1N6QB

Hiv-1 reverse transcriptase crosslinked to pre-translocation aztmp-terminated dna (complex n)
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
429
structure length
429
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of HIV-1 Reverse Transcriptase with Pre- and Post-translocation AZTMP-terminated DNA
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/immune system/dna
molecule keywords 5'-D(*AP*T*GP*CP*AP*TP*GP*GP*CP*GP*CP*CP*CP*GP*AP*AP*CP*AP*G
total genus 100
structure length 429
sequence length 429
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2002-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1n6qB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1n6qB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1n6qB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1n6qB03
3MFIA 5K14A 3QIPA 3CDWA 5KG5A 5I42B 1HYSB 1JLGB 4IR9A 2E9RX 2FVQA 3GQCA 5KT5A 3Q8RB 4RNOA 3KK1B 1VRTA 4K4SA 4O3SA 1K1QA 4ECZA 1T05B 3H5YA 3BGRA 2BE2B 3FQKA 4WZQA 4EBEA 2YNGA 4NLUA 4MKBA 5C24B 3HHKA 2AX0A 1MU2A 3D5MA 3C6TB 1C1BB 3D28A 1RA6A 4ZP7A 4ED3A 1EP4B 4KV8A 4NLXA 1FK9A 3CJ0A 3QO9A 3BSCA 1IKWA 4HKQA 4QW9A 3GIIA 4EO6A 1N4LA 3G6VA 1SH3A 1VRUB 1RT2B 2FVRA 4Q8EA 2RDJA 5F9NA 1HQUB 3H4BA 3M8PA 3HKWA 2YNIB 5KT7A 2FVPA 5KFIA 1LWFA 3I0RB 3CJ4A 1S10A 3RB0A 1J5OB 5KFRA 3ICLA 1QE1A 3DMJA 3C6TA 4J9KA 5I3UA 5D3GA 2XWYA 2BE2A 2GIQA 4IOBA 3MR6A 4NLPA 2IM3A 4K4TA 3MR5A 3HVWA 3PVXA 2GIRA 1W25A 3H59A 3KLVA 4NLYA 1KHWA 2VG6B 1ZTWA 1ZTTA 1JLEB 4RW4B 3LP1A 4O44A 3DLEA 2I1RA 5KFOA 3V4IA 1S1XB 3EPGA 2JC1A 4J9PA 1KHVA 4ID5B 2HNYB 4IG3B 3QIDA 1CSJA 5KFVA 3CJ5A 4MK8A 1N6QB 5F8MA 4LSNB 3BJYA 2DPIA 4MFBA 3GIMA 5C5JA 1SUQA 4U7CA 3BSOA 2WHOA 2C2EA 3DRRA 3OL7A 4WYLA 2VG5B 2WRMA 3N6NA 4J9NA 2VG6A 3KMQA 5K14B 1REVB 3MEEB 3KK3B 3KNAA 3QGIA 4H4MA 4NLDA 4XPCA 3G6XA 4ZPCA 3MEGA 4DL3A 4ECSA 2E9TA 3DM2B 4RU9A 4J9MA 2B5JA 4IG0A 4KHMA 4R8UA 1IKYA 2RKIB 4ZP9A 5DG8A 3IGNA 2BR0A 4URGA 4NCGB 2WOMB 4WYWA 3JSMA 4LQ9A 2VA2A 1KLMA 5HP1B 5KG7A 3NAIA 1BQNB 4RW8B 2OPSA 3GIJA 2FJVA 2B6AA 4IFVB 3H98A 4QW8A 4NLRA 4RNMA 2HAIA 4NLSA 4IKAA 4EBCA 3KLIB 2IBKA 3KLEB 1TKZA 1TQLA 2YKNA 5I42A 1S97A 1HNIA 3MEGB 5L9XA 4R5PB 4GC6A 1LWEA 1C0UB 2BRLA 1RYSA 4IH6A 2J6SA 2HWIA 5C24A 1S0MA 3PW0A 5J2QA 2W7PA 3H5XA 4M94A 1JLFB 2HWHA 4R8UB 4K4YA 2XCAA 4FS1A 3FRZA 1S9GB 2V0NA 1RT3B 4I2PB 2R8HA 5C25A 1S0OA 3CIZA 2HNDA 2BQUA 1SH2A 4G1QA 4QWEA 2BQ3A 2OPRA 1JKHA 4PUOB 4RNNA 2XGQA 3BQ1A 5EUHA 1LW0B 1QUVA 1RTHA 2XI3A 4M95A 4MK7A 1S4FA 1JLAB 1S6PB 2D3ZA 1S1VA 3GILA 5HLFB 2J6TA 4Q45A 4KFBA 2R2SA 4K4WA 4WE1B 1QE1B 1RTJB 4I2QA 3E01B 3RBDA 1N56A 3V6DA 3KLGB 3UPFA 2BQRA 4RZRA 1C1CA 1RT1B 2W9CA 1IKXA 4KB7A 5EWFA 1TKXB 4JV0A 4K50A 1BQNA 3IN5A 4ZHRB 1NNDA 4RUCA 3BREA 4KAIA 4F4YA 3LP0B 5L1KA 3PW4A 5KT6A 2YNFA 1QAIA 3V6KA 1S1WA 4LQ3A 1RTHB 4NLQA 4EYIB 3NMAA 2YKNB 2RF2A 4TN2A 2IM1A 5JXSA 1MMLA 3DDKA 2F8EX 5DQHA 3KLHB 3KK1A 1C0TA 2ZKUA 3QGHA 3EPIA 4HYKA 1WNEA 1FKOA 3FDSA 1S1TA 3LALA 3G86A 3LP1B 4O44B 2ZD1A 5KFDA 5KFFA 1IKWB 1TKTB 3H5UA 1R0AB 4F4WA 2YKMB 1N48A 4ECRA 1KLMB 2VG5A 1RT2A 3PZPA 3DRRB 1JLBA 1U09A 1XR6A 4MKAA 3OL9A 4KO0B 1TV6B 2IC3A 4IFYA 3QO9B 4ED7A 3I0SB 2D7SA 1TVRB 5CYQA 4ZPAA 5KT3A 1JXLA 1S9EA 1IKVA 1VRUA 2JLEA 1I6JA 5HLFA 3H4DA 3CJ3A 2IAJB 2WONB 1RAJA 3N6MA 4TQSA 3OHAA 4H54A 2JEGA 4NLWA 2ZD1B 4MK9A 1D1UA 1RTDA 3DRPA 3V81B 4NLTA 2WCXA 3KLHA 1NHUA 4WFZA 3PR5B 3GV8B 2ZE2B 1RYRA 3M8QA 5KFPA 1FKPA 4RW6A 5FDLB 3KJVA 2ILZA 4RNFA 3PW7A 1GX5A 3C6UB 2XC9A 3CDEA 2I5JB 5J2PA 4ICLB 3KLFA 1HPZB 4J9OA 3MEDB 1JX4A 3JSMB 2XCPA 1JLCB 3DOKB 1QAJA 2UVVA 5KFQA 1T03A 5F8GA 5HBMA 3NBPB 4ECWA 1S0NA 1TKZB 2HMIB 3MECA 2D41A 1IKVB 1RT7B 3BQ2A 2JC0A 3TVKA 4NRUA 4ED6A 3I5AA 5F9LA 1RTIB 4ECYA 3I5CA 4ZMMA 3KLEA 2V9WA 2W9BA 4ZVHA 1Z4UA 5JUMA 4MFBB 4U6PA 5C42A 4I7FB 2IA6A 2WB4A 4YQWA 3Q8SB 4QWCA 3OLAA 4R0EA 4EEYA 2ASJA 5HBMB 4F4ZA 1SH0A 3DLGB 1N6QA 2AWZA 3SFUA 4F4XA 3T5JA 4H4OB 2C2RA 1S6QB 3DLKB 5KG0A 2R8KA 4IRDA 4J9RA 3NKYA 5KFTA 3BR9A 3LP0A 4K4VA 4RW9A 2XI2A 5DQIA 1TL1A 3DOLB 4JV2A 2CJQA 2R8GA 2W9BB 4X2BA 5KFWA 3NL0A 3I0RA 1RDRA 2HNZA 1NHVA 2OPQA 5L1IA 4NLOA 2YNHB 1C1CB 2FLPA 1T94A 4RW7B 4O3OA 5J1EA 4B3OB 4DEZA 3MR2A 2V4RA 4O4RA 3DLGA 4URQU 5KFZA 1FK9B 2AGOA 5KG2A 4NYZA 3MEDA 4TQRA 1S1UB 4IDKB 4NLVA 5KG1A 4IFYB 1S1WB 1TV6A 1BQMB 2YNFB 4XPEA 1K1SA 2OPSB 3NAHA 4TYAA 3UR0A 1LWFB 5KFMA 4G3IA 1N5YA 1T3NA 4NLGA 2UUTA 1J5OA 5T14A 5KFLA 5KFJA 4NRTA 4KBIA 4FS2A 4DL7A 2ALZA 5J2MB 1S1TB 4JV1A 4K4XA 1JLFA 3DI6B 1SV5B 3TAMA 3SI8A 3RAQA 4QWBA 4URSA 3FFIB 3LAMA 2R2RA 2IC3B 4IH5A 5L1LA 4KO0A 4ZVFA 2AQ4A 5F8JA 4KHRA 3M9OB 4ZVGA 2BANA 4IFVA 3LP2B 1DLOB 1YVFA 5J2MA 4PUOA 2D3UA 3OSPA 4ED2A 1JLGA 1HNVA 3CWJA 4J9SA 3H5SA 1N5YB 4IRCA 4ECXA 3DRPB 3V81A 4Q8FA 1LW2B 1HARA 2ZE2A 2AX1A 4O3NA 5EWEA 3V6JA 4K4UA 1IKYB 2RKIA 1EP4A 2VA3A 3DLEB 5KFYA 3MR3A 2ASDA 5DG7A 2YNGB 4MIBA 4QWDA 3QZ7A 1HMVA 2GC8A 1T03B 3Q8PB 2ASLA 3M9NB 2J6UA 2W7OA 2XGPA 4H4MB 3KK2B 4O4GB 2C2DA 1TL3B 2B6AB 2AGQA 2UVWA 3OSNA 5DQGA 3KOAA 3HVTB 5CYMA 3UDLA 3MEEA 3E51A 4I2QB 3QLHA 2FJXA 3G6YA 2OH2A 2VG7B 5DGAA 4IR1A 2WOMA 2QV6A 4NCGA 2B43A 2R2UA 1HMVB 4O3QA 1DTTB 3ITHA 3KHHA 3GV5B 2FLLA 1S48A 3IG1B 4PWDA 3T19A 3Q8QB 4I7FA 3RBEA 2WTFA 3BQ0A 4FBTA 4Q0BA 3M9MB 4EYHB 2WK4A 3HVTA 5CYMB 2W8LA 1BQMA 3PW2A 1TL3A 2QE5A 2IM2A 3QZ8A 1RT5B 4KFBB 1C0UA 4ZP6A 2OPPA 4ECUA 3ITHB 4ECTA 1C0TB 3E01A 2AGPA 2IJFA 5D3GB 3GYNA 5HROB 3FQLA 3RAXA 4F50A 2OPQB 3H40A 4IH7A 1RT3A 4I2PA 5KG6A 1S1UA 3TQ1A 3KJVB 4YMEA 1FKPB 1JLBB 4RW6B 2OPRB 5FDLA 1DTQB 4DG1A 2FVSA 5J2NA 4KE5A 4ED1A 4ZHRA 4JUZA 5DGBA 4TXSA 4OL8A 3BSAA 3CDUA 4XO0A 5KFKA 2DPJA 3NBPA 1HQUA 2IAJA 2WONA 1RT4B 5DLGA 4YR2A 2C22A 3IRXA 2VG7A 3KLGA 3DM2A 1S1XA 3FFIA 1RTJA 2IM0A 5I3UB 1C1BA 1XR5A 4ED0A 1MU2B 4H4OA 1SV5A 3TAMB 4PQUA 1R0AA 2O5DA 2YKMA 4EBDA 2C28A 2E9ZA 5KFEA 3OL8A 3VQSA 5KG3A 2R2TA 3CVKA 3ISNC 1DLOA 3OHBA 5HP1A 3FSIA 1HQEB 3QGGA 1JLQB 3ISND 5F8HA 5DG9A 1S9EB 4Q43A 2W8KA 3JYTA 1UWBB 3T5LA 3DOLA 2IJNA 5KFCA 4FBUA 3LANA 2UVRA 4TY9A 2B5JB 3PJWA 4TLRA 3IRXB 3DRSB 2FJWA 4R5PA 1HNIB 3CJ2A 3HVAA 4EO8A 1TKTA 5EDWA 3IS9A 4TYBA 4TY8A 4RW7A 4WFXA 5J1EB 4B3OA 4Y3CA 3GV7B 2FLNA 4G1QB 5KFHA 1FKOB 3EZUA 4LSNA 3PR4A 4PQUB 2I5JA 4O4GA 1JLCA 4YR0A 3RB6A 2R8IA 1S9GA 5KT2A 5KFBA 3UQSA 5KFUA 3RB3A 4WZMA 1TL1B 1XR7A 3QIPB 4QPXA 4DL4A 3KK2A 1JLQA 2HMIA 4ZVEA 3NGDA 2CKWA 1S6PA 3N6LA 1S1VB 1JLAA 4WFYA 3BGRB 1UWBA 2OPPB 4YR3A 4NZ0A 4LSLA 3KHRA 1TKXA 1JLEA 1VRTB 4RW4A 3H2LA 3QLHB 3MTKA 3PJXA 3C6UA 1EETB 3T5HA 4YP3A 4TY8B 4KKOA 1S49A 4ECVA 3LP2A 4Q0BB 5KFXA 4IDKA 4DL2A 4KV8B 1ZETA 3PHEA 4O3PA 3OLBA 1LWCA 4Y34A 5KG4A 1OS5A 1SUQB 5KFGA 3IGVA 5EWGA 4DL6A 2BANB 3JYTB 4ECQA 3RB4A 3KMSA 3KLIA 1TP7A 2YNIA 3M8PB 1IM4A 4ZP8A 2RF2B 3DI6A 2HNZB 5C42B 4J9LA 5DLFA 4J9QA 2BRKA 3PW5A 1LW2A 4KKOB 4LSLB 2JEFA 3CO9A 2JEJA 2JEIA 3DMJB 3LAKA 1RTIA 5KFAA 5L1JA 3T5KA 5F8NA 5J2NB 3QYYA 2ATLA 1DTQA 4DG1B 5HROA 4K4ZA 4ZPBA 4IQXA 1S6QA 3DLKA 3BSNA 2IMWP 5F8LA 1JKHB 1LWCB 3V6HA 1RT4A 1TVRA 5CYQB 2UVUA 3I0SA 3V4IB 2UUWA 4MIAA 3DYAA 4QWAA 3KHLA 4Y2CA 2YNHA 1JIHA 3M8QB 4ED8A 2EC0A 2V4QA 5J2QB 2RDIA 3DRSA 3MF5A 1RA7A 4WXWA 3KHGA 1T05A 1GX6A 1RTDB 2ILYA 3MFHA 4IRKA 1LWEB 4MH8A 1EETA 1D0EA 3GIKA 4GC7A 4O3RA 1RT6B 1DTTA 1IKXB 2HNDB 5C25B 4Y2AA 4ID5A 4IG3A 4DL5A 5KFSA 4PWDB 4RUAA 4KSEB 3IG1A 1HQEA 1HPZA 1C2PA 4ICLA 3KLFB 1HYSA 1S9FA 4WE1A 3OL6A 1REVA 3KK3A 2AU0A 4Q44A 1HNVB 2FVCA 1LW0A 2W9AA 1RT7A 3MECB 1RT5A 4WXOA 3DYAB 3IS9B 5KT4A 2W9CB 5KFNA 1RT1A 4IG0B 2HNYA 3SFGA 3T1AA 4RW8A 3V6DB 3I5BA 2R8JA 5J2PB 1RT6A 4RW9B 4ZPDA 5F8IA 3DOKA 4RNHA
chains in the Genus database with same CATH superfamily
4I56A 5I42B 4IR9A 3A1YG 2E9RX 3JS9A 3WDOA 1FRIA 2CQHA 3NGUA 4LT6A 2FJEB 5KT5A 1KONA 3TYTA 3GQCA 3CJQA 5E41A 1KD1T 4RNOA 1QSSA 2L08A 2XYHB 4C97A 1RE1B 2JEIA 3EZOA 5BJRA 3T1YF 1JB0C 1RCXB 1WKLA 4O3SA 4CQ1A 1FE0A 2H51B 2O67A 3M8RA 1W2BR 1RTZA 4NLUA 3CD0A 4A8YA 2Z56B 3HHKA 2JZ5A 4ELUA 4ZP7A 1GK8A 3PKMA 1RA6A 3DFEA 3SDEB 1EP4B 4KV8A 3KTQA 4NLXA 3P6YC 3ZZRA 4CH7A 1N4LA 4WU3A 2CPXA 2FVRA 2QLJB 1M5PC 2LA6A 3QFHA 5A76A 4LVOP 1KFSA 4FYDA 5HMYA 3H4BA 3HKWA 3D0GE 1NSPA 1S10A 1PC4A 1ZPVA 5ETPA 1HNXJ 1PJ7A 2HIQA 3ICLA 2HS3A 1F0XA 3OPKA 5I3UA 5FLXY 4M5JA 1T8EA 4JI1J 5ETNA 2GMJA 3OUYA 4DR2F 3QJLA 2HAFA 4JI6F 2HHVA 2L48A 4K4TA 3HHLA 4B9TA 3VHQA 2AW0A 4J9VA 3MR5A 3HVWA 4O23A 4C9DA 1U49A 3PVXA 2HK2A 1TR0A 1W25A 3BN4A 3GJTB 1KHWA 4JI8F 3P4UB 4OLPA 1ZTTA 1S0VA 2V69A 4P2SA 2VOPA 2EXUA 3E3XA 3LP1A 3BO3A 2ZZMA 3EPGA 2CDRB 2PMWA 1Q5VA 2CJYB 3X1LB 2EFOA 2HNYB 1JQGA 3FUYA 4ETXA 4FXWA 4MK8A 4F3QA 2X1GA 2J0QD 1NSAA 3CUNA 1V3ZA 3UN5A 5BYQA 1DBDA 4U7CA 4JI2F 4OHXA 3C46A 2HHTA 2C2EA 3DRRA 1G6BA 2VG5B 2WRMA 3V5RA 4ELTA 3MMCA 1WHVA 1REVB 1LKZA 3W8PA 2VJUA 2BABA 3KNAA 2GS8A 2PMHA 1PILA 2GQCA 2Z2LA 4DQIA 2IRUA 2HZVA 1N36F 1N52B 1N88A 2W1BA 1KNZA 2O1PA 4MT1A 2B5JA 4KHMA 1QTNB 4R8UA 4QIGA 2BR0A 4URGA 3HMJG 4NCGB 2DGTA 4WKRA 3HM9A 1RABB 3A13A 1NXIA 1WJ9A 2ZUAA 2G2OA 3MMCB 3NOCA 4AFFA 2MQQA 3NAIA 1BQNB 1IXKA 1Y5NB 4RW8B 3LOUA 1O51A 2G2YA 2HQIA 4YB7A 4P2FA 4ETZA 3EUNA 3K17A 5GAHI 2PFDA 3H98A 4QIFA 4AYBD 4RNMA 1DRZA 1OQ6A 3EGNA 2IBKA 3DLJA 2Z0GA 1TKZA 2YKNA 1E6YA 4PQAA 5I42A 1RJJA 3LTOA 3MEGB 4ID8A 4Q2MA 5BYSA 5GMDA 5RUBA 4IH6A 1RYSA 2GZOA 2HWIA 1D8YA 2GGPB 5C24A 4CLSA 3QT6A 4LFAJ 2L9NA 4IO1A 5IV4A 4M94A 2HWHA 2R7TA 1HBUA 2L3MA 1F2GA 1S9GB 2FB0A 3AD9C 4P72A 5IOLA 1RT3B 2BX6A 3CJSA 3DN9A 1HWKA 3CIZA 2XSFA 3VAHA 4TLQA 2BUNA 4PUOB 4F02A 3P8BB 3BQ1A 2FLOA 4IQMA 5EUHA 1KQKA 1QUVA 2ZBRA 4M95A 1U45A 2ZOFA 2BXJA 4CTAB 2DR8A 4QU6A 3UFCX 4KFBA 5K5MA 3WZ0A 2IVMA 2M5YA 1FERA 1TL7B 3AY0A 4C11A 4GKJF 3TJ8A 2LVWA 4QCLA 4HH1A 4QIWD 3KLGB 3W5XA 1U1PA 2ZH3A 3HD1A 1UVMA 2QA2A 3EVMA 3M8SA 1ZM9A 4ZCIA 1IKXA 3W65A 5A2QY 5MAOA 3RRGA 2IYIA 4PG4A 1RWXB 3ZXWA 4CZCA 1DURA 3TZWA 3IM9A 5D6GA 1XMQJ 3BREA 3K5MA 5BYRA 1NDCA 2JH3A 3POTB 4DV1J 2DH9A 4YY3J 3OTCA 4Q2LA 3ZNUA 2YNFA 3V6KA 3D0IE 2V8GA 2MKSA 1NDLA 2A0FB 3ZTRA 1RTHB 4NLQA 2DH7A 4FZVA 5IXUA 1NK0A 2IM1A 3AA9A 4YFUA 2BE7D 2ROEA 3W3SA 4JI4J 2RDDA 3EPIA 2E5GA 3FDSA 1S1TA 4DV2F 1T9XA 4Y2IA 2ZD1A 2DHGA 1YJ7A 1BD6A 1IKWB 1TKTB 2XZTB 3D3CJ 1RT2A 3QBCA 2LXUA 3VWSA 3PY8A 1XR6A 4MKAA 4B9NA 4F2SA 2CPHA 4KO0B 5IT4A 1TV6B 4UOHA 4ED7A 3GSDA 1R7IA 4X4QA 3HI9A 2D7SA 3CJRA 1JXLA 2GAHC 1S9EA 1VRUA 4CLUA 2Y8WA 1OO0B 2FJDB 2QIFA 1YI2S 2IAJB 2G9OA 1RHKB 1EKSA 1S6OA 4H54A 1LEOA 2K1RB 1KTQA 2XMMA 2VBWA 4MK9A 1D1UA 3DRXA 1VHFA 2MKCA 4NLTA 1QAYA 4HTJA 4WFZA 3GV8B 2HRYA 2ZE2B 4X65J 3J7A1 3ZO7A 4XTTA 5FDLB 4RNFA 4F04B 4L6V3 3PO4A 4WJBA 2XS2A 1HPZB 2DKOB 4OZNA 3JSMB 2XCPA 2V67A 3LF0A 1QAJA 1ITPA 1F9FA 4DV5J 3Q86A 1TKZB 2M8DB 1VQYA 4CNYA 2BJ7A 2D41A 1IKVB 4CCHA 1X5SA 3ET6A 2CYYA 3TVKA 1XERA 2OGUA 2QGFB 4MKVA 1TELA 4HT7A 4OYMA 5HMZA 2DXFA 2V9WA 3IRWP 4I6WA 1D8ZA 4UW2A 4DF4A 4RX6A 2BVZA 2AYEA 2GO8A 3P45B 4LIWA 4I7FB 4U6PA 2I2YA 1VIXA 2WB4A 3WIUA 1RK8A 3OLAA 3LH2S 3M2RB 3R5JB 4ZVRB 4EEYA 2ASJA 1VC6A 2MEWA 5HBMB 4F26A 3DLGB 3QFWA 2B7CB 2D69A 3VALA 1KWMA 2LEBA 2R8KA 2RQKA 3CDBA 4UOCA 1WC4A 2U1AA 3MMBB 3BR9A 4J9RA 2F4VF 3NNCA 4DR4F 4K4VA 1TL1A 1L3UA 4LF8F 4N56A 1LFPA 2W9BB 1S7IA 2APOA 1PCAA 1RDRA 1RWMB 3BPDA 4RKUC 4AXJA 3NL0A 2HNZA 2POKA 2M4MA 2OSQA 3JTPA 5L1IA 3QRRA 1R0BG 4WP8A 2UV8G 3G8SA 2BKNA 2RHSB 2EFVA 3U1LA 3MUVP 5J1EA 4B3OB 1GMVA 2KB2A 2LEPA 3EJMA 3M30B 4KGVB 3DLGA 4C8MA 2V4RA 2FHJA 3MAQA 4WFYA 3OW2R 1MWZA 3K5NA 4DR1F 1RADB 4FKXA 1URNA 2OEMA 3NXZA 2ZH5A 1QAXA 2KJVA 4OMFG 2ZDPA 4IFYB 2HQFA 1BQMB 1K1SA 2MY8A 3MMAB 2OPSB 2ZC4A 4P7TA 4G3IA 4V1Ak 1WF2A 5L39A 1SJRA 2UU9J 2IPOB 1UZHA 2E44A 4FS2A 2DO4A 3GTYX 2M88A 4KBIA 4L75A 3IAS9 4CYUB 2YX1A 4JV1A 1V5VA 3R7SB 3GCXP 1KVIA 3UVJB 3L7UA 4RUBA 2AJ4A 3R97A 1NH7A 3GCWP 2IJRA 1T9WA 4X4PA 1ULRA 2D9OA 4YOEA 2XLKA 3TX8A 2N82B 3JSBA 3LAMA 1RWKB 2R2RA 2HEKA 2YQ3A 3TJAA 1MW7A 2LA4A 5F8JA 2XB2D 2V8DA 2AJ2A 2EVZA 3OT9A 4ZVGA 2ZH9A 2VASA 1XNQJ 4PG7A 3LP2B 2Y9HA 1DLOB 4WWSA 1YVFA 1FRJA 2D3UA 2LQ8A 2K1RA 4OV6A 1X60A 4ED5A 1N0VC 3H5SA 1N5YB 1N0UA 3DRPB 1U6FA 1BGXT 1VQ5S 3VAMA 3V6JA 4K4UA 3W7BA 2RKIA 4X62J 1EP4A 1VQOS 3AFGA 3DLEB 2OFGX 2PDAA 2MPUA 2RS8A 5KFYA 4YS2A 5HMXA 3TA0A 3MR3A 2NSBA 2YNGB 2DRDA 2YWWA 1G4CA 1WDTA 1YBTA 2HHXA 2GC8A 2Y0SD 3BGLA 3R5BA 3ENAA 3Q8PB 2ASLA 3QT8A 1RSCA 3J81j 4H4MB 4DFKA 2ZWOA 1REGX 2C2DA 3U02A 3GFHA 3CCQS 3AB2B 1PC5A 3ZZUA 3C15A 3KWMA 4AQYF 2GX8A 2ZJRQ 3HVTB 5CYMA 1SL2A 3UDLA 4P74A 3E51A 4C2MA 3CD6S 2F40A 5AXKA 3QLHA 2FJXA 4DR5F 1NB2A 2GVDB 2VG7B 3K8WA 2WW8A 2QV6A 3UDVA 2B43A 2HFOA 3CD5A 2GMLA 2XMVA 1DTTB 2JLFA 3OXFA 2NXUA 3O5TB 5ITHA 1S48A 1FJCA 2P6SA 4PWDA 3PV8A 4V19X 2LLZA 1RWNB 1I94J 2PA8D 3Q8QB 4I7FA 5HI7A 1FDNA 3THTA 2AYGA 1CJTA 2WTFA 3BQ0A 4FBTA 1ZPWX 2QLWA 2LP4A 2VKRA 3IR6B 3M9MB 2NPIA 1KTVA 3MCMA 3TAQA 1PYTA 4LR9A 2C2OB 3QZ8A 2HHSA 3NS6A 4KFBB 2I8EA 1X7VA 3US5A 2KXNB 2YWHA 4FVMA 2ZJPQ 4JI3J 2AEFA 3A8KA 2D3O1 2IJFA 1NSQA 3W2VA 1LXNA 3BBBA 3GYNA 5HROB 4KJIA 3G9CA 2CQ4A 4LJMA 1R31A 2XEXA 4ZCLA 3O6QA 4GVBA 4I2PA 3N9UC 1V3SA 3RBZA 3CCES 2N7YA 4YMEA 3B78A 1NPRA 1FKPB 4RW6B 1SBRA 1WOSA 6FDRA 2NXEA 4ED1A 4ZK7M 2GW8A 2WSEC 5BXIA 2OMOA 3RW7A 5DGBA 1WI6A 1N32F 4TXSA 2F1FA 2Y1RI 1H7XA 5KFKA 4XO0A 5B0AA 1TUWA 2IAJA 1RT4B 2V68A 3UNYA 4YR2A 2L41A 2J7WA 2R7QA 2EBEA 3GJQB 2VDIA 3A4TA 3FZ2A 2CJAA 4B3MJ 4KGKA 3TZZA 1PIEA 2JNJA 1WKJA 2PO4A 5I3UB 3MTJA 4M5DB 5D0HA 2XS7A 4X66J 3AAWB 2C28A 1WF0A 2B0GA 2YX4A 3BS9A 3MPVA 3IO1A 4WCEQ 3FSIA 3MM5A 1HQEB 1ICEB 3X3UA 4LUBA 2GAGC 2W8KA 1S9EB 4DU8A 2VQEJ 3K0JA 3T5LA 1UWBB 1CJKA 3DOLA 2IMOA 3M7VA 5H1SV 4TLRA 4FYWB 1AUDA 1UVKA 1PAEX 3CJ2A 3HVAA 2W7AA 2EFNA 2MKJA 5EDWA 3BO4A 3PNIA 2FY1A 1SJQA 4RW7A 2FLNA 3D1HA 1AZSB 3EMTA 4C7QA 4G1QB 1F3VA 3EZUA 2C2ZB 4ANDA 3RAMA 3KG1A 4LIRA 2B4VA 1DY3A 2R8IA 4DXLA 4DZ6A 4MKYA 1H72C 5KFUA 1HR0J 4NXMF 3H42A 4Z7CA 1XR7A 3W9JA 4WZMA 1SJ3P 2BACA 3N5BA 3KK2A 4CLKA 3NGDA 2F9DA 5IM0A 4AL7A 2BKPA 1S1VB 5FLXU 2OTJS 1OQ3A 2VZ9A 1YJRA 1CJKB 2BBEA 2OO4A 3I4PA 4KYZA 2OPPB 3M4XA 4LRFA 2DRBA 4GVLA 5F0UA 4RL1A 3KHRA 4PAAA 1JLEA 1VRTB 2CZ9A 2KXHA 3D68A 3H2LA 3QLHB 3GJRB 3SV4A 5KOWA 3PJXA 1UWAA 4DS5A 1ZYQA 4FF3A 3OR2B 3M1VB 1UMJA 4TY8B 1T02A 3EGWB 5HVFA 1CC8A 2DCLA 1Y10A 3RU0A 4NXNJ 2EPIA 2MZRA 1LWCA 2PGCA 4Y34A 5KG4A 2NCKL 3LQVA 4PEOA 2PEHA 4K8RA 1X5PA 3JYTB 1UVNA 1I3OB 2YWKA 1KS2A 4KPCA 5SUHA 5DLFA 1WEYA 1F5CA 1GNKA 2Z58B 4BC7A 2RF2B 1FRXA 2KDOA 4ZJLA 3UO0A 2QA4S 4FF1A 2LYVA 3M6XA 3NG8A 1LW2A 3N4WA 3R6GB 3D66A 4FN5A 2CFXA 2YVSA 2ZFHA 5L1JA 2JRSA 4D3HA 4OHYA 3QYYA 2EEYA 1DTQA 1N5QA 5HROA 1GMUA 1TTHB 3N79A 3RUBL 4IQXA 4K4ZA 1UEVA 2IMWP 1CG2A 2HFNA 1HWJA 3AH6A 4GVBB 4ZOSA 1F3FA 2BMBA 2BM1A 2K8GA 2QSWA 3FC9A 3IM8A 1JKHB 1FVSA 2HZAA 1U1LA 2DNYA 1LWCB 3IWLA 5ETOA 1HNWF 2W2MP 1FDAA 5CYQB 1R8PA 3SCKE 1WSRA 2CPJA 2RVJA 3DYAA 4PG5A 4QWAA 1V3RA 1IBCB 2GQ2A 1NZ8A 3KHLA 3VV2B 5D0RA 4OLOA 2R7SA 3Q23A 2V4QA 5J2QB 1CJUB 2RDIA 1XN9A 1FRKA 3PJ9A 3UVJA 1TMMA 4RR5A 2KXFA 1GX6A 3MFHA 4DQSA 2J0SD 1PJ5A 4P10A 4FF2A 4O3RA 3AJ2A 2KYZA 5LOQA 4IG3A 1NSKL 5HSPA 3H7HB 3WHIA 3UCZP 1HQEA 1HIYA 2E7XA 4ICLA 1HYSA 5ETSA 1NUEA 3KYLA 3LPYA 4B17A 1WTFA 3TQEA 3C15B 3CC2S 3OL6A 2AHOB 3KK3A 4UUWA 2NYIA 2RMLA 1J2VA 1HKAA 2RQMA 2ZUGA 4Q44A 1LW0A 1GFWB 1RT7A 4FP9A 5CD4H 2ZC3A 5G4DA 4A4JA 4OX6A 3AJ1A 3Q24A 2MJUA 1TK5A 2NZCA 5KOXA 2RU9A 1OIAA 3I9V9 3T1AA 4RW8A 3V6DB 3FBCA 1IBLF 4N5SA 1K47A 3AXKA 1NZAA 1V9OA 1VQ6S 4X4SA 4S0MA 2ASYA 2DGVA 2FY8A 2RNEA 1F60B 1EB0A 1FD2A 2DBBA 3P5TL 5K14A 3QIPA 1FNOA 2PSZA 8AT1B 4ZPWR 3J81Y 3MFIA 1APSA 5HO4A 1HYSB 2G0CA 3IBFB 1UPPA 4CO0A 1T11A 2B9EA 2OAUA 4FKYA 4HHUA 2I6WA 1N32J 2AT1B 3PACA 3Q8RB 2Z57B 1IBLJ 1IJEB 3IC1A 1VRTA 1K1QA 3W2VB 4DQQA 4LF5J 1U2CA 1T05B 3Q2SC 3H5YA 3FQKA 4WZQA 1EQ0A 3MM9B 3W1YC 1SQFA 4MKBA 2HYIB 1MU2A 3D54A 3D28A 1C1BB 2DK2A 3D5MA 2YTCA 3LGHA 1F1BB 1RWPB 3MPYA 3C14B 4OX7A 5M2UA 3CIMA 1VS3A 2F5GA 2XZDB 4MJKA 5F9NA 2AJQA 4Y28C 4DPWA 2RAQA 2YNIB 1ZA2B 2JFKA 2YWGA 2ZITA 1FWKA 3AB4B 1GMWA 3I32A 3MR7A 2B9XA 3D4JA 5KFIA 4HH0A 3T41A 1IWGA 3CJTA 1GAOA 3CNQP 3NMRA 2FHJD 5HANA 3J7Z5 3T1YJ 3DMJA 3C6TA 4J9KA 2W4DA 5H9EJ 5D4LA 1WG1A 4X4OA 2BA9A 2XWYA 4HHJA 4RU2A 3WC2A 2NS1B 4Y0FA 2BE2A 1SC6A 4HACA 3HFKA 3IBWA 4DX8H 4CH0S 2WW4A 4KQZA 4NLPA 2E5IA 5K8OA 1EZZB 3CXCR 1ZM3A 3M8ZA 1H2TZ 3VZHA 1YG0A 3W60A 1RHJB 2COLA 1EIYB 1JNRB 2GIRA 2C3PA 2RRBA 1PAUB 4L3NA 4ZLLA 4F3MA 4AL5A 1OY9A 2D1CA 4C0BA 4DV7F 1JMTA 4A8QA 3IXQA 4RW4B 3THVA 1B64A 3DLEA 2I1RA 4A8XA 4UOGA 3NS7B 5HQLA 3CCUS 4A8SA 2DNMA 4XK8C 1M1KT 2J5AA 1NAQA 1XMBA 2DVIA 4ID5B 4ZVTB 3CJ5A 1H2UX 1N6QB 4LSNB 2EG1A 4DR1J 2HBRB 3RR8A 3GIMA 4DL0C 1YQHA 4TKTA 2VB6A 2WHOA 2HGLA 1IM6A 5HQ8A 3B4DA 5L9NA 4WYLA 5AJ3F 1E6VA 4J9NA 1IQZA 4N41A 1JJHA 3ETMA 2IDEA 4OZ1A 4H4MA 4H4KA 4NLDA 5CH7B 5HAOA 4NXNF 4QYRA 3G6XA 4ZPCA 3MEGA 5CZVA 2MQLA 1Q16B 3TZXA 3TZYA 4ECSA 4KPYA 3K5OA 3MM7A 4RU9A 3DLBA 1I1GA 3PKYA 4IG0A 1AUSL 5A8WA 2XQCA 2F4VJ 1IKYA 4ZP9A 5DG8A 4LFCJ 3D2WA 2YXLA 1Q8IA 2WOMB 2HGNA 3JSRA 3OTBA 3JSMA 4OI6A 4WYWA 5U47A 1NJXA 1KP6A 1VLOA 2G2ZA 2UUAJ 3J81U 5HP1B 1F6TA 1RI7A 3AQOA 4Y65A 2OPSA 3RJMB 4FYVB 1O0PA 3G71S 4RBTA 1AROP 2FJVA 5IWAJ 4NLRA 4OZ3A 4YDDB 2H4WB 2HAIA 3OFGA 4GMKA 1FTCA 4IKAA 4NLSA 3WC0A 2DO0A 4UZBA 3DLHA 3A3PB 5LSLA 3OTOF 1TQLA 2DNQA 2BJDA 2EBGA 1K44A 2YX7A 1HNIA 2ZM6F 1LWEA 4AT1B 1NDPA 2AEJA 3I82A 4RLEA 1VCTA 1SXLA 3M6WA 1URRA 2KHCA 3PW0A 4CWBA 5J1NA 1WHYA 3FRZA 1IJFB 3M1VA 1FKAF 1SJ1A 1S0OA 2HLTA 3W8GA 4QWEA 4DR2J 1DFDA 4OJ3A 1JKHA 4EI2A 2XGQA 3EE3A 1FJEB 1RTHA 4I69A 4MK7A 1UVIA 1S4FA 4C8NA 2J6TA 3TA1A 5HLFB 2BOPA 4Q45A 1B0PA 5ETTA 4NA1A 4PRFA 3E01B 1WF1A 2CNNB 3ZZZA 3HHNB 3UPFA 2BQRA 4K2JA 1KLNA 5LMNF 4RZRA 4NEYA 2KG0A 1HHSA 2DHHA 1RT1B 1H7WA 2W9CA 1NBEB 5EWFA 1BWEA 5AT1B 2GHWA 3CC4S 3BN7A 1BQNA 1RU1A 1RWWB 1NNDA 3EDRB 2F7VA 2F9JA 2DCUB 2Y3YA 4OHVA 4OJGA 1HBOA 3LP0B 4NI2A 4YEAA 2PMZD 5L1KA 3TJ9A 4F7VA 4LSZB 1QAIA 2DNKA 4PYAA 4UZCA 1FF2A 5E3QA 3VGTA 4X64F 1K73T 4LQ3A 4EYIB 2KT5A 2MXYA 2VFUA 1B99A 3U1NA 2VICA 1FXLA 5DQHA 3PDNA 3KK1A 3FBBA 4RJVA 1LQ9A 2DISA 4FYYB 5EGYA 3EXYA 4O44B 5GADI 2GIFA 5KFFA 1WC1A 3H5UA 1FI4A 2JVOA 4RPFA 2HVHA 1IBMF 4U7UK 1KLMB 2VG5A 1Z1ZA 5DO2A 3SV3A 1KSPA 2F4FA 3OL9A 1TK8A 4Q5VA 2IC3A 2WVFA 3EYZA 2H3EB 4JI5F 4IOAQ 4BBYA 3I0SB 2W2OP 4ZPAA 1TVRB 3GE9A 3KNGA 4ES1A 3IR7B 1IKVA 2DNPA 1I6JA 1BY9A 2EC2A 3DGPA 3PCOB 4CLWA 1IUJA 3NLCA 3H4DA 4U8VA 2WONB 4J91A 2VFVA 4A8WA 4A8MP 2M70A 2KFNA 4GKKF 1RTDA 4DR3J 3DRPA 4K7QA 3KLHA 1NHUA 3G87A 4DV2J 2ROGA 1RAAB 2DEIA 1M1HA 3D67A 4JI4F 2OJ3A 2C2MB 2UXDF 3HHDA 4OQJA 2XC9A 5J2PA 3KLFA 3MMBA 1JX4A 3MPDA 4OX9F 2UVVA 1NO8A 1T03A 2MJNA 2WAQD 5FD1A 1OSCA 5HBMA 3NBPB 3C19A 4TNOA 1RHQB 3B82A 3AXMA 3LW5C 2HMIB 1Q8BA 2RILA 4U7UD 4U67Q 4B3TF 2RHQB 2JC0A 3LO3A 1NK8A 3PEHA 3VVTA 1P27B 4C8LA 2M9KA 1FXRA 5E3RA 1RTIB 5LSOA 4ECYA 2NZ4A 4CLFA 4ZMMA 2KJWA 4ZJQA 2W9BA 1F5BA 2YH1A 2QLFB 2BJ9A 3M2UA 4LF4F 2C42A 2V8VA 5C2GA 5D0GA 5F41A 5K20B 4DV3F 1OYEA 1SJ4P 4I67A 3MMAA 5LMNJ 2C2RA 3Q89A 3F73A 3SFUA 4F4XA 2VH7A 4H4OB 1MROA 1S6QB 5HN0A 3J7YI 2ZNYA 6AT1B 9ATCB 2YKPA 1DQ8A 1NLKL 1I51B 2GHVC 2XI2A 7FDRA 3DOLB 5EX0A 4JV2A 1WELA 2CJQA 2GCFA 3D9BA 4G65A 1WI8A 4X2BA 1RBOB 1Y3KA 3Q22A 1G7CB 2Y0BB 2OHDA 1JK9B 2CG8A 3CT9A 1FO1A 2GV1A 4EO8A 3BB5A 4ZCMA 3W63A 1U1QA 1BHNA 4O4RA 2DNNA 5KFZA 1FK9B 1IQTA 3WBZA 4IOCQ 1VQ4S 4L73A 2NPFA 3FBFA 4TQRA 1S1UB 1UFWA 2E1MC 3QPIA 2K7KA 4HVZA 2H5JB 3N28A 1TV6A 4XPEA 4NMLA 3NAHA 4NLVA 2DJWA 3HJFA 1X4AA 2XULA 2PFFB 1F9EB 1T3NA 1WEZA 1J5OA 2UUTA 2FC9A 2Q6BA 1Y5LB 1DHMA 3GONA 5KFLA 1X31C 2DT9A 3ZTSA 3K59A 2J9CA 1S1TB 3TR5A 2ZH1A 4K4XA 4DV6J 4JI7F 3DI6B 1Y5IB 3TAMA 3PFEA 3SI8A 1VHIA 1T95A 4DDFA 4URSA 5E0OA 4F3OA 2EFPA 5I3PA 2B4PA 4G6VB 1VIOA 1GQEA 2Y1LB 1CBKA 2J8AA 1Z2LA 2QYCA 3D6FB 4ZVFA 4DUYJ 2A6OA 1NJZA 3MAAA 3KUGA 3Q8UA 4OI4A 2DRAA 4B3RF 3A8EA 3O2IA 4M5HA 1MG7A 4IFVA 2M3DA 4ITSA 5F3ZA 2AF6A 2X1BA 1M1GA 4ED2A 3OSPA 2YQ0A 2BW7A 1HNVA 3DU5A 3CWJA 4KT0C 1TL4A 4CNZA 1WOOA 2DGSA 3V81A 2DNLA 5CXTA 4Q8FA 2V2ZA 2MHEA 3SCIE 2B8QA 4O3NA 3J7AN 3FCVA 2H9ZA 1B0VA 1RU2A 3POTA 3CJKB 5LJ5Y 2JDJA 2BJ8A 1Q78A 4FNIA 4QWDA 5GMKa 4NZ6A 3QZ7A 1T03B 2OELA 1HNZJ 3KK2B 1MMDA 4O4GB 2DXEA 3CCVS 2D74B 1W2IA 4BC9A 2L9WA 4YHHF 4DSEA 3K57A 4BWJA 1KKHA 3PYEA 5HMWA 5DQGA 3OSNA 2OIHA 2UVWA 4DSIA 3KOAA 2C2KB 4ALZA 1QSLA 2DIUA 1Y0HA 3KDOA 3ZFVA 4I2QB 3G6YA 3OXLA 2LKZA 4IR1A 2HQCA 4M1KA 5EN1A 2E5LF 1X4BA 4O3QA 5SZTA 1MMNA 3AD8C 1LFWA 3D6TB 3GZ7A 3NCQA 3GV5B 3IG1B 4USWA 3Q0AA 1X4GA 2B4UA 1VBZA 3ENWA 3T19A 3R9LA 3RBEA 3TO8A 3EVWA 4BWMA 1XMOJ 2C3OA 3IWNC 5D4NA 4Q0BA 4KH0B 4TU9A 2WK4A 1YZ6A 2L9DA 5G0RB 4J9SA 4EYHB 1X9WA 1BQMA 1VISA 3PIOQ 4QZVB 2B56A 3HPOA 1JJ2R 1TL3A 2QE5A 4DCOB 1U1KA 2HHQA 4UOFA 2KZZA 2HQGA 1RT5B 1Q79A 1FWPA 4ECUA 5DDOC 2KRRA 1CQNA 1YK9A 3UN2A 4MTPA 5D3GB 1X4HA 4M5DA 3EGVA 5B0CA 3RAXA 1MN9A 2CJXB 3M05A 4A47A 3MCSA 1S79A 3H40A 2QFJA 1S1UA 3QAUA 4USIA 2ZBIA 3KJVB 3MUMP 3TQ1A 1JLBB 5FDLA 2OPRB 2DGWA 4DG1A 4KE5A 2J0XA 4DFPA 4NOHA 5GAGI 2MGZB 1XBWA 2QL7B 2XMWA 4JUZA 3RTVA 4OZ0A 4LRCA 1TUGB 4CO4A 4CLPA 2MQOA 1XMQF 1AT1B 1SC4B 4ZN3A 4X84A 2DPJA 2WONA 3ULHA 1M5KC 1XK8A 5L46A 2EWHA 2ZKTA 1U8WA 4O0IA 4LFBJ 1ELOA 2PE8A 7AT1B 2VG7A 2HBYB 2RB7A 1U6BA 2KO1A 3MMJA 1S1XA 1LOUA 3LPEA 4NEZA 3CD7A 3HFVA 3JQJA 3M6UA 4WFBQ 3W61A 1RTJA 2VL1A 1F9HA 1T9VA 4JP8A 5AE3A 3TAMB 3CGIA 4EBDA 3ILIA 2QEXS 5HJYA 3O44A 5KFEA 1TAQA 3SQGA 3VQSA 1BMQB 3OL8A 1SL1A 4DWIA 2JFDA 4CLYA 2VOOA 2WVEA 3OTEA 1AA1B 2HW3A 1NK9A 3MAAB 4HEA9 3H2UB 4QR2A 2LU2A 4B08A 2XM3A 4FBUA 3CMQA 3LANA 1VQMS 2UVRA 4TY9A 2BJEA 3W9IA 1OPIA 3PJWA 3MM6B 5GMEA 2FGOA 1PKUA 1Q7LB 2FJWA 3QGPA 4R5PA 4B9VA 1HNIB 1KVKA 1Y4ZB 5EX3A 2GVZB 4WFXA 4TY8A 4Y3CA 4EWTA 1T9TA 3F41A 5KFHA 2ZH6A 1FKOB 2P8IA 4DR4J 4LSNA 3BM7A 3HLUA 3OR1A 4NYPA 3PR4A 4O4GA 3PG9A 4YR0A 1HW8A 1EQMA 1RWOB 2CWXA 1S9GA 2V6AA 1RCOB 1AW0A 1T0TV 4TU7A 2V8PA 3DOMA 3FZBA 4N8OA 3RB3A 3BGUA 1WHWA 3QIPB 4C11B 4QPXA 3WQPA 2CA9A 2FD2A 3JAMY 2KVQE 1GTEA 2MLYA 4O0NA 4ZVEA 2OTLS 2BJ3A 1S6PA 3N6LA 3ZZPA 4JI7J 2JSXA 4CTAA 1KOHA 3CCSS 4PCQA 3SYZA 2Q79A 2W24A 1K0VA 2IFXA 3JSYA 3UNGC 3ENQA 1UL3A 4MYUA 3NGRA 4CM0A 4YP3A 1VYAA 1UA0A 1BC6A 3QSYB 2PEBA 2CRLA 3OR1B 4KV8B 2EKNA 3PHEA 1FNMA 1XNRF 1UW4A 1SUQB 1R89A 2A2DA 2B9WA 3L7PA 2HVIA 3NGKA 1NKEA 4ECQA 1X9SA 3MPWA 3UD5A 4UT4A 4PWUA 1TP7A 3GFZA 2YNIA 1VK3A 3CCWA 3M8PB 2EFQA 2P9CA 3FCWA 3PM9A 4K5RA 3T6JA 3DI6A 2HNZB 5C42B 2WSCC 3ZZ0A 2RU3A 2PN6A 3LAKA 5KFAA 4MMOA 1CJUA 2VBZA 3HCXA 2NQPA 2IY5B 5F8NA 1SIZA 3CCZA 2NUHA 4DBQA 2FPHX 1FWLA 4ZPBA 5JMNA 5IWAF 1UPMB 2GA7A 4KH1B 4OYBA 4UF4A 4F0MA 3BSNA 4B3MF 1TAUA 1U26A 4ZIVA 3JQMA 1RHMB 1P6TA 4QBUA 3NCRA 3AOBA 2UVUA 2R7WA 2UUWA 3KUHA 5ETQA 4MIAA 1PBAA 2RE1A 2YNHA 1JIHA 1RLCL 5LJ3Y 3IR5B 2MB0B 1YTYA 3DRSA 1L3KA 3GU0A 3O1LA 4USKA 1RTDB 2P2CB 1VBXA 4B3SF 4FF4A 1D0EA 1EETA 5T7LA 3ZC4A 3UR3C 1BWVA 2HNDB 3HSJA 1WACA 3SXLA 4Y2AA 1P9QC 3QT5A 4DL5A 4RUAA 1HBNA 4KSEB 1Q1KA 3QJPA 1HPZA 1C2PA 4ZN1A 1RBAA 3SQGB 1YRTA 1IWAA 3FMWA 5A6WA 4LF9J 1SQGA 4C3LA 3LUYA 1WC0A 2J8SA 3ENVA 2ZHBA 4ZIWA 1RP5A 1OYDA 2W9AA 3W5YA 4A8KA 3R5AA 3TVZA 4FXDA 3MWBA 1OY6A 3VGVA 4KHPJ 4JV5J 2GVZA 1YRUA 3NWRA 1RAFB 4WP9A 2IRYA 2BE9B 3TNVA 3DNCA 3PX6A 2HFSA 2OEKA 3MM6A 1VR6A 2OD6A 2QC3A 1UJ6A 3EDQB 3SFGA 1O6XA 3I5BA 2R8JA 4OIXA 1VRQC 3MM8A 3MZIA 1RT6A 3H20A 4ES3A 1HI0P 2IYGA 1PG5B 1Q0NA 1JLCA 3DOKA 1IBMJ 1RAOA 4RNHA 4NCBA 1HBNB 2E5JA 1YSJA 3CDWA 1RAIB 2KG1A 2BKOA 2V4JB 1JLGB 4NYOA 2E1PA 2XLIA 3SZ2A 1KDNA 3M2VB 3GB0A 4K4SA 4DQPA 4K0KJ 1NDKA 4ECZA 4X64J 4CIOA 2BE2B 1ZZFA 4HACB 4EBEA 2YNGA 4U96A 5C24B 3N0VA 4YB1P 2AX0A 3PW5A 3OD2A 3C6TB 2IA0A 5A0YA 1WC3A 2GJFA 3MGJA 3HFZB 3VAIA 4ED3A 1H38A 1CPZA 3CJ0A 4DV0J 3MM8B 4HKQA 3AT1B 3HSDA 2DNRA 3O3LA 4EO6A 3HK2A 1EJ7L 2CQIA 1VRUB 2X7IA 4QIVA 4DJBA 5C2CA 4Q8EA 1UVJA 5EHHA 2RDJA 5KT7A 3CJ4A 2HLUA 4ENOA 2HHPA 2EFGA 3RB0A 1J5OB 1P1LA 1VFJA 5ETKA 5AXNA 1G1XA 3VQTA 4UQGA 1QE1A 4Y6IA 3BF4A 5D3GA 2KU7A 1SL0A 3EWGA 4F4KA 1U8SA 4OI2A 4DSLA 2PT0A 2GIQA 2J76E 3AODA 1X4EA 2HWTA 3CSKA 2IM3A 3IBCB 4K5SA 4JI0J 1D3WA 2YQ1A 3MD1A 1O5JA 1YBUA 3T1HJ 1X5TA 1GTHA 4Z7YA 1RHRB 4NPOA 4DV6F 3VAKA 3KLVA 1QSYA 3ONQA 1X4DA 1DZ5A 1HI1A 4M63A 3UCGA 2VG6B 2VUGA 1ZTWA 1NK6A 2R42A 3FEZA 5IC6B 5I3QA 2OLWA 4O44A 1FX2A 2WSFC 5AE1A 2HBZB 1YLXA 3R7NB 4NL5A 1S1XB 3FMBA 5IQQA 1QDUB 3CCRS 1JWWA 2JC1A 4P2MA 4TU8A 2PI4A 1KHVA 4IG3B 5I4MA 1CSJA 4DOZA 1UFKA 2VIHA 2HIYA 1CLFA 3PRBA 4MFBA 1IR2A 3HULA 5LMUF 2HKEA 5C5JA 3T1HF 2J7UA 2CXEA 2R7OA 3W9HA 3OL7A 3KMQA 5D4PA 3N6NA 2VG6A 2DNHA 1YKWA 3J80U 3KK3B 4FYXB 2CQ2A 2QZ8A 2XWXA 3QGIA 4JI6J 2D9PA 3K8VA 2QTWA 4P2XA 3L3CA 1T9YA 4DPUA 4JI1F 2AKWB 3DM2B 1Q7YT 2HS4A 5JJBA 2HVZA 3VAJA 2XZWA 3GFYA 2O3DA 3G82A 4W90B 1NCLA 3IGNA 2RUSA 1VQNS 4DR6J 4LQ9A 2HURA 1YJVA 2NLWA 2VA2A 3HSGA 3BYPA 1NJIT 1HNWJ 4ECVA 3PRDA 1HWIA 1Q8KA 3IAM9 4DCJB 2G1HA 4IFVB 1V5IB 2E66A 4QW8A 1FJGJ 2U2FA 4EBCA 1H74A 3KLIB 1VQ8S 2MZQA 4DV5F 3ELHA 2V4JA 3CJ8A 5L9XA 3BGOP 4CRJA 4GC6A 1C0UB 2BRLA 1WTBA 3I55S 4DV7J 1Q81T 4J7CA 3H5XA 1S0MA 2W7PA 1U0HA 3BEGB 3G82B 2CQDA 1JLFB 4NX9A 3T9ZA 4R8UB 1U1OA 3S8SA 2XCAA 1M5VC 1GH8A 2C3YA 4WTOB 4I2PB 2R8HA 1IBKF 4JYAJ 2UXDJ 5C25A 1TL5A 2BQUA 1SH2A 3VAFA 2OPRA 3P49B 4C4WA 1MROB 2DB1A 2ZJQQ 2XI3A 3GILA 2A6MA 1JLAB 2D3ZA 4LF1A 4YB5A 3TANA 1UVLA 2R2SA 4HTIA 1FEEA 2N3OA 4WE1B 1UP1A 1J5EF 1QE1B 1FRMA 4I2QA 1T9UA 1XEZA 2MHNA 2ROPA 3RBDA 1N56A 2KKHA 3BPSP 3R1LA 3V6DA 1TFYA 1C4AA 3JTNA 1S76D 4XAKA 4P52A 3OR2A 4LF4J 4DMZA 1QJHA 6FD1A 4KB7A 3L09A 1TKXB 3MD3A 1ZAWA 2GO9A 4K50A 5D8HB 2MQ8A 1HBUB 1UA1A 3TRGA 3TW0A 4ZHRB 3PYFA 3M8WA 4AXIA 4KAIA 4RUCA 4F4YA 2ACYA 2E1CA 3NS5A 2BZ2A 2F8HA 4A8OA 2UUCF 3TUZC 4ELVA 3FEXB 2FZKB 2CPZA 5E33A 1I5OB 2ATCB 3NMAA 1YIJS 2YKNB 2RF2A 1E6YB 3OXGA 2RJZA 2Y8YA 5M2RA 2FJAB 3O8WA 5JXSA 4AD6A 2F8EX 3KLHB 2CPYA 2MQMA 2ZKUA 2C2NA 2VJVA 4HYKA 4PYDA 3G86A 3GIRA 2Q6CA 1YJUA 3I31A 4UQTA 5KFDA 1WSVA 1W26A 1WC6A 1R0AB 2XMUA 2YKMB 3TX0A 4A46A 4F4WA 4ECRA 1M5OC 4C8YA 3PZPA 1PO6A 1JLBA 2FDNA 3JXOA 1JNZB 1L5UA 2JX2A 4WPAA 3QO9B 4F36A 2HHWA 3LWLA 2HG4A 2CQ1A 3T9NA 1FJ7A 1F5AA 2MLXA 2K3KA 3I56S 3N6MA 2AMCB 2YPYA 5CA5A 4WFNQ 4X4RA 5HJXA 3HP6A 2JEGA 3EGZA 1CJVB 1B70B 2DITA 2RUGA 5IM0B 1U47A 2V2QA 3V81B 2HHHJ 4W98A 2PI5A 5DDQC 5CHCB 1RAGB 3V4MA 1RYRA 5D0EA 1FKPA 4RW6A 4ZVPB 2ILZA 3M8YA 3PW7A 1WDDA 1UTAA 2ZBPA 3C6UB 3FEYB 1XNRJ 1PBUA 5H9FK 3BDEA 2HQ3A 2W4CA 2H1YA 4PXCA 5E3AA 2ZH4A 3MEDB 2MQPA 5ETVA 1HA1A 2GMHA 3SSQA 1HBOB 4NI2B 2ZH8A 5KFQA 1LWXA 5F8GA 3ZTOA 4J5OA 2YWFA 2ZM6J 3DXBA 4ED4A 1A6LA 3MECA 1RT7B 1BUXA 3BQ2A 2UUCJ 4ED6A 3I5AA 5F9LA 2HSEB 1N34J 4OHWA 2FHKA 3I5CA 4LF7J 1UETA 3KLEA 4OI1A 2J9DE 4ZVHA 5JUMA 3A8JA 4P6QA 2AYMA 3CW2C 2OUGA 5DZ7A 5B08A 2CVEA 1O8BA 1RHUB 5KAKA 3G8TA 4ZKAA 2CDQA 4OYPA 4QWCA 2XMAA 4R0EA 4I68A 4HDGA 1YJ9S 3VAGA 4F4ZA 2Q3PA 1N6QA 1CULA 1RGVA 1U7LA 2AWZA 3QWPA 3RRKA 3DLKB 4C0HA 2CZVC 5IS2A 3T5JA 1WUUA 4KGMA 1CVJA 1N36J 3QRQA 3LP0A 4RW9A 4ZPVR 2FQQB 4DUYF 4B3RJ 1S12A 2DD8S 1BLUA 3VGUA 2W01A 2R8GA 3B54A 1S4EA 1HI8A 4LREA 5B0EA 3LWMA 2B8PA 2AD9A 4NA3A 1NHVA 4HDHA 2M52A 1C1CB 2LCWA 3NP5A 1AZSA 1FESA 1T94A 4RW7B 3B8HA 2PIIA 4LBPA 4WBFA 5A6PA 2VV5A 4URQU 4D3GA 4AQYJ 4CDIA 2ADCA 2AGOA 4DUTA 5LXYA 3FJ2A 3D6HB 4GRSA 2EK6A 2AP6A 3LA0A 5KG1A 3UR0A 3CCMS 2YNFB 5DM7Q 3QAEA 1LWFB 4QR1A 5J1PA 1S72S 4W4MA 1N5YA 2NUUG 2ZVIA 4OYXA 3RGIA 5LXRA 4NLGA 1AXQA 2CPDA 2JVRA 4B9MA 3HZEA 4BCAA 4DL7A 3OBIA 4CLZA 2ALZA 1YJTA 5J2MB 2ZVSA 1SJFA 4DSKA 4FPRA 1KFDA 4WKYA 2Y1IA 3CCJS 3BYRA 3RAQA 3M2UB 1Q95G 1UKUA 1WD6A 4E98A 3ZZYA 4GKJJ 2P9GA 2H4YB 4USJC 3I96A 1QM9A 4N8NA 2IC3B 4IH5A 2R3VA 3ZTPA 5L1LA 3LGMA 4DR6F 2AQ4A 4ZITA 1R27B 2QN6B 1NM2A 3M9OB 2BANA 1E6VB 1S57A 4DF8A 1PJ6A 2ZBQA 5J2MA 4PUOA 2DY9A 1SKWA 1VQPS 1CJVA 3SCLE 1FCAA 1IR1A 3ADAC 1R8AA 3UN3A 3GG0A 1XWLA 2ZOMA 2IDLA 1R8HA 2P5VA 3DDNA 4HL9A 3RZAA 3D1QA 3Q8VA 4ECXA 2KN4A 4IRCA 2FTRA 1KVJA 2A18A 1LW2B 5A8KA 1HARA 1YBAA 2JHEA 4DCPB 1VQKS 1QUPA 2AX1A 2P6TA 4OZLA 5EWEA 1IKYB 3S6EA 2VA3A 1AFJA 3MI7X 4RWXA 2VHGA 2ASDA 4WP3A 5IQ6A 1VC0A 3BDPA 5B0GA 2Z2ZA 2R7XA 3FGVA 3T3FA 2FHOB 4CO5A 1TZ0A 3I87A 4M8LA 1CC7A 4LRDA 3SIPB 3M9NB 1KQSR 3UW1A 3M32B 3EM1A 1YDLA 5LM7E 3ETOA 1TL3B 4DPYA 1SQEA 4CM2A 1IN0A 5A8KB 3PHTA 2MTLA 3MEEA 3Q83A 3U7JA 2UP1A 2XG8A 2XY6A 2OH2A 5DGAA 4NCGA 1B0TA 3V2UC 5GAEI 1NU4A 4DR3F 4JOUA 1HMVB 1GT8A 2XSJA 3ITHA 3KHHA 2NREA 2D3OR 4QOTA 3M2RA 2AZ3A 2MDAA 2RIJA 4RBVA 3TUJC 4F2RA 1UEKA 2AJ0A 1MNEA 4ZVSB 4F25A 4OHZA 4M5KA 5B09A 2ZNZA 1VC5A 2IIHA 2BW2A 5LL6d 1ZA1B 3M6VA 4C48A 1Y11A 1WORA 4J37A 2IM2A 5H9EK 2CNOB 2HQDA 3PTWA 4B3TJ 2CWKA 2ZDOA 2FIUA 4L74A 2OPPA 3W5ZA 1U25A 3ITHB 2NYHA 2CAJA 4NA2A 3E01A 5GAEU 3OJSA 4N77A 3HVRA 1FD8A 2AGPA 4PKDB 1JJ4A 2CQ3A 2ZZNA 5B7WA 1UZDA 1H0HB 1PYOB 4R25A 2OPQB 4TVAB 5IV3A 4F50A 1Q8LA 4LF5F 1RT3A 1A7GE 2AIRB 3LGNA 1TFWA 2FVSA 2MZSA 1DTQB 1I94F 4DV4F 5J2NA 1HD1A 3ZNJ1 3HT3A 5MLCV 1XIQA 2KVIA 1GEHA 4ZHRA 3GPAA 3W64A 2VPZB 2MZJA 4HI2A 1RISA 5DRKA 4OL8A 5GAGU 3BSAA 2M8HA 2MKYA 1SC3B 3CDUA 1U0SA 4ZJOA 1HQUA 1VJQA 3EXCX 4LBHA 2KM8B 1L3TA 4LF2A 4QJVA 3EX7B 2C22A 4DSJA 3CULA 3DC2A 2DR5A 3KLGA 3AOAA 3MM7B 2QL9B 3MM9A 2BYCA 1R6YA 2V50A 1UCNA 1SIWB 1XQIA 2IM0A 2LFVA 1C1BA 3BKFA 4PXEA 1MU2B 2E7WA 4LRAA 2XO6A 1QY7A 4HHHA 2UXCJ 1HWUA 2O5DA 4MAKA 5IFMA 1FT8A 1R0AA 1R8CA 3R5CA 5HVGA 2E9ZA 3HHLD 4OV1A 4ZLJA 2MMYA 1NK4A 5KG3A 1VQLS 3CVKA 5M2PA 2QSFA 3ISNC 1DLOA 4LRBA 4DN0A 1RWVB 5HP1A 3OHBA 3CDAA 1L3SA 1UJ4A 2VBXA 3CMES 4KHPF 3QGGA 4C8OA 3DLLQ 1EARA 4Q43A 4UY85 1ACMB 2YKQA 3JTOA 3C16A 5KFCA 2CG4A 3QSIA 1DJ0A 1RQ0A 3GLJA 2GVDA 3IP0A 2CJBA 2V8HA 4RO0A 1P9YA 1S99A 3N01A 1TKTA 1S5ZA 2HVDA 4OZJA 3IS9A 2BOAA 5L38A 3GV7B 4USVA 1XNQF 1LXJA 2G13A 4FPIA 1X5OA 3FNNA 2ZHOA 4B3SJ 1B4SA 3RB6A 4PQUB 3A3NB 3FBEA 2FJBB 2QA1A 3A8IA 2MLZA 4DHVA 3L9ZA 5KT2A 3AOCA 5THWA 5G0RA 3UQSA 3C16B 4M5LA 1YZ7A 2FC8A 3KFWX 4DL4A 2MYFA 2HMIA 2CKWA 3K89A 4E2FB 2H65B 2X1FA 3BGRB 2I0XA 5KT6A 1UWBA 3ZZTA 4YR3A 2XMTA 4PXBA 4LSLA 4DN9A 3VZIA 1SCJB 4LFCF 1TKXA 4RW4A 4L72B 3UD3P 2YKAA 4EMDA 3T5HA 1SKUB 4I0WA 1BXNA 1S49A 4HLBA 3CMAS 3LP2A 5KFXA 1HL6A 1FRHA 4IDKA 3K5PA 4NWBA 4DFMA 1WEXA 2CPIA 4O3PA 1GXTA 2VU5A 3OLBA 4USTA 1K9MT 1OS5A 2CNLB 1KQGB 4LVNP 2VODA 5KFGA 3IGVA 3SQOP 1OJ4A 3QQCD 1NKBA 4JYAF 3RB4A 2CJKA 4G1IA 3KLIA 2EK1A 1ZAXA 2DY1A 2EG2A 2QMWA 4LFAF 4ZP8A 1D9DA 2X3GA 3UDEA 2JL9A 4YN3B 2BRKA 4LF6F 4KKOB 4LSLB 1P1TA 3ZTQA 3CO9A 2NR0A 4DFJA 3DMJB 2Z8QA 1U0HB 1NHKL 3CB4A 2IHR1 4C3MA 3T5KA 5J2NB 2K3IA 3SDEA 4E8UA 2KYXA 4ILRA 1S6QA 3C14A 3MOZA 2DGQA 2UXCF 5F8LA 3MHYA 2VD3A 4NZ7A 4QU7A 3WX8A 3QT7A 3H2VE 5CQGA 3GYXB 2DR9A 1TVRA 1HFEL 3I0SA 3V4IB 3CPWR 2QA4G 2OKQA 2QFIA 1GXUA 2QT7A 1S7HA 2VPYB 2UUBJ 2QLXA 4ED8A 1N5VA 4JBCA 3SSSA 4B9LA 4DLGA 2EC0A 2C3MA 1XTZA 5K8NA 1RA7A 3P3DA 4WXWA 1T05A 1WKKA 3KHGA 4IRKA 3GR0A 1LWEB 4MH8A 3HJVA 4OYAA 3GIKA 4GC7A 4FXVA 1RT6B 1DTTA 2R4FA 1H2VZ 1ZH5A 5C25B 1RXOB 3NCPA 5CCLA 3G4SS 4DX7A 1N5SA 1VQ7S 4PWDB 2Q66A 4X4UA 4PZVA 2CPFA 1GMWD 8RUCA 3MM5B 2LXIA 3KLFB 2GFFA 1S9FA 2QO3A 3N5FA 1N33F 4GO5X 1OMSA 1SPBP 2A1BA 1REVA 1X8DA 4AUKA 4KC5A 1Y3JA 3GJSB 2GQQA 3C66A 1HNVB 5D78A 3TWZA 4BHQA 4KGXB 5AE2A 3EICA 3MECB 2OEJA 2Z2YB 5DETA 3WIVA 3J7ZT 4V19J 4WXOA 3DYAB 3IS9B 2DH8A 5KT4A 5KFNA 7FD1A 1RT1A 4IG0B 5A8WB 5GADU 2HNYA 4HR2A 1SVDA 4WK1A 2E5LJ 2FZCB 4RW9B 5F8IA 3G2XA 4DX5A 4QYZJ 3VR1A 2K06A 3GSIA 1X0FA 4K2XA 1CULB 1CS4A 5KG5A 2Y1JA 3FCHA 4JI0F 4KIAA 4NASA 2FVQA 4AL6A 4DU7A 2O66A 3L4BC 3L7OA 5IZHA 2GHPA 3RW6A 3KK1B 4P7VA 1LK5A 1A9NB 1D9FA 4I64A 4M5NA 1NB7A 3H8YA 3KJNB 1FHTA 5CZXA 3BGRA 4LMZA 3W2WA 1NPPA 1U02A 4YUDA 2CADA 3OFFA 3SMZA 4QQBA 1B7YB 1U1NA 1VBKA 2GJIA 1FK9A 3QNWB 3QO9A 2KRBA 3BSCA 1IKWA 4QW9A 3GIIA 3G6VA 1YJWS 3HDSA 1SH3A 3GYGA 1RT2B 2DGOA 2DNZA 4KRWA 4ZS6A 1HQUB 1RLDA 3M8PA 1Q82T 4K59A 3RR7A 1AFIA 2FVPA 5DJBA 1LWFA 3I0RB 1NPKA 2H48B 1WG5A 4MIWA 2I9SA 2WVBA 4FDFA 5A8RA 3PO5A 4LR7A 5HK4A 3ZZOA 4ZDNA 2UZAA 5KFRA 1U2RA 2GGPA 4ZLPA 1UW9A 3FSXA 1DARA 1KRPA 1T7PA 3NNAA 4DPOA 3KG0A 4LR8A 5ETMA 4U95A 2UUBF 3DKDA 4IOBA 2HBQB 3MR6A 2F3JA 2ZZTA 2B3TB 2H5EA 4DR5J 1IBKJ 1NK5A 4UY8T 1HQ2A 2DNGA 3R6LB 1FDBA 3J7YU 3SCJE 3KG4A 4C8KA 3H59A 1K0TA 3PYDA 1RKJA 4NLYA 5K8PA 4WF9Q 1TL7A 2CPEA 1JLEB 4L76A 4CYUA 2UU9F 2PA3A 4J90A 2YBVA 2P9EA 5KFOA 3V4IA 2MZ1A 2EI5A 3CJKA 1ROFA 5DDRC 4UUXA 4J9PA 4X62F 3QIDA 1IR0A 2MY7A 5KFVA 1EHWA 2B7BB 1U2FA 1FXDA 2XHWA 5F8MA 4UTGA 3CO0P 3BJYA 1SKRA 2DPIA 3Q2TC 2B9YA 2M2BA 3GFXA 1SUQA 3BSOA 3MPUB 4G1PA 5DM6Q 1SC1B 1TU0B 3D1OA 2V2KA 1ZZNA 1P8GA 1FTRA 2F8MA 1N5TA 1X0PA 5K14B 2DHXA 3MEEB 3TEHB 2V94A 4CO2A 3M32A 3TARA 1H6KX 4XPCA 4DPXA 4N76A 1IVZA 3C2PA 4PWWA 3L95X 3G96A 4DL3A 1U48A 2E9TA 3F0NA 2J9EA 4ES2A 1R6VA 2KTQA 1GXLA 1RAEB 4J9MA 3DGVA 5LT5A 2ADBA 4OJHA 2I38A 2RKIB 1MWQA 2OMLA 4WIQA 4U8YA 2J9DA 1YJNS 3TA2A 3IWXA 1KR4A 1TK0A 2HVEA 3MDFA 2OI2A 2KM8C 4ECTA 4ERDA 3HSZA 5LSRA 1KLMA 3KKFA 1QTMA 2MSSA 2V5HG 4PXDA 3IMQJ 5KG7A 2DR6A 4N7TA 2OSRA 3VCDA 1S59A 2VBYA 3GIJA 2B6AA 1HBMA 3BR8A 4P75A 1WG4A 3CC7S 5H9FJ 1N34F 3CTRA 3JQKA 1HLWA 3KLEB 2LECA 2V2VA 1S97A 1FVQA 5IT0A 2QX0A 4R5PB 3Q8YA 1UFLA 4AE5A 3ET6B 1JXEA 4QPTA 5K9FA 1M90T 2J6SA 1OPZA 4F8RA 3QATA 2FUG9 2WZ1A 4L3KA 3ILOA 3SEOA 5J2QA 2J0WA 1Z2ZA 3SBMA 4K4YA 2WVCA 2B4OA 4FS1A 4A8FA 5K8MA 4DQRA 2V0NA 2LDYA 1CJTB 1H73A 2F63A 1FRLA 2BDPA 2HNDA 1D9AA 1LK7A 2Q43A 4X65F 4G1QA 3K58A 1R3NA 2BQ3A 1NK7A 2W2NP 3NRBA 3GR1A 2VC0A 4RNNA 2LU1A 4ZVOB 1HD0A 1LW0B 2IVFB 4DUZF 4I1TA 5HL7Q 2CVIA 4E0DA 4DR7J 1S6PB 2RH3A 1S1VA 1VK8A 2K2PA 2UV8A 3DGPB 3NEKA 3DHWC 3PEJA 4QIEA 3UI3A 4K4WA 4Y2MA 1RTJB 3OV7A 2M7SA 2YPZA 2J7KA 2HRTA 4NMXA 3UCUP 2LDIA 1C1CA 2DHAA 1W7WA 4CH1A 2VPWB 2DYAA 3BV8A 3R5DA 2C1EB 4USMA 4JV0A 1G2EA 1DQ9A 2EW9A 3MAHA 4OYZA 4PABA 3G8QA 2E7VA 3PX4A 3IN5A 3KXDA 1QLNA 2VFRA 2QMXA 1KN6A 2VPXB 3I4HX 4Z37A 3HHLB 4CT8A 3PW4A 3FRYA 2AJFE 2DHSA 2EKYA 1S1WA 2A3JA 4ZCKA 2ERRA 3QRPA 1WOPA 2AZ1A 5A2QU 4QR0A 3RG6A 4F67A 4TN2A 3NOGA 3C8YA 1MMLA 4MYTA 2CQCA 2WVDA 1OSDA 3DDKA 3CCLS 4OX9J 1C0TA 3T6BA 3QGHA 2R9LA 1WNEA 1FKOA 1U1RA 3LALA 1R0CB 1Y00A 3S01A 4C98A 3LP1B 1X4FA 4DV1F 2XY5A 2ACMA 3H25A 4JI3F 3JAMU 4USHA 3TUIC 2HHHF 2DXDA 1N48A 1G3OA 1TUVA 2YY3A 2VDHA 2NXCA 2LMIA 3DRRB 4BLGA 1U09A 3KJQB 2VFTA 3UWTA 1XC9A 4IFYA 3OVSA 1RWUA 1KQFB 3DU6A 3MEKA 5CYQA 5KT3A 2JLEA 2LQBA 4JV5F 5HLFA 1VMBA 3CJ3A 4DX6A 2KI2A 1RAJA 2V63A 1Y7PA 4TQSA 3OHAA 2CQ0A 4NLWA 3WX4A 2K7JA 4PPDA 5IT9U 2ZD1B 4M5GA 2RQ4A 3DDIA 2IRXA 3I6PA 2R7RA 2WCXA 2HFUA 2W2QP 4P71A 3EZ5A 3PR5B 5E3CA 2FLLA 3M8QA 5KFPA 2XO7A 3BH7B 3KJVA 3NNHA 1GX5A 1Q5YA 3CDEA 3H0PA 2I5JB 4ICLB 1YGYA 2GNKA 2DNOA 4LBIA 4C6AA 4PPZA 2CZ4A 4GO7X 5D15A 3HT0A 4J9OA 1X9MA 1JLCB 3DOKB 3PYGA 4CO1A 1NRKA 1M5HA 3OTOJ 4ILLA 1S0NA 4ECWA 4YY3F 1CS4B 4IYQA 4Z2XA 1FX4A 5ETLA 2OD4A 2XHCA 3AHPA 4NRUA 4DPTA 3AJDA 5AXLA 2HHUA 2JJ4D 2LQ9A 1Z4UA 2QJ3A 4KR0B 3QMQA 5KTQA 4MFBB 3PIPQ 1FFSB 4OI0A 5C42A 4IUFA 3UE2A 2IA6A 4YQWA 3Q8SB 5CCMA 1HR0F 4NXMJ 1WWHA 3FK4A 5E2QA 1SH0A 2JWNA 3BKUA 1J5EJ 4IRDA 2M0GB 3U27A 2UXBJ 2H5IB 5KG0A 3AA8A 4CI0B 5IC4B 3NKYA 5KFTA 2FYXA 1VOMA 5DQIA 1SB6A 1DQAA 3UD4P 1PYSB 1NJWA 1JXVA 2WBMA 1K8AT 5KFWA 3I0RA 3A3OB 4WK3A 2DTJA 5A8RB 5AJ3J 4DR7F 4X4VA 2IBOA 4EUVA 1SI9A 2OPQA 2ZH2A 1A0OB 1R43A 4NLOA 2YNHB 5BR8F 2FLPA 1UAWA 4O3OA 2CUYA 4DEZA 3R27A 3MR2A 2IVYA 5B0DA 2JOQA 5KG2A 5JVGQ 2A10A 4NYZA 2RD5C 3F44A 3MEDA 5FIIA 2DR7A 4EGLA 2RRNA 4IDKB 5AXMA 3HHLC 3D0HE 3KDNA 1S1WB 4TYAA 3HHEA 4OZ2A 5E3PA 4ZLNA 1WHXA 2VKZG 5KFMA 1N8RT 2AEMA 2KFZA 1RBLA 2XMKA 4P9SA 4F0KA 5T14A 2JEFA 5KFJA 4NRTA 3SSRA 2QL5B 2HFVA 3GMGA 3ILLA 2HZCA 3QWUA 5B0FA 1JLFA 2G0IA 1SV5B 3C3LA 3A12A 2QRRA 3JB9k 4QWBA 2AU0A 3FSYA 2NXJA 3H90A 2UUAF 1T3OA 3FFIB 1UEUA 3DRYA 1ZM2A 2AYBA 4KO0A 1HHTP 4LF8J 4JB8B 4KHRA 4CT9A 4CLTA 4XIUA 4DV4J 2FGCA 5FJ4A 2MKKA 3E2EA 2V34A 1VLYA 1JLGA 1HNXF 3TVYA 1RUSA 1KBRA 4JI2J 1YHQS 2XMJA 4CLLA 5CABA 1U6ZA 3D7SB 2C3UA 1MLAA 3MCNA 2ZE2A 4F4AA 1FNXH 4ANEA 1L3VA 1VDHA 2HRUA 1YWXA 5DZ6A 3F56A 4N47A 1D09B 5T41A 3MOJB 5DG7A 1NEEA 2FHMA 2VC1A 1HHQA 5F3TA 4MIBA 2HPUA 3FKBA 1HMVA 2XSJB 1CQMA 2QYGA 4I4BA 1HWLA 2J6UA 3I9ZA 1AYEA 3BH6B 1FA0A 2RT3A 3S1TA 2XGPA 2W7OA 3R2CJ 3PFOA 5GAHU 4X4NA 4B9SA 3NGTA 5GVQA 2CIMA 2B6AB 1HBMB 2AGQA 4C8ZA 2NSCA 2W25A 5C7PA 4B02A 2B51A 8ATCB 3TAPA 1NJYA 2ZWPA 1RB0A 2DGXA 3EVOA 3ILJA 3UDCA 1Q86T 2N4CA 1X4CA 2KL8A 1ZAVA 2G4BA 2WOMA 1FDDA 4USUA 2BEFA 3OFHA 2R2UA 2Z4PA 3MXHP 1JJCB 2AJ1A 1TMJA 2ZOGA 4DLEA 3VTIA 3TOQA 2QG9B 2V9KA 2KH9A 3MCOA 1VI7A 5T7LB 3BO2A 3HVTA 5CYMB 1H98A 2W8LA 2VONA 1UJ5A 2BJ1A 2DIVA 3PW2A 2G0JA 1N33J 5CYJA 3PX0A 3ISZA 5DDPC 4BS2A 1C0UA 4ZP6A 2G1DA 2N3LA 2PD1A 3OVBA 4OI3A 1Y9OA 1U1MA 1C0TB 4Y00A 3GP9A 2DGUA 1V6HA 3DHXA 1C4CA 3FQLA 2KT2A 3HO1A 2CQBA 3W2WB 4K0KF 1BE4A 4FNHA 4IH7A 5KG6A 1VJWA 2OFHX 1U4BA 1KEKA 2X1AA 4CP5A 3K2YA 2VF3A 1RAHB 2A2CA 2GJ2A 3KJFB 5ADZA 2HS0A 1QVFR 1ZOTA 2YH0A 1KOOA 2E1RA 5D4OA 3R8YA 2RQCA 2ZHAA 3NBPA 2RSQA 3D6MB 1QVGR 3R7BB 5DLGA 3VF0B 3KUEA 4EK2A 4WU2A 3IRXA 1Q53A 5CAAA 3IFEA 2MSTA 3E8OA 2ZBCA 3DM2A 2HK3A 2HFZA 2H54B 2LQ5A 2CNKB 3FFIA 4ATNA 1PSDA 4OYOA 4YHHJ 1XR5A 5A0YB 4ED0A 4H4OA 1SV5A 4PQUA 1FFGB 4HT5A 3VGSA 2YKMA 3CEDA 4DZDA 1HNZF 3J80Y 1B3TA 3THPA 1ZM4A 2R2TA 4Q7AA 1U24A 4JI5J 4H4KC 2Q1LA 4J9UE 4LF9F 3OQ2A 4EZ9A 1JLQB 3ISND 5F8HA 3U1MA 5DG9A 2N7CA 3JYTA 4WIIA 2X51A 4C3KA 2IJNA 3R5GA 3TEGA 2XYPB 4I6AA 4W92B 2B5JB 1LNQA 2O01C 3BKTA 3IRXB 3CCTA 1VBYA 3DRSB 1VQSA 3CF5Q 1VQ9S 1S6UA 3GWCA 2N4DA 4TYBA 3AD7C 1HW9A 1EAYC 5J1EB 4B3OA 3M30A 4BDPA 2XNRA 3QJJA 2SXLA 4ILMA 2ZEJA 4EU0A 2MZTA 3HKZD 1YX2A 1ZBTA 2XTJP 4YB6A 5B0BA 2I5JA 4B9UA 2MGZA 4M5MA 3PRVA 2LQJA 1NKCA 1FJGF 4RBUA 4OYIA 5KFBA 4P73A 4Y2KA 4DI6A 3G6ES 3K7RA 2VQFF 5JVHQ 2ZH7A 1TL1B 2OP5A 2X3DA 4OX8A 1XJWB 1JLQA 1OWXA 3D3BJ 3NGSA 1JLAA 3OFEA 4WFAQ 4PG8A 1MWYA 2DEJA 4PG6A 3TP2A 4NZ0A 4LF7F 1S77D 4C0OC 1FEHA 3HX9A 4QYZK 2YWEA 3HZGA 5IT9Y 1YRXA 3DXSX 1SKSA 3MTKA 4NCAA 3C6UA 4PR6A 4YDXA 5E7OB 1EETB 4ZVQB 2W4PA 3HF5A 4KKOA 4OJ1A 3NY0A 4OFZA 3PXGa 4RUHA 4DUZJ 4Q0BB 3FVYA 5HATA 3RBXA 3BBFA 2PC6A 3K5LA 2ABYA 4DL2A 2XY7A 1PGZA 4LF6J 1OY8A 1ZETA 2JLGA 1MSWD 3OJUA 3IA0A 1LV5A 3RRHA 5EWGA 2WBRA 2R7VA 9RUBA 2BANB 5ETRA 5BR8J 4DL6A 4X4TA 1M5SA 2YKOA 5L8RC 3KMSA 5LMUJ 2XS5A 4ZA1A 1NH8A 4OZ5A 2KHDA 1IM4A 3M2VA 2ALYB 4DS4A 4KTQA 2QMUB 2KZMA 5DS7A 4ZPTR 3S7RA 3OUYB 1J27A 3OVAA 4J9QA 4J9LA 4HI1A 2CQGA 4XDCA 1H3DA 5D77A 4I6YA 4X66F 4IO9Q 3RYLA 3R1HA 2HGMA 1RTIA 2BV3A 1TKDA 3R3TA 2JEJA 1N54B 1B7FA 2UXBF 3NWGA 1RZMA 2ATLA 4DG1B 3DCAA 2LEAA 4JI8J 3TI0A 3DLKA 1BQXA 4DV3J 2LXFA 1NMEB 3DOMB 4ER8A 3BGFA 3MURP 1M0SA 5HVHA 4RWWA 3V6HA 3HD2A 1RT4A 4CO3A 1KC8T 2E29A 4F0HA 2VQFJ 2RRAA 1WC5A 4LFBF 1R8BA 4Y2CA 1EKRA 1YITS 4XDDA 3M8QB 1EX8A 3W66A 3P96A 3VVUA 3MF5A 4OYWA 5F0WA 2E1AA 2ILYA 2W2PP 2RS2A 3AQPA 1DAXA 2R7UA 2MKHA 2VFSA 1IKXB 5E5NA 3MUTP 3BBCA 4ID5A 2MQNA 4ZVUB 5KFSA 4EFAC 1Q4RA 3IG1A 2KFYA 2KT3A 3GG1A 1FFWB 4FVCA 1CEZA 3TUPA 2XYGB 2Z30B 4KY3A 4ANCA 5CD4A 1VGYA 2Z2MA 4WE1A 4NE9C 3HXMA 3P5BP 4M5IA 2XLJA 4DV0F 4GKKJ 4R0JA 2VQEF 2FVCA 1MN7A 3BZQA 1RACB 2F65A 1QD1A 2AV5A 2CJ9A 3B6BA 3CE8A 3W62A 1FE4A 1RT5A 2XNQA 2QLBB 4EZ6A 3OTDA 2W9CB 1RKIA 2NXNA 3B4MA 4WTYA 2XBPA 2WB1D 4KGZB 4U9RA 2E5HA 2MKIA 1XMOF 1ZS6A 4DSFA 4A48A 2CQPA 2FZGB 5J2PB 2BM0A 1AB8A 4ZPDA 3R2DJ 1F2HA 5HQMA
chains in the Genus database with same CATH topology
4I56A 5I42B 4IR9A 3A1YG 2E9RX 3WDOA 1FRIA 2CQHA 4LT6A 3GQCA 2FJEB 5KT5A 1KONA 3TYTA 2YH1A 1KD1T 5E41A 1QSSA 4RNOA 2L08A 4C97A 2JEIA 5BJRA 3T1YF 4O3SA 1JB0C 4CQ1A 1FE0A 2O67A 3M8RA 1W2BR 4NLUA 3CD0A 4A8YA 3HHKA 2JZ5A 4ELUA 4ZP7A 3PKMA 1RA6A 3DFEA 3SDEB 1EP4B 4KV8A 3KTQA 4NLXA 3P6YC 3ZZRA 4CH7A 1N4LA 4WU3A 2CPXA 2FVRA 2LA6A 4LVOP 1KFSA 4FYDA 5HMYA 3H4BA 3HKWA 3D0GE 1S10A 1PC4A 1ZPVA 2HIQA 3ICLA 2HS3A 1F0XA 3OPKA 5I3UA 5FLXY 1T8EA 2GMJA 3OUYA 4DR2F 3QJLA 4JI6F 2HHVA 2L48A 4K4TA 3HHLA 4B9TA 2AW0A 3MR5A 3HVWA 4O23A 4C9DA 1U49A 3PVXA 1TR0A 1W25A 3BN4A 1KHWA 4JI8F 4OLPA 1ZTTA 4P2SA 2VOPA 3E3XA 3LP1A 3BO3A 2ZZMA 3EPGA 3X1LB 2EFOA 2HNYB 4ETXA 4FXWA 4MK8A 4F3QA 2X1GA 2J0QD 3CUNA 1V3ZA 5BYQA 1DBDA 4U7CA 4JI2F 4OHXA 3C46A 2HHTA 2C2EA 3DRRA 1G6BA 2VG5B 2WRMA 3V5RA 3MMCA 1WHVA 1REVB 1LKZA 3KNAA 2BABA 2PMHA 1PILA 2GQCA 2Z2LA 4DQIA 2IRUA 1N36F 1N52B 1N88A 1KNZA 2O1PA 2B5JA 4KHMA 4R8UA 4QIGA 2BR0A 4URGA 3HMJG 4NCGB 2DGTA 4WKRA 3HM9A 3MMCB 4AFFA 2MQQA 3NAIA 1BQNB 1IXKA 1Y5NB 4RW8B 3LOUA 1O51A 2HQIA 4YB7A 4ETZA 5GAHI 3EUNA 3H98A 4QIFA 4AYBD 4RNMA 1DRZA 1OQ6A 3EGNA 2IBKA 3DLJA 2Z0GA 1TKZA 2YKNA 1E6YA 4PQAA 5I42A 1RJJA 3MEGB 4ID8A 4Q2MA 5BYSA 1RYSA 4IH6A 1D8YA 2HWIA 2GGPB 5C24A 2L9NA 4IO1A 4M94A 2HWHA 2R7TA 1HBUA 2L3MA 1F2GA 1S9GB 2FB0A 1RT3B 3DN9A 1HWKA 3CIZA 2XSFA 3VAHA 4TLQA 2BUNA 4PUOB 4F02A 3BQ1A 2FLOA 4IQMA 5EUHA 1KQKA 1QUVA 4M95A 1U45A 2ZOFA 2BXJA 4CTAB 2DR8A 4QU6A 3UFCX 4KFBA 5K5MA 3WZ0A 2IVMA 2M5YA 1FERA 3AY0A 4C11A 2LVWA 4HH1A 4QIWD 3KLGB 1U1PA 2ZH3A 1UVMA 2QA2A 3M8SA 1ZM9A 4ZCIA 1IKXA 5A2QY 5MAOA 3RRGA 2IYIA 4PG4A 4CZCA 1DURA 5D6GA 3BREA 3K5MA 5BYRA 2JH3A 3POTB 2DH9A 3OTCA 4Q2LA 2YNFA 3V6KA 3D0IE 2V8GA 2MKSA 1RTHB 4NLQA 2DH7A 4FZVA 5IXUA 1NK0A 2IM1A 3AA9A 4YFUA 2ROEA 3W3SA 3EPIA 2E5GA 3FDSA 1S1TA 4DV2F 4Y2IA 2ZD1A 2DHGA 1BD6A 1IKWB 1TKTB 1RT2A 3VWSA 2LXUA