4DR5F

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, crystallographically disordered cognate transfer rna anticodon stem-loop and streptomycin bound
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
total genus 27
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dr5F00
1CQNA 1FJGF 4DV6F 1N33F 4DV2F 4X64F 1N32F 4JI0F 4GKJF 1HR0F 4DV3F 1QJHA 1N36F 2J5AA 4OX9F 4DR6F 2UUCF 2RJZA 4DUZF 1GH8A 4AQYF 2KJWA 1RISA 4K0KF 4DR4F 4DR5F 4YY3F 1HNZF 4KHPF 4JI8F 4LFAF 2E5LF 2B7CB 2F4VF 3T1HF 4YHHF 1IBKF 5LMNF 4JI4F 2BVZA 4DR7F 5AJ3F 4LF4F 4LF7F 1B64A 1LOUA 1N34F 4B3TF 1IJFB 1HNWF 2VQFF 1I94F 1IBLF 4JI6F 4LF9F 4LFBF 5LMUF 2UU9F 4X62F 4JV5F 4X65F 1XMQF 2BXJA 4DR1F 1IJEB 1IBMF 4B3MF 1VMBA 4DR3F 1XMOF 4DR2F 4NXNF 4NXMF 4JYAF 4GKKF 2VQEF 2UXCF 2HHHF 4X66F 4DUYF 4LF6F 5IWAF 3OTOF 2UXBF 2YY3A 4LF5F 2UUBF 1G1XA 2KJVA 4DV0F 4DV7F 2UXDF 3ZZPA 4JI5F 1XNRF 1CQMA 4JI7F 4B3SF 1FKAF 1G7CB 1J5EF 5BR8F 1XNQF 4DV4F 2B7BB 1F60B 4JI3F 4LF8F 3R3TA 4B3RF 2UUAF 1HNXF 4JI2F 2ZM6F 4JI1F 4DV5F 4DV1F 3T1YF 4LFCF
chains in the Genus database with same CATH superfamily
3S1TA 4JB8B 1N33F 2HAFA 4RL1A 1HBNB 4AL6A 2W9BA 3D0IE 2R42A 1O8BA 4ANDA 4Q7AA 3TO8A 2CQBA 1TFWA 4A4JA 2RMLA 3NRBA 1ACMB 4K2JA 2M5YA 1LWEA 3D3BJ 4USIA 3HJFA 2UXCJ 3FMBA 3MEGA 1Q8BA 3VF0B 1UJ4A 3RAXA 2BJ3A 3W9HA 2BBEA 4GKKF 2QTWA 1SKSA 4ED2A 4ETXA 2UXBF 2HQFA 5HVGA 2WBRA 4HI1A 1TU0B 2O5DA 5LOQA 3KWMA 3W5XA 2MLXA 1P6TA 2E1AA 4F04B 4M5IA 3MDFA 2VJUA 1S49A 2W7PA 3OLBA 3QFHA 1T8EA 1KQFB 4NZ0A 1IVZA 2FHKA 2EK1A 1UFLA 1JKHB 2FZCB 2K3KA 2ZVSA 2YWWA 2HK2A 4G1IA 3E3XA 1QSLA 1JXLA 1KRPA 2A10A 1HR0F 4LIRA 1GFWB 3UR3C 3J81j 1T9YA 3QAEA 1HMVA 3TYTA 4N5SA 4JI0J 5IM0B 5KFTA 3CIMA 3RAQA 1WC0A 5KFGA 2V69A 1LV5A 4LRCA 2O01C 4B3TF 1S57A 1RWWB 1S0OA 4ZPWR 4DPUA 3M9MB 1L3SA 2I6WA 1HQEA 2H5IB 3MMCB 3KHLA 4O4GB 1KD1T 4M5LA 4DUYF 4CLUA 3J7ZT 1W25A 5F0UA 2ACYA 1ZETA 1P1TA 1R31A 2QYGA 1SIWB 1W2BR 2XLJA 1D1UA 2ZHBA 2Z56B 1S9EB 3HHEA 5GAEU 1Q81T 2KYXA 1C1BB 1UJ5A 1EP4A 4KV8B 3IR5B 1UP1A 2AEJA 4ZPAA 3W2WB 4DFMA 5B0CA 4I1TA 5HMZA 1R43A 1MMNA 1SJ4P 2J0XA 1ZH5A 3S8SA 4QIFA 2XS2A 2KJWA 3IMQJ 1BUXA 4KO0A 4CT9A 2YX7A 2I5JB 3JYTB 4F0KA 2CG4A 1UA0A 3CCRS 4F4WA 3BBCA 3V6DA 3MMJA 5CD4H 3IRXA 1C0UB 3QLHB 3T9ZA 1T9XA 3PM9A 1Y11A 4M63A 2VOPA 2IPOB 4F67A 1R0AA 4J7CA 4K5RA 4LF9J 3FSIA 1YX2A 1SJQA 2KJVA 2YKMA 3PDNA 3ZZZA 2BJ7A 3E51A 4Y2IA 1YJWS 1VS3A 3ILJA 5E3AA 3HSJA 2IVMA 2HS0A 1NH8A 5D77A 3VVTA 2P2CB 3OTOJ 2UUBJ 2UP1A 3ZZUA 3JTOA 1KC8T 2EI5A 8ATCB 5EDWA 2QLJB 4UT4A 3IGVA 1WNEA 1XNQJ 1NKCA 2R7UA 2GW8A 1RACB 3RAMA 1CC7A 1RCXB 1G6BA 2LVWA 4RPFA 2AJFE 1AROP 2LXFA 3IGNA 1BQMB 3P6YC 2BV3A 3OVAA 4Q2LA 3ISNC 3M8WA 2OPRB 4PXDA 1VC6A 4GC6A 4LR9A 1YBAA 3JAMU 2C3PA 2HNZB 3LPYA 4LRDA 2AW0A 2W2OP 4ECUA 5B7WA 3G8TA 3KG1A 3CJ4A 4YP3A 1BQNA 3NAHA 3B8HA 4L3NA 5EN1A 2VBXA 5DDQC 2QIFA 1OSDA 2ACMA 2XNQA 4TU9A 1NHUA 1VR6A 4LBPA 3L95X 1MMDA 4JI5F 1FK9B 1QSSA 5CAAA 1YRTA 4LRAA 4HVZA 4G1QB 3EGNA 3PR4A 3PFOA 4ZP7A 1YQHA 3PTWA 2CPHA 4FZVA 1KTVA 3MEEB 1H2TZ 5KFJA 1YBTA 2UUAF 2C2EA 3CW2C 1LWXA 2Y9HA 2LP4A 4PCQA 3KLFA 4WZQA 2ADCA 1RK8A 3JSYA 3MAHA 1HI8A 1SXLA 2KFYA 2QA2A 1NK4A 1HBUA 3SI8A 2VG5B 1HD1A 4DPWA 4QYZJ 1HYSA 2DD8S 1JNZB 1J5OA 2OUGA 3H2UB 2B5JA 4DQSA 3T1HF 1IR0A 1GXTA 5HP1A 3L7OA 5AXMA 3HVTB 4CQ1A 3OT9A 2LQBA 3CUNA 3PVXA 2I38A 2BUNA 1GMVA 1NDCA 2V4JB 3GZ7A 4DX8H 4WK1A 2R8KA 4U7CA 1IBMJ 4QBUA 1FE0A 2ZJRQ 1DURA 3MM6A 4KGXB 4LF5J 3CCES 4CLKA 2PSZA 1D09B 2OEJA 2ASYA 5KT2A 3ELHA 1HQUA 2G9OA 3HP6A 4C4WA 5K9FA 3KTQA 3AFGA 1VRUA 4ER8A 1VLYA 3FKBA 1QLNA 1XBWA 5H9EK 1NK6A 2N82B 2R7WA 3CGIA 2VOOA 2KL8A 4IRKA 3U1MA 1C1CB 2YNFB 4NLPA 3GU0A 4F4YA 1AFJA 2L41A 4H4MA 4K5SA 4EBEA 4PXBA 4NZ7A 1D9FA 4P2SA 1WSVA 3LGMA 2EFQA 2BVZA 2XS7A 4NLYA 1HW8A 1S1VA 4OZ0A 1IJFB 2I8EA 3D66A 1NK8A 2APOA 3RYLA 7FD1A 3LF0A 3A4TA 3K8WA 3LP1A 1SKWA 1EKRA 1L3TA 3NXZA 2J6SA 1GX5A 1VI7A 2Q1LA 4AYBD 3MECB 4OYIA 5KFMA 2HZVA 3RR7A 2LEAA 3PO5A 2ZZMA 2LQ8A 1KFSA 5BYSA 2EKNA 3V4MA 5CABA 4ZN3A 2B56A 1S1UB 3TAQA 3THVA 3IP0A 4NA2A 4DF4A 1FJGJ 2CADA 4CYUA 4WP9A 2LXUA 2NXJA 4CNYA 3CD6S 1SKRA 4DV3J 1CQNA 2V68A 4J9QA 1QTMA 2MQQA 4K4WA 4MIBA 4I2PA 4YN3B 3CDAA 3HVWA 2J0WA 4DPTA 4DSEA 3BKUA 3AJDA 4CRJA 4KAIA 3M1VA 2CKWA 1H98A 2UUWA 4C3KA 3ENWA 2DGUA 3Q8VA 2XWXA 3HD1A 3CCMS 4ILLA 1ZM4A 4FP9A 1NHKL 2G0CA 5LL6d 5E3QA 3A8KA 1BD6A 5GADI 3A3OB 1IKYA 1RWXB 4CNZA 5EWGA 3QIDA 3BM7A 1T95A 3D3CJ 2ZD1B 4DI6A 3MUVP 2HSEB 3SBMA 5HJXA 1HNWJ 1VFJA 2GS8A 4ZA1A 3PJWA 4USWA 2FLLA 1RWPB 3LO3A 3BGOP 3GP9A 4G65A 1VLOA 4QWBA 1NKBA 4CTAA 1WD6A 4DV1J 4WFAQ 4P2MA 2ZH2A 1BE4A 4M5KA 2IC3B 4F8RA 1RQ0A 2RF2A 4N76A 1D3WA 3MMAA 5C24A 2PD1A 3BQ2A 4TKTA 4OZ5A 4WXOA 1YJ7A 4KT0C 2FY1A 4KTQA 2X7IA 4NLRA 2OH2A 2HFOA 1VHIA 1TL7A 4FNIA 1HIYA 3PIOQ 1LWFB 4CLZA 1TELA 2DNMA 1TKTB 2CJXB 4HKQA 4URSA 3R5DA 4U7UD 1NPPA 3IWXA 1S1WB 1RWOB 3KLGB 1WOPA 3MPUB 3KDNA 2XQCA 1CLFA 4U6PA 1G2EA 2HAIA 4ZVGA 1WKLA 2I2YA 2HHHF 2AD9A 4KIAA 3C8YA 5D0HA 3CULA 3QO9B 2XG8A 3GSIA 2AYBA 5D3GB 3S7RA 4X66J 4K4XA 3BSCA 1OS5A 4UUWA 3KHRA 3R9LA 4YDDB 4NOHA 3D28A 1LFPA 2Q6BA 3V81A 2V4RA 3QRQA 3LAMA 3OL6A 2XHWA 2QFIA 1OQ6A 3CJQA 2JHEA 3N6MA 1QAJA 3R5AA 3FRZA 1WHWA 3P45B 3DRYA 1QJHA 3ZZ0A 4OZJA 4Q8FA 2ZM6J 1UFWA 2KYZA 1NKEA 4J9NA 4TNOA 3DRRB 2PGCA 2DRAA 1X4AA 2MLZA 3AH6A 4NCGB 5A2QY 2E9RX 2H4WB 3EJMA 2BYCA 2IAJB 1LOUA 1UW9A 3LP0A 1S72S 5DLGA 3DOMB 1U1QA 3N6LA 2KH9A 4ZHRB 5DZ6A 1RWVB 3TUPA 2OPQA 1WORA 3TA0A 4ZPBA 3IXQA 2DCUB 4OHYA 4JI7F 3KJVB 3ET6A 3W5YA 3TAPA 3T9NA 2KM8B 4EUVA 3UN3A 3N01A 3QGIA 4FVMA 5A6PA 1VK8A 4DU8A 1F9HA 1HKAA 4UOHA 4EGLA 4IO9Q 5GMDA 2MZJA 3EGZA 4I67A 1NCLA 4A8KA 3OXLA 2QL5B 3LH2S 5HJYA 2UUCF 4FF3A 4DR4F 3UI3A 2KVQE 3Q83A 5HI7A 3FK4A 4A48A 2P5VA 2D9OA 2J7UA 4ZJOA 4PG8A 2AZ1A 3CJSA 3NS7B 2KXNB 4IYQA 1AA1B 2FJVA 2EKYA 5IT9Y 3HT0A 2R7QA 1REGX 4WKYA 2GIRA 2AWZA 2UU9F 3U27A 1SC3B 4JV5F 1F3VA 2CZ9A 3NMRA 2K06A 4P52A 4PKDB 5FD1A 2N7YA 2HVZA 1A9NB 1PC4A 2VC1A 3WBZA 4DFPA 4IH7A 2DY1A 3BDPA 4CO2A 1IWAA 3DLLQ 1TMMA 4CO5A 2UXDJ 3BPDA 1FRJA 1M5VC 1S6QA 3HDSA 1T9TA 1KLMA 1RABB 1RBAA 3M32B 3C14A 3CE8A 2K7KA 1EAYC 3KNAA 2W9CB 3OR1B 1RCOB 4Q0BB 1NSKL 5L1LA 1SJ3P 3PW2A 3DOLA 3UQSA 4CLTA 4JV0A 2FHOB 3T1YJ 4O3SA 4WE1A 5KT6A 2CZVC 3LW5C 4JV1A 3CSKA 1JLGA 2P6SA 1RKJA 2RE1A 2NSBA 1R8BA 1U45A 4B9MA 2GZOA 3C16A 3PZPA 2VQFF 2YTCA 2OTJS 1WEYA 2V8PA 1NJIT 2ZH1A 4NXMF 2EFGA 2HQGA 1TKDA 2JSXA 1JQGA 2GX8A 1ZM3A 1R27B 4PWDB 1BXNA 4ID5A 1TV6A 4OYPA 5KG0A 4DCPB 2XMKA 3GFYA 2VQEJ 3EWGA 3H0PA 4J5OA 1ZOTA 3J80Y 4F3OA 3NKYA 3NGKA 3D1QA 3DI6B 2B4PA 2H65B 2PFFB 3DXBA 2IYGA 2L9WA 5DG7A 5BXIA 1H2VZ 1HBOB 2C2MB 2RKIA 4R25A 4C11B 4K4TA 6FDRA 3ZTQA 2AYMA 5U47A 1GNKA 5HATA 2DHSA 4ELUA 1ZM2A 2YPZA 5J2QB 3FEYB 5A8KA 3ISZA 5KG2A 2HBZB 1ZZNA 3OD2A 4NLOA 4OI6A 1QAXA 3OL8A 2VB6A 3NS6A 3D68A 4WFBQ 1V3RA 3UD4P 1IQZA 1CEZA 2UXCF 1EJ7L 1IR1A 2XSJB 1HNIA 2DO0A 4CWBA 4F7VA 3DNCA 3PHTA 2YBVA 1KP6A 4JYAJ 1TL1A 2E1CA 3DLBA 5IWAJ 2JC1A 3M6XA 1OQ3A 3M8PA 4A8FA 3CB4A 4W98A 4DBQA 2B51A 4XIUA 5E3RA 4ZKAA 1HA1A 5IV4A 3LWLA 4EZ6A 4JI3J 1VQ7S 3HKWA 2FJEB 3A8JA 4HHHA 4WXWA 4DL0C 2UVVA 1FX2A 1O0PA 4X2BA 2AJ1A 2CQ0A 2NZCA 3LAKA 1HNZF 4KHPF 3G4SS 1R0BG 2PC6A 2ZH8A 4XK8C 4YHHF 1UTAA 4CLLA 2VBWA 4WYLA 1U6FA 4PG7A 4DL4A 4YY3J 2GAHC 1PYSB 1VJQA 1FNXH 4TLRA 3EICA 4X65F 2W25A 1XTZA 4IOBA 3UO0A 2I0XA 3CDWA 4UOFA 5HROA 2WCXA 1UFKA 3R97A 3KLEA 5ETTA 4DV0F 2X3DA 4RW7A 4KHMA 3H25A 2CYYA 3HKZD 5CA5A 4LF6J 3P3DA 4WP3A 4PWUA 3HFKA 1RU1A 4N56A 3OFFA 1V3SA 1S4FA 2R7OA 2VG7B 1UZHA 4TY8B 3QSIA 3QZ7A 4HYKA 3BN7A 3SEOA 1UMJA 2OKQA 2MEWA 2YKNA 3W64A 1TKXB 1TVRB 5IS2A 3UVJA 3MPVA 2LDYA 4OYMA 2EFNA 1B3TA 1LW2A 1R8AA 5I42B 3HFVA 3KK2A 1FVSA 5CYMB 4IDKB 4X4TA 3FBCA 2VPXB 4K8RA 3RB0A 2DGVA 3CJ3A 5GAHU 1RWUA 2R8GA 1CJVB 1VRQC 2ZKTA 2B6AB 1RT1B 4D3GA 2KB2A 3EXYA 2H1YA 1FKOA 1U1OA 2IM3A 4PUOB 1FRHA 4S0MA 3MGJA 1FERA 4UZCA 2EFOA 1AW0A 4P75A 1RTJB 4KBIA 3G87A 1L3KA 3QJLA 2CQHA 3AB2B 2KI2A 4BHQA 2E5GA 5F0WA 3UR0A 1YIJS 2YQ0A 4PAAA 4ECRA 4RUCA 3FCVA 4UQTA 3TQEA 2YNIB 4DV6J 3LGHA 1TL3B 2HHPA 3CDUA 5H9FK 1HLWA 2MQNA 5FDLA 4F3MA 4OJGA 1U0HB 4JI4F 4RU9A 4LBHA 3C15B 2MZRA 2J6UA 2V8VA 2M8DB 1GTEA 2HK3A 3VAGA 5RUBA 2OIHA 4TN2A 2D1CA 4O44A 3MTJA 4KGKA 1QY7A 4CIOA 2FVRA 3CCTA 2YKQA 3SSQA 2W7AA 4NMLA 3M2UA 2OJ3A 2QLFB 4V19J 2RDJA 2QMWA 4BC7A 2B9EA 1ZPWX 1RT5A 1T9UA 4QQBA 2OEKA 4MFBA 5B0BA 2XO7A 3K7RA 4OZ3A 1J5EF 2GMLA 1RHRB 3W66A 2CJYB 5L9NA 5GVQA 2ZNZA 3R2DJ 1YLXA 2Y0SD 3EVOA 4OV6A 2MLYA 4DMZA 1K1SA 8AT1B 5KG5A 3GR1A 2CWXA 1S1TB 2EEYA 5FLXY 5GAGI 3DMJA 1N52B 2WSCC 3I0RB 1VRTB 1DRZA 1XQIA 2FJDB 3AXKA 3TUZC 1HARA 1DTTB 4C98A 4F4XA 2E5IA 1FKPB 3H8YA 2RB7A 3KFWX 4RW6A 2DNLA 3NWGA 4K4ZA 4DR3F 2MHNA 1RTHB 1RTDA 2JC0A 1S5ZA 3LP2A 2GFFA 2GCFA 2MXYA 2ZVIA 4MKVA 4OHVA 2HHWA 4O4RA 2HBRB 3W8GA 1WTBA 4OYWA 3N4WA 1NSAA 2AX0A 2MKHA 2IJNA 1T05B 1KONA 3B78A 1OWXA 3HXMA 3EPIA 2V8HA 2DNQA 1N32F 1FXRA 1FFWB 4H4OB 4L74A 5IQ6A 5JJBA 4AFFA 1GAOA 1U1RA 1TP7A 2CJBA 2LA6A 1RSCA 3C6UA 2A6MA 3DKDA 1JLAA 1SV5B 4NA3A 1CJUA 1HNVA 1VQ4S 4A8XA 1K1QA 2BE2B 1FDDA 3C6TA 4BWMA 1PG5B 3A3NB 4EO6A 2HGLA 2BKOA 1VQ6S 5AXKA 2Q66A 4WZMA 1XMOF 4M95A 3W63A 2HBQB 2QMUB 4DL7A 1X9MA 3OFHA 2J76E 3OUYB 3MI7X 3SSRA 2QA4S 1VDHA 1QDUB 2XZTB 1MSWD 1SJRA 4RW8A 4QCLA 2QC3A 3KK1A 4ETZA 4LF8F 2RNEA 3TAMB 3E8OA 3N28A 3WIUA 1S6PA 2ILZA 4MYTA 4BS2A 3J7YI 2QL9B 2BRKA 5HQMA 5DLFA 2Y3YA 1FJGF 1FRKA 2DCLA 2IDLA 4DV3F 2VH7A 1FJEB 2J9DE 2PMZD 4ES2A 5DM7Q 1YBUA 5C2CA 4UY8T 4NA1A 2OI2A 2RQMA 5E41A 5LJ3Y 3GJQB 4B08A 1H7WA 1RUSA 3EYZA 1ZM9A 2LCWA 3G6YA 2HHQA 2V34A 1U2CA 3DU6A 3UNYA 1KHWA 2DEIA 4XTTA 2MYFA 3KUGA 2EFPA 1PILA 2ZH9A 1RLDA 4OYXA 4DSIA 1VMBA 3TUJC 2RQKA 2KG1A 3OVBA 3W9JA 1JLFA 4OLOA 4KB7A 4LFBJ 1NZAA 3IG1B 4O3RA 1FRLA 1I5OB 3MEKA 4RUBA 1T9WA 4BBYA 1CSJA 2V94A 4DV7J 4E8UA 2F7VA 5AE2A 5FJ4A 1R3NA 2K7JA 4DV1F 2FD2A 2YKOA 1Y00A 2EPIA 1NJWA 3SXLA 3KLHA 4C8YA 3W62A 4ZPCA 2FC8A 1JLCB 1JB0C 1GH8A 4JI8J 4QU7A 1HBNA 5K20B 2ABYA 2VODA 1QD1A 3K5LA 3CWJA 2F3JA 2N4CA 3IA0A 5KG1A 3EDQB 2DXFA 2G0IA 5J1EB 2YKAA 2HHUA 3MCOA 2BM1A 1X0PA 1FWLA 3N79A 4G6VB 5LMUF 3NS5A 3X3UA 4Y00A 3ENAA 4QJVA 3M8SA 4RU2A 2PEHA 1TUWA 4JV2A 5JUMA 3FUYA 4WTYA 2CQ1A 1WG4A 4DEZA 1SKUB 2FLOA 4P7VA 4M5DB 4WTOB 3GR0A 3QQCD 1H3DA 4MIAA 2O3DA 2V67A 1JNRB 4B3RJ 2AT1B 5I3UA 1JKHA 1RYRA 4OLPA 3OTEA 5HK4A 2PI5A 2RU3A 3IM8A 1I51B 3NOCA 4QPTA 5LXYA 3OTCA 3GLJA 3P96A 3M2VA 4B3OB 5EX0A 1WJ9A 3T5JA 4Y2KA 3V2UC 2J7WA 5KFSA 1Q86T 2EBGA 5CQGA 1XK8A 3MUMP 4KH1B 4YDXA 1U1MA 1Z2ZA 2LQ5A 4DLEA 3MMCA 3RRGA 4O4GA 3PYDA 4XAKA 2CNLB 2BOPA 4P2FA 3ILLA 1FCAA 4I69A 4DDFA 2RIJA 4USVA 4J9RA 4PG6A 3TJAA 2C3YA 1S9EA 3MM9B 1C1BA 1JMTA 5GMKa 4KV8A 4MKYA 1V5VA 2CQPA 2BDPA 4TVAB 1OSCA 4ANCA 2IVFB 1X4DA 2LFVA 4B02A 3W2WA 4AQYF 5HLFB 4GRSA 3CD5A 4XDCA 2XYPB 4D3HA 5I4MA 3HHLA 5IT4A 3CMES 2Y0BB 4J9VA 2I5JA 2ZDOA 4BC9A 3JYTA 3GJSB 4WIIA 3MR6A 2RS2A 3GV8B 1X7VA 2IYIA 1IBLF 2WB1D 2HQ3A 4P6QA 1C0UA 2HPUA 1K0TA 1YI2S 2WVBA 3Q8UA 1FWKA 2F63A 3QMQA 4KPCA 2UV8G 1WHYA 2F9DA 3WC2A 1HQEB 3ZZPA 4I68A 4ELVA 4IG0B 3J7AN 4O0IA 2FQQB 1Q8KA 4Y6IA 1FDNA 1F9EB 5F8HA 1RBOB 3RBDA 4B3SJ 1H7XA 3T3FA 2DNKA 2FHMA 3ZTPA 2Z58B 1NK0A 2VD3A 1T9VA 3UD3P 4KFBB 1BGXT 3JAMY 3VAJA 2GMHA 4C97A 1XR5A 4O3NA 1URNA 2AIRB 1YRXA 2VFVA 1B4SA 4KQZA 2ZJPQ 4OYOA 2R3VA 4IG3B 1FJ7A 1RISA 4RW9B 1BQMA 4Y34A 1NM2A 2CNKB 2EWHA 2LMIA 4RBUA 2QZ8A 2XB2D 1IM6A 3HULA 2OPRA 2R8HA 2A2DA 1V5IB 2M70A 3FCHA 1Y3KA 3W5ZA 3V5RA 2V8DA 2EK6A 2GVDB 1KNZA 2HNZA 2V2ZA 3NCRA 2R2UA 1UEKA 2I1RA 3IN5A 4URQU 5IQQA 4BDPA 1HWUA 4ZVFA 3IRXB 4EO8A 4N8OA 3QRRA 2XMAA 1YKWA 2GIQA 1APSA 4Q45A 1S0MA 1R0AB 1WF2A 5C25A 3Q8PB 1IM4A 1FK9A 3OHBA 1DHMA 3OSNA 2YKMB 2MKIA 4G1QA 2MSSA 2CQ3A 3MEEA 1IN0A 2V50A 2HZAA 2AEFA 4NL5A 3JQJA 2VKZG 3W61A 3N9UC 4IFVB 4NPOA 1N5TA 4LFCJ 2RJZA 1SQEA 1KHVA 1WC3A 4QR1A 1UPMB 3HHKA 1PC5A 3K8VA 1S0VA 3T5HA 2MQPA 3QAUA 1RBLA 4LFAF 2ZFHA 1XMBA 3KUEA 3QIPB 2XI3A 2E1PA 4LRBA 5E3CA 4NMXA 3QSYB 2IJFA 4M5GA 2BMBA 3S6EA 2PIIA 4NLTA 2JL9A 2ZOFA 3LQVA 2ZHOA 4ZCKA 2V4JA 3V6HA 2V2VA 4B3MJ 4Y28C 5HMWA 3CO9A 4Z7CA 2XULA 1WKKA 2CPXA 2MZSA 3QNWB 3MOJB 4C9DA 3R3TA 3V6JA 4M8LA 4F0HA 2W4PA 1Y5NB 5HBMB 1D0EA 1CULB 1HHQA 4LSNB 4ZN1A 1HBMA 3TI0A 3QFWA 1HNXJ 3DRSA 4DV5J 2GNKA 5KFXA 1CVJA 2VFUA 3GCXP 3VZIA 1PCAA 1WWHA 3GYNA 3PKMA 4K4YA 1C1CA 1RA6A 2YNFA 1FWPA 2XMTA 5JVGQ 2XI2A 2FVQA 1VQ5S 3QYYA 1T02A 3BSNA 1VJWA 2IVYA 4ZMMA 2ROEA 1S12A 1HBUB 2VFTA 2HURA 1LQ9A 4ZVHA 2JLGA 1WSRA 4QWDA 2KM8C 1RT6B 2IDEA 1N48A 2D3ZA 4LQ9A 1MW7A 1VBYA 3D0HE 3HSDA 3ENVA 1PAEX 4MKAA 3SCIE 2K3IA 4IQXA 4TQSA 3BO2A 2M4MA 2HHVA 3FVYA 3OXGA 1MROB 4DPYA 3OW2R 1NO8A 1IUJA 3F73A 3ILOA 1S1UA 3MM6B 1OYDA 1W7WA 1Y3JA 2AHOB 2E5HA 3DU5A 2DIUA 3T5KA 4LUBA 3E01B 1LXJA 3FRYA 1H0HB 3I5CA 1N5SA 2E1MC 2ZWPA 4QPXA 4ILMA 2RU9A 1VRUB 4YB7A 3CJKB 4I64A 3G82A 5HL7Q 4NLVA 2YXLA 1CJTB 2JVRA 3WHIA 3BGUA 4DX6A 3W7BA 3VAFA 3CCVS 1ELOA 2V8GA 2P6TA 4F25A 3PCOB 4IKAA 7AT1B 2MY8A 3PYGA 2BM0A 5CH7B 4H4MB 3EVMA 5F8JA 1WHVA 3C46A 3TUIC 2VUGA 4X62F 1VQLS 3KKFA 1S6UA 3PNIA 3CNQP 5AJ3J 4LF4J 4HACB 2DGXA 2MQLA 4FYXB 5DDRC 1A0OB 3G86A 5KFRA 4Q44A 4J9KA 1EZZB 2MKJA 1Q78A 1FVQA 2QT7A 5EHHA 4QU6A 1C2PA 4B9SA 4NXNJ 3D5MA 5KFWA 3BO3A 2MZ1A 4URGA 2DNHA 1S99A 4ILRA 3F41A 2U2FA 1VQNS 2ZNYA 4C0BA 3W2VB 2HMIB 2B4VA 4LREA 3GJTB 4X64F 2CNOB 1KDNA 2ZEJA 4RWXA 3J7Z5 3W8PA 4NYPA 3Q8RB 4M5NA 3UDEA 2MKYA 3MD3A 2JEJA 1HL6A 2MKKA 2NUUG 2G4BA 5HSPA 4ECSA 4WYWA 2KKHA 3A12A 1LWFA 1X4GA 1TKTA 3ZXWA 1X9WA 3PJ9A 4CO1A 1ZYQA 1WC1A 1S1WA 1FDBA 4YB6A 4I4BA 3B54A 4KPYA 4HHJA 4UW2A 2RUSA 5J2NA 1SI9A 2YY3A 2BKNA 3IFEA 2Q43A 5GAEI 1FF2A 1PAUB 3QT5A 4V19X 2DHHA 2EW9A 3QO9A 1X31C 3HPOA 2U1AA 3P5TL 3VQSA 2VPYB 1XNRJ 2WK4A 5ADZA 3UDLA 4DS4A 5DGAA 2YNGB 4CTAB 2IMWP 2E9ZA 4DOZA 1PJ5A 3V4IB 4DV2F 1YHQS 3G9CA 1FO1A 2C2NA 5CYQA 2FZKB 2YWKA 4L76A 2X1GA 2RF2B 1FA0A 4Z2XA 1MMLA 1UAWA 4ECXA 2VBYA 2K8GA 2DO4A 1N33J 3QATA 2MTLA 1W2IA 3CCLS 1QVFR 2CUYA 1K73T 1KOOA 2E5LF 2FLNA 2MPUA 3DRRA 2NR0A 1E6VB 1ZA2B 3MAAA 4NCGA 5EWFA 1YDLA 6FD1A 1S77D 3DGVA 1HPZA 1YGYA 1I94F 2BW7A 2IAJA 2Q3PA 1WACA 2ERRA 2OGUA 3IBFB 3DOMA 1TR0A 1CJKB 2OAUA 1EARA 1Y5IB 4ZHRA 3GCWP 4ZP9A 1RT7A 3UDVA 5KFNA 2AQ4A 1JLBA 2ASJA 1ULRA 3RB6A 3WX8A 2AJ4A 5DQHA 3D6TB 4DN9A 4LT6A 4GKKJ 3BREA 4J9LA 1N6QA 1JXEA 4ELTA 2UXBJ 2DRDA 3OXFA 3HHNB 3U7JA 3ETMA 4WU2A 1UPPA 3AHPA 4OI1A 3DLKB 4Q5VA 1SQFA 1WEXA 2B43A 4GVBB 3DGPB 2J8AA 2ZH3A 1M5HA 1S97A 2CQDA 1GT8A 1RI7A 1QVGR 1R6YA 2H4YB 4X4UA 2JLFA 2BR0A 1HR0J 2XY7A 2J0QD 1FNMA 1YITS 3NBPA 3PY8A 3KLIB 3BKTA 1CPZA 5KFZA 4EK2A 5GMEA 4ZK7M 3DRPB 4JI6F 2Z2ZA 2ZKUA 4WPAA 2O1PA 4B3TJ 3I87A 3IRWP 5ETOA 1ZZFA 4QYZK 3TVZA 3I0SB 1F1BB 3P5BP 4DS5A 1RAGB 2YWHA 1TL4A 4U95A 2HVIA 4PQUB 4DUYJ 3AJ2A 1T11A 3Q22A 1DLOB 4EBDA 3SYZA 4KH0B 3CDEA 4CM0A 4AE5A 5KOXA 3MPWA 1VQMS 5DDOC 2CPEA 5KFOA 1QE1B 4JI2F 2RAQA 3TVKA 1Y7PA 4A8QA 2DJWA 3A8EA 1RHJB 2DNYA 5KOWA 1P8GA 5HMXA 2UZAA 2YQ1A 4LRFA 1RWNB 5DO2A 1PO6A 1JLQB 4QW9A 2W7OA 2W9CA 2D7SA 1UJ6A 4TU8A 2CFXA 4C48A 3HF5A 3WQPA 3PYEA 3DDKA 2OSRA 3UN2A 1OY9A 1RTZA 3O3LA 4J9MA 1VQOS 4OHXA 1RZMA 2F4VF 3HX9A 5CZXA 5KFQA 3MR7A 2HNYB 1MNEA 2IBKA 1YJRA 4W92B 2RHQB 2VFRA 3ZZRA 5KG3A 4GC7A 3ZFVA 2CWKA 3KG4A 2NPIA 1H72C 2AF6A 2XTJP 1WC4A 3H40A 4TYAA 3UD5A 5AXLA 3MM5B 3OTDA 3FZBA 2R8JA 1Q79A 2O67A 3TR5A 2M0GB 3GTYX 4OYAA 5B0FA 2LU1A 4JI1F 1FE4A 4QIEA 3KOAA 3UFCX 2JLEA 1TZ0A 2VU5A 4ZVRB 2C2KB 3DI6A 3D6HB 4Y65A 4LJMA 4CO3A 4NLSA 3LGNA 2N3LA 4DR6J 4DUZJ 2DTJA 3O44A 3B82A 3TX0A 4ED5A 3J7A1 1M0SA 1NZ8A 2XO6A 3NGRA 2QGFB 5D78A 2N7CA 3IC1A 1BWEA 3DOLB 1HBOA 4JI8F 4WE1B 4C11A 1FRXA 1A6LA 4PR6A 2BJ8A 4N7TA 2WONA 3SQOP 5F3TA 2HQDA 2CAJA 2FUG9 5K14B 5J2QA 3Q8SB 5KFAA 2ZDPA 3TOQA 4IFYB 1W26A 5A8RB 2FIUA 4HH0A 5D4LA 1HFEL 1DZ5A 5T7LB 2GO8A 4NYOA 4CO4A 4I2QB 3H4BA 5KFEA 2VDIA 3QBCA 5BJRA 4TQRA 2F8MA 4C0OC 2FZGB 3MURP 4QIVA 1U1NA 2KT3A 2VG6A 5LXRA 1UVNA 2MMYA 2BKPA 4R5PB 2NREA 2LQJA 9ATCB 1BLUA 5A6WA 2Y1LB 1YTYA 2WSEC 3CJ0A 2UUAJ 1X9SA 1C0TB 2VA3A 4L72B 4EZ9A 1X4HA 2PA3A 2YX4A 3GFXA 3RB4A 1SL2A 1P1LA 1CBKA 3H42A 1GX6A 3Q8QB 2BJDA 4RUHA 1RE1B 1UVMA 2OFHX 2JWNA 4UF4A 3TQ1A 1FNOA 3TZZA 3O1LA 2HKEA 2MJUA 3M8ZA 2DR5A 5L9XA 5D6GA 4LBIA 3T1HJ 4X4QA 1DJ0A 5A8KB 5IFMA 2IFXA 1GMWA 3PKYA 1DQAA 2H5EA 4OJ3A 4WK3A 2HWTA 4CLWA 5IC6B 3IS9B 3AY0A 1WF1A 2WRMA 3GIIA 3I5AA 3GIMA 2JVOA 3F56A 5BR8F 1PJ7A 1NNDA 4NASA 1K47A 4U7UK 3NNAA 4Y2CA 4HTIA 4LSZB 3VGVA 2IM2A 2NXUA 3QGGA 1TL1B 4ZVOB 4EI2A 1XERA 5KT5A 4TY8A 1SUQA 3OR2A 1T3NA 1HHTP 3IAM9 2NS1B 8RUCA 2KT5A 4MMOA 3H2VE 2JRSA 4C0HA 1TKXA 1TVRA 3W1YC 1I6JA 3VGTA 1CS4B 5CYMA 4IDKA 2QRRA 1YJVA 1DQ9A 2E5JA 2KT2A 1Q7YT 3K2YA 1N54B 3POTB 3HSGA 5F8IA 4W4MA 3SDEB 2QEXS 1EB0A 4R8UA 2JEFA 3BEGB 1RT2B 2C42A 1IXKA 2EBEA 1CJVA 2AJ0A 2B6AA 4J90A 1RT1A 1YG0A 4L73A 2HFNA 3RTVA 3NLCA 1TAUA 3UCZP 1SVDA 4PUOA 4I56A 1UWBB 5ETKA 4I7FB 1L5UA 2OMLA 4DV4F 3C66A 2GMJA 3TZYA 4HT7A 1TK0A 1GEHA 3H90A 2ILYA 3IR7B 1RTJA 2RS8A 3IR6B 1WDDA 1FXDA 4RJVA 2ROGA 3H59A 3EDRB 2OTLS 1T03A 3BV8A 1SL0A 4NLXA 4KR0B 4XPEA 2J5AA 3IO1A 5J2PB 2HGNA 1WC5A 1N5YB 1FX4A 3R5JB 1ICEB 1TKZB 2YKNB 2Q6CA 2GVZA 3PW4A 4M94A 4DXLA 4P74A 4MK7A 3MWBA 1TL3A 2ZE2A 1FRIA 4NLGA 2QN6B 3KK2B 1N34F 1R8CA 1U0HA 2QLXA 1GK8A 2LDIA 3JSMA 5SUHA 4ATNA 4DX5A 2ASLA 1U49A 3A13A 4Q43A 2J8SA 1Y5LB 2RVJA 3TNVA 3K89A 1WHXA 5DG8A 1HI1A 9RUBA 4ICLA 1R6VA 3HHLD 2ROPA 4C8NA 1NB2A 2X3GA 1CC8A 4OV1A 3MCMA 2W2PP 5DGBA 4YR0A 2DGSA 4LQ3A 2ZH6A 2NCKL 2D3O1 2F4FA 3T5LA 3BR9A 5C2GA 4FYDA 1RT3B 3PFEA 1TUVA 1RHMB 2ZITA 4AT1B 4WJBA 2Z0GA 5G0RB 4ZVSB 2KFZA 2D41A 2HIYA 2CPDA 5F3ZA 4KKOB 1S1TA 1N88A 3N0VA 5J2MA 1U8SA 3RJMB 4FVCA 1A7GE 3CMQA 1EETA 4P72A 2JH3A 1DTTA 4RNNA 3MEDA 4DHVA 5F9NA 2X51A 4RX6A 4OHZA 1S79A 3D2WA 4DR1F 2M2BA 1OIAA 3ICLA 4ZITA 4X84A 1B7FA 1RTHA 3SQGB 3SCKE 3TW0A 1UETA 2I9SA 2HS4A 3PW0A 3MF5A 2XMWA 2HHHJ 1HWJA 3RW6A 1LW0B 3ZTOA 2DGTA 2H51B 2ATLA 3MR3A 2MZTA 2C3OA 5KTQA 2F5GA 1T05A 3I55S 3NCQA 3RUBL 1X4EA 1ROFA 1R7IA 1NLKL 1MN9A 1U2FA 3U1LA 1S6OA 1DFDA 1ITPA 4WF9Q 3FJ2A 4CH7A 2RH3A 4CLPA 3EUNA 3TEHB 4YS2A 4H4OA 3FFIB 1S10A 3FQLA 3VAKA 2E9TA 2CA9A 3IBCB 1RTIB 1NPKA 2QLWA 1IKWB 2D74B 2Z2LA 4MAKA 1JJCB 3L9ZA 3BQ0A 2NXCA 3DYAA 4YUDA 3RG6A 5F9LA 2ZBCA 3MM7B 1SV5A 3DLHA 4LR8A 4L75A 5KFUA 3TJ8A 3F0NA 2JFKA 2AGQA 4QZVB 3VAIA 3NAIA 3CXCR 2RHSB 4NYZA 5D15A 2DGOA 3OUYA 2XCPA 3HK2A 2DH8A 5KFCA 3LP2B 3BB5A 4HT5A 4DUTA 1NSPA 4JP8A 4JI7J 2DKOB 3VVUA 3EZ5A 2BE9B 3M6VA 4GMKA 3TAMA 1LK7A 3R7BB 4C8OA 4I6WA 5EUHA 3EMTA 4Y2MA 2A1BA 1N36F 4DR5J 4PYDA 2GC8A 4OX9F 2PFDA 3K5NA 3VALA 2BQ3A 5D0GA 2LECA 2AP6A 3O6QA 2UUCJ 2XLIA 1P9QC 2NQPA 1WF0A 2M7SA 2HEKA 4DR4J 2UV8A 2CQIA 4F36A 4CM2A 3OJSA 4FF2A 4USKA 1KWMA 3R6LB 3DLGB 3VGUA 2HHTA 3PEHA 1HNVB 2R2TA 3H5XA 3OL9A 3PXGa 2UU9J 4DJBA 4KGVB 3R27A 4JV5J 2SXLA 2XYGB 5DQGA 3RRHA 4IH6A 4N41A 5KT4A 5IC4B 3H2LA 5KT7A 4R0EA 2ALZA 2CVIA 4ZVTB 5MLCV 1HW9A 2MZQA 4FS2A 1U47A 4ZJLA 1VBZA 4Y0FA 3VHQA 4ZPVR 1Y0HA 4L6V3 3HLUA 4RZRA 4C8MA 4GKJF 4FNHA 4DCJB 3VZHA 3M9NB 1VBXA 1K44A 3DLEB 4A8YA 1JLCA 2VPZB 1EIYB 2V6AA 1LKZA 1Q8LA 2GHVC 4DR7J 4ZCMA 3MUTP 1UVIA 3G8SA 1J2VA 4X4NA 3MHYA 1Y4ZB 2HQCA 5K8OA 5LMNF 1DARA 1TFYA 4E0DA 3SV3A 4KJIA 2DBBA 2V2KA 2PDAA 3PR5B 2HHXA 2GJFA 2W4DA 4ALZA 4DU7A 1XMQF 1YZ6A 4ECQA 4F26A 4DR2F 1UVJA 2C2DA 2VQFJ 1OO0B 4WWSA 5C42B 4BWJA 1UW4A 2L9DA 2YH1A 4YB1P 2BANA 3GPAA 3OFGA 4NXMJ 2R7RA 4A8OA 5DJBA 4C6AA 3TEGA 1S1XB 1UA1A 2HRYA 1X5SA 2XMMA 4NEYA 1RHUB 2KN4A 4PG5A 5HANA 4KHRA 3FC9A 3HMJG 3KXDA 3DOKB 4RWWA 4C3LA 1H74A 3GFZA 3CVKA 3MPDA 1M5PC 1YJTA 2EC2A 2OELA 2R4FA 5GAHI 4ZDNA 1RB0A 5HAOA 2W8KA 3KLHB 1DTQB 4WP8A 3HSZA 3TVYA 4I6YA 4ENOA 1TK8A 3SCLE 4TLQA 3SSSA 1IBKF 5HVFA 4KGZB 4LF7F 4B3OA 3FBFA 1NBEB 1UL3A 1JLEB 3I5BA 4CLYA 4CDIA 1E6YA 4MYUA 5J1NA 3AXMA 5KFFA 4WFXA 4DG1B 3GB0A 4FKXA 2AYGA 3C2PA 4O3OA 1PSDA 4N47A 1UZDA 2DNZA 1F5CA 2KO1A 2MJNA 5F8NA 3BO4A 4IO1A 2WSFC 4YQWA 3UW1A 3R5GA 4ZOSA 1RAJA 4DSJA 4KE5A 3MM9A 4DSKA 3JSRA 1PKUA 1HQ2A 2GAGC 4J9OA 5KG4A 3HHDA 4W90B 2R2RA 2DPIA 5HLFA 4ECZA 5I3UB 3K5PA 3JQMA 5DDPC 4MK9A 3GQCA 1HNZJ 1Q1KA 4KHPJ 5LSRA 2JNJA 5THWA 4PWWA 4YHHJ 1QAYA 5M2UA 3M2VB 4E98A 3DRXA 2M9KA 3LUYA 3OL7A 4WCEQ 4X4SA 4X65J 5D0RA 1TTHB 1FESA 2HLUA 2B9YA 1CG2A 3H5SA 4M5JA 3KK3B 3V6KA 3PEJA 2LLZA 3I9V9 1IKXB 5KT3A 5LSOA 4IG0A 3DHWC 4DV0J 1S9GA 1SC1B 4LF1A 3R5CA 5D8HB 2XCAA 4RBTA 3IM9A 3BYPA 1O5JA 2LYVA 1VC5A 4JI0F 2DXEA 2CPZA 4KFBA 3A8IA 5D0EA 5ETSA 1ZBTA 4IG3A 3UPFA 2W01A 1WG5A 2MY7A 4RW9A 3OVSA 3CJ2A 3CJ8A 3NG8A 2JDJA 3GSDA 1O51A 2DGWA 2J9DA 1AUDA 4OI4A 5E0OA 1PYOB 2DITA 2DNNA 2ZH7A 3R6GB 3HHLB 4H54A 2GVDA 2FJBB 5KFYA 2AX1A 3I56S 4DSLA 3M8YA 4LSLB 4O3PA 1T3OA 1U7LA 5L39A 2BEFA 3OJUA 4NCAA 2L9NA 3M8QB 1BQXA 1N8RT 5KG7A 3ZO7A 2G1DA 1TAQA 2FVCA 1IWGA 2Y1RI 1BY9A 4FF1A 1VYAA 3RW7A 2KXHA 1NK5A 1V9OA 3BBBA 4DR6F 4DUZF 4TYBA 3B4DA 4IFVA 5A76A 3UN5A 3I96A 1NUEA 3L4BC 4QWAA 2RT3A 4TY9A 3BGRB 4FN5A 4I6AA 5F41A 3MZIA 3DN9A 3QIPA 3D6FB 3GONA 2A6OA 4YOEA 4LF9F 4J91A 1URRA 4JI4J 1D8ZA 3HI9A 3W65A 1AZSB 1S7IA 4CT8A 3OTOF 1IKVB 4UY85 2UUBF 2W1BA 3M30B 4ZCLA 5B0AA 3T41A 4ECVA 2DEJA 1XNQF 3FQKA 3TJ9A 1Q7LB 2UVRA 3CD7A 5DRKA 3J81U 2RRNA 4NLUA 1AYEA 1J5EJ 3VV2B 5C25B 2M52A 1X5OA 2AGPA 4HL9A 3MFIA 3QWPA 5C5JA 2ZUGA 3CCQS 5HBMA 6AT1B 1CULA 3AAWB 3EVWA 3I31A 4LSNA 1FFGB 4ECTA 4ZVPB 2X1FA 2VDHA 2ZHAA 2KZZA 2K1RB 2GO9A 1X4FA 3R8YA 3GIKA 3G6ES 4J9SA 3M8RA 3BDEA 1FEEA 1H73A 3THPA 4RKUC 2J9CA 4WFZA 2DVIA 4P10A 1F3FA 4DN0A 3KJNB 3K5OA 3SIPB 3ZZTA 1Q53A 2Y8WA 1RT6A 2LEBA 5I3QA 3FSYA 2WHOA 5AE3A 3FGVA 3JXOA 2G0JA 3AD8C 3GYXB 4DR3J 4ECYA 4K59A 4WFNQ 2ZZNA 2V5HG 3OTBA 3ZZYA 3BJYA 4YMEA 2M88A 1D9AA 4ED3A 3M2RB 2V9KA 3CD0A 1YJUA 4ED4A 1JXVA 2NXNA 2LQ9A 2XHCA 1MROA 3L7PA 2BJEA 1WC6A 1VQKS 5IOLA 2DNPA 1HWKA 2VKRA 1TQLA 3Q2TC 1R0CB 1MWQA 2DB1A 3TRGA 2CJKA 3CCZA 1KR4A 1LWCB 3Q23A 3E01A 1XC9A 5KFLA 1N32J 1HBMB 3CJKA 5IZHA 3K5MA 2YNHB 1NK9A 3DRSB 4A47A 1CJTA 4LMZA 5ETVA 3KNGA 2BJ9A 4TU7A 2RUGA 3EGWB 2CJ9A 2CZ4A 1QUPA 2A3JA 4UZBA 7FDRA 1IBMF 1RAFB 3CCJS 1U26A 3FBEA 3MPYA 3DM2B 4HACA 4IRDA 4LF5F 4PXEA 3D6MB 3RBEA 3MMBB 5CCMA 3PX0A 4DWIA 1XMOJ 3G6XA 1CQMA 2HFVA 4CLFA 1VQSA 1BMQB 1WI6A 2UVUA 2DXDA 1AB8A 4NLQA 2OPPB 2DR9A 3QGHA 4WIQA 1GQEA 3T19A 4DLGA 3IWLA 4NLWA 4MTPA 4LF8J 5JXSA 3OV7A 1GMWD 3IWNC 3W2VA 2HMIA 4USHA 5EGYA 5A0YA 2B9XA 1B0PA 1AFIA 4DQPA 4BCAA 2L08A 3TARA 3JSBA 2B4OA 4K4SA 1U4BA 1VBKA 3LWMA 2MQOA 2FLPA 2V9WA 1UCNA 2OPSB 3ITHB 3G82B 2HNDB 4NX9A 3CCSS 3NGTA 2GGPB 2JEGA 1VQYA 4C8LA 5E7OB 2UVWA 2A2CA 1NDKA 5MAOA 2W4CA 2Y1JA 1JK9B 3AODA 2XZWA 4CI0B 2DNGA 5LSLA 4P71A 2PEBA 5B0EA 4ES1A 1NPRA 1VIOA 1D8YA 4P73A 4PZVA 2E7XA 2QA1A 2DR6A 1MU2B 4RNFA 1G7CB 3E2EA 2NYIA 2ALYB 1IQTA 3UDCA 2DHXA 4L3KA 5FIIA 2POKA 2W24A 2GV1A 2CPJA 2WVFA 1REVB 4RW4B 5HQ8A 3MM8A 2L48A 4F4ZA 3R1LA 2FGCA 2YNGA 3D1HA 1BC6A 4A46A 4CH0S 3V4IA 5KFIA 2B9WA 2NXEA 5K8MA 3THTA 3PG9A 3FMWA 2OLWA 4FPIA 3PACA 1XN9A 3OLAA 2JZ5A 2AKWB 4C7QA 1AXQA 4EWTA 4ZJQA 1VCTA 2VPWB 1E6VA 1H6KX 1HNWF 1DAXA 3UCUP 4AD6A 1Q8IA 3LTOA 5A8WB 1U02A 1T7PA 5M2RA 4H4KC 5AT1B 3LOUA 5E3PA 3JTNA 5B09A 1HWLA 5EWEA 5LMUJ 2OP5A 1VQ9S 1CJKA 3CPWR 2NLWA 2XC9A 2AZ3A 2EC0A 4MIWA 5J2NB 3QT8A 3KJQB 1NSQA 3HO1A 3NGSA 4OFZA 3K17A 3KG0A 4ED7A 3MXHP 4NI2B 4Z37A 4ZLLA 5E33A 3DLKA 2ZBIA 4QIWD 5DETA 3UE2A 1RT4B 4GVBA 2H5JB 2XGQA 1UWAA 3DGPA 2BA9A 2BX6A 3AOBA 4CO0A 3HT3A 2FHJA 4OL8A 5F8GA 5CYQB 3I82A 2YPYA 3TX8A 2KXFA 3DDNA 2MGZB 4MT1A 1GXLA 3FBBA 4IR1A 3KLIA 3RU0A 2CQ4A 3DRPA 4YEAA 3MAAB 1SH0A 2XMUA 4OI2A 1HPZB 4X66F 4HLBA 2GQ2A 4KRWA 2GHPA 2OO4A 1RADB 3X1LB 5H9EJ 1U24A 3CJ5A 1YVFA 1C4AA 3I0SA 3BSOA 2MDAA 1RP5A 2ZUAA 3ISND 3WDOA 1RT7B 3M4XA 5BYRA 4PQUA 3ZZOA 1JLBB 5DS7A 2WOMB 2ZBQA 1DLOA 1RHKB 2VBZA 1NJXA 4WKRA 5ETRA 2CDQA 2AV5A 2ZM6F 1N6QB 1D9DA 1QE1A 2QX0A 5ETQA 2W9BB 2DY9A 4CH1A 4P9SA 5IM0A 4K0KJ 2W2MP 4RBVA 1XJWB 4M1KA 3GJRB 1JLQA 2HVHA 4DR5F 3CC2S 3ADAC 3BGFA 2AJQA 4DZ6A 4EBCA 1KFDA 1LWEB 2LKZA 3NNHA 2UUTA 2EFVA 3O5TB 4Y3CA 4AQYJ 3P8BB 2H48B 1Y10A 2FTRA 4FXDA 1WKJA 3MEGB 1PBUA 4X4VA 2D3OR 3NBPB 3M6UA 2HNYA 5IV3A 1J27A 1S76D 4FS1A 2PT0A 1EQ0A 3C19A 1IBLJ 5GADU 3PRVA 4WU3A 4HH1A 5KAKA 4M5MA 2HW3A 2FB0A 3EX7B 1FKAF 1SQGA 3BR8A 2ZH5A 5L38A 3D4JA 3MM5A 1YJNS 1KOHA 2QL7B 1G4CA 2XZDB 4GO7X 4IR9A 2KDOA 4EMDA 4OZ2A 4G3IA 3PX6A 5ETPA 5ETNA 1FTRA 1SL1A 1WELA 5LM7E 3OSPA 3CC7S 1HMVB 2CPIA 1X4CA 5ETLA 5HO4A 1O6XA 2D69A 2QFJA 3RBXA 2HZCA 2Z30B 2OD4A 2QSFA 2QLBB 3QLHA 4IRCA 4N77A 2YWEA 3CDBA 5K5MA 1BWVA 4WBFA 1AT1B 2X1AA 2BABA 4DR7F 2IA0A 1B64A 3WC0A 1KVIA 4FYVB 2DYAA 2Z57B 4UTGA 5K14A 2JOQA 2YQ3A 3R1HA 2D3UA 3OHAA 2HQIA 4LIWA 4DFKA 3QJJA 2WW4A 4IFYA 4F4KA 5A8RA 2NSCA 1G1XA 2VC0A 2UXDF 2X1BA 1RAOA 1UEUA 3C3LA 5KFDA 4OZNA 3MCNA 2WZ1A 3FSXA 5T7LA 4EYIB 1MLAA 2B7BB 1EP4B 3BGLA 3QT7A 4F02A 1WI8A 4I2QA 2F40A 4DF8A 4OX6A 4H4KA 1YJ9S 2OD6A 3CF5Q 2C28A 4USUA 3AA9A 3T1YF 5T41A 5F8LA 4ED6A 2R2SA 4DPXA 2ZC3A 2H3EB 1B70B 3R7SB 3AT1B 4R5PA 3MR5A 4KO0B 2HRTA 4FYYB 1C0TA 2C1EB 4USMA 4B9VA 1IBCB 3TA2A 3HM9A 2HGMA 3V6DB 3D7SB 4V1Ak 2HRUA 2XBPA 4PXCA 3PO4A 1NDLA 3AOAA 3I4PA 4LFAJ 4EU0A 4JUZA 1JJ4A 1RAAB 2BJ1A 3G71S 2WONB 2E7WA 5KFVA 2VQEF 2VL1A 5KFPA 5CYJA 2KRBA 2XMVA 2HFZA 3LALA 3VWSA 3FEXB 3HVRA 3M6WA 3IS9A 4DL6A 2C3UA 3MCSA 1FD2A 3B4MA 4JOUA 1WUUA 3G2XA 3ONQA 2KVIA 2CXEA 3WZ0A 2G2YA 3CJRA 2VG5A 1ZS6A 4O23A 2VG6B 1SC6A 1Q4RA 1SH3A 1U2RA 2FPHX 1UVKA 3CTRA 4UOCA 2FDNA 2BACA 3KLVA 3HVTA 1Q5YA 2CPFA 1RLCL 2WAQD 5HVHA 3GE9A 1CS4A 1B0TA 4U96A 3G96A 2RRBA 3R7NB 3QRPA 3POTA 2KHDA 4IUFA 1WEZA 1BQNB 3SDEA 4P7TA 4M5HA 4JYAF 2ATCB 1UKUA 1KTQA 1RT2A 3RGIA 2VONA 4OIXA 5IWAF 2BZ2A 3G8QA 4F4AA 3TZXA 2F8HA 2F9JA 3QPIA 4ZP6A 1UWBA 4JI3F 4ZVQB 2QYCA 4I7FA 2AEMA 2NYHA 2PI4A 1FJCA 1P9YA 4Y2AA 3OPKA 3KLFB 1U8WA 2FJXA 2BQRA 1GMUA 3BQ1A 4O0NA 5IT0A 3O8WA 3OFEA 2P8IA 1F2HA 3T6BA 3IAS9 4HDGA 1KEKA 3ZC4A 1HYSB 1SUQB 3HFZB 3OR2B 4CCHA 4WFYA 5J2PA 1J5OB 4YY3F 2B5JB 2DNRA 3QZ8A 1N5YA 4EFAC 2FC9A 5HP1B 1TKZA 4XPCA 1HHSA 1ZAXA 4FDFA 3MD1A 4LVNP 5D4OA 1KQKA 4QIGA 2XEXA 3W3SA 3O2IA 3MECA 2MQMA 1L3UA 2E7VA 1B0VA 2Y1IA 3K0JA 5CD4A 1S48A 4LF6F 4U67Q 3CIZA 4X62J 4R8UB 3NGDA 4FYWB 5DG9A 3A3PB 4USTA 4OZ1A 2G2ZA 2HYIB 2VFSA 3QWUA 3BYRA 2XY6A 4AXJA 2DRBA 1VGYA 1HQUB 4Q8EA 2PMHA 1XR6A 2KTQA 3PRBA 1H38A 2KG0A 2IRYA 2YH0A 2RRAA 2B8PA 1ZPVA 2DR8A 2QE5A 2PN6A 5KG6A 1Q82T 1U0SA 4MH8A 1Q16B 3PHEA 1RT3A 2V4QA 1N56A 3SMZA 4P2XA 1F5BA 4G1PA 2EG1A 5G0RA 4X64J 3I6PA 2AJ2A 4KKOA 1T03B 2Z2YB 1TL5A 1GXUA 4FPRA 2YVSA 1S1VB 2K2PA 3LPEA 1N4LA 2GA7A 2CPYA 1KS2A 2AYEA 2NUHA 2ZD1A 1NAQA 2VHGA 3H7HB 3LP1B 2GVZB 2G2OA 2XY5A 1Y9OA 5L1KA 2AMCB 2EXUA 2ZE2B 4U9RA 1I3OB 2FGOA 1KBRA 1RWMB 2HIQA 3OBIA 4OHWA 2JFDA 3B6BA 3K59A 1SBRA 3M05A 2IC3A 3JSMB 3VR1A 2VJVA 2YX1A 3SQGA 3TANA 3TZWA 4EYHB 2QO3A 1KVJA 2C22A 4BLGA 4NWBA 4CYUB 4QWEA 3H20A 4FBUA 1LW0A 4ICLB 5B0GA 3CT9A 2FVPA 4I2PB 3NY0A 4OX7A 4JBCA 4B9UA 2B8QA 5H1SV 4C3MA 3M1VB 4DV6F 4GVLA 4DZDA 1SCJB 2HLTA 1X8DA 1VQPS 3H98A 5HN0A 3I9ZA 4ZLJA 2MKCA 4DV2J 5K8PA 3FFIA 4LF2A 4RNOA 3KLGA 4YFUA 1RTIA 3AOCA 4K50A 1IKWA 5J2MB 1RAIB 1IKYB 3MTKA 2E5LJ 2HWHA 3NP5A 5K8NA 1EETB 2DISA 3MM7A 4OX8A 3MEDB 2ZOGA 2QG9B 5D3GA 1I94J 4HTJA 4PEOA 2ASDA 1RKIA 4FXVA 2NZ4A 1RYSA 3P49B 2GJ2A 3N5FA 4B9NA 4RR5A 1XIQA 4OMFG 1YSJA 3RZAA 1M5KC 4NRUA 3MMAB 2VIHA 1RWKB 2QA4G 5C24B 2OHDA 1ZAWA 3T6JA 3Q2SC 1RDRA 4ZLPA 2ZOMA 2R7VA 3GYGA 4DX7A 4OJ1A 3BN4A 5B0DA 4KYZA 3H5UA 1Q0NA 4OJHA 2C2RA 1QUVA 1NDPA 3Q0AA 2HHSA 1TL7B 3PV8A 3JS9A 2KZMA 2AU0A 1N5QA 4A8WA 4ZLNA 4RLEA 4NLDA 3HJVA 2LU2A 5F8MA 5AXNA 1KN6A 1N0UA 2ZJQQ 1X5TA 3KYLA 2HFUA 5T14A 3JQKA 5HQLA 2OEMA 1U1PA 1H2UX 3DYAB 3HD2A 3KJVA 3DLGA 4JI6J 1SB6A 4KC5A 4B9TA 4K2XA 2PMWA 2XNRA 2OFGX 2AGOA 2KFNA 4E2FB 1SPBP 4NEZA 3V81B 2QMXA 3NNCA 1V3ZA 3BF4A 5D4NA 5CXTA 3GFHA 3CC4S 2DH7A 3Q8YA 2BOAA 4ANEA 2A0FB 4ECWA 3S01A 2OMOA 2MQ8A 5DM6Q 3H5YA 4MKBA 3BS9A 3KHHA 4JI2J 1MWYA 2P9CA 3HVAA 4F50A 1YWXA 3HHLC 2L3MA 1KVKA 2J7KA 3FEZA 4IOCQ 1DQ8A 2RD5C 3DLEA 2E29A 5E5NA 2XMJA 3LP0B 3GWCA 3P4UB 2H9ZA 2OPQB 3RRKA 2WVCA 2WBMA 2F4VJ 3M9OB 2YKPA 4PQAA 1F0XA 3GV7B 2RDDA 3EGVA 3NCPA 1M1HA 3U02A 5A2QU 4ZPTR 5CZVA 5L46A 2C2ZB 1SIZA 3ET6B 3PIPQ 2QV6A 4LVOP 5C42A 4FXWA 3KUHA 3WIVA 5SZTA 4O3QA 2QSWA 3AQPA 1PJ6A 3M32A 1XWLA 3OR1A 3ZNUA 4RO0A 4Q0BA 5H9FJ 2ZC4A 4XO0A 3R5BA 1S1XA 1VQ8S 4CZCA 2P9GA 2COLA 3NMAA 3GG0A 1U25A 3EZOA 5I3PA 4ZIVA 4JI1J 3ULHA 3DOKA 3KJFB 3HZGA 4OYZA 4QR2A 3NEKA 3CMAS 5KFHA 5GAGU 2HS3A 2WVDA 4Q2MA 4C8ZA 3GIJA 4F3QA 1DTQA 3DFEA 4UOGA 4YR3A 4LFBF 1BHNA 4PWDA 4OQJA 2BXJA 1N5VA 1JLEA 3L09A 2JJ4D 1OJ4A 1Z4UA 3GMGA 4DG1A 4OYBA 3QJPA 3HCXA 4DV7F 4A8SA 4LR7A 5IT9U 2XSFA 4AUKA 3CJTA 4RNMA 3PRDA 1F60B 3I4HX 1S6QB 1TMJA 1OPZA 2GQQA 2HBYB 2BANB 1KLMB 2V2QA 2VICA 1FRMA 2RSQA 3C14B 4GO5X 1QAIA 1RA7A 4AL7A 2J9EA 5ETMA 2WB4A 1JLGB 2ZWOA 2R7TA 1ZTTA 1KQGB 2YWGA 3CCWA 3PW7A 4AL5A 2RILA 5JMNA 1U1LA 3DXSX 2MB0B 3ZTRA 4NE9C 4A8MP 2VF3A 3C16B 2XM3A 3BZQA 3VGSA 2BW2A 1U09A 3PX4A 2XSJA 2MSTA 4DL2A 1G3OA 1SJ1A 3EE3A 2F65A 2N4DA 2WTFA 5CHCB 4ID5B 1TV6B 4JI5J 3ENQA 2W8LA 3A1YG 1E6YB 1OY8A 1XEZA 1EQMA 4FF4A 4HHUA 2DHAA 2BRLA 1YK9A 3KK3A 4B3RF 4ED8A 1IKXA 2R9LA 4PRFA 5LT5A 1FXLA 2MHEA 4J37A 1SC4B 4KGMA 1QSYA 5BR8J 1NU4A 2Q79A 1WOSA 1M1GA 3BH6B 1JX4A 4DSFA 2FJWA 5HMYA 3J7YU 5L1JA 2XGPA 2DH9A 5DZ7A 2RKIB 1QM9A 3J80U 2IA6A 2BE7D 4R0JA 4K0KF 1OMSA 3JTPA 1B99A 3BSAA 2ADBA 2IRXA 1RJJA 4IOAQ 1NRKA 2B7CB 3D0GE 4ES3A 2LA4A 3LANA 3AJ1A 1S0NA 1XR7A 2DPJA 3DC2A 4J9UE 2M3DA 4F0MA 2E66A 3MOZA 1I1GA 3EM1A 3GILA 4HI2A 1HNIB 1MN7A 2W2QP 2IBOA 3SCJE 1F2GA 1LEOA 4LSLA 2CQCA 1M5SA 2R7SA 2MKSA 2FHJD 3N5BA 1VIXA 1JJ2R 1KLNA 2VG7A 1B7YB 2IIHA 3M8PB 2JX2A 1T94A 1WG1A 3M8QA 5L8RC 3T1AA 3H4DA 4XDDA 1FTCA 3CCUS 1Q95G 2FVSA 2FY8A 4DV4J 5I42A 4OZLA 1VK3A 1S9GB 3FNNA 1SH2A 1IR2A 4DFJA 1ZAVA 3GIRA 4U8YA 4EEYA 1U6ZA 2CNNB 2KRRA 1DBDA 3N6NA 3RR8A 3K58A 3PYFA 2Z4PA 2E1RA 4IQMA 3BGRA 1FD8A 3MR2A 1K9MT 4KY3A 2IM1A 1NJYA 5HROB 3VAMA 1S59A 2V0NA 3PW5A 4PG4A 3KLEB 1N34J 1KSPA 2DK2A 4ZVEA 3Q89A 3VTIA 2M8HA 3J81Y 4RW7B 4ID8A 2E44A 2VASA 1YRUA 1T0TV 3VCDA 4F2RA 1AZSA 1MG7A 1YZ7A 4NCBA 2QJ3A 1IKVA 4QW8A 4B3SF 3M30A 1R89A 4OI3A 2DR7A 3VAHA 1RU2A 1U1KA 4ED1A 1F6TA 2WVEA 1N0VC 2CG8A 3F44A 4QYRA 4C8KA 1RAEB 5C7PA 2YNIA 3UVJB 3TWZA 1LW2B 4UUXA 1VHFA 4RUAA 1NEEA 3G6VA 1LNQA 3LA0A 3C15A 5DQIA 2HVDA 2Z8QA 1LXNA 2HG4A 2CQ2A 1X60A 2PE8A 2K1RA 3CO0P 3D67A 1C4CA 3BH7B 1M5OC 1LFWA 4F2SA 4DPOA 2ZBRA 1HD0A 4YR2A 1FKOB 1M90T 4DQQA 2VV5A 2KHCA 1DY3A 4DQIA 1S4EA 1P27B 2IHR1 4K4UA 3ZTSA 4DR1J 4IH5A 2A18A 4ZCIA 2CJAA 2GJIA 3D1OA 4MJKA 3AB4B 2RDIA 3K57A 2HVEA 4ZVUB 2NPFA 2WW8A 3JB9k 2PA8D 2VZ9A 4DL5A 3M2RA 3L7UA 3I0RA 4LFCF 2B3TB 1VRTA 5KFKA 4ZS6A 4ZIWA 3SFUA 5CCLA 1ZA1B 2F1FA 3FDSA 4KSEB 2CVEA 1PIEA 1FFSB 1FKPA 4FBTA 5G4DA 5FDLB 4OI0A 1LWCA 1MWZA 3PJXA 5E2QA 3EPGA 4K7QA 2YNHA 4N8NA 2XLKA 2CQGA 4O44B 1Q5VA 1QTNB 2W9AA 1FI4A 3RB3A 3I32A 3M2UB 2IRUA 3ZNJ1 4B3MF 1X4BA 3DDIA 3VQTA 2GQCA 1HI0P 3UCGA 1RT5B 2CIMA 4MFBB 4HDHA 1R8HA 1OYEA 4NZ6A 2DHGA 1L3VA 3DM2A 2BQUA 1RHQB 1EX8A 1PYTA 3HZEA 3L3CA 3MMBA 4K4VA 3GG1A 1EHWA 5J1PA 4PYAA 1S7HA 1U48A 1HNXF 2OPPA 3SZ2A 3MFHA 4DV5F 1Z1ZA 4I0WA 5LJ5Y 2B0GA 1NXIA 3DMJB 5BYQA 4CLSA 5B08A 3D54A 1KKHA 4DCOB 3KHGA 1PGZA 4B9LA 3WX4A 1RAHB 2JEIA 3FCWA 2BE2A 1AUSL 2N3OA 1F9FA 2CRLA 2DIVA 1ZTWA 1N36J 1SJFA 4OX9J 1R8PA 5KFBA 2G1HA 1TUGB 4RW6B 1NHVA 5FLXU 4ED0A 2OPSA 5D4PA 1HWIA 1S9FA 3IBWA 3ITHA 2LEPA 2HNDA 1RTDB 2F8EX 2GGPA 3Q24A 1EKSA 3TA1A 3W60A 4ZPDA 4DL3A 3KDOA 3DLJA 1RXOB 3FZ2A 4FKYA 4QOTA 2HFSA 3GV5B 2R7XA 2DGQA 1X0FA 3TP2A 3AA8A 3NWRA 3BKFA 4YB5A 1MU2A 3SV4A 3RBZA 4U8VA 2IM0A 3MAQA 2IMOA 3DCAA 1X5PA 2EG2A 2RQCA 3SFGA 5JVHQ 1WTFA 1REVA 4RW4A 1K8AT 1KQSR 3D9BA 3DHXA 2GIFA 3C6UB 4PPZA 2PO4A 3QT6A 3ETOA 3QGPA 3AD9C 1JLAB 2ZZTA 4GKJJ 1JWWA 3NL0A 2DNOA 1CJUB 1UVLA 5A0YB 1V6HA 3C6TB 1VISA 3UWTA 5AJ3F 4LF4F 4J9PA 4X4PA 5ITHA 2DT9A 3IG1A 4DQRA 1JIHA 3CEDA 5M2PA 5LMNJ 1IJEB 4MK8A 4QR0A 4NXNF 1VC0A 2XS5A 2J6TA 5A8WA 2HWIA 2XYHB 1JJHA 4RW8B 1XMQJ 2W2NP 2IJRA 3KK1B 1PBAA 4DR2J 1NB7A 3US5A 5IXUA 1S6PB 4NRTA 1FEHA 5EX3A 1GTHA 1FDAA 2RQ4A 2C3MA 2G13A 2ZH4A 1WOOA 1NMEB 4USJC 1NK7A 2ZBPA 2EVZA 2CDRB 1TK5A 2KU7A 2D9PA 4UQGA 2YWFA 4NI2A 5J1EA 4Z7YA 4ITSA 3NOGA 3UNGC 4B17A 2O66A 3BPSP 3MM8B 4C2MA 1RT4A 2Z2MA 3W9IA 4CP5A 1WDTA 1F5AA 3OQ2A 5L1IA 1OPIA 4TXSA 3EZUA 4QWCA 2XWYA 4HEA9 2GHWA 2LXIA 1UEVA 2J0SD 1RGVA 2MGZA 3M7VA 2OSQA 2V63A 1NJZA 1NH7A 3Q86A 1OY6A 3AD7C 2B4UA 1JLFB 3U1NA 2FJAB 1IBKJ 2Y8YA 4LF7J 4PABA 3BBFA 2CJQA 4ERDA 3EXCX 5AE1A 3AQOA 1M1KT 1U6BA 3ILIA 1FT8A 1LK5A 4ZP8A 3KMSA 1FHTA 4M5DA 2IY5B 1XNRF 3R2CJ 1Z2LA 4X4OA 4RNHA 3KMQA 2VA2A 4HR2A 2H54B 3NGUA 1K0VA 2C2OB 4AXIA 1VOMA 4X4RA 2P9EA 2R8IA 2FYXA 2WOMA 4PPDA
chains in the Genus database with same CATH topology
4ED6A 2V8HA 1FXDA 2R2SA 2ZC3A 2ROGA 3S1TA 3H59A 1N33F 2DNQA 2OTLS 1T03A 1N32F 1SL0A 4R5PA 1FXRA 4NLXA 3MR5A 4H4OB 4KR0B 1HBNB 4KO0B 4XPEA 4AL6A 2J5AA 2W9BA 3IO1A 5J2PB 3D0IE 5IQ6A 5JJBA 1C0TA 1GAOA 4AFFA 2HGNA 1O8BA 4Q7AA 1N5YB 1U1RA 3TO8A 1TKZB 2YKNB 2Q6CA 1TP7A 2CJBA 2CQBA 2LA6A 3PW4A 4M94A 3C6UA 1TFWA 4B9VA 3TA2A 3HM9A 4A4JA 2HGMA 3V6DB 2RMLA 4MK7A 1JLAA 3MWBA 1TL3A 2HRUA 3NRBA 2ZE2A 1FRIA 4NLGA 1SV5B 4NA3A 3KK2B 1HNVA 1VQ4S 4A8XA 2XBPA 2M5YA 1K1QA 2BE2B 1LWEA 1N34F 4PXCA 1FDDA 1R8CA 3PO4A 2QLXA 3C6TA 4BWMA 3I4PA 4USIA 3HJFA 4EO6A 2HGLA 2LDIA 4EU0A 3FMBA 1VQ6S 3MEGA 5AXKA 1Q8BA 4JUZA 3JSMA 2Q66A 1JJ4A 3VF0B 4WZMA 1XMOF 5SUHA 1UJ4A 3G71S 3RAXA 2WONB 4ATNA 2ASLA 1U49A 2E7WA 2BBEA 5KFVA 4M95A 2VQEF 4GKKF 4Q43A 2VL1A 5KFPA 5CYJA 4DL7A 1Y5LB 1SKSA 2RVJA 1X9MA 2KRBA 2XMVA 2HFZA 3OFHA 4ETXA 4ED2A 2UXBF 2J76E 3SZ2A 3LALA 3OUYB 3MI7X 3SSRA 2QA4S 3TNVA 2WBRA 4HI1A 3VWSA 1MSWD 3FEXB 1WHXA 5DG8A 3M6WA 3HVRA 1SJRA 1HI1A 3IS9A 4RW8A 2O5DA 4ICLA 3HHLD 4DL6A 4QCLA 2ROPA 4C8NA 3KK1A 2X3GA 1CC8A 3KWMA 4OV1A 2C3UA 3MCSA 1P6TA 4ETZA 2E1AA 4LF8F 5DGBA 1FD2A 4YR0A 2RNEA 3B4MA 2DGSA 3TAMB 4JOUA 3MDFA 3E8OA 4LQ3A 3N28A 3ONQA 2ZH6A 1S49A 1S6PA 2ILZA 2KVIA 2W7PA 3T5LA 3BR9A 4MYTA 3WZ0A 4BS2A 3J7YI 3OLBA 2BRKA 1KQFB 1T8EA 4NZ0A 5DLFA 4FYDA 2FHKA 1RT3B 2EK1A 1FJGF 1UFLA 1JKHB 3PFEA 1TUVA 2K3KA 1FRKA 2ZVSA 2VG5A 4G1IA 3E3XA 1QSLA 2ZITA 1JXLA 2DCLA 2A10A 4O23A 2VG6B 4DV3F 1HR0F 1KRPA 2VH7A 4WJBA 2Z0GA 1SC6A 4LIRA 1Q4RA 5G0RB 2KFZA 2D41A 3UR3C 2CPDA 5F3ZA 1SH3A 4KKOB 1FJEB 1U2RA 2J9DE 1S1TA 2PMZD 4ES2A 2FPHX 5DM7Q 1UVKA 4UY8T 4NA1A 3CTRA 3QAEA 4UOCA 1N88A 1HMVA 2FDNA 3N0VA 3TYTA 4N5SA 5J2MA 2RQMA 5E41A 5LJ3Y 2BACA 3KLVA 1U8SA 3HVTA 5IM0B 2CPFA 5KFTA 4B08A 3CIMA 1H7WA 4FVCA 3RAQA 1A7GE 3EYZA 5KFGA 1EETA 1ZM9A 2LCWA 2WAQD 3G6YA 1LV5A 2HHQA 3DU6A 2JH3A 3GE9A 1DTTA 4RNNA 1B0TA 1KHWA 3MEDA 4DHVA 2O01C 5F9NA 3G96A 4B3TF 2RRBA 2X51A 2MYFA 4RX6A 1S0OA 2EFPA 1S79A 3POTA 2KHDA 4ZPWR 4OHZA 4IUFA 1PILA 3D2WA 1WEZA 3M9MB 2ZH9A 1BQNB 3SDEA 1L3SA 4P7TA 1HQEA 4DR1F 4DSIA 3MMCB 1VMBA 3KHLA 3TUJC 4O4GB 2RQKA 2KG1A 4JYAF 3OVBA 2M2BA 1KD1T 1JLFA 1UKUA 1OIAA 3ICLA 4OLOA 1KTQA 4DUYF 1RT2A 4KB7A 1NZAA 2VONA 3J7ZT 1W25A 3IG1B 5F0UA 4X84A 4OIXA 5IWAF 1B7FA 4O3RA 2ACYA 1RTHA 1ZETA 1P1TA 3SQGB 3SCKE 2BZ2A 3G8QA 3TW0A 1UETA 2I9SA 1FRLA 1R31A 2F8HA 2HS4A 3MEKA 3PW0A 2F9JA 3MF5A 3QPIA 2XMWA 1SIWB 1HWJA 1W2BR 3RW6A 2XLJA 1D1UA 1LW0B 4BBYA 2ZHBA 2DGTA 4ZP6A 1UWBA 4JI3F 1S9EB 1CSJA 2V94A 3HHEA 5GAEU 2QYCA 4I7FA 1Q81T 2KYXA 4E8UA 2ATLA 1C1BB 2F7VA 1UJ5A 1EP4A 5AE2A 3MR3A 2PI4A 5FJ4A 4KV8B 1R3NA 3IR5B 1UP1A 2MZTA 1G2EA 2K7JA 2C3OA 5KTQA 4DV1F 1FJCA 4Y2AA 1T05A 3I55S 3NCQA 2FD2A 2YKOA 3OPKA 3KLFB 1Y00A 2EPIA 1X4EA 1NJWA 1ROFA 1R7IA 1U2FA 3U1LA 1S6OA 2FJXA 4ZPAA 3SXLA 3KLHA 3W2WB 2BQRA 4DFMA 4C8YA 5B0CA 4WF9Q 1DFDA 4I1TA 5HMZA 3FJ2A 1R43A 4ZPCA 2FC8A 1JLCB 4CH7A 1MMNA 3BQ1A 5IT0A 1SJ4P 3O8WA 2J0XA 3OFEA 2RH3A 3T6BA 1ZH5A 3EUNA 3IAS9 3S8SA 4QIFA 2XS2A 4HDGA 1KEKA 1JB0C 1GH8A 3ZC4A 4H4OA 2KJWA 3FFIB 1HYSB 1S10A 4QU7A 1SUQB 3OR2B 4CCHA 1HBNA 4KO0A 4WFYA 2ABYA 3FQLA 3VAKA 4CT9A 3K5LA 2E9TA 2VODA 3CWJA 5J2PA 2F3JA 1J5OB 2YX7A 4YY3F 2I5JB 2N4CA 3IA0A 1RTIB 2B5JB 2DNRA 5KG1A 3JYTB 2QLWA 1IKWB 3QZ8A 5J1EB 1N5YA 2YKAA 2FC9A 2D74B 2Z2LA 4EFAC 4MAKA 2HHUA 5HP1B 1TKZA 4XPCA 1HHSA 2CG4A 1ZAXA 3MD1A 3BQ0A 1UA0A 3CCRS 4F4WA 2BM1A 4LVNP 5D4OA 3DYAA 4YUDA 3V6DA 1KQKA 3MMJA 1X0PA 5CD4H 3IRXA 5F9LA 4QIGA 2ZBCA 2XEXA 3MM7B 1SV5A 3DLHA 3N79A 3W3SA 1C0UB 3O2IA 3QLHB 4G6VB 3MECA 5LMUF 5KFUA 3NS5A 2MQMA 1L3UA 3X3UA 3T9ZA 1B0VA 3PM9A 4Y00A 4M63A 4QJVA 2JFKA 3M8SA 4RU2A 2Y1IA 2AGQA 2PEHA 3K0JA 2VOPA 4F67A 1S48A 1R0AA 4QZVB 3VAIA 3NAIA 4K5RA 4U67Q 4LF6F 3CIZA 3CXCR 3FSIA 4R8UB 3NGDA 1SJQA 2KJVA 2YKMA 3PDNA 4JV2A 4NYZA 3ZZZA 3E51A 4Y2IA 5DG9A 1YJWS 5JUMA 1VS3A 4OZ1A 2DGOA 3OUYA 5E3AA 4WTYA 2XCPA 3HK2A 2HYIB 2CQ1A 2DH8A 2VFSA 3QWUA 5KFCA 2IVMA 2HS0A 1NH8A 5D77A 2XY6A 3LP2B 4AXJA 2DRBA 3BB5A 2UP1A 1WG4A 3ZZUA 1VGYA 4DEZA 2FLOA 1HQUB 4HT5A 4P7VA 3JTOA 4Q8EA 2PMHA 1XR6A 1KC8T 2KTQA 4M5DB 3PRBA 1H38A 2KG0A 2EI5A 5EDWA 3EZ5A 2IRYA 3IGVA 3GR0A 3M6VA 4GMKA 3TAMA 1WNEA 1LK7A 2YH0A 1H3DA 1NKCA 4MIAA 2RRAA 2R7UA 2GW8A 1ZPVA 2DR8A 3RAMA 1CC7A 2QE5A 2PN6A 2O3DA 4I6WA 5KG6A 1Q82T 5EUHA 1G6BA 4C8OA 1JNRB 2LVWA 4MH8A 1Q16B 4Y2MA 3PHEA 2AJFE 1AROP 2LXFA 1RT3A 2A1BA 3IGNA 2V4QA 5I3UA 1JKHA 1RYRA 1N56A 1N36F 1BQMB 3SMZA 2GC8A 3P6YC 2BV3A 1F5BA 4OX9F 3OVAA 3K5NA 4OLPA 4G1PA 4Q2LA 2EG1A 3OTEA 3VALA 5G0RA 3I6PA 2PI5A 4KKOA 3ISNC 1T03B 2RU3A 2OPRB 4PXDA 1VC6A 2BQ3A 1TL5A 1GXUA 4FPRA 2YVSA 4GC6A 4QPTA 5LXYA 2AP6A 1S1VB 3O6QA 2K2PA 2LECA 3OTCA 1N4LA 2GA7A 2XLIA 1YBAA 2CPYA 3P96A 1KS2A 1P9QC 2C3PA 1WF0A 2HNZB 2AYEA 2NUHA 2M7SA 3LPYA 3M2VA 5EX0A 4B3OB 2ZD1A 1NAQA 2AW0A 2UV8A 2CQIA 3LP1B 3T5JA 4Y2KA 3V2UC 4ECUA 2J7WA 2XY5A 5KFSA 3OJSA 1Q86T 2EBGA 1Y9OA 5CQGA 4FF2A 5B7WA 1XK8A 5L1KA 3G8TA 3MUMP 3KG1A 4YDXA 3DLGB 2HHTA 2ZE2B 3PEHA 1U1MA 1HNVB 4U9RA 2R2TA 3CJ4A 4YP3A 1Z2ZA 3H5XA 3OL9A 1BQNA 2FGOA 3NAHA 2LQ5A 2HIQA 3B8HA 4DLEA 3PXGa 3OBIA 3MMCA 3RRGA 4DJBA 4L3NA 5EN1A 4O4GA 4OHWA 2VBXA 5DDQC 3R27A 2QIFA 1OSDA 2XNQA 2JFDA 4TU9A 2SXLA 1NHUA 5DQGA 3RRHA 4IH6A 3L95X 4N41A 3K59A 1SBRA 1MMDA 3M05A 4XAKA 2IC3A 3JSMB 4JI5F 3VR1A 1FK9B 1QSSA 2YX1A 2BOPA 3SQGA 5KT4A 3TANA 1YRTA 3H2LA 4HVZA 4G1QB 5KT7A 3EGNA 3PR4A 1FCAA 4I69A 3PFOA 4ZP7A 4DDFA 1YQHA 4EYHB 2CPHA 2QO3A 4FZVA 1KVJA 4R0EA 2RIJA 2C22A 1KTVA 3MEEB 2ALZA 2CVIA 1H2TZ 4NWBA 4J9RA 4PG6A 5KFJA 4QWEA 3H20A 4FBUA 2UUAF 1LW0A 2C3YA 5MLCV 4ICLB 1S9EA 5B0GA 1HW9A 3CT9A 2MZQA 2FVPA 4I2PB 3MM9B 4FS2A 1U47A 1C1BA 4OX7A 4JBCA 4B9UA 2C2EA 1VBZA 4Y0FA 1JMTA 5H1SV 4C3MA 5GMKa 4ZPVR 1Y0HA 4KV8A 4MKYA 3M1VB 4DV6F 4L6V3 2HLTA 2CQPA 3HLUA 4RZRA 1X8DA 4C8MA 4GKJF 2BDPA 4PCQA 3KLFA 1OSCA 4WZQA 4FNHA 1VQPS 3VZHA 2IVFB 3H98A 5HN0A 3M9NB 1X4DA 2ADCA 1RK8A 4B02A 3I9ZA 3JSYA 1VBXA 3MAHA 3W2WA 1HI8A 3DLEB 1SXLA 4AQYF 5HLFB 4A8YA 1JLCA 2KFYA 2MKCA 2QA2A 1HBUA 2VPZB 3SI8A 3CD5A 1NK4A 1LKZA 2VG5B 4XDCA 1HD1A 5K8PA 1Q8LA 4QYZJ 2GHVC 3FFIA 4D3HA 1HYSA 2DD8S 5I4MA 4ZCMA 4RNOA 3KLGA 3HHLA 5IT4A 3MUTP 3CMES 1UVIA 4YFUA 1JNZB 1J5OA 2I5JA 3G8SA 1J2VA 2ZDOA 1RTIA 2B5JA 3H2UB 4BC9A 3JYTA 4DQSA 3T1HF 4X4NA 4K50A 1IKWA 3MHYA 1Y4ZB 5K8OA 5LMNF 1IR0A 1DARA 1GXTA 5HP1A 4WIIA 1TFYA 3L7OA 4E0DA 5J2MB 3SV3A 3MR6A 2RS2A 5AXMA 1IKYB 3GV8B 3MTKA 1X7VA 2IYIA 3HVTB 1IBLF 4KJIA 4CQ1A 2WB1D 2DBBA 2V2KA 2PDAA 3PR5B 2HWHA 3NP5A 5K8NA 2HHXA 2HQ3A 1EETB 2LQBA 2W4DA 4ALZA 4P6QA 2DISA 3MM7A 4ECQA 1XMQF 1C0UA 4F26A 3CUNA 3PVXA 4OX8A 2HPUA 2I38A 3MEDB 1K0TA 4DR2F 1UVJA 2ZOGA 2BUNA 5D3GA 2C2DA 1OO0B 2V4JB 1YI2S 3QMQA 3GZ7A 5C42B 4BWJA 1UW4A 4DX8H 4WK1A 2R8KA 2UV8G 4U7CA 1WHYA 2L9DA 4HTJA 2F9DA 2YH1A 4YB1P 2BANA 3OFGA 3WC2A 2ASDA 1HQEB 4QBUA 3ZZPA 1RKIA 4I68A 4ELVA 4FXVA 1FE0A 2ZJRQ 2R7RA 4IG0B 4A8OA 5DJBA 2NZ4A 1DURA 3MM6A 1RYSA 3P49B 2GJ2A 3N5FA 4B9NA 4O0IA 3CCES 1S1XB 2PSZA 1UA1A 2HRYA 1X5SA 2XMMA 4OMFG 1YSJA 4Y6IA 3RZAA 1FDNA 5F8HA 1M5KC 4NRUA 3RBDA 3MMAB 2ASYA 5KT2A 1H7XA 1HQUA 3T3FA 2KN4A 2G9OA 3HP6A 2QA4G 5C24B 2DNKA 4C4WA 5K9FA 2FHMA 3KTQA 4PG5A 1ZAWA 4KHRA 3T6JA 1VRUA 1NK0A 1VLYA 2VD3A 3Q2SC 1RDRA 4ZLPA 2ZOMA 3HMJG 2R7VA 3UD3P 4KFBB 1QLNA 1BGXT 3DOKB 4RWWA 3JAMY 3VAJA 1XBWA 2GMHA 4C3LA 4C97A 1XR5A 4OJ1A 2N82B 3BN4A 4O3NA 1NK6A 2R7WA 1URNA 5B0DA 3CGIA 3H5UA 1YRXA 3GFZA 4OJHA 2C2RA 2VFVA 3CVKA 2VOOA 4KQZA 1QUVA 3Q0AA 2ZJPQ 1M5PC 1YJTA 2HHSA 4IRKA 3U1MA 1C1CB 2R4FA 2YNFB 4NLPA 4IG3B 5GAHI 3PV8A 1FJ7A 1RISA 4RW9B 4HYKA 1BQMA 4ZDNA 4F4YA 4Y34A 2KZMA 2L41A 1AFJA 2W8KA 4H4MA 2EWHA 4K5SA 3KLHB 1DTQB 1N5QA 2AU0A 2LMIA 4RBUA 3TVYA 2QZ8A 4EBEA 4I6YA 4A8WA 4PXBA 4NZ7A 4RLEA 1D9FA 1TK8A 2XB2D 3SCLE 4TLQA 2OPRA 4P2SA 4NLDA 3SSSA 2A2DA 3LGMA 2R8HA 2M70A 1IBKF 2EFQA 3FCHA 2BVZA 2LU2A 4NLYA 1Y3KA 1HW8A 2XS7A 5F8MA 4LF7F 1S1VA 4OZ0A 3V5RA 2V8DA 2EK6A 5AXNA 1IJFB 2I8EA 1KNZA 1KN6A 1N0UA 1NK8A 2HNZA 2APOA 2ZJQQ 1X5TA 4B3OA 1UL3A 1JLEB 3RYLA 3NCRA 7FD1A 3I5BA 3LF0