2VH7A

Crystal structure of human common-type acylphosphatase
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
94
structure length
94
Chain Sequence
TLISVDYEIFGKVQGVFFRKHTQAEGKKLGLVGWVQNTDRGTVQGQLQGPISKVRHMQEWLETRGSPKSHIDKANFNNEKVILKLDYSDFQIVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Rigidifying Salt-Bridge Favors the Activity of Thermophilic Enzyme at High Temperatures at the Expense of Low-Temperature Activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords ACYLPHOSPHATASE-1
total genus 26
structure length 94
sequence length 94
ec nomenclature ec 3.6.1.7: Acylphosphatase.
pdb deposition date 2007-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00708 Acylphosphatase Acylphosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vh7A00
2K1RB 1AFIA 2EW9A 1FEEA 1V3ZA 4QOTA 5A6PA 2PGCA 4NL5A 2LDIA 5T7LA 1YRXA 4ZA1A 1OSDA 1P8GA 4HI1A 2KYZA 2GGPB 3TOQA 4DL0C 2Q3PA 2XMUA 2HFNA 3HDSA 2K1RA 4A4JA 1S6UA 2BYCA 2BUNA 3HX9A 2OD4A 3KG1A 2HQIA 1Y3JA 4YEAA 3BM7A 1KVJA 5F0UA 3T9NA 2LXFA 1Y0HA 2N4CA 4OJHA 2QLXA 2XMMA 2GGPA 2PD1A 5B0EA 5K9FA 2HLTA 2K2PA 2N7YA 2RSQA 2JDJA 1Y9OA 3QGPA 1Q8BA 2K7KA 2RILA 2LQBA 2XMWA 3IWLA 4HH1A 5B0AA 1TZ0A 3BGUA 3BN7A 3BR8A 5B0DA 1YJUA 2IYGA 3HF5A 1N5QA 3TNVA 2OKQA 1GXUA 2OFHX 2QIFA 5KAKA 1MWZA 1Q53A 2OD6A 1TUVA 3BDEA 1YJTA 5A6WA 2AJ1A 2OMOA 4OJ3A 2FB0A 1KQKA 1Y3KA 5F0WA 5B09A 5B0CA 4F67A 2GA7A 2XMTA 1X0PA 1SI9A 3DXSX 1GXTA 4OIXA 1K0VA 2HIQA 1ULRA 1X7VA 3BF4A 4A46A 4EFAC 4NPOA 2GFFA 2N4DA 2ROGA 1AW0A 2GCFA 1KVIA 3FMBA 3DCAA 1JWWA 2K7JA 3K7RA 3HFKA 1QUPA 3IWXA 2FIUA 4ZOSA 3HHLA 1FE0A 4U9RA 4Y2IA 2ASYA 1FE4A 4Y2KA 4A48A 1X8DA 3WDOA 4Q2LA 1TL5A 2OP5A 2RU9A 3CJKA 4HH0A 1AFJA 3TRGA 2OFGX 1JK9B 5B0FA 1LQ9A 4Q2MA 3MCSA 3HHLB 2IFXA 3GZ7A 3KNGA 3KG0A 1YJRA 2XMKA 3BB5A 2OAUA 1WD6A 4FNHA 1FESA 2QLWA 1Q4RA 1IUJA 3HHLC 3KKFA 4DPOA 3LO3A 2HLUA 1OQ3A 2XMVA 3VTIA 1CC8A 1N5TA 2IYIA 4OJ1A 2KT2A 3FRYA 1VQSA 2BJEA 2QYCA 1VQYA 1N5SA 1XBWA 3LGMA 2BJDA 2G9OA 3UDCA 2AW0A 5B0BA 2W4DA 4Y2MA 2ACYA 1FD8A 2ZDPA 1OPZA 3HHLD 2AP6A 1N5VA 3FGVA 1YG0A 2LQ9A 2XMJA 3E8OA 1FVQA 3I9ZA 2VV5A 1TL4A 4HI2A 3F44A 1FVSA 2W4CA 2W4PA 2KT3A 1APSA 1S6OA 2CRLA 2HFOA 2FHMA 1Q8LA 5IXUA 2ROPA 4OJGA 5B08A 1OQ6A 1URRA 2AJ0A 2ROEA 4YDXA 2GV1A 1SQEA 2ZDOA 3CJKB 5B0GA 4A47A 1CPZA 2VH7A 3QMQA 1W2IA 4FNIA 2RMLA 1U7LA 3LGNA 1P6TA 1TR0A 1YJVA 2BBEA 2KKHA 2L3MA 5T7LB 1MWYA 2GO8A 4DN9A 1R6YA 1RJJA 1CC7A 3MZIA 2FTRA 1SB6A 4HL9A
chains in the Genus database with same CATH superfamily
5H9FJ 3ZO7A 2V6AA 4B9SA 5ADZA 4JOUA 3TA2A 1NLKL 1C1BA 1ZAXA 2EKYA 4WP9A 3DRRB 2KFZA 3CDUA 4I0WA 4Y28C 2VFUA 5BYRA 5LMNJ 1GMUA 1ZPVA 2H5EA 2ZEJA 3K5MA 4WK1A 4J9MA 4OYWA 1XJWB 2NXUA 4F36A 3BPSP 1XWLA 3CO0P 5C24B 4ED2A 2XGPA 3GJSB 2XS7A 5GVQA 3HT3A 3MM5B 4ECXA 2HG4A 2NUHA 4HR2A 2DNRA 2F5GA 1W25A 5KOWA 1VR6A 1RT6B 1P1LA 2PD1A 4O3PA 3PYGA 3OXFA 1X5TA 4OLOA 4B3OB 3WIUA 1TFYA 2MLXA 1G4CA 1TL3A 2YVSA 2B43A 5E3AA 3CJRA 1CEZA 1SKSA 4HDHA 3G87A 3BR8A 1CBKA 3TZZA 4X65F 2XG8A 5L39A 3OVSA 2OFHX 3MUVP 2P9EA 1B0TA 3FBFA 4OZLA 1RBAA 4QR1A 1DQAA 3PVXA 3IS9A 1TL3B 2LEPA 3CJSA 4NXNJ 1MW7A 4U8YA 4J91A 4OIXA 1ULRA 2I5JA 2HWIA 4QR2A 4DV1F 3S8SA 4JI1J 3SEOA 2VD3A 3RB6A 1G3OA 2NXJA 4EFAC 2E7WA 4Q7AA 3MEDB 1YZ7A 5J2NA 4DR3J 3D2WA 5I42A 2MSTA 3UDVA 2QN6B 1HW9A 2D3UA 1IBCB 4O44B 5HQLA 2HVIA 3F0NA 4ZLJA 1WHVA 2C1EB 5CAAA 2J7UA 1MWQA 1S48A 4A48A 3FK4A 2HS3A 3VAKA 4FF1A 3KNAA 4ZJQA 3NXZA 4HH0A 4ZLNA 1NK0A 2EBGA 1T9WA 1RKJA 3FVYA 2HZAA 1VC0A 3OLAA 3MUTP 5J2QA 1RACB 2EWHA 3KLEB 4TY9A 3VZHA 3U1LA 1D9AA 1Q8IA 8RUCA 1U0HA 3ADAC 1TK5A 5D0RA 1YJNS 2MTLA 4HT5A 4URGA 2D3OR 3N6NA 3DU5A 1H2TZ 4WIQA 2W2QP 3Q8QB 1CG2A 1XK8A 3VTIA 1HNXJ 1N5TA 5J2QB 2IYIA 4F2RA 4XK8C 3THPA 1TL7A 5MLCV 4PCQA 3PJXA 3AOAA 1RWVB 3CCLS 1J5EF 3UDCA 1RAGB 5K14B 1T11A 1KDNA 5D3GA 2CDQA 1ITPA 2Z0GA 3IG1A 2D41A 3Q89A 4GMKA 3MFIA 3PXGa 3HVRA 2J0SD 1G1XA 1REVA 5E3QA 2KTQA 2JLFA 1YG0A 3LP2A 1L3TA 4KR0B 2HFSA 4OHZA 3JS9A 3OXLA 1WI6A 3DOMB 4W98A 2HHTA 2QC3A 4OHVA 1HHSA 4MKVA 2G4BA 2ERRA 3TX0A 1FRIA 3K8WA 3QRQA 2FHMA 5ETVA 4RBUA 3HHNB 4HVZA 3GLJA 5KFNA 2LDYA 1NJZA 4ITSA 4K2XA 1Q82T 3SV4A 3THVA 1OSCA 2JJ4D 3D54A 1QE1B 2I9SA 2ZWOA 1FK9A 3MURP 1FDNA 5HSPA 3G6YA 4XDCA 1XC9A 2JEFA 1WOSA 2VIHA 4CO5A 1IKXA 4DL2A 4PXBA 1PYSB 1WEZA 3AJ1A 2C2RA 3C6UA 1FFSB 5AXNA 1T02A 2AU0A 1YVFA 3K0JA 1RJJA 5C2GA 4QCLA 4JI5J 3HT0A 4TU7A 2BKNA 1TAQA 2Z58B 2RQ4A 1XIQA 4KO0A 2JEIA 1DURA 4BC7A 4D3HA 2R7QA 2C22A 3M9OB 3HSZA 3ZNUA 2YNFB 1VIXA 4MFBB 2J6SA 4F4XA 3N6LA 4QWCA 1VLYA 4PWWA 3TOQA 4AYBD 3AAWB 4JI0J 1RBOB 3NNCA 2EFOA 3KFWX 4IUFA 4X2BA 3LALA 2UXBF 2J0WA 3MM8B 3L4BC 1I1GA 1Y0HA 3QYYA 3CJ2A 5C7PA 3MMCA 2UXCJ 1S5ZA 1N54B 1SPBP 5GMKa 2FGCA 2AJQA 3LPYA 4C3MA 2JDJA 1E6VB 2H1YA 1O51A 4QW9A 3Q24A 3MPUB 1TZ0A 4WFBQ 5HROB 2ZH2A 5F3TA 4RLEA 5J1EB 2ZKUA 1FDDA 4BWMA 3FEXB 4KGKA 4U6PA 4OZ1A 4YP3A 1IR2A 1A0OB 1P9YA 5F8HA 3DMJB 2XLIA 4PG4A 3IM8A 2IVYA 1N0VC 2VC0A 2XCPA 4L74A 4IRDA 2YWHA 3FFIA 3PW4A 1PCAA 4I68A 1NHKL 5D15A 1WNEA 2IRUA 3DXSX 4LRBA 3TP2A 1YRTA 1S6PB 4C8KA 3AD9C 3I9V9 3PW2A 2XBPA 3OL6A 3HSDA 1KOOA 2FJAB 1DTQA 4FYVB 3R9LA 5KFVA 2KRBA 2IAJA 4HDGA 4WFAQ 4F50A 3BBBA 1IWGA 2IJFA 3C15A 5I3UA 2BANA 4YFUA 5FLXY 1EX8A 2HURA 2PFFB 3JYTA 4QIFA 3PYFA 3KG4A 2DR6A 2CUYA 1JLEB 2BX6A 4DV0J 5C25B 4DG1B 4DCJB 2RE1A 1H2VZ 1TL5A 4GRSA 3MMJA 2MZJA 5KFLA 4PWUA 1Y5IB 2BANB 1NZ8A 2OFGX 3BH6B 4DPTA 4P72A 2BR0A 3FDSA 3JYTB 5HMXA 1S4EA 3D7SB 3GP9A 1RA6A 4OYMA 3CDEA 2QMWA 1FRKA 1OS5A 3BB5A 3OFHA 5ETOA 1S1WB 2Q1LA 3GV7B 1U45A 4ILLA 3BN4A 2W2NP 4RNOA 4ZIWA 4DV4J 1BC6A 2GIFA 2HLUA 2R4FA 4DV0F 1F3FA 3G96A 1RTHB 2IHR1 4Y65A 3OTEA 2WTFA 4DV7F 1CC8A 4OJ1A 2E5HA 9ATCB 4DFJA 3M4XA 3D6MB 3NP5A 4J9QA 4K4VA 4IDKB 3CJTA 5CCLA 4LVNP 3DDKA 3T6BA 4PEOA 2O5DA 3KLVA 4P7VA 1RTHA 1DHMA 4CLZA 2V69A 1NDLA 4DV2J 3EDRB 4F04B 2CIMA 4FXDA 3R5GA 4L72B 4XPEA 3BZQA 1C2PA 5K8MA 2D1CA 4YR0A 1VQ8S 3P5BP 2CPIA 3RB4A 4F02A 3DHXA 4KAIA 4QWBA 1S1TB 3A12A 4DMZA 3IN5A 2VKRA 1TKXA 1H3DA 2MJNA 2WRMA 4HKQA 3BQ2A 3N9UC 4F3MA 1T95A 3R7BB 4P52A 5THWA 3IM9A 4YDXA 1VQ7S 1RTDB 1P9QC 4DHVA 2VJVA 2E7XA 1D1UA 3RU0A 2OSRA 2R7XA 2A0FB 2O66A 4I56A 1Q78A 2D69A 1W2IA 3NBPA 4LSNA 2OEKA 3BYPA 4CRJA 2XY6A 2V67A 4CDIA 4C8OA 1UWBA 2ZOFA 2CVIA 3MECB 1NSQA 5L1JA 2G2YA 4QPTA 2W1BA 3ZTPA 1CC7A 4XDDA 2GNKA 5HP1B 4K4SA 2OP5A 2V68A 3CJKA 3KJVA 2V8VA 3OTOF 4LR8A 1F1BB 2XWXA 3GG0A 1AFIA 2GIRA 2V50A 3VWSA 3PIPQ 2A3JA 1R89A 1SXLA 1RUSA 1VGYA 3P45B 3CXCR 1YRXA 5F8NA 3AXKA 2YH1A 1FCAA 4DL0C 2A1BA 1RZMA 1XQIA 4PQUB 2DGQA 2MHNA 1O5JA 4P2FA 4A4JA 2MKIA 2LECA 1O6XA 2AKWB 1EAYC 3EWGA 1V5VA 1U1MA 2MQ8A 3HSJA 2LXFA 3CO9A 4BCAA 2N4CA 4OJHA 2F4VJ 4ERDA 3VAGA 2UVVA 1PC4A 3EXYA 2RUGA 1R0AB 3J7AN 3A1YG 4M5KA 5IT9Y 1CQNA 1NRKA 1RWUA 1SKUB 4CH0S 3A8KA 2J7WA 3GONA 2JC1A 2B9WA 2PIIA 2XEXA 3FSYA 1NK7A 2DR8A 3PEHA 1S1XA 2IC3A 3RTVA 1J27A 4KY3A 2L9DA 2RT3A 2QA4G 2PE8A 1RT6A 2GAGC 1LKZA 2RD5C 4J9RA 3OL9A 3N4WA 4IFYB 4NMXA 1TUVA 4EBEA 5A6WA 1SJ4P 1C0TB 1CVJA 4IQMA 4KQZA 5A76A 5J2PB 1S1XB 4Y2AA 2GA7A 5BYQA 4RNHA 3TEHB 3TVYA 1MSWD 3IAS9 3JAMU 1GXTA 3SSSA 3MR5A 5G0RA 2AEMA 1B4SA 3NNAA 5AXKA 2JFKA 5A8RB 3KHLA 2J9CA 5F3ZA 2XNQA 3EVOA 3V4IA 2VONA 2VQFF 2B8PA 1UL3A 2MZQA 2RQMA 4ZOSA 2L41A 3D1QA 4DZDA 2OLWA 2FY8A 3M2RA 3MM6A 4ZS6A 4IG0A 4TU9A 2HGMA 4RW6A 1Q86T 1F2GA 3PG9A 1V6HA 2MKJA 2W9BB 4DN0A 5F8GA 2Z56B 4ZHRB 4JV1A 3J7A1 4B9TA 4UQTA 1FNXH 1VK3A 3QPIA 4X65J 2UUAF 1SIWB 3IXQA 3MCSA 1RT2B 3GZ7A 4RBVA 3BREA 1GX6A 5GADI 2H9ZA 2XHCA 1I6JA 4I2PB 5EWGA 2DO0A 5K14A 2YX1A 1RAJA 4KGZB 2F40A 2NYHA 3QIDA 4DQQA 1XMOJ 2EK1A 2BJ3A 2Q6CA 5ETQA 2ZM6J 5A8WA 2CWKA 4LFAF 2QRRA 3JQMA 4LMZA 2IVMA 2BJEA 4EWTA 2RKIB 2H48B 4RO0A 3F41A 3JSYA 4DR3F 3PJWA 1U1NA 1R6VA 2MQLA 3QATA 1G6BA 4LF7J 2P6TA 1HI0P 2RRBA 1TTHB 3Q2TC 5HMYA 3KYLA 3TZYA 2W25A 1M5VC 2A6OA 2RKIA 1S0VA 3D4JA 4USMA 2L9NA 2RU3A 2BM1A 5I3PA 2W4CA 3OXGA 2GW8A 2KHDA 3TAQA 1YJWS 7FDRA 2VPYB 1TU0B 3AT1B 5GAHU 1UEVA 4C11A 3EGWB 5LMUJ 1Y5NB 2XULA 2DNMA 3WC0A 1H74A 1QY7A 3L9ZA 3POTB 4KFBA 3QMQA 2DR9A 3M7VA 2ZH4A 4RR5A 1RT1B 2A2DA 4NASA 2AYGA 4H54A 3TARA 5GAEU 2VHGA 4JI6J 3ET6A 1LW2A 2GO8A 2AEJA 5U47A 4DV6J 2RHSB 3QT7A 3BH7B 2ILYA 2OPPB 3H4BA 3KTQA 3MPDA 1WC6A 5E5NA 5KT7A 5IT0A 2V34A 4F26A 4NZ0A 4MYUA 4X4QA 3CPWR 4M5MA 1FEEA 2V8PA 2GZOA 3K89A 4NL5A 3C6UB 3GMGA 4CO2A 4IRKA 3MM7B 2P8IA 2R3VA 5DZ7A 4ZA1A 5LM7E 4DR4F 3Q23A 2HVZA 2F8EX 2N3LA 2V4JB 2B4VA 3FUYA 4IRCA 4JI6F 4ZVOB 5KT5A 4BLGA 4NLQA 5HMWA 1PKUA 1C0UB 4USTA 1V3SA 3NAHA 4IH7A 4YOEA 2RHQB 5CABA 3SCLE 3AD8C 4PUOB 1S0OA 2MSSA 1NB2A 1JLCA 4NEYA 1OPIA 2XHWA 4Y34A 4YHHJ 2HW3A 4LSZB 2YQ3A 1QVFR 1S7HA 2BE7D 4N56A 1M5HA 1Q8BA 1ROFA 2FZKB 2WONA 2XMWA 3DN9A 3KMQA 2D9PA 5D4LA 2PEHA 4USWA 3R8YA 2MPUA 2J9DE 1OIAA 2C2DA 1UMJA 1NKCA 1FKOB 2DNGA 4NMLA 2KG0A 1B0PA 4JI3F 4LF5F 3MHYA 3HPOA 1N5YA 2CQ4A 2OD6A 3M8QA 3W66A 3W3SA 5B09A 3QRPA 3GIKA 1Y3KA 4LF1A 4URQU 5KTQA 3FQKA 1HWIA 4DUTA 2EG1A 3DLKB 1WOOA 2VPXB 2JH3A 1YIJS 1U6ZA 2WSCC 1HKAA 1BXNA 1X4GA 3LH2S 3MGJA 3Q8UA 4LFAJ 6AT1B 1YBAA 4A46A 2ZM6F 4FBUA 5HVHA 2Y0BB 3SSQA 4FYXB 3D9BA 5CQGA 1MROA 3FFIB 4ICLB 1RA7A 3W9IA 5LXYA 4X64J 2L08A 2H5IB 2VBYA 4CI0B 2UXDJ 1M5SA 1M1GA 5EUHA 3HULA 3C15B 2CJYB 5I3UB 3I32A 3R7NB 4EZ6A 4H4MA 1S9GB 3AQOA 4K8RA 4UTGA 2GAHC 1T05B 3KG0A 1UETA 4JYAF 2BJ7A 2LA4A 3H5SA 2XSFA 3NWRA 1PAUB 1VQ4S 4ID5A 1R7IA 1TUWA 2R42A 4KIAA 3CJQA 5A0YA 1U49A 4KV8B 1VCTA 3B8HA 5FLXU 2XMVA 1D8YA 5L1LA 4DQPA 4K0KJ 4MIWA 2UVUA 2EC2A 3KUHA 1K73T 1H98A 3MPYA 5D6GA 3OSNA 1NK8A 2UUWA 1UFKA 4NI2A 4DPWA 2QZ8A 1S1WA 1RWPB 2DD8S 2LVWA 4N7TA 1N48A 4KHPJ 2CQ2A 5KFIA 4UY85 1K47A 3BSAA 1S79A 2CFXA 4DPYA 4ECSA 2ZD1B 1YX2A 1FKPA 1TL1A 1RYSA 4C7QA 2CYYA 4OZ2A 4PYAA 5KG6A 1TL4A 1XN9A 3G6VA 3UD3P 1KLMA 1HWLA 3VR1A 2C28A 4U95A 3DLGB 3F44A 1XMQJ 8ATCB 1BE4A 1S6OA 3IMQJ 4CO0A 1YWXA 4PPZA 1S99A 2ZD1A 1DZ5A 1OQ6A 1L5UA 2B4PA 4H4KC 2SXLA 5D4NA 1T7PA 3NCQA 1T03B 2F9DA 3MM9A 4TXSA 5FDLB 5B0GA 5I4MA 1CSJA 4LF4J 1C4AA 5IV4A 2HWTA 3GFHA 5T14A 1NBEB 2HSEB 5HJXA 4Q44A 1W2BR 5DGBA 1NPRA 2WOMB 4IG3B 2W24A 1HHQA 2DRDA 5FD1A 2DR5A 3KDNA 3SMZA 4CLFA 4RUHA 3KLFB 4C0BA 3CJ4A 4EYHB 3R6GB 1RB0A 1FEHA 3M8ZA 1JXLA 4RU2A 4B3SJ 3CMAS 3G2XA 1F5BA 3QBCA 5T7LA 1QLNA 4WKYA 1N33F 4DU8A 1RKIA 2HQCA 4USHA 1RT7B 4CWBA 3T1HF 1R0AA 2E5LJ 3QT5A 4LF7F 4I4BA 5LOQA 1C1BB 2IJNA 3LTOA 4AD6A 1X60A 2QSFA 2CJBA 4CNYA 3IRWP 1S9EB 1S1VA 1DAXA 4WFYA 1U1KA 4DV2F 2GGPA 3BEGB 4F4YA 2FVSA 4ZJLA 3B78A 1Q95G 3MCMA 2KYXA 4BBYA 2ACMA 1OY9A 4C98A 2NUUG 1GX5A 2RILA 2E9ZA 2DHHA 5KG4A 3VGVA 4DL5A 4W92B 2DVIA 4WP8A 1P27B 4LVOP 5DQHA 3V4MA 2QIFA 2DGXA 3HM9A 2ZVIA 1JLFA 4DL4A 2CJKA 4ZPBA 2CZ4A 1JLAA 4JV5J 2C3YA 2JL9A 2W01A 1X4FA 2X7IA 2ZUAA 4ZDNA 3OL8A 1WKLA 3QFHA 3GIJA 4DLEA 4DBQA 4A8SA 1XNRJ 3CW2C 1KVKA 4KGMA 2QLJB 5K8PA 1WJ9A 3PKMA 4ZPCA 3DLHA 1RU1A 4O3OA 2ASLA 2ROGA 1C0TA 4ZVEA 4C2MA 4AL7A 2ZOMA 4TU8A 4ZHRA 2K7JA 1QAYA 1QUPA 2RRNA 2I5JB 3LF0A 1VDHA 4YB6A 5H1SV 4ECVA 1NJYA 3PDNA 3OUYA 1W26A 3Q8SB 3FC9A 2IY5B 1YKWA 2WSEC 2XGQA 5I42B 3ZZPA 1NXIA 3H5XA 3QJLA 4WU2A 4LBHA 4Q0BA 4J7CA 3HHLB 3OBIA 3ITHB 2KXNB 3I96A 4Y0FA 1IBLJ 3U02A 5KT3A 4C9DA 5KG1A 2QLWA 2DK2A 3CCUS 3R1HA 2XS2A 3NGSA 2M8HA 3LO3A 1VQ6S 4ES3A 2CJ9A 1IKYA 1C1CB 1U25A 3BSCA 2QFIA 4I7FA 4D3GA 5IWAJ 2HMIB 2HVHA 1AT1B 1RT2A 2DXFA 3IR6B 4C8LA 1HPZB 4KPYA 3M8PA 3LP2B 1NB7A 3GYXB 2IBOA 3D6FB 3TUJC 4DLGA 3G71S 1K44A 2YWKA 3SQOP 3W5ZA 3VHQA 1HBUB 4UOFA 3OJUA 1CJUA 3W8GA 3CCJS 2HVEA 1T9VA 1S72S 3TQEA 3GU0A 2VC1A 3MD3A 1SC4B 4S0MA 4ZVTB 3QWUA 5CXTA 1R0CB 2AP6A 1J5OB 1N5VA 1WTFA 3FGVA 3T5KA 3C2PA 1RBLA 2WAQD 2RUSA 3VAIA 4DFKA 1S9FA 1TKTA 1KC8T 2EG2A 1H2UX 4MT1A 4DR5F 2APOA 2HNZB 3I0RB 5CYJA 1IJEB 3P3DA 4TVAB 3UVJB 2YWFA 4PXDA 4CP5A 4QU6A 1EKSA 3PACA 5F8IA 1ZA1B 2DNPA 2E1RA 2GV1A 2I38A 3BV8A 1D9DA 4OHYA 3GCXP 2YNHB 2FLPA 5E7OB 4JUZA 3W9HA 1WEXA 3I56S 2F8MA 3OTCA 3LWLA 4EEYA 3SI8A 4GKJF 2ALYB 4IFVA 3QZ7A 2J5AA 1UPMB 3HVTB 3RBZA 3UVJA 5HAOA 2HRYA 3TUZC 3DGPA 3D28A 3KWMA 3JSMB 2GMHA 4LR9A 5ETKA 4QW8A 2FHKA 1BLUA 1KSPA 3M8YA 4NCBA 3HVTA 1QTNB 2E1MC 1EB0A 5E2QA 3SIPB 2WHOA 1SJFA 1FNMA 2HBQB 3ICLA 1YGYA 2F1FA 2HBZB 2YX7A 5HBMB 1REGX 3GJQB 3KHRA 5K8OA 5JUMA 3CF5Q 3HDSA 4M8LA 3PW0A 1QSLA 3DLLQ 4ELUA 1E6VA 1I94J 2PT0A 2Q66A 2UU9F 1CULA 5HJYA 3Q8RB 1VQ9S 2LQ8A 2XY5A 3DI6A 4LSLA 3J7YI 3E51A 2GS8A 2R7UA 4IO1A 4USVA 3W2VB 4DOZA 1NZAA 4Z37A 2B3TB 4FKYA 2HLTA 1JLQA 1RT3A 3BSNA 1SL2A 3QGPA 2ADCA 5IV3A 2GQ2A 2LQBA 5J1NA 5KFOA 1S77D 3NNHA 3DI6B 4LSLB 4LFBF 3CD7A 3F56A 1PIEA 3DLKA 1QVGR 3UW1A 4P2SA 2B9EA 3MMAA 1WHWA 1JLCB 2V9KA 1HQEB 2YX4A 1FNOA 3TNVA 4ZPWR 2R7VA 1SC3B 2VQFJ 3TAPA 2OMOA 1HBNB 1U26A 2AD9A 5F0WA 2BQ3A 2DJWA 2YNGB 1TKDA 3DRPA 4X4NA 3UN3A 3KDOA 2OPRA 3JAMY 2KG1A 1N4LA 3GTYX 1OY8A 3BS9A 3MR3A 3US5A 3M9NB 2YBVA 2JHEA 1NAQA 1PAEX 1GQEA 2BE2B 3UE2A 5L1IA 1UVMA 2FC8A 3O1LA 1Z2ZA 4WPAA 3TAMB 1X4CA 2XMAA 1CQMA 2HRTA 3HI9A 3KXDA 3NGDA 1JWWA 1F6TA 1SBRA 4YHHF 2CJXB 4OYOA 2QLBB 4K7QA 3FEZA 3C3LA 2CG4A 3NCRA 3WDOA 2A2CA 3ENAA 2FD2A 2NPFA 3TAMA 4Q5VA 3GIIA 2WVBA 2E9TA 2E1PA 1LWCA 5F8MA 1JKHB 1PBUA 2NZ4A 5BYSA 1E6YA 5C25A 5DLFA 3A8EA 4F4AA 5IFMA 4YS2A 4NLVA 4OYZA 3UNGC 1QSSA 2ABYA 4M5LA 2FHOB 2HNDB 4WTOB 2OI2A 3K5NA 4HT7A 1CS4B 1UZHA 3N0VA 3NGKA 4TKTA 1DQ8A 1C4CA 1S9GA 1LWCB 4OI4A 4TN2A 4LBPA 1T05A 1E6YB 3WBZA 4NZ6A 2H4WB 5LSRA 3B82A 2FLNA 3C16B 1XNQJ 4DX6A 3H2UB 4QIVA 4X64F 1X9MA 3FEYB 2FJWA 3MMBB 5LL6d 3W7BA 3N5FA 4ZCKA 5E33A 1CS4A 1JLBA 2BZ2A 2MKCA 4X4SA 1L3SA 4O0IA 1LW0A 1UFWA 2QL5B 2M70A 4NLUA 1RWWB 3HJFA 2J9DA 2B51A 4NI2B 3TJ8A 3RBXA 5HQMA 4RL1A 3TR5A 1JJ4A 2CDRB 1NH8A 4UW2A 4OZNA 4LFCJ 2VG7B 1ZYQA 1HR0F 1X4BA 2BJ8A 2P5VA 1LW0B 1TQLA 3PFOA 4DV1J 3P49B 1MMLA 2XNRA 4EMDA 4ED5A 3B6BA 3I6PA 4V1Ak 2YKMB 3M6VA 4LF8F 3BQ0A 4WE1B 4L75A 4MAKA 4DV5J 3K5LA 1NDPA 1LXJA 5DS7A 4AT1B 3GV8B 1AZSB 1P1TA 3ZZZA 2VH7A 2AYBA 3Q8VA 1U7LA 3LGNA 3MR7A 3H98A 2RS8A 2MQQA 4IOCQ 3DRRA 1U8SA 1VJWA 5CYQA 6FD1A 3DOKB 5D0GA 5AE3A 2RQCA 4ZCLA 3GR1A 1S97A 1NKEA 3VAMA 1KS2A 4R8UB 4M1KA 5FDLA 4PQUA 3NBPB 4J5OA 1WC5A 2DY1A 3HO1A 2WVCA 3OQ2A 4MYTA 4OYBA 3UI3A 1V3ZA 5A6PA 1AUDA 2LDIA 1QJHA 2DH9A 3VGTA 4CQ1A 3CCQS 3CNQP 2GGPB 3KLFA 1U2FA 5LXRA 2R2RA 4DX8H 2HFNA 1U8WA 4B3OA 2LU1A 1S6UA 1WF1A 3LGHA 2DGVA 2EVZA 2X51A 3HX9A 3W5XA 2HYIB 5KT4A 3PKYA 5F8JA 1Y3JA 1KVJA 2DB1A 4KYZA 1WI8A 4PG5A 3R5DA 3T9NA 1WF2A 3HSGA 4ZKAA 5KG7A 1RT7A 1RAHB 5KFRA 3MUMP 5EDWA 4F2SA 2EFVA 2VFSA 1YITS 2QMXA 3SFUA 1VK8A 1ZAWA 3DHWC 2BMBA 3DLEA 3KUGA 4CLYA 4ETXA 2BV3A 3ZZTA 4FP9A 5J2PA 1HBMA 2W7PA 2XZWA 3LP1B 2IVFB 4RPFA 2OKQA 3S6EA 1SJQA 4DR6J 3OLBA 1MWZA 3MAHA 2D74B 3T41A 2PA3A 3LQVA 4ID8A 2FB0A 3K57A 2AGQA 3O5TB 2PMHA 1SJ3P 3M6XA 3AOCA 3OTOJ 3SCKE 2HIQA 1DQ9A 2NSCA 3NY0A 1JLFB 2A18A 3CCTA 3C8YA 1JLAB 2CPDA 1NDCA 2DXEA 2WVDA 2W9BA 3EGNA 1FWLA 4JI5F 1D09B 1FDBA 4DL7A 3P6YC 1U4BA 1BQXA 1RWOB 4L3NA 3KK2A 1SKWA 4B9VA 1LNQA 1JB0C 2CPFA 3AODA 4RUCA 3PRBA 2Z2LA 4Y2IA 2E1AA 1WC0A 4AUKA 2CNKB 1U0HB 3Q86A 4J9KA 1RCOB 4TYAA 3TRGA 4JP8A 4NYZA 3T1AA 3WQPA 2Y8YA 3BGLA 1RWMB 2J6UA 4B3MF 2HMIA 3J80U 2IFXA 2IRYA 1D8ZA 1JXVA 4AE5A 5A8WB 2C2EA 2UXCF 4RW6B 1WD6A 3A4TA 4YY3J 2VQEJ 1Q4RA 1WG4A 4M5IA 3T1YF 2DR7A 5JVHQ 1YI2S 3W65A 4OI6A 2QL9B 1FD2A 5KFYA 4R0JA 1PJ7A 1Y5LB 2YWWA 4PYDA 5EWEA 3G9CA 3CJ0A 3FRYA 1J5OA 2RJZA 2XTJP 1XMQF 1VQYA 4ILMA 3IBFB 1VQKS 3EXCX 4OLPA 1YHQS 2W2OP 3KOAA 3E01B 7FD1A 5M2UA 1T3NA 2YH0A 2ZDPA 2FVCA 4DS4A 3D3BJ 4LIRA 5DM6Q 3R5BA 2GQCA 1HPZA 1O8BA 5CZVA 5ETNA 2JWNA 3R7SB 5FJ4A 1CJTA 2DNKA 2QA2A 3A8IA 3HVWA 3BGFA 2UUBJ 3PHTA 3PRVA 4KFBB 1SH0A 2XLKA 5HL7Q 4TQSA 1YBUA 2MEWA 1RT1A 3L7UA 1ZM4A 4H4KA 5IS2A 3UD4P 1I3OB 4DS5A 2Y8WA 4OL8A 1EHWA 2V2QA 4DR2F 2CQBA 2O01C 4NLRA 4X4VA 3R2DJ 4P71A 4ECYA 1VC5A 2FUG9 1SCJB 2E1CA 5A8KB 2C3UA 1RTJA 1EP4B 4K5SA 5MAOA 1JIHA 2HZCA 1GMWD 2YPZA 2AF6A 3JSMA 2VICA 2RAQA 3UNYA 4TYBA 3K5OA 3EZOA 2I0XA 3U7JA 3NMRA 5C2CA 3M30A 1SVDA 3C14A 2WVEA 4EUVA 1N56A 3T3FA 4IR1A 1FO1A 4C97A 3PX0A 4FPIA 1VRTB 1YJ9S 2Y0SD 3NRBA 3VGUA 1CJKB 2ATLA 2FLOA 1KFDA 4DR6F 2FPHX 1BMQB 3GCWP 3NCPA 4FVCA 4ZVSB 1UEUA 4YR3A 1TVRB 2PGCA 3M30B 4ZPTR 1ZPWX 4G1IA 4UQGA 2E44A 3CEDA 4DV4F 3RRGA 2AJ2A 3MXHP 5D78A 1FXLA 1GXLA 2G1HA 1VRTA 3RRHA 3SXLA 1Y10A 4KBIA 2NZCA 3AQPA 4OYAA 4QIWD 2ZH6A 1XTZA 1RLDA 2BUNA 4R25A 2HQIA 5E3RA 3RYLA 1AYEA 1A9NB 3LOUA 4USIA 3K59A 1ZZNA 2LQJA 5HBMA 1FTCA 3NOCA 2DHXA 3C46A 5EN1A 1RABB 1U02A 1WWHA 1UEKA 2HGLA 4V19J 4IH5A 2E7VA 2RSQA 4PR6A 3I5CA 1SKRA 3M1VA 2JEJA 3MPWA 1NPPA 5JVGQ 2BQUA 5E0OA 3DKDA 4MK7A 2YNGA 3MCOA 3IWLA 1KKHA 3L09A 1XR6A 1PJ6A 2DISA 2F63A 2FJBB 1H7WA 2VG5A 2P9CA 3MMCB 1ZM3A 4M5NA 4ZP8A 1XEZA 5GMEA 2DCUB 2Y1IA 1Q53A 1SIZA 4M63A 2Y1LB 2PO4A 5AXMA 3SCJE 4ECTA 1WKKA 2E29A 1Q5VA 3NG8A 2LEBA 4DR7F 2K8GA 2LYVA 1KBRA 4AFFA 5HLFA 1RI7A 1IKWB 2JRSA 3HJVA 4FVMA 5KOXA 3NL0A 1VISA 2CVEA 2B6AA 2YKNB 4A8FA 1FI4A 3DC2A 3GYGA 4C3KA 1N5YB 2FZCB 2KVIA 3P96A 4FDFA 4B9MA 1NMEB 4X4TA 3FSXA 3DRSA 2XC9A 4K4YA 1QTMA 2HPUA 4ELTA 3UR0A 2FY1A 3GFXA 3RB0A 5KFMA 1FE0A 4ZP9A 3OT9A 3TWZA 2AWZA 1NEEA 1DTQB 3HXMA 5AE1A 3GR0A 4ZVHA 1MROB 5JJBA 3W2WA 5CYMB 3IRXB 2VOPA 4A8KA 4KGXB 4P2XA 2CPHA 2Q6BA 1EZZB 1FWKA 4WCEQ 2UUBF 1LK5A 3RR8A 2XMKA 1IBMF 4K59A 4OZ0A 2MXYA 2ZH3A 2AZ1A 4C0OC 2W7AA 1M5PC 4B02A 3TEGA 3CCRS 2CKWA 1NK9A 3CD0A 4JI8J 1URNA 1ICEB 2PDAA 1JKHA 4KRWA 4QPXA 4LRFA 4QWEA 2NR0A 4FS1A 2Y9HA 1OYDA 1IQZA 1HYSB 4DL3A 1UAWA 3GG1A 3M2UB 3R2CJ 1RAOA 2JEGA 2Q79A 2VBWA 4QYRA 2AW0A 3HVAA 3NGTA 1VBXA 2VA2A 3E3XA 2LXIA 2UVRA 2H4YB 2YXLA 3PO4A 2IM2A 2AX0A 1FJGF 4RJVA 2H3EB 1X4AA 2KO1A 2B0GA 2HS0A 3QO9A 2M9KA 4W4MA 3I0SB 4CYUA 1X9SA 2CJAA 4RUAA 1Q7YT 1X5PA 2YKOA 3C66A 3MEKA 5KFKA 2XI2A 5ETTA 3PW5A 1KRPA 2CQ0A 2O3DA 4NCGB 4V19X 4YUDA 2BW2A 2LP4A 2UV8G 4OJGA 2AJ0A 5CH7B 1SJ1A 2BRLA 3BKFA 4YB7A 2BM0A 3KK3B 1TKZA 3IBCB 4ZPVR 3BDPA 3OTDA 4R8UA 3FSIA 2HAIA 2QV6A 4A47A 3W63A 3DLGA 4O4RA 1FXRA 2LLZA 2VG7A 4QZVB 4AXIA 1HNWJ 2R7TA 3ENQA 3MPVA 3GFYA 4NRUA 2KJWA 3V6DB 1KOHA 2DGTA 1KNZA 3MR6A 3LANA 1ZOTA 3H5UA 5IQ6A 4GVBA 1TKZB 1VLOA 3I31A 4ECQA 1AZSA 4I6YA 1N33J 2VOOA 4BDPA 1RT4B 2R8GA 2CAJA 5BR8F 2Y1RI 1XMBA 3C6TB 1AB8A 2KXFA 3HFZB 4JI0F 4EU0A 4IKAA 5HN0A 3BO3A 1S1VB 4GC7A 1OSDA 3DLBA 4GVBB 2HHVA 3PR4A 4PRFA 2HHWA 2DNLA 4NA1A 1EQMA 2VASA 2ZH8A 4XPCA 1NHUA 4KKOA 4XO0A 2OD4A 2GX8A 2EFNA 1XNRF 2WB4A 3DRYA 5F0UA 3AB2B 4NXMF 1OY6A 2IC3B 2JSXA 2ZOGA 3AHPA 3FKBA 9RUBA 1M1HA 2XMMA 3AB4B 3GJRB 4I69A 3PEJA 4M5HA 2IMOA 5B0EA 2K2PA 5K9FA 1V3RA 1WSRA 1T8EA 1XR5A 1WDTA 4RBTA 4EYIB 1N36F 3UPFA 4DUZJ 1DLOB 3SV3A 1G2EA 1S9EA 3I87A 2HHHJ 3UWTA 1N8RT 4MK9A 2ZHBA 3FBCA 4EBDA 4B3TF 2GQQA 3QJPA 2IIHA 4NA3A 2MDAA 2H51B 2NXEA 4OYIA 5AT1B 2KH9A 2M7SA 3OFEA 2KM8B 1LFPA 3HHEA 3QLHB 4CM0A 5B0CA 4PG7A 4CLSA 1DJ0A 1DLOA 3K5PA 4J9OA 4DSJA 4U7UD 2C2KB 4DF8A 4X4PA 2AYEA 2XMTA 3NS7B 4G1QA 1RISA 3A13A 3QSIA 3G82B 2GJ2A 2IM0A 1FX4A 3EVMA 3I5AA 3MTJA 3PNIA 2K3KA 4JI8F 4IFYA 1SUQA 4HTIA 1KEKA 2DTJA 1K1SA 2MKSA 4P10A 2QMUB 4KB7A 4WFZA 2HFZA 5ETPA 2QA4S 1S6QA 2KRRA 1KTQA 5DGAA 3PZPA 2QT7A 5KFSA 2C2MB 4R5PB 2YQ1A 3G82A 3CC4S 3ITHA 4DCOB 5L46A 1UA0A 1FE4A 1RGVA 4Y2KA 3EPIA 1N34F 3KLHA 1ZZFA 3ILOA 4DR1J 5F9NA 4URSA 2WCXA 3P4UB 3U1NA 4O44A 5H9EK 4Q45A 1TELA 3BGRB 1LQ9A 4BWJA 1R31A 3Q0AA 4HACA 2RRAA 1RAIB 2VPZB 4DFPA 1NSKL 1YJRA 1WOPA 4DR5J 3TQ1A 3CJ3A 4ZN1A 1WELA 1VYAA 3JSRA 3D1HA 2GO9A 4HTJA 1D0EA 3CB4A 2P6SA 2HAFA 3D66A 2DIVA 1RWXB 5DM7Q 4ED4A 3IG1B 4DQSA 5K20B 4RU9A 4CZCA 2V4RA 4P6QA 2N82B 5DQGA 4L76A 4AQYF 4OV6A 3N79A 1RHMB 2OPQA 5HMZA 1HR0J 2J6TA 3CD6S 5L9NA 1DRZA 2BJDA 1DTTB 4C8ZA 4JI7J 4CO1A 1B64A 1UW9A 1ZH5A 4W90B 1C1CA 1IKYB 1JJCB 1KWMA 3PTWA 3KHHA 2EPIA 2OJ3A 4RWWA 4C11B 2J76E 2B5JB 4DUYJ 2P2CB 2RDIA 2DT9A 1DBDA 5J2MB 4NXNF 3E2EA 1EP4A 1NH7A 4DZ6A 1HBUA 1QE1A 5KFXA 4E8UA 1FVSA 4X66J 2W4PA 4O3RA 4PZVA 3DM2B 1HI1A 1W7WA 2YKQA 4E0DA 5IXUA 4I64A 4JI7F 3C14B 3CD5A 5EWFA 3AY0A 3NKYA 5KFQA 4C4WA 4CLTA 3N6MA 3D6TB 1TKTB 1VQOS 2HFUA 1CPZA 2M0GB 4LF2A 3PCOB 2RMLA 3EDQB 1JX4A 1P6TA 4ZPDA 2MY7A 1HNZF 4CTAB 2A6MA 1HL6A 2WB1D 4UF4A 2G0JA 4M94A 4DSLA 2CQGA 1RTJB 3MZIA 4P73A 1JJ2R 1B99A 2IRXA 1KONA 3VVTA 2MZSA 1NPKA 4ZIVA 5F9LA 4B3TJ 3AA8A 4NLXA 4CTAA 1RAFB 2BE9B 4RW4B 3MTKA 1VBZA 3JSBA 2FYXA 3CDBA 4CT9A 3PX4A 2FQQB 5HVFA 4PUOA 2DRAA 3W2VA 3EX7B 1FTRA 2C42A 3D67A 3WX4A 1S0MA 2H65B 3H5YA 3QRRA 4ATNA 1ZTWA 1HNXF 1NO8A 2ZBIA 2LCWA 4MH8A 4K5RA 4TLQA 3OV7A 1K0TA 4PQAA 2XYHB 4A8QA 1WTBA 1S0NA 1QSYA 1YBTA 2VDHA 1ACMB 3WHIA 1ZAVA 1SQGA 1RWNB 2V4JA 4J9UE 4NZ7A 4UUXA 3VZIA 2VG5B 2ALZA 4K50A 2HK3A 4N8NA 1LK7A 2N7YA 2JZ5A 3CWJA 3MEEA 4K2JA 1QAJA 2QE5A 4C48A 1HBNA 3RAMA 1VBYA 2DNOA 3T19A 3A8JA 4X4OA 1T0TV 1WHXA 4DR1F 1S1UB 4K4TA 1YZ6A 4QJVA 1N34J 3FMWA 1GNKA 3BBCA 3HF5A 4XIUA 1VQPS 3DYAB 1WKJA 3IO1A 1HARA 1LV5A 4GKJJ 3FCWA 5AJ3F 3MEEB 1CJVB 3VQSA 1UTAA 1NJWA 1BY9A 3CSKA 2PFDA 4OV1A 4GKKF 4QYZJ 2ZBPA 3DRSB 3I4HX 4ED3A 2VZ9A 4LBIA 3UR3C 3UCZP 2Z57B 2CPZA 3VF0B 7AT1B 3GYNA 4ES1A 3M8SA 1X0PA 2GJFA 2W9AA 1U1PA 1DY3A 2YQ0A 3ELHA 3DYAA 4O3QA 2FC9A 2DEIA 2E5GA 5BR8J 5DDOC 3I5BA 1OWXA 1SV5B 5K5MA 3NMAA 2VB6A 3EGVA 3GPAA 4IYQA 4OX9F 2ADBA 2R7RA 4C8YA 3OPKA 1GFWB 4FPRA 5F8LA 3BJYA 3UDEA 1X5OA 3A3PB 4B3RF 3W2WB 4YY3F 2VQEF 3OHBA 3T1YJ 1ELOA 2C3OA 1RAEB 3H20A 3IWXA 2YKNA 5LJ5Y 4WK3A 2UUAJ 2KFNA 5M2RA 3WIVA 1HMVA 1WG1A 3MWBA 1NM2A 2ZZTA 3RW7A 2RU9A 5LJ3Y 2DHGA 2DBBA 3EUNA 3PHEA 4O4GB 2MGZA 4LQ3A 3PYEA 1GMVA 1HNIA 1JK9B 4J9PA 1MN7A 4LJMA 2ASDA 3CC7S 5CA5A 4OX9J 2KXHA 3CIMA 3P8BB 5IM0A 2QYGA 2ZVSA 4CLUA 3G6XA 1IXKA 1FRXA 2ZE2A 3SDEB 2B56A 2R7WA 3SYZA 4LFCF 3OR2A 3RAQA 2R7SA 1VHFA 3UN2A 4DPOA 1HNIB 4GC6A 1EARA 3FZ2A 2H54B 4WYWA 3H8YA 1U09A 2KHCA 3ZNJ1 1WUUA 2B8QA 2KN4A 4FZVA 4JB8B 3KK1A 1VQSA 2M2BA 2QYCA 3D0GE 5DO2A 1U1RA 3ZTSA 1XBWA 3NGUA 1N6QA 4FF3A 1V9OA 1ZS6A 5L9XA 1FJCA 4ZMMA 3CE8A 4UZBA 5LSOA 1MMNA 4A8OA 4JV5F 4RNMA 4F3OA 1RSCA 3HHLD 1B3TA 4HHUA 1RTZA 5IC4B 1WHYA 3NS5A 1Z2LA 4ECUA 1PO6A 2E9RX 4X4UA 4BHQA 1X4EA 4HI2A 3MM9B 5L8RC 4HYKA 1TFWA 4MJKA 3H25A 2RDDA 4WJBA 3SZ2A 2HNYA 3GV5B 2HEKA 4L6V3 1Q8LA 2MZ1A 2YNIB 3RR7A 3B4DA 3M32B 5B7WA 4ZLLA 1A7GE 1KLMB 1Q5YA 4M5GA 1FRJA 5D4OA 4QBUA 1FT8A 2CPJA 1M5OC 4OI2A 2DNQA 3OVAA 1BD6A 1RU2A 1YJVA 2QEXS 2BBEA 2RF2B 2AYMA 2QA1A 1MWYA 2YKMA 2YNIA 3FBEA 4LREA 1Q1KA 1Q8KA 4DN9A 4DV3J 1SC6A 4ZCIA 3EMTA 5CCMA 4PWDB 3Q22A 1FA0A 4OQJA 4ECZA 4FS2A 1JLGB 2EW9A 4QOTA 2YY3A 2GMJA 4I6AA 1B70B 1UVJA 3MM5A 2EFGA 3HD2A 2ZBCA 2OUGA 1UJ6A 2WW4A 3QGGA 3UN5A 5LT5A 1VRUA 3T9ZA 5KG5A 4DV7J 5HATA 1RT4A 3BR9A 5C42A 4C8MA 3PM9A 3T1HJ 2DRBA 2E5LF 2DNZA 1SH2A 2RB7A 4OMFG 5DDQC 1WEYA 3JB9k 1TMJA 4K4WA 2UXBJ 3LP1A 2CG8A 2XSJA 3IFEA 1NU4A 1VRUB 3MEGA 2M3DA 1U1LA 5GAGU 5C42B 1S57A 1VI7A 4RKUC 1K8AT 2YTCA 3D0IE 4ZJOA 2ZUGA 3CCVS 3VAHA 3A3NB 1IM6A 2GVDA 4ECWA 3BN7A 3MF5A 1HNVB 2L48A 4F3QA 2IYGA 3ZZUA 5I3QA 1JNZB 2DGOA 4LF6J 4ANEA 2G0IA 3QZ8A 2D3ZA 5KAKA 1SUQB 1YJTA 2HS4A 1NCLA 4OJ3A 4PAAA 3W64A 1KHWA 2Z30B 2G2OA 3H0PA 2VPWB 3PIOQ 2HHXA 2OPSB 1GK8A 1OJ4A 1HNVA 5CHCB 5KFEA 5KT2A 2B9XA 4R5PA 3IGVA 3TI0A 3QIPB 3TW0A 4I6WA 1TK8A 1UJ4A 2LQ5A 3QLHA 3M8RA 2HHSA 4HLBA 1EQ0A 2WW8A 4DCPB 3PR5B 4EBCA 4NRTA 2PC6A 1GTHA 2FVQA 1MU2B 1RT5B 2IDLA 2PMZD 3UQSA 3ZZOA 1NJXA 1IBMJ 2UUCJ 4MKYA 5IT9U 3HFKA 4G1QB 3RW6A 1Y7PA 3S7RA 4N77A 2AHOB 3QIPA 2ASYA 2GHWA 5L1KA 2UVWA 1I5OB 1BWVA 2M8DB 3MEDA 4I2PA 2DCLA 3K58A 1ZBTA 3K17A 2D9OA 2OSQA 3TA1A 5KFGA 4CT8A 2R2SA 1VQLS 1M5KC 1R43A 1RQ0A 3L7OA 4Q2MA 4I7FB 4ZITA 2ZKTA 4GVLA 3TUPA 5HANA 1FRHA 3OUYB 2GVZA 4IG0B 4DXLA 4ZK7M 2BEFA 1FESA 3EJMA 1NK6A 4MIBA 3HHLC 1SL1A 1Q79A 2BDPA 1N32J 3QJJA 3CCZA 1GAOA 5BJRA 2CQHA 2B7CB 2OHDA 3E01A 4CCHA 2XS5A 2OTJS 3W62A 4EO8A 2HBYB 4KHPF 1SC1B 1F5CA 1REVB 3CJ5A 4DI6A 2LKZA 4LFBJ 2O67A 2WVFA 3AOBA 4WFXA 1IKVA 1QM9A 3QT6A 2M4MA 4CLKA 4GO5X 5B0BA 1RYRA 2F3JA 1F9FA 2HWHA 2OGUA 2ZNYA 1FD8A 3O44A 4P74A 2L9WA 4B17A 3CCSS 1FHTA 2XB2D 1Y11A 4A8WA 2PN6A 1LFWA 2G0CA 2G1DA 3ETOA 1PBAA 2NYIA 3PFEA 1Z1ZA 4K4XA 3V6JA 5GMDA 1IKVB 3NLCA 3POTA 4DSKA 1RLCL 4M5JA 1CJUB 1FK9B 4YR2A 1EIYB 3DOLA 1FF2A 1B7YB 2KT3A 2V63A 1NDKA 5HO4A 4WU3A 2MZTA 2HQGA 1R8BA 4KGVB 1M1KT 4DWIA 3ETMA 4MIAA 2EKNA 8AT1B 4NEZA 5HVGA 4ENOA 1VS3A 1RAAB 2RNEA 1N88A 3WC2A 2DKOB 2HNZA 3I0RA 2AGPA 2DPJA 1VIOA 4B3SF 3X1LB 2LU2A 4RW4A 1TAUA 4NE9C 1F9HA 3QSYB 2VF3A 4M95A 3DFEA 4AXJA 4P7TA 4WBFA 2MKKA 2BW7A 3MAAA 4HL9A 1QAXA 1F5AA 2O1PA 2AX1A 1LWFA 2VU5A 3MOZA 5IC6B 2AQ4A 4LQ9A 2R8IA 3ZXWA 4B08A 4JI4F 4USKA 4YQWA 4ZVFA 1MMDA 2W2MP 1CULB 3MM8A 5DDPC 1N36J 1FWPA 2BXJA 1PSDA 2QTWA 1J2VA 2QJ3A 3RUBL 4C6AA 2Q3PA 2X1AA 4BC9A 1NK5A 4ES2A 2OIHA 4M5DB 1XMOF 2VODA 4K4UA 4U8VA 4O0NA 2WONB 3V2UC 4HHHA 1XNQF 4WXWA 4YDDB 1R3NA 3DXBA 5DRKA 2QLXA 5KFUA 4H4OA 3VGSA 3LA0A 3MMAB 4U7UK 2DNYA 2VL1A 3SSRA 2V9WA 4JI4J 3VV2B 1RHQB 4DR2J 1AXQA 3KHGA 3OW2R 3G8TA 3DMJA 1KQGB 2DYAA 3NGRA 2XO6A 3HD1A 5KFHA 1IKWA 3J7Z5 1YJUA 1N5QA 2JX2A 2X3DA 3QWPA 4NLGA 4Y3CA 4Y00A 2VBZA 2C3MA 4U7CA 2BE2A 4DV3F 2I6WA 5LMUF 1H73A 4J90A 1PYOB 3M2VB 1YSJA 5HROA 2MZRA 4A8XA 4AL6A 2DITA 2JVRA 2UV8A 3DU6A 2NS1B 3FZBA 4G1PA 5A2QY 3AJDA 2KFYA 3T6JA 2UUTA 2OEMA 3HCXA 1T9UA 2RDJA 3KLIB 3K8VA 3Q8YA 2W8KA 3M2VA 3O2IA 3QGIA 3OVBA 3IRXA 1S6PA 4FXVA 4TQRA 4PG6A 2EC0A 1B0VA 1SV5A 4DQRA 3ZTRA 1FFWB 1HBOA 2GHPA 3M8WA 4Q2LA 4EZ9A 5IZHA 1AFJA 2HNDA 4FXWA 3VVUA 4G6VB 4MKAA 5B0FA 3OL7A 1WDDA 4IH6A 5RUBA 1Q81T 4NCAA 3HHKA 4KH0B 1RXOB 2RS2A 2KL8A 1TV6B 2ZBQA 4WF9Q 4DG1A 2DH8A 2N7CA 4OX6A 4PXEA 3CCWA 3SQGB 5KFWA 2FJVA 1WC3A 3D6HB 2BQRA 1JLBB 1QDUB 2KI2A 4LF6F 2CQ3A 1IBKJ 2FDNA 4OI0A 4Q43A 5EHHA 4OZJA 2J0QD 3MD1A 3I0SA 3LGMA 2ZJRQ 4OFZA 2G9OA 1MG7A 5LMNF 4UY8T 4ETZA 5C5JA 3BKUA 2YKPA 1AA1B 3GJTB 4KV8A 4L73A 3ZZ0A 2R2UA 4ECRA 2HQDA 4ED0A 2HNYB 4ELVA 4NA2A 5EX3A 1X4HA 2ZFHA 3PO5A 1EKRA 1JMTA 1Q7LB 4NLPA 1DARA 1XERA 2WBRA 3DDNA 3M32A 3PW7A 1HW8A 2MHEA 3ILIA 2VV5A 3DDIA 3M05A 1OYEA 1YDLA 1WC4A 3D5MA 5JMNA 1T03A 2CNNB 4JV2A 1B7FA 5D0HA 4PPDA 3OSPA 4DSIA 2W7OA 3UDLA 2F65A 1APSA 4DL6A 1LOUA 2W9CB 2LMIA 1NNDA 2V2VA 1FRMA 2Z2MA 5H9FK 1FERA 2XCAA 1FDAA 2HQ3A 1S4FA 2D3O1 1D9FA 3OD2A 3R5JB 4FNIA 2M88A 4DU7A 3TYTA 2MKYA 1RADB 3RRKA 1M90T 3H42A 5CZXA 4WKRA 3WX8A 4IQXA 1HWJA 1R6YA 4WE1A 3HKZD 1RTDA 2VA3A 1UVKA 1HQUB 1UPPA 4BS2A 1VJQA 2JVOA 1Y00A 4KHMA 4DV6F 2Y1JA 3KLGA 4CM2A 1FX2A 4KKOB 3B54A 3MECA 2Z8QA 5DG7A 4IG3A 4RX6A 5D8HB 3DOKA 4IOBA 4Y2CA 1KD1T 1T94A 3KJVB 1K1QA 2AJ4A 4PWDA 2KVQE 2POKA 2GIQA 3GFZA 1U2RA 1BQMB 3TJ9A 2BVZA 3QNWB 4F25A 4J9NA 4F4WA 1F2HA 2ZHOA 4NLWA 4K0KF 2GHVC 3DLEB 2FZGB 5DZ6A 3L3CA 4YEAA 4X62J 4DEZA 3N28A 1KLNA 3D0HE 3THTA 1YQHA 4NOHA 2HGNA 1KTVA 3G6ES 3PJ9A 5IWAF 4KT0C 4PKDB 4RNFA 2HQFA 1V5IB 3R6LB 4DX7A 5DG9A 4NYPA 3RG6A 2XM3A 1FJ7A 4HH1A 3NS6A 3VCDA 1OO0B 4LR7A 1NUEA 4WYLA 3TJAA 2DEJA 3D3CJ 5SZTA 3RBEA 2OTLS 2OH2A 2GMLA 3MEGB 3Q2SC 5A8RA 1YJ7A 2WZ1A 2N3OA 1KP6A 1UJ5A 2AJFE 3LW5C 1KQKA 1X31C 5KFTA 2V2ZA 1IQTA 5J2NB 3Q83A 3HKWA 4NYOA 1MU2A 1RT5A 2GVDB 3IR7B 1HBMB 4CIOA 5A2QU 1SI9A 6FDRA 4B9UA 3OTBA 1K0VA 1R8HA 2U2FA 3KK2B 2VKZG 1X7VA 1IBKF 2KDOA 3O3LA 3AXMA 4Y6IA 3MM6B 2OEJA 3H4DA 3EYZA 3AH6A 3L95X 2ZJQQ 2GFFA 1O0PA 1S10A 2FGOA 4ZP6A 2GCFA 3J7YU 2R8HA 1KVIA 3TANA 3BGRA 4Q0BB 2HFVA 2NREA 2DXDA 2ZWPA 3HHLA 5G0RB 4ZVQB 1X9WA 1U6FA 2GVZB 4ZP7A 1S76D 4L3KA 4MK8A 3FQLA 4NXMJ 3PRDA 4I1TA 3EE3A 3UFCX 3IA0A 4DUYF 4ED7A 1VQMS 4O3NA 4J9VA 3UCGA 3KNGA 1UWAA 3M2RB 5KFFA 2VUGA 2U1AA 5GAHI 3CUNA 1NKBA 4X66F 1FKAF 2QX0A 4FNHA 3L7PA 3R27A 2JNJA 3KLHB 4AQYJ 2DPIA 1DTTA 2G2ZA 4TNOA 3F73A 5D3GB 1IJFB 4FBTA 1OQ3A 4CH1A 1KN6A 3MOJB 2QO3A 4ANDA 5KFBA 2AGOA 2FVPA 1N0UA 2PMWA 3NAIA 4JI2J 3IWNC 4FKXA 4ANCA 1H7XA 1R0BG 2BOAA 2X1GA 1S7IA 2E66A 3K2YA 1VC6A 2IA0A 5D4PA 3TVKA 3H40A 2BJ1A 2ZH5A 2CJQA 2R7OA 4RZRA 2GJIA 2HHQA 1Z4UA 2AMCB 3OR1A 1S12A 3DNCA 2FHJA 3EM1A 3CCMS 3E8OA 2OPQB 4EI2A 2E5IA 1G7CB 1X5SA 1FRLA 5A8KA 4PABA 2JC0A 2R2TA 3CC2S 2DGWA 3HMJG 1T9YA 2CRLA 2HFOA 4AL5A 2ROPA 3IGNA 4ZVGA 1LW2B 5FIIA 2JOQA 2ROEA 2X1FA 1IR0A 1SQEA 2OPPA 1T3OA 5D0EA 2DO4A 2EFPA 3UD5A 4Q8EA 1UZDA 1LEOA 3DOLB 4OHWA 3H2LA 3IAM9 4TY8B 1SQFA 1TR0A 2W8LA 4F4ZA 5IOLA 4QIEA 1GT8A 1X0FA 2HZVA 2IM3A 4CNZA 5DDRC 1TK0A 2K3IA 2BRKA 4IR9A 3LP0A 4RNNA 4USUA 2EXUA 2YNHA 1U1OA 1UVIA 2K06A 3ILJA 4EK2A 1UW4A 4OZ3A 4IFVB 1L3KA 3HK2A 3CVKA 3TA0A 1VQ5S 2AIRB 5D77A 3V6KA 3ET6B 1WACA 2XI3A 3HLUA 5SUHA 1U48A 1BWEA 2CNLB 4RWXA 2BJ9A 2I8EA 3QFWA 3GIMA 4HI1A 1BGXT 2KYZA 2EFQA 2M52A 3NWGA 4KO0B 5KG2A 1D3WA 3BO2A 2IA6A 3BPDA 3N01A 1LWXA 4F0KA 5E41A 2K1RA 2RH3A 1GMWA 2QGFB 3M1VB 4OX7A 3J81j 1L3UA 4PG8A 2ZH7A 2YWEA 3KG1A 1TVRA 2HHPA 2HVDA 2ZJPQ 4MFBA 2ZH1A 3OHAA 4C3LA 3M9MB 2CQDA 1S49A 3WZ0A 3BGOP 3NOGA 4ZCMA 5L38A 1KHVA 3ZZRA 2JFDA 5AJ3J 1C0UA 4B3RJ 2K7KA 2DH7A 1IN0A 3GE9A 3CDAA 3V81A 2Y3YA 2NPIA 5HLFB 3TO8A 1HA1A 3VAFA 4NX9A 3KJFB 3DLJA 3ONQA 4H4OB 2QSWA 5AXLA 5KFAA 4N41A 3HFVA 4NWBA 3ZTQA 2B6AB 2I1RA 3TVZA 2JLGA 3W1YC 3BDEA 4KE5A 3S1TA 2WBMA 4GO7X 2V8DA 3I4PA 2EI5A 2KZZA 1S1UA 3R3TA 2KU7A 3MCNA 4ILRA 3T5JA 4A8MP 1JJHA 2V5HG 5HI7A 1HNWF 4J37A 1JLEA 4B9NA 4OHXA 1HBOB 2BKPA 4NPOA 1EETB 1U2CA 2BKOA 2N4DA 1AW0A 4DV5F 2KT5A 2W2PP 3FMBA 3JQJA 2MQPA 1SL0A 1T9XA 2BOPA 3LUYA 5EX0A 2R8JA 2V94A 1F0XA 2J8AA 2MJUA 2Q43A 3IC1A 1VHIA 3IP0A 4JBCA 4WTYA 1QD1A 1EETA 2LFVA 1RK8A 3OR2B 4FYYB 4X84A 3KLIA 4MMOA 1YTYA 1RHUB 3HZEA 4ICLA 5A0YB 4F0HA 3CULA 2XLJA 2MLZA 1JXEA 4NLYA 4WFNQ 4CH7A 2COLA 3BO4A 1CLFA 4N5SA 3KK1B 4YN3B 2XYPB 1PGZA 4U96A 3EVWA 1VRQC 3VAJA 4HHJA 4CO4A 2ZHAA 4DR4J 3RBDA 2C3PA 5DLGA 2D7SA 2LA6A 2BA9A 1X4DA 2OMLA 3KKFA 4LRDA 3SBMA 3BYRA 4WZMA 1ZM2A 2IM1A 4MKBA 3PV8A 2PI4A 3J81Y 3EGZA 2VFRA 3O6QA 5DQIA 3H90A 1Y4ZB 2QLFB 3QO9B 1N5SA 4CYUB 2V0NA 4DUZF 1TP7A 1R8CA 3MAQA 5M2PA 1Q0NA 3X3UA 4WZQA 4Q8FA 4Y2MA 1TUGB 1TKXB 3M6UA 2FVRA 1LWEA 1IVZA 1U0SA 1JQGA 1OPZA 1H6KX 1VOMA 3RAXA 1T9TA 2FJXA 2LQ9A 1Q16B 1HYSA 2QG9B 3I9ZA 1N6QB 3GSIA 3W9JA 4QU7A 4OZ5A 3BKTA 1UA1A 4LSNB 1FJGJ 1MN9A 4KJIA 2AEFA 4PXCA 3LAKA 1LWEB 2CQCA 2XY7A 1L3VA 2LEAA 2RF2A 1NSAA 3QAEA 2AZ3A 3CTRA 4MTPA 1URRA 1ZM9A 2QFJA 2CPYA 3PYDA 2E5JA 1WF0A 2FJEB 5IQQA 4RW9A 4FF4A 3H7HB 2GC8A 4JV0A 1ZETA 1VQNS 2KB2A 4QIGA 1QAIA 4ZVUB 4DPUA 4N76A 1YK9A 3C6TA 4NCGA 4F7VA 2B4UA 4OYXA 3KK3A 3AD7C 1U47A 1IWAA 4NLOA 3T5LA 3V5RA 3KMSA 1NK4A 1BQMA 2ILZA 2ZZMA 2ZITA 3A3OB 1UWBB 4IO9Q 3G8QA 1S59A 5DETA 1VMBA 5CYQB 2NLWA 4TLRA 2EK6A 2CA9A 1VFJA 5HP1A 3U1MA 2UXDF 5F41A 2Z2YB 4YMEA 2XMUA 2RQKA 2XSJB 5KFCA 2ZZNA 3KLGB 3MFHA 1HI8A 2BYCA 4NLTA 3LAMA 3EICA 2EEYA 4ALZA 1KR4A 2WSFC 3JXOA 4LT6A 4A8YA 3JQKA 4U67Q 3R5AA 2CPEA 4QWAA 3OFGA 4DX5A 3AFGA 2XYGB 1BHNA 1HHTP 3B4MA 4J9LA 2UUCF 1U6BA 4RW8B 4I67A 3IS9B 1QUVA 3R5CA 5C24A 3ENVA 1AUSL 4B9LA 4DR7J 3JTNA 2FLLA 2YPYA 4N47A 3BGUA 3GSDA 5AE2A 5B0DA 3UCUP 1R8PA 2H5JB 1GXUA 3GB0A 2PSZA 3V6HA 2F4FA 5E3CA 2CWXA 2OO4A 4RW8A 2AJ1A 2NQPA 2VFVA 5HQ8A 3FBBA 4F67A 4LF9F 4IOAQ 1S6QB 1H0HB 3ISNC 1HWKA 1HNZJ 2ZC3A 2V8HA 1N52B 1WSVA 3DGVA 3BF4A 4DSFA 3CMES 5ETRA 4R0EA 5EGYA 4CLLA 1ZA2B 1RHJB 3H2VE 2XZTB 4DDFA 2OPSA 2XZDB 4LF4F 3QAUA 3S01A 1PILA 2J9EA 3ZFVA 5LSLA 3KLEA 1H38A 2ZBRA 1RE1B 2NXNA 2PA8D 4C8NA 4DPXA 1F3VA 4KPCA 3KUEA 3J80Y 4HEA9 1IR1A 3I82A 3V4IB 2MB0B 2HKEA 1IBLF 2P9GA 4UT4A 3VALA 5H9EJ 1GH8A 3AA9A 3QT8A 1TL7B 4DSEA 4NLDA 3ISZA 1UVNA 2OAUA 3CT9A 1R27B 2F7VA 2QL7B 3NEKA 4LRAA 1IUJA 3PY8A 2WK4A 1HD0A 4ZPAA 3P5TL 2OELA 4DFMA 1IM4A 3U27A 3VQTA 3BQ1A 2J7KA 4HACB 2KT2A 3G86A 4OX8A 3J81U 4O3SA 3W5YA 1M0SA 3GILA 1CJTB 3ULHA 1LXNA 2V8GA 2UZAA 3ZZYA 1HFEL 1MNEA 5J2MA 3FCVA 5J1PA 4Z7YA 3MDFA 3UO0A 2X3GA 3TX8A 4P2MA 3RJMB 3DM2A 1YLXA 2B9YA 1UP1A 2DIUA 1KQFB 4WP3A 5KFJA 3M8PB 1NSPA 3O8WA 4J9SA 2B7BB 3FRZA 5K8NA 3RZAA 2J8SA 3CJ8A 1KQSR 2IJRA 2YWGA 1RTIB 2NSBA 4F4KA 1TMMA 4ED6A 2VDIA 4WXOA 4EGLA 5T41A 2HHUA 3OR1B 2B5JA 3ILLA 3DGPB 3LP0B 1FXDA 2ZH9A 4FF2A 2LXUA 3DOMA 2DGSA 2ZDOA 3DRXA 2C2ZB 2HBRB 4OYPA 3G8SA 2VFTA 1RTIA 1YRUA 3BSOA 4QYZK 4XTTA 2PEBA 1RCXB 1F60B 3EZ5A 3J7ZT 4ED8A 2MQOA 2KKHA 1UKUA 4LF8J 2YNFA 5E3PA 1JNRB 1KFSA 1WORA 3LPEA 1N32F 4KSEB 3I55S 3MI7X 4KC5A 4ZN3A 2FTRA 4QR0A 4ZLPA 3ISND 3EPGA 3PX6A 3IR5B 3RGIA 1BUXA 1BQNA 2IPOB 4I2QB 4M5DA 3IBWA 2K1RB 1OMSA 4TY8A 4E2FB 2CPXA 4B3MJ 5GAGI 1IKXB 1SJRA 4O23A 2CADA 4YB5A 1WG5A 1UCNA 3QGHA 1P8GA 3G4SS 1R8AA 5JXSA 2G13A 5BXIA 5CD4A 4NLSA 5KFZA 3MAAB 3OJSA 1I94F 1ZTTA 1GTEA 3KJQB 1BQNB 4I2QA 1LWFB 2J0XA 1CJKA 4KHRA 2DHAA 2RVJA 4UOHA 1JLQB 1RT3B 1DFDA 2KZMA 2IDEA 1HIYA 2NXCA 4F0MA 2VG6A 3SCIE 2IBKA 3BM7A 5ITHA 2XQCA 3MM7A 2HHHF 3ZC4A 4CLWA 5J1EA 1PG5B 1FKOA 2HIYA 4E98A 1HQEA 4ER8A 4LRCA 2M5YA 4CLPA 4FYWB 1CJVA 5GAEI 3LWMA 1HLWA 3MR2A 3CIZA 1Y9OA 2C2OB 3M6WA 2HRUA 2VG6B 4C0HA 4CO3A 2UP1A 2DY9A 1RWKB 4JYAJ 4RW7A 5B0AA 3DRPB 2KM8C 1FJEB 4UZCA 4QWDA 3R1LA 1WC1A 2OPRB 3GWCA 1HWUA 3TUIC 1GEHA 2R8KA 3EZUA 1PC5A 2MY8A 3JTOA 2IAJB 2ZNZA 1H72C 4UUWA 3CCES 2A10A 2RIJA 2MQMA 4RW7B 3V81B 1J5EJ 4GKKJ 1RHKB 1NHVA 4LUBA 4JI3J 5KG0A 4LF5J 5KFPA 4FYDA 3C19A 3R97A 2F8HA 5HK4A 4RUBA 2HK2A 4OI3A 5CD4H 3M8QB 4FN5A 5KT6A 5GADU 3HP6A 3FCHA 3ZTOA 4KTQA 2BACA 2FJDB 5ETLA 3CGIA 3FJ2A 2MGZB 3RB3A 3DCAA 1MLAA 2XO7A 4OI1A 5CYMA 2KJVA 3K7RA 2DGUA 1HD1A 2FIUA 4WWSA 5KG3A 2ZC4A 2CQIA 2ASJA 2B4OA 5DJBA 2FHJD 4U9RA 3W61A 4G65A 3SDEA 1X8DA 2CXEA 2MQNA 2MLYA 2Z4PA 3GIRA 3SQGA 1RHRB 2EBEA 4ID5B 4Z2XA 2DHSA 3BBFA 4Z7CA 4JI2F 2PI5A 2MKHA 3N5BA 2ATCB 5IT4A 3Q8PB 1U24A 2CQ1A 4DQIA 1SH3A 3FNNA 4USJC 3GQCA 4UOCA 1HMVB 2BABA 2F9JA 4ZVPB 2R9LA 3HZGA 3M2UA 4O4GA 3MMBA 1PJ5A 2AV5A 1NJIT 3OFFA 4EO6A 4H4MB 4JI1F 2YKAA 3CDWA 3D1OA 4DJBA 1RDRA 3HHDA 3TZXA 5IM0B 5ETMA 5KFDA 1TV6A 3W8PA 1FFGB 1TL1B 3T5HA 2ZE2B 1RP5A 2V2KA 1PYTA 2MYFA 2VBXA 3AJ2A 4ZVRB 2UU9J 4LF9J 1UFLA 2CZ9A 3JTPA 1HQ2A 2XWYA 2Z2ZA 2W4DA 1EJ7L 4P75A 2ACYA 3H59A 4G3IA 4LIWA 2AT1B 1K9MT 2CQPA 4F8RA 2W9CA 4DF4A 1AROP 1XR7A 2XMJA 4WIIA 3W60A 2DNNA 1FVQA 3C16A 2VJUA 4XAKA 4QQBA 2IMWP 4N8OA 4IDKA 4RW9B 5DG8A 2I2YA 3TZWA 3QQCD 2CZVC 3V6DA 5ETSA 2JLEA 3SFGA 4KH1B 4YB1P 1U1QA 2WOMA 1FKPB 5B08A 2C2NA 2MMYA 4UOGA 1HQUA 3ENWA 3CJKB 2F4VF 2CNOB 1A6LA 2NCKL 3D68A 4K4ZA 5G4DA 1S1TA 4X62F 4ED1A 1F9EB 2DNHA 1JLGA 4X4RA 2X1BA 2L3MA 5T7LB 1VBKA 3CMQA 1I51B 2V4QA 1UVLA 3KJNB 4P9SA 1SB6A
chains in the Genus database with same CATH topology
5H9FJ 4B9SA 5ADZA 4JOUA 3TA2A 1C1BA 1ZAXA 2EKYA 3DRRB 2KFZA 3CDUA 4I0WA 4Y28C 2VFUA 5BYRA 1ZPVA 2H5EA 3K5MA 4WK1A 4J9MA 2NXUA 1XWLA 5C24B 4ED2A 2XGPA 2XS7A 5GVQA 3HT3A 3MM5B 4ECXA 2HG4A 2NUHA 2DNRA 1W25A 5KOWA 1RT6B 1P1LA 2PD1A 4O3PA 3OXFA 1X5TA 4OLOA 4B3OB 1TFYA 1TL3A 2YVSA 2B43A 5E3AA 1CEZA 1SKSA 4HDHA 3BR8A 4X65F 2XG8A 5L39A 3OVSA 2OFHX 3MUVP 2P9EA 1B0TA 4OZLA 3PVXA 4QR1A 1DQAA 3IS9A 1TL3B 2LEPA 1MW7A 4OIXA 1ULRA 2I5JA 2HWIA 4QR2A 4DV1F 3S8SA 3SEOA 2VD3A 3RB6A 1G3OA 4EFAC 2E7WA 4Q7AA 3MEDB 5J2NA 3D2WA 5I42A 2MSTA 1HW9A 2D3UA 4O44B 2HVIA 1WHVA 2J7UA 1S48A 4A48A 2HS3A 3VAKA 4FF1A 3KNAA 4HH0A 1NK0A 2EBGA 1RKJA 3FVYA 1VC0A 3OLAA 3MUTP 5J2QA 2EWHA 3KLEB 4TY9A 3VZHA 3U1LA 1D9AA 1Q8IA 1TK5A 1YJNS 4HT5A 4URGA 2D3OR 3N6NA 3DU5A 1H2TZ 3Q8QB 1CG2A 1XK8A 3VTIA 4F2RA 1N5TA 5J2QB 2IYIA 4XK8C 3THPA 5MLCV 4PCQA 3PJXA 3CCLS 1J5EF 3UDCA 5D3GA 5K14B 2CDQA 2Z0GA 3IG1A 2D41A 4GMKA 3MFIA 3PXGa 3HVRA 2J0SD 1G1XA 1REVA 5E3QA 2KTQA 2JLFA 1YG0A 3LP2A 1L3TA 4KR0B 4OHZA 3OXLA 1WI6A 2HHTA 4OHVA 1HHSA 2G4BA 2ERRA 1FRIA 3K8WA 2FHMA 4RBUA 3HHNB 4HVZA 5KFNA 2LDYA 1NJZA 4ITSA 4K2XA 1Q82T 3SV4A 3THVA 1OSCA 2JJ4D 3D54A 1QE1B 2I9SA 2JEFA 1FK9A 3MURP 1FDNA 3G6YA 1XC9A 4XDCA 4CO5A 1IKXA 4DL2A 4PXBA 1WEZA 2C2RA 3AJ1A 2AU0A 3C6UA 5AXNA 3K0JA 1T02A 1YVFA 1RJJA 4QCLA 4TU7A 4KO0A 1TAQA 2JEIA 2RQ4A 1DURA 4BC7A 4D3HA 2R7QA 2C22A 3M9OB 2YNFB 1VIXA 4MFBB 2J6SA 4F4XA 3N6LA 4QWCA 1VLYA 3TOQA 4AYBD 3AAWB 3NNCA 2EFOA 3KFWX 4IUFA 4X2BA 3LALA 2UXBF 2J0WA 3MM8B 1I1GA 1Y0HA 3QYYA 3CJ2A 3MMCA 1N54B 5GMKa 2FGCA 2AJQA 3LPYA 4C3MA 2JDJA 1E6VB 1O51A 4QW9A 3Q24A 1TZ0A 4WFBQ 5HROB 2ZH2A 5F3TA 4RLEA 5J1EB 2ZKUA 1FDDA 4BWMA 3FEXB 4KGKA 4U6PA 4OZ1A 4YP3A 5F8HA 3DMJB 2XLIA 4PG4A 2IVYA 1N0VC 2VC0A 2XCPA 4IRDA 2YWHA 3FFIA 3PW4A 4I68A 1WNEA 2IRUA 3DXSX 3TP2A 1YRTA 1S6PB 4C8KA 3I9V9 2XBPA 3OL6A 1KOOA 2FJAB 1DTQA 4F50A 5KFVA 2KRBA 2IAJA 4HDGA 4WFAQ 5I3UA 2IJFA 2BANA 4YFUA 5FLXY 2PFFB 3JYTA 4QIFA 3KG4A 1JLEB 5C25B 4DG1B 2RE1A 1H2VZ 1TL5A 3MMJA 2MZJA 5KFLA 4PWUA 1Y5IB 2BANB 2OFGX 2BR0A 3FDSA 3JYTB 5HMXA 1RA6A 3CDEA 2QMWA 1FRKA 1OS5A 3BB5A 3OFHA 3GV7B 1S1WB 2Q1LA 4ILLA 1U45A 3BN4A 4RNOA 1BC6A 2HLUA 2R4FA 4DV0F 3G96A 1RTHB 2IHR1 4Y65A 3OTEA 2WTFA 4DV7F 1CC8A 4OJ1A 2E5HA 4DFJA 3M4XA 3NP5A 4J9QA 4K4VA 4IDKB 5CCLA 4LVNP 3DDKA 3T6BA 2O5DA 3KLVA 4P7VA 1RTHA 1DHMA 2CIMA 4FXDA 4L72B 4XPEA 3BZQA 1C2PA 5K8MA 2D1CA 4YR0A 1VQ8S 2CPIA 3RB4A 4F02A 3DHXA 4KAIA 4QWBA 1S1TB 4DMZA 3IN5A 2VKRA 1TKXA 1H3DA 2MJNA 2WRMA 4HKQA 3BQ2A 3N9UC 4F3MA 1T95A 5THWA 4YDXA 1VQ7S 1RTDB 1P9QC 4DHVA 1D1UA 2E7XA 3RU0A 2OSRA 2R7XA 2O66A 4I56A 1Q78A 4LSNA 1W2IA 3NBPA 2XY6A 3RBDA 4C8OA 2ZOFA 1UWBA 2CVIA 3MECB 5L1JA 4QPTA 1CC7A 4XDDA 2GNKA 5HP1B 4K4SA 2OP5A 3CJKA 3KJVA 2V8VA 3OTOF 2XWXA 3GG0A 1AFIA 2GIRA 3VWSA 3PIPQ 2A3JA 1R89A 1SXLA 3CXCR 1VGYA 1YRXA 5F8NA 2YH1A 1FCAA 4DL0C 2A1BA 4PQUB 2DGQA 2MHNA 1O5JA 4A4JA 2MKIA 2LECA 1U1MA 4ERDA 2LXFA 3CO9A 4BCAA 2N4CA 4OJHA 3VAGA 2UVVA 1PC4A 3EXYA 2RUGA 1R0AB 5IT9Y 3A1YG 1CQNA 1NRKA 1RWUA 4CH0S 2J7WA 2JC1A 2B9WA 2PIIA 2XEXA 3FSYA 1NK7A 2DR8A 3PEHA 1S1XA 2IC3A 3RTVA 2QA4G 2L9DA 2RT3A 2PE8A 1RT6A 1LKZA 2RD5C 4J9RA 3OL9A 3N4WA 4IFYB 1TUVA 4EBEA 5A6WA 1SJ4P 1C0TB 1CVJA 4IQMA 4KQZA 5J2PB 1S1XB 4Y2AA 2GA7A 5BYQA 4RNHA 3TVYA 1MSWD 3IAS9 1GXTA 3SSSA 3MR5A 5G0RA 3NNAA 5AXKA 2JFKA 5A8RB 3KHLA 2J9CA 5F3ZA 2XNQA 3V4IA 2VQFF 1UL3A 2MZQA 2RQMA 4ZOSA 2L41A 3D1QA 2OLWA 3M2RA 3MM6A 4ZS6A 4IG0A 4TU9A 2HGMA 4RW6A 1Q86T 1F2GA 1V6HA 2MKJA 2W9BB 4DN0A 5F8GA 3J7A1 4ZHRB 4JV1A 4B9TA 4UQTA 1FNXH 1VK3A 3QPIA 2UUAF 1SIWB 3IXQA 3MCSA 1RT2B 3GZ7A 4RBVA 3BREA 1GX6A 5GADI 2H9ZA 1I6JA 4I2PB 5EWGA 2DO0A 5K14A 2YX1A 1RAJA 2F40A 3QIDA 4DQQA 2EK1A 2Q6CA 4LFAF 5A8WA 2QRRA 2IVMA 2BJEA 4EWTA 2RKIB 3F41A 3JSYA 4DR3F 3PJWA 1U1NA 2MQLA 1G6BA 2P6TA 1HI0P 2RRBA 3Q2TC 5HMYA 3KYLA 1M5VC 2W25A 1S0VA 2RKIA 2L9NA 2RU3A 2BM1A 5I3PA 2W4CA 3OXGA 2GW8A 2KHDA 3TAQA 1YJWS 7FDRA 2VPYB 5GAHU 1UEVA 4C11A 3EGWB 1Y5NB 2XULA 2DNMA 3WC0A 1QY7A 3POTB 4KFBA 3QMQA 2DR9A 2ZH4A 1RT1B 2A2DA 2AYGA 4H54A 3TARA 5GAEU 1LW2A 2GO8A 5U47A 3KTQA 2ILYA 2OPPB 3H4BA 5E5NA 5KT7A 5IT0A 4F26A 4NZ0A 4MYUA 4X4QA 3CPWR 1FEEA 4NL5A 3C6UB 3GMGA 4CO2A 4IRKA 3MM7B 4ZA1A 4DR4F 3Q23A 2V4JB 2HVZA 2F8EX 2N3LA 2B4VA 4IRCA 4JI6F 5KT5A 4NLQA 5HMWA 1C0UB 1V3SA 3NAHA 4IH7A 4YOEA 3SCLE 4PUOB 1S0OA 2MSSA 1JLCA 4Y34A 1OPIA 2XHWA 2HW3A 2YQ3A 1QVFR 1S7HA 4N56A 1M5HA 1Q8BA 1ROFA 2WONA 2XMWA 3DN9A 3KMQA 2D9PA 5D4LA 2PEHA 2MPUA 2J9DE 1OIAA 2C2DA 1UMJA 1NKCA 1FKOB 2DNGA 4NMLA 2KG0A 1B0PA 4JI3F 4LF5F 3MHYA 3HPOA 1N5YA 2CQ4A 2OD6A 3M8QA 3W3SA 5B09A 3GIKA 1Y3KA 4URQU 5KTQA 3FQKA 1HWIA 2EG1A 3DLKB 2VPXB 1YIJS 2JH3A 1U6ZA 2WSCC 3LH2S 3MGJA 1X4GA 2ZM6F 1YBAA 4A46A 4FBUA 3SSQA 5CQGA 1MROA 3FFIB 4ICLB 1RA7A 5LXYA 2L08A 2VBYA 4CI0B 1M5SA 5EUHA 5I3UB 3I32A 4EZ6A 4H4MA 1S9GB 3AQOA 1T05B 3KG0A 1UETA 4JYAF 3H5SA 2LA4A 1VQ4S 2XSFA 4ID5A 1R7IA 4KIAA 5A0YA 1U49A 4KV8B 3B8HA 4DQPA 2XMVA 5L1LA 4MIWA 2UVUA 1K73T 1H98A 3MPYA 5D6GA 3OSNA 1NK8A 2UUWA 2QZ8A 1S1WA 2DD8S 2LVWA 1N48A 2CQ2A 5KFIA 4UY85 3BSAA 1S79A 2CFXA 4ECSA 2ZD1B 1FKPA 1TL1A 1RYSA 4C7QA 2CYYA 5KG6A 1TL4A 1XN9A 3G6VA 3UD3P 1KLMA 1HWLA 3VR1A 2C28A 3DLGB 3F44A 1S6OA 4CO0A 1YWXA 4PPZA 1S99A 2ZD1A 1DZ5A 1OQ6A 1L5UA 2B4PA 4H4KC 2SXLA 5D4NA 1T7PA 3NCQA 1T03B 2F9DA 3MM9A 4TXSA 5FDLB 5B0GA 5I4MA 1CSJA 1C4AA 2HWTA 3GFHA 5T14A 4Q44A 1W2BR 5DGBA 2WOMB 4IG3B 2W24A 5FD1A 2DR5A 3SMZA 4RUHA 4EYHB 3KLFB 4C0BA 3CJ4A 1FEHA 1JXLA 4RU2A 3CMAS 1F5BA 5T7LA 1QLNA 4WKYA 1N33F 1RKIA 4USHA 1RT7B 3T1HF 1R0AA 4LF7F 4I4BA 1C1BB 2IJNA 2QSFA 2CJBA 4CNYA 3IRWP 1S9EB 1S1VA 1DAXA 4WFYA 1U1KA 4DV2F 2GGPA 3BEGB 4F4YA 2FVSA 3B78A 2KYXA 4BBYA 4C98A 2NUUG 1GX5A 2RILA 2E9ZA 5KG4A 4DL5A 4W92B 2DVIA 1P27B 4LVOP 5DQHA 3V4MA 2QIFA 2DGXA 3HM9A 4DL4A 1JLFA 2CJKA 4ZPBA 2CZ4A 1JLAA 2C3YA 2JL9A 3OL8A 1X4FA 3GIJA 4ZDNA 4DLEA 4DBQA 4A8SA 4KGMA 5K8PA 3PKMA 4ZPCA 3DLHA 4O3OA 2ASLA 2ROGA 1C0TA 4ZVEA 4C2MA 4AL7A 2ZOMA 4TU8A 4ZHRA 2K7JA 1QAYA 1QUPA 2RRNA 2I5JB 3LF0A 4YB6A 5H1SV 4ECVA 1NJYA 3PDNA 3OUYA 3Q8SB 2WSEC 2XGQA 5I42B 3ZZPA 3H5XA 3QJLA 4WU2A 4Q0BA 3HHLB 3OBIA 3ITHB 2KXNB 3I96A 4Y0FA 3U02A 5KT3A 4C9DA 5KG1A 2QLWA 2DK2A 3CCUS 3R1HA 2XS2A 2M8HA 3LO3A 1VQ6S 4ES3A 2CJ9A 1IKYA 1C1CB 1U25A 3BSCA 4D3GA 4I7FA 2HMIB 2HVHA 1RT2A 3IR6B 4KPYA 4C8LA 1HPZB 3M8PA 3LP2B 1NB7A 3GYXB 2IBOA 3TUJC 4DLGA 4LMZA 3G71S 2YWKA 1HBUB 3OJUA 3CCJS 1S72S 2VC1A 3MD3A 5CXTA 3QWUA 2AP6A 1J5OB 1N5VA 1WTFA 3FGVA 3T5KA 3C2PA 2WAQD 3VAIA 1S9FA 4DFKA 1TKTA 1KC8T 2EG2A 1H2UX 4DR5F 2APOA 2HNZB 3I0RB 5CYJA 1IJEB 3P3DA 2YWFA 4PXDA 4QU6A 3PACA 5F8IA 2DNPA 2E1RA 2GV1A 2I38A 1D9DA 4OHYA 2YNHB 2FLPA 5E7OB 4JUZA 1WEXA 3I56S 2F8MA 3OTCA 3LWLA 4EEYA 3SI8A 4GKJF 4IFVA 3QZ7A 2J5AA 3HVTB 2HRYA 3TUZC 3DGPA 3D28A 3KWMA 3JSMB 2GMHA 4QW8A 2FHKA 1BLUA 1KSPA 4NCBA 3HVTA 2E1MC 5E2QA 2WHOA 1SJFA 1FNMA 3ICLA 1YGYA 2F1FA 2YX7A 5HBMB 3KHRA 5K8OA 5JUMA 3CF5Q 3HDSA 4M8LA 3PW0A 1QSLA 3DLLQ 4ELUA 1E6VA 2PT0A 2Q66A 2UU9F 3Q8RB 1VQ9S 2XY5A 3DI6A 4LSLA 3J7YI 3E51A 2R7UA 4IO1A 3W2VB 4DOZA 4Z37A 1NZAA 2B3TB