2VH7A

Crystal structure of human common-type acylphosphatase
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
94
structure length
94
Chain Sequence
b'TLISVDYEIFGKVQGVFFRKHTQAEGKKLGLVGWVQNTDRGTVQGQLQGPISKVRHMQEWLETRGSPKSHIDKANFNNEKVILKLDYSDFQIVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACYLPHOSPHATASE-1
publication title A Rigidifying Salt-Bridge Favors the Activity of Thermophilic Enzyme at High Temperatures at the Expense of Low-Temperature Activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 26
structure length 94
sequence length 94
ec nomenclature ec 3.6.1.7: Acylphosphatase.
pdb deposition date 2007-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00708 Acylphosphatase Acylphosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vh7A00
1Y3KA 2QIFA 1Q4RA 1ULRA 4OJ3A 3FMBA 1APSA 1YG0A 4FNHA 1N5VA 5A6WA 1FVSA 3F44A 4A48A 3T9NA 2ROPA 2QYCA 1P8GA 2W4PA 2OAUA 3BN7A 3IWLA 2K1RB 4HI2A 1YJUA 2AW0A 2GGPB 2KT3A 3DXSX 2FTRA 1S6UA 2RU9A 4OIXA 4A47A 2N4CA 2ACYA 2IFXA 1SI9A 2BYCA 1KVJA 5IXUA 2OD6A 2RILA 2OP5A 1Y9OA 1TZ0A 1Q8BA 1YJTA 2HLTA 2GV1A 2K7JA 1VQYA 5F0UA 1WD6A 5B08A 3I9ZA 4OJHA 4Y2KA 3MCSA 4HI1A 2N7YA 2OD4A 3HHLA 4FNIA 2GA7A 3BF4A 2XMUA 1OQ3A 3TOQA 2KKHA 2ROEA 4ZOSA 4DN9A 1V3ZA 3QGPA 2LDIA 3HX9A 2K1RA 3HHLB 4U9RA 1CC7A 1W2IA 1Q53A 2GGPA 5T7LB 1AFJA 4YDXA 1JK9B 4Y2MA 2LQBA 2N4DA 4QOTA 5B09A 2GO8A 3FGVA 4Q2LA 2OMOA 3TNVA 1QUPA 2LQ9A 4OJGA 2GCFA 1N5SA 2XMWA 4EFAC 4ZA1A 2BUNA 2RMLA 3HDSA 2CRLA 3CJKB 2JDJA 1FE4A 4NPOA 1GXUA 4Q2MA 2FB0A 1OSDA 3WDOA 1Y3JA 1N5QA 1Y0HA 3BB5A 3VTIA 2PD1A 2K7KA 4A4JA 5K9FA 5T7LA 2ASYA 2KT2A 3KNGA 3IWXA 4YEAA 1XBWA 1URRA 1FVQA 1S6OA 5B0GA 2ZDPA 2VV5A 1RJJA 1SB6A 2ROGA 2XMMA 1KQKA 2XMTA 3KG1A 2QLXA 2BJDA 3LGMA 2FIUA 2HLUA 1AFIA 1VQSA 2XMVA 3CJKA 3LO3A 5B0EA 1FEEA 1MWZA 4DL0C 5B0BA 2W4DA 2RSQA 1TL4A 2VH7A 2KYZA 2XMKA 3UDCA 1TUVA 2W4CA 3DCAA 3K7RA 4OJ1A 4HH1A 4A46A 1JWWA 1U7LA 2L3MA 1FD8A 2XMJA 1X7VA 1YJRA 3KG0A 2BJEA 1LQ9A 1TL5A 2HQIA 5B0DA 1KVIA 2HFOA 3MZIA 5KAKA 1X0PA 1OPZA 1N5TA 1P6TA 1X8DA 1R6YA 1OQ6A 1Q8LA 5B0AA 1K0VA 2AJ1A 3LGNA 2BBEA 2EW9A 1CC8A 5A6PA 2GFFA 5F0WA 2QLWA 2LXFA 1IUJA 2Q3PA 3BR8A 3BGUA 1TR0A 1YRXA 2PGCA 3BDEA 4HL9A 1CPZA 2OKQA 2HIQA 5B0FA 1GXTA 1SQEA 1MWYA 3TRGA 4Y2IA 3BM7A 2OFHX 5B0CA 3HFKA 2ZDOA 1AW0A 2G9OA 4HH0A 3FRYA 3KKFA 3GZ7A 1FESA 2AP6A 2HFNA 3E8OA 2IYIA 2OFGX 3HHLD 2FHMA 3HF5A 2IYGA 3QMQA 4DPOA 4NL5A 2K2PA 4F67A 2AJ0A 3HHLC 1YJVA 1FE0A
chains in the Genus database with same CATH superfamily
4ZHRA 1FKOB 2CJXB 2NXEA 2W8KA 3DGPB 4BDPA 1QD1A 2ZBCA 1BWVA 1TAQA 2VQFJ 4C3MA 4NYOA 1PYOB 2V63A 3G86A 4KHPF 5HANA 5KFNA 1Q1KA 1W2BR 2HHQA 5KFWA 1N36J 2XWXA 2AV5A 4G6VB 5J2PB 4ZCKA 4OJGA 3QAEA 4FYYB 1DLOB 2KFYA 1Q86T 3GSDA 5CH7B 3C6TB 2JC1A 4WZMA 4NE9C 2BW2A 3THTA 1T05B 5JVHQ 1NK5A 4LVNP 3CEDA 4UQTA 4LSZB 3Q86A 4ZIWA 2IY5B 4L75A 4QCLA 3PYEA 2LXFA 1H2UX 2XYHB 4DHVA 1B7YB 4LF7J 4I7FB 2YWKA 4ID8A 5BYSA 3OFEA 4B3TF 5F3TA 1WC3A 1LNQA 2ZVIA 4ANEA 2FPHX 4YDDB 2CZ9A 1FKPA 3CC7S 1MNEA 2HGNA 2PN6A 4ECRA 5GAHU 4LFCJ 1K1QA 4RNMA 2H9ZA 4ZJLA 3CCRS 4WIQA 2I9SA 8ATCB 4NEZA 2ROEA 2VA2A 2FJWA 4FF2A 1AFJA 1JLBA 1CJTB 1GAOA 1Q7LB 3LP1A 3TNVA 1SKWA 4Y3CA 3QT8A 4L72B 4U96A 2RHSB 3D4JA 4I6AA 3Q2TC 2XWYA 2C2MB 2OPRB 3TW0A 2H5IB 1NDKA 3D2WA 4MKAA 4DN0A 3D5MA 3TAMB 3BYRA 5A8WA 4LSLA 4YUDA 2XZWA 3WHIA 4DSIA 4K5RA 1LK5A 1TL5A 3V2UC 4CM0A 4KHPJ 2WB4A 3BKFA 2CPXA 4P74A 1R6VA 1DAXA 1D9DA 2G0CA 2VKRA 4DFPA 4RW9B 4WE1B 1SH3A 3TO8A 2XULA 2ZH2A 2D9OA 2FLPA 5KT6A 1TL1A 3FMBA 3D6FB 4FF1A 1DZ5A 1GFWB 5AE1A 3OVAA 2ZWOA 4ED3A 1TP7A 4P73A 3DHWC 1TZ0A 4DV1F 5KT5A 3RBDA 5AXLA 2W7PA 4RUHA 2ZC3A 3MURP 5C5JA 4DCPB 2ATCB 2GC8A 1HR0F 3N4WA 4YFUA 2QSFA 2CZ4A 1CULB 4FS1A 1WG1A 2L9NA 2PC6A 2QZ8A 2ASJA 3K5NA 2V0NA 3KG1A 4QU6A 4B3TJ 3VAHA 2QYGA 1ZM2A 8AT1B 3UNGC 4PKDB 1KLMB 3AFGA 1JLEA 4F4WA 1RTIA 5BR8F 1BUXA 3OFGA 3PV8A 4X4PA 2DXFA 4GRSA 3V81A 4F0MA 3HFKA 1FD2A 5F3ZA 1VBKA 1FJGJ 1EQ0A 3L7PA 3BV8A 2CJYB 1YQHA 1NUEA 4O3OA 2YNFA 3M6XA 2A10A 4DR3F 3ISZA 3UVJB 4UW2A 3MFHA 2N4CA 1ZTTA 1RHJB 5DGBA 2R42A 1RU1A 1SPBP 3M4XA 2AX0A 1QTNB 4KV8B 2DY9A 5KFQA 3ONQA 4IYQA 3ZZTA 3PW2A 2HBYB 4HR2A 4WJBA 2M8HA 1RACB 3MEEA 2BACA 2LFVA 4QWCA 4PQUB 1Y4ZB 1KDNA 3D7SB 3A12A 3KLHB 4DR5F 1PG5B 3ILLA 2BJDA 3RBZA 1VQSA 2X7IA 2ZH8A 1S57A 4W98A 2IM2A 5CZVA 1S6PB 4IRCA 2F1FA 4C11A 3OVBA 2MKYA 3GV7B 5L1JA 1PJ7A 4IQMA 2CQCA 2OPPB 3GYNA 4DV1J 5F0WA 3T1AA 3BDEA 3UQSA 4AL7A 4RR5A 4I69A 4JUZA 3VAJA 4DQPA 4ID5B 1QY7A 2AF6A 4WU3A 4F7VA 2WHOA 2Z57B 1HR0J 1SUQA 4JI6F 1CJVA 2QN6B 3GIRA 1SV5A 4FYDA 2RU9A 4DX6A 1TKTB 5KT3A 1CJKB 2B8QA 2VBXA 3MOZA 3ENVA 4LQ3A 1BQMB 2P6SA 3SDEB 5HP1B 3OTEA 5EX0A 4U7CA 5BR8J 3UNYA 1OYEA 1PYTA 2R8KA 5D77A 3PRBA 3BSNA 2HLUA 5HVHA 1NPKA 3VV2B 3Q8YA 1UVNA 5KFRA 2IRXA 1NKCA 1UVIA 2AIRB 1NDLA 2FVQA 1TR0A 4OX7A 2HQDA 4WBFA 4CYUA 3AAWB 4PPDA 3ENAA 4NLPA 1VQ9S 2UVWA 1AROP 2V5HG 3AA9A 3W61A 2YWEA 3W2VA 2J9EA 3M05A 3OL6A 1FJ7A 5JXSA 1VBXA 4K2XA 2BJ3A 3GONA 4DR5J 2NPIA 2NXJA 3DRPA 3E01A 4WKRA 2AJ4A 3TQ1A 1DQ9A 4OYPA 2GJ2A 1TV6A 3LPYA 2F40A 2NLWA 1QAYA 4EMDA 1HD0A 3CO0P 4JV1A 3R9LA 3SSRA 5D4NA 3PJ9A 4YB1P 2WBRA 1OYDA 2XHCA 3QIPA 3PRDA 4LR9A 3Q22A 2MPUA 2EG2A 2YKMA 4WFAQ 4PUOA 3VR1A 3M8ZA 3I55S 1D3WA 4DX8H 4JI6J 3OXGA 2ZBRA 4ZS6A 2MMYA 1GTEA 2CNLB 5I3UA 4U6PA 2E1AA 3GR0A 1H74A 1Q8LA 3RBXA 2C3YA 3H42A 1UWBA 1HWUA 3CCQS 4PG5A 2IMWP 3HHDA 2MZTA 5DDQC 1HNXF 3ENWA 4F2RA 5CABA 2ZH5A 2LXIA 1EJ7L 5KFOA 1S6UA 3FCWA 5FD1A 1XERA 1M5SA 2F9JA 4ED6A 2GHWA 3ZZRA 3IO1A 1U6BA 1MN9A 2HBRB 2ZM6F 2C2OB 3HO1A 1VQ5S 1GMVA 1HARA 3QO9B 3CJ3A 2XI3A 5KG6A 4CT8A 2U1AA 3MECA 5KFVA 2EEYA 3DI6B 1U1KA 3PKYA 3L7UA 3TVKA 2GAGC 4URGA 4K50A 1S0OA 2LXUA 4NCGB 4F3QA 3RYLA 1DTQA 2KH9A 2RDDA 2RQ4A 2NXCA 5HL7Q 4MK7A 2FC8A 1HMVB 1FHTA 4C4WA 2YKPA 2L41A 2DK2A 1FNOA 3CWJA 3I0SA 3QT7A 1JLQB 4NCAA 3Q2SC 4Q45A 2DH9A 2XGPA 1HHSA 2HFVA 1SCJB 5D0RA 4NL5A 5EX3A 1P1TA 3QJLA 1Y3KA 1YZ7A 5JJBA 2VPZB 1NK8A 4HTJA 4RWWA 5E3PA 1TL7B 3C16A 3W8GA 3HZGA 4HYKA 2ZBQA 2LEAA 2H51B 2W25A 2JLFA 1ELOA 3LP0B 4IR9A 1HI8A 2ZHOA 1Q8BA 1KBRA 3A3OB 4FPRA 1RABB 4EO6A 3QGHA 1KFSA 2A6MA 5ETPA 2FY1A 4MTPA 4TQSA 2JJ4D 2UUBF 2HVEA 2J9DE 1REVB 3C15A 2ALZA 1O8BA 1F3VA 4ZCMA 3POTA 2HWTA 4N56A 2FGOA 2HQGA 2BOPA 5IT0A 2IAJA 4MIAA 2HNDB 3BREA 1MU2A 4LR8A 2WB1D 5IV4A 2M70A 1HNXJ 4LREA 4XTTA 2N82B 3RW6A 3WIUA 4KQZA 1CG2A 2UXBF 2RDIA 3KJNB 3OL7A 3S8SA 4ZMMA 1FX2A 4I4BA 3BGUA 1RT6A 3DXBA 3KDNA 2G0IA 2I5JB 3TRGA 2DBBA 4JI4F 2QJ3A 1JJHA 2ZM6J 3X3UA 4AL6A 1RBLA 4JP8A 2Y1JA 3M2VB 1Z2LA 1S1UB 3K59A 1RWVB 4MK8A 1TKZA 3OUYB 1KVKA 1VRTA 2BYCA 2VPWB 2JWNA 3KUEA 3HKWA 1KLNA 1U1PA 3MPVA 2AGPA 4NXNF 3HSZA 1GMWD 4N5SA 2Z4PA 1KONA 2OELA 5THWA 3K5MA 1U1NA 1WF2A 3AD8C 3GFZA 5A0YB 1RWMB 3PX6A 1TL3A 1RTZA 2WAQD 1D9AA 3SV3A 2ZZNA 4DG1B 4K4VA 2DNLA 3D0IE 1T95A 3C3LA 3HSDA 4R25A 1D0EA 3MHYA 1XIQA 5G0RA 3RZAA 1IR0A 3EZOA 3EPIA 4EEYA 3MM7B 3GG0A 4YMEA 5FDLB 3OFFA 4QWDA 3DOLA 2VG7A 3VQSA 1IM4A 3U1NA 4IOAQ 2OI2A 1UVJA 1VC0A 1LK7A 2CQ1A 2YTCA 3QJJA 3DM2A 3SCKE 2MGZA 2UUBJ 3A8KA 4C8ZA 1S6QA 4C3KA 3IXQA 4ECSA 3CJSA 2B0GA 4JI2F 4Z37A 2AWZA 1LW0A 4DQRA 4L6V3 1NSQA 4QU7A 3FKBA 1IR1A 3BH6B 2QLBB 3AJ2A 3DNCA 2FC9A 2GO8A 2ZC4A 1QUPA 3NS5A 2UXBJ 1W7WA 4DQQA 1MSWD 1P9YA 4ZLNA 1JNRB 1SJ1A 3I31A 1XBWA 4JI4J 2W9CA 1FRKA 4DZ6A 3V6HA 3OBIA 3CUNA 1KKHA 3J7Z5 3GJRB 2R2TA 2W4CA 3DCAA 4CT9A 1N52B 3TJ9A 3P49B 2CNOB 4ZHRB 3MR6A 4M5MA 1RHKB 4QPXA 1G2EA 3DLKA 1XMBA 4NXNJ 2KZMA 4NX9A 2ZBPA 1AUDA 3JQJA 3CIZA 1TVRA 2D41A 2KRBA 1NK7A 2JEJA 5A2QU 5ETLA 2ZFHA 3RBEA 3NS7B 3FFIA 2IM3A 3NNCA 1IWGA 4ZPDA 1R0AA 1KHWA 2FVCA 3AA8A 5B09A 4TKTA 4FKXA 2AEFA 4F02A 3IBCB 2GIRA 2VZ9A 4CNZA 1EAYC 2DRAA 1KNZA 4Q8FA 2K7KA 1X4BA 3CC2S 1WF1A 3NP5A 1HPZA 3H2VE 4F25A 3MFIA 5FLXU 3WIVA 4DWIA 4URSA 1KR4A 4KJIA 1U7LA 3ISNC 2E5LF 4OHXA 3OTOF 5HI7A 2YVSA 1FRMA 2M4MA 1X9MA 2H54B 1FKPB 4OYMA 2CUYA 4JI0F 2MEWA 2VBZA 3TAQA 1SXLA 3OT9A 1XEZA 3OFHA 2AGQA 5GAEU 1F3FA 2D7SA 3CDAA 2QX0A 3IM8A 4NZ0A 1YTYA 5HROA 1NSKL 3K89A 2R8HA 3VAIA 1JLBB 1YJ9S 3FC9A 4H54A 3LP1B 1OY8A 3HSGA 5CQGA 2KTQA 5HMZA 1TMJA 3H5SA 3K8VA 1BXNA 3M7VA 2HSEB 2LDIA 3QWPA 2B5JA 4KH0B 4FS2A 2LQBA 4TYAA 3FK4A 1NHKL 2BJ8A 5A8WB 3Q8QB 2BOAA 2P9CA 4CLYA 2IDLA 3MEDA 4LSLB 3RAMA 2X1FA 3VTIA 2BDPA 4DPUA 4KSEB 4DLGA 3R8YA 2DNPA 3DDNA 2BM0A 1OY6A 2C3MA 3G82A 2VH7A 3T19A 1X4GA 1QSYA 1G7CB 4J9UE 1YWXA 3I56S 4C8KA 5HLFA 1TL1B 3CJ8A 4YB5A 3P5TL 3TZXA 3BM7A 3BKTA 2VFTA 4X4UA 3PFEA 3OXLA 4P2MA 1HLWA 3UN3A 2GMJA 4ECTA 1FDNA 4DUZJ 5KFEA 1WEYA 2VC1A 3WZ0A 2QL5B 2BA9A 3IWLA 4OI2A 1HW8A 3N28A 2KT3A 2E44A 3EPGA 2W01A 1T03B 3TA2A 4K4YA 5SZTA 4PRFA 5GAEI 2FLLA 4BHQA 4QJVA 2FVRA 1W2IA 4H4OA 4EBDA 3JB9k 2F65A 2FJVA 3HVTA 3CO9A 2ADCA 5BJRA 3AB4B 1OSCA 4PXDA 3OTOJ 1EX8A 2E5LJ 3DRSA 4H4KC 2X3GA 3MUTP 5C2CA 2HHUA 1JLEB 1OO0B 2HVIA 3IGNA 2D1CA 1RTIB 2OMLA 1H38A 1IQZA 3R1HA 1FEEA 3V81B 1ZPVA 4OX9F 1YLXA 3JAMY 2MZ1A 2YWWA 1YBAA 2XBPA 1LQ9A 2YNFB 4CLKA 5CCMA 3L7OA 1GNKA 3CD6S 4LFBJ 1FA0A 4EBCA 5F41A 1ZA2B 4PR6A 2LMIA 1N0UA 4OYBA 2C2DA 4USVA 3DFEA 2B9WA 1E6VA 3MEEB 1FI4A 5B08A 4E8UA 1G6BA 2EKYA 2ATLA 3KJQB 2E7WA 1YK9A 4WWSA 4M5KA 1ZZFA 4JBCA 4J9KA 3M9OB 2DO4A 4NPOA 1IKWA 2H3EB 3D66A 4C11B 1PKUA 2QMWA 4FXWA 5B0GA 5HJXA 1TKDA 2C42A 4PWUA 3ZC4A 4TY9A 1B3TA 3L9ZA 4EI2A 4AD6A 1F2GA 1DQAA 3CD7A 1KN6A 1SUQB 1CJVB 2GS8A 2I1RA 4UY85 4I1TA 1SV5B 2YNIA 1S9GA 3GZ7A 3I82A 4F67A 5KTQA 2A2CA 2PSZA 4ANDA 1XC9A 1RBAA 2FTRA 3NAHA 1B70B 3JSMA 1WD6A 2MZSA 2Q79A 2QA4S 3LOUA 1LKZA 2DR5A 1W25A 2GHPA 2PT0A 4OZ0A 3QSIA 2K1RA 1N6QA 4NLOA 2GGPA 5CAAA 3M8PA 5DDRC 1VK8A 2RDJA 1IJEB 4OX9J 3U1LA 4TXSA 5EWEA 3HDSA 1FWPA 3CVKA 2PD1A 2W8LA 1NXIA 3C19A 3OSPA 3BBBA 4B3MF 2WK4A 2V8DA 3O3LA 4CYUB 4RLEA 4ZVRB 3A8IA 5IWAF 3BEGB 1OJ4A 1UZHA 3EWGA 3ISND 3W2VB 2VBYA 3VAFA 1BWEA 2PMWA 2PGCA 3CJ4A 2VC0A 5L9NA 3K5LA 5AT1B 2DNHA 3G6ES 4TY8A 3EXYA 1WOPA 3DRPB 2DD8S 1NHVA 3E01B 3GFYA 2DXEA 1TV6B 5IC6B 2YQ1A 3FBCA 3TYTA 3HVRA 2KL8A 1VR6A 4ZKAA 1B99A 2B9EA 2JH3A 2D3ZA 3G96A 2LP4A 4WKYA 3L09A 1URNA 2VPXB 3QIPB 3TEGA 4X84A 3AD9C 2LCWA 2YKMB 1SJ4P 3NWGA 1NKEA 4PUOB 3QNWB 4KB7A 2OSQA 3EUNA 4DCJB 4RWXA 3NCRA 5D4PA 3GCWP 3I5AA 5I3UB 1UPPA 3LGMA 2FIUA 2IRUA 5KG4A 4NEYA 1UWBB 3V5RA 2IC3A 1AA1B 3BSAA 3GLJA 4NLSA 4TU9A 2ASLA 1VQ8S 3CPWR 4A8QA 1QTMA 4GVBA 4DFMA 5J1PA 1T9VA 2PEBA 3TEHB 2UV8G 3T9NA 2DHGA 1WORA 4C2MA 3W2WB 2CDRB 3KLIA 4RNNA 5GAGI 2BVZA 1R8PA 4L3KA 4DSJA 2Z2LA 2ILZA 4B3MJ 1BLUA 3MECB 3MUMP 1JKHB 4LJMA 2MZRA 5IWAJ 2M88A 4X4QA 3H2UB 3CCSS 3R6LB 4LUBA 3GR1A 3J81j 4O3QA 3SFUA 4HDHA 2B4VA 3BBCA 3S01A 2XC9A 3I0SB 2H65B 2XSFA 3ZTOA 3FZ2A 2AQ4A 3F41A 2YX4A 3M8YA 4FZVA 2R7UA 1UEUA 4FF4A 2EFNA 3I96A 1YJRA 1Y00A 1O51A 5SUHA 3EMTA 3C16B 1RAIB 4KBIA 5B0CA 1Z4UA 8RUCA 2X1BA 1N33J 4NRUA 4X4TA 1BQNA 3HF5A 2CYYA 3FSYA 1NK4A 3DGPA 2LECA 1K1SA 3F44A 4QIEA 4Z7YA 4CO3A 4UQGA 2OD6A 2DNGA 3H5YA 5JMNA 2HRYA 1VQ7S 3I9V9 2JLGA 4B9TA 4MJKA 3ETMA 3MCSA 3C15B 3Q23A 1WHVA 1WEZA 2YNHA 3POTB 3TA0A 3DHXA 4MYUA 1JLGA 5LM7E 5AE2A 4TVAB 1O0PA 2IAJB 1SBRA 4Q2LA 2V2QA 2DNMA 1MU2B 5KFPA 4DR2F 2HQCA 4R5PA 3I0RA 3FRZA 4I0WA 1Y0HA 4B3SF 3GYXB 5LL6d 2ROGA 2K3KA 1PO6A 3X1LB 1RT6B 3FEZA 3OXFA 4DL0C 4QIVA 3OLBA 3MM5A 3WX4A 4CRJA 1RT5A 5E3AA 3MF5A 2J0XA 1R43A 1LWEA 1TKZB 4RUCA 1WEXA 1HBOA 1VRTB 1DURA 2WW8A 3H5XA 1KC8T 3CJTA 3VZIA 3MMBA 5KFGA 1DRZA 2ZWPA 3FEXB 2AW0A 2W2PP 1WKKA 3W60A 1UP1A 4RPFA 2BRLA 1M1HA 1TL3B 5HMYA 1CJTA 2Y9HA 3C6UA 1Z1ZA 4YDXA 2IRYA 1UFLA 1CS4A 2OMOA 2HRTA 1WC5A 3R2DJ 3HVWA 4KGZB 4FKYA 3HT0A 5G0RB 4EBEA 3LAKA 3ADAC 2OEMA 3CJRA 2QA2A 4LT6A 4ZVEA 2E9ZA 3DOLB 2VG7B 2PI4A 4YOEA 2ZH3A 1RLCL 2ZOGA 3MEGA 3OQ2A 3M1VA 4R8UA 2L3MA 2MGZB 2G2OA 3RR7A 4DV2F 3JSBA 1S6QB 4BWJA 5LJ3Y 1R8AA 4IH7A 1PC5A 3H59A 3M2UA 3MI7X 3GIIA 2YH0A 2HWIA 4MKVA 1LW0B 1RWUA 2D3OR 4DR2J 1EZZB 1Q78A 4U95A 4IH6A 4B3SJ 1HL6A 4J9OA 4ED4A 2M8DB 2H4WB 2MQ8A 1S1WA 3JSYA 2NUHA 3MR2A 5L1IA 4ECUA 3K8WA 5DDOC 2XB2D 2W9CB 2CPEA 3GMGA 1RT2A 1D1UA 1H7XA 2BQRA 4V1Ak 4N76A 3UPFA 1FRLA 4RW7B 2CIMA 3CULA 2X1GA 4DV5F 1FXDA 4UOHA 4DV0F 2CKWA 4LIWA 3DLKB 2VPYB 2IHR1 1X4EA 2HHSA 3HT3A 3HHEA 3FBBA 5LOQA 2J6UA 4S0MA 1FTCA 5C42A 1WHYA 2YQ3A 1UA1A 2L48A 1TVRB 4QWEA 4RUBA 1PILA 3KMSA 2CNKB 4OL8A 3QMQA 3HHLC 1FO1A 3P5BP 5ETNA 1FXRA 3FFIB 3PZPA 2MHEA 5CYQA 1R0AB 3KG4A 1FERA 1N34F 2MQLA 1V3SA 4C48A 1NJZA 4CI0B 3SQGA 4XK8C 2HHTA 3H90A 4W4MA 5D0GA 1U4BA 1N8RT 1F5CA 1VLOA 3KLEA 3M9MB 4F36A 2R8JA 3RU0A 1HPZB 1S7IA 4DMZA 3AOAA 1M1GA 4KC5A 5DLGA 4DV2J 1ITPA 4P2FA 1NDPA 1UJ6A 3EXCX 4MH8A 3SQOP 2CXEA 1RCXB 4FVCA 4NMLA 6FD1A 3PCOB 3R6GB 1VJQA 2HMIA 4CH0S 1WDTA 4PYDA 2W1BA 2BABA 2HFUA 2HBZB 3MCMA 4FDFA 4OI3A 5HROB 3A3NB 2CG4A 2ZUAA 1XR5A 1S72S 5DRKA 4ERDA 1GT8A 3J7YU 4G65A 2KXHA 1Q0NA 3PEJA 2HYIB 2B5JB 3JTOA 1RKIA 2CQ3A 5AJ3F 2QG9B 1U1MA 4FPIA 4KT0C 1KQGB 5KT4A 4PG7A 4Y2KA 4DV5J 3ZTSA 3GJTB 3MEDB 4C0BA 2GVDA 4DV0J 2J8AA 1BGXT 4M95A 4WTOB 5HP1A 3QSYB 3V4MA 7AT1B 4OZNA 3THPA 5D78A 3R27A 4LRAA 1RB0A 2HRUA 3G9CA 2RT3A 4Y2AA 3T1HF 4DV7F 1UA0A 4N8OA 2HS4A 5HLFB 5LT5A 3IC1A 2O3DA 2YPZA 1X9SA 2DPIA 1U0SA 4ZLLA 1IKVA 3R5AA 3UD5A 2OPQA 2AEJA 3DLGA 2G1HA 1N34J 3TP2A 1WHXA 3P3DA 2EG1A 1J5OA 2E1MC 2VA3A 4MMOA 4UZCA 3CMAS 2WCXA 5DZ7A 1ROFA 4FVMA 2F3JA 2J0SD 3HK2A 5F8HA 5CD4H 3CCMS 4ZPCA 4J37A 4DLEA 3IG1A 3FSIA 3RB6A 3CD0A 3HVTB 1N88A 2OD4A 2CQ4A 3QGIA 3NCQA 3DRSB 3ZTQA 2JVOA 2XYPB 4KHRA 1EETA 4M5DA 1N5SA 4DL5A 2GVZB 3QT6A 3PVXA 5FJ4A 3FEYB 4O0NA 1G1XA 3ILJA 2ZOFA 4ED2A 2JEFA 4ZJQA 1S6OA 4DUYF 5IT9U 2WVCA 2EVZA 5EN1A 2FLNA 4OHYA 1UJ4A 5LSOA 1RWPB 4NI2A 1U48A 1H2VZ 1VISA 3J7ZT 5AJ3J 1KVIA 3MZIA 3QGGA 5J1EA 2JRSA 2DGQA 1RTHA 2ZBIA 1YJVA 3DMJA 1WI6A 3J80U 5KFXA 4A48A 1I5OB 1H6KX 2LKZA 3S1TA 2IMOA 2R3VA 1YJUA 2DNOA 1U6ZA 1HBNA 4WP3A 5AXKA 4CO5A 1SVDA 1F1BB 2ABYA 1WKJA 1XK8A 4X64J 3T1HJ 4DV7J 2RRBA 3QGPA 1KSPA 2MKCA 3LPEA 3KHRA 2EWHA 1ZTWA 3PJWA 1PSDA 3QQCD 3HD1A 4IG3A 2R7RA 4DX5A 2KT2A 4BS2A 3PJXA 1RHUB 3U27A 3ZTRA 1KRPA 1X0FA 2ILYA 4WFXA 2WSFC 1X31C 4MFBB 2VHGA 1MWZA 1VMBA 2HGMA 1PIEA 1S9GB 4C8MA 2NZ4A 4JYAF 1KD1T 2YNGA 2E1PA 2J6TA 1DJ0A 3H0PA 1HI1A 1AB8A 4UT4A 3PG9A 3DU5A 4DSEA 3OJUA 5L46A 3HHLD 2QC3A 3JSMB 1FE0A 3MMAA 5K14A 1IQTA 1FEHA 1KHVA 4P2XA 2V67A 2K1RB 1S79A 2GGPB 2DY1A 3M8PB 2R2SA 1RADB 3ZZYA 4P2SA 4TU8A 2FZGB 3NGKA 3MCOA 2KZZA 4CQ1A 4DUYJ 3EGWB 4RU2A 5C7PA 2F63A 2R7QA 5LSLA 3MOJB 2B9XA 1LW2A 1S1VA 3NRBA 1PYSB 4P75A 2DNZA 2W2QP 3DGVA 4ILLA 2BJ1A 3AY0A 3TX0A 4XPEA 1FE4A 3Q8SB 1F9HA 5A2QY 4OI1A 3CTRA 5AXMA 2LLZA 4PG4A 1KQKA 2G1DA 3KHLA 2YX7A 3OW2R 4QIFA 4NA2A 2GHVC 1T3NA 2HS0A 1T9YA 1FNMA 3KK2A 3W7BA 1R6YA 2XSJA 3LWLA 4J9SA 2V4RA 2VOOA 4QW9A 5A8KA 3SI8A 2BE9B 2XNQA 3D6TB 3FNNA 5E2QA 2W4PA 1O6XA 3JAMU 1NEEA 1RT1A 3KLFA 2OP5A 3D0GE 2K06A 3NCPA 4MT1A 5K8PA 4DCOB 4Y28C 3BBFA 3QT5A 1UW9A 3TUZC 4Q7AA 3NGRA 1RWNB 4IFVA 1U1OA 2N4DA 4XDDA 4NCBA 2P9GA 1QAXA 4WIIA 4JYAJ 1GEHA 2AEMA 2C3OA 3MD1A 1FF2A 1Y3JA 2IC3B 2HAFA 4EGLA 1T9UA 1RAEB 4NLYA 3GWCA 5DM7Q 2WVBA 2VODA 2KM8C 5E3CA 1TL4A 1T9XA 4FYVB 3LTOA 4TLQA 4GVBB 3W9HA 1IN0A 1IKYB 2HQIA 4PQAA 4Y00A 3PO4A 1FRXA 2Y8YA 3UO0A 4IO1A 4JV2A 2RS8A 3KLIB 3OHAA 3B82A 2VB6A 3B6BA 5I3PA 3AJDA 1V5VA 1QVFR 3OL9A 4I6YA 2UZAA 1RI7A 4DEZA 4JI1F 2UP1A 1UVMA 2MLZA 1RTJA 1WC0A 1LXJA 1BC6A 4B9MA 3OR1A 3G87A 2E7XA 4LFAJ 4DN9A 1TFWA 2GQCA 1B7FA 2V4JA 2DR8A 2V8GA 4K8RA 2DRBA 1U47A 3H7HB 4RU9A 4C0HA 3NMAA 2KI2A 1XWLA 2V2ZA 1QDUB 4F4ZA 3G6VA 5T7LA 4L76A 3AD7C 2EPIA 1IKXA 1UWAA 2X1AA 1IBLF 4X65F 2DGVA 1UW4A 2AZ1A 3T6BA 4KY3A 1BQNB 1EKSA 5C24A 2MJUA 1RUSA 4N7TA 1OPZA 2OTLS 3JYTA 2E5IA 1OIAA 5KFLA 4Y2IA 1XJWB 1L5UA 3ZZZA 1NKBA 3T5HA 4UY8T 2HZAA 2E1CA 3T5JA 1UFWA 1APSA 1F2HA 2YNHB 3VVTA 2OAUA 2ZD1A 4M5HA 1JLGB 1SC4B 4PABA 1SI9A 2W2NP 3E3XA 3TJ8A 1S7HA 2KHCA 3DN9A 1OWXA 3N6LA 5KG1A 4R5PB 3I0RB 3VAMA 2B43A 2GA7A 3NGSA 2XI2A 3UW1A 4F3MA 1TUGB 4F4XA 4DS4A 2RJZA 5L8RC 1RQ0A 2J0QD 5E0OA 5IC4B 2WSCC 1HBMA 3MM5B 3D3BJ 3SBMA 2F8HA 3BGLA 3RUBL 1RT5B 3OTDA 1LWEB 1VQPS 1HBOB 4JI1J 3AH6A 2MY8A 2W9AA 5L9XA 5U47A 4DOZA 3IWNC 2L9WA 3M8SA 4CLUA 3MMBB 1OQ6A 2MJNA 4Q44A 3PO5A 2J7WA 1FK9A 2QMXA 2OFGX 2KVIA 4C6AA 3V4IA 1RYRA 1RE1B 4GO5X 1HW9A 2JEGA 3C6UB 3VGSA 5I3QA 1NPPA 1CS4B 3W1YC 1UCNA 2DPJA 4CLWA 1NJWA 4PEOA 1R0CB 3BH7B 3J81U 2CAJA 1ZOTA 2CNNB 3FQLA 5E7OB 2ZUGA 1IBLJ 4X65J 3HHLB 5DM6Q 1UAWA 1L3TA 4CLPA 4WXWA 4RNFA 4LF5F 2C2KB 4CLFA 5HMXA 4CO2A 2APOA 3U7JA 4PAAA 2IIHA 1GXUA 4Q2MA 3CCTA 2Z8QA 2DR6A 3MEGB 2ZZTA 1HNVA 3M1VB 4R8UB 2H5EA 1KS2A 4IRKA 2VBWA 1YDLA 3BQ1A 5RUBA 5M2PA 2M3DA 2BKNA 2O66A 3PY8A 3NWRA 4KKOA 3UCUP 3QRPA 2CPHA 2D74B 1NK6A 1EIYB 3M2UB 5DQIA 2ZH7A 4IG0A 1N32F 1FRJA 3FCVA 3GPAA 3IRXA 4J9QA 3BR8A 4E2FB 1PGZA 4HH0A 1NRKA 1SIZA 2XLKA 4RW6A 5J2MA 4C8LA 4DPYA 4I6WA 1S1WB 2V6AA 4KFBA 3LGHA 2EK1A 1NJIT 2VU5A 2DNQA 4V19J 4PWDB 2Y1IA 1VYAA 4F26A 2PEHA 1T03A 2RILA 2NREA 2HFZA 1YJTA 5GAHI 1ICEB 2B8PA 1RT2B 4O3NA 2ZE2A 4HT5A 3ULHA 3SYZA 3AJ1A 5KFYA 4JI5F 2P6TA 2CPFA 4EZ6A 3UWTA 3C46A 2BE2A 4P7TA 3LUYA 2V50A 1H7WA 1GMWA 1VC5A 1JMTA 4YR3A 4LMZA 2Z2MA 5C42B 2F8MA 5IQ6A 2BM1A 2VDIA 2OSRA 2D3O1 2R8GA 3GFXA 4U8YA 1RWXB 1B0PA 2XTJP 3GE9A 4TQRA 1RWKB 1QVGR 2XS7A 2QFJA 4NA1A 1MLAA 4YB6A 4I64A 5CYQB 5K8MA 3HJFA 1DTTA 1U24A 3E8OA 2EXUA 4OLOA 2J0WA 4EYIB 4LF5J 3SQGB 4WZQA 3NNHA 4RBUA 3I4PA 4B9UA 4JOUA 3KLEB 3PNIA 4ICLA 1I3OB 4ER8A 2YX1A 1NK9A 1DARA 2HHWA 3EVMA 4URQU 3UI3A 3EVWA 3C8YA 4QYZJ 2PFDA 5EUHA 2XZTB 2HMIB 2ZJQQ 3VCDA 2GO9A 2V2VA 1N32J 3R7BB 4FP9A 5IM0A 5JVGQ 1QSLA 3GB0A 1JIHA 3NGTA 5CZXA 3BGFA 4X4SA 3CCVS 3AXKA 3DOKA 1N5YA 4IRDA 3EGNA 5KT7A 4KGKA 2V68A 2ZH9A 2EK6A 2F5GA 1LWCA 2LEPA 1TK5A 2YBVA 1N54B 3BN4A 3HD2A 3RAQA 3GG1A 2DTJA 3M6WA 4ZITA 1S1TA 1IBKF 1J27A 1FESA 4G1IA 4JV0A 2AP6A 1RHRB 2OEKA 2IYGA 1DHMA 1M5KC 4UTGA 4JI5J 1F60B 1ZETA 2GVDB 5AE3A 2OTJS 2B4OA 4B9LA 1P1LA 5IXUA 4OYIA 1S4FA 2A3JA 2VJUA 2ERRA 2W24A 1UEKA 4NZ6A 3T41A 3QFHA 3GIMA 2XG8A 2H5JB 3R5DA 4DF4A 2CRLA 4DR3J 3G2XA 3WDOA 1NAQA 4ILRA 4M5LA 1IKVB 2DGTA 2OPQB 4OZLA 5CXTA 2GQ2A 3DLGB 5KFTA 2RKIA 2VV5A 3OL8A 3W5XA 1VDHA 1J5OB 2XGQA 2AYGA 4Y6IA 1C4CA 3UDCA 4A46A 1RTDA 1RLDA 1FFSB 2GAHC 3CDUA 5ETTA 4F2SA 3IG1B 4GKJF 4EWTA 4FXVA 4J90A 2BJ9A 3WC2A 1WUUA 2FHOB 3HLUA 1PAUB 2AJ0A 2Z2ZA 4YB7A 4B9VA 1ULRA 4OQJA 2DGUA 3K2YA 3IS9A 1EETB 5KFIA 2ZH1A 2V8VA 4M5DB 3DC2A 1UPMB 5D6GA 5DJBA 4PZVA 1MN7A 2W9BA 4B17A 2AX1A 2LQ8A 4IO9Q 2DKOB 3IP0A 2DH8A 1T94A 1VCTA 4P52A 4HTIA 2QL7B 1NSAA 4NI2B 2KRRA 1MWQA 1U0HA 1IBKJ 4OX8A 1X4AA 3HFVA 9RUBA 3IGVA 5J1EB 1SL0A 4G1QA 5GMDA 2XMVA 1HFEL 3HM9A 5LJ5Y 1HWKA 4ZK7M 2HQ3A 2WBMA 1RTHB 2CJQA 3NNAA 2C3UA 4USMA 3DMJB 1X0PA 1YJNS 2CPYA 3F0NA 2EFVA 3WBZA 1JQGA 1F5AA 4ECYA 1HBNB 1XR7A 1T9WA 1T0TV 4ECXA 2NCKL 2LQJA 3A4TA 2AT1B 3W2WA 1S99A 3CMQA 2DEJA 1YITS 2HHVA 2F4FA 4ZVQB 2J8SA 2VD3A 4X4OA 5K8OA 3RGIA 4WP8A 2DXDA 3PR4A 3RRHA 4NASA 3D6MB 2IPOB 4IG3B 1JKHA 4QBUA 4P7VA 2JOQA 1S0MA 4PYAA 2NSBA 4CH1A 1N4LA 2LA6A 4EO8A 4KE5A 2VG5B 4EUVA 5HQ8A 2VFRA 2VFSA 1N5QA 4MIWA 2GJFA 2GIQA 4CP5A 2NZCA 2YNGB 3E51A 2O5DA 3IAS9 4GKJJ 2ZNZA 1WTFA 1X4FA 2GIFA 3AHPA 2QGFB 3NY0A 3OR2A 1D9FA 4HH1A 4E98A 3OVSA 4USWA 1M5OC 1HQEA 1K0TA 2WTFA 3MMAB 4OYAA 5K14B 2AYMA 4OZ1A 2W7AA 5KG0A 4RBVA 3NBPA 3EZUA 1ZM4A 2XEXA 3TI0A 3FZBA 3MM8A 1VQLS 1U2FA 3GFHA 4B3OA 4CH7A 5KG5A 3MAAA 4CLZA 4CO0A 1U09A 3JTPA 3G6YA 3TVYA 4A8XA 2CJAA 3W3SA 2MKSA 1LW2B 2HURA 1S1VB 5F8JA 2M0GB 2K8GA 1VRUA 4I2PA 3OJSA 1P9QC 5HQMA 2R9LA 4WF9Q 4FYXB 4HVZA 1V3ZA 2W2MP 1S59A 2F9DA 1C0TA 1HWLA 1U02A 3H4BA 1RHMB 1TUWA 3CIMA 1U45A 4PPZA 2JFKA 2FQQB 2QEXS 4RJVA 1GX5A 4LBPA 4B9NA 3CT9A 2AJ2A 2FB0A 2R7WA 1NDCA 4Q5VA 4ES2A 4QYZK 2B6AA 3HFZB 1GTHA 4CTAA 4KAIA 2MLXA 2D69A 5GADU 4OLPA 3KK2B 2Z56B 2XSJB 3D54A 2YY3A 3M8RA 2MKJA 3A13A 3M32A 5A8KB 2BJ7A 1S0NA 4KR0B 1RU2A 2VFUA 2DIUA 2VIHA 5K20B 2BANA 2YKNA 2J7KA 2RUSA 3I4HX 5CYMA 2I2YA 4KHMA 2C28A 4BLGA 4KIAA 2DT9A 4WP9A 1RT1B 2KXNB 3KLFB 2JHEA 3OD2A 4X66F 1NU4A 4PXBA 4RUAA 3D1QA 4IFVB 4OIXA 1XMQF 4F0HA 3T6JA 3R5CA 2XM3A 2IA6A 5F0UA 1FKAF 2ZKUA 2LQ5A 1HHQA 2HVHA 4ELVA 4DBQA 4U9RA 1SL2A 2FD2A 2GMLA 1RHQB 1Y5NB 3H25A 4RW8A 3VGVA 2MSTA 4LRFA 3SCLE 2QTWA 2IJFA 4P71A 1REGX 4NWBA 5KOXA 2YWFA 2H1YA 3BB5A 3AODA 2C22A 3TZWA 4DR6F 3LANA 1YVFA 3GQCA 3CJ2A 1HNZF 1HQ2A 4O4GA 2JSXA 1U49A 2CJKA 3K7RA 2HNZA 2MZQA 4Y2CA 2EFGA 3TZYA 2RU3A 4X4VA 1LWFA 2B7BB 2DJWA 1CPZA 4P6QA 2NSCA 1U6FA 3H98A 4Z2XA 1RTJB 2IDEA 3T5LA 2IBKA 3SFGA 3OR1B 4CO4A 1HI0P 3HHKA 5IT4A 1WC6A 4J5OA 2V4JB 3GU0A 3K5PA 3TUIC 5KFCA 3HSJA 3TUPA 3Q0AA 5G4DA 4IH5A 2CVIA 4NRTA 3SCIE 1WG5A 1O5JA 2KKHA 4Y65A 1PCAA 5T7LB 3W9JA 3ITHA 3PXGa 2OIHA 1IKXB 4P10A 2C2NA 5D15A 3IBWA 1NBEB 2QT7A 4HKQA 4RW7A 3PIOQ 3TVZA 1HWIA 3GILA 2CQBA 5C24B 1LFWA 2CPIA 2NYIA 1OS5A 1RJJA 3JYTB 4LSNA 4X66J 4ETXA 1CEZA 3GSIA 4YR2A 4NLRA 1S97A 4B3RF 3B4MA 3M6UA 1TAUA 3D68A 3P4UB 1VK3A 1IUJA 3PACA 2ZD1B 4O3SA 5IV3A 3NL0A 5IT9Y 2FY8A 4ZVTB 2AD9A 4C98A 4H4MA 4CDIA 1UMJA 5I4MA 4LF2A 3CCJS 4ZPWR 1KTVA 1JJ2R 4IFYA 4DR6J 2CWXA 1HNZJ 2KYXA 1GX6A 1HBMB 3J80Y 1Q8IA 2RF2A 2M52A 4ZVHA 3PX0A 1R3NA 5FIIA 3VVUA 3NG8A 4PXEA 4N47A 4JI2J 1Q5VA 4IDKA 3MUVP 2QRRA 4RO0A 2XS5A 1FK9B 5KOWA 4O44A 4N41A 4J9MA 3DRXA 4H4KA 2V4QA 4OX6A 1F5BA 2XLJA 3SEOA 3LQVA 4EU0A 3V4IB 1TK0A 1MWYA 4UOFA 3NOCA 2HK3A 3KHGA 4U7UD 3G4SS 1NB7A 5ETVA 3EDQB 1YG0A 4FNHA 4BCAA 3ZNJ1 1VQNS 1X9WA 3BYPA 4NYZA 4PXCA 2QFIA 1RDRA 2QLJB 2PMZD 2GV1A 2OPSA 2Q1LA 4UUXA 4TLRA 5KFSA 5KFUA 2BW7A 2V8HA 1HNVB 3VAGA 5CA5A 2OGUA 4C8OA 1T02A 1RAFB 4XO0A 3ET6B 2J9DA 2BXJA 3IR6B 4B3RJ 1KP6A 2EFPA 5H9EJ 2FUG9 2LYVA 4FYWB 4KKOB 3ZO7A 3VHQA 3MR5A 3MCNA 5HN0A 1FJGF 1CBKA 4YEAA 3OHBA 4BBYA 4IG0B 2D9PA 3IRXB 3IR5B 2VKZG 1RAAB 3VQTA 4ZDNA 3Q8RB 2O67A 3SXLA 4NLUA 3FBEA 1CVJA 4RW6B 1EB0A 5J2MB 4DI6A 1YIJS 1X8DA 4KFBB 4AT1B 3Q83A 3QIDA 4TYBA 4NYPA 4K2JA 1RAGB 4PG6A 3Q8PB 4QIWD 5C25A 3R7SB 3V6JA 5D3GA 2I6WA 3VALA 5D0EA 2FHJD 4WFBQ 2PIIA 5E3QA 1L3UA 4ZP6A 3GJSB 2ZE2B 4AXIA 2KO1A 3SSSA 2G0JA 3MWBA 4A8OA 1KVJA 3GIJA 3L95X 2N7YA 1HKAA 5DDPC 5KFKA 2BE2B 2FJEB 4R0EA 1L3VA 2KXFA 4JI0J 1SJFA 1IXKA 1U25A 3NLCA 3BPSP 3UR0A 4CZCA 2YXLA 2UU9F 1JLAB 3SIPB 2RS2A 2GVZA 2E9TA 4P9SA 1WELA 2BUNA 4DPXA 5HSPA 3HULA 3CDWA 4WYWA 2F7VA 3N6NA 2F4VF 3I87A 3W9IA 2IBOA 4I2QA 2LU1A 3E2EA 1HBUA 3EE3A 1K47A 1DTTB 3TA1A 1H3DA 5EGYA 5DG9A 1BMQB 4OZ5A 3C14A 4DR1F 4CLSA 4ICLB 3RRGA 4ZP9A 5J1NA 1A0OB 4OJ3A 1FNXH 3BN7A 7FD1A 4ECWA 5GVQA 2XS2A 4ILMA 1VQYA 3QWUA 2PI5A 2DB1A 1HNIA 5IM0B 3N5BA 3QJPA 3NAIA 3MAQA 2AJFE 1YRUA 4KRWA 2IM0A 3DOKB 4QOTA 4TU7A 3QZ8A 1N5YB 2CQIA 3AQPA 2XQCA 4ELTA 4ZA1A 1VJWA 3CJQA 1LWCB 4NMXA 2B9YA 4ZVUB 5EDWA 2BQ3A 1A9NB 1YGYA 1RXOB 3QRQA 2N3LA 1FVQA 5L38A 1R8HA 1WNEA 3K17A 4MFBA 5L39A 3NS6A 4OI0A 2XZDB 2RD5C 5B0EA 2HS3A 1S1TB 2E9RX 4NLDA 5DETA 1DQ8A 1K0VA 3G8QA 2ADBA 4ED7A 2RH3A 2Y3YA 5KG2A 1SQEA 4YN3B 1YBTA 1WOSA 1YBUA 3OPKA 1NPRA 5C2GA 1VIOA 1SJ3P 2K2PA 3J7A1 4KPCA 4UOGA 2UU9J 3KMQA 2WOMA 4FN5A 3US5A 3W66A 2ROPA 3F73A 1EKRA 4E0DA 4HT7A 4HI2A 1HNWF 3B4DA 4DQSA 3GV5B 3UD3P 2CQ2A 3R3TA 2B51A 1NCLA 1XNQF 2F4VJ 4NXMF 5D4OA 2XCPA 4YS2A 3TUJC 3HP6A 3FUYA 3TWZA 1PC4A 2A2DA 2ZJPQ 3R2CJ 2RKIB 4A8YA 3D28A 4JI8F 4GMKA 1C2PA 1OSDA 1RAJA 3GCXP 1R31A 2VICA 2RRNA 4DR1J 4HHUA 1RTDB 1D8YA 4EZ9A 4OZ2A 1BD6A 4WFYA 4CIOA 1TMMA 3CJKA 2B7CB 2FYXA 2CPDA 3EDRB 3IBFB 1TKXA 5E33A 3A3PB 4ZLJA 3QZ7A 3TANA 1T3OA 3PW7A 1N5TA 2GQQA 2BBEA 2HBQB 3BPDA 3DDIA 2VQEF 3IS9B 1JXVA 1WKLA 3W5ZA 1K9MT 1TFYA 3NKYA 3CJ0A 5D8HB 2PA3A 5CCLA 5ETOA 4JB8B 1VOMA 2W9BB 1IBMF 3GJQB 2IA0A 1FFGB 2Z2YB 2W7OA 2CPJA 4ZCLA 2P8IA 1LEOA 3HX9A 4F8RA 1YZ6A 2QSWA 1EHWA 2E29A 2DNNA 1M5VC 1U0HB 3T3FA 3N9UC 3MD3A 3FJ2A 3BQ2A 4O4RA 3UDEA 1MG7A 1QLNA 4ZN3A 3S6EA 4G1QB 3B54A 1VS3A 3DLEB 1VI7A 1Q8KA 3TARA 3KWMA 3IWXA 3M30A 3ZNUA 3D9BA 3J81Y 2ZH6A 2V9WA 5H9EK 2XMTA 3P45B 4ED8A 1XMOF 3ILOA 2YKAA 3T9ZA 3G71S 3JTNA 1G4CA 4KO0A 4QW8A 4LBHA 2DR9A 3Q8UA 1IKYA 1HNWJ 1GXLA 4DS5A 2C3PA 1XNQJ 2VDHA 4NXMJ 1S9EA 1AW0A 3QBCA 2XMAA 1Q4RA 3KNAA 4JI8J 1A6LA 3G8TA 1KFDA 5MLCV 3DLLQ 1UVKA 1XN9A 3DU6A 1M5PC 4LR7A 2CJBA 2E7VA 1L3KA 1H72C 5T41A 3VF0B 1ZH5A 3SSQA 1S1XA 3DKDA 1IJFB 4QR0A 3KUHA 2DGSA 1C1CA 3OR2B 2MQQA 4ZVGA 1LV5A 2VQEJ 1HQEB 2OEJA 1KTQA 4NLWA 1VQ6S 2HFSA 3NBPB 2PE8A 1TK8A 1MW7A 3TAPA 3MM8B 1QAJA 5HJYA 4B3OB 1IBMJ 4YP3A 5B0DA 2GJIA 5KAKA 3MAAB 4LF4F 4LQ9A 1YRXA 2G2ZA 1NH7A 3GYGA 1RA6A 1VRUB 4I2PB 4WFZA 2LA4A 4KTQA 1C0TB 4ECZA 4ES3A 3BKUA 5KFDA 1MMDA 4USHA 1VQOS 2JEIA 3CE8A 3O44A 2B4PA 1XMOJ 3BO3A 2B6AB 1VIXA 4CTAB 1FCAA 4DV6F 5KFJA 3K58A 1U8WA 3UN5A 2DNKA 3MTJA 1RT3A 3TX8A 4QR2A 5KT2A 2OUGA 5EWGA 2ZZMA 3M32B 1N48A 3KLGA 2BANB 2YKNB 2Y0SD 5CYMB 1FFWB 3W65A 1GMUA 1RT4A 3MAHA 2DR7A 2ZNYA 3ZZPA 3UD4P 1FWKA 2OHDA 2R4FA 2EW9A 4ZCIA 1RKJA 5HO4A 2A0FB 1GQEA 1RCOB 4HACA 1Y5LB 4Y0FA 4EK2A 3Q8VA 1U26A 1P8GA 2HKEA 3JS9A 4UZBA 1Q81T 4RW8B 1V3RA 4DPTA 2FJXA 5CYJA 3LWMA 2FJBB 3OV7A 3FQKA 4NA3A 2CDQA 3HHLA 2KHDA 2C2EA 1NLKL 5J2NA 5IQQA 1RBOB 2M7SA 4IQXA 2OLWA 4FF3A 1JLCA 1MROA 3EJMA 4DL7A 4O4GB 4HDGA 4LF4J 3ILIA 2HNZB 2AYEA 3NXZA 4FBTA 3FBFA 1YX2A 2GX8A 4AQYF 4G3IA 1X5OA 2DHHA 2AGOA 1LWFB 4A8WA 1I94F 1TQLA 4DL6A 4RBTA 4LF9F 3UN2A 2Q66A 3R7NB 4WTYA 5B0FA 4K5SA 3KFWX 4WK1A 4RZRA 5GMEA 4HLBA 4DV6J 1KEKA 2QYCA 4PWDA 4C8NA 3ITHB 1S77D 1WWHA 3KK1A 3Q89A 4OHVA 1WJ9A 3CB4A 1SKRA 2SXLA 3FVYA 2R2RA 1KOOA 2CQPA 2DNRA 2IM1A 4K0KF 1AZSB 1Y10A 5M2RA 1AUSL 1KQSR 3V6KA 4F4YA 3LP2A 3IRWP 1ZS6A 2V2KA 3D3CJ 5HATA 4LSNB 3MPYA 2B3TB 2HHXA 1LFPA 4O23A 1URRA 5KFMA 1S76D 2V94A 1RT7A 3Q24A 3KJFB 1EP4A 3GV8B 4KYZA 2HHPA 1S4EA 1FXLA 1QAIA 5KFZA 1Z2ZA 1HIYA 2FZCB 3KLVA 4O0IA 3M8QB 4H4MB 2CZVC 4R0JA 4J9VA 1HWJA 4MK9A 1U2CA 2QA4G 4ES1A 3PYFA 1T11A 2KB2A 2IYIA 4K4TA 2BKPA 3PRVA 4IFYB 2FVPA 3MR3A 1UETA 4YQWA 2CADA 3K57A 1V6HA 2GZOA 4DSLA 5F8MA 2BZ2A 4WYLA 1VFJA 3B8HA 1BE4A 2RF2B 2WVEA 3CJ5A 1S5ZA 3WC0A 1JJ4A 4AQYJ 4GVLA 2XLIA 1I94J 1YRTA 5DZ6A 1UTAA 4LF9J 4IDKB 4NOHA 2RQKA 3KTQA 1WHWA 2JDJA 1M1KT 3RB0A 4DUTA 1QSSA 2R7SA 1LXNA 5HQLA 4O44B 1QUVA 1F9EB 4OI6A 2RUGA 4DUZF 2RVJA 2EC0A 3BZQA 2HIYA 4IR1A 2YWHA 2VG6A 3J7AN 3W5YA 3O8WA 3KG0A 4I67A 2WSEC 3LA0A 2HFOA 2V34A 5DG7A 1M90T 2Q3PA 2KVQE 1M5HA 4MKYA 1ZAVA 2A18A 4K0KJ 3F56A 2OPSB 2FZKB 3H8YA 2AZ3A 2MQMA 1X4HA 1NZAA 2XO6A 3TQEA 1UKUA 4BC9A 4DR4F 2VOPA 1I51B 1K44A 1X4DA 2B56A 4USUA 4ECQA 2CVEA 4K4XA 1QE1A 1JK9B 4ZPVR 3LH2S 1IWAA 4J7CA 1T9TA 3BO4A 3KK3A 2AU0A 4QIGA 1RAHB 2GW8A 2HAIA 4A4JA 4LFBF 1R8BA 4ANCA 3HPOA 2IVFB 1AFIA 2NS1B 5J2QA 1DFDA 5C25B 5D3GB 2EKNA 1WC4A 2BJEA 3OTCA 1IBCB 3N79A 3ZTPA 2ZDOA 3PTWA 3MM6A 5E41A 2KN4A 5JUMA 3J7YI 2H48B 1RA7A 1XR6A 2ACYA 4ZP8A 3CCWA 1Y9OA 2MB0B 3UFCX 2DHAA 1C4AA 3BO2A 4ZVPB 4WXOA 2XMUA 4C3LA 2QV6A 5HBMA 4F50A 1KOHA 1ZM3A 4I2QB 1RZMA 1CQMA 1I6JA 5DQGA 3CXCR 1HBUB 2YWGA 2MKKA 3TR5A 1HA1A 4DU7A 2DYAA 2EBEA 2O1PA 4B02A 1TU0B 4QWAA 1SB6A 2W2OP 5HVGA 1XTZA 3C14B 2LDYA 2BMBA 1VBYA 2MLYA 4F4AA 5T14A 2FLOA 3VGUA 1TUVA 2OH2A 4ELUA 3G6XA 4UUWA 1Q79A 2ZKTA 4U67Q 3P96A 2QLWA 4DR4J 4ZVSB 2ZJRQ 2BE7D 3AQOA 4LBIA 1NM2A 1BQXA 1U8SA 3MEKA 1IR2A 3ETOA 1JLFA 3JSRA 1VLYA 1K73T 4DQIA 3ICLA 3MM9A 4K4ZA 1HYSA 1HNIB 3M2RA 4N8NA 5I42A 3UDLA 3EYZA 4USJC 4P72A 1YJWS 4X4RA 1Y11A 4ATNA 2N3OA 2NUUG 2HNYA 2MQNA 2V8PA 1H98A 5D4LA 5AXNA 3JQKA 3VZHA 1RK8A 3U02A 3ZFVA 1UJ5A 2VG5A 3BR9A 2LQ9A 3I6PA 5DS7A 1R0BG 1J2VA 1SIWB 4A8KA 2WONA 4CLLA 2X51A 4LF8F 4J9PA 5A8RA 3ELHA 3QLHA 5K8NA 2YH1A 6AT1B 1TELA 1UFKA 2P2CB 1CJUA 1JWWA 1FD8A 2YPYA 3SZ2A 5KFHA 3O1LA 3LAMA 3MMCA 1P6TA 3V6DA 4M5GA 2WOMB 2YKQA 3OLAA 2JC0A 3EX7B 4OI4A 3RR8A 2ZEJA 3M8WA 4I56A 3BGRA 4FBUA 1HQUA 3PKMA 1RSCA 4C97A 1WSRA 2E5JA 1VHIA 3GTYX 2A6OA 9ATCB 5K5MA 3P6YC 2AJQA 2K7JA 2ACMA 5HAOA 3I9ZA 1VHFA 4OJHA 1OQ3A 3M6VA 2UVUA 4G1PA 1WF0A 1CQNA 4AE5A 4NLVA 4ED5A 2CQHA 4QPTA 5H9FJ 3PDNA 3VAKA 3NEKA 5ETQA 3CJKB 1F0XA 3VGTA 1TKXB 3DLHA 4QZVB 2AKWB 3CW2C 2ZDPA 5B7WA 2ZHAA 5ITHA 3NOGA 2GMHA 1C0UA 2LVWA 2O01C 2J9CA 4OJ1A 2IJRA 3CCLS 4Q0BA 3RW7A 4A8SA 1GH8A 2KG1A 1WACA 3CD5A 4DPWA 4FXDA 2DNYA 2E1RA 3HKZD 2G9OA 2RQCA 4LRDA 1ZA1B 4U8VA 4OZJA 2XCAA 4OYZA 1ZYQA 2VUGA 2WVFA 1N5VA 2XYGB 2XHWA 2DIVA 3I32A 2MTLA 4C9DA 1S49A 4RNHA 3KOAA 2DHSA 4F04B 4RW4A 4A47A 2F8EX 3S7RA 2IFXA 5GAGU 2D3UA 3SV4A 2BEFA 4V19X 2AMCB 4K59A 4FNIA 4L3NA 1JX4A 2I8EA 4LF8J 2RRAA 1VQMS 4ALZA 3MPDA 3M30B 3R5BA 4HEA9 3DOMA 3N0VA 2LU2A 4CWBA 5M2UA 4DXLA 1Y7PA 1B64A 1RWOB 2Q6BA 4KO0B 1E6YA 2MXYA 1N33F 5F8IA 3U1MA 2CPZA 3A8JA 4F0KA 4DDFA 4ZN1A 2RSQA 1S9EB 4YY3F 4MAKA 2HG4A 2VL1A 4JI7F 4WK3A 5ETKA 2Z0GA 3ENQA 3KXDA 1C1BA 2UV8A 4HL9A 2ZHBA 5CD4A 2OFHX 1BHNA 3FRYA 4N77A 3O2IA 1ZM9A 2ZOMA 3P8BB 1GK8A 4X4NA 3KHHA 4NLQA 4IOCQ 1Q82T 3C2PA 3EM1A 3UCGA 1H0HB 4XAKA 3QFWA 4RKUC 1XNRF 4XPCA 1WOOA 3JQMA 1ZZNA 1AXQA 1S1XB 4K4WA 3N6MA 4UF4A 5ETSA 3DYAA 3UDVA 2RB7A 4DSKA 3T1YF 1WTBA 4EYHB 2DGXA 2Z58B 1C1CB 2PO4A 3M9NB 3PW4A 3HXMA 4ZLPA 3CGIA 1K8AT 3EICA 3RAXA 1NJYA 2KFNA 4A8FA 2FHKA 2G2YA 3CSKA 2DO0A 5IOLA 2BV3A 1D09B 2K3IA 2Y0BB 2NPFA 3THVA 3W62A 1Q95G 2YQ0A 4YR0A 4J91A 5LMNF 4OYXA 2MQPA 1DTQB 1LOUA 3KJVA 1L3SA 2DVIA 4AL5A 1W26A 4QR1A 3IR7B 5DLFA 5DGAA 5A6PA 1BY9A 3H20A 3IA0A 4CM2A 2CJ9A 1FT8A 2DRDA 2R7OA 5DO2A 1SC6A 3BSOA 4GC6A 3IAM9 3DRRA 1RT3B 2DEIA 3I5BA 1T7PA 1FKOA 5KG7A 5ETRA 5LMUF 4M94A 4RNOA 3KLGB 1OY9A 1VQKS 1SKUB 3FGVA 2FJDB 3HMJG 1NSPA 4YY3J 1NZ8A 2NXNA 1FWLA 2LEBA 1M0SA 1RT4B 1F9FA 4JI7J 4AFFA 1EARA 3PHTA 5K9FA 5J2PA 2BX6A 1S0VA 5E5NA 3DLJA 1H2TZ 1SC3B 1DLOA 1WSVA 2JLEA 3C6TA 4HACB 2KDOA 4C0OC 4M5IA 1XNRJ 3EGVA 2VJVA 4U7UK 2HVDA 1AT1B 2UUCF 2HIQA 3UR3C 2WVDA 1T05A 3T1YJ 2E5HA 2H4YB 2FHMA 4CO1A 1X60A 2QIFA 1FX4A 3HHNB 4J9RA 3R97A 1U2RA 5J2NB 4I7FA 2VFVA 2UUTA 4OHZA 2V9KA 1JLCB 1MROB 3IMQJ 1Q53A 3ET6A 2XY5A 5LMNJ 3PW5A 2KG0A 2EFQA 4AYBD 2RMLA 2Q6CA 2XNRA 4CLTA 3K5OA 5H1SV 3R5GA 2WRMA 1PAEX 2J6SA 5H9FK 2DISA 4LIRA 1PJ6A 2HW3A 4ZJOA 5GMKa 1OPIA 5F8NA 3MDFA 1SQFA 1XQIA 2OPRA 4DL4A 3MGJA 4WFNQ 1UVLA 2ASDA 2XMJA 3AB2B 5F8GA 3TAMA 5IZHA 3LALA 3QPIA 1RAOA 2R2UA 4DZDA 2OKQA 4NLTA 4KGMA 4USKA 3KK1B 2DCLA 5LMUJ 3PX4A 3HVAA 3BJYA 2HPUA 4DL2A 3IN5A 1N56A 3DM2B 3H5UA 3EZ5A 4M1KA 3MTKA 4RW9A 4WE1A 1FRHA 3LP2B 1YJ7A 3D0HE 2HWHA 3RB4A 3MMJA 4B9SA 2UXCF 2KJWA 5KFAA 4ZOSA 2FVSA 4M63A 1JLAA 3GP9A 3OTBA 1RT7B 2P9EA 4Y34A 2GCFA 1EP4B 3B78A 1YHQS 3R5JB 1S12A 2C2ZB 2PA8D 1VQ4S 4BC7A 3L4BC 4HHHA 1SJRA 1VC6A 4AXJA 2UUCJ 5MAOA 1OMSA 4J9NA 1IVZA 4IKAA 2QLXA 4YHHF 3LO3A 1SQGA 2MY7A 2W4DA 1CULA 3H4DA 3PFOA 2DGWA 3CCUS 2HGLA 4DFJA 1Q7YT 3A1YG 2AJ1A 5EWFA 3BSCA 4LF1A 4MKBA 2JL9A 7FDRA 3PYDA 4L73A 2J7UA 5IS2A 1KLMA 1UL3A 2MZJA 3O6QA 3DLBA 3NMRA 2DH7A 4ZPAA 3PR5B 2CG8A 1YSJA 1X5TA 1TTHB 1NNDA 5ETMA 1QJHA 3BF4A 5HK4A 2QLFB 3UVJA 1PJ5A 1J5EF 1UEVA 2CQ0A 2IVMA 3UCZP 4KV8A 4XIUA 5L1KA 1FDDA 2KT5A 3ZZOA 1VBZA 1X5SA 2VG6B 2ASYA 4LF6F 4TNOA 1RISA 1R27B 4RL1A 3EGZA 2R7VA 2BRKA 1F6TA 5F9NA 2J76E 4PQUA 4ZP7A 2MDAA 2HK2A 3MR7A 4QWBA 3I5CA 2KYZA 3A8EA 3KLHA 4OV6A 2M5YA 3L3CA 1T8EA 4ED0A 4USIA 2R7XA 1D8ZA 4ZVFA 1CSJA 3RRKA 4F3OA 2UXCJ 1S6PA 3BDPA 1B0TA 4DPOA 1ZAWA 3PM9A 4IOBA 2OPPA 2MQOA 3G8SA 1ZBTA 5A6WA 2PMHA 5E3RA 3MPUB 1QE1B 1RYSA 4IUFA 4ID5A 2ZVSA 3UE2A 2FJAB 4WCEQ 3QATA 3LF0A 2G13A 3KK3B 2XY7A 3QAUA 2M2BA 1HD1A 4YHHJ 4J9LA 5D0HA 4Y2MA 4DR7F 2MKHA 5LXRA 2E66A 1LWXA 1TKTA 1NO8A 1CJKA 4OHWA 2VF3A 2M9KA 1MMNA 4DFKA 2EBGA 1U1RA 4NLGA 2PFFB 3W8PA 2HVZA 4KGXB 1U1LA 5J2QB 1BQMA 3SDEA 4D3GA 4LVOP 5F9LA 4Q43A 3G82B 3MM6B 1V5IB 2EFOA 1KWMA 3C66A 1EQMA 2P5VA 5KFFA 4X64F 2NYHA 1N0VC 1GXTA 3TZZA 3WX8A 4NLXA 4DV3F 2UVVA 3AOBA 1J5EJ 4USTA 1B0VA 4QYRA 1Y5IB 4B08A 3CMES 3PYGA 5HBMB 3CCZA 1AYEA 1RP5A 3LW5C 3DRYA 1S9FA 2BQUA 4LF6J 2IVYA 4WU2A 5KG3A 3HJVA 2Z30B 3QYYA 2ALYB 2HQFA 3D1HA 3D67A 2VASA 1QM9A 4X62F 3PHEA 1SC1B 4M5JA 4W90B 4H4OB 3HI9A 2XMWA 4EFAC 2KJVA 1P27B 5CHCB 3DLEA 1PBAA 1FRIA 1VGYA 1WI8A 3RB3A 2KU7A 4L74A 4DU8A 1S48A 4PWWA 1SJQA 4D3HA 2Y1RI 1NK0A 2CQGA 5L1LA 4CNYA 4A8MP 3CF5Q 3T5KA 4ETZA 2WZ1A 1JLFB 4UOCA 1KQFB 3RG6A 3CDEA 2JVRA 3FSXA 1FJEB 3WQPA 4XDCA 2QE5A 3MM9B 5B0AA 1CC8A 4ZIVA 1HYSB 3M2RB 2MSSA 5I42B 4DX7A 3BQ0A 4BWMA 3AT1B 2HFNA 5LXYA 2HNYB 1WC1A 2MHNA 4DR7J 2RIJA 2XY6A 1VRQC 3RJMB 4X2BA 2FGCA 2C1EB 1V9OA 1YKWA 2FDNA 2YKOA 4K4UA 3IFEA 1E6VB 2I0XA 4HI1A 2FHJA 4ENOA 4KH1B 2WONB 2C2RA 3QRRA 5A8RB 3QLHB 2ZH4A 1S10A 3R1LA 1B4SA 1NJXA 1SH2A 2CQDA 4JV5F 2N7CA 1CJUB 3FDSA 2GNKA 3KNGA 1IKWB 2COLA 1DY3A 2RHQB 4DV3J 3MMCB 3NGUA 3V6DB 2VONA 3MPWA 2NXUA 3SCJE 3PIPQ 4KGVB 3QO9A 2HEKA 2OO4A 2Y8WA 4OMFG 2JNJA 4I68A 3DI6A 2KM8B 2QO3A 3BGRB 1NB2A 1HQUB 1NMEB 4DF8A 6FDRA 2I38A 2J5AA 1NHUA 4NCGA 3EVOA 5IFMA 1G3OA 4PG8A 1ZAXA 1Q5YA 4OYOA 3D6HB 4MIBA 4ED1A 2YNIB 2EI5A 1I1GA 4K7QA 1HMVA 4OZ3A 5DG8A 1UZDA 5KFBA 4X62J 1FVSA 4GO7X 4KPYA 2HZVA 3VWSA 2WW4A 2MKIA 1JLQA 3MXHP 1ZPWX 2L9DA 3DXSX 2DHXA 4NZ7A 3W63A 4M8LA 2JZ5A 4RX6A 4Z7CA 1A7GE 1ACMB 2U2FA 4CCHA 1JJCB 2QA1A 1TL7A 3FCHA 3LP0A 1N6QB 1JNZB 1DBDA 3BS9A 3OSNA 3D1OA 1JXLA 4AUKA 1C0UB 2UVRA 1R89A 4Q8EA 1FJCA 4M5NA 4OYWA 4Q0BB 3AXMA 2AHOB 4ZPBA 2XMMA 1NH8A 3CC4S 1REVA 2A1BA 4GKKF 5BYQA 2NQPA 4HHJA 3TJAA 1RWWB 2IJNA 4GC7A 2Q43A 2AYBA 1X7VA 2HNDA 2UUAF 4LFAF 4MYTA 2RQMA 4RW4B 2CA9A 4DV4F 1X4CA 2BR0A 1SKSA 4JI3F 4TY8B 1WG4A 2HHHF 4WPAA 5DQHA 2NR0A 1CLFA 2I5JA 1X5PA 2UXDF 4JV5J 2RE1A 5ADZA 5A76A 1Q16B 3DOMB 4F4KA 1R8CA 4DL3A 2HLTA 1MMLA 3K0JA 2R8IA 3M2VA 4O3PA 2PDAA 5FLXY 1WDDA 1YI2S 1S1UA 1E6YB 4ECVA 3KDOA 2RAQA 3OUYA 4OV1A 3O5TB 3W64A 2VQFF 1IM6A 4W92B 4C8YA 3H40A 3CNQP 5BYRA 5GADI 5A0YA 3RTVA 4PCQA 2JX2A 2OJ3A 1C1BB 3CCES 2KFZA 4O3RA 1N36F 1U1QA 3CDBA 3GIKA 3ZXWA 4DG1A 2ZITA 2JFDA 2UUWA 3N01A 3ZZ0A 2GFFA 1PBUA 1RGVA 5LSRA 4LRCA 3IM9A 2R7TA 5HVFA 3MM7A 3DDKA 2Y1LB 2QL9B 1FTRA 3FMWA 5FDLA 1HHTP 3DYAB 3PW0A 4ZPTR 5HMWA 2XO7A 3KYLA 2G4BA 2DCUB 4C7QA 4DSFA 3HCXA 4ITSA 1SH0A 3H2LA 4ZVOB 3BGOP 4LF7F 3AOCA 3TOQA 3N5FA 1FDBA 2BKOA 1AZSA 4QQBA 5F8LA 4GKKJ 1CC7A 2MYFA 2POKA 4DJBA 1R7IA 2UUAJ 4LFCF 2V69A 1XMQJ 1FDAA 3HZEA 3KJVB 3PEHA 4K4SA 4DV4J 2DGOA 2CFXA 2B4UA 2E5GA 3SMZA 2HZCA 4JI3J 2DITA 1JXEA 5B0BA 2CWKA 2HHHJ 2XMKA 1SL1A 4LRBA 3KUGA 2X3DA 3M8QA 4TN2A 2UXDJ 3ZZUA 3LGNA 1JB0C 5EHHA 3JXOA 5BXIA 3KKFA 1H73A 3NGDA 4OFZA 3DRRB 2EC2A 2L08A 2RNEA 2QMUB
chains in the Genus database with same CATH topology
3H8YA 1ULRA 4ZHRA 1FKOB 2UV8G 2W8KA 2MQMA 3T9NA 4BDPA 2DHGA 2ZBCA 3W2WB 4C2MA 4OQJA 2DGUA 1TAQA 3K2YA 3IS9A 4C3MA 4NYOA 1X4HA 1NZAA 1EETB 5KFIA 2ZH1A 3G86A 3KLIA 2V8VA 4RNNA 4KHPF 5GAGI 5KFNA 4M5DB 3DC2A 2BVZA 1UKUA 4BC9A 4DR4F 1R8PA 4DSJA 1Q1KA 2VOPA 5D6GA 1X4DA 1W2BR 2Z2LA 5DJBA 2B56A 4ECQA 2CVEA 2ILZA 4K4XA 1BLUA 3MECB 3MUMP 2W9BA 2HHQA 4B17A 1QE1A 5KFWA 1JK9B 1JKHB 4ZPVR 2XWXA 2AV5A 2AX1A 4G6VB 5J2PB 4IO9Q 2DH8A 3LH2S 4ZCKA 1T94A 4LJMA 4OJGA 2MZRA 2M88A 3QAEA 3BO4A 4X4QA 1DLOB 2KFYA 3H2UB 3KK3A 3CCSS 4HTIA 2AU0A 1Q86T 3GSDA 5CH7B 4QIGA 3C6TB 2GW8A 4LUBA 3GR1A 2HAIA 4A4JA 2KRRA 4O3QA 2JC1A 3SFUA 4OX8A 4LFBF 4HDHA 2B4VA 1X4AA 4WZMA 1R8BA 3IGVA 3S01A 5J1EB 3HPOA 2BW2A 2XC9A 2IVFB 4G1QA 1SL0A 1AFIA 3I0SB 3THTA 2XMVA 2NS1B 1HFEL 2XSFA 3HM9A 1T05B 5JVHQ 3FZ2A 2AQ4A 5LJ5Y 1HWKA 5J2QA 4ZK7M 1DFDA 2HQ3A 1NK5A 2WBMA 4LVNP 1RTHB 5C25B 3F41A 2YX4A 4FZVA 2R7UA 1UEUA 5D3GB 3CEDA 4UQTA 4FF4A 2EFNA 2CJQA 3I96A 2C3UA 1YJRA 1Y00A 3NNAA 2BJEA 3OTCA 3DMJB 4QCLA 1X0PA 1YJNS 1O51A 5SUHA 2CPYA 3N79A 2LXFA 1H2UX 2EFVA 3WBZA 4DHVA 4KBIA 5B0CA 1F5AA 2ZDOA 4I7FB 1Z4UA 4ECYA 1HBNB 1XR7A 2X1BA 3MM6A 2YWKA 4NRUA 4X4TA 1BQNA 5E41A 3HF5A 2CYYA 4ID8A 4ECXA 3FSYA 5BYSA 2LQJA 3OFEA 1NK4A 4B3TF 5F3TA 2KN4A 3DGPA 2LECA 5JUMA 3W2WA 1S99A 3J7YI 1K1SA 3F44A 1YITS 4QIEA 2HHVA 2FPHX 4YDDB 1RA7A 1FKPA 3CC7S 2VD3A 1MNEA 1XR6A 2HGNA 4CO3A 4X4OA 2ACYA 2PN6A 4ECRA 5K8OA 4UQGA 2OD6A 2DNGA 4ZP8A 3H5YA 3CCWA 5GAHU 2HRYA 1VQ7S 1Y9OA 1K1QA 3I9V9 2JLGA 4RNMA 2MB0B 4B9TA 4MJKA 3PR4A 3UFCX 3MCSA 2H9ZA 2DHAA 3Q23A 1C4AA 3BO2A 3RRHA 3CCRS 1WHVA 1WEZA 4WXOA 2YNHA 3POTB 2XMUA 3TA0A 2I9SA 3DHXA 4IG3B 2ROEA 1JKHA 2VA2A 4C3LA 4QBUA 4MYUA 4P7VA 2QV6A 5HBMA 2FJWA 4F50A 1JLGA 5AE2A 2JOQA 4FF2A 1AFJA 1KOHA 1S0MA 1JLBA 2NSBA 4CH1A 1O0PA 2IAJB 1N4LA 1GAOA 1SBRA 1Q7LB 1ZM3A 2LA6A 3LP1A 4Q2LA 4EO8A 4I2QB 4KE5A 3TNVA 2DNMA 1CQMA 1MU2B 5KFPA 4Y3CA 4DR2F 1SKWA 2VG5B 5DQGA 1I6JA 3CXCR 4L72B 4R5PA 3I0RA 4I6AA 3FRZA 4EUVA 3Q2TC 5HQ8A 1HBUB 2VFRA 2VFSA 2YWGA 2XWYA 1N5QA 1Y0HA 4I0WA 4MIWA 3TR5A 2MKKA 4B3SF 2OPRB 2GIQA 1HA1A 2YNGB 3E51A 3TW0A 2O5DA 2EBEA 2O1PA 3IAS9 4MKAA 2ZNZA 3GYXB 5LL6d 4B02A 4DN0A 3D2WA 3D5MA 3TAMB 1WTFA 4QWAA 1SB6A 2ROGA 5A8WA 1X4FA 2K3KA 1PO6A 1XTZA 3AHPA 2LDYA 3X1LB 1VBYA 1RT6B 4LSLA 3FEZA 3OXFA 4DL0C 4YUDA 2XZWA 5T14A 2FLOA 4DSIA 3OR2A 1TUVA 1D9FA 4HH1A 4QIVA 4E98A 2OH2A 4K5RA 3OLBA 1LK5A 3OVSA 1M5OC 3MM5A 4ELUA 1HQEA 1K0TA 1TL5A 2WTFA 4UUWA 3V2UC 1Q79A 2ZKTA 3MMAB 5K14B 3G6XA 2AYMA 4OZ1A 3WX4A 4U67Q 2W7AA 1RT5A 5E3AA 3P96A 2WB4A 2CPXA 2QLWA 2J0XA 3MF5A 5KG0A 1R43A 1LWEA 1DAXA 2ZJRQ 1D9DA 3AQOA 2G0CA 4RBVA 2VKRA 3EZUA 3NBPA 1BQXA 1U8SA 4DFPA 1ZM4A 2XEXA 3MEKA 1TKZB 4RUCA 3TI0A 1VRTB 1HBOA 1WEXA 3ETOA 3FZBA 1JLFA 1SH3A 3MM8A 4RW9B 4WE1B 1VQLS 3TO8A 1DURA 1U2FA 2WW8A 2XULA 3GFHA 4B3OA 3H5XA 3JSRA 2ZH2A 4CH7A 1VLYA 1KC8T 5KG5A 3VZIA 2D9OA 1K73T 2FLPA 3MMBA 5KT6A 1TL1A 3FMBA 5KFGA 3ICLA 3MM9A 1DRZA 4CO0A 4DQIA 1U09A 3JTPA 4K4ZA 3G6YA 1HYSA 1HNIB 3M2RA 3TVYA 4N8NA 4A8XA 3FEXB 4FF1A 1DZ5A 2CJAA 2AW0A 5AE1A 5I42A 3UDLA 3OVAA 4USJC 3EYZA 3W3SA 1YJWS 2MKSA 4ED3A 4X4RA 1LW2B 1S1VB 1TP7A 3DHWC 1UP1A 5F8JA 4ATNA 2M0GB 1TZ0A 4DV1F 2K8GA 2N3OA 5KT5A 2NUUG 2HNYA 2BRLA 2MQNA 1VRUA 4I2PA 3RBDA 5AXLA 1H98A 1P9QC 1TL3B 3OJSA 2R9LA 5D4LA 5AXNA 2W7PA 4WF9Q 4HVZA 5HMYA 1V3ZA 3VZHA 2F9DA 4RUHA 1C0TA 2ZC3A 3MURP 1HWLA 1RK8A 5C5JA 3C6UA 1Z1ZA 4YDXA 3H4BA 2GC8A 3U02A 3ZFVA 1UJ5A 1HR0F 2VG5A 2IRYA 1UFLA 3CIMA 1U45A 3BR9A 3N4WA 4PPZA 2OMOA 2LQ9A 2JFKA 3I6PA 2QSFA 4YFUA 5DS7A 2QEXS 2CZ4A 1GX5A 3HVWA 4B9NA 3CT9A 1J2VA 2FB0A 1SIWB 5G0RB 2R7WA 4FS1A 4EBEA 1WG1A 3LAKA 4A8KA 4Q5VA 2WONA 4ES2A 2L9NA 2B6AA 1GTHA 2QA2A 4LT6A 4CTAA 2PC6A 4KAIA 5GADU 2X51A 4OLPA 2QZ8A 4ZVEA 2ASJA 2E9ZA 3K5NA 3KK2B 4LF8F 2V0NA 4J9PA 3KG1A 5A8RA 3DOLB 2VG7B 2XSJB 3QLHA 3D54A 5K8NA 2YH1A 4QU6A 2PI4A 3VAHA 4YOEA 2YY3A 2ZH3A 3M8RA 1ZM2A 2MKJA 2ZOGA 3UNGC 3MEGA 3M32A 3OQ2A 5A8KB 4PKDB 3M1VA 4R8UA 1S0NA 1KLMB 4KR0B 2VFUA 1JWWA 2DIUA 1JLEA 2L3MA 1FD8A 4F4WA 3SZ2A 2BANA 5KFHA 2YKNA 1RTIA 3O1LA 2J7KA 5BR8F 2MGZB 3LAMA 3I4HX 3MMCA 1P6TA 3V6DA 3RR7A 4DV2F 3OFGA 2WOMB 5CYMA 2I2YA 3PV8A 4KHMA 4X4PA 2C28A 2YKQA 3OLAA 2JC0A 3JSBA 3V81A 1S6QB 4BWJA 3EX7B 4KIAA 5LJ3Y 2DT9A 3HFKA 1FD2A 5F3ZA 4OI4A 3RR8A 1R8AA 4IH7A 1PC5A 1RT1B 3H59A 4I56A 3L7PA 3BGRA 2JHEA 2KXNB 3KLFB 4FBUA 3M2UA 3MI7X 3GIIA 2YH0A 4X66F 1HQUA 1YQHA 1NU4A 2HWIA 3PKMA 1LW0B 4C97A 4O3OA 2YNFA 1RWUA 3M6XA 2E5JA 2A10A 2D3OR 4DR3F 3ISZA 4PXBA 1Q78A 4UW2A 4RUAA 3MFHA 3D1QA 4IFVB 4IH6A 4OIXA 2N4CA 1ZTTA 1XMQF 5DGBA 5K5MA 3P6YC 3T6JA 1HL6A 4J9OA 3R5CA 2AJQA 2K7JA 2M8DB 2IA6A 5F0UA 1FKAF 3I9ZA 1VHFA 4OJHA 2ZKUA 3M4XA 2AX0A 2LQ5A 1S1WA 2HVHA 4KV8B 4ELVA 5KFQA 3JSYA 1OQ3A 2NUHA 3ONQA 4IYQA 4DBQA 3MR2A 3M6VA 2UVUA 4G1PA 1WF0A 3ZZTA 5L1IA 3PW2A 4U9RA 1CQNA 1SL2A 4ECUA 3K8WA 4WJBA 2FD2A 2GMLA 2M8HA 1Y5NB 4AE5A 5DDOC 4NLVA 2XB2D 4ED5A 3H25A 2CQHA 4QPTA 4RW8A 3MEEA 2BACA 2MSTA 2W9CB 3SCLE 2CPEA 2IJFA 4QWCA 5H9FJ 3PDNA 3VAKA 4PQUB 1Y4ZB 3GMGA 4NWBA 5KOXA 1RT2A 3CJKB 1D1UA 2YWFA 1F0XA 3BB5A 1H7XA 2BQRA 3KLHB 1TKXB 3DLHA 4DR5F 4N76A 4QZVB 1FRLA 3UPFA 2C22A 4RW7B 2CIMA 3CULA 2X1GA 4DV5F 2ZDPA 1FXDA 4DR6F 3LANA 5B7WA 2ZHAA 1YVFA 3GQCA 3CJ2A 5ITHA 4DV0F 1HNZF 2CKWA 2GMHA 2BJDA 4LIWA 3DLKB 1VQSA 2VPYB 4O4GA 2ZH8A 1C0UA 2IHR1 2JSXA 2LVWA 2O01C 1X4EA 1U49A 2HHSA 2J9CA 2CJKA 2IM2A 5CZVA 1S6PB 3HT3A 3K7RA 2F1FA 3HHEA 4OJ1A 4IRCA 4C11A 3OVBA 3CCLS 2HNZA 3GV7B 2J6UA 2MZQA 4Y2CA 2EFGA 5L1JA 4Q0BA 4IQMA 2CQCA 2OPPB 3RW7A 4A8SA 1FTCA 5C42A 1WHYA 3GYNA 2YQ3A 2RU3A 1UA1A 4X4VA 1LWFA 1GH8A 2L48A 2B7BB 5F0WA 2KG1A 1WACA 3CD5A 3T1AA 2DJWA 3BDEA 1TVRB 4QWEA 1CPZA 4FXDA 2DNYA 3UQSA 1PILA 4P6QA 2NSCA 2E1RA 4AL7A 4I69A 1U6FA 3H98A 3HKZD 2G9OA 4JUZA 4Z2XA 3KMSA 3VAJA 2RQCA 4DQPA 4ID5B 1RTJB 1QY7A 2AF6A 3T5LA 2IBKA 4WU3A 4OL8A 3QMQA 3SFGA 3HHLC 2WHOA 3OR1B 4OZJA 2XCAA 1ZYQA 1FO1A 2VUGA 1SUQA 4JI6F 1N5VA 1FXRA 2XHWA 2DIVA 3FFIB 3PZPA 3I32A 4CO4A 2MHEA 4C9DA 5CYQA 1S49A 1HI0P 3HHKA 5IT4A 4RNHA 1R0AB 3KOAA 2DHSA 3KG4A 1SV5A 4RW4A 4FYDA 4J5OA 2RU9A 2F8EX 2V4JB 4A47A 3K5PA 3S7RA 2IFXA 5GAGU 3TUIC 1FERA 5KFCA 2D3UA 3SV4A 1N34F 1TKTB 5KT3A 2MQLA 3Q0AA 5G4DA 4IH5A 1V3SA 2VBXA 1NJZA 2CVIA 4NRTA 3MOZA 4V19X 4CI0B 3SCIE 3SQGA 1WG5A 4K59A 4FNIA 3ENVA 4XK8C 4L3NA 2HHTA 1JX4A 1O5JA 2KKHA 2I8EA 4Y65A 2RRAA 4LQ3A 1VQMS 5T7LB 1U4BA 1N8RT 1F5CA 1BQMB 3ITHA 4ALZA 3KLEA 2P6SA 3M9MB 3PXGa 3SDEB 3M30B 3R5BA 4HEA9 3DOMA 3N0VA 2OIHA 5HP1B 2LU2A 1IKXB 2R8JA 3OTEA 3RU0A 1HPZB 5M2UA 1Y7PA 5EX0A 4U7CA 1B64A 3IBWA 2QT7A 4DMZA 2Q6BA 4HKQA 4KC5A 5DLGA 4KO0B 4RW7A 3PIOQ 1E6YA 3TVZA 1HWIA 1UJ6A 3GILA 3EXCX 2CQBA 4MH8A 2MXYA 2R8KA 5D77A 1N33F 5C24B 5F8IA 3PRBA 1LFWA 4FVCA 3U1MA 2CPIA 2NYIA 4NMLA 6FD1A 1OS5A 2CPZA 1RJJA 3BSNA 2HMIA 4CH0S 2HLUA 4LSNA 3JYTB 4ETXA 1CEZA 4DDFA 1UVNA 5KFRA 2RSQA 4YR2A 1S9EB 2BABA 4NLRA 1S97A 4YY3F 4MAKA 2HG4A 2IRXA 4B3RF 3B4MA 3M6UA 1TAUA 1NKCA 1UVIA 2VL1A 4JI7F 4WK3A 2FVQA 2Z0GA 1VK3A 4OI3A 3ENQA 1C1BA 1IUJA 3PACA 5HROB 2UV8A 2CG4A 1TR0A 1XR5A 2ZD1B 4