DQQ A;  3MUM P;  2V8H A;  4NA3 A;  5LMU J;  3V4I A;  3ET6 A;  2PO4 A;  2VQF F;  4JI6 F;  3B78 A;  5J2P B;  4ZK7 M;  2PSZ A;  5ETV A;  1X60 A;  4K4W A;  3QNW B;  5I3U B;  4ILM A;  4CNY A;  2AZ3 A;  2F3J A;  1JJC B;  1WOO A;  4LVO P;  5H9E J;  1GNK A;  2CQ0 A;  2CNO B;  3FBE A;  2XLI A;  2CFX A;  1S9G B;  3GCX P;  4QYR A;  4I1T A;  5A0Y B;  4Z7C A;  2UXB F;  2DIS A;  1TQL A;  3TP2 A;  1VJQ A;  3GJS B;  4HL9 A;  5E5N A;  1WDD A;  5LOQ A;  2RIL A;  4MFB A;  2ALZ A;  2NUH A;  4EMD A;  2APO A;  1DQ9 A;  2A6O A;  3GFX A;  3N28 A;  1K0V A;  4Y2A A;  4EFA C;  1FRM A;  2PMZ D;  1RAC B;  1VQ6 S;  3PO4 A;  2ROP A;  1FVS A;  4RNM A;  2W2M P;  3MPV A;  1T02 A;  1WC5 A;  4DXL A;  5IM0 A;  4QPX A;  2KVQ E;  1R31 A;  3TOQ A;  1SUQ A;  3NMR A;  3DMJ B;  3EVM A;  1IBK F;  2COL A;  1IBC B;  3MM8 B;  3M6U A;  2CJK A;  5ETN A;  3VV2 B;  3FRZ A;  4G3I A;  4KC5 A;  5K8P A;  4RW4 B;  1UWB B;  1HBN B;  3POT B;  3W5Z A;  4OYX A;  1FFG B;  2QRR A;  5KFF A;  4CT8 A;  2HVE A;  4LR9 A;  4LF9 F;  2YWG A;  2J6U A;  1TKZ B;  2B4O A;  4JI2 J;  4DPY A;  4KAI A;  4USM A;  4KO0 B;  1AYE A;  4XTT A;  3TI0 A;  4W90 B;  1N36 F;  4HH0 A;  2FHK A;  1GH8 A;  3ZZR A;  2HWH A;  3OHB A;  2LEA A;  2UZA A;  3W60 A;  2C3Y A;  3MPW A;  3KLG A;  8AT1 B;  4ZP6 A;  1A9N B;  2HVH A;  3AOD A;  3J7Y U;  4EK2 A;  2HQ3 A;  3BEG B;  4X4S A;  3ZFV A;  3MUR P;  4OHY A;  1KQG B;  3DXB A;  3MEE A;  3VQT A;  2OUG A;  3PDN A;  3V6H A;  4QWC A;  2HFZ A;  5KG3 A;  3QRP A;  2XMT A;  2OFG X;  4BC9 A;  1SKU B;  3BPD A;  3G6X A;  4Q5V A;  2XLJ A;  3FBF A;  4ELU A;  4KPY A;  3Q8U A;  2H51 B;  3DDI A;  1FWP A;  2W4C A;  1YI2 S;  3OR1 A;  4NYP A;  2HFU A;  1VHF A;  4NRT A;  1UWA A;  2L08 A;  4DV3 F;  2RS2 A;  1FKA F;  2LMI A;  1O8B A;  1SVD A;  1Y9O A;  2ZBQ A;  3OTE A;  2Y1L B;  1IKY B;  1RHQ B;  3L09 A;  1H0H B;  4HHJ A;  4RX6 A;  3UN5 A;  1FRK A;  1L3K A;  1WC3 A;  4QR2 A;  4GO7 X;  4LRC A;  1XMO F;  4WU2 A;  2ROE A;  2RB7 A;  1SC3 B;  4L74 A;  2HS3 A;  1P9Q C;  4ILR A;  1BQM B;  2VQF J;  4JI6 J;  1YBU A;  1AB8 A;  1SC6 A;  2ZBR A;  3ULH A;  4WE1 B;  2KHC A;  2BJ9 A;  1SPB P;  2VBX A;  3JQK A;  5KFV A;  1IWG A;  2DT9 A;  3C15 B;  1UVI A;  4KHR A;  3DKD A;  3MPY A;  1WWH A;  1K0T A;  1R0A A;  3NCR A;  1UA1 A;  3MMC B;  2Q6C A;  4UW2 A;  1FWK A;  3GLJ A;  5C24 B;  3M2V B;  4LRD A;  3X1L B;  2UXB J;  3DOL B;  3HJF A;  4JI8 F;  1RT5 A;  1S7I A;  4IH6 A;  4CTA B;  4P2X A;  2AD9 A;  4YR2 A;  3N5B A;  2CJQ A;  4DQP A;  5GVQ A;  1XNQ F;  2V8V A;  4CNZ A;  1YGY A;  2ZJR Q;  1YJR A;  2J9D A;  3KJV A;  4OJG A;  4F3Q A;  3N0V A;  2QMW A;  4OJ1 A;  1R3N A;  1GMU A;  2C2D A;  4FVM A;  2ZBI A;  1CQM A;  4QR1 A;  4BWJ A;  3V6D A;  2OLW A;  1YJW S;  1EKS A;  2DNY A;  4RUH A;  4RBT A;  1MW7 A;  5H9E K;  1IBK J;  4PG7 A;  3T5L A;  2DYA A;  1LFP A;  1WG1 A;  3NCP A;  2J0X A;  4HT5 A;  3NKY A;  4CQ1 A;  2R7O A;  3KMS A;  4PCQ A;  5K14 B;  4LF9 J;  2XEX A;  3GIK A;  1Q16 B;  2GV1 A;  3MXH P;  2SXL A;  5FDL B;  1KS2 A;  4A8X A;  2HFV A;  4RR5 A;  3NGK A;  2R2T A;  2H3E B;  1GK8 A;  1N36 J;  1DQ8 A;  4NPO A;  3W9H A;  2BE2 B;  1S79 A;  1X4C A;  1JNZ B;  1Q8K A;  5KG0 A;  2CVI A;  4LIR A;  2HAF A;  2ZKU A;  3TZZ A;  2MHN A;  4QWD A;  2BJ3 A;  4DL7 A;  1YLX A;  4RBU A;  3HVA A;  2I5J B;  1TL1 B;  4K0K F;  4IG0 B;  5GMD A;  3RBE A;  1YJT A;  4WFY A;  2GJI A;  2CRL A;  1PKU A;  2Q66 A;  4RJV A;  2MKY A;  3SYZ A;  3SCL E;  1ZZF A;  2HHU A;  1V3R A;  1N54 B;  1BWV A;  3GFY A;  1Q8L A;  1RHR B;  2FHM A;  2M88 A;  4NXM F;  3PHE A;  1RT2 A;  2QLJ B;  3CDB A;  2GAG C;  1FNO A;  1S9F A;  1SH2 A;  1HMV B;  2G9O A;  1R8P A;  4LBH A;  3SDE B;  2OH2 A;  2WVB A;  2AJF E;  4LSZ B;  2YWF A;  4DV3 J;  3ELH A;  2EFO A;  4RWW A;  5DM7 Q;  4AYB D;  2FVR A;  1JLF A;  1NND A;  2V5H G;  5D3G A;  4ID5 A;  2Y1I A;  1QVF R;  3ZZU A;  2KZZ A;  4HTI A;  4KQZ A;  4PWW A;  3FUY A;  3O8W A;  1KOH A;  1QTN B;  1XMO J;  1QE1 B;  3FCV A;  3E01 B;  1U2R A;  1R0B G;  4OYW A;  3I82 A;  5A2Q Y;  2AHO B;  1NHU A;  1YHQ S;  3SI8 A;  4ZJQ A;  2DH8 A;  2ZZT A;  3D0H E;  1XK8 A;  4I7F A;  4J9N A;  1BE4 A;  3GSD A;  3ENV A;  4CLT A;  4M5D A;  4DG1 A;  1KLN A;  4X4O A;  1F9H A;  2MQO A;  3ZTS A;  4FYW B;  5KT6 A;  3EZ5 A;  4JI8 J;  1HNI A;  1HNX F;  1Q7Y T;  2RRB A;  1TU0 B;  3C8Y A;  1VQO S;  3CCQ S;  3Q86 A;  4DQR A;  3CD5 A;  4N77 A;  4ZOS A;  1XNQ J;  5HLF A;  4GO5 X;  3M8Z A;  2R8J A;  5HP1 A;  1EQM A;  5JUM A;  1IWA A;  2FLL A;  3G71 S;  2W2P P;  2LLZ A;  2XCA A;  2UUB J;  4NLU A;  4WFB Q;  3D5M A;  4PWD A;  3CB4 A;  4LF8 F;  2CPZ A;  3CJR A;  1VQM S;  4Q2L A;  3LP0 B;  4X66 F;  1MN9 A;  2K8G A;  1RB0 A;  4HT7 A;  2ZH3 A;  1FJ7 A;  5CYQ A;  3VVT A;  2MQQ A;  2V4J A;  3DRP B;  5K8M A;  4JI3 F;  2PMH A;  2ZHO A;  2CJY B;  3OTO F;  3EZO A;  5T41 A;  1LWE B;  1ZET A;  3T5J A;  1HYS A;  3GG0 A;  1HKA A;  1LK7 A;  2DGT A;  3WX4 A;  1FT8 A;  3TNV A;  2HVZ A;  2BM1 A;  2Z2Z A;  4GVL A;  4RLE A;  3MMB B;  2CZ9 A;  2GVZ A;  5CYM A;  4OI1 A;  3M8W A;  1DTT B;  4K0K J;  4EBE A;  4DV4 F;  1I3O B;  2FC8 A;  5C2G A;  1VK3 A;  3H40 A;  4UQG A;  2B5J B;  3O2I A;  2DPJ A;  1SJF A;  2NCK L;  2QSW A;  4ZS6 A;  3S1T A;  4TU9 A;  2XNR A;  1PYS B;  2K7J A;  1Y7P A;  4JI5 J;  3C16 B;  5HQM A;  4NXM J;  1CJV B;  3TWZ A;  1PBA A;  3R5D A;  5K5M A;  4AND A;  4OI2 A;  4WFN Q;  1FI4 A;  2JVR A;  1UL3 A;  2MZJ A;  5A0Y A;  2B4U A;  4I64 A;  1F2G A;  1K47 A;  4IDK B;  3UO0 A;  4Y65 A;  3CCZ A;  1REV B;  2B7C B;  2EVZ A;  3PXG a;  5A8W A;  3QT6 A;  2QYG A;  2QL9 B;  4F0H A;  1HL6 A;  4NEZ A;  4C3M A;  3G6E S;  4TVA B;  5K8N A;  1FKP A;  1KOO A;  4LIW A;  2DHS A;  4B3O A;  4H4O A;  2Z2Y B;  3DHX A;  1F9F A;  1LK5 A;  3D6T B;  3M32 B;  1OS5 A;  3MM8 A;  1CJK B;  1F5B A;  4NLP A;  4A8W A;  4C8Z A;  4RW4 A;  4A8O A;  2GC8 A;  5FLX Y;  2VG5 B;  4G1I A;  5DO2 A;  1RLC L;  3EDR B;  2G1H A;  4AL7 A;  1M5V C;  1TKZ A;  1CEZ A;  5HVH A;  1JKH B;  2B56 A;  3NGD A;  3RRK A;  1HNX J;  3WQP A;  4RNO A;  1WHY A;  4N8N A;  4N47 A;  3CUL A;  1T8E A;  4TYA A;  2J7K A;  2BW2 A;  3TUZ C;  4FYV B;  2FVC A;  3M30 B;  2YKQ A;  5IQ6 A;  3PRB A;  4P6Q A;  2DHA A;  2HS4 A;  5DJB A;  3UDC A;  3EVO A;  1J5O B;  4BS2 A;  2DR6 A;  2VIC A;  3GV7 B;  6FD1 A;  2RQK A;  3B54 A;  2PI5 A;  3SFU A;  3R7B B;  4O3Q A;  4DFJ A;  5HAN A;  3G8T A;  3LWM A;  1Y5N B;  4ANE A;  4JI3 J;  1RT3 A;  3FEX B;  5KFO A;  4F67 A;  1VRU B;  5KG2 A;  2EEY A;  3OTO J;  4PUO B;  3K5N A;  1C1C B;  2CPJ A;  1LWF B;  5CAB A;  2MGZ B;  3I4H X;  2EBG A;  2AEF A;  1M1K T;  1P6T A;  3KG4 A;  1LOU A;  1ACM B;  4C3L A;  2J0S D;  1X5T A;  3M2R B;  4DF8 A;  2EG1 A;  4WYL A;  2FJV A;  4MT1 A;  4DV4 J;  5F9N A;  2ZH7 A;  1JLG B;  2G2Z A;  1HHT P;  3EX7 B;  3J7Y I;  2L48 A;  4DMZ A;  4J9K A;  4H4M A;  1YWX A;  1K44 A;  2RRN A;  1PCA A;  4U7U K;  2NUU G;  1RBO B;  1R0C B;  5D6G A;  2QZ8 A;  2Q43 A;  3ADA C;  1EJ7 L;  2EWH A;  4RU2 A;  3M8Q B;  3JSR A;  1X9W A;  2DIU A;  5IC6 B;  2AW0 A;  2F4F A;  3CIM A;  4CO1 A;  3M2V A;  3X3U A;  1KLM A;  4LF5 F;  3ZC4 A;  2RQM A;  3W5X A;  2R4F A;  1WTF A;  1AFI A;  4CTA A;  2KXN B;  3EIC A;  2AGP A;  3IM9 A;  4JI0 F;  2V4Q A;  2WOM A;  2E1A A;  5J1N A;  2R7W A;  4QW9 A;  1MWZ A;  2WVE A;  3V2U C;  5F8J A;  1Q95 G;  3LWL A;  3C14 B;  3IAS 9;  4KRW A;  4FKX A;  4DL6 A;  4O44 A;  2KM8 C;  3DYA A;  7AT1 B;  3GCW P;  5EN1 A;  1X4B A;  4ZVG A;  3IG1 B;  4B08 A;  3PW7 A;  3RW7 A;  3NS7 B;  2BJ8 A;  5CAA A;  3ZTQ A;  4NLX A;  1GX6 A;  2FHJ A;  3MGJ A;  3A3N B;  1SCJ B;  4DFP A;  2AF6 A;  2M7S A;  1WC1 A;  3PW0 A;  1UA0 A;  4YB6 A;  5IS2 A;  3TYT A;  3W62 A;  4PQU B;  2CA9 A;  4L76 A;  1UJ5 A;  5F8I A;  3LH2 S;  2ZZM A;  4Q0B B;  4LRA A;  2OML A;  2CAD A;  3DI6 B;  3J81 U;  5D4N A;  1XNR F;  3UN3 A;  1BHN A;  4FKY A;  3CD6 S;  4DV6 F;  1DUR A;  4QIG A;  2HLT A;  5GME A;  4RBV A;  3D4J A;  1A6L A;  3UPF A;  2MSS A;  1MRO B;  2PFD A;  5LJ5 Y;  2MZ1 A;  2AYG A;  1SC1 B;  3KLI B;  2BYC A;  2C42 A;  4XPE A;  4O4G A;  3IRX A;  4M8L A;  2IBK A;  1WJ9 A;  1MMD A;  3N6L A;  1VQP S;  3IWN C;  1HMV A;  4OX6 A;  3A4T A;  4FBT A;  2EW9 A;  2XO6 A;  2DNK A;  3HHN B;  2IJN A;  5M2P A;  3IFE A;  1YJ9 S;  2A6M A;  2DRB A;  4TYB A;  2W8K A;  4TU8 A;  2XHW A;  3SQG A;  4K4T A;  2DO0 A;  5HI7 A;  2QA4 G;  1AW0 A;  1VOM A;  3HF5 A;  4YEA A;  1HIY A;  1JXE A;  4ZPA A;  1QE1 A;  3R27 A;  2RQC A;  2W1B A;  2UVW A;  5EUH A;  1L3S A;  2ZWP A;  2D69 A;  3D1Q A;  1OPI A;  1DAX A;  2P9G A;  1FEH A;  3MFI A;  3B6B A;  2CQ4 A;  4YQW A;  3D9B A;  1B64 A;  1GXT A;  4DOZ A;  4Q2M A;  4I6W A;  4KGM A;  1PJ6 A;  3I32 A;  3KLF B;  3QWU A;  4WXW A;  5C25 B;  3QIP A;  4I6A A;  2XTJ P;  1IVZ A;  2MMY A;  4LF5 J;  3UW1 A;  3ZZO A;  1RK8 A;  4ZMM A;  5ETK A;  1LWX A;  3E8O A;  2GHV C;  1T9Y A;  3QLH A;  1C0U B;  3L7O A;  4J9P A;  4JI0 J;  2W7O A;  2V2Z A;  3QRR A;  4I69 A;  2RE1 A;  1ZZN A;  2DCU B;  4ZIV A;  5BJR A;  4M5G A;  1S1X B;  2WVC A;  4BBY A;  5E3Q A;  2QMU B;  3QGG A;  1MWQ A;  2M0G B;  3NRB A;  3CC4 S;  1PC5 A;  1GX5 A;  3CJK B;  1FD2 A;  3LP0 A;  1VIS A;  4B9L A;  4TQS A;  2Z2L A;  3GON A;  2ZM6 F;  3ENW A;  3LA0 A;  3PG9 A;  2LEP A;  2LU1 A;  3HX9 A;  3NLC A;  4ZA1 A;  4NLW A;  2R7X A;  4ETX A;  3IA0 A;  2ZKT A;  4CM0 A;  1RWU A;  3M4X A;  4OI0 A;  2Z57 B;  4LJM A;  3LW5 C;  4UST A;  2DHH A;  4C98 A;  3MEC B;  2X1F A;  2VBW A;  4FYX B;  1XNR J;  2BV3 A;  2VOO A;  2CG4 A;  2QA2 A;  3NG8 A;  2GHW A;  4DV6 J;  2BEF A;  2Z56 B;  4DR2 F;  1TKT B;  1VBK A;  1DTT A;  1NK8 A;  2MKS A;  3CO9 A;  5L1I A;  4ENO A;  2HNZ A;  2IM0 A;  2IVY A;  2LDY A;  3S8S A;  3CT9 A;  2RJZ A;  5L1J A;  5D4L A;  1K9M T;  1N56 A;  3M8R A;  3A13 A;  2F63 A;  1B0P A;  4G1Q A;  2G0I A;  4IH7 A;  3BGR A;  5RUB A;  2MQN A;  3TZY A;  1LW2 A;  1VQ8 S;  2KRB A;  2IRY A;  2MKC A;  3AHP A;  2HHW A;  3H5Y A;  1EET B;  2GJ2 A;  2XMW A;  1WSR A;  3BO3 A;  1Q1K A;  4IDK A;  3TX0 A;  1REV A;  3EJM A;  2RDD A;  4BC7 A;  1ZA1 B;  4MYU A;  4YB5 A;  4CO5 A;  3HSD A;  4WIQ A;  4OL8 A;  2W9C B;  2VC0 A;  8ATC B;  1NJW A;  1CJT B;  3DXS X;  3MAA B;  2O1P A;  1JWW A;  1TKX B;  3GU0 A;  4XDD A;  2OPP B;  3UDL A;  4YHH F;  1VQL S;  1F1B B;  1I94 F;  4DL4 A;  2IYI A;  4J5O A;  1CQN A;  3M32 A;  1RQ0 A;  4UT4 A;  2CAJ A;  4B9S A;  5A2Q U;  4FYD A;  1U2C A;  1FDN A;  3TRG A;  2R7V A;  4P2S A;  1FRH A;  3W7B A;  2A1B A;  2PII A;  1QLN A;  5F8H A;  5KFD A;  5AT1 B;  2P9E A;  4X64 F;  2LXF A;  3H98 A;  5F8N A;  1SKS A;  1JKH A;  5I4M A;  5IFM A;  4ZP8 A;  1WC6 A;  1N88 A;  4BWM A;  1AUD A;  1FNM A;  3LP1 B;  4MKV A;  4CLY A;  2V34 A;  2MY8 A;  1UZH A;  1NDL A;  4WJB A;  1R8H A;  2O01 C;  4IG3 B;  1AT1 B;  3H2U B;  3PYF A;  3MED A;  2HQG A;  4FPR A;  3NCQ A;  2E29 A;  4OZL A;  3DLG B;  4ED5 A;  1RTJ B;  4TQR A;  3D0G E;  3O5T B;  1NKB A;  4MKY A;  1TMM A;  3OL7 A;  2IRU A;  1TAQ A;  2JX2 A;  4ZVE A;  1PAE X;  2YXL A;  4ELT A;  1URR A;  2QJ3 A;  3KK2 B;  3O3L A;  1TUG B;  1TL5 A;  4A8S A;  4UY8 5;  3FEZ A;  2JEI A;  2ZM6 J;  4HAC B;  2ZVI A;  4DQS A;  2GX8 A;  3J80 Y;  1VRU A;  3MM7 B;  1D3W A;  2D7S A;  4MH8 A;  4WKR A;  3ILJ A;  2ZBP A;  1N5T A;  1Q8I A;  3R7N B;  3T1A A;  2XYH B;  1LWF A;  1DQA A;  1LNQ A;  2DNO A;  3IAM 9;  4DN9 A;  3CCV S;  4X4U A;  2ZIT A;  5CHC B;  1S0O A;  4R5P B;  1VI7 A;  1NO8 A;  2QC3 A;  3NGT A;  1WG5 A;  1S1W B;  1NJY A;  4DR2 J;  3MEK A;  2O66 A;  1JLG A;  4WK3 A;  2FJE B;  3CC7 S;  5EX3 A;  3NNH A;  2VD3 A;  4JI7 F;  3R8Y A;  5C7P A;  2XI2 A;  2IIH A;  3R1L A;  4DL2 A;  2M8H A;  4OHV A;  1J5E F;  3PR5 B;  1B70 B;  1GT8 A;  1S6U A;  4WP3 A;  2BBE A;  3BRE A;  2DY9 A;  2E44 A;  3DRX A;  2J0W A;  5A8R A;  3MR2 A;  1SV5 A;  2IAJ B;  2D74 B;  2DNL A;  1FEE A;  3EGW B;  3ZZZ A;  4MYT A;  4NL5 A;  2W4P A;  3UR3 C;  1BY9 A;  3RR8 A;  2PT0 A;  5LJ3 Y;  2KJV A;  1KFD A;  3TQ1 A;  3SSS A;  3V81 A;  2I38 A;  2CZV C;  3I9V 9;  5HN0 A;  3SMZ A;  1KVJ A;  4ZHR A;  4DR7 F;  3SFG A;  3EYZ A;  4C11 B;  4RO0 A;  4Y2M A;  2NLW A;  3T9N A;  2UXD F;  1S99 A;  3BSN A;  4YHH J;  1I94 J;  4F7V A;  3C14 A;  2EFP A;  3M9O B;  3RAX A;  4QU7 A;  3JSM A;  5HSP A;  1NRK A;  1YRU A;  3NS6 A;  2RKI A;  5E3R A;  3LAN A;  2QGF B;  3IG1 A;  2NR0 A;  4ZVP B;  2LQB A;  1UKU A;  3AY0 A;  3C2P A;  4PXC A;  4DV2 J;  3MMJ A;  2HMI A;  4F4Z A;  2W9B B;  1UFK A;  2IJF A;  1Q8B A;  2K1R B;  2MQL A;  2CPH A;  4QIW D;  2E1P A;  3E3X A;  3TJ8 A;  4PPD A;  2BW7 A;  2R8I A;  4Q0B A;  5CZX A;  4DL0 C;  1V6H A;  2LYV A;  3CE8 A;  3O1L A;  1IKW A;  1Q78 A;  3LPY A;  1YJV A;  1GQE A;  3PR4 A;  4KGZ B;  3ITH A;  1HBM A;  3VQS A;  3DRS B;  3TAN A;  2QO3 A;  2JFD A;  2E1M C;  2FGO A;  3L95 X;  2WBM A;  2C2Z B;  2DR5 A;  4FNH A;  1SIZ A;  4LF6 F;  1MRO A;  3S01 A;  2NPF A;  3OR2 B;  4JUZ A;  4DQI A;  3JYT B;  4LRB A;  2QL5 B;  3MM6 B;  4WWS A;  2RML A;  1TV6 A;  1NPK A;  3OBI A;  2MKH A;  1U1L A;  2YY3 A;  2AZ1 A;  3S6E A;  3CCT A;  2YKN A;  3H2L A;  1S1U B;  4IUF A;  5F41 A;  1ZAW A;  5K20 B;  2KFZ A;  4LVN P;  4O3S A;  4ZP9 A;  3QAT A;  2Z2M A;  4CRJ A;  4ED3 A;  1Q79 A;  4KV8 A;  1VR6 A;  1T94 A;  1NDC A;  1DY3 A;  1N0U A;  2AX0 A;  1Q0N A;  3AQO A;  3SV3 A;  3CCL S;  2N3O A;  3LGM A;  3FGV A;  2HVI A;  4ZVR B;  4DSI A;  1VC0 A;  2HGL A;  1NDP A;  1GMW A;  3EE3 A;  4B3M F;  4JI7 J;  1U0H B;  4PKD B;  4BCA A;  1GXL A;  4AD6 A;  4N7T A;  1NEE A;  1AZS B;  3D6H B;  1J5E J;  4QIV A;  2A2D A;  3CED A;  2MST A;  4L3N A;  3BBF A;  1RTI B;  1ICE B;  3QZ7 A;  3DGP A;  3NGS A;  2DNQ A;  3PFE A;  3BSO A;  1U1O A;  1T9X A;  2BRK A;  4DEZ A;  2J5A A;  2CQD A;  4RWX A;  5C25 A;  1H7W A;  4AL6 A;  4DSK A;  3UI3 A;  3AD9 C;  3DLE A;  1U1K A;  3RBD A;  4M5K A;  3AH6 A;  2E9Z A;  4I0W A;  1H3D A;  3ILI A;  1XR5 A;  3A8E A;  3VTI A;  4UUX A;  2OPR B;  1R27 B;  3I0R A;  5THW A;  3RJM B;  4DR7 J;  3AXM A;  2N82 B;  2H65 B;  4RU9 A;  2CDR B;  4Z7Y A;  1NKC A;  2HW3 A;  2UXD J;  5H9F J;  4PXB A;  1S1X A;  3RW6 A;  4FXD A;  2R8G A;  1JK9 B;  2G1D A;  4Q43 A;  2HEK A;  3WBZ A;  3OJU A;  1D0E A;  1S1V A;  3VAK A;  2J6T A;  4ZVT B;  3NOG A;  2OPS B;  3GR0 A;  3HCX A;  2ZFH A;  2K06 A;  4DSL A;  4CO4 A;  1QAI A;  3GIM A;  3G82 B;  1W7W A;  2MQM A;  3DDN A;  1FX2 A;  2V8G A;  3MEC A;  1KP6 A;  1M1G A;  4CT9 A;  1SJR A;  1X8D A;  3DDK A;  4DV1 F;  2DNN A;  2KYZ A;  3UR0 A;  3W9I A;  2KL8 A;  5HRO B;  1OMS A;  2IVM A;  2RUS A;  3M8P A;  2UUT A;  4CLK A;  1DHM A;  2JH3 A;  2WRM A;  1S0M A;  4L6V 3;  4PG4 A;  5DDP C;  4LF6 J;  1EP4 A;  2AX1 A;  4ETZ A;  4YDD B;  2CJX B;  1UAW A;  3PV8 A;  4M94 A;  2EFG A;  1TEL A;  3UD5 A;  3T41 A;  4NYZ A;  1V5I B;  4IOC Q;  3FMW A;  2FJX A;  4OZ5 A;  1JXV A;  3QO9 B;  1S7H A;  5LMN F;  1EET A;  2BAN B;  1JJ4 A;  2XS2 A;  4JV5 F;  5B0B A;  4ZJO A;  3WZ0 A;  3MAH A;  1U6Z A;  3ISZ A;  5KFU A;  4K59 A;  2HND B;  1WHX A;  2FD2 A;  3KOA A;  1VJW A;  3LO3 A;  1V9O A;  2DJW A;  3MAA A;  2R8K A;  2MLZ A;  3IBW A;  2MKK A;  4U8Y A;  3Q8P B;  1HD1 A;  1UVM A;  4B3M J;  3GR1 A;  3ZTR A;  2ZDO A;  2YWH A;  2DD8 S;  3DLK A;  2HQC A;  4RNF A;  3DHW C;  3EPG A;  4IR9 A;  2OTJ S;  2MJN A;  4IFY B;  4ICL A;  4YUD A;  3MOJ B;  4DPT A;  1X4H A;  3KKF A;  5AJ3 F;  2VU5 A;  2ZBC A;  4QQB A;  2J9E A;  2HHS A;  1ZYQ A;  3HSJ A;  3P6Y C;  4M95 A;  4OV1 A;  2AJ1 A;  5IOL A;  2DRA A;  4J9S A;  2EPI A;  4FXW A;  1NZA A;  2VKR A;  2DHG A;  3W8G A;  1G1X A;  4IG3 A;  1O6X A;  3G8Q A;  4NLV A;  1WF2 A;  1X7V A;  1AUS L;  4KH1 B;  3UQS A;  2H5I B;  5T7L A;  4DZD A;  5IQQ A;  2F9J A;  2XQC A;  1RTJ A;  2YNG A;  3FFI B;  1IM4 A;  3G8S A;  1M0S A;  4RW6 B;  2Q79 A;  1HBO B;  1T9V A;  3I87 A;  5DQH A;  3OL6 A;  2K3I A;  4NZ0 A;  4ECQ A;  3LUY A;  4FF2 A;  4DFK A;  2I9S A;  3HMJ G;  4YN3 B;  3RU0 A;  1CVJ A;  2B6A B;  1RWW B;  3NBP B;  2OGU A;  3MF5 A;  4HTJ A;  1UET A;  2HK3 A;  4DWI A;  2AJ4 A;  2CPY A;  3DLH A;  2EG2 A;  1S59 A;  1Q5Y A;  1EIY B;  2VPZ B;  1RE1 B;  1CUL B;  4HAC A;  4ES2 A;  3HVT B;  3W2V B;  3KJQ B;  3MM7 A;  2OAU A;  3N79 A;  1R43 A;  1RU1 A;  5HL7 Q;  5G4D A;  2YKM B;  5KG1 A;  1IKX B;  2NXJ A;  1YQH A;  3EXY A;  4UOF A;  3MR5 A;  5L1K A;  4R5P A;  2V50 A;  1ULR A;  3U1M A;  4DX6 A;  3NMA A;  5H9F K;  4DV1 J;  4AQY F;  5AXM A;  2UUW A;  4WXO A;  3LQV A;  1QAJ A;  1XMQ F;  2LXI A;  2F9D A;  1N6Q A;  1TL7 B;  2WB4 A;  3AOB A;  2RSQ A;  1X0F A;  1L5U A;  2LU2 A;  1RYR A;  1NH8 A;  3MM9 B;  1S6P A;  1U6F A;  3QRQ A;  3MM5 A;  4LSN B;  4QZV B;  3RB3 A;  3OFF A;  1X4F A;  4I2P B;  5CXT A;  5B7W A;  1NSP A;  4J9U E;  1LFW A;  5J1E B;  2ZC4 A;  4PYD A;  1Y4Z B;  3HI9 A;  5A8K B;  3MEG A;  2XSJ A;  5LMN J;  4B02 A;  4UOG A;  3D6M B;  4Y3C A;  1V3S A;  4JV5 J;  4OYM A;  3A3P B;  2JDJ A;  1N32 F;  1FRX A;  2E5H A;  3CDU A;  1FDA A;  1X4E A;  3BDE A;  3TA2 A;  1ZA2 B;  4TY8 B;  3O44 A;  1MN7 A;  3OHA A;  4O4R A;  4J9Q A;  5LSO A;  3RTV A;  1SKR A;  2NYH A;  3VF0 B;  3ZZ0 A;  3RB4 A;  4C11 A;  2GML A;  1W25 A;  3D54 A;  3VGU A;  1N5V A;  2MDA A;  5LXY A;  4USK A;  1VC5 A;  4F4W A;  2XUL A;  5DM6 Q;  5ETT A;  4OHX A;  3OW2 R;  3I96 A;  4F3M A;  3RYL A;  1I5O B;  1U8S A;  2G0C A;  4WKY A;  1FXL A;  2OI2 A;  3GE9 A;  3BSA A;  5KOW A;  2F5G A;  4E8U A;  5E3A A;  5MLC V;  2J9C A;  3VZI A;  2J6S A;  3DOK B;  1NKE A;  2QN6 B;  2WHO A;  4KIA A;  4AT1 B;  5AJ3 J;  2G13 A;  2QLF B;  1TK5 A;  1T05 B;  3N6M A;  2LEC A;  3AA9 A;  4KHM A;  1MG7 A;  4G65 A;  2YNF A;  3QMQ A;  1S48 A;  4HI2 A;  4DJB A;  2L41 A;  2CQB A;  1VQ7 S;  2VKZ G;  4RW9 A;  4OZN A;  4L73 A;  5LXR A;  1WAC A;  3EMT A;  2FZK B;  3JXO A;  1P9Y A;  2KJW A;  4X4N A;  2DB1 A;  3DRS A;  1YIT S;  2IRX A;  4GVB B;  3KLH B;  1WUU A;  3ILL A;  2I8E A;  1SC4 B;  2ATL A;  1PYT A;  4EBC A;  1RTH B;  1VRT A;  3OR2 A;  2FJA B;  3FMB A;  1YVF A;  3MM6 A;  2E7W A;  4OHW A;  4M1K A;  4P10 A;  3OTD A;  4IRC A;  5KFX A;  3BYR A;  4K4X A;  2B3T B;  5GAD I;  1KDN A;  2QA4 S;  1PC4 A;  4UUW A;  1S1U A;  2WK4 A;  3UN2 A;  4IQM A;  1CJU B;  3JS9 A;  1D9F A;  4USW A;  1DTQ B;  3CWJ A;  1U47 A;  3K5L A;  2Y9H A;  4F25 A;  1KON A;  4MIB A;  3FEY B;  3T6B A;  3VWS A;  3JTN A;  1SXL A;  3QT8 A;  4NEY A;  4AQY J;  2H9Z A;  3M9M B;  3QGP A;  2X3G A;  2XM3 A;  1XMQ J;  5KFH A;  3GZ7 A;  2ERR A;  3AD7 C;  3D68 A;  2IA6 A;  5KG5 A;  2WZ1 A;  2LA6 A;  5IWA F;  1T3O A;  1VBY A;  3PRV A;  4E0D A;  3BS9 A;  2V2Q A;  4DS5 A;  1C0T B;  1NK7 A;  4ZPD A;  3TJA A;  3BYP A;  2KM8 B;  4DCO B;  3N5F A;  4OLP A;  2XS7 A;  1YRT A;  2DK2 A;  3GFZ A;  3OL8 A;  1IBM J;  2UVU A;  4GRS A;  3SV4 A;  1RT6 A;  3BB5 A;  1PG5 B;  3MCS A;  4FBU A;  3W65 A;  1U48 A;  4OYA A;  1N32 J;  2DGS A;  5J2M B;  1BD6 A;  1NZ8 A;  1FRL A;  3PJX A;  4Y2C A;  3HHL C;  3BZQ A;  4K4Z A;  4PG6 A;  1RTD B;  2ZVS A;  3PRD A;  5JVH Q;  2WBR A;  1QJH A;  4ES3 A;  1WEY A;  4QYZ J;  3QGI A;  4P73 A;  3F0N A;  3CDW A;  2WSC C;  2R42 A;  3DM2 B;  1FKO B;  2DH9 A;  3PY8 A;  3ISN D;  1KQF B;  4F36 A;  4X62 J;  1BQN B;  1OPZ A;  4DPO A;  5DLF A;  1M5K C;  2BKN A;  2DGU A;  1M90 T;  2QFI A;  4DX8 H;  3VZH A;  3CPW R;  2XSF A;  1JLB B;  2VV5 A;  1K1Q A;  4YR3 A;  1K8A T;  1I6J A;  1U8W A;  1LW0 B;  1F3F A;  3H8Y A;  1TL3 B;  4K2J A;  5HK4 A;  2OPS A;  2FHJ D;  3A1Y G;  2G0J A;  2Q6B A;  3AXK A;  4X2B A;  4C0B A;  2R3V A;  2V67 A;  5KFP A;  2XMK A;  2VA3 A;  4URS A;  1HFE L;  1SL1 A;  4WK1 A;  2CNN B;  2W7P A;  1RHJ B;  2A18 A;  1FCA A;  2V8P A;  4CH7 A;  3NWG A;  1Y10 A;  1JLC B;  4ZPT R;  1TVR B;  1H2V Z;  1NCL A;  2JWN A;  5B0F A;  3M9N B;  3EUN A;  4E2F B;  2YVS A;  2WCX A;  5HRO A;  4ZIW A;  4M5N A;  2N4C A;  4I67 A;  3I5A A;  2ACY A;  3UE2 A;  3FKB A;  3HT3 A;  3TEH B;  4YFU A;  1S77 D;  4ITS A;  1EB0 A;  1QSL A;  3I6P A;  5AE2 A;  1RT1 B;  5KT2 A;  2LFV A;  4NCG B;  4C3K A;  4E98 A;  2FDN A;  1HNW F;  3F44 A;  1JX4 A;  3K5M A;  1B3T A;  3QO9 A;  4WFZ A;  3K17 A;  3RBX A;  2AYM A;  4KFB B;  3MR6 A;  1JMT A;  5EWG A;  3FBB A;  5E3P A;  3KUG A;  2PA3 A;  1X4G A;  2HIY A;  4A4J A;  1WNE A;  2QG9 B;  5DQI A;  5IWA J;  4DPU A;  1RTZ A;  4K7Q A;  2NXN A;  2H1Y A;  2CQC A;  2XY6 A;  2VQE J;  3FBC A;  1T95 A;  3LP2 A;  4Y2I A;  4DUY F;  2RD5 C;  3N4W A;  3C46 A;  1O51 A;  4MIA A;  4IFV A;  2ILZ A;  3UCG A;  5DG8 A;  4DR5 F;  1VLY A;  3W2W B;  2KFY A;  2NZ4 A;  4LBP A;  1FTR A;  1N33 J;  1CS4 A;  4ZVF A;  2VG7 B;  3K89 A;  5GAG I;  3SCK E;  3GB0 A;  4F8R A;  3H5U A;  2MXY A;  3A8I A;  2HRT A;  2EFQ A;  4NA2 A;  3R5J B;  2DXE A;  3NNC A;  3R7S B;  4H4K A;  4P72 A;  4X4T A;  1TFW A;  5JJB A;  1XQI A;  2KTQ A;  1R6V A;  4CH1 A;  2BOA A;  1CBK A;  4ECV A;  5C42 B;  4WP9 A;  3EM1 A;  3NY0 A;  1X4A A;  2KVI A;  4RW6 A;  3K7R A;  2OPQ A;  4Y6I A;  1HBO A;  3QYY A;  4HLB A;  4LF7 F;  3GYG A;  4OX8 A;  2VOD A;  1H98 A;  3D67 A;  4ELV A;  2DXF A;  2B6A A;  1VIX A;  2MYF A;  3NBP A;  2MLX A;  4U7C A;  3ZTP A;  2J0Q D;  4CLU A;  1WKL A;  4J37 A;  2B4V A;  4W4M A;  3KHG A;  1K73 T;  5KFZ A;  3I5C A;  2WAQ D;  4IOB A;  2RF2 B;  1VQ5 S;  3H7H B;  3BKU A;  1HNV A;  2A10 A;  3KNG A;  4N8O A;  3H4B A;  3ZO7 A;  2LCW A;  1HQU B;  1VMB A;  3GJR B;  3KHR A;  1FDB A;  1UTA A;  2OTL S;  1A7G E;  4QYZ K;  3R6L B;  2DIV A;  1MMN A;  2OSQ A;  3DRR A;  2DVI A;  3NNA A;  1NAQ A;  5D15 A;  4PQA A;  1OWX A;  5J2Q B;  2YNI A;  2JLF A;  2C28 A;  1NH7 A;  3OPK A;  2DCL A;  2FY8 A;  4K4Y A;  1MU2 A;  3A8K A;  2R7Q A;  1TL7 A;  3I31 A;  2VG6 B;  5CD4 H;  2DPI A;  2GVD B;  1GFW B;  3KK1 B;  1DAR A;  3GWC A;  3FSY A;  3MMA A;  1EX8 A;  2D41 A;  4JB8 B;  3CW2 C;  3R1H A;  1U1N A;  1QM9 A;  2F65 A;  1VC6 A;  4LSN A;  4C4W A;  2FLP A;  3BBB A;  2PDA A;  2FLN A;  2M9K A;  3R5G A;  1ZTW A;  1HNW J;  2QV6 A;  4EZ6 A;  1LV5 A;  1IKV B;  4ECU A;  3C6U A;  1RT4 B;  2XLK A;  5G0R B;  4RW7 A;  5IT9 U;  2ZD1 A;  4AXJ A;  3CVK A;  2C3O A;  1S57 A;  1YZ6 A;  2I1R A;  4CO3 A;  1FWL A;  4F0M A;  2B0G A;  4BHQ A;  3Q8Q B;  2UXC F;  2KI2 A;  5HBM A;  2JJ4 D;  1VBX A;  4LQ9 A;  1HW9 A;  2MQ8 A;  1Y00 A;  2UUB F;  1X9M A;  1KFS A;  1KC8 T;  4YY3 F;  1N5Q A;  3FJ2 A;  1EKR A;  2IC3 A;  4KGV B;  6FDR A;  5KT4 A;  2CWK A;  3M2U A;  2EK6 A;  2BX6 A;  1B0T A;  3IR5 B;  4J9O A;  1S12 A;  4DUY J;  3T6J A;  2OEK A;  3BGU A;  1FXD A;  3GFH A;  3PJ9 A;  5D78 A;  2ZZN A;  3E51 A;  4NLS A;  2BAC A;  2W25 A;  4DR5 J;  4EYI B;  1S6O A;  4IRD A;  4ECY A;  1FJG F;  1UP1 A;  5GAH I;  4Z2X A;  3ET6 B;  7FD1 A;  3FSX A;  3LOU A;  2GA7 A;  5JVG Q;  2P8I A;  2HBZ B;  4PAB A;  3M1V B;  5D4P A;  3QBC A;  3HXM A;  1RU2 A;  2YPZ A;  1H74 A;  2CQ2 A;  2CJA A;  3PKY A;  3EGV A;  2WON A;  2Y3Y A;  5KFI A;  1D9A A;  2E5L F;  2XMU A;  1X0P A;  3NAH A;  2ZE2 B;  3KLH A;  2GIF A;  3H5S A;  1RTH A;  1KTQ A;  3QGH A;  4LF7 J;  1N34 F;  1NB2 A;  2LQ9 A;  4MFB B;  4TXS A;  4JI5 F;  2GFF A;  3C6T B;  1T9U A;  4CLW A;  4DF4 A;  1TUV A;  3AB2 B;  1F0X A;  1T03 B;  3K8V A;  5DET A;  1G6B A;  5F0U A;  4EYH B;  2WW8 A;  1M5P C;  1HWJ A;  2V9W A;  2GO8 A;  5L9X A;  1DFD A;  3IM8 A;  3OXG A;  4YDX A;  1APS A;  2G4B A;  1D8Y A;  2E66 A;  3VAH A;  1N48 A;  2FIU A;  2UUC F;  2F1F A;  3HLU A;  1XTZ A;  3ILO A;  3VAM A;  2LP4 A;  2H4Y B;  1TAU A;  4UTG A;  1B4S A;  3K0J A;  3SSR A;  3KG1 A;  5CYJ A;  1LQ9 A;  4O3R A;  4O3N A;  1TTH B;  1OYE A;  4C6A A;  2X3D A;  3H25 A;  1NM2 A;  4B9V A;  4F3O A;  3M8S A;  4DR6 F;  4QPT A;  2GQ2 A;  3JTO A;  3KLV A;  4NLR A;  2MPU A;  3BKT A;  2KHD A;  4IKA A;  4FXV A;  1NPP A;  4DI6 A;  3P5B P;  1NJI T;  2IMW P;  3ZZY A;  5DDR C;  4WP8 A;  3MDF A;  3UVJ B;  5HQ8 A;  3GV5 B;  4DUZ F;  4K8R A;  1T9T A;  1RLD A;  1J2V A;  1T9W A;  3RBZ A;  3MEE B;  4FDF A;  1WEZ A;  2W9A A;  4CP5 A;  3J7Z 5;  2J7U A;  2W2N P;  2YQ3 A;  1KD1 T;  4KSE B;  2BQR A;  3KJF B;  1BC6 A;  3Q0A A;  1F5C A;  1VFJ A;  3V5R A;  2UXC J;  3BGO P;  2ZH1 A;  1IJE B;  4K50 A;  4L75 A;  3QT7 A;  5KFY A;  4B3T F;  4A8Q A;  4NWB A;  2DNH A;  4YY3 J;  2HG4 A;  5EWF A;  4I4B A;  1BQN A;  2GS8 A;  3NWR A;  4CYU A;  1HW8 A;  3ZZP A;  1ZH5 A;  2DNR A;  2KKH A;  5GMK a;  2M4M A;  3BGF A;  4U96 A;  5KFG A;  1RHU B;  1YBT A;  3Q22 A;  1LW0 A;  1TL3 A;  2OP5 A;  2OMO A;  1H7X A;  4K2X A;  3MR3 A;  5E41 A;  3N6N A;  4WII A;  1FJG J;  3ZNJ 1;  2V69 A;  2QL7 B;  4CH0 S;  1EAR A;  1OQ3 A;  4QJV A;  2Z8Q A;  1Q86 T;  4ZPB A;  1HNZ F;  4LFB F;  3M6X A;  3N9U C;  3OT9 A;  2AKW B;  3VAI A;  3IGN A;  4MIW A;  5LT5 A;  2C3P A;  1R0A B;  2HZV A;  2QE5 A;  2BJ1 A;  2MZT A;  4FPI A;  4UOC A;  2PD1 A;  1G3O A;  1RAD B;  4YP3 A;  2E5L J;  1I1G A;  4OQJ A;  4W92 B;  5J2P A;  3G87 A;  3TAP A;  1SJQ A;  2GQC A;  2HFS A;  3IRW P;  2XG8 A;  3MHY A;  1DZ5 A;  3J7A 1;  1RT5 B;  1UJ4 A;  5I3U A;  1N34 J;  2CDQ A;  2RRA A;  5L39 A;  1SL2 A;  3GIJ A;  1GTH A;  2KO1 A;  1S9G A;  1D1U A;  2GCF A;  1XJW B;  2K2P A;  4LF2 A;  5ITH A;  1B99 A;  1YKW A;  5KFR A;  5CCL A;  4J7C A;  4CDI A;  5CA5 A;  4F4X A;  4HHH A;  2E1R A;  4ED2 A;  1Y5L B;  4MMO A;  4NYO A;  2VJU A;  4RUA A;  2UUC J;  3K5P A;  1QTM A;  2Z0G A;  3DC2 A;  4FZV A;  4WBF A;  1S0V A;  5E33 A;  1GMW D;  3OD2 A;  3HZE A;  3DMJ A;  5E7O B;  5IXU A;  2O67 A;  2RS8 A;  1Q82 T;  2VAS A;  4QU6 A;  1FFW B;  4Y00 A;  3HO1 A;  2FLO A;  2V6A A;  3K5O A;  4G6V B;  1W2I A;  4DR6 J;  1UWB A;  1HBN A;  1URN A;  3POT A;  3THV A;  3W2W A;  3T9Z A;  2V9K A;  1VK8 A;  4C8L A;  1EAY C;  3NL0 A;  4DUZ J;  1X4D A;  4KO0 A;  4DX5 A;  3D6F B;  2BUN A;  3PW2 A;  4DLG A;  1G7C B;  2HIQ A;  1RWM B;  4OIX A;  2VFR A;  3BM7 A;  3TVZ A;  3EZU A;  3BQ0 A;  3TA0 A;  2VL1 A;  4X4P A;  4PG8 A;  3BJY A;  2U1A A;  5KFM A;  3CGI A;  4ZKA A;  5D4O A;  4LFC F;  4K4U A;  3QFW A;  2ZH8 A;  2VBY A;  2XGP A;  2CNK B;  3D28 A;  4B3T J;  1BLU A;  1Q5V A;  2GQQ A;  2CQG A;  5CZV A;  1Z2Z A;  3LTO A;  2H5E A;  1IBL F;  1U1M A;  3PW4 A;  2GIQ A;  2VJV A;  3RRG A;  3EWG A;  1CC8 A;  4GC7 A;  3TAQ A;  4ZVS B;  1Z1Z A;  4H54 A;  2IDL A;  1C4A A;  1S5Z A;  1TFY A;  4OJH A;  1QDU B;  2EXU A;  2ILY A;  3FVY A;  1HQ2 A;  2BJ7 A;  2E5I A;  2RF2 A;  4ED0 A;  4CZC A;  4YB1 P;  5DRK A;  3RAM A;  2PFF B;  1HQU A;  1RKJ A;  5IT4 A;  3CJQ A;  1HNZ J;  4LFB J;  1IKY A;  1NJZ A;  3KUE A;  2KT5 A;  5L38 A;  1FE0 A;  5J2Q A;  1NUE A;  4M5D B;  1C4C A;  2I0X A;  5IC4 B;  3WHI A;  1D8Z A;  3KWM A;  1BQM A;  3G4S S;  1SIW B;  4WE1 A;  4ECZ A;  1HNI B;  2XY5 A;  4U67 Q;  3VHQ A;  4DDF A;  3C15 A;  4ZIT A;  3SXL A;  1W26 A;  4EBD A;  4DSJ A;  3LAL A;  3MMC A;  3W63 A;  4QWB A;  5LSR A;  5HLF B;  1YSJ A;  5U47 A;  4KH0 B;  1PAU B;  5HP1 B;  5C24 A;  3CD0 A;  3Q2T C;  3MWB A;  3I56 S;  3DOL A;  1IKV A;  1RT4 A;  2E7X A;  3JAM Y;  2V68 A;  2R2U A;  4OFZ A;  2ZDP A;  2W2O P;  1NPR A;  1XMB A;  4PWD B;  1WHV A;  2DH7 A;  4J9V A;  2N4D A;  3D1H A;  1H6K X;  4A8M P;  4UZB A;  2HRY A;  3I4P A;  3FRY A;  2Y0B B;  2HYI B;  2FY1 A;  5HJY A;  5CYQ B;  4USH A;  1QSS A;  1OSC A;  4R0J A;  4AE5 A;  2GMJ A;  5KG4 A;  2CVE A;  4KYZ A;  4OYO A;  1IR0 A;  2R7S A;  1HYS B;  2MQP A;  4XO0 A;  2NSB A;  3GTY X;  4KGK A;  1LKZ A;  3ETO A;  4ZVH A;  5K14 A;  3IR6 B;  4URG A;  1HI0 P;  4IYQ A;  2GVZ B;  5CYM B;  2BMB A;  2X7I A;  5FDL A;  2QTW A;  2PA8 D;  1U2F A;  3AAW B;  2OSR A;  3MCN A;  5HQL A;  2YH0 A;  5BR8 F;  2BE2 A;  2XMM A;  2CJB A;  4WU3 A;  3BR8 A;  1Y3K A;  3W3S A;  4FN5 A;  1HLW A;  3M1V A;  1RBA A;  4IOA Q;  4B9N A;  2CQH A;  3BF4 A;  2GHP A;  2I5J A;  1TL1 A;  4IG0 A;  4LFA F;  3OUY B;  4LFC J;  2EBE A;  3TZW A;  1QY7 A;  4DSF A;  4HDH A;  2ZE2 A;  2CQP A;  3CSK A;  1RWP B;  2QX0 A;  3DOM B;  1IBL J;  4P7V A;  3NXZ A;  2FJB B;  3C6T A;  1S4E A;  2ZWO A;  4L3K A;  5A8W B;  4XPC A;  3CJ3 A;  1VGY A;  1T03 A; 
#chains in the Genus database with same CATH homology
 4ZVP B;  5K20 B;  3R6L B;  1SC1 B;  3D6M B;  1RWN B;  2XYG B;  4DCJ B;  2C2M B;  2QL7 B;  1RE1 B;  3RJM B;  3IBF B;  3KJN B;  1RWV B;  2CNK B;  1RWO B;  3P45 B;  3QNW B;  3KJQ B;  2H65 B;  3R5J B;  2CDR B;  4DCP B;  3R7S B;  1PYO B;  3GJQ B;  2CJX B;  3EDQ B;  2CNO B;  2Y1L B;  1RHQ B;  4DCO B;  2CJY B;  1PAU B;  2C2O B;  1SC4 B;  3SIP B;  1BMQ B;  2QLB B;  3NS7 B;  4ZVU B;  2QL9 B;  1GFW B;  4ZVR B;  4ZVS B;  3P4U B;  2C1E B;  1RHR B;  2CNN B;  4JB8 B;  1RHJ B;  2HBY B;  1SC3 B;  2XZT B;  2XYP B;  3KJF B;  1QDU B;  4ZVT B;  2QLJ B;  3GJS B;  3R7N B;  2XYH B;  3D6H B;  2XZD B;  1RWX B;  5IC6 B;  2HBR B;  2P2C B;  3R7B B;  2HBQ B;  2C2Z B;  3IBC B;  1F9E B;  2H5J B;  1ICE B;  1RHM B;  2H4W B;  4LSZ B;  1I3O B;  2Y0B B;  2H5I B;  2DKO B;  2QL5 B;  1RWP B;  3D6F B;  2HBZ B;  2H4Y B;  2H54 B;  4ZVO B;  3R6G B;  4ZVQ B;  1I51 B;  1RWM B;  3GJT B;  1RHU B;  2QLF B;  3EDR B;  2C2K B;  5IC4 B;  1NME B;  1RHK B;  2FQQ B;  1RWK B;  1QTN B;  1RWW B;  2H48 B;  2H51 B;  3GJR B;  1IBC B;  2CNL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...