4DR5F

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, crystallographically disordered cognate transfer rna anticodon stem-loop and streptomycin bound
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
101
structure length
101
Chain Sequence
b'MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 27
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dr5F00
1HNZF 4DUZF 4GKKF 4K0KF 4B3TF 2BVZA 4OX9F 4X64F 4X62F 4GKJF 4DV3F 4B3SF 4JI0F 3OTOF 1IJEB 4NXNF 4DV2F 4DR2F 4JI6F 4X65F 1N33F 1XNQF 1I94F 1N34F 2UXBF 1B64A 2UUCF 4JI2F 1HNWF 5AJ3F 3R3TA 2RJZA 4JI3F 4DR4F 1VMBA 4YHHF 1N32F 4B3RF 5LMNF 2VQFF 3T1YF 1XNRF 4LF5F 2UUBF 1N36F 3ZZPA 4DUYF 2E5LF 2YY3A 4DV1F 4LFCF 3T1HF 1RISA 1QJHA 5LMUF 4LFBF 1F60B 1IBLF 4LF9F 4DR6F 1G7CB 4DV5F 2VQEF 4NXMF 2KJVA 2UXCF 4JYAF 4AQYF 1GH8A 2ZM6F 4DR1F 2F4VF 1IBMF 1IBKF 4LFAF 1CQMA 2UXDF 4JI1F 5IWAF 4LF8F 2B7BB 4JV5F 1HNXF 4DR7F 4LF4F 4JI4F 2UUAF 2KJWA 2J5AA 5BR8F 1FJGF 2UU9F 1FKAF 2B7CB 4YY3F 4DV7F 4X66F 4LF6F 2BXJA 4DV0F 4KHPF 4JI5F 4DV4F 4JI7F 1XMQF 4B3MF 4DR3F 1IJFB 4JI8F 2HHHF 1XMOF 1LOUA 4DV6F 1CQNA 4DR5F 4LF7F 1G1XA 1HR0F 1J5EF
chains in the Genus database with same CATH superfamily
5SUHA 3HZGA 4A8QA 2FHKA 3BB5A 2ZBCA 2VPZB 5E3CA 4NYOA 4EYIB 3U27A 2ZWPA 2HFNA 2HKEA 1IKXB 2ZUGA 4PUOA 1VOMA 1QAYA 1S9FA 2J8SA 4P2MA 4C8MA 2R8HA 3MEGA 2JOQA 2YX4A 3PYGA 4OLOA 3R3TA 4QYZJ 3D7SB 3PXGa 3K57A 2K06A 4NL5A 4C0BA 4W4MA 2Y1RI 3UDLA 1C1BB 1RDRA 5L9NA 2ZM6J 3NAHA 1RCOB 2OD6A 4F3QA 4K4TA 2GMLA 4Z37A 1REVA 2D69A 2H5EA 2HQDA 4TN2A 4ECSA 3MFIA 2LVWA 4OL8A 7FDRA 3WC2A 3CJ8A 5B0EA 4DV4J 3GJQB 1HNXF 3CJKA 5FDLA 4JI8J 1VI7A 3ZZYA 2KT3A 5HLFB 2V6AA 1MSWD 3TJ9A 3UN5A 3U1NA 3RW6A 3OUYA 2HHVA 4A8FA 1RADB 4P52A 3DRPA 3V4IB 1PIEA 4OZ3A 5K8PA 2HG4A 1HIYA 3ENAA 5A8RA 3CW2C 1SH2A 2GO8A 3JAMU 3FFIA 2G1HA 4CO2A 4CLWA 4ZPAA 3ETOA 5G0RA 3AJ1A 4MFBA 1X7VA 3UNYA 1B0PA 1JKHB 4DR4F 2BW7A 2JNJA 1DY3A 1S1WA 4CYUA 3AOCA 2JVRA 1D9DA 3IM9A 3KHLA 4ECQA 1NK9A 4GRSA 1FTCA 3WIVA 1KNZA 1N8RT 1JQGA 4P10A 1WD6A 3ZFVA 2XSJB 4LF8J 3N28A 2LEPA 4KGMA 3D0IE 1LWCA 2GJIA 3FCHA 2CRLA 2AD9A 2ZEJA 2CADA 5DG9A 2BEFA 2OPQA 4U95A 2N4CA 3J80Y 2LXUA 4F50A 1W2IA 4BBYA 1XERA 2BQRA 4FNHA 3DLLQ 2BJ1A 2EC0A 2CPJA 4JV1A 1A7GE 2B0GA 4KBIA 2DVIA 4FZVA 3EWGA 2L3MA 4Y28C 3G82A 4TKTA 1SL2A 2M5YA 3AOBA 3LALA 3LW5C 4F4ZA 1CPZA 2IM0A 4LF1A 3HP6A 4JI6F 2DNPA 4LVNP 4HACB 2DHGA 1X60A 4L6V3 3MF5A 6AT1B 1U6BA 5HI7A 2OTJS 3IGVA 3M8QB 1X4AA 2ZOMA 5F8LA 1JMTA 1RAIB 5B0FA 2XO6A 3MDFA 3G6ES 1FEHA 1PGZA 4OJHA 3IRWP 3KG4A 2JC0A 3MM6B 4USJC 4KH0B 1Q4RA 1IKXA 4J9UE 4M5LA 2CDRB 1K47A 1H2TZ 3GSDA 3MMCB 4PR6A 3MUMP 3L7UA 4LBIA 1NXIA 1WC5A 3PKYA 2VFTA 2WW8A 4LF6J 4W92B 5CYQA 5IV3A 3KLIB 4H4MB 2IA0A 5E41A 2COLA 4MKVA 2AF6A 1FF2A 5CZXA 3D1HA 1C1BA 5J2MA 1KVIA 2IPOB 2W9AA 2WSEC 3BV8A 2B4UA 4LRDA 1HMVB 4KHPF 3EZUA 2FB0A 4PCQA 1NJIT 1RTIA 3HD2A 2FGCA 3CJRA 3AH6A 3EMTA 1NKCA 3OSPA 2HAIA 1YTYA 1WF2A 4C98A 2Y1IA 1M1KT 1VQ6S 1UVLA 3ICLA 5HLFA 4F4AA 3Q22A 2AQ4A 1TKXB 2QL9B 2ZBRA 2GMHA 5K5MA 1U1LA 1DURA 3QATA 2DGQA 2J0XA 3V4IA 2AIRB 4LREA 1MLAA 5JJBA 4NI2A 2MGZB 4DBQA 3T1YF 1FK9B 1VBZA 2XEXA 2AJ0A 1HHTP 2E5LF 4I7FB 5H9EJ 1QY7A 3RB0A 2DNQA 1U1NA 2EW9A 1BUXA 1WOPA 1GQEA 4IRCA 4FPIA 4UY85 2IBKA 2CNNB 4WFBQ 4EBCA 1HI0P 3BH6B 1JXVA 2E1CA 3CJQA 4R0JA 1QE1B 4PWUA 2R2SA 1FFSB 3V81B 2BQ3A 4HHHA 2EFGA 2DPJA 1WJ9A 1XNQJ 2NCKL 4MJKA 2J6SA 1FRMA 4ZPCA 5GAEU 3SEOA 3GFZA 1IKWB 4V1Ak 5IQ6A 3FVYA 1WC4A 3AJ2A 2F8EX 1VMBA 2SXLA 4TU8A 4Y65A 1OYEA 1WKJA 4I0WA 5F9NA 2C3OA 3I56S 2UUTA 4O4GB 3Q2TC 4USKA 2BJEA 3KNGA 2YQ0A 2VBZA 2XY5A 1HNIA 3I4PA 1U8SA 3IR6B 1JLQB 2VH7A 4O23A 5GMDA 3PYFA 2YNIB 4P2XA 2KZZA 3DHWC 5L1JA 4B02A 3M8QA 1AT1B 4RX6A 4WKRA 4KR0B 2CZVC 2RUSA 4JI4F 2VF3A 3MCNA 2KVQE 1Z4UA 4A8XA 4X4QA 1TMMA 3O6QA 5IC6B 2VFUA 5C24B 1WOOA 1TL1B 2DXFA 2HFVA 3MMCA 1XMOF 1CC7A 4K5RA 1KN6A 3M8YA 3K59A 4F7VA 1WHXA 1XR7A 1VBKA 5HK4A 5KG1A 1EZZB 2V2VA 3D54A 1RHQB 2G13A 2P9CA 2XMKA 4HH0A 3KLIA 1RT7B 3BR8A 4H4MA 3CCES 2CPYA 2K3KA 1HBOB 1YG0A 1S4EA 3RB6A 1YITS 5U47A 1NDLA 4U7UK 2DHAA 2F4FA 5FLXY 2ASLA 1HL6A 3D5MA 1RU2A 2ZZTA 5DDQC 1O6XA 4ZJQA 2AGQA 1X4DA 4NLWA 3IN5A 1YZ6A 4DPYA 3CCLS 1TKTA 5BYSA 2QSWA 4DL5A 2F65A 3R5JB 2FTRA 3HVTB 2DEJA 1F2GA 1KSPA 3MOZA 2DNOA 1SQFA 2YNHB 1FK9A 2IJFA 2VFVA 3QWPA 1RTJA 1RWWB 4DV0F 4I7FA 4B3TJ 4JI5F 4MIBA 4GVBA 2JVOA 2KXFA 4EGLA 3AB2B 3IAM9 2LEAA 4ZP7A 3TOQA 3FBBA 4WYWA 1TQLA 3F41A 3W63A 4EMDA 2R7WA 3CC4S 4QU6A 4J37A 4CWBA 3GSIA 3W2VB 1QE1A 5IV4A 2DNYA 1KRPA 5KFYA 2P2CB 5C5JA 1DBDA 3V81A 3MTJA 1SKWA 3QGIA 1X8DA 4FP9A 4YOEA 3UO0A 2RD5C 2ZD1B 4G1QA 3A3OB 4B3OB 1W26A 3B82A 1OS5A 3KJVA 3FUYA 2CJ9A 5CYMB 1IKWA 3OTDA 2DR9A 4EBEA 3UQSA 1IKVB 1NSQA 5HATA 5F8JA 1WHWA 5HL7Q 3NAIA 3KK2B 1JNRB 5ETKA 2X1BA 3FCWA 1KP6A 3LPYA 5F8NA 2WBMA 5LSOA 3SBMA 4F04B 5CZVA 4Q7AA 4O4GA 3ENQA 3HHKA 3FGVA 4YY3F 1UWBB 3G71S 9RUBA 1R8CA 1KEKA 3KKFA 3EZ5A 3H2VE 2PEBA 2FJBB 2DCLA 2X3GA 2BA9A 1JLQA 3QSIA 4DV3J 4QWEA 3W65A 4OHZA 3D2WA 4C11B 3Q23A 3NL0A 2YNIA 4Y6IA 2V63A 1VQ9S 3UR0A 1SJ1A 2OH2A 4J7CA 5KOXA 3WC0A 2Y3YA 1N34F 4Q8EA 4MK9A 1UMJA 2ZKUA 5C24A 1EARA 1RWVB 4GC7A 1TL1A 2BV3A 2R7RA 2RT3A 1UW9A 3CO9A 3QO9B 4KC5A 4E2FB 1FXLA 1N5TA 5KT5A 2VUGA 1RT7A 4QQBA 1CJUB 3H5YA 2IMWP 2BJDA 3PO4A 2HLTA 4HI1A 4EZ9A 4ZN1A 3JYTB 1HBOA 3EVMA 1GNKA 4KV8B 1TL3A 1IBMF 1FCAA 1Q0NA 4HT5A 1YJUA 3BF4A 4B3MJ 3MECA 4KQZA 4K4XA 3M6UA 3BPSP 2YX7A 4ZKAA 1UZHA 3PVXA 4XTTA 1RHJB 3LP2B 2DO0A 2QMXA 2HHHF 1FNMA 2DPIA 1SXLA 2Z0GA 3R5CA 5IT0A 3TZXA 4PZVA 5KFSA 1RWKB 4XPCA 4E98A 3S01A 3DI6B 4RNHA 3P96A 2YNHA 4U7UD 3LAMA 1X0FA 1AUSL 1N5YB 4WU3A 1U09A 3SDEB 1PAUB 1KONA 3VGSA 3ZZRA 4LFCJ 1FO1A 1S1VB 1B7FA 4FF2A 2CQGA 2UVRA 5AXLA 4DR1J 5B0CA 1SC4B 3NOCA 5IOLA 4NLRA 1SJQA 3W2VA 2VQEF 4CO3A 1F2HA 4BHQA 3MEEB 3EGNA 2A2DA 4B9SA 3MMBB 1TL5A 2FIUA 3NGKA 2I6WA 4DI6A 1S1UB 2HFZA 5E5NA 2QMUB 2ZD1A 3D3BJ 1VQOS 4B3OA 1RHUB 4FYDA 4KAIA 1U1OA 1HR0J 5M2UA 4J9SA 2KO1A 3Q8SB 4ED5A 5CYMA 2XMJA 1GMWA 2HNYB 5DQHA 5EHHA 1NZAA 5HANA 1NBEB 3T1AA 3KK2A 3SI8A 3R8YA 1LFWA 1S1XB 4YR2A 1NK8A 4DV2F 1DTQB 2KKHA 3RGIA 3FEYB 4X4SA 1ZYQA 2NXCA 1UWBA 2MXYA 2WVFA 4ITSA 4CLFA 5AXKA 3N6NA 3C6TB 3EXCX 2MYFA 5BXIA 1VHFA 3IG1A 4ECXA 2NXEA 1FEEA 4KJIA 3CMAS 1IR0A 4DCPB 5KG5A 5K14A 3M1VB 4RW9A 4FBTA 2XZWA 3MR7A 2F4VJ 1DQ9A 2ZH2A 4UTGA 4DQSA 2VASA 2LLZA 4D3HA 1NJZA 2PD1A 4F0KA 5H1SV 1PCAA 3ZNJ1 1CQMA 2YKMB 3QO9A 1OIAA 3DGVA 1U7LA 2CQ0A 2ZZNA 2DIUA 2YKQA 3MI7X 4UOCA 2XHCA 3R2DJ 1SUQA 2GX8A 4DUZJ 1CJUA 4ZDNA 4DR3F 2CZ4A 4GKJJ 3QJLA 2FQQB 1U4BA 4KO0B 3JYTA 3NGTA 3IWXA 1RT3B 4KV8A 8AT1B 4AXIA 1B3TA 2HVIA 5L39A 4XDDA 3K89A 1KOOA 2ZFHA 2FD2A 1FJ7A 1S97A 4JI2F 2V0NA 4FYWB 4RU2A 3J81Y 2J6TA 4KPCA 2M8HA 1VQMS 3QYYA 2LEBA 1Q86T 1BWVA 2HZAA 2RS8A 1PG5B 5AT1B 1U2RA 1UA0A 2QLFB 1U24A 2ZH7A 3LP1B 2N3LA 2HLUA 2B8PA 1TK0A 1N5YA 2RRNA 2KFZA 2DNKA 4ZJOA 3SDEA 1D3WA 2KYZA 3H40A 1CC8A 3EPIA 4QZVB 4OX8A 3POTA 1HW9A 4ZP9A 3HSZA 3HFZB 1S1VA 4NCBA 4P7TA 2UV8A 1RI7A 1J5EJ 1YSJA 3UI3A 3H42A 4ZITA 2CQPA 3MAAB 2JLEA 2IM3A 1RBOB 3HSDA 2R7OA 4JI0J 5SZTA 1M90T 3TA1A 5D77A 3D68A 4USVA 3FQKA 2W8LA 1SJ3P 2RB7A 3MEEA 1PSDA 1N5VA 1S1UA 2RSQA 1NH7A 3U7JA 2V9WA 4ELUA 1ZH5A 1UVJA 1FKPB 1HNWF 2E1AA 5FJ4A 1HARA 5DLGA 4EWTA 4OX6A 5GAGU 1SKSA 1NHUA 3BGLA 1F1BB 2FLLA 3MUTP 3TANA 4ZCMA 3CCWA 1S1XA 2YWEA 3FKBA 3I4HX 2IJRA 3KJQB 4P74A 2ZH6A 1DTQA 5K20B 5IWAJ 2BOAA 2MJUA 2DR7A 4O44B 4P6QA 3D9BA 4QIEA 3FZ2A 3NY0A 1U47A 4E0DA 2W7PA 1EAYC 2F1FA 2GQ2A 4U8YA 2YX1A 3T9ZA 3KWMA 4NRTA 3SXLA 1H2VZ 1UPPA 5L1LA 1GFWB 2CJQA 1JLAA 3GMGA 3CVKA 2ZC3A 3VGTA 4ZP6A 3LQVA 2K8GA 4UF4A 4OHYA 1MW7A 4YDXA 2GHWA 1ROFA 5L46A 1HNZF 2C2NA 5B09A 2PSZA 4ZCIA 1XMBA 3UN3A 3I5AA 3DLHA 4AUKA 4ZLLA 3R2CJ 2CUYA 5A2QY 3OW2R 1T11A 1M5PC 4B3RJ 4X65F 4QR2A 4ED8A 2FJDB 2R8JA 1MWYA 4GO7X 3MEKA 3VAFA 1L3SA 2IBOA 4URSA 4KO0A 1OQ6A 1N54B 1RT3A 3JXOA 2MZJA 1VQLS 3DOLB 3RU0A 2YY3A 3Q83A 5KFEA 1KLMB 3HPOA 4KGZB 4RW6A 3QRQA 2XWYA 2A6OA 3HHNB 4I69A 4M5MA 3DFEA 4RNOA 2H65B 3GFXA 3T5JA 2GAGC 3NWGA 2L9DA 2XG8A 4WK1A 3QT7A 3CXCR 3QJPA 2OUGA 2OHDA 5CXTA 1GMWD 4JV5F 3AA9A 4B9VA 2HNDB 4EEYA 3IBCB 2QFIA 5HP1A 1MROB 3LP1A 2NR0A 2R7VA 4X64J 1H0HB 1WOSA 3NXZA 2HPUA 3OHAA 2NXUA 1V6HA 1REGX 4B9MA 2FVSA 4ES1A 2Z56B 4ED2A 5THWA 1HQEA 2MY7A 1JX4A 3PTWA 3MAAA 2UP1A 1CJTB 3G6YA 4A8WA 1RSCA 4WZMA 2K2PA 2UVVA 3VVUA 4P2FA 4BWJA 3CSKA 2CPXA 4DWIA 3LGMA 4USUA 3VAMA 3FEZA 2AX1A 3KLHB 2X1GA 2K7JA 1KFSA 1R27B 1S10A 3QRRA 1IUJA 1KDNA 4N56A 2KZMA 1TV6B 1FKPA 1RYSA 1SC3B 4NYPA 3H90A 1YJRA 3UVJB 5C25A 2Y8YA 3RAQA 2ERRA 3HLUA 4K59A 5J2NB 1FDAA 3TX8A 4X66F 3NMRA 3FMWA 3KHHA 3TI0A 3R5AA 1VLYA 1WELA 4YMEA 2XNRA 1RBLA 2ZUAA 5HAOA 1OY6A 4DQQA 4OV1A 4Q44A 3ADAC 2VG5B 2R8GA 1LXJA 4YN3B 4IKAA 3NGUA 1T0TV 5DM6Q 2WBRA 3MR6A 2YWHA 5J2PA 2BJ8A 4Z2XA 4OZ1A 2VG7B 4A8KA 2EK6A 3CCZA 2R7SA 1R8HA 1YJNS 1UL3A 3ONQA 4MKBA 1L3UA 2GS8A 2C3UA 3RTVA 2C3YA 4TYBA 2XS5A 1IXKA 2Q79A 2H54B 3EX7B 2QEXS 3VHQA 3WBZA 2VKRA 1Y5IB 3C19A 3G8SA 3K5NA 1RT5A 2ATLA 2Q6BA 3BSNA 4CNZA 3DGPB 3QAEA 2A0FB 4OLPA 2FJXA 5KFOA 3BEGB 4TU7A 3DOLA 2H3EB 3PX6A 4ZLNA 1KLMA 1TELA 4C8OA 4OX9J 3PRBA 3C14A 4Z7YA 2HFUA 3PNIA 1H2UX 3QZ7A 2HHWA 5CYJA 4ZPTR 3CJ0A 3ILLA 1T3OA 4B9NA 1SJRA 1P27B 2N3OA 3UCUP 1TKZB 4DL6A 1JLEB 5KFLA 2WZ1A 3MCSA 1MROA 2V4JB 3PRDA 2PA3A 2DY1A 5CAAA 4OI4A 3ILOA 2KM8C 4NXMJ 3LP0B 2PMWA 4DQPA 3CO0P 2C2EA 1FWLA 1R0AB 2HHQA 4GMKA 4H4KC 3HXMA 1FE4A 2E5JA 3QAUA 1FRJA 2AJFE 2VPXB 2VU5A 4WFYA 2AP6A 1CJTA 4ECVA 4F0MA 3KNAA 4I6WA 3MM5A 3E01B 2KI2A 2QL5B 3W61A 1VQPS 4OHWA 4F4XA 2ILZA 3KLHA 1SV5A 2VHGA 5B0DA 1S6OA 1TV6A 2HURA 5HQMA 3GYGA 3U02A 4WZQA 2R7QA 5HVHA 1VQSA 2WVCA 2NQPA 3UVJA 1PBAA 3RUBL 2VZ9A 1FWPA 1CVJA 4CO5A 3H5UA 3AODA 1CJKA 5J2NA 3CJ2A 2G0CA 2HQIA 4Q2MA 2F5GA 4HHUA 5JXSA 3LWMA 2E7XA 3ZTQA 3HVRA 4ECWA 1FKOB 3OVSA 1FX2A 1OQ3A 2BX6A 1UA1A 4Q0BB 1U48A 4OHVA 3TAQA 1Y00A 4RW4B 2MKKA 2FY8A 2VG5A 2QA4G 2R3VA 4FNIA 1BY9A 4GO5X 4U7CA 1SI9A 1WC1A 4JYAF 3ZZZA 3FBCA 2VG7A 1K8AT 1VGYA 2X1FA 4PQUA 2DNZA 2KN4A 3AQOA 2XMUA 2RVJA 1XEZA 2UU9F 4ANCA 2OP5A 1YHQS 3AQPA 2AYMA 2D3ZA 4UOHA 4OZ0A 2I38A 5KT7A 3PW0A 1D8YA 3GYNA 1U1RA 4NYZA 5L9XA 4Q5VA 1QVFR 3IRXA 3J7YU 2DXEA 3DOMA 5ETVA 2LU2A 4MYUA 1B64A 3EDQB 2CPZA 1N32F 2F63A 2A10A 2H48B 1BQMB 1T9VA 3P4UB 3J7A1 1XQIA 2DKOB 1IN0A 5DDPC 2D3OR 1HPZA 2CQBA 4ZIWA 3VAGA 1XJWB 3PJXA 1F60B 2FUG9 1JLEA 1KHVA 2V4JA 1JNZB 3PCOB 2XY7A 1QTNB 4I1TA 1FWKA 3HULA 4WFXA 4UQTA 4QYZK 4QIGA 3LP0A 2W9BA 4YP3A 1UAWA 4MIWA 4NRUA 1R0AA 4ZVEA 1TK5A 1JXEA 4U9RA 4JI7F 1UFWA 4CLUA 3G6XA 5DETA 4CTAB 2CIMA 4DN9A 1F9HA 2MZQA 3FZBA 1UW4A 2JFDA 2KT5A 2JH3A 3E01A 1HWJA 1ZTWA 1X9SA 1MWQA 3VV2B 3C15B 2CPHA 3QGPA 4AL6A 1M5HA 1F6TA 4O3PA 2ZH1A 4ZA1A 3F0NA 3P8BB 1EX8A 4RPFA 1Q81T 3WX4A 4FVCA 2GC8A 1AXQA 3LPEA 3RBXA 2RQMA 1MMNA 3OFHA 5BR8J 4R0EA 2QMWA 4USTA 4P72A 1S0OA 1FKOA 3DXSX 3GR1A 4ETXA 1XC9A 3ZZTA 3OR2B 1QVGR 3GV7B 5LMNJ 1RAOA 1RT4B 3SSQA 3EXYA 3L4BC 4LF7F 3FDSA 2NSBA 4X4RA 1RWOB 4KGVB 1WEXA 3KTQA 5BJRA 3RAXA 2V8PA 3P3DA 3UFCX 2ABYA 2PFFB 3PHTA 2ZH4A 4LSLB 3F56A 3GFHA 2ACMA 2M4MA 4V19J 3HHLA 4J90A 2WTFA 5ETRA 1XNRF 3PRVA 3TX0A 2WVBA 3ZTSA 4QW9A 2ALYB 4PAAA 4HTIA 1EKRA 1FDNA 1Q78A 2GVDB 1N0VC 2IIHA 1S9EA 4KHMA 2QZ8A 2AT1B 1BQMA 4NLUA 5IS2A 2OPSB 1EHWA 4DF8A 3HCXA 3EE3A 1T8EA 1WF0A 4ID8A 4IO1A 2B3TB 4ZVTB 2BKNA 4ERDA 3C46A 2V69A 2Z57B 2R9LA 3QWUA 2YBVA 1HQUB 2E5IA 5GAEI 1M5KC 1X0PA 4C48A 2UXBJ 4DFPA 4DF4A 2G1DA 4KFBB 2I2YA 3PJWA 5DG8A 3QGGA 2G0IA 1RWUA 4X4VA 4ETZA 1PBUA 2QG9B 3PYEA 5IM0B 5DO2A 4YB1P 1GK8A 4WJBA 1QM9A 3N01A 1R43A 4LQ9A 1YJVA 4ES2A 3MM7B 4QR0A 3OTCA 3BH7B 2NUUG 3BDEA 3C15A 1LK5A 1BLUA 2VDHA 4YR3A 4J9PA 1H74A 3W5XA 1O8BA 5KFKA 2IM1A 3IS9B 1KFDA 2DB1A 2CYYA 2B7CB 3VVTA 4DJBA 1KD1T 3JAMY 1OJ4A 4B9UA 1FNOA 1UVMA 2CQ4A 3LA0A 4RUCA 4L72B 4CRJA 1JLGB 4L75A 4MKAA 4PRFA 2BE9B 2DH9A 3OR2A 2JJ4D 4RWXA 1YIJS 3MPWA 3GYXB 4EYHB 3RB4A 4K4SA 2KM8B 1WC3A 4IG3B 2PI4A 3NEKA 2R2RA 3E51A 1RKJA 4K4UA 2LQBA 5C42A 1NDCA 3DRRA 3J7Z5 1S1TB 3L3CA 4LF5F 2OKQA 1VRTB 3KFWX 1RWNB 1NAQA 5EGYA 2RU3A 1NHVA 5I3PA 2LQ8A 4K4YA 2FVPA 1WHYA 4LFAJ 2PFDA 1HA1A 1VDHA 3OQ2A 2DNHA 4I2QB 2MQQA 4LSLA 4DS5A 3M6VA 2I5JB 4DSIA 4FBUA 4WXOA 4M5KA 1PJ7A 4ECZA 4CM0A 3OL8A 4PWWA 1ZM4A 2Y1JA 1UVNA 3NG8A 4JP8A 3VR1A 2HZCA 4TY8B 3GIIA 2OEMA 2QYCA 2MZRA 3EVWA 3T5KA 1GTHA 1DJ0A 1VK3A 2AX0A 3BBCA 3HX9A 3SZ2A 4FVMA 4CLKA 4KE5A 1C0UB 2V2KA 2K7KA 3NCRA 3SCLE 2GVDA 2GHVC 4ED7A 3TZZA 2CA9A 1U2CA 4NLTA 1SQGA 4B3SF 1X5OA 3EGVA 1QAJA 4YHHJ 1O51A 3CCJS 1PC5A 2R7XA 4IOCQ 2WAQD 1L5UA 1K1SA 4CQ1A 1G2EA 4Y0FA 2Q1LA 3GONA 5LMUJ 2V94A 3GIRA 2IVMA 2WOMB 4F3OA 2AZ1A 4DV5J 3MXHP 3FRZA 4USMA 1CS4B 1YBTA 5KFCA 4EK2A 4WTYA 4N76A 3SIPB 1ZAWA 4LF4J 5I4MA 4H4OB 1DARA 2AJQA 3SYZA 4OYXA 5L38A 3M30A 1HHSA 4PKDB 4Q43A 4GVLA 2VFSA 4FYVB 2MHEA 2WVEA 5B7WA 1R3NA 4M5JA 5KG3A 2DGWA 1NH8A 1I1GA 4ZK7M 2RH3A 2KFNA 4WBFA 1UKUA 5FLXU 1B7YB 1Y3KA 1SIWB 3CJ3A 3FSIA 2XZDB 3QGHA 2JHEA 3HJVA 4NCGB 1KTVA 1CBKA 2K3IA 4X84A 3IS9A 4PYAA 2GVZA 1X9MA 2DRBA 2XYPB 3TARA 3KK1B 1FA0A 3SV4A 2E29A 3PIPQ 2ZKTA 1M5VC 1YGYA 2LKZA 4XPEA 2HQ3A 3NNHA 3KXDA 1VK8A 5LXRA 2O3DA 3V5RA 2PE8A 4KIAA 1B0TA 4CT9A 4FF4A 5A8WB 1NSPA 3OR1B 1IBLF 4M63A 2ZH9A 5CA5A 2W25A 3MM9A 2V8VA 4IG3A 4WWSA 3R27A 4H4KA 3I0SA 4QWDA 3W2WB 1XMQJ 2IC3B 4DZ6A 1NJYA 2POKA 2QV6A 1KWMA 3DC2A 2B9EA 5KFJA 1QAXA 4C0OC 1Q79A 3U1LA 5KT4A 4LUBA 2XLIA 1BMQB 4F36A 4DHVA 1LQ9A 2ZJQQ 4DX8H 1EIYB 1HHQA 2YKAA 3K5OA 4JI3J 4F4KA 1HNVB 4ED3A 2CAJA 4DL4A 2GCFA 4RJVA 3DCAA 3U1MA 1RAHB 2HMIA 1RACB 3DMJB 1F0XA 1RAJA 3KMQA 2HVEA 3US5A 3Q8PB 3K5MA 3PIOQ 1RYRA 2C2MB 2C2RA 1LFPA 2C22A 3VQSA 3G87A 2J0SD 3KOAA 2XMAA 3KG0A 3GV8B 3GJRB 3PEJA 3KUEA 2KYXA 2RU9A 2N7YA 1VLOA 4ZLPA 2UXDF 2EFOA 2Q66A 2YKOA 2WOMA 4P2SA 3BGUA 4HLBA 3GILA 2HGNA 4PG6A 4DV7F 1CS4A 1HI8A 3ZZUA 1NK4A 4DUTA 3MPVA 2RDJA 1VQ7S 2CXEA 4XO0A 4ECUA 1N33J 5J1PA 1OY8A 3OTEA 3KUGA 2QIFA 4A46A 2DO4A 2HIQA 1X4EA 4PWDB 5EWGA 1RBAA 2JWNA 1XR5A 3CJ5A 1EQ0A 1IJEB 4H54A 4FXDA 3O2IA 2H4WB 4UUWA 1N36J 4I6AA 4RO0A 3DLBA 4B9LA 1ACMB 2R2UA 2KDOA 4RKUC 3FFIB 4K8RA 2RUGA 3H0PA 4DL3A 5G0RB 2IJNA 4LVOP 4MFBB 4TXSA 1KC8T 4XK8C 2R7UA 3JQMA 1VBYA 1S1WB 5E3QA 5DS7A 2FC9A 3IMQJ 4ZHRB 3GR0A 4BLGA 4DR5J 3BS9A 2VONA 3AJDA 5A8WA 2C1EB 3B4DA 3OR1A 3G9CA 4ECTA 1SC6A 4ZS6A 4MH8A 1LWCB 2P6TA 3TP2A 5KFUA 1FTRA 2UUCJ 5KFAA 2HFSA 3W2WA 3Q8VA 1VFJA 2OELA 3AFGA 1FNXH 1TTHB 5T7LB 2ATCB 2AV5A 2EFQA 4PEOA 2U2FA 1OSCA 4OYIA 2BABA 2B4VA 4LSZB 4DUYJ 1IM4A 3IA0A 4LR7A 2GGPB 4M94A 2EFPA 1T9XA 2Q6CA 4NLYA 4OHXA 1EP4A 4WCEQ 3R9LA 4CO1A 2OI2A 4N8NA 2BR0A 4DR6F 2V34A 4XIUA 1LKZA 3OD2A 2JRSA 1J2VA 2B43A 3DKDA 4Y34A 3IGNA 2MQOA 4HDHA 1E6YB 1ZPWX 4O0NA 4G3IA 4O3QA 2FJAB 2CQCA 2QGFB 1VBXA 5IT4A 1Q5VA 1AYEA 3OXGA 1ZAXA 2LDIA 3AOAA 3PX4A 4OI0A 2ZH3A 4OI6A 4HI2A 2HAFA 1PYTA 3KLEA 1FXRA 5CYQB 1Z2LA 2UVWA 1N0UA 2DD8S 2C2OB 4NXNF 4U96A 5GAGI 5J2MB 2BJ9A 4UT4A 4YEAA 1C0TB 3UD4P 4J9OA 2V4QA 1RTIB 3W7BA 3M6XA 3D6FB 3FC9A 4XDCA 3ISNC 5HROA 5D4OA 3Q8YA 2JC1A 2RILA 2UUBF 2BM0A 1RAFB 2KH9A 2NXJA 5DDOC 4PWDA 1JJCB 3G96A 3CCUS 4DV6J 3W9JA 3CMES 1HNXJ 1WI8A 2UXCF 1NCLA 3TZWA 3M8SA 4BDPA 1D9FA 3BO4A 1IBKF 2DGOA 5LOQA 2UZAA 4QPTA 4PXBA 4WFAQ 4NI2B 4ZVRB 2A6MA 1VQYA 1FKAF 2HS4A 2QA4S 3MPUB 1H6KX 3J81U 3MZIA 4NLPA 2VBWA 1JLFB 5DM7Q 1IJFB 3MPYA 3B6BA 2HS3A 4F67A 2AZ3A 2W4DA 2IRXA 3ENVA 1BQNB 1RGVA 4QW8A 4C2MA 1WF1A 4OQJA 4CI0B 3F73A 4DR4J 2GIRA 2HVHA 2RHQB 4WP3A 4ZHRA 4C8NA 3P5BP 2ZZMA 4TLQA 3WHIA 2ZHOA 2OJ3A 2YKPA 2AGOA 1ITPA 1PILA 2DEIA 1WG1A 1IM6A 1YVFA 1L3VA 4J9RA 1R6YA 1IBCB 4UQGA 2HHTA 4CO0A 5F41A 1JLBA 5T7LA 3DYAA 2ALZA 1GH8A 1FDBA 2W2PP 1S49A 4FN5A 4NASA 4ZVQB 2GGPA 2YXLA 3CEDA 2RIJA 1N5QA 1FRIA 4LQ3A 1D1UA 1HNIB 5A0YB 4Q2LA 2MSTA 3D0HE 2ZHBA 4JI6J 4EU0A 2XC9A 2CFXA 3ZTOA 1EETA 1JLCA 2DNGA 1NMEB 1E6YA 3MPDA 4DG1B 3AXMA 3GTYX 1QSSA 1JB0C 2GV1A 1V5IB 2Z2LA 2DIVA 3B78A 5LMNF 2FLOA 1KHWA 4CLTA 3ENWA 1MU2B 3MMJA 3D6HB 3K8WA 3C3LA 2M2BA 1UCNA 3L7OA 1TUGB 1APSA 2ZHAA 2VBYA 4Y2MA 2CQHA 2GIQA 3R1LA 4Y2CA 3TJ8A 2GJ2A 2QYGA 1C0TA 5A2QU 4M5GA 3R97A 1S77D 5F8GA 3D0GE 4KHPJ 2VODA 2BMBA 1Y10A 4RNMA 2KJWA 3CB4A 4HVZA 2V68A 1IQTA 4DFKA 1TKTB 2QA1A 5KAKA 3THPA 5A8KA 2PI5A 2OFGX 4K0KF 4I4BA 3DRYA 3BYRA 3A8EA 4DR2F 2HNZB 4DFMA 1RTJB 3IBFB 3IM8A 3T1YJ 1JLFA 2HBYB 5AJ3F 4GVBB 3Q8RB 3O3LA 2E5LJ 1NKEA 3PKMA 1XWLA 1ZM9A 3A3NB 3ISZA 4N8OA 2OEKA 2BRKA 2ZOGA 1BQNA 1R89A 1G6BA 4N7TA 2RQKA 4LF9F 4HYKA 2F7VA 1M5OC 4MKYA 3BQ2A 4UOFA 2KRRA 2LDYA 1HI1A 4I67A 4HT7A 4I2PB 1J27A 3JQJA 4G1QB 3ZNUA 5B0GA 1T05A 4DCOB 3KJVB 2NYIA 2ZDPA 1VJWA 2DHSA 2YPZA 2XGPA 3UDEA 4PG4A 1V3RA 1QTMA 4X4OA 4C7QA 3HKWA 5D0GA 4UY8T 4NLVA 3CD5A 1QD1A 1RP5A 3KDNA 2W2OP 4L3KA 5LT5A 4IOBA 3WX8A 3K58A 3W64A 2XMTA 3BKTA 4PQAA 1OSDA 5A0YA 1HBUB 1YBUA 3I32A 2VQFF 2MZTA 1IR1A 1S6QB 1XBWA 2ILYA 3B4MA 3BREA 3V6HA 1RKIA 3ET6B 2E5HA 1MWZA 1XK8A 2N7CA 4J9QA 1V5VA 4EUVA 2D3O1 4KKOA 4DG1A 1ZOTA 2BKPA 3MAQA 4TQSA 3M05A 4ZPWR 4JI4J 3JTNA 5BYQA 3VZIA 3D6MB 3BQ0A 2PN6A 4X4UA 4DR7F 1ZS6A 1D09B 1R7IA 1TUVA 3SQOP 1MU2A 3KLFA 1XMOJ 1UVIA 2OD4A 1SKRA 3OXFA 3VAJA 1U8WA 3DN9A 4TQRA 4GKKF 5IT9Y 3T41A 1TL3B 2NS1B 2E1RA 2QE5A 1URNA 4U8VA 3MECB 1TAQA 5D78A 3A8JA 1S4FA 2L9WA 4PPZA 2X7IA 4F4YA 3A4TA 4FKXA 3NLCA 4DS4A 1SVDA 3IAS9 3TAPA 3VGVA 3EPGA 1UFKA 4RUBA 1WG5A 2R2TA 2J0WA 5HMZA 3UWTA 2IAJB 1QLNA 1WWHA 1G7CB 2HNZA 2E44A 1J5OB 4RUHA 1FRKA 1Q5YA 2M7SA 3OL9A 1Y3JA 4MMOA 1SH0A 2H51B 1B70B 3CDWA 4DV0J 3K8VA 4JI5J 3BKUA 2UUAF 1PC4A 3CTRA 3Q8QB 1FJGF 2W9CA 3FSYA 5KFPA 2MQPA 2DGXA 1AW0A 1U1QA 1WACA 1B99A 3Q89A 5D4NA 3J7YI 3PHEA 5ADZA 3UR3C 1F3FA 1TMJA 2DGTA 2G2OA 1F5AA 4A4JA 2JEGA 2B56A 4NMXA 1S7HA 1F5CA 4A47A 3H5SA 4O0IA 2YH1A 4X62F 4I2PA 3H59A 1LW0B 1SKUB 4DLGA 5F0UA 4YS2A 3FBFA 3DDNA 1GTEA 2J9DE 2FC8A 2Z58B 1FT8A 2XLKA 3FEXB 3ZZPA 1RT1A 4P75A 5D15A 2JEJA 5LL6d 4HKQA 4ELVA 5D3GB 2ZE2B 1HBUA 3D1QA 4OYWA 3MTKA 2FGOA 1K1QA 4YY3J 2DXDA 5HSPA 1DQAA 2ASJA 3IG1B 4WP8A 2B7BB 3B8HA 4LIRA 1S6QA 3FCVA 4C3MA 5K14B 2MDAA 3ET6A 1S59A 4RW9B 4ZVPB 3KHGA 2V5HG 1ZZFA 4CIOA 3LOUA 4O3NA 1N34J 4OZNA 4ZVSB 4MAKA 3RG6A 3PY8A 3W9IA 1FVSA 3CDEA 2N82B 1I94F 5GVQA 2YWGA 1YJ9S 1SUQB 3J7AN 3UE2A 2WB4A 4AL7A 2M70A 2DGUA 1H38A 1KTQA 5F8IA 3R7SB 5L1IA 3RBDA 3UCGA 1VJQA 2WRMA 5DQGA 4DV1F 3T1HF 1LW2B 1IBMJ 2BKOA 2MSSA 1OYDA 1Q8LA 2DJWA 4RU9A 5B0BA 1ZBTA 1EJ7L 3BGFA 2Y1LB 4BC9A 4TY9A 1RTZA 1VRQC 4QIFA 3TYTA 2HHHJ 1WNEA 1RWMB 1X4GA 4A48A 2VA3A 3TQEA 2IAJA 3VWSA 3IWLA 1UEUA 3EJMA 1CULB 1TUWA 5I3UA 1KQKA 1J5OA 1LOUA 3RR7A 3GP9A 3DDIA 4RWWA 4C8LA 1X4HA 3EYZA 3POTB 2PMZD 2O66A 2F8MA 2FJVA 1B4SA 4OYZA 3HHEA 3UD5A 1UJ5A 3SQGB 4P71A 2CPIA 1JK9B 4KGKA 4I64A 3CCSS 3P49B 1NO8A 5F8HA 4U67Q 3NCQA 4WIIA 1DRZA 2V67A 2VQEJ 2ZH8A 1RHRB 2RRBA 3IO1A 1EKSA 1XN9A 2PMHA 2JL9A 4EFAC 1LW0A 2F40A 4HH1A 1QUVA 3M2VA 4F02A 3RRHA 1TFYA 2V2ZA 1T95A 1RE1B 2FJWA 4DCJB 5GMEA 3H2UB 1N48A 2R8KA 1VHIA 2B5JA 5ETTA 5D3GA 2RF2A 2ZE2A 1XR6A 4DV2J 2YKNB 4IH7A 5KG4A 2KXNB 4YUDA 3BN4A 3QT5A 1N6QB 1KLNA 4DU7A 2L08A 3A13A 2XB2D 1JLAB 1DAXA 4DXLA 1NU4A 1ZZNA 2MKCA 2E1PA 1Y5NB 3EICA 1HW8A 4ECYA 2C3PA 4R8UB 3JSRA 1X4CA 3SV3A 2MZSA 2A3JA 3RYLA 1N52B 2R42A 2VC1A 2E7WA 3UDVA 3OLAA 2EC2A 3M2UB 1VIXA 1ZPVA 3AA8A 1IR2A 1TR0A 2HK3A 4DQIA 1HLWA 4AQYF 4HTJA 3EGWB 2BE7D 2JX2A 4LR9A 3PFOA 1PAEX 2HVDA 2MLYA 1FJEB 1TAUA 2RDIA 1FI4A 4DR3J 4K4WA 2OO4A 2F9DA 3OL6A 4ZMMA 4JB8B 1LW2A 4F25A 2X1AA 3C6UB 3M8ZA 4RW6B 1GXLA 4K2XA 2W7OA 2P9GA 3THVA 3K17A 3M32A 1F9EB 3C8YA 1DLOB 1FJCA 4LFBJ 4JI2J 5KT2A 3OTOF 1AFJA 3IXQA 3CJ4A 1NK7A 1OWXA 5HP1B 1SIZA 3EZOA 3A8KA 1RTHA 3GPAA 1CULA 1Y9OA 4QWBA 2FHMA 2XM3A 3QLHA 4TNOA 2VD3A 3M4XA 4O4RA 2D9PA 3CULA 4N41A 4ES3A 4LBPA 4R25A 4ZVHA 1P6TA 3AT1B 2KHCA 4F26A 3GLJA 3UNGC 3OL7A 1WDTA 1UZDA 1HD0A 1HQEB 3BBBA 2IHR1 3SQGA 5GADU 2KTQA 4W98A 4MK8A 2ZM6F 3SFUA 1W7WA 2PA8D 3TA0A 3TRGA 2ADCA 2LA4A 1KQSR 3TVKA 1WG4A 5ETOA 3JSMA 4Y3CA 2L48A 4ED1A 5KG6A 3VQTA 2FZKB 4DV4F 1V9OA 3HHLC 3N0VA 1YLXA 4JI8F 3OXLA 4DV6F 5C25B 1VQ5S 3MR3A 1HNWJ 2EFNA 4LSNB 3V6DB 2IRUA 4DX6A 2Z30B 4JI1J 1JXLA 1BHNA 5ETQA 2RRAA 5T41A 4EZ6A 2YKNA 4CCHA 3O8WA 1IVZA 4P9SA 5ITHA 4L3NA 3G6VA 4ED0A 1H3DA 1N6QA 5AE1A 1JJ2R 4ID5B 5F3TA 2WK4A 1AROP 3DRXA 1O5JA 3AD8C 2D1CA 4DPUA 2I0XA 5J2PB 5HVGA 1NJWA 2MKSA 3JSYA 2KHDA 4FS1A 3TAMA 1U2FA 4V19X 4LF8F 3I9ZA 1FESA 5KFNA 3ZXWA 2VOPA 4R8UA 4A8OA 1RB0A 1FRLA 2C2DA 5DZ6A 1HNZJ 1V3ZA 3NBPA 3TNVA 2B8QA 2BQUA 3M2UA 2ADBA 4RNNA 2APOA 3QRPA 1BD6A 4X65J 1U49A 1YWXA 4NZ0A 1RT5B 2XS7A 3SMZA 3A8IA 5HMXA 2QX0A 3HD1A 4ELTA 3LANA 3N6MA 3ETMA 3HKZD 3C6UA 3ISND 4NLXA 4WFZA 3C14B 3IC1A 5C7PA 1KVJA 3CD0A 3DU5A 2KU7A 4LRCA 4DQRA 5KFTA 1DLOA 6FDRA 4ZVOB 1RWXB 3DHXA 3TUZC 1FD8A 1WTBA 4A8MP 4HR2A 3EGZA 2KL8A 4L73A 2CZ9A 4BCAA 1TL4A 4JV5J 1RK8A 4TU9A 2RQCA 3CD6S 3SCJE 5I42B 2LQJA 4PG8A 3H7HB 3A12A 3NMAA 2AGPA 2DYAA 3G2XA 5B0AA 5KFGA 1UTAA 4OYOA 1I5OB 2QT7A 1W2BR 4M5NA 1DTTB 4LF6F 3BZQA 3QPIA 2X3DA 1WORA 3H20A 5JUMA 2OEJA 2LQ5A 3I0RB 4OX7A 2M0GB 2Z8QA 2VV5A 3MM5B 3CF5Q 1S48A 2ROGA 4QR1A 1WTFA 1YRXA 2GQCA 1SV5B 3P45B 2V8HA 1WSRA 2XI2A 5DGBA 3Q24A 3ULHA 2EEYA 2FVRA 3QFWA 4NLOA 5BYRA 2IVFB 2E1MC 4ZPBA 2CJXB 2JFKA 1R6VA 1S5ZA 2BE2B 1XIQA 2DISA 2DTJA 4IQMA 2MQLA 3OLBA 1CJKB 4LSNA 3S7RA 3V6DA 5E3AA 2HHXA 1JJ4A 2XQCA 4IQXA 4FXVA 3I96A 2YWFA 4X66J 1PJ6A 3R5GA 1R31A 4AE5A 1U0SA 2VG6B 3K2YA 1OO0B 3BR9A 4PG7A 2EG2A 1H98A 2AJ1A 4BWMA 4F2RA 1EB0A 1TU0B 4ID5A 1K9MT 4WKYA 2H5IB 3LGNA 4G1IA 1JKHA 2J9CA 3RJMB 2OTLS 4NZ7A 1Q8IA 1GX5A 2W1BA 4PXDA 4PQUB 2G2YA 4OI3A 5EX0A 3RB3A 2QLXA 1XNQF 2XSJA 1OPIA 3DLEB 2HRTA 2HIYA 3H4BA 1K73T 2J76E 2FZGB 1RU1A 4N47A 3TO8A 1WKLA 4ANDA 3T3FA 1RUSA 3IRXB 5D0RA 3W62A 3DOMB 4J91A 3SCIE 1KQGB 5CHCB 4A8YA 2Z2YB 5DGAA 2VFRA 4DPTA 1C4CA 1UETA 2JZ5A 1HKAA 1UEKA 5F8MA 2BJ7A 1H7XA 1VQNS 2D9OA 3OFGA 2AEJA 2MTLA 3HZEA 3MURP 1HPZB 4Q8FA 4HACA 2M88A 2BM1A 4OJ1A 1A0OB 2HW3A 2RKIB 3TQ1A 2H5JB 1S7IA 3HSGA 3KJFB 2RMLA 1QSYA 5CABA 1K0TA 2YWKA 3I31A 3BSAA 5I42A 1VISA 3T19A 3RZAA 4K50A 4WYLA 1Q7LB 2W24A 3MM6A 1M1HA 2YNGB 3W8PA 4IOAQ 3WDOA 2ZC4A 1URRA 3FSXA 3CUNA 3Q86A 2W9BB 2OSQA 1DTTA 1V3SA 3R1HA 4OZLA 2ASDA 3GIKA 2G4BA 1T3NA 1F3VA 4WF9Q 1BC6A 3UCZP 5G4DA 4HHJA 5C2CA 1S0NA 1LWFB 1WSVA 5JVGQ 3I0RA 2W2NP 2AEMA 2ACYA 1BQXA 4OV6A 4FF1A 4X2BA 1HBMB 3EUNA 2HWTA 1HMVA 4PXCA 4DPXA 2RQ4A 5M2RA 4M95A 1FX4A 2CG4A 4C8ZA 2FHJA 4PABA 3I5BA 3MM8B 3KLGB 3EM1A 1JWWA 2XZTB 2HHUA 1AB8A 4F0HA 2R8IA 1TKXA 3NWRA 2BE2A 2BXJA 3H25A 4DZDA 1LK7A 2J9EA 4KPYA 2XLJA 4D3GA 4KTQA 2XSFA 2MGZA 2EBEA 2MPUA 4B3TF 5CH7B 2VG6A 3NS5A 2XMMA 3K7RA 1SPBP 3NS6A 3OJUA 3DOKB 3BJYA 2YVSA 4JV0A 2BANB 2PGCA 1Q95G 1LXNA 2OLWA 1Q8KA 3M7VA 1X9WA 3W3SA 4ALZA 3T5HA 2E9TA 4JYAJ 4DDFA 2LECA 5ETLA 5KG0A 2OPRB 5IC4B 4A8SA 3CDUA 2HHSA 4USHA 1X5PA 3GE9A 2IDLA 3DLEA 3N5BA 3ILJA 2UU9J 2H4YB 3RRGA 3TVYA 1RJJA 3HHLB 3SCKE 5AXMA 3UN2A 2HEKA 2CJYB 3HDSA 3LGHA 4RBTA 2GHPA 2XTJP 4DEZA 1QAIA 3PR4A 3H98A 3NP5A 1FD2A 1F5BA 2V8DA 2OSRA 3QJJA 1S9EB 4L76A 3H8YA 3D28A 1QSLA 4USIA 2GJFA 1GMUA 4DV3F 2AJ2A 3V6JA 2PT0A 4ZP8A 1N32J 3M9OB 3M9NB 3GIJA 5CQGA 4ZCLA 1AA1B 2BACA 2RKIA 2HQCA 3BO2A 3DLJA 3TR5A 2R7TA 4CLZA 4C0HA 2AJ4A 3TZYA 2IRYA 2NXNA 4QCLA 3VTIA 2HSEB 4OZJA 2YNGA 4IYQA 5L1KA 2FVQA 3OT9A 3HVAA 1T94A 2EBGA 4P73A 2DNMA 4CH1A 3AHPA 3PX0A 3L09A 2C2ZB 2RS2A 3ZC4A 2PC6A 1U1MA 4CDIA 1IWAA 5M2PA 4JI7J 1SL0A 3MOJB 2EXUA 1LWFA 2CJKA 2LXIA 4K5SA 3PO5A 2ZITA 1HBMA 5D4PA 1HFEL 1HQ2A 3NKYA 4B3MF 1K44A 1Q8BA 1X5SA 1UWAA 4IH5A 3SSSA 3I6PA 3OPKA 3MM8A 3KLGA 4MK7A 4KH1B 4PPDA 5JMNA 4NLQA 1ZTTA 5IQQA 3HFVA 3VAIA 3VAHA 3QT8A 1S9GB 4FPRA 3HVTA 1U25A 1SQEA 4MTPA 4ED4A 5D8HB 4N77A 3BPDA 4LFCF 3BO3A 2D41A 3X3UA 3KDOA 1RCXB 2KJVA 1GMVA 1N56A 3DOKA 4JBCA 3L7PA 4DN0A 2BANA 4E8UA 4JV2A 4DR1F 5F0WA 1NB7A 1ULRA 1SC1B 4J9MA 5C42B 3DRRB 3MHYA 3GG1A 2B6AB 4OZ2A 4LF7J 3GCWP 4P7VA 2OPRA 3OFEA 4IR9A 2F8HA 3QT6A 3OJSA 1U0HB 5AXNA 5RUBA 1C4AA 1DQ8A 1UPMB 3DRSB 1N88A 1HR0F 3J80U 2W2QP 2CWXA 3MD3A 2EKNA 1LWXA 1Y5LB 2H9ZA 2LFVA 5ETMA 3RBZA 5GAHU 2J7UA 3OSNA 3PW5A 1YJTA 2E9RX 2B9WA 1IKVA 1XNRJ 4WPAA 3MUVP 2RJZA 4FKYA 2LCWA 3HK2A 2ROPA 2IM2A 2FHJD 1X31C 2J7KA 1CJVB 4U6PA 2MKIA 2G0JA 2MEWA 4DL0C 4C11A 3TEGA 4C97A 4QIWD 2F4VF 2B4PA 3G4SS 1RLCL 2W7AA 5KFVA 4NA3A 3KMSA 1FERA 2W2MP 3ZZOA 2B9XA 2CPEA 2NPIA 3CDBA 3BYPA 4OYPA 3VAKA 5A76A 4CP5A 1ZA1B 3LUYA 5LM7E 2O01C 4RNFA 1JJHA 4DUZF 1P1LA 3M30B 2EWHA 2HK2A 3DDKA 4F4WA 4GKJF 2DITA 4NMLA 3P5TL 3MFHA 2A1BA 2GZOA 4USWA 3FQLA 1N5SA 2HFOA 2MKJA 3CCVS 3CDAA 1M5SA 3TEHB 2IDEA 3LO3A 2AKWB 1H72C 3LF0A 1NDPA 4G6VB 3W5YA 4YB6A 1FVQA 3QNWB 1SCJB 1DFDA 1U6FA 1RT6B 1NM2A 3V4MA 4LFBF 2DK2A 2EI5A 2GVZB 4NE9C 5EWEA 3LP2A 5E7OB 5J1NA 4QWAA 4DL2A 5T14A 1G4CA 1S9GA 3OVBA 2C3MA 4CZCA 2MQNA 3R6LB 4OFZA 1VQ8S 2VB6A 3DI6A 5CD4H 2DH7A 4WFNQ 4IRKA 2J6UA 3GZ7A 4OJ3A 4JOUA 4IFYB 2P9EA 3BDPA 2HBZB 1KVKA 3CWJA 4EO6A 4TYAA 4ENOA 3MM9B 2P8IA 1J5EF 3CNQP 4ANEA 2KG1A 3I0SB 1R0CB 1X4FA 4XAKA 3M2RB 2EFVA 4JI0F 1I51B 2B6AA 4WTOB 1S99A 3AY0A 1U6ZA 4DSEA 2VPYB 3OBIA 1RHMB 1VCTA 2VIHA 5LSRA 1FE0A 2DR6A 1X5TA 4LF5J 2KG0A 1U0HA 3DRSA 3MMBA 2BZ2A 2DCUB 4NZ6A 1G3OA 3GV5B 4IG0B 1YJ7A 5KFFA 2KB2A 1X4BA 2KVIA 1K0VA 4ZLJA 1C2PA 2CPFA 2HNYA 2HMIB 2W01A 3BSCA 1R8BA 1U02A 2HQFA 4JI1F 5IWAF 3VZHA 2Z2ZA 2AEFA 3R5DA 2FY1A 4IH6A 1FFGB 4OYAA 1RA6A 1HWUA 3J7ZT 2BW2A 3LTOA 4OYBA 1CJVA 3K5LA 3C6TA 4HEA9 5IXUA 4ZJLA 1CG2A 5HJXA 2OPPB 3O44A 4B3SJ 3T9NA 3ELHA 4CLSA 5KTQA 2DH8A 3GG0A 4F2SA 3M1VA 4DSFA 3FBEA 4DSLA 2FLNA 2E9ZA 4J9NA 3D67A 3V2UC 1WC0A 2FHOB 3D1OA 2V9KA 3CC7S 4B3RF 3S1TA 2YKMA 5EX3A 2NZCA 3NS7B 1NDKA 2J9DA 4OJGA 1RISA 1UJ6A 4KGXB 4WXWA 2DR8A 3VF0B 5IT9U 2BUNA 4YFUA 4M1KA 2AWZA 3NNCA 1MMLA 3N6LA 5MLCV 2HHPA 3E8OA 4R5PB 2QO3A 4WP9A 3SSRA 4UZBA 3Q8UA 4IO9Q 1Z2ZA 2YNFB 4HDGA 4LRAA 2HWIA 3HHLD 4X4TA 1RT2B 1RT6A 5L8RC 3C2PA 1HWKA 4ED6A 3LWLA 1RAEB 4YR0A 1G1XA 2V8GA 2G2ZA 2ASYA 4MIAA 2BVZA 5E3PA 4X64F 1VQKS 4DFJA 4QWCA 4FDFA 4ZOSA 5KFXA 1I3OB 3ZTRA 3QFHA 5FIIA 4IFYA 2M9KA 1GT8A 3TW0A 1VC0A 3KUHA 3E3XA 4I68A 1IBLJ 3JB9k 1IQZA 2VKZG 2GAHC 4NEYA 4M5IA 3D3CJ 2HRUA 3M2RA 4KHRA 4LF2A 2QFJA 2VJUA 2JLGA 4URGA 1HD1A 5JVHQ 4DLEA 1PKUA 4KT0C 2H1YA 1VRUB 4NLDA 2Y9HA 5CD4A 3G8TA 2XHWA 4ZCKA 4IG0A 5LSLA 3E2EA 3CIZA 2BOPA 4KYZA 3S8SA 2R4FA 2HGLA 4CLLA 4N5SA 1EP4B 4GC6A 3CC2S 1TVRB 5H9FK 2VJVA 4IR1A 4UOGA 4DL7A 1NHKL 4EI2A 3HM9A 2GA7A 1HWIA 1HYSB 2QA2A 3HT3A 3OFFA 3H2LA 4OYMA 1VC6A 3QIPB 1T9UA 4BS2A 1PJ5A 3D4JA 2NZ4A 4QYRA 3Q2SC 3V6KA 3PG9A 4O44A 3RW7A 5MAOA 2IYGA 4Y2IA 2OPPA 5HQ8A 3PM9A 1EQMA 3DLKB 4RR5A 5ETPA 3KLEB 3CCQS 4YB7A 3VCDA 1N4LA 4NX9A 4J9KA 2DNLA 2CDQA 2UXDJ 4I6YA 3KYLA 7AT1B 2DT9A 5LJ3Y 3IFEA 4DV7J 3IP0A 3NGSA 5HROB 5EN1A 3PDNA 4CM2A 3I87A 3M8PB 1NJXA 2GO9A 3GQCA 4O3RA 4QIVA 3MCMA 2GNKA 3M8WA 4BC7A 2VBXA 2UV8G 1VYAA 1CSJA 2GMJA 1IKYB 1M0SA 5KFBA 4OX9F 3M9MB 4R5PA 5KFHA 4HL9A 4LT6A 2XWXA 3KHRA 1VQ4S 2V4RA 2YNFA 4RW8B 1WHVA 2V2QA 5KFWA 4DX5A 4K4VA 1RT2A 5DG7A 3BBFA 1W25A 1WEYA 5J1EB 5I3QA 2ZNZA 1R8PA 3R7NB 5KFRA 2HNDA 1YI2S 3T6BA 3FMBA 2WW4A 4NXMF 3CMQA 3BGRB 2HZVA 1U1KA 3M8RA 2AMCB 2WVDA 3MR2A 2ZJRQ 5HBMB 1BE4A 5EUHA 2Q3PA 1UP1A 4MT1A 3GCXP 3I5CA 1P1TA 4Z7CA 2CQ1A 3BGOP 3MEDB 4RW7B 2DGVA 1JLBB 1NK6A 2F3JA 2DHHA 3DYAB 5D0HA 3QBCA 1VRUA 2QTWA 4NLGA 2PO4A 2BBEA 5GMKa 2JDJA 2D7SA 2XMWA 2XBPA 4OI1A 3N4WA 4LR8A 3IBWA 5ETSA 2ZNYA 4RLEA 1Y0HA 2AHOB 3RRKA 1TVRA 1P9YA 2XO7A 4M8LA 5LJ5Y 3ILIA 1Q1KA 1HYSA 5HMYA 4DR6J 1U1PA 1TFWA 2CQ2A 3QIPA 2MB0B 5GADI 4IDKB 4C3KA 2QLBB 1EETB 1JLCB 3JTPA 5EWFA 1PYOB 2JEIA 3TWZA 5AE2A 3N9UC 4KY3A 3ZTPA 1VS3A 1WKKA 3F44A 2UVUA 3G8QA 1S6PB 5E3RA 4O3SA 3DLKA 5KT6A 4KSEB 5FD1A 1SBRA 4ATNA 2EKYA 4ZPVR 1RAAB 2MLXA 4Y00A 1T7PA 4DMZA 4RBVA 3TA2A 3JS9A 2OIHA 4NXNJ 3C66A 1D8ZA 4LMZA 1NPKA 4LIWA 3J81j 4K4ZA 3KK3B 5KFIA 2CQDA 3RBEA 4EO8A 2XMVA 3M8PA 4F8RA 5F9LA 2G9OA 2XYHB 3MR5A 1Y7PA 1UEVA 3G86A 3TJAA 2DGSA 1T02A 2UUBJ 2CVIA 5ETNA 2PDAA 1OMSA 1Y4ZB 3OVAA 4ZVUB 1WI6A 5A8KB 3DGPA 3FJ2A 1SJFA 1WUUA 1IKYA 5E2QA 4QU7A 2Y0BB 2UXCJ 2WSCC 4NEZA 3AD7C 1IBKJ 2XNQA 4ZPDA 1B0VA 2A18A 4RW8A 1IWGA 3D66A 4M5DB 2XI3A 1KBRA 4CLPA 1CLFA 5J1EA 1ZM3A 2ZDOA 2CNLB 1TKZA 3CD7A 4K2JA 4LBHA 4KB7A 3FNNA 3N5FA 3MMAB 5KT3A 2WB1D 3BGRA 4DPOA 3NNAA 4G65A 2UUWA 2QJ3A 3W66A 5HBMA 3NRBA 3BKFA 2P5VA 3L9ZA 1RQ0A 4NLSA 4RL1A 3JTOA 1T05B 2YQ1A 4UW2A 3MEDA 4RW7A 4FS2A 3MCOA 3CE8A 5KFMA 1GXTA 2KXHA 3BM7A 2RNEA 1PO6A 4PXEA 1OY9A 3SFGA 2BDPA 4MYTA 1I6JA 2EVZA 4RBUA 4TVAB 2GW8A 4ILLA 5E0OA 3R7BB 1NUEA 3JQKA 3PACA 3CCMS 4AT1B 5DQIA 1GEHA 3O1LA 4J9LA 3T6JA 1YRTA 2VA2A 2HRYA 4Q45A 1VR6A 5BR8F 4IDKA 2Z2MA 1UFLA 1T9TA 1R0BG 1AFIA 1S12A 4NA2A 4KKOB 2FYXA 2E7VA 1RAGB 2VOOA 3OV7A 3JSBA 5KFDA 3HJFA 1NRKA 4Q0BA 4RW4A 1S6PA 1MG7A 3IR5B 2ZVSA 3KLFB 2L9NA 2FVCA 3CIMA 2B9YA 4YB5A 2MQ8A 4ILRA 4AXJA 2OGUA 5A6WA 5F3ZA 2I8EA 4OZ5A 3I9V9 1T03B 4K7QA 5DJBA 5K9FA 4FF3A 3HSJA 2CKWA 1U26A 4O3OA 3KK3A 3GIMA 1HBNB 5D0EA 3NGDA 5CCMA 2NLWA 1YKWA 2KRBA 4Y2KA 1Q7YT 3HO1A 3CGIA 3PZPA 2EG1A 3UDCA 1YZ7A 2Y0SD 2QRRA 4J5OA 1RWPB 2D74B 1SH3A 1VIOA 1GX6A 4ICLB 7FD1A 1MMDA 5DLFA 1HWLA 4OI2A 4K0KJ 2NUHA 2FLPA 1TP7A 2WONB 3M6WA 4M5DA 4DR2J 1E6VB 2I9SA 4YQWA 1BWEA 2IY5B 2QSFA 4IUFA 3I55S 3PR5B 5AJ3J 3ITHB 1NLKL 2W9CB 3KLVA 1Z1ZA 2UXBF 2MJNA 2GIFA 1Q53A 2B4OA 2FZCB 2AYBA 1RTDB 3MMAA 3MAHA 1C1CB 4ZVGA 4LRBA 4ZN3A 4B9TA 2V50A 1FRXA 1YRUA 2ROEA 4LF9J 3AD9C 2VICA 4L74A 3LH2S 2D3UA 4M5HA 4NOHA 3MGJA 2ZBPA 4WU2A 2MHNA 4CTAA 1QUPA 4B17A 4CNYA 2XULA 1TK8A 2NPFA 2NREA 3N79A 2RHSB 2C28A 1FFWB 1U45A 2FPHX 2W4PA 2J5AA 2FJEB 4KRWA 1RT1B 2CQ3A 3WIUA 5AE3A 2LA6A 1NSAA 2I1RA 1WEZA 6FD1A 3GFYA 3TUIC 5B08A 2J0QD 3S6EA 3C16B 1O0PA 1KKHA 4RUAA 2MY8A 3B54A 4X4PA 2LXFA 4DSKA 2EK1A 3DLGB 3CCTA 2ZOFA 2PEHA 1QDUB 5DZ7A 1ZETA 5KG2A 3IWNC 2C42A 1YX2A 2IMOA 2JLFA 3W1YC 2VQFJ 4C6AA 3H5XA 5HVFA 5H9EK 3KJNB 3PW7A 4NPOA 2XCAA 1L3KA 3O5TB 1FHTA 2ZBIA 2Z4PA 3K5PA 2IA6A 2ZBQA 3W8GA 4QPXA 4J9VA 4I56A 4C9DA 2OAUA 3T5LA 4DOZA 1NSKL 1S6UA 3W5ZA 2YQ3A 2DBBA 5C2GA 1H7WA 3PV8A 2P6SA 1RT4A 4DR7J 1KQFB 2A2CA 3PYDA 3QZ8A 4F3MA 2K1RB 1KR4A 2AYGA 3MWBA 3TUJC 1SJ4P 3PW4A 4YDDB 2AU0A 4LFAF 2J8AA 1T03A 1S79A 1ZM2A 2HGMA 2YH0A 3LAKA 4OMFG 1KOHA 2CJBA 1UVKA 1DHMA 2W4CA 4CO4A 1NZ8A 4GKKJ 1RZMA 2IFXA 1HBNA 1S0MA 1A9NB 3HT0A 1H73A 5HN0A 3HF5A 5HJYA 1YQHA 4RZRA 3GJSB 2CNOB 3DM2B 2DNRA 5A6PA 5KFQA 1TL7B 4ICLA 2QL7B 2NSCA 5E33A 2HS0A 2KT2A 3RR8A 2DNNA 3VGUA 2FDNA 5I3UB 1XTZA 2RE1A 3I82A 4YHHF 3BN7A 2WONA 4FXWA 1E6VA 2JSXA 2VPWB 2OPSA 1NPRA 1M1GA 3ITHA 5LMUF 4DV5F 4Y2AA 3NOGA 2UUAJ 1HQUA 1FJGJ 2O67A 2ZH5A 2O1PA 3OHBA 1RTDA 1NEEA 1LV5A 1C1CA 3HFKA 4B08A 4LF4F 1Y11A 2XYGB 4KFBA 1UJ4A 2QLJB 1WC6A 5DRKA 1D0EA 2QC3A 1AUDA 1YK9A 3GWCA 4NCAA 2HVZA 3GJTB 3VALA 3W9HA 5IM0A 1YBAA 4X62J 2LMIA 4ILMA 1CQNA 4CT8A 3PFEA 3BQ1A 2L41A 3M2VB 2YWWA 2RAQA 2RDDA 2VC0A 3A3PB 3MM7A 5H9FJ 5CCLA 1LNQA 3CCRS 2QN6B 3K0JA 3CJSA 2MKYA 1MN9A 3QIDA 2GFFA 2CWKA 2B5JB 1Q82T 1RA7A 2B51A 2RF2B 3C16A 3WQPA 1ELOA 3KG1A 3EVOA 3EDRB 2OMLA 1TZ0A 1MN7A 3DLGA 1QJHA 2WCXA 1PYSB 1A6LA 1YJWS 2O5DA 5J2QB 4JUZA 3ZO7A 1RXOB 3AB4B 1JLGA 4ZVFA 2DHXA 1RABB 5HMWA 2VL1A 2QLWA 3DNCA 1S0VA 3DU6A 2IVYA 2MZ1A 2E5GA 1CEZA 3PEHA 2JEFA 1NB2A 4EBDA 2BYCA 3HHDA 1XMQF 3R5BA 3RAMA 2ZWOA 4DSJA 4QBUA 1JIHA 2CVEA 1GXUA 4DX7A 1ZA2B 2K1RA 1RLDA 1LWEB 3HMJG 1I94J 2XGQA 5DDRC 1S1TA 1VRTA 4DPWA 3NGRA 4X4NA 2M52A 2XS2A 2CQIA 4C8KA 2OMOA 4I2QA 2I5JA 4IFVB 3WZ0A 4JI3F 4DV1J 3T1HJ 2DY9A 4URQU 3W60A 2MKHA 3M32B 3UPFA 4TY8A 4WE1B 3MD1A 4C8YA 1FXDA 3DXBA 3DM2A 2AYEA 4CH0S 2DR5A 2N4DA 4FYYB 2LP4A 1AZSB 1TL7A 4AD6A 2EPIA 3FRYA 4UUXA 1NPPA 2IYIA 4FYXB 1C0UA 1RTHB 2HBQB 2NYHA 1S76D 1NNDA 4TLRA 3H4DA 2WSFC 4AYBD 3QLHB 3THTA 1SB6A 5HO4A 4ZIVA 4G1PA 2ZJPQ 4W90B 1BXNA 4PUOB 3BSOA 2E66A 5K8OA 1P9QC 2BJ3A 3MEGB 4DU8A 2XY6A 1OPZA 3UW1A 2CNKB 2MQMA 2BRLA 2CG8A 1NKBA 3L95X 2HBRB 5EDWA 2ZVIA 2KFYA 2C2KB 5GAHI 1NK0A 3ZZ0A 1D9AA 3JSMB 1N33F 4LJMA 5K8MA 4NWBA 4C4WA 1Q16B 3FK4A 1T9YA 1REVB 5D6GA 4H4OA 1MNEA 3GB0A 4ECRA 2J7WA 5KOWA 4AFFA 3R6GB 2AW0A 2Y8WA 2CPDA 1GAOA 3HI9A 3QMQA 1ZAVA 3P6YC 1FRHA 3CJKB 5FDLB 1S57A 1N36F 5HQLA 1YDLA 3OUYB 5K8NA 2DRDA 3PW2A 2OFHX 3DRPB 2X51A 4NA1A 2CJAA 1DZ5A 4IRDA 4NCGA 5A8RB 2LQ9A 1VC5A 2XCPA 3OTBA 4ER8A 4PG5A 2HQGA 2M3DA 3KK1A 3AXKA 4QOTA 4AL5A 3NCPA 1FDDA 2LU1A 5IZHA 5J2QA 5LXYA 2DRAA 2HYIB 4DR5F 4CYUB 3CT9A 1S72S 3IR7B 3D6TB 3TAMB 1T9WA 3QSYB 4PYDA 4UZCA 3QQCD 2GQQA 3Q0AA 3PJ9A 4S0MA 4QJVA 1P8GA 1ICEB 1KS2A 1LEOA 3NBPB 2UUCF 2PIIA 4CLYA 2YPYA 2OPQB 5D4LA 1NK5A 1LWEA 1SL1A 2IC3A 4WIQA 2VDIA 2HWHA 5IFMA 1WDDA 4AQYJ 4DUYF 3HVWA 1RHKB 1R8AA 3AAWB 2M8DB 1L3TA 9ATCB 3CJTA 3TVZA 3UD3P 4OIXA 3G82B 2U1AA 1F9FA 4C3LA 5KG7A 4IFVA 4WK3A 2WHOA 2YTCA 5KFZA 3A1YG 4LRFA 4CH7A 2Q43A 4WE1A 1HNVA 3GU0A 2MMYA 2MLZA 2W8KA 1TKDA 3DMJA 1AZSA 8RUCA 1BGXT 8ATCB 3X1LB 2F9JA 2LYVA 3CPWR 3OTOJ 3TUPA
chains in the Genus database with same CATH topology
5SUHA 3HZGA 4A8QA 2FHKA 3DN9A 3BB5A 2R7QA 4TQRA 4WZQA 1VQSA 2ZBCA 4GKKF 5IT9Y 1TL3B 2VPZB 5E3CA 4NYOA 2NQPA 4EYIB 3U27A 2NS1B 2KG1A 3I0SB 2E1RA 2QE5A 2HFNA 1URNA 1X4FA 4XAKA 2VZ9A 3MECB 3M2RB 1IKXB 2EFVA 2B6AA 2ZUGA 1TAQA 4JI0F 1S99A 1VOMA 4CO5A 3H5UA 5D78A 1QAYA 4PUOA 1S4FA 1S9FA 2L9WA 5J2NA 3CJ2A 4C8MA 2R8HA 2G0CA 3AY0A 3MEGA 4PPZA 1U6ZA 2JOQA 2YX4A 2HQIA 4Q2MA 4DSEA 2VPYB 3OBIA 4F4YA 3NLCA 5JXSA 5LSRA 1FE0A 1X5TA 3LWMA 4DS4A 2KG0A 4OLOA 2E7XA 3R3TA 4QYZJ 3HVRA 3IAS9 3TAPA 3EPGA 4ECWA 3DRSA 3MMBA 3PXGa 1FKOB 1WG5A 3OVSA 2BZ2A 3K57A 2R2TA 2DCUB 4NL5A 4C0BA 1OQ3A 2J0WA 1UA1A 4NZ6A 1G3OA 2Y1RI 3GV5B 4Q0BB 5HMZA 1U48A 4IG0B 4OHVA 3UDLA 3UWTA 3TAQA 1C1BB 1Y00A 4RW4B 1RDRA 5KFFA 2IAJB 5L9NA 3NAHA 2MKKA 1QLNA 2VG5A 2QA4G 2OD6A 2KB2A 1WWHA 1X4BA 2KVIA 1K0VA 4F3QA 1G7CB 2GMLA 2HNZA 4FNIA 4K4TA 1BY9A 2E44A 1J5OB 1C2PA 4RUHA 4Z37A 4GO5X 2CPFA 4U7CA 1SI9A 1FRKA 2HNYA 4JYAF 2M7SA 2HMIB 1REVA 3ZZZA 2H5EA 4ECSA 4TN2A 3MFIA 2LVWA 4OL8A 3OL9A 7FDRA 1Y3JA 2VG7A 4MMOA 3BSCA 1SH0A 1K8AT 1R8BA 1VGYA 2X1FA 3WC2A 3CDWA 4JI1F 5IWAF 3VZHA 3K8VA 5B0EA 1HNXF 3R5DA 2FY1A 4IH6A 4PQUA 2DNZA 2KN4A 1RA6A 3CJKA 2UUAF 1PC4A 3AQOA 3CTRA 5FDLA 3Q8QB 2XMUA 1VI7A 2RVJA 1XEZA 3ZZYA 2UU9F 2KT3A 1HWUA 3FSYA 2W9CA 3J7ZT 5HLFB 2BW2A 2OP5A 1YHQS 5KFPA 2MQPA 3AQPA 2DGXA 1AW0A 1MSWD 2AYMA 3U1NA 1U1QA 1WACA 3RW6A 3K5LA 3C6TA 2D3ZA 4HEA9 5IXUA 3OUYA 2HHVA 5D4NA 1CG2A 4A8FA 3J7YI 3PHEA 2OPPB 4OZ0A 3O44A 2I38A 3DRPA 5ADZA 3UR3C 3V4IB 5KT7A 2DGTA 1F5AA 4A4JA 2JEGA 2B56A 5K8PA 3PW0A 2HG4A 3T9NA 1S7HA 1D8YA 3GYNA 1U1RA 5KTQA 1F5CA 2DH8A 4A47A 3H5SA 4NYZA 5A8RA 5L9XA 4O0IA 3GG0A 4Q5VA 2YH1A 1QVFR 4X62F 3IRXA 3J7YU 4F2SA 1SH2A 2GO8A 4I2PA 3M1VA 3FFIA 3DOMA 4DSFA 4CO2A 3H59A 1LW0B 4DSLA 2FLNA 2LU2A 4MYUA 2E9ZA 1B64A 4J9NA 3V2UC 4ZPAA 3ETOA 5G0RA 3AJ1A 4DLGA 5F0UA 4MFBA 1X7VA 1B0PA 2FHOB 3D1OA 3DDNA 1GTEA 1JKHB 2V9KA 4DR4F 2CPZA 3CC7S 1N32F 4B3RF 3S1TA 1S1WA 2A10A 2J9DE 2FC8A 1BQMB 2YKMA 5EX3A 2JVRA 3J7A1 2D3OR 1IN0A 5DDPC 1FT8A 1D9DA 1HPZA 3KHLA 2XLKA 2CQBA 3FEXB 3ZZPA 1RT1A 4ECQA 1NK9A 1FTCA 2J9DA 1KNZA 4OJGA 3VAGA 1RISA 1UJ6A 1N8RT 2JEJA 4WXWA 3PJXA 5LL6d 4HKQA 1F60B 2DR8A 3VF0B 1WD6A 2FUG9 3ZFVA 2XSJB 1JLEA 4ELVA 3N28A 1KHVA 5D3GB 2LEPA 2BUNA 4KGMA 2ZE2B 4M1KA 4YFUA 2AWZA 3D0IE 1LWCA 1HBUA 3NNCA 3D1QA 2GJIA 3FCHA 1MMLA 2CRLA 2FGOA 3MTKA 1K1QA 2V4JA 2AD9A 1JNZB 2XY7A 3N6LA 1DQAA 4I1TA 2ASJA 5MLCV 5DG9A 3IG1B 2HHPA 2OPQA 2B7BB 3E8OA 3B8HA 2N4CA 3J80Y 2LXUA 4F50A 4R5PB 4LIRA 1S6QA 2QO3A 1W2IA 4WFXA 3SSRA 4UQTA 4BBYA 4IO9Q 4QIGA 4C3MA 5K14B 3LP0A 2W9BA 1XERA 1Z2ZA 2YNFB 4HDGA 4YP3A 2MDAA 2BQRA 1UAWA 4FNHA 4MIWA 4RW9B 2HWIA 4NRUA 3KHGA 3HHLD 4X4TA 3DLLQ 1RT2B 1RT6A 4ZVEA 1R0AA 1JXEA 4U9RA 5L8RC 1TK5A 2CPJA 3C2PA 2EC0A 4JI7F 4JV1A 1UFWA 3G6XA 1A7GE 2B0GA 1HWKA 2V5HG 1ZZFA 4KBIA 5DETA 4CTAB 2DVIA 4ED6A 2CIMA 4FZVA 4CIOA 3LOUA 3LWLA 2L3MA 4Y28C 4YR0A 1G1XA 2V8GA 4TKTA 4DN9A 1SL2A 2MZQA 4O3NA 2ASYA 3FZBA 4OZNA 2M5YA 4MIAA 2BVZA 1UW4A 2JFDA 4MAKA 3LALA 2KT5A 5E3PA 3LW5C 4X64F 4F4ZA 3PY8A 1VQKS 1CPZA 2IM0A 2JH3A 4DFJA 1FVSA 3CDEA 3E01A 1HWJA 2N82B 4QWCA 1ZTWA 1X9SA 3HP6A 4ZOSA 4JI6F 2DNPA 4LVNP 5KFXA 1I94F 2DHGA 5GVQA 4L6V3 2YWGA 1YJ9S 2CPHA 1SUQB 3MF5A 5FIIA 3UE2A 1U6BA 4IFYA 2WB4A 4AL7A 2M9KA 3QGPA 2M70A 1GT8A 1M5HA 2DGUA 5HI7A 3TW0A 4AL6A 2OTJS 3IGVA 1KTQA 1VC0A 1H38A 3M8QB 5F8IA 4O3PA 2ZH1A 4ZA1A 1X4AA 2ZOMA 5F8LA 3E3XA 1JMTA 4I68A 5B0FA 3JB9k 3MDFA 3G6ES 5L1IA 3RBDA 1IQZA 1Q81T 1FEHA 3WX4A 2VKZG 4OJHA 3UCGA 1PGZA 3IRWP 3KG4A 2JC0A 3MM6B 4FVCA 2WRMA 5DQGA 2GC8A 4USJC 2HRUA 4DV1F 1Q4RA 3T1HF 1AXQA 1LW2B 3M2RA 1IKXA 4KHRA 2QFJA 2JLGA 2MSSA 2RQMA 1MMNA 1Q8LA 2DJWA 4URGA 1H2TZ 3GSDA 3MMCB 4PR6A 5B0BA 4RU9A 5JVHQ 4DLEA 3MUMP 1ZBTA 3OFHA 4KT0C 3BGFA 4BC9A 1VRUB 4NLDA 4TY9A 4R0EA 2QMWA 3PKYA 2VFTA 2WW8A 1S0OA 4W92B 3G8TA 5CYQA 1FKOA 3DXSX 3GR1A 4QIFA 4ETXA 1XC9A 3KLIB 2XHWA 4H4MB 2IA0A 4ZCKA 2COLA 5E41A 2AF6A 3TYTA 1FF2A 3ZZTA 4IG0A 5CZXA 5LSLA 3CIZA 1X4GA 3D1HA 3OR2B 4A48A 3S8SA 1C1BA 2BOPA 2VA3A 5J2MA 2IAJA 3VWSA 2R4FA 2HGLA 1KVIA 2W9AA 2WSEC 4N5SA 1EP4B 1QVGR 2B4UA 3IWLA 1UEUA 4GC6A 1HMVB 4KHPF 3CC2S 1TVRB 3GV7B 3EZUA 2FB0A 5I3UA 4IR1A 4PCQA 1NJIT 1RTIA 1KQKA 1RT4B 4DL7A 1J5OA 3SSQA 3EXYA 1LOUA 3RR7A 2FGCA 4LF7F 3HM9A 3FDSA 2NSBA 3AH6A 4X4RA 2GA7A 4RWWA 1HWIA 1HYSB 4C8LA 2QA2A 1X4HA 1WEXA 3HT3A 3KTQA 3EYZA 3OFFA 3POTB 5BJRA 3H2LA 2PMZD 1VC6A 2O66A 3RAXA 3QIPB 3OSPA 1NKCA 2HAIA 1YTYA 1WF2A 4C98A 2Y1IA 4BS2A 3P3DA 2F8MA 3UFCX 2ABYA 2FJVA 2PFFB 1M1KT 3HHEA 2ZH4A 1VQ6S 1UVLA 2NZ4A 1UJ5A 3ICLA 4QYRA 5HLFA 3Q2SC 3Q22A 3V6KA 3SQGB 4LSLB 2AQ4A 3F56A 1TKXB 2CPIA 3GFHA 4O44A 1JK9B 3RW7A 2GMHA 5K5MA 4KGKA 5MAOA 1U1LA 1DURA 4I64A 2M4MA 3CCSS 2DGQA 2IYGA 4Y2IA 2J0XA 2OPPA 4V19J 3HHLA 3P49B 1NO8A 5HQ8A 3V4IA 3PM9A 2WTFA 5F8HA 4U67Q 3NCQA 4WIIA 5JJBA 2MGZB 4DBQA 3T1YF 3DLKB 1FK9B 1DRZA 1XNRF 1VBZA 3KLEB 2ZH8A 2RRBA 3IO1A 2XEXA 3CCQS 2AJ0A 1XN9A 1HHTP 2PMHA 2E5LF 4YB7A 3VCDA 1N4LA 2JL9A 4I7FB 4NX9A 4EFAC 4J9KA 2DNLA 4QW9A 5H9EJ 1QY7A 1LW0A 2CDQA 3RB0A 4I6YA 3KYLA 2DNQA 2F40A 4HTIA 1U1NA 1FDNA 1Q78A 2EW9A 4HH1A 1GQEA 2DT9A 4IRCA 1N0VC 4UY85 1QUVA 5LJ3Y 3IFEA 2IBKA 1S9EA 3M2VA 4F02A 3RRHA 4WFBQ 5HROB 1TFYA 5EN1A 4KHMA 2QZ8A 1T95A 4EBCA 1BQMA 1HI0P 4NLUA 3PDNA 5IS2A 3I87A 3M8PB 2OPSB 2E1CA 1NJXA 2GO9A 2FJWA 3GQCA 4R0JA 4DF8A 4O3RA 1QE1B 1T8EA 1WF0A 4ID8A 4IO1A 2B3TB 4QIVA 4PWUA 4ERDA 2R2SA 3H2UB 1N48A 2R8KA 2GNKA 3C46A 2B5JA 3V81B 4BC7A 2VBXA 2BQ3A 2UV8G 2R9LA 5D3GA 2RF2A 2ZE2A 3QWUA 2EFGA 1CSJA 2DPJA 2GMJA 1HQUB 2E5IA 1XR6A 5GAEI 1M5KC 1IKYB 1X0PA 2YKNB 4IH7A 1M0SA 5KG4A 2KXNB 5KFBA 4DFPA 4MJKA 2J6SA 4YUDA 3BN4A 4OX9F 1FRMA 3M9MB 4DF4A 2G1DA 4ZPCA 1N6QB 1KLNA 4R5PA 2L08A 4KFBB 5KFHA 4HL9A 4LT6A 5GAEU 2XWXA 3SEOA 3GFZA 2I2YA 3KHRA 1IKWB 3PJWA 2XB2D 5DG8A 1VQ4S 2V4RA 3QGGA 1JLAB 5IQ6A 1RWUA 2YNFA 4RW8B 1WHVA 5KFWA 1DAXA 3FVYA 4ETZA 4X4VA 4K4VA 1RT2A 1NU4A 1ZZNA 2MKCA 3AJ2A 5IM0B 5DG7A 2F8EX 5DO2A 1Y5NB 1W25A 1VMBA 1WEYA 2SXLA 1HW8A 4ECYA 2C3PA 4TU8A 4YB1P 4Y65A 5J1EB 5I3QA 4R8UB 2ZNZA 1R8PA 3JSRA 4I0WA 2C3OA 5F9NA 4WJBA 1QM9A 3N01A 5KFRA 1X4CA 2HNDA 2UUTA 4O4GB 3I56S 3SV3A 3Q2TC 2BJEA 2MZSA 1R43A 4LQ9A 1YJVA 2A3JA 3KNGA 3RYLA 2VBZA 2XY5A 1HNIA 1N52B 4ES2A 2VC1A 3MM7B 2E7WA 1YI2S 3I4PA 3T6BA 4QR0A 1U8SA 3OTCA 3IR6B 1JLQB 2NUUG 3FMBA 3OLAA 2VH7A 3M2UB 4O23A 1VIXA 1ZPVA 3BDEA 1LK5A 4NXMF 3AA8A 3BGRB 1U1KA 4DQIA 1TR0A 1BLUA 4AQYF 4YR3A 4HTJA 2YNIB 4J9PA 2KZZA 3DHWC 3EGWB 5L1JA 2JX2A 1O8BA 3M8RA 4B02A 3MR2A 3M8QA 2ZJRQ 5HBMB 3PFOA 5KFKA 4RX6A 1FJEB 4WKRA 2IM1A 4KR0B 3IS9B 1TAUA 2RDIA 5EUHA 2CZVC 1KFDA 4JI4F 1TFWA 2Q3PA 1UP1A 1Z4UA 4A8XA 2DB1A 2CYYA 4X4QA 2B7CB 4K4WA 4DJBA 2OO4A 2F9DA 3I5CA 4ZMMA 1P1TA 3O6QA 3OL6A 1KD1T 2CQ1A 3JAMY 2VFUA 5C24B 4B9UA 3MEDB 4RW7B 1LW2A 1FNOA 4F25A 1UVMA 2DGVA 2X1AA 1TL1B 3C6UB 4RW6B 2CQ4A 1GXLA 4K2XA 2W7OA 4RUCA 2P9GA 1JLBB 3THVA 1NK6A 2F3JA 3MMCA 1CC7A 4K5RA 4L72B 1XMOF 3DYAB 1KN6A 3K59A 1WHXA 1XR7A 1JLGB 1VRUA 3M32A 5KG1A 4MKAA 3C8YA 1DLOB 4PRFA 3D54A 4NLGA 2G13A 2PO4A 2BBEA 2P9CA 2XMKA 5GMKa 2DH9A 2JDJA 1FJCA 2D7SA 2XMWA 4HH0A 2XBPA 3KLIA 4OI1A 1RT7B 3BR8A 5KT2A 4H4MA 3OTOF 1AFJA 3IXQA 3CJ4A 3N4WA 3IBWA 3OR2A 2JJ4D 4RWXA 1OWXA 3CCES 1YIJS 3MPWA 1NK7A 2CPYA 3GYXB 4EYHB 3RB4A 5HP1B 1SIZA 2KM8B 4K4SA 2ZNYA 1RTHA 4RLEA 1Y0HA 3RRKA 1TVRA 2K3KA 1HBOB 2XO7A 1Y9OA 1YG0A 4QWBA 4M8LA 2FHMA 4IG3B 5LJ5Y 2PI4A 2R2RA 3QLHA 3RB6A 4TNOA 2VD3A 3M4XA 1YITS 3E51A 1RKJA 4K4UA 4O4RA 2LQBA 5C42A 2D9PA 5U47A 1Q1KA 3CULA 4N41A 1HYSA 3DRRA 4U7UK 5HMYA 2DHAA 3J7Z5 4ES3A 4ZVHA 4R25A 5FLXY 1P6TA 1S1TB 3L3CA 1U1PA 2ASLA 4LF5F 2CQ2A 2KHCA 3QIPA 4F26A 2OKQA 2MB0B 5GADI 4IDKB 1VRTB 3KFWX 3UNGC 1NAQA 5EGYA 4C3KA 2RU3A 1NHVA 3OL7A 1EETB 5I3PA 1JLCB 3JTPA 4K4YA 1HL6A 5EWFA 3D5MA 2FVPA 5DDQC 1WHYA 2JEIA 5AE2A 1X4DA 4NLWA 2AGQA 1HD0A 1HA1A 1HQEB 3N9UC 2IHR1 3IN5A 3OQ2A 2DNHA 4I2QB 3SQGA 4LSLA 2MQQA 5GADU 4DS5A 3M6VA 3CCLS 2I5JB 4DSIA 1TKTA 2KTQA 5BYSA 4MK8A 4FBUA 4WXOA 1VS3A 2ZM6F 2QSWA 4ECZA 3SFUA 4DL5A