1RHMB

Crystal structure of the complex of caspase-3 with a nicotinic acid aldehyde inhibitor
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
91
structure length
91
Chain Sequence
KIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Reducing the Peptidyl Features of Caspase-3 Inhibitors: A Structural Analysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords CASP-3
total genus 15
structure length 91
sequence length 91
chains with identical sequence D
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2003-11-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 1rhmB00
1RHMB 1RWNB 1QDUB 1PYOB 2QL5B 3IBCB 4DCJB 1IBCB 1ICEB 3R7SB 3R7NB 4DCOB 5IC4B 2C2ZB 4ZVPB 2FQQB 4JB8B 2QL7B 1RWMB 2HBYB 1SC4B 3RJMB 4ZVTB 2XYPB 1RWXB 4ZVUB 3KJQB 1RHUB 1SC1B 2Y1LB 3R6LB 4ZVSB 2XZTB 2CJYB 2QLJB 2CDRB 2H5IB 3D6HB 1RWVB 2P2CB 1RWPB 3EDRB 2H4WB 2HBQB 3P45B 2XYGB 4ZVRB 5K20B 1RHKB 1I3OB 2C1EB 1RHJB 2HBRB 3KJNB 4LSZB 3GJRB 2H65B 3NS7B 3P4UB 4DCPB 1BMQB 2CJXB 2CNLB 2H48B 3KJFB 1RE1B 2Y0BB 3D6MB 3SIPB 2HBZB 3EDQB 2QLBB 1RWWB 3D6FB 3R7BB 2DKOB 2QL9B 5IC6B 2H4YB 1I51B 1RWKB 2H54B 3GJTB 4ZVOB 1PAUB 2CNOB 2C2OB 3GJQB 3R5JB 3GJSB 3QNWB 1F9EB 2XZDB 2QLFB 1RHRB 1RWOB 2H51B 4ZVQB 1GFWB 2H5JB 2C2KB 1SC3B 2CNKB 1NMEB 1RHQB 2XYHB 3R6GB 1QTNB 2CNNB 3IBFB 2C2MB
chains in the Genus database with same CATH superfamily
1R8HA 2WCXA 2YKNA 2M88A 1HBOB 1PYOB 2FHJD 3IRXA 4PUOB 3IBCB 5E3PA 4ZPVR 4WK3A 5HMZA 4IH5A 1P27B 1VK3A 2AQ4A 1HNXJ 3TUIC 3UVJB 2E66A 1E6VA 3IBWA 2YPYA 4JB8B 1RSCA 4XDCA 3OVAA 2XULA 5KOXA 1HHSA 4WTYA 4H4MA 1UVIA 5KT3A 2ZD1B 3GE9A 3DOLA 4OQJA 4ECRA 2YNGA 1SL0A 4ZLPA 2GIFA 2CDQA 2DNPA 1MROB 2CPYA 4FF3A 1VRTB 3ZZ0A 3UCUP 3ZNJ1 2WVEA 4LFCJ 2MZSA 3GYXB 1AB8A 3L7PA 3PHEA 1IBKJ 2AJFE 3BSNA 1HD1A 2N4DA 1J5EF 2NLWA 2RNEA 3OXGA 5CD4A 2HVZA 1RAEB 2MKIA 1BGXT 4OYOA 4YB1P 4NPOA 2BW7A 2B9YA 1VHFA 3I5CA 1R7IA 2I5JB 2Y8YA 1K47A 4W90B 1U0HB 2V4RA 1VOMA 2R7WA 1RTDB 1RCOB 2GFFA 2HPUA 4ER8A 5JJBA 2COLA 3O3LA 2BRKA 2JSXA 1JX4A 1Q78A 1RBAA 5M2PA 1RWPB 3GYGA 2VBYA 1HNWF 2CQ2A 2YNHB 3GYNA 3M8ZA 4F0MA 4USVA 3M9OB 1HNXF 4USUA 3KHRA 2XNRA 1WDDA 2W01A 3MOJB 1WC3A 1WG1A 3DU6A 2W4DA 3CJSA 1T9XA 4F50A 2DRDA 2KT2A 3KK1A 3BH6B 4DV2F 5CXTA 2YWKA 3NBPB 3BYPA 1DBDA 5F41A 2GQCA 3TJAA 3NKYA 4X84A 1YSJA 2C28A 1K9MT 1GX5A 2QFIA 2H65B 3JAMY 2M8DB 1VJQA 2B6AA 1M5OC 1IR1A 2DCLA 1CSJA 5KFLA 1NJZA 5FLXY 1DAXA 1UAWA 3DMJA 1NK5A 3MECB 2X7IA 2WB4A 3ELHA 3ET6B 4P52A 4ZLLA 2D3O1 2NZ4A 2Y0BB 2VQEJ 4ED1A 3R5GA 1N48A 5KFNA 2DR8A 3EXYA 2XB2D 1VRQC 4BBYA 4ZITA 4ELVA 5CAAA 4WF9Q 1AA1B 1XBWA 4MAKA 4ED0A 4YN3B 4C8OA 2E9TA 4TVAB 3FBEA 1FT8A 2W24A 3D9BA 4DU8A 1LW2A 4Y65A 5G0RB 2HQFA 5IM0A 4I68A 3M9NB 3QJPA 1C1CB 1T9TA 4DX6A 1VQ5S 3AHPA 3UD3P 1QD1A 3ILIA 2FY1A 5A8RB 4LF4J 2R7TA 3X3UA 3ZXWA 1H6KX 1UCNA 1UTAA 2C2NA 5GAGU 4V1Ak 1JJHA 5E0OA 3KK3B 3MAAB 1PAUB 3OBIA 2J9CA 3JTNA 1YZ6A 5DGBA 1WTFA 2M70A 2UUAF 2IM1A 5J2NB 2A1BA 2KZMA 4FYYB 2Y1IA 1RISA 3MCMA 4P74A 1ZETA 1HNIA 2Z2MA 3G8SA 3R2DJ 5HMWA 1NDLA 3LPEA 2BACA 3PRDA 7AT1B 1F9FA 2HHQA 1U6FA 3OVSA 3V6KA 2FZCB 1H74A 1UZDA 1HI0P 3DOKA 1JXVA 1SC3B 3MM7A 4M5GA 3H20A 3LPYA 4MJKA 1CG2A 3JSRA 3RYLA 2Z2ZA 3KWMA 3CUNA 1AZSB 4JI1J 1RTJA 2DHHA 3V81B 3HHEA 2HGLA 3I0RB 3LUYA 1V3SA 1RAFB 2YNHA 3H0PA 1GNKA 2KVIA 2QMWA 2OPRB 3JXOA 4GKJJ 3ICLA 5M2RA 3M8PB 1DY3A 1UPPA 5CYMB 5KT2A 2CFXA 2ZWOA 3TZYA 1FF2A 3R7NB 3QT8A 4AL6A 2V5HG 3BBBA 3MEEB 3JB9k 4X4NA 2R2RA 1QUPA 1FERA 4B3SF 2IHR1 4N77A 3EUNA 1SL1A 2GIQA 2HWIA 3PEHA 1RTHB 4AT1B 2MEWA 2UU9F 5C2GA 3D28A 5JVHQ 1HWJA 2CWXA 3FGVA 1ZH5A 2XYPB 1OIAA 4PG4A 4YQWA 1M5KC 3V5RA 1JLBB 2GO9A 2APOA 4N8NA 4U7UD 2CPXA 1RT3A 2BMBA 3R9LA 3VCDA 4PG7A 2CVEA 3G8QA 1RTZA 4DG1A 1S7IA 3LH2S 2Y8WA 3MOZA 2DYAA 4P2SA 2L9DA 3HI9A 3W61A 4WP8A 3J81j 2XG8A 5E5NA 1O0PA 2K7JA 3VZHA 2W2PP 1VISA 4I64A 2VQFF 5FDLB 1HNVB 1K1QA 1UFLA 4P71A 3I0RA 1GMWA 2AZ3A 1SJRA 2RUSA 3C15B 3OR1B 4C0OC 4YDDB 5KG7A 4EU0A 2QA2A 1HLWA 1KFDA 1AFJA 2G0CA 4ECSA 1OSDA 2LU1A 4QR0A 2MZQA 4DPUA 2FVQA 3PX0A 1FK9A 3OFHA 1R31A 1RHKB 2QO3A 3A8EA 1CC8A 2VHGA 2F9JA 2LYVA 3H2UB 1HQ2A 3ZNUA 4AFFA 4MKAA 2W8LA 1O5JA 1WI8A 4IH7A 3FQKA 5KG4A 5HLFB 1IJFB 1HFEL 2CA9A 1UWBB 2HK2A 3AB4B 4OZLA 3RBXA 1CULA 1H73A 1R6YA 4DX5A 5HMYA 5ADZA 2VH7A 5JMNA 2HYIB 4F02A 3RG6A 3T5KA 3GFZA 2X1GA 4K4WA 1YJUA 4OYZA 4UOGA 4Y28C 2XSJB 4EO6A 5B08A 1X4GA 2WZ1A 3L3CA 1YX2A 5ETTA 1VQLS 3SIPB 2IJRA 3HVRA 2DT9A 1U2FA 3JQJA 1DTQA 3MAAA 4NWBA 2EKNA 3I6PA 2AEFA 1K44A 4NYPA 3SSQA 3CMQA 5DS7A 3MM5B 3I31A 5THWA 4F25A 4LR7A 4TQRA 3CCQS 1KTQA 3IA0A 4DR2F 3HHNB 1V6HA 1O6XA 4KFBB 2P6TA 4NLWA 2IVFB 1HNIB 1FE0A 4F0KA 4RW4A 4DR4J 4FP9A 2XNQA 4RWWA 3N5FA 4ZJOA 4YS2A 5CD4H 5EWGA 2ROGA 4KIAA 3V6HA 2C2OB 2G2OA 2BVZA 3GTYX 3B8HA 2PE8A 1B99A 2JWNA 3EMTA 3D7SB 2V63A 3WBZA 3NG8A 1KHWA 4NYZA 1U1QA 3CSKA 1O8BA 2SXLA 1DHMA 2RU9A 1H2VZ 2HQGA 1IN0A 3QIPA 5K5MA 2OH2A 1K0VA 3M1VA 2MJUA 1NHUA 2DNHA 5DDPC 1S1XB 2H51B 2JEGA 3D66A 4BC9A 2B9EA 2HMIA 2B4UA 3N6NA 4NCGA 8ATCB 1CC7A 3BJYA 3H4DA 4KHMA 4WTOB 1NMEB 4TN2A 3AQOA 3DM2B 2WVDA 3BN7A 3HHLD 2ZM6J 2AGOA 5EWFA 4DL5A 1IBMJ 2XYHB 1FJGF 1Q81T 4J9UE 2UXBJ 3NGKA 2HNDB 1JJ4A 2HHSA 4NI2B 3KXDA 4WBFA 2ABYA 4F67A 2QA4G 2XY6A 1NB7A 4WKRA 4ZK7M 1KS2A 5LXYA 1Q8IA 3D1OA 4QBUA 4UZCA 4DPXA 5EWEA 3E01A 1HPZB 5AJ3J 4IKAA 4N41A 1GMUA 1WKKA 2PGCA 2V34A 3AAWB 4CNYA 1SIWB 2HFUA 3DRSA 4ZVPB 5DLGA 3VAIA 2KRBA 2W9BB 5D3GA 3IS9A 3NGUA 4FDFA 1TAQA 1U6ZA 1XMOF 1KLMB 2CVIA 1G6BA 1V3RA 4DR1J 3FFIB 3TR5A 1RA6A 4FN5A 2XHCA 1HQUB 4FVMA 3KFWX 2H9ZA 1RTDA 2AJQA 4DX8H 2R7SA 1VC6A 2GAHC 2IRXA 1YWXA 4WE1A 4UOCA 2IBKA 4ECYA 1AFIA 2PFFB 2QSFA 4CM0A 1Q4RA 4I1TA 1CBKA 3W2WA 2Q1LA 2BE2B 1LWFB 1RI7A 3P96A 4UTGA 3OQ2A 3HMJG 3BQ1A 5L1LA 1HWUA 2NR0A 3KDOA 2CPHA 2HZVA 1T03B 3FBCA 3CMES 2Y1RI 4NZ7A 2HURA 2OSRA 3M8WA 2L9WA 2VOPA 3EXCX 1N56A 2GGPB 4H4KA 4DSKA 2M9KA 3A8JA 1RT6A 3PRBA 4NLPA 1SUQA 1P6TA 4USKA 1TKZB 3S7RA 3TA1A 3C14A 5A0YA 3WIVA 3ZZZA 1ZM2A 3IMQJ 2L41A 3FNNA 1D9AA 3NWGA 2ZOMA 2JLFA 3HHLA 3UQSA 1IR2A 2HVDA 5F0WA 2WVCA 3ZZYA 3HHKA 3HZEA 1KQGB 4B3MJ 1QM9A 2WB1D 3HD1A 5ETSA 2KH9A 4WYWA 4A8WA 2R7UA 4BCAA 3BB5A 5IWAF 3KG0A 5MLCV 3D2WA 1NPKA 4X2BA 3MAHA 3P4UB 4QOTA 2VL1A 4DV4J 4K4ZA 1BWEA 4YHHF 4C4WA 3KJFB 1MW7A 4MT1A 2DK2A 4TQSA 4I67A 1X4EA 3M32A 3NGDA 3UDEA 2J8AA 3IWLA 5GVQA 1UEUA 4HDHA 3RGIA 3DYAB 1QAXA 1O51A 3TUZC 3TAQA 1SCJB 4EZ9A 1H0HB 2DGWA 3WX4A 4PPZA 3ISNC 5L1KA 1NDKA 1JIHA 2EBEA 3BS9A 4Y2MA 2WONB 3QYYA 4CO0A 2J6TA 1Z1ZA 4M1KA 2AJ0A 5H9FJ 4ZIVA 1NJYA 5RUBA 2A6OA 2FJWA 3DRXA 7FD1A 4C8ZA 2BZ2A 5D3GB 2UUWA 3C16B 3OW2R 2N4CA 2WSEC 1S5ZA 3H25A 1S72S 2IJNA 4Y34A 3T5HA 3EVWA 3MGJA 3DFEA 2YTCA 2VOOA 3C66A 3HX9A 5D4NA 3GSDA 1JKHB 3H59A 3IAM9 4ZDNA 5CCLA 1ZZNA 2R8HA 5AJ3F 2M4MA 4PR6A 3Q8RB 1RT5B 2FHKA 2OO4A 3K8VA 1WHWA 2FZGB 3VAHA 1LXNA 1RU2A 5U47A 2GQQA 4L75A 3E01B 4QYZJ 3M8PA 4HH1A 5CYMA 1VFJA 4OJGA 2OPSA 3MCOA 4TYAA 2KFYA 4MK8A 3PIPQ 2QIFA 2ASJA 4DV1J 4NXNJ 1CQNA 3K89A 4J90A 1VHIA 3V6JA 2BRLA 4F8RA 2CNNB 2E29A 3I0SA 5EDWA 3NRBA 4HTIA 4FF2A 1RT6B 1S4EA 4J9NA 1KLMA 1RHMB 4WCEQ 4DN0A 1RT7A 2EWHA 1N5YB 1ELOA 3HVTB 3T41A 1XNRF 1ZPWX 3DOKB 4O3SA 1VRUB 2KJWA 2LKZA 3I56S 2EC2A 1TKTA 1CJUB 1IBCB 1SXLA 3QLHB 5I3UA 3L7OA 3OHBA 1JJ2R 1U48A 4QJVA 4XPCA 5HVFA 3GPAA 4KGMA 2XMJA 1PGZA 1LWFA 2BE7D 5AE1A 1MSWD 5E3AA 1JLGA 2QL7B 3THTA 2D3ZA 3M8QB 3TANA 2UP1A 3V81A 3AD7C 5KFPA 1JB0C 2FJBB 3GWCA 3OTCA 4GRSA 4R5PA 4I6YA 1NAQA 3Q22A 2QYCA 5IS2A 3BM7A 2HQ3A 1JLFB 2CQIA 2R3VA 1NLKL 4BLGA 1HR0J 4B3OA 3D3CJ 1W26A 4L3NA 3NAHA 4HEA9 1BY9A 1TL5A 5K8PA 2V6AA 2UVVA 5KFVA 4GVBB 4DR7J 4MFBB 2JEJA 1AXQA 4UOHA 4DQPA 2KL8A 1SC1B 3WDOA 3Q24A 2UVRA 1NZ8A 1PILA 4GVLA 5JXSA 3T6BA 2UUAJ 4ECTA 3GG1A 2DH8A 2PIIA 1FRLA 2RUGA 1T95A 2YKMA 4CO3A 4CLPA 4OI2A 1FX4A 3N6LA 1S12A 4IG0A 3QFWA 1S1UB 2YWEA 2ZFHA 1MN9A 2HFNA 5E3RA 2MLZA 2RH3A 1N5YA 4DQQA 2E1PA 2OIHA 3LTOA 5IV3A 2VPYB 2HVEA 3SSRA 2XMVA 3UCZP 1PIEA 1TUVA 1WC6A 1C4AA 2D41A 3PYGA 3KUEA 2ZHBA 4B9NA 4UUXA 2NXEA 5K14B 2V8DA 1TUWA 3BGOP 4NYOA 3VQSA 1JLGB 1PO6A 1VQ9S 1VQ8S 4ZCKA 2ZH1A 1X4AA 2UVUA 4OI3A 3W63A 4OX9J 2DXFA 2HNYA 3K17A 3DLJA 3RTVA 2R4FA 3HJVA 2FJVA 3GQCA 2PEBA 2AX0A 3CULA 2NYHA 3GG0A 4RW8A 3QSYB 4BS2A 5AXNA 2ALZA 4Z7CA 2XLKA 5KFQA 2DEJA 1U1NA 4X4VA 2F63A 2V68A 3GMGA 1LQ9A 1HA1A 2AEJA 4G1QA 2QLXA 4X65F 4L3KA 3MR6A 3KK1B 1C0TB 3G6VA 1TFYA 5J2PA 3I0SB 1ZYQA 1VIOA 3EPIA 5HLFA 4KE5A 4KV8A 1HBOA 2WOMB 2YVSA 4I7FB 2RDIA 2MSTA 2FJXA 5GAGI 4WP3A 2HQIA 2OPPB 9ATCB 4DPTA 3UVJA 5DG7A 1L3UA 3OFFA 2B5JA 3BGRA 2AJ4A 3KHGA 3RAMA 4ZVOB 4L72B 5KFWA 2KYZA 3MM9A 1N5SA 4CLKA 2LXUA 3JSMB 4YB6A 4M5DB 2HHPA 1KSPA 4KAIA 2F3JA 2VG6B 1UVNA 3R5JB 3D67A 3ENAA 4A48A 4EI2A 3JQMA 3DCAA 1S59A 2F4VF 1VGYA 2CZ9A 1IKYB 4NA2A 3NNHA 1YHQS 1RUSA 2DNKA 2DIUA 5CYQB 3M6VA 3PFOA 3KJVB 4I2PB 1UMJA 3CJ2A 2VFVA 2W2NP 2KFNA 2CNKB 1LKZA 1P1TA 1LK5A 2N7YA 4RZRA 1SIZA 1U2CA 2DITA 3PFEA 4M94A 4NLXA 2VICA 2ZUAA 4WFZA 3M30A 4LF6F 5ETMA 1RWUA 1HARA 4A46A 2XLJA 1XK8A 2ATLA 1RWNB 3Q8VA 3D54A 2HFVA 1HQUA 3CDAA 1SPBP 1VLYA 3FEZA 1M5PC 2J76E 3UN2A 3VTIA 2FJEB 2G1DA 2P9GA 2VG7B 3H42A 2XQCA 3RAQA 4WFAQ 2B5JB 3BGRB 4CH7A 4EGLA 4Q0BB 3CJ4A 2E7XA 4Q5VA 3NP5A 4DL2A 1YI2S 5D6GA 4FKXA 1RTJB 4NLQA 3PVXA 3NS5A 4DXLA 4F4ZA 1RTIB 3DRYA 1FEEA 2FYXA 2C42A 4FF1A 1IKWA 2J0XA 2R42A 1FFSB 1WC0A 3ZZRA 2FTRA 2D1CA 2G9OA 4LF8F 5AT1B 2YH0A 2KXHA 1REGX 4IG0B 3CCUS 1TKZA 3RAXA 3TAMB 1G4CA 4DV5J 1NNDA 4WIIA 1C0UA 3W8PA 1U1KA 3BPDA 4QIWD 3FKBA 1MG7A 2RRAA 1JLEB 3U1MA 3CJKA 2OD4A 2JNJA 1TTHB 3FK4A 4LSLA 5KFUA 2VJUA 1HKAA 1S0VA 1B64A 4YR2A 3QZ7A 3PX4A 4DR1F 1C1CA 2VBXA 4P7TA 3G8TA 4DFKA 2CDRB 2KKHA 2QV6A 5LM7E 3MCSA 1HI1A 1RWVB 3BREA 5L39A 5F8LA 2DR9A 4TKTA 1TK8A 4UUWA 3KK3A 4PG8A 4UY8T 1HI8A 1CEZA 4CH0S 1TAUA 2OTJS 3R5AA 1T03A 3RW6A 2KG0A 2N3LA 2YXLA 4PCQA 1RKIA 3CCMS 4OIXA 4KHPJ 2ZE2A 4NMXA 3W8GA 5K20B 5D0GA 1FVSA 4WXWA 4AXJA 4ZOSA 3ZTPA 4F7VA 1RHJB 3KHLA 1FE4A 2XI3A 1G1XA 2CQ3A 3DDKA 4OX8A 1UFWA 3DLKA 2LMIA 5BR8F 1CVJA 4JV5F 4ED2A 3ZO7A 1T02A 2HKEA 1G3OA 2K2PA 4C48A 2YQ3A 3OR2A 4WFBQ 5A8KB 1RE1B 2RQ4A 2ZUGA 7FDRA 4J9OA 1FK9B 1GAOA 2AV5A 5KT4A 3G71S 4EBEA 4NCBA 3LP1B 2O5DA 1GXUA 2MQ8A 4KO0B 3ETOA 5J1PA 4A8QA 1Z2ZA 1H38A 3EDQB 3FMWA 3CIZA 4NLSA 2AU0A 1JLEA 3CDBA 3LWLA 4JI6F 4I4BA 4QR1A 1J5EJ 2ZNZA 2CQDA 4DSEA 2D69A 2AYMA 3TJ8A 3GIMA 5EN1A 2VG7A 2ZM6F 1EX8A 3VR1A 4Z2XA 3LP0B 2R2TA 3HM9A 2MXYA 1RT5A 4GC7A 4ZP7A 3DDIA 3DGVA 5F8HA 3IWNC 2NUHA 3FMBA 2V69A 3N5BA 3KJVA 3BEGB 2PMWA 1D1UA 3K0JA 3Q23A 3T5LA 1Q8BA 5KG1A 1MWYA 1TKXB 3MPUB 3PV8A 3N28A 3EJMA 4UQGA 5C5JA 2ERRA 1I94J 3S01A 4DR6J 2B8PA 4DFJA 3SQOP 3NBPA 1S0OA 4RW7A 5B0CA 2DR6A 1WORA 3FJ2A 4MK9A 3VHQA 3K5LA 1LOUA 3FC9A 3BGUA 3FRZA 1B0VA 1FXDA 1BWVA 1P9YA 2XMTA 2UV8A 1YJVA 1RAAB 4KKOA 3CJ5A 3A13A 1UP1A 2FVCA 4O3NA 3R97A 2HS0A 2LQJA 3TWZA 4EEYA 4NXMJ 4ELTA 1WEYA 1NBEB 3GR0A 3BR9A 3M2VA 2VUGA 5KG0A 1UZHA 1Q79A 3AA8A 5A8WB 1EHWA 1JKHA 4DV3F 2V67A 4UY85 8RUCA 3MR7A 2XSFA 1N34F 1AUSL 1VR6A 3AJDA 2V2ZA 3M4XA 5D4PA 2CPIA 2CQPA 4TU7A 2X1AA 2CJAA 1S76D 1D8ZA 3IAS9 4IH6A 4BWMA 2D7SA 1M5VC 4ZHRB 2XS2A 1MN7A 3G4SS 1X9MA 3LQVA 3C19A 4ZN1A 4C0HA 3HJFA 2RRBA 5CABA 1UW4A 4RUCA 4FNIA 4QWAA 3OXFA 4RUAA 4LRFA 1NU4A 1S6OA 2VB6A 5SZTA 1TKXA 1S1WA 5J2MB 3M8SA 3LF0A 2HHUA 3VZIA 4V19J 4QPXA 5KFHA 1BQMB 1J5OB 3K2YA 3DI6B 4OFZA 2DHGA 2GZOA 2WSCC 4DN9A 3KLEA 1APSA 2RSQA 2N82B 1BC6A 1GXLA 1ZA1B 2JFDA 3W9HA 3OTOF 2HAFA 2AF6A 3KJQB 1MU2B 4FVCA 3D3BJ 3OTDA 2DISA 2DEIA 1RADB 5H9FK 4JI4F 4DEZA 2ZH3A 1S9EB 3FDSA 2HLTA 4JI5J 1TL3B 1SQEA 4DMZA 4QU7A 1FKOB 1U8WA 1XEZA 2ZKTA 3HVAA 3M6UA 4ZLNA 2IBOA 4V19X 2HHXA 4ECXA 4PXCA 2PMZD 2PMHA 4NEYA 5EUHA 1KN6A 2E44A 3W2WB 4JV1A 3D6HB 2E1CA 2ZVSA 4IDKB 4ICLA 4NLVA 1UW9A 2CQBA 3EDRB 3HT0A 1XR6A 1FRHA 1KOHA 2DNYA 4GVBA 4C3LA 3BO2A 5FJ4A 2B4PA 2LU2A 4ZCMA 2LVWA 1XTZA 3LP1A 3QRRA 2J0SD 2JZ5A 2J9DE 2Y3YA 4AQYJ 1OYDA 2YX1A 1NSAA 3IS9B 3LGHA 3OD2A 3PCOB 5KFZA 3AXKA 1S1VB 3QGIA 5KT5A 3KK2B 1OY9A 1VYAA 4NA3A 1HR0F 2HHHJ 1F1BB 3SCLE 1R6VA 2R7XA 2IMWP 1LW2B 5HBMB 1RTHA 4DPYA 3OL7A 3QRQA 1TU0B 1SH3A 3DXBA 2IM0A 3HFZB 4FPRA 4WE1B 2H5EA 4JYAF 2WK4A 3C6TA 2MDAA 1FNMA 2VZ9A 4RPFA 1HWKA 5K14A 2UUBF 3EPGA 1RT2B 1KQSR 4O3RA 4W92B 1QUVA 2HBZB 4ES3A 1AZSA 1OPIA 1Y00A 1S6QA 2DGTA 1G7CB 4F2SA 5AXMA 2BXJA 4HTJA 4PZVA 1X7VA 3UD4P 1UFKA 2DY9A 1DFDA 4CLWA 1VS3A 3B78A 5KTQA 2BKNA 2DH9A 4YP3A 4OI0A 1NHKL 2RB7A 2G4BA 2VODA 1ZAXA 3ILOA 3AD9C 4URQU 1TL1A 2QA1A 2H4YB 5I3PA 1LFWA 3MEDB 1RWKB 4ED8A 1FESA 2MKSA 2DBBA 2R7OA 1N33J 2E1MC 3K57A 1A7GE 1OJ4A 4X4QA 2GNKA 1IUJA 4JV5J 5BYSA 3NGRA 5BR8J 3T9ZA 3J80U 4DV1F 2HHHF 3C3LA 3J7A1 4MYTA 4U95A 4CYUB 5CYJA 4W98A 5L1JA 3BBCA 3D4JA 1D8YA 4D3HA 2YNFA 1CJKA 1X4FA 2JVRA 4NL5A 1SKWA 3BYRA 3QNWB 2ZH8A 4BDPA 5DZ6A 1R0AA 4Y3CA 3KK2A 3UDCA 4OL8A 1FJ7A 4FXDA 4A8SA 1T94A 1M1KT 4ETZA 1CULB 3QWPA 4KH1B 3ITHA 4PWWA 1U7LA 1NPPA 3BN4A 5HBMA 1LWCB 4KBIA 2DGXA 4O44A 2G13A 2VU5A 3TAPA 1SKRA 3N9UC 1S9EA 3G6YA 3AT1B 1S57A 2MKJA 3UNYA 1YQHA 2BM0A 3NXZA 1EAYC 4AYBD 4XK8C 4ECWA 3W5ZA 2FJDB 1M1GA 5HQLA 2ATCB 2BQ3A 3MFIA 1Y3KA 3H2VE 3KLGA 2CYYA 3IBFB 4PXDA 4Y6IA 5BXIA 3WC0A 4AL7A 4B9TA 5IOLA 3I55S 1YJRA 3D0HE 4LFBJ 4CLTA 2MZ1A 2BE9B 2X1BA 2EXUA 2YWHA 1Y11A 2HK3A 2I6WA 3R7SB 3PACA 4DV7F 3TX0A 2XY5A 1MLAA 3TAMA 3OPKA 4KGVB 2IDLA 2YKQA 3C16A 3L7UA 2CUYA 5IZHA 1S1VA 2RDDA 4TYBA 3VGVA 2R8GA 4A8FA 1U02A 3IR5B 2OHDA 5KG2A 4NXMF 1Y7PA 4YUDA 3V2UC 5CQGA 4ZVTB 2UV8G 1NCLA 3IXQA 3W2VA 2XSJA 2W9CA 1DQ8A 2MKHA 4Z7YA 3GCWP 3H90A 5KOWA 5FDLA 3W62A 1V5IB 4X62F 2CPJA 5D0RA 1XC9A 1S99A 2CJBA 4IDKA 4URGA 5I42A 4WZMA 1CPZA 2XTJP 2HNZA 2Z58B 1DTQB 3G2XA 1IWAA 1XERA 3V4IB 1I94F 2QC3A 3P5TL 2RE1A 4H4MB 2F4VJ 1REVB 4NASA 2ZJPQ 2ASYA 4DV3J 4IRKA 5I3QA 1B70B 2XZTB 1LK7A 1VRTA 1ZAVA 3CF5Q 1KFSA 1UVMA 1RAIB 3W5XA 2OELA 4C2MA 3ZTQA 4I56A 1EKRA 2P2CB 1UWBA 2F7VA 5KFAA 2J6SA 1NK0A 1GX6A 4LF9J 1XNQF 4JUZA 1DLOA 3A3OB 2DH7A 3HXMA 4JI6J 2I5JA 4IFVA 4RU2A 2HS4A 2QTWA 1LNQA 3HKZD 1NKCA 4ILRA 4HDGA 2ZBQA 5H1SV 1IBKF 2ZH7A 2CG8A 1RYRA 1KVIA 3GFYA 3R5BA 4NX9A 3N79A 4P7VA 4WFNQ 2ALYB 2HBRB 4QR2A 1KONA 4MKBA 3A4TA 1TFWA 2XLIA 2VC1A 2CPEA 3A3NB 4QIGA 3BSCA 4DUTA 4ZVHA 2MQQA 1BQXA 1HQEA 2LDYA 3P3DA 3PYEA 3RRKA 4X4RA 2BJ8A 2DNMA 2VFRA 2WHOA 4J9KA 4PYAA 5IFMA 1ZPVA 1WC5A 2MYFA 2GMHA 1M1HA 2YKAA 3NCPA 3W7BA 4CCHA 4LRCA 3DRPA 1GEHA 5EX3A 4I0WA 3RUBL 2XGPA 1S10A 1SQFA 4KT0C 1FDNA 1KRPA 4KHPF 4TU8A 3MEKA 2JC1A 2F9DA 1RP5A 4OZ1A 2MSSA 2MPUA 1U24A 5KT6A 4K4VA 3KTQA 5J2NA 5B0BA 1FHTA 4N8OA 4RW8B 2IMOA 5HQMA 2VG5A 1BQNA 1VRUA 5IT9Y 2QL9B 3CJQA 1FTRA 2G2YA 1SL2A 4KO0A 3GJTB 3KG4A 4OJ3A 1TV6A 1NH8A 3CCTA 1WC1A 2NUUG 2OPQA 3HULA 1SC6A 4F04B 2B51A 3VAJA 1TK5A 1CQMA 3HK2A 1FJCA 2QJ3A 2FHJA 2X1FA 1FWPA 1J2VA 2PT0A 2RRNA 2UUTA 4DX7A 4FZVA 1P9QC 1JLFA 3OL8A 1IKXB 5A8RA 4DR5J 2QSWA 4OYAA 3W65A 4CZCA 1V9OA 4LR9A 3CB4A 3RU0A 5IT0A 2MY8A 5LL6d 2GVZB 3WHIA 4DV6F 1N36J 4BHQA 3BKTA 3MMBA 4TY8A 1V3ZA 3LOUA 4ED3A 2ZOGA 3KNGA 4LUBA 3KHHA 3AOCA 2Z57B 3V4MA 2RU3A 3OV7A 4DL7A 1VBZA 3NWRA 2P5VA 1YVFA 4ES1A 1RAGB 1NDPA 3QFHA 1M0SA 1J27A 2QG9B 2RJZA 3ILJA 4K59A 3B4MA 1UVKA 2RQKA 3P8BB 5L46A 4DV5F 3Q83A 3TUPA 4QIEA 1CJVA 2IC3A 5D15A 3TARA 4P75A 1HWLA 2AHOB 2KDOA 2WW4A 3NS6A 5F9LA 2U2FA 2C2ZB 1PG5B 2P6SA 2RILA 4HI1A 2DNOA 3EM1A 5T7LB 3HKWA 3IFEA 3KUGA 1WUUA 4HT5A 2YX4A 3H5UA 2O01C 2M7SA 4K8RA 4OV6A 4C97A 5GAHU 1URNA 3P49B 3DLEA 4B9LA 3I96A 2E9ZA 1Q7YT 1KEKA 4PQUB 1SC4B 4CH1A 4USJC 1QE1B 3LO3A 4ZLJA 5SUHA 1NEEA 1KTVA 2ZKUA 3LP2A 2W7PA 2B0GA 4ECZA 2O3DA 4KB7A 2QRRA 1P1LA 3ETMA 4Y0FA 4Q0BA 1YBUA 4QW9A 4JI8F 1TL7A 3SSSA 5E41A 1SH0A 2RKIB 4JI7F 2F5GA 4B3RJ 2H3EB 3D6TB 2Y1LB 2FLPA 3TVKA 3O5TB 4C8LA 3NNCA 5D77A 2HFOA 4HR2A 3CIMA 3FCWA 3W3SA 1MROA 2A3JA 4C9DA 2JLEA 2LQBA 1S7HA 3ILLA 3MTKA 3GLJA 4L74A 3DLBA 2LA4A 1R3NA 2H5IB 3CC7S 2A10A 5LMNF 4ILMA 4JI2J 5K8NA 3MWBA 1XIQA 3CCVS 2HZCA 5LOQA 3MM9B 1MWQA 5AXLA 3B6BA 1LWXA 1PCAA 2DIVA 4UT4A 4FF4A 2ZZMA 4ED6A 2HBQB 4M5KA 2V8GA 1KQFB 4DFPA 2GMLA 3NGTA 4I2QA 5L9NA 1S77D 1QSSA 2FDNA 1I3OB 1EP4A 2LQ9A 2ILZA 4BC7A 2R8IA 4M5JA 4CLLA 4ZIWA 1KWMA 1UEKA 2RHSB 1HNVA 2MY7A 3GJRB 3B4DA 1FA0A 3RW7A 3VGTA 1OY8A 2OTLS 4K4TA 4LFAF 2BBEA 3HFKA 5C42B 2WONA 5IT9U 2DTJA 3LWMA 3ZZPA 3LANA 3Q8YA 1YJNS 3PY8A 4M5IA 2YNIA 3R2CJ 5A6PA 2PO4A 3BH7B 3FVYA 4P10A 5GADI 2OAUA 1U1LA 1IXKA 1D3WA 5GADU 3OJSA 5DG8A 4JI8J 4QW8A 1CJKB 1YLXA 2VDHA 3LALA 5LSLA 3MCNA 3DKDA 2C22A 2PC6A 4F4KA 3PO4A 1S9FA 5KFJA 3PEJA 4J91A 4OHVA 3SDEA 3PW5A 4EYIB 5HJXA 5H9EK 1L3TA 2O1PA 2MZRA 5HO4A 2XY7A 1S1TB 1VQKS 4HL9A 3RB4A 1WHXA 2RT3A 3DLGB 4RBTA 3CTRA 1NJWA 4JV2A 3DLEB 3AFGA 3M6WA 1NH7A 2VBWA 1Q82T 1RXOB 1FO1A 3FBBA 4GO7X 1U26A 1X31C 4DV6J 2DRBA 1Y4ZB 2EG1A 5DM7Q 1H98A 2LFVA 3PJXA 4NI2A 1RHRB 4CT9A 9RUBA 1X60A 2PA8D 3POTB 2WRMA 3AQPA 4CO1A 4O3QA 3MPYA 4DU7A 3PRVA 5K8MA 1CJVB 3I4HX 3IM8A 4FXWA 4AD6A 5CCMA 3CC2S 2LECA 1VMBA 1YIJS 4ED5A 1JNRB 4C11A 3EGZA 2CQ0A 2G1HA 4I6AA 3DRSB 1VQ6S 4RNFA 1RB0A 3RB3A 2XHWA 1QTNB 3CDUA 5GMEA 3KLVA 3CMAS 5IQQA 4LF4F 4N56A 3HO1A 2P9CA 3HVWA 4YY3F 2DHSA 4B9VA 2JH3A 2FHMA 2CQ4A 2NPFA 2K3KA 2ZVIA 3SCKE 2O67A 3TYTA 2DNQA 2DNZA 2DHXA 1XNRJ 3MM7B 1IQTA 1N52B 4HI2A 3A12A 4DL0C 1MMNA 2QGFB 5HVGA 2I9SA 2QLWA 1SV5A 1WTBA 4U6PA 3Q2SC 4D3GA 2BE2A 5LMUJ 1DRZA 2ZWPA 2XMMA 3VF0B 3THVA 3LA0A 5EX0A 1JLAB 2AP6A 2OSQA 2VPXB 3IP0A 3DLKB 4NXNF 2W2QP 1H2TZ 4WIQA 3GV7B 2FLNA 1U25A 1OYEA 4RR5A 4IQXA 1HPZA 2YKMB 4KTQA 3R27A 3L9ZA 4YEAA 1Y3JA 3S1TA 1X8DA 4X4PA 1NKEA 2ZC3A 1FWKA 3FBFA 4GMKA 2E5GA 2BANB 3BBFA 4A47A 1S48A 4FS1A 1Y10A 2JLGA 3MI7X 5DLFA 3MMCB 4OYMA 2Q6CA 3TW0A 4DSJA 4MKYA 4RJVA 1E6YA 4LRAA 4DJBA 2UVWA 3IRWP 2KTQA 4IG3B 1S97A 4YOEA 2XMUA 3ZZTA 1KD1T 3BKFA 3VVUA 4DI6A 3MMJA 4C8YA 4K4SA 4MH8A 1RQ0A 4MYUA 4OHYA 2FB0A 5J2QA 4P73A 2CADA 2IYGA 2XGQA 2Y9HA 2ADCA 2C2DA 1L3SA 1TQLA 4HHUA 5K9FA 1EARA 3FUYA 4M5LA 4NMLA 3UE2A 3H5SA 5L38A 2UUCF 2A18A 1RAJA 2JHEA 3GP9A 1FDBA 1HBUA 3G82B 3QAUA 3QIDA 1SVDA 2PDAA 3P45B 3ZC4A 4X4OA 2XWXA 3GFHA 4DFMA 2GHWA 1KBRA 2X51A 2EFGA 4IR1A 4CNZA 3LW5C 4KGZB 3RR7A 4RBVA 3RBZA 5KAKA 4O4GA 3IM9A 4FBTA 4GC6A 2IVMA 2JDJA 4DUYJ 4X64J 2YNGB 2Q6BA 2DRAA 4HHHA 1PC5A 1Q53A 3IO1A 3MAQA 1BQNB 4JV0A 1ZTWA 2NCKL 3MMAB 4KYZA 4WPAA 2Q3PA 2V2QA 3DI6A 2NREA 4LREA 4ANCA 1AT1B 1WD6A 3RR8A 1W2BR 1U45A 2HS3A 5DDRC 3DGPB 1HL6A 1TV6B 4DL6A 3QBCA 2NXNA 4F2RA 1F6TA 1FD8A 4EUVA 3HSJA 3PJ9A 4B3MF 4DG1B 2QLBB 2V50A 1KKHA 2DXDA 1TL3A 2JVOA 4C3MA 4CWBA 5F8MA 1SKSA 2K8GA 4PUOA 4X62J 3M05A 2NXUA 2LA6A 2U1AA 3K5NA 2HIYA 4FKYA 1IJEB 1LW0B 1PBUA 4HH0A 3M8RA 2BJEA 4RW6A 2ZJQQ 4URSA 1B4SA 2J7WA 3DRPB 4N47A 3OJUA 5L8RC 5KFGA 4L73A 2OP5A 5DZ7A 1KHVA 1N0UA 3AOBA 1NRKA 1SI9A 3DOLB 3F56A 2YKPA 4NZ0A 2IDEA 4OMFG 5F3TA 2ASLA 2HQDA 3WZ0A 3LAKA 5B7WA 2VDIA 3M6XA 5KFIA 3EE3A 3KLEB 1X4HA 4LBIA 5B0EA 4H4OB 4LFBF 2EFNA 4LRDA 4A8MP 1RAHB 4MK7A 2B4OA 1U0SA 2MTLA 4RO0A 4S0MA 4MKVA 4JI2F 4N5SA 3RRGA 2VKZG 1OS5A 3BZQA 1RHQB 2WW8A 4C8NA 1NHVA 2QMUB 5J2QB 3FSYA 2ZZNA 3UR3C 4DF4A 3HHDA 3KLIA 5D8HB 1FNXH 4NEZA 4DV0F 4G65A 3C6UB 2YH1A 1NUEA 1QDUB 2ZD1A 3LAMA 4I69A 2DB1A 2GJ2A 2OD6A 1LWCA 4O44B 1QE1A 4ANEA 4DPWA 4GKJF 1WG5A 5F9NA 4JI3J 2ZHOA 2VV5A 4CIOA 2RAQA 4QYZK 1HHTP 1FVQA 4DOZA 2FQQB 2EEYA 1IBLJ 4HT7A 4O4GB 2UUBJ 1X0PA 3BDEA 5LMNJ 4MFBA 3EYZA 4WWSA 2K06A 2KYXA 1LEOA 1RWMB 1VQSA 2VPWB 3TUJC 1KP6A 2C2EA 1YBAA 1T8EA 1A9NB 1GMWD 4FS2A 4M63A 4ZPTR 1B0PA 2I0XA 2GIRA 2XZWA 5BYRA 2IRYA 3G86A 3VALA 1Q95G 2R8KA 2PN6A 3ZZOA 2AYEA 3JTPA 3TRGA 4DR3J 4NCAA 1JNZB 1RWXB 4ZVUB 1OMSA 4LSNB 4FYXB 4UW2A 3GILA 3M7VA 3M8QA 1WHYA 5CZXA 2VFUA 2VIHA 5ETLA 3FFIA 2HAIA 1JWWA 3EVMA 4DQSA 3RZAA 2ASDA 4NLRA 5KFYA 2XO6A 5KFDA 2XO7A 4PYDA 1U4BA 3EZOA 3LP2B 1R43A 1X5OA 4O23A 3MEDA 2C3UA 3LP0A 3KLGB 2RQCA 4K4UA 2XS7A 2FVRA 3TEGA 2HHTA 2YPZA 4PG6A 2NXCA 2PFDA 1OY6A 4RL1A 4WFYA 3TZZA 3OR2B 1OWXA 3MECA 5J1EA 4DR5F 1K8AT 2FVPA 4ALZA 5EGYA 1NJXA 1FXLA 3HFVA 2B4VA 4ZVRB 2IYIA 3M9MB 3OTOJ 1YRUA 1YITS 2FVSA 2A0FB 5ETRA 4MTPA 2KU7A 5HROA 3SFGA 4U67Q 1BMQB 2D9PA 4QZVB 3QQCD 2V4JB 4ANDA 2W2OP 1RYSA 3HLUA 4OZNA 1BQMA 4FBUA 5E3QA 4IUFA 1W25A 3PXGa 4NE9C 1T3NA 2K3IA 5HMXA 3AA9A 1Z4UA 2EK6A 1U8SA 3R3TA 1RA7A 1Y5IB 5D4OA 1N54B 3ZTSA 2V0NA 4ZPCA 5C2CA 1DZ5A 4CDIA 4JI5F 1MU2A 2HNDA 3TQEA 3Q8SB 1X9WA 1D9FA 1W2IA 1PAEX 1REVA 3K5OA 4ZJQA 2FIUA 4ID5B 2K7KA 1EIYB 1DTTB 1X4BA 5C42A 5K8OA 2QEXS 1QAJA 4CLUA 3THPA 4Y2KA 3EGNA 1F5CA 1I51B 1FXRA 3CC4S 5ETQA 4M5HA 1KOOA 1URRA 3C15A 3O8WA 2L08A 2JFKA 4KKOB 4E8UA 3RBDA 3DC2A 3NOGA 2KM8B 1U2RA 3GIRA 2XWYA 5J2MA 2Z2LA 4NOHA 3TX8A 2PI5A 1XMQJ 4DZDA 1RBOB 4ATNA 1B7YB 3W2VB 2W9CB 2V2VA 2MQPA 5HANA 3SV4A 1WWHA 1FFGB 3HCXA 2WSFC 3A1YG 2CPFA 3C8YA 4NLOA 1RK8A 1M5HA 1N34J 4PABA 3H40A 3Q8QB 2GX8A 2FC9A 5A76A 5DQIA 4B3SJ 2C3PA 2IRUA 2GJIA 1CJTB 4LMZA 1S9GA 2VF3A 3OFGA 3QATA 3U1LA 3F73A 3EWGA 4USWA 1FDDA 2FZKB 1JQGA 3MHYA 3C14B 1S1WB 4Q2MA 5CYQA 5A0YB 5HJYA 4DLGA 1PBAA 2JJ4D 2Y0SD 3J81Y 1T9UA 3V6DB 1Q86T 4PWDA 3FCHA 5LT5A 4ETXA 2NYIA 2GS8A 3D68A 4ZP6A 4NLGA 3OHAA 2JOQA 1TVRB 5KFFA 3GONA 2Y1JA 4F26A 3VAMA 2GO8A 4DQRA 5HAOA 2XCAA 2HZAA 1H2UX 2QE5A 3M2UA 3T19A 4ES2A 3MMCA 2ZDPA 4NRUA 1PKUA 4P2FA 3DRRB 3R1LA 3BQ2A 1R8AA 2YKNB 4CYUA 3FRYA 4P6QA 1WHVA 4OHWA 4IFYB 1HYSB 3D1HA 4GO5X 3RJMB 1GQEA 1WSRA 3HDSA 2D74B 2MQNA 3O2IA 2J0WA 3MUVP 1UL3A 3PW4A 2LP4A 3M32B 3M8YA 4KSEB 3HZGA 4B9SA 5HP1B 1NK7A 2W7AA 5CA5A 1IWGA 2GJFA 4K2JA 3TEHB 5B0DA 3KLHB 2RIJA 4A8YA 1RHUB 2J9DA 3BV8A 2X3DA 2Z2YB 2CQGA 3R5DA 1RJJA 4JI1F 3HSZA 1OQ3A 2K1RA 2B9WA 2F65A 3ADAC 2EFQA 2FGOA 2CZ4A 4ID5A 4ZCLA 4X66F 1F3FA 2ZE2B 3QT6A 4LT6A 1FKAF 4R0JA 3W5YA 2MQMA 1VCTA 2DPIA 4X4SA 4IRDA 1H72C 3B54A 1CS4A 2IIHA 3O1LA 3J7Z5 4OLPA 4P2MA 3BGLA 5LJ5Y 5B0GA 1TL7B 5IT4A 5ETVA 3UFCX 2NZCA 3MTJA 2H4WB 4X4UA 3RBEA 4QQBA 4L76A 2CJQA 5FD1A 2W4PA 3WIUA 3T1HJ 1YJ7A 1H3DA 3UN5A 3T1HF 2AEMA 3GR1A 4PG5A 4IO9Q 2I2YA 1UKUA 4OZ5A 3KJNB 5T7LA 2MKCA 1RAOA 2B8QA 2FPHX 1S1UA 3SFUA 2M52A 3EZUA 3I4PA 3ITHB 3KLFB 4B02A 1F9HA 1VDHA 5IM0B 1WKJA 2HFSA 2WBMA 4P72A 1HBUB 2OPSB 2AIRB 3G82A 2XMWA 3PYDA 5L1IA 2C3OA 3Q86A 4B3OB 4PAAA 3F41A 4F4AA 4UZBA 3WC2A 3I87A 4EZ6A 4TLQA 4LF7J 4OYWA 3I32A 2AMCB 4B9UA 2OI2A 3CWJA 3UD5A 3UI3A 3TI0A 3GV5B 2CG4A 5GAEU 4IOAQ 5ETPA 4CQ1A 3M2RA 2IFXA 1P8GA 1UA1A 4KPYA 1WOSA 2GVDA 2RMLA 2V9KA 1LXJA 3UN3A 4X4TA 5H9EJ 3D6FB 3P6YC 3R7BB 2UXBF 2H1YA 1X5TA 5DJBA 4DS4A 5KFSA 1HBNA 1CJUA 3CJ8A 3QLHA 5E3CA 5KFRA 2OMOA 4DLEA 3DXSX 3CO0P 3VQTA 4Q2LA 3IR7B 3Q0AA 1NK4A 3M1VB 2IA6A 3Q2TC 2GAGC 3T5JA 2L48A 3MM8A 4RNMA 1N33F 2E5LJ 3PDNA 5KFTA 1JLCB 3AB2B 2FUG9 4F3MA 4IFVB 2O66A 2MZTA 1YZ7A 6FDRA 3G9CA 1YK9A 1A0OB 2W4CA 1VQMS 1VC5A 1GH8A 1IQZA 1S9GB 4H4KC 3SDEB 4C3KA 2EK1A 2I1RA 4OHZA 1U1MA 2V94A 2PA3A 4M5MA 3VGUA 4ENOA 2EFOA 2AGPA 1B3TA 3KLHA 1ACMB 4ZVQB 4R8UB 2KG1A 3KLFA 1HNWJ 3J7AN 2POKA 1Z2LA 4PWDB 4JYAJ 3DLGA 3D1QA 2MKKA 1G2EA 2JX2A 5T41A 5C25B 2UXDJ 1IM4A 2QX0A 4CO5A 1GT8A 2BJ9A 4B17A 3N4WA 5IXUA 4U96A 3ENVA 2A2DA 1MWZA 3DRRA 4O0IA 1TR0A 3US5A 4AQYF 4KV8B 3UWTA 1ZM3A 2KFZA 1EKSA 4NLUA 4J9QA 1C1BA 2V8HA 2PD1A 2FGCA 4G3IA 1FRKA 1DURA 2E5IA 4J9VA 4OX7A 2OPPA 4F36A 1D0EA 4J37A 3BKUA 3SEOA 2EW9A 4DV0J 3M2VB 2AYGA 4CI0B 2ZBRA 1QSLA 5ETNA 2RQMA 2OKQA 1DJ0A 2KZZA 2DGUA 4A8KA 2G0IA 3V4IA 2UXCF 3DLLQ 4WP9A 3B82A 2HBYB 1VQ7S 4PWUA 2Z0GA 4LBHA 5HI7A 2DXEA 4LFAJ 4ZHRA 2A6MA 2ZH9A 2QA4S 2OJ3A 1QVGR 2HEKA 3AXMA 1F0XA 3HP6A 1HW9A 2GGPA 2DO0A 2G0JA 2YNIB 1RACB 3L4BC 1SUQB 4OYXA 1WF1A 1RT1B 2B7CB 4ED7A 1Y9OA 2QYGA 4I2PA 2BABA 2VFSA 2CQHA 2HRTA 3I82A 2IVYA 3SYZA 1S79A 1WF0A 4LF2A 2FHOB 2EFPA 1AROP 1LFPA 2BM1A 1U6BA 3H4BA 3W9JA 2BKPA 3OT9A 2DGQA 4HACA 4M95A 3BR8A 1EB0A 2R7VA 2RF2B 2BA9A 3E3XA 1ZA2B 3K58A 4DZ6A 2ZDOA 3NOCA 3CD6S 2W9AA 5DGAA 2W7OA 1C1BB 1LWEA 1SJ4P 2PI4A 2V4JA 4RX6A 1WEZA 1JLQA 2VPZB 4ID8A 1RBLA 1Q16B 2IAJA 5CZVA 5E2QA 2LQ8A 5HK4A 4LF5F 3BDPA 3WQPA 2DNRA 4ZPAA 1FWLA 2LXIA 4IYQA 2BR0A 4WU2A 2J9EA 2C1EB 3OUYB 1PJ7A 2VJVA 3N0VA 4OYPA 4AE5A 4I6WA 2KXNB 5KT7A 1KVJA 4LJMA 2UXDF 4R8UA 1T05B 3L95X 4DBQA 1UJ5A 1QSYA 3CJTA 1N8RT 1RKJA 1WG4A 2HHVA 1SH2A 4O0NA 3SCJE 2YX7A 4B3TJ 5C25A 3HSGA 1VQPS 2YWGA 1U47A 1YKWA 1UPMB 4N76A 2RKIA 2F8MA 1JLCA 2RS2A 1WNEA 4K0KJ 3MR5A 3W66A 2WBRA 3MF5A 4IQMA 4QWBA 1Y5NB 1F5BA 3MMAA 5IC6B 5A2QU 2VKRA 3CCLS 4LIRA 2UUCJ 4MMOA 2E5LF 5IQ6A 1R8BA 2KHCA 4HYKA 2P9EA 4PPDA 1UVLA 2AJ1A 3KMQA 1UEVA 4EFAC 3OXLA 2OEJA 3AOAA 1IBLF 3UO0A 2HHWA 1XQIA 2F8EX 3MMBB 1FNOA 3CEDA 4H54A 3KYLA 3MPDA 4J5OA 4USHA 4K50A 2OEMA 2MKYA 4E2FB 1OSCA 1TZ0A 2R7QA 1VBXA 1ZS6A 3PJWA 2J7UA 2IPOB 3CD5A 4FXVA 3DU5A 1Q8LA 4KPCA 2B6AB 4DV4F 1FI4A 4OZ3A 4KC5A 1EZZB 1FRIA 3AJ1A 2UZAA 1TUGB 3C46A 2B3TB 2NSBA 3GV8B 2RDJA 3CE8A 2N3OA 2NPIA 3CJKB 1HMVA 2MQOA 4OJHA 3BPSP 2W9BA 1R0AB 1L3VA 2BDPA 1RDRA 4R0EA 2HRYA 3GFXA 3ISND 2C2MB 4J7CA 1ZTTA 1T0TV 5CHCB 4ZCIA 1Q5VA 1KVKA 1NSPA 1T3OA 3GSIA 3ZTOA 2XCPA 5G0RA 1HYSA 3KKFA 1F2HA 1WF2A 4U7CA 4NCGB 3FZ2A 4ELUA 2OUGA 2CWKA 4A8OA 1FFWB 5B09A 5C7PA 3X1LB 4DCOB 1YJTA 5HP1A 5IC4B 1WI6A 3MEGA 2Z8QA 5GAHI 4KHRA 4KRWA 4OLOA 3OUYA 1SJ3P 2HWHA 1L5UA 4K4YA 2CQ1A 2XMKA 1F60B 1S4FA 1YGYA 4RNNA 3PIOQ 3KMSA 3HF5A 2PEHA 2VG6A 3EGVA 1N5TA 4QCLA 1R8CA 3CW2C 3VVTA 4XO0A 1T05A 3KNAA 2B43A 1L3KA 1TELA 4AXIA 3J81U 3V6DA 2DPJA 2CJKA 3TA0A 2KO1A 4O3PA 4CLFA 2XM3A 5JVGQ 3MPVA 4DSIA 1D09B 2RF2A 3PTWA 3NNAA 4Y00A 3DGPA 2ROPA 2LEAA 4Q43A 1KDNA 3CGIA 1DLOB 1IVZA 1JLQB 1FTCA 3DOMA 3J7YU 4ZVEA 4USMA 4ECUA 2KHDA 2ZOFA 1NK6A 3TVYA 1F2GA 3J7YI 1PSDA 5A2QY 2DGOA 4RLEA 4YHHJ 2QN6B 2ZHAA 3KLIB 3VGSA 3NCRA 4C0BA 4WKYA 4OI1A 2IM3A 3CD7A 1S0MA 1RT3B 2MZJA 2CKWA 4ERDA 1EETB 2K1RB 2AWZA 3CCWA 4Q7AA 5FIIA 5BJRA 2KB2A 4F4XA 2YWFA 4MIWA 4KJIA 2V8PA 2KI2A 5KFXA 3T3FA 4LSZB 2AT1B 4EMDA 4YDXA 3T1YF 3HPOA 2FLOA 2B9XA 3QT7A 3K5PA 1EQMA 4DCPB 3CCES 8AT1B 5G4DA 3VAKA 1PYSB 3NLCA 1TK0A 1VK8A 2ZC4A 5HVHA 5ETKA 2ZH2A 2CPZA 2E7WA 1SJQA 3CVKA 3H5YA 4FPIA 1M90T 2GQ2A 1OO0B 1UJ4A 5HROB 4ED4A 2ZITA 1XMQF 3IRXB 3IGNA 4OZ2A 4ECQA 5DRKA 3OSPA 1RWWB 4JI0F 2MB0B 1ZOTA 1UVJA 2DY1A 3GIJA 3BO4A 1LV5A 2DKOB 1E6VB 3EGWB 4G6VB 3BSOA 4CO2A 1TMMA 2E7VA 1Q1KA 1SJFA 4C8KA 1S6QB 2HLUA 3VWSA 2BYCA 1VQNS 3CDWA 4WU3A 2XMAA 3CCRS 3CCSS 4OX9F 2LEPA 2BOPA 3GJQB 3K7RA 1S6PA 3QGHA 2AW0A 1HMVB 1HNZF 1NM2A 2CQCA 2FY8A 2XEXA 1MMDA 3GJSB 4B3RF 2HIQA 1EJ7L 2L9NA 2A2CA 5KG6A 3JYTB 2IY5B 5KFBA 1Q5YA 2QLFB 2XZDB 4G1PA 1JMTA 5HATA 4LSNA 4X65J 4DF8A 1XN9A 2KRRA 3PM9A 4YB7A 3HVTA 3QGPA 1ZZFA 2OPQB 3ULHA 3U7JA 3EX7B 1RABB 2IC3B 1A6LA 3TJ9A 2ROEA 3ET6A 3VV2B 3GIKA 5I3UB 1N5VA 2VASA 3D5MA 3MFHA 1M5SA 2B7BB 5F8IA 2NQPA 3OVBA 1R8PA 2F4FA 1RT2A 2VD3A 2ZNYA 3R6GB 4Z37A 3I9ZA 5LSRA 4XPEA 3NMAA 4OHXA 3Q89A 1BD6A 1JLAA 1GFWB 4C8MA 3T1AA 2ZJRQ 1S6UA 2E9RX 4ICLB 4O3OA 3CCJS 4DR7F 2QL5B 1TP7A 4LF1A 3UNGC 4EBCA 3KOAA 1DTTA 1IKWB 1FRJA 2BJ7A 4R5PB 2HMIB 2RVJA 4DL4A 4P9SA 4NLTA 1T9WA 4KY3A 1SKUB 1ICEB 2BJ1A 3NEKA 4DDFA 1UWAA 2MJNA 3QJJA 4TU9A 1K1SA 2R2UA 2BW2A 3AJ2A 3SV3A 1I6JA 4F0HA 2FC8A 4U9RA 4KH0B 4B9MA 4CM2A 2GA7A 1S6PB 2CRLA 2LLZA 2YNFB 5KG5A 4U7UK 1NXIA 1N6QB 2JEIA 3PR5B 1N36F 2M3DA 3JYTA 3CT9A 1WOPA 2EKYA 3C6TB 2PSZA 3PG9A 3SBMA 2V9WA 3NCQA 1IR0A 2MGZB 1B7FA 2KM8C 3PZPA 4DR3F 4PKDB 4K0KF 1S1XA 2BQUA 2DVIA 3T6JA 4ZA1A 4FYWB 3QMQA 1FJEB 5DO2A 1T11A 4PQUA 1RU1A 2M8HA 3R6LB 1WJ9A 3TP2A 1C4CA 3MM5A 4C6AA 4LF6J 2NXJA 4ZVSB 2HRUA 4NZ6A 3H7HB 2D3OR 1CJTA 2BOAA 1KC8T 2DNLA 4LVOP 3E8OA 1JJCB 1NO8A 1ITPA 2DCUB 3U27A 3J7ZT 1U1RA 4AL5A 3MUTP 2G2ZA 2MHNA 5FLXU 4JI3F 3RB0A 3W1YC 4GKKF 3QGGA 2LQ5A 4FYVB 4WJBA 4DSFA 3SQGB 2AX1A 2DD8S 2XYGB 4JP8A 2AKWB 2YWWA 3GIIA 2DNGA 1VQOS 2MHEA 2HGMA 3S6EA 2W8KA 1I5OB 3W64A 3F0NA 2FJAB 3P5BP 1ZBTA 5GMKa 4J9PA 2VFTA 4JBCA 2OGUA 2VBZA 2GHPA 3QIPB 4HLBA 4CTAB 3MR3A 4K5SA 2AGQA 3G6XA 1U1OA 2NS1B 4IFYA 4LIWA 1SB6A 1XMBA 4Q8EA 4P2XA 1SJ1A 2NSCA 1BE4A 3BF4A 1N4LA 4ZVGA 4RW6B 2GMJA 2QT7A 3D0IE 1MNEA 1JLBA 1YRXA 3D6MB 1S1TA 2EVZA 4R25A 4XAKA 2YQ1A 4CLSA 4TXSA 5A8WA 5I42B 4F4YA 5KFEA 4DWIA 3JSMA 4LFCF 2HVHA 1JK9B 2HWTA 1PYTA 4J9MA 1U49A 1QAIA 3PW7A 3MDFA 3EVOA 2V8VA 3HSDA 1FKOA 2ZZTA 3BO3A 4GKKJ 2KT3A 1I1GA 5GAEI 3QT5A 4O4RA 4F3QA 3CCZA 1XNQJ 4DUZF 2VA2A 1GTEA 1VBKA 1WOOA 1TVRA 1XR7A 3NGSA 4IO1A 5DDOC 4G1QB 1X4DA 1BLUA 4XTTA 1FEHA 3T9NA 1ZM9A 2F8HA 3OR1A 3E51A 2VONA 4OZ0A 1SQGA 4DQIA 3GZ7A 2GW8A 3HT3A 3PO5A 3UPFA 3T1YJ 2Q66A 3SQGA 1V5VA 5IWAJ 2V4QA 2XC9A 2HSEB 5LJ3Y 2QMXA 5F8JA 2EPIA 2KN4A 1YRTA 4JI7J 4WXOA 3M30B 2J5AA 3QWUA 4USTA 3CJ3A 5JUMA 4Q45A 5AE3A 3QAEA 4YMEA 3FZBA 1HIYA 1MMLA 5D0EA 5IV4A 1WEXA 1U1PA 4CLZA 2HNZB 3O44A 5MAOA 3TZWA 1U09A 3OLAA 3G96A 1GK8A 4ZMMA 2E1AA 4RUHA 2W1BA 2FLLA 3AODA 2OEKA 4OV1A 3QO9A 5E33A 5C24B 1HW8A 4XDDA 4UQTA 1K73T 2JRSA 2ZBPA 4F3OA 5DQHA 5D4LA 3MEGB 4X64F 1HBMB 1R89A 3MEEA 4KR0B 1BUXA 4M8LA 4CLYA 1IKYA 2DJWA 1VI7A 4AUKA 2IA0A 1BXNA 1XJWB 2Q43A 2FD2A 3I5BA 4QYRA 5I4MA 3UW1A 5F8GA 1H7XA 4DS5A 3M2RB 4ZS6A 4USIA 1NSQA 3UDLA 2GVDB 2M5YA 4C7QA 3PW2A 4OYBA 2ACMA 4DCJB 3DNCA 3AH6A 1FKPB 4ZP9A 1KNZA 4CT8A 4C11B 5EHHA 4YFUA 3IN5A 2BJDA 2BANA 3OTEA 2ZBIA 1FDAA 4QIFA 2MGZA 1DARA 4LRBA 3SMZA 3ISZA 5M2UA 3Q8UA 1KLNA 1H7WA 1Y5LB 2OMLA 2MQLA 4HVZA 3BGFA 3TNVA 4KGKA 4CTAA 1E6YB 3J80Y 2DR5A 1WDTA 4DL3A 1N5QA 3JSBA 4MIBA 3VAGA 3E2EA 1QLNA 5F8NA 3CD0A 3K8WA 4YB5A 3U02A 4J9LA 3A8KA 1RT4B 3ZTRA 3PW0A 1NPRA 2CPDA 1ZM4A 4PXEA 4K4XA 2MMYA 1OPZA 3H98A 1WKLA 3VAFA 5DDQC 1D9DA 1X0FA 4ZKAA 1R0CB 3TOQA 4DV2J 2D9OA 3SI8A 3NY0A 1HHQA 3ENQA 1AUDA 2YKOA 1RCXB 4HKQA 3KG1A 3IR6B 1UJ6A 2Z4PA 4OI6A 3FCVA 5J1EB 4C98A 5AXKA 3OSNA 1F5AA 4NLDA 2VQEF 2VC0A 1AYEA 2L3MA 5KFMA 2V2KA 1VQ4S 6FD1A 4FYDA 1TL1B 4KFBA 3I9V9 4KQZA 2BX6A 2QZ8A 4Y2AA 1QVFR 1N88A 5DETA 2IM2A 1RT7B 2R7RA 4EYHB 3AY0A 2DGSA 1YBTA 1R0BG 2GHVC 2ILYA 3JTOA 3DHXA 3DMJB 2ZH4A 4QWDA 2KJVA 2XBPA 3RRHA 5A8KA 4JOUA 4IG3A 3R8YA 1FKPA 3QZ8A 2W2MP 4NRTA 1C2PA 3L09A 3MD3A 4W4MA 4EWTA 1U0HA 2GV1A 2HQCA 2WVBA 3Q8PB 5BYQA 2ZH6A 4LR8A 1YG0A 4YY3J 1JXLA 2AD9A 1K0TA 3OFEA 3AD8C 4E98A 3K5MA 1GTHA 1IKXA 3BSAA 1IBMF 3QRPA 2M2BA 3MM6A 1Q8KA 2E5HA 3TA2A 1S0NA 4B3TF 4QU6A 2B56A 1QJHA 2GVZA 1F3VA 1LWEB 2CZVC 1RT4A 1JXEA 1TL4A 2CJXB 2CNLB 2H48B 4QIVA 5AE2A 1T7PA 5LMUF 3QO9B 5C24A 4ILLA 3HD2A 1LW0A 3DM2A 2HVIA 2I8EA 1OQ6A 5ITHA 3UDVA 4M5NA 2XI2A 3OLBA 4DR2J 2F1FA 3MUMP 3KUHA 2CAJA 2LDIA 3TZXA 3DN9A 4G1IA 1NK9A 2ZEJA 2CIMA 4ECVA 3CJ0A 3IC1A 3G6ES 2JEFA 4MIAA 3F44A 2WTFA 3DLHA 4WFXA 2BKOA 1DQAA 3LGNA 4OX6A 4LF9F 4HACB 2R2SA 1CS4B 4RW7B 5E7OB 2H54B 3O6QA 2WAQD 4H4OA 1ULRA 2KT5A 4ZPDA 3ZFVA 4J9RA 3U1NA 2F40A 4DR4F 1KR4A 2XS5A 3M2UB 1YTYA 1T9VA 3SXLA 3MD1A 4ZPWR 3DHWC 3OL9A 4I2QB 3OL6A 4TY9A 4PQAA 2AZ1A 4DV7J 4JI4J 3MR2A 5B0FA 2BEFA 4RU9A 1VC0A 3TO8A 3EZ5A 1FX2A 1S49A 1X9SA 1NJIT 3NMRA 1IM6A 4RW9A 3W9IA 2BJ3A 2M0GB 2RHQB 4PEOA 3C2PA 1RWOB 2HNYB 2GCFA 3C6UA 1NKBA 2BV3A 5DQGA 1AW0A 1QY7A 1Q0NA 2C3YA 1HQEB 2OPRA 2IJFA 4J9SA 3W60A 2H5JB 2J7KA 2C2KB 3QPIA 4M5DA 3MZIA 4TLRA 3HHLC 5D0HA 4QPTA 3I5AA 5F0UA 5B0AA 3N6MA 5HQ8A 2W25A 2C2RA 2E5JA 2C3MA 2LXFA 2HFZA 5HSPA 4DUZJ 2AJ2A 1WSVA 1W7WA 1ROFA 1N32J 1C0TA 5L9XA 2X3GA 1XR5A 3DYAA 4PXBA 2OLWA 2OFHX 3H8YA 4WK1A 1YJWS 4WZQA 4IOCQ 3MXHP 3S8SA 2WOMA 4I7FA 2Z56B 4YR0A 3SCIE 3CO9A 1NDCA 3PR4A 4NA1A 1FCAA 5ETOA 5DG9A 5KG3A 4IR9A 2ZBCA 4K7QA 2JC0A 1QAYA 2JL9A 4LQ9A 4Y2CA 4Q8FA 1IKVA 2RS8A 3FQLA 2MLYA 5KFCA 2QFJA 3MM8B 2J8SA 2UU9J 2EBGA 3ENWA 2Q79A 5F3ZA 2DNNA 2I38A 1YDLA 2VQFJ 4U8VA 1VBYA 1HWIA 1GXTA 4RUBA 5T14A 2KXFA 5A6WA 3MM6B 1XMOJ 2EFVA 1NK8A 4U8YA 3H5XA 2UXCJ 3QSIA 4F4WA 4ZVFA 1WELA 5HN0A 4ZPBA 3A8IA 3NAIA 1DQ9A 1GMVA 1N0VC 1NZAA 5LXRA 4TNOA 4DUYF 2KVQE 3WX8A 4RW9B 4FNHA 6AT1B 3G87A 1UA0A 4B08A 5J2PB 1KQKA 2RD5C 1TMJA 2DR7A 3GU0A 3QJLA 4DR6F 1R27B 1T9YA 3EICA 3HHLB 4TY8B 3CXCR 1VQYA 4OI4A 3JSYA 2DHAA 1FJGJ 2HW3A 1NSKL 2CJYB 4RWXA 2EG2A 2QLJB 1N6QA 4BWJA 2VG5B 1B0TA 3SZ2A 3OTBA 2ZH5A 1HBNB 4EK2A 1TKDA 2EC0A 2N7CA 1PJ6A 5CH7B 1YJ9S 3TVZA 5GMDA 5KFKA 2DGVA 4YR3A 1FRXA 3CJRA 2EI5A 3IG1B 4DHVA 4WYLA 5HL7Q 1ZAWA 4Y2IA 4IRCA 4K2XA 1TKTB 4DPOA 5LSOA 3BQ0A 3GCXP 4LVNP 4OZJA 1Y0HA 3CPWR 2BQRA 2WVFA 1CLFA 3LGMA 1VJWA 2J0QD 3JQKA 3FSXA 3NS7B 3UCGA 3POTA 2GC8A 4IOBA 2YY3A 3ZZUA 3RB6A 3K59A 3KDNA 3MPWA 4QWCA 2AYBA 4L6V3 3PNIA 5J1NA 3D0GE 1WC4A 1PC4A 3A3PB 3CDEA 4Q44A 1QTMA 3PHTA 3IGVA 2R9LA 1SBRA 4CP5A 2ACYA 1X5SA 3TQ1A 4RNOA 3JAMU 1RLCL 2YQ0A 4LF5J 4LBPA 4XIUA 3R1HA 3R5CA 3JS9A 4LSLB 4RNHA 5D78A 2CJ9A 4LF7F 1FD2A 1RLDA 4PRFA 4OJ1A 4UF4A 2LEBA 4LQ3A 2VA3A 1SV5B 4HHJA 3PKYA 1VIXA 2P8IA 3FEXB 4RBUA 3FSIA 4EO8A 3H2LA 3ONQA 3IG1A 2CNOB 4RKUC 1EQ0A 4UOFA 1EETA 3FEYB 2J6UA 2R8JA 2IAJB 4X66J 4QWEA 1RTIA 2Z30B 3CNQP 4ZP8A 4ZJLA 1XWLA 2CXEA 4A8XA 4CRJA 1HBMA 2DO4A 3PX6A 1J5OA 1EP4B 1F9EB 2ADBA 3NL0A 1HNZJ 1FRMA 1BHNA 3DDNA 4RW4B 4K5RA 4DSLA 4OYIA 4A4JA 4EBDA 5KFOA 3N01A 1RT1A 5DM6Q 4LF8J 1C0UB 1X5PA 2YBVA 4E0DA 2E1RA 1Q7LB 2D3UA 3PYFA 4ITSA 3DOMB 3GB0A 4N7TA 1VLOA 3PKMA 2MLXA 1N32F 2BUNA 2OFGX 3MURP 1HD0A 2HG4A 4NLYA 1PJ5A 4ZN3A 4KGXB 1IKVB 1RZMA 1NB2A 1WACA 2LCWA 3UR0A 1X4CA 1RGVA 4JI0J 3IWXA 4CO4A 1UETA 2HGNA
chains in the Genus database with same CATH topology
1RHMB 1RWNB 1QDUB 1PYOB 2QL5B 3IBCB 4DCJB 1IBCB 1ICEB 3R7SB 3R7NB 4DCOB 5IC4B 2C2ZB 4ZVPB 2FQQB 4JB8B 2QL7B 1RWMB 2HBYB 1SC4B 3RJMB 4ZVTB 2XYPB 1RWXB 4ZVUB 3KJQB 1RHUB 1SC1B 2Y1LB 3R6LB 4ZVSB 2XZTB 2CJYB 2QLJB 2CDRB 2H5IB 3D6HB 1RWVB 2P2CB 1RWPB 3EDRB 2H4WB 2HBQB 3P45B 2XYGB 4ZVRB 5K20B 1RHKB 1I3OB 2C1EB 1RHJB 2HBRB 3KJNB 4LSZB 3GJRB 2H65B 3NS7B 3P4UB 4DCPB 1BMQB 2CJXB 2CNLB 2H48B 3KJFB 1RE1B 2Y0BB 3D6MB 3SIPB 2HBZB 3EDQB 2QLBB 1RWWB 3D6FB 3R7BB 2DKOB 2QL9B 5IC6B 2H4YB 1I51B 1RWKB 2H54B 3GJTB 4ZVOB 1PAUB 2CNOB 2C2OB 3GJQB 3R5JB 3GJSB 3QNWB 1F9EB 2XZDB 2QLFB 1RHRB 1RWOB 2H51B 4ZVQB 1GFWB 2H5JB 2C2KB 1SC3B 2CNKB 1NMEB 1RHQB 2XYHB 3R6GB 1QTNB 2CNNB 3IBFB 2C2MB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RHM B;  1RWN B;  1QDU B;  1PYO B;  2QL5 B;  3IBC B;  4DCJ B;  1IBC B;  1ICE B;  3R7S B;  3R7N B;  4DCO B;  5IC4 B;  2C2Z B;  4ZVP B;  2FQQ B;  4JB8 B;  2QL7 B;  1RWM B;  2HBY B;  1SC4 B;  3RJM B;  4ZVT B;  2XYP B;  1RWX B;  4ZVU B;  3KJQ B;  1RHU B;  1SC1 B;  2Y1L B;  3R6L B;  4ZVS B;  2XZT B;  2CJY B;  2QLJ B;  2CDR B;  2H5I B;  3D6H B;  1RWV B;  2P2C B;  1RWP B;  3EDR B;  2H4W B;  2HBQ B;  3P45 B;  2XYG B;  4ZVR B;  5K20 B;  1RHK B;  1I3O B;  2C1E B;  1RHJ B;  2HBR B;  3KJN B;  4LSZ B;  3GJR B;  2H65 B;  3NS7 B;  3P4U B;  4DCP B;  1BMQ B;  2CJX B;  2CNL B;  2H48 B;  3KJF B;  1RE1 B;  2Y0B B;  3D6M B;  3SIP B;  2HBZ B;  3EDQ B;  2QLB B;  1RWW B;  3D6F B;  3R7B B;  2DKO B;  2QL9 B;  5IC6 B;  2H4Y B;  1I51 B;  1RWK B;  2H54 B;  3GJT B;  4ZVO B;  1PAU B;  2CNO B;  2C2O B;  3GJQ B;  3R5J B;  3GJS B;  3QNW B;  1F9E B;  2XZD B;  2QLF B;  1RHR B;  1RWO B;  2H51 B;  4ZVQ B;  1GFW B;  2H5J B;  2C2K B;  1SC3 B;  2CNK B;  1NME B;  1RHQ B;  2XYH B;  3R6G B;  1QTN B;  2CNN B;  3IBF B;  2C2M B; 
#chains in the Genus database with same CATH topology
 1R8H A;  2WCX A;  2YKN A;  2M88 A;  1HBO B;  1PYO B;  2FHJ D;  3IRX A;  4PUO B;  3IBC B;  5E3P A;  4ZPV R;  4WK3 A;  5HMZ A;  4IH5 A;  1P27 B;  1VK3 A;  2AQ4 A;  1HNX J;  3TUI C;  3UVJ B;  2E66 A;  1E6V A;  3IBW A;  2YPY A;  4JB8 B;  1RSC A;  4XDC A;  3OVA A;  2XUL A;  5KOX A;  1HHS A;  4WTY A;  4H4M A;  1UVI A;  5KT3 A;  2ZD1 B;  3GE9 A;  3DOL A;  4OQJ A;  4ECR A;  2YNG A;  1SL0 A;  4ZLP A;  2GIF A;  2CDQ A;  2DNP A;  1MRO B;  2CPY A;  4FF3 A;  1VRT B;  3ZZ0 A;  3UCU P;  3ZNJ 1;  2WVE A;  4LFC J;  2MZS A;  3GYX B;  1AB8 A;  3L7P A;  3PHE A;  1IBK J;  2AJF E;  3BSN A;  1HD1 A;  2N4D A;  1J5E F;  2NLW A;  2RNE A;  3OXG A;  5CD4 A;  2HVZ A;  1RAE B;  2MKI A;  1BGX T;  4OYO A;  4YB1 P;  4NPO A;  2BW7 A;  2B9Y A;  1VHF A;  3I5C A;  1R7I A;  2I5J B;  2Y8Y A;  1K47 A;  4W90 B;  1U0H B;  2V4R A;  1VOM A;  2R7W A;  1RTD B;  1RCO B;  2GFF A;  2HPU A;  4ER8 A;  5JJB A;  2COL A;  3O3L A;  2BRK A;  2JSX A;  1JX4 A;  1Q78 A;  1RBA A;  5M2P A;  1RWP B;  3GYG A;  2VBY A;  1HNW F;  2CQ2 A;  2YNH B;  3GYN A;  3M8Z A;  4F0M A;  4USV A;  3M9O B;  1HNX F;  4USU A;  3KHR A;  2XNR A;  1WDD A;  2W01 A;  3MOJ B;  1WC3 A;  1WG1 A;  3DU6 A;  2W4D A;  3CJS A;  1T9X A;  4F50 A;  2DRD A;  2KT2 A;  3KK1 A;  3BH6 B;  4DV2 F;  5CXT A;  2YWK A;  3NBP B;  3BYP A;  1DBD A;  5F41 A;  2GQC A;  3TJA A;  3NKY A;  4X84 A;  1YSJ A;  2C28 A;  1K9M T;  1GX5 A;  2QFI A;  2H65 B;  3JAM Y;  2M8D B;  1VJQ A;  2B6A A;  1M5O C;  1IR1 A;  2DCL A;  1CSJ A;  5KFL A;  1NJZ A;  5FLX Y;  1DAX A;  1UAW A;  3DMJ A;  1NK5 A;  3MEC B;  2X7I A;  2WB4 A;  3ELH A;  3ET6 B;  4P52 A;  4ZLL A;  2D3O 1;  2NZ4 A;  2Y0B B;  2VQE J;  4ED1 A;  3R5G A;  1N48 A;  5KFN A;  2DR8 A;  3EXY A;  2XB2 D;  1VRQ C;  4BBY A;  4ZIT A;  4ELV A;  5CAA A;  4WF9 Q;  1AA1 B;  1XBW A;  4MAK A;  4ED0 A;  4YN3 B;  4C8O A;  2E9T A;  4TVA B;  3FBE A;  1FT8 A;  2W24 A;  3D9B A;  4DU8 A;  1LW2 A;  4Y65 A;  5G0R B;  2HQF A;  5IM0 A;  4I68 A;  3M9N B;  3QJP A;  1C1C B;  1T9T A;  4DX6 A;  1VQ5 S;  3AHP A;  3UD3 P;  1QD1 A;  3ILI A;  2FY1 A;  5A8R B;  4LF4 J;  2R7T A;  3X3U A;  3ZXW A;  1H6K X;  1UCN A;  1UTA A;  2C2N A;  5GAG U;  4V1A k;  1JJH A;  5E0O A;  3KK3 B;  3MAA B;  1PAU B;  3OBI A;  2J9C A;  3JTN A;  1YZ6 A;  5DGB A;  1WTF A;  2M70 A;  2UUA F;  2IM1 A;  5J2N B;  2A1B A;  2KZM A;  4FYY B;  2Y1I A;  1RIS A;  3MCM A;  4P74 A;  1ZET A;  1HNI A;  2Z2M A;  3G8S A;  3R2D J;  5HMW A;  1NDL A;  3LPE A;  2BAC A;  3PRD A;  7AT1 B;  1F9F A;  2HHQ A;  1U6F A;  3OVS A;  3V6K A;  2FZC B;  1H74 A;  1UZD A;  1HI0 P;  3DOK A;  1JXV A;  1SC3 B;  3MM7 A;  4M5G A;  3H20 A;  3LPY A;  4MJK A;  1CG2 A;  3JSR A;  3RYL A;  2Z2Z A;  3KWM A;  3CUN A;  1AZS B;  4JI1 J;  1RTJ A;  2DHH A;  3V81 B;  3HHE A;  2HGL A;  3I0R B;  3LUY A;  1V3S A;  1RAF B;  2YNH A;  3H0P A;  1GNK A;  2KVI A;  2QMW A;  2OPR B;  3JXO A;  4GKJ J;  3ICL A;  5M2R A;  3M8P B;  1DY3 A;  1UPP A;  5CYM B;  5KT2 A;  2CFX A;  2ZWO A;  3TZY A;  1FF2 A;  3R7N B;  3QT8 A;  4AL6 A;  2V5H G;  3BBB A;  3MEE B;  3JB9 k;  4X4N A;  2R2R A;  1QUP A;  1FER A;  4B3S F;  2IHR 1;  4N77 A;  3EUN A;  1SL1 A;  2GIQ A;  2HWI A;  3PEH A;  1RTH B;  4AT1 B;  2MEW A;  2UU9 F;  5C2G A;  3D28 A;  5JVH Q;  1HWJ A;  2CWX A;  3FGV A;  1ZH5 A;  2XYP B;  1OIA A;  4PG4 A;  4YQW A;  1M5K C;  3V5R A;  1JLB B;  2GO9 A;  2APO A;  4N8N A;  4U7U D;  2CPX A;  1RT3 A;  2BMB A;  3R9L A;  3VCD A;  4PG7 A;  2CVE A;  3G8Q A;  1RTZ A;  4DG1 A;  1S7I A;  3LH2 S;  2Y8W A;  3MOZ A;  2DYA A;  4P2S A;  2L9D A;  3HI9 A;  3W61 A;  4WP8 A;  3J81 j;  2XG8 A;  5E5N A;  1O0P A;  2K7J A;  3VZH A;  2W2P P;  1VIS A;  4I64 A;  2VQF F;  5FDL B;  1HNV B;  1K1Q A;  1UFL A;  4P71 A;  3I0R A;  1GMW A;  2AZ3 A;  1SJR A;  2RUS A;  3C15 B;  3OR1 B;  4C0O C;  4YDD B;  5KG7 A;  4EU0 A;  2QA2 A;  1HLW A;  1KFD A;  1AFJ A;  2G0C A;  4ECS A;  1OSD A;  2LU1 A;  4QR0 A;  2MZQ A;  4DPU A;  2FVQ A;  3PX0 A;  1FK9 A;  3OFH A;  1R31 A;  1RHK B;  2QO3 A;  3A8E A;  1CC8 A;  2VHG A;  2F9J A;  2LYV A;  3H2U B;  1HQ2 A;  3ZNU A;  4AFF A;  4MKA A;  2W8L A;  1O5J A;  1WI8 A;  4IH7 A;  3FQK A;  5KG4 A;  5HLF B;  1IJF B;  1HFE L;  2CA9 A;  1UWB B;  2HK2 A;  3AB4 B;  4OZL A;  3RBX A;  1CUL A;  1H73 A;  1R6Y A;  4DX5 A;  5HMY A;  5ADZ A;  2VH7 A;  5JMN A;  2HYI B;  4F02 A;  3RG6 A;  3T5K A;  3GFZ A;  2X1G A;  4K4W A;  1YJU A;  4OYZ A;  4UOG A;  4Y28 C;  2XSJ B;  4EO6 A;  5B08 A;  1X4G A;  2WZ1 A;  3L3C A;  1YX2 A;  5ETT A;  1VQL S;  3SIP B;  2IJR A;  3HVR A;  2DT9 A;  1U2F A;  3JQJ A;  1DTQ A;  3MAA A;  4NWB A;  2EKN A;  3I6P A;  2AEF A;  1K44 A;  4NYP A;  3SSQ A;  3CMQ A;  5DS7 A;  3MM5 B;  3I31 A;  5THW A;  4F25 A;  4LR7 A;  4TQR A;  3CCQ S;  1KTQ A;  3IA0 A;  4DR2 F;  3HHN B;  1V6H A;  1O6X A;  4KFB B;  2P6T A;  4NLW A;  2IVF B;  1HNI B;  1FE0 A;  4F0K A;  4RW4 A;  4DR4 J;  4FP9 A;  2XNQ A;  4RWW A;  3N5F A;  4ZJO A;  4YS2 A;  5CD4 H;  5EWG A;  2ROG A;  4KIA A;  3V6H A;  2C2O B;  2G2O A;  2BVZ A;  3GTY X;  3B8H A;  2PE8 A;  1B99 A;  2JWN A;  3EMT A;  3D7S B;  2V63 A;  3WBZ A;  3NG8 A;  1KHW A;  4NYZ A;  1U1Q A;  3CSK A;  1O8B A;  2SXL A;  1DHM A;  2RU9 A;  1H2V Z;  2HQG A;  1IN0 A;  3QIP A;  5K5M A;  2OH2 A;  1K0V A;  3M1V A;  2MJU A;  1NHU A;  2DNH A;  5DDP C;  1S1X B;  2H51 B;  2JEG A;  3D66 A;  4BC9 A;  2B9E A;  2HMI A;  2B4U A;  3N6N A;  4NCG A;  8ATC B;  1CC7 A;  3BJY A;  3H4D A;  4KHM A;  4WTO B;  1NME B;  4TN2 A;  3AQO A;  3DM2 B;  2WVD A;  3BN7 A;  3HHL D;  2ZM6 J;  2AGO A;  5EWF A;  4DL5 A;  1IBM J;  2XYH B;  1FJG F;  1Q81 T;  4J9U E;  2UXB J;  3NGK A;  2HND B;  1JJ4 A;  2HHS A;  4NI2 B;  3KXD A;  4WBF A;  2ABY A;  4F67 A;  2QA4 G;  2XY6 A;  1NB7 A;  4WKR A;  4ZK7 M;  1KS2 A;  5LXY A;  1Q8I A;  3D1O A;  4QBU A;  4UZC A;  4DPX A;  5EWE A;  3E01 A;  1HPZ B;  5AJ3 J;  4IKA A;  4N41 A;  1GMU A;  1WKK A;  2PGC A;  2V34 A;  3AAW B;  4CNY A;  1SIW B;  2HFU A;  3DRS A;  4ZVP B;  5DLG A;  3VAI A;  2KRB A;  2W9B B;  5D3G A;  3IS9 A;  3NGU A;  4FDF A;  1TAQ A;  1U6Z A;  1XMO F;  1KLM B;  2CVI A;  1G6B A;  1V3R A;  4DR1 J;  3FFI B;  3TR5 A;  1RA6 A;  4FN5 A;  2XHC A;  1HQU B;  4FVM A;  3KFW X;  2H9Z A;  1RTD A;  2AJQ A;  4DX8 H;  2R7S A;  1VC6 A;  2GAH C;  2IRX A;  1YWX A;  4WE1 A;  4UOC A;  2IBK A;  4ECY A;  1AFI A;  2PFF B;  2QSF A;  4CM0 A;  1Q4R A;  4I1T A;  1CBK A;  3W2W A;  2Q1L A;  2BE2 B;  1LWF B;  1RI7 A;  3P96 A;  4UTG A;  3OQ2 A;  3HMJ G;  3BQ1 A;  5L1L A;  1HWU A;  2NR0 A;  3KDO A;  2CPH A;  2HZV A;  1T03 B;  3FBC A;  3CME S;  2Y1R I;  4NZ7 A;  2HUR A;  2OSR A;  3M8W A;  2L9W A;  2VOP A;  3EXC X;  1N56 A;  2GGP B;  4H4K A;  4DSK A;  2M9K A;  3A8J A;  1RT6 A;  3PRB A;  4NLP A;  1SUQ A;  1P6T A;  4USK A;  1TKZ B;  3S7R A;  3TA1 A;  3C14 A;  5A0Y A;  3WIV A;  3ZZZ A;  1ZM2 A;  3IMQ J;  2L41 A;  3FNN A;  1D9A A;  3NWG A;  2ZOM A;  2JLF A;  3HHL A;  3UQS A;  1IR2 A;  2HVD A;  5F0W A;  2WVC A;  3ZZY A;  3HHK A;  3HZE A;  1KQG B;  4B3M J;  1QM9 A;  2WB1 D;  3HD1 A;  5ETS A;  2KH9 A;  4WYW A;  4A8W A;  2R7U A;  4BCA A;  3BB5 A;  5IWA F;  3KG0 A;  5MLC V;  3D2W A;  1NPK A;  4X2B A;  3MAH A;  3P4U B;  4QOT A;  2VL1 A;  4DV4 J;  4K4Z A;  1BWE A;  4YHH F;  4C4W A;  3KJF B;  1MW7 A;  4MT1 A;  2DK2 A;  4TQS A;  4I67 A;  1X4E A;  3M32 A;  3NGD A;  3UDE A;  2J8A A;  3IWL A;  5GVQ A;  1UEU A;  4HDH A;  3RGI A;  3DYA B;  1QAX A;  1O51 A;  3TUZ C;  3TAQ A;  1SCJ B;  4EZ9 A;  1H0H B;  2DGW A;  3WX4 A;  4PPZ A;  3ISN C;  5L1K A;  1NDK A;  1JIH A;  2EBE A;  3BS9 A;  4Y2M A;  2WON B;  3QYY A;  4CO0 A;  2J6T A;  1Z1Z A;  4M1K A;  2AJ0 A;  5H9F J;  4ZIV A;  1NJY A;  5RUB A;  2A6O A;  2FJW A;  3DRX A;  7FD1 A;  4C8Z A;  2BZ2 A;  5D3G B;  2UUW A;  3C16 B;  3OW2 R;  2N4C A;  2WSE C;  1S5Z A;  3H25 A;  1S72 S;  2IJN A;  4Y34 A;  3T5H A;  3EVW A;  3MGJ A;  3DFE A;  2YTC A;  2VOO A;  3C66 A;  3HX9 A;  5D4N A;  3GSD A;  1JKH B;  3H59 A;  3IAM 9;  4ZDN A;  5CCL A;  1ZZN A;  2R8H A;  5AJ3 F;  2M4M A;  4PR6 A;  3Q8R B;  1RT5 B;  2FHK A;  2OO4 A;  3K8V A;  1WHW A;  2FZG B;  3VAH A;  1LXN A;  1RU2 A;  5U47 A;  2GQQ A;  4L75 A;  3E01 B;  4QYZ J;  3M8P A;  4HH1 A;  5CYM A;  1VFJ A;  4OJG A;  2OPS A;  3MCO A;  4TYA A;  2KFY A;  4MK8 A;  3PIP Q;  2QIF A;  2ASJ A;  4DV1 J;  4NXN J;  1CQN A;  3K89 A;  4J90 A;  1VHI A;  3V6J A;  2BRL A;  4F8R A;  2CNN B;  2E29 A;  3I0S A;  5EDW A;  3NRB A;  4HTI A;  4FF2 A;  1RT6 B;  1S4E A;  4J9N A;  1KLM A;  1RHM B;  4WCE Q;  4DN0 A;  1RT7 A;  2EWH A;  1N5Y B;  1ELO A;  3HVT B;  3T41 A;  1XNR F;  1ZPW X;  3DOK B;  4O3S A;  1VRU B;  2KJW A;  2LKZ A;  3I56 S;  2EC2 A;  1TKT A;  1CJU B;  1IBC B;  1SXL A;  3QLH B;  5I3U A;  3L7O A;  3OHB A;  1JJ2 R;  1U48 A;  4QJV A;  4XPC A;  5HVF A;  3GPA A;  4KGM A;  2XMJ A;  1PGZ A;  1LWF A;  2BE7 D;  5AE1 A;  1MSW D;  5E3A A;  1JLG A;  2QL7 B;  3THT A;  2D3Z A;  3M8Q B;  3TAN A;  2UP1 A;  3V81 A;  3AD7 C;  5KFP A;  1JB0 C;  2FJB B;  3GWC A;  3OTC A;  4GRS A;  4R5P A;  4I6Y A;  1NAQ A;  3Q22 A;  2QYC A;  5IS2 A;  3BM7 A;  2HQ3 A;  1JLF B;  2CQI A;  2R3V A;  1NLK L;  4BLG A;  1HR0 J;  4B3O A;  3D3C J;  1W26 A;  4L3N A;  3NAH A;  4HEA 9;  1BY9 A;  1TL5 A;  5K8P A;  2V6A A;  2UVV A;  5KFV A;  4GVB B;  4DR7 J;  4MFB B;  2JEJ A;  1AXQ A;  4UOH A;  4DQP A;  2KL8 A;  1SC1 B;  3WDO A;  3Q24 A;  2UVR A;  1NZ8 A;  1PIL A;  4GVL A;  5JXS A;  3T6B A;  2UUA J;  4ECT A;  3GG1 A;  2DH8 A;  2PII A;  1FRL A;  2RUG A;  1T95 A;  2YKM A;  4CO3 A;  4CLP A;  4OI2 A;  1FX4 A;  3N6L A;  1S12 A;  4IG0 A;  3QFW A;  1S1U B;  2YWE A;  2ZFH A;  1MN9 A;  2HFN A;  5E3R A;  2MLZ A;  2RH3 A;  1N5Y A;  4DQQ A;  2E1P A;  2OIH A;  3LTO A;  5IV3 A;  2VPY B;  2HVE A;  3SSR A;  2XMV A;  3UCZ P;  1PIE A;  1TUV A;  1WC6 A;  1C4A A;  2D41 A;  3PYG A;  3KUE A;  2ZHB A;  4B9N A;  4UUX A;  2NXE A;  5K14 B;  2V8D A;  1TUW A;  3BGO P;  4NYO A;  3VQS A;  1JLG B;  1PO6 A;  1VQ9 S;  1VQ8 S;  4ZCK A;  2ZH1 A;  1X4A A;  2UVU A;  4OI3 A;  3W63 A;  4OX9 J;  2DXF A;  2HNY A;  3K17 A;  3DLJ A;  3RTV A;  2R4F A;  3HJV A;  2FJV A;  3GQC A;  2PEB A;  2AX0 A;  3CUL A;  2NYH A;  3GG0 A;  4RW8 A;  3QSY B;  4BS2 A;  5AXN A;  2ALZ A;  4Z7C A;  2XLK A;  5KFQ A;  2DEJ A;  1U1N A;  4X4V A;  2F63 A;  2V68 A;  3GMG A;  1LQ9 A;  1HA1 A;  2AEJ A;  4G1Q A;  2QLX A;  4X65 F;  4L3K A;  3MR6 A;  3KK1 B;  1C0T B;  3G6V A;  1TFY A;  5J2P A;  3I0S B;  1ZYQ A;  1VIO A;  3EPI A;  5HLF A;  4KE5 A;  4KV8 A;  1HBO A;  2WOM B;  2YVS A;  4I7F B;  2RDI A;  2MST A;  2FJX A;  5GAG I;  4WP3 A;  2HQI A;  2OPP B;  9ATC B;  4DPT A;  3UVJ A;  5DG7 A;  1L3U A;  3OFF A;  2B5J A;  3BGR A;  2AJ4 A;  3KHG A;  3RAM A;  4ZVO B;  4L72 B;  5KFW A;  2KYZ A;  3MM9 A;  1N5S A;  4CLK A;  2LXU A;  3JSM B;  4YB6 A;  4M5D B;  2HHP A;  1KSP A;  4KAI A;  2F3J A;  2VG6 B;  1UVN A;  3R5J B;  3D67 A;  3ENA A;  4A48 A;  4EI2 A;  3JQM A;  3DCA A;  1S59 A;  2F4V F;  1VGY A;  2CZ9 A;  1IKY B;  4NA2 A;  3NNH A;  1YHQ S;  1RUS A;  2DNK A;  2DIU A;  5CYQ B;  3M6V A;  3PFO A;  3KJV B;  4I2P B;  1UMJ A;  3CJ2 A;  2VFV A;  2W2N P;  2KFN A;  2CNK B;  1LKZ A;  1P1T A;  1LK5 A;  2N7Y A;  4RZR A;  1SIZ A;  1U2C A;  2DIT A;  3PFE A;  4M94 A;  4NLX A;  2VIC A;  2ZUA A;  4WFZ A;  3M30 A;  4LF6 F;  5ETM A;  1RWU A;  1HAR A;  4A46 A;  2XLJ A;  1XK8 A;  2ATL A;  1RWN B;  3Q8V A;  3D54 A;  2HFV A;  1HQU A;  3CDA A;  1SPB P;  1VLY A;  3FEZ A;  1M5P C;  2J76 E;  3UN2 A;  3VTI A;  2FJE B;  2G1D A;  2P9G A;  2VG7 B;  3H42 A;  2XQC A;  3RAQ A;  4WFA Q;  2B5J B;  3BGR B;  4CH7 A;  4EGL A;  4Q0B B;  3CJ4 A;  2E7X A;  4Q5V A;  3NP5 A;  4DL2 A;  1YI2 S;  5D6G A;  4FKX A;  1RTJ B;  4NLQ A;  3PVX A;  3NS5 A;  4DXL A;  4F4Z A;  1RTI B;  3DRY A;  1FEE A;  2FYX A;  2C42 A;  4FF1 A;  1IKW A;  2J0X A;  2R42 A;  1FFS B;  1WC0 A;  3ZZR A;  2FTR A;  2D1C A;  2G9O A;  4LF8 F;  5AT1 B;  2YH0 A;  2KXH A;  1REG X;  4IG0 B;  3CCU S;  1TKZ A;  3RAX A;  3TAM B;  1G4C A;  4DV5 J;  1NND A;  4WII A;  1C0U A;  3W8P A;  1U1K A;  3BPD A;  4QIW D;  3FKB A;  1MG7 A;  2RRA A;  1JLE B;  3U1M A;  3CJK A;  2OD4 A;  2JNJ A;  1TTH B;  3FK4 A;  4LSL A;  5KFU A;  2VJU A;  1HKA A;  1S0V A;  1B64 A;  4YR2 A;  3QZ7 A;  3PX4 A;  4DR1 F;  1C1C A;  2VBX A;  4P7T A;  3G8T A;  4DFK A;  2CDR B;  2KKH A;  2QV6 A;  5LM7 E;  3MCS A;  1HI1 A;  1RWV B;  3BRE A;  5L39 A;  5F8L A;  2DR9 A;  4TKT A;  1TK8 A;  4UUW A;  3KK3 A;  4PG8 A;  4UY8 T;  1HI8 A;  1CEZ A;  4CH0 S;  1TAU A;  2OTJ S;  3R5A A;  1T03 A;  3RW6 A;  2KG0 A;  2N3L A;  2YXL A;  4PCQ A;  1RKI A;  3CCM S;  4OIX A;  4KHP J;  2ZE2 A;  4NMX A;  3W8G A;  5K20 B;  5D0G A;  1FVS A;  4WXW A;  4AXJ A;  4ZOS A;  3ZTP A;  4F7V A;  1RHJ B;  3KHL A;  1FE4 A;  2XI3 A;  1G1X A;  2CQ3 A;  3DDK A;  4OX8 A;  1UFW A;  3DLK A;  2LMI A;  5BR8 F;  1CVJ A;  4JV5 F;  4ED2 A;  3ZO7 A;  1T02 A;  2HKE A;  1G3O A;  2K2P A;  4C48 A;  2YQ3 A;  3OR2 A;  4WFB Q;  5A8K B;  1RE1 B;  2RQ4 A;  2ZUG A;  7FDR A;  4J9O A;  1FK9 B;  1GAO A;  2AV5 A;  5KT4 A;  3G71 S;  4EBE A;  4NCB A;  3LP1 B;  2O5D A;  1GXU A;  2MQ8 A;  4KO0 B;  3ETO A;  5J1P A;  4A8Q A;  1Z2Z A;  1H38 A;  3EDQ B;  3FMW A;  3CIZ A;  4NLS A;  2AU0 A;  1JLE A;  3CDB A;  3LWL A;  4JI6 F;  4I4B A;  4QR1 A;  1J5E J;  2ZNZ A;  2CQD A;  4DSE A;  2D69 A;  2AYM A;  3TJ8 A;  3GIM A;  5EN1 A;  2VG7 A;  2ZM6 F;  1EX8 A;  3VR1 A;  4Z2X A;  3LP0 B;  2R2T A;  3HM9 A;  2MXY A;  1RT5 A;  4GC7 A;  4ZP7 A;  3DDI A;  3DGV A;  5F8H A;  3IWN C;  2NUH A;  3FMB A;  2V69 A;  3N5B A;  3KJV A;  3BEG B;  2PMW A;  1D1U A;  3K0J A;  3Q23 A;  3T5L A;  1Q8B A;  5KG1 A;  1MWY A;  1TKX B;  3MPU B;  3PV8 A;  3N28 A;  3EJM A;  4UQG A;  5C5J A;  2ERR A;  1I94 J;  3S01 A;  4DR6 J;  2B8P A;  4DFJ A;  3SQO P;  3NBP A;  1S0O A;  4RW7 A;  5B0C A;  2DR6 A;  1WOR A;  3FJ2 A;  4MK9 A;  3VHQ A;  3K5L A;  1LOU A;  3FC9 A;  3BGU A;  3FRZ A;  1B0V A;  1FXD A;  1BWV A;  1P9Y A;  2XMT A;  2UV8 A;  1YJV A;  1RAA B;  4KKO A;  3CJ5 A;  3A13 A;  1UP1 A;  2FVC A;  4O3N A;  3R97 A;  2HS0 A;  2LQJ A;  3TWZ A;  4EEY A;  4NXM J;  4ELT A;  1WEY A;  1NBE B;  3GR0 A;  3BR9 A;  3M2V A;  2VUG A;  5KG0 A;  1UZH A;  1Q79 A;  3AA8 A;  5A8W B;  1EHW A;  1JKH A;  4DV3 F;  2V67 A;  4UY8 5;  8RUC A;  3MR7 A;  2XSF A;  1N34 F;  1AUS L;  1VR6 A;  3AJD A;  2V2Z A;  3M4X A;  5D4P A;  2CPI A;  2CQP A;  4TU7 A;  2X1A A;  2CJA A;  1S76 D;  1D8Z A;  3IAS 9;  4IH6 A;  4BWM A;  2D7S A;  1M5V C;  4ZHR B;  2XS2 A;  1MN7 A;  3G4S S;  1X9M A;  3LQV A;  3C19 A;  4ZN1 A;  4C0H A;  3HJF A;  2RRB A;  5CAB A;  1UW4 A;  4RUC A;  4FNI A;  4QWA A;  3OXF A;  4RUA A;  4LRF A;  1NU4 A;  1S6O A;  2VB6 A;  5SZT A;  1TKX A;  1S1W A;  5J2M B;  3M8S A;  3LF0 A;  2HHU A;  3VZI A;  4V19 J;  4QPX A;  5KFH A;  1BQM B;  1J5O B;  3K2Y A;  3DI6 B;  4OFZ A;  2DHG A;  2GZO A;  2WSC C;  4DN9 A;  3KLE A;  1APS A;  2RSQ A;  2N82 B;  1BC6 A;  1GXL A;  1ZA1 B;  2JFD A;  3W9H A;  3OTO F;  2HAF A;  2AF6 A;  3KJQ B;  1MU2 B;  4FVC A;  3D3B J;  3OTD A;  2DIS A;  2DEI A;  1RAD B;  5H9F K;  4JI4 F;  4DEZ A;  2ZH3 A;  1S9E B;  3FDS A;  2HLT A;  4JI5 J;  1TL3 B;  1SQE A;  4DMZ A;  4QU7 A;  1FKO B;  1U8W A;  1XEZ A;  2ZKT A;  3HVA A;  3M6U A;  4ZLN A;  2IBO A;  4V19 X;  2HHX A;  4ECX A;  4PXC A;  2PMZ D;  2PMH A;  4NEY A;  5EUH A;  1KN6 A;  2E44 A;  3W2W B;  4JV1 A;  3D6H B;  2E1C A;  2ZVS A;  4IDK B;  4ICL A;  4NLV A;  1UW9 A;  2CQB A;  3EDR B;  3HT0 A;  1XR6 A;  1FRH A;  1KOH A;  2DNY A;  4GVB A;  4C3L A;  3BO2 A;  5FJ4 A;  2B4P A;  2LU2 A;  4ZCM A;  2LVW A;  1XTZ A;  3LP1 A;  3QRR A;  2J0S D;  2JZ5 A;  2J9D E;  2Y3Y A;  4AQY J;  1OYD A;  2YX1 A;  1NSA A;  3IS9 B;  3LGH A;  3OD2 A;  3PCO B;  5KFZ A;  3AXK A;  1S1V B;  3QGI A;  5KT5 A;  3KK2 B;  1OY9 A;  1VYA A;  4NA3 A;  1HR0 F;  2HHH J;  1F1B B;  3SCL E;  1R6V A;  2R7X A;  2IMW P;  1LW2 B;  5HBM B;  1RTH A;  4DPY A;  3OL7 A;  3QRQ A;  1TU0 B;  1SH3 A;  3DXB A;  2IM0 A;  3HFZ B;  4FPR A;  4WE1 B;  2H5E A;  4JYA F;  2WK4 A;  3C6T A;  2MDA A;  1FNM A;  2VZ9 A;  4RPF A;  1HWK A;  5K14 A;  2UUB F;  3EPG A;  1RT2 B;  1KQS R;  4O3R A;  4W92 B;  1QUV A;  2HBZ B;  4ES3 A;  1AZS A;  1OPI A;  1Y00 A;  1S6Q A;  2DGT A;  1G7C B;  4F2S A;  5AXM A;  2BXJ A;  4HTJ A;  4PZV A;  1X7V A;  3UD4 P;  1UFK A;  2DY9 A;  1DFD A;  4CLW A;  1VS3 A;  3B78 A;  5KTQ A;  2BKN A;  2DH9 A;  4YP3 A;  4OI0 A;  1NHK L;  2RB7 A;  2G4B A;  2VOD A;  1ZAX A;  3ILO A;  3AD9 C;  4URQ U;  1TL1 A;  2QA1 A;  2H4Y B;  5I3P A;  1LFW A;  3MED B;  1RWK B;  4ED8 A;  1FES A;  2MKS A;  2DBB A;  2R7O A;  1N33 J;  2E1M C;  3K57 A;  1A7G E;  1OJ4 A;  4X4Q A;  2GNK A;  1IUJ A;  4JV5 J;  5BYS A;  3NGR A;  5BR8 J;  3T9Z A;  3J80 U;  4DV1 F;  2HHH F;  3C3L A;  3J7A 1;  4MYT A;  4U95 A;  4CYU B;  5CYJ A;  4W98 A;  5L1J A;  3BBC A;  3D4J A;  1D8Y A;  4D3H A;  2YNF A;  1CJK A;  1X4F A;  2JVR A;  4NL5 A;  1SKW A;  3BYR A;  3QNW B;  2ZH8 A;  4BDP A;  5DZ6 A;  1R0A A;  4Y3C A;  3KK2 A;  3UDC A;  4OL8 A;  1FJ7 A;  4FXD A;  4A8S A;  1T94 A;  1M1K T;  4ETZ A;  1CUL B;  3QWP A;  4KH1 B;  3ITH A;  4PWW A;  1U7L A;  1NPP A;  3BN4 A;  5HBM A;  1LWC B;  4KBI A;  2DGX A;  4O44 A;  2G13 A;  2VU5 A;  3TAP A;  1SKR A;  3N9U C;  1S9E A;  3G6Y A;  3AT1 B;  1S57 A;  2MKJ A;  3UNY A;  1YQH A;  2BM0 A;  3NXZ A;  1EAY C;  4AYB D;  4XK8 C;  4ECW A;  3W5Z A;  2FJD B;  1M1G A;  5HQL A;  2ATC B;  2BQ3 A;  3MFI A;  1Y3K A;  3H2V E;  3KLG A;  2CYY A;  3IBF B;  4PXD A;  4Y6I A;  5BXI A;  3WC0 A;  4AL7 A;  4B9T A;  5IOL A;  3I55 S;  1YJR A;  3D0H E;  4LFB J;  4CLT A;  2MZ1 A;  2BE9 B;  2X1B A;  2EXU A;  2YWH A;  1Y11 A;  2HK3 A;  2I6W A;  3R7S B;  3PAC A;  4DV7 F;  3TX0 A;  2XY5 A;  1MLA A;  3TAM A;  3OPK A;  4KGV B;  2IDL A;  2YKQ A;  3C16 A;  3L7U A;  2CUY A;  5IZH A;  1S1V A;  2RDD A;  4TYB A;  3VGV A;  2R8G A;  4A8F A;  1U02 A;  3IR5 B;  2OHD A;  5KG2 A;  4NXM F;  1Y7P A;  4YUD A;  3V2U C;  5CQG A;  4ZVT B;  2UV8 G;  1NCL A;  3IXQ A;  3W2V A;  2XSJ A;  2W9C A;  1DQ8 A;  2MKH A;  4Z7Y A;  3GCW P;  3H90 A;  5KOW A;  5FDL A;  3W62 A;  1V5I B;  4X62 F;  2CPJ A;  5D0R A;  1XC9 A;  1S99 A;  2CJB A;  4IDK A;  4URG A;  5I42 A;  4WZM A;  1CPZ A;  2XTJ P;  2HNZ A;  2Z58 B;  1DTQ B;  3G2X A;  1IWA A;  1XER A;  3V4I B;  1I94 F;  2QC3 A;  3P5T L;  2RE1 A;  4H4M B;  2F4V J;  1REV B;  4NAS A;  2ZJP Q;  2ASY A;  4DV3 J;  4IRK A;  5I3Q A;  1B70 B;  2XZT B;  1LK7 A;  1VRT A;  1ZAV A;  3CF5 Q;  1KFS A;  1UVM A;  1RAI B;  3W5X A;  2OEL A;  4C2M A;  3ZTQ A;  4I56 A;  1EKR A;  2P2C B;  1UWB A;  2F7V A;  5KFA A;  2J6S A;  1NK0 A;  1GX6 A;  4LF9 J;  1XNQ F;  4JUZ A;  1DLO A;  3A3O B;  2DH7 A;  3HXM A;  4JI6 J;  2I5J A;  4IFV A;  4RU2 A;  2HS4 A;  2QTW A;  1LNQ A;  3HKZ D;  1NKC A;  4ILR A;  4HDG A;  2ZBQ A;  5H1S V;  1IBK F;  2ZH7 A;  2CG8 A;  1RYR A;  1KVI A;  3GFY A;  3R5B A;  4NX9 A;  3N79 A;  4P7V A;  4WFN Q;  2ALY B;  2HBR B;  4QR2 A;  1KON A;  4MKB A;  3A4T A;  1TFW A;  2XLI A;  2VC1 A;  2CPE A;  3A3N B;  4QIG A;  3BSC A;  4DUT A;  4ZVH A;  2MQQ A;  1BQX A;  1HQE A;  2LDY A;  3P3D A;  3PYE A;  3RRK A;  4X4R A;  2BJ8 A;  2DNM A;  2VFR A;  2WHO A;  4J9K A;  4PYA A;  5IFM A;  1ZPV A;  1WC5 A;  2MYF A;  2GMH A;  1M1H A;  2YKA A;  3NCP A;  3W7B A;  4CCH A;  4LRC A;  3DRP A;  1GEH A;  5EX3 A;  4I0W A;  3RUB L;  2XGP A;  1S10 A;  1SQF A;  4KT0 C;  1FDN A;  1KRP A;  4KHP F;  4TU8 A;  3MEK A;  2JC1 A;  2F9D A;  1RP5 A;  4OZ1 A;  2MSS A;  2MPU A;  1U24 A;  5KT6 A;  4K4V A;  3KTQ A;  5J2N A;  5B0B A;  1FHT A;  4N8O A;  4RW8 B;  2IMO A;  5HQM A;  2VG5 A;  1BQN A;  1VRU A;  5IT9 Y;  2QL9 B;  3CJQ A;  1FTR A;  2G2Y A;  1SL2 A;  4KO0 A;  3GJT B;  3KG4 A;  4OJ3 A;  1TV6 A;  1NH8 A;  3CCT A;  1WC1 A;  2NUU G;  2OPQ A;  3HUL A;  1SC6 A;  4F04 B;  2B51 A;  3VAJ A;  1TK5 A;  1CQM A;  3HK2 A;  1FJC A;  2QJ3 A;  2FHJ A;  2X1F A;  1FWP A;  1J2V A;  2PT0 A;  2RRN A;  2UUT A;  4DX7 A;  4FZV A;  1P9Q C;  1JLF A;  3OL8 A;  1IKX B;  5A8R A;  4DR5 J;  2QSW A;  4OYA A;  3W65 A;  4CZC A;  1V9O A;  4LR9 A;  3CB4 A;  3RU0 A;  5IT0 A;  2MY8 A;  5LL6 d;  2GVZ B;  3WHI A;  4DV6 F;  1N36 J;  4BHQ A;  3BKT A;  3MMB A;  4TY8 A;  1V3Z A;  3LOU A;  4ED3 A;  2ZOG A;  3KNG A;  4LUB A;  3KHH A;  3AOC A;  2Z57 B;  3V4M A;  2RU3 A;  3OV7 A;  4DL7 A;  1VBZ A;  3NWR A;  2P5V A;  1YVF A;  4ES1 A;  1RAG B;  1NDP A;  3QFH A;  1M0S A;  1J27 A;  2QG9 B;  2RJZ A;  3ILJ A;  4K59 A;  3B4M A;  1UVK A;  2RQK A;  3P8B B;  5L46 A;  4DV5 F;  3Q83 A;  3TUP A;  4QIE A;  1CJV A;  2IC3 A;  5D15 A;  3TAR A;  4P75 A;  1HWL A;  2AHO B;  2KDO A;  2WW4 A;  3NS6 A;  5F9L A;  2U2F A;  2C2Z B;  1PG5 B;  2P6S A;  2RIL A;  4HI1 A;  2DNO A;  3EM1 A;  5T7L B;  3HKW A;  3IFE A;  3KUG A;  1WUU A;  4HT5 A;  2YX4 A;  3H5U A;  2O01 C;  2M7S A;  4K8R A;  4OV6 A;  4C97 A;  5GAH U;  1URN A;  3P49 B;  3DLE A;  4B9L A;  3I96 A;  2E9Z A;  1Q7Y T;  1KEK A;  4PQU B;  1SC4 B;  4CH1 A;  4USJ C;  1QE1 B;  3LO3 A;  4ZLJ A;  5SUH A;  1NEE A;  1KTV A;  2ZKU A;  3LP2 A;  2W7P A;  2B0G A;  4ECZ A;  2O3D A;  4KB7 A;  2QRR A;  1P1L A;  3ETM A;  4Y0F A;  4Q0B A;  1YBU A;  4QW9 A;  4JI8 F;  1TL7 A;  3SSS A;  5E41 A;  1SH0 A;  2RKI B;  4JI7 F;  2F5G A;  4B3R J;  2H3E B;  3D6T B;  2Y1L B;  2FLP A;  3TVK A;  3O5T B;  4C8L A;  3NNC A;  5D77 A;  2HFO A;  4HR2 A;  3CIM A;  3FCW A;  3W3S A;  1MRO A;  2A3J A;  4C9D A;  2JLE A;  2LQB A;  1S7H A;  3ILL A;  3MTK A;  3GLJ A;  4L74 A;  3DLB A;  2LA4 A;  1R3N A;  2H5I B;  3CC7 S;  2A10 A;  5LMN F;  4ILM A;  4JI2 J;  5K8N A;  3MWB A;  1XIQ A;  3CCV S;  2HZC A;  5LOQ A;  3MM9 B;  1MWQ A;  5AXL A;  3B6B A;  1LWX A;  1PCA A;  2DIV A;  4UT4 A;  4FF4 A;  2ZZM A;  4ED6 A;  2HBQ B;  4M5K A;  2V8G A;  1KQF B;  4DFP A;  2GML A;  3NGT A;  4I2Q A;  5L9N A;  1S77 D;  1QSS A;  2FDN A;  1I3O B;  1EP4 A;  2LQ9 A;  2ILZ A;  4BC7 A;  2R8I A;  4M5J A;  4CLL A;  4ZIW A;  1KWM A;  1UEK A;  2RHS B;  1HNV A;  2MY7 A;  3GJR B;  3B4D A;  1FA0 A;  3RW7 A;  3VGT A;  1OY8 A;  2OTL S;  4K4T A;  4LFA F;  2BBE A;  3HFK A;  5C42 B;  2WON A;  5IT9 U;  2DTJ A;  3LWM A;  3ZZP A;  3LAN A;  3Q8Y A;  1YJN S;  3PY8 A;  4M5I A;  2YNI A;  3R2C J;  5A6P A;  2PO4 A;  3BH7 B;  3FVY A;  4P10 A;  5GAD I;  2OAU A;  1U1L A;  1IXK A;  1D3W A;  5GAD U;  3OJS A;  5DG8 A;  4JI8 J;  4QW8 A;  1CJK B;  1YLX A;  2VDH A;  3LAL A;  5LSL A;  3MCN A;  3DKD A;  2C22 A;  2PC6 A;  4F4K A;  3PO4 A;  1S9F A;  5KFJ A;  3PEJ A;  4J91 A;  4OHV A;  3SDE A;  3PW5 A;  4EYI B;  5HJX A;  5H9E K;  1L3T A;  2O1P A;  2MZR A;  5HO4 A;  2XY7 A;  1S1T B;  1VQK S;  4HL9 A;  3RB4 A;  1WHX A;  2RT3 A;  3DLG B;  4RBT A;  3CTR A;  1NJW A;  4JV2 A;  3DLE B;  3AFG A;  3M6W A;  1NH7 A;  2VBW A;  1Q82 T;  1RXO B;  1FO1 A;  3FBB A;  4GO7 X;  1U26 A;  1X31 C;  4DV6 J;  2DRB A;  1Y4Z B;  2EG1 A;  5DM7 Q;  1H98 A;  2LFV A;  3PJX A;  4NI2 A;  1RHR B;  4CT9 A;  9RUB A;  1X60 A;  2PA8 D;  3POT B;  2WRM A;  3AQP A;  4CO1 A;  4O3Q A;  3MPY A;  4DU7 A;  3PRV A;  5K8M A;  1CJV B;  3I4H X;  3IM8 A;  4FXW A;  4AD6 A;  5CCM A;  3CC2 S;  2LEC A;  1VMB A;  1YIJ S;  4ED5 A;  1JNR B;  4C11 A;  3EGZ A;  2CQ0 A;  2G1H A;  4I6A A;  3DRS B;  1VQ6 S;  4RNF A;  1RB0 A;  3RB3 A;  2XHW A;  1QTN B;  3CDU A;  5GME A;  3KLV A;  3CMA S;  5IQQ A;  4LF4 F;  4N56 A;  3HO1 A;  2P9C A;  3HVW A;  4YY3 F;  2DHS A;  4B9V A;  2JH3 A;  2FHM A;  2CQ4 A;  2NPF A;  2K3K A;  2ZVI A;  3SCK E;  2O67 A;  3TYT A;  2DNQ A;  2DNZ A;  2DHX A;  1XNR J;  3MM7 B;  1IQT A;  1N52 B;  4HI2 A;  3A12 A;  4DL0 C;  1MMN A;  2QGF B;  5HVG A;  2I9S A;  2QLW A;  1SV5 A;  1WTB A;  4U6P A;  3Q2S C;  4D3G A;  2BE2 A;  5LMU J;  1DRZ A;  2ZWP A;  2XMM A;  3VF0 B;  3THV A;  3LA0 A;  5EX0 A;  1JLA B;  2AP6 A;  2OSQ A;  2VPX B;  3IP0 A;  3DLK B;  4NXN F;  2W2Q P;  1H2T Z;  4WIQ A;  3GV7 B;  2FLN A;  1U25 A;  1OYE A;  4RR5 A;  4IQX A;  1HPZ A;  2YKM B;  4KTQ A;  3R27 A;  3L9Z A;  4YEA A;  1Y3J A;  3S1T A;  1X8D A;  4X4P A;  1NKE A;  2ZC3 A;  1FWK A;  3FBF A;  4GMK A;  2E5G A;  2BAN B;  3BBF A;  4A47 A;  1S48 A;  4FS1 A;  1Y10 A;  2JLG A;  3MI7 X;  5DLF A;  3MMC B;  4OYM A;  2Q6C A;  3TW0 A;  4DSJ A;  4MKY A;  4RJV A;  1E6Y A;  4LRA A;  4DJB A;  2UVW A;  3IRW P;  2KTQ A;  4IG3 B;  1S97 A;  4YOE A;  2XMU A;  3ZZT A;  1KD1 T;  3BKF A;  3VVU A;  4DI6 A;  3MMJ A;  4C8Y A;  4K4S A;  4MH8 A;  1RQ0 A;  4MYU A;  4OHY A;  2FB0 A;  5J2Q A;  4P73 A;  2CAD A;  2IYG A;  2XGQ A;  2Y9H A;  2ADC A;  2C2D A;  1L3S A;  1TQL A;  4HHU A;  5K9F A;  1EAR A;  3FUY A;  4M5L A;  4NML A;  3UE2 A;  3H5S A;  5L38 A;  2UUC F;  2A18 A;  1RAJ A;  2JHE A;  3GP9 A;  1FDB A;  1HBU A;  3G82 B;  3QAU A;  3QID A;  1SVD A;  2PDA A;  3P45 B;  3ZC4 A;  4X4O A;  2XWX A;  3GFH A;  4DFM A;  2GHW A;  1KBR A;  2X51 A;  2EFG A;  4IR1 A;  4CNZ A;  3LW5 C;  4KGZ B;  3RR7 A;  4RBV A;  3RBZ A;  5KAK A;  4O4G A;  3IM9 A;  4FBT A;  4GC6 A;  2IVM A;  2JDJ A;  4DUY J;  4X64 J;  2YNG B;  2Q6B A;  2DRA A;  4HHH A;  1PC5 A;  1Q53 A;  3IO1 A;  3MAQ A;  1BQN B;  4JV0 A;  1ZTW A;  2NCK L;  3MMA B;  4KYZ A;  4WPA A;  2Q3P A;  2V2Q A;  3DI6 A;  2NRE A;  4LRE A;  4ANC A;  1AT1 B;  1WD6 A;  3RR8 A;  1W2B R;  1U45 A;  2HS3 A;  5DDR C;  3DGP B;  1HL6 A;  1TV6 B;  4DL6 A;  3QBC A;  2NXN A;  4F2R A;  1F6T A;  1FD8 A;  4EUV A;  3HSJ A;  3PJ9 A;  4B3M F;  4DG1 B;  2QLB B;  2V50 A;  1KKH A;  2DXD A;  1TL3 A;  2JVO A;  4C3M A;  4CWB A;  5F8M A;  1SKS A;  2K8G A;  4PUO A;  4X62 J;  3M05 A;  2NXU A;  2LA6 A;  2U1A A;  3K5N A;  2HIY A;  4FKY A;  1IJE B;  1LW0 B;  1PBU A;  4HH0 A;  3M8R A;  2BJE A;  4RW6 A;  2ZJQ Q;  4URS A;  1B4S A;  2J7W A;  3DRP B;  4N47 A;  3OJU A;  5L8R C;  5KFG A;  4L73 A;  2OP5 A;  5DZ7 A;  1KHV A;  1N0U A;  3AOB A;  1NRK A;  1SI9 A;  3DOL B;  3F56 A;  2YKP A;  4NZ0 A;  2IDE A;  4OMF G;  5F3T A;  2ASL A;  2HQD A;  3WZ0 A;  3LAK A;  5B7W A;  2VDI A;  3M6X A;  5KFI A;  3EE3 A;  3KLE B;  1X4H A;  4LBI A;  5B0E A;  4H4O B;  4LFB F;  2EFN A;  4LRD A;  4A8M P;  1RAH B;  4MK7 A;  2B4O A;  1U0S A;  2MTL A;  4RO0 A;  4S0M A;  4MKV A;  4JI2 F;  4N5S A;  3RRG A;  2VKZ G;  1OS5 A;  3BZQ A;  1RHQ B;  2WW8 A;  4C8N A;  1NHV A;  2QMU B;  5J2Q B;  3FSY A;  2ZZN A;  3UR3 C;  4DF4 A;  3HHD A;  3KLI A;  5D8H B;  1FNX H;  4NEZ A;  4DV0 F;  4G65 A;  3C6U B;  2YH1 A;  1NUE A;  1QDU B;  2ZD1 A;  3LAM A;  4I69 A;  2DB1 A;  2GJ2 A;  2OD6 A;  1LWC A;  4O44 B;  1QE1 A;  4ANE A;  4DPW A;  4GKJ F;  1WG5 A;  5F9N A;  4JI3 J;  2ZHO A;  2VV5 A;  4CIO A;  2RAQ A;  4QYZ K;  1HHT P;  1FVQ A;  4DOZ A;  2FQQ B;  2EEY A;  1IBL J;  4HT7 A;  4O4G B;  2UUB J;  1X0P A;  3BDE A;  5LMN J;  4MFB A;  3EYZ A;  4WWS A;  2K06 A;  2KYX A;  1LEO A;  1RWM B;  1VQS A;  2VPW B;  3TUJ C;  1KP6 A;  2C2E A;  1YBA A;  1T8E A;  1A9N B;  1GMW D;  4FS2 A;  4M63 A;  4ZPT R;  1B0P A;  2I0X A;  2GIR A;  2XZW A;  5BYR A;  2IRY A;  3G86 A;  3VAL A;  1Q95 G;  2R8K A;  2PN6 A;  3ZZO A;  2AYE A;  3JTP A;  3TRG A;  4DR3 J;  4NCA A;  1JNZ B;  1RWX B;  4ZVU B;  1OMS A;  4LSN B;  4FYX B;  4UW2 A;  3GIL A;  3M7V A;  3M8Q A;  1WHY A;  5CZX A;  2VFU A;  2VIH A;  5ETL A;  3FFI A;  2HAI A;  1JWW A;  3EVM A;  4DQS A;  3RZA A;  2ASD A;  4NLR A;  5KFY A;  2XO6 A;  5KFD A;  2XO7 A;  4PYD A;  1U4B A;  3EZO A;  3LP2 B;  1R43 A;  1X5O A;  4O23 A;  3MED A;  2C3U A;  3LP0 A;  3KLG B;  2RQC A;  4K4U A;  2XS7 A;  2FVR A;  3TEG A;  2HHT A;  2YPZ A;  4PG6 A;  2NXC A;  2PFD A;  1OY6 A;  4RL1 A;  4WFY A;  3TZZ A;  3OR2 B;  1OWX A;  3MEC A;  5J1E A;  4DR5 F;  1K8A T;  2FVP A;  4ALZ A;  5EGY A;  1NJX A;  1FXL A;  3HFV A;  2B4V A;  4ZVR B;  2IYI A;  3M9M B;  3OTO J;  1YRU A;  1YIT S;  2FVS A;  2A0F B;  5ETR A;  4MTP A;  2KU7 A;  5HRO A;  3SFG A;  4U67 Q;  1BMQ B;  2D9P A;  4QZV B;  3QQC D;  2V4J B;  4AND A;  2W2O P;  1RYS A;  3HLU A;  4OZN A;  1BQM A;  4FBU A;  5E3Q A;  4IUF A;  1W25 A;  3PXG a;  4NE9 C;  1T3N A;  2K3I A;  5HMX A;  3AA9 A;  1Z4U A;  2EK6 A;  1U8S A;  3R3T A;  1RA7 A;  1Y5I B;  5D4O A;  1N54 B;  3ZTS A;  2V0N A;  4ZPC A;  5C2C A;  1DZ5 A;  4CDI A;  4JI5 F;  1MU2 A;  2HND A;  3TQE A;  3Q8S B;  1X9W A;  1D9F A;  1W2I A;  1PAE X;  1REV A;  3K5O A;  4ZJQ A;  2FIU A;  4ID5 B;  2K7K A;  1EIY B;  1DTT B;  1X4B A;  5C42 A;  5K8O A;  2QEX S;  1QAJ A;  4CLU A;  3THP A;  4Y2K A;  3EGN A;  1F5C A;  1I51 B;  1FXR A;  3CC4 S;  5ETQ A;  4M5H A;  1KOO A;  1URR A;  3C15 A;  3O8W A;  2L08 A;  2JFK A;  4KKO B;  4E8U A;  3RBD A;  3DC2 A;  3NOG A;  2KM8 B;  1U2R A;  3GIR A;  2XWY A;  5J2M A;  2Z2L A;  4NOH A;  3TX8 A;  2PI5 A;  1XMQ J;  4DZD A;  1RBO B;  4ATN A;  1B7Y B;  3W2V B;  2W9C B;  2V2V A;  2MQP A;  5HAN A;  3SV4 A;  1WWH A;  1FFG B;  3HCX A;  2WSF C;  3A1Y G;  2CPF A;  3C8Y A;  4NLO A;  1RK8 A;  1M5H A;  1N34 J;  4PAB A;  3H40 A;  3Q8Q B;  2GX8 A;  2FC9 A;  5A76 A;  5DQI A;  4B3S J;  2C3P A;  2IRU A;  2GJI A;  1CJT B;  4LMZ A;  1S9G A;  2VF3 A;  3OFG A;  3QAT A;  3U1L A;  3F73 A;  3EWG A;  4USW A;  1FDD A;  2FZK B;  1JQG A;  3MHY A;  3C14 B;  1S1W B;  4Q2M A;  5CYQ A;  5A0Y B;  5HJY A;  4DLG A;  1PBA A;  2JJ4 D;  2Y0S D;  3J81 Y;  1T9U A;  3V6D B;  1Q86 T;  4PWD A;  3FCH A;  5LT5 A;  4ETX A;  2NYI A;  2GS8 A;  3D68 A;  4ZP6 A;  4NLG A;  3OHA A;  2JOQ A;  1TVR B;  5KFF A;  3GON A;  2Y1J A;  4F26 A;  3VAM A;  2GO8 A;  4DQR A;  5HAO A;  2XCA A;  2HZA A;  1H2U X;  2QE5 A;  3M2U A;  3T19 A;  4ES2 A;  3MMC A;  2ZDP A;  4NRU A;  1PKU A;  4P2F A;  3DRR B;  3R1L A;  3BQ2 A;  1R8A A;  2YKN B;  4CYU A;  3FRY A;  4P6Q A;  1WHV A;  4OHW A;  4IFY B;  1HYS B;  3D1H A;  4GO5 X;  3RJM B;  1GQE A;  1WSR A;  3HDS A;  2D74 B;  2MQN A;  3O2I A;  2J0W A;  3MUV P;  1UL3 A;  3PW4 A;  2LP4 A;  3M32 B;  3M8Y A;  4KSE B;  3HZG A;  4B9S A;  5HP1 B;  1NK7 A;  2W7A A;  5CA5 A;  1IWG A;  2GJF A;  4K2J A;  3TEH B;  5B0D A;  3KLH B;  2RIJ A;  4A8Y A;  1RHU B;  2J9D A;  3BV8 A;  2X3D A;  2Z2Y B;  2CQG A;  3R5D A;  1RJJ A;  4JI1 F;  3HSZ A;  1OQ3 A;  2K1R A;  2B9W A;  2F65 A;  3ADA C;  2EFQ A;  2FGO A;  2CZ4 A;  4ID5 A;  4ZCL A;  4X66 F;  1F3F A;  2ZE2 B;  3QT6 A;  4LT6 A;  1FKA F;  4R0J A;  3W5Y A;  2MQM A;  1VCT A;  2DPI A;  4X4S A;  4IRD A;  1H72 C;  3B54 A;  1CS4 A;  2IIH A;  3O1L A;  3J7Z 5;  4OLP A;  4P2M A;  3BGL A;  5LJ5 Y;  5B0G A;  1TL7 B;  5IT4 A;  5ETV A;  3UFC X;  2NZC A;  3MTJ A;  2H4W B;  4X4U A;  3RBE A;  4QQB A;  4L76 A;  2CJQ A;  5FD1 A;  2W4P A;  3WIU A;  3T1H J;  1YJ7 A;  1H3D A;  3UN5 A;  3T1H F;  2AEM A;  3GR1 A;  4PG5 A;  4IO9 Q;  2I2Y A;  1UKU A;  4OZ5 A;  3KJN B;  5T7L A;  2MKC A;  1RAO A;  2B8Q A;  2FPH X;  1S1U A;  3SFU A;  2M52 A;  3EZU A;  3I4P A;  3ITH B;  3KLF B;  4B02 A;  1F9H A;  1VDH A;  5IM0 B;  1WKJ A;  2HFS A;  2WBM A;  4P72 A;  1HBU B;  2OPS B;  2AIR B;  3G82 A;  2XMW A;  3PYD A;  5L1I A;  2C3O A;  3Q86 A;  4B3O B;  4PAA A;  3F41 A;  4F4A A;  4UZB A;  3WC2 A;  3I87 A;  4EZ6 A;  4TLQ A;  4LF7 J;  4OYW A;  3I32 A;  2AMC B;  4B9U A;  2OI2 A;  3CWJ A;  3UD5 A;  3UI3 A;  3TI0 A;  3GV5 B;  2CG4 A;  5GAE U;  4IOA Q;  5ETP A;  4CQ1 A;  3M2R A;  2IFX A;  1P8G A;  1UA1 A;  4KPY A;  1WOS A;  2GVD A;  2RML A;  2V9K A;  1LXJ A;  3UN3 A;  4X4T A;  5H9E J;  3D6F B;  3P6Y C;  3R7B B;  2UXB F;  2H1Y A;  1X5T A;  5DJB A;  4DS4 A;  5KFS A;  1HBN A;  1CJU A;  3CJ8 A;  3QLH A;  5E3C A;  5KFR A;  2OMO A;  4DLE A;  3DXS X;  3CO0 P;  3VQT A;  4Q2L A;  3IR7 B;  3Q0A A;  1NK4 A;  3M1V B;  2IA6 A;  3Q2T C;  2GAG C;  3T5J A;  2L48 A;  3MM8 A;  4RNM A;  1N33 F;  2E5L J;  3PDN A;  5KFT A;  1JLC B;  3AB2 B;  2FUG 9;  4F3M A;  4IFV B;  2O66 A;  2MZT A;  1YZ7 A;  6FDR A;  3G9C A;  1YK9 A;  1A0O B;  2W4C A;  1VQM S;  1VC5 A;  1GH8 A;  1IQZ A;  1S9G B;  4H4K C;  3SDE B;  4C3K A;  2EK1 A;  2I1R A;  4OHZ A;  1U1M A;  2V94 A;  2PA3 A;  4M5M A;  3VGU A;  4ENO A;  2EFO A;  2AGP A;  1B3T A;  3KLH A;  1ACM B;  4ZVQ B;  4R8U B;  2KG1 A;  3KLF A;  1HNW J;  3J7A N;  2POK A;  1Z2L A;  4PWD B;  4JYA J;  3DLG A;  3D1Q A;  2MKK A;  1G2E A;  2JX2 A;  5T41 A;  5C25 B;  2UXD J;  1IM4 A;  2QX0 A;  4CO5 A;  1GT8 A;  2BJ9 A;  4B17 A;  3N4W A;  5IXU A;  4U96 A;  3ENV A;  2A2D A;  1MWZ A;  3DRR A;  4O0I A;  1TR0 A;  3US5 A;  4AQY F;  4KV8 B;  3UWT A;  1ZM3 A;  2KFZ A;  1EKS A;  4NLU A;  4J9Q A;  1C1B A;  2V8H A;  2PD1 A;  2FGC A;  4G3I A;  1FRK A;  1DUR A;  2E5I A;  4J9V A;  4OX7 A;  2OPP A;  4F36 A;  1D0E A;  4J37 A;  3BKU A;  3SEO A;  2EW9 A;  4DV0 J;  3M2V B;  2AYG A;  4CI0 B;  2ZBR A;  1QSL A;  5ETN A;  2RQM A;  2OKQ A;  1DJ0 A;  2KZZ A;  2DGU A;  4A8K A;  2G0I A;  3V4I A;  2UXC F;  3DLL Q;  4WP9 A;  3B82 A;  2HBY B;  1VQ7 S;  4PWU A;  2Z0G A;  4LBH A;  5HI7 A;  2DXE A;  4LFA J;  4ZHR A;  2A6M A;  2ZH9 A;  2QA4 S;  2OJ3 A;  1QVG R;  2HEK A;  3AXM A;  1F0X A;  3HP6 A;  1HW9 A;  2GGP A;  2DO0 A;  2G0J A;  2YNI B;  1RAC B;  3L4B C;  1SUQ B;  4OYX A;  1WF1 A;  1RT1 B;  2B7C B;  4ED7 A;  1Y9O A;  2QYG A;  4I2P A;  2BAB A;  2VFS A;  2CQH A;  2HRT A;  3I82 A;  2IVY A;  3SYZ A;  1S79 A;  1WF0 A;  4LF2 A;  2FHO B;  2EFP A;  1ARO P;  1LFP A;  2BM1 A;  1U6B A;  3H4B A;  3W9J A;  2BKP A;  3OT9 A;  2DGQ A;  4HAC A;  4M95 A;  3BR8 A;  1EB0 A;  2R7V A;  2RF2 B;  2BA9 A;  3E3X A;  1ZA2 B;  3K58 A;  4DZ6 A;  2ZDO A;  3NOC A;  3CD6 S;  2W9A A;  5DGA A;  2W7O A;  1C1B B;  1LWE A;  1SJ4 P;  2PI4 A;  2V4J A;  4RX6 A;  1WEZ A;  1JLQ A;  2VPZ B;  4ID8 A;  1RBL A;  1Q16 B;  2IAJ A;  5CZV A;  5E2Q A;  2LQ8 A;  5HK4 A;  4LF5 F;  3BDP A;  3WQP A;  2DNR A;  4ZPA A;  1FWL A;  2LXI A;  4IYQ A;  2BR0 A;  4WU2 A;  2J9E A;  2C1E B;  3OUY B;  1PJ7 A;  2VJV A;  3N0V A;  4OYP A;  4AE5 A;  4I6W A;  2KXN B;  5KT7 A;  1KVJ A;  4LJM A;  2UXD F;  4R8U A;  1T05 B;  3L95 X;  4DBQ A;  1UJ5 A;  1QSY A;  3CJT A;  1N8R T;  1RKJ A;  1WG4 A;  2HHV A;  1SH2 A;  4O0N A;  3SCJ E;  2YX7 A;  4B3T J;  5C25 A;  3HSG A;  1VQP S;  2YWG A;  1U47 A;  1YKW A;  1UPM B;  4N76 A;  2RKI A;  2F8M A;  1JLC A;  2RS2 A;  1WNE A;  4K0K J;  3MR5 A;  3W66 A;  2WBR A;  3MF5 A;  4IQM A;  4QWB A;  1Y5N B;  1F5B A;  3MMA A;  5IC6 B;  5A2Q U;  2VKR A;  3CCL S;  4LIR A;  2UUC J;  4MMO A;  2E5L F;  5IQ6 A;  1R8B A;  2KHC A;  4HYK A;  2P9E A;  4PPD A;  1UVL A;  2AJ1 A;  3KMQ A;  1UEV A;  4EFA C;  3OXL A;  2OEJ A;  3AOA A;  1IBL F;  3UO0 A;  2HHW A;  1XQI A;  2F8E X;  3MMB B;  1FNO A;  3CED A;  4H54 A;  3KYL A;  3MPD A;  4J5O A;  4USH A;  4K50 A;  2OEM A;  2MKY A;  4E2F B;  1OSC A;  1TZ0 A;  2R7Q A;  1VBX A;  1ZS6 A;  3PJW A;  2J7U A;  2IPO B;  3CD5 A;  4FXV A;  3DU5 A;  1Q8L A;  4KPC A;  2B6A B;  4DV4 F;  1FI4 A;  4OZ3 A;  4KC5 A;  1EZZ B;  1FRI A;  3AJ1 A;  2UZA A;  1TUG B;  3C46 A;  2B3T B;  2NSB A;  3GV8 B;  2RDJ A;  3CE8 A;  2N3O A;  2NPI A;  3CJK B;  1HMV A;  2MQO A;  4OJH A;  3BPS P;  2W9B A;  1R0A B;  1L3V A;  2BDP A;  1RDR A;  4R0E A;  2HRY A;  3GFX A;  3ISN D;  2C2M B;  4J7C A;  1ZTT A;  1T0T V;  5CHC B;  4ZCI A;  1Q5V A;  1KVK A;  1NSP A;  1T3O A;  3GSI A;  3ZTO A;  2XCP A;  5G0R A;  1HYS A;  3KKF A;  1F2H A;  1WF2 A;  4U7C A;  4NCG B;  3FZ2 A;  4ELU A;  2OUG A;  2CWK A;  4A8O A;  1FFW B;  5B09 A;  5C7P A;  3X1L B;  4DCO B;  1YJT A;  5HP1 A;  5IC4 B;  1WI6 A;  3MEG A;  2Z8Q A;  5GAH I;  4KHR A;  4KRW A;  4OLO A;  3OUY A;  1SJ3 P;  2HWH A;  1L5U A;  4K4Y A;  2CQ1 A;  2XMK A;  1F60 B;  1S4F A;  1YGY A;  4RNN A;  3PIO Q;  3KMS A;  3HF5 A;  2PEH A;  2VG6 A;  3EGV A;  1N5T A;  4QCL A;  1R8C A;  3CW2 C;  3VVT A;  4XO0 A;  1T05 A;  3KNA A;  2B43 A;  1L3K A;  1TEL A;  4AXI A;  3J81 U;  3V6D A;  2DPJ A;  2CJK A;  3TA0 A;  2KO1 A;  4O3P A;  4CLF A;  2XM3 A;  5JVG Q;  3MPV A;  4DSI A;  1D09 B;  2RF2 A;  3PTW A;  3NNA A;  4Y00 A;  3DGP A;  2ROP A;  2LEA A;  4Q43 A;  1KDN A;  3CGI A;  1DLO B;  1IVZ A;  1JLQ B;  1FTC A;  3DOM A;  3J7Y U;  4ZVE A;  4USM A;  4ECU A;  2KHD A;  2ZOF A;  1NK6 A;  3TVY A;  1F2G A;  3J7Y I;  1PSD A;  5A2Q Y;  2DGO A;  4RLE A;  4YHH J;  2QN6 B;  2ZHA A;  3KLI B;  3VGS A;  3NCR A;  4C0B A;  4WKY A;  4OI1 A;  2IM3 A;  3CD7 A;  1S0M A;  1RT3 B;  2MZJ A;  2CKW A;  4ERD A;  1EET B;  2K1R B;  2AWZ A;  3CCW A;  4Q7A A;  5FII A;  5BJR A;  2KB2 A;  4F4X A;  2YWF A;  4MIW A;  4KJI A;  2V8P A;  2KI2 A;  5KFX A;  3T3F A;  4LSZ B;  2AT1 B;  4EMD A;  4YDX A;  3T1Y F;  3HPO A;  2FLO A;  2B9X A;  3QT7 A;  3K5P A;  1EQM A;  4DCP B;  3CCE S;  8AT1 B;  5G4D A;  3VAK A;  1PYS B;  3NLC A;  1TK0 A;  1VK8 A;  2ZC4 A;  5HVH A;  5ETK A;  2ZH2 A;  2CPZ A;  2E7W A;  1SJQ A;  3CVK A;  3H5Y A;  4FPI A;  1M90 T;  2GQ2 A;  1OO0 B;  1UJ4 A;  5HRO B;  4ED4 A;  2ZIT A;  1XMQ F;  3IRX B;  3IGN A;  4OZ2 A;  4ECQ A;  5DRK A;  3OSP A;  1RWW B;  4JI0 F;  2MB0 B;  1ZOT A;  1UVJ A;  2DY1 A;  3GIJ A;  3BO4 A;  1LV5 A;  2DKO B;  1E6V B;  3EGW B;  4G6V B;  3BSO A;  4CO2 A;  1TMM A;  2E7V A;  1Q1K A;  1SJF A;  4C8K A;  1S6Q B;  2HLU A;  3VWS A;  2BYC A;  1VQN S;  3CDW A;  4WU3 A;  2XMA A;  3CCR S;  3CCS S;  4OX9 F;  2LEP A;  2BOP A;  3GJQ B;  3K7R A;  1S6P A;  3QGH A;  2AW0 A;  1HMV B;  1HNZ F;  1NM2 A;  2CQC A;  2FY8 A;  2XEX A;  1MMD A;  3GJS B;  4B3R F;  2HIQ A;  1EJ7 L;  2L9N A;  2A2C A;  5KG6 A;  3JYT B;  2IY5 B;  5KFB A;  1Q5Y A;  2QLF B;  2XZD B;  4G1P A;  1JMT A;  5HAT A;  4LSN A;  4X65 J;  4DF8 A;  1XN9 A;  2KRR A;  3PM9 A;  4YB7 A;  3HVT A;  3QGP A;  1ZZF A;  2OPQ B;  3ULH A;  3U7J A;  3EX7 B;  1RAB B;  2IC3 B;  1A6L A;  3TJ9 A;  2ROE A;  3ET6 A;  3VV2 B;  3GIK A;  5I3U B;  1N5V A;  2VAS A;  3D5M A;  3MFH A;  1M5S A;  2B7B B;  5F8I A;  2NQP A;  3OVB A;  1R8P A;  2F4F A;  1RT2 A;  2VD3 A;  2ZNY A;  3R6G B;  4Z37 A;  3I9Z A;  5LSR A;  4XPE A;  3NMA A;  4OHX A;  3Q89 A;  1BD6 A;  1JLA A;  1GFW B;  4C8M A;  3T1A A;  2ZJR Q;  1S6U A;  2E9R X;  4ICL B;  4O3O A;  3CCJ S;  4DR7 F;  2QL5 B;  1TP7 A;  4LF1 A;  3UNG C;  4EBC A;  3KOA A;  1DTT A;  1IKW B;  1FRJ A;  2BJ7 A;  4R5P B;  2HMI B;  2RVJ A;  4DL4 A;  4P9S A;  4NLT A;  1T9W A;  4KY3 A;  1SKU B;  1ICE B;  2BJ1 A;  3NEK A;  4DDF A;  1UWA A;  2MJN A;  3QJJ A;  4TU9 A;  1K1S A;  2R2U A;  2BW2 A;  3AJ2 A;  3SV3 A;  1I6J A;  4F0H A;  2FC8 A;  4U9R A;  4KH0 B;  4B9M A;  4CM2 A;  2GA7 A;  1S6P B;  2CRL A;  2LLZ A;  2YNF B;  5KG5 A;  4U7U K;  1NXI A;  1N6Q B;  2JEI A;  3PR5 B;  1N36 F;  2M3D A;  3JYT A;  3CT9 A;  1WOP A;  2EKY A;  3C6T B;  2PSZ A;  3PG9 A;  3SBM A;  2V9W A;  3NCQ A;  1IR0 A;  2MGZ B;  1B7F A;  2KM8 C;  3PZP A;  4DR3 F;  4PKD B;  4K0K F;  1S1X A;  2BQU A;  2DVI A;  3T6J A;  4ZA1 A;  4FYW B;  3QMQ A;  1FJE B;  5DO2 A;  1T11 A;  4PQU A;  1RU1 A;  2M8H A;  3R6L B;  1WJ9 A;  3TP2 A;  1C4C A;  3MM5 A;  4C6A A;  4LF6 J;  2NXJ A;  4ZVS B;  2HRU A;  4NZ6 A;  3H7H B;  2D3O R;  1CJT A;  2BOA A;  1KC8 T;  2DNL A;  4LVO P;  3E8O A;  1JJC B;  1NO8 A;  1ITP A;  2DCU B;  3U27 A;  3J7Z T;  1U1R A;  4AL5 A;  3MUT P;  2G2Z A;  2MHN A;  5FLX U;  4JI3 F;  3RB0 A;  3W1Y C;  4GKK F;  3QGG A;  2LQ5 A;  4FYV B;  4WJB A;  4DSF A;  3SQG B;  2AX1 A;  2DD8 S;  2XYG B;  4JP8 A;  2AKW B;  2YWW A;  3GII A;  2DNG A;  1VQO S;  2MHE A;  2HGM A;  3S6E A;  2W8K A;  1I5O B;  3W64 A;  3F0N A;  2FJA B;  3P5B P;  1ZBT A;  5GMK a;  4J9P A;  2VFT A;  4JBC A;  2OGU A;  2VBZ A;  2GHP A;  3QIP B;  4HLB A;  4CTA B;  3MR3 A;  4K5S A;  2AGQ A;  3G6X A;  1U1O A;  2NS1 B;  4IFY A;  4LIW A;  1SB6 A;  1XMB A;  4Q8E A;  4P2X A;  1SJ1 A;  2NSC A;  1BE4 A;  3BF4 A;  1N4L A;  4ZVG A;  4RW6 B;  2GMJ A;  2QT7 A;  3D0I E;  1MNE A;  1JLB A;  1YRX A;  3D6M B;  1S1T A;  2EVZ A;  4R25 A;  4XAK A;  2YQ1 A;  4CLS A;  4TXS A;  5A8W A;  5I42 B;  4F4Y A;  5KFE A;  4DWI A;  3JSM A;  4LFC F;  2HVH A;  1JK9 B;  2HWT A;  1PYT A;  4J9M A;  1U49 A;  1QAI A;  3PW7 A;  3MDF A;  3EVO A;  2V8V A;  3HSD A;  1FKO A;  2ZZT A;  3BO3 A;  4GKK J;  2KT3 A;  1I1G A;  5GAE I;  3QT5 A;  4O4R A;  4F3Q A;  3CCZ A;  1XNQ J;  4DUZ F;  2VA2 A;  1GTE A;  1VBK A;  1WOO A;  1TVR A;  1XR7 A;  3NGS A;  4IO1 A;  5DDO C;  4G1Q B;  1X4D A;  1BLU A;  4XTT A;  1FEH A;  3T9N A;  1ZM9 A;  2F8H A;  3OR1 A;  3E51 A;  2VON A;  4OZ0 A;  1SQG A;  4DQI A;  3GZ7 A;  2GW8 A;  3HT3 A;  3PO5 A;  3UPF A;  3T1Y J;  2Q66 A;  3SQG A;  1V5V A;  5IWA J;  2V4Q A;  2XC9 A;  2HSE B;  5LJ3 Y;  2QMX A;  5F8J A;  2EPI A;  2KN4 A;  1YRT A;  4JI7 J;  4WXO A;  3M30 B;  2J5A A;  3QWU A;  4UST A;  3CJ3 A;  5JUM A;  4Q45 A;  5AE3 A;  3QAE A;  4YME A;  3FZB A;  1HIY A;  1MML A;  5D0E A;  5IV4 A;  1WEX A;  1U1P A;  4CLZ A;  2HNZ B;  3O44 A;  5MAO A;  3TZW A;  1U09 A;  3OLA A;  3G96 A;  1GK8 A;  4ZMM A;  2E1A A;  4RUH A;  2W1B A;  2FLL A;  3AOD A;  2OEK A;  4OV1 A;  3QO9 A;  5E33 A;  5C24 B;  1HW8 A;  4XDD A;  4UQT A;  1K73 T;  2JRS A;  2ZBP A;  4F3O A;  5DQH A;  5D4L A;  3MEG B;  4X64 F;  1HBM B;  1R89 A;  3MEE A;  4KR0 B;  1BUX A;  4M8L A;  4CLY A;  1IKY A;  2DJW A;  1VI7 A;  4AUK A;  2IA0 A;  1BXN A;  1XJW B;  2Q43 A;  2FD2 A;  3I5B A;  4QYR A;  5I4M A;  3UW1 A;  5F8G A;  1H7X A;  4DS5 A;  3M2R B;  4ZS6 A;  4USI A;  1NSQ A;  3UDL A;  2GVD B;  2M5Y A;  4C7Q A;  3PW2 A;  4OYB A;  2ACM A;  4DCJ B;  3DNC A;  3AH6 A;  1FKP B;  4ZP9 A;  1KNZ A;  4CT8 A;  4C11 B;  5EHH A;  4YFU A;  3IN5 A;  2BJD A;  2BAN A;  3OTE A;  2ZBI A;  1FDA A;  4QIF A;  2MGZ A;  1DAR A;  4LRB A;  3SMZ A;  3ISZ A;  5M2U A;  3Q8U A;  1KLN A;  1H7W A;  1Y5L B;  2OML A;  2MQL A;  4HVZ A;  3BGF A;  3TNV A;  4KGK A;  4CTA A;  1E6Y B;  3J80 Y;  2DR5 A;  1WDT A;  4DL3 A;  1N5Q A;  3JSB A;  4MIB A;  3VAG A;  3E2E A;  1QLN A;  5F8N A;  3CD0 A;  3K8W A;  4YB5 A;  3U02 A;  4J9L A;  3A8K A;  1RT4 B;  3ZTR A;  3PW0 A;  1NPR A;  2CPD A;  1ZM4 A;  4PXE A;  4K4X A;  2MMY A;  1OPZ A;  3H98 A;  1WKL A;  3VAF A;  5DDQ C;  1D9D A;  1X0F A;  4ZKA A;  1R0C B;  3TOQ A;  4DV2 J;  2D9O A;  3SI8 A;  3NY0 A;  1HHQ A;  3ENQ A;  1AUD A;  2YKO A;  1RCX B;  4HKQ A;  3KG1 A;  3IR6 B;  1UJ6 A;  2Z4P A;  4OI6 A;  3FCV A;  5J1E B;  4C98 A;  5AXK A;  3OSN A;  1F5A A;  4NLD A;  2VQE F;  2VC0 A;  1AYE A;  2L3M A;  5KFM A;  2V2K A;  1VQ4 S;  6FD1 A;  4FYD A;  1TL1 B;  4KFB A;  3I9V 9;  4KQZ A;  2BX6 A;  2QZ8 A;  4Y2A A;  1QVF R;  1N88 A;  5DET A;  2IM2 A;  1RT7 B;  2R7R A;  4EYH B;  3AY0 A;  2DGS A;  1YBT A;  1R0B G;  2GHV C;  2ILY A;  3JTO A;  3DHX A;  3DMJ B;  2ZH4 A;  4QWD A;  2KJV A;  2XBP A;  3RRH A;  5A8K A;  4JOU A;  4IG3 A;  3R8Y A;  1FKP A;  3QZ8 A;  2W2M P;  4NRT A;  1C2P A;  3L09 A;  3MD3 A;  4W4M A;  4EWT A;  1U0H A;  2GV1 A;  2HQC A;  2WVB A;  3Q8P B;  5BYQ A;  2ZH6 A;  4LR8 A;  1YG0 A;  4YY3 J;  1JXL A;  2AD9 A;  1K0T A;  3OFE A;  3AD8 C;  4E98 A;  3K5M A;  1GTH A;  1IKX A;  3BSA A;  1IBM F;  3QRP A;  2M2B A;  3MM6 A;  1Q8K A;  2E5H A;  3TA2 A;  1S0N A;  4B3T F;  4QU6 A;  2B56 A;  1QJH A;  2GVZ A;  1F3V A;  1LWE B;  2CZV C;  1RT4 A;  1JXE A;  1TL4 A;  2CJX B;  2CNL B;  2H48 B;  4QIV A;  5AE2 A;  1T7P A;  5LMU F;  3QO9 B;  5C24 A;  4ILL A;  3HD2 A;  1LW0 A;  3DM2 A;  2HVI A;  2I8E A;  1OQ6 A;  5ITH A;  3UDV A;  4M5N A;  2XI2 A;  3OLB A;  4DR2 J;  2F1F A;  3MUM P;  3KUH A;  2CAJ A;  2LDI A;  3TZX A;  3DN9 A;  4G1I A;  1NK9 A;  2ZEJ A;  2CIM A;  4ECV A;  3CJ0 A;  3IC1 A;  3G6E S;  2JEF A;  4MIA A;  3F44 A;  2WTF A;  3DLH A;  4WFX A;  2BKO A;  1DQA A;  3LGN A;  4OX6 A;  4LF9 F;  4HAC B;  2R2S A;  1CS4 B;  4RW7 B;  5E7O B;  2H54 B;  3O6Q A;  2WAQ D;  4H4O A;  1ULR A;  2KT5 A;  4ZPD A;  3ZFV A;  4J9R A;  3U1N A;  2F40 A;  4DR4 F;  1KR4 A;  2XS5 A;  3M2U B;  1YTY A;  1T9V A;  3SXL A;  3MD1 A;  4ZPW R;  3DHW C;  3OL9 A;  4I2Q B;  3OL6 A;  4TY9 A;  4PQA A;  2AZ1 A;  4DV7 J;  4JI4 J;  3MR2 A;  5B0F A;  2BEF A;  4RU9 A;  1VC0 A;  3TO8 A;  3EZ5 A;  1FX2 A;  1S49 A;  1X9S A;  1NJI T;  3NMR A;  1IM6 A;  4RW9 A;  3W9I A;  2BJ3 A;  2M0G B;  2RHQ B;  4PEO A;  3C2P A;  1RWO B;  2HNY B;  2GCF A;  3C6U A;  1NKB A;  2BV3 A;  5DQG A;  1AW0 A;  1QY7 A;  1Q0N A;  2C3Y A;  1HQE B;  2OPR A;  2IJF A;  4J9S A;  3W60 A;  2H5J B;  2J7K A;  2C2K B;  3QPI A;  4M5D A;  3MZI A;  4TLR A;  3HHL C;  5D0H A;  4QPT A;  3I5A A;  5F0U A;  5B0A A;  3N6M A;  5HQ8 A;  2W25 A;  2C2R A;  2E5J A;  2C3M A;  2LXF A;  2HFZ A;  5HSP A;  4DUZ J;  2AJ2 A;  1WSV A;  1W7W A;  1ROF A;  1N32 J;  1C0T A;  5L9X A;  2X3G A;  1XR5 A;  3DYA A;  4PXB A;  2OLW A;  2OFH X;  3H8Y A;  4WK1 A;  1YJW S;  4WZQ A;  4IOC Q;  3MXH P;  3S8S A;  2WOM A;  4I7F A;  2Z56 B;  4YR0 A;  3SCI E;  3CO9 A;  1NDC A;  3PR4 A;  4NA1 A;  1FCA A;  5ETO A;  5DG9 A;  5KG3 A;  4IR9 A;  2ZBC A;  4K7Q A;  2JC0 A;  1QAY A;  2JL9 A;  4LQ9 A;  4Y2C A;  4Q8F A;  1IKV A;  2RS8 A;  3FQL A;  2MLY A;  5KFC A;  2QFJ A;  3MM8 B;  2J8S A;  2UU9 J;  2EBG A;  3ENW A;  2Q79 A;  5F3Z A;  2DNN A;  2I38 A;  1YDL A;  2VQF J;  4U8V A;  1VBY A;  1HWI A;  1GXT A;  4RUB A;  5T14 A;  2KXF A;  5A6W A;  3MM6 B;  1XMO J;  2EFV A;  1NK8 A;  4U8Y A;  3H5X A;  2UXC J;  3QSI A;  4F4W A;  4ZVF A;  1WEL A;  5HN0 A;  4ZPB A;  3A8I A;  3NAI A;  1DQ9 A;  1GMV A;  1N0V C;  1NZA A;  5LXR A;  4TNO A;  4DUY F;  2KVQ E;  3WX8 A;  4RW9 B;  4FNH A;  6AT1 B;  3G87 A;  1UA0 A;  4B08 A;  5J2P B;  1KQK A;  2RD5 C;  1TMJ A;  2DR7 A;  3GU0 A;  3QJL A;  4DR6 F;  1R27 B;  1T9Y A;  3EIC A;  3HHL B;  4TY8 B;  3CXC R;  1VQY A;  4OI4 A;  3JSY A;  2DHA A;  1FJG J;  2HW3 A;  1NSK L;  2CJY B;  4RWX A;  2EG2 A;  2QLJ B;  1N6Q A;  4BWJ A;  2VG5 B;  1B0T A;  3SZ2 A;  3OTB A;  2ZH5 A;  1HBN B;  4EK2 A;  1TKD A;  2EC0 A;  2N7C A;  1PJ6 A;  5CH7 B;  1YJ9 S;  3TVZ A;  5GMD A;  5KFK A;  2DGV A;  4YR3 A;  1FRX A;  3CJR A;  2EI5 A;  3IG1 B;  4DHV A;  4WYL A;  5HL7 Q;  1ZAW A;  4Y2I A;  4IRC A;  4K2X A;  1TKT B;  4DPO A;  5LSO A;  3BQ0 A;  3GCX P;  4LVN P;  4OZJ A;  1Y0H A;  3CPW R;  2BQR A;  2WVF A;  1CLF A;  3LGM A;  1VJW A;  2J0Q D;  3JQK A;  3FSX A;  3NS7 B;  3UCG A;  3POT A;  2GC8 A;  4IOB A;  2YY3 A;  3ZZU A;  3RB6 A;  3K59 A;  3KDN A;  3MPW A;  4QWC A;  2AYB A;  4L6V 3;  3PNI A;  5J1N A;  3D0G E;  1WC4 A;  1PC4 A;  3A3P B;  3CDE A;  4Q44 A;  1QTM A;  3PHT A;  3IGV A;  2R9L A;  1SBR A;  4CP5 A;  2ACY A;  1X5S A;  3TQ1 A;  4RNO A;  3JAM U;  1RLC L;  2YQ0 A;  4LF5 J;  4LBP A;  4XIU A;  3R1H A;  3R5C A;  3JS9 A;  4LSL B;  4RNH A;  5D78 A;  2CJ9 A;  4LF7 F;  1FD2 A;  1RLD A;  4PRF A;  4OJ1 A;  4UF4 A;  2LEB A;  4LQ3 A;  2VA3 A;  1SV5 B;  4HHJ A;  3PKY A;  1VIX A;  2P8I A;  3FEX B;  4RBU A;  3FSI A;  4EO8 A;  3H2L A;  3ONQ A;  3IG1 A;  2CNO B;  4RKU C;  1EQ0 A;  4UOF A;  1EET A;  3FEY B;  2J6U A;  2R8J A;  2IAJ B;  4X66 J;  4QWE A;  1RTI A;  2Z30 B;  3CNQ P;  4ZP8 A;  4ZJL A;  1XWL A;  2CXE A;  4A8X A;  4CRJ A;  1HBM A;  2DO4 A;  3PX6 A;  1J5O A;  1EP4 B;  1F9E B;  2ADB A;  3NL0 A;  1HNZ J;  1FRM A;  1BHN A;  3DDN A;  4RW4 B;  4K5R A;  4DSL A;  4OYI A;  4A4J A;  4EBD A;  5KFO A;  3N01 A;  1RT1 A;  5DM6 Q;  4LF8 J;  1C0U B;  1X5P A;  2YBV A;  4E0D A;  2E1R A;  1Q7L B;  2D3U A;  3PYF A;  4ITS A;  3DOM B;  3GB0 A;  4N7T A;  1VLO A;  3PKM A;  2MLX A;  1N32 F;  2BUN A;  2OFG X;  3MUR P;  1HD0 A;  2HG4 A;  4NLY A;  1PJ5 A;  4ZN3 A;  4KGX B;  1IKV B;  1RZM A;  1NB2 A;  1WAC A;  2LCW A;  3UR0 A;  1X4C A;  1RGV A;  4JI0 J;  3IWX A;  4CO4 A;  1UET A;  2HGN A; 
#chains in the Genus database with same CATH homology
 1RHM B;  1RWN B;  1QDU B;  1PYO B;  2QL5 B;  3IBC B;  4DCJ B;  1IBC B;  1ICE B;  3R7S B;  3R7N B;  4DCO B;  5IC4 B;  2C2Z B;  4ZVP B;  2FQQ B;  4JB8 B;  2QL7 B;  1RWM B;  2HBY B;  1SC4 B;  3RJM B;  4ZVT B;  2XYP B;  1RWX B;  4ZVU B;  3KJQ B;  1RHU B;  1SC1 B;  2Y1L B;  3R6L B;  4ZVS B;  2XZT B;  2CJY B;  2QLJ B;  2CDR B;  2H5I B;  3D6H B;  1RWV B;  2P2C B;  1RWP B;  3EDR B;  2H4W B;  2HBQ B;  3P45 B;  2XYG B;  4ZVR B;  5K20 B;  1RHK B;  1I3O B;  2C1E B;  1RHJ B;  2HBR B;  3KJN B;  4LSZ B;  3GJR B;  2H65 B;  3NS7 B;  3P4U B;  4DCP B;  1BMQ B;  2CJX B;  2CNL B;  2H48 B;  3KJF B;  1RE1 B;  2Y0B B;  3D6M B;  3SIP B;  2HBZ B;  3EDQ B;  2QLB B;  1RWW B;  3D6F B;  3R7B B;  2DKO B;  2QL9 B;  5IC6 B;  2H4Y B;  1I51 B;  1RWK B;  2H54 B;  3GJT B;  4ZVO B;  1PAU B;  2CNO B;  2C2O B;  3GJQ B;  3R5J B;  3GJS B;  3QNW B;  1F9E B;  2XZD B;  2QLF B;  1RHR B;  1RWO B;  2H51 B;  4ZVQ B;  1GFW B;  2H5J B;  2C2K B;  1SC3 B;  2CNK B;  1NME B;  1RHQ B;  2XYH B;  3R6G B;  1QTN B;  2CNN B;  3IBF B;  2C2M B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...