4DR5F

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, crystallographically disordered cognate transfer rna anticodon stem-loop and streptomycin bound
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 27
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4dr5F00
2UU9F 4DR5F 4NXNF 4X66F 4JI5F 4LFBF 4X65F 4AQYF 1XNQF 3T1YF 1XNRF 4DUZF 5LMUF 2B7CB 5IWAF 4DV6F 1I94F 2UXBF 4JI7F 4DR7F 2KJWA 1VMBA 1F60B 2BVZA 1HNWF 4LFAF 4X62F 2KJVA 4JYAF 1FKAF 1XMOF 2RJZA 2UUAF 4B3RF 4DV2F 2UUBF 2E5LF 4GKJF 4LF9F 4LF4F 4DR4F 1QJHA 3R3TA 1XMQF 4JI6F 1N33F 4JV5F 5LMNF 4OX9F 2VQFF 4LF5F 4B3SF 1IJFB 3T1HF 2ZM6F 4K0KF 1J5EF 4LF8F 1G7CB 4DR3F 2VQEF 1IBLF 1CQNA 2UXDF 1HNZF 4DR1F 1N32F 1B64A 2YY3A 4JI1F 4DV0F 1N36F 4DV1F 2HHHF 4LF7F 2F4VF 5BR8F 4KHPF 4DR6F 1LOUA 2UXCF 4JI2F 4DUYF 1HNXF 4LFCF 4JI4F 4B3MF 1CQMA 1G1XA 4JI0F 1N34F 5AJ3F 2J5AA 1IBKF 4YY3F 2UUCF 4DV3F 4LF6F 1IBMF 4NXMF 4X64F 4JI8F 4DR2F 3OTOF 4DV5F 2BXJA 4DV7F 1GH8A 4JI3F 3ZZPA 1FJGF 1RISA 4GKKF 2B7BB 1HR0F 4YHHF 4DV4F 1IJEB 4B3TF
chains in the Genus database with same CATH superfamily
1H0HB 1MLAA 1V6HA 2GVDB 2FD2A 1C0UB 3RRGA 1XIQA 4EFAC 1VQYA 2HNZB 3MAAB 3K5PA 1IR2A 5KT2A 1I5OB 3QYYA 2YKMB 1HARA 2BJ7A 2M2BA 1RWPB 2IM3A 2OEMA 2UV8A 3Q8UA 2KT5A 4PKDB 4CLPA 1WEXA 5LMUJ 5KFBA 5J2MA 2I38A 4IG0A 4MKVA 2ZH7A 2QLFB 4CLZA 1JLAA 4LFBJ 4X4NA 2VQEJ 4DV1J 3A8JA 1HWJA 2MQOA 3MM8B 5HJYA 1AUSL 4DX7A 3OSNA 3W2VB 2DVIA 4R8UB 2M4MA 1HNWJ 3ET6A 2WTFA 3UCUP 4HR2A 4QCLA 3D66A 5KFOA 4WPAA 4ZP9A 2W4CA 4HHJA 2VJVA 1R0BG 4ZIVA 2DY9A 2ROGA 1HI8A 4IH5A 3POTB 3HI9A 5E3AA 4C3LA 1HBOA 2VFUA 1KLMB 1F60B 1NDKA 1NZAA 3ZZTA 3MCNA 2HQIA 4OYPA 4CLKA 2V67A 1K8AT 5IC4B 4ERDA 4PPDA 5D3GA 4QWAA 4RBTA 3G6ES 3JYTA 3MECA 2UP1A 3RR8A 1F3FA 1HW8A 2GX8A 2JC0A 4IH7A 4NZ6A 3H4DA 1APSA 4WYLA 1HHTP 2RF2B 3DLBA 3GU0A 2C2NA 1NM2A 5B08A 2AJ4A 2DISA 4KGVB 2ASJA 2AYGA 3R97A 3HZEA 1IQZA 3F73A 2FB0A 4TY9A 4IG3A 1GTHA 5C25A 3D7SB 2G1HA 3M6UA 1NNDA 1OYEA 4I4BA 2JLEA 2FHKA 4OYOA 4DZ6A 1DRZA 4Z2XA 1PYTA 3DRPA 3MMCA 2KU7A 3IO1A 2B4VA 3CF5Q 1U1PA 1JLCB 3IWXA 4ZP6A 2QE5A 1ZAXA 1NEEA 2ZHAA 5CCMA 2Q79A 2X3GA 4ID5B 4NZ0A 1UA0A 2ACMA 2FJAB 4RW7B 4DN0A 3I0SB 4HYKA 2POKA 1OSCA 3L7OA 3CE8A 4X84A 3CIMA 4DLEA 4FF3A 2F5GA 3NCQA 1S72S 4BDPA 5CHCB 1D09B 2ZH3A 1DTTA 1WG1A 1N5VA 4HVZA 3TEGA 3CD5A 1N0VC 2HLUA 3I55S 2XYHB 4OQJA 4ETXA 1M1HA 4FXWA 4GC7A 1HWKA 4N47A 4ED0A 2EK1A 1YITS 4WP3A 1YI2S 3R1HA 1LFWA 2XLIA 4OZ5A 1HPZA 1ZA1B 3R5BA 1JLFA 2PIIA 4HDGA 3TUPA 1R8BA 2V0NA 1Q8BA 3O1LA 2HWHA 4E2FB 3N9UC 2AEJA 2HFSA 1WJ9A 1TKZA 1N32J 2C2DA 4K4YA 4CNZA 1SC1B 3JQMA 1Y5NB 4U8YA 5D4NA 4XDCA 2XNQA 4A46A 1UP1A 2SXLA 1UVLA 3KXDA 4OMFG 1H73A 4QR0A 3IAM9 4DN9A 1BLUA 1C1BB 3QAUA 1DFDA 1Q81T 4K4SA 2I2YA 4Y65A 2XI3A 2XMVA 3KLVA 2YNHA 3MPVA 4G1QB 4RWXA 5HQLA 4RO0A 5B0BA 3I0RB 4WCEQ 3OUYA 1M0SA 4P52A 4B17A 4ZK7M 2XCAA 1AUDA 4K5RA 5ETPA 4LFCJ 2LA6A 3OTOF 1CJUB 2DPIA 2PI5A 1FD8A 3AD9C 1KLMA 2PFFB 2GC8A 4UTGA 5LJ3Y 1OY6A 1EETA 4LSNA 4PG5A 5J1PA 3CWJA 3VQSA 3HVAA 5CXTA 4C3MA 4KPCA 3F44A 5IFMA 3H0PA 4DWIA 4J9QA 4WKRA 1F5AA 5H9EK 4OI0A 1QLNA 3FSXA 1KP6A 1FHTA 2CJAA 1CSJA 3TP2A 3JSRA 1RUSA 5GMDA 3BREA 4DG1B 1TP7A 1FVQA 2W1BA 3M32B 2B5JB 4NLXA 1J2VA 4QIGA 1UJ4A 4DCJB 3GIKA 4K4TA 4A8OA 3PYFA 2WAQD 2XLKA 2B7CB 1U2CA 4N5SA 3QRPA 4K4UA 1X9SA 3MAQA 2BM1A 2M88A 2OMOA 2CG8A 4I56A 2IJFA 1KN6A 2H65B 4BWMA 5HQMA 3Q8PB 1WI6A 3Q8YA 4CNYA 1VK8A 3CJ5A 3P5BP 5CYMA 4ANEA 1HNVA 3MM9A 4CRJA 4E8UA 4GC6A 1X5PA 1EP4A 3JQJA 4Q2MA 1U48A 2GMHA 3CMES 4C4WA 1OY9A 1RJJA 4A8QA 4OJHA 2WVFA 3EVMA 5G0RB 2AYMA 5C42A 1XMQJ 1XC9A 1V5IB 4N77A 1R89A 3ZNJ1 2R7QA 2AP6A 3OTEA 1ZBTA 4Y2AA 5DQHA 2RD5C 2M7SA 3VZIA 1M5PC 3R2CJ 3V2UC 4K8RA 1L3VA 3I5CA 4DV2F 5DQIA 3IA0A 2C42A 4K4VA 1IKXB 1R7IA 3TVKA 1MWZA 2MKJA 3M1VA 3H59A 3OXLA 3S01A 4U8VA 1N5QA 4USMA 2ZBRA 5A0YB 3PW2A 4ZIWA 1PBAA 1OMSA 5HN0A 2MB0B 4JI6F 3RBZA 2D69A 2BACA 4RUBA 3ULHA 2WSEC 4Z7CA 5L1JA 3DRPB 1R3NA 2WB1D 2E1AA 2MEWA 3DRXA 1FWKA 2PA3A 4OLPA 1ZS6A 4DPWA 1RWUA 4EEYA 1NK7A 1TFYA 1JJCB 3U27A 1MN9A 4FYVB 3CDEA 1DQ8A 4KGXB 4O0IA 3BN4A 2AEMA 1D3WA 5KFKA 4RUCA 5DQGA 2W2NP 1OQ6A 5KT5A 3KK2B 2UUAJ 2CVEA 2RMLA 4DR6J 2VC0A 5F8LA 1L3UA 3RYLA 4DFKA 2E5GA 1WG4A 3BQ1A 1B64A 2BUNA 1ITPA 4NRTA 3X3UA 2E1CA 1KQGB 2G1DA 2RKIA 5DG8A 3BH6B 3NMRA 1QAIA 2VFRA 4DR6F 1TAQA 2IIHA 3AJDA 1M5KC 4JI2F 5LMNJ 1FNMA 2IY5B 4JBCA 5L39A 2L41A 3BBFA 2V34A 3QO9A 4S0MA 3EMTA 3SSQA 5IM0A 5DLGA 4DL6A 3R1LA 1ZM4A 5IS2A 1T9TA 5H1SV 3CTRA 2RQCA 2YNGB 2C2OB 3LGHA 1PJ5A 2ZM6J 4U95A 4ECSA 1T94A 1U6ZA 2AEFA 2BANB 3MCOA 4JV1A 2IBOA 3W60A 3I4HX 1FFWB 2NXCA 3FJ2A 2QC3A 2IDLA 3VQTA 1JJ2R 2MQ8A 2LQ5A 3I87A 3PRBA 2W7OA 1UKUA 4ECQA 2ZHOA 2HQCA 3OV7A 5F0UA 4X4UA 1Q16B 2Z58B 1JLEA 1SH3A 2GVZB 3MR3A 3BH7B 1XMBA 5LXRA 2Q6CA 1CEZA 2H1YA 1QVGR 4FPIA 1D0EA 2UVWA 3HO1A 2DNOA 3IM9A 2OAUA 1S5ZA 3KYLA 2BJ3A 3CD7A 4JP8A 2C3UA 2IBKA 3NGRA 2FHJA 5DJBA 3US5A 2CQ4A 1S0NA 2ZBIA 1ZYQA 3OXFA 3BO2A 2AJ1A 2DHSA 4IR9A 2CNLB 4X66F 3H7HB 3M1VB 4M1KA 1U09A 1HYSB 4CLSA 1NKBA 3GB0A 1WNEA 3P49B 4L74A 4DQRA 3AXKA 3CJ8A 4RWWA 3AY0A 1V5VA 1DJ0A 4NYZA 2VBXA 3ZFVA 4MKBA 3SFUA 3MPDA 3CCMS 2BE2B 3AFGA 4K4WA 2HZVA 4EYIB 5ETTA 1RZMA 4ZLNA 3M8SA 3VALA 4DR2J 2HFVA 2ACYA 2W2PP 1Y5LB 4GO5X 2DGUA 2MQNA 5LT5A 1S6OA 2X1FA 3IWNC 5MAOA 1T9UA 1RHUB 4JI7F 3IG1A 5DZ6A 5D4PA 1EQ0A 3UVJA 1S1TB 4NCBA 1H2TZ 2ZH1A 3V6HA 2CZ4A 3BB5A 4YEAA 2DRBA 2CVIA 1S79A 3N6MA 4LF2A 3NGTA 4OI1A 2FIUA 4ZVOB 1VC5A 5JVHQ 4U7CA 2BJEA 2OPRA 2FLOA 4V1Ak 3G4SS 3V81A 2Y1IA 2GIRA 1YRUA 1FKAF 1FKOB 4CTAA 4DL3A 5GADI 3DLGB 4Q8FA 3MR2A 1Q7LB 3PM9A 5DDOC 5IT9Y 3TX0A 2FLPA 1S4EA 2W9BA 4YMEA 4ED2A 2ZJQQ 2CUYA 3OVAA 4NA1A 5K8OA 5B0EA 2UVUA 1N6QB 1OIAA 4ED6A 2AGOA 4CO3A 1T11A 1UCNA 3D3CJ 3J7AN 2B8QA 4FDFA 4MIAA 4TVAB 4BLGA 4ECUA 4A8KA 2MZSA 3PYEA 4DFJA 3FC9A 1ELOA 2R7TA 4DPOA 1A0OB 2IA6A 4W92B 1E6YB 1WTFA 2QLXA 2K1RA 2OEJA 4RU2A 4RW8B 2E9RX 1S1XB 4Y00A 4K0KF 3W9IA 2RDJA 1KWMA 3RJMB 2CQHA 4I2QB 3UDEA 1G7CB 3D2WA 4JI1J 1HFEL 3R8YA 2Y3YA 3AB2B 1T9YA 2DEJA 4P72A 1X5OA 2W2QP 5CD4A 2ROPA 2YWFA 4PYAA 3WC0A 1S1VA 3QIDA 9ATCB 2YKNB 2YWEA 5HROB 3EGWB 2MKCA 1OO0B 1NH7A 2JDJA 2Y1LB 1J27A 2GJFA 3PTWA 4MIWA 1PIEA 3HPOA 1NHVA 3NAIA 3GV7B 2OPPA 4I2QA 4Q0BA 5B0DA 1KONA 1RU1A 3M8ZA 4B3SJ 3I9ZA 3UCZP 4DR7J 2HVEA 4ZJQA 1NK4A 2W7PA 1T05A 3UNGC 4ZPAA 2B56A 4KHMA 4LQ9A 4USHA 3UN5A 5IQ6A 1HNXF 5HJXA 2ADCA 3IGVA 1SQEA 2CQ3A 5DGAA 4QW8A 4BCAA 3OHBA 2RAQA 4J9MA 3ZTPA 2VBYA 3KLIA 1LWEB 1N34F 1FJGJ 4M5DA 2YNFA 3NEKA 4TY8A 4DSJA 2HHQA 3JTNA 4UZCA 3FDSA 4CDIA 5BR8J 1BD6A 5FLXU 2Y1JA 2RNEA 2UUCF 5HANA 4FNIA 4XIUA 1TL4A 3CXCR 2HG4A 3CB4A 3PX4A 1SKSA 3CDUA 3DM2A 3T3FA 4PUOA 2E7WA 3SQGB 3Q23A 4J9KA 4O4GA 4I1TA 1YG0A 2A10A 3LP0A 2NZCA 2MZ1A 1Y3JA 3BGRA 3T9ZA 3ENQA 2CNNB 4M63A 1YQHA 1P1TA 3KHGA 3T41A 1E6VB 1M5HA 4A8WA 4NLUA 2FJVA 2UUCJ 1SJ1A 4EU0A 5EWEA 4RW9A 3MEGA 4YHHF 3T1YJ 4IG3B 5C2GA 2HHHJ 3UDCA 5F9NA 2QJ3A 4DBQA 1VISA 3TZXA 3DLHA 3CO0P 1LWCA 3C8YA 1HBUA 4WXOA 4X4OA 5KT4A 5D0HA 1R0CB 2B9XA 1DY3A 2HAFA 4PRFA 1T95A 2I5JB 2K8GA 3I82A 3LP0B 2OPQA 2RQMA 4E0DA 1XNQF 1FE0A 3ZXWA 3T1YF 3IWLA 5GADU 1OQ3A 4I7FA 2LEPA 1EHWA 1UJ5A 2K7JA 3MUMP 5J2NA 4P2FA 4P2MA 2GHWA 1KR4A 4F4ZA 2ASYA 2R8KA 3K2YA 2QSWA 3DLLQ 2R3VA 2VG7B 2ALYB 4FKXA 2XTJP 5EN1A 2QLWA 4NI2A 2NXUA 2B9YA 1S10A 1BY9A 2HRYA 1IWGA 2AYEA 2ZC3A 4C0OC 3C46A 3DHWC 2LYVA 1NSAA 1UL3A 1VK3A 2AHOB 2KVIA 2R4FA 3S8SA 4CIOA 2B43A 2Y8YA 4DL4A 2V8PA 3GQCA 4O3RA 3UI3A 3T9NA 3MPWA 2BVZA 4PQAA 1NO8A 1PJ7A 4B9LA 4ANDA 7FDRA 3PNIA 2CQ0A 1WWHA 2AX1A 2HRTA 3Q8VA 5KFFA 1SVDA 4ES1A 4DSIA 2A2DA 3BM7A 1WHYA 3M6WA 3LO3A 5ETSA 5CCLA 1NZ8A 1CLFA 1YBUA 2CQCA 2X7IA 3PW0A 4FF1A 2IYGA 3V5RA 2FY1A 4OYIA 3CD6S 2Q6BA 3D1HA 5A2QU 3KNAA 2Y9HA 3CCJS 3TVYA 1H38A 2PC6A 3SV4A 2CJQA 4Y2CA 4DV3J 3JB9k 4DU8A 2M3DA 4QU7A 3H42A 2MSSA 2WVEA 4F0MA 4R5PB 2HIQA 2YQ1A 3TYTA 2GMJA 5HVHA 2ZH6A 3OBIA 1JLQA 2VG5A 5GAHU 3QMQA 3HT3A 3BO3A 2NPIA 3BDEA 2F65A 3P45B 2ZM6F 4M94A 3OJUA 2HW3A 3HKZD 2VFVA 1VYAA 3PFEA 3C66A 5IZHA 4ZMMA 1RT1A 4LF8F 3CNQP 1T03B 1YX2A 2VKRA 1YBAA 4IOBA 4DR3F 2WRMA 3TUIC 3OFFA 4NWBA 3IRXA 2XWYA 2LQ9A 4FYYB 3KKFA 3GYGA 4C7QA 1D8YA 2XULA 3Q83A 1A7GE 3DN9A 1N54B 2CQ1A 3EJMA 3PHTA 3Q0AA 1HNZF 4N41A 4IOAQ 2KFNA 4U67Q 1HBNB 4DR1F 4DQIA 2R8HA 4JYAJ 1T9XA 3AB4B 4Y2MA 3KFWX 2KKHA 3BSAA 1HNIA 2Z2MA 1FXRA 3NS6A 4Q43A 2VQFF 1FDDA 2W24A 3GWCA 1N36F 1OWXA 4GO7X 4OYZA 1PBUA 1S6PA 2RDIA 2WOMA 4YB6A 1Q95G 5HP1A 4KBIA 3PW7A 3E51A 4CO5A 1HNZJ 2C2KB 3SBMA 3DKDA 5HBMA 4ZHRA 2A3JA 3W66A 3K58A 4L6V3 1SKRA 1P6TA 3LALA 2O67A 1B7YB 4ZPBA 1H7WA 1K0VA 3N4WA 2LA4A 1S9EB 4FNHA 4DX6A 3QGPA 3N28A 1CJVA 2U1AA 1NJIT 2RF2A 4J9UE 1WKLA 1HNIB 3BSCA 3DRRA 4H54A 2COLA 5AJ3F 2JEJA 3DLKB 1S97A 4ED5A 1RT1B 2V50A 1Q8IA 4GVBA 4AFFA 4Y0FA 4PQUA 4JV5J 2RHQB 4L75A 1VBZA 5KTQA 4M5JA 1NKCA 1UAWA 2JOQA 4TY8B 3W3SA 3JS9A 4PG4A 4ZLJA 3BR9A 1FT8A 2CQBA 1Y3KA 4CYUA 5HSPA 4Q0BB 3K5NA 4G65A 1UJ6A 3I6PA 1FKPB 2RH3A 3UN3A 3N01A 3UR0A 3M2RA 3KLEB 3H5XA 2ZC4A 4I68A 3GE9A 1LWFB 4H4OA 2WOMB 1NJZA 1MMLA 1IKVB 3G6VA 2FUG9 1FFGB 3MR7A 2ERRA 2AMCB 3OUYB 5KG1A 4OYBA 3BS9A 3FSIA 3ILLA 3WQPA 4RLEA 2XLJA 2XO6A 4O3OA 1Y0HA 3MHYA 3D1OA 4DUZF 2IRUA 1IBCB 3L4BC 1VQSA 1HHQA 1Y10A 2A0FB 4TQRA 3EX7B 1HQEB 1VQ7S 2GMLA 3PX6A 4LF4J 2CAJA 3F41A 3VWSA 4EBEA 1FRLA 3JAMY 2L9WA 2C3YA 3DDKA 3CULA 1RWVB 3C16B 2HQDA 1UW4A 4LJMA 4PCQA 3OW2R 3V6DB 1TL1A 1IBMJ 1OPIA 1VS3A 4DL0C 2HGNA 3MUTP 4Q44A 1IUJA 5A6PA 2DKOB 4J9VA 4ILRA 4EGLA 4ENOA 4EO8A 2HVIA 1T0TV 3P3DA 2VL1A 1F1BB 4K7QA 4LREA 5KT7A 3V6DA 1GTEA 1X8DA 3QBCA 5I3PA 1KD1T 3EXYA 4ITSA 1DBDA 2IM1A 3CEDA 4USIA 3ZTRA 4DSLA 2M9KA 4YB1P 1K47A 2M8DB 1HNWF 1HQEA 3ZTSA 2XCPA 1VQPS 4LF6J 1BXNA 2J9CA 1ZPWX 4LFAF 4RUAA 2B6AB 5HO4A 4PWDA 2IC3A 8AT1B 1GX5A 5HVFA 3RW7A 2FJEB 2XZWA 3GIMA 3EZ5A 4DU7A 2MY8A 5KFDA 1UVKA 3FVYA 3CCTA 1RE1B 2XSJA 3D0HE 4M5NA 3FZ2A 4DPYA 4CLTA 5KFMA 3TA0A 4F2RA 1T3OA 1QJHA 2YKPA 4ER8A 2NREA 4DR4F 3KK2A 5ADZA 2KHCA 3LAMA 4QWDA 2DEIA 5IOLA 1LWFA 5AXKA 2HQGA 1HBUB 1RXOB 2HYIB 4WZMA 2WCXA 3RBEA 2V4JA 1MMDA 1LWXA 3V6KA 4TXSA 5J2QB 4DR3J 2IJNA 1PYSB 2WSCC 4X65J 3RBDA 4DUYJ 2V63A 2VHGA 3GLJA 5A6WA 1V9OA 1SIZA 3KK1A 4NYPA 1U0HA 2HQ3A 4UT4A 1JXEA 4IYQA 3K5MA 2XO7A 2DRAA 5A8RA 2XQCA 2AF6A 5D0GA 4LQ3A 3FSYA 2G2OA 3CSKA 1RTIB 4A48A 4DG1A 3DRRB 5IXUA 2IVFB 2DPJA 3NMAA 2HAIA 4QYZJ 1X4CA 2I9SA 3NL0A 2J6SA 5HLFA 4JI3J 4OX6A 4AD6A 2P2CB 4DUTA 3UO0A 8RUCA 1LWEA 2EPIA 3FQLA 3MM9B 1RACB 4J9SA 4DV0F 3E2EA 2IRXA 1X0FA 3C14B 3OQ2A 3EYZA 3QQCD 1BHNA 1NMEB 2ILZA 4FZVA 2CPIA 4WK1A 5G0RA 5C42B 3B54A 4O23A 3MMAA 4O44A 3OTDA 2R2SA 1B0PA 1B0VA 1MWQA 1S7HA 2FVCA 2NCKL 3HHLD 2LXUA 4HDHA 5U47A 4CO2A 5HI7A 4IO9Q 4ED8A 4KIAA 4YP3A 2K3KA 3PR4A 1M5OC 1SI9A 4F4KA 1EAYC 4PUOB 1NB7A 2Q1LA 3D1QA 3ICLA 2MXYA 2VOPA 1RSCA 2CJXB 5DM6Q 1TQLA 1S1VB 2KRBA 3QT5A 4FYWB 3QLHA 2B0GA 4AUKA 5SZTA 4K50A 3H5SA 2BX6A 3KLIB 4QWBA 3G8QA 1R0AB 3TA2A 2GZOA 3DGPB 3MD3A 2EFPA 3EUNA 3M32A 3HHDA 4NCGB 2OH2A 2VBZA 1ZOTA 2RRBA 2ZDPA 3VAHA 4O3PA 4NMXA 4QJVA 4AXIA 2Q66A 1ULRA 4IKAA 3GILA 1Q79A 2D9PA 4ZVUB 4QYRA 3MFHA 2CJBA 3CUNA 1CS4A 1N6QA 1CC7A 2DHHA 3NXZA 1S48A 3MM7A 3QWUA 5LJ5Y 1TFWA 3KJVA 2O3DA 4TKTA 3THVA 1HBMB 5DM7Q 2YXLA 4W4MA 1SL2A 3DLGA 3VF0B 2LECA 1WHVA 3TQ1A 2E66A 3M8PA 4WF9Q 4R0EA 1HL6A 2FJBB 2ILYA 3MZIA 3AA9A 4TYAA 5H9FJ 2DGOA 2DNMA 1XBWA 2JSXA 2VDHA 4UUWA 1XJWB 3SEOA 3W2VA 1DURA 1X60A 2UUTA 3N5BA 5CAAA 2R8IA 3RB3A 3NNHA 2ZDOA 2XMTA 3UWTA 1TL5A 2ZOGA 1RAOA 3UPFA 1RAAB 1XTZA 2D3UA 1SIWB 2E9TA 2G13A 1GX6A 1UWBA 3KDOA 2H51B 4OZLA 4OX7A 3K5OA 1M1KT 1D8ZA 1R6VA 1TKZB 2LMIA 3R5JB 1UMJA 4OX8A 1FESA 4G1IA 2KG0A 3FNNA 4NI2B 3EICA 3H25A 1YSJA 1Q4RA 3QNWB 3IG1B 1VOMA 1JJ4A 4G3IA 3GYXB 3TJ9A 1Y00A 2Z2LA 2F9DA 4WFAQ 3OVBA 5L38A 1SJRA 2RU3A 1WD6A 3MPYA 1RLCL 2APOA 4A8FA 3CDWA 4NLQA 4JYAF 3QZ8A 2RRAA 3WBZA 3D6HB 2UU9F 2CG4A 3LTOA 2AKWB 1RBAA 3MDFA 2GCFA 3CC7S 3KG4A 2YKQA 2JEIA 2GGPA 1RTZA 1FNOA 2BKNA 1KS2A 4I2PB 5E2QA 1AZSB 3S1TA 4X4SA 2PMZD 4J9RA 2HHUA 3AQOA 1F3VA 2VV5A 3GTYX 3NCRA 5CYMB 3J7YU 1IQTA 1NSPA 4USTA 2PMHA 2UXDJ 1JLEB 2GVZA 2YWGA 3MUVP 5LXYA 2HMIB 4TQSA 3M9OB 1GXLA 1X7VA 2FY8A 2YKNA 2Z2ZA 2JC1A 1JNZB 4BHQA 2HVZA 2HRUA 4FYXB 1NPPA 1Q53A 3NS7B 3DHXA 5LSOA 1J5EF 5GAHI 2D74B 2RU9A 3CJ0A 3MECB 1B3TA 3O6QA 4KE5A 3ZZOA 4AQYJ 1U2RA 3CJRA 4Y28C 4ELVA 4UZBA 1WEZA 1WF1A 1CG2A 4ICLB 4CH1A 3DFEA 5ETQA 1BMQB 1MWYA 1D9DA 3GYNA 2R7XA 5KG2A 4JI1F 4DMZA 4ES3A 3MR6A 2VA2A 4F0HA 1TK0A 2XSFA 1FEHA 1GMWA 4WXWA 4DV1F 4PR6A 2WVBA 1JMTA 1RAFB 1R43A 3OR1A 4NCAA 5EDWA 1JLQB 2VG5B 4DV6J 1RHRB 4OZ0A 4M5KA 2UXCF 1DTQB 3JAMU 4QWEA 2FGOA 2L08A 1KKHA 3ISNC 4WE1B 1UTAA 1RAEB 3LGMA 1RTDA 4F26A 1FFSB 1TL3A 4DI6A 2GFFA 4RUHA 1FKOA 2DIUA 3SYZA 3DYAB 4HI2A 3CC4S 2B9WA 3RAXA 3C6UA 1YZ7A 3D67A 1HA1A 3V6JA 3IBCB 4NLVA 3O2IA 1CJTB 3H2UB 1N5TA 4ECWA 1X9MA 5KFRA 1IBMF 3CDBA 1X4AA 3R6LB 1PYOB 3C6TA 4H4KC 1RWKB 5J2MB 2EFGA 2N82B 2GJIA 2R7UA 3HSGA 2IVMA 3DRSA 3OR2A 3EZUA 2V8VA 4HTIA 1E6YA 4LVOP 4RW6B 3CMQA 1RHQB 2PGCA 2JL9A 3M2VB 2EFVA 4CO1A 1BC6A 1TU0B 2BV3A 4QWCA 1XNRJ 1UFLA 3FRYA 2GQ2A 5HL7Q 3M8QA 2VG7A 1FXLA 4QYZK 5M2UA 1WC0A 2VUGA 4H4MA 3MMBB 1TKDA 4IRCA 4UW2A 3WIUA 1VQOS 1FRJA 3FBCA 3RB0A 4PQUB 5FIIA 3FK4A 4IDKA 2R2RA 1JLCA 4B9MA 2H4YB 2YVSA 3OL8A 1FCAA 4C97A 1XNRF 2WVDA 1AB8A 4I69A 1IKYB 1GXUA 1MROB 2ZH9A 3TA1A 4ECRA 2OPRB 5IT0A 3I0SA 5CA5A 1X5TA 2E44A 2YQ0A 2QA2A 3KMSA 3QRRA 1SJ3P 2MDAA 3GFYA 1VHFA 3HSDA 3PX0A 2DY1A 3W64A 1HQUA 5F8JA 1JWWA 1TKXA 3DDNA 2BM0A 4N8NA 1NKEA 4K4XA 4NLGA 1RTHA 5KFGA 2HGMA 3K8WA 1J5OA 1UVJA 1PILA 3RW6A 5L9NA 3IAS9 3P8BB 5EX0A 4KSEB 4NOHA 5FJ4A 3MF5A 2R9LA 1H72C 1HNVB 2KT3A 5C25B 2DCUB 4ZITA 2B5JA 1JNRB 1RT3B 2OMLA 2CZ9A 2DO0A 2OP5A 3W65A 5CZVA 3VGUA 2AJFE 1AW0A 2WB4A 3SIPB 4YY3J 3IRWP 3I5AA 3HJVA 3ZNUA 3EDQB 4A8XA 2B8PA 4MFBB 4O3SA 2OHDA 4URGA 3DXSX 1FK9A 3VGSA 4C3KA 3TI0A 2VASA 2KXNB 2DO4A 3ZC4A 2V6AA 4PG7A 2JX2A 4N7TA 2DXFA 1S12A 4LRDA 5KG6A 2QRRA 4KTQA 5KFHA 2PMWA 2GQQA 1W25A 4WTYA 4WIQA 3U1LA 3GV5B 4EBDA 1FRXA 2VPXB 1TAUA 4U7UK 2VF3A 3AQPA 1NCLA 1U49A 2DXDA 5BYQA 1S1UB 4OFZA 1BWEA 3UDLA 1S57A 1K0TA 1H2VZ 4NL5A 5JUMA 4EMDA 2OI2A 2BR0A 4RKUC 2W8KA 3AH6A 2D7SA 3CJKB 5K8NA 4MTPA 4TN2A 1QAXA 2EC2A 2GW8A 4OI6A 5ETVA 4F50A 4KGMA 4DL5A 5DETA 2BANA 2ZEJA 3D54A 1RT3A 2HFUA 2FHJD 3EE3A 4A8MP 2AGPA 4ZN3A 4LF9J 1ICEB 4LF8J 2KVQE 3BBCA 1X9WA 2WVCA 4K0KJ 4P9SA 1S1XA 2FJXA 1HW9A 4ZJOA 3FMWA 2DH7A 1TKTB 2F4FA 2W9AA 2I1RA 2HMIA 4LF7F 1FRIA 4NYOA 4IRKA 3GP9A 1W2IA 3ENWA 1WOSA 1GXTA 3G82A 4CQ1A 4HT7A 3VGVA 5BYRA 4X66J 2ZHBA 2VG6A 1URNA 2MZQA 1XR5A 2DTJA 1LW2A 3D5MA 4OZ2A 1AFJA 2ALZA 5K5MA 1VR6A 3C19A 5A8WB 4WJBA 1IKYA 4N8OA 5IQQA 5DDQC 3JSYA 4B9UA 3ZTOA 2FZGB 3ZZYA 1WI8A 2VPWB 4IFVB 2MQPA 1WSVA 5K20B 4FXDA 4PXDA 1YLXA 2NSCA 3KLHB 4WP8A 3M9MB 2C3PA 2XMKA 2B9EA 3NP5A 3GJSB 3L95X 1SKUB 4QZVB 3UN2A 4DR5J 1VIXA 1ZTTA 1CBKA 4X64F 1SJFA 2UU9J 2O01C 1N0UA 2DBBA 1YVFA 2XG8A 5DZ7A 3R9LA 3TJAA 1EQMA 2ASDA 1RB0A 2ZBCA 1NK6A 3N79A 1H3DA 2G9OA 3IS9A 1VHIA 2JWNA 1WC4A 3UR3C 3J80Y 2J9DE 2Q3PA 1W7WA 2CJYB 2DITA 3FRZA 3ISZA 4MH8A 2OO4A 2CPDA 4OJGA 4OYXA 2HK3A 2BW7A 3T6JA 4A8SA 1U0SA 4ELUA 3IS9B 3J7ZT 1PO6A 3K57A 3P6YC 3R7SB 1F9FA 2DYAA 2FVQA 4B3RJ 1YJRA 6FD1A 3M8PB 4ZVRB 4TLRA 1HYSA 1F2HA 2EFNA 2AZ1A 4J7CA 4ZCIA 5DG7A 3VAKA 1GFWB 3ENVA 3G71S 3JYTB 2E1MC 4M5MA 1N48A 2NZ4A 2XI2A 2FVSA 5K8PA 1CS4B 4OJ1A 3JTPA 1GEHA 2ZNZA 2FLLA 1WHWA 1KNZA 3BN7A 3NY0A 2VC1A 1RT2A 2F3JA 1VLYA 3Q22A 1CULA 3CJ4A 3IR6B 3AXMA 4KY3A 1JLAB 4PG6A 3RUBL 3OLBA 2CPYA 4DF4A 3PVXA 2DNLA 3MFIA 1WSRA 1HKAA 4CM0A 2YNIB 3EZOA 2X1BA 4KFBB 3ENAA 4DDFA 5F8NA 5AE1A 3ET6B 3UD5A 1N5SA 2WHOA 4QBUA 1NJWA 2MJUA 3CDAA 1BQMB 2BJ9A 5LM7E 3CCUS 4WYWA 3H5YA 1R27B 2RHSB 1JXVA 4GKJF 3PIPQ 2XS5A 1S99A 1Y7PA 4GRSA 4KC5A 4JV2A 2O66A 1XK8A 1C4AA 5E5NA 4ZA1A 5ETKA 1WDDA 1ZM2A 4WP9A 5A8KB 2GHVC 2VIHA 1C0UA 2MTLA 1FE4A 1FXDA 1WUUA 3DU6A 2MPUA 3QATA 1SL0A 4UY8T 4V19J 4FYDA 5KG4A 2PN6A 4MK7A 4JI0J 2AV5A 3D28A 4HH0A 1XR6A 3GFHA 5IT9U 1ZETA 4CLUA 2J7UA 4ZS6A 3P4UB 2HBZB 2NS1B 4HHHA 1FF2A 1ZAWA 3EVOA 2ZH4A 2XY7A 4KHPJ 3OLAA 1CQNA 1SV5B 2GO8A 2EVZA 2J7KA 2O1PA 4MT1A 2IRYA 5KFIA 2OTLS 3OD2A 4JI4J 3KLGA 2J7WA 1RYRA 5F8HA 2YPZA 2YY3A 2ZFHA 1O51A 3M9NB 5J2PA 2ATCB 1C0TA 2DCLA 3BZQA 2F4VF 4N56A 3EGVA 3ZZRA 2GHPA 4NLTA 2HHXA 1X4EA 3BPDA 3KJNB 3VAFA 1YHQS 5C2CA 3H98A 4QU6A 3W8PA 2KM8C 2VQFJ 1SQFA 2PEBA 3K8VA 3TAMA 2N4DA 1N5YB 2EK6A 3RR7A 2CWKA 4DV5J 5JXSA 2W9CB 3AHPA 2IM0A 1CQMA 3A1YG 2IFXA 1DTTB 3MAHA 2A1BA 2R2TA 8ATCB 2BJ1A 2BKOA 3G8TA 3DOKA 1EKRA 4YS2A 4YUDA 4YY3F 3M8QB 1VQMS 4QQBA 2HHWA 2IAJA 3SCKE 1SC4B 3T5LA 5K8MA 2K06A 2VG6B 1DQAA 3TR5A 3FEYB 4IFVA 2V2QA 4FS2A 1S77D 4WZQA 2EI5A 2R7VA 3DOLA 2D3ZA 2YKAA 3TAMB 1N5YA 3MM7B 3KTQA 3ILJA 1T02A 4A4JA 1CPZA 1KVJA 4KT0C 1KBRA 2OEKA 2DRDA 2MHEA 2V2VA 3UCGA 4C0BA 3W5XA 4KV8A 5HQ8A 2RT3A 5F8MA 3RB6A 1HR0F 2FVRA 5H9FK 1TZ0A 1KHVA 2DGSA 3SXLA 1U8WA 2YH0A 2VONA 3M2VA 2CDQA 2RSQA 1VDHA 3N5FA 4ZPDA 2RILA 1C2PA 3EPIA 2HFOA 2XBPA 3IR7B 3LUYA 2HS4A 2R7SA 1GK8A 1N52B 4TU9A 1RT4A 2YNGA 3KG1A 3A8IA 2HHPA 4QIFA 1FX4A 1SH0A 1YDLA 4AT1B 5IT4A 2MKIA 2JEGA 2LQ8A 2XHCA 1IKVA 1MG7A 4YDDB 2KHDA 4J90A 4YN3B 4ZVSB 2W4DA 2V4RA 3CJTA 2LEAA 3KDNA 2RS2A 3JSBA 1TR0A 5KFLA 3DC2A 3QJJA 5A8KA 1FJEB 3NLCA 2A2CA 1U25A 3B4MA 2FHOB 3W7BA 3HJFA 2MKHA 1NXIA 3GSIA 4UOHA 2W2MP 2AJQA 2HGLA 5IC6B 4RBVA 4CO0A 3G2XA 9RUBA 3MM8A 4F25A 3H90A 2V8DA 3PG9A 2P9CA 2XMWA 7AT1B 3FCVA 2MLZA 1VQ8S 4DFPA 4FBTA 3GPAA 4LIRA 1DLOB 3QJLA 3Q8SB 3M8YA 3FZBA 4LF9F 3MPUB 2P8IA 3DMJA 4WTOB 5I42A 1XMQF 1Q8LA 4AL5A 3J80U 1U24A 3O8WA 2MGZA 5J2QA 1UEVA 2M0GB 3QT7A 4I0WA 5KFCA 2ZKTA 2X1AA 2CPHA 1FVSA 4DEZA 1C0TB 1XEZA 2W8LA 2YWWA 3EGNA 4B3RF 4QPTA 4DV2J 3TZYA 3FEZA 4YB7A 3JTOA 3T1HF 2Y0SD 1WC6A 5IV4A 2LCWA 4P74A 1VIOA 3RB4A 3GJQB 1UEKA 4PWUA 5LSLA 4J9OA 2XSJB 5I3UA 1SQGA 1HBNA 2AW0A 1WC5A 3V4IA 4K2XA 1EJ7L 1LK7A 1S7IA 1KDNA 4I64A 4MAKA 2BQ3A 4C8ZA 3PW5A 4HACB 4Z7YA 3NAHA 2ASLA 3N6NA 3V4IB 4RW4A 1FRKA 1QAYA 2Z0GA 2M5YA 1OY8A 2ZD1B 1N88A 2R7OA 3W1YC 2CJKA 2ZUAA 1PJ6A 4J9PA 2LEBA 5KFAA 3CT9A 4ZPCA 4F3OA 1VQNS 2CPEA 2ZVIA 1RHMB 2UUWA 3KHLA 2JH3A 3BKUA 2OLWA 3VR1A 1LOUA 3MMJA 3C6TB 4PPZA 4RNHA 1TL7A 5B0FA 5THWA 1N33J 4PYDA 1G2EA 4NCGA 2EBGA 1WACA 4KGZB 4DUYF 2AU0A 3ILOA 1FRMA 3A3OB 4KGKA 2C2MB 2N3LA 4RW6A 2QT7A 4DUZJ 3CCZA 2ZKUA 2DHAA 4OHXA 1VRTB 4MMOA 5K14B 2QMUB 2I0XA 4C0HA 2YTCA 2GA7A 3NGSA 1Y5IB 5D6GA 1KSPA 1MNEA 2DJWA 1SC6A 1KLNA 4C8LA 2UZAA 3X1LB 3R5AA 4DV7J 5KOWA 2HHTA 3L7PA 2VDIA 1QE1A 3MTJA 3CJ3A 3W9JA 3S7RA 2W01A 1K73T 1F2GA 3JQKA 5KG0A 3FFIA 4DSEA 2F8EX 3RTVA 3GIRA 1H74A 2J8SA 2CNKB 4ZLLA 3MEDA 4KKOB 2JLFA 5L46A 3QLHB 3R27A 4ZDNA 5A76A 1WF2A 2QIFA 1O6XA 3A3PB 3P5TL 4U9RA 3PEJA 2LFVA 4NPOA 4NZ7A 1RT4B 2AWZA 2J0XA 3HX9A 4GKJJ 3CC2S 3WX8A 1UETA 3CGIA 5CQGA 4ANCA 3IBFB 3PYGA 1VCTA 4Q45A 1R0AA 1U0HB 4FVCA 2I5JA 1EKSA 2DT9A 3CJKA 3T6BA 4CZCA 3J81U 4P7TA 2ZZTA 1NHUA 3WDOA 3TAPA 4OX9J 1TVRA 2QN6B 2K7KA 2RQKA 4ZCLA 3MURP 3CPWR 4AL7A 2GVDA 2XY6A 4LRAA 3IM8A 4O3QA 1YTYA 2AJ0A 1TL7B 4NXMJ 3PRVA 3NNAA 3DI6B 2H4WB 2E1PA 3OPKA 4USVA 5EHHA 3BKFA 3MR5A 1YJVA 3DNCA 3HD2A 2RE1A 3PKMA 1B4SA 1QTNB 1IKWB 3W63A 1U2FA 3D6TB 4FVMA 2CQ2A 3GIJA 3J7A1 1WC1A 5E3CA 4DZDA 1QTMA 5ETNA 3DXBA 3IP0A 4RW4B 5HMXA 1QD1A 3NRBA 3PDNA 3I5BA 1RK8A 4OHVA 3KK1B 4IQMA 2CPXA 4I6AA 3OFEA 5A8WA 3AJ2A 2YWKA 3DLEB 2XGQA 4R25A 2NXEA 5KFTA 2F7VA 4F4YA 2QG9B 3HF5A 3NCPA 3DDIA 1RTIA 5ETLA 4DHVA 1T03A 2W7AA 1UVIA 1YBTA 3R6GB 5J1EA 4IDKB 2ZBQA 2R2UA 1KTVA 2L48A 3G82B 3KJQB 4P2XA 4F8RA 4DPXA 1UWBB 2ZNYA 3SCLE 5J1NA 3RAQA 4JV5F 1Q5VA 3KHHA 1ZH5A 4LF5F 1JK9B 1MU2B 1VBKA 4JV0A 2C22A 2CQPA 2H48B 1KOHA 1B70B 1ZM9A 4PXCA 1AROP 1RTJA 5GAEU 1ZPVA 1DHMA 4L76A 2CQIA 1S6UA 1R31A 3G6XA 2B6AA 1U45A 4ED7A 4PWDB 4ECZA 1TV6B 2MQQA 3VVUA 3DOMA 4ECXA 4OZJA 4LR9A 2B4PA 1LV5A 1S1UA 1HD0A 4MKAA 2I6WA 4ZP8A 2FYXA 2QMXA 2NUHA 2QX0A 3PW4A 3BF4A 4RR5A 4TNOA 3MCMA 4I67A 4YR3A 1N32F 2XM3A 4GVLA 1DTQA 1WC3A 2O5DA 2JHEA 3D4JA 3E8OA 4ATNA 2EW9A 2LU2A 2PEHA 2RB7A 3HT0A 4CLWA 3CCVS 5GAGU 2QYCA 1HWUA 3IFEA 1QSLA 3CCQS 1X4DA 1FDNA 1O0PA 1RKIA 1R6YA 1TL3B 2LDYA 1FK9B 1U7LA 4G6VB 3D68A 1RWNB 3NBPB 3NKYA 5T7LB 1WOPA 1JLBB 4FBUA 3THPA 1TKTA 4CYUB 5DRKA 1P9QC 3OR2B 3LWMA 2VFSA 1W26A 2J0SD 3GG0A 4ZOSA 4OZ3A 5EWFA 2PDAA 3BBBA 2KFYA 1RDRA 3U7JA 3T5JA 1BUXA 3W9HA 3CVKA 2E5LJ 2BDPA 4NLPA 3FMBA 1OPZA 3DGPA 1NK9A 1X4HA 2CWXA 5AT1B 1FDBA 1EARA 1UZHA 1IBKF 7FD1A 4GKKJ 4NLSA 1U4BA 1O8BA 3V81B 1CJVB 4LF6F 2YKMA 2VBWA 2CIMA 1RTHB 4AXJA 2Z2YB 1HI0P 3Q89A 1TMJA 4ETZA 3L09A 1GH8A 1YGYA 4AE5A 4TU7A 4OIXA 1N34J 1FJGF 3AOCA 2ZUGA 1RKJA 4X4TA 4DSFA 3W2WA 3BPSP 1IJEB 2HVDA 1LXNA 4X64J 2FDNA 1HNXJ 4QPXA 3O5TB 2BBEA 4GVBB 2P6SA 2XYPB 2L9DA 3RZAA 3DM2B 2E5IA 3Q8QB 5K9FA 1Q82T 1NPKA 1DQ9A 2DIVA 5B09A 4UOFA 2P5VA 4MFBA 1FTRA 3TZWA 4XO0A 1S76D 4X65F 2OD6A 2G4BA 4WK3A 2J8AA 3GMGA 4AQYF 2C1EB 4D3GA 1NU4A 3BEGB 1VBYA 4F4WA 5KFWA 4CP5A 1M90T 4IR1A 3OL9A 1JB0C 2ABYA 2KN4A 4C11B 4EI2A 5D0RA 1H7XA 4ZCMA 2HWIA 4C8NA 4RU9A 1T05B 1T8EA 3K89A 2DK2A 1GAOA 1NAQA 2E1RA 2ROEA 1DAXA 4Q7AA 3KHRA 4OHYA 3F0NA 1L5UA 4F67A 2BE9B 4NA3A 2NXNA 4KHRA 2Q43A 3C6UB 5B7WA 2BOPA 4RPFA 1PKUA 1GMWD 3DCAA 4X62F 2W25A 1NK0A 2YBVA 1VRQC 2ZITA 1XR7A 2IA0A 1HQ2A 4RL1A 3SQGA 5KG5A 2JLGA 2Y8WA 3M05A 3MOZA 4RJVA 4URQU 2RIJA 5F8IA 3ZTQA 3RRHA 2UUBF 4C8MA 4KH1B 3VAGA 5DO2A 3FBBA 3WC2A 3R3TA 3G86A 4LIWA 5CYQA 2B51A 1LXJA 4KO0A 1JLBA 5CD4H 3TEHB 1N33F 1LW2B 2HZCA 5C7PA 3E01B 3IMQJ 5FDLA 1VBXA 1X0PA 5LL6d 3HCXA 4O3NA 1P1LA 2G0IA 1X31C 1CJKB 1O5JA 1Q1KA 1IJFB 1Q8KA 2D1CA 2QMWA 5DLFA 2C2ZB 1U1KA 4O0NA 3AAWB 4USKA 2X51A 5DS7A 4B3MJ 2HNYA 3HULA 4CI0B 2OUGA 2CQGA 3I0RA 5IWAJ 1G6BA 3NOGA 4C8KA 2DH9A 3C15B 2RDDA 2BJ8A 3NWRA 3M2UA 3HVTA 1MMNA 3G96A 5L1LA 4LFAJ 2V68A 3I56S 1D1UA 2XB2D 4UOCA 2H9ZA 3AOBA 2GQCA 2ZOMA 2U2FA 3OTCA 3ZO7A 1I94J 3GR0A 4M95A 3M2UB 4PG8A 5BJRA 5HMZA 3M2RB 3KLEA 4JI8J 4M8LA 1KC8T 1B99A 4WFNQ 3KJVB 2YPYA 4KQZA 1N56A 1K1SA 1MU2A 1CULB 4DPTA 4HEA9 2Y0BB 1SJ4P 5AE3A 2MQMA 2OTJS 3DLJA 4ZVEA 1U1LA 3GFZA 3BO4A 3HVWA 1DARA 4L3KA 3KUHA 1M5VC 3OT9A 3MEEA 4PXBA 3RU0A 2YX1A 1UWAA 4B9NA 4CM2A 3G8SA 2GIQA 1M1GA 4C6AA 3HXMA 5KFJA 1QM9A 2QA4S 2KTQA 4DSKA 5KT3A 2NQPA 1IKXA 2OKQA 3Q2SC 4ICLA 3W61A 5GAGI 3FCHA 2PSZA 4L73A 1YJTA 2ATLA 1LWCB 5D4OA 1QSYA 3LAKA 2G0JA 2G0CA 4XK8C 1U1OA 4NXMF 2ZVSA 4QIVA 4ILMA 4ZHRB 3AODA 3MEGB 2OPSB 5A8RB 3MI7X 2XC9A 3UE2A 4JOUA 1RABB 1Z1ZA 4DV7F 3C2PA 4ECTA 2MMYA 1WELA 1NDPA 5KAKA 4LF5J 4B9SA 4A47A 4Y2IA 2P6TA 2ZJPQ 3SDEA 1RISA 4O4GB 2MLXA 4Q8EA 4OL8A 2KXFA 2CNOB 2C3OA 3A8EA 2HHVA 4YOEA 4F4AA 1IM4A 3SMZA 2CA9A 1NBEB 4OZNA 1OSDA 5E7OB 3W8GA 3ONQA 2L9NA 3LOUA 3TWZA 4NXNF 4C9DA 4ELTA 4XPCA 3VAJA 2AT1B 4XPEA 2QO3A 2V4QA 4FPRA 1VFJA 5AJ3J 3KLHA 1F5BA 4AL6A 2BW2A 2PA8D 3VV2B 3H5UA 1D9AA 2C3MA 5JVGQ 4CLFA 2DH8A 1QUPA 2R42A 3EVWA 2GJ2A 4WFZA 2N3OA 3AOAA 2L3MA 2E7XA 2KG1A 2QL9B 3Q8RB 1Y9OA 1UFKA 1HMVA 2HS0A 1HIYA 1LW0A 1FO1A 1HBOB 2FC9A 2HS3A 4JB8B 4NMLA 3WIVA 1PGZA 2UXBF 2ZH2A 1FD2A 1SKWA 4L72B 1AT1B 3ZZZA 4X4PA 3TVZA 4DQSA 2OJ3A 1SBRA 2C28A 4BC7A 1JXLA 5L8RC 2KYXA 3PIOQ 2MHNA 4ECVA 2FVPA 3OFGA 1VGYA 4LSLA 3QT6A 5KG7A 1OS5A 1SUQB 1YJUA 2JZ5A 2QSFA 1JLGA 3SCIE 2EKYA 3GR1A 2W4PA 2UUBJ 2V9WA 1XMOF 1KVKA 4IUFA 1U6BA 5D77A 2PE8A 1Y11A 3EDRB 4OI2A 4OV6A 1IBKJ 1GNKA 3DOMB 5IV3A 1QAJA 3A8KA 4YB5A 1K1QA 3PY8A 1VC6A 4DJBA 3DYAA 3N6LA 1FNXH 1VC0A 4EZ6A 4X4QA 4CCHA 3WHIA 4LF4F 3MXHP 4ES2A 4R0JA 4OZ1A 2DNRA 1VRUB 2KYZA 2ZBPA 5C24A 4OYWA 5LMNF 4DQPA 1FWLA 4ZVHA 4B3SF 1G3OA 1PC4A 2HBQB 2MKSA 3BR8A 4QIEA 3WX4A 2JFKA 2MKKA 4DLGA 1TK5A 1VQLS 2M70A 2V5HG 4USJC 1FA0A 1LK5A 3LANA 4LSZB 2J0QD 2FC8A 2IMOA 3PHEA 5A0YA 3QGGA 2N4CA 1XN9A 1ZA2B 2IAJB 2VU5A 1YKWA 2Z4PA 4WFXA 3BJYA 1NK5A 1FEEA 5CYQB 5AE2A 2OIHA 3UDVA 3OFHA 4E98A 4DS4A 1G4CA 4URSA 1UZDA 4ZKAA 4LUBA 2KT2A 4KAIA 4ZN1A 5KOXA 1YIJS 1R8PA 4KJIA 2V94A 3LH2S 3KMQA 1N4LA 1GMVA 1RA6A 1RA7A 2CYYA 4F0KA 4BS2A 1QUVA 4CTAB 2EXUA 3SDEB 5HBMB 3MMCB 2RRNA 2QLJB 4FF4A 1IR0A 2ADBA 2F8HA 1S6QB 1YWXA 2YKOA 1V3ZA 1IWAA 5D0EA 4DCPB 2YWHA 1FX2A 1UW9A 4KHPF 4TYBA 1ACMB 1IBLF 4MIBA 3TZZA 3HLUA 4QW9A 3R7NB 1TKXB 1HQUB 2MZJA 3UVJB 4Y6IA 3QZ7A 4P6QA 3KJFB 2ZZMA 2IC3B 3FBFA 1E6VA 3KLGB 5HLFB 2K2PA 2BA9A 2J76E 1SJQA 4P75A 1KTQA 2OPSA 3SI8A 1KVIA 3A3NB 3G6YA 2GV1A 4YFUA 5HATA 4B02A 1RT5A 2BMBA 2UVVA 4NLWA 2WONB 1IR1A 4CT8A 3MMBA 1NK8A 1KQSR 4H4MB 1I1GA 4EBCA 4R5PA 3BQ2A 2BXJA 3HDSA 1RBLA 3I9V9 1KEKA 4DV5F 2DHGA 1TELA 4ZP7A 2FZCB 3BGUA 2F9JA 3KOAA 5T7LA 4UOGA 3W5YA 1WKJA 1Q78A 1WHXA 2HWTA 1Q5YA 2EG2A 2NYHA 3IC1A 4RX6A 3J81j 2RVJA 4B3TF 4XTTA 2MZRA 3EGZA 3KWMA 2CPZA 4RNMA 3HKWA 1LKZA 3G9CA 1EZZB 1YRXA 3CD0A 5C5JA 3ISND 2WSFC 1NJYA 2VFTA 4EZ9A 1HLWA 3HMJG 3HFVA 3L7UA 2HNYB 4ID8A 2IJRA 2VOOA 3TJ8A 1LFPA 2QYGA 3K5LA 1UPMB 1TV6A 3IRXB 3QSYB 3TW0A 1BQXA 3LP1A 3QAEA 2EBEA 4C48A 4DX5A 1HWLA 3IN5A 3HVTB 2WZ1A 4DV6F 2XY5A 1MSWD 2EC0A 4PWWA 1HBMA 1FKPA 5F41A 3ELHA 3CJSA 2VKZG 1YJNS 3BQ0A 4KV8B 4WE1A 4WKYA 4KO0B 2F1FA 4LSLB 4WFYA 2EEYA 2V2KA 4DX8H 3BSNA 1WORA 6AT1B 1TUGB 1UPPA 1VI7A 4HL9A 2NR0A 2I8EA 3M7VA 4NRUA 4DL7A 2LU1A 2OFGX 4B9TA 3DLKA 4IFYB 2R7RA 2QFJA 5CABA 2OFHX 4LRBA 5KFZA 1RT7B 2VH7A 1HMVB 2FJDB 2RJZA 2FHMA 4F4XA 1BGXT 1S9EA 1SCJB 3FGVA 3IGNA 3K7RA 4G1PA 4ID5A 4Q2LA 4EK2A 5M2PA 2KZMA 1Z2ZA 3H2LA 3HHKA 4M5LA 2E7VA 1JLGB 3LF0A 5HMYA 4RNOA 4YQWA 2XGPA 3PZPA 2JJ4D 3B6BA 2J9DA 2IVYA 1N36J 3GJTB 3HZGA 2HURA 1FI4A 2DGTA 3QGHA 4DPUA 3M30B 1L3KA 4ZVPB 5KFSA 3BGRB 2BRKA 4NLYA 2B3TB 1R8AA 2HIYA 3B78A 2PT0A 3EM1A 3PJXA 5D15A 5EUHA 3C14A 1ZTWA 1HR0J 1ZM3A 2DNGA 2FTRA 1NH8A 1REGX 3R5GA 1SB6A 4WIIA 4IOCQ 2WW8A 1NUEA 2DNKA 4RW9B 5G4DA 2MSTA 3DLEA 2V2ZA 2KM8B 3SV3A 1RWXB 1Y4ZB 3D6FB 5DDRC 4DCOB 3GG1A 5I4MA 2HKEA 1AZSA 1NLKL 1EIYB 4I2PA 2DD8S 2WONA 4IQXA 2BKPA 2DGXA 2FGCA 2HBYB 4I7FB 2BRLA 5J2NB 3W5ZA 1Z4UA 2ZD1A 1S0MA 3RBXA 2QZ8A 2DGWA 2QL5B 2UXDF 1RAIB 1NHKL 3U1MA 2NSBA 3KUGA 3MEEB 4QR1A 1YJWS 2CXEA 2VA3A 4LRFA 3GZ7A 2P9EA 4DXLA 3P96A 2DR6A 2ZWOA 4RW7A 2DNHA 4M5DB 3PKYA 1H6KX 2NXJA 4CLYA 1J5EJ 2XNRA 2LXFA 3OL7A 3MEDB 2HHHF 3MCSA 2J6UA 4HLBA 5E3PA 4OHZA 1YRTA 1FJCA 2EKNA 1I3OB 4GMKA 4Y34A 2CPJA 4PEOA 1RAGB 1U1RA 1S6PB 3PEHA 5HP1B 1S6QA 2XS2A 1CJUA 1RI7A 2Z57B 4WU3A 2A6MA 2LQBA 4X4RA 3OTOJ 4IRDA 2D41A 1P9YA 3DU5A 4KR0B 2C2EA 4LFCF 3Q2TC 1KFDA 4ECYA 2LLZA 1X5SA 3C15A 1UVMA 2OELA 1BQNA 3LP2B 2AX0A 3T19A 1Z2LA 3CJ2A 4J5OA 5CYJA 1PG5B 1SUQA 1S59A 5LOQA 1WKKA 5GAEI 2UXCJ 3O44A 3M6VA 2UXBJ 1S9GB 3NBPA 3F56A 2LQJA 3FFIB 3CIZA 2PD1A 1NRKA 5DG9A 2GAGC 4MJKA 4UQTA 3U02A 2Z8QA 3HFKA 3L9ZA 1PAUB 3JXOA 1TUWA 3ZZPA 4AYBD 5B0CA 5DDPC 2YH1A 2KFZA 3SZ2A 2OD4A 5E33A 4RW8A 3A13A 5IM0B 2XEXA 5KG3A 2GNKA 1KHWA 4ZVTB 4LF7J 4QOTA 3GCXP 5F3TA 3C16A 2YNHB 1U8SA 1GMUA 4G1QA 3TARA 1JQGA 1ZZFA 3EPGA 2HSEB 3VGTA 4JI2J 2KZZA 1S9GA 2KRRA 2VPZB 3LP1B 3NGKA 3AJ1A 4JUZA 3IR5B 2DNQA 3QGIA 3Q24A 2Z56B 3KUEA 3CMAS 1WTBA 4FF2A 2VZ9A 2HQFA 4FP9A 4OHWA 4YR0A 5IWAF 1VLOA 2PO4A 1X4FA 2M8HA 3LP2A 2DR8A 1WOOA 3HHLA 1HD1A 3OXGA 4F02A 1S1TA 4DR4J 5HK4A 3I96A 4JI6J 1VQ9S 2H54B 2JFDA 3HK2A 1MN7A 1I94F 4ILLA 3MMAB 3PRDA 2MZTA 3MAAA 2JVOA 2XZDB 3SSSA 2M52A 2G2YA 1LEOA 1NB2A 1A6LA 3OTBA 1I6JA 4HKQA 2KO1A 4IH6A 1KQFB 5J1EB 4LT6A 5JJBA 2BQRA 3H2VE 1VMBA 4NA2A 3CCSS 4C8YA 1PAEX 2F4VJ 2XYGB 2BZ2A 4PZVA 5KFYA 4MYTA 2HZAA 2QV6A 4L3NA 2HBRB 2W9BB 3QIPB 1JIHA 5AXMA 2HHSA 2UUAF 4NEZA 1JKHA 1KRPA 4UY85 1T9VA 4FXVA 3JSMA 1OJ4A 2VB6A 2ZJRQ 2LDIA 4K59A 1IVZA 1HHSA 4J37A 3NGDA 4ZLPA 1T9WA 3A4TA 2DR5A 3B82A 2IYIA 3MWBA 4DV0J 4YHHJ 1TTHB 2KH9A 2MQLA 3D3BJ 3PJ9A 4ZPTR 2UVRA 1CVJA 3ILIA 2E29A 1B0TA 5L1IA 2E5JA 4USUA 4BWJA 3DRYA 2DXEA 2V8HA 4NASA 2CJ9A 5I42B 2KL8A 2KI2A 3UW1A 5KFVA 1IBLJ 4F2SA 3VHQA 2NLWA 2BJDA 2DGVA 4LBHA 5GMEA 2VQEF 1VJQA 2DGQA 3FCWA 5CZXA 5ETRA 1OYDA 2BE2A 3AT1B 1Q86T 1P8GA 3KLFB 3HHNB 2CQDA 3G87A 2EWHA 1UFWA 2YNFB 1REVB 2YNIA 1YK9A 1SXLA 3QFHA 4KFBA 4P71A 3UFCX 2MJNA 3V4MA 3K59A 1SV5A 4ED1A 3FBEA 3TRGA 1YJ7A 1IM6A 3GIIA 4P2SA 5B0GA 3RAMA 3THTA 3PJWA 3K0JA 1RT2B 1NDCA 4LR8A 5F3ZA 1L3TA 2A18A 2MY7A 5KFPA 3H4BA 3PXGa 3GONA 3VAMA 1AA1B 2QL7B 3H8YA 4TLQA 4NEYA 3FKBA 4Y2KA 2LXIA 2XWXA 2F8MA 1Q7YT 1TUVA 2WK4A 1IXKA 5D4LA 2MKYA 5E41A 5GMKa 1EETB 2FZKB 2XHWA 1BWVA 3D6MB 5KT6A 5HROA 2KXHA 1G1XA 4JI0F 1XQIA 3UD3P 3NWGA 3R2DJ 3KK3B 2D3O1 4KPYA 1RP5A 1QY7A 3E3XA 3MM6B 4Q5VA 3FEXB 1F6TA 5CH7B 1RBOB 4DV3F 2BQUA 2FLNA 4N76A 1FDAA 1PCAA 3CW2C 3ZZUA 3BYRA 1RT6A 2QFIA 5K14A 4DR2F 4KYZA 1S0VA 3LWLA 3QO9B 4MKYA 2ZOFA 4H4OB 3NG8A 2K1RB 5SUHA 1S1WB 3TQEA 4JI3F 2X3DA 1MW7A 1WG5A 3PO4A 3U1NA 2VODA 2NYIA 3CJQA 3MTKA 4ZVGA 2DNNA 4D3HA 1RCXB 4DOZA 4GKKF 3D9BA 3E01A 4WWSA 5FDLB 5FD1A 5A2QY 3L3CA 2RKIB 3BGLA 2CFXA 1A9NB 1LW0B 2Y1RI 4HT5A 4MYUA 4RZRA 4DR5F 3HP6A 1VQ6S 3ADAC 2N7YA 3MD1A 3OL6A 3ZZ0A 1MROA 3AA8A 4M5IA 4DR1J 4BC9A 4B3TJ 4LFBF 5ETOA 1X4GA 2HFNA 5KFQA 5I3UB 6FDRA 2B4OA 3C3LA 3HFZB 4K5SA 3SFGA 4C2MA 2XMAA 1RAJA 1RLDA 2ZH5A 4X4VA 4HI1A 4HACA 1GT8A 2PFDA 2XMMA 3RG6A 1SH2A 3DOKB 1JX4A 4NXNJ 1EP4B 3PFOA 3T5KA 1DZ5A 3UNYA 3KNGA 1FERA 2MYFA 5B0AA 1F9HA 3M4XA 4KH0B 4F7VA 4OI3A 3CCRS 4DFMA 2RUSA 1AYEA 4M5HA 2DNYA 1TVRB 1U02A 2IPOB 2P9GA 5JMNA 3HVRA 3HD1A 4DR7F 2HEKA 2YQ3A 1RWMB 1TK8A 2BEFA 3HHEA 1H98A 5F9LA 1YJ9S 1S9FA 4OJ3A 3R5DA 3DI6A 4WFBQ 2RUGA 4F36A 1NJXA 1CC8A 3HHLB 4ALZA 1U6FA 1BQMA 2IM2A 1JJHA 3RGIA 4J9NA 3MM6A 1SL1A 5LSRA 1K9MT 3BGFA 3A12A 2HK2A 4FN5A 5AXNA 2MLYA 1U1QA 2E9ZA 2AYBA 4XAKA 3R7BB 2KDOA 2AZ3A 1LQ9A 5GVQA 4FS1A 4IO1A 2CKWA 1KFSA 4I6YA 4EO6A 1R8HA 3OVSA 3J7Z5 1RU2A 4CLLA 1UA1A 5DGBA 2XMJA 1T7PA 3CCES 1RWWB 2F40A 1RHJB 3CCWA 3AD8C 3BYPA 3MGJA 3PCOB 5F0WA 1VJWA 3W2WB 4BBYA 1SC3B 2BABA 1YZ6A 5D3GB 1SPBP 4X2BA 1U1MA 1EB0A 1C1CB 5BXIA 4YDXA 1RAHB 3M6XA 2QLBB 5C24B 2CDRB 4B08A 2N7CA 4OLOA 1NPRA 5ITHA 3Q86A 4YR2A 4HTJA 3TOQA 2F63A 3MEKA 2EFOA 4USWA 1REVA 1URRA 1ZZNA 1U1NA 2IMWP 5MLCV 4DQQA 2HNDB 3NGUA 1XNQJ 1KQKA 4U6PA 2HPUA 1RTJB 3M8RA 4LVNP 4WU2A 4LF1A 4F3MA 4QR2A 4Y3CA 4IG0B 2HNDA 1JLFB 3LQVA 1HPZB 1D9FA 3WZ0A 1VRTA 2DR9A 1K44A 1ROFA 3K17A 4HHUA 4O44B 5KFXA 1RADB 4KKOA 3CCLS 4ZVFA 1J5OB 2CRLA 2D3OR 2RQ4A 1CJKA 5BR8F 2V8GA 2FQQB 5E3QA 2LP4A 1N8RT 3J81Y 3VTIA 4PABA 3SSRA 1L3SA 4LBIA 3T1AA 3OSPA 3AD7C 1IN0A 1H2UX 4JI4F 4NLOA 4OI4A 3MM5B 2BOAA 3NS5A 2R7WA 2JEFA 2R8JA 4B3MF 4EYHB 3LA0A 3JSMB 4V19X 2NPFA 3UQSA 4P10A 2V69A 2OSRA 5I3QA 3I4PA 3H40A 3T5HA 3GJRB 2E5HA 1V3RA 2OPQB 3QIPA 4ZVQB 1S4FA 1XWLA 4C8OA 4UF4A 1NSQA 1T3NA 2J9EA 2JNJA 2EFQA 3KG0A 4RBUA 2ZE2B 4JI8F 1PSDA 3FQKA 3N0VA 4LBPA 4ZJLA 5T14A 1I51B 1UEUA 3TO8A 1F5CA 4DL2A 2V4JB 3NNCA 1U26A 1KOOA 1WF0A 2MGZB 3QRQA 3LPYA 2AGQA 3ITHA 4UUXA 5RUBA 1P27B 3QPIA 3M30A 3UD4P 4DV4F 1PC5A 1F9EB 3DRSB 4X62J 1RGVA 5KFEA 1RHKB 3W62A 4EUVA 3FUYA 1HWIA 2ZH8A 4NLDA 1HI1A 4CO4A 4KRWA 3LW5C 3QFWA 4C11A 4ED3A 3PACA 4JI5F 3IBWA 3DMJB 3MM5A 3J7YI 4DV4J 4ZPWR 1WEYA 2IHR1 2A6OA 1S0OA 2J6TA 4RNNA 5LMUF 4JI7J 2VJUA 1FTCA 4K4ZA 2YX7A 2DHXA 3TAQA 4IFYA 2H5EA 4DS5A 3VVTA 4U96A 3SQOP 3DGVA 5L9XA 2DNPA 1FRHA 4LSNB 2J0WA 4PAAA 4F04B 3RRKA 4P73A 2W2OP 3HSJA 3T1HJ 3HHLC 3PR5B 1RYSA 5AXLA 4WBFA 4O4RA 5D78A 3PV8A 3HSZA 4R8UA 1QE1B 3I31A 4ZPVR 3GV8B 2KJWA 3OR1B 3QSIA 2OPPB 3ETMA 4MK9A 3BV8A 5BYSA 4PXEA 1FJ7A 2YX4A 2X1GA 4ZCKA 5M2RA 2IDEA 2AD9A 1AFIA 4CT9A 3QT8A 4B9VA 4OYAA 2LKZA 2NUUG 5HAOA 2JVRA 1DLOA 2KJVA 3GSDA 2D9OA 4LR7A 4FKYA 2VPYB 3VZHA 2EG1A 3D0GE 2GS8A 2HNZA 4XDDA 4JI5J 2H5IB 1EX8A 2CPFA 2HFZA 1RCOB 2H3EB 1BQNB 1S49A 1BE4A 3GCWP 3TX8A 2E5LF 3TUJC 2QTWA 2V9KA 3VCDA 3KK3A 1C1CA 2DNZA 2C2RA 2WBMA 4CWBA 3BDPA 3OJSA 1F0XA 4EWTA 3TNVA 3PYDA 1RQ0A 3EWGA 4TU8A 2QGFB 4OX9F 5KFNA 2DR7A 3B4DA 4CH0S 3GFXA 3POTA 5HVGA 2WBRA 3D0IE 5T41A 2ZWPA 3IXQA 3BSOA 5E3RA 2G2ZA 3BGOP 3EXCX 2HLTA 3LGNA 5FLXY 1NSKL 1NDLA 2B4UA 4QIWD 5KFUA 2CZVC 3H20A 4OYMA 5EX3A 1X4BA 2GIFA 2GGPB 2RS8A 4J91A 1RT5B 2K3IA 3SCJE 2QEXS 2JRSA 1XERA 1C4CA 4NE9C 5E0OA 1XMOJ 3TUZC 4Z37A 2BE7D 5H9EJ 2ZZNA 1C1BA 1ZAVA 4P7VA 4W90B 1AXQA 2KB2A 2DB1A 2QA1A 2UV8G 5F8GA 2AQ4A 2XMUA 3OHAA 2FJWA 1RWOB 2AIRB 4M5GA 3KLFA 3ITHB 4HH1A 3QJPA 4MK8A 4NLRA 1M5SA 1QDUB 2OSQA 4NX9A 2VICA 2W9CA 4K2JA 3QWPA 3M8WA 1S1WA 1TMMA 3I32A 3O3LA 4I6WA 4W98A 4DF8A 2QA4G 5L1KA 2OGUA 4UQGA 2XS7A 5HMWA 3DOLB 2GO9A 5ETMA 4CH7A 1VQKS 5EGYA 1UVNA 5D8HB 1CJTA 2AJ2A 5EWGA 4B3OA 3CO9A 5J2PB 2HVHA 2FPHX 2J5AA 2Z30B 2ZE2A 3ETOA 3NOCA 2WW4A 2PI4A 4RNFA 1RT7A 4C98A 1VQ5S 3PO5A 3HM9A 1LNQA 2VD3A 4ED4A 4B3OB 1B7FA 1W2BR 3VAIA 1GQEA 1JKHB 4A8YA 4KB7A 2BYCA 1VQ4S 2XZTB 4LRCA 4J9LA 3TANA 1QVFR 1RTDB 2LVWA 3B8HA 1IKWA 2H5JB 4OV1A 3S6EA 3LPEA 3R5CA 3MOJB 1U47A 3BKTA 1V3SA 4H4KA 4U7UD 2CADA 1WDTA 1RT6B 1TL1B 2B7BB 4LMZA 2R8GA 1QSSA 2GAHC 1VRUA 4F3QA 1R8CA 1FWPA 1Q0NA
chains in the Genus database with same CATH topology
1H0HB 1V6HA 3RRGA 2FD2A 1C0UB 4EFAC 1VQYA 2HNZB 5KT2A 3K5PA 3QYYA 2YKMB 1HARA 2UV8A 2M2BA 2IM3A 4PKDB 4J9MA 5J2MA 2KT5A 1WEXA 5KFBA 2I38A 4IG0A 2ZH7A 1JLAA 4X4NA 1HWJA 2MQOA 3MM8B 3OSNA 2DVIA 3W2VB 4R8UB 2M4MA 2WTFA 3UCUP 4QCLA 5KFOA 4ZP9A 2W4CA 4HHJA 2ROGA 1HI8A 4IH5A 3POTB 3HI9A 5E3AA 4C3LA 1HBOA 2VFUA 1KLMB 1F60B 1NZAA 3ZZTA 2HQIA 1K8AT 4ERDA 4PPDA 5D3GA 4QWAA 4RBTA 3G6ES 3JYTA 3MECA 2UP1A 3RR8A 2GX8A 1HW8A 2JC0A 4IH7A 4NZ6A 1APSA 3H4DA 4WYLA 1HHTP 2RF2B 3DLBA 5B08A 2AJ4A 2DISA 2ASJA 2AYGA 3HZEA 1IQZA 3F73A 2FB0A 4TY9A 4IG3A 1GTHA 5C25A 3M6UA 1NNDA 4I4BA 2JLEA 2FHKA 1DRZA 4Z2XA 3DRPA 3MMCA 2KU7A 3IO1A 2B4VA 3CF5Q 1U1PA 1JLCB 3IWXA 4ZP6A 2QE5A 1ZAXA 1NEEA 2ZHAA 5CCMA 2Q79A 2X3GA 4ID5B 4NZ0A 1UA0A 2FJAB 4RW7B 4DN0A 3I0SB 4HYKA 2POKA 1OSCA 3L7OA 3CE8A 4X84A 3CIMA 4DLEA 4FF3A 3NCQA 1S72S 4BDPA 5CHCB 2ZH3A 1DTTA 1WG1A 1N5VA 4HVZA 3I55S 3CD5A 1N0VC 2HLUA 4ETXA 4OQJA 4GC7A 4ED0A 4FXWA 1HWKA 4N47A 2EK1A 1YITS 1YI2S 3R1HA 1LFWA 2XLIA 4OZ5A 1HPZA 3R5BA 4HDGA 1JLFA 2PIIA 1R8BA 2V0NA 1Q8BA 3O1LA 2HWHA 3N9UC 1TKZA 2C2DA 4K4YA 4CNZA 1Y5NB 5D4NA 4A46A 4XDCA 2XNQA 1UP1A 2SXLA 1UVLA 4OMFG 4QR0A 3IAM9 4DN9A 1BLUA 1C1BB 3QAUA 1DFDA 1Q81T 4K4SA 2I2YA 4Y65A 2XI3A 2XMVA 3KLVA 2YNHA 3MPVA 4G1QB 4RWXA 4WCEQ 1YJ9S 5B0BA 3I0RB 3OUYA 1M0SA 4B17A 4ZK7M 2XCAA 1AUDA 4K5RA 2LA6A 3OTOF 2DPIA 2PI5A 1FD8A 1KLMA 2PFFB 2GC8A 5LJ3Y 5CXTA 1EETA 4LSNA 4PG5A 5J1PA 3CWJA 3VQSA 3HVAA 4C3MA 3F44A 5IFMA 4DWIA 4J9QA 4WKRA 1F5AA 4OI0A 1QLNA 3FSXA 1FHTA 2CJAA 1CSJA 3TP2A 3JSRA 3BREA 4DG1B 1TP7A 1FVQA 3M32B 2B5JB 4NLXA 1J2VA 4QIGA 1UJ4A 3GIKA 4K4TA 4A8OA 2WAQD 2XLKA 2B7CB 4N5SA 4K4UA 1X9SA 3MAQA 2BM1A 2M88A 2OMOA 4I56A 2IJFA 1KN6A 4BWMA 3Q8PB 1WI6A 4CNYA 1VK8A 3CJ5A 5CYMA 4GC6A 1HNVA 3MM9A 4IR9A 4E8UA 1X5PA 1EP4A 4Q2MA 1U48A 3CMES 2GMHA 1RJJA 4A8QA 4OJHA 5G0RB 2AYMA 5C42A 1XC9A 4N77A 1R89A 2R7QA 2AP6A 3OTEA 1ZBTA 4Y2AA 5DQHA 2RD5C 2M7SA 3VZIA 1M5PC 3V2UC 1L3VA 3I5CA 4DV2F 5DQIA 3IA0A 2C42A 4K4VA 1IKXB 1R7IA 3TVKA 1MWZA 2MKJA 3M1VA 3H59A 3OXLA 3S01A 4YQWA 1N5QA 5A0YB 3PW2A 5HN0A 2MB0B 4JI6F 2XB2D 5L1JA 2BACA 3ULHA 2WSEC 3DRPB 1R3NA 2WB1D 2E1AA 3DRXA 2PA3A 4OLPA 1RWUA 4EEYA 1NK7A 1TFYA 3U27A 3CDEA 1DQ8A 4O0IA 3BN4A 1D3WA 5KFKA 4RUCA 5DQGA 5KT5A 1OQ6A 3KK2B 2CVEA 2RMLA 2VC0A 5F8LA 1L3UA 3RYLA 4DFKA 2E5GA 1WG4A 3BQ1A 1B64A 2BUNA 4NRTA 3X3UA 2E1CA 1KQGB 2G1DA 2RKIA 5DG8A 3NMRA 1QAIA 2VFRA 4DR6F 1TAQA 1M5KC 4JI2F 1FNMA 4JBCA 5L39A 2L41A 5IM0A 4DL6A 3QO9A 3SSQA 5DLGA 3R1LA 1ZM4A 5IS2A 5H1SV 3CTRA 2RQCA 2YNGB 4ECSA 1T94A 1U6ZA 2BANB 4JV1A 2IBOA 3I4HX 3VQTA 3FJ2A 1JJ2R 2LQ5A 3I87A 3PRBA 2W7OA 1UKUA 4ECQA 2ZHOA 3OV7A 5F0UA 4X4UA 1Q16B 1JLEA 1SH3A 3MR3A 1XMBA 5LXRA 2Q6CA 1CEZA 1QVGR 2UVWA 1D0EA 3HO1A 2DNOA 3KYLA 2OAUA 3CD7A 2C3UA 2IBKA 2FHJA 5DJBA 3US5A 2CQ4A 1S0NA 2ZBIA 1ZYQA 3OXFA 3BO2A 2AJ1A 2DHSA 4X66F 3M1VB 4M1KA 1U09A 1HYSB 1NKBA 1WNEA 3GB0A 3P49B 4DQRA 4RWWA 3AY0A 1DJ0A 4NYZA 2VBXA 3ZFVA 4MKBA 3SFUA 3CCMS 2BE2B 4K4WA 4EYIB 3M8SA 3VALA 2ACYA 1Y5LB 4GO5X 2DGUA 2MQNA 5LT5A 1S6OA 2X1FA 3IWNC 5MAOA 4JI7F 3IG1A 5D4PA 1S1TB 4NCBA 1H2TZ 2ZH1A 3V6HA 2CZ4A 3BB5A 4YEAA 2DRBA 2CVIA 1S79A 3N6MA 4OI1A 2FIUA 1VC5A 5JVHQ 4U7CA 2BJEA 2OPRA 2FLOA 2Y1IA 3G4SS 3V81A 2GIRA 1YRUA 1FKAF 1FKOB 4CTAA 4DL3A 5GADI 3DLGB 4Q8FA 3MR2A 1Q7LB 3PM9A 5DDOC 5IT9Y 2FLPA 2W9BA 4YMEA 4ED2A 2ZJQQ 3OVAA 4NA1A 5K8OA 5B0EA 2UVUA 1N6QB 1OIAA 4ED6A 2AGOA 4CO3A 4MIAA 4ECUA 4A8KA 2MZSA 4DFJA 1ELOA 2R7TA 4DPOA 2IA6A 4W92B 1E6YB 1WTFA 2QLXA 2K1RA 4RU2A 4RW8B 2E9RX 1S1XB 4Y00A 4K0KF 2RDJA 2CQHA 4I2QB 3D2WA 1G7CB 1HFEL 3AB2B 1X5OA 2ROPA 2YWFA 3WC0A 1S1VA 3QIDA 2YKNB 2YWEA 5HROB 3EGWB 2MKCA 1OO0B 1NH7A 2JDJA 4MIWA 3HPOA 1NHVA 3NAIA 3GV7B 2OPPA 4I2QA 4Q0BA 5B0DA 1KONA 3I9ZA 3UCZP 1NK4A 2W7PA 1T05A 3UNGC 4ZPAA 2B56A 4KHMA 4LQ9A 4USHA 5IQ6A 1HNXF 2ADCA 3IGVA 1SQEA 2CQ3A 5DGAA 4QW8A 4BCAA 3OHBA 2VBYA 3KLIA 1LWEB 1N34F 4M5DA 2YNFA 4TY8A 2HHQA 4DSJA 3JTNA 3FDSA 1BD6A 2UUCF 2Y1JA 2RNEA 4FNIA 4XIUA 1TL4A 3CXCR 2HG4A 3CB4A 3PX4A 1SKSA 3CDUA 3DM2A 3T3FA 4PUOA 2E7WA 3SQGB 3Q23A 4J9KA 4O4GA 4I1TA 1YG0A 2A10A 3LP0A 2MZ1A 3Q0AA 1Y3JA 3BGRA 3T9ZA 3ENQA 4M63A 3KHGA 1YQHA 1P1TA 4F4ZA 1E6VB 1M5HA 4A8WA 4NLUA 2FJVA 1SJ1A 4EU0A 5EWEA 4RW9A 3MEGA 4YHHF 4IG3B 3UDCA 5F9NA 4DBQA 3DLHA 1LWCA 3C8YA 1HBUA 4WXOA 4X4OA 5KT4A 2B9XA 4PRFA 1T95A 2I5JB 2K8GA 3I82A 3LP0B 2OPQA 2RQMA 4E0DA 1XNQF 1FE0A 3T1YF 3IWLA 5GADU 1OQ3A 4I7FA 2LEPA 1UJ5A 2K7JA 5J2NA 3MUMP 2GHWA 1KR4A 2ASYA 2R8KA 3K2YA 2QSWA 3DLLQ 2VG7B 5EN1A 2QLWA 2NXUA 2B9YA 1S10A 1BY9A 2HRYA 2AYEA 2ZC3A 4C0OC 3C46A 3DHWC 2LYVA 1UL3A 1VK3A 2R4FA 2KVIA 3S8SA 4CIOA 2B43A 4DL4A 3GQCA 4O3RA 3UI3A 3T9NA 3MPWA 2BVZA 4PQAA 1NO8A 4B9LA 7FDRA 3PNIA 2CQ0A 1WWHA 2AX1A 5KFFA 4ES1A 4DSIA 2A2DA 3BM7A 1WHYA 3M6WA 3LO3A 5CCLA 1CLFA 2CQCA 3PW0A 4FF1A 2IYGA 3V5RA 2FY1A 3CD6S 2Q6BA 3D1HA 3KNAA 3CCJS 3TVYA 1H38A 2PC6A 3SV4A 2CJQA 4Y2CA 3JB9k 2M3DA 4QU7A 2MSSA 4R5PB 2HIQA 3TYTA 2GMJA 2ZH6A 3OBIA 1JLQA 2VG5A 5GAHU 3QMQA 3HT3A 3BO3A 2NPIA 3BDEA 2ZM6F 4M94A 2HW3A 3OJUA 3HKZD 2VFVA 3PFEA 5IZHA 3C66A 4ZMMA 1RT1A 4LF8F 1T03B 2VKRA 1YBAA 4IOBA 4DR3F 2WRMA 3TUIC 3OFFA 4NWBA 3IRXA 2XWYA 2LQ9A 3KKFA 4C7QA 1D8YA 2XULA 1A7GE 3DN9A 1N54B 2CQ1A 1HNZF 4IOAQ 2KFNA 4N41A 4U67Q 1HBNB 4DR1F 4DQIA 2R8HA 4Y2MA 3KFWX 2KKHA 3BSAA 1HNIA 2Z2MA 1FXRA 3NS6A 4Q43A 1N36F 2W24A 1FDDA 3GWCA 4AL5A 1OWXA 4GO7X 2RDIA 1S6PA 2WOMA 4YB6A 5HP1A 4KBIA 3PW7A 3E51A 4CO5A 5HBMA 4ZHRA 2A3JA 3K58A 4L6V3 1SKRA 1P6TA 3LALA 2O67A 4ZPBA 1H7WA 1K0VA 3N4WA 2LA4A 1S9EB 4FNHA 3QGPA 3N28A 2U1AA 1NJIT 2RF2A 4H54A 1HNIB 3BSCA 3DRRA 5AJ3F 2COLA 2JEJA 3DLKB 1S97A 4ED5A 1RT1B 1Q8IA 4AFFA 4Y0FA 4PQUA 1VBZA 5KTQA 1NKCA 1UAWA 2JOQA 4TY8B 3W3SA 4PG4A 3BR9A 1FT8A 2CQBA 1Y3KA 4Q0BB 3K5NA 1UJ6A 3I6PA 1FKPB 2RH3A 3N01A 3UR0A 3M2RA 3KLEB 3H5XA 2ZC4A 4I68A 3GE9A 1LWFB 4H4OA 2WOMB 1NJZA 1MMLA 1IKVB 3G6VA 2FUG9 2ERRA 3OUYB 5KG1A 3BS9A 3FSIA 4RLEA 2XLJA 4O3OA 1Y0HA 3MHYA 3D1OA 4DUZF 2IRUA 1VQSA 4TQRA 3EX7B 1HQEB 1VQ7S 2GMLA 3PX6A 3F41A 4EBEA 3VWSA 3CULA 1FRLA 3JAMY 2L9WA 2C3YA 3DDKA 4LJMA 1UW4A 4PCQA 3OW2R 3V6DB 1TL1A 1OPIA 1VS3A 4DL0C 2HGNA 3MUTP 4Q44A 1IUJA 5A6PA 2HVIA 4ILRA 4EGLA 4EO8A 3P3DA 2VL1A 5KT7A 3V6DA 1GTEA 1X8DA 1KD1T 5I3PA 3EXYA 4ITSA 1DBDA 2IM1A 3CEDA 4USIA 4DSLA 2M9KA 4YB1P 2M8DB 1HNWF 1HQEA 1VQPS 2XCPA 4LFAF 2J9CA 1ZPWX 4RUAA 2B6AB 5HO4A 4PWDA 2IC3A 1GX5A 3RW7A 2FJEB 2XZWA 3GIMA 3EZ5A 2MY8A 5KFDA 1UVKA 3FVYA 3CCTA 2XSJA 3D0HE 3FZ2A 5KFMA 4F2RA 3TA0A 4DR4F 1T3OA 1QJHA 2YKPA 2NREA 3KK2A 5ADZA 2KHCA 3LAMA 4QWDA 1LWFA 5AXKA 1HBUB 2HYIB 4WZMA 2WCXA 3RBEA 2V4JA 1MMDA 3V6KA 4TXSA 5J2QB 2IJNA 2WSCC 3RBDA 5A6WA 1V9OA 1SIZA 3KK1A 4NYPA 2HQ3A 3K5MA 1JXEA 4IYQA 2DRAA 2XO7A 5A8RA 4LQ3A 2AF6A 3FSYA 3CSKA 1RTIB 4A48A 4DG1A 3DRRB 5IXUA 2IVFB 2DPJA 3NMAA 2HAIA 4QYZJ 1X4CA 2I9SA 3NL0A 2J6SA 5HLFA 4OX6A 1LWEA 2EPIA 3FQLA 3MM9B 4J9SA 4DV0F 3E2EA 2IRXA 1X0FA 3OQ2A 3EYZA 4FZVA 2ILZA 5G0RA 4WK1A 2CPIA 5C42B 4O44A 4O23A 3MMAA 2R2SA 3OTDA 1B0PA 1B0VA 1S7HA 2FVCA 3HHLD 2LXUA 4HDHA 5U47A 4CO2A 5HI7A 4IO9Q 4ED8A 4KIAA 4YP3A 2K3KA 3PR4A 1M5OC 1SI9A 4F4KA 4PUOB 1NB7A 2Q1LA 3D1QA 3ICLA 2MXYA 2VOPA 5DM6Q 1TQLA 1S1VB 2KRBA 4AUKA 5SZTA 3QLHA 2B0GA 4K50A 3H5SA 3KLIB 4QWBA 3G8QA 1R0AB 3TA2A 3MD3A 2EFPA 3EUNA 3M32A 3HHDA 4NCGB 2OH2A 2VBZA 1ZOTA 2RRBA 2ZDPA 3VAHA 4O3PA 4QJVA 2Q66A 4AXIA 1ULRA 4IKAA 3GILA 1Q79A 2D9PA 3CUNA 4QYRA 3MFHA 2CJBA 1N6QA 1CC7A 5LJ5Y 3QWUA 1S48A 3MM7A 1TFWA 3KJVA 2O3DA 4TKTA 3THVA 1HBMB 5DM7Q 1SL2A 3DLGA 3VF0B 2LECA 1WHVA 3TQ1A 2E66A 3M8PA 4WF9Q 4R0EA 1HL6A 2FJBB 2ILYA 3MZIA 3AA9A 4TYAA 5H9FJ 2DGOA 2DNMA 1XBWA 2JSXA 3SEOA 4UUWA 3W2VA 2R8IA 3RB3A 1DURA 2UUTA 3N5BA 3NNHA 2ZDOA 2XMTA 3UWTA 1TL5A 2ZOGA 3UPFA 1XTZA 2D3UA 1SIWB 2E9TA 2G13A 1GX6A 1UWBA 1M1KT 4OZLA 4OX7A 3K5OA 1D8ZA 1TKZB 2LMIA 4OX8A 1UMJA 1FESA 4G1IA 3FNNA 3H25A 1YSJA 1Q4RA 3IG1B 1VOMA 1JJ4A 4G3IA 3GYXB 1Y00A 2Z2LA 2F9DA 4WFAQ 3OVBA 5L38A 1SJRA 2RU3A 1WD6A 3MPYA 2APOA 4A8FA 3CDWA 4NLQA 4JYAF 3QZ8A 2RRAA 3WBZA 2CG4A 3MDFA