2VH7A

Crystal structure of human common-type acylphosphatase
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
94
structure length
94
Chain Sequence
TLISVDYEIFGKVQGVFFRKHTQAEGKKLGLVGWVQNTDRGTVQGQLQGPISKVRHMQEWLETRGSPKSHIDKANFNNEKVILKLDYSDFQIVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ACYLPHOSPHATASE-1
publication title A Rigidifying Salt-Bridge Favors the Activity of Thermophilic Enzyme at High Temperatures at the Expense of Low-Temperature Activity.
pubmed doi rcsb
source organism Homo sapiens
total genus 26
structure length 94
sequence length 94
ec nomenclature ec 3.6.1.7: Acylphosphatase.
pdb deposition date 2007-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00708 Acylphosphatase Acylphosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vh7A00
1MWZA 1Q8BA 2HQIA 2ZDOA 2AJ1A 1W2IA 3BM7A 3BR8A 4OJGA 4A4JA 5IXUA 3DCAA 3LO3A 3WDOA 5B0BA 1CPZA 3KG0A 1R6YA 3GZ7A 3CJKA 3UDCA 3TNVA 1YJVA 2K7KA 1CC8A 2XMTA 3E8OA 3FMBA 4OIXA 1OQ6A 5F0WA 1APSA 2Q3PA 3TRGA 2AP6A 2G9OA 1P8GA 3TOQA 1Y3JA 2GO8A 1SQEA 2OAUA 3KG1A 3KNGA 2OFHX 3HHLA 2K2PA 2LQ9A 1LQ9A 1Y3KA 1FE4A 1FD8A 5T7LA 2OD6A 1S6OA 1Y9OA 4Y2IA 3QMQA 3BDEA 2ZDPA 2IYGA 5F0UA 1OPZA 2XMKA 4HH0A 2FB0A 1AFJA 1OQ3A 1TUVA 2HLTA 5B08A 4FNIA 1KQKA 2OD4A 1TL5A 2BJDA 3LGNA 3F44A 2PGCA 1N5TA 1OSDA 1N5QA 2AJ0A 5B0EA 3I9ZA 1U7LA 2QYCA 4HI2A 2BUNA 1ULRA 1SB6A 1X8DA 2XMVA 4FNHA 1YJTA 5B09A 2BJEA 1Q8LA 2GA7A 2XMMA 3K7RA 1QUPA 2ASYA 4ZA1A 3BF4A 2IYIA 2VV5A 4HH1A 2GGPA 3LGMA 3MCSA 2K7JA 4OJ1A 2RSQA 2KT3A 1K0VA 4Y2MA 1Y0HA 5B0GA 2FHMA 1CC7A 1V3ZA 2N4CA 4Q2LA 2K1RB 2ROPA 5B0AA 2AW0A 1IUJA 4OJHA 3FGVA 4EFAC 2XMUA 2W4CA 3IWXA 2L3MA 2QIFA 4DL0C 3IWLA 2KYZA 3QGPA 1X0PA 4OJ3A 2GCFA 1KVJA 2N4DA 1S6UA 4NL5A 1FVSA 4A47A 2PD1A 3CJKB 3HFKA 2FTRA 1GXUA 2OKQA 4F67A 4QOTA 1FVQA 2IFXA 2VH7A 1YJRA 1P6TA 1RJJA 4U9RA 5B0FA 1GXTA 1AW0A 2RU9A 4HI1A 1N5SA 2KKHA 5K9FA 3BGUA 2RILA 1Q4RA 1FE0A 3T9NA 1N5VA 2XMWA 3DXSX 2QLWA 4YDXA 1FEEA 3KKFA 5B0DA 2W4PA 2HFNA 2ROEA 3HF5A 1VQYA 2OP5A 2LDIA 2OMOA 1Q53A 3HHLD 2HFOA 2FIUA 4NPOA 5T7LB 3VTIA 2BBEA 5A6PA 4Y2KA 2GFFA 2HIQA 2LQBA 1TL4A 1SI9A 2ROGA 4A48A 1YG0A 5B0CA 1JWWA 2KT2A 2QLXA 3HX9A 1YRXA 2GV1A 3BB5A 1JK9B 5KAKA 1FESA 2N7YA 2CRLA 1MWYA 1X7VA 3MZIA 1KVIA 4A46A 2JDJA 2BYCA 1VQSA 2OFGX 3FRYA 2ACYA 4Q2MA 4ZOSA 1AFIA 4DPOA 1URRA 1XBWA 3BN7A 4YEAA 1TZ0A 4DN9A 2K1RA 2EW9A 2RMLA 2GGPB 3HHLB 2LXFA 3HHLC 1TR0A 2XMJA 2HLUA 5A6WA 3HDSA 2W4DA 1WD6A 4HL9A 1YJUA
chains in the Genus database with same CATH superfamily
2RT3A 5IXUA 2FPHX 4GC7A 1UJ5A 3FQKA 4P73A 4WZMA 4OIXA 4O4RA 1P8GA 2VBXA 2I1RA 1Q82T 5E3RA 4DV4F 1GQEA 2G4BA 3QO9B 4J9NA 1TUVA 1U6BA 2AMCB 3ZTSA 3I82A 2L9WA 4HI2A 2RF2B 1CJUB 1K0TA 1RI7A 5KFIA 5A8KA 1D0EA 1T9YA 3FCHA 3KLVA 4EBEA 3HHKA 2IMWP 2L48A 1TKZA 1GT8A 3AQPA 5G0RB 4JYAJ 4AXIA 1KRPA 4S0MA 4MJKA 5KT2A 4E0DA 2QLWA 1RSCA 5T41A 4NA2A 2BKOA 2EBGA 1ZTTA 2KT2A 5H1SV 2APOA 4DV7J 3N79A 4FZVA 3N6MA 3FRYA 2HIYA 4PQUB 2X3GA 2JNJA 2OELA 2XS2A 3MPYA 3BR8A 2XSJB 1S12A 4CT9A 1YJVA 2X1AA 4FVCA 1RWOB 4N47A 3B54A 4DR6F 2IRUA 4F26A 3NS7B 3HT3A 3QZ8A 3WC2A 3KJVB 1T11A 3A3PB 3G8TA 2NZ4A 1MROA 3H59A 1OQ3A 5CQGA 2CVIA 3F44A 4DDFA 3ISND 2UUWA 4JI2J 1CJVB 1H98A 1CBKA 3ITHB 4M5GA 2L9DA 1UWBB 2OEJA 2I0XA 4DPYA 1UJ6A 4LIWA 5BYRA 3PDNA 1LWFB 2DH9A 2KG1A 2M9KA 4F4ZA 1R89A 3CD5A 1RWMB 4Z7YA 2ZOMA 1TL4A 1LWCB 4B3SF 3ISNC 5HMYA 1XTZA 1NK8A 1R8AA 2KZZA 2W1BA 4XO0A 2I2YA 1M5HA 3GG0A 1EQMA 4IRKA 2YKPA 3KLFB 3NS5A 2CWXA 1BUXA 3OHBA 2HAIA 1SJ3P 2DD8S 1RP5A 1R0AA 4B3MF 2VHGA 2R2TA 3V6HA 3MCNA 2XMKA 2OD4A 3C2PA 4U95A 3MPWA 2OIHA 1NZAA 4HHJA 4OHVA 1B0TA 1JKHB 2RRAA 2GGPA 3JS9A 3VAGA 4XTTA 1MWQA 1PSDA 4RW6A 2XLKA 1REVA 2JX2A 5CAAA 2Y0SD 4OX6A 3AXMA 1N0UA 2NUUG 3H2VE 2KM8C 4TQRA 2CPEA 1YJWS 4B3RF 4GVBA 3NGDA 2VG5A 2VBWA 2YKNA 2VG7B 5IM0A 5DQIA 1U4BA 2BANB 3GJSB 2P9CA 4U8VA 3TA1A 2C28A 1HI0P 5A2QY 1LEOA 3FSXA 4DQQA 2DXFA 3WIUA 3EX7B 5F8HA 1C0UA 5F8NA 4PWUA 2UXDJ 2AJ1A 2H3EB 1CPZA 2ZE2A 1NJIT 4DWIA 4W4MA 4W90B 2E7XA 4PPZA 4ED0A 2O1PA 4B17A 3D6HB 1LQ9A 1LWEA 1TL1B 3ZZRA 3R27A 3UD5A 2D3O1 2KXFA 2XHCA 1GMWD 3QJLA 1PC4A 3MPUB 2NXJA 4KH1B 2AEMA 2BW2A 3NCQA 3FBEA 2GX8A 1TKZB 4ZA1A 4Y2AA 3T41A 5C25B 1PKUA 1HWLA 3DYAA 2VQEJ 5GADI 1HQ2A 3BR9A 2NUHA 1SV5A 2XMWA 2CJQA 2AQ4A 1CULA 1HBUB 2VFTA 2GFFA 3RBEA 3LAMA 4MKAA 4WXWA 1M1KT 3SEOA 3UW1A 4U6PA 1A0OB 4B9LA 3NBPB 2E44A 3PX4A 3R7SB 3C14A 1YBTA 3BM7A 1S76D 3D54A 3H2LA 3HMJG 1U09A 1J2VA 4OI0A 3J7YU 3DXBA 1ZM2A 4DLEA 2DXEA 1RK8A 1PILA 1R31A 3VALA 4ZLPA 1WOPA 4WTYA 3G96A 4KJIA 4IOAQ 3AD9C 1XNQJ 4QR2A 4DV2J 3IGNA 1FA0A 1NHUA 3IWLA 1KHWA 2E5JA 3A8KA 1NK6A 1I6JA 2F40A 3QFWA 1JB0C 4DXLA 1NNDA 4MK7A 2C2EA 2Q79A 1GH8A 5AXLA 3EZOA 4G1IA 4EYHB 4KHPJ 4NLSA 4XPEA 3CVKA 1HA1A 1L3SA 4XDDA 2DNOA 1HMVB 3X3UA 1BE4A 2FDNA 3POTA 5J1EB 4O3SA 1D8ZA 2QTWA 3DFEA 4YY3J 2J0XA 1B64A 4KR0B 4FYVB 1Y11A 1R0AB 3TUPA 3OFFA 2IM1A 2VIHA 1FERA 4X4SA 3UVJB 3W2WA 3M8SA 5ETPA 3K8VA 1QVGR 3OVBA 1S1TB 4RW6B 4JI6J 4WBFA 4PUOB 1REVB 3DRRB 3I96A 3DI6A 1NDPA 3D6TB 2EC0A 2VFVA 3SSQA 2B9XA 2V8HA 4QU7A 3FMWA 3NKYA 1N33J 1NMEB 2AYMA 2V50A 5IM0B 4PPDA 2L3MA 3KWMA 4OV1A 4O44A 3DGPA 1RAJA 3HP6A 5KG6A 2GVDA 1B7YB 3AA9A 5B0FA 5KFQA 1IR0A 3RBDA 1VBXA 2VA2A 2OTJS 3LP2A 4LBPA 1M90T 4V19X 3P45B 1URNA 2HHPA 2ZNZA 2F8EX 1C0UB 4NA3A 2BBEA 3MPDA 2UXBF 2LQ5A 3BEGB 7FDRA 2ZE2B 3PEHA 2XZDB 2FLPA 5CYMA 4USMA 3LUYA 3ZO7A 1LFWA 3CTRA 4P2SA 5GMDA 2W9AA 1A6LA 1LWEB 1OS5A 4C11A 4C4WA 4OZ0A 4HHHA 1NKEA 2YX1A 4ZIVA 1FF2A 2W8KA 1NLKL 2CZ9A 7AT1B 3IBCB 2DRDA 1XIQA 4WPAA 5H9EJ 3JAMU 3EYZA 3J81Y 2AWZA 3V6DA 2RHQB 4IH7A 1OSCA 4J9QA 2FY1A 1VK3A 1TV6A 1BMQB 2BJDA 3AD7C 2BQRA 3CCWA 3CD0A 1ZTWA 3IRXB 4ELVA 1P9YA 1SV5B 2QE5A 4ZPVR 4MK8A 1NSKL 1EIYB 4BDPA 1EAYC 4DFPA 1CULB 4L3KA 5HMZA 2POKA 4K8RA 2ZH7A 4F67A 2OI2A 5T14A 1FXLA 2CPJA 4EO6A 3SV3A 4OYZA 3OL8A 2FJDB 1WEYA 1W2BR 2WCXA 1HL6A 3VTIA 3SIPB 4URGA 3C14B 4ITSA 1YVFA 3DMJA 1PYSB 2GW8A 4A48A 3QAEA 3IAS9 5HP1B 1G6BA 3Q24A 3M6VA 4AT1B 3S7RA 4F04B 5LMUJ 4TLRA 4MKYA 3H5YA 3AB4B 5KFFA 2FC8A 1TKXB 1S7IA 3VAHA 3R5JB 3R7BB 4F3MA 3NLCA 2ZFHA 5DLGA 2YWWA 2JC1A 1KN6A 4IG0B 2CUYA 3DU5A 3NXZA 3KMQA 3ENQA 2CQPA 4N5SA 2HLTA 4ZVEA 3NNAA 4D3GA 2BE9B 4M63A 1RAOA 2R7QA 1LXNA 2M52A 2HK3A 4HKQA 1VQNS 4QIVA 2DGSA 2DCLA 3TVKA 3QGPA 1X0PA 3R6LB 3KK2A 3S01A 1QAYA 4OZNA 4C9DA 4M5KA 3IN5A 1BQMB 4JI0J 2KU7A 1UKUA 2VL1A 3IBWA 4DSKA 3VHQA 1U8WA 2CYYA 3POTB 2W8LA 5FD1A 2HKEA 3J7AN 4Y2KA 5CD4H 2WB4A 2C2MB 2KJVA 5HVFA 4J9LA 1ZA2B 4NLQA 3PVXA 5IC4B 2JDJA 1JQGA 1YJ7A 3W2WB 1VRTB 1X5OA 1WD6A 2UXCF 3CCVS 4FVMA 4AD6A 3MR6A 3GYGA 1E6YB 2DNRA 5F0WA 3EMTA 2LCWA 4ELTA 4FF4A 3AY0A 4ERDA 3ET6A 3BH7B 4TXSA 4J91A 5F8LA 3QIDA 3DGPB 1F6TA 3RUBL 1T95A 2G1DA 3CJQA 3TAPA 4Q7AA 4OMFG 1J5EF 2KJWA 2VPXB 1OYDA 4N41A 2JVOA 2GIFA 1XK8A 1C4CA 2PC6A 4DF8A 5CYMB 4UOCA 1KD1T 3D28A 3HF5A 2OSRA 1FTRA 2KYXA 4C11B 3TEGA 4ZJQA 3CO0P 4QYZK 3CCTA 4IO1A 4K4YA 2HHHJ 2OHDA 2Z4PA 2VF3A 2XC9A 2HWHA 3MCMA 3QQCD 2W9CA 3C46A 1HLWA 5EWFA 5LSOA 1ZAXA 3M6XA 4K0KF 5A8WA 4ZPCA 1TV6B 3TRGA 5DGAA 2B8PA 4DX6A 3P5BP 2DNHA 4UZBA 1Y7PA 2Z58B 3DOMB 1ZS6A 5F41A 1JNRB 3KDNA 3H7HB 4KAIA 3TJ8A 1WEZA 5DETA 4UQTA 5D3GA 2M2BA 3RB3A 1VC5A 1ITPA 1QUVA 2G0CA 5M2RA 1TAUA 3G82B 1QD1A 4C3KA 1S1VA 2CJBA 2PMHA 5T7LB 1VQPS 4L6V3 2HSEB 3C19A 4WYWA 4IOBA 1XMOF 1YRXA 3NG8A 5DG9A 1RTHA 2JWNA 3HHLC 3RYLA 1GX6A 2CQIA 2ZH4A 3M8QA 4UF4A 3UDCA 4H4KA 2K7KA 1RWKB 4LVNP 4DV0F 3LPYA 2YKMA 3UE2A 4Z2XA 2BJ1A 2GS8A 2E5HA 3L3CA 3MTKA 4C97A 5KT7A 5CYQA 2BX6A 2UUAF 1V6HA 2AJ0A 3KK2B 3ILJA 1JLCB 1NSAA 2AZ3A 1FK9B 2F5GA 2E5GA 3GIRA 4J9SA 4RR5A 1HHSA 3D68A 4YQWA 4G65A 3HJVA 2HWIA 5DDRC 4EEYA 4LF6J 4FBTA 3GFHA 2DNQA 3J80Y 5KG5A 3EZUA 3P5TL 1WACA 4BLGA 2RU9A 9ATCB 3ZZ0A 1WHXA 4LRBA 2R4FA 4USVA 3CO9A 3BH6B 5BR8F 2HS3A 1N48A 3ZZZA 4NI2A 1IR2A 4UQGA 2IJFA 3T5KA 3BN7A 1FTCA 2MMYA 3PM9A 3GZ7A 3ET6B 1IBMF 2R2UA 3P6YC 2DHGA 2QGFB 2WOMB 4ZVQB 3HXMA 4K4SA 4N7TA 2KI2A 2WVDA 1WF2A 3R2DJ 3H20A 4F3QA 4C48A 3VV2B 2V2VA 4DG1B 1H7WA 4OHXA 1FD2A 1W25A 2AJFE 4KB7A 6AT1B 2J5AA 1R3NA 2A2CA 3BGRA 4JV1A 1SH0A 4OJ3A 1KVJA 1Z2ZA 4CYUA 4KKOA 1CQNA 2LFVA 4LFBJ 2X51A 3LPEA 2CQDA 5GAHU 3K58A 4JYAF 2BACA 4MKVA 1NKBA 4KFBA 4ZVTB 2W9CB 3IM8A 1SVDA 5J2MB 4OZ5A 1WKKA 3AHPA 1S6QA 1Z1ZA 4DV7F 2C2DA 1T05A 2MDAA 2MKHA 3LH2S 3MM8A 2ZH3A 3PYDA 2AEFA 3PRDA 3S8SA 1X4DA 1BQNA 2VC1A 4NLXA 4BWJA 1N6QA 3KK3A 4OX9J 5HK4A 2OPQA 4ICLB 1RAGB 4X4QA 4JI8J 2CA9A 3TQ1A 5D3GB 3MEKA 3I9ZA 2QA4G 3CXCR 3FVYA 4WU3A 1N52B 4CO1A 1JLGA 3OTOJ 4JI2F 2ZVIA 5IT4A 5AE1A 3HM9A 3AOAA 3G8QA 2WB1D 4J9KA 2Z8QA 3D6FB 1YJ9S 4C8YA 1YIJS 2KTQA 1FEEA 2V9WA 2OUGA 3C16B 3M8QB 3MMCA 2DB1A 5IV4A 2MKYA 2YX7A 1KKHA 2OFGX 4H4OB 2WVCA 1RAEB 2YKMB 4DHVA 3HKWA 2FVRA 3GILA 2KVIA 1RZMA 1FNMA 2KVQE 3IFEA 1O6XA 3K8WA 2WVFA 1RU1A 3QIPB 2LDYA 4M94A 1ZZNA 4NRUA 4LRAA 3I5BA 2E1RA 2IDLA 1C1BB 3BV8A 4UT4A 3MR2A 2CFXA 4RW4A 3BDEA 3QFHA 4A8MP 2L9NA 2EG1A 2V8GA 1BXNA 3BJYA 5M2UA 1FWLA 1F9HA 4TYBA 3JTNA 4R0EA 4I6AA 3W65A 4BC9A 4TY9A 4A8WA 3IWNC 1WNEA 2J6TA 3Q83A 4OYWA 2XMUA 4OYAA 5DQHA 3Q8UA 2JFDA 2HYIB 2I8EA 2XTJP 4H4KC 4NI2B 2DH8A 1ACMB 4CM2A 1P6TA 4L76A 4UY85 3UR0A 3GCXP 4PABA 3US5A 2P9EA 1NXIA 5M2PA 4DR3J 3RAXA 5A6PA 2HNYA 4CZCA 3GTYX 5KFOA 5HBMB 3M7VA 4Q0BB 2QFJA 4ECVA 2XO7A 4YFUA 2A0FB 4KGXB 5U47A 1O51A 4IR9A 4OYOA 3RZAA 3HHDA 4JUZA 1SIZA 1SUQB 2G13A 2J7KA 2ZUGA 3E3XA 2UXDF 1U2CA 3CCSS 3HSGA 4ZN3A 1VQLS 3MEDA 4CT8A 5HAOA 3AJ2A 4OZLA 3QMQA 3KDOA 2VFUA 2CQCA 2IIHA 1RXOB 4KKOB 1B99A 1FKPA 2GIQA 4ZDNA 4PR6A 1WOOA 1YZ7A 1Y0HA 3F73A 1KTQA 2DGXA 3R1HA 4L74A 5F9NA 2J0SD 2RS8A 4KFBB 2W2MP 2MQQA 3QJJA 2WK4A 2VQEF 3VZHA 3MM6B 2L08A 1UVLA 1MMNA 1O5JA 1YHQS 5DDOC 2MHNA 2VKRA 2DNPA 2NSBA 4E98A 3MM8B 5I3UA 5IWAJ 1BQNB 3UN2A 2BRKA 2PDAA 1FRMA 1NPPA 3MM5B 1N6QB 3KK3B 2PE8A 1HIYA 2OPQB 3KHRA 2J6UA 4P2FA 3GFXA 4ZPBA 3MEGA 2AP6A 3PCOB 1VBZA 4YR3A 4PXBA 2MYFA 2LECA 1RWPB 5DM7Q 1ZA1B 1LKZA 2JJ4D 4ZP6A 4WTOB 4TVAB 2Y9HA 2FJWA 1NRKA 4IDKA 5HANA 1U45A 1FKAF 2F9DA 2QEXS 3HD2A 2KT3A 2B6AB 3SMZA 4Y6IA 4HDHA 1U6FA 3ISZA 3QGGA 4BCAA 2Y3YA 1XNQF 1QDUB 4QCLA 5AXNA 4DV2F 3CJKB 3PACA 3MMCB 3TQEA 4Q8FA 4XDCA 1S0OA 4ECZA 2WVEA 4PG7A 2QYGA 2COLA 1TU0B 5KG7A 3HX9A 4XIUA 4KHPF 1FT8A 2Z0GA 3RW7A 3NAHA 1S5ZA 1WC3A 4GKKJ 2W01A 3EWGA 4LVOP 1MWZA 3QAUA 2IAJA 4YY3F 2XULA 5D8HB 4YP3A 3D67A 1N5YB 3BKTA 2KG0A 3NCRA 1LK7A 1YSJA 4JI4J 1RACB 1KQKA 2BEFA 1IBCB 4JI6F 3B4DA 3GV5B 1QUPA 1NB2A 2VV5A 2R8JA 1WUUA 1YDLA 1OO0B 3WC0A 1NAQA 2RQMA 5KFJA 1N33F 2QA2A 5HVHA 3CJTA 2HNYB 3CIMA 2AU0A 6FDRA 2IFXA 1AZSB 1UWAA 2VG6A 1Q4RA 1SBRA 4NYZA 2IJNA 1V9OA 2DIUA 2G2OA 1T8EA 2FGOA 2MEWA 1YG0A 1X5TA 3MEDB 5HSPA 3KHLA 3UQSA 2JEFA 4USJC 3NL0A 2DGQA 2VASA 2M3DA 2A6OA 1TP7A 2OPPB 3MAAA 4ILRA 3CULA 1F60B 2IA0A 3UDLA 1FKPB 1XQIA 4UOGA 3QRPA 4MMOA 1WEXA 2D3ZA 5KT4A 1H74A 2HHWA 4ZVGA 3QRRA 4A8YA 1GMUA 2DHHA 3D7SB 2M70A 1KHVA 1R8CA 4DEZA 4ZP8A 4EFAC 4X4VA 3R97A 1P1TA 4EUVA 3GV8B 1T94A 2M0GB 4I6WA 4KV8A 5I3UB 1H2VZ 4YDXA 1X4BA 2HFVA 2HQFA 4P75A 3M30A 2R8GA 5HVGA 3GR0A 1FFSB 4LSNB 2YTCA 4X4PA 2MY7A 3CCRS 2QJ3A 3MAHA 5LMUF 3UN3A 2VFRA 1FWKA 3O3LA 4DV5J 3WIVA 1UPPA 2ZH6A 1VQ6S 5GVQA 1RBOB 3U1MA 4I2PB 5JVGQ 2K2PA 1A7GE 4KT0C 4ECWA 4A8OA 3E51A 1C1CB 4P72A 3CMES 1WI8A 2W24A 1OSDA 2YPZA 2FJVA 1XC9A 3OSNA 2OEKA 4I68A 2KH9A 4RZRA 3KHGA 2CQ4A 1FNOA 3H0PA 2NZCA 4O3PA 1FHTA 4ZJOA 3ILOA 2QO3A 1SL0A 3R7NB 4ZCIA 4CO4A 2DT9A 1FVQA 4DBQA 4FF3A 5DRKA 3L7UA 3CCUS 2I5JB 1DTQA 2YKOA 4JI0F 1PYOB 3DRSB 4H54A 7FD1A 2HNZB 2JSXA 1G3OA 4XK8C 1T03B 2R7RA 2IAJB 4CQ1A 1J5OA 3LW5C 2ZKUA 2P2CB 2J8AA 1FCAA 2H4WB 2ZITA 2EW9A 2XYHB 3MWBA 1HNXJ 2CAJA 3DLLQ 4A4JA 1FRKA 4E8UA 2KO1A 2JEIA 2OMLA 4DJBA 4R5PB 4C98A 1EX8A 4CLYA 4PWDA 4QBUA 2ZM6J 1SQEA 3KNGA 2C1EB 2YH0A 4QWAA 2HGMA 4NA1A 1WSRA 3MCOA 1IKXA 2D1CA 5ADZA 3KUGA 4USKA 1VJQA 2N3OA 1RT6A 4YB1P 2R8HA 2DCUB 4B3TJ 2HVHA 1I94J 5KFTA 5D4LA 2C2OB 1HNIB 4DUZJ 1REGX 4USWA 3TAQA 5GMKa 1RT1B 2VJUA 1WC4A 1PBAA 1IKYA 1SC6A 3OJUA 2B4VA 2VBYA 2GNKA 2HQ3A 1F9EB 3HKZD 1LNQA 4IRCA 1U25A 2EFOA 1UZHA 1NDCA 2F63A 1PJ5A 2DY9A 1C0TA 4RBUA 3TANA 2RB7A 1S97A 2DY1A 4DL6A 5K8OA 1UA0A 4HACB 3VWSA 3CCQS 1UETA 1ZM4A 2QRRA 2XCAA 2HHHF 5IOLA 2R7XA 2HHUA 3TNVA 3TA2A 3D3CJ 1NJZA 1M5KC 4KSEB 2WSEC 3ZTRA 3HI9A 4R8UB 2MQNA 2HFZA 2BJ9A 1RT7A 4IG3A 1KOHA 3NRBA 4WIQA 2QSWA 1FDDA 1RHRB 1K8AT 3MM9A 1FDNA 1XWLA 3D1OA 1E6VA 5KTQA 4KV8B 2PMZD 2XHWA 3SV4A 5SUHA 3UCUP 4BBYA 2GJFA 1TTHB 3BBFA 5AJ3J 3IG1B 1DTTA 3ZZPA 3M30B 2GMLA 4HLBA 3IBFB 3I0SA 3SYZA 3FEYB 3PYGA 3H8YA 3I0RA 4F36A 3WZ0A 4ED3A 5LOQA 4FDFA 1XR7A 4QWBA 1SC4B 3K2YA 4BC7A 2CNNB 3E2EA 1RA6A 1TMJA 3G4SS 3S6EA 4KE5A 4WFBQ 2ACYA 1K1SA 2RUGA 2ZBRA 3G2XA 3ADAC 1YJUA 3Q8SB 1S1XA 4I1TA 5DG7A 4EGLA 4CWBA 4TLQA 1NO8A 3E8OA 4IFYB 4B3OA 3H5SA 1DHMA 4ECTA 1KLMA 5J1PA 3NGSA 2BRLA 1TAQA 4RNHA 4F0MA 3PJXA 3JYTA 2K3KA 4DL3A 3UPFA 2FLNA 1GEHA 4CO5A 1RTDB 3SBMA 4ED7A 1HYSA 4DS5A 2K7JA 2MKSA 2V6AA 4LF1A 1WHWA 5FDLA 2DKOB 3QNWB 2FJEB 2W4CA 1YGYA 4ED5A 1F1BB 2VUGA 4N76A 1Y5NB 2ATCB 3GSDA 3SCLE 3V4MA 1F9FA 1NK9A 1SKRA 4LF6F 3HPOA 3T1YJ 3LQVA 1WF0A 3UNGC 4WP9A 2EK1A 5ETQA 1JWWA 4KC5A 4RW9A 1LV5A 2FD2A 3LTOA 2CIMA 2W2OP 1FRIA 1MWYA 2ZJQQ 3K59A 1OWXA 2HHXA 4CTAB 3SQGB 1NK4A 4YOEA 4DPXA 3IS9A 1IKXB 4NRTA 4Y2CA 1RT6B 2HPUA 5C42A 2H9ZA 3GCWP 4X4TA 2AJ4A 4G3IA 1HQEB 2HQCA 4PXCA 2KFYA 3M8WA 1WG5A 5L46A 3SCIE 5B08A 1EZZB 2DEIA 3U27A 2QYCA 3DLHA 5KFNA 2EFVA 2VQFJ 4OX8A 2XYPB 3JTPA 3OD2A 3OXFA 3MMBA 4CLFA 1D3WA 4DZ6A 3M05A 2HS4A 5A8RB 1RCOB 1C0TB 1FVSA 1MU2A 5HN0A 2D74B 4LREA 3HHEA 1N5SA 2KRBA 3WHIA 3FQLA 2RILA 2UV8G 4ZN1A 3D3BJ 4LFBF 3C6UB 2Z57B 2OMOA 1RTIA 4F0HA 1SKWA 3A1YG 2V8PA 2QLXA 4JV2A 5ETVA 1VR6A 4ILMA 4QQBA 2NSCA 3EPIA 1UVNA 4DPUA 3GIMA 1HFEL 1UFWA 1SC1B 2ILYA 2CPDA 2LXFA 2XMJA 2HLUA 1XJWB 4WZQA 1LK5A 1RT7B 3LO3A 2YQ0A 3OVAA 4KRWA 1N56A 4IOCQ 2BZ2A 2OGUA 1RKIA 3BZQA 3P8BB 4DR2J 3BYRA 2H54B 3FCWA 3IGVA 3K5OA 3GIKA 2EVZA 4OX9F 1WC0A 4P74A 1PJ6A 5LMNJ 4FNIA 2XY7A 3K17A 4JI8F 3ENVA 3KNAA 2RDDA 1K0VA 3HZGA 3IR7B 3I0SB 2DITA 3FDSA 1JLBB 4URQU 2IBKA 3I0RB 4ZJLA 3AODA 3ETOA 3NS6A 2DNKA 1RHKB 1F2HA 1ROFA 3OTOF 2ZC4A 3W60A 3BPSP 4FYDA 1RT2A 1IQTA 2V2ZA 5E2QA 1RAIB 5F3TA 1SJQA 3CW2C 5BXIA 3Q22A 2VU5A 3EZ5A 2QLFB 2RKIB 2CJAA 2JC0A 2IC3A 2BXJA 5KG1A 2YNGA 1AUSL 1XMQJ 4QR0A 1KS2A 2CQ2A 4ZCKA 4RJVA 1KLMB 4LRDA 4GRSA 2V4JA 5B0BA 4NE9C 4LR9A 1V3SA 3PR5B 3JYTB 3DOLA 3CGIA 2J6SA 4ED1A 4DQIA 1VLOA 4FKYA 1IN0A 1S9EB 3CJ4A 3RGIA 4JI7J 2RU3A 2WONA 5FDLB 4DL4A 3A3OB 3A8JA 1P9QC 3RB4A 2R7TA 1U1KA 2PFFB 4F25A 3M8RA 2UUTA 4JI1J 3KYLA 5A0YA 1HD1A 2FHJD 1YRTA 2H4YB 1N8RT 1NJXA 1X4FA 4RW9B 4LF5J 3T9NA 3SXLA 4YHHJ 2UUBJ 3N28A 3JSMA 2M88A 1WG1A 2I9SA 4DR3F 5C42B 4TY8B 3MMAA 1VQSA 4AUKA 2R2RA 4QIWD 5EN1A 4HL9A 1MSWD 1VC0A 3IMQJ 4MFBA 2XMTA 4A8XA 2GQCA 2OPSB 2GO8A 3G6ES 1FDBA 4OYBA 2W2PP 4C0HA 2VZ9A 2ZH9A 4QPTA 2XGPA 2A18A 2G0IA 4Y2IA 1UL3A 2X7IA 2ZZTA 5E3AA 3PKYA 3MMBB 3A13A 5DG8A 4ZVPB 1T3NA 4RO0A 3C8YA 4NXMJ 2CJXB 5B0GA 2K1RB 1X9WA 3OR1B 4H4MA 4MH8A 2FC9A 4I7FA 4I56A 4EYIB 1HQUA 2CNLB 3RBZA 3R8YA 2BE7D 2M4MA 3DXSX 4M5DB 4I4BA 3G86A 1YRUA 4PG5A 3TAMA 1IM6A 2AT1B 3HVAA 3FJ2A 1U0HB 3B82A 5KT3A 2AX0A 1Y10A 3ZFVA 5L1IA 4RW7B 3PG9A 5GAEU 3GJQB 4OHZA 5IWAF 2HURA 2AYEA 4JOUA 2HQIA 1UFKA 1YITS 3TARA 4F50A 2IM2A 4A8QA 2DO4A 3BBCA 4C7QA 3CT9A 3G6XA 3TP2A 3WX8A 3RRGA 2VA3A 1FJ7A 3E01A 2QSFA 4BHQA 3VGTA 2E66A 2YWFA 2Y1RI 1IKWB 1Q8LA 1CJTA 4I67A 3DHXA 3MF5A 5HROB 3U02A 3OSPA 5HO4A 2YVSA 4LF8J 5IT0A 2FZKB 1HW9A 3NGRA 4PZVA 5GAGI 4RNOA 1B70B 3M9OB 2IJRA 3KKFA 2XEXA 1VRQC 2VPZB 4P9SA 1S1WA 5JJBA 2OSQA 2B3TB 3MECA 4U8YA 4LR7A 1QJHA 2EKNA 2MQ8A 1RLDA 4DR4J 3DHWC 1JMTA 2UP1A 2IVMA 2V94A 1VMBA 2Z2YB 3S1TA 4MIBA 2HAFA 5K8PA 4GKKF 4KTQA 1S72S 2G2ZA 2CKWA 2LQ9A 3L7OA 2YY3A 2EFNA 2FHKA 5E7OB 4W98A 4QIEA 4OLOA 2UVUA 1S4EA 4WE1A 4OZJA 2FZCB 1TK8A 3DDNA 1BWVA 4JI4F 5C2CA 1BQXA 3C6TB 1JLFA 4K5SA 3PW2A 1K44A 3D5MA 3AT1B 1SJRA 3JSMB 2LU2A 3G8SA 5BJRA 2AHOB 1S9GA 4HVZA 5F3ZA 4DI6A 3TZZA 3MMAB 4Y28C 4U7UD 1QAXA 1VQ4S 2LLZA 5MAOA 5FJ4A 2FIUA 4OV6A 3CDEA 1TL7B 3DC2A 3C15A 2C42A 4YR2A 2RH3A 3T1AA 1PYTA 4F4WA 1QSLA 3J7Z5 4ECQA 4OYPA 1VQ9S 3FBBA 1W26A 1D8YA 4YN3B 3W2VB 4KGZB 1YTYA 1R27B 1S0VA 5KOXA 4TKTA 1EHWA 3M2RA 1CS4A 1MNEA 2MZSA 1YX2A 3T6JA 1JLAA 3R6GB 4C3MA 2FLLA 4F0KA 2DPJA 1FFGB 2EXUA 3DNCA 1CJKA 1TUGB 1LWXA 4EBDA 3BSCA 5CD4A 4QIGA 3GQCA 4FXVA 4DFJA 5JUMA 2IHR1 4ZPDA 2C22A 1RWVB 4H4MB 1FEHA 2FZGB 1HQUB 4ATNA 5LM7E 1VJWA 1DQ9A 2YNFA 5HQ8A 2KM8B 3H5XA 2H5EA 4A47A 1HNVA 3HVTA 2O3DA 5KFKA 4IUFA 3RB0A 2MQMA 4I0WA 3W8GA 5LXYA 5ETKA 1UPMB 2K06A 3V4IA 5JMNA 5FLXY 1XEZA 2MJNA 2PEHA 4XPCA 4MK9A 4G6VB 4LSLB 1UVIA 2CJYB 2MLYA 3WQPA 1KEKA 3GLJA 4URSA 2B9WA 4KO0B 4PXEA 3VAKA 3GJRB 4IKAA 3DRPB 2KL8A 2FYXA 5KFAA 1TQLA 1I5OB 1R8PA 4Q43A 1HPZB 1HBMA 2LP4A 4MYTA 1RT5A 2HBQB 4DV5F 2R8KA 1CJTB 4NZ7A 1UCNA 4IFVA 2DGUA 5CCLA 3QLHA 4TU8A 1VRUA 4FS1A 4BS2A 1N5QA 2CNOB 3K7RA 2VJVA 5K20B 4LRFA 2JLGA 2Q43A 4ANCA 4ZP9A 1Q5VA 2ACMA 2PA8D 2VC0A 1MMDA 1X4AA 1I1GA 2GVZA 3OL7A 1S1WB 3R2CJ 1YWXA 1DY3A 2DGTA 2E1MC 3K5LA 4LF2A 3JB9k 4L72B 1JXEA 1YK9A 4JI3J 3QGHA 4F4AA 5K14A 3PX0A 2BOAA 3PW0A 4ANDA 2MJUA 1QSYA 1NUEA 4WU2A 4RW8A 2YWEA 1DQAA 1J27A 2BYCA 4Q2MA 2RMLA 5HQLA 3HDSA 5A8KB 3MURP 3AQOA 1HNZJ 4U96A 4LMZA 3D6MB 3OTEA 3UO0A 2JVRA 1HNXF 4A8SA 3PNIA 4NLPA 1SJFA 2IPOB 5CCMA 2VD3A 2YWGA 4DN0A 2ZM6F 4KGKA 3EGZA 4UOHA 1JLFB 1H6KX 1Y00A 3OFHA 3KFWX 1ZM9A 3H2UB 1DFDA 4B3TF 1I94F 3IR6B 2DHXA 2XLIA 1VCTA 3WX4A 3UDEA 2V8VA 4LF4J 3IWXA 4DUZF 2AD9A 2NXNA 2PN6A 1UW9A 3HFZB 3W9JA 3ILIA 4GC6A 1G4CA 2EG2A 2KFNA 3M2VA 4M5NA 4GVLA 3M32A 3Q23A 2RIJA 1MROB 5B7WA 4IH5A 1FX2A 3GB0A 4IQXA 4ZOSA 2R7VA 2YQ1A 2YXLA 1SL2A 1TKDA 4CP5A 2NYHA 1RWUA 3ZNJ1 5JXSA 2J9DA 1AYEA 2JOQA 3F56A 3GIIA 3V81A 1CC8A 4LQ3A 8ATCB 2E9ZA 5ETLA 3H5UA 2EK6A 4OZ3A 5A2QU 2PA3A 3K57A 5LL6d 3G71S 3B6BA 3BGFA 1MN7A 2NYIA 2VPYB 3PKMA 4P7TA 1VYAA 1HNWJ 5L8RC 4R0JA 2DH7A 4HH1A 3LWMA 1V5IB 3I31A 4OI2A 2GMHA 4DCJB 4DL0C 3IAM9 1M5OC 2RVJA 1ICEB 3PW7A 2JLEA 2ADBA 1H72C 5D77A 1VHIA 1AW0A 3OHAA 5AJ3F 4B08A 1RAAB 5KFGA 2HFOA 1NU4A 1JIHA 4WIIA 4OI6A 5LJ5Y 2B9EA 1KNZA 3OR2A 4PG8A 2YWHA 1Q7LB 2GJ2A 1HBMB 3R3TA 4ED4A 1RT5B 1UW4A 3TR5A 2GGPB 5LSLA 4OJGA 4NASA 3DCAA 2DGVA 1Q78A 4HEA9 2MKJA 3IO1A 4IFVB 3QLHB 1OQ6A 2QX0A 3CJ5A 5EWEA 3QBCA 3GIJA 3GR1A 3CJRA 4F4XA 4GVBB 1CG2A 2VG5B 2YKNB 4CH0S 3M9NB 4Y34A 2QL5B 2I38A 3KLIA 2YWKA 2IYGA 4HH0A 1GK8A 2BM1A 2V69A 2RUSA 2GVZB 3TX0A 1UAWA 2M5YA 5HATA 4TN2A 3T1HJ 1HKAA 1RTJA 2M8DB 1RT3A 1H7XA 1RT4A 2GHPA 2IDEA 1NK0A 2LEBA 2Z56B 4C0OC 3QWUA 1U2RA 2VB6A 2ZWOA 3HVRA 3I6PA 3T1YF 4QZVB 1Q86T 2RNEA 3D1QA 1N32J 4K4UA 3MM7A 1OIAA 2AYGA 1WDDA 3DLKA 4RBTA 1T9WA 5DQGA 4K2JA 1YI2S 5H9EK 4DSIA 5BYQA 2BQ3A 3ZZUA 2HG4A 3DYAB 4MTPA 4F2SA 4ED8A 2Q3PA 2HZCA 5THWA 1LOUA 1WELA 5ETMA 3Q2TC 3HHLA 1T0TV 4PG6A 3IM9A 2R9LA 1S1UA 2AIRB 3W8PA 3JTOA 4KH0B 5CZVA 3B8HA 3TW0A 2AGPA 1XNRJ 2YQ3A 3OW2R 2VKZG 1JNZB 3A8EA 1SB6A 3BO4A 2GHVC 3LGMA 1FKOA 3W5XA 4ZMMA 2HZAA 2MSTA 2YNIA 2AF6A 2VQFF 4DLGA 4ZP7A 3V5RA 4QWCA 1T9UA 3M32B 2PEBA 2FUG9 4ZKAA 1PJ7A 4LBIA 2R3VA 4YDDB 1KVKA 1LW2A 1YQHA 4HT7A 5I3QA 3ILLA 4LJMA 2HMIA 4PCQA 1XMBA 2ASJA 1U2FA 2F1FA 1QY7A 5IT9Y 4M8LA 1NEEA 2LYVA 3MAQA 2B9YA 3DU6A 3LP0A 1RWWB 1Q8BA 3PR4A 5KG0A 4A8KA 3WDOA 3HCXA 3AB2B 4JV5J 3TJAA 4IO9Q 2ZD1A 2DR5A 4R25A 4K4WA 3QT5A 2DVIA 1RISA 3FFIA 4DR2F 2EWHA 3Q8QB 1B4SA 5ETOA 3CJ8A 4F8RA 1UTAA 1BD6A 2E7WA 1DQ8A 2DNGA 5LMNF 2MZRA 4GO7X 1KONA 1TL3A 1JJ4A 3IXQA 4J9OA 2D9OA 1FRLA 4ES1A 2Y0BB 1Q8KA 3AJ1A 3EDRB 4RNFA 2H51B 3OXLA 2D9PA 3CC7S 3UDVA 2VOPA 3J81U 3W66A 2PD1A 4CRJA 4QOTA 2KN4A 4OHYA 4B9TA 2B8QA 5B0DA 2LDIA 3N6NA 4NLOA 3CJ2A 1G2EA 1CSJA 2RRBA 4F3OA 2V68A 3DLGA 3MUMP 2AGOA 3DI6B 2RF2A 1CJUA 2LKZA 2XCPA 4FXWA 2CPFA 4OYMA 4Z37A 1FX4A 3LALA 3HHNB 2B4UA 2EPIA 4O0NA 1XMQF 3HD1A 3KLIB 1R6YA 4NYOA 2XY6A 3FZ2A 4O44B 1G1XA 2QZ8A 1Y3JA 2GVDB 2C3PA 5DZ6A 1M0SA 3TI0A 3LP2B 3FNNA 1F5AA 4X62J 2CQGA 1RTJB 1UEVA 4DR5J 1CVJA 3PEJA 5KFRA 2V67A 1RT4B 3EXCX 4JI7F 1TELA 3EUNA 4RUBA 5AXKA 2CDQA 3OTCA 4PQUA 3Q8RB 4CI0B 5EX0A 2HBYB 2MZTA 4M5MA 1G7CB 4KHMA 1VQMS 2IVFB 4UW2A 3UI3A 5CHCB 4JI1F 4P10A 3CIZA 2RDJA 1RJJA 4OYIA 4HI1A 2MPUA 5I42A 3JSBA 1FE0A 2FJXA 4LF5F 3V6DB 3SDEA 4NPOA 4RNNA 4HTIA 1T3OA 5KFZA 4YHHF 5EGYA 2UUBF 1RDRA 3CDUA 2OTLS 3BB5A 3W62A 5K8MA 2MXYA 2BKNA 1KFSA 1URRA 3A12A 4D3HA 3HHLB 4DS4A 2GO9A 1S1UB 4FP9A 1RABB 2L41A 3MMJA 5H9FJ 4WCEQ 4ZLLA 4FXDA 3U1NA 4X65J 2FVSA 4ID5A 1U1MA 2BOPA 2LA6A 4ZVSB 1FKOB 4Q5VA 4LF9J 4UTGA 2QG9B 4CH7A 1S6PA 2YNIB 3BPDA 1LWCA 1NDLA 2MHEA 1U48A 2DR6A 3DMJB 5IZHA 2XWXA 3UFCX 2X3DA 1TFYA 1WF1A 3J81j 4LIRA 3MR5A 2FY8A 4DFKA 1LW2B 1NH7A 2ILZA 2ZKTA 4NXMF 3KLFA 1BY9A 1R6VA 4C8MA 3H4DA 3PHEA 4YR0A 4RU2A 3VZIA 2YH1A 3B4MA 3SSRA 1EKSA 4QU6A 2B7CB 1RHMB 3SFUA 3SCKE 4J7CA 1JKHA 4Y3CA 5L9NA 2X1FA 1B3TA 3NNHA 4K4ZA 2J76E 4TU9A 1QSSA 4EMDA 3FFIB 4WP8A 2XY5A 2VG7A 2ZJPQ 1KC8T 2BANA 4CLSA 1ZM3A 1TL3B 2CZVC 1CLFA 4KIAA 1NHKL 2EFGA 2RHSB 5D15A 4FPIA 4HR2A 2XS5A 4DCOB 1X9SA 3GONA 4X64J 3KLGA 4RKUC 5C7PA 3W7BA 3FZBA 3KJQB 5ITHA 3UWTA 3THTA 2IM3A 3N5BA 1MLAA 3DM2A 4N8NA 1RBLA 1N34J 3DLGB 1KR4A 1F3FA 4LF8F 1X31C 1YJRA 1TL1A 5KFEA 3T5LA 3H40A 2JEGA 4CLZA 2X1BA 2HW3A 2QFIA 4DU7A 3HO1A 2E29A 2GV1A 3PIOQ 3MZIA 4DCPB 5C25A 1OJ4A 2E1PA 4YEAA 4DR4F 4USTA 3PW4A 4NLWA 3TZXA 4DSEA 4CCHA 2IMOA 4JBCA 3CMQA 4MIWA 3QATA 3CDBA 2ZBIA 5GAEI 3QSIA 3OL6A 3KG1A 5E3QA 4OZ1A 3H98A 2DRBA 4EZ9A 1FD8A 1HBUA 5E5NA 4OFZA 4DZDA 1H0HB 5KT5A 2BV3A 2GA7A 3NBPA 1K1QA 4ZLJA 1WJ9A 2CQHA 5I42B 4ER8A 5B0AA 4TU7A 4F7VA 3THVA 1IWGA 2D3OR 4V19J 3SDEB 4YMEA 3NWGA 4K4VA 4C8KA 2GHWA 5A8WB 2WW8A 5IQ6A 3FEXB 1AROP 4DQSA 1VQYA 2HQDA 2ASLA 1O8BA 3ZTPA 1T02A 1L3VA 1VQ8S 4UUWA 2CJ9A 5B0CA 3RRKA 3TEHB 5BYSA 1NBEB 3UN5A 3TWZA 2CPHA 2ZH1A 3J80U 4ID5B 2QC3A 3I56S 2ZJRQ 5ETNA 2LXIA 4PXDA 2Y1IA 3VF0B 3TJ9A 1S6PB 4ECSA 2OFHX 3PV8A 4E2FB 3MTJA 4N8OA 2UVRA 3HLUA 2J8SA 1S1VB 2WSCC 5EWGA 2PO4A 1V5VA 4RBVA 2Q6BA 3SZ2A 1HMVA 1X8DA 2XMMA 5J1EA 3L9ZA 2V8DA 1RTHB 1N4LA 4DMZA 3QWPA 2QLJB 4C8LA 2J9DE 3AH6A 4ZVUB 2DNYA 4PG4A 1OPIA 4NYPA 3UVJA 1GXUA 3J7ZT 2EBEA 2B7BB 1N5VA 5L9XA 1S1TA 4ECYA 4OQJA 3VAJA 2OP5A 2I6WA 4PUOA 1PAUB 3DRRA 4NCBA 3D0HE 4FBUA 5CYQB 1KVIA 2E7VA 2BVZA 2ZBQA 3BKFA 1SH2A 4K50A 1KDNA 2MTLA 2KXNB 3PHTA 4F4YA 2KB2A 3M8ZA 3K5PA 2OAUA 1M5PC 4LR8A 5RUBA 3KLGB 1IXKA 3RG6A 1VIXA 2QV6A 1DZ5A 1MN9A 3C66A 3DM2B 4RPFA 4ILLA 1K47A 3DDIA 1Q1KA 4CLLA 4G1QA 1JX4A 4Q2LA 3VVTA 3FGVA 5L1JA 1VFJA 4I64A 2B43A 2U1AA 2VDIA 5KFSA 1JLQA 4CIOA 1EKRA 1Q0NA 4NLVA 2V63A 3QT6A 3MPVA 3RR7A 1MG7A 2KXHA 4HT5A 5HL7Q 4JI3F 4NZ6A 3I32A 1R0BG 1P27B 2D69A 4N56A 3CMAS 2N7YA 3IRXA 3DOKA 2XQCA 4A46A 4OL8A 1GMVA 1ZBTA 2NXEA 4I6YA 2MZQA 2KZMA 1RYRA 4P2MA 4B9NA 2HEKA 2W7AA 3O5TB 3Q2SC 1WC1A 1VDHA 5JVHQ 3GSIA 2DNLA 3BGRB 2JHEA 1F5CA 3LWLA 3FMBA 1HNZF 4CYUB 4PYAA 2HRYA 3W1YC 3AJDA 1QAIA 2B5JA 1PGZA 2QMWA 4JI5J 5HP1A 4AFFA 1WOSA 2WTFA 4ZITA 4C8ZA 2Z30B 1TKXA 1OY8A 1S6QB 4Y2MA 2YBVA 2GMJA 2H5JB 2YKAA 2ZEJA 3HVWA 2DR8A 3CD6S 1VI7A 5E33A 2LXUA 1T05B 2R7SA 4LF4F 3BSOA 1SPBP 3MHYA 2YKQA 2BMBA 5IQQA 4IG0A 2F4FA 4QW8A 4OI1A 4O4GA 5KFPA 3EVOA 3GYNA 3JAMY 1S10A 1TK5A 1JK9B 3QYYA 2Q66A 3HSZA 2EFQA 2HBZB 3N9UC 1JLGB 4AL5A 3T5HA 2B4PA 4YB5A 4ZHRA 1BQMA 2J0WA 2LA4A 1TVRA 1Q8IA 1GAOA 4DV6J 1VLYA 2HHSA 2DYAA 3CCLS 2KDOA 1F3VA 1S7HA 4MIAA 2Y8YA 3C3LA 1X5SA 2R8IA 2OH2A 1C4AA 2RDIA 2WSFC 1IR1A 1VGYA 5IFMA 3EGWB 3EDQB 1VRTA 6FD1A 4CM0A 1HNWF 2H65B 2PIIA 2N4CA 4CO2A 1HHQA 3FRZA 2J7WA 3T5JA 1E6YA 4QWEA 1KBRA 4NL5A 1U24A 4NXNJ 2CXEA 3BBBA 1R8BA 2VICA 4IRDA 2KHDA 4RW4B 2JLFA 3MXHP 1PAEX 1RBAA 1U6ZA 2ERRA 5HQMA 3FKBA 5EHHA 4ETXA 1IVZA 1TZ0A 3AD8C 2CQ1A 4FYWB 4EWTA 3PZPA 1HR0J 4LFCJ 2BE2A 2RS2A 3PTWA 1ZH5A 5CZXA 2UVWA 3J7YI 3LAKA 4OHWA 3IC1A 3UD4P 3CCJS 1D9DA 5E3CA 3DRYA 2ZDPA 4G1QB 1U49A 4B9VA 1L3UA 3EPGA 3I4HX 1FO1A 2WVBA 1JLQB 4WFYA 3TA0A 1RGVA 2OO4A 4ZIWA 2IBOA 2DNNA 3DKDA 4OZ2A 4ANEA 3T1HF 4LQ9A 5D78A 1NJWA 2CG4A 3KLHA 2FTRA 4KHRA 3LOUA 2F3JA 3BREA 1BC6A 1SJ1A 3RB6A 2HVDA 3BDPA 3DOKB 3DOMA 4RUCA 2ZHBA 2HFNA 4DU8A 4J90A 2RQCA 1EQ0A 3VGUA 3R5AA 1BWEA 3TYTA 2R7UA 3ZXWA 3IR5B 1N32F 1Q5YA 1ZZFA 3NP5A 1IJFB 4RWXA 4NCGA 4L73A 2MKKA 2WBMA 4NOHA 2B5JB 3T3FA 3G82A 1RQ0A 3GJTB 3ZZTA 3R5DA 4DFMA 4JB8B 3O2IA 5L39A 3T9ZA 2PI4A 3ICLA 4K4TA 4ZVHA 5E3PA 1RHUB 4NZ0A 5T7LA 2OD6A 3HULA 4WK3A 2FB0A 1VBYA 2PGCA 3DDKA 3H25A 2EKYA 8RUCA 1XNRF 2E5LJ 3QSYB 2DR7A 3OJSA 4FKXA 1V3ZA 1RKJA 2FQQB 1SJ4P 2KYZA 1JJCB 1Q7YT 2GZOA 4NX9A 4DV3J 4O4GB 2CG8A 2Z2LA 3MEGB 4LF7J 4C6AA 2EC2A 1U26A 5F8JA 3U7JA 3CE8A 2VPWB 1RUSA 2ZOFA 1JLCA 3Q89A 4C8NA 2P5VA 4KGMA 2DNMA 4EK2A 4O3QA 4ZHRB 1TVRB 1FK9A 4IDKB 2ZHOA 5KFLA 2RAQA 4DN9A 2DEJA 3NCPA 2HRTA 4M5JA 3UR3C 2O66A 2AJ2A 3QT8A 1GTHA 3OV7A 1IKVA 3A3NB 3OLBA 3ZTOA 2DR9A 4WFXA 5D0GA 3P49B 2NCKL 4JV5F 3GMGA 4X2BA 5HMWA 3W63A 1S57A 4WJBA 1RADB 1NZ8A 3CD7A 4L75A 1NPRA 4MYUA 2JFKA 2HHVA 1L3KA 1FJCA 3OPKA 4P71A 4FYYB 1NK5A 1B0PA 1H2UX 3IRWP 2R7WA 2WOMA 4AQYJ 1F2GA 1Y5LB 3CNQP 4ED6A 3MDFA 2KKHA 1S4FA 2CQ3A 3BGUA 4DX5A 3M1VA 1WSVA 4ZPTR 2C3MA 4XAKA 4DG1A 2O01C 1EP4A 3HSDA 2BE2B 2N82B 5HJYA 3O6QA 3HK2A 2H1YA 3NOGA 2E5IA 5E0OA 1RTZA 5CYJA 1RWXB 1FXDA 4AE5A 2HFUA 1C2PA 3TVYA 4DL5A 1VBKA 4QYZJ 1IBLJ 1FRXA 2K3IA 3FSYA 2E9RX 2FVQA 2BDPA 2FVCA 2DBBA 2ZH8A 4NLTA 2XZTB 2VG6B 4J9RA 1HBNA 1RAHB 2XYGB 1CEZA 1S6OA 4DSJA 3TUIC 1NCLA 2PSZA 1FRHA 4USUA 5J2MA 4Q44A 1SQFA 4X62F 4W92B 4DR5F 4FNHA 3KLHB 5FIIA 1GXLA 4B9SA 1RHJB 2UUCJ 1YZ6A 1RYSA 1FJEB 1N36J 4KGVB 1H73A 2GCFA 1VS3A 1HW8A 5J2QA 3MAAB 1U1NA 3EXYA 4CLWA 3W9HA 3T19A 2QL9B 3JSRA 4ICLA 3DRXA 2JRSA 3MR7A 3VAMA 1WI6A 3GPAA 3HHLD 4NCGB 3ZZOA 4DPTA 3NMAA 3GG1A 3KLEA 1KQGB 3SI8A 5J2NA 4CNZA 2WZ1A 2NLWA 2P8IA 1U1RA 4USIA 1SKUB 5AE2A 4G1PA 3PRVA 2QT7A 3BGOP 3K5NA 3Q8PB 2C3UA 2V4QA 4NMXA 1FJGJ 2MZ1A 4DF4A 1GFWB 3IP0A 4X65F 3MFHA 2BM0A 3C16A 2BABA 3NMRA 2CPXA 2F65A 1L3TA 4RX6A 1PG5B 4LF9F 4H4OA 5B09A 2RQ4A 4L3NA 1U1QA 3BQ1A 3BS9A 5DS7A 4I2QA 5D6GA 4FYXB 1WWHA 5F8GA 4OI4A 2AKWB 5LJ3Y 3QIPA 3U1LA 2VH7A 2H5IB 4MT1A 5IS2A 2E1AA 9RUBA 2ASDA 1C1BA 1FWPA 1Q79A 2C2ZB 4WKYA 4CLPA 1JJ2R 1WTFA 2M7SA 4DR7J 1B7FA 4PYDA 3FBCA 1IKVB 3OUYA 1JLEA 1TKTA 3P96A 2V5HG 3JQMA 1QM9A 2C3OA 4P52A 1DAXA 2XSFA 1EARA 2B51A 2EI5A 5CH7B 3Q0AA 1DTQB 2FHJA 1K73T 2XLJA 3DN9A 1IWAA 3KJNB 3D4JA 1YBAA 5HBMA 2WAQD 3LGNA 4Q0BA 2GC8A 1WKJA 1J5OB 1DLOA 4DR1J 4DUTA 1UFLA 2CDRB 3OXGA 4WWSA 5EX3A 1WC5A 4CH1A 2UU9J 3ONQA 1S77D 3M1VB 1SUQA 3RTVA 4X64F 3RU0A 1OYEA 4ZPWR 3JXOA 3W9IA 2NPFA 1EP4B 5AE3A 3PIPQ 1YBUA 2CQBA 1RB0A 4P6QA 3R5GA 3RRHA 4PWDB 3D9BA 1N34F 4LBHA 3J7A1 1TMMA 3OTDA 2BQUA 2Z2ZA 2W4PA 1UVMA 5DDQC 4O23A 1IM4A 4ZK7M 2B0GA 3KHHA 4GKJJ 5A6WA 3H42A 2ABYA 1HBNB 4F02A 3CDWA 4PEOA 3KG0A 2BKPA 1R43A 1IKYB 3W5YA 3MM6A 3TOQA 3ZNUA 1XN9A 2F9JA 2C2RA 3TZWA 3WBZA 2AJQA 2DNZA 3TUJC 1VOMA 2BJ3A 2HWTA 2XI3A 5ETTA 4ZVOB 3NGTA 4IR1A 4ES2A 2XS7A 4CLTA 2ASYA 1Y5IB 3CJ0A 2DHAA 5J2QB 3MM5A 2P6SA 3EICA 1S49A 4EO8A 1UEKA 4AL6A 4FF1A 2QMUB 5EDWA 2G0JA 2GIRA 4KQZA 4ECXA 2B56A 4Z7CA 2F4VJ 4U9RA 3KLEB 2BJ8A 4WKRA 4ID8A 2J0QD 5J2NB 1UZDA 1UVKA 4IG3B 4O3OA 4YB7A 4X4UA 1R7IA 3MM9B 5KAKA 3AA8A 3CCZA 2B6AA 2CNKB 5A76A 1UEUA 1E6VB 1DBDA 3LP1A 2DPIA 1ZAVA 1M1HA 4WK1A 1KQSR 1F5BA 3P3DA 3CJKA 3QJPA 4CLKA 4PKDB 2XG8A 1DTTB 4LUBA 2KFZA 1KSPA 2VOOA 3PX6A 2J9EA 2WBRA 4I2QB 5CABA 2GQ2A 2A3JA 2CVEA 4NEZA 4EI2A 1YJNS 3CF5Q 4HTJA 3SFGA 2FHMA 2ROPA 2ALZA 2JEJA 2N3LA 4DV1J 3KK1A 1S1XB 3DLEA 2HNDA 4K7QA 5GAHI 2RQKA 1SXLA 1N5YA 5G4DA 4B3OB 5K9FA 3OUYB 1JLEB 1TKTB 1PCAA 5KG4A 3O1LA 2U2FA 3KOAA 3CJ3A 2XGQA 2H48B 1OY9A 3D0GE 1HWUA 5AT1B 3VGVA 4NLYA 4EZ6A 3HFVA 1NSQA 2XMAA 2A1BA 5KFVA 4DPOA 4FS2A 3N01A 2LEAA 1HYSB 2HS0A 3I87A 1LW0A 1FDAA 5DO2A 4CLUA 2ZDOA 2HGLA 1KTVA 2HHQA 1WDTA 1AZSA 1KQFB 3QGIA 2AV5A 4KY3A 4IH6A 1DLOB 3SSSA 3Q8VA 5D4PA 2Z2MA 3OVSA 2CPZA 3M6UA 2HRUA 2ZBCA 2F8HA 2VDHA 2W25A 5LSRA 5DDPC 1DRZA 3QPIA 3MFIA 1RAFB 1OY6A 4QIFA 1NH8A 1CC7A 1IBKJ 1RWNB 2YX4A 2VODA 3IS9B 2OPPA 3TO8A 2W7OA 5ETRA 1I51B 4ES3A 1IQZA 3FK4A 3G6VA 2EEYA 4DX8H 5GAGU 1N88A 3CWJA 3ZZYA 4NWBA 4HHUA 1SI9A 3F0NA 4JP8A 4DX7A 3BQ0A 3NNCA 1X7VA 4X66J 2MKCA 3I4PA 3OL9A 2YNHA 1UVJA 4DUYJ 1LXJA 2XB2D 1Q81T 1EETA 1OMSA 2CPIA 3M8PA 1W7WA 1QTNB 4LFAJ 2W2QP 1MU2B 4UY8T 2IA6A 3NY0A 1DJ0A 1D09B 1R0CB 1Q95G 5KFWA 5C2GA 2RD5C 1KOOA 4DQRA 1WHYA 4F4KA 1HARA 1RTIB 3KG4A 4ZVRB 4RUHA 2XZWA 3QT7A 3PYFA 4QYRA 3PJ9A 4K2XA 4ED2A 3GWCA 2GJIA 4FF2A 3MOJB 4JI5F 3UCGA 2BJEA 4LSNA 3RAQA 3RW6A 4AXJA 2OEMA 2DO0A 1QAJA 5KG2A 4PAAA 2AX1A 4I2PA 5HJXA 3JQKA 3QRQA 2Y8WA 4PWWA 1C1CA 2VONA 1RE1B 1SQGA 3LP1B 2ADCA 4ZLNA 3EGNA 1VQOS 3ENAA 4P7VA 4YB6A 3NGUA 3BN4A 5KFXA 4RNMA 2IM0A 4J37A 1NPKA 3UCZP 5HLFA 1NSPA 4DV4J 1B0VA 1XERA 4WFNQ 2I5JA 2MKIA 2R42A 1RT2B 5LT5A 3DRSA 3CDAA 2ZUAA 4DV6F 1HWKA 2HNZA 2HVZA 1Y9OA 1T03A 5L1KA 1VQKS 3K5MA 1VHFA 1X4HA 3KK1B 3PO5A 3DLEB 1YJTA 2HNDB 5HI7A 2IC3B 2DXDA 5DJBA 2YNGB 4OJHA 4HYKA 3G9CA 4R5PA 2MLXA 2V4JB 3R5BA 5GMEA 4Y65A 2ZBPA 2XBPA 1X60A 3DOLB 4UZCA 4K5RA 5F8MA 1GMWA 1QLNA 3TUZC 4NXNF 3R9LA 2BW7A 3K0JA 1LW0B 4UOFA 4ETZA 2WONB 1NHVA 5KFBA 2BR0A 2ALYB 2JZ5A 2DIVA 3MEEA 4U7CA 1HNIA 3D0IE 5DLFA 5D0HA 1RT1A 1S59A 2HBRB 4NMLA 4O0IA 1HR0F 5A0YB 1U47A 4LFCF 2V9KA 4DR6J 5DGBA 1T9XA 2G9OA 1IJEB 1K9MT 2SXLA 1AUDA 1U1OA 3THPA 1S79A 2HQGA 4ECRA 1S0NA 1DARA 2NREA 3CC2S 3V2UC 1NB7A 2OLWA 3L4BC 1H2TZ 1FE4A 2FJBB 3BSNA 2AYBA 1SKSA 4FPRA 1CQMA 1S0MA 1Z4UA 1ELOA 1ZPWX 8AT1B 2QLBB 2AGQA 1VC6A 3PO4A 1PBUA 2MB0B 3HZEA 4HACA 3L95X 2ZWPA 3VAIA 3FEZA 3I55S 4NLGA 2MZJA 4X4RA 2WW4A 5I4MA 1S99A 1D1UA 2ATLA 3EJMA 2HFSA 3SCJE 4MFBB 4R8UA 3F41A 1H3DA 4C0BA 2NPIA 3DLJA 3K89A 2R7OA 3BGLA 2YNHB 2HHTA 1WHVA 2Y1LB 1EETB 4B3SJ 2P9GA 2ZH2A 4NLDA 4V1Ak 1KLNA 2QL7B 2DHSA 3CSKA 3VCDA 4DSFA 3M8PB 5AXMA 2NQPA 3FUYA 2AZ1A 1YLXA 2CWKA 3NAIA 4NEYA 2MSSA 3IG1A 3O8WA 3GV7B 4I7FB 2V2QA 2DK2A 5DZ7A 4B3MJ 2BJ7A 2MQLA 3CEDA 1FFWB 4PRFA 2ZOGA 4CNYA 1OPZA 3TAMB 3RAMA 1HBOA 3UNYA 2EFPA 3GFYA 2RRNA 1KFDA 2BUNA 2D3UA 5GADU 3TVZA 3W61A 5CXTA 1X4CA 4B9UA 3EVWA 4USHA 5C24A 2E5LF 5F8IA 5KFMA 2V4RA 4B3RJ 1SIWB 4IFYA 4J9MA 1TK0A 4DV3F 2MGZA 4P2XA 1LFPA 1ZOTA 3BO3A 3GFZA 1U1PA 4M5HA 3ELHA 4DSLA 4DL2A 4ZPAA 2E1CA 4LF7F 1HWIA 4DL7A 3HJFA 1X0FA 1YKWA 4WFZA 3E01B 3CCES 3PY8A 5HLFB 1RTDA 2MY8A 5J1NA 1FRJA 3H4BA 3OFGA 1ZYQA 5MLCV 4K59A 3CPWR 3X1LB 4DPWA 2O5DA 3N6LA 1DURA 2G1HA 4MKBA 4M5LA 2PT0A 2DJWA 1APSA 4C2MA 4AYBD 4U67Q 3NEKA 1JJHA 3EGVA 3VQTA 4J9PA 1M5VC 4CO3A 3NOCA 2CPYA 3W5ZA 3M4XA 4B02A 2V34A 2XI2A 3I5AA 4ALZA 1U7LA 4RWWA 3MECB 2XMVA 3P4UB 4CTAA 3SQGA 3RR8A 4EBCA 1VIOA 5IC6B 4JV0A 4M95A 5IV3A 2UV8A 4X4NA 1RA7A 2AW0A 5KFHA 2QIFA 5F9LA 2OPRA 1FNXH 2ZZNA 3AFGA 5C5JA 2AEJA 1GNKA 1HQEA 1O0PA 3MEEB 3KTQA 4AQYF 3KUEA 1WG4A 2NXUA 2W9BA 3GP9A 2LVWA 2NXCA 3HSJA 1UA1A 2V2KA 2VBZA 4WE1B 2CRLA 5KG3A 3GYXB 1F0XA 3CJSA 3VQSA 1N0VC 5A8RA 3Q8YA 4MAKA 1ZAWA 5KFUA 5D0RA 3R1LA 5FLXU 1IBLF 2JL9A 3L09A 1P1LA 1S9GB 3C6UA 2Q6CA 2Y1JA 1FI4A 4OX7A 5KOWA 2KHCA 2OJ3A 3C15B 1GTEA 3MGJA 1JXVA 1AT1B 1RU2A 4OJ1A 3GU0A 1SL1A 3PW5A 1UP1A 2A2DA 1JXLA 3A8IA 2UUCF 3M2UA 3M2RB 1HI8A 1CS4B 3HFKA 1N36F 1M5SA 1JLAB 4C8OA 4CDIA 2C2NA 2ZZMA 1CJKB 4O3RA 4DQPA 3AOCA 1HD0A 1U1LA 4NCAA 1I3OB 1QE1A 2LQBA 3L7PA 3CB4A 2A6MA 1AXQA 3OFEA 3VAFA 1SCJB 3PFEA 4Q45A 1ZETA 4WP3A 5K8NA 2M8HA 1JLBA 2ZVSA 1KWMA 2QN6B 4GMKA 4QW9A 4WYLA 3MOZA 2YNFB 2XM3A 3G87A 2IRYA 1HBOB 1HNVB 3HVTB 4KYZA 4RL1A 1BGXT 5DM6Q 4Q8EA 1Y3KA 2IRXA 3V4IB 1AA1B 1A9NB 1FJGF 4Y00A 1AFJA 5C24B 2RKIA 1QTMA 3T6BA 2DGWA 2XO6A 4OLPA 2UZAA 2MGZB 3MD1A 4ZCLA 2D7SA 1S6UA 2V0NA 4NLUA 3NWRA 1WKLA 3ZTQA 1S9EA 3ETMA 1PO6A 2UXBJ 2IVYA 1SC3B 5D4OA 2G2YA 3D1HA 1RCXB 2K8GA 1HHTP 1EJ7L 1Y4ZB 1VRUB 3JQJA 4DR7F 3LANA 1HWJA 1W2IA 3BKUA 4ZVFA 2RJZA 3PRBA 1HI1A 1EB0A 3UD3P 3MR3A 5K14B 5F0UA 3BSAA 2HVEA 4NLRA 2OPRB 2JH3A 1QVFR 1TL5A 1N5TA 4TY8A 2C2KB 1FXRA 3N4WA 2NR0A 4RW8B 3BQ2A 2LU1A 3GE9A 4DR1F 3OT9A 2UU9F 1GX5A 1H38A 3PFOA 2OPSA 2W9BB 1WTBA 4TQSA 1PIEA 4J9UE 2ZNYA 4OI3A 4IQMA 1MW7A 2HZVA 3M8YA 3BO2A 1UMJA 4WFAQ 3MD3A 2FLOA 1FESA 2GAHC 5J2PA 3D2WA 3G6YA 3FC9A 2MQPA 2K1RA 3OR1A 4M1KA 3MUVP 4X4OA 2ZHAA 4GKJF 3VGSA 4B9MA 3FSIA 1Q16B 3MI7X 4BWMA 4M5DA 1U0SA 3M2VB 4I69A 1U0HA 3CCMS 3M2UB 3V6KA 4LSZB 3DLBA 4J5OA 3R5CA 1RLCL 1S48A 4RW7A 2QA1A 3BF4A 4X84A 3VVUA 3JSYA 5D0EA 1WORA 1NK7A 4KPCA 4ELUA 4IYQA 3V81B 3N5FA 2CZ4A 1SH3A 4RU9A 1QE1B 1X5PA 1UJ4A 2MLZA 3RJMB 4M5IA 4OYXA 3O44A 2FGCA 5KFYA 1KP6A 2F4VF 4ZS6A 1X4EA 2KT5A 2CADA 2QA4S 1S9FA 3MUTP 3TZYA 2A10A 2O67A 3PXGa 5E41A 2ROGA 1RHQB 3LF0A 1IKWA 1VK8A 5ETSA 1U02A 2N7CA 3I5CA 2UXCJ 3AAWB 5HROA 2F7VA 1AFIA 2GAGC 3PYEA 2PMWA 2LEPA 1BLUA 3IA0A 1D9AA 1Z2LA 2FHOB 3ZC4A 1BHNA 4YUDA 2MQOA 1MMLA 2XWYA 2Q1LA 5K5MA 5LXRA 2YPYA 4N77A 2X1GA 3A4TA 3FCVA 2HK2A 2FVPA 3ENWA 4YS2A 3OR2B 3OTBA 2IYIA 4FN5A 4WXOA 3AOBA 3RBXA 4LT6A 3MCSA 1J5EJ 3QO9A 2WRMA 1R8HA 2HVIA 4AL7A 2W7PA 4DV1F 1X4GA 2DGOA 3VR1A 1GXTA 2J7UA 1NM2A 1U8SA 3W3SA 2PFDA 4DOZA 4Y0FA 3B78A 3CUNA 1Q53A 3KXDA 4U7UK 4ZCMA 4UUXA 2HIQA 4QPXA 5G0RA 4CO0A 1VQ7S 4A8FA 3DGVA 3BYPA 3PJWA 2J9CA 2DTJA 3C6TA 3OLAA 2W2NP 2E9TA 3TX8A 4K0KJ 1TFWA 1RT3B 4QR1A 3EE3A 5EUHA 2F8MA 2LQJA 5SZTA 4O3NA 5KT6A 4KBIA 1XR6A 5CA5A 4WF9Q 3AXKA 2XSJA 4C3LA 5IT9U 4PQAA 1TL7A 5I3PA 3QZ7A 2CQ0A 5B0EA 2NS1B 3KJFB 4K4XA 3MM7B 3W2VA 3KJVA 5D4NA 1L5UA 3DLKB 3V6JA 2R2SA 3KMSA 3HT0A 4F2RA 3CC4S 5KFCA 1IBKF 2N4DA 2D41A 1XR5A 3FBFA 4KPYA 1T9VA 2RE1A 2OKQA 4GO5X 1VQ5S 3LA0A 4RUAA 5J2PB 4EU0A 1CJVA 2ZH5A 2ROEA 3OBIA 3ITHA 3NGKA 4LRCA 1XMOJ 2FJAB 1UWBA 3M9MB 2B4OA 4ECUA 2KRRA 1LWFA 1XBWA 5H9FK 2QMXA 2ZC3A 3SQOP 3ULHA 4X66F 1M1GA 1X9MA 4DV0J 5KFDA 2DRAA 4ENOA 4DUYF 2PI5A 1AB8A 3N0VA 2LQ8A 3Q86A 1TUWA 1T9TA 5L38A 4RLEA 2LMIA 4J9VA 4LFAF 2IY5B 3OQ2A 1D9FA 3W64A 2UUAJ 4LSLA 1NJYA 4TYAA 3EVMA 2UVVA 4HDGA 1T7PA 2HMIB 4KO0A 1WC6A 1ULRA 1N54B 5HMXA 2GQQA 2CJKA 3DRPA 2RSQA 3M6WA 3EM1A 1IUJA 3LP0B 2VFSA 1HPZA 3LGHA 3D66A 3H90A 2P6TA 2ZD1B 2XNQA 5BR8J 4QJVA 2C3YA 5L1LA 1ZPVA 2WHOA 1NKCA 2HGNA 3I9V9 1VISA 1PC5A 4QWDA 4TNOA 2BA9A 2DISA 3KUHA 2XNRA 1TR0A 1IBMJ 2W4DA 1V3RA 1NDKA
chains in the Genus database with same CATH topology
1MWZA 2RT3A 2C3OA 4OJGA 5IXUA 2FPHX 3DCAA 3QAUA 4GC7A 2IAJA 2DGVA 1UJ5A 1Q78A 1DAXA 4HEA9 2MKJA 3FQKA 3IO1A 4IFVB 4YY3F 4WZMA 4OIXA 3QLHB 4O4RA 1OQ6A 3CJ5A 5EWEA 2XULA 1P8GA 3GIJA 3GR1A 5D8HB 4YP3A 2VBXA 2I1RA 2XSFA 4F4XA 1Q82T 5E3RA 1CG2A 4DV4F 2B51A 2EI5A 5CH7B 2VG5B 2YKNB 3Q0AA 1N5YB 1GQEA 4CH0S 1DTQB 3M9NB 4Y34A 2FHJA 2I38A 3KLIA 1K73T 2YWKA 2KG0A 2G4BA 2XLJA 3DN9A 3NCRA 1LK7A 2IYGA 3QO9B 4HH0A 4J9NA 1YBAA 2BM1A 1TUVA 5HBMA 1YSJA 1U6BA 1KQKA 2WAQD 3I82A 3LGNA 4Q0BA 4JI6F 2GC8A 1UAWA 2M5YA 2L9WA 4HI2A 3B4DA 2RF2B 3GV5B 1J5OB 1DLOA 1QUPA 1UFLA 1K0TA 3OXGA 2VV5A 4TN2A 5EX3A 1RI7A 4CH1A 2R8JA 5KFIA 5A8KA 1RTJA 3ONQA 1D0EA 1S77D 2M8DB 1RT3A 1H7XA 1OO0B 3FCHA 3WC0A 3KLVA 3M1VB 1SUQA 1NAQA 1RT4A 4EBEA 3HHKA 2RQMA 3RTVA 4X64F 5KFJA 3RU0A 1N33F 2IMWP 2GHPA 4ZPWR 2QA2A 2NPFA 1EP4B 5AE3A 3PIPQ 2HNYB 2L48A 3CIMA 2AU0A 6FDRA 1NK0A 1TKZA 1GT8A 3AQPA 2IFXA 2CQBA 5G0RB 4P6QA 3RRHA 4PWDB 4AXIA 2LEBA 1KRPA 2VG6A 4MJKA 1N34F 3J7A1 1Q4RA 1SBRA 4NYZA 3OTDA 2IJNA 5KT2A 4E0DA 2BQUA 2QLWA 4C0OC 1V9OA 2W4PA 2DIUA 3QWUA 1T8EA 1U2RA 5DDQC 1UVMA 2VB6A 5T41A 3HVRA 4NA2A 2FGOA 3I6PA 4O23A 3T1YF 1IM4A 4QZVB 1YG0A 1Q86T 1ZTTA 2EBGA 2KT2A 5H1SV 1X5TA 2APOA 2RNEA 3N79A 3D1QA 4FZVA 3MM7A 4K4UA 3N6MA 4ZK7M 3FRYA 2B0GA 4PQUB 1OIAA 2AYGA 3KHHA 3DLKA 4RBTA 3MEDB 2JEFA 2X3GA 3UQSA 3KHLA 5A6WA 4USJC 5DQGA 2XS2A 2ABYA 1HBNB 4F02A 3MPYA 3BR8A 1YI2S 3NL0A 3CDWA 4DSIA 5BYQA 2BQ3A 2DGQA 2VASA 2XSJB 3KG0A 4CT9A 3ZZUA 2M3DA 2HG4A 1YJVA 3DYAB 4MTPA 1TP7A 2OPPB 2X1AA 1R43A 1IKYB 4ILRA 4F2SA 4ED8A 3CULA 2Q3PA 3MM6A 2HZCA 5THWA 3TOQA 1LOUA 1WELA 1XN9A 4FVCA 2F9JA 3Q2TC 3HHLA 4N47A 4DR6F 1F60B 2IRUA 2C2RA 3WBZA 4F26A 2IA0A 3UDLA 1FKPB 4PG6A 3HT3A 3QZ8A 2AJQA 3WC2A 3KJVB 2R9LA 3G8TA 2DNZA 1S1UA 2NZ4A 1MROA 3H59A 3JTOA 3TUJC 1VOMA 1OQ3A 5CQGA 5CZVA 3B8HA 3TW0A 2CVIA 2AGPA 2HWTA 2YQ3A 4MMOA 2XI3A 3F44A 1WEXA 2D3ZA 2VKZG 5KT4A 3OW2R 1JNZB 2HHWA 3A8EA 4ZVGA 4IR1A 4DDFA 1SB6A 4ES2A 3ISND 2XS7A 4A8YA 2ASYA 1Y5IB 3CJ0A 2DHAA 3BO4A 5J2QB 2GHVC 3MM5A 2P6SA 3LGMA 1FKOA 2M70A 1S49A 4EO8A 2UUWA 4AL6A 4ZMMA 2MSTA 1KHVA 1R8CA 4DEZA 2YNIA 2AF6A 4ZP8A 4FF1A 5EDWA 4EFAC 1H98A 2VQFF 4DLGA 4ZP7A 2GIRA 3V5RA 4QWCA 3ITHB 4X4VA 3M32B 4KQZA 4ECXA 2L9DA 1UWBB 2B56A 2FUG9 1P1TA 4ZKAA 2I0XA 1UJ6A 4EUVA 3GV8B 4LIWA 1T94A 2M0GB 5BYRA 4U9RA 4I6WA 4KV8A 3PDNA 5I3UB 1H2VZ 3KLEB 4WKRA 4YDDB 4ID8A 1LWFB 4YDXA 1LW2A 1YQHA 2DH9A 2J0QD 5J2NB 2KG1A 4HT7A 1X4BA 2M9KA 4F4ZA 5I3QA 1R89A 3CD5A 1UVKA 4IG3B 4LJMA 2ZOMA 2HMIA 1TL4A 4O3OA 4PCQA 4YB7A 1XMBA 2ASJA 1U2FA 2F1FA 4X4UA 1R7IA 1LWCB 5L1JA 4B3SF 2R8GA 3ISNC 3M30A 3MM9B 5KAKA 1QY7A 5HMYA 3AA8A 5IT9Y 3GR0A 4M8LA 3CCZA 2B6AA 4LSNB 2YTCA 1XTZA 4X4PA 1NK8A 1NEEA 1R8AA 2LYVA 2KZZA 2MY7A 1UEUA 1E6VB 1DBDA 3MAQA 2B9YA 3DU6A 3LP0A 3LP1A 3MAHA 4XO0A 3CCRS 5LMUF 2DPIA 1Q8BA 1ZAVA 3PR4A 2VFRA 4WK1A 5KG0A 4A8KA 3WDOA 2I2YA 1KQSR 1M5HA 1F5BA 3P3DA 3CJKA 3GG0A 3O3LA 4IRKA 2YKPA 3KLFB 3NS5A 3QJPA 2ZH6A 3AB2B 1VQ6S 4IO9Q 3OHBA 2ZD1A 2HAIA 5GVQA 4PKDB 2DR5A 2XG8A 4R25A 1DTTB 4I2PB 3U1MA 1SJ3P 4LUBA 5JVGQ 2K2PA 1A7GE 4KT0C 4ECWA 1KSPA 2VOOA 2KFZA 2DD8S 4A8OA 4K4WA 1RP5A 3E51A 1R0AA 2DVIA 4B3MF 3PX6A 1RISA 1C1CB 3FFIA 2R2TA 3V6HA 4DR2F 3CMES 2XMKA 1WI8A 2J9EA 2WBRA 2W24A 2EWHA 2OD4A 4I2QB 3Q8QB 2GQ2A 3C2PA 2A3JA 4F8RA 1OSDA 2CVEA 1BD6A 3MPWA 2FJVA 2OIHA 1NZAA 2E7WA 1DQ8A 2DNGA 1XC9A 3OSNA 4HHJA 5LMNF 4I68A 4OHVA 1B0TA 1JKHB 2MZRA 1YJNS 4GO7X 2KH9A 1KONA 1TL3A 2GGPA 2RRAA 4RZRA 1JJ4A 3CF5Q 3IXQA 3VAGA 1PSDA 2CQ4A 4HTJA 4RW6A 3KHGA 2D9OA 1FRLA 3SFGA 4J9OA 2FHMA 1FNOA 4ES1A 2XLKA 1REVA 2ROPA 2JX2A 3AJ1A 2ALZA 2JEJA 4RNFA 2N3LA 4O3PA 2Y0SD 4OX6A 3OXLA 1FHTA 2D9PA 3CC7S 3KK1A 1N0UA 2NUUG 2QO3A 3H2VE 2VOPA 1S1XB 3DLEA 1SL0A 2KM8C 4TQRA 2CPEA 4ZCIA 4CO4A 2PD1A 2HNDA 5GAHI 2DT9A 2RQKA 1FVQA 4QOTA 4DBQA 1YJWS 4FF3A 5DRKA 3CCUS 4B3RF 2KN4A 3NGDA 1SXLA 4OHYA 1N5YA 5G4DA 2VG5A 2VBWA 2YKNA 5K9FA 4B3OB 2I5JB 2VG7B 1DTQA 5IM0A 5DQIA 3OUYB 4B9TA 1JLEB 2YKOA 1TKTB 4JI0F 5B0DA 5KG4A 1U4BA 3O1LA 2BANB 2LDIA 3DRSB 3N6NA 4NLOA 4H54A 3CJ2A 1G2EA 2U2FA 7FD1A 3KOAA 1CSJA 2HNZB 2RRBA 2P9CA 3CJ3A 2XGQA 4F3OA 2JSXA 1G3OA 3D0GE 4XK8C 1T03B 1HWUA 3DLGA 3TA1A 2R7RA 3MUMP 2AGOA 3DI6B 2C28A 2IAJB 5A2QY 1HI0P 4CQ1A 2RF2A 4NLYA 4EZ6A 1J5OA 3FSXA 4DQQA 3LW5C 2ZKUA 2A1BA 2LKZA 5KFVA 2XCPA 3EX7B 4DPOA 4FS2A 2J8AA 5F8HA 1FCAA 3N01A 2ZITA 2EW9A 1C0UA 5F8NA 4PWUA 2LEAA 2CPFA 4FXWA 2HS0A 3I87A 4Z37A 1LW0A 1HYSB 3LALA 3MWBA 3HHNB 1FDAA 2B4UA 2EPIA 5DO2A 2ZDOA 2AJ1A 3DLLQ 4A4JA 1XMQF 1FRKA 4E8UA 1CPZA 2KO1A 3KLIB 2ZE2A 1R6YA 2HGLA 1NJIT 4NYOA 2OMLA 2XY6A 4DWIA 3FZ2A 1KTVA 2HHQA 4DJBA 4R5PB 4O44B 4C98A 4W90B 1G1XA 2QZ8A 1KQFB 2E7XA 4PWDA 4QBUA 4PPZA 1Y3JA 4ED0A 3QGIA 2O1PA 1SQEA 4B17A 3KNGA 2AV5A 2C3PA 2YH0A 1LQ9A 4IH6A 1LWEA 1M0SA 1TL1B 1DLOB 2HGMA 4NA1A 3R27A 3SSSA 1IKXA 3ZZRA 3TI0A 3LP2B 5D4PA 2D1CA 5ADZA 2KXFA 2Z2MA 3FNNA 1F5AA 2N3OA 1RT6A 2CPZA 3M6UA 2CQGA 4YB1P 3OVSA 1RTJB 1UEVA 2R8HA 3QJLA 1CVJA 2HRUA 1PC4A 3PEJA 2ZBCA 5KFRA 2DCUB 1RT4B 3EXCX 2HVHA 4JI7F 5KFTA 2F8HA 2W25A 2BW2A 3EUNA 3NCQA 5AXKA 5LSRA 2CDQA 5DDPC 2GX8A 3OTCA 4PQUA 3Q8RB 5D4LA 1DRZA 4CI0B 5EX0A 1TKZB 4ZA1A 1HNIB 3QPIA 3MFIA 4Y2AA 5C25B 4QIFA 2MZTA 1NH8A 1CC7A 1G7CB 4KHMA 3TAQA 1VQMS 5GMKa 1RT1B 2YX4A 2VODA 1HWLA 3DYAA 3IS9B 2IVFB 2OPPA 3TO8A 1IKYA 1SC6A 4UW2A 2W7OA 5GADI 3UI3A 3OJUA 5CHCB 4JI1F 2B4VA 3CIZA 2VBYA 4ES3A 2RDJA 1IQZA 1RJJA 3G6VA 3BR9A 2GNKA 4HI1A 2MPUA 5I42A 2NUHA 3JSBA 1FE0A 1SV5A 2XMWA 4DX8H 5GAGU 2HQ3A 2CJQA 2AQ4A 2FJXA 1N88A 3CWJA 3HKZD 4IRCA 1U25A 2EFOA 3ZZYA 3V6DB 4LF5F 1VQNS 3SDEA 4NPOA 4RNNA 1C0TA 1HBUB 4RBUA 4NWBA 4HTIA 2VFTA 1T3OA 2GFFA 3RBEA 3LAMA 5KFZA 4MKAA 1SI9A 3TANA 4YHHF 5EGYA 2UUBF 3BQ0A 3NNCA 1RDRA 4WXWA 3CDUA 2OTLS 2RB7A 3BB5A 1M1KT 5K8MA 1X7VA 1S97A 3SEOA 3UW1A 4U6PA 2MKCA 2MXYA 4B9LA 3I4PA 1KFSA 1URRA 4D3HA 4DL6A 3OL9A 3NBPB 5K8OA 2YNHA 1UA0A 1UVJA 2E44A 3PX4A 1LXJA 3HHLB 3VWSA 3CCQS 1EETA 1UETA 1ZM4A 1Q81T 2XB2D 2QRRA 2XCAA 3BM7A 2HHHF 4DS4A 1S76D 2GO9A 2CPIA 2R7XA 3M8PA 2HHUA 1S1UB 3TNVA 4FP9A 3TA2A 2L41A 3D54A 3H2LA 3MMJA 5H9FJ 3HMJG 1NJZA 1U09A 4WCEQ 1J2VA 1M5KC 4KSEB 2WSEC 4FXDA 1MU2B 4UY8T 3HI9A 2IA6A 1DJ0A 4OI0A 3U1NA 4R8UB 3J7YU 2FVSA 2MQNA 4ID5A 3DXBA 1U1MA 2BOPA 2HFZA 2LA6A 5KFWA 1RT7A 1ZM2A 2RD5C 4DLEA 1FKOB 1KOOA 4DQRA 1WHYA 4Q5VA 4F4KA 4IG3A 1RK8A 1KOHA 3NRBA 1PILA 1HARA 1RTIB 3KG4A 2QSWA 4CH7A 1FDDA 1S6PA 2YNIB 1R31A 1K8AT 4RUHA 1LWCA 2MHEA 2XZWA 1U48A 3VALA 3MM9A 1FDNA 3DMJB 4QYRA 5IZHA 1XWLA 4K2XA 4ED2A 2XWXA 3GWCA 3UFCX 2GJIA 4FF2A 3MOJB 4ZLPA 4JI5F 3UCGA 2BJEA 4LSNA 1TFYA 4WTYA 3D1OA 3G96A 1WF1A 1E6VA 5KTQA 4KV8B 4KJIA 4IOAQ 2PMZD 3RAQA 3RW6A 4AXJA 2XHWA 4QR2A 4LIRA 3SV4A 5SUHA 3UCUP 2DO0A 3MR5A 4BBYA 3IGNA 4DFKA 1FA0A 1LW2B 1NH7A 1NHUA 3IWLA 2ILZA 2ZKTA 4NXMF 1QAJA 3KLFA 1BY9A 5KG2A 1KHWA 2E5JA 4C8MA 3H4DA 3PHEA 1NK6A 1I6JA 2F40A 2AX1A 3IG1B 1DTTA 4I2PA 4YR0A 3ZZPA 4RU2A 1JB0C 3M30B 2GMLA 1NNDA 4HLBA 4MK7A 3VZIA 2YH1A 3B4MA 3SSRA 3I0SA 3SYZA 2NREA 2C2EA 3FEYB 4QU6A 2Q79A 1C1CA 1GH8A 3H8YA 3I0RA 5AXLA 4G1IA 2VONA 3WZ0A