1S1UB

Crystal structure of l100i mutant hiv-1 reverse transcriptase in complex with nevirapine
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
424
structure length
401
Chain Sequence
IETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWHPAGIKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Reverse transcriptase
publication title Crystal structures of HIV-1 reverse transcriptases mutated at codons 100, 106 and 108 and mechanisms of resistance to non-nucleoside inhibitors
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 113
structure length 401
sequence length 424
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1s1uB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1uB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1uB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1s1uB03
5KG1A 3QGHA 1JLEB 5F8IA 4KB7A 4Q45A 3GIJA 1S97A 4ZHRA 5J2PA 2AWZA 1TL1A 1EP4A 1FKOA 1HMVA 1JLGB 4MFBA 5J2QA 1HNVA 3RB4A 2FLPA 5KFXA 1R0AA 4RNNA 1RT3A 2W9CB 3RB0A 4ZMMA 2W7OA 4K4TA 1J5OA 2VG5A 4KV8B 1S48A 2HMIA 3H5XA 2WOMA 4J9MA 2JLEA 4RW7A 5KG6A 4K50A 5F8HA 4TLRA 4DG1A 4I2QA 2UUTA 2IA6A 1DLOA 4I7FA 2JEFA 1LW0A 4NLQA 2OH2A 3DOKA 4ZPAA 3MEGA 3LP1B 5CYMA 2IM3A 4WZMA 2W8LA 2DPJA 2BRLA 2B6AA 3QIPB 1RTHB 2D7SA 5KFDA 3DM2B 4M94A 3N6LA 5KFOA 5K14B 3NAHA 4IQXA 1JLEA 3LALA 3H5UA 3GIMA 1JLGA 3DMJB 4U6PA 3MR5A 4ZPDA 2W9CA 2D3UA 2V4QA 2BQ3A 3NAIA 3QYYA 1N4LA 4KV8A 1S9FA 2ASJA 4YR2A 4K4ZA 3BSOA 4OL8A 4LQ3A 4Y2CA 4TQSA 1RDRA 4NLVA 3TQ1A 4ZVEA 2R2TA 2XWYA 4NLWA 4WXOA 3BREA 4MK9A 4NLXA 3BQ0A 2BE2B 4MH8A 3G86A 3H59A 1REVA 3GIKA 4ED6A 3QIPA 1RTHA 4QWBA 1S1UB 3DM2A 1TVRB 3CJ3A 5K14A 2YNHB 1HARA 5KFEA 3KMSA 4DL6A 4XPEA 4WFXA 2YNGB 2HNYA 3DMJA 4O3SA 1FKPB 4WZQA 1XR5A 4XO0A 1DTQB 1NHUA 4KKOB 2GC8A 4TY9A 4FS2A 3KK2B 1S9EB 3DI6A 3LP0B 2FJXA 2R8IA 4RNMA 4J9QA 3KLVA 1TKZB 4ZPBA 1KHVA 4TY8B 3C6UB 3V6DB 5KFRA 4RNHA 5KT2A 4DL4A 4WFYA 2UVUA 5KFPA 4NLGA 4RW6B 2QE5A 2J6UA 3OSNA 1S0NA 3OHAA 2R2SA 2R8KA 2OPSA 1HPZB 4J9NA 1JLAB 2BE2A 1QAJA 1S1TA 4M95A 1KLMB 3MFIA 1S1UA 1TVRA 4TYBA 3KLIA 4O4GB 2YNHA 3DLEB 3PW7A 4Q43A 4RW4B 3MEEA 1FKPA 3LAMA 3CDUA 4KKOA 2BANB 3KK1B 4TYAA 3KK2A 1S9EA 1LWFB 3LP0A 1RTIA 4KFBB 4Q44A 4DL3A 1RT7A 3OL9A 4O4RA 2J6SA 2RDIA 1IKYB 3C6UA 1SV5A 4IDKA 3V6DA 4ZP6A 5KG5A 3NGDA 4GC6A 1RA7A 3QIDA 2WTFA 4ECXA 4RW6A 3PJXA 1RYRA 4NLSA 4DL5A 1RTDB 4ZPCA 1HQUA 1VRUA 3Q8PB 1HPZA 4I2PA 3LP2A 1IM4A 2ZKUA 3CDWA 4K4WA 1NHVA 2BR0A 1HYSA 3I5BA 3OHBA 1JLCB 1NNDA 3V81B 4YQWA 2W7PA 4DL2A 4X2BA 5CYQA 4IFVB 4F4XA 4RW4A 1C1CA 2WCXA 4JV2A 3GIIA 1TV6A 2HNDB 4R8UB 4IFYA 3CJ4A 3KK1A 4EBDA 4ZHRB 5J2PB 3N6MA 5EUHA 1LWFA 4K4VA 3MR2A 4MFBB 5KG7A 2JEGA 3KMQA 1LWEB 1MU2B 1R0AB 2YKMB 1JXLA 3TVKA 5KFUA 3T1AA 2VG5B 2HMIB 3QLHB 4JV1A 3CJ0A 3JYTA 5KT5A 2VG6B 3UQSA 1RT6B 1HNIA 5HROA 5KFKA 1S1VA 4I7FB 5HBMB 1JLCA 5F8LA 3GV5B 3DOKB 4R5PB 3LAKA 4KHRA 3EPGA 3TAMB 4WYWA 2I1RA 5T14A 3BSNA 2B6AB 4ECQA 3D28A 2JC1A 4TQRA 2HNDA 4ECRA 1OS5A 1SH2A 4IH5A 4ECWA 1RYSA 2C2DA 4QW8A 4ZP9A 3KOAA 3HHKA 5J2MB 2WHOA 4NLYA 1Z4UA 3MR3A 4J9RA 4TN2A 5KFZA 4EO6A 4RU9A 5DG8A 1LWEA 1MU2A 3EZUA 1IKXA 2YKMA 3QLHA 2VG6A 1RT6A 5J2NB 2E9TA 3HVTA 3KLHB 4NRUA 1IKVA 2ALZA 1K1QA 2XGQA 2YNIB 5HBMA 2VA2A 4R5PA 1QAIA 1BQMA 3IGNA 4NLUA 3QZ8A 3KNAA 3RAQA 3TAMA 3H4DA 2JEJA 4KO0A 3KLEA 1JKHA 3FSIA 4YMEA 3I5AA 4RUCA 3PW2A 1HQEB 1REVB 2BRKA 5KFCA 2OPPB 3G6YA 3G6XA 2BQUA 4KBIA 4TXSA 4LSLA 2CJQA 2RDJA 3EPIA 5KT6A 5J2MA 2QV6A 5HP1A 2B43A 2HNYB 5J1EA 1RA6A 1T05A 4RW9B 4K4YA 4RNFA 4QWEA 5KFTA 2OPQA 4PWDB 2C28A 4H4MA 3DI6B 4URQU 1RTJB 3PW0A 1S49A 3PVXA 2C2EA 5J2NA 3RBDA 1EETA 4F4YA 3KLHA 1BQNB 3QZ7A 2W9BA 2YNIA 3H5SA 1TP7A 2AQ4A 2FLLA 3OL6A 2ASLA 2OPSB 2W8KA 1IKWB 2IC3A 2O5DA 1HQEA 1S1TB 2OPPA 2RF2B 4MK7A 5DQIA 2DPIA 3KLIB 1JIHA 4Y34A 2GIRA 3KK3B 3DYAB 3DRRB 4ED0A 5DGAA 2IBKA 3MEEB 4RW9A 1RT5B 2ILYA 4HYKA 4QWAA 3MR6A 3I0SB 4PWDA 4ZVHA 3MEDA 3V6KA 1RTJA 1RTIB 1T94A 5KT7A 1SH0A 1RT7B 4ED2A 1XR6A 5EWFA 1T03B 3BSCA 4J9OA 1SV5B 4IDKB 1VRTB 1BQNA 4WFZA 1UWBB 3RBEA 1S1WB 4ZVGA 5KFFA 4NLDA 4FS1A 2FVQA 3H98A 1JLFB 2B5JA 5KFWA 3ITHA 1HQUB 1VRUB 3NKYA 4EYIB 4I2PB 3LP2B 3V6JA 2ZE2B 1T3NA 1IKWA 1HYSB 2RF2A 3IG1B 3G6VA 4IRKA 1RAJA 3PJWA 5DG7A 2AGPA 3KLGB 2CKWA 3KK3A 5CYQB 4KHMA 3DYAA 3DRRA 2WONA 2AU0A 5L1KA 1C1CB 5KT4A 2ZD1A 1TV6B 3QGIA 4IFYB 3BGRA 3PR4A 3H40A 1RT5A 4IR1A 4YR3A 1TL3B 3I0SA 2WK4A 1C2PA 4Y2AA 1DTTB 1D1UA 4URGA 3M9NB 1S1XB 3IN5A 4EBEA 3T5LA 1T03A 4G1QB 3CJ5A 1VRTA 5KFJA 2D41A 3BSAA 5C5JA 1UWBA 1S1WA 3NBPA 1K1SA 3CIZA 5KFHA 1JLFA 3JYTB 3FQLA 3UPFA 1HNIB 2ZE2A 5KG2A 4ZP7A 4IRCA 2RKIB 3QO9A 5HROB 1TQLA 3PW4A 1S1VB 3DRPB 3IG1A 2C22A 2IM2A 4JUZA 3KLGA 2FVRA 1C1BA 1JLBA 2I5JB 3E01A 3M9MB 4FBTA 2E9RX 2V0NA 4J9SA 3KLFB 2UVWA 4G3IA 4F4WA 4GC7A 3DRSB 3CVKA 3SFUA 3Q8RB 1TL3A 2ILZA 1D0EA 1JLQB 1DTTA 2IMWP 4ECZA 1S1XA 3ISNC 3T5HA 3BQ1A 4G1QA 3FFIB 3OL7A 1IKXB 1S6PA 4WE1B 5DG9A 4K4UA 4LSNB 3KHRA 2FVSA 5I42B 5DGBA 3QGGA 4PUOA 4IH6A 4MKAA 3DOLA 3HVTB 2RKIA 1IKVB 3DRPA 3PR5B 2R8GA 4NZ0A 4YP3A 4ED3A 1S0OA 1BQMB 2I5JA 2OPRB 4MIBA 4ZVFA 4KO0B 3KLEB 1JKHB 2XI3A 3KLFA 5KFIA 3GILA 5F8GA 1SUQA 1GX5A 5KFMA 3DRSA 4LSLB 2D3ZA 1JLQA 5HP1B 1I6JA 3HVWA 4EYHB 3M8PA 5J1EB 1T05B 4JV0A 3FFIA 5FDLB 3NL0A 4WE1A 4LSNA 2OPQB 2IJFA 4H4MB 1N6QB 5I42A 5C42B 3OL8A 2UUWA 5KFAA 4O3OA 1W25A 1CSJA 1U09A 1EETB 5KFSA 5DQGA 2W9BB 4ID5A 3MF5A 1ZTTA 3ICLA 4F4ZA 2EC0A 3ISND 3BJYA 5EWEA 1S10A 3UDLA 2OPRA 1WNEA 1S4FA 4RW8B 4ECTA 2IC3B 3MTKA 1XR7A 2FLNA 2VA3A 4O44B 4IG0B 1RT1B 5F8MA 3T5KA 1GX6A 4KAIA 3KHLA 2FVPA 3BR9A 5EWGA 3DLGB 1RT2A 5D3GB 3I5CA 3GV7B 2AX0A 5HLFB 2GIQA 5FDLA 3D5MA 5I3UA 1N48A 3JSMB 1FK9A 3MEDB 1N6QA 5KFGA 5C42A 2ASDA 3PW5A 4EBCA 3RAXA 3HVAA 2UVVA 3M8QB 3DLKB 3C6TB 2R2UA 5L1JA 4ED1A 4F50A 1QE1B 3CWJA 4NCGB 2VG7A 4ED8A 2B5JB 2WRMA 4URSA 3ITHB 1ZTWA 3VQSA 4RW8A 4O44A 4IG0A 1RT1A 1N56A 5JUMA 2E9ZA 2HNZB 5KG4A 4O3NA 3DLGA 3KJVB 5KFBA 3LANA 5KG3A 2WONB 5D3GA 3M9OB 5DLGA 1SH3A 2ZD1B 5HLFA 4KSEB 3BGRB 5JXSA 4ECVA 4IR9A 3JSMA 4QWCA 2V9WA 3PHEA 3FQKA 5L1IA 1TKXB 3IS9B 3Q8QB 4O3RA 4FBUA 3SFGA 3PZPA 5DQHA 3M8QA 3DLKA 3C6TA 3LP1A 4K4SA 1QE1A 3NBPB 4H4OB 4NCGA 3IGVA 4LQ9A 2FJWA 3H2LA 5KFQA 3CJ2A 4YR0A 4IG3B 2YKNB 3QO9B 4IOBA 4R0EA 1YVFA 2HNZA 4IKAA 4O3QA 3GQCA 4EEYA 5L1LA 2XCPA 3OLAA 1JX4A 1C1BB 1JLBB 1MMLA 3E01B 3KJVA 4DEZA 2UVRA 4U7CA 4RNOA 3IRXB 4J9KA 4WXWA 3Q8SB 4J9PA 4WYLA 5F9NA 1TKXA 2C2RA 3IS9A 3RB6A 2J6TA 1KHWA 5KFNA 5F8NA 1S6PB 4NRTA 2JC0A 3H4BA 2IM0A 4H4OA 4QWDA 1S9GB 3RB3A 1TKTB 1RT4B 2FVCA 2AX1A 1C0TB 4PUOB 2HWHA 5KT3A 3DOLB 4IG3A 1N5YB 2YKNA 5KFLA 4ECSA 3E51A 2XI2A 3OLBA 4NYZA 4ZP8A 4NLPA 3KHGA 2YNGA 3MECB 1LWCB 1LW2B 4J9LA 1DTQA 2JEIA 4RZRA 3KHHA 2IAJB 4Q8EA 1C0UB 1SUQB 3CO9A 3IRXA 4NLOA 4RUAA 1TKZA 2R8JA 3NMAA 4TY8A 2YNFB 1ZETA 2AGQA 2FJVA 3M8PB 3H5YA 2XC9A 5F8JA 4ECUA 4PQUB 5C24B 1QUVA 4DL7A 2F8EX 3I0RB 3T19A 1S6QB 5C25B 4XPCA 1S9GA 1JLAA 1TKTA 4Q0BB 2R8HA 1RT4A 5L9XA 1C0TA 1KLMA 4QPXA 4B3OB 3V4IB 4Q8FA 1N5YA 2WB4A 4ID5B 4O4GA 3CDEA 4H54A 3UR0A 3V6HA 3DLEA 4ICLB 3FRZA 4MKBA 5EDWA 2V4RA 4K4XA 3MECA 2XCAA 1LWCA 3DDKA 4EO8A 4NLRA 1LW2A 2ATLA 3GV8B 2IM1A 5DLFA 2BANA 2IAJA 1C0UA 3HKWA 2AGOA 1TL1B 4KFBA 1EP4B 1FKOB 1HMVB 5J2QB 2R2RA 4NLTA 1HNVB 1RT2B 4O3PA 1IKYA 3BQ2A 2YNFA 1RT3B 2IJNA 3FDSA 2XGPA 4ED7A 5KFYA 2HWIA 1J5OB 4PQUA 5C24A 2WOMB 5I3UB 3I0RA 1RTDA 4IH7A 1S0MA 1FK9B 1S6QA 4RW7B 5C25A 4KE5A 5F9LA 3SI8A 4DG1B 4Q0BA 4IRDA 4MK8A 5KFVA 4QW9A 4I2QB 1DLOB 4MIAA 3T5JA 4B3OA 3V4IA 1LW0B 3V81A 3N6NA 3GYNA 4ECYA 3OSPA 3MEGB 3MFHA 5CYMB 4ICLA 2BQRA 5KG0A 2VG7B 4IFVA 2W9AA 4Y3CA 4HKQA 2HAIA 4R8UA
chains in the Genus database with same CATH superfamily
5LOQA 4K7QA 1T9UA 3EXYA 1FVQA 3RB4A 4DV3J 4ZMMA 2VBXA 1KKHA 2V4JA 1X5SA 4K8RA 4ZCLA 4NLQA 1B64A 4OV1A 3MEGA 2XBPA 4S0MA 2XY7A 3NAHA 3FGVA 4FVMA 1S79A 2EXUA 2CWXA 3PYFA 3W8GA 1UFLA 3QYYA 1VC5A 2B7BB 4DI6A 3GIKA 5L8RC 3IR5B 2CJYB 3AXKA 4XPEA 4CH0S 4O3SA 3UW1A 1DY3A 3KK2B 1NK8A 4J9QA 1XWLA 2NXUA 1WOPA 5F0WA 1QAJA 3M2UB 1S1TA 3ET6B 2IIHA 2AEFA 3FZBA 4Q43A 2MQ8A 2KT5A 1VQPS 1WI8A 4KTQA 4Y2IA 1UFKA 4EI2A 1IKYB 4GC6A 1LFWA 3PACA 1XTZA 2W7PA 4B08A 1NBEB 1Q8BA 4R8UB 4IFYA 4J37A 3G87A 3C19A 1MU2B 2Y8YA 3FZ2A 4DV6J 3W9HA 3CJ0A 2VHGA 2BYCA 4PEOA 4H4KC 4J90A 1Q78A 2I1RA 2LLZA 4IH5A 2C1EB 2LXIA 3HHKA 4RBTA 4OHVA 4A47A 4GVBB 3E2EA 1VGYA 5CD4H 1CULB 3GB0A 3TAMA 3FSIA 4OZ0A 4ZPWR 3W66A 2B43A 2MTLA 4RW9B 5GMDA 1I94F 3BBFA 1TP7A 2FLLA 1H7WA 2BJ9A 3M8SA 1FERA 2G13A 2Y8WA 4USWA 1B99A 1HR0J 1RT5B 3MR6A 2ADCA 4F3MA 3D2WA 3JXOA 4HVZA 1F5BA 4DV7F 1U8WA 4K5RA 1T3NA 1UFWA 5L9NA 2RF2A 1X5OA 5DG7A 3WC0A 5KT4A 4HLBA 3FUYA 2O1PA 3VAIA 1C2PA 4USTA 3CCJS 4X4RA 1UWBA 3R6GB 2G0IA 4CYUB 4U8YA 3DLBA 1ZA1B 4DPOA 3IG1A 2KH9A 4J9SA 3K5MA 1QUPA 2CPEA 3EYZA 3DRPA 3PR5B 2R8GA 2LU1A 4LIRA 1U8SA 5MLCV 8ATCB 3NL0A 2K06A 2YXLA 4OJHA 4NYOA 4JV5F 1XR7A 1VYAA 3PRBA 2CPJA 2E7VA 4KR0B 6AT1B 3KDNA 4WFAQ 5M2RA 3TVZA 2GIQA 3EVMA 2CNLB 1M5VC 4ELTA 1EKSA 4PYDA 4F50A 2VFTA 4A8MP 1WEXA 2CQ4A 3SSRA 1NDKA 2PI4A 2WONB 3M9OB 1N0UA 2N3OA 1SKWA 5EX3A 4M8LA 2KDOA 3PO4A 2IRYA 1FNMA 3H25A 3Q8QB 4LR7A 3M2VA 4H4OB 2QL5B 4YR0A 1RB0A 3HJFA 3ENQA 2YKNB 2HNZA 4IKAA 5L1LA 3OLAA 1ZM9A 4RNOA 1F5CA 1S12A 2HVIA 5F8NA 1NH8A 2NR0A 2J0SD 2HBYB 4WU2A 1WG4A 3NCPA 2XYGB 4ECSA 1G7CB 2XI2A 1NPRA 5CCMA 4MIWA 3G4SS 4DHVA 2LEAA 4CM2A 3KHHA 3CD5A 3CDAA 1KQSR 3CCSS 3H5YA 2F8EX 2ZHAA 4IYQA 2AMCB 2UV8A 3CNQP 3MECA 2XSJB 1NLKL 3BGUA 2YBVA 1YJWS 4JI8J 1RHUB 2W2NP 4CLPA 2NUHA 3BDEA 4HR2A 5KFVA 4QW9A 5D4PA 2R9LA 3OSPA 3DXBA 1IVZA 2V8PA 1OYEA 2MLYA 4JI7F 5F8IA 4LF8F 1FKOA 1EQMA 1WF1A 5T7LA 2RT3A 2FHJD 3G8QA 2J7WA 1TMMA 7AT1B 4NEYA 1NK9A 1KNZA 3HZEA 3MPVA 2H65B 3LQVA 4YR2A 1K0VA 4A8SA 3TQ1A 2GO9A 1LWXA 3W62A 3G86A 2JL9A 2YNHB 3B78A 1SCJB 1RACB 2GC8A 1PBUA 3LP0B 2GHVC 4DR5F 2EFVA 4DL4A 4G1IA 4ZKAA 4CTAA 3GMGA 3DLEB 5DJBA 4YDDB 3PX0A 4P10A 4TYAA 4DL3A 5IT4A 2M88A 3D3CJ 4ZLPA 2IYIA 4I2PA 1B7FA 2VBYA 2ZEJA 3DCAA 3W63A 2RILA 4HHJA 4OI3A 3MAAB 2PE8A 5LSLA 3OXLA 2ZVIA 3VAHA 2DRBA 4JI3F 1F9FA 1LWEB 2ZVSA 3MTJA 1R0AB 2BW2A 1UEVA 2CWKA 1D9AA 3GR0A 4ZS6A 3Q23A 2BKPA 2B6AB 2HNDA 4ECRA 1SH2A 2M0GB 5D4OA 4EUVA 3EZUA 4CLLA 2XLIA 4JI5J 4WPAA 4ZVOB 3CB4A 1K73T 4FYYB 4DWIA 1H7XA 4OZ5A 1Q1KA 3G6YA 2LDYA 4KBIA 5KT6A 2V9KA 3OXGA 1CJVA 3AD9C 2QLBB 1T9XA 3ENAA 1YZ7A 2MQNA 1VQKS 1VFJA 3AODA 2DY9A 1Q95G 1TL4A 3NNHA 2ILYA 4JI6J 4PWDA 2XMWA 2XNQA 1JLFB 2B5JA 2UUAJ 2DEJA 2ZH2A 5MAOA 4DLGA 3T9ZA 4OI4A 3H40A 2WK4A 3PFEA 5HVGA 1VRTA 5C5JA 3WHIA 1KONA 3ZZUA 4ZP7A 3QO9A 1HI8A 1IWGA 2Q6BA 4CI0B 1MMDA 3L09A 3GWCA 2ILZA 1GMVA 3FNNA 5J1NA 2M52A 1S1XA 2PA3A 1RCXB 3QGGA 2RKIA 1P8GA 4I1TA 5IXUA 1BQMB 5H9FJ 1NUEA 4ZVFA 2X7IA 2VFUA 3HCXA 2NPIA 2HEKA 3VR1A 3HVWA 5AXKA 5J1EB 2RHQB 1N6QB 3RTVA 1U1MA 2W9BB 1UVKA 1U2FA 1S4FA 1RT1B 3K8WA 1GX6A 2K8GA 4OFZA 1H74A 1FXLA 1HA1A 3GV7B 1KQFB 2OD4A 2HHHF 1FK9A 4FN5A 5IOLA 5HAOA 1DQ9A 3SDEA 2FUG9 1HBOA 2X1BA 2F4VJ 1VHFA 3HX9A 5I4MA 5D3GA 5SUHA 2X51A 3R7BB 3MURP 3DLKA 4PZVA 3TOQA 2G1DA 3HSJA 3K89A 1CJTA 3KJVA 4CQ1A 2UU9F 2JWNA 5HO4A 4RUBA 1KHWA 5CD4A 3THVA 3AT1B 1PIEA 2FVCA 1YJNS 5KT3A 2FB0A 2NS1B 3OLBA 4HDHA 1WHVA 3KG1A 3R5JB 4DV3F 1P9QC 4ECUA 4NA2A 1U0HB 4XPCA 3GIRA 2D3OR 3IR6B 4DSEA 3G71S 4F4KA 3UDCA 3GV8B 2V2QA 5J2QB 3ZZZA 2WOMB 2LKZA 3SI8A 1I1GA 1CPZA 3A3NB 1OIAA 5T41A 5F3ZA 2HAIA 4F0HA 2AWZA 3GCWP 5KFXA 1RT3A 1S48A 3H5XA 1FRXA 5DO2A 5AXLA 1LW0A 4Y00A 1X0FA 4DR6J 1UVMA 4KQZA 2JLGA 3J81j 4IQXA 2OIHA 3MM8B 2FC8A 2BUNA 1T11A 2AD9A 3FEXB 4ZVEA 4NLXA 3WDOA 3H59A 3NP5A 3DGPA 3I82A 4QR2A 4LF4J 1IBMJ 3A8EA 4WZQA 1NHUA 4QR1A 2AJ2A 2HHTA 1KHVA 3R8YA 4RNHA 2RS2A 3QAEA 4D3HA 4DCOB 1TR0A 1R6VA 3MFIA 2MQQA 4C7QA 2D9OA 3UFCX 1FDBA 1UVIA 1S0VA 1IR1A 1UCNA 3IRWP 2KRRA 3KK2A 2VONA 4PG6A 3BF4A 4ZPCA 1HQUA 1Q7YT 3M2UA 3A13A 3ET6A 2DHGA 3NS6A 1T02A 3MCSA 1C1CA 3PY8A 3GIIA 4KIAA 2DXDA 2VG5B 3HKZD 1N36J 2QL7B 5F8LA 3LAKA 1LV5A 3D28A 1RYSA 2DH9A 5DZ6A 1XK8A 2ZH8A 4UOFA 2MZ1A 4RU9A 1HR0F 1AZSB 3NCQA 1MU2A 1SQGA 2OFHX 3NGSA 3TAQA 2FD2A 3VZIA 1H2UX 2XGQA 3U27A 4NLUA 3QZ8A 3RAQA 4BC7A 5GMKa 4RUCA 2AEMA 3IC1A 4FP9A 2QV6A 3GONA 2J7UA 2E7WA 2B8PA 2MHEA 5KFTA 1GQEA 3AA9A 1KQKA 4YB7A 3W8PA 4OIXA 1BQNB 5D4NA 1CVJA 1CULA 3G2XA 4CO0A 1VJWA 5D77A 3DRRB 2XNRA 4RW9A 3TJ9A 3DGVA 1NDPA 1RAFB 3W2WB 4DUTA 2CQGA 2EG2A 2FJAB 5LSOA 3ITHA 3AJDA 3NKYA 2NSBA 3LP2B 2ZE2B 4IRKA 1U48A 3BZQA 3LWLA 3IWNC 3JS9A 4KHPJ 1VJQA 3BGRA 1VBKA 1T9WA 1RT5A 4EBEA 2PGCA 1WC5A 4PKDB 2AW0A 3BN4A 1JQGA 2OHDA 1TQLA 3PW4A 2FVRA 4CLFA 5K8PA 2V0NA 3KLFB 1X7VA 4TU7A 4GC7A 5SZTA 3D0IE 3T5HA 4CLYA 3BQ1A 3FFIB 2LFVA 2B7CB 2FVSA 4MKAA 4CYUA 3PTWA 4ED3A 4RJVA 2AKWB 2QLFB 4LSLB 4A48A 4IO9Q 4UW2A 5CQGA 4BCAA 1ULRA 4WTOB 4LFAJ 3OL8A 4EGLA 1U09A 2V2ZA 1ZTTA 1S10A 4USHA 3W5ZA 2C3UA 4QU6A 2VA3A 2YQ1A 1NK5A 2V63A 2OEMA 2DNZA 3ZNJ1 2KYZA 2NREA 3C6TB 2BJEA 4ED1A 4A8XA 3E3XA 3EE3A 4FYXB 2VPWB 1X4CA 2NLWA 3MOZA 1XEZA 1FNOA 4ENOA 2QG9B 3HP6A 5DQHA 2I8EA 2PI5A 1QSLA 1SVDA 2BMBA 1U2RA 1YVFA 2FIUA 3OR1A 1WSVA 3WX4A 5CAAA 4JI8F 2Y1JA 1X4FA 4FF4A 5BYRA 1HNWJ 5KFNA 1YZ6A 3ZZPA 4A8KA 4H4OA 3N79A 3TQEA 4U95A 5HQMA 2YKNA 1URNA 4B17A 1WF0A 4WIQA 1D8YA 2XZWA 2E5IA 1ZETA 3PKMA 2H9ZA 3W60A 4UT4A 1W26A 3RG6A 3V4IB 1CQMA 4O4GA 3UR0A 3FRYA 1WG5A 2XY6A 4EO8A 2ZHBA 2ATLA 1XBWA 1SKUB 4J9UE 4NLTA 2AZ3A 5KFYA 3KDOA 5I3UB 1RTDA 4R25A 4OQJA 5C7PA 2PSZA 3O2IA 4PG8A 1U6FA 2ZJRQ 3ENVA 3PEHA 3RB0A 1U1OA 2EVZA 2JLEA 5KG6A 1BGXT 5F8HA 2VJVA 4ANCA 4B3SJ 4ERDA 2XLJA 2DPJA 4AD6A 1Y5LB 4PG7A 3ENWA 1RWVB 2C2ZB 2R42A 4BDPA 3HSDA 2RRAA 1RSCA 5AJ3J 2FPHX 2YX4A 1HHSA 1AUSL 4BS2A 2O01C 3BH7B 1SJ1A 2LQJA 4ZVSB 3NWRA 2QE5A 2DEIA 2OD6A 3DRYA 2QC3A 1RE1B 2X3DA 2QSWA 2YNHA 3AJ1A 1BMQB 3KUGA 3MM5B 3LP0A 3ETMA 2W01A 4ZP6A 1WEZA 2JVOA 4OX9J 4JI5F 1RWPB 2ZKUA 2ZOFA 4L3KA 1JLCB 1J5EJ 2XO6A 4GMKA 1O6XA 2C2MB 2CZVC 4X4VA 2CPZA 2YWWA 1KVJA 3JQKA 4V19J 3IBWA 3CUNA 2AYGA 3RRHA 4KGMA 2XMUA 4YN3B 1IR0A 2KO1A 4I7FB 3GV5B 3DOKB 5T14A 1X5TA 1OS5A 3MAAA 1XMBA 2R7XA 1YGYA 4JI6F 1LWEA 3DHWC 4KY3A 4LF9J 1R43A 2M2BA 2DGTA 3F73A 4CT9A 1SKSA 1T8EA 2MKJA 5E3CA 2UUAF 2W4DA 2BQUA 2OPPB 4TXSA 3C66A 5M2UA 2JSXA 2ZUGA 2JHEA 8RUCA 4GKKJ 2R3VA 3SSQA 1S49A 4ZOSA 4DS5A 4Y2KA 2C2EA 3T9NA 3GYXB 1EZZB 4W4MA 1EQ0A 1ZBTA 4LRCA 3MEKA 3CF5Q 4WIIA 1FTRA 4ED2A 2HHUA 4HH1A 3X3UA 2Y1LB 2UZAA 5D0HA 2K2PA 3QNWB 4EYIB 1M5SA 5D15A 1KD1T 1HYSB 1NEEA 3E8OA 3EMTA 3PJWA 2RQ4A 3EICA 4C8NA 3P8BB 4YR3A 4DFMA 1BY9A 2D41A 3BSAA 5D4LA 1JLFA 2NXJA 3UPFA 1AW0A 1HNIB 3HVRA 3DU6A 2IBOA 1F9HA 5HROB 1S1VB 1A6LA 2EW9A 2EFPA 4MTPA 2E9RX 1PG5B 1M1KT 4O23A 5JMNA 1D0EA 2Z8QA 4DXLA 3BGOP 2RU3A 1U1RA 3WX8A 2F4VF 2QA4S 2Z2MA 1S0OA 4MIBA 2BA9A 1EX8A 5KFIA 1YBUA 3ZO7A 5F8GA 5KFMA 2HGMA 2JOQA 3OR2B 3W61A 4H4MB 2ZC3A 5KFAA 2DNLA 4OV6A 4O3OA 4ZJLA 1EETB 5KFSA 2IC3B 4PQAA 3PHTA 2CNKB 4GO5X 3L7UA 5HLFB 1GMWD 2DTJA 1N6QA 5BR8J 4EBCA 5HMYA 4BC9A 2WVCA 4ZLJA 4NCGB 5B09A 3FEYB 2CNOB 4RWXA 1RT1A 4ZPTR 2ZD1B 5IFMA 4RBVA 3MCOA 2I38A 2V9WA 3PHEA 2BOPA 2ADBA 3SFGA 1BC6A 1K47A 3K5OA 3M30A 1PC5A 3DKDA 1JLBB 1MMLA 3DDIA 1U1KA 2JNJA 1S6PB 2B0GA 2DCUB 3GLJA 1TKTB 4NCBA 4CLZA 2R7QA 3KHGA 2YNGA 3D6HB 1U02A 4C11B 1LW2B 1L3TA 3FVYA 2DGWA 4TY8A 3SSSA 3HI9A 3ILIA 1WG1A 1U6ZA 3KTQA 3V4MA 1KLMA 2A10A 4DR6F 2GHPA 1QSYA 1Q8KA 3CMES 2H1YA 1VBYA 2HGNA 1HNVB 3PG9A 4FNIA 3AH6A 3UN2A 1S0MA 1U0HA 1QAXA 4MK8A 1FJGJ 1XJWB 5KG0A 1N52B 4LF4F 1IBMF 5ETRA 5J2QA 2PMWA 1S4EA 3D54A 1NSPA 3NOCA 1GMUA 2W2MP 2WOMA 3MMJA 5CZVA 1TL7A 3CJKB 4DQRA 4WU3A 1AROP 4M94A 1GK8A 2ZBPA 3GIMA 3NGKA 3BSOA 4NXMJ 3IA0A 1RAHB 2DD8S 1M5OC 1IR2A 1PCAA 3KMSA 1LXJA 2H48B 4WFXA 1DTQB 4F25A 1RADB 2KYXA 3DI6A 1EIYB 1TKZB 3K5LA 2F65A 2J6UA 2HFOA 4AFFA 1N36F 2U1AA 4FYVB 3IR7B 2J8SA 4M95A 2AF6A 1X9MA 5IC4B 3A12A 2ZH9A 2HRTA 3LAMA 3T1YJ 1V6HA 3KK1B 4E0DA 1FDDA 2PN6A 1RT7A 4DU8A 5KG5A 5FJ4A 3KNGA 2PFFB 3D1HA 1GXLA 4GRSA 2HZAA 1VLOA 1TV6A 4LR8A 3SQGB 2F5GA 5HVFA 1AA1B 1RWXB 1YLXA 3AB4B 2NPFA 2HMIB 2QZ8A 3QLHB 2XY5A 2FHMA 3CD7A 3R5DA 4QW8A 3R9LA 1BLUA 3EJMA 2EK1A 1LEOA 2KKHA 3GJSB 3QBCA 1R7IA 1YBAA 2ALZA 1K1QA 3T6JA 3AFGA 1H38A 3C15B 1SIWB 2CJQA 3POTB 2YQ0A 5HP1A 4KHPF 2CQ2A 3U02A 5E41A 3H5SA 1P1LA 3BPSP 1X0PA 4ANEA 1KVKA 4IOCQ 2OMLA 4FYWB 1SH0A 1Q79A 3BSCA 2KVIA 1R27B 1BQNA 3HHLC 1S6UA 3PYGA 2DVIA 9ATCB 3W7BA 3UDVA 3DRRA 1IQTA 3UVJA 2VZ9A 3PR4A 4C6AA 1KFDA 1TL3B 4WP3A 4DX7A 4UTGA 1U2CA 1TTHB 2CQCA 3IFEA 5KFJA 4DV2J 3VTIA 4LFAF 2KFZA 2HFUA 5L39A 3MZIA 2ZE2A 5A8KB 4JUZA 3LUYA 2JVRA 1VQ4S 3SFUA 2KB2A 2WVFA 3KJNB 4DCJB 3IWLA 4K4UA 1NCLA 2MZTA 1ZA2B 5K8MA 4MKVA 2GZOA 5AE3A 1NKCA 3UE2A 4NZ0A 3HZGA 3U1LA 2WVDA 3KLFA 3HT3A 3D66A 1F2HA 2BE9B 3FFIA 1HW9A 2OPQB 2IJFA 2BABA 2HHQA 4EFAC 3SIPB 4F4ZA 5D8HB 3MF5A 2EC0A 5HQ8A 2P6SA 1U7LA 2ZOMA 3QRPA 3K5NA 4F67A 4UF4A 1ACMB 1HNWF 5H9EJ 2EPIA 3MPUB 2E1MC 1O8BA 3VHQA 2UVVA 2R2UA 3CWJA 2VG7A 3R1HA 4URSA 2XTJP 3KFWX 1ZTWA 3CXCR 2DNOA 2VPYB 2AJQA 1YJ7A 3SCLE 1S59A 4DN9A 2CZ4A 4DJBA 4IR9A 2L48A 3FSXA 1RI7A 4DFJA 2D69A 1FFGB 1WHXA 4IUFA 5FD1A 3C6TA 3S8SA 2AZ1A 2VFRA 4J5OA 2PO4A 3QFWA 4A46A 2HFZA 3RW7A 4L6V3 2IMOA 3IRXB 1VLYA 2EFQA 1Y0HA 3NWGA 3M6VA 1Q81T 1VQYA 3D0HE 4EWTA 4QWDA 1N5YB 5KFLA 3EVWA 3OFGA 3TVYA 4ZP8A 4WFNQ 3NG8A 2MGZA 1CBKA 3VCDA 3DXSX 1D8ZA 2ZH5A 4ZLLA 1WTBA 4ZDNA 2K7JA 4Q0BB 1JJ4A 5L9XA 1YBTA 4QPXA 4Q8FA 4B3SF 2HAFA 4H54A 4CT8A 4QIGA 2GVDB 3N9UC 3QJJA 3O8WA 3AXMA 1YI2S 4KFBA 1DARA 3GR1A 4KPCA 5AJ3F 2FJBB 5LJ5Y 3V4IA 3V81A 3A3PB 2XM3A 5CYMB 1FT8A 4U8VA 1RAGB 4ID8A 4HKQA 1JLEB 4C8ZA 2XQCA 5J2PA 3PRDA 4DV0J 5B08A 1QY7A 3VZHA 1YJVA 3PYEA 3O3LA 4LRDA 5GAHU 1HBMB 5IM0B 4WKYA 3AOCA 3FKBA 2SXLA 2BJ8A 3BGLA 2DT9A 2BW7A 2PMHA 5K14B 4LIWA 4PG5A 1VQ8S 1HBUB 1S7IA 2BQ3A 4NMLA 4OX9F 3I31A 1RDRA 2J7KA 3CULA 1Y9OA 3HDSA 2K3KA 1J5EF 1REGX 3TZZA 1FDNA 1B0PA 1FKPB 4FS2A 2RVJA 2GVZA 4WTYA 4CNZA 1N32J 1PJ5A 3J81U 4DR2J 4NI2A 2BOAA 1TFYA 2VICA 3KLIA 3L7PA 2GS8A 3I56S 3MEEA 3HFKA 1QM9A 5E0OA 4F02A 1NH7A 2BANB 4DMZA 1YTYA 4DZ6A 1L3VA 4TNOA 1RTIA 1QAYA 4PG4A 4N56A 2J6SA 2RDIA 1SV5A 4OZ3A 5KAKA 1RA7A 4LF9F 3TJAA 1FRJA 5IT0A 1YRUA 4DN0A 6FD1A 4JV2A 4W98A 2ABYA 2PA8D 4EBDA 1VR6A 2GQCA 3MR2A 4GKKF 4N5SA 2H51B 4TVAB 3JYTA 5HBMB 3JQJA 1JLCA 3MM9B 2HHSA 1CJKA 4ECWA 2YH1A 4DR1J 4A8QA 4YB1P 1UP1A 4C8OA 3HVTA 5K20B 1IKVA 5LJ3Y 1ZZNA 2BKOA 3IGNA 1WSRA 1O5JA 3KLEA 1S7HA 3PW2A 1IN0A 2GQQA 3MMCB 3EPIA 3JQMA 4ZVTB 4XAKA 1TELA 4YOEA 3WIVA 3THTA 1L3UA 4H4KA 2RQKA 2OPPA 2AJ0A 3I9ZA 4IQMA 4OLOA 4QWAA 1VK3A 5KT7A 3S6EA 1VQLS 4IDKB 3CEDA 2V8DA 1IJEB 3CCVS 3Q24A 1LK7A 3CSKA 4AQYJ 3W9JA 3KLGB 3OTEA 4KHMA 4A8FA 3QGIA 1G6BA 1WACA 3TA1A 4IR1A 3RW6A 1FI4A 3HXMA 2M3DA 2MSTA 1ICEB 4G1QB 2KJWA 3QT8A 2W2QP 3M8ZA 3M9MB 3W9IA 1Y00A 2DNGA 3VGVA 3MAQA 4F4WA 3CD0A 3K7RA 2F40A 3ZNUA 5BR8F 4LSNB 3VVUA 4DR3J 4M5KA 3TZWA 3TNVA 2KJVA 4OZJA 4KYZA 2W2PP 2QLXA 2KHDA 4QCLA 4FXVA 4KGKA 1AYEA 1FHTA 5KOWA 3ZXWA 3MCMA 2VASA 3UDLA 4C0HA 1RJJA 4I56A 1T3OA 3I5CA 1L3SA 5E7OB 5RUBA 1Q4RA 2RRBA 5AXNA 3MEDB 3PW5A 2A2DA 2QA1A 1X4GA 4ED8A 4CWBA 4OZLA 2RNEA 2QEXS 2E9ZA 2E7XA 5HLFA 4DFKA 2VC0A 4CH1A 4ZPVR 4K4SA 3NBPB 4NCGA 4LQ9A 1YX2A 3QSYB 1PC4A 4R0EA 2OGUA 4LVOP 5L46A 2NYIA 1U1NA 1FE0A 4U7CA 2CUYA 4M5JA 1M0SA 2C2RA 4ELUA 2CQ0A 1FWKA 2J6TA 4ZCKA 4NRTA 3Q0AA 4L76A 1FJGF 1C0TB 2G9OA 3NY0A 3DOLB 1UEKA 2OUGA 1NSAA 4J9LA 3AY0A 3SXLA 2RIJA 3M8PB 2XC9A 3GTYX 1S6QB 1TKTA 2B4VA 2HSEB 3TUZC 4B3OB 1LW2A 2C3PA 3D3BJ 1EP4B 2RH3A 2ZKTA 1VMBA 4NXMF 4RW7B 1DLOB 2CPFA 3BH6B 2COLA 3GYNA 5EGYA 4IFVA 4G6VB 3A4TA 4KB7A 4ZHRA 4JOUA 1HNVA 4RNNA 5G0RB 1RU2A 4OHYA 2KL8A 2HS0A 3J7A1 5D0RA 1RU1A 3EZ5A 4WZMA 5A2QU 1RTHB 4JYAJ 2LXUA 5KFOA 3R1LA 3DMJB 3T1YF 4ZPDA 4CO4A 2CJ9A 4XTTA 2F63A 4HHUA 3HFVA 3CJKA 3Q8UA 1WOSA 2DNNA 2Z56B 8AT1B 2RUSA 2CQDA 4LRAA 4XO0A 1TUVA 2HLTA 2RSQA 4I64A 4Z7YA 2ZZTA 4GKJJ 1FJEB 5ETSA 3CMQA 4NWBA 1QJHA 1FA0A 4C8LA 7FD1A 4FF3A 3M8YA 3IM9A 4ZCMA 1D3WA 2W4CA 3NGDA 1KC8T 1X5PA 2CPIA 3BB5A 5GAEI 4B9LA 4BWJA 1VQ6S 4DV4J 3JTPA 3ONQA 3MUVP 2JLFA 3KK1A 4DSIA 5EUHA 3ELHA 1UAWA 3AQPA 4JV1A 1H2VZ 3FBFA 1PYOB 4J7CA 5THWA 2JC1A 1EARA 2J5AA 3SQGA 4JI0J 2VBZA 3MR3A 5J2MB 2GMLA 4EO6A 3PJ9A 5K8OA 3QLHA 3Q2TC 1N5TA 3GU0A 2YNIB 1L5UA 4X4SA 2MY8A 2HFNA 1MWYA 4AT1B 1TU0B 2G0CA 1T05A 3DC2A 3M6UA 1WC6A 2A6OA 4DV2F 1YHQS 1PSDA 2XMKA 3C15A 4F3OA 3FK4A 3H20A 3POTA 4B9SA 3DYAB 2MKHA 3AA8A 2YKAA 4LF6J 3ETOA 1NM2A 2KG1A 2HPUA 2RDDA 3TZXA 3BO4A 1N8RT 3V6KA 2ZH6A 3PXGa 2XS5A 2KFNA 3SV3A 1VRUB 4HTJA 2JRSA 4USJC 3T1HJ 5A8RA 1RKJA 4Y2AA 2V2KA 3G8TA 4F26A 2CXEA 2NYHA 2DNYA 3JSBA 5B0DA 3MOJB 3W2VB 3OD2A 1WI6A 1Q8IA 2Q6CA 4YFUA 1TL3A 1KTVA 2DO0A 3RBXA 1IKXB 3KHRA 2VQFJ 1UWAA 4ZIWA 4ZVPB 1MROB 1CS4B 5A8KA 2HIYA 2R7OA 2E44A 2WVBA 4QZVB 1VIXA 2ACYA 2G2OA 4QIEA 5I3PA 2HFSA 2E1CA 2M4MA 5HMXA 2CPXA 1UZHA 2G4BA 3T5KA 1AXQA 2DGSA 4B3TJ 1UL3A 5HI7A 1C4CA 2ASDA 3ULHA 1NK7A 2J0WA 2KZZA 3R2DJ 3UCGA 4BLGA 1NJWA 2J9DE 1NJYA 2IRXA 1SH3A 1YQHA 1QSSA 3HF5A 2MQMA 3R5BA 1TKXB 2N7CA 3IS9B 1YJTA 2Z58B 1JJHA 2CRLA 4IOBA 4O3QA 3IO1A 1C1BB 3MMBB 1DFDA 4F0KA 2VU5A 4J9PA 4F7VA 2X3GA 3N4WA 1RT4B 2R7VA 1L3KA 2M8HA 3CJSA 1BWEA 2EBEA 4DV0F 2QYGA 3IRXA 3R7NB 4UUXA 4ZLNA 4DL7A 1FTCA 3I0RB 3HHDA 4X4TA 2HBZB 1N5YA 4DR7J 4ID5B 4RU2A 2HRYA 2AYBA 3DDKA 2RS8A 3Q89A 4ZVUB 1KSPA 3THPA 3FDSA 2YTCA 1XNQJ 1R0BG 4Q0BA 1K8AT 4P71A 2I9SA 2GVDA 2VPZB 1OJ4A 1CJUB 3GIJA 2OP5A 2XMTA 2CJKA 2F9DA 4MFBA 3OQ2A 4KV8B 1N32F 1B70B 2GJIA 2Q66A 4LJMA 5GADI 4DR2F 1DHMA 3LP1B 5CYMA 2HK3A 2IM3A 4X64J 5D6GA 1Y11A 3SEOA 1JLEA 2AYMA 2FZGB 2DNRA 2ASJA 1GAOA 5DETA 4EZ6A 3EVOA 2YH0A 3BREA 2OSRA 1REVA 3GFZA 2B9EA 5K14A 1HARA 4N76A 3EWGA 2MJNA 1X60A 3H2VE 1FFWB 4Y6IA 2BVZA 4USKA 2MQLA 3V6DB 4RW6B 1ZM2A 1MWQA 1JLAB 4JI4J 2MZRA 4OI2A 4RW4B 1ZAVA 1FKPA 4FPIA 4DX8H 1CQNA 4PXBA 4DR1F 1G2EA 1Q82T 2ZZMA 2MXYA 4UUWA 4YQWA 4DL2A 1OQ3A 1IUJA 4ZITA 1SJRA 2LEPA 3HULA 3CCQS 3FEZA 2OKQA 2GIFA 3Q22A 3OVSA 3DLJA 3H42A 6FDRA 4HI2A 4P6QA 2ZWOA 3CD6S 2V8VA 2BJ1A 4WYWA 1N33J 2AJ1A 3EXCX 4NLYA 3CJTA 1HIYA 3UDEA 2R4FA 4LR9A 3J81Y 2XMAA 2E9TA 5HBMA 2VA2A 3MM9A 2NQPA 3D68A 3PIOQ 4KO0A 4AQYF 1HQEB 2E5JA 5KFCA 2P2CB 5C2GA 2HVDA 3BM7A 5ETVA 3MPWA 4X62J 2M9KA 3ZTSA 4UY85 3PVXA 5C2CA 4CO2A 2Z57B 1NB2A 2RAQA 3D6TB 4PCQA 2YKOA 2ZJQQ 1IKWB 1S1TB 3MR7A 3IBCB 4Y34A 3MMCA 4DX6A 4ED0A 2IBKA 4B9TA 3U1NA 3FMWA 4J9OA 1QD1A 4QYZJ 2L9NA 1S1WB 5KFFA 1PYTA 4DR3F 3V6JA 2V67A 3GG0A 4OZ2A 3HJVA 2ZZNA 3DFEA 4DS4A 4JB8B 4HL9A 2ATCB 4IFYB 2K1RB 3QSIA 2D74B 4PABA 2POKA 3IN5A 3N0VA 5KFHA 3US5A 3HHLB 2IVMA 4P9SA 2UXCJ 3HHLD 3KLGA 3A8KA 1M5KC 1JLQB 2IMWP 1NDCA 2V2VA 3C16B 4G1QA 1MLAA 4WE1B 2BXJA 2VIHA 4DU7A 2W25A 4CLUA 4YP3A 4DPXA 1UMJA 2Z0GA 2LA4A 1SUQA 2EEYA 1X4HA 4PWWA 3RZAA 1ZM3A 1TUGB 3AJ2A 4LSNA 3M8WA 3ICLA 4Z37A 3UNGC 2VOOA 2FLNA 3FCWA 4LF7J 3FJ2A 2CIMA 2ZH1A 4CCHA 5CYJA 2FVPA 5EWGA 1ELOA 1FE4A 3DLGB 1Y5NB 4TLQA 3MWBA 1VQMS 2CG4A 3RAXA 1YDLA 4N47A 3VQSA 2XO7A 4ETXA 4Y2MA 1NK4A 4LFBJ 3MCNA 4QWCA 4FF2A 3QATA 5DM7Q 2YKPA 1DZ5A 1V3ZA 3EDQB 1LNQA 1RHMB 2XCPA 4DEZA 4Z7CA 3CW2C 2A2CA 2FYXA 2OMOA 2QLJB 2FTRA 4R0JA 2AX1A 3UN5A 2EC2A 3OTBA 4BHQA 3TO8A 2JEIA 4Y0FA 3J7YI 2AGQA 5C24B 4O0NA 5C25B 1VS3A 1C0TA 3TP2A 1YKWA 2V4RA 1R89A 4JYAF 2CNNB 4TU9A 3HKWA 2AGOA 4DSKA 3BPDA 2CQPA 3MI7X 1S6QA 1S72S 2YVSA 4B3OA 3NS7B 1QTNB 2W9AA 2RQMA 3HHNB 1R8BA 1HNXJ 3CPWR 2MB0B 1S97A 1EP4A 1WWHA 2FLPA 1XMOJ 1X9WA 4RW7A 4IO1A 2UUTA 4GKJF 1DLOA 4C0OC 3W3SA 1B0VA 3LGNA 2KT2A 3QIPB 3DM2B 4RKUC 2ZH7A 3BBCA 3B82A 5G0RA 3HSZA 1JNRB 1NZAA 5AT1B 2LQ9A 2DK2A 5BJRA 4ZN3A 3HT0A 2BE2B 4MH8A 1ROFA 2NUUG 1WF2A 3M4XA 1RTHA 3QT6A 4QWBA 3CCLS 2KTQA 3ILLA 4DV4F 2HNYA 3DMJA 4ES1A 1R0CB 2MKIA 3CCWA 1S9EB 1OPZA 4RNMA 1F6TA 3F41A 4DBQA 1CC8A 4WFYA 4CO3A 1WKKA 4X84A 2OPSA 1HPZB 2HHPA 1DRZA 1Y4ZB 3VGSA 1PBAA 2VPXB 4JI0F 1LWFB 3MAHA 5CHCB 3EX7B 4HH0A 5DDRC 3Q8PB 1IM4A 5E3QA 1SB6A 5A2QY 1NNDA 2Q43A 5CYQA 1WJ9A 1NXIA 1OY6A 2DR8A 3N6MA 3GJQB 2PEBA 2YKMB 1H6KX 2ZITA 3TX0A 5KFKA 1RHQB 2ROPA 4U7UD 5IC6B 3U7JA 4X4UA 4LF6F 5KFZA 1E6VA 5DG8A 4C3KA 2ZC4A 3GE9A 3CJQA 4ZK7M 3HHEA 3R7SB 1JKHA 4NA3A 3TYTA 3H0PA 4CO1A 3T1HF 5F3TA 2GGPB 5J2MA 2IVYA 1FX2A 5AE1A 2HQGA 2YNIA 2ASLA 2M8DB 1QLNA 4MK7A 1YJ9S 5HSPA 4NX9A 3KK3B 4ZVHA 1H3DA 4NMXA 4LBPA 5EWFA 3T41A 2MY7A 2VQFF 4OYIA 3W5XA 3RBEA 3H98A 4ALZA 4I2PB 3M6XA 1RAJA 4MT1A 2Z2ZA 3UD3P 3DYAA 1U1QA 1DTTB 2F8HA 4UZCA 3CJ5A 1RHJB 4AE5A 3QFHA 1K1SA 4P52A 2EFOA 4MYTA 3E01A 2F3JA 4FBTA 3T3FA 4DSLA 4OYPA 1VQ9S 2BBEA 2DHXA 4B3TF 1IBLJ 1I3OB 1DJ0A 2YWFA 5DGBA 9RUBA 4PUOA 1SIZA 3PRVA 4HI1A 2BJ3A 4F04B 2F7VA 1FNXH 2XI3A 3GILA 4WP8A 5C42B 3SCIE 1YIJS 2WAQD 2EKYA 2AJFE 2A0FB 2OSQA 4RW8B 2QL9B 4KAIA 1Q0NA 3QWUA 4MKYA 2J0XA 1RT2A 2LQ8A 2AX0A 1WEYA 3GFXA 3D5MA 1N48A 2AIRB 1GTEA 1SJQA 3HVAA 2P9GA 2VFSA 2B5JB 1U1PA 4K0KJ 2GW8A 4RR5A 3LANA 3AOAA 3AAWB 5KG3A 3VAJA 1NKEA 2DR7A 1JJCB 4KSEB 5JXSA 5B7WA 4ES2A 4G65A 3OJUA 2LA6A 4Y65A 4DR7F 3CJ2A 3QO9B 3QJLA 2YKQA 1HNZJ 4KPYA 3CGIA 4B3RJ 3CCZA 1TKXA 3IS9A 1XNQF 4ZN1A 4DQPA 3H4BA 1AUDA 2P8IA 4XIUA 4U7UK 1WUUA 5IS2A 3M1VB 5HK4A 3PCOB 3MMBA 1C0UB 3ZC4A 4X4NA 1MN7A 2XHWA 3D6FB 1G1XA 5IZHA 1SQFA 1RT4A 2H4YB 4X64F 2BJ7A 1OSCA 2IM1A 1U6BA 5CZXA 4ITSA 1RAEB 4DOZA 1IKYA 4QPTA 3CTRA 1NK0A 1TZ0A 3I0RA 1A9NB 1FK9B 1JJ2R 3N6NA 1IQZA 2WSCC 3MD3A 1KN6A 3GP9A 4UOCA 4R8UA 3QGHA 3KG4A 1JLGB 2HZCA 4USMA 3OBIA 1DAXA 4M5LA 4K4TA 4J9MA 3DLHA 4M5MA 3BO2A 4JI4F 3DHXA 2D7SA 4DF4A 2YWHA 3G8SA 4GVBA 4KV8A 4ZCIA 3AD8C 4B3MJ 4KGVB 4NLVA 2R2TA 4WXOA 2HIQA 2CADA 2NZ4A 5KFEA 1MMNA 4P73A 2H5JB 4MJKA 1TK5A 5LT5A 1F3FA 1F60B 4QQBA 2PDAA 1NAQA 2E5LJ 2CQHA 2IPOB 1N33F 5IT9U 2CG8A 5BYQA 1Z2LA 1FRKA 3V6DA 4RW6A 2L41A 2DNQA 5H9FK 3JAMU 1EB0A 5E3RA 4I68A 4RW4A 2VJUA 1Y5IB 2W4PA 1WDTA 2E1AA 4X62F 2AV5A 2YWEA 2FY1A 3GZ7A 1HWLA 5KG7A 1ZS6A 4P2SA 4RX6A 2MKCA 1N5SA 3RJMB 4U67Q 1GNKA 3GCXP 2YPZA 3NOGA 2ZM6J 4U96A 4WF9Q 2RJZA 2WHOA 4J9RA 2XWXA 2BJDA 2DXFA 3DRXA 1HW8A 3EGWB 2FQQB 4DF8A 3M2RB 4NRUA 3R5GA 3UR3C 4NOHA 3HSGA 4YMEA 1R31A 2ALYB 2BRKA 5B0EA 3DGPB 2DKOB 3VAFA 4LF2A 3HMJG 3I87A 1RHKB 1F5AA 2Y9HA 3CC4S 4RNFA 3HPOA 2C28A 3T6BA 1RTJB 3L7OA 4F3QA 2XEXA 5FLXU 3BBBA 2W8KA 2UXCF 1HQEA 2DPIA 1VISA 4ED4A 4EU0A 1JIHA 1N5QA 2GIRA 4NZ6A 5EHHA 5DS7A 4FVCA 1R8PA 1FX4A 4WFZA 1FJ7A 4ZVGA 2FVQA 1UA1A 1HQUB 1IKWA 5LXRA 2CKWA 5E3AA 1GT8A 2ACMA 3RRGA 2WONA 1C1CB 2F9JA 1KQGB 4C4WA 4I6YA 2B4OA 4P75A 3LO3A 2FGCA 1HD0A 1S1WA 3OFEA 5GAGU 3D1QA 3P4UB 4J9VA 4LF7F 5GMEA 4G3IA 2K1RA 3DRSB 2M70A 4OYXA 1FWLA 3ISNC 2MLZA 1HFEL 4W92B 3HHLA 3IM8A 2KN4A 4KGZB 3SCKE 3TUIC 4KT0C 1KRPA 1TK8A 2OO4A 1Q5YA 1JLQA 4LFBF 2LP4A 2W1BA 3C16A 2E5HA 4WE1A 3TUJC 3RR8A 2UUWA 1W25A 4CO5A 1VQ5S 3BJYA 3J80U 4WK1A 2XSJA 2I6WA 5HVHA 4P74A 4IG0B 5F8MA 3HK2A 1NJXA 3BR9A 1KVIA 1VQSA 4P7VA 1KS2A 2B4UA 2UV8G 1TK0A 2DR9A 2WRMA 3ITHB 4P7TA 3CIMA 3DLGA 1E6YB 5DDOC 4DSFA 3BGRB 2FHJA 3JSYA 4X4PA 4ECVA 2IRUA 4N7TA 2Y3YA 3VQTA 2IVFB 2MDAA 4N8NA 2VQEJ 4FBUA 2CYYA 3UD4P 2FJWA 4OX8A 1H98A 2X1GA 1X4DA 1U26A 3QPIA 1S9GB 2E66A 1S5ZA 1V9OA 4I6AA 1HNXF 1HQ2A 2APOA 4AL7A 2YWKA 1CC7A 1XMOF 1NDLA 4PQUB 2I2YA 2XS2A 4OHZA 4USVA 2WB4A 1V5IB 1TAQA 3DLEA 4ICLB 2JFKA 4WWSA 4NLRA 2AHOB 5K5MA 3C46A 2IJNA 1QVGR 5C24A 4CLWA 5C25A 2R7WA 1BWVA 2ZDOA 4ECYA 5L38A 7FDRA 1RWKB 4TU8A 4ZVRB 4FDFA 2Q1LA 2IJRA 2KRBA 1KLNA 1R0AA 3R3TA 2AT1B 2LU2A 4K50A 3CC2S 5IV3A 3EDRB 2OEKA 3PYDA 1X4BA 2BRLA 1M5PC 2B6AA 3D6MB 4LUBA 4C8KA 3LALA 3OR1B 3RUBL 2HFVA 2XYHB 1QDUB 1SC3B 1OWXA 1F1BB 4XDDA 4M5IA 3M32B 3QIPA 3DM2A 2D3O1 2MZJA 4OJGA 3BDPA 2CQ1A 4KKOB 3DN9A 3KYLA 2FJXA 4C9DA 3SQOP 2R8IA 1NSQA 1FJCA 4HACB 5KFPA 2DISA 3CE8A 3CJRA 4PPZA 2BE2A 2KFYA 4O4GB 3W1YC 4LMZA 3GJRB 5HN0A 1S9EA 3MMAB 4DR4J 1QVFR 3KKFA 1RTDB 3TEGA 4M5DB 1HPZA 1VQOS 3BR8A 3QGPA 1YITS 4F4XA 2CJXB 1LWFA 4X4OA 5D0GA 3TI0A 1FD2A 2X1AA 2KXFA 4QIFA 5KT5A 2EFNA 1RT6B 1PJ6A 2MEWA 2HHXA 1YK9A 4L3NA 2NXNA 3EPGA 3SV4A 2V8GA 2C2NA 2ZFHA 4HT7A 2E5GA 2YKMA 1P6TA 5J2NB 1HI0P 3O44A 1BQMA 4C2MA 4PWUA 3EUNA 2HVEA 4N41A 5J1EA 3CCTA 4K4YA 1WHYA 4QWEA 2NZCA 3BO3A 1SJ3P 2W9BA 3QMQA 4KGXB 2GCFA 1RUSA 5DDPC 3P3DA 2GHWA 2GGPA 4LT6A 1T9VA 4UOHA 3I0SB 2B3TB 1IBLF 4YHHJ 3P5TL 1U0SA 3AQOA 1NJZA 5D0EA 1RQ0A 3VWSA 3KK3A 4M63A 1YJUA 3R27A 3JB9k 3RGIA 2HURA 1D1UA 1RBOB 4DQSA 4V1Ak 3N5FA 3NMRA 2DR5A 4OI0A 4CDIA 2ROEA 2PMZD 1CEZA 2I5JB 4Q7AA 3PO5A 2QMXA 2G0JA 1B3TA 2A6MA 3O5TB 3CVKA 1DTTA 4NYPA 4ILLA 5DG9A 1N5VA 5I42B 2LQ5A 3UI3A 3KUEA 4K0KF 2OPRB 3J7Z5 5AE2A 4YY3J 4PPDA 2QT7A 4FKXA 3JTOA 2D3ZA 4Y28C 3OTDA 4M5NA 2I0XA 4YB5A 2N4CA 2QFIA 2JDJA 3I55S 4ETZA 4P72A 5B0CA 1MW7A 1Y3KA 4QR0A 2DHHA 1YWXA 2FJEB 2LQBA 5E3PA 3BKTA 3LF0A 1RAOA 2CJBA 1TMJA 3OUYB 1HNZF 3QQCD 4DV1J 1M90T 1NB7A 4B3RF 3ZFVA 3JSMB 1RAAB 5C42A 5B0AA 2R7RA 4RW8A 1U1LA 2ZUAA 3H8YA 1LFPA 3K58A 4X65J 3N5BA 5IQ6A 2B9XA 3IP0A 4L74A 2DRDA 1WC3A 3FBCA 3MM8A 4FNHA 4M1KA 1KDNA 2Y0BB 1ZZFA 1H72C 2Q3PA 1X4EA 2IM0A 1Y7PA 1S6OA 2C42A 2BDPA 2G2ZA 2ROGA 1RLDA 1XC9A 1YSJA 4NLPA 4UOGA 4ATNA 2KG0A 3GPAA 4RZRA 3NCRA 3IAM9 3OT9A 2ZBIA 4NLOA 2ZNYA 5LXYA 1KOHA 2B56A 1IBCB 2R8HA 2KHCA 1NO8A 2O66A 3M1VA 3TUPA 3JSRA 1RISA 1A0OB 3S7RA 2UUBJ 1RABB 1C0UA 1U47A 3EGZA 4O3PA 4ED7A 2HWIA 2WSFC 2DNKA 2ZWPA 4B3MF 5F9LA 5CXTA 3MPDA 2QSFA 2IHR1 3OVAA 2OTJS 5J1PA 3P45B 2VG5A 1BXNA 5ETQA 2JEFA 2IA6A 3IXQA 4DFPA 1DQAA 3RBZA 2ZBQA 2E5LF 3M30B 4OLPA 1JLGA 1AZSA 2CJAA 3NAIA 2HQCA 3TANA 1RTZA 4OL8A 2HLUA 4Y2CA 4BWMA 2OI2A 2XWYA 1LQ9A 1RK8A 4ED6A 1TVRB 5HJXA 3G9CA 3NGTA 3LH2S 2G1HA 2YNGB 5CCLA 1XR5A 5HJYA 2MMYA 3BN7A 4ZPBA 4TY8B 3QT7A 1UZDA 4JI1J 1KLMB 2J9CA 2HBRB 2BM1A 2ZM6F 1SC1B 4C98A 3CDUA 2N82B 3LGHA 3L4BC 2VD3A 4I6WA 3W2WA 3JTNA 3QIDA 4OMFG 3LP2A 4K4WA 3I5BA 2IDLA 1AT1B 2WVEA 2OAUA 2WCXA 4M5GA 2N3LA 2Y1RI 1VHIA 1Z2ZA 1RWMB 3KMQA 2DJWA 2MQOA 2FGOA 3Q83A 5KFUA 4DUZJ 2VG6B 1TL7B 4R5PB 2QJ3A 1Q7LB 2QRRA 5E33A 3BSNA 3RU0A 2CAJA 4ZP9A 4ED5A 2UUCJ 4TN2A 5A8WB 4DZDA 1N0VC 2K7KA 3PV8A 3KLHB 4ILRA 2CPYA 4IOAQ 1ITPA 4UY8T 2CDRB 3WZ0A 3H4DA 2JEJA 3FMBA 5IT9Y 2RB7A 4LSLA 2ZBRA 2EBGA 1RA6A 1P27B 4CNYA 2KXNB 3DI6B 3PW0A 3CCES 3JAMY 1U24A 3M2RA 4CIOA 5A6PA 1UA0A 3MD1A 2O5DA 4B9MA 4K2XA 4QBUA 3DLLQ 2PFDA 3P5BP 2E29A 3NLCA 1PAUB 3D7SB 1RTJA 1T94A 1RT7B 4K5SA 1XR6A 2KT3A 4DV6F 4NXNJ 5ETMA 1FXDA 1UTAA 4I69A 2GFFA 2VDHA 4PRFA 3P6YC 1H2TZ 1TV6B 4G1PA 3MXHP 1BE4A 1VI7A 1UJ5A 3T5LA 2V34A 3CCRS 1FKAF 4LBIA 2V8HA 5KG2A 3LW5C 2WW4A 2L9DA 2C22A 4F8RA 4RWWA 4RBUA 1TL5A 1FVSA 2UVWA 2UXBJ 5E2QA 3NNCA 2UXDJ 5IQQA 2IDEA 3PX6A 2HKEA 3OL7A 5FLXY 5KTQA 2OTLS 1J27A 1OQ6A 2WBRA 5CH7B 3WC2A 4NCAA 2X1FA 3MM6B 5GVQA 1GX5A 3DRSA 5HP1B 2HW3A 2VQEF 1RKIA 1RBLA 1OMSA 5U47A 3OTOJ 1RP5A 4ECTA 4Q2MA 3ZZOA 2NXCA 3Q8YA 2QTWA 3I96A 3CO0P 3SYZA 4DPTA 5I3UA 1ZOTA 5B0BA 5KFGA 3SZ2A 1NZ8A 4IG0A 4O3NA 4WCEQ 3SMZA 2MQPA 3M8RA 3C2PA 3UVJB 4DUYJ 3FQKA 3GSIA 3ZZ0A 3IGVA 3ILOA 4Q2LA 1UJ4A 1E6YA 2A3JA 5DM6Q 3G82B 4WXWA 4YDXA 3RB6A 1UW4A 2VUGA 4RPFA 3RB3A 3J80Y 5LL6d 1F3VA 3A1YG 3NXZA 2GA7A 1LK5A 4Q8EA 3FBEA 3MDFA 2FJVA 2ZOGA 1GXTA 1S9GA 2XZTB 4LSZB 1WD6A 5ITHA 3V6HA 4AUKA 4OX7A 2CDQA 1N34J 3UO0A 1RWOB 2XCAA 4E2FB 3MM5A 4F36A 2LECA 1TUWA 2HHVA 2XGPA 1J5OB 4PQUA 2QYCA 1KOOA 3KJQB 3T5JA 4ICLA 2VG7B 3M6WA 2HVZA 2MYFA 1MWZA 1SC6A 2H54B 4UQGA 3QT5A 3TJ8A 2DH8A 5D78A 4I7FA 2VL1A 1EJ7L 3DOKA 2VODA 5KFDA 3N6LA 2XMJA 3H7HB 5IWAJ 4U6PA 4DCPB 2D3UA 1WC0A 1N4LA 4K4ZA 2GAGC 3TWZA 4DR4F 4LQ3A 2JFDA 3IMQJ 1SI9A 1S1UB 3CJ3A 4HDGA 2V68A 2MGZB 2B9WA 3C6UB 1M1HA 1XERA 1WC1A 3I4HX 2R8KA 2WBMA 4J9NA 3M32A 1GFWB 1WOOA 3W65A 3MUMP 4KKOA 1WORA 2ZDPA 4KFBB 1G4CA 3QAUA 4Q44A 1HWJA 4A8OA 2DHSA 4QIWD 2EI5A 4HACA 2JJ4D 3W5YA 2J9EA 2NXEA 2BR0A 1HYSA 3OHBA 1WELA 3V81B 4B02A 5JVGQ 1FEEA 3WBZA 2DGOA 3CJ4A 2PIIA 5J2PB 3MMAA 2VF3A 4K4VA 2DYAA 5GAEU 4F2SA 2FY8A 2HS3A 1JXLA 4LFCJ 2FHKA 4M5DA 2R7SA 1HNIA 5HROA 4XDCA 1S1VA 1FESA 1SPBP 4ELVA 1K0TA 4TKTA 1F0XA 1DURA 2FDNA 1HBNB 4I4BA 1P1TA 2QMUB 2O3DA 4KH0B 5H9EK 3B8HA 4OZNA 2VC1A 2QX0A 3QWPA 1JK9B 4YHHF 4FXWA 4U9RA 1RT6A 2KZMA 2RU9A 4QIVA 3DOMB 1T7PA 4ER8A 2VKRA 1XNRJ 4CM0A 2W24A 1FEHA 1RLCL 4DPUA 3OR2A 3RAMA 4H4MA 4URQU 2GJFA 2GVZB 5J2NA 1EETA 2CVIA 3VV2B 3Q2SC 2IC3A 4NI2B 4A4JA 5DQIA 3TA2A 4X66J 3D9BA 3KLIB 1GMWA 2W7AA 5DGAA 2GO8A 3MEEB 1M1GA 4ZJOA 1MSWD 2HBQB 1RTIB 3D1OA 4Z2XA 1SV5B 1C4AA 3TR5A 4RUHA 4WP9A 5KFWA 3AB2B 3VAKA 3G6VA 2IYGA 2AGPA 4YY3F 4XK8C 2HG4A 1P9YA 1ZYQA 2ZD1A 3WIUA 3I9V9 3I0SA 4URGA 3OV7A 4WK3A 1FRLA 2GNKA 3JYTB 2Y0SD 1M5HA 1JB0C 1UKUA 2F8MA 1JLBA 2VV5A 4K2JA 1CJKB 3CMAS 4JI2J 5K8NA 4DV1F 3TW0A 4ECZA 3SBMA 2DGUA 2EKNA 2RUGA 2FHOB 1S6PA 1NPKA 4Q5VA 1RCOB 3HVTB 1IKVB 3TARA 1OYDA 3KJFB 5F41A 2I5JA 4C11A 3KLEB 3UD5A 2KM8C 4V19X 4A8WA 1I6JA 4X65F 1KWMA 5FDLB 3OTCA 3B4DA 5I42A 1HKAA 5DQGA 2L3MA 1R8HA 3ISND 5EWEA 5ADZA 2OPRA 3R97A 3ZZTA 1PGZA 1VK8A 2QN6B 1JWWA 3B6BA 3KXDA 3OXFA 4CLTA 3MGJA 4NEZA 1HL6A 3HM9A 3M8QB 2BZ2A 4FF1A 1QE1B 4OHXA 1UETA 3I6PA 1MN9A 3OUYA 5JUMA 5DLGA 2XB2D 1MNEA 5M2PA 3JSMA 3K5PA 4NL5A 3PZPA 2B51A 4IG3B 2OEJA 2HRUA 2QA4G 1H73A 2HZVA 2GAHC 2UUBF 2V50A 1XMQJ 5GAGI 1CG2A 1SKRA 2JX2A 3TAPA 3ZTQA 2HWHA 5IV4A 3ZZYA 4NYZA 2KI2A 1LWCB 5EX0A 3HD1A 1DTQA 2MPUA 2DNHA 3AHPA 4DV5J 3R2CJ 1A7GE 2R8JA 1TKZA 4GO7X 2PD1A 1S99A 1UVJA 5LMUJ 2C3MA 5F8JA 1R8CA 3MM7B 3TX8A 4C3MA 3FRZA 1IBKJ 3ISZA 4OYWA 3EGVA 2FZCB 1TL1B 1HMVB 3BQ2A 4ES3A 3C14B 4DG1B 4I2QB 4MIAA 3K57A 4FYDA 1Y3JA 3HD2A 3I32A 5KG1A 3UCZP 1SXLA 2M7SA 1NHKL 2W9CB 2W7OA 1VQ7S 2HMIA 2C3YA 1NU4A 5A6WA 4OJ1A 2E1PA 2OH2A 3EM1A 4ZPAA 4NE9C 2NSCA 4JI1F 2OJ3A 2RQCA 2QMWA 3H5UA 1GEHA 1JXVA 5GADU 3D4JA 4OYZA 4JP8A 3IBFB 1AB8A 2V5HG 2DB1A 3QRQA 2LVWA 2RMLA 3VGUA 2ZJPQ 1WKLA 3BQ0A 3LGMA 2WB1D 5F0UA 4WFBQ 2QO3A 1HD1A 3MPYA 4DL6A 4KRWA 1NRKA 3X1LB 1FDAA 3KLVA 1WC4A 5KT2A 2H4WB 4DUZF 3FSYA 3OHAA 3ZTRA 3CJ8A 1N54B 3GFHA 1ZM4A 2CQIA 3VVTA 5H1SV 1TVRA 4EMDA 4DQQA 2H5EA 1PJ7A 3BGFA 3RRKA 3D67A 3TZYA 3RR7A 4B9VA 2UUCF 1K44A 4DQIA 3OL9A 2XMVA 5LMNJ 4OI6A 4ECXA 1RYRA 1FF2A 5CA5A 4DL5A 1NJIT 3CDWA 4CLKA 1Z1ZA 2RE1A 2DITA 2DIVA 4IFVB 4ZHRB 3NEKA 1JNZB 3Q86A 4PXCA 3VALA 3BKFA 1V3SA 3UNYA 4ECQA 4LF5J 2DNMA 2J8AA 1AFIA 3KUHA 2CPDA 3SCJE 3DDNA 2VG6A 1UW9A 4WBFA 2QFJA 4NXNF 4GVLA 1YG0A 4R5PA 3B54A 3BKUA 5BXIA 2B8QA 2CFXA 4PXEA 4YS2A 5A8WA 3C8YA 3NGRA 2OPQA 4F4YA 3KLHA 2AQ4A 4AL5A 5ETLA 3H2UB 4P2MA 3LWMA 4OHWA 2UXBF 3OJSA 3PFOA 2UXDF 1IXKA 2C3OA 2ZH3A 1T03B 1O0PA 2HK2A 3QRRA 1APSA 4NLDA 2PC6A 4J91A 3W64A 2D1CA 2GQ2A 2OLWA 2VBWA 2RRNA 3TRGA 3BYRA 2YQ3A 4OYOA 2P9EA 1QTMA 1X8DA 2AU0A 4CRJA 1ZPWX 2EFGA 4OX6A 1U45A 1W2BR 4M5HA 1PO6A 2LMIA 2GMHA 2XULA 3LTOA 2WW8A 3F0NA 3MHYA 3OTOF 3M7VA 4IRCA 3AOBA 2ASYA 1VQNS 2CQBA 3GFYA 2Z30B 2UP1A 3PNIA 3Q8RB 5EN1A 4ANDA 1IM6A 4MMOA 1OY8A 1SJ4P 2DIUA 2LYVA 2QLWA 4IH6A 5LM7E 2C2KB 1NMEB 4DUYF 2BX6A 1T05B 3B4MA 2EG1A 1RWNB 3UWTA 2DBBA 1WNEA 5A0YB 3MM6A 4O44B 3KHLA 1SBRA 1TKDA 1D09B 2D9PA 4KC5A 1FRMA 5L1JA 2P5VA 1N56A 4OJ3A 3BEGB 2VKZG 3HO1A 5A8RB 1UVNA 3TA0A 1HBMA 3OW2R 5IM0A 1Q16B 3BV8A 2FC9A 2XLKA 3BS9A 1VC0A 5KFQA 4DX5A 1PKUA 2K3IA 3TEHB 1N34F 4EEYA 4HEA9 4PXDA 1HBUA 3N28A 3D0GE 3IAS9 3KG0A 2DGQA 1RGVA 4C48A 1VRQC 2P6TA 3CCUS 2HVHA 3ZTPA 3R5AA 4YEAA 3MUTP 1F9EB 2C2OB 2WZ1A 1X9SA 1PAEX 2IAJB 3G82A 3A3OB 2YNFB 3OPKA 1Q5VA 1WHWA 4C8YA 3J7YU 2N4DA 3CDBA 1SC4B 4K4XA 2OELA 5IWAF 2BANA 2XSFA 2R2RA 4LRFA 2HWTA 2V4JB 1FWPA 4IRDA 3K17A 3MEGB 3MFHA 1CLFA 3FBBA 3L95X 1FD8A 5FIIA 3NRBA 3NS5A 2V6AA 1J2VA 1S57A 1RWWB 4USIA 1H0HB 1YRTA 1J5OA 2VFVA 1HWIA 3S1TA 2W8LA 1RBAA 4RO0A 4OYAA 2ZNZA 1S9FA 2MKKA 4TQSA 4UQTA 2VB6A 4MK9A 4C97A 4AYBD 5LSRA 2V94A 2R7UA 2L08A 1OY9A 2RD5C 1Q8LA 4CH7A 1KR4A 1RWUA 1KFSA 2AP6A 2BKNA 4LFCF 5KFRA 2CVEA 4NLGA 2MKYA 1S0NA 3IWXA 2R2SA 1S1UA 3PW7A 4PR6A 2XHCA 4C3LA 1VOMA 2DGXA 3C6UA 4IDKA 5A76A 2WTFA 4NLSA 1SL2A 4OYMA 1NHVA 3LPEA 4X2BA 1XNRF 3K2YA 3H90A 4OI1A 4MFBB 3G6ES 3EGNA 3T1AA 3V2UC 3UQSA 1VBZA 1FFSB 3K59A 1NPPA 3TAMB 1BUXA 2LXFA 4X66F 4TQRA 1Q53A 1URRA 2Z4PA 4F0MA 1Z4UA 1K9MT 1FRHA 1XIQA 2V69A 2GV1A 3PM9A 3P49B 4HT5A 1UPPA 3C3LA 4FZVA 5B0GA 1QAIA 1REVB 3G6XA 1HBNA 1OO0B 2RDJA 3N01A 4FKYA 1SL0A 1UJ6A 4D3GA 3QZ7A 5ETTA 3DOMA 2CQ3A 2OFGX 2CA9A 3WQPA 2RF2B 4ZIVA 2MZSA 4JI2F 3VGTA 4AXIA 3Q8VA 3MEDA 4NA1A 5B0FA 4UZBA 3FCVA 1UWBB 3LPYA 3IG1B 2DGVA 5DRKA 4E8UA 4DPYA 4HTIA 2DY1A 1XN9A 1VDHA 3L9ZA 5DZ7A 3NBPA 1I94J 1I5OB 2LDIA 1ZPVA 5HMZA 2A18A 3DRPB 1V5VA 2IM2A 4P2XA 3BYPA 1X31C 4PYAA 1EHWA 2W2OP 3VAGA 3J7ZT 1D9FA 3HFZB 2XMMA 5HATA 3O6QA 5HL7Q 4DV7J 3DOLA 1HHQA 4LBHA 4KO0B 1FCAA 1MG7A 3OFFA 4MYUA 4MAKA 2GX8A 4EYHB 2BM0A 3M8PA 4JV0A 3GJTB 1CSJA 1EAYC 3A8IA 5ETOA 2JZ5A 1BQXA 3MTKA 2VH7A 5DDQC 2RHSB 1XMQF 4P2FA 2YX1A 1F2GA 1PILA 4DL0C 5FDLA 2MJUA 2F4FA 4L73A 3QJPA 1SL1A 3M2VB 3OVBA 2LCWA 1SJFA 1FRIA 3EZOA 4CP5A 3V5RA 2HNZB 1UPMB 5KFBA 2Q79A 5ETPA 4DV5F 4AXJA 5JJBA 5LMUF 3FCHA 4LRBA 1U25A 2HS4A 4O3RA 2BV3A 3M8QA 3ILJA 2ZBCA 1QE1A 4DDFA 1TAUA 2XS7A 4JV5J 1IBKF 1O51A 2HYIB 4EK2A 3ZZRA 1VIOA 1JX4A 2HQIA 2MZQA 3PKYA 1LKZA 1GXUA 4J9KA 3Q8SB 1RAIB 2L9WA 4WYLA 1U4BA 1D9DA 2EK6A 4IG3A 1IJFB 3HLUA 3E51A 3MECB 2U2FA 2CPHA 1SUQB 1IWAA 1S76D 1W7WA 1WTFA 1GTHA 4LF1A 3PIPQ 1HLWA 4DLEA 4CZCA 3CDEA 2FLOA 2QIFA 4MKBA 1LWCA 1FKOB 2DO4A 1JXEA 2YWGA 4CLSA 5T7LB 1OPIA 4N8OA 4DSJA 1B0TA 2A1BA 3MM7A 1FO1A 1VCTA 2BEFA 2BQRA 2MHNA 3L3CA 2M5YA 5GAHI 4HYKA 1PYSB 2DCLA 4Q45A 1TL1A 1HMVA 3I4PA 3PX4A 2IFXA 3C14A 5G4DA 4TLRA 4DG1A 3R5CA 4I2QA 2VOPA 4ZVQB 4AL6A 3G96A 2PEHA 4LREA 2DHAA 5K9FA 3DU5A 1VBXA 3MR5A 1T95A 4QYZK 2W9CA 2V4QA 2H5IB 5LMNF 4FPRA 2FZKB 3P96A 3F44A 4NLWA 2GMJA 4CTAB 2J0QD 4NPOA 5KOXA 4LVNP 1B7YB 4JI7J 1KP6A 4KJIA 4LF8J 4ZJQA 2AJ4A 2HQFA 1RXOB 4TY9A 2DRAA 1HHTP 3GG1A 2UVUA 4C8MA 1Q86T 3VAMA 3OSNA 4QJVA 3R6LB 4TYBA 2XYPB 4DPWA 3U1MA 5HMWA 4LF5F 4PAAA 2YPYA 4O4RA 3PJXA 1U49A 3NGUA 4A8YA 1VRUA 1R6YA 3OFHA 4RL1A 3GYGA 4ZA1A 1YJRA 2HNDB 5E5NA 2HQDA 3RYLA 2BACA 2JEGA 4DR5J 4EZ9A 3TVKA 2ZH4A 3LA0A 2HQ3A 3W2VA 2FJDB 3KWMA 4KHRA 3CC7S 1HWUA 2C2DA 3KOAA 2O67A 1CJVB 2PT0A 2KU7A 1IKXA 1VC6A 2AEJA 2HGLA 5HQLA 1MROA 1CS4A 4KH1B 2YX7A 3KNAA 2B4PA 4QOTA 3I5AA 4QYRA 1S77D 1XQIA 3CT9A 4I67A 2XG8A 2HNYB 4JI3J 1KBRA 4PWDB 1Y10A 2DH7A 3RBDA 4YB6A 3OL6A 2OPSB 1HWKA 4L75A 5HANA 1GH8A 1R8AA 1AFJA 3FC9A 3NNAA 4RLEA 5JVHQ 3F56A 5BYSA 4B9NA 5AXMA 1VRTB 1T9TA 4NASA 3PDNA 1WDDA 1G3OA 5CYQB 1TFWA 1NK6A 2Z2YB 5L1KA 4BBYA 1R3NA 1LOUA 2N7YA 3M9NB 1S1XB 1T03A 4F2RA 3J7AN 4QU7A 3CIZA 2H3EB 3FQLA 2RKIB 1C1BA 3O1LA 4I0WA 1JMTA 2QGFB 2AYEA 3ADAC 1SQEA 2DR6A 1E6VB 2J76E 2DXEA 4WKRA 2CZ9A 4F4AA 2E1RA 2VDIA 1ZAWA 2MKSA 4E98A 1N88A 1ZAXA 1UVLA 1JKHB 2YY3A 3PEJA 1RZMA 4OZ1A 1KEKA 4NZ7A 2WSEC 1FXRA 3UCUP 4HHHA 4ID5A 5ETKA 3SDEB 4B9UA 1HBOB 3K0JA 1BD6A 4FXDA 2MLXA 2HHWA 2F1FA 2KM8B 5D3GB 3K8VA 3GSDA 2KXHA 1NKBA 1I51B 3UN3A 3DNCA 2QA2A 4YUDA 1EKRA 3DLKB 2JH3A 4ILMA 2G2YA 5A0YA 1NSKL 1CJUA 4O44A 5KG4A 4O0IA 1CJTB 3KJVB 4WJBA 3CCMS 2LEBA 5L1IA 4L72B 4K59A 1LXNA 2KVQE 3LP1A 1ZH5A 1V3RA 3H2LA 1DQ8A 1T0TV 2P9CA 1KTQA 4N77A 1YRXA 4X4QA 2IY5B 3GQCA 3A8JA 1OSDA 2UVRA 3E01B 5I3QA 2DNPA 5CABA 2J9DA 2BE7D 2EWHA 4OYBA 5F9NA 2HHHJ 2NCKL 1W2IA 3S01A 3M05A 2JC0A 3VF0B 2Y1IA 4PUOB 1HI1A 4JBCA 1UEUA 1B4SA 3CO9A 1DBDA 4RUAA 3NMAA 1QUVA 3T19A 3AD7C 1JLAA 5EDWA 1RHRB 3ZTOA 2ZHOA 2GJ2A 5DLFA 2IAJA 4W90B 2UU9J 1BHNA 1RT2B 1WKJA 2MSSA 2YNFA 4C0BA 1RT3B 5ETNA 3LOUA 2Z2LA 2B9YA 2XZDB 4IH7A 4KE5A 2R7TA 4USUA 2IA0A 1LW0B 1X4AA 1T9YA 2ERRA 4Y3CA 4FS1A
chains in the Genus database with same CATH topology
1R8BA 3CPWR 4LF4F 1IBMF 2MB0B 1S97A 3EXYA 1EP4A 1FVQA 1WWHA 5J2QA 2HVZA 2FLPA 3RB4A 3D54A 2MYFA 1MWZA 1SC6A 4ZMMA 2VBXA 4UQGA 2V4JA 2WOMA 3MMJA 1X9WA 4RW7A 1X5SA 2DH8A 4IO1A 4ZCLA 2UUTA 5CZVA 5D78A 1DLOA 4I7FA 2VL1A 4C0OC 4GKJF 4NLQA 1B64A 3W3SA 3DOKA 4OV1A 3MEGA 3CJKB 4DQRA 2VODA 2XBPA 1B0VA 3LGNA 2KT2A 4WU3A 3QIPB 5KFDA 2XY7A 3DM2B 1AROP 4M94A 3N6LA 4RKUC 3NAHA 2XMJA 3FGVA 4FVMA 1S79A 2ZH7A 3GIMA 4U6PA 3B82A 5G0RA 2D3UA 1UFLA 1N4LA 3QYYA 3NGKA 1JNRB 1VC5A 4K4ZA 1NZAA 3BSOA 2LQ9A 4LQ3A 4DR4F 2DK2A 5BJRA 2JFDA 2B7BB 3IA0A 2DD8S 2BE2B 4MH8A 1SI9A 1ROFA 2NUUG 3GIKA 1WF2A 3M4XA 1RTHA 4QWBA 1S1UB 3CCLS 2KTQA 5L8RC 3IR5B 3CJ3A 1M5OC 4DV4F 3KMSA 4HDGA 4XPEA 1LXJA 4WFXA 2HNYA 3DMJA 4CH0S 4O3SA 1DTQB 4ES1A 2MKIA 3UW1A 4F25A 3CCWA 2KYXA 3KK2B 1S9EB 3DI6A 1OPZA 2B9WA 2MGZB 4RNMA 1NK8A 4J9QA 1TKZB 3K5LA 3C6UB 3F41A 1XWLA 1CC8A 4DBQA 4WFYA 1XERA 4CO3A 2J6UA 4X84A 2HFOA 2NXUA 4AFFA 3I4HX 2R8KA 2OPSA 2WBMA 1HPZB 2HHPA 2U1AA 1QAJA 3IR7B 3M2UB 5F0WA 4J9NA 1Y4ZB 1DRZA 1S1TA 3M32A 4M95A 2AF6A 3FZBA 1X9MA 4Q43A 2ZH9A 1VQPS 2KT5A 2VPXB 1WI8A 4JI0F 3MUMP 3LAMA 1V6HA 4KKOA 4KTQA 3KK1B 4E0DA 2ZDPA 1LWFB 4KFBB 3QAUA 1FDDA 2PN6A 3MAHA 1RT7A 1HWJA 4Y2IA 5CHCB 4Q44A 1IKYB 4A8OA 2DHSA 5KG5A 3EX7B 3KNGA 4QIWD 2EI5A 4GC6A 5FJ4A 4HH0A 1LFWA 2JJ4D 3PACA 5DDRC 2PFFB 3Q8PB 2J9EA 1IM4A 3D1HA 5E3QA 1SB6A 1GXLA 2BR0A 1HYSA 5A2QY 3OHBA 1NNDA 3V81B 1WELA 1XTZA 2Q43A 2W7PA 4B08A 5CYQA 4B02A 5JVGQ 1FEEA 1TV6A 1Q8BA 3WBZA 4R8UB 4IFYA 2DGOA 3CJ4A 2PIIA 4J37A 3SQGB 2DR8A 5J2PB 3N6MA 2NPFA 3AB4B 3MMAA 4K4VA 5GAEU 4F2SA 1MU2B 2HS3A 2YKMB 1JXLA 2FHKA 3FZ2A 2HMIB 2QZ8A 3QLHB 3CJ0A 2XY5A 4M5DA 1H6KX 1HNIA 2R7SA 2BYCA 2ZITA 5HROA 4H4KC 2FHMA 3CD7A 4XDCA 1S1VA 1FESA 5KFKA 1Q78A 3R5DA 2ROPA 4ELVA 1K0TA 2I1RA 2LLZA 4TKTA 1F0XA 3U7JA 1DURA 4IH5A 2FDNA 1HBNB 4I4BA 4QW8A 1P1TA 2LXIA 2O3DA 4X4UA 1BLUA