1S1UB

Crystal structure of l100i mutant hiv-1 reverse transcriptase in complex with nevirapine
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
424
structure length
401
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWHPAGIKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of HIV-1 reverse transcriptases mutated at codons 100, 106 and 108 and mechanisms of resistance to non-nucleoside inhibitors
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords Reverse transcriptase
total genus 113
structure length 401
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1s1uB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1uB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1uB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1uB03
1TL1A 2HNYB 2BANB 3MEDB 1IM4A 4MIBA 4EBDA 3H5XA 4O3PA 1VRUB 2BR0A 4DG1A 3IRXA 3DOKA 3V4IA 2DPJA 4JV2A 2WOMA 1WNEA 3QYYA 3RB3A 4WYWA 5J2PA 2OPPB 4NLSA 2W8LA 3M8PB 4IG3B 4ZP8A 5KFYA 3FQKA 3NL0A 5I42A 1RT2B 3CWJA 4DEZA 3Q8SB 4PQUB 5KFMA 3CJ5A 3RB4A 4IH7A 4G1QB 5F9LA 3RAXA 5HROA 2HNYA 4WFZA 1FK9A 1RTHB 4IG0B 4TY9A 4ED8A 4LQ9A 4F50A 3QZ8A 3H5YA 1T03A 2WB4A 3ISNC 5DQGA 3EPIA 5DLGA 2W9AA 2IM0A 3KOAA 4RW6B 4IH5A 2R8IA 1UWBA 1FKOB 3GILA 1IKVA 3KLFB 1JKHA 4ECXA 5K14A 2ATLA 2WRMA 5I42B 4K4YA 3CDEA 3N6MA 2UVVA 3E01A 3DRRA 3DYAB 5J1EA 2B6AB 3ITHB 3KLGB 2ZE2A 4JV0A 1S9GB 3H5UA 5EUHA 4RW4B 5KG0A 1TL3B 1BQMB 4YP3A 1KLMB 4K50A 2YNGB 2JC1A 5CYQB 4ZP6A 3KJVB 5KFVA 4FS1A 5DG7A 3M9OB 4IKAA 2HNZB 4URQU 1XR7A 5DG8A 2WCXA 3ICLA 2ZD1A 4U7CA 4O3RA 4I2QB 1FKOA 4ECVA 4MFBB 3V6DA 4LQ3A 3PW2A 2WOMB 1S6QB 2VG7A 2YNHA 3DLKA 4ZPBA 3G6VA 1RAJA 4WZQA 2AX0A 4R0EA 3QGHA 4TN2A 3E01B 4TLRA 3PZPA 3DRRB 2FLNA 2YKNA 3BSAA 1HQEA 1S9GA 1RT4B 5C24A 3BQ2A 4NLPA 4XO0A 1KLMA 4H54A 5J2QB 5KG4A 3Q8QB 4MIAA 2RF2B 1JXLA 4HYKA 2D3ZA 3MEEB 4EYIB 4NLXA 5JXSA 2ZKUA 4ED0A 1TQLA 3HVWA 3HVTA 4MKAA 3NGDA 2GC8A 3DLKB 1S9EB 1TVRB 1QE1B 3FQLA 2B43A 1N5YB 1S1UB 2XCAA 4EO6A 3BQ1A 4O4GB 4RNMA 1HQUB 3NAIA 2RDIA 2FLLA 1RT4A 5C24B 3KK3B 1QAIA 1Z4UA 2I1RA 5J1EB 3KLGA 4KSEB 3DLGB 2ZE2B 4M94A 2BE2B 4ED2A 3DRSB 2QE5A 4MK9A 3IG1A 3MECA 1BQMA 4NLDA 3KHLA 1TL1B 3MEDA 5KG7A 3QIPA 4EBEA 5KFQA 4WFYA 4WE1B 4F4WA 4ED1A 5DLFA 2ZD1B 5KFEA 3MR2A 4F4XA 4LSLB 4I2QA 1S9EA 1TVRA 5J2PB 3OL7A 1LW0A 1N56A 5F8MA 3OHBA 3OSNA 1HARA 3QGGA 2W9CB 2BE2A 2IAJA 4QWAA 3DRSA 3ISND 2RKIA 1REVB 1RA7A 3IN5A 3MECB 4J9KA 4DL3A 1NNDA 4KE5A 2BQRA 1DTQA 4B3OA 4WYLA 4J9PA 2IJFA 1IKWA 1C0UA 5KG6A 4WFXA 2WONB 4NCGB 4TYAA 1LWEA 4LSLA 1UWBB 1HYSB 1HPZB 2IC3A 3GIIA 2CKWA 3C6UA 5KT7A 4O4GA 3GQCA 3RAQA 2B6AA 3ITHA 4DL6A 4ZPCA 1HQUA 2AU0A 2IAJB 5D3GB 3QGIA 3KNAA 5KFFA 4RW4A 1C1CA 3IGNA 4JV1A 4NRTA 3MF5A 3PR5B 4O3SA 1C0UB 5KT5A 4KV8B 4KBIA 4FS2A 1KHVA 1BQNB 3QLHA 2V4QA 3KHHA 4F4YA 1RYSA 2V9WA 2AGQA 1JLGB 2OPQB 1S1VA 1HYSA 2WTFA 4ECTA 3PW5A 3UPFA 3GV7B 3PW7A 2UVUA 4KHMA 5DQIA 4EYHB 2IC3B 2FVSA 4IQXA 3IS9B 3CDWA 4RNHA 1TKXB 5KFXA 3GV8B 1TKTB 4RW9A 4RZRA 4YR0A 4R5PA 2GIRA 3FSIA 3DLEB 1QUVA 3V6KA 3I5CA 2R2RA 1JLQA 3OL8A 3BSNA 2WHOA 2W8KA 4KV8A 3MEEA 5FDLB 5KG5A 4PWDA 2R2TA 1BQNA 3QLHB 1K1QA 2AGPA 2GIQA 1JLGA 2OPQA 2WONA 4O3QA 4DL2A 3SFUA 4NLRA 3LP0A 5C5JA 4G3IA 4IR1A 3IS9A 1QE1A 3PR4A 4KO0B 1ZETA 1D0EA 3DMJA 2J6TA 5C25A 1HPZA 1C2PA 1TKTA 2XI2A 3T5LA 2BQUA 5F8JA 1DLOB 5F8HA 3CJ4A 4MH8A 3H40A 3TAMA 3KK2A 3NMAA 3C6UB 2F8EX 4R5PB 3CJ3A 4J9RA 1S10A 3T19A 1TKZB 3CO9A 3KLVA 1RYRA 4ECUA 3IG1B 4ED6A 3DI6B 3M8QB 3H98A 3H59A 3QIPB 4RNOA 2JC0A 4NLVA 4ZVHA 4PWDB 2RDJA 3E51A 3H5SA 2ASLA 4JUZA 1JLAA 3FRZA 5KFTA 4ECSA 5C42A 2YKMA 4O4RA 1S1VB 4YR2A 4J9OA 3I0SB 5C25B 4O3NA 1JKHB 4DL5A 4YQWA 1DLOA 5KFWA 2ALZA 1FKPA 2R8JA 3Q8PB 3KK2B 4DL7A 3LAKA 3DYAA 3BR9A 4WXOA 3KLIA 3N6NA 5KFJA 3CIZA 5KT3A 1REVA 2RKIB 1RT6B 2V4RA 4ID5B 2IM3A 3KLHB 2YNGA 2JLEA 4TY8B 3KJVA 1S0OA 4J9NA 5L1KA 2ASJA 1IKWB 3PW4A 3RB6A 4IFYA 3M9MB 4ECQA 3PW0A 1JLAB 2HAIA 5F8NA 3GIKA 5FDLA 4IOBA 2J6UA 2BRKA 2E9RX 1LWEB 1S1TB 3MFHA 1RT7A 1SV5A 2UUTA 2R2SA 1DTTB 1R0AB 1RTIA 3I0SA 3QIDA 2YNHB 1RDRA 3LALA 2ASDA 1S6PA 3DMJB 4KFBB 1SH2A 3V6JA 1SH3A 4TQRA 3MR5A 1ZTWA 3LP1A 3KLIB 1HNIA 1LW2B 4URSA 4QW9A 2W7PA 4ID5A 1C1CB 3Q8RB 3I5AA 5DGAA 5KFBA 1RT1B 3BSOA 2RF2A 4ECRA 1NHVA 3DI6A 3HHKA 4WXWA 4RUCA 2OPRB 2I5JA 2VA2A 2VA3A 2HWIA 2C22A 3BQ0A 1DTTA 1R0AA 2JEFA 4K4UA 4KKOB 4K4WA 2D3UA 5KFCA 3PVXA 1JLCB 4KAIA 4QW8A 1D1UA 3TQ1A 1RT3A 1W25A 4IRKA 5KFAA 5KFHA 1EETB 4NLQA 1HNIB 1LW2A 1JLEA 2W7OA 2FJXA 2CJQA 3EZUA 5EDWA 1S1XB 2O5DA 5L1IA 1S97A 1RT6A 4KB7A 4EO8A 4NLYA 3KLHA 3OL6A 4XPEA 2OPRA 5KFIA 2HNDA 4I2PA 4WE1A 3DM2A 1TV6A 5CYMB 5F8GA 3RBEA 4Q43A 4QWEA 1RT5B 4Y2CA 3PHEA 3LP0B 4ZP7A 1MU2B 4R8UB 1JLBA 1S1TA 4O44A 4ZVEA 2OH2A 2YNIA 4ZHRA 3PJWA 1RTIB 2XWYA 3MEGA 1KHWA 1T05B 2JEJA 3PJXA 1EETA 4NZ0A 1S0MA 3GYNA 1HNVB 2OPSB 4Y34A 5KFOA 3G86A 4ZPDA 3LP1B 1N48A 3TVKA 4FBUA 2VG6A 3DOLA 4IDKB 3M8QA 4OL8A 3HVAA 1NHUA 1T94A 3T5KA 3OLAA 3KLEB 5CYMA 1N4LA 1S1WB 5J2NA 5F9NA 3OSPA 4RW8A 2I5JB 1C0TA 5HLFB 4NCGA 1C1BB 1YVFA 2C2RA 1JLBB 2YKMB 4ED3A 1HMVA 3NBPB 2FLPA 2JEGA 2IJNA 4ZHRB 2W9BB 1S9FA 5KFKA 1QAJA 5T14A 3KHRA 3MEGB 1LWFB 4ZPAA 3JSMA 1JLCA 3FDSA 4Q45A 3UQSA 3SI8A 3QO9A 5EWGA 3T5JA 4M95A 4KHRA 3MR3A 3BSCA 2BANA 4I7FB 2FVPA 5D3GA 1EP4A 1GX5A 3MTKA 3N6LA 4NRUA 3DRPB 4NLWA 1CSJA 2IM1A 5KFGA 4TY8A 4K4XA 2B5JB 4ZVGA 4Q8EA 3FFIA 4IFYB 2UUWA 3LP2B 5J2NB 5KT6A 4RW8B 5HLFA 4J9QA 3G6YA 3DM2B 3D28A 2R8GA 3M8PA 4IG3A 1JX4A 1RT5A 1S0NA 2D7SA 2DPIA 1MU2A 4R8UA 1LWFA 5F8LA 3RBDA 4EEYA 5KFPA 3BJYA 3DDKA 1S6PB 1TKXA 3QO9B 3V81A 1T05A 4GC7A 4G1QA 3T5HA 4PUOB 5J2MA 2E9ZA 2C2EA 2EC0A 1HNVA 2OPSA 5KT4A 4MKBA 3DLEA 1T03B 3CDUA 1RT1A 3DOLB 4IDKA 4HKQA 1JLQB 1TP7A 5KG2A 4J9SA 4F4ZA 4X2BA 3KLEA 4YMEA 2FVQA 2V0NA 1GX6A 1C1BA 1RA6A 4KKOA 3SFGA 2XGPA 1IKXB 2BQ3A 4Y3CA 2W9BA 2IM2A 4KO0A 4QWDA 1SUQB 1VRTA 3V81B 5L1LA 4K4ZA 1JLFA 3I5BA 4PUOA 1RT3B 1TL3A 3TAMB 1MMLA 3NAHA 1SH0A 2FJWA 2XI3A 4J9MA 2JEIA 4URGA 1N6QA 3V6HA 5HP1B 1TKZA 3C6TB 3GV5B 3OL9A 1EP4B 2ILZA 1XR6A 5DQHA 4H4MB 2WK4A 2B5JA 1TV6B 2R8KA 1RTJA 5KFRA 3LP2A 1S6QA 2VG7B 4TYBA 2FJVA 3MR6A 2XGQA 4Q0BB 5C42B 5JUMA 4IR9A 2YNIB 1I6JA 4NLTA 4RW7B 1RTDA 2XC9A 4IFVB 1SUQA 1VRTB 1HQEB 5DGBA 2R8HA 4RUAA 1JLFB 2C28A 4XPCA 3UR0A 4IRCA 1FKPB 5KFUA 2UVRA 5J2QA 5KFSA 5J2MB 5HP1A 2VG6B 1IKYB 5HBMB 2HMIA 2C2DA 4NLGA 3H2LA 2VG5B 2E9TA 3HVTB 3IRXB 3V4IB 1XR5A 3NKYA 3CJ2A 4K4VA 2QV6A 3I0RB 5I3UB 1LWCA 4QPXA 3MFIA 4TQSA 3VQSA 4H4OA 1S1UA 4QWCA 3NBPA 1RT7B 1SV5B 1RTDB 4FBTA 4ZMMA 3H4DA 3JSMB 3OLBA 3OHAA 2YNFB 4KFBA 4RNNA 1OS5A 2IBKA 2FVRA 4IH6A 4I7FA 3GIMA 4ECZA 1IKYA 3DRPA 5HBMA 1N6QB 2HMIB 3CVKA 3GIJA 3BGRB 2VG5A 3LAMA 3C6TA 3T1AA 2J6SA 3JYTA 3FFIB 4RW6A 3I0RA 5I3UA 1IKVB 3KLFA 4Y2AA 5KG3A 5F8IA 1RTJB 4H4OB 4IRDA 1LW0B 5K14B 5KT2A 4RU9A 2AGOA 2IA6A 3M9NB 4K4SA 4IFVA 2W9CA 4LSNB 3KK1A 2D41A 5EWEA 4J9LA 4NYZA 1DTQB 5CYQA 1J5OA 1JLEB 4B3OB 3G6XA 2IMWP 1U09A 4K4TA 3KMSA 4TXSA 4ECYA 3RB0A 1S1XA 3IGVA 4ED7A 3DOKB 3JYTB 3EPGA 4U6PA 4YR3A 4Q44A 2HNDB 2OPPA 4I2PB 4MFBA 3V6DB 5KG1A 4DL4A 2AX1A 2R2UA 3HKWA 1T3NA 4MK7A 1LWCB 1RT2A 4NLOA 1IKXA 4O44B 3KHGA 3KMQA 2YKNB 2XCPA 4RNFA 4ICLB 2BRLA 5KFDA 3KK1B 4NLUA 4GC6A 5KFLA 5HROB 3BREA 2YNFA 1K1SA 1FK9B 1RTHA 4IG0A 1J5OB 1S48A 1S49A 3CJ0A 3D5MA 2HWHA 4ZVFA 5EWFA 1VRUA 3BGRA 4H4MA 2FVCA 4MK8A 1ZTTA 4DG1B 1S4FA 4ECWA 2AQ4A 1S1WA 3H4BA 3LANA 1C0TB 4O3OA 1JIHA 4ZP9A 4Q0BA 5KFZA 1N5YA 1HMVB 2AWZA 3QZ7A 2ILYA 4RW7A 4RW9B 4ICLA 5L1JA 5DG9A 3KK3A 4PQUA 5L9XA 3UDLA 3DLGA 4QWBA 2UVWA 4Q8FA 4WZMA 4LSNA 4EBCA 5KFNA 2HNZA
chains in the Genus database with same CATH superfamily
4A47A 3R5CA 4LUBA 2HNYB 2BANB 1G4CA 1IM4A 1UAWA 1VIXA 5K8NA 2V69A 2K1RA 1PYSB 4BC7A 1Q95G 2FHKA 3NCPA 2RQKA 9ATCB 1F5CA 2ZH6A 2QA4S 3KNGA 3LH2S 3TJ8A 4JV2A 2DH9A 2DPJA 3AQPA 1IR2A 3WBZA 4CO0A 3G8TA 3MMBB 1VGYA 1YJTA 4WYWA 1SIWB 5J2PA 2LQ8A 4PEOA 2FC9A 2YWGA 1EIYB 2W25A 2W2NP 4X66J 1GAOA 3IO1A 2RUGA 3EGZA 3BGFA 1YJ9S 3GG1A 3Q8SB 1VLOA 3JTNA 3SCLE 3GIRA 1F3FA 5F9LA 4LBPA 1Q81T 4WFZA 1FK9A 1MROA 1MMDA 2F40A 1FESA 4LQ9A 3R5BA 1T03A 1FNMA 5DQGA 2JFKA 4B02A 5DLGA 2IRUA 4RW6B 2GQ2A 1FKOB 2RUSA 3SCKE 3P45B 5F41A 3PTWA 4AXIA 1BWVA 4OZ5A 5E2QA 5CD4H 4ECXA 5K14A 3IR7B 5I42B 4K4YA 3IR6B 2H3EB 3N6MA 1LK7A 2H48B 3ITHB 1FFGB 4F3OA 4B3RJ 1U2CA 2HZAA 3OXGA 4DV7J 2HWTA 4A8YA 1K0TA 1TL3B 1BQMB 4K50A 3RRKA 2DGVA 2H4WB 2M70A 4URQU 1W2BR 5I4MA 4ZVSB 3OV7A 1FWPA 3EICA 3ICLA 2XS5A 5D4OA 3OFEA 1FKOA 2J7KA 4NE9C 3DN9A 3QPIA 3RAMA 2WOMB 4OV6A 4PZVA 1Y9OA 4B9SA 1UFKA 1VBZA 2F4FA 5HQ8A 1ZA1B 2BW2A 1BHNA 4R0EA 3QGHA 1FRKA 3PZPA 2DR8A 2KT3A 1NJZA 3N79A 2D9OA 3HHEA 3BQ2A 4NA1A 2DIVA 3R7NB 2AP6A 2VBWA 4B3MF 2E5IA 5J2QB 4O0IA 2C3OA 4OX9J 4JV5F 1Q0NA 2GMJA 4EYIB 4NLXA 4DI6A 4LFCF 4C2MA 4ED0A 1ZM9A 1WORA 1ZPVA 5D8HB 1UWAA 3PNIA 4M1KA 1VLYA 1N34F 2VU5A 1S1UB 1S72S 2BUNA 2A18A 4F2RA 2CPHA 1RT4A 5C24B 3KK3B 2CG4A 2Z2LA 3R27A 3KLGA 5B0BA 2VFTA 4M94A 3LPYA 2HW3A 1R27B 2DY1A 2E5JA 3G8SA 1QTMA 2QE5A 4LF7J 1WC4A 3LW5C 5HK4A 5C7PA 3DGPA 5K8OA 5KFQA 3MUVP 1XMQF 4WE1B 4M63A 2RRAA 3J7A1 3TA2A 1D9FA 2A6MA 3OTOJ 2GJFA 3W5XA 2H5IB 2DGQA 1FX4A 2EW9A 5IWAF 1GXTA 1LW0A 3H42A 2KXNB 4DV0J 1N56A 3TP2A 2X1AA 4G1PA 5F8MA 4CLZA 4F36A 4DQQA 4LF9F 2BE2A 2IAJA 4CDIA 3UCGA 4QWAA 3GSDA 4XTTA 2RKIA 4F0KA 1FKAF 3CCJS 1FT8A 3D7SB 1VBXA 4ZVQB 1FJCA 4B3OA 1WHYA 2HHTA 4WYLA 3M8WA 1IKWA 5LXYA 1Z2ZA 3CCWA 1UFWA 2WONB 2B8QA 5EX3A 3LQVA 4ES2A 1Y10A 4USHA 2K2PA 3CJRA 3M30A 1IBMJ 1UMJA 3J7YI 2ZBQA 2RU9A 2IC3A 3MAAA 2YKPA 2MLXA 2BKPA 3GU0A 1YHQS 4WKYA 2R7VA 2DD8S 2YH0A 3C6UA 1FRIA 1O0PA 4O4GA 1HFEL 1PC4A 3RAQA 4DL6A 4CCHA 5J1NA 4PRFA 2IAJB 5FD1A 1NSKL 4DN0A 1NPPA 2KJWA 1SJFA 4LF8J 3TNVA 1UW9A 2B0GA 2GO9A 2HQCA 3R6LB 4DR3F 2IYIA 1KKHA 2C2OB 4LFCJ 4UOGA 3CC2S 3GE9A 3PR5B 4QOTA 2HHXA 3NGSA 3CCZA 4KV8B 3SSQA 2JLGA 5JVHQ 4W92B 1BQNB 1RSCA 1TR0A 2B4PA 2YQ0A 4C11B 3MURP 2V4QA 2AGQA 1YI2S 1RYSA 1YX2A 2CVIA 3M30B 4NMLA 2G0IA 4QPTA 2WTFA 4ECTA 2UVUA 3NS5A 3MM7A 5DQIA 5GMKa 4ZDNA 3EXCX 3CDWA 4FXDA 2ZNYA 4DSLA 5DDOC 3C16A 3PHTA 4N7TA 1PJ7A 4DFKA 1U24A 2DEIA 4OHYA 1NK8A 1K0VA 3VAHA 4OI0A 4QQBA 1UL3A 3KTQA 3MM6B 5IS2A 5T41A 4CRJA 4CT9A 3UE2A 1WELA 3RW7A 3C46A 4DCJB 2O67A 5HQMA 3W2VB 3MXHP 3BF4A 2AKWB 3AA8A 1K1QA 1C4CA 1VJQA 2FTRA 3UNGC 1U1LA 4JI7J 4I6WA 1APSA 1UVLA 2D1CA 4OYWA 1FRXA 1HD0A 2AJFE 4LRBA 4O3QA 3SFUA 4ELTA 3MM8B 3VAMA 1G1XA 2DEJA 2R9LA 2AD9A 3IS9A 3FSYA 4M5IA 1ZETA 2FGCA 4OZLA 1IWAA 1C2PA 1HPZA 2FY8A 3C16B 2Y1RI 4I0WA 4O23A 2J0QD 5F8HA 1FI4A 4BWJA 4A8MP 1Z2LA 2LXIA 1VIOA 2RB7A 1RBLA 1TKZB 1VCTA 1MWQA 2HK3A 3BYPA 4DZ6A 2ZBPA 1DQAA 4B08A 4ED6A 3M8QB 3Q89A 1X4DA 3H98A 2EC2A 3QIPB 3H59A 2CNKB 1AUSL 1HWUA 4M5NA 4NLVA 4ZK7M 5B0CA 4JI0F 2RDJA 4DUZF 2KHDA 4JUZA 2ZNZA 4DZDA 2XHCA 5KFTA 1QSSA 5GVQA 1S1VB 4YR2A 2MZJA 3IWXA 4L73A 3LGHA 4B17A 2QSFA 2OSRA 4P71A 3FJ2A 3F0NA 4GVBA 4YQWA 4DL5A 5KFWA 1FRHA 2ALZA 2R8JA 3Q8PB 1NJIT 2PDAA 2DNOA 2GMLA 1XIQA 3EE3A 1FO1A 4NXNF 3T41A 4KTQA 3N6NA 2KG0A 1REVA 3SSRA 4DR5F 2V4RA 4ID5B 2CWXA 1IUJA 3ENQA 3KJVA 2CZVC 4M5DB 3PW4A 4JP8A 1PYOB 1NDLA 3LO3A 3PW0A 1SBRA 2PN6A 1D8YA 1A6LA 2BRKA 2DHSA 1F60B 3QAUA 5D4NA 5ETVA 3ZNJ1 4ANEA 5A8WB 3MFHA 4KH0B 2UUTA 4ZS6A 2R2SA 1DTTB 4ANCA 1VC6A 4C0HA 2CQ3A 2IHR1 2YNHB 2CJ9A 4GVBB 4RLEA 1S6PA 3JTPA 4CQ1A 4KFBB 1WDDA 3V6JA 2MB0B 2Z2YB 1NSPA 5DDRC 2HZCA 5HANA 5GAEI 5IZHA 4RU2A 1OPIA 2KL8A 2W7PA 2ZM6F 3BV8A 4DX6A 4QW9A 5KAKA 4NZ7A 3NOCA 3Q8RB 3W65A 1O5JA 3OQ2A 3BSOA 1KQGB 3NLCA 1NU4A 1WEZA 4YB5A 1RAHB 4P75A 5D0GA 3K57A 2GW8A 3W64A 2VA2A 5CQGA 4PG8A 1P9QC 2J9EA 4C7QA 4A8QA 1D9DA 1PAUB 3BQ0A 1RAAB 1D8ZA 2JEFA 3PX6A 3QQCD 4B9UA 1S5ZA 2IMOA 4YB1P 1S77D 1RE1B 2B4OA 4NEYA 1RT3A 1W25A 1UVKA 1RWMB 1EETB 1DY3A 4DPXA 3M32B 1ZOTA 4DN9A 2UV8G 3W9IA 2COLA 3GG0A 2KG1A 3MZIA 1VQNS 1HNZF 2FUG9 2VJVA 1RT6A 1HNWJ 3KLHA 2ZOFA 2HK2A 3OL6A 4DMZA 3M4XA 5KFIA 2E5HA 3MGJA 2IIHA 4KR0B 4WE1A 3DM2A 5F8GA 4Y65A 3M8RA 5E0OA 1YBTA 2KRBA 3AODA 5HAOA 1NKBA 4QU6A 2QG9B 1S1TA 1WKKA 2P2CB 3P4UB 4GKJJ 3VAIA 1RTIB 2ROPA 4HI2A 3MEGA 4EK2A 2D3OR 2WSFC 1RHRB 3NGRA 2CAJA 5A8KB 1EETA 1MWZA 4NZ0A 4B3MJ 1XC9A 1CEZA 5KFOA 1CPZA 5KOXA 1P1LA 3G86A 2CYYA 3SDEA 3LP1B 1Y7PA 2YX4A 3TVKA 3OTDA 4ZLNA 2N7CA 2XB2D 3DOLA 4IDKB 4ZLJA 1T9XA 1X5TA 1GXLA 2EKNA 1FNOA 1N0VC 3ZZRA 4L3NA 2MKIA 2KFZA 1S1WB 2E7XA 5J2NA 1VK3A 2V63A 5F9NA 4RW8A 5HLFB 4DJBA 5MLCV 3CCQS 1C1BB 3HKZD 3CGIA 2C2RA 4E2FB 2W9BB 1GEHA 3MEGB 1LWFB 4N47A 4ZKAA 3CC7S 2OMOA 5E33A 2NPFA 3FBFA 5IQ6A 1OO0B 1MW7A 3BN7A 4CLFA 4YY3J 1K8AT 5ETRA 3N6LA 4I7FB 2FVPA 4RJVA 1EP4A 4F4AA 1QAXA 3MTKA 3DRPB 4D3HA 2HURA 2ZDOA 3CCES 3MM5B 4C8NA 3V5RA 9RUBA 2B5JB 1RXOB 1CBKA 4USIA 5KT6A 2J6TA 2BA9A 4OI1A 1Y4ZB 2EG1A 1XMQJ 3E3XA 3D28A 4I64A 1FDAA 4IG3A 2BACA 5DZ6A 4B9VA 2AIRB 2D9PA 1RT5A 4AXJA 2ZOGA 3H2UB 3MMCA 5A8RA 3G71S 2KHCA 2DPIA 4PABA 2J7UA 1HNWF 1Q78A 5KFPA 2OEKA 3DDKA 1RKIA 1TKXA 4DX8H 1K44A 1T05A 1U4BA 2DNRA 4G1QA 2EFPA 5J2MA 2DXFA 2FJBB 5D4PA 2OPSA 2V34A 1WF2A 5KT4A 2XEXA 2U1AA 3UVJB 4HTJA 4WU2A 3DLEA 3KFWX 3CDAA 2ZZMA 4QR0A 2HS0A 2JJ4D 2OEJA 5HVFA 4LIWA 5CYJA 1RAEB 2BX6A 4F4ZA 4X2BA 3D3CJ 3MPWA 1KVJA 2NLWA 1W7WA 3CD0A 3HHLB 4ZVUB 2LA4A 2VL1A 3HSDA 1RA6A 3SFGA 3DCAA 1IKXB 1KTQA 2CQGA 5ETKA 2AEMA 2VQFJ 1WUUA 1KFSA 4WK1A 4QWDA 2CJXB 2HG4A 3NAHA 4FYVB 2DCLA 2GGPB 1OPZA 2V9KA 2YBVA 2HGMA 3EDQB 3OXFA 1TKZA 2M3DA 5IC6B 4ILRA 3UD4P 2RJZA 1WTBA 3GPAA 3OL9A 1XJWB 5DQHA 2PE8A 3UD3P 3RBXA 2R8KA 1RTJA 1X0FA 3TA0A 5IT9U 4TYBA 5C2GA 3MR6A 1OQ6A 3HSZA 1TZ0A 1J5EJ 2BJ9A 2YNIB 2ADBA 4NX9A 1RTDA 2XC9A 3K5MA 3O3LA 4X4TA 2AYEA 3QJLA 4XPCA 3UR0A 1X4BA 3TUPA 1Y00A 3DC2A 4IQMA 2MQQA 2UVRA 2BOAA 1DURA 5KFSA 1FERA 3B4DA 2DGXA 3TUIC 4ILLA 3KUHA 5HBMB 2HMIA 3G6ES 1KVKA 1CC8A 3CXCR 2C2DA 1U47A 2VG5B 2RIJA 2OTJS 1OWXA 1X7VA 2V4JA 3BB5A 3ONQA 1T9UA 5HI7A 2OUGA 1IQZA 2ZWOA 4ZN3A 2IA0A 4NCBA 2NUHA 3I0RB 4USJC 1LWCA 5B09A 4QPXA 2A1BA 3AD9C 3HJVA 4H4OA 3U1NA 4QWCA 2X3DA 3NBPA 1RT7B 3ZZYA 2B7CB 3MPUB 3TX0A 4KPYA 4J5OA 2OLWA 4ZMMA 3W1YC 2OO4A 2FQQB 3GMGA 2ALYB 4AQYJ 2EFNA 2YNFB 3PFEA 1OS5A 5DO2A 1JQGA 2FVRA 2IFXA 3HULA 3N5FA 3FK4A 4B3SF 1ZH5A 1B0PA 4ZN1A 1IKYA 4ECZA 4CO4A 3MCOA 4DR2F 6FDRA 3G82A 4DPUA 4DUYF 3JYTA 2IVMA 1GXUA 1CQNA 2A2CA 2H4YB 3M2VB 3QSIA 3W8PA 3BO4A 4I4BA 4RKUC 4KGKA 2N7YA 3A12A 5F8IA 4H4OB 2OAUA 2VFRA 1Y11A 3DKDA 4RU9A 5CXTA 1BC6A 1G2EA 1VQMS 3EVMA 4K4SA 1RHMB 2DYAA 4AFFA 4DV0F 2YWFA 4CH0S 5LSRA 2ADCA 3WDOA 2LFVA 3KK1A 2AEFA 2D41A 1WSRA 3TR5A 4J9LA 2R4FA 5D6GA 4NYZA 2HBYB 1DTQB 1SC4B 3M32A 2F65A 2FJDB 2MLZA 4LT6A 1FFSB 4K4TA 2WVEA 2VUGA 4L72B 4TXSA 4LFBJ 1RK8A 2JH3A 4ED7A 3KYLA 4ERDA 3JYTB 4U8YA 4NMXA 3EPGA 3OTCA 4N41A 2F3JA 8RUCA 4Y00A 4R25A 1T3NA 2AX1A 2R2UA 4PWUA 1R8HA 3N01A 1PJ5A 4LF8F 4ZVRB 1IJFB 2L9WA 3IBCB 3KMQA 3HZEA 4JV5J 2NSCA 2YKNB 1GTEA 2EKYA 2EI5A 2BRLA 1NB2A 1WI6A 1WEYA 4CO5A 4C48A 5L39A 3KG4A 5KFLA 2L41A 5HROB 1B7YB 1K47A 1R43A 3K5NA 4UY8T 4KQZA 4I6AA 4IG0A 3PCOB 4BWMA 5K8MA 1NKCA 5IV4A 2AJ2A 4ZVFA 1JK9B 2G1HA 2AJQA 2XY5A 1FEHA 2CZ9A 2K7JA 3ZXWA 1VRUA 2OD6A 2HHPA 1HHSA 2FVCA 1ZTTA 3R6GB 1RBAA 4MK8A 2MEWA 4NZ6A 3A8IA 1ZBTA 4FPIA 3HFVA 4YY3F 3TRGA 3C19A 3OW2R 3C15A 2MQOA 4DU7A 1HMVB 4OYBA 2KU7A 2ILYA 1U0HA 2ZH5A 4RW7A 3D0GE 2R42A 1TK0A 1SKRA 2PI4A 4LF5J 1MWYA 3KK3A 4PQUA 5L9XA 2MKJA 2MKCA 3R9LA 2J8SA 3L4BC 4LSNA 3EVOA 4M5LA 3W63A 2HGLA 1B64A 4MIBA 2CZ4A 3DOMB 1VRUB 2ASYA 3IAM9 2XZDB 2NUUG 3DOKA 4DV6J 4TKTA 2NXNA 2WOMA 2OGUA 3O44A 5E41A 1NK7A 1K9MT 2BOPA 2OPPB 4ZIVA 3C15B 2ZVIA 3BBCA 2CNLB 2FD2A 4NLSA 4IG3B 3G96A 2W8LA 5KFYA 3FQKA 3T1HJ 4F4KA 3CCRS 4IUFA 3CWJA 2KXHA 4DEZA 1FTRA 2MXYA 4PQUB 1YKWA 2LYVA 3PX0A 2V6AA 4GKJF 3CJ5A 4FYDA 2PIIA 2XMTA 5LOQA 1H2TZ 1V6HA 3I4HX 1HBNA 5IXUA 4G1QB 4MYUA 3CUNA 4YFUA 3PY8A 1HW8A 1VHFA 3DU6A 2OSQA 4I56A 4RWXA 2CPIA 1P1TA 2CPXA 3DOMA 3QZ8A 3OD2A 4ED8A 2PGCA 5EHHA 2NXJA 1X9WA 4IRCA 3AOAA 2LLZA 1SCJB 2N4DA 2YKAA 3KDOA 4P9SA 3B4MA 5T7LB 2EBGA 2PD1A 2G2YA 3KLFB 1AXQA 2OD4A 2ZEJA 2QLWA 4QJVA 4XDCA 1N33F 2R7TA 1JKHA 3ENAA 4DR3J 4U96A 2IBOA 1RCXB 2UVVA 8AT1B 2NQPA 1C4AA 3DRRA 1OSDA 3V4MA 3J80U 5J1EA 1J5EF 2ZE2A 2GHPA 1HBOB 2HIYA 1S9GB 1B99A 2GVZA 3JSRA 2YNGB 1EAYC 5CYQB 2JC1A 2DISA 3NEKA 2CPZA 4FS1A 5DG7A 2NREA 3W5YA 1XR7A 3W2WB 2ZH1A 4C6AA 3UN5A 4ENOA 3Q0AA 4NCAA 1HA1A 1Q82T 2K1RB 5KFNA 4FDFA 4U7CA 3GCWP 4C11A 1MMNA 4I2QB 2DKOB 4ECVA 4DCOB 3V6DA 2CADA 3D2WA 3EGVA 3PW2A 2MGZA 2BJ8A 2VG7A 2LDIA 3FZ2A 4LVNP 5DDPC 3FKBA 4RBVA 2AX0A 4WZQA 4TN2A 5ETQA 4TLRA 1QVFR 3AB2B 2FLNA 4B3RF 3N28A 2Q66A 1BMQB 1AZSB 4XO0A 1N54B 4H54A 5KG4A 1U45A 4MIAA 4AQYF 2RF2B 1U1NA 3OFHA 5F3TA 4BCAA 3TARA 2DGUA 2D3ZA 2ZKTA 3MD1A 1HL6A 1LFWA 1HQ2A 2IRXA 4LR9A 5KT3A 4K0KJ 4FYWB 2IDEA 3RYLA 4DCPB 1YIJS 3MAAB 3KG1A 3QRQA 4FXWA 2MHNA 3B6BA 1VFJA 4P7TA 1U02A 5AE3A 4O4GB 3BQ1A 2F9DA 2WW8A 4RNMA 1SJ4P 2NR0A 2NZ4A 3NAIA 2RDIA 2W7AA 2JFDA 1Z4UA 2QRRA 5D4LA 2I1RA 1YBAA 1D9AA 2P9CA 4USWA 5D15A 3BDPA 2XHWA 2V5HG 1LOUA 3DRSB 4ED2A 3IG1A 2MYFA 5KG7A 3IWNC 2GO8A 3CJ8A 4WFYA 2M88A 4F4WA 4MT1A 3I96A 2B9EA 3G82B 1FE4A 1S59A 1SC3B 4J91A 4X62J 4ED1A 5DLFA 2IRYA 5GMEA 3M2VA 3SQOP 1KOHA 4LSLB 1DJ0A 4HVZA 1S9EA 2Q43A 4C3MA 2M8DB 4DR7J 1GK8A 2MKHA 5G0RA 3US5A 4DFJA 2G4BA 2C1EB 2GNKA 4RBTA 2D3O1 1HARA 4LREA 3I82A 2W9CB 4LRDA 3ILJA 3QT8A 4YEAA 1CJVB 3ISND 3BKUA 1REVB 1RA7A 2I9SA 4KC5A 4OX8A 5ETSA 2CQIA 4U95A 4DL3A 4OJ3A 2V2ZA 4DPWA 4Y0FA 4C8OA 4J9PA 1EQ0A 4TNOA 4X4QA 2RHQB 3PYGA 4M5DA 5HJYA 5K8PA 1NK5A 3MWBA 3OT9A 1KLNA 1GMWA 2DVIA 2K7KA 4JI7F 3M6WA 1UW4A 2MKYA 2HS3A 1N88A 4C4WA 3RRGA 1Y5IB 4M5KA 1CS4B 1UWBB 4GKKJ 3OBIA 2WVFA 1TL5A 4KPCA 3P6YC 2CQBA 3H7HB 4PYDA 2E1CA 2G2OA 2HPUA 4F0MA 1U2FA 3UO0A 2CKWA 1CG2A 1FVSA 1QY7A 2E44A 3ITHA 3NCQA 4FZVA 4EU0A 2AU0A 3JSYA 5M2PA 3GWCA 3QGIA 3N5BA 5KFFA 4RW4A 1YSJA 2FHJD 4U7UD 3IGNA 4JV1A 4QIGA 1VQSA 2RS2A 4ZOSA 2XYHB 1RBOB 5KT5A 4FS2A 4KBIA 5ETNA 1KHVA 2MQNA 4NI2A 3CF5Q 3ZC4A 3KHHA 3QJPA 1JLGB 2V8HA 1S1VA 1HYSA 2AV5A 3GJRB 4DOZA 3PW7A 4KHMA 2RQCA 4CI0B 1HNZJ 1S79A 4RUBA 5HMWA 4UZCA 1H7XA 4RNHA 5E3PA 3GV8B 1FX2A 1U0HB 5L46A 3KKFA 3T1HF 4RW9A 3K8WA 4R5PA 1WWHA 3FSIA 4PPDA 1IBKF 2KZMA 4HL9A 3DRXA 3LWLA 1S76D 1QUVA 2R7WA 2B3TB 3HT3A 3I5CA 1JLQA 3TJAA 4DR7F 4ZVPB 3SBMA 3HXMA 3MEEA 1B0TA 2O1PA 2QMWA 4PWDA 2KVIA 2R2TA 4NEZA 4PXCA 2AGPA 2GIQA 1RI7A 2QLJB 4J90A 1JLGA 5H1SV 4WTOB 4DL2A 5BXIA 1VJWA 2WVBA 5C5JA 3RRHA 1OMSA 3A3OB 3PR4A 4KO0B 4B9NA 4DS5A 3DMJA 5C25A 4PQAA 1TKTA 1NDPA 1PCAA 2QYCA 3BKFA 3CJ4A 2AYGA 4DPTA 4B3TJ 3C6UB 3CJ3A 2MZTA 2RNEA 4KT0C 4QIEA 4YDXA 5F0WA 3J7Z5 4X62F 3MEKA 3WC0A 3KLVA 2MZRA 3GFHA 3DI6B 3DNCA 4NXMJ 5HSPA 2MY8A 2OP5A 1UPPA 2AJ1A 5LSLA 2DNZA 5KFJA 3NMRA 3H5SA 2ASLA 2C3MA 2QYGA 3NS7B 1T7PA 1KDNA 2LQ9A 3FRZA 1RWOB 1QSYA 2H9ZA 3D0HE 4OV1A 2NYHA 4O4RA 3JB9k 4J9OA 2DHGA 3M2RA 2V8GA 5ETLA 3ZO7A 4WFBQ 2OIHA 3KUEA 5CZXA 3ILOA 2NXUA 2ACYA 3DXSX 3NWRA 2J0WA 3ZZ0A 3MPYA 3GB0A 3DYAA 3BR9A 1RWXB 1CQMA 2J9DE 2NYIA 3KLIA 3DXBA 2MQMA 3T6BA 3QNWB 1LEOA 1WG4A 2CQ2A 2RKIB 2J0XA 5AXLA 3B8HA 2IM3A 1RWUA 3KLHB 4Z37A 1WKJA 4J37A 1YTYA 2JLEA 1XNQF 4BBYA 5ADZA 2Z56B 3J80Y 3RR8A 5L1KA 1S0VA 1IKWB 5GAEU 2AJ0A 4IFYA 4ECQA 2E5LF 4DPYA 2GHVC 2HAIA 4BC9A 4F0HA 3ZTSA 8ATCB 1L3SA 3FCWA 3TZWA 3CD6S 3W9JA 4DV4F 1S1TB 1KTVA 3MD3A 4RO0A 3W5ZA 4ANDA 2DHAA 4A8WA 1R0AB 3TZYA 1RTIA 3I87A 4HT7A 4U8VA 3VAGA 1K73T 1RDRA 1RABB 2MQLA 5B0DA 2XWXA 3LALA 2Y3YA 4DLGA 2J5AA 2HAFA 1SH3A 4PAAA 1M5PC 2GMHA 4TQRA 3QT7A 3MR5A 2FHOB 2DR9A 3LP1A 1HNXF 4F3MA 4A46A 4B3SJ 4DSKA 2AMCB 3D0IE 4QIWD 2RF2A 5KFBA 4DQIA 1NHVA 3G9CA 1UEVA 2UXDF 3OUYB 2KN4A 3M8SA 1KD1T 2E5GA 4ZJQA 3L3CA 2C22A 3HHLA 4CIOA 4DR1F 4ZVTB 4JI5F 1R0AA 4KKOB 5KFCA 1U1QA 4NXNJ 4KAIA 5A6WA 4C0OC 2HYIB 4QW8A 1MN9A 5CD4A 4DUZJ 2Y0SD 1NK0A 3Q2SC 4PKDB 3I32A 1O6XA 1RU2A 4YHHJ 3TQ1A 3DLHA 4C9DA 5KFAA 1LK5A 5KFHA 1U1MA 1HBMB 3B78A 4GO7X 4NYOA 1JLEA 1AFJA 1CJUB 1T9YA 2A2DA 4G6VB 1XNRF 4DV5J 1X4FA 3HSJA 4DR5J 1S1XB 1X5PA 4OIXA 3EDRB 3IR5B 1XNRJ 3FEZA 4NLYA 2CIMA 4X4UA 4XPEA 2Q3PA 4ITSA 3I56S 3UCZP 4GVLA 5CYMB 2HFSA 4LRCA 1SJ1A 1SXLA 4Q43A 4QWEA 4PG6A 4LF1A 2EFVA 2HHSA 2VV5A 1TMMA 4ZP7A 1MU2B 4R8UB 5GAGI 1X60A 1BLUA 4MTPA 2YNIA 2VKRA 3M8YA 2KKHA 4I67A 1KHWA 2DTJA 4NPOA 4UOFA 4I6YA 3MAQA 4NXMF 2CWKA 4H4KC 2OPSB 4JBCA 2XY6A 4WPAA 3NGUA 4LF9J 4ZPDA 1MLAA 1N48A 1X5SA 2M5YA 3DGVA 2AF6A 3IBFB 4ZLLA 3M8QA 1I1GA 3OLAA 5SZTA 2K06A 1N4LA 2CNOB 2W1BA 2I5JB 2GVDB 5E5NA 5HL7Q 3J81j 1KQKA 2CPYA 4LRAA 2I6WA 2XO6A 2DBBA 1S9FA 2Z58B 5KFKA 1TMJA 5T14A 2YXLA 2ZUAA 3FDSA 1RCOB 2QSWA 3BEGB 3QO9A 3LUYA 4FKYA 2KM8B 3T5JA 3Q24A 1SKUB 2ZH3A 2F5GA 2KDOA 3LGNA 2BANA 1S7HA 2GJIA 1VBKA 1NHKL 2VPZB 1CSJA 2W2PP 5KFGA 1VBYA 4K4XA 4TVAB 1CJTB 3Q86A 1NCLA 4GO5X 1FJEB 2VPXB 4UW2A 1H38A 1Q8KA 1HW9A 4DR4F 3FBCA 2VH7A 3L7OA 1I51B 3O6QA 3QBCA 4DR4J 4F8RA 1X4EA 2WZ1A 3K89A 3RBDA 1DHMA 2PFDA 2EBEA 3QO9B 3V81A 1UVJA 3EX7B 4GC7A 4X64J 2Z4PA 3RGIA 2E9ZA 5A8KA 2C2EA 3HT0A 2EC0A 3S01A 1DRZA 1A0OB 1N5VA 4LJMA 1DARA 1FDNA 2XULA 3CCSS 2UUAJ 1T03B 2FZCB 2DR7A 2VD3A 1RT1A 3DOLB 4IDKA 1S4EA 4HKQA 2XYPB 1TP7A 3GLJA 5AXKA 1YJVA 4FNIA 3D6FB 5KG2A 4J9SA 1RB0A 3G4SS 2XZTB 4YMEA 2UU9F 1RAGB 1C1BA 5FIIA 1IQTA 3HD2A 3OTBA 4Y3CA 1IM6A 2W9BA 1NSQA 5LMNF 1XQIA 2M8HA 1HI8A 2F8HA 2M2BA 5L1LA 5LMNJ 2G0CA 4YB7A 4DV2J 5CZVA 5IC4B 5HMZA 3SCIE 4J9MA 3MMAB 1P8GA 3W60A 2DB1A 2DHXA 2PEHA 1RAFB 2OFHX 3NWGA 4PXEA 5HP1B 2FJEB 3GV5B 1EP4B 2ILZA 2QGFB 3OTOF 3LWMA 1FRJA 1EKRA 1R6YA 2VPYB 2ZWPA 4BHQA 2J9DA 4DR2J 1HHTP 2UXBF 2VOPA 4MKYA 3SV3A 3AQOA 3I6PA 2WVDA 2OKQA 2P8IA 5L38A 2GQCA 1I94J 1S6QA 1KN6A 2FJVA 1CULB 2QJ3A 3IAS9 3BPSP 4OZNA 5H9EK 3HDSA 3M05A 5CH7B 4W90B 1M1GA 2JOQA 3AB4B 4IR9A 4KRWA 4YB6A 5A8RB 2JRSA 1HQEB 4E98A 3GFZA 1JLFB 4RUAA 4D3GA 1FJGJ 4DSFA 4CO2A 5J2QA 4N8OA 4W4MA 3FBBA 1ROFA 1BE4A 1WEXA 2KB2A 1TK8A 2VB6A 1WG1A 3O5TB 1LQ9A 3HVTB 3IRXB 3V4IB 2DGOA 5HVGA 4M5GA 2XY7A 3TW0A 1H3DA 2B9YA 2CA9A 2QV6A 4C97A 4EGLA 6FD1A 3U7JA 1U6ZA 1OJ4A 5HVHA 2C3YA 3F56A 2ZJRQ 1B70B 3JSMB 2MSSA 2XMKA 2UXDJ 1URRA 1RWNB 4ILMA 4P73A 5IOLA 4RNNA 2Q6CA 7FDRA 3BO2A 4DR1J 1X4AA 1WOOA 3QSYB 1TFWA 2XNQA 4IH6A 3CJKB 3UNYA 4CLTA 4B9MA 2RT3A 3GIMA 2ZOMA 3GIJA 1HBUA 1VYAA 4JI2F 3LAMA 1IWGA 2CNNB 4CT8A 2YWWA 3BS9A 5JJBA 5L8RC 1UFLA 3S7RA 3FFIB 4HACB 3SSSA 4AL6A 5G4DA 2O66A 1RQ0A 3P5BP 4MAKA 4JI6F 1WG5A 3GJTB 1QDUB 4USKA 2Q6BA 2XLIA 1RTJB 1NJYA 4IRDA 3HSGA 2IA6A 3KDNA 2ZH9A 1FNXH 2CPFA 2Z57B 4QIFA 1HBOA 2ZBIA 4XDDA 3MDFA 5EWEA 1NK6A 1YITS 1GMWD 1T11A 1D3WA 2GZOA 2M7SA 4DHVA 1M1KT 5CYQA 1J5OA 1H2VZ 2ZZTA 3G6XA 2FPHX 3ILIA 3R97A 2IMWP 3KMSA 2N3LA 2MHEA 3PRVA 3I31A 5AT1B 3DOKB 2YWHA 3CJTA 1VQLS 2Z8QA 4U6PA 1N36F 4OZ1A 4UUXA 2E66A 2HNDB 2FGOA 4MFBA 5KG1A 1WHVA 3CPWR 1PKUA 1N8RT 1T95A 4R0JA 3HHNB 3TI0A 4NLOA 3FCHA 5B0FA 1IKXA 4O44B 2XSJA 2MMYA 4OYXA 3R8YA 1RWWB 1X5OA 4OI2A 2XCPA 1EB0A 4Z7YA 4ICLB 1HWIA 4PCQA 5KFDA 1T9VA 2PA8D 3BO3A 4GC6A 1GTHA 2BE7D 3BREA 5A6PA 3OTEA 4WFNQ 3IMQJ 3U1LA 2YH1A 2UUCJ 3R5AA 1H0HB 2CXEA 5LXRA 2GGPA 2HHWA 4OYIA 3SXLA 2EG2A 3CJ0A 1QAYA 2HWHA 1YJNS 1KQFB 4L75A 1PSDA 4PG4A 1EZZB 4WP8A 2KO1A 3ZTOA 4AUKA 3BGRA 1E6VB 2CQPA 4IO1A 4UF4A 5EWFA 1S4FA 4DG1B 2VBXA 3OR2A 4X4OA 1KQSR 4JI0J 1T3OA 1FF2A 5DDQC 3H4BA 2Y8WA 4LF6F 2GVDA 4ZLPA 1WC5A 2V67A 1N5YA 3L95X 1KC8T 2AWZA 3QZ7A 3SV4A 1U49A 2L9DA 3HCXA 4ICLA 3EXYA 3ILLA 3R5GA 1VOMA 3AJDA 2VJUA 4QYRA 3DLGA 1FRLA 4X65F 2UVWA 4Q8FA 4C3LA 1YRUA 5C2CA 3NNCA 2LMIA 2HNZA 2E7WA 2EFOA 4HTIA 1TL1A 1V3SA 3W2VA 1Q4RA 1WDTA 4DSIA 1FDBA 2BR0A 4DG1A 2BXJA 3HP6A 3QYYA 4U7UK 5BJRA 4X64F 1VQKS 3QWUA 2KH9A 1NB7A 3HK2A 4PWWA 3MUTP 3CMES 4ZP8A 2NS1B 5E3QA 3BYRA 3DRYA 2AJ4A 2HVIA 5I42A 3JTOA 3MMJA 4CLUA 2F1FA 2FYXA 3IBWA 3UW1A 3VQTA 1RUSA 2XZWA 3RB4A 1CJVA 2ZUGA 3RAXA 4UOHA 1OYEA 2IVFB 5HROA 2PI5A 3PEHA 5IT9Y 3A8EA 2HNYA 4IG0B 1VQPS 2JHEA 3GCXP 4TY9A 4F50A 3ISNC 3VTIA 5HATA 1SJRA 3N0VA 3OVAA 2ZH8A 3TWZA 2IVYA 1UWBA 2R8IA 3GILA 1IKVA 2HRTA 1Q5YA 2V2QA 2Z0GA 3L7UA 4OZ3A 2CVEA 2FJAB 5FJ4A 2RRBA 2WRMA 5A0YB 3E01A 2DRDA 1IVZA 3K58A 3C3LA 3JAMY 2B6AB 1IBLF 4X4NA 2DR6A 1G3OA 5ITHA 5EUHA 4RW4B 5KG0A 4YP3A 4OZ2A 3G87A 1KLMB 1KRPA 3HF5A 3KJVB 3S8SA 4WIQA 4IKAA 1A7GE 3VAFA 3CIMA 3VALA 4MIWA 2M0GB 4FNHA 4G1IA 4C8MA 1SC1B 3NRBA 3K5LA 1Q5VA 2OI2A 1ITPA 2CUYA 4HH1A 2I38A 1UZDA 2AHOB 1SQEA 1S6QB 2YNHA 1DQ8A 3DLKA 1FA0A 1VQYA 2DJWA 3KJNB 5D78A 4ZPBA 3ULHA 1MG7A 3E01B 5DRKA 1N5SA 4X65J 2YKNA 1KFDA 3BSAA 1N5QA 1HQEA 1RT4B 5C24A 2X7IA 3DHWC 3BGUA 2CJBA 5IFMA 1KLMA 3QMQA 5KTQA 3HO1A 1HD1A 2XMVA 3HHLD 4DPOA 1JXLA 4LF6J 2XQCA 5GMDA 3TUJC 3MEEB 5IQQA 4CLLA 4RWWA 4LF2A 1B7FA 3KJQB 3AHPA 3CCVS 1ZM2A 4ZIWA 2XS2A 1TUVA 1V3ZA 3HVTA 4MKAA 2DGSA 2YQ1A 3ZTPA 3NGDA 4LVOP 1N34J 3PO4A 3RW6A 3DLKB 1TVRB 1M5VC 2D74B 4FF2A 1WC1A 2B43A 2LCWA 3AH6A 3OXLA 4AYBD 2XCAA 1TFYA 2AT1B 2W4CA 3CE8A 1VQ7S 4HI1A 5CCLA 2UXCJ 2FLLA 3D54A 2BV3A 2HVZA 2Q1LA 2XMJA 4KHRA 5J1EB 2HSEB 4ZCMA 4DSEA 2ZE2B 3JQKA 1PGZA 2BE2B 3W3SA 1NO8A 1TUWA 1KNZA 3AOBA 2DHHA 4NLDA 3SCJE 3MECA 3KHLA 3ZZTA 2YX1A 3MEDA 1JJHA 3LTOA 2G0JA 1F9HA 3S1TA 4EBEA 1M5SA 2J7WA 4BS2A 3K59A 1UVMA 2BE9B 2VC0A 3W2WA 5LJ5Y 3UI3A 2ZD1B 2K3KA 3H90A 5KFEA 3MR2A 4I2QA 1TVRA 2WW4A 2VKZG 3P5TL 1F3VA 1U7LA 4OLPA 1VQOS 1F6TA 1RISA 2AYMA 3MCSA 2MY7A 3ISZA 4YOEA 4GMKA 4I68A 3F44A 3OHBA 2BEFA 3OSNA 1HR0F 3QGGA 3O8WA 1YQHA 1HBNB 4UQGA 3MECB 4J9KA 5HMYA 2R7SA 4KE5A 2BQRA 5EX0A 5HMXA 3TEGA 1Q79A 2IJFA 1QUPA 4KGMA 4M8LA 4UUWA 3VGTA 1C0UA 3A8KA 4IYQA 3W9HA 2HFVA 1GQEA 3PM9A 4WFXA 4WF9Q 3VAJA 4NCGB 2ZITA 4NL5A 2NSBA 3SZ2A 5T7LA 3DFEA 1YJRA 2CPDA 1LFPA 1H2UX 3AD7C 3BBFA 3JQMA 3MM9A 4Y2MA 2ZHBA 3DLBA 1E6YB 4K5SA 3P96A 1FWKA 5ETOA 4C8ZA 2AZ1A 2IJRA 2XSJB 1VQ6S 1XMOJ 4DR6F 4AE5A 1HQUA 4DV3F 1JJCB 4CO1A 3QFWA 5CA5A 1YJUA 4NRTA 3Q8YA 2WAQD 3AAWB 5CHCB 4LIRA 4PG5A 1C0UB 4MMOA 1J2VA 1WF0A 2UXCF 3W7BA 4UZBA 3POTB 4GKKF 4LFAF 1TAQA 4DF8A 1GH8A 3TANA 3D66A 3EMTA 3UPFA 3OPKA 3GV7B 4EYHB 3MM8A 1KS2A 2IC3B 2FVSA 1WSVA 4FF3A 3IS9B 2NPIA 3JAMU 1TKXB 2E29A 2K3IA 5KFXA 2V8VA 3X3UA 1KOOA 2MJUA 1VC0A 1RKJA 3AXKA 4CM0A 2VONA 5G0RB 1HWJA 1RJJA 2MQPA 4RZRA 3M6VA 2CQ0A 2BJ3A 5BR8F 2EVZA 3DLEB 4TU7A 3V6KA 3EVWA 2I8EA 2OMLA 3PRBA 1YRXA 3I9ZA 4F67A 3OL8A 2CQ4A 3JSBA 2ZVSA 1NPKA 2WHOA 4KV8A 4J9VA 5FDLB 4HEA9 4ZCLA 4KYZA 5KG5A 1BQNA 4WWSA 2FY1A 2UP1A 2H54B 3EWGA 3NXZA 2UU9J 4DV1F 4NLRA 1MN7A 2LXUA 2RD5C 2P9GA 3MMBA 1QE1A 2YPZA 2QT7A 2N4CA 3EUNA 1D0EA 1RU1A 2LQJA 3IXQA 1WHXA 3PYDA 4A8XA 5CAAA 2BQUA 1SKSA 2OTLS 1DLOB 5AE1A 3H40A 3KUGA 5F8JA 3TAMA 3KK2A 4AD6A 3NMAA 3A13A 3PDNA 3HI9A 1WC3A 2F8EX 3ZZZA 1S10A 2QN6B 2XMMA 3VGUA 1IBKJ 3CO9A 1RYRA 4V19J 1R6VA 5B0AA 3IG1B 3QGPA 3TO8A 1V3RA 4UQTA 1DAXA 2BJDA 2JC0A 2YTCA 4ZVHA 2HVHA 1VS3A 2QLFB 2QX0A 3E51A 1X9SA 1RZMA 2E5LJ 4RX6A 4Q2MA 5GAHU 2YKMA 4ZA1A 2QMXA 4BDPA 2GCFA 3ET6A 4O3NA 5HQLA 2DNLA 1DLOA 3MCNA 2RHSB 2VC1A 5A0YA 3KK2B 4DL7A 1XN9A 1OSCA 2BVZA 2RRNA 1XEZA 3HX9A 4F04B 3TZXA 2VDIA 2UUBJ 5GAGU 1RWVB 2Y8YA 3CIZA 2CQCA 1T8EA 2KZZA 2VF3A 3UDVA 2N3OA 3RB6A 3M9MB 2LU2A 5F8NA 4OHZA 3D68A 2ROGA 4IOBA 3GIKA 2J6UA 2F4VF 1LWEB 1R3NA 1RT7A 2V9WA 2C2ZB 4LF4J 3AXMA 3MUMP 4F2SA 1TKDA 2ROEA 2AYBA 3MI7X 1IR1A 1F5AA 2ASDA 3DMJB 1SH2A 4Y28C 4RUHA 4A8KA 4HDHA 1HWKA 4EFAC 2DR5A 1ZTWA 1HNIA 1LW2B 4DV1J 4ID5A 1C1CB 4EI2A 3I5AA 4DS4A 1RT1B 1U25A 1QTNB 3HHKA 3DI6A 3GFYA 4WXWA 2MDAA 4NASA 2XG8A 3EGWB 3K17A 2I5JA 2W2MP 4RUCA 2RDDA 2HWIA 1NJWA 3OVBA 1WOPA 4Z2XA 1F5BA 3OR1A 1DTTA 2GQQA 4K4UA 4USTA 3LGMA 2B4UA 2D3UA 2F9JA 1IBCB 3NNHA 3OJUA 1HI1A 4P2FA 1VQ4S 3FMBA 3FNNA 2O01C 2BM1A 3HFZB 3U1MA 1A9NB 2WBRA 4P6QA 3FGVA 1HNIB 1LW2A 1RAIB 4P7VA 4CLSA 4CYUA 4EUVA 1VC5A 2FJXA 2CJQA 4PXBA 2QA4G 2Y1IA 3J7AN 2PC6A 5L1IA 4ER8A 1S97A 4KB7A 4EO8A 3UCUP 1URNA 1VDHA 4I2PA 2ATCB 2CFXA 1TV6A 2MPUA 2QA1A 2K8GA 4X4RA 4C98A 1N0UA 3BN4A 3OR1B 3PHEA 2LVWA 3LP0B 3PXGa 3SYZA 1R0CB 2OH2A 4ZVEA 4YDDB 1UEKA 2DNMA 4ZHRA 2IPOB 3VZHA 2HS4A 4OHWA 1SQFA 2XWYA 3P8BB 3RBZA 2AEJA 2POKA 4PPZA 2H65B 3BH6B 2PT0A 3PJXA 5K9FA 1JJ4A 1DZ5A 1S6OA 3T6JA 1M5KC 1S0MA 1TTHB 3EZOA 3H25A 2P6TA 2VPWB 4PG7A 4OX9F 3A3PB 2NXCA 2VQFF 4OL8A 2QC3A 3FUYA 1YG0A 3G2XA 3HVAA 3MM5A 3T5KA 1N52B 1ZAXA 2A0FB 3C8YA 3C2PA 2FZKB 2HFOA 3OSPA 4CLPA 5K5MA 2QEXS 4NCGA 3LA0A 1YVFA 3PO5A 2HHQA 2RVJA 4ED3A 4YS2A 1HMVA 1ZZNA 4DBQA 2FLPA 1HIYA 4ZHRB 2IJNA 5FLXY 3VF0B 5LM7E 4LSZB 1UA1A 1HKAA 1E6YA 4ZPAA 3JSMA 5HJXA 1JLCA 4K59A 1Z1ZA 3UQSA 5EWGA 1JNRB 1Q7LB 4Q5VA 3D9BA 2ABYA 3BSCA 3SDEB 3PX4A 2ZJPQ 4NRUA 4C8KA 2J9CA 4P10A 2JLFA 4UTGA 3H2VE 2ZZNA 2J8AA 2IM1A 2LQ5A 4USVA 2YWEA 1PBAA 1T9TA 2DNKA 2YKOA 3A4TA 4TY8A 5HN0A 3R1LA 2GIFA 2YQ3A 4ZVGA 3FFIA 4IFYB 2UUWA 4HACA 5J2NB 1T0TV 2W24A 3THTA 4RW8B 5HLFA 1V5IB 4ZCKA 4P2MA 4AT1B 4BLGA 2ZH4A 3TQEA 4J9QA 2MLYA 3M8PA 2R8GA 1NJXA 1XNQJ 5AJ3F 3CJSA 2D7SA 3C14B 1MU2A 1I3OB 1LWFA 1P27B 1PIEA 4R8UA 5F8LA 4DLEA 2O3DA 3TJ9A 3ZTRA 2CQHA 3T5HA 2GAGC 4PUOB 5LT5A 2NXEA 1S57A 4FXVA 4CLWA 3CTRA 1HNVA 4PXDA 2R7UA 3MM6A 3TX8A 2X1BA 3CDUA 3O2IA 3ETOA 5ETMA 4K0KF 3JS9A 5EGYA 2XMAA 3J81U 4C8LA 4ES3A 3KLEA 3EYZA 2FVQA 2XO7A 4A8OA 5IM0B 4KKOA 2XGPA 1HNXJ 4KIAA 2BQ3A 3UDCA 2BMBA 4DF4A 2IM2A 3T1YF 1QLNA 4C3KA 4N56A 2MKKA 4DFPA 2B9XA 2XBPA 4IO9Q 4K4ZA 3EJMA 4JI8F 3CDBA 4B3TF 4PUOA 2OEMA 3BH7B 2GVZB 3HVRA 3CCUS 3TAMB 4DR6J 1MMLA 4CTAA 1SH0A 1Y3KA 4WU3A 1KEKA 3T9ZA 3V6HA 3AD8C 4ELVA 4MJKA 3C6TB 3BPDA 2GS8A 1XR6A 1REGX 2VQEF 3MPVA 4P52A 3QRPA 1CJTA 2X1FA 1J27A 5KFRA 3WZ0A 3LP2A 2VG7B 2VFSA 2KYXA 4F26A 5E3AA 3KJFB 3AJ1A 2VOOA 5IM0A 2OHDA 2XGQA 4Q0BB 4E8UA 1I6JA 4NLTA 1RHJB 1H73A 1AROP 2DCUB 2H5JB 2ZHOA 3JXOA 3WX8A 3ZTQA 2R8HA 3W62A 4DX7A 4QYZK 1H7WA 2C3PA 4TLQA 3VCDA 2W2OP 2IYGA 3VVUA 2LP4A 4DUTA 3UWTA 2VG6B 2RILA 2CDRB 2QL5B 1IKYB 3BBBA 3ETMA 2SXLA 4GRSA 2C28A 3H2LA 3QATA 2E9TA 3TAPA 2M4MA 3BKTA 3NKYA 5AJ3J 3CJ2A 1N5TA 4M5HA 3IRWP 3MFIA 2HBZB 1X31C 5A8WA 4KY3A 1RTDB 3H4DA 2GA7A 3OFGA 1FJGF 1WF1A 3OHAA 4KFBA 2DK2A 1F2GA 3PKYA 4UT4A 3FCVA 1NZAA 1HLWA 2IBKA 2CRLA 3HD1A 4WK3A 4YN3B 2JZ5A 4Y2KA 2CJKA 4Q7AA 5HBMA 2HMIB 1N6QB 3GONA 4OZJA 4WJBA 3BSNA 3BGRB 2VG5A 1E6VA 5LSOA 4N76A 1DFDA 4OMFG 5H9EJ 4HH0A 3UD5A 4RW6A 2HQFA 3I0RA 2UV8A 2WSCC 1IKVB 2QA2A 2HQGA 5KG3A 2DXDA 4ETXA 5FLXU 3X1LB 2Z2MA 2BBEA 4JOUA 5K14B 5KT2A 2AGOA 1X8DA 2B9WA 1WOSA 3RTVA 4DQRA 1NKEA 1PAEX 4L74A 1VQ5S 3D6MB 1X0PA 3QRRA 4IFVA 2W9CA 4X4PA 5A2QY 3PIPQ 3IWLA 4FVCA 2QFIA 4OYMA 5B0GA 1DBDA 3TA1A 1SL0A 3DLJA 4CYUB 1R8AA 3CEDA 2OFGX 4WTYA 3WIUA 1X4CA 1U09A 3RU0A 1KP6A 1VI7A 3N9UC 4U9RA 5ETTA 4WBFA 3RB0A 4V19X 3IGVA 4YR3A 3GR0A 4Q44A 4I2PB 3MTJA 3WHIA 4DL4A 2Y1JA 1Q86T 4X4VA 1YJ7A 3HKWA 3VHQA 1GT8A 2ZBRA 3CNQP 4OLOA 3R2CJ 7AT1B 4ALZA 4ED5A 2L08A 2AZ3A 3KHGA 2FHMA 4WP9A 3DLLQ 4RNFA 3KK1B 1GNKA 2PMWA 1RWPB 2NCKL 3D67A 3GTYX 3K5OA 1FK9B 1MROB 2YPYA 1UA0A 1FFWB 2VZ9A 4JYAF 1ELOA 1S49A 3D5MA 3QFHA 3C66A 4LBIA 1HHQA 4NI2B 5D0RA 3ZNUA 3MAHA 2E7VA 4H4MA 4X4SA 4J7CA 4ECWA 2AQ4A 1TK5A 3Q2TC 2KI2A 1S1WA 4KHPF 3LANA 4L76A 1NK4A 1UPMB 1PC5A 1CULA 1OYDA 4O3OA 4ZP9A 3TOQA 4LF5F 1WTFA 2UXBJ 4ZPTR 2HQIA 1JJ2R 4IOCQ 3M7VA 4RW9B 3RUBL 4FP9A 4KGXB 3TUZC 5DG9A 3FZBA 3UDLA 4QU7A 2F7VA 1XMOF 1AB8A 2QIFA 2L48A 3MEDB 4EBDA 4L6V3 2B51A 4DV7F 2DRBA 1VRQC 4FN5A 4RPFA 4O3PA 1HR0J 3AFGA 3H5XA 1IN0A 3RR7A 4FKXA 3IRXA 3V4IA 4MYTA 4RBUA 1WNEA 1RGVA 2F4VJ 3AY0A 3RB3A 3IM9A 3UN2A 2FC8A 3K8VA 3M8PB 3NL0A 1EKSA 2LECA 4XK8C 2XMWA 1KONA 3HHLC 5DM7Q 1RT2B 2A3JA 3ZFVA 5KFMA 2HRUA 2Q79A 3ADAC 3IM8A 1KWMA 4IH7A 1RHUB 2VODA 1RTHB 3KWMA 1F1BB 1HBUB 3H5YA 5KOWA 2WB4A 2RAQA 3EPIA 3OJSA 2W9AA 2IM0A 3OVSA 3KOAA 4IH5A 2CDQA 1ZPWX 2I0XA 3M2RB 1NUEA 1JB0C 2LKZA 3OR2B 2J0SD 2XYGB 2MGZB 2VQEJ 4JI5J 1TAUA 4H4KA 2ATLA 4K8RA 1NAQA 2JNJA 3CDEA 5DETA 4OQJA 3J81Y 1NDCA 2RSQA 3A1YG 4HR2A 4QYZJ 3DYAB 3KLGB 3VGVA 4JV0A 1SIZA 1U8SA 2DGWA 4V1Ak 5IT4A 4YHHF 2IY5B 1AZSA 3BGLA 3H5UA 5E3RA 4A8FA 4Q2LA 1U0SA 3NNAA 5DJBA 4OHVA 1NDKA 4JB8B 5KFVA 4ZP6A 1UKUA 3R5DA 1CC7A 2DNHA 4USUA 2HNZB 4ES1A 5DG8A 1GMVA 3M9OB 2E9RX 2WCXA 1NM2A 2IDLA 2ZD1A 2CJAA 2HLTA 3ELHA 3ZZUA 5HO4A 2H5EA 5BR8J 2LEPA 6AT1B 4O3RA 2G9OA 4MFBB 4LQ3A 1SVDA 1XERA 2QLBB 2WVCA 4LF4F 3WQPA 4ATNA 5IWAJ 1FRMA 1S7IA 3G6VA 1RAJA 2HQ3A 4WCEQ 5A2QU 3SEOA 3DRRB 1OY9A 4I1TA 5DZ7A 1IBLJ 1NPRA 2GJ2A 4AL5A 1CJKA 3GZ7A 3L09A 4EMDA 1M5HA 1S9GA 4N8NA 3D3BJ 4NLPA 2RMLA 3CD5A 5BYRA 2KRRA 3D6TB 3GJSB 3Q8QB 2EPIA 1OQ3A 5MAOA 2PMHA 2ZC3A 1EHWA 3PFOA 4DV4J 4HYKA 2VHGA 4JI1F 2KT5A 3IFEA 5EN1A 5JXSA 2ZKUA 3GFXA 4ED4A 4OFZA 1IR0A 1TQLA 3HVWA 2V4JB 2PMZD 4PR6A 3L9ZA 2ZH2A 2UUCF 1ZYQA 1B0VA 1OY8A 2GC8A 3H20A 2KM8C 3OFFA 1S9EB 1RWKB 3A8JA 1QE1B 2GFFA 3FQLA 1NBEB 2YVSA 1N5YB 2W2QP 4EO6A 3R7BB 1FTCA 3CD7A 1I5OB 1HQUB 5K20B 1QAIA 1OIAA 2Z30B 2ZDPA 4KSEB 3DLGB 2F8MA 3L7PA 3EZ5A 1IXKA 2KJVA 3SQGB 4DV3J 2ERRA 3PACA 4MK9A 2G2ZA 1ZM3A 5F0UA 1BQMA 1TL1B 1Q1KA 1PJ6A 3QIPA 3O1LA 2QFJA 3CW2C 1YBUA 4CNYA 2FZGB 2BJEA 1XK8A 2HVDA 3PG9A 3POTA 4HHHA 1JWWA 1U1PA 2JWNA 4DFMA 2VASA 3Q83A 3MM7B 3NP5A 1CS4A 4F4XA 1PO6A 5J2PB 2DIUA 3OL7A 1YWXA 3LOUA 4DL0C 5E7OB 3QT5A 3GJQB 2ZJQQ 2DNNA 2C2MB 2BM0A 4FF1A 4CZCA 2DRAA 1MNEA 3FVYA 4A4JA 4ETZA 4UY85 4OI4A 1ZA2B 1AUDA 4KGZB 3HZGA 1LKZA 3NCRA 3F73A 3SQGA 3MOZA 4EZ9A 3DRSA 2DO4A 2EFQA 2R7QA 1W2IA 1GMUA 3IN5A 2XSFA 1L3VA 1NNDA 3H0PA 3UDEA 1DTQA 1YJWS 1AT1B 2HHHF 2HHUA 5KG6A 2BDPA 3AA9A 4DQPA 4JYAJ 4TYAA 2ZHAA 1LWEA 1XTZA 2CPEA 4LSLA 1HYSB 1FJ7A 2LA6A 4PYAA 2XLKA 3CCTA 1HPZB 3GIIA 2QMUB 4UOCA 3B54A 4MKVA 4Z7CA 2MZSA 4QBUA 4FF4A 3AT1B 2CG8A 4S0MA 5KT7A 3GQCA 1AFIA 2B6AA 4ZPCA 3VZIA 3BR8A 1U8WA 5D3GB 3D1HA 3KNAA 1M0SA 4FVMA 3MCMA 1C1CA 4Y2IA 1EARA 1X4HA 1L5UA 3PYEA 3MF5A 4CH7A 2BW7A 2KFYA 1L3UA 4O3SA 4JI3F 3FEYB 1NH7A 3TVZA 3MR7A 4EWTA 1LNQA 1Q16B 2D69A 2MQ8A 5AE2A 2HKEA 4TU8A 3QLHA 2ZBCA 4F4YA 5H9FJ 4P2XA 2OPQB 3PW5A 1I94F 1SKWA 4OHXA 2QO3A 2LXFA 2BABA 1ZAVA 1YDLA 5J1PA 3M1VA 2R7RA 4N5SA 4IQXA 4AL7A 4OJHA 1TL4A 2HBQB 5LL6d 3Q22A 1AYEA 3R3TA 1YRTA 1TKTB 2PSZA 4XIUA 3VVTA 5A76A 3NGTA 2DY9A 4YR0A 4W98A 2GIRA 3EM1A 4J9UE 4LFBF 2KTQA 4CWBA 4CH1A 2R2RA 2CJYB 4OYOA 1S99A 4ZPWR 2EK1A 3NOGA 2W8KA 3THPA 3UR3C 3QLHB 3HLUA 4KHPJ 2OPQA 2JX2A 2WONA 3DU5A 2R3VA 3A3NB 3LP0A 1AA1B 2EWHA 1UJ4A 2PO4A 2XM3A 4IR1A 2V2KA 4G3IA 1RHQB 3MM9B 2HHVA 2C42A 2L3MA 4LF7F 4M5JA 1P6TA 1GFWB 2XI2A 5BYQA 3T5LA 2BJ7A 3EGNA 2I2YA 2VICA 4MH8A 4QCLA 2MZQA 1N33J 3D1OA 5IV3A 3D1QA 4C0BA 4U67Q 4R5PB 4J9RA 3T19A 2A10A 3PV8A 4JI2J 5U47A 2A6OA 1O8BA 2VFVA 5B08A 4ECUA 2BKNA 1QVGR 1N32F 3DGPB 4RNOA 1TUGB 1Y0HA 4PWDB 1PILA 1WC0A 1JMTA 2RU3A 1JLAA 1UTAA 1RAOA 1WKLA 1SPBP 1FEEA 2V8DA 3M8ZA 1FD2A 4ECSA 2R7XA 5C42A 1ZM4A 1UP1A 2H1YA 1FHTA 4DQSA 2DNPA 4N77A 4KJIA 4F25A 1NSAA 3I0SB 1SB6A 2XLJA 5C25B 1JKHB 1LXNA 1R7IA 2WB1D 1WC6A 3K5PA 3KG0A 3PYFA 3RJMB 1FKPA 4A8SA 3CCLS 2VDHA 1S6UA 4KGVB 3LAKA 1FXRA 1U48A 1TL7A 3BM7A 3HM9A 2JVOA 4WXOA 2JL9A 1U1RA 3R5JB 4ZVOB 4K2JA 1M90T 4JI3J 1R89A 3CSKA 3CB4A 2RE1A 1RT6B 1UJ5A 2U2FA 2YNGA 4TY8B 2LEAA 1UEUA 4P2SA 1S0OA 4J9NA 4DXLA 2ASJA 2GX8A 3HFKA 3GSIA 1U6BA 1JLAB 3AJ2A 2B7BB 4B9TA 4CP5A 5FDLA 1NLKL 3FC9A 3VWSA 5I3QA 2MJNA 1M5OC 5CCMA 1SV5A 1JNZB 1QD1A 1R0BG 4ID8A 2MZ1A 5BYSA 3CMQA 4DV6F 3I0SA 2FIUA 2YX7A 1FWLA 3BZQA 3QIDA 1X4GA 4ZITA 3IP0A 1VQ8S 4CNZA 3I9V9 4NWBA 1JXVA 3R7SB 3M2UB 3LF0A 2CQ1A 5DM6Q 2V2VA 2WSEC 1BUXA 4JI4J 1CJKB 1R8BA 3KLIB 1VR6A 2B56A 4URSA 4F7VA 3SIPB 4JI4F 1NMEB 2HFZA 3THVA 2GHWA 2DT9A 2C3UA 4K5RA 2M9KA 5DGAA 1NXIA 4ECRA 1BD6A 1NZ8A 4LR8A 2OPRB 2HLUA 3U02A 3UN3A 2VA3A 3LPEA 4Y6IA 2BJ1A 1WJ9A 3ENWA 4DWIA 3HHDA 1UETA 1Q7YT 1QSLA 4K4WA 2EK6A 1YZ6A 4ELUA 2HEKA 2QZ8A 2BZ2A 1JLCB 4LBHA 1BY9A 3PVXA 1HI0P 1H98A 1D1UA 4IRKA 1ACMB 4NLQA 2V8PA 1ULRA 2M52A 1W26A 2W01A 1VK8A 4RL1A 2W7OA 2ZH7A 3EZUA 1LV5A 2UUBF 5EDWA 2LU1A 1FDDA 3M6UA 1O51A 3GYXB 2O5DA 1NEEA 3HMJG 1WI8A 2XTJP 4ZJLA 3F41A 2OPRA 2GAHC 3QT6A 2HNDA 2LDYA 3VGSA 3RZAA 5GADI 3RBEA 2JDJA 3HPOA 2FLOA 1T9WA 3IC1A 3W8GA 3T9NA 1RT5B 4Y2CA 2X1GA 3KXDA 1RP5A 3FMWA 1RLDA 1JLBA 1SJQA 4O44A 1RHKB 1IJEB 2X3GA 1SI9A 4LRFA 3AOCA 1U1OA 3PJWA 4OI3A 5I3PA 4M5MA 1T05B 2JEJA 1TU0B 3D6HB 1N32J 3U27A 2EXUA 5RUBA 2DNYA 3GYNA 1HNVB 1CJUA 4Y34A 3FEXB 5D0HA 1NK9A 3TZZA 2HQDA 2Z2ZA 1JXEA 2KT2A 2DH8A 4HDGA 4NYPA 3UVJA 7FD1A 4FBUA 2VG6A 2KXFA 5L9NA 3NY0A 1R8PA 2GV1A 2Y1LB 3TEHB 2LQBA 2MSTA 1NHUA 1T94A 3P3DA 5H9FK 3FSXA 3NG8A 3TVYA 3KLEB 5CYMA 1C0TA 1CVJA 1U2RA 1JLBB 2YKMB 5D0EA 3NBPB 2HFNA 1SC6A 4NOHA 3K2YA 3ET6B 4CM2A 3KHRA 1QAJA 4DUYJ 2JEGA 1HWLA 3HJFA 1R8CA 2DH7A 4Q45A 3SI8A 4JI8J 4LR7A 1Q8BA 1UZHA 4CTAB 4M95A 3T1YJ 3MR3A 1XMBA 3ENVA 5D3GA 2V50A 1GX5A 3NGKA 4OI6A 4HT5A 4NLWA 1YZ7A 1PG5B 3WX4A 1RTZA 4NA3A 2VBYA 4Q8EA 3R2DJ 3WIVA 3LP2B 1YGYA 1D09B 4DU8A 3G6YA 2E1MC 3DM2B 1WHWA 2HBRB 3TAQA 2VIHA 3W61A 2DGTA 2ACMA 4DV5F 1JX4A 4QR2A 1S0NA 1L3TA 4TU9A 3I4PA 3M1VB 3B82A 1SJ3P 4EEYA 4XAKA 3BJYA 1S6PB 4OZ0A 1OY6A 1H74A 2EEYA 1B3TA 1G7CB 1UVNA 1H6KX 1KBRA 3MMAA 2XS7A 4RR5A 4MKBA 1VISA 4B9LA 1FE0A 2B4VA 2ZC4A 2HHHJ 2PEBA 2CQDA 2QLXA 1EQMA 1VHIA 5AXNA 1JLQB 3PRDA 3UFCX 3S6EA 1PYTA 5IT0A 1F9FA 3QJJA 2QTWA 3P49B 2V0NA 4CLYA 4K2XA 4WKRA 2RH3A 1GX6A 2P6SA 1SL2A 3G8QA 4HHUA 4L3KA 2ZM6J 4JI6J 2F63A 3MPDA 2VFUA 4KO0A 3K0JA 1SUQB 1VRTA 2ZFHA 3V81B 1UVIA 1Q8IA 1JLFA 3I5BA 2YY3A 5ETPA 1RT3B 1U26A 1TL3A 1H72C 2FHJA 2XI3A 2FJWA 3JQJA 1KSPA 3M6XA 4DV2F 2JEIA 4URGA 1N6QA 2UZAA 3CT9A 5CABA 1UCNA 5SUHA 5JVGQ 1ZAWA 3GP9A 4DSJA 4HLBA 3SMZA 1WD6A 3BGOP 4IOAQ 1RACB 4H4MB 4OJ1A 2WK4A 1U6FA 4ZCIA 3J7ZT 2B5JA 2AW0A 1TV6B 2J76E 1NRKA 2HGNA 2E1RA 1B4SA 1FD8A 2V94A 2P9EA 3MOJB 4FYXB 2DNGA 5C42B 5JUMA 1Q53A 2W4PA 1EJ7L 4C8YA 4QIVA 4RW7B 4WP3A 4IFVB 1SUQA 1VRTB 1WACA 5DGBA 5DS7A 3NS6A 1M1HA 1L3KA 2BYCA 3Q8UA 4P74A 4ZJOA 1FKPB 1FVQA 2E1AA 2FB0A 2G13A 5B0EA 5KFUA 3WC2A 2KYZA 1TL7B 4QR1A 4LFAJ 1YK9A 5J2MB 2MTLA 4OYPA 2PFFB 2HVEA 5HP1A 3CJKA 1F0XA 1NH8A 2RQ4A 3VV2B 1F2HA 4JI1J 4NLGA 2NZCA 5LJ3Y 1MSWD 3H8YA 2QL7B 1LXJA 3PKMA 4F02A 3CCMS 1XR5A 3K7RA 2MKSA 2G1DA 3CJQA 2Y0BB 3V2UC 4K4VA 1SQGA 5I3UB 1SL1A 4TQSA 3VQSA 4EZ6A 1S1UA 2DO0A 2YKQA 1SV5B 3PEJA 3RG6A 1IBMF 4OX7A 2UUAF 4FPRA 5M2RA 1X9MA 4FBTA 4WIIA 4A48A 1VQ9S 2WBMA 4O0NA 3QAEA 3OLBA 1CLFA 2APOA 2R7OA 2RQMA 3M2UA 5THWA 2OELA 3CC4S 3BDEA 1TELA 2LEBA 2V68A 4LMZA 2VBZA 4X66F 1Y5LB 2HIQA 4G65A 4I7FA 1BGXT 3D4JA 2HZVA 3DRPA 3CVKA 3QWPA 4OYZA 4X84A 3J7YU 1U1KA 1FXLA 3C6TA 3T1AA 4YUDA 4DX5A 3I55S 5LMUJ 1S12A 2J6SA 3DDNA 2C2NA 3FRYA 3GR1A 4OJGA 5I3UA 5JMNA 2KVQE 3OUYA 3KLFA 1G6BA 4Y2AA 3CMAS 1KR4A 1RLCL 4F3QA 4HHJA 1LW0B 3MMCB 5F3ZA 3M9NB 1Q8LA 3C14A 3MHYA 3E2EA 2XMUA 4OX6A 2DXEA 3FBEA 2L9NA 4QZVB 1V9OA 5AXMA 3ZZOA 3VAKA 1XBWA 4ZPVR 4LSNB 4DDFA 1BQXA 2N82B 4CLKA 1DQ9A 4B3OB 1V5VA 1HBMA 1JLEB 4CO3A 2EFGA 3PJ9A 5M2UA 1AW0A 5GAHI 3N4WA 4WFAQ 3PIOQ 1S1XA 4ECYA 2OJ3A 4I69A 1PBUA 2X51A 3T3FA 2OPPA 3V6DB 1T02A 1YLXA 2H51B 1FCAA 1N36J 4MK7A 2CPJA 2QL9B 1LWCB 1RT2A 1F9EB 2YWKA 2FDNA 1XWLA 2E1PA 2RS8A 4KH1B 1Y3JA 4NLUA 3CO0P 2BKOA 2YNFA 1FXDA 2JSXA 1K1SA 1RTHA 1J5OB 3E8OA 4OYAA 1S48A 2PA3A 2JVRA 5D77A 3Q8VA 2DITA 4USMA 1ICEB 1BXNA 3GYGA 1VMBA 3TYTA 5B7WA 2XNRA 1BWEA 2P5VA 4NA2A 2C2KB 2HRYA 1LWXA 3ZZPA 3IA0A 3VR1A 3W66A 3DHXA 2HFUA 1C0TB 1ZZFA 1JIHA 4FYYB 1UJ6A 4Q0BA 5KFZA 1KVIA 3R1HA 1R31A 2W4DA 3Q23A 5GADU 5L1JA 1P9YA 5LMUF 4E0DA 4K7QA 1QM9A 1QJHA 3DDIA 4P72A 2KFNA 1Y5NB 2DNQA 4QWBA 2Y9HA 1RADB 5E3CA 3CULA 1EX8A 4EBCA 4WZMA 2B8PA 1ZS6A
chains in the Genus database with same CATH topology
4A47A 3R5CA 4LUBA 2HNYB 2BANB 1UAWA 1IM4A 1VIXA 5K8NA 2K1RA 4BC7A 2FHKA 3NCPA 2RQKA 2ZH6A 1F5CA 2QA4S 3KNGA 3LH2S 4JV2A 2DH9A 2DPJA 3AQPA 3WBZA 3G8TA 4CO0A 3G4SS 3MMBB 1VGYA 1YJTA 4WYWA 1SIWB 5J2PA 4DFMA 2FC9A 2YWGA 2W25A 1GAOA 3IO1A 2RUGA 3EGZA 3BGFA 1YJ9S 3GG1A 3Q8SB 3JTNA 3SCLE 5F9LA 1Q81T 4WFZA 1FK9A 1MROA 1MMDA 2F40A 1FESA 4LQ9A 3R5BA 1T03A 1FNMA 5DQGA 2JFKA 4B02A 5DLGA 2IRUA 4RW6B 2GQ2A 1FKOB 3SCKE 5F41A 4AXIA 4OZ5A 5E2QA 5CD4H 4ECXA 5K14A 3IR7B 5I42B 4K4YA 3IR6B 3N6MA 1LK7A 3ITHB 4F3OA 3OXGA 2HWTA 4A8YA 1K0TA 1TL3B 1BQMB 4K50A 3RRKA 2DGVA 1W2BR 2M70A 4URQU 5I4MA 3OV7A 3ICLA 2XS5A 5D4OA 3OFEA 1FKOA 2J7KA 3DN9A 3QPIA 3RAMA 2WOMB 1Y9OA 4B9SA 1VBZA 5HQ8A 2BW2A 4R0EA 3QGHA 1FRKA 3PZPA 2DR8A 2KT3A 1NJZA 3N79A 2D9OA 3HHEA 3BQ2A 4NA1A 2DIVA 2AP6A 2VBWA 4B3MF 2E5IA 5J2QB 4O0IA 2C3OA 4JV5F 2GMJA 4EYIB 4NLXA 4LFCF 4C2MA 4ED0A 1ZM9A 1ZPVA 5D8HB 3PNIA 4M1KA 1VLYA 1N34F 1S1UB 1S72S 2BUNA 2A18A 4F2RA 2CPHA 1RT4A 5C24B 3KK3B 2CG4A 2Z2LA 3R27A 3KLGA 5B0BA 2VFTA 4M94A 3LPYA 2HW3A 1R27B 2E5JA 3G8SA 1QTMA 2QE5A 3LW5C 3DGPA 5K8OA 5KFQA 3MUVP 1XMQF 4WE1B 4M63A 2RRAA 3J7A1 3TA2A 1D9FA 2DGQA 2EW9A 5IWAF 1GXTA 1LW0A 2KXNB 1N56A 3TP2A 2X1AA 4G1PA 5F8MA 4DQQA 4LF9F 2BE2A 2IAJA 4QWAA 3UCGA 3GSDA 2RKIA 1FKAF 3CCJS 1FT8A 1VBXA 1FJCA 4B3OA 1WHYA 2HHTA 4WYLA 1IKWA 5LXYA 1Z2ZA 3CCWA 1UFWA 2WONB 5EX3A 3LQVA 4ES2A 4USHA 2K2PA 3M30A 1UMJA 3J7YI 2RU9A 2IC3A 2YKPA 1YHQS 4WKYA 2R7VA 2DD8S 2YH0A 3C6UA 1FRIA 1O0PA 4O4GA 1HFEL 1PC4A 3RAQA 4DL6A 4CCHA 5J1NA 4PRFA 2IAJB 5FD1A 4DN0A 2KJWA 1SJFA 3TNVA 2B0GA 2GO9A 4DR3F 2IYIA 2HHXA 3CC2S 3GE9A 3PR5B 4QOTA 3CCZA 4KV8B 3SSQA 2JLGA 5JVHQ 4W92B 1BQNB 1TR0A 3MURP 2B4PA 4C11B 2V4QA 1YI2S 2AGQA 1RYSA 2V9WA 3M30B 2CVIA 4NMLA 4QPTA 2WTFA 4ECTA 2UVUA 4B9UA 3NS5A 3MM7A 5DQIA 5GMKa 4ZDNA 3EXCX 3CDWA 4FXDA 2ZNYA 4DSLA 5DDOC 4DFKA 1U24A 4OHYA 1NK8A