2VH7A

Crystal structure of human common-type acylphosphatase
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
94
structure length
94
Chain Sequence
TLISVDYEIFGKVQGVFFRKHTQAEGKKLGLVGWVQNTDRGTVQGQLQGPISKVRHMQEWLETRGSPKSHIDKANFNNEKVILKLDYSDFQIVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACYLPHOSPHATASE-1
publication title A Rigidifying Salt-Bridge Favors the Activity of Thermophilic Enzyme at High Temperatures at the Expense of Low-Temperature Activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 26
structure length 94
sequence length 94
ec nomenclature ec 3.6.1.7: Acylphosphatase.
pdb deposition date 2007-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00708 Acylphosphatase Acylphosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vh7A00
2BUNA 1Q8LA 4Y2MA 2HQIA 2LQ9A 1KVIA 1V3ZA 2ZDOA 3BGUA 1FD8A 2KYZA 5A6WA 2W4CA 4NPOA 3HX9A 1JWWA 1CC8A 1TR0A 3LGNA 2QYCA 4A48A 1Y3JA 1YRXA 1YJUA 1VQYA 3GZ7A 4HL9A 2IYIA 4Y2KA 4FNHA 1SI9A 2GO8A 5B09A 4OJGA 4NL5A 4ZOSA 4A47A 3BF4A 4Q2LA 2N7YA 1FE4A 5T7LB 2K7KA 2GGPB 5KAKA 2VV5A 2OFHX 1TL5A 2XMTA 4FNIA 3HHLD 2OFGX 4ZA1A 3T9NA 2ROGA 5T7LA 3FMBA 2GGPA 2GFFA 1MWYA 2RMLA 1Y3KA 3E8OA 2QIFA 5B0BA 2RU9A 1KVJA 5K9FA 2ACYA 1X8DA 1URRA 2FB0A 1OSDA 2AJ0A 3MCSA 2OKQA 5B0GA 2QLXA 1TUVA 2GA7A 3IWLA 2XMJA 1FESA 1Y0HA 2N4DA 3KKFA 4HH1A 2XMVA 3HHLA 1S6UA 1QUPA 2OD4A 2BBEA 2IFXA 2OAUA 1OQ3A 3BB5A 3HDSA 3CJKB 2BYCA 2KT3A 4A4JA 2PD1A 3IWXA 1MWZA 2K1RB 1YJRA 3I9ZA 1KQKA 2XMUA 3KG1A 1U7LA 2Q3PA 1FEEA 2XMMA 2BJEA 3CJKA 1GXUA 1ULRA 2GCFA 3HFKA 1P6TA 2LXFA 3F44A 3QMQA 3TRGA 4OJ3A 4EFAC 2K1RA 1FVSA 1X0PA 1K0VA 2HFOA 2ZDPA 1N5SA 4A46A 2LDIA 4HI1A 3KNGA 5B0FA 2JDJA 2K7JA 3DCAA 5F0UA 3HHLC 5B0DA 2XMKA 2RILA 3WDOA 2QLWA 3TOQA 2W4PA 2ROEA 4U9RA 2OP5A 1VQSA 5A6PA 1FVQA 3HF5A 3MZIA 5B08A 3FRYA 4F67A 1R6YA 2G9OA 5B0AA 1RJJA 2K2PA 1N5VA 1CC7A 1TZ0A 2FHMA 2W4DA 4DPOA 1AFIA 2HLTA 4HH0A 5F0WA 3FGVA 1TL4A 4Q2MA 1APSA 1IUJA 1SB6A 5B0CA 4YEAA 2HIQA 4DL0C 2AW0A 2XMWA 1JK9B 3DXSX 3K7RA 3UDCA 4HI2A 1GXTA 2HFNA 4OIXA 4DN9A 3BM7A 2OD6A 2VH7A 2IYGA 3QGPA 1N5TA 2AJ1A 5IXUA 1W2IA 2HLUA 2PGCA 1Y9OA 2LQBA 1CPZA 3BN7A 2CRLA 4YDXA 2KKHA 1Q4RA 1SQEA 2GV1A 2KT2A 4OJ1A 1AW0A 3LGMA 1OPZA 1YJTA 2L3MA 3VTIA 1N5QA 1Q8BA 1AFJA 2RSQA 1X7VA 4OJHA 1LQ9A 3TNVA 2N4CA 2OMOA 2FTRA 1OQ6A 1P8GA 1S6OA 1XBWA 2AP6A 1Q53A 1FE0A 2EW9A 3BR8A 3KG0A 3LO3A 1YJVA 2ASYA 2BJDA 3BDEA 2FIUA 5B0EA 1YG0A 4Y2IA 1WD6A 2ROPA 3HHLB 4QOTA
chains in the Genus database with same CATH superfamily
2FVRA 3ILJA 4CM2A 2BKNA 5KFFA 2ZWOA 3AODA 4OLOA 4YB6A 1PC4A 3KK3A 3GR1A 5CCMA 2GFFA 4JI4F 4A8WA 1RYSA 4QW9A 1XR5A 1YK9A 1M90T 2KDOA 5M2PA 5CXTA 3TVKA 2KT3A 4FKYA 3ZTOA 5IT9U 5HO4A 4K4ZA 3PW2A 4MMOA 2IVFB 3UDEA 4DQSA 1SJ3P 3ENWA 3KHRA 4F67A 3R7BB 1CC7A 3ZNJ1 1AFIA 3GP9A 1YRUA 5L1IA 3DDKA 1HBOB 5KFEA 3GIRA 4GVBA 2ASDA 4DU8A 1VHFA 2OPRA 4C0HA 2L48A 3M2UB 4CO5A 2DEJA 1NDCA 4ED8A 4HHJA 4F0MA 3DM2B 3DLGB 2LVWA 1B0VA 5BR8F 3PNIA 3FFIA 2KFZA 2BV3A 4H4KA 5HROA 1JLGA 1YJUA 2XMAA 2EFQA 4FS2A 2MKHA 1WG1A 2XC9A 1S12A 2RQCA 4J9QA 3QFHA 2VC0A 1RT1B 1JX4A 2J0WA 5F9LA 2QTWA 3W9JA 5KFRA 3SSQA 2KXFA 5KFHA 1FT8A 3IWXA 4DQPA 5DLFA 2BOAA 1U7LA 1FXRA 1J5OB 3KOAA 2P5VA 5D3GA 6FD1A 4QW8A 4EO6A 6AT1B 1NDPA 1S97A 3PIPQ 1WHYA 1N34J 5B08A 1JJ2R 1JLEB 3CDUA 2DPIA 3SCLE 4E8UA 3ELHA 1L3SA 4B3SF 1WSRA 3NOCA 5KT7A 3H0PA 3BO4A 4C3MA 1GH8A 4XTTA 4IH5A 4IFVA 3EDRB 1CVJA 5L9XA 2W7PA 2M9KA 2PSZA 2D3OR 3GFZA 2ZH3A 1QTNB 3CCMS 3BGLA 2N7YA 3QQCD 3P5BP 4ED2A 5J2QA 4JI4J 4PCQA 1NHUA 3L4BC 2GA7A 4CIOA 4AFFA 3T1HF 1NK6A 3ISZA 1ZPWX 2HBQB 3F44A 3I55S 3RRKA 2Y8YA 2QO3A 2M8HA 3QGHA 4K8RA 2ATCB 3G87A 2QT7A 5D77A 4OZ2A 4JI1J 4AQYF 2NUHA 3MR6A 4GVBB 4DV7F 3PDNA 3ZTPA 2OPRB 3JQKA 3ET6B 1RHKB 3BO2A 1VQ7S 5F3ZA 5LM7E 4WF9Q 1LEOA 3FFIB 3SXLA 2E5IA 2IM3A 2BJDA 1NSQA 4WK1A 4B9TA 2ROPA 3RBDA 5LMUJ 1PJ7A 1U0HA 2XZTB 3A3NB 1DY3A 4CO3A 1GK8A 4HL9A 4WZQA 3BF4A 2RUGA 4NASA 3OHBA 4EEYA 3S01A 2YNIB 1RGVA 1N32F 4ZVUB 3HZGA 5KT2A 2M3DA 2IJRA 3NY0A 3Q8SB 1M1GA 5EX3A 1VMBA 1WI6A 2WONB 4OZ5A 3PX0A 5MLCV 2BW7A 2JDJA 4F3OA 4KV8A 3MM7B 3PYFA 4X4VA 1U26A 3HJVA 3R1HA 5LOQA 3RU0A 2JLFA 4J9LA 3H2VE 4OHYA 2R2RA 5F8JA 4A8QA 5IFMA 3L95X 2W9CA 2HLUA 5DQIA 2K3IA 4GO5X 4MIBA 3LPEA 2C2NA 4P2SA 3RB3A 3D0GE 3PEJA 3MPDA 3QGGA 3D0HE 4BWJA 2FHJA 1CC8A 5J1NA 1Q7YT 4WXWA 1B7FA 3DYAA 5J2QB 4CP5A 3IA0A 2BJ3A 5ETOA 2QYGA 1E6VA 1I5OB 1S77D 2UXBJ 5LSRA 2JHEA 1NLKL 3EJMA 2Y1JA 4LR7A 4F4YA 2DNRA 5I42B 3OUYA 4DPWA 2HPUA 2Q6BA 1N5YA 5KFKA 1IBMJ 2YKPA 3HHLC 3LW5C 3EVMA 4JI6F 5ETPA 4LF5F 1GMUA 3D66A 2HLTA 4CO0A 2AZ1A 2JFKA 4YY3J 3DOMA 3I0SA 2IC3A 1Q8KA 4G3IA 3LPYA 3THPA 2UP1A 2PGCA 2AJ2A 3Q0AA 3QJPA 7AT1B 2JVRA 3HFVA 3BQ0A 4EBDA 5K8PA 2CWXA 2X1FA 2GMJA 2QFIA 3VAMA 1U0HB 2YPYA 3H40A 4USKA 2DNMA 1HI8A 2V2VA 4ILRA 4HDHA 4Q8EA 4UQGA 4MKBA 4Y2KA 2KXHA 2RRAA 4ZCIA 4M5LA 2U1AA 3PX4A 2CPFA 3HHLD 1JKHA 1YVFA 3J7Z5 3UNGC 5L38A 1IR1A 2G13A 1TMMA 1RWOB 4DUYF 1VLYA 3EZ5A 2ZE2A 2DXFA 4AL6A 4BS2A 2Y1LB 2HBYB 2A6MA 3BKFA 1KQKA 4NLQA 4C3LA 1HNVA 5F8NA 1HW8A 1H6KX 4P74A 4O0IA 4NCAA 3D6TB 3LGHA 4PXCA 5ADZA 4F4ZA 1SB6A 4S0MA 5E3RA 3SFGA 4B3TJ 3FSIA 1RT6A 1SH2A 4DV4J 4WFYA 1CPZA 3HVAA 2WW4A 4XPCA 5KFGA 3H8YA 2VA3A 2XS7A 1NPKA 4ZP8A 4OYOA 2D3ZA 2RHSB 4JI5J 4L3NA 4LFBJ 2FJWA 4X2BA 4O4GA 4DLGA 1KHVA 3DYAB 2DNKA 5DDOC 5HMXA 1TKTA 1RYRA 4DR6J 5E3QA 4C4WA 1E6VB 4J9VA 3H5YA 4YFUA 1KS2A 3R9LA 3A1YG 2XLJA 5ITHA 4TN2A 4QQBA 5LJ5Y 3NGUA 2XI3A 1DLOA 1T9WA 3BS9A 2FC9A 5H9FK 3VAKA 1U2FA 2DTJA 2Y9HA 2UUAF 2KYXA 1N5YB 2B4VA 4LR9A 1XC9A 3EDQB 3JQJA 4OJ3A 3O3LA 2PFFB 3R2CJ 1VRTB 1KQGB 3NRBA 3Q8YA 1S6PA 1ZZFA 2IC3B 2ZJQQ 3AOAA 4P2XA 5A76A 4DR1J 4ELTA 3G96A 4XPEA 5H9EJ 2D3UA 4RU2A 5AT1B 1X4AA 1RWXB 2BKPA 3ZTSA 1S1XA 4ECZA 3NLCA 3ZZPA 1PAUB 1Y10A 3GTYX 1U45A 3DRPA 3A8KA 2A18A 2NSBA 3SV3A 1XNRF 1KEKA 2HGMA 5DRKA 3SCIE 4CH7A 4B3RF 2FLLA 3F56A 4FNHA 4G6VB 2UU9J 1G4CA 4K2XA 3HHKA 3G6XA 1JKHB 3FBEA 5A0YA 1W7WA 2VJUA 2ZBCA 3UCZP 1SVDA 4H4KC 3C15A 4DSLA 2Z8QA 4PG6A 2V34A 4U7UD 2IFXA 2DYAA 2R7XA 4N41A 4X4RA 4JI3J 1HNVB 3SMZA 3D67A 1JLFA 2HZVA 3KNGA 2ZH5A 2V5HG 3OXFA 3M8YA 2ZM6F 2UUCF 2GNKA 3J81j 2F8EX 2F1FA 4IRDA 2UUBJ 1M1HA 2HQCA 2F5GA 4MYUA 1Y9OA 3ADAC 1TELA 1WI8A 3TUIC 2HS4A 1SV5A 2MKCA 2WRMA 3UD4P 4X62J 3CJTA 4CLSA 3H5SA 1OQ6A 2EW9A 4ZVRB 2QLFB 2E5LF 5E3AA 5B0EA 2BKOA 1FJGJ 3GQCA 3UCUP 2JRSA 4DSFA 5C24B 6FDRA 4QYZJ 4LBHA 4OYXA 5LMNJ 1YLXA 3M30A 4IQXA 4A47A 1N36J 2E44A 3R8YA 1DLOB 2OFHX 3MMBB 1IKXA 2PMHA 2LU2A 2HHSA 4UY85 1VK3A 2UUAJ 1U6FA 1B99A 1ZA2B 1H72C 5DZ6A 1S59A 4NE9C 2YXLA 4P75A 5C42A 2Y0BB 4AYBD 2XCPA 4RW4B 3DLKA 2A6OA 2GJIA 2CJ9A 3B8HA 1IJFB 4OX9J 4JI2F 3QZ8A 3OVAA 1KTVA 2NXJA 1QVFR 1G2EA 4ELVA 1DRZA 1NH8A 1IQTA 2XMWA 2RNEA 1RT7A 4OIXA 1BGXT 2HFZA 3O5TB 1H0HB 1X5OA 3DRPB 1VISA 2MGZA 1UW9A 3FVYA 2QZ8A 2YKNA 3H5XA 1CG2A 1FE0A 4MK7A 3RAXA 4IRCA 4PG7A 2F63A 1S10A 1YGYA 3D1HA 3HSGA 4OZJA 2CDRB 1N0UA 4GKJJ 3I0RA 1QUVA 5A0YB 1URNA 4LIWA 2WVDA 4NL5A 3CIZA 3KJQB 3CIMA 3W65A 2PIIA 3Q83A 3TZWA 1NK4A 5EWGA 3VQTA 3HI9A 4UTGA 2E5JA 3GYXB 1JLFB 4CLTA 3QGIA 5CAAA 2AF6A 2B5JA 3IP0A 1YZ7A 2ZDPA 2VQFJ 4A46A 1ICEB 3OL9A 4PQAA 4EO8A 2GAHC 2HHXA 2JLGA 1HD0A 1JK9B 4ECVA 4JYAJ 4DI6A 3JS9A 3EYZA 3C8YA 4UQTA 4JV5F 1FRMA 3F73A 2OTJS 2DGUA 3PRVA 2K3KA 1R3NA 2X1GA 4Q44A 4LQ3A 4GRSA 4K4YA 3N6MA 1OPZA 2JEFA 3U02A 1Y00A 3VZHA 3MOZA 3SQGB 1JQGA 2JL9A 2CFXA 4IG3A 1FRLA 4KGZB 3TARA 3OTDA 2XLKA 1IKYB 3M30B 3O6QA 3PFEA 3DU5A 2ZH6A 1WC5A 1AYEA 4P6QA 4O0NA 1MLAA 2MSSA 3HVRA 2PN6A 2FYXA 1FRHA 3K8VA 5M2RA 1U47A 1X8DA 5L39A 5C42B 4A8FA 4GO7X 2XMJA 3OTOF 1OQ3A 2CNLB 2Z30B 1IKWA 4I67A 3VF0B 1XMBA 3IAM9 1PYSB 4DUZJ 2HNYA 1IM6A 4RNFA 2HFOA 4PWDA 1UPMB 2LDYA 1QSYA 3H7HB 4I64A 4KPCA 2YQ0A 1IBCB 2OO4A 3ZZ0A 1F1BB 1RT7B 2R7VA 1WEYA 2BJ7A 2FLPA 4DL0C 5EN1A 1N52B 4KC5A 2RH3A 3M2VA 2NXUA 3NWRA 2MGZB 3W66A 2YKNB 2KT2A 4C11B 1BQMB 1CJVA 3T9ZA 3HJFA 2FHJD 2FJXA 1BD6A 4IQMA 1UW4A 4L72B 3SEOA 3CO9A 1YTYA 3I0RB 4F50A 3HHNB 5U47A 1R27B 3THTA 4RO0A 3VAHA 4LIRA 3Q8VA 3LGNA 4X4QA 4A48A 3KFWX 1MMNA 2XSJA 5ETMA 5E7OB 1NKCA 2HFUA 2V2KA 2HWTA 3TAMA 2PEHA 1JNZB 4ZA1A 1SCJB 1Y3KA 2B4OA 1R89A 1QE1A 2MYFA 3W2VB 3TAQA 4YHHJ 4DR5F 2DRBA 3GILA 4CLLA 4U67Q 1WEXA 3FDSA 3HFKA 2OEMA 5CHCB 3C66A 1OS5A 5D4LA 2EK1A 1K1QA 2G1DA 2VICA 1SKRA 4LJMA 5B0AA 2LYVA 3ZZUA 2MQMA 1T8EA 3QGPA 4ZLJA 2EEYA 4NOHA 2MKJA 4I6YA 3CD7A 4L75A 4YQWA 1Q4RA 2DH9A 4Z37A 3MGJA 2XZWA 3G71S 4IG3B 1DTTA 1SJQA 1JXEA 2PA3A 3RB4A 1IJEB 4LRFA 4LBPA 4PR6A 4I2QB 2KHDA 2B9XA 4KR0B 3BQ2A 1KR4A 5D0HA 3JTOA 4CT9A 2MEWA 3FK4A 1F60B 1YWXA 2RU9A 4MK8A 3IWNC 1X4CA 1GNKA 1IKWB 1BHNA 5KFXA 5HANA 3Q86A 2DGQA 3PZPA 3B54A 1KBRA 1F3VA 2HNYB 2CQHA 2RHQB 1ULRA 5GVQA 2OEKA 2BQ3A 4PWDB 3M7VA 3GV8B 4RW7A 1PYTA 2DR6A 4NLWA 2W7OA 2BANA 3MD1A 1LFWA 1U1MA 3SQOP 2UZAA 4R8UB 1TZ0A 4IH6A 1HW9A 1VQMS 1VQ5S 1KFSA 3T5KA 1VLOA 2WVBA 1OJ4A 1CJVB 4OYZA 4DPUA 2NPIA 2WW8A 1N6QA 4CM0A 3DGPA 3KK2A 2M5YA 3QATA 3I4HX 1SL1A 4KH1B 2UXDF 3FBCA 2HZCA 4FPRA 1WHXA 2XSJB 3NNAA 2MLZA 4WWSA 2FLOA 2AGPA 4AD6A 1H73A 2R8GA 5B09A 4B9SA 5A2QY 2LU1A 2O67A 3BGRB 1LWFB 1YSJA 5DQHA 1QE1B 3H2UB 4ZN1A 3HMJG 4ECYA 3WC0A 2H5EA 5AXLA 4MKVA 4KHRA 4DV2J 1HI0P 4NA2A 5THWA 1FHTA 2CNNB 4X4OA 4JP8A 2M70A 3I9ZA 4C8LA 5C2CA 3OTBA 4F7VA 2W8LA 2RU3A 3FQLA 3ILLA 1WKLA 4NLGA 4Z2XA 3IBWA 3HHDA 5T14A 1RT3A 2G9OA 1K9MT 1NHVA 1HPZA 4ES2A 4DV1F 5F0WA 3WC2A 3UDLA 4B3OA 4WZMA 3A4TA 4NCBA 3HP6A 4ILLA 1RB0A 1TP7A 2EFVA 2GS8A 2UVVA 1DTTB 4RUBA 2P9GA 3P96A 2J6UA 3QJJA 3AOCA 2YWHA 4P72A 4QU7A 2RRNA 5BYRA 1WJ9A 2IVYA 4Q0BA 3C16A 4J9NA 2R7WA 1MWQA 2W2PP 5C2GA 1SKWA 1YRXA 2AX0A 2AEFA 4NEZA 4WK3A 1ZZNA 4EBCA 1NZAA 3PXGa 1T9XA 4DSJA 1AT1B 1P1LA 1AXQA 3MEDA 3V6HA 2I6WA 3KJFB 1KKHA 1KOOA 3O44A 1TK5A 2VODA 3F0NA 4LF6F 4K2JA 3MWBA 4X4TA 3GU0A 3NS5A 3KHGA 2QLBB 4ZCKA 2XM3A 4OZ1A 1Y7PA 1CQMA 2NYIA 4CLFA 4A8MP 2BA9A 1FTRA 2BE2A 8ATCB 2CZVC 2QE5A 2QEXS 1F6TA 1BE4A 1TKZA 1N6QB 3DGPB 3KK2B 1T03A 2IRUA 1NHKL 2UXDJ 2WZ1A 3U1LA 2NXEA 2DJWA 3OR2A 1KP6A 4LQ9A 5KFWA 5F8GA 2BE9B 2QJ3A 1VQYA 2OHDA 2YNGA 3K17A 2IYIA 2V4RA 4V19X 5CCLA 2MDAA 2F40A 3E2EA 2RDJA 2M8DB 4QIFA 2YH1A 3BYRA 4QWBA 3FQKA 4DR3F 5JXSA 4P9SA 1RKIA 1SXLA 1YJRA 2HHWA 3G4SS 3ZZRA 3D28A 3R7SB 3G82A 2Z58B 3UR3C 2RKIB 1T3NA 1S4EA 2J9EA 2CQCA 1Q5VA 4ZIWA 1HPZB 4NLRA 2ACMA 3EGVA 2GZOA 3OVSA 2V2QA 1U24A 5KG4A 4AE5A 2P6SA 1S1WA 4P7TA 1JNRB 1OPIA 2ZBPA 4DCJB 1UEUA 5E3PA 3W2WB 4K59A 4KQZA 3MDFA 1UVLA 4Q0BB 1BQXA 3MF5A 3C16B 1JLAA 2FJEB 2OLWA 1FFSB 3IR6B 4B9UA 2WTFA 3JXOA 3THVA 1S7IA 2VDIA 1YI2S 4F4KA 5DLGA 4LFAF 1HBUA 2ZKTA 3S8SA 4I2PB 3P45B 3MEDB 5CYMA 1VQ6S 2HBZB 2CJQA 1I1GA 3LAMA 2GJFA 1WEZA 2HKEA 1QAXA 2JSXA 2NQPA 2FHKA 2Q3PA 1WG4A 1IKVA 1DTQB 3CMQA 4OYWA 3KLVA 4RNHA 3QNWB 4LF1A 4GKKJ 2W7AA 3Q8RB 3LA0A 3KMSA 3BN4A 4F26A 3AH6A 1Q5YA 4UY8T 2QV6A 4DV5F 1TKZB 3DU6A 3IRWP 3GMGA 3OLBA 3DLEA 2ZOFA 3BSOA 2LQJA 4X4PA 3C6TA 5IWAF 1U1KA 1T95A 2V2ZA 1X7VA 3ZXWA 2C2KB 2MZRA 5HL7Q 4Q8FA 4L6V3 1HNXF 3PFOA 3W62A 1TL7A 3KYLA 1NSAA 1S57A 1FCAA 5H9FJ 3CJQA 5D6GA 2ZH1A 1K44A 1FE4A 1Y5LB 3MMJA 2GAGC 3ZZYA 5IC4B 1G7CB 2G0IA 2DGXA 3AQPA 4USIA 1WOPA 3JYTA 4WJBA 1L3TA 2DO0A 1WC0A 4HI1A 2CJKA 3PKMA 1C0TA 2ZKUA 2PI4A 2OUGA 4ZN3A 3DRSA 1Y5NB 3SBMA 2J7WA 4NMXA 4LT6A 1KRPA 1S1WB 4ANCA 2F9DA 3V81A 3OQ2A 1GXTA 1KLMB 3MFHA 2IM1A 3OT9A 1W2IA 5HMZA 3M1VB 4ANDA 1IBKJ 1Z2ZA 1JLAB 3ETOA 1GMWA 3PX6A 3HZEA 2WOMA 1D8ZA 3GCWP 1HNZJ 4M5NA 1D9FA 3MR7A 2F8MA 4NLDA 1HBUB 4PKDB 3OL8A 4RW9A 3LUYA 2FZGB 2FZCB 2BE7D 2QGFB 2XYGB 5CYMB 4YR0A 2IMWP 5LSOA 2RMLA 4Q5VA 2JX2A 1URRA 3P3DA 1IN0A 2XYPB 4DDFA 1IKVB 5DG7A 4ECUA 2VU5A 4ED3A 1S6QA 1U2CA 2CUYA 3GJRB 3UCGA 1T0TV 2YX4A 1TV6A 4F04B 2F3JA 3I96A 2EFGA 1X5PA 2XS2A 3H98A 4EMDA 3PYGA 3TP2A 3VCDA 3W9HA 4DQRA 2VASA 3C6TB 4A8KA 4JUZA 3ITHA 1T9VA 2HGNA 3WZ0A 1T7PA 5KOXA 3LGMA 4HTIA 1M5VC 1DARA 3A8IA 3Q24A 3R1LA 1UVMA 4N8OA 4OX7A 2YWGA 1XTZA 3BR9A 2Z2LA 2Q66A 2G0JA 3BSNA 3QLHA 3DC2A 2MQNA 1H2TZ 3GYGA 1V3ZA 3R97A 5IZHA 3NS7B 3MXHP 2KB2A 1E6YA 2V8HA 2YX1A 1Q1KA 3BZQA 5BJRA 1QJHA 2Q43A 3V6DA 3CMAS 2E1AA 4BLGA 2DHXA 3DRRA 1Q86T 5IQ6A 2RVJA 2QX0A 1QD1A 2HQ3A 2PD1A 3PJXA 1B4SA 1UZDA 2BJEA 1FVSA 4ECSA 2EFOA 1DAXA 4JV1A 5A8KB 2OP5A 3A12A 3DRSB 3RAQA 2AYBA 4U7CA 1HHSA 3HF5A 1R6YA 3V81B 4U96A 3T1AA 4K5RA 4OFZA 1B3TA 3ONQA 4C7QA 1HNWJ 3MURP 4E98A 1HWJA 2WOMB 4TYAA 3MAAA 4OV6A 2BUNA 1SH0A 3H90A 2O1PA 4PAAA 5KG7A 1R0BG 2R7UA 1SPBP 1C4CA 3E01B 2NLWA 4K4VA 4Q7AA 2RS8A 2HK3A 3MHYA 3ZO7A 5K9FA 4DJBA 4CO4A 3QWPA 1Y5IB 2BVZA 1FK9A 2AU0A 2B7CB 2XSFA 2IY5B 3K5PA 4ED5A 1M5OC 1S6QB 3TWZA 4HACA 3AT1B 4C3KA 2K7JA 1TV6B 2ILYA 1X9MA 4NZ7A 4B9VA 3EMTA 2LLZA 4ZHRA 2NREA 5KFMA 3EZUA 3U27A 2DNPA 3ITHB 1U4BA 2AYMA 2ZOMA 4DMZA 1RDRA 3ISND 4ICLB 1YIJS 2FVQA 4MKAA 5E33A 5MAOA 2ATLA 3MOJB 2WVCA 4Y0FA 1S9EA 2OMOA 4DSIA 3QLHB 2ASYA 4CLZA 1YG0A 3N5FA 1SC1B 1E6YB 1RCXB 4DLEA 3W3SA 2J8AA 1BQNB 5FDLA 3DGVA 3V6DB 4A8XA 5KFCA 5M2UA 3OV7A 3JTNA 3DRRB 4ED1A 2WSFC 1O51A 4FF3A 5D8HB 4M95A 1RTDA 1HD1A 4F8RA 2Z57B 1NAQA 4WP8A 1RWVB 5FLXY 1HI1A 1IBLF 2H9ZA 2J6TA 4QCLA 2R7TA 3MM8A 1HHQA 2DY9A 3WBZA 2CPIA 2OI2A 1EKSA 4N77A 3O1LA 1RU1A 1R7IA 2ZC4A 5C5JA 2F65A 4WU3A 2ZUGA 2MQQA 4I6WA 2XHWA 2IIHA 4ZVTB 1DQ8A 3MAAB 4DS4A 1P8GA 1XBWA 2E5GA 3A8EA 3PW0A 4F0KA 4CI0B 2MQOA 3MEEA 3P5TL 1R0AA 1X4BA 1CEZA 4PG5A 2FVCA 2AX1A 3PW7A 3KTQA 2XNQA 3AAWB 3PV8A 3HVTA 1TL5A 4WIIA 1HWLA 4BDPA 2MKKA 2K06A 3IBCB 3PW4A 2QIFA 1FK9B 2ACYA 4DR2J 3N6NA 1XEZA 2CJXB 3CDAA 4IDKA 2N3OA 4PPDA 4HACB 2C2EA 3PJ9A 4WCEQ 3EX7B 1IR0A 1LK7A 5EHHA 2XMKA 2GQQA 3W9IA 1N88A 2H65B 4RWXA 3NNHA 1T3OA 4DG1B 5H9EK 3FRYA 3B78A 1XNQF 3CULA 4PQUB 3TX0A 1JMTA 2IM2A 2W9AA 1OY8A 4K4WA 2C3MA 1RXOB 2EFPA 1BXNA 1RHMB 2W2QP 2HYIB 2XY6A 2XBPA 5AJ3J 4OLPA 5F8HA 5B7WA 1S9EB 1UVNA 5LSLA 2J5AA 3GJTB 5D4PA 1LQ9A 2VC1A 3MEGA 1VHIA 1J5EF 2VG5A 4HI2A 4MIWA 2YQ3A 2W01A 2QYCA 1KHWA 1Q95G 3AD9C 1WTBA 4HEA9 3J7YU 3UFCX 5A2QU 4QPTA 2BXJA 3MPYA 2ZBQA 3FMBA 4FYDA 3PJWA 4M5DB 2A1BA 1RTDB 1WOOA 2KHCA 2J9DE 3M2RB 2LXUA 3VGVA 3CDEA 1CS4B 4C0OC 3MM8B 3GB0A 5HQLA 1EJ7L 3T6JA 2RD5C 4K5SA 2RILA 4NLTA 2BEFA 4YB7A 1S0NA 1ZOTA 4OX6A 4BHQA 3OFGA 1NK7A 3CCWA 1FWKA 1AUDA 1KLNA 2LQBA 1HNIA 4TLRA 4WE1A 2RDIA 3KLHA 1S0MA 1AW0A 2H51B 2RSQA 2DNZA 1R0AB 4DSEA 5KG5A 3Q8QB 3NMAA 1LXJA 1KWMA 2W4CA 3KG4A 3MR2A 3TUPA 3NL0A 3GZ7A 3HVTB 2WVEA 2Q1LA 1XJWB 3DOKA 1U1LA 4UOGA 2XGQA 3WIUA 2VIHA 2HHHJ 4PG4A 3RR8A 1RT4A 3B6BA 3DDIA 4IDKB 1UCNA 3QIPA 1D9DA 2QLXA 3MR5A 1FJ7A 3M9OB 2E1CA 1RHJB 3VR1A 3ETMA 2VOPA 1VFJA 3D68A 1EX8A 4M5HA 2WSCC 3IS9B 3Q2SC 2A10A 4J9RA 4J5OA 2DHSA 2V4QA 1FD2A 3K5MA 3VV2B 3CJ5A 3RBXA 2FDNA 3DDNA 1NK8A 1APSA 1TL4A 3J80Y 1FX2A 2E7XA 2CA9A 3KLIA 2F4VF 2DXEA 1UETA 3D5MA 3BKUA 2KU7A 1RWNB 2SXLA 5J2MB 3T1YF 3MEGB 5J1EA 2CQ1A 1F5AA 4EZ6A 2IJNA 1NSKL 2M52A 1EB0A 1VC0A 3KG0A 4IFYA 2XTJP 3T5JA 4J9OA 3CTRA 5JJBA 3A13A 4B3MF 1U09A 5L1JA 4RL1A 9ATCB 3QAUA 4K0KJ 1RBOB 3BPSP 2Z0GA 3BGFA 1NDLA 1GEHA 1C1BA 2H4YB 3CJ0A 4KKOB 2MZTA 5G4DA 4OMFG 3KLGA 5KT6A 4DS5A 4J91A 1F9EB 1RT2A 3R3TA 2WK4A 2V8DA 1L3UA 4IOAQ 2Q6CA 4UT4A 4DEZA 1T94A 3GFHA 1U02A 1S1TA 3D9BA 1EQ0A 1ZM9A 3OBIA 2ZWPA 3DCAA 4M8LA 4NMLA 3WDOA 1FNMA 4NZ6A 1RSCA 3ZTRA 1FWLA 3ZNUA 3BSCA 1KOHA 4ZPCA 2FC8A 3R5CA 4WE1B 2VH7A 5E3CA 2ZJRQ 4ZITA 2FZKB 3TJAA 3IR5B 2NS1B 2YWWA 1YJWS 3LP1A 4DBQA 2UXCF 1H98A 5HSPA 1YBUA 1F5CA 3QJLA 4N5SA 1R8PA 4IH7A 3EWGA 1EARA 1HLWA 4UZBA 2L9DA 4Q2LA 2QRRA 1RT4B 5K5MA 2HWIA 1REGX 3QIPB 3T5HA 1RTIA 5DG9A 3AJDA 5B0BA 4Y34A 4DPTA 1OSDA 4OYPA 1NUEA 1REVA 1Y0HA 2HHTA 4ZP9A 1EETA 3KG1A 2NZ4A 5GMKa 3OL7A 2ABYA 4JI0F 2K1RA 2VG6B 3LWLA 3ZFVA 3C19A 4IG0B 3CCZA 2V68A 4MJKA 1NEEA 1RLDA 2E9RX 1C1CA 2DHGA 4OYIA 4FPIA 3C6UA 3AB2B 4DPOA 3KLIB 1UFLA 5ETVA 2HW3A 4O3PA 4PUOA 4YDXA 4OJHA 4IFYB 3HVWA 1A0OB 1NZ8A 4AUKA 3MPWA 4FYVB 4ECWA 2EXUA 2ZITA 3HHLB 4RW8A 4J9MA 2LP4A 1HBNA 3NKYA 3SZ2A 1UVIA 2C2DA 3EGWB 1MMDA 4URQU 3SSRA 4ES1A 5GADI 1FRJA 1FNXH 1S72S 2E1MC 1VDHA 1RT2B 2OPQA 1VQ8S 4OV1A 1U48A 4KGXB 3BGOP 2FJDB 2PEBA 4ED6A 2C2RA 1S1TB 4RJVA 2AD9A 3G8QA 1Q8IA 3WX4A 2HS3A 1ZYQA 4X4UA 3QZ7A 4G1PA 3FCWA 3B4MA 1RP5A 4I1TA 2OH2A 3NGTA 3UWTA 5DDQC 3UDCA 2C28A 3NCQA 1QAJA 4NZ0A 3KLEA 3MFIA 4ED4A 3LP1B 2E7WA 4ZPDA 5E2QA 3OSNA 1NPRA 3VVUA 3N4WA 2J9DA 4OJ1A 4Q43A 3KUHA 4C97A 3K59A 3ENQA 3NNCA 1NK0A 5IQQA 2AZ3A 2AYGA 5DQGA 3NOGA 1S0OA 4OZ0A 3NXZA 3IGNA 5I3PA 4HTJA 3DMJA 4ECXA 2CADA 1UP1A 3MPVA 2CVEA 2G2OA 4QR2A 1S9FA 1RTIB 1XMQF 2ZHBA 2HQDA 2BX6A 2B4UA 2V8GA 1RAOA 1O6XA 4YDDB 1REVB 2QL9B 3KUGA 1KN6A 2C3UA 2AEJA 3K58A 1GTHA 1TUVA 1CJUA 1U1RA 4LSLA 4RLEA 4TQSA 4A4JA 2K1RB 1C4AA 1DURA 1P6TA 3KMQA 1VOMA 2LXIA 4UW2A 3CJRA 3R6GB 3NP5A 4X64F 1I94F 4AXJA 3C6UB 5BYQA 2IVMA 3TEHB 1ZTTA 3CNQP 1VC5A 3PR5B 4KGKA 2XGPA 2HWHA 1VK8A 1ZAVA 2IYGA 1V5IB 5DGBA 4ZVSB 4DN0A 1ZTWA 4ID8A 1WACA 2PO4A 2MLYA 3F41A 5D15A 1WSVA 4OHZA 1XMOF 3KK3B 4OYMA 3UE2A 2HMIA 4RNOA 4BWMA 3D2WA 5D0GA 1HBNB 3CXCR 1A9NB 4P71A 4NLPA 3P6YC 4OYBA 5DGAA 2B8QA 1S4FA 1VRUA 3LWMA 1ZPVA 4C48A 3KDNA 3KJVA 1CJTA 4U8YA 4C8OA 2PI5A 3D7SB 2RF2A 2DXDA 3US5A 1F5BA 2E9TA 1SIWB 3JSRA 4OZLA 1C0UA 1IM4A 2VPYB 3KKFA 4N8NA 1RZMA 1U1NA 2XWXA 2COLA 4LVOP 2YWEA 3O2IA 5B0FA 3L09A 5F0UA 2IRYA 2CYYA 3M6VA 1LW0A 3GJQB 4FF4A 5A8WA 4MKYA 2LQ5A 4O3RA 2GMHA 3KLEB 3IO1A 2KN4A 5BR8J 4PYDA 4DL5A 2HFNA 1GMVA 5HROB 3H59A 1JLGB 1GTEA 5KFQA 4J37A 2DKOB 3GPAA 2AT1B 1NCLA 1S1VA 3WX8A 5F8IA 3SFUA 3HXMA 2G1HA 1GT8A 3VAGA 4HT7A 3KLFA 2ERRA 4ZP6A 1X9WA 3UN2A 4ZMMA 4PXDA 1UA0A 3MM6A 5KG2A 2R8KA 1YITS 1SJ1A 3MMAA 2XWYA 4P2MA 5D3GB 3CVKA 2H1YA 3LP2A 3NGRA 4DR7F 3DKDA 5GAEI 2RB7A 4LF9F 4LSLB 3OTCA 1OMSA 2X1AA 5I3UA 3EPIA 4B3SJ 4IO9Q 2VL1A 5HMYA 1VBYA 2C2MB 2EG2A 5HATA 1SQFA 4N7TA 3TOQA 4IFVB 3HKZD 4DQIA 2I5JA 4RPFA 5J1PA 3NBPA 1RJJA 2J0QD 5DJBA 4J7CA 4ECRA 1M0SA 1ITPA 3CEDA 2MQ8A 3W5YA 3CDWA 4MYTA 1U1QA 2AHOB 2JWNA 3FZ2A 4DOZA 4LF2A 2CG8A 4Y3CA 2HMIB 2F7VA 2YTCA 4DXLA 2QA1A 3R5GA 5CZXA 2ZOGA 1RLCL 3T1HJ 4YUDA 2B7BB 1VRUB 2KO1A 1OYEA 1AA1B 3KJVB 1CJTB 3U7JA 1OWXA 2RF2B 2EBEA 2IBKA 2I8EA 2GMLA 4C8NA 1C0UB 5ETRA 2VFRA 2VQEF 1YJ7A 3L7PA 3AJ2A 4AQYJ 1KD1T 4HYKA 2EKYA 3BB5A 4DV7J 2KRRA 1ZETA 2XHCA 2EKNA 4QBUA 1SJRA 3CJ8A 3MCNA 4NXMF 5FLXU 3MM5A 1LW0B 1EZZB 4LVNP 1JIHA 1IXKA 1PKUA 2OPPA 4KHPF 1QLNA 5JVHQ 4QIEA 1H74A 2WAQD 2B0GA 3MCMA 4EK2A 3SDEA 3J7YI 2J0SD 4FS1A 4V1Ak 2MKYA 2DGVA 3BM7A 3AD7C 4DV0F 3CCJS 5KFYA 1PG5B 3ZTQA 3GG1A 1YQHA 2UV8G 4QWCA 3PG9A 2MMYA 5L8RC 5KT4A 1WF1A 1N32J 3MM6B 4QOTA 4LF7F 2MHNA 4OHWA 2O66A 1NU4A 3OR1A 4DR7J 2QSFA 2CJBA 2DIUA 1VRQC 4KV8B 4PG8A 5C7PA 1RAIB 3I9V9 3MD3A 5G0RA 1FDBA 3RB6A 2ALZA 5HP1A 4HH1A 4MAKA 1UTAA 3S7RA 4CZCA 3G8TA 2G2YA 4YP3A 2W9CB 4I69A 4ZVPB 4TU9A 2D74B 2BJ8A 1YX2A 4OI3A 1SL2A 1P9QC 2I5JB 3NBPB 2VBXA 4U9RA 3RBZA 3MAQA 3KJNB 1NM2A 3EM1A 3HD2A 1RWMB 2GQ2A 7FD1A 1XK8A 2GIFA 4DV3F 3AXMA 4D3GA 5K14A 4KIAA 3VAIA 4ID5A 2C3OA 3W8PA 3FKBA 3I87A 2YQ1A 2NXNA 4CCHA 1PILA 1S6OA 3SCKE 4CH1A 3K5NA 4ER8A 1N33F 1KDNA 3DHXA 5DZ7A 5KFDA 3OUYB 4NYZA 5CA5A 2DCLA 3PACA 4RKUC 4OJGA 5F9NA 4NLSA 4USVA 3GSDA 3W61A 3UI3A 1U6BA 4ZIVA 1A7GE 3OLAA 5T7LA 4JI6J 2DNLA 1R8HA 4LF5J 1X4DA 3R5BA 3QRPA 2FB0A 1T02A 3DOMB 1DJ0A 3I0SB 2N4DA 3VGSA 2HRYA 1IWGA 1PIEA 4ZJQA 3MM5B 4WFZA 3QMQA 1MU2A 2JC1A 1FXLA 5I3QA 1M5PC 2KFNA 2OPPB 4C8MA 1NK5A 1R8CA 1JXVA 3X1LB 1MROA 1HR0F 2DK2A 3HSJA 5L9NA 4DR4F 1V9OA 2DNQA 2W2MP 1X60A 3RRHA 2QG9B 2CQBA 3PYEA 1WOSA 4QJVA 5E0OA 3CCTA 3ILOA 2HZAA 3UVJA 2DGWA 2KZMA 4DUYJ 2KJVA 2ZE2B 1OY6A 2W2NP 3CD0A 4OL8A 2AV5A 2LEBA 3QO9A 3OR1B 4M63A 2ZNZA 4EYIB 5G0RB 5HAOA 3T9NA 4RUCA 4X65F 2PMZD 4A8SA 5HP1B 4W92B 4U7UK 5A8RA 1V6HA 2BR0A 3NEKA 2KTQA 1RT6B 4GC6A 2IJFA 3EVWA 3PKYA 4H4MA 5ETQA 3OPKA 1UEVA 3CCQS 1NBEB 4O4GB 1D3WA 1JLCA 1VJQA 3J80U 3DFEA 3RBEA 1TKTB 5LXRA 1XQIA 1NJIT 4ID5B 5EUHA 3OHAA 5CQGA 1VS3A 1P9YA 2DIVA 2I2YA 1T9YA 1RE1B 5IOLA 4NI2A 2DR9A 4G65A 4LSZB 4DU7A 2RJZA 2DNHA 2DT9A 3Q23A 2CQIA 3NCPA 3RUBL 2G4BA 2ZDOA 1FD8A 2FY8A 4IUFA 1S9GA 1Z2LA 1TUWA 4QZVB 2VB6A 4FN5A 4M5JA 3I5AA 4KB7A 5T7LB 3H5UA 2VV5A 3OVBA 8AT1B 2EI5A 4P52A 5F41A 1S6PB 3M6WA 4O4RA 4DF8A 2FLNA 2GC8A 4Y6IA 5KG6A 4P10A 5KFVA 5K8MA 4XO0A 1MU2B 2DNYA 1FKOA 2RRBA 2FD2A 1S1XB 4OZNA 2AMCB 3RGIA 5LJ3Y 4PWUA 1LKZA 3HK2A 3G86A 1MROB 1FDDA 4PXEA 2Q79A 1NKEA 2ZEJA 1HR0J 1OIAA 2ZZMA 5KT3A 4YEAA 3K7RA 4FXWA 1HWUA 4F4WA 1XNRJ 5HJXA 1FKPA 1TL1A 2IM0A 4B3RJ 2CRLA 1X5TA 4RBUA 1DFDA 2GV1A 1TKXA 4EZ9A 3UVJB 2HNZA 3KDOA 1VIXA 4FYYB 3C15B 3HCXA 3QO9B 3QRRA 4Y2MA 2GHVC 1YBAA 2N3LA 4F2RA 3H4DA 2V9KA 1O8BA 1H7XA 1NJYA 4GMKA 3BDPA 2KVQE 1RAAB 4OZ3A 2K7KA 4FNIA 2R8HA 4BC9A 4ZJLA 3OJUA 4PEOA 5A8RB 3GIMA 1FX4A 2ZM6J 2UUCJ 4IYQA 2D9OA 3X3UA 4PRFA 1B0PA 4ZLPA 3DLLQ 3CD6S 2F8HA 3I4PA 5F3TA 1WC3A 4A8OA 1SV5B 2YWKA 3AY0A 5D78A 2KFYA 1JLCB 4PZVA 2E5LJ 4HH0A 3LTOA 5KFUA 3IRXA 1RBLA 2R8IA 1XWLA 5E41A 3IM9A 4CLKA 1AB8A 4KHMA 2AGOA 2DPJA 3U1MA 2MZJA 3CCSS 1J5OA 1J2VA 1HYSA 2H54B 3IBFB 4TY9A 1CULA 3QAEA 4NI2B 1YJTA 3DLHA 1IKXB 1N34F 2BMBA 1D09B 1Q82T 2APOA 4G1QA 4J90A 1S9GB 3G6YA 4DCPB 4QWDA 3DLKB 2JFDA 1ZAXA 1N4LA 3L9ZA 2O5DA 2VDHA 1HKAA 4AT1B 4NLUA 2IDLA 4N56A 4JI2J 1SJFA 3GFYA 1ELOA 4YB5A 3MCSA 1FKOB 1SC3B 3HHEA 3FBFA 3HT0A 2VD3A 1V5VA 4RNMA 3I31A 3RB0A 3I32A 3QPIA 3BEGB 1XERA 1RUSA 1A6LA 1AZSA 5EGYA 5KFPA 1W2BR 1EKRA 4DF4A 1FKPB 3LAKA 2E29A 1TL1B 1TKXB 3N6LA 4FYXB 1HMVA 2HNZB 1R8BA 4ZCMA 2IMOA 4U8VA 2HQFA 2DBBA 2N4CA 1WELA 4JI1F 4NRUA 5HBMA 4TKTA 3V4MA 3DXBA 3EGZA 4HKQA 4LF8F 3HX9A 2FVPA 4H54A 3ET6A 2B5JB 2V69A 2D41A 4LRCA 2MQPA 3OL6A 2P2CB 4GC7A 3AJ1A 4LMZA 2XMTA 3MUMP 1VQLS 1XR6A 4URSA 2ZD1A 3TA2A 5LMUF 1DBDA 1HARA 1QUPA 1SL0A 4MIAA 5J2NA 4DZ6A 2OIHA 5KG3A 1Z4UA 4JV5J 3NMRA 4EU0A 4X4SA 1U2RA 1OSCA 3IAS9 3IRXB 2YNIA 1FDAA 1RKJA 1M5SA 2VUGA 5B0CA 4UOCA 1SBRA 4CQ1A 1DZ5A 2B6AA 1HYSB 3H25A 1RACB 4X66F 5IXUA 1CULB 4OI4A 2WONA 4I0WA 2GIRA 3I5BA 4DSKA 4RBVA 4G1QB 3TNVA 3MM7A 2FTRA 3BYPA 2XULA 4FF1A 3N01A 4X4NA 1W26A 3QT8A 4BBYA 2R2SA 5IV4A 3OTOJ 4NPOA 4DFKA 3CUNA 5AXKA 4NWBA 2MZQA 4O3NA 5FJ4A 3M9MB 3GIIA 4XK8C 3CCUS 2CNOB 2OFGX 2BACA 3CF5Q 4YOEA 3CGIA 3G8SA 1ACMB 3CMES 4ZPBA 4PABA 1SC4B 3M2VB 2GCFA 2O01C 4EFAC 3D3CJ 3N5BA 2VONA 1AZSB 4KH0B 3FEZA 2HHQA 4TYBA 4MK9A 2UXBF 3HLUA 3W5ZA 4J9UE 2DGOA 4C0BA 4WTOB 1HMVB 2AJ1A 2XNRA 5I42A 3FUYA 3VAJA 1IBMF 2RUSA 1SQEA 2CQ3A 5F8LA 3TAMB 2FJVA 3QYYA 1NO8A 2QL7B 2R42A 2BQRA 2E9ZA 2DHAA 2MZSA 5IV3A 1U49A 8RUCA 4F02A 4XIUA 4WFBQ 5HBMB 3KXDA 5CH7B 3LO3A 4YY3F 3L7UA 4LF8J 4M1KA 3KHLA 4DR5J 4CYUA 4IO1A 1WNEA 2MSTA 1UZHA 3JSMA 1D0EA 2HFVA 3CWJA 4L74A 3TUJC 1FF2A 2WVFA 1TVRA 1DQAA 4DL6A 5LL6d 2ZD1B 2FVSA 4F4XA 1KVJA 3TZZA 3M8SA 5J2NB 2XMVA 1LFPA 1SKUB 3J7ZT 3W7BA 1K0VA 2HK2A 4E2FB 1UFWA 2QLWA 5JMNA 2P9EA 3Q89A 3MR3A 3BSAA 4OYAA 2B6AB 1VBZA 1X4HA 4FZVA 3FSYA 1TTHB 4C2MA 3E51A 2AW0A 4X66J 2PA8D 2KG1A 4KE5A 3I56S 3RYLA 3JAMU 1X4GA 5LT5A 1T05A 3EE3A 1XR7A 4AL7A 2AWZA 2OGUA 5DDRC 1NJXA 4B3TF 3L3CA 2DO4A 2FGOA 1TKDA 1IVZA 2ZVIA 4DV4F 2DR7A 4RW7B 1WKKA 5KFIA 5DO2A 2IAJA 2RQMA 2DGSA 4QIVA 2BANB 2V8PA 4JI5F 4TU7A 2E1RA 4LFBF 2OKQA 2OMLA 3PYDA 3OFEA 1RWUA 4MTPA 2BYCA 1RU2A 1FI4A 4DR6F 3RRGA 2X3DA 3A3PB 4OX8A 4ZVOB 4K4TA 3MCOA 2RQKA 4ZKAA 3BREA 1JXLA 3MTJA 4M94A 4R25A 4YN3B 4CNYA 1O5JA 1RAFB 1NNDA 2MLXA 1VRTA 4F3QA 4OI6A 2LKZA 5L1KA 3C2PA 2ZBRA 4QWAA 4B08A 1HL6A 4CYUB 4DR1F 4I68A 1VQOS 3CJSA 3JSMB 4UUXA 3CJ4A 3CCES 2HVIA 1TVRB 1HQ2A 3GONA 3JSYA 4AXIA 1X4FA 2P8IA 4CLPA 2B43A 1RT3B 3UW1A 2BDPA 2WB1D 4DV1J 2YKQA 2OD4A 4B3OB 1NDKA 1PO6A 1EAYC 2MTLA 2UU9F 1TAQA 2JZ5A 1RK8A 1RHQB 2CQ2A 2IRXA 4ELUA 5B0DA 4CO2A 4YS2A 1JLBA 1NXIA 1FVQA 1EQMA 4F4AA 3GIJA 2W4DA 4CNZA 4O44A 3R27A 2WCXA 4JI3F 1N5TA 1EIYB 2KI2A 2H5JB 4TVAB 1T05B 5EWFA 3D6MB 3FC9A 2VG7A 1OYDA 1JLQA 4C6AA 2ZZTA 3RJMB 4ITSA 2HHUA 1MN9A 4IRKA 2UUBF 5A6WA 4JI8F 2EVZA 3ZC4A 1TFYA 4Z7CA 2IAJB 2IBOA 4Y28C 4LF6J 3S6EA 4CTAA 3V6KA 5H1SV 5GMEA 1BWEA 4X62F 5JVGQ 3UO0A 3T19A 2BZ2A 2AJFE 3VZIA 1WKJA 4JBCA 4BCAA 4KFBA 3TA1A 4KTQA 2BE2B 1FJGF 1ZBTA 5KFNA 3AD8C 3M4XA 3T5LA 1WDDA 5C24A 5LMNF 3GV7B 4JV0A 2RT3A 1N36F 1BLUA 2LDIA 1T03B 1S99A 1UWAA 3MMBA 3IGVA 3G6ES 4TXSA 2OJ3A 2DGTA 5HMWA 1CLFA 1NKBA 4QR1A 3NAIA 4B9NA 3CT9A 3TX8A 3OR2B 2QMWA 1RHRB 3EUNA 5SZTA 3IMQJ 2YNGB 4RW4A 4TNOA 3POTA 2Z56B 4ETXA 4CDIA 4KGVB 1RADB 4WYWA 5AE2A 1AFJA 4OX9F 3SCJE 3M6UA 1NRKA 1YBTA 3CD5A 3PTWA 3TAPA 4DR3J 4NYPA 5RUBA 2ZUAA 1ZH5A 1TR0A 4WBFA 1FRIA 3G82B 1VBKA 2GO8A 3BV8A 4IR1A 2OTLS 3SSSA 1HA1A 4PXBA 2DH7A 3I82A 2C22A 2MJUA 5CYJA 3I6PA 5HLFA 3PRBA 4NXNF 3VVTA 2WBMA 4GKJF 1U8WA 2JJ4D 3NS6A 3VGUA 4NYOA 1VCTA 1JLBB 4NLYA 3EICA 1WF2A 4HHUA 3A8JA 3CDBA 4Y2CA 4TY8A 4O44B 3OTEA 2HRTA 2YKAA 5CABA 3CJ3A 2MQLA 3J81U 2A2DA 1BY9A 4EWTA 1RTJA 3PRDA 2VG7B 2DNNA 4B17A 1JLQB 4LFAJ 2VQFF 2B3TB 3RZAA 4RZRA 4JB8B 3D54A 1OY9A 2BM0A 4L76A 4HT5A 1RISA 3KK1A 2RE1A 4FP9A 4NA3A 1FKAF 4Y2IA 4JI8J 5GMDA 3R5JB 4JYAF 2KYZA 3FCHA 1F2GA 4ZLNA 3SIPB 3TJ8A 2G2ZA 1GFWB 3JTPA 4CTAB 1AUSL 4FKXA 3M32A 4WYLA 4WP3A 2JH3A 3CC2S 1CBKA 1WORA 3SQGA 4KFBB 3E8OA 3ZZOA 2D9PA 3O8WA 4LUBA 4FXDA 3GLJA 3SI8A 2R4FA 2BBEA 4IOBA 2NCKL 5GADU 2R8JA 2HURA 1IKYA 1MWZA 4BC7A 4USTA 4DV5J 2CDQA 3DLEB 5C25A 2EPIA 3FNNA 4I56A 4DL4A 5EWEA 1LWEA 5IWAJ 3N9UC 2PMWA 3OJSA 1L3KA 3MZIA 4C9DA 3OW2R 1HNXJ 2UVWA 3R5DA 3CE8A 5IC6B 4K4UA 1TL7B 3D6HB 3GR0A 3POTB 4IOCQ 1SH3A 1YRTA 4DUZF 2HVZA 4NRTA 2V94A 1TFWA 2RS2A 1MMLA 2IDEA 2A3JA 2X1BA 3G2XA 5KT5A 3JYTB 1FJCA 2LQ9A 1AROP 2FJAB 3FJ2A 4WP9A 2I38A 4X84A 2VKRA 3TANA 1CSJA 4LREA 2DY1A 4C11A 2ILZA 2D69A 3CSKA 1BQMA 4DFJA 1LW2A 1C0TB 5HLFB 3AB4B 3QSIA 4NXNJ 3N28A 3LP0A 2AJ0A 1N54B 3K8WA 4URGA 4DL7A 5HQ8A 2XMMA 3RG6A 4H4OA 5HVFA 4TY8B 2J9CA 2W4PA 4Y65A 1NMEB 2DR5A 2DD8S 5DG8A 3T3FA 3OFFA 3B4DA 3V5RA 3W2VA 3PHTA 2ZZNA 4MH8A 1RTJB 4YHHF 4ETZA 4RUHA 1HQEA 2P6TA 4RW9B 4WKRA 1QTMA 3P8BB 1G1XA 3ISNC 4ZP7A 3KK1B 4ZVQB 4MFBA 5FIIA 1KTQA 4ILMA 2XCAA 2VZ9A 3VAFA 3K5LA 1TMJA 4ZVEA 1KSPA 5KFBA 2C3PA 2XS5A 3M6XA 2Y1RI 1TK0A 3ILIA 4F0HA 4QR0A 1WC6A 1Y3JA 3M32B 4N76A 1K0TA 3GSIA 1F3FA 1FXDA 2OELA 2KVIA 4ATNA 3DLJA 4OI1A 4WPAA 1H2VZ 2GHPA 3FEXB 3NWGA 1RWPB 5D0RA 5C25B 2BOPA 1TAUA 1LWEB 4I2QA 4TU8A 3D0IE 2CQDA 4ECTA 1P1TA 1N5SA 3QT7A 2LCWA 3PO4A 3A3OB 1G6BA 1V3RA 2GHWA 2XG8A 4F2SA 4LSNA 4JI7F 1HWKA 2VBZA 3GCXP 1HHTP 1LWXA 1YJNS 2CQ0A 1YKWA 5EX0A 2Y0SD 1KFDA 3HO1A 2CKWA 3BQ1A 1G3OA 1UJ5A 3NAHA 4ZS6A 2DB1A 3QT6A 4R8UA 2FGCA 1HFEL 1K47A 1QAYA 3BBFA 3HD1A 2YNFA 1FRXA 1Q16B 1BC6A 2CQ4A 1FO1A 1S49A 2CJYB 2E7VA 1NH7A 4O3QA 4ECQA 4DL3A 2K8GA 2CQPA 4HDGA 1LW2B 3T41A 5HI7A 1RAGB 3LP0B 3K89A 1MWYA 3CCRS 5ETTA 3UD3P 2HG4A 5JUMA 1U25A 4USMA 1PBUA 2PC6A 5IT0A 5D0EA 2G0CA 4H4OB 3RW6A 4UZCA 1QAIA 4ZVFA 3V4IA 4JV2A 3V6JA 1T11A 5GAEU 4ZVGA 4EBEA 2EC2A 3BGRA 1LWFA 2CNKB 3RR7A 2CIMA 2DNOA 2L9WA 4NLVA 3LQVA 2K2PA 4DV2F 2ZHAA 1HQEB 4M5IA 3ENAA 1SKSA 4OHXA 2J7KA 4P2FA 3D1OA 2MY7A 2D7SA 5KFAA 4KO0A 4MFBB 2NZCA 2HBRB 3D1QA 4L3KA 5HJYA 3B82A 3VHQA 4U95A 2R7QA 2UVRA 1YHQS 2Y8WA 3CC7S 1WD6A 1PSDA 3GV5B 2IA0A 1BMQB 4R5PA 2Y3YA 1QSSA 1YDLA 5DETA 2M7SA 2AJQA 2PE8A 4JOUA 3NGKA 2HFSA 4NLXA 1RTHA 4ZHRB 5I4MA 2XYHB 1N8RT 3GWCA 2LFVA 1NB7A 4O3OA 2ZVSA 1VQ9S 2KRBA 3TRGA 1VQKS 1Y4ZB 3H20A 1FFWB 2HAIA 2PT0A 5AXMA 3NCRA 2OSQA 2QFJA 4LSNB 3ULHA 1YJ9S 4JI7J 1F0XA 5LXYA 3FGVA 1OO0B 2KM8B 3DXSX 5HN0A 2OD6A 1VGYA 1RTZA 1H7WA 3JB9k 4LRDA 1GX5A 4ED0A 5FDLB 2JNJA 4KSEB 5IM0A 2P9CA 4G1IA 3W5XA 1JB0C 4ZJOA 2YNFB 1Q53A 1JJCB 1MNEA 2ZH7A 2XLIA 3EXCX 1LV5A 3IR7B 1UL3A 1JJ4A 1IBLJ 2EWHA 4ZCLA 4TLQA 3TQ1A 3H42A 3PR4A 2PDAA 3GFXA 2J8SA 1B64A 5KFLA 3SYZA 1GQEA 3IN5A 3V4IB 4OI0A 3BH7B 5IT4A 3LOUA 2RQ4A 1RAHB 3BBBA 3TJ9A 1NJWA 2R2TA 3G6VA 4LBIA 3IXQA 4IKAA 1S5ZA 5KFZA 1D9AA 1B0TA 1U1OA 1K1SA 3G9CA 2CXEA 3MEEB 3BPDA 1B70B 4KO0B 4DPXA 4LRBA 2R7SA 2NR0A 2W8KA 3WQPA 4DX6A 1O0PA 1UKUA 2RKIA 4USUA 2HVEA 2ALYB 3NG8A 3DHWC 2CG4A 2LA4A 2AP6A 1PJ6A 4K50A 1FWPA 4UF4A 4R5PB 5GAHU 3H4BA 2QN6B 3BGUA 5DS7A 5HK4A 2GVDA 2UV8A 2VKZG 1H2UX 4WKYA 5KOWA 1RT5A 1WC1A 3W2WA 1KNZA 1T9UA 2AJ4A 1RTHB 5EDWA 1UJ4A 1N48A 1XNQJ 2HVDA 3UQSA 2M0GB 2LMIA 3PEHA 3DRYA 3OFHA 4O23A 2L9NA 2PFDA 3CCVS 1HBMA 5GAGU 2EG1A 4I2PA 1S79A 1GXLA 3JQMA 2Z2MA 2FHMA 1NPPA 1RI7A 2VG5B 2BM1A 1J5EJ 2IPOB 1I51B 4KGMA 1WWHA 5IM0B 3VGTA 1DTQA 3PCOB 4ERDA 3WIVA 2X7IA 4GKKF 1X0FA 4YR3A 1ZM2A 2JVOA 1N0VC 3DLBA 1VJWA 7FDRA 1TK8A 4USJC 4RNNA 4WFNQ 1I3OB 1UWBA 4WIQA 4KYZA 4NLOA 3ENVA 2H4WB 3DOLA 2LA6A 5KAKA 1HWIA 4OI2A 3QFWA 3P4UB 2XY7A 3PVXA 3MTKA 4D3HA 2D1CA 1CJKA 1S6UA 4OHVA 1PAEX 2JEIA 3GJSB 1HNIB 2VPWB 3KLHB 4CLUA 2JC0A 3OSPA 2B56A 2OPSA 2YKOA 4PYAA 3C14A 2AKWB 4Q2MA 5L46A 2MPUA 1NJZA 2W24A 1C2PA 3WHIA 4C8YA 3P49B 2CPJA 4ZPVR 2YH0A 2V8VA 4CT8A 1FFGB 3DOKB 3EVOA 2HRUA 1X9SA 2DITA 2XI2A 2EK6A 2KZZA 1MN7A 3BDEA 2GVDB 3M8PA 4CH0S 1KLMA 4NEYA 3NGDA 1RT5B 1LWCA 2Z2ZA 3M1VA 4ZLLA 2MKIA 1IBKF 2DR8A 1R8AA 2AGQA 4QYRA 2X3GA 1WTFA 4RX6A 2V6AA 2MHEA 2BW2A 4J9KA 1MW7A 1HNZF 1WHWA 4B9MA 5FD1A 2V0NA 3TYTA 2XMUA 2F4VJ 3QRQA 1HBMB 1SQGA 2R2UA 3I5CA 2XEXA 2KG0A 1UFKA 3T1YJ 2DISA 5J1EB 1VQSA 2HQGA 3R6LB 3EXYA 1KQSR 4DCOB 4CLWA 4WXOA 4C98A 1LK5A 2LECA 3KUEA 3AXKA 4USHA 3C3LA 3OXGA 3Q22A 4B3MJ 2GQCA 4DL2A 2VA2A 1RABB 1U1PA 5E5NA 3M8RA 1KC8T 3HPOA 3BN7A 5IS2A 1C1BB 2VBYA 3LANA 2VHGA 1P27B 3EGNA 3PHEA 3KLGB 2KM8C 1UWBB 2HNDA 1QSLA 3M9NB 2JEGA 2GO9A 3TUZC 5T41A 4NX9A 3DOLB 2V4JA 1NSPA 5BXIA 3RW7A 3DI6A 2ADBA 3W1YC 3DRXA 2YNHA 2FQQB 2BQUA 2I9SA 5DM7Q 4DUTA 4I7FA 1NK9A 2GW8A 1CJKB 1FESA 4EYHB 2OAUA 2FJBB 1GXUA 5IT9Y 2M88A 1UA1A 3HT3A 1FTCA 2OPSB 2YVSA 3AA9A 3MUVP 3FRZA 2LEPA 3C14B 2UXCJ 3IC1A 1PC5A 3FBBA 3ICLA 1FNOA 5CD4A 3LH2S 2J7UA 1WHVA 4DN9A 1SC6A 3KWMA 1MSWD 4NCGA 3Q8UA 2DCUB 1FEHA 1Z1ZA 4AL5A 3K2YA 3GIKA 2B9YA 2VOOA 1ZAWA 1S1UA 5A8KA 5ETNA 3M8PB 4EI2A 1RA6A 1LWCB 1Q8LA 1X4EA 2H5IB 3R2DJ 1EETB 1T9TA 1UMJA 2ZFHA 4DPYA 1PBAA 1WUUA 4A8YA 4JI0J 2B9WA 4ZOSA 1HNWF 2HGLA 1RQ0A 1C1CB 3K57A 5KG0A 2DHHA 1BUXA 4ALZA 2C3YA 4FYWB 1RWWB 1LNQA 4KBIA 4PUOB 3MM9A 1FERA 3E01A 2NUUG 2OEJA 3MPUB 2E66A 3RTVA 2ROEA 3TZXA 5DM6Q 1J27A 4B9LA 5KFSA 4YR2A 3QT5A 3J7AN 2HIYA 4RW8B 2HHVA 2J0XA 3D6FB 3VWSA 1LOUA 3CJ2A 2EC0A 2IA6A 2AQ4A 3CPWR 2IHR1 2OPQB 2ZH8A 2QA4G 2HNDB 1WDTA 1YZ6A 4DFMA 4I4BA 2GX8A 3HULA 1F2HA 5K8OA 2V4JB 1HQUA 1MG7A 3DI6B 3PIOQ 2YNHB 1VQ4S 4ICLA 3AFGA 4DHVA 4I7FB 3N79A 3UPFA 5KFJA 3LALA 2QA2A 4I6AA 1XN9A 4K4SA 4XDCA 1U0SA 4HR2A 2C2OB 2RIJA 2ZBIA 3W63A 3M05A 1M5HA 4XDDA 4FVCA 2ZH2A 1BQNA 4F36A 2E5HA 2J6SA 5AXNA 1FRKA 4Z7YA 2CPEA 2LEAA 2CPZA 1L5UA 2XQCA 3FZBA 4DWIA 4P73A 4ZVHA 4NCGB 4RUAA 1Q79A 2Y1IA 5KFOA 3DMJB 2ZJPQ 2CJAA 2MZ1A 1N56A 4RU9A 4RBTA 1KONA 1S1UB 1V3SA 3IG1A 4IR9A 1XMQJ 3PO5A 2Z2YB 4ZPWR 3MI7X 1VR6A 2UUWA 1CJUB 2HHPA 3VQSA 1GAOA 1IWAA 2KL8A 4KRWA 2R3VA 2UUTA 2KXNB 1CQNA 2YPZA 4K7QA 4LF4F 4P7VA 1VYAA 2CAJA 2VBWA 4X64J 1I94J 2HSEB 2GGPA 2XO7A 2KT5A 3PW5A 1UVKA 2QLJB 4V19J 1PJ5A 3IWLA 1ROFA 2ASJA 3L7OA 4FF2A 2ADCA 1R6VA 2I0XA 1XIQA 2ZH4A 3MM9B 3QBCA 4EUVA 1Q0NA 1VIOA 2FUG9 2YKMA 3JAMY 2EBGA 4CO1A 1XMOJ 1SJ4P 4WFXA 5DDPC 1S0VA 1H3DA 4DR2F 3BKTA 2NPFA 1ZA1B 3QSYB 2CVIA 2C42A 5CYQA 2NXCA 4YB1P 3R7NB 2L3MA 2ZH9A 1DQ9A 1Q8BA 1B7YB 3KHHA 3HSDA 2U2FA 4ANEA 4DG1A 4PQUA 4RR5A 1HQUB 2H48B 2C1EB 4ZPAA 2HQIA 2V50A 3M8QA 1U8SA 3TQEA 1JWWA 2JEJA 5AJ3F 2QMUB 2GVZA 2VPZB 4O3SA 3HFZB 3CC4S 4QIGA 3TEGA 4R0JA 3S1TA 2YX7A 2L41A 5A8WB 4KAIA 2N7CA 3TI0A 3HDSA 3UN3A 2AIRB 5HVGA 1QY7A 4UOHA 1LXNA 3FCVA 3MECA 4M5MA 2DRAA 4Q45A 3H2LA 2VF3A 2ASLA 1TUGB 1S1VB 1K73T 4LR8A 1X31C 4Y2AA 1DHMA 4DX8H 2BABA 1H38A 4KJIA 3KLFB 2KJWA 4M5DA 3KNAA 3M8ZA 2XB2D 2WSEC 2HEKA 4RWWA 2HS0A 3QIDA 3M2RA 3W8GA 3UR0A 3IG1B 3MMAB 2YWFA 3TR5A 1CS4A 2FHOB 5ETSA 4XAKA 4DZDA 3LP2B 1RHUB 2CPDA 3BJYA 1N5QA 4ED7A 2ZNYA 3PM9A 1PYOB 1RAEB 1Q78A 4LF9J 5KTQA 3BBCA 2B4PA 2R9LA 4UOFA 1EHWA 3OXLA 3TA0A 4HLBA 1WG5A 5I3UB 2CZ4A 1SI9A 4LF4J 2R7RA 3HKWA 2GGPB 3TW0A 1HIYA 3R5AA 3MUTP 3ZZZA 3Q2TC 2QSWA 2M2BA 1FA0A 2VFTA 3PY8A 3W60A 4WU2A 3EZOA 3BO3A 2EFNA 1Q81T 3FMWA 4EGLA 2YKMB 3J7A1 2WB4A 4ES3A 3UN5A 4M5KA 5GAHI 2J76E 1QDUB 2HHHF 1SUQA 2DNGA 4F25A 5L1LA 1S7HA 1ZM4A 2RAQA 3DNCA 5CYQB 5CZVA 1WF0A 3CO0P 2DEIA 3IS9A 1NB2A 2KKHA 2QA4S 1RCOB 3MMCA 3VTIA 3RAMA 3GE9A 3M8QB 2VQEJ 4J9PA 4ZPTR 4QU6A 1Y11A 5GAGI 4NA1A 5AE1A 2GVZB 2W9BA 1Q7LB 4NXMJ 5AE3A 2BRLA 1PCAA 2XO6A 5J2MA 1FJEB 2ROGA 1TL3A 4KHPJ 4PPZA 2KH9A 3SDEB 3E3XA 4FDFA 5ETLA 3ZZTA 3MECB 2MY8A 3UDVA 4K0KF 1ZS6A 2FPHX 3CJKA 3UNYA 4L73A 3Q8PB 3QWUA 4DV0J 3TO8A 3BH6B 2OSRA 4KKOA 5HVHA 4GVLA 4QPXA 1KVKA 1UJ6A 3UD5A 3C46A 3DN9A 4CRJA 2MKSA 4C8ZA 1K8AT 4HHHA 4QIWD 2F4FA 2VFUA 3CW2C 2BJ9A 4LF7J 2UVUA 4KPYA 1KQFB 1F9FA 4DV6F 5J2PA 1SIZA 2A2CA 5ETKA 5HQMA 2XY5A 4FVMA 2MB0B 4DX7A 1BWVA 4N47A 1VI7A 2CWKA 2VJVA 4LFCF 1I6JA 1UPPA 4OQJA 1W25A 3MEKA 2N82B 2NYHA 2B8PA 2RDDA 1U6ZA 4W90B 3HSZA 1GX6A 2VPXB 2V67A 4PWWA 1VQNS 4QYZK 5B0GA 5D4OA 3J81Y 4DV3J 2LXFA 5K14B 3M8WA 3TVYA 1SUQB 1X0PA 2CPYA 2FY1A 3VALA 2CZ9A 3K0JA 3EPGA 4DFPA 2JOQA 1N5VA 1EP4A 2I1RA 4ENOA 2BJ1A 3FEYB 1ZM3A 2B51A 1N33J 2YBVA 1UEKA 3FSXA 2CPHA 4RW6A 3MMCB 2BRKA 2VG6A 3OD2A 4FBUA 4IG0A 4R0EA 5CD4H 3D4JA 3JSBA 2HAFA 3TZYA 2ZHOA 3BR8A 1YJVA 2FIUA 4K4XA 3IM8A 4CLYA 2W9BB 2MJNA 1KVIA 4CWBA 1GMWD 1M5KC 1D1UA 4ZK7M 1PGZA 2JLEA 1WC4A 1TL3B 5SUHA 2QL5B 4WFAQ 4J9SA 1UAWA 4DQQA 2DH8A 2NSCA 2GJ2A 2V63A 3T6BA 5K20B 3HHLA 3CJKB 4DR4J 4UUWA 2W1BA 5KG1A 2H3EB 2POKA 3CB4A 1RA7A 1S48A 4YMEA 3V2UC 4KY3A 3TVZA 2WHOA 9RUBA 3GG0A 1RBAA 1F9HA 2B9EA 5A6PA 1UVJA 1IQZA 1R0CB 4Y00A 2HVHA 4WTYA 2V9WA 2CQGA 2F9JA 2AEMA 1IUJA 2HIQA 4ZDNA 3W64A 2AYEA 5D4NA 5F8MA 2Z4PA 5J2PB 4U6PA 4DV6J 1S76D 3IFEA 1HBOA 1JJHA 3HM9A 3AA8A 5K8NA 1RWKB 3M2UA 4LFCJ 2L08A 4X65J 1TQLA 1TU0B 1X5SA 1VC6A 3U1NA 3AQOA 3DM2A 3DLGA 3AOBA 1RAJA 2E1PA 2VFSA 4M5GA 3D3BJ 2WBRA 2C2ZB 3MAHA 3N0VA 4MT1A 4B02A 1IR2A 4H4MB 4W98A 5KFTA 1VBXA 2M4MA 1R43A 2W2OP 4HVZA 4DX5A 1RT1A 4QWEA 2DVIA 2QC3A 4LRAA 1M1KT 4TQRA 1QVGR 3GYNA 2VFVA 1FEEA 2MXYA 3K5OA 4F3MA 3NGSA 2D3O1 5BYSA 1EP4B 2O3DA 1VQPS 1QM9A 1D8YA 2YY3A 2XZDB 2LQ8A 4RW6B 1JLEA 2ZC3A 2W25A 3SV4A 1L3VA 2X51A 3AHPA 4FXVA 1FDNA 3CCLS 2QMXA 4W4MA 1R31A 2CPXA 2A0FB 2R7OA 4USWA 4E0DA 2DRDA 3LF0A 4FBTA 4C8KA 4KT0C 2GIQA
chains in the Genus database with same CATH topology
1Q16B 3IR6B 2FVRA 1BC6A 4B9UA 2CQ4A 1FO1A 1S49A 2WTFA 3THVA 4LF7F 2MHNA 4OHWA 1NH7A 2O66A 1YI2S 4O3QA 5DLGA 4ECQA 4F4KA 1NU4A 3OR1A 4DL3A 2K8GA 4LFAF 1HBUA 2CQPA 5KFFA 4HDGA 1LW2B 2QSFA 2ZKTA 3S8SA 2CJBA 4I2PB 4OLOA 5HI7A 2DIUA 4YB6A 1PC4A 3LP0B 3KK3A 4KV8B 3GR1A 4PG8A 3I9V9 3MEDB 5CCMA 2GFFA 1MWYA 3CCRS 5CYMA 4JI4F 4A8WA 1VQ6S 3MD3A 1RYSA 5G0RA 4QW9A 1XR5A 3UD3P 1FDBA 2HG4A 5JUMA 1U25A 2CJQA 1I1GA 3LAMA 1M90T 1WEZA 2PC6A 3RB6A 2ALZA 2KDOA 5HP1A 4HH1A 4MAKA 1QAXA 2JSXA 5M2PA 5CXTA 3TVKA 5IT0A 2KT3A 2G0CA 4H4OB 3RW6A 3S7RA 1QAIA 4CZCA 2FHKA 4ZVFA 3G8TA 2NQPA 4YP3A 2Q3PA 3V4IA 2W9CB 4I69A 1WG4A 3V6JA 4JV2A 1IKVA 1DTQB 4TU9A 2D74B 5HO4A 5GAEU 4K4ZA 4ZVGA 3KLVA 4EBEA 4OI3A 4RNHA 4MMOA 3PW2A 1P9QC 2I5JB 3BGRA 1SL2A 2W7AA 3NBPB 2IVFB 1LWFA 2VBXA 4U9RA 3Q8RB 4DQSA 3MAQA 2CIMA 3RR7A 1SJ3P 2DNOA 2L9WA 3ENWA 3KMSA 4NLVA 3KHRA 4F67A 3LQVA 2K2PA 1CC7A 3BN4A 1AFIA 4F26A 4DV2F 2ZHAA 1YRUA 1HQEB 3AH6A 5L1IA 1SKSA 3DDKA 4OHXA 4UY8T 2GQ2A 2QV6A 7FD1A 1XK8A 2J7KA 1HBOB 5KFEA 4DV5F 1TKZB 3D1OA 3DU6A 3IRWP 3GMGA 3OLBA 2ASDA 2MY7A 4DV3F 3DLEA 1VHFA 2D7SA 4D3GA 2ZOFA 5K14A 4KIAA 5KFAA 3BSOA 2OPRA 3VAIA 4C0HA 2L48A 2LQJA 3M2UB 4CO5A 4KO0A 4MFBB 4X4PA 3C6TA 4ID5A 3D1QA 5IWAF 4ED8A 2C3OA 1U1KA 1T95A 4HHJA 1X7VA 3B82A 3I87A 3DM2B 2MZRA 5HL7Q 3DLGB 4CCHA 1PILA 1S6OA 4Q8FA 3SCKE 2R7QA 2UVRA 4L6V3 1YHQS 3CC7S 1HNXF 4CH1A 3K5NA 2LVWA 1B0VA 3PFOA 1WD6A 1PSDA 1N33F 5BR8F 3PNIA 3FFIA 3KYLA 3GV5B 2IA0A 1FCAA 3DHXA 5KFDA 2KFZA 2BV3A 4H4KA 5HROA 5H9FJ 1JLGA 4R5PA 1YJUA 3OUYB 2EFQA 4NYZA 5CA5A 4FS2A 5D6GA 2ZH1A 2DCLA 2MKHA 3PACA 1QSSA 4RKUC 4OJGA 1WG1A 5F9NA 2XC9A 2RQCA 4J9QA 4NLSA 1FE4A 1Y5LB 3MMJA 3ZZYA 3GSDA 2VC0A 5DETA 1G7CB 2DGXA 3UI3A 1RT1B 1U6BA 1JX4A 2J0WA 2M7SA 1A7GE 2AJQA 3AQPA 3OLAA 5T7LA 2PE8A 4JOUA 2DNLA 1R8HA 5F9LA 4USIA 3NGKA 1X4DA 4NLXA 3R5BA 1RTHA 2FB0A 4ZHRB 5KFRA 3JYTA 3SSQA 1T02A 4WJBA 3I0SB 1DJ0A 5I4MA 2KXFA 5KFHA 2N4DA 1FT8A 2HRYA 1N8RT 3GWCA 3IWXA 4DQPA 5DLFA 1NB7A 4O3OA 1U7LA 1FXRA 3MM5B 1J5OB 3KOAA 2P5VA 2ZVSA 4WFZA 1VQ9S 1L3TA 5D3GA 2KRBA 3QMQA 3TRGA 1MU2A 2JC1A 1FXLA 5I3QA 1M5PC 1VQKS 2DO0A 1Y4ZB 3H20A 2KFNA 6FD1A 2OPPB 4C8MA 4HI1A 4QW8A 4EO6A 2HAIA 2PT0A 1NK5A 5AXMA 1S97A 2CJKA 3PKMA 3NCRA 1R8CA 3PIPQ 2OSQA 2QFJA 1C0TA 1WHYA 4LSNB 3ULHA 2ZKUA 2PI4A 5B08A 1YJ9S 1MROA 3X1LB 1HR0F 3DRSA 1Y5NB 2J7WA 1F0XA 1JLEB 2DK2A 3CDUA 3FGVA 4LT6A 5LXYA 1JJ2R 1OO0B 5L9NA 2KM8B 3SCLE 2DPIA 1V9OA 4E8UA 4DR4F 1KRPA 1S1WB 3DXSX 5HN0A 2F9DA 3V81A 2DNQA 3OQ2A 1GXTA 3RRHA 1KLMB 2OD6A 3MFHA 1L3SA 1VGYA 2IM1A 4B3SF 1W2IA 1H7WA 3JB9k 5HMZA 1GX5A 2CQBA 3M1VB 5KT7A 4ED0A 5FDLB 3BO4A 4C3MA 4KSEB 1GH8A 5IM0A 2P9CA 4QJVA 5E0OA 3CCTA 4IH5A 4G1IA 4IFVA 1CVJA 1Z2ZA 1JLAB 1JB0C 5L9XA 3ETOA 3PX6A 2DGWA 2YNFB 1Q53A 2KZMA 2W7PA 3HZEA 2KJVA 2ZE2B 2WOMA 1MNEA 2M9KA 1D8ZA 2ZH7A 2XLIA 3EXCX 1LV5A 3IR7B 2PSZA 3CD0A 4OL8A 2AV5A 1D9FA 2LEBA 1UL3A 3QO9A 3OR1B 2F8MA 4NLDA 2D3OR 1HBUB 4PKDB 3GFZA 4M63A 1JJ4A 3OL8A 4RW9A 2ZH3A 3LUYA 3CCMS 2ZNZA 4EYIB 3BGLA 2N7YA 2EWHA 4ZCLA 5CYMB 4ED2A 5J2QA 4YR0A 5G0RB 4PCQA 4TLQA 3T9NA 4RUCA 2IMWP 5LSOA 4X65F 3TQ1A 2RMLA 2PMZD 4A8SA 5HP1B 3PR4A 2PDAA 1NHUA 3GFXA 4Q5VA 2JX2A 1URRA 3P3DA 5KFLA 4W92B 3SYZA 1IN0A 1B64A 1GQEA 4U7UK 2GA7A 4CIOA 5A8RA 3IN5A 4AFFA 3V4IB 4OI0A 4DDFA 3T1HF 1IKVB 1V6HA 2BR0A 5DG7A 1NK6A 3ISZA 5IT4A 1ZPWX 2KTQA 1RT6B 3LOUA 4GC6A 2RQ4A 4ECUA 2IJFA 3F44A 3I55S 3PKYA 4H4MA 4ED3A 3OPKA 1S6QA 3RRKA 1NJWA 2QO3A 2M8HA 2R2TA 3G6VA 3QGHA 3UCGA 3IXQA 2YX4A 4IKAA 1TV6A 5KFZA 1D9AA 2F3JA 1UEVA 2QT7A 3CCQS 3I96A 5D77A 4AQYF 2EFGA 1B0TA 1U1OA 4O4GB 1D3WA 2NUHA 1JLCA 1X5PA 3MR6A 4DV7F 1K1SA 2XS2A 3G9CA 3DFEA 3MEEB 3H98A 3PDNA 3RBEA 2OPRB 3TP2A 3VCDA 4DQRA 4KO0B 1TKTB 2VASA 5LXRA 3C6TB 4ID5B 4A8KA 1NJIT 5EUHA 4JUZA 3ITHA 2R7SA 3WZ0A 2HGNA 3OHAA 2NR0A 5CQGA 2W8KA 1T7PA 5KOXA 3BO2A 1O0PA 1VS3A 1UKUA 2RKIA 1VQ7S 3LGMA 2DIVA 2I2YA 4HTIA 1M5VC 1DARA 3NG8A 3Q24A 5F3ZA 3R1LA 3DHWC 1UVMA 2CG4A 4N8OA 4WF9Q 2LA4A 4OX7A 2AP6A 2YWGA 2DR9A 1XTZA 3BR9A 2RJZA 2DNHA 2DT9A 2Z2LA 3FFIB 3SXLA 2E5IA 2IM3A 2CQIA 3Q23A 3BSNA 2Q66A 2BJDA 4K50A 4WK1A 4B9TA 3QLHA 3NCPA 2ROPA 3RBDA 4R5PB 3DC2A 5GAHU 2MQNA 1H2TZ 3H4BA 2G4BA 1V3ZA 2ZDOA 3BGUA 5IZHA 1FD8A 5DS7A 4IUFA 1S9GA 1Z2LA 4CO3A 2KB2A 3MXHP 2UV8A 2VKZG 1E6YA 4QZVB 2V8HA 4HL9A 2YX1A 1H2UX 4WZQA 2VB6A 4FN5A 1Q1KA 4WKYA 5KOWA 3I5AA 3BF4A 1RT5A 3BZQA 4KB7A 2RUGA 3W2WA 5T7LB 1KNZA 3H5UA 5BJRA 2VV5A 3OVBA 1QJHA 2Q43A 2EI5A 3OHBA 2AJ4A 4EEYA 1RTHB 3V6DA 5F41A 3S01A 5EDWA 1S6PB 3M6WA 4O4RA 4DF8A 3CMAS 2FLNA 2E1AA 2YNIB 1RGVA 1UJ4A 1N48A 2GC8A 1N32F 3HZGA 5KT2A 2DHXA 2M3DA 3DRRA 4Y6IA 5IQ6A 1Q86T 5KG6A 5KFVA 2RVJA 5K8MA 4XO0A 2HQ3A 1MU2B 2PD1A 2DNYA 3PJXA 1FKOA 3Q8SB 3UQSA 2M0GB 5EX3A 2LMIA 3PEHA 2BJEA 2RRBA 1VMBA 3DRYA 1WI6A 1S1XB 2FD2A 2WONB 2L9NA 3OFHA 4O23A 4OZNA 4OZ5A 5LJ3Y 4PWUA 1FVSA 3PX0A 3CCVS 1LKZA 4ECSA 3HK2A 5MLCV 2EFOA 1DAXA 2JDJA 3G86A 1HBMA 5GAGU 4JV1A 4F3OA 1MROB 2EG1A 4I2PA 5A8KB 2OP5A 1S79A 1FDDA 1GXLA 3DRSB 4PXEA 3RAQA 2AYBA 2Q79A 4KV8A 1NKEA 4U7CA 1HHSA 3MM7B 3HF5A 1OIAA 2Z2MA 4X4VA 1R6YA 1U26A 2FHMA 3V81B 3R1HA 1RI7A 2VG5B 2ZZMA 2BM1A 5KT3A 4YEAA 3RU0A 2JLFA 4J9LA 3H2VE 3K7RA 4OHYA 3T1AA 4FXWA 4K5RA 1HWUA 4KGMA 1WWHA 2R2RA 4OFZA 4A8QA 5IFMA 4F4WA 5F8JA 3L95X 1FKPA 5IM0B 2W9CA 2HLUA 5DQIA 1DTQA 2K3IA 4GO5X 1TL1A 2IM0A 3ONQA 4C7QA 4ERDA 2CRLA 1X5TA 4MIBA 4RBUA 1DFDA 2GV1A 4GKKF 1TKXA 4EZ9A 3MURP 4E98A 1X0FA 4YR3A 1ZM2A 2JVOA 1N0VC 2HNZA 1HWJA 2WOMB 3DLBA 1VJWA 4P2SA 4TYAA 7FDRA 3RB3A 1VIXA 3D0GE 3PEJA 1TK8A 3QO9B 4USJC 4RNNA 4WFNQ 3QGGA 3D0HE 2BUNA 1SH0A 4Y2MA 1UWBA 2GHVC 1YBAA 4BWJA 2FHJA 1CC8A 5J1NA 2N3LA 4F2RA 2O1PA 3H4DA 2V9KA 1O8BA 4NLOA 1H7XA 3ENVA 5KG7A 4WXWA 4GMKA 1NJYA 1Q7YT 1B7FA 3DYAA 2R7UA 5J2QB 3BDPA 3IA0A 1C4CA 3E01B 3DOLA 2NLWA 2K7KA 2LA6A 4K4VA 5KAKA 4Q7AA 4FNIA 2RS8A 2R8HA 4BC9A 1E6VA 1HWIA 4OI2A 3OJUA 3MHYA 5A8RB 1S77D 3GIMA 5K9FA 5LSRA 4DJBA 4CO4A 2JHEA 4IYQA 2XY7A 3QWPA 1Y5IB 3PVXA 3MTKA 4D3HA 2D1CA 2D9OA 2BVZA 3X3UA 1S6UA 4OHVA 4PRFA 1FK9A 2AU0A 2Y1JA 1B0PA 4ZLPA 4F4YA 2B7CB 2XSFA 3DLLQ 3CD6S 3K5PA 2DNRA 4ED5A 5I42B 2F8HA 3I4PA 3OUYA 1M5OC 1S6QB 2JEIA 2HPUA 2Q6BA 1HNIB 1N5YA 5F3TA 5KFKA 4C3KA 2VPWB 3KLHB 4A8OA 2K7JA 2JC0A 1TV6B 1SV5B 2YKPA 3HHLC 3LW5C 2YWKA 2ILYA 1X9MA 3AY0A 4NZ7A 5D78A 4JI6F 4B9VA 2KFYA 3OSPA 2B56A 2OPSA 1JLCB 4LF5F 2YKOA 2LLZA 4ZHRA 2HLTA 4HH0A 4CO0A 2JFKA 4Q2MA 5KFUA 3DOMA 3I0SA 3IRXA 2NREA 2MPUA 5KFMA 1NJZA 2R8IA 2IC3A 3EZUA 1XWLA 3U27A 2W24A 1C2PA 5E41A 4G3IA 2AGOA 4KHMA 3LPYA 2DNPA 3ITHB 1U4BA 3THPA 2DPJA 2AYMA 4C8YA 2UP1A 3P49B 3U1MA 2ZOMA 2MZJA 4DMZA 3CCSS 1J5OA 2PGCA 1J2VA 2CPJA 4ZPVR 2YH0A 3Q0AA 1RDRA 2V8VA 2JVRA 3ISND 3QJPA 4ICLB 1YIJS 1HYSA 4CT8A 2FVQA 4MKAA 5E33A 3BQ0A 5MAOA 4EBDA 3DOKB 4TY9A 2ATLA 5K8PA 3QAEA 1YJTA 3MOJB 3DLHA 1IKXB 2X1FA 4Y0FA 1N34F 2HRUA 1X9SA 2DITA 2XI2A 1S9EA 2OMOA 4DSIA 3QLHB 2GMJA 2EK6A 1Q82T 3VAMA 2APOA 2KZZA 4G1QA 2ASYA 3BDEA 3H40A 1S9GB 1YG0A 2DNMA 3N5FA 3M8PA 1E6YB 1HI8A 3G6YA 4DLEA 3W3SA 2J8AA 4CH0S 1KLMA 4ILRA 4HDHA 1RT5B 1BQNB 4QWDA 3NGDA 1LWCA 4Q8EA