1N6QB

Hiv-1 reverse transcriptase crosslinked to pre-translocation aztmp-terminated dna (complex n)
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
429
structure length
429
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/immune system/dna
molecule keywords 5'-D(*AP*T*GP*CP*AP*TP*GP*GP*CP*GP*CP*CP*CP*GP*AP*AP*CP*AP*G
publication title Structures of HIV-1 Reverse Transcriptase with Pre- and Post-translocation AZTMP-terminated DNA
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 100
structure length 429
sequence length 429
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2002-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1n6qB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1n6qB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1n6qB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1n6qB03
3I5BA 1OS5A 3C6TA 2V0NA 4MK8A 3MR2A 2R2SA 4ICLA 1NHVA 4TLRA 5KFBA 1HNVB 1TV6A 4IFVA 5KFHA 1IKVA 2WOMA 4WE1B 4ECSA 3TVKA 4JV1A 4JV2A 2IM0A 1LWCB 3GV8B 3DRSB 4JV0A 2YNGA 3BQ1A 4B3OB 2HAIA 2W8KA 4MFBB 3KLFB 1IKWB 3KOAA 2YNFA 4R5PB 2W9CB 4H4MB 4ID5B 4PQUB 4IH7A 1JLAA 1VRUA 1RT1A 2ZE2B 2HNYA 2VG5A 1RT7A 4WYWA 1TL3B 4IR1A 1S1TB 3KJVA 2R2TA 2FLPA 4J9RA 4LSNA 3GQCA 3G6VA 5I3UB 1NNDA 4KHRA 4ZP7A 5K14A 5HROA 5CYQB 1FKOB 2IM1A 2VA2A 3C6UB 3MEEA 2DPJA 1JLQA 1SUQA 4ZMMA 2BQ3A 4KO0A 4RU9A 4IG3B 2V9WA 1BQMA 1HPZA 2YNIA 3MF5A 2E9RX 3M9OB 4ZPDA 4LQ3A 2IC3B 1RA7A 2D3UA 4EYHB 3NAIA 3M8PB 4I7FA 1TV6B 2GIQA 4WZQA 5KFLA 4ZVEA 5JXSA 5JUMA 3RBEA 2ZD1A 1S6PA 2YKNA 4RW9B 1FK9B 3DOKA 2B43A 4DL5A 4Q8EA 2YNFB 5I42B 4NLDA 5DQGA 4KFBA 4FBTA 1EP4B 4IG0B 4F4ZA 3DOLA 2B5JA 4J9MA 1KHVA 2B6AB 4Y2CA 3DRPB 4FS2A 3DMJB 4J9SA 2VG6A 3KLHA 3MEGA 4LSNB 2WCXA 2W9BB 3H5YA 5CYMB 1RTHA 3IGVA 3DRRB 4ED8A 3TAMB 4IKAA 4WXWA 2RF2B 4F50A 4I2PB 3MR5A 1C1CA 1JLQB 3RAXA 3BGRB 4O44A 2D41A 1R0AB 4PUOB 2CKWA 4KKOA 1N6QB 2I1RA 2FVPA 1MU2A 2YNIB 1JLEB 1C1BB 3QGIA 1RYSA 4G3IA 5L1KA 5C25B 4EYIB 5F8NA 4YR2A 4NLWA 3ITHA 2IM2A 4O4GB 4ZP9A 1NHUA 5L9XA 3JSMB 3SFGA 5KFMA 1N5YB 3LP0A 5KG0A 5KFNA 2XCPA 5L1IA 1EETA 1S1VA 4I2QA 1WNEA 1HNIA 2ZD1B 1S48A 3PW0A 4EBDA 2YKNB 3OL8A 2ASJA 3OSNA 2BQRA 4EEYA 4X2BA 2OPQA 4ECTA 3NMAA 4NCGA 3DOLB 3H5XA 2YKMB 4GC6A 1S1UB 2VG6B 5EDWA 2AU0A 4DL2A 1RTJA 3MEGB 1LW2B 1JLGA 1IM4A 4NLOA 5KFTA 2OPPB 1S9GB 2FLLA 4NYZA 2WONB 5KFCA 5KFWA 3I5CA 5EWEA 3LALA 1JXLA 4K4TA 4MH8A 1KLMA 3KNAA 5J1EB 3T19A 1HMVA 3BR9A 3DLGB 4O44B 2UVRA 4O3PA 1S0OA 3FFIB 4Q44A 4IH6A 1Z4UA 1RAJA 1HNVA 5DGAA 2XI3A 1RT5B 1DTTA 4TYBA 3IN5A 3E01B 1MMLA 3ITHB 5KT7A 4Q8FA 4ECVA 4B3OA 3GILA 1TKZB 4MFBA 1IKWA 1JLFB 1RT3A 1EETB 3NL0A 2BRKA 2FVCA 4R5PA 4RNHA 5EWGA 4H4MA 4LQ9A 4PQUA 3GIJA 3EPGA 5J2PB 4ED1A 2ZE2A 3KLEB 3BSOA 1TL3A 4F4XA 4TY8B 2AX0A 2FLNA 1S6QB 2JLEA 1TKXB 1TL1B 2C2RA 2IMWP 2GIRA 5KFXA 4WZMA 2IAJB 5I3UA 5F8JA 1XR7A 2RKIB 5CYQA 3HHKA 1FKOA 3KK2B 3N6LA 4WFXA 4YMEA 2C2DA 4Q0BB 4ZVHA 3C6UA 4F4YA 2IA6A 2EC0A 1QAIA 5KFSA 5KG3A 4MIBA 3RAQA 4ZP8A 3FSIA 1HQEB 2J6TA 1QE1B 4IG3A 4QPXA 1KLMB 1LWFB 2IC3A 3CDUA 4NLYA 3OL9A 4OL8A 3PW7A 4ZHRB 3M8PA 3IGNA 1I6JA 2OH2A 4TQRA 1JIHA 3DLKB 4YR3A 3T5HA 1DTTB 4EBEA 4RW9A 2GC8A 4LSLB 2OPRB 1FK9A 3Q8PB 5F8HA 4K4XA 1RT3B 4O3SA 5I42A 3RBDA 2JEGA 5DLGA 4RW8B 1EP4A 4IG0A 2QV6A 2FVSA 2WHOA 2WRMA 5KG7A 5EWFA 4ZPBA 2B6AA 3BREA 3DRPA 4NRTA 3OLAA 3DMJA 4DL7A 3CJ5A 1S9EB 4NLRA 2W9BA 4IFYB 5CYMA 1TKTB 4NRUA 3JYTB 3NGDA 1JKHA 3DRRA 1D1UA 3TAMA 5KFVA 2RF2A 3BQ2A 2UVUA 4I2PA 1DTQB 3BGRA 5KT2A 1S0MA 1W25A 1R0AA 4PUOA 4IRDA 1N6QA 1S4FA 4IDKB 4DL3A 5DQIA 3ICLA 3Q8SB 4KV8B 1JLEA 1C1BA 3V6HA 4TXSA 3Q8RB 5C25A 1RT6B 1HYSB 3H59A 3FDSA 1C0UB 4QWAA 4O4GA 3PR4A 2R8KA 1S1XB 3JSMA 3TQ1A 4K4VA 4K50A 3QIPB 1N5YA 2XC9A 4O3NA 3LP2B 4ECXA 2IJNA 2VG7A 1S0NA 3KHLA 1JLCB 5FDLB 5J2QB 5KFGA 5HLFA 1K1SA 2J6UA 1S49A 3UR0A 4ED2A 3MEDB 1JLBA 3RB6A 4ZP6A 1S1WB 4RUAA 2YKMA 2JC0A 3PR5B 3KLGB 2XI2A 1S1UA 1YVFA 3SI8A 1LW2A 4HKQA 5HBMB 1U09A 5F9NA 2OPPA 1S9GA 3I0SA 4KAIA 2AGOA 1JKHB 2WONA 1CSJA 1RYRA 3T5LA 2CJQA 5KT3A 5J1EA 2HWIA 2FJVA 3DLGA 4ZVGA 5J2NB 4J9PA 2ILZA 3DLEB 3FFIA 4IRKA 4IH5A 2BANB 4KB7A 1UWBB 1RA6A 1N56A 2AWZA 1IKXB 1RT5A 3CO9A 3E01A 2BE2B 5DGBA 3LP1A 5KG4A 3MFHA 1TKZA 1C0TB 1JLFA 2AGPA 2VG7B 2HMIA 4YQWA 1HQUA 5J2PA 3KK3B 5KG2A 2HNDB 3NKYA 5HLFB 3I5AA 3KLEA 3QZ7A 4TY8A 4NLPA 5KFZA 4RUCA 1JLBB 1S6QA 1TKXA 1TL1A 1DLOB 4URSA 2IAJA 1J5OB 2R8JA 4ZPAA 1C2PA 2RKIA 3G86A 3KK2A 5KFIA 4QW8A 4Q0BA 1S10A 2JEIA 5F8LA 4RNFA 4ECUA 3I0SB 3KLIB 3GIKA 2QE5A 5C5JA 4PWDB 1HQEA 1VRTB 3PHEA 1QE1A 2W9AA 4Q45A 4YR0A 1LWFA 5L1LA 2AQ4A 3H2LA 5HP1B 3V4IB 1XR5A 4TQSA 3CDEA 1SH0A 4ZHRA 4NLXA 4URQU 3MTKA 5KFJA 3GIIA 2E9ZA 3QLHB 3V6DB 3DLKA 1FKPB 3D5MA 4TYAA 3GV5B 1GX5A 3KK1B 5KFQA 3LP1B 5KFFA 4QWCA 3IS9B 4RW6B 4LSLA 2OPRA 4G1QB 5DLFA 3NBPB 4IQXA 4ECYA 5C24B 5KG6A 2HMIB 3DI6A 1HQUB 4ED6A 4RW8A 4XO0A 3PZPA 5DG7A 3KHRA 4RW4B 4XPEA 5D3GB 3UDLA 1T05A 2D3ZA 2ILYA 1D0EA 4MKAA 4O3QA 2OPSB 5EUHA 2J6SA 1S9EA 4IFYA 3BJYA 2DPIA 5DG8A 3ISNC 1TKTA 3JYTA 1IKYA 3H4DA 4RNMA 5KFAA 1K1QA 1DTQA 2YNHB 3PJXA 4NLVA 3PVXA 4IDKA 2IM3A 4DG1B 4KV8A 4ED0A 4IOBA 3Q8QB 4ECZA 2UVVA 3LAMA 1RT6A 1HYSA 4TN2A 1C0UA 1S1XA 1BQNB 4RNOA 3KHGA 3IRXA 3QIPA 2R8HA 1HARA 3LP2A 3H5SA 3PW5A 1REVA 1ZTWA 1S9FA 4J9QA 1RT4B 1JLCA 2F8EX 5FDLA 5J2QA 1LW0B 2ASLA 3DI6B 1TVRB 1RTIB 4RZRA 3MEDA 3V81B 2WK4A 4WFZA 3OLBA 1S1WA 4M95A 3CIZA 4J9OA 4RW7B 4KE5A 1T03B 3ISND 5L1JA 3KLGA 1T05B 1QAJA 5F8GA 3CJ4A 3NAHA 1GX6A 4WXOA 5HBMA 4R0EA 4EBCA 3HVAA 1IKYB 5J2MB 4K4YA 2R2UA 5C42A 3BSNA 4IRCA 2O5DA 3EZUA 3MFIA 5J2NA 5KFEA 5F9LA 3DLEA 4R8UB 1RT2B 4ZPCA 2BANA 1ZTTA 3UQSA 1LWEA 4NLTA 1UWBA 3FQLA 1IKXA 3G6YA 3G6XA 2BE2A 2I5JA 5F8MA 3PW2A 4Y3CA 3IRXB 3KHHA 1C0TA 3T1AA 3QO9B 2FJXA 2ALZA 4O3OA 3QZ8A 1REVB 3M8QA 3GIMA 4J9NA 4GC7A 4KHMA 3DM2A 4NLSA 5F8IA 3KK3A 2HNDA 3FQKA 4QWDA 4K4WA 3PJWA 4ECWA 3RB0A 3I0RB 3CVKA 5DQHA 5KFKA 1DLOA 3H40A 1J5OA 2XGPA 2RDIA 4K4UA 4O4RA 5KT6A 1RTDA 3C6TB 4IR9A 3KLIA 3HKWA 4ICLB 1TQLA 4PWDA 1T3NA 3DYAA 1VRTA 5C42B 2WB4A 3MECA 4IFVB 1IKVB 2WOMB 3CWJA 3QGGA 4FS1A 1KHWA 3D28A 4ECQA 1N4LA 4XPCA 5HP1A 3V4IA 2UUTA 3EPIA 2YNGB 1LWEB 3QLHA 3V6DA 1FKPA 3OHBA 2C28A 2BRLA 5DG9A 3RB3A 3KK1A 2I5JB 1JLAB 1VRUB 1RT1B 4H4OA 2HNYB 2VG5B 1RT7B 3IS9A 4G1QA 4RW6A 1SH2A 3NBPA 3KJVB 4Y34A 5C24A 4QW9A 3OL7A 1S97A 3M8QB 3SFUA 3E51A 4Y2AA 3DM2B 2RDJA 5K14B 5HROB 2ASDA 2JEJA 4RW4A 1SH3A 5D3GA 2R8GA 3N6NA 4WYLA 1T94A 4U7CA 5KG5A 3MEEB 2OPSA 3VQSA 5KFYA 4TY9A 2XCAA 1SUQB 2FVRA 3CJ2A 4NZ0A 5KFRA 4RNNA 3FRZA 4KO0B 2ATLA 2XGQA 3LANA 1BQMB 3V6KA 1HPZB 3GYNA 1RTDB 4J9KA 2C22A 2YNHA 3CJ3A 3OHAA 3GV7B 3DYAB 2HNZA 3IG1A 4I7FB 2WTFA 3MR6A 4URGA 3MECB 4DG1A 4K4SA 2JC1A 2W7PA 3V6JA 2C2EA 3MR3A 1S6PB 4EO6A 1QUVA 3H98A 2BQUA 4JUZA 3DOKB 1BQNA 3HVWA 5T14A 4H54A 4KFBB 5KFDA 3UPFA 4WFYA 2B5JB 2ZKUA 3DDKA 1SV5A 4NLGA 2VA3A 4H4OB 1RT4A 3CDWA 3QYYA 4NLQA 4HYKA 3T5JA 3HVTA 1LW0A 5KFOA 3KLHB 4MK9A 1TVRA 1RTIA 3V81A 2V4RA 1RTHB 2E9TA 4RW7A 3KMQA 1T03A 4KSEB 2IJFA 4DL4A 4FBUA 3M9MB 4NLUA 3OSPA 1C1CB 4ED3A 3KLVA 4Q43A 4KKOB 4DEZA 4ED7A 2UVWA 5J2MA 4MKBA 1MU2B 4ECRA 4YP3A 3N6MA 4F4WA 2AX1A 4EO8A 4QWBA 3M9NB 4WE1A 1TP7A 5KFPA 4MK7A 2XWYA 1LWCA 2W8LA 2HNZB 3IG1B 3DRSA 1RT2A 4R8UA 2FJWA 2R8IA 2BR0A 5KFUA 4KBIA 3KLFA 3H5UA 3OL6A 3LAKA 3LP0B 3BSAA 3KMSA 2IBKA 1S1VB 4MIAA 2UUWA 4I2QB 2W9CA 4K4ZA 1HNIB 4ID5A 1RDRA 2W7OA 4O3RA 2JEFA 1N48A 3RB4A 4J9LA 2OPQB 1ZETA 4U6PA 4M94A 1S1TA 3QO9A 2R2RA 3BQ0A 4NCGB 3QIDA 4DL6A 2AGQA 1SV5B 5KT4A 3BSCA 3CJ0A 4ZVFA 2V4QA 3QGHA 3HVTB 1RTJB 3I0RA 2HWHA 3PW4A 1JLGB 1JX4A 1XR6A 3H4BA 5KG1A 4QWEA 2D7SA 5KT5A 2FVQA 3T5KA 1HMVB
chains in the Genus database with same CATH superfamily
2LYVA 3DOMA 3TA2A 1U25A 3W63A 4IFVA 3Q2TC 3DRSB 4N56A 2YNGA 3ZO7A 1GAOA 3VGVA 3NS5A 4PYAA 3QSYB 4U67Q 5A6PA 1RT1A 4A8XA 2VG5A 2FGCA 3G6VA 4UF4A 5HROA 3VGSA 1UA0A 3FGVA 4ZPDA 4LQ3A 2XG8A 2D3UA 3NAIA 9ATCB 2MSSA 1TV6B 2PC6A 4NL5A 3I56S 1GMVA 3PX6A 1ICEB 2ZHBA 3KFWX 2EFGA 3R2CJ 4Y65A 2VH7A 3BEGB 4FXVA 2VD3A 3WBZA 3RAMA 4QU6A 2J76E 1R43A 3TYTA 3GONA 3IM8A 3QJJA 4LRDA 5HL7Q 4WU2A 5L9XA 1F5BA 2HLUA 5AXMA 4ZOSA 3OL8A 4UTGA 1VS3A 3NMAA 2KYZA 2CPEA 5J1NA 4J9VA 2XNQA 1S1UB 2QYGA 4TVAB 1JLGA 1R8BA 1VK3A 1RCOB 5KFWA 2IMOA 3PX0A 3TVZA 3K5LA 2J5AA 1T9UA 5U47A 3UN3A 4X4SA 3NGTA 4CH7A 2FLNA 2FHOB 5E2QA 3D6HB 4R25A 1GXLA 2IA6A 2AEMA 1KLMB 1CG2A 2FD2A 1HHQA 3M2VA 4K59A 2I2YA 3J7YI 4ZPWR 4QR2A 1CQMA 4K0KF 1T11A 4U9RA 2GVDA 1D1UA 1FE4A 5BXIA 2CQCA 5KT2A 1R0AA 4IRDA 4Q5VA 1RT6B 3HHLB 4I4BA 3HO1A 1SKSA 2V2KA 4QWAA 3FSXA 1QLNA 4X4PA 5FDLB 5B09A 5IS2A 1XERA 2AHOB 2FGOA 2AJFE 1CBKA 3I0SA 4ETXA 1EAYC 4QR0A 5GMEA 1H6KX 3IWXA 2LKZA 3SQOP 4L6V3 2EW9A 4IOAQ 1VQYA 3R5BA 4DPTA 5HVGA 2HNDB 3KLEA 3MD3A 5ETNA 4A8WA 2HFZA 3NLCA 3ZZRA 3KK2A 2ADBA 5L39A 5I3QA 2RU9A 2V2VA 2E7VA 1D9DA 3PHEA 1QD1A 1IR0A 1VRQC 3GIIA 3CCVS 2BV3A 5DLFA 2OKQA 3OR1B 4RW8A 2GMLA 4PEOA 4P9SA 1Z2LA 4ANCA 4PG5A 2D3ZA 4DUYJ 4NZ6A 3RGIA 2DO4A 2CUYA 5AXLA 3D0IE 1M5OC 3NXZA 2XMTA 3FBEA 5GAEI 2W2NP 1NCLA 2KFNA 1F1BB 2COLA 1C0UA 2KO1A 2L41A 1M1KT 3IRXA 5J2QA 2VOPA 1XQIA 3T1YJ 2RE1A 1B0PA 4ZCLA 1XC9A 1FJCA 4IRCA 4E2FB 4JI0J 4R8UB 4W4MA 2OFGX 1UVMA 4C0HA 1BLUA 2CADA 1IQZA 3K17A 4O3OA 4K2JA 2VKZG 2RS2A 2RDIA 4NMLA 4B9TA 2DO0A 1N36J 1UTAA 4FYYB 4PWDA 3DYAA 1FNOA 3D6FB 3CC7S 4CRJA 1MG7A 2I5JB 4QYZK 5CCMA 2J9EA 1RBLA 3ZTSA 3FCWA 3EYZA 3JQJA 3IRWP 1U2CA 4C98A 1HPZB 1G3OA 1NDLA 5LSLA 4DUYF 3MM9A 4FXDA 5ETMA 4NYPA 1XNQJ 1G7CB 3HVWA 3W60A 3AODA 2HFSA 3TZYA 4H4OB 3CDWA 3W3SA 4AD6A 1U2RA 2E1RA 2MKYA 3T1YF 3CUNA 5H9FJ 4HLBA 4ZLPA 3M1VB 2KTQA 2GS8A 3LAKA 2ZH3A 4JI0F 1UW9A 2JEFA 3RB4A 4X4TA 2Z30B 3HVTB 2BOAA 4RO0A 3C6TA 1XMBA 4PZVA 4LRAA 4Y0FA 1CVJA 3TVKA 1N33J 3UFCX 1KVIA 2VJVA 1L3KA 2HKEA 4WIQA 3QWUA 1NLKL 3ULHA 4J9RA 4AE5A 3MEEA 4F04B 2D3OR 4KO0A 2YWKA 4CZCA 4S0MA 1VQNS 3GP9A 2Y1IA 3T41A 1BMQB 3HXMA 3DOKA 1NUEA 3JQKA 1XNQF 1FEEA 1KHVA 1HNXF 3H5YA 5CYMB 1R0BG 4UY85 1C1CA 4YB5A 1ZBTA 3W9JA 2NPFA 2M8DB 4ZP9A 5L1IA 1N8RT 2EXUA 3G8SA 4ATNA 3I32A 1X4HA 2RMLA 3JQMA 3LUYA 2VG6B 3O1LA 3MEGB 1LW2B 2DNZA 3BKTA 5GADI 2EBEA 4O3PA 3WHIA 5B0FA 1RAJA 2MLXA 5HVFA 1PGZA 2JLGA 1FE0A 1T02A 2BRKA 1N33F 1HBNA 3K8VA 2NUHA 1WKJA 1S6QB 2PMHA 3JSRA 4Q0BB 4F3OA 4RLEA 1QAIA 2FZKB 5KG3A 4MIBA 2J6TA 1U1KA 1LWFB 2FY8A 5ETKA 3PW7A 4ZHRB 3G4SS 2QLJB 2RH3A 3JAMU 4DPUA 1KSPA 2I8EA 4ZPBA 5IWAJ 5LSRA 2LVWA 3GFYA 2L3MA 2H48B 2RF2A 2C3YA 3B78A 2UVUA 3TJ8A 4PUOA 3BBFA 6FD1A 4LBIA 4DL3A 2FLOA 1IJEB 1H3DA 5D4LA 3EVWA 3LP2B 4UOFA 3VAFA 4DPOA 1JLCB 1U26A 2VOOA 4B9UA 3DNCA 3CCES 1SKRA 1T9WA 1RCXB 4ZVGA 2RQMA 5LXRA 4IRKA 2CJKA 4DF4A 2E66A 1VDHA 3GYGA 3H90A 2LU2A 1C0TB 2MKCA 3N01A 5GMKa 3ETOA 3QSIA 1U2FA 5H1SV 4ZPAA 3G86A 2CQHA 1KRPA 2KM8C 4EZ9A 4DV1J 2G1HA 3O2IA 5A8KB 1IBLJ 5BYSA 1SKUB 3B82A 4DV2F 4AQYJ 2OPSB 4DR6J 5IWAF 5KAKA 4RNMA 1MWZA 3CCUS 4JI3J 1K1QA 3OR2B 3VVUA 5T41A 4RBVA 4LBPA 1GXTA 3ILIA 2DCLA 3P49B 4IOBA 4ECZA 5GAHI 2HG4A 1S1XA 4LREA 5G4DA 2R8HA 4D3HA 1VBZA 4X4NA 1HWIA 5CA5A 3BZQA 1UJ4A 1TVRB 2HZCA 2DR8A 2KJWA 2XMJA 2R4FA 1AROP 2HHXA 1F2GA 1VK8A 4DX8H 1RADB 2W4DA 3PM9A 2DNGA 3CCLS 1ELOA 1VMBA 1GEHA 1IN0A 4NE9C 4X64F 1AXQA 1JJHA 2GJIA 1QSYA 5A76A 2E29A 3CVKA 4Z37A 2IYGA 4K4UA 1CJKB 3DU6A 2IDLA 2N3OA 1VRTA 2CNNB 2H5JB 3EPIA 4J9UE 1UJ6A 4DV1F 2BRLA 3BR8A 3QQCD 1IBLF 5EN1A 3UNYA 2ZUAA 2ASDA 5K14B 3W8PA 2JEJA 1D8ZA 3FBCA 5LSOA 4TY9A 1WHWA 2XHCA 1WF2A 2G13A 4DR6F 3OHAA 4YOEA 2OTJS 4K4SA 1V6HA 2J0SD 4MAKA 4F26A 4JI3F 1GK8A 4ERDA 1LK5A 1FESA 4A8KA 5KOWA 2RB7A 3PCOB 1QAYA 2GQQA 4F2SA 4HYKA 2WSCC 1A6LA 3GWCA 3FBFA 2R7TA 2YBVA 3PV8A 4L72B 4DEZA 3N6MA 1Y11A 4M5IA 4C0OC 3NWGA 4USVA 4K4ZA 2W7OA 5D0GA 3QIDA 3BSCA 4ZVFA 3HD1A 3VAHA 2LQ9A 2WW8A 2HWHA 2M2BA 2I38A 2CJYB 1HMVB 4B9LA 2G9OA 1M5SA 4X4RA 2ROPA 1HNVB 1EKRA 1RXOB 1X5PA 3ZTRA 4KGKA 4EWTA 4ILMA 4CNZA 2HS4A 3TEHB 2W9CB 3ZNUA 1ITPA 3QAUA 1S1TB 1NK0A 1VQ5S 1B0VA 2DNQA 1K0VA 2VA2A 3HFVA 3HJVA 2YX4A 4NZ7A 4BHQA 3A8EA 2E9RX 4EYHB 3BB5A 3DOMB 4I7FA 1I1GA 4Z2XA 4KR0B 4LRFA 1H73A 1Y5NB 4Q8EA 4Y2MA 2ZDOA 5HJXA 2B6AB 2W9BB 4IQMA 3TWZA 4DL0C 1VQ8S 4L3KA 1B0TA 4O44A 3EVOA 2GNKA 5L1KA 4EYIB 1RGVA 5KFMA 4OX9J 5KG0A 4RX6A 2RSQA 5JJBA 1KP6A 4ECTA 1J5EF 3P4UB 3D4JA 2G2YA 2LEPA 3I5CA 4KJIA 4OZJA 2OD4A 4WTYA 4NCAA 4KT0C 2YKPA 2BBEA 1VLYA 3MPVA 1DTTA 3E01B 3AY0A 4MFBA 4R5PA 4DX6A 2LXUA 2HIYA 1KLNA 5IM0A 2LECA 4CQ1A 4E0DA 4B3TF 2IJRA 3W62A 2ZM6J 1Y5LB 2EFNA 1RQ0A 3UE2A 2HBZB 3N0VA 4LR9A 4LF9J 2OPRB 1AZSA 2NR0A 3PY8A 1CJUA 2V4JA 3V2UC 4ER8A 1KC8T 3MUMP 2CVEA 1BHNA 1C4AA 2NZCA 1JLEA 4BS2A 3D3BJ 1S76D 3TQ1A 4K50A 1R8CA 5A6WA 1G2EA 1HWUA 3M2VB 2Q1LA 4OX9F 3RB6A 4M5HA 2AJ0A 2XI2A 1N0UA 4ZJOA 5HBMB 1ZZFA 2ZC3A 4C6AA 2WONA 4OYAA 2MHEA 2DNYA 3FZ2A 1YZ7A 4KPYA 1RT5A 1ZAXA 1HQUA 1X5OA 2KT5A 1TL1A 1DLOB 3E8OA 1UVIA 3ZTQA 2DISA 5J1PA 5KFIA 3BM7A 3I0SB 3PIOQ 5C5JA 4DV5J 2VBZA 1KONA 2CFXA 3H2LA 2Y1JA 1V3ZA 4U95A 1NSKL 3D5MA 2ZM6F 2XS5A 4LF9F 3OFEA 5EX0A 4TU9A 1VBKA 4NLVA 1UETA 3UDVA 1TL7B 2HW3A 4X4OA 4TU7A 3K57A 2ZZMA 1NKEA 1RZMA 1UKUA 3OJUA 1HWLA 4HHHA 1ZAWA 4R0EA 1X9WA 1RE1B 3L95X 4B3SF 3BSNA 4CP5A 1S7HA 2ZWPA 1MROB 1JQGA 1U8WA 2MKSA 2CNOB 1WDTA 3IRXB 2JDJA 2POKA 3KK3A 3PJWA 1HI0P 3TA0A 3H40A 2LU1A 2ADCA 2KXNB 1AFIA 4DV5F 4ZLJA 3VZHA 3FKBA 4DR4J 2M5YA 2UVVA 1RT7B 4Y34A 2OI2A 1S97A 3T6JA 1DRZA 5A8WB 5D3GA 1NH7A 3PRVA 1RP5A 4LF5J 1KKHA 1U0HA 3DYAB 2HNZA 4DG1A 2FHJD 5JVGQ 2M4MA 4KFBB 3FCVA 1VI7A 1LW0A 5DDQC 3D9BA 1RTHB 2IJFA 4FBUA 1FERA 3US5A 4ED7A 1AW0A 4C8NA 1MU2B 3IO1A 5CQGA 2FJWA 1S1VB 1I3OB 4I2QB 4ID5A 1EQMA 4C4WA 1L3SA 4NCGB 2FZCB 1SC1B 1VGYA 1Q16B 3I5BA 1SJ3P 4DXLA 4ZCMA 2EC2A 5KFBA 1FO1A 4UW2A 2XTJP 2V6AA 2LDYA 4IH7A 1JLAA 3GQCA 4C97A 4DR4F 4DF8A 2IM1A 2F5GA 3LA0A 1G4CA 2XEXA 4I6AA 2LMIA 5KFLA 1Q53A 2ZD1A 3EMTA 2MGZA 2V2QA 1KBRA 3M32B 5DQGA 4OYIA 1KR4A 4BWJA 3N79A 3H0PA 3AQOA 3W2WA 3DRRB 2P5VA 2D41A 1S77D 3W64A 1C1BB 2W2PP 4LVOP 4P2FA 4KY3A 1OIAA 5C25B 3VTIA 2IM2A 3JSMB 2OSQA 1N5YB 2XCPA 1HNIA 3VGTA 3CE8A 4F3QA 3CDBA 3OSNA 3OFFA 1MNEA 2PDAA 1X60A 2DNOA 3MCNA 4CM0A 3TR5A 2WZ1A 4K4TA 4PYDA 3DHWC 4DFMA 1GNKA 4M5LA 2OLWA 1S4EA 2APOA 4U8YA 3HHNB 3IFEA 2Z2MA 1CJVA 1N0VC 1TKZB 3WX8A 1WC3A 2HSEB 4YFUA 3BSOA 1VR6A 2RU3A 1PC4A 1OY8A 2J9DE 4JP8A 4F4YA 4C2MA 2DITA 2V67A 1ZZNA 2M52A 2KHDA 1JIHA 3OBIA 3PJ9A 1HI1A 3TO8A 3DMJA 1I94J 2G0CA 2DR7A 3BQ2A 2E1MC 1MWQA 3Q8SB 5CXTA 1VQ7S 3H59A 2XC9A 4ECXA 4MMOA 5A8RB 5HLFA 1K1SA 3UR0A 4ED2A 2GO8A 5I4MA 2KFZA 3D3CJ 1DURA 1OQ3A 2HWIA 3IA0A 5D15A 2XSJB 1RA6A 3Q2SC 1RACB 4CO3A 4UOCA 3K2YA 2Z57B 1YHQS 2XMAA 4NLPA 1KVKA 4DFPA 1TKXA 1KN6A 3W61A 3GSIA 4N76A 1RWOB 2KZZA 2ATCB 4Q45A 2PGCA 4TQSA 2VICA 4NLXA 3CD5A 3TOQA 1VBYA 1R31A 5AE2A 2VONA 2YH1A 3IS9B 2CDRB 1SVDA 1SB6A 3P5BP 5DG7A 2B7CB 3M30B 4I0WA 3F41A 2SXLA 3PIPQ 1I94F 4DLEA 3N4WA 2WVCA 2FJDB 2ZVSA 3D68A 2GVZB 3BBBA 1PJ5A 4I1TA 1EB0A 2MPUA 2J7KA 4KE5A 2UXDJ 1QAJA 4USKA 5AE3A 2HRUA 3IMQJ 1RSCA 4L74A 3G6YA 3S6EA 3QZ8A 5LOQA 3M8YA 1MMDA 5MAOA 5IC4B 2XGPA 1BGXT 1WHVA 1FVQA 2NXEA 4PXBA 4A46A 2W24A 2DHGA 3D28A 5BYQA 4NYOA 3EZ5A 2KM8B 3QLHA 2XZTB 2DCUB 5E3AA 5C24A 4NEYA 3HMJG 2RDJA 4FKXA 3NG8A 1O0PA 1SUQB 2DGOA 1FX2A 3KG1A 5F0UA 4J9KA 3MR6A 3T3FA 2AJ1A 3MR3A 2UP1A 3OJSA 2BQUA 4V19J 4A47A 3RUBL 4ED5A 4ZVPB 2YKAA 4PCQA 4LF1A 4RBUA 2HQCA 3K58A 2VQEJ 5B0EA 1U48A 2UXDF 4Y2IA 2CIMA 1TP7A 5KFPA 2BR0A 3H20A 3K89A 3LP0B 3EDQB 1R0CB 4QZVB 2PO4A 1VCTA 3K5NA 1N48A 4JOUA 4P73A 4LF6J 1RLCL 3CJ0A 1YTYA 1TMJA 4ZLLA 4J91A 3MM5A 2AP6A 2L9WA 1D8YA 3AOCA 2PEBA 4ECSA 1W2BR 2XM3A 4ZITA 1S79A 5IQ6A 3PKYA 1IKWB 3TI0A 2MKKA 3C15A 3DFEA 4WP8A 1Q7YT 3SBMA 1RHRB 5E3QA 3TUZC 4KHRA 3CW2C 1HBMA 5FLXU 5E33A 2HVIA 1E6YB 4RU9A 4IG3B 2V69A 1LKZA 1NJXA 5E5NA 4KGMA 2ZWOA 4KC5A 1RBAA 4UQTA 2YKNA 3KUHA 3CJSA 1FK9B 3R97A 1Q0NA 5I42B 1EP4B 1KQKA 2VBWA 3DRPB 3BPSP 4FS2A 2ZBIA 4QU7A 4IKAA 1RAGB 2H9ZA 2O01C 2H5IB 1VC5A 2CPHA 4G3IA 2DR5A 2GCFA 3SFGA 2GQCA 1EETA 1YKWA 3EJMA 2X1GA 2OPQA 1FKAF 2HWTA 1W7WA 2GQ2A 3JTPA 4NLOA 4LF6F 2FC9A 3HHLD 5J1EB 2BE9B 4O44B 2RDDA 3CC4S 4Q44A 2RQ4A 1L3UA 2HQIA 3A8KA 4PAAA 2XMWA 1JLFB 5HO4A 2QSFA 3EPGA 2JVOA 2ZHAA 2AX0A 3PFOA 2IMWP 5IT9U 2E5IA 5I3PA 5KFSA 2VQFF 2Y9HA 3SDEB 3ZZZA 3CDUA 4CYUB 3PTWA 1H72C 1FFSB 4PKDB 1B4SA 5ETTA 3R6GB 3DLKB 2CQ2A 1DTTB 1URNA 2JFKA 5CZVA 3H8YA 3BKFA 2QV6A 2UU9J 2QMUB 1NJZA 2IRUA 2BJ1A 3M8SA 1U1MA 3TAMA 4PXEA 4ILLA 1JJ4A 3BGRA 1N6QA 4CM2A 2VUGA 2VV5A 3NGRA 1M5PC 5JMNA 1UP1A 1ZM9A 3A1YG 1NBEB 2ZZNA 4CLUA 3TX0A 3R5DA 4ZP6A 4RUAA 3CPWR 5H9EK 4CLTA 2V4JB 2A3JA 1U02A 1SPBP 4WKYA 1AT1B 5J2NB 2E1CA 4X65J 2BANB 3VGUA 2AGPA 4JI2J 4OI4A 5KG2A 3I5AA 4OYXA 4N77A 1J5OB 2H54B 1WOOA 1EQ0A 3KDNA 4YR0A 2DHSA 2B8QA 4CO2A 1FHTA 5KFJA 3W7BA 3KK1B 1VQ4S 2P8IA 4TNOA 1HQUB 4A8OA 3AXKA 1T05A 4O3QA 2J6SA 4WK3A 2UU9F 2G2OA 4RJVA 4ZJQA 1WTBA 5D78A 2VBXA 2QG9B 2IM3A 1S99A 4ED0A 4KV8A 4X66J 1TUVA 1HARA 3H5SA 1ZTWA 3OTBA 2EFVA 3IXQA 1RT4B 2F8EX 2MY8A 1RUSA 4RW7B 4EMDA 3ISND 4B3RJ 3M8RA 4NOHA 2KB2A 1P8GA 4F02A 2E5GA 3GZ7A 4FP9A 5KFEA 3UCUP 1UWBA 1O6XA 2VIHA 2BE2A 1ZA2B 3QRPA 4Y3CA 3KHHA 1M5KC 3QO9B 4PRFA 3SXLA 2RHSB 4X62J 3I0RB 3F56A 3BO4A 4WP9A 5DZ6A 3KLIA 3HSGA 2V8PA 4DR7F 3C66A 3R1LA 1PJ7A 5DG9A 3D2WA 3Q22A 3RB3A 5F41A 5K9FA 3NBPA 2YVSA 3NNAA 1SH3A 4DSKA 2HGMA 3N6NA 2BXJA 2BA9A 2DH9A 5A0YB 3S8SA 1B64A 4DV6J 1RAOA 3DLHA 3HHEA 2JC1A 2WSEC 1RHKB 1QUVA 4H54A 2CPZA 1F3VA 3CXCR 2HS3A 3U1LA 1NKCA 2MY7A 2E9TA 2ZH2A 4Q43A 3UDCA 4B3RF 5J2MA 2KRBA 4ECRA 4EO8A 2DB1A 1V3SA 2O3DA 2W8LA 2HNZB 2JH3A 3KLFA 3KDOA 3GG0A 2M9KA 2QFIA 2MQPA 4OZ0A 2R2RA 3BDPA 2PI4A 4HR2A 2OAUA 1HIYA 2CWXA 1PJ6A 4X62F 4ZA1A 3OUYA 2K3KA 4OI0A 3M2UA 2DXDA 2DGTA 1WHYA 4B3OB 4H4MB 4ID5B 4X4UA 2HNYA 1VBXA 4DQPA 2AZ1A 4ITSA 5D4OA 1FRKA 1RKJA 4ZPVR 1PBUA 4WFBQ 2XULA 1NKBA 1GMWD 4DV6F 3AD8C 1K0TA 3A12A 2F63A 1S6PA 2V9KA 2KVIA 1UFKA 5K20B 4F4ZA 5ETRA 3D7SB 4Y2CA 2F65A 5LT5A 2H51B 1K9MT 2XYHB 2DH8A 3G71S 3TAQA 4NI2A 4Q2MA 3C8YA 3ITHA 1Q1KA 4AYBD 1EIYB 5M2RA 2ZD1B 3AB2B 4EBDA 1OPZA 4X2BA 3A3PB 3P3DA 3CT9A 2ACMA 1RTJA 1A9NB 2NXCA 5B0AA 3RTVA 4OHXA 3CCWA 1UEVA 3GCXP 1KQSR 1H2UX 3NCPA 1Y3KA 1N32J 4PQUA 3L7OA 3HF5A 5CYQA 1UZHA 4YMEA 3NNHA 3C6UA 2HQGA 3TRGA 2VFSA 2F7VA 3B8HA 3IGNA 1I6JA 5ETQA 2VHGA 5THWA 3C14A 3Q8PB 3RBDA 2B3TB 3PYFA 2FVSA 2PEHA 3GMGA 2I0XA 3NS7B 5KFVA 1NK6A 3NNCA 2J7WA 3ZZOA 1UVNA 2NXNA 3MM7B 3QIPB 2VG7A 3MPDA 5EHHA 2YWHA 4CLLA 1CS4B 3MOJB 4JI8J 2OPPA 3T5LA 2O66A 3DLGA 3F0NA 1U1PA 2C2KB 1F9HA 1P1TA 2HMIA 4YQWA 3QAEA 5HLFB 5GVQA 2E5LJ 4USTA 3IM9A 1N32F 2IAJA 3ILJA 1KFSA 1QE1A 2W9AA 2OP5A 2V50A 2XQCA 3V4IB 5HN0A 3MTKA 1MN9A 5ETVA 3MMCA 1FKPB 3K8WA 2ZOFA 2FPHX 3DDIA 1WSRA 4JI1J 3AXMA 3CC2S 4DFJA 2OMOA 4AL5A 1S9EA 4IFYA 3JYTA 1DHMA 2YNHB 3B6BA 1XWLA 2I9SA 2JJ4D 1SJ1A 2NLWA 2Z0GA 3TAPA 2LEBA 5CAAA 3DU5A 2E44A 5LXYA 2G4BA 3MM6A 4MYTA 2BM0A 4RZRA 3MM8A 4F67A 1U6ZA 1GX6A 1VLOA 2MZ1A 2DTJA 3IR7B 1HWJA 2XLJA 1R89A 1FDNA 5C42A 2EEYA 4HACA 3DLEA 2ZH6A 1ZTTA 2C2OB 4UZCA 3CMQA 1ZYQA 2BE7D 5ADZA 1WI8A 1WOSA 1DQAA 4OJ3A 2ZUGA 4DR5J 2W25A 2PN6A 1B70B 3E3XA 5HP1A 1HW9A 3V6DA 2RUGA 2M70A 4FPRA 3KJVB 3EWGA 4RW4A 3KYLA 2Z56B 1T94A 2ZJPQ 5KG5A 4JI1F 4NZ0A 3HDSA 1SQEA 3V6KA 2HEKA 2K3IA 3CJ3A 3THTA 4URGA 2MLYA 2FYXA 2H4YB 2EI5A 3X1LB 4DR2J 3EGWB 4EO6A 3TJ9A 3IR5B 4WFYA 4ZVQB 5E3PA 3T5JA 4U7UK 3IAS9 3FEXB 2M88A 5BR8J 3OW2R 3S7RA 1GH8A 1G1XA 5HSPA 5GAEU 2BJDA 1TU0B 4E98A 2IBKA 3KMSA 4MIAA 1N88A 2UUWA 3BYPA 3OVBA 3BGUA 4M94A 3CO0P 1IR1A 5CZXA 5IZHA 1Q95G 3QFWA 1TL5A 1XR6A 3H4BA 4KYZA 4YEAA 5HATA 1WF1A 8ATCB 1P9QC 2AMCB 3KUGA 1FDDA 2YNFA 5B0BA 1Q5YA 4DUZJ 1VRUA 1KS2A 4AL7A 1JXEA 3R27A 2X3GA 3ZZUA 2LA4A 1NK9A 2IC3B 5DO2A 2DNHA 4WZQA 2PE8A 1YIJS 4DL5A 4IG0B 3C15B 3W2VB 1IM6A 3KXDA 3LGMA 2VFVA 2DD8S 4C11A 1RYSA 2OSRA 3P96A 3MTJA 5F8NA 4FNIA 2RRNA 4O4GB 1UA1A 4RBTA 2QZ8A 2YKNB 3FEYB 1WDDA 3GE9A 4GC6A 1RISA 2AIRB 5EDWA 2FJAB 2AU0A 1RHUB 4ZDNA 4DU7A 1X9SA 1DARA 2UVRA 1B3TA 4Y6IA 2QL5B 3ZTOA 3HZGA 5DGAA 1PBAA 1U49A 3IN5A 4OI2A 3PHTA 3GILA 1EETB 5J2PB 3M8WA 3TVYA 2ZE2A 2JLEA 2QMXA 5KFXA 5I3UA 4DUZF 3HHKA 3C2PA 2Z2ZA 2DNKA 3RAQA 2V2ZA 1XNRJ 2QC3A 3MZIA 4MJKA 2OH2A 2X1FA 1V5IB 3G82B 5GMDA 4CH1A 4RW9A 3LW5C 3JAMY 1JK9B 3U7JA 3VZIA 3ZFVA 2HHVA 3AA8A 3LH2S 2Q6BA 5B7WA 4I2PA 1MWYA 2JFDA 2DGVA 1L5UA 2IHR1 1XMOJ 3MMBA 4K4VA 1NDKA 2EFPA 2VF3A 3J80U 2ZBPA 4LFAJ 1KDNA 1YJTA 2YKMA 1D3WA 1EX8A 3H2UB 2P6TA 1QDUB 3FJ2A 4BWMA 1BY9A 3FFIA 1KQFB 1VIXA 1K44A 1U45A 3QZ7A 4TY8A 4RUCA 2AKWB 1XJWB 1OMSA 5G0RA 3MAAA 4OZLA 2QE5A 1HQEA 3AJ1A 4XK8C 2R7WA 2MQNA 4XDCA 4URQU 4PG7A 1TMMA 5IFMA 4TYAA 4QWCA 3QJPA 2L9DA 4N47A 3PZPA 2R7QA 5D77A 3BJYA 1TKTA 1U7LA 3F73A 4LIRA 2EBGA 1R8HA 3OTEA 3UNGC 3MURP 4G65A 3Q8QB 4BDPA 3PW5A 3TZXA 1XMOF 2MYFA 1CULB 3MEDA 2KT3A 5K5MA 1T05B 5F8GA 4LFAF 2AD9A 3NRBA 3HVAA 1RAAB 3RBXA 3MR7A 1BD6A 4HH0A 4WJBA 2VPYB 4J9NA 4ECWA 4QIFA 5KFKA 5DQHA 4CLFA 4DV0J 1D9AA 2H4WB 5B0CA 2P9GA 2Y0BB 4GVBA 4DQSA 3QGGA 1IKVB 1KHWA 3PRDA 4K0KJ 2XMKA 1RBOB 2YPYA 3ILOA 1NRKA 2B9YA 1HKAA 4UOHA 1QM9A 1YJUA 2W1BA 2XCAA 2HVEA 4RNNA 3M4XA 2PMWA 4MKYA 5DDRC 4WPAA 3LGHA 4P2XA 5HK4A 3SSRA 3GV7B 2WTFA 3HFKA 2W7AA 2HPUA 1BWVA 2QFJA 3AT1B 3UPFA 2KZMA 2P6SA 3KLHB 3V81A 2WVEA 3M2RB 2ABYA 2R7UA 3B4DA 5BYRA 4KKOB 5KOXA 3CCMS 4R0JA 2AX1A 4FVCA 4MK7A 3CTRA 2R8IA 1RT2A 5KFUA 4YN3B 3G9CA 2XMVA 4J9LA 1SKWA 3OV7A 4DL6A 2DY9A 2CPYA 2PA3A 2VL1A 3PW4A 4CTAB 3TUIC 3T5KA 1ZA1B 4A8FA 2JWNA 4DV0F 2D1CA 4ICLA 1X0PA 2WOMA 3CJKA 3KLFB 4M5NA 4OIXA 1P1LA 2N4CA 4P7TA 4WU3A 3IWNC 1WHXA 2DGUA 4ZMMA 4Q7AA 4UUXA 4RWWA 2V9WA 2YNIA 2MJUA 1V9OA 1NK5A 3M8PB 2LA6A 2X1AA 4ZVEA 3M2UB 3EGZA 2LXFA 1H74A 4YS2A 1NU4A 1RWKB 2OFHX 3GFHA 2V8DA 2HZVA 4C8LA 3ONQA 3RAXA 2KG0A 1YJVA 2WVFA 4TLQA 1FRJA 4P10A 4B9MA 4NLWA 5KTQA 3M7VA 1F5AA 3LF0A 4DX7A 4Z7CA 1CQNA 4DPWA 3L9ZA 1QTMA 3SQGB 2CQBA 4RPFA 3K0JA 1S9GB 4DHVA 4HHUA 5EWEA 1O51A 2MQOA 4GMKA 3WIVA 2BVZA 1VJWA 3ITHB 5KT7A 1APSA 4FYDA 3M05A 5EWGA 4LQ9A 3HX9A 3RYLA 4GKJJ 1FVSA 3HM9A 2C2RA 1OYEA 4ZVHA 2GA7A 5LMNJ 3FEZA 1MW7A 4GO5X 4K2XA 4UT4A 4UOGA 4HDGA 3JTOA 2KN4A 3UO0A 1Y3JA 4LSLB 1N5QA 2HVHA 2AEFA 5E0OA 2XZDB 1DTQB 2NREA 1S4FA 4IDKB 1YDLA 2JL9A 2PA8D 1KEKA 1HYSB 1E6VB 2XLIA 1IJFB 4CLWA 4CLSA 1D9FA 1JLBA 1S1UA 1Q79A 2MSTA 1U09A 2IIHA 3CCJS 3O6QA 3HHLC 4DDFA 3DXBA 1FNXH 4KB7A 3LP1A 2VG7B 4QYRA 1RWMB 4HI1A 1DAXA 4GKJF 5F8LA 3D1HA 4RNFA 3QT6A 3GIKA 2H1YA 2BOPA 2AQ4A 5LMNF 2MZJA 1HNXJ 2ZEJA 1FJGJ 2F8HA 1YZ6A 5L8RC 3GV5B 4RW6B 4G1QB 4ECYA 2HMIB 3D54A 3JSBA 3UDLA 3R5AA 3A3OB 1NM2A 2DPIA 1K47A 1IBMF 1HNWF 2DHXA 2VFTA 2JHEA 4FPIA 3LAMA 1RT6A 3HHLA 1WWHA 3BGFA 4F36A 4J5OA 1RHJB 5FDLA 5BJRA 4LF8J 4PABA 1RTIB 2IFXA 3IAM9 3CIZA 4M95A 1T03B 5L1JA 2QA4S 2BW2A 1U6BA 3CJRA 2VASA 3G8QA 5F9LA 4YY3J 2J0WA 4B9VA 1LWEA 5SZTA 3RRKA 3HK2A 3PW2A 4X4VA 1FF2A 1B7YB 3OVSA 2HNDA 3QRQA 1ZAVA 4FF2A 4O4RA 3QBCA 1TELA 5C42B 3MECA 1QJHA 1PAEX 1MSWD 4C8KA 5B0GA 3I96A 3BGOP 2CQ4A 4I56A 1FJGF 1SJFA 2BJ9A 3OR1A 3OL7A 2OJ3A 3HCXA 4OV6A 4CIOA 3IBFB 4H4KC 3W66A 4EI2A 3O3LA 2RRBA 1U1NA 1BQMB 3GYNA 5T7LB 1RABB 1IBCB 4FNHA 1NZ8A 4ENOA 4PG6A 4PWUA 2HLTA 2RUSA 2CZVC 5AT1B 3IBCB 1XEZA 2B5JB 4EU0A 2MB0B 3CB4A 1R3NA 5E41A 4LF8F 2HGLA 2LQ8A 4YDXA 2L9NA 1X4FA 1VQ6S 1JJCB 3GIRA 4WE1A 2X7IA 2XSFA 5IT0A 3I82A 4R8UA 2UZAA 4OZNA 3UCGA 3W5ZA 4YY3F 1JMTA 2IA0A 4G6VB 1PSDA 2RAQA 2EFQA 1KQGB 2IVFB 4CO5A 2BEFA 2ZITA 3RG6A 4H4KA 3MMJA 2XMMA 3AJDA 3I6PA 4DV2J 3BQ1A 3Q24A 2VKRA 1DY3A 3MPWA 2ZJRQ 2G2ZA 1M90T 1FNMA 1TL3B 2GMHA 2GHWA 4LFBF 2AJ4A 1FKOB 1U4BA 2DIUA 2ROEA 4OHWA 3TA1A 1HPZA 1BC6A 4JBCA 2GIQA 2VFUA 3UVJB 3RBEA 4NWBA 2YNFB 1M5HA 3QT5A 4J9SA 2WBRA 3GPAA 5EX3A 1VIOA 4OV1A 4ANEA 2FVPA 1U24A 3M1VA 4ANDA 4U8VA 4X64J 2HHHJ 4DWIA 2UV8A 3R9LA 3BS9A 2R7RA 3PW0A 5HAOA 4QQBA 1FCAA 4F4KA 2KDOA 1IM4A 2CQ0A 5CHCB 1JXLA 2DK2A 1S57A 4QOTA 3A8IA 2BW7A 1FRXA 1RT3A 4YDDB 3O44A 3OT9A 3L09A 3NS6A 4P74A 3Q0AA 2RKIB 4WFXA 3D1OA 2N82B 4HHJA 5D0EA 3NGKA 4ZP8A 1IR2A 4QPXA 2B56A 4DOZA 3AB4B 1SC3B 4RR5A 2ZHOA 3MWBA 2HHQA 4HEA9 3ELHA 4O3SA 3I4PA 2RQCA 2WHOA 2WRMA 5EWFA 4CLYA 4C48A 5CYMA 3U27A 1IQTA 3CD7A 4WWSA 3SYZA 2YPZA 4PR6A 3V6HA 5LL6d 2HHHF 2IJNA 4WTOB 2Y8YA 1S1WB 2QYCA 3KLGB 1LW2A 4HKQA 5F9NA 1RAHB 2CJAA 4LIWA 5D0RA 4IUFA 1RWUA 4E8UA 4IH5A 1TR0A 2X3DA 2MLZA 1N56A 1IKXB 3CO9A 1O8BA 1FX4A 2QA4G 1GMWA 4ES3A 5KFZA 1S6QA 3WQPA 1AUDA 2FDNA 2B4UA 2HHPA 3HI9A 2DEIA 4Q0BA 1S10A 2MKIA 1Y9OA 1LWFA 1OPIA 4OZ2A 3R3TA 3CDEA 4DCJB 3T1HJ 4ZHRA 3PNIA 1NAQA 2P2CB 1OY9A 1GTEA 3GR0A 2GMJA 3A8JA 3R8YA 2XY5A 1QAXA 2CQ3A 3DGPB 1HQ2A 2OGUA 5FIIA 4XPEA 1LWXA 2HYIB 5HMXA 2KT2A 4P6QA 2MKHA 4ZIVA 1S59A 1WI6A 1J5EJ 2ZNYA 1BQNB 3S01A 2HURA 3LP2A 2ZOGA 1JLCA 4MTPA 2ASLA 4OJHA 3TZZA 4LF7J 4PG4A 3CJ4A 3SCLE 3T6BA 4ZCIA 4KH1B 4HT5A 4LVNP 3BH7B 4K4YA 4B02A 3W5XA 2NSBA 4GKKF 1RU2A 3MD1A 2BZ2A 4M5DB 1C0TA 1WEZA 3MMAB 2ALZA 2LQ5A 5IT4A 2QO3A 3P5TL 1PC5A 4B3TJ 5GAGI 3PEHA 4W92B 2QTWA 3A13A 2JZ5A 1AA1B 2CQ1A 4IFVB 4FS1A 1WACA 1DQ8A 2YNGB 3K5MA 5A8KA 2KRRA 3B54A 4DJBA 3T1HF 1WC5A 5FJ4A 1RT1B 2VG5B 2HQDA 4WF9Q 2R7VA 4ZK7M 3E51A 3Q8VA 5HROB 2Y3YA 3AD7C 3O5TB 2JLFA 2OPSA 4OI1A 3LANA 3OR2A 4B9SA 4LMZA 3LQVA 3RW7A 2PT0A 3PX4A 2RILA 4JUZA 1NMEB 5T14A 3Q83A 2ZKUA 1BE4A 2EK6A 2EWHA 1TVRA 1YGYA 2ALYB 4WKRA 4DPYA 1FRMA 4ED3A 1N54B 1F3FA 3R2DJ 4LF7F 4MKBA 4FKYA 3M9NB 4QWBA 1LWCA 3S1TA 4KBIA 1GXUA 4ZVOB 2DR9A 3N9UC 4DN9A 1XIQA 1CLFA 1JLGB 1V3RA 1YRTA 1KD1T 5KG1A 2D7SA 2HBRB 1CJKA 3C46A 5DDOC 2M8HA 1Q5VA 4JV0A 3M8ZA 4ILRA 1DZ5A 1RWVB 3W9IA 4L75A 1F5CA 1ZPWX 1NNDA 5K14A 1JLQA 3UCZP 1SC4B 1MMNA 2HS0A 3J81Y 1CC8A 2QEXS 2M3DA 1HLWA 9RUBA 2W2OP 4HTIA 2KKHA 4ZCKA 2DNMA 3QATA 3FMBA 4AXJA 1U47A 2B9WA 4B3SJ 2P9EA 1UW4A 4XAKA 2UXBF 2GVDB 1YJ7A 1B7FA 1S5ZA 1R0AB 2YNIB 4Y2KA 4DQIA 2QA1A 5KFNA 1NSAA 4F7VA 1WNEA 1FFWB 1S48A 4JYAF 4CNYA 2ASJA 2J9CA 2C2ZB 2R3VA 1U0SA 3AOAA 1HMVA 1HNVA 3D1QA 5ITHA 1ZOTA 4ECVA 4JV5F 3NL0A 3EGNA 4ELTA 4USUA 2QMWA 3KLEB 4F4XA 1CJTA 3CULA 1XR7A 3KK2B 5IT9Y 3PO4A 3J81j 3GG1A 2C2MB 2F4FA 3LWMA 3OL9A 3DHXA 3VR1A 4LRCA 2ERRA 4F3MA 1F2HA 2JOQA 5DLGA 4RW8B 4OZ1A 2B6AA 4M5MA 3HSZA 2W9BA 2HZAA 4NRUA 3EDRB 4DN0A 1QY7A 2QLBB 1LEOA 1U1OA 3R5CA 1HL6A 3QNWB 1C0UB 1I5OB 2DRBA 5J2QB 5KFGA 5A2QU 2HVDA 1D09B 2ZH1A 2V8HA 4DSJA 4OYWA 1CSJA 2CJQA 5KT3A 3OXLA 2FJVA 4ZN3A 4J9PA 5CD4H 2DXEA 3SSQA 2IVYA 3M6WA 3E01A 5KG4A 3Q8YA 2ACYA 1UPMB 1JLBB 2OMLA 4NA1A 2BJ7A 1UEKA 4XTTA 1NHKL 4DV3J 3MCSA 4PWDB 1X4AA 1WF0A 2PMZD 1YITS 2ZJQQ 4LFCJ 3ZZTA 5M2PA 1UFWA 3LP1B 5KFFA 2OPRA 4LUBA 4K5SA 2YQ1A 2L08A 4I64A 2ILYA 1U1RA 3H4DA 1RAEB 1T8EA 3MM9B 2NYHA 5D8HB 1SL2A 4TN2A 4RNOA 3SCKE 4NASA 5HBMA 2DKOB 2V5HG 4ZPTR 2O5DA 1L3VA 3EZUA 3MFIA 2E7WA 1TAQA 1GTHA 1X8DA 3VAKA 4IO9Q 3FQLA 5HVHA 4WIIA 3G6XA 1HR0J 2FJXA 3M8QA 2L48A 5E7OB 3RRGA 3BN7A 1DLOA 7FDRA 4OI3A 2QT7A 3C6TB 2AW0A 4DV3F 1ULRA 2YXLA 5DM7Q 1LWEB 1SQGA 4HT7A 3OFGA 1P27B 4LFCF 4UY8T 3MEEB 3CJ2A 4KO0B 4I67A 2QLWA 5H9EJ 1F6TA 3IG1A 3KKFA 3MECB 1TL7A 4YB6A 2W7PA 2DNPA 3KJFB 1VQMS 4Z7YA 3DOKB 1XBWA 3MXHP 4FYXB 4ES1A 3DDKA 5LJ3Y 2XYPB 4KHPJ 2YWGA 2Z4PA 5F0WA 5JVHQ 1C1CB 3KLVA 3OFHA 3OPKA 4J7CA 2E5JA 2KJVA 3FCHA 1MROA 2F9DA 2AEJA 2KFYA 1Q82T 4A8MP 3HP6A 1FWPA 2C3OA 4KQZA 4C9DA 3PACA 3BQ0A 3QT8A 3EX7B 4TU8A 1HR0F 2RVJA 2WAQD 2V0NA 5DRKA 2R2SA 4TLRA 4F25A 2B9EA 1EJ7L 2YX7A 5KFHA 4WE1B 2RD5C 2C3PA 3KOAA 3D6MB 1PYSB 1HBNB 3BKUA 1RT7A 5A8WA 2HAFA 3CD0A 4DI6A 2WVBA 3SZ2A 3HVRA 3MF5A 4KGXB 2HFUA 7AT1B 3I9ZA 5C2CA 4C8OA 2XNRA 3DCAA 3L7PA 2N7YA 5JUMA 3BGLA 1HI8A 3EXCX 4NLDA 4KFBA 1FDBA 3DOLA 4J9MA 2ZH5A 1RTHA 1FWKA 4KHPF 2RF2B 4QPTA 4PUOB 2XY6A 1MU2A 2JSXA 1H98A 1S1VA 4I2QA 3EE3A 4BLGA 1VFJA 4NCGA 3H5XA 1Q81T 1T3OA 1Y10A 2HFOA 3C19A 5HMWA 2IY5B 3MEKA 5KFCA 1LOUA 3LALA 3Q89A 2CPJA 4IH6A 2MZRA 4D3GA 4Q8FA 1NZAA 4ED1A 2CAJA 4K7QA 1PIEA 3KNGA 4DR1J 4WZMA 1WTFA 3K5OA 3AOBA 2X51A 2BABA 2EK1A 2V94A 3SV3A 3N5BA 4NLYA 3LOUA 1KVJA 3POTA 3MDFA 1N36F 2YWEA 4EBEA 3RBZA 3H7HB 4P2MA 5F8HA 1RT3B 3M32A 5HMYA 3W9HA 2MJNA 3EUNA 3OLAA 3GYXB 4NLRA 3OD2A 3DRRA 4HVZA 1CC7A 1C1BA 5C25A 2K7JA 1Y4ZB 2R8KA 1S1XB 3JSMA 1N5YA 4V19X 2BKNA 4F2RA 1VOMA 1FTRA 3A4TA 5HQMA 2NQPA 1X4DA 1Y7PA 4KAIA 1RYRA 1FD8A 1HD0A 1FJEB 4LR8A 3NOCA 4OZ3A 1PKUA 1WKKA 2AWZA 2EFOA 1TKZA 2Y0SD 4Y00A 4URSA 3Q8UA 2YTCA 1T9XA 4QIGA 4DR1F 4LJMA 1PILA 3C16A 3MAHA 2CQDA 2VU5A 3MPUB 1VRTB 2UUBJ 2HHUA 4LRBA 1SH0A 4JI7J 2DY1A 4NPOA 2MMYA 1YJ9S 5DM6Q 2EPIA 2CG4A 2OTLS 2ZVIA 2XO6A 1S0VA 1QSSA 2MQQA 3ZNJ1 2Q43A 1T0TV 1GMUA 7FD1A 2P9CA 1YJRA 3GCWP 4WFAQ 3NMRA 1PG5B 2BUNA 2QSWA 3TQEA 3MPYA 1ZS6A 3VWSA 4OFZA 1NJIT 5A8RA 4CLZA 1F9EB 1JWWA 2GIFA 1U1QA 4CO0A 2WK4A 3CF5Q 3DRYA 4DV4J 4WXOA 3V5RA 4EBCA 1OY6A 2XB2D 2XSJA 1TK5A 1U1LA 3PG9A 2A6MA 1LFPA 4GC7A 1AUSL 3GIMA 2VQFJ 3ZZ0A 1BQXA 1SIZA 4QWDA 3FQKA 4K4WA 3HPOA 5ETOA 2F40A 1SJQA 3JS9A 1S6UA 1FRHA 5KT6A 2M0GB 1SC6A 2LFVA 3UD5A 1N4LA 2KYXA 2B51A 2GO9A 1WC0A 2UUBF 5DZ7A 2QN6B 2ZH9A 2R7OA 3UD3P 4JI7F 3IS9A 2Q79A 3M30A 3VQSA 3RJMB 4P52A 5KFRA 4OX8A 4OLOA 3D66A 2C22A 1UEUA 4I7FB 3OTOJ 1RHQB 4OYBA 2XO7A 3B4MA 1Q78A 4AXIA 3CJTA 3EGVA 5K8OA 1YSJA 2GVZA 4FN5A 3FNNA 4L73A 4NLQA 8AT1B 3H25A 2G0JA 3FSYA 2GZOA 3AA9A 4NLUA 4CWBA 4IO1A 4DV4F 1BUXA 4LT6A 4OZ5A 4X84A 2BACA 3DLBA 3V4MA 2CYYA 1VQSA 3QGHA 3NP5A 4CI0B 2B4OA 4QWEA 3UN2A 2G0IA 1OS5A 3MR2A 1YJNS 1IUJA 3BBCA 4JV2A 4JV1A 1LWCB 1NEEA 2HAIA 2W8KA 4MFBB 3MHYA 5M2UA 1WG5A 4R5PB 2CXEA 5D6GA 2E5HA 1RTZA 1T7PA 3LGNA 2K1RA 4LSNA 5HMZA 4MIWA 2AYGA 4MKVA 5IM0B 2DNNA 1OO0B 2B4PA 1SUQA 2FJEB 3ET6A 1UFLA 3PYGA 3MCMA 1VQPS 1HWKA 2UXCJ 1RWNB 3PEJA 1LV5A 3OTOF 2B43A 2VODA 1AZSB 4EUVA 1CJUB 1HHTP 3IGVA 2HHSA 2CJBA 3MR5A 1JLQB 2NS1B 2BJ3A 2CKWA 3WZ0A 1JLEB 3QGIA 3NCRA 4AQYF 1URRA 3LP0A 1WG1A 4W90B 4CT8A 1H0HB 1U8SA 1N34J 1FWLA 2UV8G 5KFTA 2WONB 4DR7J 3FBBA 3KNAA 3T19A 3VQTA 2XI3A 1PYTA 3WX4A 1RT5B 1IKWA 3GR1A 1X4CA 2FVCA 4I6YA 4RNHA 1AFJA 2OD6A 2CDQA 1Q7LB 1SJRA 1ZM2A 1TL1B 4F0KA 1XN9A 1RLDA 4CO4A 2KXFA 2FIUA 3FSIA 1E6YA 4IG3A 5AJ3J 4OI6A 4KTQA 1YG0A 4C8YA 1EARA 1JJ2R 1FK9A 4K4XA 5I42A 4YB7A 2UXCF 3P8BB 1EP4A 4ELVA 3DRPA 3G2XA 1CJTB 2GW8A 3G6ES 1TZ0A 2A6OA 1SBRA 5DQIA 2O1PA 3ICLA 1WOPA 2KG1A 4OYOA 1OQ6A 4O3NA 2F3JA 1Q8BA 3J80Y 1R7IA 3UWTA 1M0SA 3FC9A 4U7UD 4NMXA 4G1PA 2AGOA 3W8GA 2OELA 1N34F 5J1EA 2A10A 3E2EA 4ZIWA 1SL0A 4N41A 2DGSA 1VHFA 2AT1B 1JLFA 3AQPA 3D0HE 3KK3B 1FRIA 3NKYA 3UD4P 3DXSX 5H9FK 1IWAA 1X0FA 4P7VA 3NY0A 2JEIA 3VAIA 3D6TB 3SDEA 3R1HA 2RRAA 4CYUA 2XMUA 2QLFB 4P71A 4DZ6A 4K5RA 5AJ3F 3DLKA 2LCWA 2LQBA 4JI4J 5D3GB 2W4PA 4NA3A 5EUHA 1YBTA 2XLKA 1X4BA 1U0HB 3L7UA 4DG1B 2VC0A 1KFDA 3HD2A 1Q8LA 4DX5A 2EG2A 3VVTA 2GX8A 2EVZA 2VDIA 1S9FA 1LW0B 1N5SA 2H3EB 1G6BA 2U2FA 4V1Ak 1PCAA 1ZH5A 4UUWA 2HFVA 5J2NA 3RR8A 4C0BA 4UZBA 4QIVA 1WEYA 2BANA 2IBOA 4IYQA 2DNLA 1RJJA 1HFEL 4FF4A 4NLSA 1UAWA 4M8LA 3CDAA 3CCRS 1OYDA 1J5OA 1R8PA 2LP4A 2Y1RI 2W2MP 1OJ4A 1RTDA 3D0GE 2RQKA 5AXNA 2WB4A 3CWJA 2UUTA 2AJ2A 3NGSA 3HULA 3OHBA 4F0MA 3KK1A 1JLAB 3MCOA 3M8QB 4GO7X 4B3MJ 4JI4F 2GAHC 4IR1A 2YKOA 2ZFHA 2ATLA 2BKOA 3TZWA 2QJ3A 4I69A 2EKYA 2VC1A 3Q86A 3TP2A 2J9DA 3KTQA 1WD6A 1DQ9A 2MGZB 1J27A 5D4PA 4NLGA 3SSSA 1AYEA 3GFZA 1RT4A 3QYYA 2OUGA 2Z2YB 4X4QA 4DCOB 3W2WB 3GJSB 5F3TA 4M5KA 4RW7A 3OSPA 3UI3A 2B7BB 3IG1B 2B0GA 2ZH7A 4JI6J 3PRBA 1HNIB 1HA1A 4CO1A 2QX0A 3CMAS 3QO9A 2ZZTA 4CT9A 4U96A 2V4QA 3I0RA 1JX4A 4AFFA 5KG7A 4UQGA 1UVLA 3PFEA 5K8MA 3CMES 1JXVA 1NHVA 1OWXA 4LF4J 3PKMA 4EFAC 1CJVB 1Q86T 3QGPA 3BDEA 3OXGA 4ETZA 5HJYA 2ASYA 2FLPA 2J8AA 2D3O1 1KNZA 3R7SB 3HSDA 5A0YA 3RU0A 1H2VZ 2NXJA 4B3MF 3GLJA 1RA7A 3LWLA 5CABA 1ROFA 2FQQB 4NEZA 4L76A 2MDAA 3C3LA 4PQAA 3DMJB 3DRXA 3I87A 2LLZA 2OO4A 4WXWA 2I1RA 2CZ4A 4LSZB 5HANA 3R6LB 1YBUA 1LK7A 1J2VA 3M6XA 4MYUA 4LF2A 1OSDA 2ZKTA 2GHPA 4JI6F 1QVGR 4RWXA 3DOLB 3ZZYA 4TKTA 4DL2A 2C3UA 4J90A 3X3UA 3FZBA 3VALA 3G8TA 3IBWA 4M5JA 2F9JA 1NB2A 4B3OA 2DR6A 3TNVA 1LFWA 4LF4F 2HFNA 4H4MA 3RRHA 2CPIA 1TKXB 1M1HA 2DYAA 4DS4A 3SMZA 3MUTP 2ROGA 2EC0A 3CEDA 3OQ2A 2DRDA 2HBQB 4OL8A 3MAQA 4TQRA 2CRLA 2DXFA 3M6VA 3J7YU 2Z2LA 4M5GA 4USWA 3K7RA 2C3MA 3CIMA 2KVQE 3NGDA 1C4CA 3CCQS 1O5JA 1W25A 3VHQA 4ZS6A 2BKPA 1KWMA 3Q8RB 4OHYA 2HGNA 4LF5F 3N5FA 3POTB 1RWPB 2DGQA 4KIAA 4AT1B 3CD6S 1S0NA 3DDNA 3ZXWA 2A18A 2N3LA 1SIWB 2DGXA 2YQ0A 1UCNA 2FHMA 4QR1A 2JX2A 5DGBA 2GAGC 3QPIA 4N7TA 2FB0A 2IYIA 2OIHA 4YUDA 3CCTA 2R8JA 4DSEA 1WELA 4WFNQ 5L1LA 4DV7J 4DQQA 3NGUA 3QLHB 4N8NA 3O8WA 4CLPA 3PO5A 4IQXA 5C24B 5KG6A 4ED6A 4QCLA 3GB0A 2BX6A 5DG8A 3EVMA 4W98A 2R7XA 2F4VJ 3C16B 1SI9A 3PJXA 2B9XA 4OX6A 2VZ9A 2VJUA 1RWXB 3MM7A 3QIPA 2J8SA 3FVYA 1REVA 1K73T 5CD4A 2PSZA 1CS4A 2AYBA 4DSFA 2XS7A 4QIEA 3QRRA 3ILLA 3ISZA 4HL9A 4J37A 2NYIA 5L9NA 1EKSA 2XS2A 1WUUA 3ENAA 1NH8A 5D0HA 5CCLA 3UW1A 4M1KA 3ZC4A 1DBDA 4OMFG 3MM5B 2LDIA 2R7SA 1SCJB 2W4CA 5B0DA 3QFHA 4NXNJ 3V4IA 4USMA 1UL3A 2KU7A 4DV7F 3JB9k 1FKPA 3UDEA 2V68A 2CJXB 2C2NA 2YWWA 4YHHJ 2HK2A 3J7AN 4Y2AA 3L3CA 1H7XA 1HBMB 4PG8A 2N7CA 3JSYA 2MZQA 2YNHA 2NSCA 3TEGA 2F4VF 4XIUA 4N8OA 4NXMJ 4GVLA 2GGPA 2RNEA 1SV5A 1H38A 1KTVA 1ZM3A 5FD1A 4GRSA 3HSJA 1FXDA 3Q23A 1NPPA 3KUEA 2DRAA 2RHQB 4WP3A 3EZOA 2RT3A 4F4AA 3H5UA 1V5VA 2LEAA 3IC1A 3D67A 2OPQB 2D9PA 4U6PA 4ID8A 3SEOA 2FHJA 4O0IA 3PXGa 1HBUA 5HI7A 2FVQA 2AZ3A 2XZWA 4C8MA 4F0HA 4EZ6A 2CPXA 3BN4A 2KI2A 1IVZA 1FD2A 1WC1A 3AAWB 4NXNF 1YBAA 3KG4A 5ETPA 1F9FA 3KJVA 2R2TA 2AYMA 3THPA 3OXFA 1NJWA 4YHHF 4PPZA 1HBOA 2BQ3A 1SL1A 3M9OB 2GHVC 1NSPA 5JXSA 1YRUA 2FHKA 4WK1A 2GJFA 2BYCA 4DMZA 2V63A 4NXMF 2C42A 2K1RB 2DT9A 4LSNB 3BPDA 1VQKS 4ED8A 3TAMB 4F50A 2E1PA 3BGRB 3VAGA 4FXWA 2E1AA 1N6QB 1NK8A 3LTOA 3K59A 3ET6B 1JNRB 4ED4A 1NK7A 5HQ8A 2BQRA 3J7A1 2UUCJ 4C8ZA 4ZKAA 4P75A 1TL4A 5GADU 2FLLA 5DDPC 3BR9A 4DQRA 4DU8A 1TK0A 5LMUJ 1UVJA 1RAFB 2VBYA 5DJBA 1MMLA 1UZDA 4EK2A 1N5VA 3GU0A 2VPWB 5ETLA 3OVAA 1WKLA 1WC4A 3N6LA 2C2DA 2QRRA 2QIFA 1VC6A 3GFXA 3LPEA 4DFKA 3FK4A 4O0NA 2IC3A 1S7IA 1NO8A 1F60B 4F8RA 1RAIB 2VPZB 4B9NA 2JEGA 1YWXA 4IG0A 3W2VA 4M63A 2RIJA 3G87A 2XWXA 2IRYA 1X5TA 1JKHA 2W2QP 1GQEA 4DLGA 2HRTA 1CPZA 4KV8B 3H42A 3J81U 2MHNA 2Y1LB 5C7PA 3FDSA 3WC0A 4O4GA 2YY3A 4DUTA 4CLKA 1M5VC 3KHLA 1QTNB 4FF3A 3HLUA 1QVFR 1FT8A 2JC0A 3IR6B 3PR5B 1YVFA 3SI8A 1ZPVA 2UUCF 1T9VA 3CCSS 4RKUC 1M1GA 1ACMB 2C1EB 1UWBB 1NPRA 2VQEF 4C7QA 5LMUF 2BE2B 1FXLA 1UPPA 2IRXA 4G1IA 5J2PA 3BO3A 2NPIA 5CH7B 5E3RA 1PAUB 1C2PA 2IDEA 3KLIB 4DS5A 2CQPA 1TUWA 1XR5A 3CGIA 3G82A 5KFQA 2A2DA 3NBPB 3DI6A 2CJ9A 1PYOB 4XO0A 2OHDA 3H2VE 2YX1A 3J7ZT 1D0EA 4MKAA 5DETA 5F3ZA 2D69A 1IKYA 5KFAA 2RS8A 1SQFA 4HTJA 3PVXA 4ZVSB 5GAHU 4OX7A 1UWAA 5AE1A 3KHGA 4WBFA 2J7UA 3GSDA 2FZGB 3AFGA 1K8AT 4WFZA 4J9OA 3ZTPA 1UJ5A 3NAHA 2I6WA 1XMQJ 4AL6A 5J2MB 2HK3A 1BXNA 1WORA 4ZVUB 6FDRA 2DIVA 4ZPCA 4FF1A 4NLTA 2U1AA 3VF0B 2CWKA 3HT3A 4OYMA 3T1AA 3DKDA 2A1BA 3DM2A 3L4BC 1XK8A 4EGLA 3RW6A 2MZTA 1F0XA 5AXKA 3I9V9 1LXNA 1EZZB 4RUBA 4L3NA 2M7SA 2HQ3A 3RR7A 2V8VA 5IV3A 3OUYB 1P6TA 1S6OA 2Z58B 3T5HA 2MZSA 2V8GA 2VFRA 1Q8IA 3THVA 1HNZJ 4RL1A 1T95A 2V34A 2HNYB 2R8GA 2OEKA 1TK8A 2HVZA 5KFYA 2FVRA 3FMWA 3FRZA 3BV8A 2CQIA 1RTDB 4KH0B 1JNZB 1Z1ZA 3BF4A 1S6PB 5E3CA 4PPDA 2CPFA 3M6UA 3UN5A 1YX2A 4P2SA 2VA3A 2FTRA 5KFOA 1CULA 3CJ8A 4C3MA 3KMQA 4KSEB 3PDNA 2H5EA 2RJZA 4I6WA 2QA2A 3CSKA 2OEJA 2HRYA 4NI2B 2LXIA 2XWYA 1XMQF 4DZDA 3DRSA 2NCKL 4P72A 4O3RA 3JXOA 3W5YA 1ZETA 3OTCA 3MI7X 1RTJB 2K06A 5MLCV 3WIUA 1NJYA 1WC6A 5KT5A 1Y00A 2HQFA 4MK8A 3WDOA 2PFDA 1TV6A 1IKVA 3QJLA 1TTHB 3GV8B 1Y5IB 2XBPA 2X1BA 1R6YA 3VAMA 4X65F 4PQUB 1GT8A 1IBMJ 1LXJA 1HNZF 1HNWJ 4JB8B 4ZP7A 5CYQB 5K8PA 4JI2F 4CDIA 3C6UB 5GAGU 4A4JA 3DC2A 3ADAC 1W2IA 2QLXA 3C14B 4QIWD 2K2PA 2KH9A 2CNLB 3KLHA 1YLXA 1KOOA 3M2RA 6AT1B 2CG8A 4KKOA 1VYAA 2YKQA 2WSFC 1UVKA 4USIA 4EEYA 4X66F 1HD1A 3ZZPA 4HH1A 1EHWA 2N4DA 4HI2A 2DH7A 2OPPB 3PYEA 4CTAA 2HHTA 1A7GE 1KLMA 3DLGB 3J7Z5 1A0OB 1S0OA 3FUYA 3KJNB 1Z4UA 1NSQA 2WBMA 2E7XA 2CZ9A 2JVRA 3GTYX 4ZVRB 2Q66A 1Q8KA 3BO2A 4FYVB 2IAJB 2ZNZA 5EGYA 5F8JA 1P9YA 1IXKA 2K7KA 1QE1B 3SV4A 1LQ9A 3R7NB 4OYZA 4A8YA 1R8AA 3I55S 3M8PA 4RUHA 2ZH4A 2MKJA 3MMCB 2GC8A 4OLPA 3EM1A 3GJTB 3I4HX 3CJ5A 1S9EB 4IFYB 4Q2LA 3JYTB 3I31A 1OSCA 1T9TA 1N5TA 4TXSA 1FEHA 2XYGB 1HHSA 2BMBA 3PR4A 1BWEA 2GFFA 3MM6B 2YH0A 3KJQB 1UMJA 2D74B 2J6UA 3AHPA 4B08A 2EKNA 3MM8B 5A2QY 1LNQA 4A48A 3SQGA 1WJ9A 1S9GA 3VCDA 2MQMA 5IXUA 4OJGA 1X4GA 2PI5A 1SXLA 1NB7A 1Q4RA 1FXRA 4HACB 3DLEB 3VAJA 3GJQB 3OTDA 4LFBJ 3T9NA 1XTZA 4K8RA 1FRLA 1TFWA 4BC9A 4QW8A 2ZDPA 4DSLA 2QL7B 5HP1B 2E9ZA 3V6DB 3TUJC 1GX5A 1QUPA 1QSLA 4CCHA 4LSLA 2F8MA 4CH0S 3KHRA 4RW4B 3HFZB 4BCAA 3TARA 2B4VA 3ISNC 1VQLS 2W01A 1ZM4A 1DTQA 1MN7A 4IDKA 2ZH8A 1WSVA 3HJFA 1HYSA 1E6VA 1R27B 4LBHA 5CYJA 1I51B 2GJ2A 1MLAA 2R9LA 3OLBA 3F44A 3R5GA 1T9YA 4PWWA 4OYPA 4DPXA 3UQSA 1VHIA 2I5JA 5SUHA 3NWRA 4DBQA 5F8MA 3SCIE 2IVMA 1REVB 2UUAJ 2G1DA 2J0XA 2ZOMA 3AJ2A 4ALZA 2NZ4A 1Y0HA 5RUBA 4KGZB 1CEZA 3QT7A 2HBYB 1VQOS 4N5SA 4IR9A 3LPYA 3HKWA 4ZVTB 4XPCA 2MQ8A 3DLJA 2DVIA 2C28A 2CNKB 1VRUB 4H4OA 4RW6A 4G1QA 4QW9A 4YB1P 3SFUA 4DSIA 2F1FA 5B08A 2LQJA 2R42A 3MOZA 3NCQA 1WEXA 5DS7A 3PYDA 1KTQA 4NX9A 3ENVA 3V6JA 1X31C 2C2EA 3W1YC 3CJQA 1FI4A 3P6YC 1RK8A 1W26A 5KFDA 2A0FB 3HVTA 2Z8QA 1RTIA 1KOHA 1T03A 4DL4A 3M9MB 4PXCA 4C11B 3ETMA 5IOLA 2UVWA 2DHHA 4YP3A 4F4WA 2KXHA 4OQJA 5IQQA 2CVIA 2QL9B 3BSAA 2CPDA 1RDRA 2GGPB 2AGQA 1SV5B 1YRXA 2MEWA 1AB8A 1TKDA 1PO6A 2UUAF 3TUPA 4USHA 4BC7A 4JI8F 2IM0A 5D4NA 1RKIA 4XDDA 3HHDA 2ZE2B 4WYWA 3IWLA 1VC0A 3JTNA 1FA0A 2DEJA 4FZVA 3RZAA 5I3UB 2HHWA 2DPJA 1HBUB 1BQMA 3TANA 3WC2A 4DCPB 5T7LA 2E5LF 3GJRB 3HZEA 1VISA 4WCEQ 3BH6B 1YQHA 4RW9B 5LJ5Y 2HIQA 4FBTA 2B5JA 2FY1A 5L46A 2VG6A 3MEGA 2WCXA 2CQGA 3KG0A 4I2PB 3TJAA 4GKKJ 1HBOB 5HQLA 2A2CA 4YR2A 1TFYA 1JB0C 3MMBB 1NHUA 1U6FA 3VV2B 4FYWB 4KGVB 3NOGA 3G96A 2YKMB 2DJWA 1NDPA 2D9OA 4NYZA 2VPXB 4MH8A 2GV1A 2NXUA 3FFIB 4BBYA 1YI2S 4HDHA 2NUUG 4TYBA 3FRYA 3T9ZA 2ZBRA 2WVDA 3GIJA 4DR3J 2O67A 1TL3A 4TY8B 2KL8A 2GIRA 1FKOA 4QJVA 5G0RB 3MAAB 1HQEB 4C3LA 3CCZA 4DR5F 8RUCA 1TAUA 4ES2A 4YR3A 1NK4A 1VJQA 2PFFB 3UVJA 2BJEA 2WW4A 2Y8WA 3CNQP 3NEKA 1NPKA 3SCJE 2H65B 3BREA 4NRTA 4DL7A 2MTLA 3A3NB 1TKTB 3W65A 2XHWA 2CA9A 1S0MA 2YWFA 2BM1A 4KPCA 1RB0A 3IP0A 4A8SA 1NXIA 2IPOB 1NDCA 2PD1A 2DBBA 1RI7A 1DJ0A 1S49A 4LR7A 2JRSA 3MEDB 1WG4A 2XY7A 4DR2F 3N28A 4USJC 4JI5J 1RHMB 1X7VA 3DGVA 1JKHB 1X9MA 1YK9A 4FDFA 3TX8A 2ILZA 4ELUA 4ZLNA 1SJ4P 5BR8F 3BYRA 3MFHA 4AUKA 3EXYA 4MT1A 3HKZD 4OJ1A 2JNJA 4ZJLA 4DR3F 2FJBB 2RKIA 1H7WA 4QYZJ 2WB1D 4ECUA 4GVBB 4PXDA 1L3TA 4QBUA 4IOCQ 5C2GA 2VB6A 3HT0A 2UXBJ 1RU1A 2PIIA 2YQ3A 5IV4A 3ENQA 2ZBCA 4JYAJ 4KRWA 2J0QD 1Z2ZA 1B99A 4C3KA 5L38A 2FUG9 1S72S 5K8NA 1VQ9S 4J9QA 4O23A 2EG1A 2ZBQA 2AYEA 3DI6B 2B8PA 3V81B 5ETSA 1S1WA 1TUGB 3KLGA 3R7BB 3P45B 1IBKJ 1IKYB 4NA2A 4JV5J 2R2UA 4JI5F 3R5JB 3EICA 2KHCA 2K8GA 1RT2B 3LO3A 3U1MA 1IKXA 2DNRA 3U02A 3UR3C 2AF6A 3MUVP 1R6VA 1REGX 4KHMA 5F8IA 2OEMA 3DN9A 4Y28C 3RB0A 2ZC4A 4OHZA 4B17A 5FLXY 2VDHA 4A8QA 4RU2A 4ICLB 1TQLA 1T3NA 1FTCA 2WOMB 4ECQA 3QMQA 3CJKB 3U1NA 1H2TZ 1X5SA 1N52B 3AH6A 4OHVA 1SH2A 3AD9C 1RWWB 2Q6CA 3DGPA 1DFDA 3DM2B 2Q3PA 3K5PA 4WYLA 4U7CA 3KWMA 1IWGA 2XGQA 2AV5A 2MXYA 1FFGB 3MGJA 1FJ7A 3QWPA 2QGFB 5IC6B 4NCBA 1FDAA 3H98A 1BQNA 1YJWS 1HW8A 1XNRF 4I68A 4ZN1A 4MK9A 2DGWA 2V4RA 5LM7E 1GFWB 3SIPB 1S12A 4FVMA 1X4EA 3DLLQ 1IBKF 3ENWA 3OL6A 2W9CA 2BJ8A 2DHAA 4M5DA 1S1TA 3MMAA 2MQLA 5KT4A 2BDPA 2AJQA 3TW0A 2FC8A
chains in the Genus database with same CATH topology
5K8MA 1D8YA 3CMES 2LYVA 1NHVA 3DOMA 1U25A 3TA2A 4IFVA 3MMJA 2XMMA 4ECSA 1W2BR 1OWXA 3PKMA 3Q2TC 3I6PA 4EFAC 3DRSB 4N56A 1S79A 2YNGA 1Q86T 3QGPA 3BQ1A 5IQ6A 3PKYA 3BDEA 1IKWB 1GAOA 3OXGA 3Q24A 2VKRA 3NS5A 3MPWA 3TI0A 4ETZA 2MKKA 2ZJRQ 4U67Q 5A6PA 1RT1A 4A8XA 2VG5A 1FNMA 3DFEA 2FGCA 1TL3B 1M90T 2ASYA 2GMHA 1Q7YT 2GHWA 2FLPA 3G6VA 5E3QA 3TUZC 4KHRA 4LFBF 2AJ4A 5HROA 2J8AA 1FKOB 1HBMA 1U4BA 1KNZA 2DIUA 1UA0A 5E33A 2HVIA 5A0YA 3RU0A 2ROEA 4OHWA 1H2VZ 1E6YB 3TA1A 4RU9A 4IG3B 4B3MF 1NJXA 1LKZA 3FGVA 1HPZA 5E5NA 4KGMA 4ZPDA 4LQ3A 1RA7A 2D3UA 2XG8A 4JBCA 1BC6A 3NAIA 4KC5A 2MSSA 1TV6B 2GIQA 2PC6A 2VFUA 4UQTA 3LWLA 3RBEA 1ROFA 2YKNA 4NL5A 1FK9B 3I56S 4NWBA 2YNFB 3PX6A 5I42B 1EP4B 2ZHBA 3KFWX 2MDAA 1KQKA 2VBWA 3C3LA 2EFGA 4PQAA 4Y65A 3DRPB 4FS2A 3DMJB 1M5HA 3DRXA 4J9SA 2WBRA 2VH7A 2ZBIA 3BEGB 3I87A 5EX3A 4FXVA 2VD3A 1VIOA 3WBZA 2LLZA 2OO4A 4QU7A 4IKAA 4OV1A 4WXWA 2H9ZA 2O01C 3RAMA 4QU6A 2J76E 1R43A 3TYTA 2I1RA 2CZ4A 2FVPA 1U24A 1VC5A 2CPHA 3M1VA 4G3IA 3QJJA 2DR5A 1LK7A 5HL7Q 4DWIA 1J2VA 2UV8A 4WU2A 5L9XA 2GCFA 3SFGA 1F5BA 2HLUA 2GQCA 5AXMA 3BS9A 1EETA 2R7RA 4ZOSA 3M6XA 4MYUA 3PW0A 3OL8A 1OSDA 2ZKTA 1VS3A 2X1GA 2OPQA 2GHPA 4QQBA 4JI6F 1QVGR 4RWXA 1FKAF 3NMAA 1FCAA 3DOLB 2KYZA 4F4KA 2CPEA 5J1NA 2HWTA 3ZZYA 2XNQA 4TKTA 1S1UB 2KDOA 2GQ2A 4DL2A 3JTPA 1JLGA 1IM4A 1R8BA 1VK3A 2C3UA 4NLOA 2FC9A 3HHLD 3X3UA 4LF6F 3FZBA 2CQ0A 2IMOA 5CHCB 5KFWA 3G8TA 3VALA 3PX0A 3IBWA 1JXLA 3TVZA 5J1EB 2DK2A 4O44B 3CC4S 4Q44A 3K5LA 4QOTA 2F9JA 2RQ4A 1L3UA 2HQIA 2J5AA 2XMWA 4B3OA 3TNVA 1JLFB 5U47A 1FRXA 5HO4A 1RT3A 1LFWA 4LF4F 2QSFA 2HFNA 4H4MA 4YDDB 3RRHA 2CPIA 4X4SA 3EPGA 3O44A 4CH7A 2JVOA 3L09A 2ZHAA 2AX0A 3NS6A 2FLNA 1TKXB 3PFOA 2IMWP 2FHOB 2E5IA 5E2QA 5I3PA 4R25A 2RKIB 3Q0AA 4DS4A 4WFXA 1GXLA 3SMZA 3MUTP 3D1OA 2IA6A 2N82B 2ROGA 4HHJA 3NGKA 3CEDA 5KFSA 2VQFF 2EC0A 4ZP8A 3OQ2A 4QPXA