1S1UB

Crystal structure of l100i mutant hiv-1 reverse transcriptase in complex with nevirapine
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
424
structure length
401
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWHPAGIKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Reverse transcriptase
publication title Crystal structures of HIV-1 reverse transcriptases mutated at codons 100, 106 and 108 and mechanisms of resistance to non-nucleoside inhibitors
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 113
structure length 401
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1s1uB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1uB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1uB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1uB03
1C0TA 1RTJA 4MK8A 1HYSA 1LW2B 3M8QA 3LP0A 2FVSA 1JXLA 4K4UA 4KV8B 3BSAA 4Y2AA 1SUQB 4ECXA 3M9NB 1TV6B 4LSNA 5D3GB 1IKYA 3KLFA 4O3QA 5F8HA 4Q44A 3OLBA 2HWIA 3SI8A 4MIAA 4WFZA 3PZPA 2YNGA 3HVTA 2AU0A 1DTTB 1JLFB 5KFBA 2W9BB 2FLNA 4RW7B 4TYAA 4EBCA 3FSIA 4EYHB 4NLRA 2I1RA 3IGNA 1N5YB 3MEGB 4YR3A 3IRXA 3GV8B 1RYSA 1S1TB 2VG6A 1QUVA 2WK4A 5KFXA 1Z4UA 4ECYA 2C2RA 4JV1A 1RT6A 1S48A 1EP4B 1JLGA 4MH8A 5CYQA 2OH2A 1JLQA 3I0SB 2FLLA 2WOMB 3MECA 5I42B 2JLEA 5F8JA 1N6QB 1NHUA 2FVCA 2HNYB 4NLUA 1K1QA 3DM2B 3PW7A 1RT7B 3DOKA 1S1UB 2FJXA 3SFGA 2J6TA 3ISNC 4IFYB 5KFWA 2OPSA 3T1AA 2UUTA 3EPIA 1HQEB 4IRDA 1IKXA 4NLYA 3H98A 1LWEA 2I5JA 2BANA 4KHMA 3QGGA 1TKTB 1S9EA 1C0UA 3KLGB 3QIPA 3LANA 2J6UA 2VA2A 5F8NA 3QLHA 1T3NA 5KFLA 5KG3A 1S1WA 1S1VB 4I2PB 4O44A 3KK3B 4F50A 2WONA 4Y34A 4J9KA 1SV5A 2JC1A 1HYSB 3LAMA 4URSA 4QWEA 5EUHA 3DYAA 3KK2B 5KG6A 4OL8A 1JLEA 4LSNB 1BQMA 4ZVHA 1KLMA 4NLWA 4GC7A 3MR6A 3KOAA 3OL7A 5L1IA 2YNGB 3HVTB 1XR5A 3FFIB 1JIHA 1JKHA 3PR4A 4IFVA 3G6XA 3T5JA 3T5LA 5DLFA 3KLEB 5KFDA 1EETA 4MKAA 3G6VA 5KG4A 4WYLA 2ASJA 5KT6A 3RB3A 2ATLA 4IRCA 1RT3A 4J9LA 5C24B 4NLQA 4WE1B 5F9NA 3N6LA 2VG6B 5KG7A 2DPIA 5HLFB 1RT6B 4J9NA 4K4VA 3EPGA 5CYQB 4M94A 1JLQB 3DRPA 4MK7A 2AGQA 3MECB 1S10A 1BQNA 2FLPA 3MFHA 1S9FA 5DGAA 3KJVB 4URGA 1HARA 2VG7A 4QW9A 1S0OA 1IKXB 2BANB 3KHLA 3IG1B 3BSCA 3N6NA 1S9EB 4ICLA 3CDUA 4R0EA 4KKOA 3QLHB 1UWBB 4MFBA 1RTIA 2ALZA 4FBTA 3CJ4A 4TY8A 1RA6A 2XI2A 1S1WB 4O44B 5KFGA 3MFIA 2HAIA 3H5YA 2WONB 4ED3A 3N6MA 2XCPA 4TQSA 1SV5B 1DLOA 3CWJA 3DYAB 3Q8RB 1IKVA 5KFFA 1BQMB 1KLMB 1JLAA 1S9GA 5F8LA 4H54A 1DTQA 1RT4A 4G1QB 1FKPA 4I2QB 3QIDA 4ZP7A 3BSOA 5DG9A 2EC0A 3CVKA 4YMEA 1JKHB 4IFVB 3C6TA 4IDKA 3FRZA 4HYKA 1EETB 2JEJA 2RDIA 4NLSA 1QAJA 1RT3B 4NRTA 4ZP6A 4M95A 3V6HA 2CJQA 3UR0A 3H5SA 4IH5A 2RKIA 3MR2A 4EBDA 1RAJA 4EO6A 1XR7A 1BQNB 3CJ0A 2AX1A 4LSLA 3OSPA 4MKBA 3RB4A 4RNMA 1LWFA 3LP2B 5CYMA 1C2PA 5JUMA 4WFXA 4F4WA 1S49A 3ITHA 1FKOA 1U09A 3EZUA 3NMAA 2ZD1A 4PQUA 2WTFA 4PUOB 2W9CB 3DOLA 1ZETA 3FDSA 2XGPA 4ZHRB 1RT2A 3MF5A 4ED0A 4ICLB 2FVRA 4O3OA 1REVA 4MIBA 4KKOB 5F8GA 4MFBB 1HMVA 1IM4A 1K1SA 3PJXA 4TY8B 1RTDB 2V0NA 1KHWA 5L9XA 3C6UA 3TVKA 4RUAA 4F4YA 4KO0A 3PHEA 4WXWA 1DLOB 1MU2B 1TVRA 1HNVA 4YR2A 2R2UA 1RT5A 3DRSA 4DL5A 3NAIA 1S9GB 1GX5A 1DTQB 1RT4B 3OLAA 1FKPB 3IN5A 1HPZB 3V81B 3G86A 5KG2A 4WZQA 4TY9A 2IAJB 5F9LA 1VRTA 5DGBA 3C6TB 4IDKB 3CO9A 4RW6A 4IG0A 2HNDB 4Q45A 5KT7A 3H5XA 3NL0A 5DG7A 1T94A 5KFUA 2DPJA 2IM1A 2YNIA 2RKIB 5I3UA 3FQKA 1JLCB 3DMJA 3H4DA 4EBEA 4LSLB 1TKXB 4O3RA 3QGHA 3MR5A 3DLGB 1NNDA 2BQUA 4WZMA 2AWZA 1FKOB 4LQ3A 4ECQA 2ZD1B 4PQUB 2F8EX 2GIQA 4ECZA 3DOLB 4O3PA 3GV5B 3DDKA 3LALA 4I7FA 4H4OB 5J2QA 1REVB 4NLPA 2OPQA 1XR6A 4WXOA 4RW4B 5EWFA 1HMVB 4YP3A 1C1CA 5K14B 3BR9A 4ECRA 3I0RA 4H4MA 4RNOA 3BQ0A 4RW9A 4J9RA 4F4ZA 3PW0A 4KO0B 2E9ZA 3DLEA 3DLKA 2JC0A 3D5MA 1VRUB 5DQGA 2E9RX 1TVRB 4RNNA 1C0TB 1RTJB 3DRSB 3M8PA 3V6DA 5HROA 1T05A 3I5CA 4ZP9A 2GIRA 3M8QB 3LP0B 3OL9A 3NBPA 4DL4A 5KFNA 2WB4A 3LP1A 1VRTB 1RT1A 1TKZA 4B3OA 3GIJA 3FQLA 2B6AA 2XGQA 2W7OA 1IKYB 3KLFB 4ZPAA 1QE1A 3RBDA 1JX4A 5L1KA 3RBEA 2XC9A 4DL7A 1T03A 4RW6B 3GV7B 5J2NA 3IS9A 2CKWA 2R2TA 1N4LA 4ID5A 1FK9A 1S97A 4IG3A 2YNIB 3V4IA 3M9MB 1S0MA 4FS2A 4DL2A 4RZRA 2V9WA 3IRXB 2YKNA 4O4GA 3Q8QB 4RNHA 4ECVA 2IM2A 3PVXA 2QV6A 3T5HA 2RDJA 1JLGB 4RU9A 3BQ2A 2QE5A 3QZ7A 4KFBA 1S6QA 2UVRA 4IR9A 5JXSA 3KHRA 3KMQA 3DOKB 1J5OA 3CJ5A 3H5UA 1C1BA 2OPSB 3CDWA 4R5PA 2B43A 1SH3A 4DG1A 4K4WA 4I7FB 5J2QB 3ISND 4ED8A 2OPQB 4QW8A 1HQUA 2I5JB 1LWEB 1C1CB 4XO0A 5KFRA 2ASDA 3HKWA 2UUWA 2AQ4A 3I0RB 2B5JA 4H4MB 1R0AA 2FVQA 1C0UB 2ZE2A 3QIPB 2WCXA 5KFVA 3QO9A 4ZPDA 5J2PA 2W8KA 2YNHA 1TL1A 2OPPA 3ICLA 4KHRA 4QWAA 5HROB 2O5DA 3V6DB 2FJVA 2OPRA 1T05B 2XWYA 1RDRA 5KFQA 2YKMA 5EDWA 1HNIA 1TKZB 4B3OB 1JLEB 4NLTA 1S6PA 5HBMA 3DI6A 1T03B 5KFOA 4NRUA 4TYBA 4ECSA 4ED7A 4NLGA 2WRMA 2YNFA 2W7PA 4ID5B 1FK9B 5L1LA 1RYRA 3KNAA 4NLXA 3CDEA 4Y3CA 3KK1A 1LW0A 1LWCA 5KFHA 1D1UA 2YKNB 4K4XA 3I5BA 4NLOA 3NGDA 4GC6A 1TL3A 4KFBB 3DRPB 1S6QB 2FJWA 3H40A 4DEZA 1S0NA 1KHVA 5DLGA 3RB0A 4RUCA 4NCGA 2BRKA 3QYYA 3KLHA 1J5OB 4KSEB 2IM0A 3NKYA 1NHVA 3H59A 3MR3A 4R5PB 2VG7B 4DG1B 4KV8A 4QPXA 1SUQA 2IC3A 1HQUB 2D3ZA 1TV6A 2AGPA 1R0AB 1D0EA 1N56A 3UPFA 3MEEA 3PW5A 2IA6A 4HKQA 2YNHB 4X2BA 1RTIB 2OPPB 3Q8PB 4WFYA 2R2SA 4ZPBA 2OPRB 3MEGA 3DRRA 4EEYA 4IQXA 2YKMB 3KMSA 1IKVB 1HNIB 3JYTA 1EP4A 5HBMB 1JLAB 3HHKA 2BQRA 3DI6B 3RB6A 2V4RA 3I0SA 2JEFA 1WNEA 5I42A 1RTHA 3T19A 1N6QA 2AGOA 3KLVA 4MK9A 4ZP8A 4TLRA 2IJNA 5F8IA 1LW0B 2HMIA 1TP7A 3E51A 4ED6A 2BQ3A 5KFEA 3JSMA 2UVWA 5J2MA 5KFCA 1S1XA 4JUZA 5C5JA 5L1JA 1QAIA 1TKTA 3GIIA 2IM3A 1TL3B 3KLGA 5HP1A 4TN2A 4URQU 1JLBA 4KE5A 3I5AA 5KG0A 4NCGB 1S1VA 1LWFB 5CYMB 1I6JA 4TQRA 3TAMA 3M9OB 4ED2A 5KT2A 3ITHB 4R8UA 2VG5A 3KK2A 2IC3B 3CIZA 4NLVA 4YR0A 2R8JA 4ZVFA 1IKWA 1RT2B 1MMLA 4IH7A 3MEEB 3FFIA 1ZTTA 1GX6A 2R8KA 3KLEA 4EYIB 4IR1A 2JEGA 3C6UB 3BQ1A 3DRRB 5C24A 4WE1A 4K4TA 5HLFA 3NAHA 4KAIA 2W9AA 1HNVB 4U6PA 2JEIA 1RT5B 3JYTB 2WHOA 2FVPA 3SFUA 5DG8A 4ECUA 3CJ3A 3PR5B 1RTHB 1CSJA 4K4SA 4F4XA 4YQWA 4IG0B 3KJVA 4XPCA 2HMIB 3JSMB 4ZMMA 5J2MB 2IMWP 2IBKA 1S1XB 3IG1A 4XPEA 4O4RA 4K4YA 5I3UB 1TQLA 5HP1B 3DMJB 3TQ1A 1JLBB 2R8IA 1UWBA 3H4BA 3OL6A 4RW8A 5C42A 4PWDA 5C25A 4RNFA 1SH2A 5KFZA 2ASLA 1N48A 3TAMB 3BGRA 1W25A 2BE2A 4R8UB 2VG5B 2D3UA 3QZ8A 4K50A 3KHHA 4K4ZA 4NZ0A 3E01A 1IKWB 1RA7A 2UVUA 3PW4A 4G1QA 2IJFA 4I2QA 3HVAA 5KFIA 2XCAA 2C2EA 5KT3A 1ZTWA 5EWEA 2BRLA 3KLIA 3HVWA 4IRKA 2ILZA 4J9MA 5KG1A 4RW9B 1SH0A 4Q0BA 1YVFA 4FS1A 3DLEB 3DLKB 3QGIA 5J1EA 4ZPCA 3VQSA 3M8PB 3CJ2A 4DL3A 3NBPB 4NLDA 4J9OA 3MEDA 4O3NA 3IGVA 2R8GA 3LP1B 3D28A 1RT1B 3T5KA 2B6AB 3LP2A 4Y2CA 1QE1B 3GQCA 4FBUA 5J2NB 3IS9B 2D7SA 4JV2A 2RF2A 4LQ9A 2HNZA 4PUOA 4JV0A 4IG3B 2W9CA 2R8HA 2C28A 3V4IB 4ZHRA 2D41A 2XI3A 5KFSA 5KFAA 2E9TA 5KFKA 4O4GB 3RAQA 4J9QA 5DQHA 4RW8B 5FDLA 5C42B 1RTDA 5C25B 4PWDB 4IH6A 3GYNA 4QWBA 3PW2A 3BGRB 1MU2A 2BE2B 3UQSA 3E01B 4WYWA 4QWDA 1C1BB 3BREA 4ED1A 1LW2A 3PJWA 4DL6A 5F8MA 1HPZA 3V81A 5EWGA 3BJYA 2IAJA 2C2DA 2J6SA 4O3SA 4IKAA 4NYZA 5T14A 5D3GA 4TXSA 3KLIB 3LAKA 2B5JB 3G6YA 2ZE2B 3OSNA 2BR0A 3QO9B 5J2PB 4Q0BB 2HNDA 1DTTA 1JLFA 5KT5A 5J1EB 2W9BA 1TL1B 4RW7A 2ILYA 4IOBA 5KFMA 5KG5A 4J9PA 4U7CA 1JLCA 1N5YA 4EO8A 2ZKUA 4QWCA 4ECWA 3Q8SB 1S1TA 3MEDB 1TKXA 5KFYA 3DLGA 4J9SA 2HWHA 4ECTA 5KFJA 1S6PB 2UVVA 3RAXA 2GC8A 3OHBA 2WOMA 3UDLA 2HNYA 3OL8A 3DM2A 2YNFB 1RT7A 2RF2B 4ZVGA 2HNZB 1S1UA 5KFPA 2W8LA 1S4FA 3GIKA 3KHGA 4IFYA 4Q8EA 3KK1B 4KBIA 1LWCB 3BSNA 2R2RA 5DQIA 1HQEA 4H4OA 4KB7A 5KFTA 4Q8FA 3H2LA 1OS5A 2V4QA 4RW4A 3V6KA 3GILA 5K14A 2AX0A 5FDLB 3V6JA 4G3IA 4ZVEA 2C22A 3OHAA 3GIMA 5KT4A 3MTKA 4Q43A 1VRUA 2VA3A 3KLHB 4I2PA 3KK3A
chains in the Genus database with same CATH superfamily
1C0TA 5GAHI 3LP0A 2OLWA 1TV6B 1U6FA 3DRXA 1RHMB 1FEHA 2VB6A 3IGNA 4EUVA 4DV4J 1S48A 2EPIA 2OH2A 1Y7PA 2H4YB 1Q81T 4NLUA 3R5BA 4A8WA 4ZJOA 3HVRA 3ISNC 4FYWB 4KGMA 3PG9A 1PAUB 2W2NP 1Y9OA 1C0UA 3QIPA 5HN0A 3SEOA 3W65A 2OHDA 3R7BB 4ZS6A 2HQDA 3RGIA 2QTWA 4USIA 1VQKS 3BBCA 4A8XA 2QA1A 3GFHA 4ZLPA 1U1PA 2KZMA 2W4PA 2ASJA 2DH8A 5KT6A 4ZN3A 3PYDA 5T41A 1NK6A 2DPIA 4HT5A 3K57A 3P5TL 1M5HA 4X84A 2PA8D 2P9EA 3CDAA 1S77D 2BANB 3IP0A 4O23A 3CDUA 1ELOA 4TY8A 1S1WB 4ED3A 4TQSA 3J7ZT 3TQEA 4I4BA 2APOA 2PA3A 4H54A 3QIDA 3DGPB 4IDKA 1VFJA 1WHVA 1QAJA 3KDNA 5HAOA 4F8RA 1TMJA 4C8YA 1YKWA 2DXEA 3BYPA 3BB5A 3LP2B 3K8WA 4MKVA 3FVYA 3DOLA 3B8HA 1ZETA 4KKOB 4MFBB 4A4JA 3VVTA 1SIZA 2J7KA 4C7QA 3C6TB 1X4BA 2ZZMA 2DNOA 2DITA 4EBEA 3ENWA 2ROPA 3A8JA 1WC6A 3A3NB 3P8BB 5HJYA 2DR9A 1FFWB 1DHMA 1C0TB 3LP0B 5GADU 3NBPA 2JFDA 2W7OA 2L41A 4ZPAA 1N54B 3TR5A 1G4CA 3CMQA 1SPBP 3M6UA 5B0AA 1Q86T 2BMBA 1IR0A 3KMQA 2Y1JA 5J2QB 4XO0A 1KWMA 1C0UB 3KJQB 3QIPB 2VKRA 4KGZB 1OMSA 2N7CA 2MZJA 2JLFA 1RDRA 1YITS 2ATCB 2IRYA 2JZ5A 1DZ5A 2LFVA 3I5BA 2FJWA 3H40A 1A6LA 3VWSA 2YBVA 2KYZA 3A4TA 3POTA 3C16A 5K5MA 2ZNZA 3MXHP 3PTWA 3MEGA 3BGFA 4DV4F 3N79A 3HHKA 1P8GA 2A0FB 2QL5B 4K7QA 1QAXA 5E3QA 1TP7A 1NK8A 3CXCR 3SCKE 1QY7A 3KLGA 4TN2A 4URQU 3VAFA 2W4DA 4ED2A 2W2QP 2DNQA 1Q7LB 1NSPA 4B17A 2N82B 3NP5A 3W7BA 2D69A 3UFCX 1YDLA 5D0RA 4U6PA 2FVPA 3GJQB 4XPCA 4DR1F 3QAEA 3W5XA 1S1XB 5KFZA 4F36A 5C2GA 2VQEJ 1YRXA 3SSRA 4AFFA 4PCQA 1KBRA 1YVFA 3M4XA 1Q16B 3IXQA 2QMUB 2K2PA 4RX6A 5HMZA 3NBPB 2FY1A 2XBPA 4ZCIA 4Y2CA 1VIXA 2D7SA 1PJ5A 3UDVA 2Q6CA 5LM7E 5KFAA 5CCLA 2PEBA 1FDAA 3FBCA 5C42B 2BDPA 1UJ6A 4PYAA 4QWBA 3LPEA 3IO1A 1PBUA 2GAGC 4U9RA 4TU9A 3R1LA 3O44A 4OIXA 3W5YA 4O3SA 2FUG9 5D3GA 3LAKA 3HHLD 4C8ZA 4J7CA 3TEGA 3NXZA 2FGOA 3PRBA 2RQMA 4BDPA 4OZ5A 3O6QA 1TL5A 1Q8LA 1J5EJ 2HWHA 1HI0P 3OHBA 3UDLA 1H6KX 3QNWB 3KHGA 2EKYA 3FMWA 2FGCA 3V6KA 1Q82T 3KK3A 2IHR1 2KFNA 3R6GB 2V2VA 4O3QA 3MEKA 1IKYA 3SQGA 4Q5VA 2Q43A 3MEGB 3GV8B 4P9SA 1RYSA 1CJTA 4DUYF 3LTOA 4OLOA 2HFUA 2EFQA 1RABB 3K5PA 3T1AA 1FNOA 3GTYX 4IRDA 1O0PA 4PXBA 1W2IA 3KLGB 1WHYA 4QJVA 3ZNJ1 1RISA 2QLWA 4URSA 3DYAA 5KG6A 4M8LA 2WW8A 4EZ9A 4GC7A 3CC4S 1P27B 5KFDA 3UCZP 1UKUA 1NDKA 1R8HA 2POKA 3MAQA 3D68A 2MQNA 4QW9A 2BJ3A 2M8DB 1Y00A 4OYZA 2ZH5A 3BO3A 2XI2A 4HR2A 2CWKA 2ADBA 2NS1B 3BSOA 3U1MA 1LOUA 3QRQA 3UD4P 4OHZA 2F65A 3UR0A 5LSRA 1WHXA 3UVJB 2VF3A 2Y8WA 3MI7X 3PKMA 1S49A 2ZD1A 2WTFA 3ZZPA 4TKTA 2HBYB 3MF5A 4BCAA 4DR6J 8RUCA 1MNEA 4ZVTB 3T6BA 2AJFE 5THWA 1YJ9S 4ANDA 5LJ5Y 1OYDA 2K3IA 1NZAA 4WZQA 3G86A 1LV5A 2FPHX 1VQPS 3FCWA 3GCWP 3DMJA 3OFEA 1V5IB 3M6XA 1NNDA 5KOXA 1SL2A 2GIQA 4BC9A 4O3PA 2VQEF 2F3JA 4N41A 1C1CA 3C15B 5D4LA 5DQGA 1T7PA 2GIRA 5ETOA 4OYBA 4OZ1A 4M5HA 1RT1A 4B3OA 1IKYB 3SQGB 3I4PA 3GU0A 1KDNA 4RNHA 2RDJA 4RU9A 3BQ2A 4IR9A 1WI6A 3Q2SC 1X9MA 1IJEB 2WB1D 1SH3A 1SJRA 2J9CA 4H4MB 1R0AA 1S6OA 5J2PA 5DRKA 2OPPA 5D0EA 3WX8A 1HNWJ 3M2VA 1B70B 3CO0P 2DGUA 3D2WA 3NCRA 2ABYA 3KNAA 4QYZK 3BKUA 2GQ2A 1SJ4P 4LRBA 3W61A 3T1YJ 3SMZA 2BRKA 3KLHA 4KSEB 4RBTA 2G1HA 4R5PB 1F3VA 3UCUP 1DAXA 1AXQA 2IPOB 4DLEA 4X2BA 1E6YA 3FEZA 2YKMB 3E3XA 1FFGB 2HHVA 3I0SA 2QFJA 3DXSX 5F8IA 2BQ3A 1HBUA 1ZM4A 3MM6A 3GFXA 2ZNYA 4KE5A 3I5AA 5EX0A 1TMMA 1IBMF 3D0GE 1D8ZA 2KFYA 3MEEB 4USTA 3CULA 4YDXA 2V67A 1TL4A 1Q5YA 4LT6A 1AA1B 5HLFA 4DR3J 2XM3A 3CJ3A 4P2FA 4LF5J 2M9KA 2PN6A 3MMCA 4LF6J 5J2MB 1U1LA 2MLZA 5A8RB 3DMJB 1FJGJ 3H4BA 2MKHA 4RJVA 2CA9A 3MAHA 4R8UB 2DR7A 2VG5B 3MMAB 3KHHA 4NZ0A 5BYSA 2J5AA 4CLZA 5HVHA 4H4KC 4A8KA 2WVEA 1UPPA 3MEDA 3HX9A 1VBYA 1RT1B 4FYXB 3T5KA 4PG5A 2OD4A 1FKAF 2MXYA 4FBUA 1ULRA 2IVFB 2RF2A 1UTAA 4DR6F 1A0OB 3DLLQ 3LPYA 1UEVA 4NWBA 2YXLA 3US5A 2XO6A 1Q95G 4ED1A 1Q79A 1R0CB 3V81A 3BJYA 1R8CA 4FN5A 4GMKA 1HI1A 5J2PB 2VFVA 4RW7A 2RVJA 2B7CB 4U7CA 3MTJA 2JVRA 4OJ1A 4ZA1A 2QYGA 2UVVA 2ZDPA 4P7TA 5KFPA 4IFYA 3G96A 3QJPA 3GILA 3P5BP 3AQPA 1RSCA 3KLHB 4I2PA 2E7XA 1HYSA 2DEIA 2KT2A 3C66A 4DQIA 2YX1A 1E6YB 3HMJG 1HW9A 4NLRA 3QWUA 2ZH3A 1S1TB 2F7VA 4X66J 1L3UA 3GIRA 1DQAA 3I0SB 2FLLA 1WC5A 5DJBA 1HBUB 4PR6A 2VA2A 3QFHA 2VUGA 3D1HA 2WVDA 2ZM6J 2FHKA 3M8YA 2ZUGA 1NHKL 2HVHA 2MLYA 2WBRA 1FXLA 3HCXA 4GKJJ 3H90A 1PJ7A 4WYLA 2QLBB 5HLFB 3R7SB 2RILA 5HK4A 4AD6A 1KOHA 3MMCB 2KRBA 1RHKB 1X5OA 3I6PA 2MHNA 3R5JB 1KLMB 4DR4J 2JEJA 2RDIA 3VALA 4X62J 4ZOSA 2GMHA 2B4OA 3NS5A 1XR7A 4UOHA 3UDEA 1U24A 4KY3A 3THPA 4X65F 3CCZA 5F3TA 4DV6F 4ED0A 2DCLA 1UFKA 3FEXB 3GJTB 3VAMA 3K17A 3ILIA 1VLYA 2MQPA 1RT4B 3V81B 1CJKA 1TUGB 5FLXY 2V8PA 4LF5F 3BV8A 3K5MA 4LF6F 3AXMA 1M5SA 2EEYA 4CO5A 4O3RA 1TR0A 2J8SA 2I6WA 1DRZA 1FO1A 1UEUA 3BQ0A 1DURA 1HHQA 2K7JA 1R6VA 2OUGA 1RP5A 1X4GA 4WP3A 2WB4A 3FQLA 5L1KA 1T03A 1I3OB 4USVA 4ZVUB 1FK9A 4RZRA 1N32J 4U95A 2VJUA 2VKZG 1WOOA 3HKWA 3I0RB 1TUVA 3ICLA 3JS9A 2Q6BA 4LIRA 1RB0A 4KC5A 3FMBA 3DI6A 2R9LA 4ED7A 4ECSA 2ZOMA 2V6AA 3LF0A 4U96A 2PD1A 3NGDA 3DKDA 3W8PA 2V8HA 2E7WA 1Y5LB 3KXDA 1F0XA 1ZAVA 1PCAA 2XY5A 1N56A 4OYIA 1FVQA 2A18A 3HXMA 3FGVA 3K58A 2B7BB 3DRRA 2NSBA 4X4TA 2NXEA 1EP4A 2V4RA 5K8OA 4TLRA 4YB5A 3SV3A 4P52A 3QWPA 1LW0B 4DN0A 4WPAA 1RKJA 4ED6A 2RE1A 3WQPA 5IT9Y 2G0JA 1RU2A 1TKTA 3GSIA 4Y2MA 1AROP 3CCMS 2ZM6F 5IZHA 3UN5A 4DLGA 2MHEA 4DPYA 4IH7A 4A8MP 1M1GA 1FA0A 3VZHA 5CA5A 3I31A 1NXIA 2E66A 4GRSA 2QSFA 3TX0A 3J7YU 5DDOC 2IMWP 4HHJA 3JB9k 2V2KA 3CCVS 2GVZA 4DQPA 2RRNA 3K5NA 2V5HG 2IA0A 4G1QA 4DR4F 2HZAA 5KT3A 3KLIA 3N5BA 3GMGA 4CRJA 3W9IA 1KVJA 1EKSA 4J9OA 4O3NA 3D28A 3O1LA 1KFSA 2EI5A 4JV2A 1VQ4S 4NMXA 3CUNA 4YUDA 5CD4A 4LF8J 4ZIWA 4LF4J 1XMQF 3GZ7A 4CLTA 2WVCA 3T9ZA 1VIOA 3SCLE 1UFWA 3CC7S 2W24A 1F5AA 5KFMA 5KG5A 1AUSL 1VQLS 4LR8A 2EK1A 1N34J 3V4MA 1S4FA 4U8YA 4I68A 3I9V9 2V4QA 2AKWB 2GGPB 3MTKA 1WG5A 3HSJA 4KHMA 3MCOA 1RTJA 1U1MA 5AE3A 3WC0A 2OGUA 2HZCA 4WFBQ 3M32B 3NG8A 2IDLA 4YR3A 2Q66A 1PILA 2LA6A 5KFXA 2R7OA 1EP4B 1N32F 1JLQA 5GAEU 3MECA 3D6MB 3DM2B 3H20A 3M8SA 2MTLA 1TKTB 1UVIA 3K2YA 1S9EA 4EU0A 1BGXT 3DLJA 4CT8A 5KFLA 1CC8A 1IQTA 4Y34A 2RD5C 1U1RA 3RU0A 1FRMA 2MYFA 3OTBA 2E44A 3O3LA 2YNGB 3L3CA 4F02A 4USJC 3CCJS 3A12A 1RWPB 1RLCL 4F2RA 3FSXA 4K8RA 4LR7A 1HARA 1YX2A 4ETXA 1JJ2R 1IKXB 4TLQA 2GVZB 1F5CA 1SV5B 4OYPA 4DV5J 4G1QB 4TU7A 4Z2XA 4DZDA 5HMWA 1F2GA 1EETB 4HTIA 4QIEA 3F56A 1GT8A 4LSLA 3BN7A 1W7WA 5E41A 1NCLA 4EMDA 1JJHA 2G13A 1FTCA 3TZXA 2CNKB 3T9NA 1FJEB 3R3TA 2AYGA 4JBCA 2VL1A 3VHQA 3B4DA 1KKHA 3OJUA 2JNJA 1KQSR 4KIAA 1S9GB 2YWGA 4JYAJ 1FRXA 5GMKa 3TA1A 3DNCA 3PIPQ 4ZVPB 3FJ2A 3OR1B 4HLBA 2E1AA 5I3UA 3FQKA 3IWNC 1FRLA 3D6HB 2YVSA 4OHXA 3GV5B 1ZOTA 1NDLA 1WKJA 3PRVA 3KUGA 1RUSA 2PGCA 3DLEA 3DLKA 3D5MA 3G4SS 1U1NA 1FNXH 2E9RX 1OJ4A 3BEGB 1RTJB 5HROA 4DL4A 4YS2A 3CJSA 1BD6A 5CHCB 3RBDA 1QE1A 5AXKA 5GAGU 1S97A 2HS4A 4DL2A 2QV6A 2FHMA 1S6QA 1LNQA 3KHRA 3NWRA 1C1BA 4LF8F 3RG6A 2B43A 4LF4F 4DG1A 4QW8A 3K5LA 2YNHA 2PIIA 4P2XA 4FYDA 3J80Y 2OELA 1T05B 5IWAJ 3MAAA 4C11A 4DSFA 3F0NA 4P73A 5KFOA 2KO1A 3CMES 1Z2LA 4K4XA 2FY8A 4DEZA 2PMZD 1J5OB 3NKYA 2IM0A 2HHHJ 1S5ZA 3FNNA 4Q7AA 2JLGA 1V3ZA 2EFOA 2B9YA 1NH8A 1HNIB 1X8DA 3PYGA 6AT1B 1XQIA 2L9WA 1CG2A 1RTHA 4MK9A 3M8ZA 2PFFB 1YJ7A 2Z2LA 3ZFVA 2RQKA 3DGVA 3RBZA 4ZVRB 2VONA 1FESA 2IC3B 1U0SA 4ZVFA 4WCEQ 2E5GA 5E3AA 4EYIB 1BLUA 2CVEA 1LK5A 2VBZA 2CPYA 4LRAA 3NOCA 2GMLA 4V1Ak 1WSRA 2PDAA 2WHOA 1UP1A 4DN9A 2H1YA 3SCIE 4UUXA 2R4FA 1SQEA 2FQQB 2EW9A 1FCAA 3QSIA 2DT9A 4K4YA 3AY0A 5I3UB 2AJ1A 3TQ1A 1G2EA 1G1XA 4RNFA 3BBFA 1Y3JA 2JWNA 5IC4B 3M2UA 4DV5F 3EXYA 2XCAA 3A1YG 4FP9A 4HHHA 3TYTA 1T11A 2DNMA 5B0EA 2AMCB 1GFWB 4CDIA 4FS1A 3DLEB 3DLKB 5L39A 1QE1B 2X7IA 2HNZA 4PUOA 1SC4B 2E9TA 4J9QA 2BACA 3OV7A 5B7WA 2CQPA 4PWDB 1XMBA 4RPFA 4DV0F 4LF7F 1DQ9A 3J7AN 5HQMA 1C1BB 1BY9A 1EKRA 5EWGA 2CPFA 2J6SA 4JYAF 1AYEA 3G6YA 2X1FA 4X4NA 4N56A 3DFEA 4DFJA 2F9JA 4YN3B 2KVQE 2NLWA 2DHXA 5KFJA 4CP5A 2HZVA 3OL8A 4YEAA 4KYZA 2OFGX 4QCLA 3J81U 2ZH7A 4G3IA 4F0KA 4M5IA 3SSSA 4BBYA 4UTGA 1BUXA 2DR6A 4Y2AA 2LDYA 3PZPA 1DTTB 2GV1A 1YQHA 2H5EA 3N28A 2BA9A 3KFWX 4HEA9 4QIVA 3PV8A 3ETOA 3MM8A 2J6TA 1RJJA 2HBQB 3CEDA 4ZPWR 1VDHA 5IWAF 1JLEA 1BQMA 4IFVA 1URNA 3M2RA 1F60B 3RB3A 1FTRA 3ILLA 2VG6B 2DO0A 1FVSA 2MKJA 2EFPA 3LGNA 1S10A 2MKSA 2NXCA 3PX0A 4V19J 1I1GA 2RMLA 4ICLA 5LMUJ 1RAEB 1RTIA 4LVNP 4LIWA 3W64A 3U1LA 4Y0FA 3FSYA 3NCPA 2BOPA 3M2UB 2XWXA 2FLOA 4C8NA 2BKOA 1HFEL 2QC3A 2HKEA 2MDAA 2WZ1A 3QT5A 5DO2A 7FDRA 3CCUS 2OIHA 3K8VA 2UXCJ 3N4WA 2C2ZB 4ZCKA 4J91A 4PUOB 2XGPA 4DJBA 2V8DA 4ES1A 1S72S 4UZBA 1XK8A 1FKPB 2NXNA 1EIYB 4TY9A 1VRTA 2DRBA 1L3TA 3TUPA 4Q45A 2HVDA 4A8YA 4ED4A 2MKYA 1LK7A 2ZWOA 4CYUB 3OPKA 2EG1A 4EZ6A 4PQUB 1YK9A 4USUA 2OPQA 1VQYA 1HMVB 3BR9A 4DCJB 2B0GA 3C19A 3PW0A 2QA4S 2HFVA 1TVRB 4FPIA 3DRSB 4Y00A 4FPRA 2GFFA 1TKZA 2B6AA 3QGPA 3MD3A 2R2TA 1N4LA 2WBMA 3JQKA 2M8HA 4RBVA 2HBZB 3LWLA 3BGLA 3MM8B 4DI6A 2E5JA 5BYQA 4ED8A 5JVHQ 2QG9B 5KFRA 1SC6A 2UUWA 4C9DA 5IQQA 3HKZD 3V6DB 1OO0B 1JLEB 4NLTA 2MGZB 5JMNA 3CJ8A 4ID5B 3M2RB 3D1OA 2YKAA 2HLTA 3KK1A 1U2RA 2VQFJ 5L46A 1XJWB 3DLHA 4R0JA 4OX9F 1OY9A 1TL3A 3TJ8A 3THTA 4NEYA 4F7VA 1NHVA 3BDPA 3OJSA 3X3UA 4ZIVA 1SUQA 1N0UA 4C3KA 1W2BR 2IA6A 1RTIB 1Q53A 2GHWA 4G1IA 3TAPA 1YJVA 2HS3A 3JXOA 3VGVA 3CD6S 4I67A 3L7PA 5A0YA 1FRJA 4NCBA 1TK0A 2IJNA 3EMTA 4OFZA 3HJVA 5L1JA 2LU1A 3W2WB 5KG0A 4DSIA 4YDDB 1I6JA 4ELUA 5E3CA 5G0RB 1H38A 4M5NA 1XERA 3RUBL 1B4SA 4NLVA 1Y5IB 4DS4A 3EXCX 4ZN1A 5ETTA 3KLEA 3EGZA 3NAHA 3ZTRA 3OFGA 4M5DA 4HDGA 1R8PA 2HURA 2ZVSA 1X4DA 3IG1A 4O4RA 4P2SA 5LMUF 3TX8A 1KNZA 2EKNA 2EFGA 2P9CA 3E01A 4MKYA 2ZWPA 1NMEB 5KG1A 1C4AA 1K73T 3IR6B 4A48A 2QEXS 2B6AB 4DPXA 2UXCF 3GJRB 4QR0A 1UFLA 3ZZYA 4DR7F 4I69A 3GR1A 5FDLA 1RTDA 3HZEA 4RKUC 1Y5NB 4OI6A 1MU2A 2WVBA 5LSOA 1U6BA 3PJWA 1QSLA 2FB0A 3OSNA 4FZVA 2AW0A 2BOAA 4WKRA 1TKXA 5E3PA 4ZVGA 3W62A 2W8LA 2NREA 1H3DA 2DIVA 3N0VA 3KK1B 4KBIA 1U8SA 3V6JA 5B0BA 4IUFA 1SUQB 1T0TV 5F8HA 2ROEA 1N5YB 2IIHA 1Y0HA 3IRXA 1IUJA 1MN9A 1RT6A 4PXDA 4I1TA 2JLEA 5A0YB 1NHUA 2HNYB 3S1TA 5KFWA 3MMJA 5LJ3Y 3WDOA 2EC2A 1GTHA 2A2CA 4DXLA 3QLHA 2ZUAA 3RAMA 3LAMA 3AA8A 1FXRA 1WEZA 2DY9A 3HVTB 1JKHA 5IV3A 3KLEB 1U2FA 2VQFF 4M5DB 1R89A 3W9JA 1VRQC 3PCOB 2VG7A 3IG1B 4OJ3A 3N6NA 1UETA 4K59A 2CWXA 4O44B 5E7OB 1H2UX 4DX6A 3A8KA 1CEZA 2LQJA 2UU9J 4NRTA 1GXLA 5HQLA 1O51A 2VPZB 3TEHB 2CXEA 3CJ0A 4MKBA 1NKEA 3EZUA 1F9HA 2FC9A 3FDSA 2DRAA 2DNRA 1XEZA 1RTDB 3O5TB 1CBKA 3PHEA 3I82A 1DLOB 1MU2B 2Q3PA 4JB8B 4ZJQA 1FHTA 3AOCA 4ZJLA 2EXUA 2HFNA 1R6YA 2ZBCA 1U49A 1T94A 1NK5A 2G9OA 2RKIB 1TL7A 2E5LJ 1RU1A 1TKXB 1H98A 2FJEB 3OTCA 2LQBA 1GMWA 2C3OA 2XHCA 2OAUA 4MJKA 1K0TA 4TNOA 3UN3A 2QLXA 4FVCA 4DL7A 1S0MA 3IRXB 5FIIA 2YKNA 2HHQA 4NI2B 3PHTA 3PFOA 3T5HA 4FXVA 1UJ4A 4WTYA 3TJAA 4I7FB 3ISND 2WW4A 2WCXA 3QO9A 4ZPDA 3QATA 1NH7A 4N7TA 3PFEA 4Y3CA 3CDEA 2YTCA 3MCNA 1SXLA 2CG4A 2XZTB 1REGX 3QJLA 1GMUA 1B0PA 1Y11A 1ROFA 2VG7B 4QPXA 3D3CJ 4HVZA 2UUBJ 5IXUA 1AFJA 4B3MF 4W90B 5B0CA 1X4CA 1HL6A 4WP9A 1PC5A 3KG1A 2BE9B 3EGNA 3JYTA 5HBMB 2DISA 1CULB 1WNEA 2AGOA 1Q78A 2CPJA 4B3RJ 2LEAA 4IQMA 2HMIA 4G65A 5A2QU 3BH7B 2J0WA 3M6VA 4ZCLA 1S1VA 3HM9A 3TP2A 4CH0S 4Y2IA 1MMLA 2XYHB 4UY85 4WE1A 1CJVB 3MM9A 1YJRA 3WZ0A 2B8PA 3KJVA 4KT0C 1FDDA 5F41A 4XPEA 1NLKL 4HH0A 1JWWA 2E1PA 1L3KA 2VC1A 2XTJP 1KD1T 3TAMB 4UQGA 5D15A 1X9WA 2XSJB 1B3TA 4DWIA 2XLJA 4UZCA 3HVWA 3G82A 2PI5A 2UU9F 3AHPA 5HVFA 3TW0A 3EVWA 2CQHA 4NLDA 2R8GA 3IGVA 4WU3A 1H2VZ 4ANEA 2W9CA 2R8HA 4DU7A 4NOHA 3UI3A 2KZZA 2HRYA 3BYRA 1OQ6A 4NMLA 1PG5B 2MKKA 4ILLA 4CH1A 3QO9B 3MM7A 4EO8A 3Q8SB 4ECTA 1PYSB 4I6YA 5IM0A 1HQEA 1N5SA 3H2LA 4RW4A 3RR8A 1RAAB 1LW2B 1JXLA 2DB1A 1I94F 4E0DA 3M9NB 3PNIA 2CQ4A 1H0HB 3HT0A 2MLXA 3JTOA 2I1RA 1U2CA 3HSZA 3AB4B 2WOMB 4LF9F 1K1QA 4DV7J 1MWZA 2V9KA 2FJXA 2OPSA 1U47A 1TFWA 3L4BC 4CM0A 1AZSB 5ETMA 3KJFB 2K7KA 5C2CA 1S1VB 1I51B 1UAWA 4MYUA 3MMBA 4LSNB 3FK4A 1KP6A 2ZC4A 3G6VA 1NB7A 4WE1B 3MM9B 1RZMA 4JI6J 3MURP 4QR2A 2FLPA 1S9FA 2YPYA 3KJVB 2X3GA 3KUHA 1Y3KA 2KN4A 4YB1P 2XMUA 1BWEA 3TZZA 4JI8J 2RQCA 1X7VA 5KFFA 1VC5A 1HD1A 5HATA 4YMEA 3D67A 2QA2A 4B3RF 1UJ5A 3G82B 4ZP6A 4EK2A 3TRGA 2AJ2A 3OXGA 3B82A 3B54A 2AX1A 1FE0A 4IO1A 1VJQA 2ZZTA 3ITHA 3TUJC 2MZQA 2VPWB 2W9CB 2YX7A 1FWPA 1REVA 5M2UA 4ZLLA 1HNVA 1MROB 1DTQB 5DGBA 1LQ9A 4EWTA 4DZ6A 2EG2A 4LJMA 3CCWA 1HBMA 2M7SA 4ECQA 5HMYA 2ZH4A 3LALA 4RW4B 3LWMA 3TA0A 3DOMA 4ECRA 2W2PP 5T7LB 1SJFA 4ZITA 1NBEB 2XGQA 1JX4A 3RBEA 3CDBA 3IS9A 2GQQA 1D09B 4FF2A 2YNIB 4DX8H 4O4GA 2CQIA 2IRXA 4J37A 2IM2A 4ZPTR 1K0VA 3EWGA 3HHNB 3MUVP 2OPSB 3CD7A 1WTBA 4OV1A 1IBLJ 5BYRA 2FJVA 1V9OA 2BJ1A 5B09A 3TO8A 1TTHB 1HD0A 3JQJA 1D1UA 3ZZUA 2C1EB 2HHUA 4B9TA 1U0HA 4GC6A 2GVDB 2E7VA 2CPDA 3QYYA 1QJHA 1IVZA 1O6XA 4UF4A 1M5VC 4DDFA 5U47A 1CQMA 3TVZA 3TANA 4ZPBA 1RI7A 4IOAQ 2AJ0A 2IYGA 4DV7F 5JJBA 1XTZA 5C5JA 4JUZA 4DS5A 3P4UB 2ZOFA 3Q2TC 3ITHB 1GQEA 1IKWA 4F3MA 3OTOJ 1BE4A 4RWXA 2JEGA 3PX4A 2DGXA 4FF4A 5AXNA 1HNVB 4JI6F 1U1KA 1ICEB 2HFSA 2RS2A 2AF6A 5DZ6A 1RWVB 4WIIA 3M6WA 2MZ1A 2WSEC 1V3RA 5HMXA 4RUBA 3OL6A 1HBMB 3FCHA 2BE2A 4JI8F 1X5TA 1QDUB 4GVLA 1KSPA 1Y10A 1WHWA 2CQ1A 3DOMB 1VK8A 5J1EA 2VDIA 4G6VB 4DR1J 3IS9B 2DR8A 4LQ9A 1NK9A 1YZ6A 3UN2A 2MPUA 2D41A 2QZ8A 4O4GB 2M70A 3CIMA 1U48A 2HFZA 4QYRA 5F0WA 4NXNJ 4Q2MA 4DL6A 4NYZA 3ET6B 5AE1A 4DPTA 3AFGA 2JH3A 2ILYA 2E1MC 1YGYA 4DHVA 4J9SA 1A9NB 4X4SA 1SL0A 4P10A 1S7IA 2RU9A 1TK8A 1RT7A 4U67Q 1URRA 2R2RA 5DQIA 5KFTA 3SDEA 1L3VA 1U0HB 4USHA 3BBBA 2P6SA 3MM5A 4MK8A 2ZOGA 1XN9A 3M8QA 1IR2A 4DQQA 1N5QA 4ECXA 4CTAA 3KLFA 2HPUA 5A8WA 1FNMA 4CLYA 1DQ8A 2GW8A 4CNZA 3F73A 2ALYB 3PYEA 4MH8A 5CYQA 1FD8A 2H4WB 5F8JA 3TUIC 1S1UB 2UP1A 2BZ2A 3ZZ0A 2UUTA 1T3OA 3CJRA 4NLYA 5A76A 3KTQA 2VD3A 1Z2ZA 4HI1A 1IBLF 5IC6B 2WONA 4CLSA 3IWLA 3QQCD 3Q24A 4CLWA 3OL7A 5DLFA 4CO2A 1EAYC 4AXIA 1RT3A 1VBKA 4CM2A 5ETPA 4DUYJ 5KAKA 2D9OA 1BQNA 2NXJA 2F4FA 2KT5A 1S0OA 2YX4A 4FBTA 1RA6A 5KFGA 2RU3A 2GHVC 2XMJA 4CO0A 5DG9A 3G87A 3CVKA 4F3OA 3CCRS 2MZTA 4IH5A 5AXLA 4EO6A 3FCVA 1IBKJ 2WSCC 1HNZF 1VBZA 2ZJPQ 1G3OA 2K8GA 4TY8B 3OTOF 2DEJA 4FF1A 3T41A 4ZLJA 3AD8C 4YR2A 2R2UA 2KG1A 1HWLA 3UNYA 2P9GA 1WF1A 3IN5A 3M30A 5KG2A 3H2UB 4M5JA 4IDKB 2D3OR 5KT7A 3J7A1 3L9ZA 1QLNA 3W9HA 3NGSA 3H4DA 3MUMP 4KGKA 3B6BA 3DOLB 1NRKA 3DDKA 1ZA1B 2LXUA 4WXOA 3SDEB 1X5PA 4LBHA 5HL7Q 4UOGA 3M7VA 3QPIA 3M8QB 3PO4A 3KLFB 5J2NA 2FHOB 1KFDA 3AOBA 4IG3A 2LDIA 1LXNA 2F4VJ 4NXNF 1F3FA 2ZH2A 2Z58B 4FYYB 4X4QA 2LXFA 1HQUA 3EICA 2ZHBA 2W8KA 2W4CA 2RQ4A 4X4UA 2OPRA 1HQ2A 2XWYA 2QMWA 5EDWA 3MPDA 4KPYA 1T9VA 4L74A 4ZVOB 4CZCA 3SBMA 1GMWD 3ILOA 1NUEA 4OJGA 3KJNB 3P96A 4NLOA 3NNAA 3ISZA 4CO3A 4OHYA 2UZAA 2VHGA 1OSCA 2UV8A 5J1NA 3DDNA 2ACYA 1WI8A 2BYCA 5AT1B 2W01A 1NJWA 4EEYA 5L8RC 2MSSA 3J81j 2G2OA 4BWMA 3E51A 4U7UK 5KFEA 3JSMA 4MT1A 5KFCA 2V63A 2VFSA 3S8SA 3QMQA 4F0HA 1JLBA 3ENVA 3POTB 3C16B 1VS3A 5KT2A 1DJ0A 2A10A 3RR7A 4NZ6A 2F8MA 2J0SD 4DPUA 1JXEA 5B0DA 2K1RA 3MPYA 2W9AA 2GX8A 3QT8A 3BGUA 2DKOB 5GAHU 4DR5J 3H2VE 2BJDA 4HTJA 2ERRA 1S0VA 1U45A 2XZDB 3UW1A 1IBMJ 3BGRA 4OYAA 1KTQA 2KXNB 3GPAA 1WORA 3HVAA 2R3VA 5AXMA 4LBIA 4M5KA 2K06A 4Q0BA 1NSKL 1UPMB 1HBNA 1CC7A 1HA1A 4ZVSB 1IBKF 5J2NB 3FBFA 2JSXA 4WJBA 4IG3B 2HHTA 1EX8A 3RAQA 3L7OA 1BQXA 3EDRB 3TNVA 5JVGQ 3ZTSA 4LREA 3FZBA 4A46A 1ZA2B 1JLFA 2W9BA 4IOBA 4FNHA 1YBTA 3DLGA 3AA9A 2ZJRQ 2AP6A 1QAYA 3NOGA 2KHCA 1YRTA 3GJSB 4Q8FA 2P2CB 3OVSA 2AX0A 1FX2A 4ZVEA 1RWOB 5KT4A 2A2DA 3A8IA 1EQ0A 1VRUA 2BW2A 2OO4A 3HD1A 3DC2A 3TARA 5D3GB 4Q44A 3OLBA 2HWIA 2MQ8A 2C42A 4EFAC 5H9EK 3ZZOA 3U27A 4DFMA 1KS2A 2F4VF 2LEBA 3NGUA 1JLGA 1QM9A 1NDCA 3SYZA 4CLUA 2X1GA 4A8OA 2HIYA 3A8EA 4X4OA 4BWJA 5F8NA 4TU8A 3KK3B 2UXDJ 4J9KA 4WK1A 2KT3A 2BV3A 4Q2LA 1WELA 4ED5A 2R7TA 1CJTB 2BJ7A 5DDQC 4C48A 3MPVA 2VOPA 1UZDA 2CADA 3BH6B 2AGQA 4GVBA 3AJDA 4DV3J 4I56A 2ZZNA 1YWXA 2COLA 3EVOA 3K89A 5BXIA 3KUEA 3WIVA 3H5YA 2XCPA 1UVNA 3DYAB 3Q23A 4B9LA 4B9MA 4CI0B 3ELHA 4HYKA 3FBEA 4NLSA 5G4DA 4PQAA 2YQ1A 3V6HA 4KGXB 1H2TZ 3GONA 5CH7B 1HKAA 2RUSA 3IWXA 1P9QC 1FKOA 2Y0SD 2N7YA 2VC0A 2HW3A 3Q22A 3OD2A 3BPDA 2CJXB 4KO0A 1RHRB 4DR5F 2Z2YB 2GO8A 4RW6A 1WJ9A 1K8AT 3CPWR 3UDCA 3K7RA 2XG8A 3OFFA 1IJFB 3DLGB 4OYMA 5E33A 3L7UA 1M90T 1CLFA 2ZD1B 1NM2A 4X65J 3GYXB 2CQGA 3OQ2A 4DV6J 2G1DA 3BGOP 1KTVA 4ELVA 1EB0A 4UOFA 1CJUA 5H9FJ 2E9ZA 1VRUB 1T8EA 1YZ7A 3I5CA 2EK6A 2O66A 3EX7B 4CLFA 2F5GA 3OBIA 1L3SA 1U25A 4OI0A 1YJUA 4C8MA 2MEWA 3HI9A 2LMIA 1JLGB 4KFBA 1JJCB 3NWGA 3R8YA 3FEYB 1S59A 1C1CB 3FZ2A 4WFAQ 2MZRA 2MSTA 1TL1A 2W2MP 2V69A 4B3OB 3R2DJ 4KGVB 2HK2A 2YNFA 2YH0A 4NLXA 1MMNA 5KFHA 2XMKA 1HWIA 2AYBA 1S0NA 4JI0F 4NZ7A 4LRFA 5IV4A 4NCGA 1Q0NA 2C2KB 2IVMA 2E5IA 1XBWA 1R0AB 3CGIA 1RBLA 2OPPB 4HI2A 4OMFG 3OT9A 2C3YA 4WFYA 2R2SA 4CLLA 1XNQJ 3M2VB 4V19X 1XWLA 2JEFA 1P1LA 2NPIA 2HIQA 1SJ3P 1VYAA 5HP1A 2XMVA 2UXDF 5GADI 1NJXA 2HGLA 5KTQA 3HZGA 2DHAA 3S01A 1NJIT 4CH7A 1F6TA 3FFIA 4P6QA 1HW8A 3IC1A 1R8AA 2KHDA 4KAIA 3DHWC 2KFZA 2G0IA 3VCDA 4DV3F 1RWNB 1ZM2A 3ADAC 1YBAA 3MM6B 3CCLS 1BC6A 1GTEA 4RW8A 4I64A 5LXYA 5C25A 4WTOB 4PRFA 4K50A 1WG1A 2BXJA 3G8QA 3ILJA 3I55S 2AYMA 3PJ9A 1JXVA 3QGIA 3TA2A 2C2OB 2PMWA 2QYCA 1RAIB 2AJ4A 1RK8A 1AB8A 2XZWA 4ZCMA 1WACA 3GE9A 3N01A 4B9UA 2B4UA 2YWEA 2QO3A 1EZZB 4IO9Q 5DQHA 1D9DA 3C14A 3OUYA 3W66A 1DFDA 1WUUA 5HANA 4F0MA 2RRBA 2BR0A 3ZZTA 1TL1B 4WWSA 1JLCA 3VZIA 1YIJS 3J7Z5 3MEDB 4KPCA 2YNFB 2RF2B 2FJBB 4OV6A 3OHAA 1VQSA 2JVOA 3G6ES 3W3SA 5LXRA 1XMQJ 4C0OC 4ZDNA 3P49B 2HHSA 3SI8A 2VFRA 2FLNA 1NPRA 2BE7D 1R27B 4RW7B 4TYAA 3FSIA 4L3NA 3AD7C 1KLNA 1Z4UA 2ZC3A 1NAQA 4WF9Q 2FVCA 1UVLA 4IYQA 4IFYB 4M5GA 2VICA 2BANA 2DTJA 2CZVC 2DNZA 1N33J 1S1WA 4I2PB 1TU0B 1HYSB 4JI3F 1IR1A 4LFBF 4OL8A 2W1BA 4K5SA 4KJIA 1T9WA 2GMJA 3FFIB 8AT1B 3DGPA 1VC6A 5E3RA 3R97A 4JOUA 3D4JA 2EFVA 4J9LA 4IRCA 2DNGA 2CVIA 4D3HA 4MK7A 3H8YA 4X4PA 2OSRA 2M52A 1PBAA 4D3GA 4FF3A 3KHLA 2V4JA 3BSCA 4R0EA 4KKOA 4MFBA 1KEKA 1XNQF 3CWJA 5ETNA 4PAAA 2DCUB 4MMOA 1KQFB 3MOJB 3H25A 4XK8C 3WX4A 2X51A 3C6TA 5LOQA 3FRZA 1NJYA 5BR8F 4YHHF 2LA4A 2M4MA 3OSPA 1LWFA 5CYJA 2LYVA 4OQJA 4J9VA 2QL7B 5F8GA 4DV2J 3TVKA 3JSRA 3ZTQA 2ZEJA 1RT5A 4B3SJ 1GX5A 3AH6A 2XLIA 2N4CA 3G8TA 1NJZA 5LMNJ 3H5XA 5KFUA 1JLCB 1RAFB 2U2FA 2KDOA 2D9PA 4LF2A 2J76E 4OZ3A 4FVMA 2I9SA 4OX6A 5J2QA 2RNEA 2VPXB 4UQTA 4PWUA 4YY3F 2IJRA 1ZS6A 1CJKB 2ACMA 2HG4A 3DU6A 2RJZA 3CJKA 3M8RA 5CD4H 2X1BA 3LW5C 2BBEA 3MZIA 3CJ5A 5L9NA 3VAGA 7FD1A 1WDTA 4QOTA 3SZ2A 2HRUA 1T03B 1D8YA 2W7PA 1FK9B 1RYRA 1FJ7A 2J9DE 3L95X 2ADCA 4MAKA 2IBOA 3LGMA 3SQOP 2CQ3A 4ER8A 2V4JB 3TI0A 3BDEA 2Z8QA 3CCQS 3D66A 4ENOA 2R42A 3HULA 3C46A 1AW0A 2YWWA 3DI6B 2H65B 2KM8B 3KLVA 4F04B 3JAMU 4JI5F 1S1XA 4OZ0A 3BO4A 1QAIA 3CD5A 3WBZA 1B7FA 2OP5A 4MYTA 2XULA 1N33F 1LWFB 4B3TF 1U8WA 3W1YC 1HWKA 3UD3P 3R5AA 2R8JA 3CIZA 1N52B 1CVJA 3VR1A 3BR8A 2CUYA 1GNKA 1TKDA 3DRRB 2FHJA 3G2XA 2DD8S 1RT5B 2EWHA 4PG4A 1EHWA 4ECUA 2FZCB 2E1CA 4PG7A 2KL8A 3U1NA 2F63A 4YQWA 5DZ7A 1RXOB 3QBCA 1VJWA 4M63A 3GLJA 2R7UA 3D1QA 3HT3A 5C42A 4JV5F 2ASLA 1NPPA 1N48A 4CNYA 3J81Y 1AUDA 1VBXA 1F9EB 2EVZA 3GSDA 3MHYA 1SH0A 1UW4A 4ZPCA 3G8SA 3VQSA 2FD2A 3AT1B 1IQZA 2QMXA 3GQCA 2CQ0A 2L3MA 3CJKB 4NE9C 5KFSA 3EZ5A 1TAQA 2CDQA 2J7WA 2OSQA 1X4HA 4DV2F 2Z30B 4PXEA 1GXUA 4B3SF 4FKXA 3R5DA 3KDOA 3MD1A 1UEKA 4FNIA 3KLIB 2UV8G 2PT0A 3GR0A 1RLDA 5KT5A 5LMNF 2CJAA 2G4BA 5IOLA 3DHXA 3HP6A 3MPWA 5HO4A 2CJ9A 2AJQA 4WFNQ 1FXDA 4DV0J 5EX3A 4LF7J 2HVEA 4UW2A 2FC8A 4BLGA 2P5VA 3SSQA 2XEXA 1P9YA 2R7VA 2NZCA 4ECYA 4WBFA 2XQCA 3K59A 2NYHA 5SUHA 2GHPA 3THVA 1OWXA 1MW7A 2XB2D 3BPSP 4C97A 2J6UA 3CB4A 1WSVA 3UO0A 1VQ9S 2Z2ZA 4F50A 1KVIA 2BVZA 2YWKA 2GJIA 4QWEA 5EUHA 4ZVHA 2VBWA 3KOAA 3T5JA 3G6XA 3T5LA 3RRGA 5KG4A 1KQGB 3N6LA 2DO4A 4J9NA 2MKCA 2KG0A 1JLQB 2YQ3A 3MECB 3UVJA 1S12A 1CPZA 2O01C 2XMMA 4W92B 1S9EB 2ALZA 3CJ4A 2B4VA 4FYVB 4TVAB 1ZM3A 1IKVA 3ZZRA 4ZP7A 2W2OP 1VC0A 1RCOB 2XSFA 2YKPA 2VFUA 3H5SA 2GJFA 4RNMA 5CYMA 4N8NA 1HR0J 1U4BA 4MIBA 1IM4A 2NPFA 1K1SA 4DU8A 3C15A 2DBBA 2LKZA 4RUAA 4WXWA 5DDPC 4A8FA 3NAIA 3GWCA 2V8VA 1NPKA 2OMLA 3UCGA 1OYEA 3ZZZA 3HSDA 1OY8A 4HH1A 3QT7A 4LSLB 1A7GE 3MR5A 4PYDA 2RAQA 3TZWA 4F4KA 5ETSA 3ZXWA 1WOSA 4H4MA 2QRRA 4P2MA 3HHDA 4NPOA 3M8PA 3EM1A 4J9UE 4DSEA 2HRTA 4HL9A 3P6YC 4B02A 1GAOA 2NR0A 1T9TA 1B0TA 2XMAA 4NYOA 2BM1A 4ECVA 2PSZA 2Y8YA 1EJ7L 3CDWA 4R5PA 4USKA 4K4WA 2B9XA 4B9SA 3SCJE 2ASDA 2LLZA 2FVQA 1X60A 5KFVA 4LRDA 2HQFA 3I32A 2DGOA 2JOQA 5HROB 4K2JA 1JJ4A 3X1LB 5FD1A 2YKMA 1KR4A 1KRPA 2H51B 1S6PA 3A13A 1LWCA 2OEMA 1S6QB 2R7XA 2MY7A 1R7IA 3RJMB 2CPIA 4DG1B 2BW7A 1WC3A 4N76A 3MEEA 4HKQA 2YNHB 2HBRB 4AXJA 3MAAB 4IQXA 3JQMA 1IKVB 4C11B 3AB2B 1RGVA 1RTZA 2UUCJ 2PO4A 4CWBA 5J2MA 2RB7A 4OX9J 5A8RA 1H7WA 1WC1A 4ILRA 1ZZNA 5CYMB 3JSBA 1RWMB 1X0PA 4R8UA 2VG5A 3MMAA 2R7SA 4A47A 3TOQA 2XY7A 1GX6A 4RU2A 2DY1A 5E2QA 3BQ1A 1FX4A 2JDJA 1HLWA 1RTHB 2DNNA 1NB2A 1ZAWA 2PFDA 4PG6A 4XIUA 3NGRA 1T02A 3BO2A 5ADZA 2G2ZA 3GFYA 2QL9B 1W25A 3O2IA 4K4ZA 3CD0A 3QZ8A 2UVUA 5EWEA 2I0XA 1UA1A 2BRLA 4IRKA 5AE2A 1SKSA 3NGTA 1S6UA 2F1FA 3M8PB 4DL3A 3UD5A 3W8GA 1S4EA 3FUYA 1J5EF 4Z37A 5H1SV 1VK3A 4L6V3 2XI3A 3AOAA 3HHEA 1HR0F 4CQ1A 3PYFA 4J5OA 3D6TB 1VOMA 3GYNA 2RRAA 2M5YA 4P7VA 1HPZA 2IAJA 2FIUA 1PKUA 4TXSA 3OVAA 2ZH6A 2HNDA 4JI1J 1YJTA 1S1TA 3AJ1A 5D6GA 5KFYA 4PG8A 1S6PB 2GC8A 4DR7J 2HNZB 4Q8EA 1LWCB 2AZ1A 4X4RA 3EUNA 1OS5A 5D78A 3OTEA 1PO6A 3FKBA 2ZBQA 4Q43A 1KC8T 2M0GB 2UXBJ 4OX7A 3J7YI 4AL7A 4FKYA 5HQ8A 3CJQA 5KFBA 1PC4A 5EN1A 1H72C 3AQOA 3C8YA 1G7CB 1QUVA 1H73A 2GJ2A 2ZH1A 2VDHA 2HQCA 5LT5A 3SFGA 2V94A 4I6WA 3EPIA 4OI4A 3VQTA 2DGTA 1M5KC 1KLMA 2MB0B 4G1PA 3D9BA 3G9CA 1X9SA 1D3WA 1SKRA 1RE1B 3EPGA 1QVGR 3DRPA 3PRDA 2EBGA 3I9ZA 3GB0A 1GEHA 5DGAA 4C98A 1GK8A 2P8IA 1UA0A 3PY8A 5RUBA 1N8RT 5ETQA 3N6MA 4C8KA 2CFXA 2Z0GA 4DPWA 1BQMB 5F8LA 2B3TB 1RT4A 2EC0A 3CT9A 4IFVB 5BJRA 3HLUA 1FFSB 3R7NB 2UUCF 2HYIB 1X5SA 1UL3A 1SCJB 2A6MA 3MR2A 2BKNA 3NMAA 4ICLB 3W2VA 2H9ZA 4OJHA 4F4YA 1WKLA 2ZJQQ 1VMBA 5GAEI 5M2PA 1HPZB 1P6TA 4YB6A 2IAJB 5H9FK 3KKFA 2C3UA 2HNDB 4R25A 3NL0A 1AFIA 1QTNB 4WZMA 4LQ3A 4ECZA 2F8EX 3IBFB 4NCAA 2WSFC 3I0RA 4RNOA 2H48B 4RW9A 1LKZA 3LA0A 1WOPA 1HNWF 3Q8VA 1VRTB 3ENQA 1R0BG 1MMDA 2LP4A 4EI2A 3ZTPA 1HNXJ 3MCMA 9RUBA 2QE5A 5A6PA 4KH0B 3T1YF 5JXSA 5A2QY 2OPQB 3HHLC 3VAHA 5KFKA 3OXLA 2VPYB 4DPOA 4JI1F 4KHRA 2YPZA 5DM7Q 2KH9A 2AIRB 1TKZB 3R6LB 2PE8A 2JJ4D 3ENAA 2A3JA 2HHPA 5L1LA 1LW0A 2JX2A 4QBUA 2DHSA 3GFZA 3DRPB 2Z57B 1PGZA 3RB0A 4O0IA 4QZVB 3TAQA 1B99A 2UXBF 1N0VC 2D3ZA 3IAM9 2AGPA 1OIAA 3Q8PB 1UWAA 3HD2A 3CE8A 2GIFA 2VODA 2KXHA 5D0HA 1H7XA 4DR3F 5I42A 3T19A 3BN4A 1N5TA 1KOOA 1SI9A 1UVMA 1C4CA 3MDFA 3CCES 2DHHA 4NA3A 5GVQA 1LEOA 3PX6A 1PIEA 1LXJA 1TL3B 3K0JA 1FJGF 4LSZB 1M5PC 1FI4A 2RDDA 4RR5A 5B0FA 2C3MA 3M05A 3B4MA 4B3MJ 1T9YA 1RWUA 5GAGI 3W2VB 1ZTTA 3SV4A 2HWTA 2LQ8A 4OZLA 9ATCB 2OD6A 4WU2A 1IBCB 1OQ3A 3H42A 3R2CJ 3SXLA 4HACA 1J2VA 1NSAA 2R8IA 4EGLA 4H4KA 2CQDA 2MJNA 5H9EJ 2D3UA 1HBOA 1FT8A 3QSYB 1V5VA 2XO7A 3EYZA 4RW9B 1YJNS 4FXWA 2JL9A 3VTIA 2Z4PA 2U1AA 3NNCA 2ZVIA 2Q1LA 1SBRA 2BUNA 4ZHRA 2DH9A 2FHJD 3Q86A 1KVKA 2GGPA 3RRKA 4NYPA 3E01B 4WYWA 3BREA 4K2XA 3U7JA 2C2DA 2FJDB 2G2YA 4X64J 6FD1A 3M32A 4J9PA 3P3DA 4ECWA 1QSSA 4X66F 2AZ3A 3JTNA 4DQRA 3DM2A 3DRYA 1RCXB 2BABA 4YOEA 5FDLB 3IR7B 2V50A 2C22A 4PPDA 3GIMA 1GXTA 3T1HJ 2FVSA 3CSKA 1NK0A 2CPHA 3RBXA 4F2SA 2YNGA 2AU0A 4GKJF 4EBCA 1HNXF 1JNZB 1S99A 4JV1A 1LFWA 5I42B 1SJ1A 3DOKA 4ETZA 4KH1B 3IBWA 1RWWB 5CCMA 1APSA 2D74B 1M1HA 2ZFHA 2MMYA 1IKXA 2I5JA 4NXMJ 2Z56B 1BMQB 1T3NA 1ZYQA 1RHUB 1ZM9A 1SV5A 2JC1A 1I94J 1S7HA 1J27A 3PR4A 1Z1ZA 1BXNA 1EETA 1F9FA 4NLQA 4X62F 3EVMA 1FJCA 2PEHA 1RT6B 4M94A 3DN9A 4LF9J 2CNLB 3R27A 1AT1B 2FDNA 4URGA 1HI8A 3H0PA 4HACB 5D77A 3QLHB 1JK9B 5I4MA 3BS9A 2MQQA 5K8PA 1HBOB 3Q8RB 2JHEA 2CPZA 1S9GA 2QFIA 1JKHB 5AJ3J 1FRKA 4B08A 4DF4A 3OR1A 5ETVA 3EE3A 2CJQA 4AL6A 2N4DA 4QIGA 4WFXA 4DR2J 1VGYA 2ZHOA 3RW7A 4ZHRB 3VGTA 2V0NA 3C6UA 4L76A 2J8AA 4M1KA 5M2RA 4DL5A 2Y0BB 2ZH8A 5F9LA 2NXUA 3CO9A 4C3MA 1XIQA 1RAHB 1TAUA 5DG7A 2IM1A 2DYAA 3QGHA 3BKFA 4USMA 2BKPA 3IM9A 1VQNS 2AWZA 3CTRA 3WHIA 2Y3YA 3HFZB 5DDRC 4NLPA 2CQ2A 4ZK7M 4F4ZA 1W26A 2QIFA 4LUBA 1T05A 4ZP9A 5KFNA 2HS0A 2FTRA 3HK2A 2AV5A 5D0GA 3V4IA 1TL7B 4FS2A 2A1BA 3LGHA 3TZYA 3QZ7A 3DOKB 1J5OA 2OJ3A 4WP8A 1QUPA 1CS4A 2I5JB 5FLXU 2ZE2A 4X64F 2AHOB 4OYXA 2O5DA 1YTYA 1PSDA 2L48A 4K5RA 2MZSA 1HNIA 2YKOA 4DSLA 2RHQB 4NLGA 4TYBA 3EJMA 2YKNB 3GG0A 4L75A 2ZITA 2QN6B 2RSQA 1SC3B 4OYWA 4LRCA 2ZDOA 2DR5A 2QT7A 3MR3A 3T1HF 4KV8A 2IC3A 4I6AA 2DNYA 2VJVA 3UPFA 2PC6A 1WC0A 1QSYA 3PM9A 3NS7B 2DNKA 1Q4RA 4DX7A 3P45B 1SKWA 3NS6A 1VHFA 1VQ6S 1N5VA 2NCKL 3MPUB 4ZKAA 4ZLNA 2RIJA 2DGQA 4DL0C 3D7SB 4NXMF 3PIOQ 3ZTOA 4TQRA 1X4FA 4E8UA 4YR0A 3RRHA 2EBEA 2O67A 2QJ3A 2R8KA 4J90A 3EZOA 3C6UB 1FDBA 2OKQA 3DLBA 1FEEA 3JYTB 2JRSA 2BJEA 1CSJA 4K4SA 2HFOA 4OI1A 2YH1A 2VH7A 2HMIB 3UWTA 1HIYA 5HI7A 1YG0A 4AT1B 3RYLA 2KTQA 1TQLA 2CQBA 2MKIA 1UWBA 1F5BA 4PWDA 1VQOS 4RBUA 3D0IE 3PW4A 1WF0A 4I2QA 3JTPA 5I3QA 2OTJS 5AJ3F 2HVZA 2ILZA 2LVWA 5A6WA 3AD9C 1LWXA 1HWJA 5IT9U 3PO5A 3LQVA 4BC7A 1N34F 2HGMA 4DR2F 4JV0A 1SL1A 3V4IB 2F9DA 3GCXP 5CQGA 1YI2S 3ETMA 2CRLA 4QWDA 1Q8BA 1CS4B 4IKAA 1TK5A 2ZE2B 3OW2R 1DTTA 2LECA 2XS5A 4QIFA 4WKYA 2NQPA 1T95A 2XMTA 2QGFB 2GZOA 2CIMA 3GIKA 5DS7A 5K20B 2VV5A 4KB7A 4H4OA 1MSWD 3LO3A 4UY8T 2R7RA 2XS7A 4OI3A 1XR6A 3Q83A 2IVYA 2NUUG 5K8NA 4K4UA 1BHNA 1TZ0A 4KV8B 3MM7B 4PABA 4WFZA 4C3LA 1ZAXA 1JQGA 4ID8A 3VAIA 3NMRA 3BZQA 2VG6A 1X4AA 2OEKA 1OY6A 5IM0B 1HQEB 1KN6A 4X4VA 4JP8A 2R7QA 2Z2MA 3OR2A 4F4AA 2VASA 1DBDA 4NASA 4RLEA 3MGJA 2QLJB 4UUWA 2B9EA 5L1IA 3M1VA 1JIHA 2P6TA 1NK4A 5KOWA 2A6OA 2ATLA 5KG7A 2CAJA 4DUZJ 4KHPJ 5E0OA 1FWKA 4GKKJ 2KJWA 2LCWA 3IFEA 5DETA 3KYLA 1UWBB 2J9EA 3MFIA 2Q79A 1R31A 5IT4A 3MMBB 4ES3A 1JLAA 4LR9A 3MOZA 1FKPA 4I2QB 4RWWA 3GG1A 4M95A 1X0FA 4DQSA 1OSDA 4EBDA 1RACB 1RAJA 2CYYA 3RB4A 1C2PA 4CYUA 4OZ2A 4PQUA 1RT2A 2FVRA 3ULHA 2Y1LB 4O3OA 1HMVA 5L9XA 3FRYA 1RQ0A 4ZVQB 4ILMA 2NYIA 1TVRA 1OPZA 2M3DA 3DRSA 1K44A 3OLAA 5C7PA 3L09A 3MR7A 2L08A 4PWWA 1U7LA 4IG0A 2OI2A 4GO7X 3QFWA 2X1AA 1FRIA 2BQUA 1HNZJ 5I3PA 4F26A 2VZ9A 1TELA 3EDQB 5K9FA 4H4OB 1REVB 4YP3A 4AQYJ 4M5LA 4J9RA 2IFXA 3FC9A 4RNNA 3E2EA 5K8MA 3V6DA 3IAS9 3EGVA 2IRUA 3LP1A 2AEMA 3GIJA 2MGZA 2XC9A 4K0KJ 1IWAA 4A8SA 3QT6A 4ID5A 3M9MB 3Q8QB 3IA0A 4JI4J 2VIHA 1ITPA 4KRWA 4QU6A 2HHHF 4MIWA 2WAQD 1WC4A 5ETKA 2AQ4A 2DGWA 2CPXA 1ACMB 2QA4G 3OR2B 4FXDA 3S6EA 4QWAA 3WIUA 2UUAJ 3OFHA 2ZBPA 1RAOA 1T9XA 1T9UA 3Q8UA 3M1VB 1HWUA 4ERDA 4O0NA 1NEEA 2KU7A 5SZTA 4DSKA 3VGUA 4C0BA 1M5OC 1NDPA 1KHVA 3W2WA 3W63A 3PXGa 1MWYA 3I4HX 1Q8IA 5G0RA 4DFPA 3D0HE 3R5CA 1QTMA 3TWZA 4ITSA 4PPZA 2VU5A 2L9DA 1YBUA 3Q0AA 3R5GA 1YSJA 2B51A 3KMSA 2DRDA 1FWLA 5CZXA 1JLAB 4PEOA 4QR1A 4ZP8A 1VLOA 2EFNA 1YLXA 1SIWB 4U8VA 2KKHA 1U1QA 4RL1A 2XY6A 1GH8A 2G0CA 3J80U 5D8HB 1RT2B 5HSPA 4JI7J 4IR1A 3RZAA 5C24A 3DXBA 4KQZA 4K4TA 1NKBA 2B56A 4ES2A 4DUZF 4KHPF 3CW2C 5DG8A 2YWFA 4F4XA 2QLFB 4GKKF 4W4MA 4IG0B 4XAKA 2FZKB 5B08A 2YQ0A 5IQ6A 4LBPA 3W60A 1RAGB 2DIUA 1IKWB 5KFIA 1UVKA 4ZPVR 3V5RA 1ZPVA 4DSJA 3CJ2A 3DCAA 3LP1B 5DM6Q 1DARA 2CDRB 3IM8A 5F0UA 4OHWA 4P74A 2KVIA 2ROGA 3KG0A 2MQLA 2I8EA 2HQGA 1IXKA 2BE2B 2E1RA 1GMVA 3UQSA 2ZKTA 2RUGA 2CG8A 5F8MA 3OXFA 2VBYA 5MLCV 5D4NA 5J1EB 3TVYA 3E8OA 1N5YA 2V68A 2W7AA 3NNHA 2D3O1 4MTPA 3NEKA 2OFHX 2HNYA 1HHTP 2SXLA 3M8WA 2Y1IA 3BSNA 1I5OB 5K14A 2HEKA 2RHSB 1X4EA 1SB6A 4AQYF 2BM0A 1OPIA 3GP9A 4HT7A 3EGWB 2DXFA 4P71A 1IN0A 2QSWA 3BSAA 2LQ9A 2CNNB 4IOCQ 4F25A 5GMDA 3ZC4A 2XNRA 4K0KF 3HVTA 2GAHC 4OI2A 4EYHB 3HF5A 2XLKA 4P75A 1V6HA 2WK4A 2C2RA 4AL5A 4JI4F 3PW7A 1RT7B 4ATNA 1M0SA 2O1PA 3VAKA 4P72A 1KQKA 4CO1A 1WEXA 1FF2A 3HPOA 1Q5VA 1X31C 3CNQP 4LFAJ 2NZ4A 5KG3A 4O44A 3MM5B 2UUAF 1ZBTA 2HGNA 1K47A 4CTAB 2DHGA 4C8LA 2KI2A 2YKQA 2DXDA 2RT3A 1WTFA 2IMOA 5B0GA 5A8WB 1IWGA 3NRBA 4N5SA 4B9VA 5C24B 4K4VA 5CYQB 3QRRA 2C2MB 3VAJA 3N9UC 2KYXA 4CLPA 5CZVA 3QRPA 3PACA 1BWVA 1HHSA 2FJAB 4S0MA 1QD1A 5ETRA 2LXIA 1JMTA 2WONB 2M2BA 1DLOA 2B8QA 5L38A 2L9NA 1NZ8A 4BHQA 3W5ZA 1RT3B 3RTVA 1RBAA 1Q8KA 4AUKA 2RKIA 2IY5B 2JFKA 2RH3A 1BQNB 3Q89A 3VV2B 2O3DA 3BKTA 3UNGC 4OYOA 3BF4A 4F4WA 1SJQA 3R9LA 3O8WA 3MCSA 4JI7F 1WWHA 3PJXA 4HDHA 4YFUA 2ZHAA 1EQMA 1NO8A 4N77A 3N5FA 4FDFA 2HVIA 5HJXA 4F67A 4N47A 1NKCA 4NI2A 3G71S 5EHHA 4WK3A 1UZHA 3D54A 4DUTA 1R8BA 4I7FA 5EWFA 2N3OA 5K14B 3JSYA 2IYIA 4JI2J 2CPEA 2GO9A 5IFMA 3M30B 3OL9A 1UMJA 3KG4A 5F3ZA 1U6ZA 1WKKA 1VISA 2V2ZA 3T6JA 1U1OA 2CKWA 2RS8A 3Q8YA 1FDNA 3AXKA 4Z7CA 2IDEA 1LFPA 3IR5B 4USWA 3KNGA 2DGSA 4WIQA 2XNQA 3HFVA 1JNRB 4PXCA 1FERA 4N8OA 5D4OA 3UR3C 5IS2A 1S76D 1XMOJ 1O8BA 3WC2A 4Y2KA 1WDDA 5D4PA 1CQNA 5HBMA 1CULA 4BS2A 4UOCA 1B7YB 2WRMA 1RHQB 2OMOA 1RWXB 4OZNA 2J9DA 2KXFA 3IMQJ 1IM6A 2BEFA 3IBCB 5DLGA 4RUCA 4LF1A 3H59A 3T3FA 1HQUB 4L72B 1D0EA 3CF5Q 3PW5A 2X3DA 3PEHA 4DOZA 4AYBD 4NL5A 5MAOA 2OPRB 2C2NA 4QYZJ 1CJVA 4QQBA 4DCOB 4OHVA 2E29A 2BQRA 2J0QD 3MUTP 3HJFA 1SVDA 1N6QA 2R7WA 3LUYA 3HO1A 3MWBA 2VOOA 1B64A 2OEJA 3I56S 4JI0J 1FE4A 3RW6A 1M1KT 4LFAF 1ZH5A 1UCNA 3TAMA 3M9OB 1WEYA 3KK2A 2YY3A 2XSJA 4HHUA 4XDCA 3F44A 1D9FA 3QAUA 2AEJA 3FBBA 1ZZFA 2XS2A 4CIOA 4PKDB 3D3BJ 1VR6A 2XHWA 5HVGA 3JSMB 4ZMMA 3ZO7A 3ONQA 2CJYB 4DFKA 3HHLA 3D6FB 5EGYA 2OTLS 1JLBB 4Y6IA 3ZNUA 3UE2A 4LFCJ 2ZBIA 2DK2A 1RA7A 1FD2A 5ETLA 2IJFA 2KB2A 3U02A 4CO4A 2XYGB 4NEZA 4J9MA 2HAFA 1NK7A 2K1RB 4DV1J 4RO0A 3VF0B 1XNRJ 4LMZA 2C28A 3CCSS 3KWMA 3DDIA 4IH6A 4CLKA 2KRRA 4ELTA 3BGRB 2DVIA 2DNPA 3AJ2A 1LW2A 4AE5A 2F40A 1Q1KA 2K3KA 5T14A 2HHWA 4NX9A 3PKYA 4Q0BB 3BM7A 1HBNB 1R3NA 2DNLA 2ZKUA 4QWCA 3RAXA 2WOMA 4I0WA 1D9AA 2MQMA 5CXTA 1AZSA 4DBQA 3LH2S 4JI2F 2H3EB 4LSNA 4MIAA 1JLFB 2F8HA 2W9BB 1VQ7S 3A3OB 1N6QB 2CZ4A 1F2HA 4NA2A 4LVOP 2WVFA 3TJ9A 5CAAA 1TFYA 3H98A 1LWEA 3QGGA 2AEFA 1NSQA 3LANA 1VI7A 4L73A 1XMOF 3KK2B 2ZBRA 3LOUA 3OVBA 2DH7A 4C8OA 4NLWA 3MR6A 1N36J 2KJVA 5E5NA 1XR5A 4MKAA 5F9NA 3H7HB 3I96A 1YJWS 2C3PA 2HQIA 2CZ9A 3MFHA 2FYXA 1N88A 1VQ8S 1PYTA 2PMHA 2MY8A 3HHLB 4DX5A 4U7UD 3QJJA 4RUHA 2HAIA 4B9NA 4JI3J 1F1BB 3F41A 4DCPB 4LFBJ 2LQ5A 1Q7YT 1MROA 1DTQA 2ASYA 2V34A 1RADB 4ANCA 2CNOB 4ALZA 2E5HA 3A3PB 4KR0B 1FRHA 2J0XA 4KTQA 2HSEB 2NUHA 5J1PA 2E5LF 4GVBB 2GA7A 4QU7A 2KM8C 1DY3A 1G6BA 5JUMA 3R1HA 1WD6A 1U09A 3CCTA 3CJTA 1KHWA 1Y4ZB 1P1TA 5T7LA 2HQ3A 5LSLA 4Y65A 3SIPB 1WF2A 3AODA 2BJ8A 4C4WA 2GQCA 5BR8J 1SC1B 4YHHJ 1WG4A 2DPJA 5FJ4A 2YNIA 4CT9A 1RWKB 2FZGB 5A8KA 3C3LA 4LFCF 1SQGA 1FKOB 2B9WA 2V2QA 3NCQA 2AT1B 1YRUA 4KO0B 2HLUA 2JC0A 2MJUA 4YB7A 1SKUB 4DV1F 1O5JA 2H5IB 2J7UA 1TUWA 2LU2A 3C2PA 2V8GA 3PEJA 2UVWA 1XNRF 1E6VA 4RW6B 4E98A 3GV7B 4OX8A 3OTDA 3TUZC 4W98A 2V9WA 3PDNA 5GMEA 3PVXA 2I2YA 2UVRA 1UVJA 2GVDA 4UT4A 3JAMY 2AYEA 3H5UA 1RBOB 4DF8A 2PI4A 2UUBF 1LWEB 1CJUB 2B5JA 3DU5A 2LEPA 3HFKA 4NA1A 1VCTA 2B4PA 4YY3J 1EARA 3CC2S 5KFQA 3AAWB 4C2MA 4NRUA 7AT1B 2YWHA 4M5MA 2H54B 1S57A 1SQFA 4KFBB 3V2UC 2DGVA 3VVUA 1XC9A 2GNKA 5CABA 1TV6A 3NGKA 4OLPA 2N3LA 3GYGA 1L5UA 2CJKA 1MN7A 1PAEX 1JB0C 2M88A 4DMZA 1MWQA 3RB6A 1QVFR 2GS8A 2QX0A 2VBXA 5ITHA 2CQCA 3GIIA 3CMAS 2IM3A 1VQMS 2W25A 4NCGB 4F3QA 5LL6d 4XDDA 4GO5X 4A8QA 2CJBA 1R43A 4PZVA 1V3SA 1B0VA 1N36F 2NSCA 2ZH9A 2BJ9A 1H74A 2JEIA 3VGSA 4Y28C 3SFUA 3PR5B 8ATCB 4JI5J 2XYPB 2I38A 2H5JB 2IBKA 1KONA 1RKIA 3NLCA 5HP1B 1S79A 5A8KB 3I87A 1SH2A 1VHIA 4B3TJ 1UW9A 4OZJA 4Z7YA 2VFTA 4C0HA 2C2EA 2Y9HA 4L3KA 1ZTWA 3B78A 3ET6A 1U26A 3S7RA 3HSGA 1MLAA 1K9MT 1NU4A 2GCFA 3LP2A 1E6VB 1RHJB 3K5OA 3HDSA 2XMWA 4JV5J 4RW8B 1PJ6A 5C25B 1ZPWX 2Y1RI 3PW2A 3IRWP 1VQ5S 1YHQS 2MQOA 1PYOB 4QPTA 6FDRA 2DJWA 2B5JB 4CCHA 1U02A 2DNHA 4C6AA 4QIWD 1S1UA 2HHXA 2BX6A 1MG7A 5IT0A 3NY0A 3C14B 4E2FB 2D1CA 4XTTA 3OUYB 2AD9A 2HK3A 2VA3A
chains in the Genus database with same CATH topology
1C0TA 2OO4A 1GXTA 5GAHI 3LP0A 2FVSA 3CSKA 1NK0A 4Y2AA 3DC2A 3TARA 2OLWA 2CPHA 1TV6B 5D3GB 4Q44A 2LDYA 3OLBA 4F2SA 2HWIA 3PZPA 2YNGA 1U6FA 3DRXA 1DTTB 2AU0A 4GKJF 1FEHA 4EBCA 2C42A 4EFAC 2GV1A 2VB6A 1HNXF 1YQHA 3IGNA 4EUVA 3ZZOA 3U27A 4DFMA 1JNZB 1KS2A 2F4VF 1S99A 4JV1A 2LEBA 1S48A 2EPIA 1JLGA 1QM9A 2H5EA 3N28A 2OH2A 2BA9A 3KFWX 4HEA9 1Y7PA 1LFWA 5I42B 1Q81T 3SYZA 4NLUA 3R5BA 4A8WA 4QIVA 3HVRA 1SJ1A 3DOKA 3ETOA 3MM8A 4ETZA 3IBWA 5CCMA 3PV8A 1RJJA 3ISNC 2D74B 2X1GA 4A8OA 2J6TA 1APSA 2ZFHA 2MMYA 3A8EA 4X4OA 4KGMA 1IKXA 2I5JA 4BWJA 1Y9OA 3CEDA 1C0UA 3QIPA 5F8NA 5HN0A 4TU8A 3SEOA 1T3NA 4ZPWR 1ZYQA 3KK3B 1ZM9A 4J9KA 4WK1A 1SV5A 2JC1A 2KT3A 4ZS6A 4USIA 5IWAF 1S7HA 2BV3A 1VQKS 1JLEA 4A8XA 1BQMA 4Q2LA 2QA1A 1WELA 3GFHA 3PR4A 4IFVA 1Z1ZA 4ED5A 4ZLPA 1U1PA 3M2RA 1EETA 1F60B 2W4PA 2ASJA 2DH8A 1URNA 1F9FA 5KT6A 3RB3A 2R7TA 1FTRA 4NLQA 5T41A 4X62F 1FJCA 2VG6B 1NK6A 2DPIA 2PEHA 5DDQC 1RT6B 3MPVA 2DO0A 4HT5A 4M94A 1FVSA 3DN9A 3K57A 2MKJA 2VOPA 2EFPA 3P5TL 3LGNA 2AGQA 1S10A 1M5HA 4I56A 2MKSA 3R27A 2ZZNA 1YWXA 4X84A 3PX0A 2FDNA 2PA8D 4URGA 2COLA 1HI8A 4V19J 1I1GA 2P9EA 3CDAA 1S77D 2RMLA 2BANB 4O23A 4ICLA 3CDUA 5D77A 1ELOA 3QLHB 1JK9B 5I4MA 1RTIA 4TY8A 1S1WB 3H5YA 4LVNP 4LIWA 4ED3A 2XCPA 4TQSA 3BS9A 3U1LA 2MQQA 4Y0FA 5K8PA 3J7ZT 1UVNA 3DYAB 3Q23A 1HBOB 3FSYA 4I4BA 3Q8RB 3NCPA 2JHEA 2CPZA 2BOPA 2APOA 3M2UB 4B9MA 4B9LA 1S9GA 2PA3A 4H54A 3QIDA 2XWXA 2FLOA 1JKHB 4IDKA 1VFJA 1WHVA 4CI0B 4HYKA 4C8NA 1FRKA 4B08A 4DF4A 4NLSA 5G4DA 1QAJA 1HFEL 3OR1A 4PQAA 2MDAA 3V6HA 2CJQA 4F8RA 4C8YA 4AL6A 5DO2A 7FDRA 1H2TZ 3CCUS 2OIHA 5CH7B 3BB5A 3K8VA 3LP2B 3K8WA 3N4WA 2N4DA 3IWXA 4QIGA 1P9QC 4WFXA 3FVYA 1FKOA 4ZCKA 2Y0SD 1VGYA 4PUOB 3DOLA 2ZHOA 3B8HA 3RW7A 4DJBA 4ZHRB 2N7YA 2XGPA 2V8DA 2VC0A 1ZETA 2HW3A 4KKOB 4MFBB 3Q22A 4A4JA 2V0NA 4ES1A 3C6UA 1S72S 1SIZA 4KO0A 2J8AA 2J7KA 4M1KA 5M2RA