1S1UB

Crystal structure of l100i mutant hiv-1 reverse transcriptase in complex with nevirapine
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
424
structure length
401
Chain Sequence
b'IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWHPAGIKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase
publication title Crystal structures of HIV-1 reverse transcriptases mutated at codons 100, 106 and 108 and mechanisms of resistance to non-nucleoside inhibitors
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 113
structure length 401
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1s1uB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1uB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1uB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1uB03
4TYAA 5J2QA 4NLUA 4DL7A 2R8GA 3PHEA 4DEZA 1IKYA 2XCPA 1S6QA 5DG8A 5HLFA 3JYTA 3D28A 1BQNB 1JKHB 4I2QB 1RT7A 3LP1A 1S1WB 4O3PA 3H5YA 4EYIB 2ILYA 1QAJA 2FVQA 1QE1B 4KBIA 5KFGA 1TV6B 2ZKUA 4RW4A 5HBMA 3G86A 2W9AA 4YR2A 3KLGB 4ZPAA 4ED7A 2ASJA 1T03A 2R8IA 1RT6A 3T5JA 2IC3B 2BRKA 4ZPBA 1S1VB 1RAJA 3ITHA 4I7FA 4RNFA 5L1IA 4IRKA 1TVRB 2HAIA 5KG4A 5EWFA 1T05B 4K50A 2HNZB 3FDSA 3TAMB 2YNFB 1HARA 4K4SA 3OL7A 5F8IA 4PQUB 3HVAA 4NLYA 2VG5A 1TL1A 4PWDA 3QGIA 4NLXA 5C24B 4EO6A 3KK1B 3DYAA 3GV5B 3RBEA 3IS9A 3HVTB 5J2MA 4EO8A 5J2PB 3HKWA 1JLQB 4J9OA 1TP7A 3IN5A 1DTQB 1RA7A 4KO0B 1HNVA 3DLGB 5KFNA 2W8LA 2C22A 3KLHA 1RA6A 4NZ0A 3T5LA 3H4DA 4RW7A 4URSA 4Q43A 1IKWA 1I6JA 2D3UA 4NRUA 4YP3A 4WZQA 1UWBA 1QAIA 5KG0A 3MF5A 4ZP8A 3GV7B 1SUQB 5L1JA 3DLEB 4TLRA 3V81B 4O44A 5EUHA 4RNOA 3BJYA 2FVCA 2IM1A 4Q44A 1N48A 2FVSA 2UVVA 4TY9A 1C0TA 4IG0A 4WE1A 3IRXA 2UVUA 3KHGA 2C2EA 1DTTB 3UDLA 4ZMMA 4YMEA 4IQXA 2F8EX 4JV0A 2XGQA 2FLLA 3DRRB 3JSMA 1Z4UA 4NCGB 3NBPA 5KFHA 2JEFA 3I0RA 1S1UB 4PUOB 3DI6B 2FJWA 1BQNA 1JKHA 1XR6A 5F8GA 4K4XA 3KLIA 2XI3A 4R8UB 3T5KA 2UUWA 4NLQA 3PW0A 4ZVEA 3TQ1A 1RTHB 3PW2A 2IC3A 4FS1A 1S9FA 2WTFA 2I5JA 2YNIB 1TVRA 5KFDA 4LSLB 5KFCA 3GIMA 5F8LA 3QLHB 4M95A 3KJVB 4MIAA 2FLNA 2ZE2A 3KK1A 5EWEA 5KFAA 4IH7A 2YNHB 5J2PA 3OSNA 3RAXA 1HQUA 3QO9A 3MR5A 1DTQA 4RZRA 4QW9A 4ED6A 4Q8EA 4LQ3A 4R0EA 5DQIA 4ID5B 4WFZA 2IAJB 3DRSB 5CYQB 3FRZA 2AX1A 4MKBA 2IA6A 2WCXA 5KFJA 5C5JA 1VRUB 1BQMB 2YNGA 1S6PA 1YVFA 4NLVA 5KFTA 5KG6A 3BSOA 4M94A 3DLEA 2AGOA 3V81A 3BGRB 4IKAA 4ECQA 4ZPCA 1GX5A 2GIQA 2J6TA 1RT4A 1KLMB 3CJ3A 2W8KA 4J9KA 3I0SB 4R5PA 2E9RX 1DTTA 1S97A 3CDUA 2OPRA 5KFZA 3NL0A 4RUAA 1C1BB 3D5MA 4QWAA 1S1UA 3BR9A 2IM0A 3FFIA 1ZTTA 1TKTA 4RW9B 2BRLA 5I3UA 4KAIA 4KKOA 3HHKA 3CIZA 4KHMA 5KFPA 1T3NA 1S49A 4H4MA 4NRTA 3C6TB 4DL3A 3KK2B 3RB4A 1IKVB 5KG3A 4ZVHA 3Q8RB 3T19A 3M9MB 4QW8A 1D1UA 4FBTA 3QLHA 2ATLA 1XR5A 4ICLB 1LWCA 1TQLA 2FJVA 4IRCA 1JLFB 1WNEA 5DG7A 1VRTA 2YNHA 4IOBA 1SV5B 5F8MA 5L1KA 4GC7A 3V6DB 3MEGB 4LSNA 1RTIB 1S1XB 1JIHA 1HQEB 3BSCA 5KFYA 4ID5A 3IG1B 2IAJA 3LAKA 1C1CA 3DRSA 1JLEA 5CYQA 3V4IA 1D0EA 4ZP7A 4K4VA 4TYBA 1REVB 2E9ZA 1VRUA 2HWIA 3KLFB 1HPZB 4Y2AA 4URQU 4ECZA 2J6SA 5L1LA 1R0AB 5KT3A 5HROA 1GX6A 3M9OB 1FK9A 4F4WA 1S9GB 3I0SA 1J5OA 2FVRA 2RF2B 3H40A 5FDLB 2W7OA 1N56A 2HNYB 2WHOA 1TL3A 2ZD1B 4XPEA 3DOKB 3RBDA 3N6LA 4HYKA 2GIRA 1JXLA 4EBDA 4IFVA 2W9CA 5KG1A 1RTDB 1XR7A 4ED8A 1C2PA 3NKYA 3KK2A 3DM2B 4H54A 1IKVA 4K4UA 3T5HA 3GYNA 4MFBA 4Y34A 3MEEB 5KG7A 5KT5A 3PW5A 4F4YA 4ZHRB 2R2UA 5I42A 3MECA 5DQGA 4RW8B 5JXSA 3M8PB 2IJNA 1TKXA 2WOMA 2WK4A 3SI8A 3TVKA 3DLKB 5F9LA 1JLFA 4RNNA 1JLCA 1MU2B 1U09A 5KFVA 4QWEA 1SV5A 4NLSA 4U6PA 3MEDB 5K14A 5J1EB 4KV8B 1IKXA 3OHAA 3MR6A 3MEGA 5CYMA 1S1XA 4Q0BA 2HWHA 3H5UA 5D3GB 2B5JB 4QPXA 1N6QA 2UUTA 4ED1A 1HQEA 4IFYB 2ASDA 3IG1A 3EPIA 4ED2A 1S9EA 1ZETA 3ISNC 3M9NB 2JEGA 1SH2A 4F4ZA 3G6YA 4RU9A 2UVRA 4J9NA 3LP0B 4I2QA 5DLFA 4O3QA 2YKMB 3PW4A 1S1WA 4KSEB 1QE1A 4G1QB 2CKWA 5KFWA 3BQ1A 1TV6A 4J9PA 3GQCA 1FKOB 5DLGA 3KLGA 3KK3B 1HYSB 3H5SA 1JLBB 1EETB 1NHUA 3NAIA 2I1RA 3Q8PB 3BSNA 4K4WA 3NMAA 1HNIB 1S1VA 3KLVA 3KMSA 2BANB 1N5YB 2IMWP 5FDLA 2HMIB 1T05A 2HNYA 2HNZA 3TAMA 2YNFA 5KFOA 4Q8FA 2FLPA 1S0OA 4H4OB 3M8QB 4PQUA 3BREA 2R8KA 2WB4A 4J9RA 5C24A 4IR1A 2V9WA 4O4RA 2EC0A 2DPIA 3IGVA 1RT5B 4QWDA 2JEIA 3HVTA 2OPSB 1RTDA 4QWBA 3SFGA 3LAMA 3MR2A 1JLQA 2OPPB 3RAQA 3DMJB 4NLPA 4KO0A 3DLGA 4DL4A 1RT1B 4DL6A 2DPJA 3MEEA 4LQ9A 4MK8A 4O3OA 3OL6A 3LP2B 3KNAA 3LALA 3M8PA 4RUCA 3DOLB 5F8HA 4TXSA 4F4XA 1ZTWA 4WFYA 3DLKA 4U7CA 4WXOA 4IG3B 3EZUA 1SUQA 1T94A 4ZP6A 2HNDB 2B6AB 1LW2B 1S4FA 2W7PA 4F50A 2VG7B 4EBCA 1RT2B 4O4GB 2WONB 1S1TB 5D3GA 4J9SA 1CSJA 2WRMA 1LWEB 3GIIA 4IR9A 4WYLA 1JX4A 5C25B 3G6XA 5JUMA 4ZP9A 1JLGB 1RYRA 4K4ZA 3NGDA 3E51A 4MKAA 3DRRA 4NCGA 5DGBA 4PUOA 2D7SA 3DI6A 1RDRA 2IBKA 4ZVFA 5EWGA 2R2SA 2JC0A 3OL8A 1JLAB 4R8UA 1IKYB 3KK3A 1S6QB 3V6HA 1JLBA 1RTHA 3JYTB 3OSPA 4J9LA 3LP1B 2AWZA 2R8HA 1HNIA 1MMLA 3UQSA 3KHRA 3V6JA 3OL9A 1N5YA 2YNIA 4NLTA 4DL5A 4JV2A 4LSLA 2XWYA 5HBMB 2E9TA 3Q8SB 1EP4B 3M8QA 3KJVA 5KFUA 1FKPB 2FJXA 4I7FB 1RT5A 4RNHA 4ECYA 4KHRA 1RT3B 4IRDA 2VG5B 1TL1B 3C6UB 4EEYA 4KE5A 2W9BB 5KFKA 4ECVA 2JLEA 4NLWA 3IS9B 5EDWA 3KMQA 5J2MB 2GC8A 4K4TA 4O3SA 2VA3A 2RKIB 3LP2A 4NLGA 3OLAA 3KHHA 1HNVB 5KFEA 1N4LA 3H59A 4ECWA 5KFQA 1BQMA 4DG1B 4NLDA 4KB7A 2V4QA 5C42B 3RB6A 1LW2A 3OHBA 3RB0A 2VG7A 3BGRA 2XC9A 3H4BA 3T1AA 1UWBB 4ED0A 5KG2A 4YR3A 2D41A 1KLMA 1LWEA 4IH5A 2RDJA 4O44B 3BQ0A 4MK7A 3E01B 1S0NA 3QIPB 3DDKA 2AQ4A 4IDKB 4WYWA 1C0TB 1C1BA 1HMVB 3IRXB 3VQSA 3EPGA 3CDWA 4RW9A 3PZPA 4O3NA 2BE2B 2R2RA 3CJ2A 1JLAA 1QUVA 4TN2A 3JSMB 4Y2CA 3NBPB 3I0RB 3C6TA 1LWFB 3QGHA 3Q8QB 3MFHA 1TKZB 2B43A 3KLIB 4JUZA 3GIJA 1RTJB 1K1QA 1EP4A 5KFSA 3ISND 4ICLA 3CJ4A 3LANA 3GV8B 1FKPA 2IM3A 2I5JB 3OLBA 4ECSA 4KFBB 1IM4A 4MIBA 5J2NB 1RT3A 3I5CA 2QE5A 5F8JA 3C6UA 1K1SA 4EBEA 3V6DA 1S10A 2W9BA 2ZE2B 1RTIA 3IGNA 5DG9A 3KHLA 4ZPDA 3N6MA 2C2DA 3KOAA 1HQUB 2RKIA 3QO9B 3QZ8A 5T14A 3HVWA 1C0UB 3PVXA 1REVA 2V0NA 1S0MA 3CJ5A 2XGPA 3FSIA 4DG1A 3KLFA 1HPZA 5C42A 3H98A 4URGA 4G3IA 1W25A 3QYYA 3ICLA 1R0AA 3GILA 2XCAA 4NLRA 2ALZA 5F9NA 4I2PB 4YR0A 4O3RA 1LW0B 4B3OB 2YNGB 1S6PB 4TQSA 3CJ0A 1S9GA 2R8JA 2IJFA 2VG6B 4NLOA 4MK9A 5KFRA 2RF2A 3E01A 2CJQA 3QIPA 5DGAA 3UR0A 4TY8B 3MR3A 4IDKA 2IM2A 3CDEA 3I5BA 2ZD1A 1RT4B 1HMVA 3DOKA 4R5PB 2D3ZA 3RB3A 1SH3A 4FS2A 3KLEB 2BE2A 2J6UA 2OPRB 2AU0A 4XPCA 3FFIB 1LWFA 1TKTB 3DM2A 2R2TA 5I3UB 1TKZA 4KKOB 4MH8A 5KT4A 5HP1B 4ZHRA 2OPQB 5L9XA 5KFBA 4H4MB 1RTJA 4RW8A 2ILZA 3CO9A 3CVKA 5KFFA 5KFXA 4JV1A 2FVPA 5KT2A 4ECTA 3NAHA 4TQRA 2YKNB 2XI2A 4KFBA 1S48A 4OL8A 4RNMA 5J2NA 1MU2A 2VA2A 3MEDA 5J1EA 4KV8A 4RW6B 1LWCB 3DRPB 3SFUA 2B5JA 3BQ2A 4IFYA 1VRTB 1DLOB 2C28A 4LSNB 1C0UA 3PR5B 4ECRA 2JC1A 4K4YA 5DQHA 4EYHB 2BR0A 2RDIA 5KFMA 3LP0A 4WXWA 1C1CB 1JLEB 2YKMA 3V4IB 1NHVA 5KFIA 3FQLA 5J2QB 5KFLA 4G1QA 4HKQA 4I2PA 3QIDA 1LW0A 4B3OA 4IH6A 1FKOA 1HYSA 5HLFB 1EETA 2AGQA 1RT7B 2VG6A 4ZVGA 4GC6A 5HROB 2BANA 1FK9B 2HMIA 4TY8A 4RW4B 2BQ3A 2C2RA 2BQUA 3V6KA 1T03B 4H4OA 4ECUA 1RT6B 3MFIA 3UPFA 1J5OB 3ITHB 2O5DA 3KLEA 1NNDA 1SH0A 2UVWA 2OPSA 1TL3B 1KHWA 2OPPA 4PWDB 3DMJA 3QGGA 3DYAB 1RT1A 5HP1A 4IFVB 4NYZA 2W9CB 3GIKA 2OPQA 4FBUA 3I5AA 2AX0A 3DOLA 4Q45A 4ECXA 1RYSA 2OH2A 2YKNA 4Y3CA 1OS5A 4MFBB 3KLHB 3CWJA 3H5XA 4IG3A 3MTKA 4RW7B 5KT7A 3N6NA 5I42B 3MECB 3G6VA 2HNDA 2B6AA 1IKWB 5KT6A 3PW7A 2AGPA 1TKXB 2WOMB 1RT2A 4O4GA 4RW6A 2ASLA 2WONA 3DRPA 4J9QA 1S1TA 2QV6A 4ED3A 2BQRA 4QWCA 3PR4A 1JLCB 2V4RA 1KHVA 1DLOA 4X2BA 4WZMA 5K14B 5C25A 5F8NA 1IKXB 5CYMB 4Q0BB 1JLGA 3BSAA 4DL2A 3H2LA 4YQWA 1N6QB 2JEJA 4IG0B 4WE1B 4WFXA 3PJWA 5KG5A 3FQKA 1S9EB 3QZ7A 3PJXA 4XO0A 4J9MA
chains in the Genus database with same CATH superfamily
1XNQJ 2PMWA 2R8GA 4DEZA 2XCPA 3JYTA 1BY9A 1RGVA 4EYIB 5FIIA 1RTZA 2ILYA 1DRZA 3ONQA 2XMMA 1ULRA 3T5JA 1RAJA 2HQIA 3EJMA 3OL7A 1HLWA 1TL1A 1FT8A 2BDPA 2AYBA 1JLQB 2M2BA 2QLJB 2ZUGA 4HT5A 3GV7B 2HK2A 5L1JA 2RIJA 2FHJA 2HGNA 1OQ6A 1N48A 4KT0C 3MEKA 3HHLA 1DTTB 3E2EA 2V8HA 2J8AA 1U8WA 2J7KA 3AD7C 2HQCA 4LFAJ 1GT8A 2XS7A 2I5JA 5KFCA 3GIMA 4M95A 1LXJA 3KK1A 3I6PA 1R6YA 3OSNA 5J2PA 2Y1IA 3AJDA 2C2MB 4ED6A 4DV3J 5H9FK 4M1KA 2B9XA 4C8MA 1VC0A 3D4JA 1RT4A 2RU3A 3DGPA 1HBOB 2R7OA 3BR9A 2KFYA 2JHEA 2YWHA 1IKVB 4P10A 4PQAA 1N34J 3VWSA 3B54A 2EBGA 3T3FA 5A0YB 3BO2A 3OFGA 3D7SB 2RD5C 2O01C 2YXLA 1SV5B 1WF2A 4CYUB 2YPZA 3RTVA 1S1XB 3IG1B 1WJ9A 1JLEA 3HT0A 1FXLA 4TYBA 4HHHA 1N52B 1T9VA 3DN9A 3I0SA 3UDEA 1N56A 2ZBRA 1HBNA 1S7IA 3FEYB 1RU2A 1RWXB 2DGQA 2Z2YB 3PW5A 4ZHRB 2R2UA 2WK4A 1KNZA 4DV6J 1O51A 4ZOSA 2HURA 2ZVSA 2NPFA 4I2QA 1HR0J 1K44A 1WELA 4NYPA 4OI0A 2H65B 3W5XA 1XNQF 2CQGA 5IT9U 3BREA 2R8KA 4MJKA 1RT5B 3TRGA 1RTDA 2AJ4A 4USTA 1IVZA 2HQFA 2DITA 1UW4A 2XO6A 1X4HA 3ZO7A 3FEXB 3VGSA 1MWYA 1FJGJ 2Q79A 3TA2A 3ADAC 1R6VA 5JUMA 1MWQA 1JLGB 3FZBA 2AIRB 1O0PA 1JLBA 3LP1B 3M30B 4Y2KA 4LFAF 3MMJA 3OTDA 1VYAA 1YZ6A 2QLBB 3TI0A 3KMQA 3MPUB 4FXWA 4WPAA 2DCLA 1K8AT 3VGUA 1K0TA 1UWBB 5L38A 4ED0A 1JQGA 1VQ8S 2HHTA 4DV3F 3VQSA 4ZDNA 2X3GA 2QTWA 1UMJA 5D15A 2BE9B 2VL1A 3MFHA 1R8AA 2WSCC 3GIJA 1N8RT 2CADA 2G0JA 1SB6A 2NXJA 1HI0P 4LIRA 1J5EJ 1X0PA 2W25A 3N6MA 2MQOA 1X9WA 2RHQB 3MUTP 1GNKA 5T14A 4DF8A 1UCNA 1IWAA 3FSIA 1HPZA 5FJ4A 3IR5B 1WDTA 1R0AA 2EVZA 4NL5A 2JLGA 3C19A 2LEAA 1JWWA 3MR3A 2AU0A 2GAGC 4XPCA 1O6XA 2OSRA 3W9IA 1TKZA 5IT9Y 1B70B 1OJ4A 3IXQA 2Y1RI 2DISA 2DGWA 4DPOA 2XI2A 4KFBA 1SL1A 2ZJRQ 4AL5A 5LJ5Y 4DV6F 3QT6A 4L75A 4HKQA 4IH6A 2AGQA 4DX6A 4WFNQ 3CULA 1B0VA 2V2KA 1PJ6A 2HKEA 1HR0F 3C16B 5LM7E 3V6KA 1T9YA 3HP6A 4DV1F 4NCBA 1ZAWA 2OPPA 2BJ7A 2KJVA 2E5LF 2VFUA 3KLHB 1G1XA 2NREA 2HBYB 3N6NA 2AGPA 3NRBA 2AJ1A 3S6EA 4F67A 3CCMS 3E3XA 5IC4B 3PR4A 1BLUA 4JI8J 2HWTA 1FJGF 2X7IA 5KG5A 2A1BA 2MJNA 3NGSA 2KN4A 3PJXA 2FPHX 5E41A 3L7OA 1NPRA 3U1LA 5IM0A 4P75A 1T03A 1VQYA 1Q5VA 2BRKA 4I7FA 2GCFA 3O1LA 4ANEA 4P2XA 2ZH5A 4KO0B 3DOMB 1HI1A 3R5CA 1Y4ZB 3MF5A 1MROA 1NCLA 5HVFA 2LA6A 2F8HA 1S76D 4QR0A 2DNPA 4WBFA 3WC2A 5F8GA 4P2FA 1ZOTA 3PW0A 3BPSP 4A8SA 1UVIA 2AMCB 2HK3A 3OTCA 4J9VA 4ZCLA 2Z0GA 4C3LA 3O3LA 4BC9A 4PG5A 4R0EA 5D4OA 3S1TA 3FJ2A 1J5EF 2AEJA 4DS4A 1BQMB 1S6PA 3B82A 1S77D 5ETKA 2N4CA 2NR0A 1CVJA 4R5PA 4PYDA 1ZTTA 2BRLA 1KFSA 3MMAB 1SKSA 4DL3A 4DV5J 1KQKA 4WJBA 1URRA 4B17A 1W26A 3PO4A 4CP5A 1H73A 1JB0C 3NNHA 4ID5A 4MYUA 2E9ZA 2HWIA 4ECZA 3M9OB 2YWKA 1WKLA 5GVQA 3MPYA 3NOCA 1F3VA 4M5LA 4EBDA 1RAEB 1T0TV 4JI1J 3M8RA 3N0VA 3SEOA 1KS2A 1YBAA 3TVKA 3DLKB 2E1RA 1J2VA 1UJ6A 2F1FA 5AXLA 1B7FA 2VV5A 4NLSA 4LRDA 4FKXA 4OI6A 2B9EA 2BBEA 3PV8A 1T3OA 3MM5B 3W61A 5DDRC 2XS2A 4DX5A 2MQNA 1NZ8A 2Y0BB 3OT9A 3TQEA 1S1WA 2H5IB 4F25A 3NMAA 1RP5A 3KNGA 1UVLA 2IMWP 4ZKAA 3TANA 4HTJA 3HD1A 3ET6B 3ZNJ1 1FXDA 3H2VE 2AV5A 3JTOA 4DHVA 1JMTA 1TK0A 3M8PA 2JNJA 4Y6IA 4AUKA 2CDQA 1RT2B 4O4GB 2WRMA 2BJ3A 2R7RA 3JS9A 4F0KA 4NCGA 5DGBA 3M2UA 1T8EA 4E0DA 3CJQA 1IKYB 2HFNA 3L95X 1P8GA 3UQSA 4M5IA 4C8NA 3ILLA 3PEHA 2F4VJ 2XLIA 3LP2A 4TNOA 1DURA 3IC1A 1OY9A 4DG1B 3BGRA 1L3UA 3UN5A 2RDJA 3BQ0A 2AQ4A 2RS2A 2E7WA 3OTOJ 5L8RC 4OJ3A 1HW9A 3DU5A 3W1YC 3VAFA 4ICLA 2IM3A 4DV5F 3JB9k 4AE5A 4HACA 3IGNA 3EUNA 3KHLA 3F0NA 4M5JA 1VQOS 2FHMA 1PYTA 2PMZD 1NO8A 2XGPA 2I38A 5EGYA 1WI8A 4G3IA 3ICLA 4O3RA 4I2PB 5HI7A 2DKOB 2IYGA 2VFSA 2AEMA 2ZH7A 5KFRA 4RX6A 4IDKA 3I5BA 3DOKA 3KLEB 3OUYB 3PIPQ 2YBVA 3HT3A 3CTRA 1D9AA 5I3UB 4RW8A 3CC7S 2LKZA 4JI1F 5LSOA 3H0PA 3M6WA 2VA2A 3H7HB 5DRKA 4A8YA 2COLA 1T9TA 2X1GA 2JC1A 1U6BA 4MTPA 2RDIA 1S79A 4EFAC 2HGLA 5H1SV 4G1QA 4B3OA 3HFVA 4ILLA 4B9NA 2GVDB 1NKEA 2BQ3A 4USWA 2CYYA 7FD1A 5HATA 3D66A 4YB5A 1NNDA 3R7NB 2XZDB 1RT1A 3NG8A 2ZM6J 4Y0FA 4Q45A 3BZQA 3C14B 2HNDA 5KT6A 4G1PA 4LF8J 2WBRA 2WONA 1S1TA 2J5AA 3C2PA 4Q0BB 5CH7B 4IG0B 3PJWA 4A8WA 5DG8A 1RT7A 2DIUA 4UUWA 1UP1A 2ZJPQ 1GMWD 1EJ7L 3FDSA 5C24B 4NXMF 2B9YA 1E6VB 2F4VF 2VZ9A 3I82A 2FHJD 2NUUG 1JJ2R 1WG1A 1REGX 3HHLD 3NP5A 2RMLA 5LXRA 1ZM9A 3CDBA 2C2EA 1YJTA 4P73A 4F3OA 1KSPA 3OTOF 3T5KA 4D3GA 1RTHB 1EARA 2MHEA 2XBPA 5IQQA 3CCJS 3W7BA 3O6QA 4DLGA 4QW9A 4NMLA 2DNQA 3SMZA 4KC5A 1P6TA 3MM8B 3IWLA 5KFTA 2CG4A 2CDRB 4ECQA 4K8RA 2B7CB 1BMQB 1DFDA 2W2QP 4XIUA 3UW1A 3NL0A 3D5MA 1M0SA 3CIZA 1OMSA 5KFPA 5CABA 4C8KA 4FXDA 2EC2A 2QYGA 4EZ6A 3G82A 3FNNA 3GFYA 3SQGB 2MSTA 2I9SA 3UR3C 2W2PP 3ETMA 2ASYA 1AW0A 3V4IA 2B4OA 1X5SA 1X31C 3H40A 2ZD1B 1TAUA 1DQ9A 4OYIA 2EFPA 3J80U 3S01A 4F4YA 5DQGA 2MQMA 4C98A 1BXNA 3UDVA 2Y8WA 1RHUB 4OYBA 3ILOA 1JLCA 2GQ2A 1F6TA 3SV4A 3GYGA 4HVZA 2JEGA 1NSQA 5HVGA 1V5IB 2E44A 2L08A 4CH1A 2OO4A 1HNZJ 3K5MA 2BANB 1QSYA 2FLPA 3CCSS 4GKJJ 5AE2A 2RE1A 3AHPA 3QATA 2G1HA 2AYGA 3RAQA 1JLQA 3DMJB 1FERA 2EFQA 2CJAA 3OL6A 2XY7A 1LV5A 3GSIA 4TXSA 2A2CA 2WBMA 2OIHA 1SQEA 3BGLA 5A2QY 3AOAA 5C25B 2WW4A 3R8YA 1B0TA 5CQGA 2CQCA 2IRXA 1FESA 4UTGA 1HNIA 1Q1KA 1D8YA 1N5YA 1O5JA 2DNHA 1MSWD 1Z2LA 2NSBA 1CEZA 4I6YA 1N88A 3FBBA 3IS9B 2P6TA 1ZA1B 5D6GA 1XTZA 1HNVB 3H59A 2N7YA 1LW2A 1FDDA 5BYSA 3T1YJ 1DY3A 2QSWA 4OZ3A 1TL5A 2NLWA 4O0NA 4BBYA 1LWFB 3K5LA 3IAM9 1X5TA 4YDDB 5A0YA 1EP4A 2RU9A 2EW9A 2BEFA 3KWMA 1IM4A 1HBUB 2PI5A 2JDJA 4CYUA 2K3KA 4B9MA 4FP9A 2C2DA 2RKIA 4DQIA 3J7YI 2GO9A 3PVXA 1KP6A 4NYOA 1SC3B 1SQFA 4JI4J 3GCXP 3RR7A 3TUZC 4U95A 5AT1B 1T11A 2DY9A 5F9NA 3QQCD 3E01A 4Q5VA 4RL1A 2VB6A 1RKJA 3AT1B 3VAKA 2L9WA 4P72A 4ES3A 3VVUA 5U47A 4ZHRA 4H4MB 4DR5F 1AZSB 3TZZA 1TUGB 2QA1A 4UW2A 5D4NA 4CRJA 3C15B 2PIIA 3TUPA 4U9RA 3DDIA 3HF5A 1VRTB 3H42A 1WDDA 1C0UA 3LGMA 3HK2A 2DR5A 2HVIA 1RUSA 1WG5A 4P74A 3HJFA 2VG6A 3CGIA 3TZYA 4KR0B 1AUSL 4HLBA 3NWRA 1EKSA 4CO4A 5HP1A 2Z2LA 4GKJF 1YJUA 3JSYA 4PG4A 3I55S 4FBUA 1H98A 1CG2A 3MTKA 1IKWB 2XMKA 2WOMB 1RK8A 1KHVA 4WZMA 3SXLA 1JLGA 2ZWOA 1S9EB 2Q1LA 2W4DA 2XYGB 4CO2A 3A8IA 5DM6Q 3VGTA 2LDYA 3LP1A 3M30A 3IR7B 4U67Q 2FQQB 2QLWA 4LF6J 1T95A 3GMGA 3Q89A 3JSBA 1FVSA 2RUGA 1RA7A 3BPDA 2EWHA 2AP6A 3VF0B 3MI7X 4HI1A 4Q43A 2MKJA 3ZZRA 5DDPC 1UWBA 4HDHA 3BDEA 4IUFA 1HWUA 5EUHA 2FVCA 2IM1A 8ATCB 3GSDA 2DR6A 5DETA 3T1YF 3VAHA 3UDLA 4DUZF 3RRHA 2VQFF 1JXEA 2C3UA 4P71A 1RBLA 1CJKA 4ER8A 1JKHA 3MM9B 2QA2A 4R8UB 4ZITA 3FRYA 2PO4A 4DPWA 2CQ2A 3UVJB 3WZ0A 2EPIA 3LQVA 2G13A 1TTHB 3TO8A 5IFMA 5D4LA 3K59A 2QGFB 5ETNA 3DXBA 5A76A 3WX4A 3DRSB 2OHDA 4DUYF 5KFJA 1NK4A 1Q53A 3DLEA 3MCOA 1DARA 2ALYB 1KLMB 3MR7A 3CDUA 4GO5X 4F2SA 2DXEA 3P49B 4KHMA 2MKCA 4MAKA 3EVMA 2LCWA 1TMJA 4NA1A 5J1PA 2G0IA 2IFXA 3PACA 3TZXA 3ZZOA 1HQEB 5KFYA 3CD5A 1FNOA 3KUGA 3UNYA 3THVA 3KLFB 4DCOB 2V50A 1TL7B 1S9GB 3CT9A 1S99A 4F7VA 3SQOP 2E5JA 4WP8A 5KG7A 3NMRA 3CJ8A 2RQKA 1JLFA 4RNNA 1U09A 5KFVA 3MM7B 2P9CA 1WEXA 2UUBJ 4XDDA 1ICEB 3QWPA 1RISA 2Z30B 5GADI 3HSJA 2MLZA 3PW4A 3EVOA 4F02A 1HYSB 2WVBA 3KLVA 3LA0A 3SZ2A 2HMIB 2QT7A 1S0OA 4Q7AA 4AXIA 4IR1A 4DOZA 2EC0A 2ZH3A 2DPIA 3DC2A 1UJ4A 4KO0A 4CH0S 3NCPA 4LF6F 5BXIA 3RAMA 3DOLB 3OR1B 2AD9A 5H9EJ 4IG3B 3QJPA 5EHHA 1TK8A 1CSJA 2UZAA 5E33A 4ZP9A 3P5BP 2HRUA 1IR0A 4Z37A 2MY8A 3KHRA 4DL5A 4CLSA 4WTYA 5DZ6A 1FE0A 1N0UA 2JLEA 3GR0A 3FCWA 1BQMA 2BUNA 4DR6F 1R3NA 2D41A 4NPOA 2F5GA 4ZLPA 2LQ9A 2MSSA 2Q3PA 3PZPA 4NE9C 1JLAA 1RLCL 1LWXA 2B43A 5HVHA 3UCZP 3IM9A 1S10A 2DVIA 3FBCA 4FYWB 2KRRA 2CVIA 4S0MA 5C42A 4U96A 4URGA 2YX1A 4F3MA 3AOCA 4NLRA 2ALZA 3NS5A 1XN9A 2DCUB 2Y1JA 3UR0A 3CDEA 2CJ9A 2JVOA 4DXLA 5G0RA 1KLNA 3W64A 2G9OA 1IR1A 2GJIA 2RH3A 2J9EA 1D09B 2LEBA 3HHLC 2Y9HA 5L9XA 4JV1A 5D8HB 1FDNA 4ILRA 2RQMA 4YHHJ 3A1YG 4O23A 2DH9A 4OHXA 3MM5A 1XBWA 3MMCA 3DCAA 1HKAA 1RHQB 1RLDA 3SCIE 5KFIA 2VASA 5JVHQ 2HFOA 1L3TA 3HHNB 5JJBA 1HNWJ 2WB1D 2DB1A 1ZYQA 3UPFA 3T6BA 1TL3B 4X4OA 2NYIA 3B4DA 1FDBA 3GIKA 2R3VA 2PGCA 2AX0A 4WCEQ 1XWLA 3CWJA 3CCRS 3PKYA 2CWXA 1RT2A 4O4GA 2VQEF 2MDAA 2AJ0A 4L6V3 5F8NA 4UOGA 1FEHA 2V8VA 2AYEA 5J2QA 2E5HA 1IKYA 2E1AA 5E3AA 5HLFA 2HW3A 2ZJQQ 3G96A 1QLNA 1FNMA 4RNFA 4QIGA 1T05B 5G4DA 4K4SA 5F8IA 2VPWB 1NHKL 5ETOA 2CRLA 3OTBA 4HHJA 1Q95G 5A6WA 4OZJA 1LXNA 2UV8A 3PM9A 4ZN3A 5E3PA 4NI2A 2V8PA 1QAIA 2HS4A 4DFPA 2B7BB 2R7TA 1VFJA 5E3CA 2BJ8A 2H3EB 2HFSA 3WIVA 1NKCA 4HHUA 3ZZYA 3DRRB 4OX7A 4C4WA 4LF7F 1X0FA 4KHPJ 3DGVA 1TVRA 2MQLA 1ZS6A 3QLHB 4JOUA 5B0GA 4M63A 2BACA 1SJQA 2GO8A 4A8KA 4FPRA 1U45A 1SJ1A 2DNGA 1UVMA 1T02A 2L41A 5CYQB 1IUJA 1NJYA 4N77A 2XZTB 3TYTA 3QWUA 4NLVA 2GVZB 2HQGA 2OMLA 4FNHA 2CQ1A 2VJUA 2BXJA 4DCPB 1S1UA 2HIYA 5I3UA 1PGZA 1IBLJ 1WC6A 1XMBA 5ETRA 3KK2B 4J5OA 1WF1A 3PIOQ 4QW8A 2YH0A 1F9HA 1TQLA 4IO9Q 2KYZA 2QL9B 3ZTRA 4YHHF 1GAOA 4OZ1A 2DGUA 4QIWD 3TEHB 2JX2A 2HZAA 2W7AA 5IXUA 5KT3A 4LBIA 4EWTA 2MGZB 2EG2A 3OD2A 8RUCA 4ZS6A 2EFOA 2GHVC 3CJKA 2ZZMA 2KRBA 3UE2A 1WEYA 1F5CA 2LDIA 3P5TL 3MEEB 3C14A 1N5QA 3GR1A 1X9MA 3HXMA 1WI6A 1SL0A 3MEGA 4Q0BA 2HWHA 2HRTA 5DDOC 2ZOGA 3ZNUA 1UVKA 2OGUA 5DS7A 2QMXA 2KXNB 2CKWA 1HWIA 3A3NB 2MZQA 4C8ZA 2XNRA 2WB4A 5C24A 2ZITA 3OVSA 1E6VA 4QWBA 1FF2A 4NLPA 2CZVC 3TVYA 2B4PA 4J37A 2LFVA 1UEKA 3MTJA 4OYMA 3POTB 1M1KT 2JL9A 4O0IA 2E5IA 1U6ZA 2NZCA 1S72S 1RTHA 2QL5B 5JVGQ 1MMLA 1FHTA 3MD1A 4LFBF 2J0XA 3R3TA 1RWVB 2WVCA 2XSFA 4KGVB 5A8RB 2GC8A 1FA0A 3EDRB 2C3MA 3HULA 3MM8A 4YR3A 3EXCX 3NWGA 2OUGA 2BKNA 4ZPTR 2ZHOA 4M5DA 2HFVA 1EHWA 4OX8A 3JSMB 1SKWA 1WHYA 3Q8QB 4JUZA 5KFSA 3SQGA 4ECSA 3LANA 2DO0A 1KR4A 3GV8B 2GJ2A 4CQ1A 5F8JA 2ZE2B 4ZPDA 4TVAB 3W62A 4QCLA 2YH1A 3NLCA 1UFWA 3HM9A 1HD0A 2OFGX 2LQ5A 3UN2A 4X4PA 1ZAVA 2CJQA 4JYAJ 3GJTB 2ZD1A 4Y2MA 1TMMA 1HQ2A 3T1HJ 2DIVA 2GIFA 2VF3A 4NASA 1PC4A 2R2TA 5KT4A 1XEZA 2CXEA 3UNGC 1RTJA 1D8ZA 2FGOA 2YKNB 1S48A 2XZWA 2DNYA 4BS2A 2XSJB 3RBZA 2BE7D 3VHQA 1FI4A 2J9CA 1SC1B 3FCVA 2D1CA 4C3MA 1FE4A 4GC6A 2BANA 4LR9A 1RJJA 1YJWS 3SYZA 1YTYA 3PYGA 5E5NA 2MTLA 2P6SA 5B0EA 4ETXA 1XERA 2QG9B 3PYEA 1SH0A 1B64A 1VHFA 3QRPA 1WHXA 5FD1A 3DMJA 4WK1A 1GXLA 4NYZA 1KWMA 2IBOA 1OS5A 1WSRA 4B9UA 1TKXB 3EX7B 2QV6A 4ED3A 2BQRA 5C25A 3BSAA 1SC6A 2PE8A 1N6QB 4JP8A 1SJ4P 1QSLA 2BABA 3NS6A 2AGOA 3D28A 2VU5A 2FHOB 5BYQA 1PJ5A 4YR2A 4ZJLA 1RT6A 3TUJC 1UTAA 2XS5A 2OAUA 3ITHA 5EWFA 3UWTA 3IS9A 2VPXB 3HVTB 2K1RB 4I4BA 1DTQB 1HNVA 2XLKA 1PKUA 1G6BA 2ADBA 2XNQA 1GFWB 1B99A 1XJWB 1H2VZ 1MWZA 2FVSA 4WE1A 2ZZNA 1GXTA 3TX0A 2UUCJ 2DRDA 3W9HA 2IMOA 3TQ1A 2EK1A 2YNIB 1HBUA 2M8DB 3M8WA 4MIAA 3AQPA 3C46A 2J8SA 4LF4J 3CCES 1NJIT 5DQIA 1SIWB 4DR2J 3WX8A 2IJRA 5AE3A 2A3JA 4XK8C 3V81A 1DAXA 2MLXA 1G2EA 2QX0A 5KFZA 4AL6A 4MMOA 2DNKA 4H4MA 1OY8A 3PYFA 3MOJB 5IV4A 1FO1A 6FDRA 1WNEA 4UZBA 1VRTA 5L1KA 2KXFA 3V6DB 3KTQA 1NDLA 1RTIB 1TL4A 3FC9A 4KY3A 4M5MA 1VRUA 4OLOA 1VC5A 3W2WB 2B56A 3GG1A 4OJGA 4QIFA 1JJHA 1T7PA 4OZ2A 3SCKE 3AXMA 1X4GA 4ZLLA 3LGHA 2V2ZA 3G8SA 5JXSA 2WOMA 1FTCA 2L48A 3R6LB 1QVGR 4P7TA 2CIMA 3BS9A 3L09A 3ILJA 1L3SA 1S9EA 4DR4J 1SH2A 5DLFA 3QPIA 5KFWA 2E29A 5GAGU 5KFOA 1A0OB 2M4MA 3QBCA 1PILA 9ATCB 1VBXA 1NDCA 2V34A 2P2CB 5EX0A 5H9FJ 3CCVS 1NMEB 2OSQA 2MQPA 4KGKA 4WXOA 2XMAA 2A10A 1VBZA 2DHGA 1NK8A 3JAMU 1RYRA 5L46A 3MM9A 3OL8A 4R8UA 7AT1B 1S6QB 2IRUA 2XWYA 3UVJA 3R97A 2UUCF 2CPFA 4RLEA 3EE3A 4F04B 3ZZZA 1QTNB 1GXUA 2CPXA 2V2VA 2ROGA 4O3SA 4F2RA 4QBUA 3KHHA 4ECWA 1NSAA 4LF4F 4WP3A 3RB0A 2VG7A 2XC9A 4WK3A 2E1MC 1RAAB 1KLMA 4DR2F 2HZCA 1S0NA 3QIPB 3BV8A 3Q22A 1FFSB 1HMVB 4LMZA 3U27A 2HS3A 2XTJP 3D0IE 1T9XA 4LF5F 2V5HG 3BBFA 1U26A 2HHSA 2WAQD 3OFEA 1VJQA 3I5CA 1K1SA 2W9BA 4KRWA 2PMHA 3KLFA 2PFFB 2J7WA 1TL7A 1S9GA 2IJFA 2FUG9 4IOAQ 2D3ZA 5A8WB 2R7VA 3W2VB 2ZHAA 4KKOB 4LRCA 1NSPA 5CZVA 4RNMA 2Z4PA 3MM7A 3W3SA 3RUBL 2AYMA 4LSNB 3PR5B 4K4YA 3B8HA 2R9LA 3IMQJ 4NWBA 1HYSA 3IRWP 1ZM2A 3MPDA 2HMIA 4TY8A 4A48A 2WVFA 4X64F 1TU0B 3SDEB 1RWPB 2CQPA 3DOLA 4ZVTB 3IWXA 3RBXA 3OR1A 4MFBB 1S4EA 4IG3A 4OHZA 4ZVUB 1N33J 2OEJA 4RW6A 2A2DA 3Q0AA 4LF9J 3I87A 2POKA 4LFCJ 1NEEA 4DF4A 2MMYA 2DEIA 1GQEA 3ZFVA 3H5YA 2YKOA 2BJ9A 2IC3B 1D9DA 4IRKA 4B3TF 4NLXA 3P3DA 3TA1A 3DYAA 3CPWR 2MZRA 2KKHA 4FZVA 3IA0A 4M5HA 4ZVPB 3HDSA 2AZ3A 4GMKA 1NK5A 4NZ0A 1CC8A 3HHDA 4TLRA 5A8KB 4OIXA 5E3RA 4WFAQ 4WFBQ 3BGFA 3N5BA 4IQXA 1H74A 1VR6A 2L9DA 4CLLA 2HHVA 1SBRA 3UDCA 4AFFA 2DD8S 1IBMF 3CD0A 2GS8A 4RZRA 4PG6A 4ERDA 2RDDA 1UL3A 1UJ5A 1RBAA 3RRKA 4B9VA 4KAIA 3N4WA 1S49A 2F4FA 4OYAA 5B0FA 1VBKA 3M9MB 2AHOB 3CJRA 1XR5A 4CLFA 4IRCA 1NPPA 4ZK7M 1R0CB 2PFDA 5K20B 2OMOA 3BSCA 3FZ2A 3UD5A 3VAMA 4DFJA 2IAJA 3J81j 4NOHA 5F3ZA 3EGWB 3DNCA 1REVB 1CPZA 5DM7Q 2GMLA 1H7WA 4ID8A 1GX6A 1QSSA 1UEVA 4F4WA 1U1QA 1FDAA 2RF2B 1AXQA 4NCAA 4E98A 1TL3A 2F9DA 4PAAA 2KTQA 1Y00A 2V6AA 3SI8A 1X5PA 1PYSB 2KT5A 4IO1A 5J1EB 3MR6A 1VQ4S 2ASDA 4I68A 4ED2A 3WQPA 2X1BA 1WSVA 2ZH4A 4LF9F 5GAHI 1NJZA 4LFCF 2VONA 1BUXA 2QN6B 1EETB 3R2DJ 4LT6A 1F5BA 1T05A 2V2QA 4H4OB 4O4RA 3MCNA 2H5JB 1T9UA 1RWUA 1TFWA 4HL9A 4DL6A 4LQ9A 4O3OA 1EIYB 1RWMB 2DR9A 3KNAA 4WFYA 3BYPA 3LWLA 2ZH6A 2YWGA 1NK6A 4WYLA 1RI7A 2LECA 3DRRA 2Z8QA 4N41A 3CSKA 3IAS9 1OO0B 1WWHA 1FKPB 2MB0B 1U1MA 1F0XA 3BN4A 5B7WA 2VG5B 3C6UB 3NCQA 1XK8A 4Y00A 3IBCB 2KVIA 3QRQA 1N4LA 3HSZA 4XTTA 5KFQA 2QA4S 2GVZA 2Z58B 1ZPVA 1B3TA 4HH0A 1M5HA 2JOQA 4O44B 2D69A 4MK7A 4BWJA 3R6GB 3HSDA 2N4DA 3GP9A 4AL7A 3F41A 2LXUA 3NBPB 4K0KF 1WC3A 3OBIA 3X3UA 2ZZTA 1D9FA 3VAJA 3MHYA 4DR3F 4ANCA 3K5OA 5FLXY 3M1VB 3CJSA 3KUEA 4B3RJ 3PX0A 2YNGB 4TQSA 2MGZA 1FEEA 1Y3KA 3H20A 2LQBA 4YS2A 4OV6A 2FHKA 4X4QA 3RB3A 2Z56B 2J6UA 2CNLB 1D3WA 1WC1A 1UVNA 1TKTB 2FJAB 2J7UA 4I6AA 5KT2A 4A46A 1FRHA 2BJEA 4PKDB 1VK3A 3HKZD 3PDNA 4PCQA 3CD6S 2C28A 1MN9A 3QJJA 3BGUA 3PO5A 3AB2B 4KH0B 2V4JA 1LW0A 2B51A 3CE8A 5HQ8A 1LFWA 3V2UC 2OP5A 2ZUAA 2MKKA 2XMJA 2OH2A 2L3MA 2FB0A 2OEKA 1YX2A 4CTAB 1F2GA 4J9QA 4EZ9A 3K89A 3P6YC 2G4BA 5K14B 3POTA 6AT1B 3QFWA 2YKQA 3PEJA 3HHLB 4J9MA 2F40A 4DL7A 1WG4A 1U1RA 2X1AA 4FYDA 4OHYA 1PIEA 2V67A 5D4PA 4RW4A 3TX8A 1IBKJ 2BJDA 5B0BA 3GJQB 1H3DA 4PWDA 1XNRF 3KK1B 5A8RA 2DHSA 3JTNA 3NXZA 5J2PB 3G9CA 2DYAA 3H4DA 2HHQA 3TJ8A 5LOQA 2DJWA 1PAEX 4Q44A 1HHTP 4GVLA 2AJQA 1U4BA 3VCDA 4ZMMA 3DGPB 2JEFA 3JSMA 3DI6B 1ZZNA 2FJWA 1BQNA 4C0HA 4DV1J 5K8MA 4DPYA 1KRPA 1VQ7S 3S8SA 2ZE2A 5KFAA 3OJSA 5HMZA 2E5LJ 3PHTA 4LJMA 1HI8A 4WFZA 3LOUA 1CULA 2MKHA 3MUVP 4M94A 4DQPA 1NK0A 3I0SB 3UFCX 4B3RF 2E9RX 1HBNB 4A8FA 3TR5A 4CWBA 1ZH5A 3MGJA 2X3DA 5KG3A 2VOOA 1CQNA 3HFZB 5HQLA 3PRBA 3L7PA 3FVYA 2FZKB 4IOBA 1RZMA 4DPUA 4AQYJ 1YGYA 1D0EA 2OTLS 1FXRA 5IWAJ 2HQ3A 1VCTA 1NXIA 3NNAA 2J0WA 2YWFA 4NZ7A 2FVRA 2VDIA 2QFIA 2C3YA 4HYKA 4KJIA 2GIRA 1RTDB 4ED8A 3I9V9 4K4UA 4DV4J 2EKYA 2ZC4A 1TKXA 4DX8H 2OD6A 2KH9A 4JI6F 4CI0B 5J1NA 5CAAA 3NY0A 3OHAA 1V3RA 3VGVA 1N6QA 1VJWA 1H38A 4U7UD 1ZZFA 5HN0A 5BR8F 4F4ZA 1I5OB 3R9LA 5ETQA 2DNNA 1EKRA 1S59A 1VHIA 1WOPA 3R27A 3V5RA 3D54A 2C3PA 1AFIA 1PBAA 4CLWA 1JLBB 3Q8PB 2B8PA 2BM1A 2HNYA 4Q8FA 1KVKA 1RHJB 2MQ8A 3CUNA 3RYLA 1IBKF 3HVTA 4JI5F 4MIWA 4DSLA 4J9UE 3RJMB 2B6AB 1HD1A 2XMUA 2PD1A 5D3GA 5H9EK 3W63A 3HMJG 2D7SA 1RDRA 2IBKA 1OSCA 4E2FB 3TA0A 2QEXS 3KK3A 2AWZA 1RABB 2Q43A 2YNIA 5SZTA 4NEYA 1OYDA 5LSRA 3UO0A 2V68A 1FWKA 4AXJA 3IO1A 4HDGA 1HWKA 3ULHA 3AH6A 5KFEA 1X4BA 3O44A 1RHKB 1U1KA 2CPEA 3T1AA 2VD3A 2Y3YA 3CD7A 4TU8A 2JJ4D 4P2MA 2KZZA 1Y11A 1QUVA 2V63A 2RAQA 1TKZB 2H48B 2JSXA 1I3OB 3VZHA 4KFBB 3PTWA 2OI2A 2WVEA 2DT9A 2HVZA 3V6DA 1RTIA 4DSEA 3B6BA 4QIEA 5LMUJ 2DGXA 2WVDA 1RAGB 1YRUA 4AT1B 1N5SA 4AQYF 1Z1ZA 2QMUB 4ZLJA 6FD1A 4B9LA 5IWAF 2F63A 3W2WA 1X60A 5HSPA 1DQ8A 2KM8B 2H51B 3MMBB 2OPRB 1NH7A 2Q6BA 2KT3A 2MZJA 3U02A 4PXDA 2W4PA 3FFIB 2M9KA 5KFBA 2M88A 5J2NA 1QY7A 2HVDA 2V8DA 2K7JA 4DV4F 4JBCA 1RAFB 1Q4RA 3DKDA 4PXEA 3UD3P 1G3OA 4DSJA 3AA8A 5GMKa 5DQHA 2HG4A 1EQMA 2OJ3A 5F3TA 2ZH9A 2FZGB 1NDKA 3HZGA 5IM0B 2ZDPA 1FWLA 4IQMA 1T03B 3MPWA 1F9FA 1PCAA 2KHDA 1KHWA 3Q8YA 2HAFA 2ZWPA 4BCAA 2OPQA 1U1LA 2D9PA 3G6VA 4DCJB 3Q23A 2M70A 2ASLA 5ADZA 4QWCA 4UY85 3SSRA 1H2UX 1S6QA 1QAJA 5KFGA 4X62F 4ZPAA 3A8KA 2QC3A 3O8WA 4OYZA 3RBEA 2VC1A 3QSYB 4NXNF 3Q83A 4KGXB 4DV2F 2VBYA 1R27B 4WZQA 4ZP8A 4HI2A 4ED5A 4X4SA 2HRYA 1AT1B 1HA1A 2NCKL 4YEAA 2DBBA 2LU2A 1RAOA 1BHNA 1KOHA 1U1OA 1Z4UA 4K4XA 4H4KC 1HL6A 4FNIA 3R1LA 1KC8T 2IDEA 3TWZA 4NZ6A 2WTFA 5ETTA 5KFDA 3W60A 1OPIA 5ETVA 1WF0A 4ID5B 4V19J 3GPAA 3FRZA 4DS5A 3T9ZA 2IA6A 5LMUF 4DQQA 1RE1B 3PG9A 3AD9C 2C2OB 2A18A 4W98A 1ELOA 2CA9A 3W2VA 4QWAA 4JI2J 1VI7A 4KKOA 2MYFA 3HHKA 2PEBA 1U49A 3PYDA 4MKVA 4ZCIA 3Q8RB 4NXMJ 2HFZA 3IWNC 2G0CA 1H6KX 4PZVA 2YNHA 4WIQA 4LSNA 1KQSR 4A8XA 2GX8A 2QO3A 4DBQA 4F3QA 2B8QA 2ZOMA 3BKUA 2J6SA 2OD4A 1X4EA 5T7LB 1IXKA 2W1BA 4DZ6A 2DNOA 1R31A 2CUYA 1HNXJ 2BW2A 3WC0A 4MFBA 2UXCF 3J7YU 3M8PB 2IJNA 4PPDA 3OFFA 1EQ0A 3NGTA 3EXYA 4B9SA 4KV8B 3QAUA 3GFZA 5M2UA 2HBRB 4ZVRB 3F73A 3RW7A 2G1DA 3TJAA 1MW7A 4RU9A 5HQMA 1U48A 2LU1A 4M5NA 3NAIA 4K4WA 1NHUA 5FDLA 2GZOA 5DZ7A 1KFDA 4OQJA 2DRAA 2VFTA 3MAQA 2BX6A 3LP2B 4RUCA 3GWCA 4G1IA 1ZTWA 3GFXA 4LREA 4LRFA 1UFKA 4Q2LA 3GIIA 3I4PA 3D1OA 3E51A 4ZVFA 2I6WA 4B3MF 5EWGA 1R43A 2K3IA 1VQKS 2GGPB 3M8QA 1FJEB 3AXKA 5B08A 3P4UB 4EEYA 5ETMA 5KFKA 4HACB 4ZPVR 3NCRA 3D2WA 4NLGA 1NRKA 3T6JA 3D6MB 4TLQA 3OJUA 1QJHA 1LWEA 1NDPA 2MLYA 1V6HA 4TU9A 4IDKB 1P27B 4PWWA 3M2VA 2ZBIA 4JI2F 3CJ4A 3OLBA 1RT3A 5DG9A 1U0HA 1RACB 4JI7F 3QO9B 1REVA 2V0NA 1M1HA 4USMA 1FRIA 3EDQB 1UWAA 4BWMA 1TR0A 4YR0A 4B3OB 1UZDA 1E6YB 2K06A 2RF2A 5T41A 4LRAA 2IM2A 4UY8T 3CC4S 2BE2A 4ED4A 1PG5B 3OV7A 2IYIA 2ATCB 2P8IA 4TU7A 2ILZA 2VIHA 3K0JA 3L7UA 3NAHA 4TQRA 1HNXF 2Y8YA 4DDFA 5J1EA 2ERRA 1U25A 4R0JA 2VBZA 3C66A 5L39A 1VQ5S 4DV7J 2BR0A 1VOMA 2ZH2A 3EGVA 5A2QU 5KFLA 3CEDA 1PSDA 1EETA 1NZAA 2HSEB 2YKPA 1RT7B 3EZ5A 4MKYA 2D3OR 2VHGA 2C2RA 2J0QD 4FVMA 4H4OA 1PYOB 4IYQA 3MFIA 5LL6d 2F7VA 2NXUA 2M8HA 3U1NA 1FVQA 3HLUA 3QGGA 1F9EB 3L4BC 3N9UC 2W9CB 1UPPA 5K5MA 2QFJA 1AFJA 3LUYA 5KT7A 5I42B 1CS4A 3PW7A 4OZLA 3DRPA 2V4RA 1DLOA 3BB5A 2DNMA 1IKXB 2JEJA 1CJTA 5MLCV 1R8HA 3PHEA 5F41A 1KDNA 2E5GA 2LXIA 3U7JA 4ZPBA 1S1VB 1WACA 2I2YA 1CLFA 4PQUB 4NLYA 2VG5A 4NMXA 3DLHA 4DR5J 2F65A 2MQQA 2W8LA 3DLGB 3T5LA 4RW7A 2BM0A 5GADU 1RXOB 2PA3A 4O44A 1OY6A 2UVVA 2LA4A 4OMFG 2XGQA 3NBPA 5IOLA 3GE9A 4PRFA 3DU6A 2HBZB 3G71S 4DU8A 2FY8A 1FJ7A 1PC5A 3DDNA 3EMTA 3QSIA 2DNLA 3W8PA 1U2FA 1M5OC 3K17A 3M1VA 4CT8A 2Z2MA 1LNQA 1QDUB 2CG8A 3QGPA 4MKBA 5C7PA 5CA5A 3DRXA 2YNGA 4ELUA 1YSJA 1GX5A 1DTTA 5B0CA 1TKTA 3K57A 3FSXA 3C6TB 1I94F 2QLFB 1HWLA 2W2NP 3RB4A 4WWSA 2RS8A 2N3LA 2XYPB 4K59A 4GKKF 1F60B 4OI3A 1WORA 5DG7A 2MZ1A 3GTYX 2HBQB 4GC7A 1L3KA 3LAKA 4X4RA 2GMJA 2CAJA 4Y2AA 2ZH8A 4DV7F 5ITHA 4DUZJ 2VQFJ 1U1PA 1WTFA 3CW2C 1HBOA 4L74A 1GMWA 4XPEA 1H2TZ 1UAWA 2LLZA 4RO0A 1YJRA 3NKYA 1IKVA 4OJHA 3K58A 1NUEA 4P6QA 4CTAA 4N8NA 2XHWA 3I31A 3QT7A 1LKZA 1MU2B 4DR1J 1SV5A 5K14A 4U8YA 1S1XA 2YY3A 3H5UA 1KEKA 5D0HA 2DO4A 4DUYJ 4IFYB 4W90B 3IG1A 3SSSA 3TNVA 1NK9A 4ILMA 2HHXA 2LP4A 4J9NA 4CO5A 1U0SA 4KSEB 1GMVA 1LFPA 2PA8D 3H5SA 2I1RA 1HNIB 4WU2A 5I4MA 1N5YB 1OPZA 1Q8BA 2V9KA 4QWDA 2OPSB 4UT4A 2DEJA 2FTRA 4DI6A 5ETPA 4YN3B 4U7CA 3K5NA 3M2RB 1Y9OA 1LW2B 3R5AA 1GH8A 2R7XA 3G6XA 2RRNA 4MKAA 2CJYB 2HS0A 3DI6A 3JQMA 3F56A 3I9ZA 1SCJB 2DNZA 3MM6B 2R8HA 4OYXA 2JWNA 1K0VA 1AB8A 3BM7A 5HBMB 1QTMA 3Q8SB 1EP4B 1UA0A 5THWA 1RT5A 3MAAB 3QFHA 1HBMB 3NS7B 4KE5A 3QNWB 1U8SA 2CFXA 2VA3A 2RKIB 5EX3A 4WP9A 2DGSA 2CNOB 1S7HA 3BR8A 3ZXWA 3JSRA 3GJSB 4GRSA 3RU0A 2UU9J 3E01B 4FYVB 3T9NA 1C0TB 5I3QA 3I0RB 1WHWA 1S12A 4D3HA 5K8PA 4DV0F 2CWKA 4MT1A 2EFGA 4HH1A 1C0UB 3PJ9A 1W25A 3J7Z5 2KXHA 2W4CA 3O5TB 4AYBD 2VG6B 4L76A 3CCWA 1A7GE 3G8TA 3QT8A 2E66A 4L3NA 4DL0C 3LW5C 4EU0A 5HP1B 4M8LA 4I0WA 1YBTA 2FVPA 3PXGa 4FKYA 1LWCB 2HEKA 4DR1F 1NJXA 1S6UA 1WOOA 1SL2A 4DR6J 4WTOB 1S57A 5HJYA 3QIDA 3D6HB 3D0HE 4K5RA 1FK9B 2EKNA 4OZ0A 1IBCB 1HIYA 2MZTA 2KZMA 3VV2B 2HHWA 3P96A 3PRDA 4Z7CA 2CPDA 3H5XA 3W65A 2B6AA 1JNZB 1WKJA 2XEXA 3M32B 4DL2A 4XO0A 3Q8VA 3H90A 3AJ1A 2H1YA 1CJKB 1NAQA 2IY5B 1JKHB 2QSFA 1FJCA 2YWWA 2A6MA 1QE1B 4NX9A 3W5ZA 2W9AA 4ED7A 3C16A 3VAIA 5D77A 4XDCA 5B09A 2HNZB 3TAMB 3AA9A 1HARA 1Y7PA 3ZZTA 1N34F 3QGIA 1NU4A 3GV5B 2VPZB 5A6PA 2DNRA 3IN5A 5KFNA 3KLHA 1MLAA 2OTJS 1SUQB 4PXCA 3DLEB 4A4JA 4TY9A 4M5KA 3KHGA 2LXFA 2QMWA 3DHXA 2UU9F 1RCOB 4HR2A 5D0EA 4CO3A 1V5VA 4K5SA 2JFDA 1S9FA 4FN5A 3SIPB 4LSLB 2HLUA 3KJVB 4N47A 5BYRA 5EWEA 3K8WA 4UQGA 4QPTA 1VGYA 3DOMA 1U47A 2AKWB 2VQEJ 2AX1A 4ZPCA 4OI1A 2J6TA 2VBXA 3Q8UA 3MMBA 2OPRA 1C1BB 2XB2D 2MY7A 3FFIA 3OTEA 1TK5A 2EBEA 3TJ9A 1T3NA 4YB7A 2NPIA 2JVRA 2CNKB 5CCMA 1VRQC 2QA4G 5K8NA 1VK8A 1JLFB 2RJZA 1A9NB 3D3CJ 3OXFA 3A8EA 4K4VA 2FJEB 4M5GA 2FZCB 4LVOP 1X4AA 1F1BB 2CQ4A 4KH1B 4FDFA 1Q5YA 3JQJA 4ES1A 1NH8A 1EAYC 4QU7A 4J90A 2G2OA 3RGIA 4J7CA 4LF7J 3RBDA 1WC0A 3MMAA 1R8PA 2PT0A 4H54A 2CQDA 1NB2A 1YJNS 4USUA 4KIAA 4CT9A 4WF9Q 1XMQJ 1SQGA 4FF4A 2BVZA 3EPIA 1LK5A 1SJRA 4EI2A 8AT1B 1DQAA 1ZM3A 1SIZA 4O3QA 1BC6A 2B0GA 1FKOB 2B9WA 1L5UA 1DJ0A 3OVAA 2I8EA 4BLGA 3I32A 4NEZA 4UOCA 5HMXA 5LT5A 2IVFB 1KOOA 1PAUB 2GAHC 4F4XA 3DLKA 3LH2S 4ZP6A 2E7XA 1OIAA 4PABA 4DSKA 4V19X 1W2BR 1JX4A 3I96A 4UUXA 2XULA 2J9DE 2M7SA 3PFOA 2JC0A 3BYRA 1JLAB 3RRGA 2CPZA 1LQ9A 3J7ZT 4LBPA 3BGOP 2FY1A 3OQ2A 2C2KB 3C8YA 1YDLA 5E3QA 1VIOA 1A6LA 2YQ0A 3ET6A 1KBRA 4RPFA 2DK2A 2XLJA 4PG8A 3CMAS 1U1NA 1FRLA 3CNQP 2O1PA 1VDHA 5GMDA 1TELA 3CB4A 5C42B 5IT0A 1SI9A 1SVDA 4PPZA 4A8MP 5G0RB 2R2RA 2YKAA 3CJ2A 4Y2CA 2CZ4A 2D74B 2ACYA 1RAHB 3KKFA 4ITSA 2GW8A 2QE5A 3Q86A 1KQFB 1OYEA 1M90T 2ACMA 5KOWA 3BBBA 3MMCB 3BH7B 3KJQB 4DZDA 4DG1A 4JI8F 3QYYA 2N82B 1YHQS 3GILA 4RUBA 5T7LA 2KDOA 4Y65A 4FF3A 2GV1A 4ENOA 1VLYA 2U2FA 2M0GB 4I69A 4E8UA 2ZFHA 2WSFC 4LFBJ 1X4CA 3EGNA 3IM8A 2DGTA 3BEGB 5KFXA 4OV1A 5CHCB 1DZ5A 1UKUA 4DN9A 5M2RA 4KV8A 3BQ2A 4X4VA 5KFMA 1XMQF 4FYXB 2DGOA 2FJDB 5J2QB 4I2PA 3TZWA 3SV3A 2CPYA 5HLFB 1FRJA 1WD6A 2ZKTA 2GQQA 2QLXA 3CF5Q 4K2XA 4PR6A 3NNCA 3KLEA 3OUYA 1R8CA 3DRYA 2RNEA 4NI2B 1YJVA 4OLPA 2DTJA 4C9DA 2CPHA 3DLLQ 4OX6A 3KJFB 2GVDA 1UZHA 5CD4A 2GGPA 1TV6B 2ZKUA 3G86A 1ZPWX 1UEUA 4ZN1A 1TVRB 3R7BB 4C6AA 3D6TB 4HT7A 1VQNS 1Q7LB 4WIIA 3IFEA 1NB7A 4KPCA 5HL7Q 4NRUA 2K2PA 3HVRA 1KD1T 1RSCA 3E8OA 5AJ3J 4RNOA 3TAPA 4USHA 4IG0A 2FD2A 4DJBA 4YMEA 1S1UB 4PUOB 2VBWA 1XR6A 1RHRB 1X9SA 3PY8A 3B78A 4LIWA 2ZHBA 1X4FA 2HQDA 3C3LA 4CLYA 4QYZJ 5F8LA 5CYJA 5AE1A 2FLNA 2VPYB 3IR6B 3QO9A 2O66A 3CO0P 5LXYA 2KG0A 3FK4A 5C5JA 5KG6A 1E6YA 5GMEA 2P9GA 3M6UA 1RHMB 2GIQA 3CJ3A 3CJKB 1SC4B 3MDFA 1HHSA 2MXYA 2DH8A 4OX9J 3HCXA 2X1FA 3D6FB 2AJ2A 3NGRA 2KM8C 3MEGB 3NEKA 3CMQA 1NJWA 5IT4A 2SXLA 3HHEA 1Q7YT 1OSDA 2KL8A 1OWXA 3TVZA 4X4TA 2QIFA 2M52A 3US5A 5LJ3Y 2O3DA 2W9CA 3OVBA 3N01A 3FCHA 3GZ7A 3BDPA 1URNA 2PN6A 5I42A 1WC4A 5HAOA 3WDOA 1IKXA 2E7VA 4QPXA 1PBUA 2QRRA 3S7RA 1TKDA 4N8OA 2X51A 4CIOA 4ZPWR 2A0FB 5IQ6A 2GHPA 2NXNA 3K2YA 2YKMB 2HFUA 5ETLA 4CLPA 3BQ1A 5DLGA 3VR1A 1S1VA 1KVJA 4PQUA 1P9QC 3WHIA 2V9WA 4QYRA 1RWKB 2LMIA 3DLGA 4DL4A 1Q78A 1ZA2B 5CXTA 5LMNJ 2WZ1A 1IQTA 1KN6A 1VS3A 5C2GA 4J9SA 3HO1A 4PWUA 5AJ3F 4M5DB 4CM0A 4OHWA 4DX7A 2JRSA 4LRBA 3OSPA 3M6VA 4R25A 4JV2A 3TUIC 2ZDOA 1R8BA 3AODA 4RNHA 1U02A 3OPKA 4EMDA 4KGZB 4ECVA 4N76A 4C97A 1XIQA 4KB7A 1C4CA 3RB6A 3H4BA 1I1GA 3M4XA 4FXVA 3EPGA 4O3NA 3JXOA 4TN2A 1K73T 3C6TA 2RRAA 5AXNA 1FD2A 1RTJB 3D1QA 3HPOA 3ISND 1Y5IB 2ZM6F 1U24A 4OX9F 3KUHA 4AD6A 3JTPA 4NA3A 3ENVA 4LF8F 1HQUB 1S0MA 2QZ8A 3H98A 2IHR1 1M1GA 2NUHA 3J81U 3CJ0A 2PEHA 2GJFA 5DGAA 2NQPA 4ZJQA 1GMUA 3FUYA 1LWFA 1Q8LA 2C2NA 5KFFA 3CO9A 3CVKA 1TFYA 3A13A 3DLJA 1MU2A 3CDAA 1CBKA 4IFYA 4N56A 1AA1B 1QAXA 2JH3A 2WW8A 1S6OA 1C1CB 1CJVB 2ROEA 4FF2A 1WC5A 5E0OA 2C3OA 3FBFA 5HROB 2XM3A 4ATNA 3ENQA 2BQUA 4ECUA 1RT6B 3ITHB 4ZLNA 4LF5J 2OPSA 2HVEA 1BGXT 2FYXA 2RB7A 3FKBA 1AZSA 1YJ7A 2MHNA 2DRBA 2KO1A 3M6XA 3M2RA 3C15A 3H25A 1R0BG 1IM6A 1VISA 4WKRA 1Y0HA 4W4MA 3K5PA 1Y3JA 1EB0A 4OI4A 5LMNF 1IQZA 4WE1B 3OFHA 1RU1A 3G8QA 4KGMA 3MM6A 5D0RA 2PSZA 2FVQA 3PCOB 5HBMA 1TUVA 2L9NA 1SPBP 4EK2A 2ADCA 3MAAA 1HBMA 1WKKA 3HVAA 3J80Y 2KB2A 1ITPA 2KT2A 2PC6A 4J91A 3ENAA 2IRYA 1IKWA 2AF6A 4LR7A 1P9YA 3R5BA 5GAHU 3AB4B 2IDLA 4CZCA 3V81B 1U2RA 2D3O1 5DDQC 1C0TA 1MG7A 4BC7A 3J81Y 4ES2A 2KYXA 3I0RA 4L3KA 1AYEA 3OR2B 2AEFA 1SJ3P 2AZ1A 2R7WA 4X64J 3K8VA 3QJLA 3HZEA 2EXUA 3CCTA 3AQOA 2UUAJ 2CJXB 2BOAA 1Q8KA 3RAXA 2YTCA 5HANA 3SSQA 1VRUB 4RWXA 2ZC3A 2VICA 3FGVA 3MUMP 2HYIB 4RWWA 2XMVA 1RQ0A 1S97A 3FBEA 1HNZF 2R42A 1H0HB 1Q86T 4OI2A 1IWGA 5RUBA 1B0PA 4B3TJ 1VQ9S 3MURP 1D1UA 2J9DA 5HO4A 3HX9A 4USKA 3W8GA 1LWCA 3H8YA 1QD1A 3KDOA 4JB8B 2ZBPA 3DRSA 4PXBA 4JI3J 4URQU 2BJ1A 1FK9A 4YUDA 3D0GE 1RWNB 1Y5LB 3ZTSA 1EZZB 2C1EB 2RQCA 4OYPA 3DM2B 2XG8A 3T5HA 4I1TA 1RCXB 1IBMJ 2W2OP 3M32A 4KYZA 3MEDB 2B5JB 1HQEA 3WIUA 4JV5J 1ZETA 5IC6B 3GFHA 2V94A 1IJEB 2YX4A 3X1LB 2KVQE 4ZCKA 1ACMB 4LSZB 4RUHA 2W01A 1QE1A 2GNKA 3MWBA 3CCLS 3BBCA 5JMNA 2HNZA 3TAMA 4J9RA 3SFGA 1UPMB 5MAOA 3M05A 1BD6A 4DUTA 1SUQA 1Y10A 1VBYA 1S4FA 2W7PA 4F50A 2VG7B 3KJNB 4JI4F 3G2XA 3QAEA 3GU0A 3ELHA 4K4ZA 4IOCQ 4I64A 4QJVA 2JFKA 3HJVA 1PJ7A 3W9JA 4KPYA 2B3TB 4NLTA 4LSLA 3CCZA 2E9TA 2RT3A 3MCMA 2M3DA 3KJVA 5DJBA 5KOXA 5HK4A 2DGVA 2W9BB 4NLWA 2XO7A 5J2MB 3CCUS 2UUAF 1Y5NB 4A47A 1WTBA 3TW0A 3OHBA 3IP0A 3MXHP 3VQTA 4K7QA 1X7VA 4IH5A 3DDKA 2LEPA 1C1BA 3IRXB 1FFWB 5IS2A 3D67A 3QGHA 1Z2ZA 3KLIB 3O2IA 3N28A 4ANDA 3P8BB 3GCWP 2IPOB 3M8ZA 1I51B 2UP1A 4DSFA 2XY5A 4X66J 1SXLA 3CJ5A 1YWXA 3W5YA 2YX7A 3UN3A 1V9OA 4JI3F 3BN7A 1VQMS 4TY8B 1O8BA 1XC9A 2DR7A 4A8OA 2J76E 3CMES 2VFRA 2CQIA 1BE4A 4W92B 1YLXA 3N5FA 4OL8A 1RWWB 2C42A 5L9NA 4RW6B 4P52A 1SKUB 2I0XA 4C8OA 4JI0J 1G7CB 4WXWA 2HLTA 4JV5F 1LK7A 1FKOA 4UQTA 2CVEA 4RU2A 1J5OB 2O5DA 3W66A 2UVWA 4K0KJ 3DYAB 4GVBB 3H2UB 4IFVB 1LOUA 2MKSA 1Q81T 2XHCA 1RB0A 4Y3CA 2Q6CA 1N32J 4DR3J 3MECB 3V4MA 1VIXA 4I67A 4RBUA 5CYMB 3HI9A 3QZ7A 4QOTA 4NLUA 3UI3A 2H54B 4KBIA 2CZ9A 2YWEA 4CO1A 3ZC4A 3KLGB 3JQKA 2KHCA 2YQ1A 1S5ZA 5HJXA 5L1IA 2HAIA 4K50A 2YNFB 2RSQA 4EO6A 1BWVA 3LPYA 2KU7A 1BWEA 2V69A 5IV3A 1RBOB 2C22A 1CJUB 4PG7A 1RKIA 3L9ZA 3TARA 2XMWA 3EICA 1C4AA 5FLXU 3OXLA 4YP3A 1TUWA 4F4KA 4WU3A 2VJVA 5KAKA 4DLEA 4OYOA 2KI2A 2QYCA 2YQ3A 4JV0A 1WEZA 3QRRA 4HTIA 3KG0A 2FC9A 1GTHA 2QL7B 2Z2ZA 2XI3A 2IVMA 4RJVA 3PW2A 4FS1A 3THTA 1NM2A 2NYHA 3M7VA 1NKBA 4I6WA 1V3ZA 1M5VC 4FF1A 3DHWC 3PFEA 1FCAA 2BKOA 3EM1A 4LQ3A 2IAJB 1S0VA 2WCXA 2UUBF 1MNEA 2VKZG 4X66F 3BSOA 1YVFA 2MJUA 4YY3J 4C11B 2DY1A 1VMBA 3DLBA 4CDIA 1FX4A 4RW9B 2LVWA 3CJTA 3PX6A 1YKWA 2CPJA 3T19A 4USVA 1XNRJ 3QLHA 1KONA 3OXGA 2FLOA 3G4SS 5CYQA 1VQSA 4Q2MA 4CH7A 1M5KC 4JI0F 4OFZA 1MMDA 2GMHA 2ZNYA 1K47A 3RR8A 3SBMA 2DXDA 5IZHA 1XR7A 4UZCA 3KK2A 1U2CA 4OZNA 3GYNA 4Y34A 4ZIVA 2CQ3A 3LO3A 2DHAA 4QWEA 1N32F 3HD2A 3LF0A 3ISNC 4GO7X 3G6YA 1CQMA 3LP0B 1OQ3A 4ALZA 1TV6A 1NBEB 3GQCA 1XMOJ 3SCJE 3TEGA 1X8DA 1U6FA 1XQIA 1FRXA 3VTIA 3MAHA 3MR2A 2R7SA 2CJBA 3MEEA 3MPVA 1YG0A 2FJBB 3KG1A 2ZNZA 1MN7A 1RAIB 4K2JA 3ETOA 2BMBA 2RQ4A 5K8OA 3D9BA 4MYTA 1AUDA 2ZBQA 3GB0A 4PUOA 2OFHX 3LGNA 2R2SA 1U7LA 2P5VA 3V6HA 3JYTB 3VZIA 2B4UA 4F8RA 2LQJA 3LTOA 4QR1A 2FJXA 1TL1B 4K4TA 4JI6J 2ZVIA 4L73A 3MCSA 2V4QA 4NLDA 1UFLA 3J7A1 2NXEA 5D78A 5BR8J 2N7CA 5CD4H 4USIA 4OHVA 4ZCMA 3FEZA 3R2CJ 1HNWF 3Q2SC 4YY3F 5EN1A 1BQXA 1K1QA 2I5JB 4P9SA 4JI5J 1SKRA 2DR8A 1FRMA 4DU7A 3KOAA 1QVFR 2ZOFA 5D0GA 4H4KA 2HHPA 2DHXA 1FD8A 2Y1LB 2V4JB 1LW0B 1RT4B 4UOFA 3EYZA 1SH3A 3GYXB 4DFMA 2KJWA 1R7IA 2M5YA 3ILIA 2HZVA 2Q66A 4X4UA 5GAEU 3A3OB 2DH7A 2OLWA 3RZAA 4ECRA 1VQ6S 1FKAF 4PEOA 4EYHB 1RWOB 1JLEB 2YKMA 2NS1B 3FQLA 3AAWB 3TP2A 4P2SA 2HPUA 4ZVGA 2H4WB 2BOPA 1Q16B 2NSCA 2F3JA 4RW4B 1H7XA 2RRBA 4G65A 4RR5A 1XMOF 2LQ8A 1HWJA 1RADB 4KHPF 4PWDB 1N0VC 5F0WA 1NLKL 3I5AA 2YKNA 3KFWX 4A8QA 4F36A 2VDHA 4USJC 2XSJA 1UW9A 2KFNA 1YK9A 4CNYA 4WFXA 3QMQA 1Q8IA 4TYAA 4NA2A 1JXVA 3GJRB 4O3PA 1BQNB 4I2QB 4HEA9 2ASJA 1IBLF 2R8IA 3R5JB 4EUVA 2ROPA 2PI4A 5KG4A 5B0DA 4ZJOA 2E1CA 1GEHA 3G87A 4J9OA 1TP7A 1NPKA 4URSA 1CULB 2H9ZA 1I6JA 5KG0A 3A12A 3Q24A 2GA7A 3M8YA 1YRXA 2FLLA 5KFHA 1P1LA 1KVIA 3G6ES 3PRVA 2UUWA 2MPUA 4ZVEA 3ISZA 1FX2A 4DPXA 3CC2S 4UF4A 3K7RA 4IH7A 3WBZA 2K1RA 1HQUA 3GIRA 3UCGA 1DTQA 2CPIA 4Q8EA 3AD8C 4ZIWA 4V1Ak 1VQPS 4IKAA 3A4TA 3GLJA 2PDAA 2W8KA 4B08A 4LUBA 4RUAA 3A3PB 1IR2A 4X62J 1HFEL 2LYVA 1KTQA 4OYWA 2OEMA 4NRTA 3DFEA 1Q0NA 2RILA 4ZVHA 3Q2TC 3P45B 4YDXA 4WKYA 1T9WA 3D1HA 4NXNJ 5K9FA 1JNRB 1H72C 4DV2J 5F8MA 4N5SA 1YBUA 1C1CA 1CJVA 4ZP7A 2ZBCA 1HPZB 5E7OB 5L1LA 1R0AB 5HROA 3KXDA 1WOSA 3I4HX 3RW6A 3THPA 2HGMA 2W7OA 2HNYB 2WHOA 1CC7A 1TZ0A 1AROP 4DN0A 1JXLA 2FDNA 3MD3A 2BKPA 5KT5A 4YFUA 4CLUA 3UCUP 2VODA 2RHSB 4B9TA 1JJ4A 3D68A 5D3GB 4ED1A 3QT5A 4C8YA 2RVJA 3ZZ0A 1J27A 3I56S 4J9PA 4G6VB 3KK3B 3QZ8A 1WHVA 3BSNA 4DPTA 3KMSA 1TAQA 3J7AN 2XWXA 1KKHA 1PO6A 2FC8A 2OPPB 1QM9A 4MK8A 2MKIA 1YZ7A 3AY0A 5DO2A 3EZUA 1T94A 4ZA1A 4ELTA 4DWIA 4IR9A 2QJ3A 3OW2R 3PKMA 1YIJS 3DXSX 4JYAF 1FWPA 3OR2A 2U1AA 5AXMA 3T1HF 4FPIA 3EWGA 4C0BA 4BHQA 5I3PA 3EGZA 5KFUA 4X84A 4I7FB 4DQRA 1N5VA 4IRDA 2J0SD 2UXCJ 1P1TA 4C2MA 2MEWA 5EDWA 2ZEJA 3OLAA 4N7TA 4ZVSB 4U8VA 1W7WA 1APSA 1KQGB 1MROB 4Y28C 2ZH1A 4QR2A 4WYWA 3CDWA 2OKQA 3F44A 3R5DA 3VAGA 4LR8A 2W24A 2EI5A 3ZTOA 1ZAXA 3CCQS 3D3BJ 1NK7A 2IA0A 4MIBA 5J2NB 4EBEA 4YOEA 2JZ5A 2CNNB 4XAKA 1YRTA 1X5OA 3HVWA 2HVHA 3FMBA 3ZZPA 2XCAA 1MMNA 3BKFA 1S6PB 2UXBJ 4NLOA 3T41A 1UA1A 1B4SA 3QIPA 4B3MJ 1KTVA 3PNIA 1HMVA 4R5PB 1QUPA 3DM2A 1YJ9S 4MH8A 4X65J 2OPQB 3N79A 3MEDA 2FGCA 2MKYA 4QZVB 2BV3A 2CJKA 1UETA 2B5JA 1F5AA 3HFKA 1QAYA 4CCHA 4CLKA 1FTRA 4EGLA 1NHVA 4C0OC 5GAEI 5CZXA 1ZBTA 1NSKL 3IBFB 2GFFA 1M5SA 1ZM4A 5A8WA 3NGUA 2HHHJ 2ABYA 2K7KA 2BA9A 2CQHA 2C2ZB 2NXCA 3EVWA 4QIVA 2CQ0A 1RYSA 1VQLS 4C3KA 1N54B 5B0AA 1UVJA 3SCLE 4QQBA 4JI7J 2Y0SD 4B3SJ 4X2BA 3GG0A 3H2LA 4YQWA 2GHWA 3KYLA 3FQKA 3PX4A 3BO4A 5HMYA 3UD4P 2UV8G 1S1WB 1N36J 2O67A 2R7UA 9RUBA 3NOGA 5M2PA 5E2QA 2XQCA 3SDEA 2Z57B 1DBDA 5J2MA 4EO8A 2EFNA 3HKWA 5C2CA 1X4DA 4LF1A 4X4NA 1RA6A 4DQSA 2D3UA 2HIQA 3BJYA 2IVYA 1FNXH 3IRXA 5CCLA 2UVUA 2F9JA 1YI2S 2AW0A 2F8EX 4NCGB 2B4VA 3FMWA 4C7QA 3U1MA 3M2UB 4LF2A 3KLIA 4NLQA 4DR7J 3FSYA 2IC3A 4YB6A 5KTQA 4DSIA 4FYYB 2EK6A 4QYZK 2YNHB 3MR5A 4RBVA 4LVNP 3KG4A 1LEOA 1GK8A 3ZTPA 3R1HA 2GQCA 1GTEA 4DR4F 4ETZA 3JAMY 4Z7YA 2WSEC 2H5EA 3BGRB 4RBTA 5A8KA 2BYCA 4J9KA 3LPEA 3BKTA 2UXBF 4OZ5A 3ENWA 2IM0A 2FIUA 2VC0A 2VKRA 4BDPA 4CLTA 2XMTA 4FBTA 2ATLA 4X65F 4ICLB 2FJVA 5HMWA 2DXFA 1JIHA 2HHUA 2YVSA 7FDRA 1G4CA 3NGKA 2VUGA 2R4FA 3B4MA 1J5OA 2KG1A 3M8SA 5FDLB 1WUUA 3DOKB 3N6LA 3KDNA 4GVBA 4IFVA 5KG1A 5BJRA 1C2PA 2HHHF 2F8MA 4B02A 4F4AA 3MECA 4RW8B 4KQZA 2G2YA 5F9LA 1Q79A 5AXKA 3R5GA 4U6PA 3BF4A 1YQHA 4LBHA 5CYMA 2UUTA 1FFGB 4ZVQB 3A8JA 3M9NB 2KFZA 4B3SF 2UVRA 3CIMA 4G1QB 3VVTA 3AJ2A 3KLGA 1JK9B 4F26A 2YNFA 3M8QB 1Q82T 1N36F 2UXDJ 4C48A 1I94J 3IGVA 2JEIA 1L3VA 4UOHA 2K8GA 3LAMA 4C8LA 2AJFE 1RT1B 1CJUA 2DPJA 4GKKJ 1HW8A 3LALA 4CLZA 2EG1A 5F8HA 1VLOA 2HNDB 2APOA 4RKUC 4EBCA 2EEYA 2WONB 2A6OA 2P9EA 1S1TB 2AT1B 3R7SB 1LWEB 1ROFA 2G2ZA 2D9OA 3NGDA 2VH7A 4QU6A 3M2VB 4CO0A 2W2MP 4J9LA 4I56A 3V6JA 2JLFA 1N5TA 3OL9A 1M5PC 2XY6A 1EX8A 4DR7F 4ECYA 4KHRA 1RT3B 5SUHA 3IBWA 2YPYA 1U0HB 4OJ1A 1B7YB 1VC6A 1FRKA 4P7VA 2R7QA 4C11A 5KG2A 4CNZA 4YB1P 4KTQA 4RW9A 2BE2B 2IIHA 1K9MT 1JJCB 5ETSA 1HHQA 4F0HA 3ZTQA 1FKPA 4FVCA 3C6UA 4L72B 1N33F 3BH6B 4TKTA 2VFVA 1F2HA 2N3OA 3ZZUA 4DMZA 1IN0A 2VOPA 2R8JA 4MK9A 4FS2A 2H4YB 3RG6A 3MZIA 4CM2A 2V8GA 5GAGI 4Y2IA 2CQBA 4ECTA 3GONA 4PYAA 3G82B 1CS4B 2BZ2A 3TOQA 3DRPB 3SFUA 3TAQA 4ELVA 1DLOB 3HSGA 2OELA 1CJTB 3MOZA 3LP0A 4U7UK 4Z2XA 3V4IB 3VALA 2E1PA 1YITS 5F0UA 2NZ4A 2XYHB 2MZSA 3AOBA 3CXCR 4ZVOB 1V3SA 3AFGA 1SJFA 4DFKA 2UXDF 1F3FA 2EFVA 4ECXA 4DV0J 4RW7B 1IJFB 2RUSA 3LWMA 2DHHA 4F0MA 5LSLA 1JLCB 3BO3A 1DHMA 2BW7A 1R89A 3L3CA 1W2IA 3EZOA
chains in the Genus database with same CATH topology
2AYEA 5J2QA 2E5HA 3G8QA 2R8GA 4KGMA 4DEZA 1IKYA 2E1AA 2XCPA 1S6QA 5E3AA 5HLFA 3JYTA 1BY9A 2HW3A 1RGVA 3MM6A 4EYIB 5FIIA 2ILYA 2PSZA 1QAJA 2FVQA 5KFGA 1DRZA 5HBMA 1TUVA 3ONQA 4X62F 2ZJQQ 2XMMA 4ZPAA 3G96A 1ULRA 2L9NA 3T5JA 1QLNA 1RAJA 1FNMA 4RNFA 4QIGA 2HQIA 1T05B 5G4DA 2ADCA 4K4SA 1HBMA 3OL7A 5F8IA 3HVAA 3O8WA 3J80Y 1TL1A 2VPWB 1FT8A 3RBEA 2VC1A 2BDPA 2KB2A 2CRLA 3OTBA 2AYBA 4HHJA 1JLQB 2KT2A 5A6WA 4NXNF 4OZJA 2PC6A 1LXNA 2UV8A 4DV2F 3PM9A 2VBYA 5E3PA 1R27B 2IRYA 1IKWA 2M2BA 2AF6A 2ZUGA 4WZQA 1QAIA 2HS4A 4ZP8A 3R5BA 4HI2A 4HT5A 4DFPA 3GV7B 2B7BB 3AB4B 5GAHU 4ED5A 5L1JA 2RIJA 4X4SA 2FHJA 2HRYA 4CZCA 3V81B 1U2RA 2HGNA 1OQ6A 1HA1A 1N48A 2R7TA 4KT0C 1VFJA 4YEAA 2DBBA 5E3CA 5DDQC 1C0TA 3MEKA 2LU2A 4BC7A 3J81Y 1KOHA 3HHLA 4ES2A 1DTTB 1U1OA 1NKCA 3E2EA 2KYXA 3ZZYA 3DRRB 1Z4UA 2V8HA 4OX7A 2J8AA 3I0RA 2J7KA 4K4XA 3OR2B 1GT8A 4H4KC 4C4WA 1HL6A 4FNIA 1SJ3P 4LF7F 3R1LA 1KC8T 1X0FA 2R7WA 2XS7A 4NZ6A 2WTFA 2I5JA 3K8VA 3QJLA 1TVRA 2MQLA 5KFDA 5KFCA 3GIMA 1OPIA 3QLHB 4M95A 4JOUA 4M63A 5B0GA 3HZEA 1LXJA 3KK1A 2BACA 3CCTA 3AQOA 3I6PA 1SJQA 1R6YA 2GO8A 3OSNA 5J2PA 4FPRA 4A8KA 1WF0A 3RAXA 1SJ1A 1U45A 2Y1IA 2DNGA 1UVMA 1T02A 2L41A 4ED6A 2YTCA 4ID5B 4V19J 3SSQA 5CYQB 3FRZA 4DS5A 1IUJA 1NJYA 4N77A 3T9ZA 2IA6A 5LMUF 4DQQA 1VRUB 3TYTA 3QWUA 4NLVA 4RWXA 2ZC3A 3FGVA 4M1KA 2B9XA 2OMLA 3MUMP 4C8MA 2HYIB 1VC0A 4RWWA 1RT4A 2A18A 2RU3A 2XMVA 1ELOA 1RQ0A 4FNHA 1S97A 3DGPA 2CQ1A 1HBOB 3W2VA 2R7OA 1HNZF 4QWAA 2BXJA 1S1UA 1VI7A 3BR9A 2KFYA 5I3UA 1H0HB 4KKOA 2MYFA 1PGZA 1Q86T 2JHEA 3HHKA 1U49A 2YWHA 1XMBA 4OI2A 3KK2B 1IKVB 4J5OA 4ZCIA 1B0PA 4PQAA 3Q8RB 1WF1A 3VWSA 1VQ9S 3PIOQ 4QW8A 3MURP 2EBGA 1D1UA 3T3FA 2J9DA 5A0YB 3BO2A 2YH0A 3OFGA 3HX9A 5HO4A 2HFZA 2RD5C 3IWNC 1LWCA 1TQLA 2G0CA 3H8YA 4IO9Q 2O01C 1H6KX 2YNHA 1SV5B 1WF2A 2KYZA 3RTVA 4LSNA 1U4BA 1S1XB 1KQSR 4YHHF 1GAOA 4OZ1A 4A8XA