1N6QB

Hiv-1 reverse transcriptase crosslinked to pre-translocation aztmp-terminated dna (complex n)
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
429
structure length
429
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of HIV-1 Reverse Transcriptase with Pre- and Post-translocation AZTMP-terminated DNA
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/immune system/dna
molecule keywords 5'-D(*AP*T*GP*CP*AP*TP*GP*GP*CP*GP*CP*CP*CP*GP*AP*AP*CP*AP*G
total genus 100
structure length 429
sequence length 429
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2002-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1n6qB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1n6qB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1n6qB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1n6qB03
1RT5B 5F8LA 3H5XA 2RKIA 2HNYA 2D3UA 4JV2A 1T05B 1JLFB 4XPCA 1JLCA 1TV6B 4TQSA 2VG6B 3DRPB 5EUHA 3DMJA 3DLGB 3CDUA 2XCAA 1VRUA 1RTIA 1S1XB 2QV6A 3DMJB 4MK8A 3BQ0A 3PW5A 3OL6A 4EBEA 1BQMA 1C0UB 3KLHB 4QWDA 4H4OA 2EC0A 1TKZA 5CYQA 1RA6A 1HNIB 2VG7A 3IGNA 4KKOB 1RT2B 4I7FB 1S1WA 3RBDA 4H4MB 4I2PA 2UVUA 2IMWP 2HNZA 3IG1B 4LSNA 3DI6B 2IM3A 3D28A 2F8EX 2CJQA 3DLKB 3LP1B 4LSNB 5HLFA 3I5CA 4IH6A 3MFHA 1ZETA 3DLKA 3LP1A 3M8PB 4RW8A 1HMVA 3D5MA 2WTFA 3KK3A 1K1QA 3OSNA 3PW2A 4NLYA 3QZ7A 4PWDA 1TKZB 3CIZA 4ED1A 4URGA 4RU9A 4R0EA 2HNDB 3RB3A 3QO9A 4WE1A 1K1SA 3JYTA 3MFIA 1IKVA 4ZP7A 4NCGB 5J2PB 1W25A 4NYZA 4J9NA 3DDKA 1RTHA 3NBPB 3GILA 4TYBA 2DPJA 1RTHB 4NZ0A 3GV5B 4IFYA 4J9KA 5KFAA 4WFYA 3RB6A 5DGBA 2V9WA 2BQRA 1C1BA 1LWEB 4FS2A 1S48A 4EO8A 2B6AB 1TP7A 2ZKUA 2R8KA 3SFGA 5J2NB 4LSLB 3V6DA 1I6JA 3KLVA 4ECSA 4NLQA 5KT3A 1S9GA 1RT2A 1RT7A 3KLGB 3UDLA 4WYWA 3GYNA 2ZD1B 5KG6A 4EBCA 2C2EA 5KT5A 3DOKA 4IRCA 2DPIA 5CYMB 4MKBA 3BSOA 3I5AA 5JUMA 3DRRA 5FDLB 5HROA 1SUQA 4ECVA 3M8QB 4J9OA 5F9LA 1T03B 1RT1A 3LP0B 3H98A 4NRTA 1HNIA 4EYHB 4X2BA 4B3OA 3Q8PB 1JLBB 4NLWA 3LALA 3T5HA 3IRXB 3OL7A 4K4UA 3SI8A 3V81A 2IM0A 3E01A 4KO0B 3C6UA 1WNEA 4NLDA 5KG4A 5KFHA 4KFBB 3MECB 1RT3A 1SH3A 1C1CA 1JLGB 5KT4A 2FLNA 2XGQA 3DOLA 1HMVB 1XR5A 4YR2A 1IKXA 2YNIA 1C2PA 4PWDB 4K4SA 2JEFA 4ED2A 1JLAA 4YR3A 2RDJA 4DL7A 4K4VA 4U6PA 1NHUA 2OPQB 3LANA 2JLEA 3KHGA 3DM2B 1LWEA 2OPSB 1MU2B 5F8JA 1FKOA 4IRKA 3KMQA 2R2TA 4H4OB 4ZVEA 1N6QB 1SH0A 5KFYA 3MECA 3QLHB 3HVAA 1BQMB 3E51A 4ZP6A 1IKWA 5KFOA 3KNAA 1TL1A 2BQUA 3MR6A 2W9BB 3IS9A 2CKWA 4O44B 4IG3B 3TAMA 1N5YB 4H54A 5I42A 4WXWA 4R8UA 1IKXB 2OPPA 2FVQA 5F8HA 5EWEA 1C1BB 1C0TB 3M9MB 3V6JA 2IA6A 1DTQA 4PQUB 3DLGA 5F9NA 5DG7A 1SUQB 2D3ZA 2FVCA 5C24B 4NLXA 1SV5B 2RDIA 3C6TB 3MEEB 3DLEA 1RT1B 4TN2A 1HQUB 5KFZA 4ED0A 2VA2A 5C25A 1KHWA 4O3RA 4TXSA 2IC3B 4DL6A 5I42B 3EPIA 1VRTA 1LW0B 1LWCB 4ZMMA 4R5PB 3KJVA 5T14A 3KK3B 4R5PA 2YNFA 1JIHA 3M9OB 1JLQA 3G6XA 3JSMA 3HVWA 5C25B 1RTJA 2WONA 5C42A 2IC3A 2JEGA 2AX0A 5J1EA 4YP3A 4J9MA 1ZTTA 3GQCA 4ZPDA 4ECWA 1FK9A 2YKMB 3NBPA 1GX6A 3GIKA 2E9ZA 4O44A 1N5YA 1RDRA 3H5YA 2W8LA 3KHRA 1C0TA 1T3NA 5KFIA 4R8UB 1S6PB 4KHRA 4ZPCA 2HMIA 2OPRB 1MU2A 5F8GA 3DRRB 5FDLA 3M8QA 3FFIB 1S4FA 2XGPA 1IKWB 3KK1A 2W7PA 1DTTA 4H4MA 1N56A 4I7FA 3ITHB 4NLUA 2B43A 4Q0BB 3DI6A 3OHBA 1J5OA 3MTKA 1C1CB 3UR0A 2I1RA 4KFBA 3CVKA 3KJVB 4DEZA 2HMIB 4QWAA 2AU0A 1RYSA 4FBUA 4DG1A 2O5DA 4KV8A 4YR0A 3NL0A 4TY8B 2B5JB 5KFKA 3I0RA 4RW4B 4ZPBA 5KFPA 4RNNA 2YNHA 5KFFA 3Q8RB 4GC6A 3H59A 2AQ4A 5KFTA 2ILZA 1HQEA 2WHOA 1S9FA 3E01B 1RT6B 4KO0A 1HQEB 1XR6A 2XI3A 4TQRA 5JXSA 5EDWA 2W9AA 3T5KA 4MK9A 1RT5A 5D3GA 2GIQA 1HPZB 3CJ5A 3N6MA 5DQHA 2B5JA 2WRMA 4NLGA 2YNGB 4Q45A 2YNHB 3GV8B 4J9SA 3TAMB 1EETA 2I5JB 3OL8A 4ECTA 2ALZA 4MH8A 1JKHB 3BREA 5KFBA 1T94A 4XPEA 5KG3A 1KHVA 4ECRA 3N6LA 5KFXA 1S10A 4Y3CA 3KLIA 2FVSA 3FFIA 3FQKA 4IQXA 3ITHA 3H4BA 4G3IA 1R0AB 1XR7A 2HNZB 4ZP8A 4K4TA 3MR2A 2C28A 3V4IA 3PW0A 3DYAA 4K4XA 1TVRA 4G1QA 1JLGA 2BRLA 1DTQB 5KFMA 3DOLB 5J2MA 3PHEA 3I0RB 4RW4A 3RAXA 5HBMA 5KFLA 3NAHA 5HBMB 2VG6A 3DRPA 3PJXA 2ATLA 1KLMB 3IRXA 4O4GB 2W9CB 4ECZA 3QO9B 1RYRA 1RAJA 1RTJB 4ZVFA 3QZ8A 1GX5A 3QLHA 3DYAB 3HHKA 5J1EB 3UQSA 5KT6A 1Z4UA 4Y34A 4KE5A 4ZHRB 2W8KA 4ED7A 2IAJB 2AGQA 3BGRA 1JLAB 2ZE2B 1JLQB 3OL9A 4K4ZA 1LWFB 3UPFA 4ECYA 2RF2A 4IG0B 3V6HA 3Q8SB 1EETB 2I5JA 3KLFB 5KFGA 2BR0A 2OH2A 3ISNC 2FLLA 2R8IA 3BSCA 3LAKA 1S9GB 4ZP9A 1FKPA 1HNVA 4KBIA 4DL3A 1HQUA 3GIIA 5CYQB 2IM2A 3I5BA 4ED3A 1QUVA 4J9RA 4IRDA 1FK9B 1D0EA 1HPZA 2HNYB 3FRZA 1IM4A 2UUTA 4RW9A 3T1AA 3OLAA 2FLPA 4IFVA 4PQUA 1TVRB 2W7OA 2BE2B 3HVTA 1MMLA 3NKYA 2BE2A 3HVTB 4NCGA 5J2PA 2IJNA 4QWEA 2GC8A 1S6QA 3CDWA 4J9PA 2C22A 1RTDB 3BQ1A 4IKAA 3EZUA 3JSMB 2C2DA 4K4YA 1DLOB 4F4YA 4WE1B 4Q8FA 2VG5A 5F8NA 5KFNA 4IDKB 4Q0BA 4ZPAA 2R2UA 5L1KA 1N6QA 1LW0A 3FQLA 3KMSA 5DLFA 1VRTB 3BR9A 5HLFB 4TYAA 3H40A 2E9TA 2IAJA 3M8PA 4RW8B 2V0NA 1RA7A 2ASLA 1S1VB 1S9EA 4I2QB 3BSNA 5EWFA 4ECUA 2E9RX 5KFWA 4RUAA 2OPQA 4F50A 4WXOA 5DG8A 5L1LA 2QE5A 1D1UA 1S6PA 3NAIA 5KT7A 1KLMA 1OS5A 2OPRA 5KT2A 5C24A 5KFDA 3KLHA 3MEDA 1HYSA 3G6YA 4JUZA 2ASDA 4TY9A 4MKAA 2YKMA 3G86A 4B3OB 3T5JA 3NMAA 5KG0A 4IG3A 2HWHA 3QGGA 3V81B 4URQU 4MK7A 3OHAA 1LW2A 3LP2B 3V4IB 1EP4A 1JLCB 1TV6A 5KFUA 1S0NA 4HKQA 2JC0A 4G1QB 2FJXA 4RNFA 3CDEA 5HROB 4KHMA 1JXLA 3I0SA 2XC9A 1S1TB 5CYMA 4IH5A 2YNFB 1REVA 4TY8A 3TQ1A 4EBDA 4NRUA 1HNVB 5EWGA 1RT7B 3MR5A 3CJ3A 3CJ4A 4QW8A 2HAIA 2GIRA 3KLEB 5DQGA 4ED6A 4KAIA 4K4WA 2R2SA 4MIBA 4Y2CA 1EP4B 4IR1A 1S97A 2R2RA 3PR5B 5L1JA 3RB4A 3GIJA 2WB4A 5D3GB 1S6QB 5KFVA 1HARA 5J2MB 3ISND 1T05A 3CWJA 2UUWA 4IH7A 3RB0A 4XO0A 2AGOA 5F8MA 2BANB 3KK2B 3GIMA 2XWYA 4NLOA 3HKWA 3V6KA 4O4GA 5C5JA 2WONB 5C42B 2J6SA 1RT6A 1S1UA 4QWBA 2AGPA 1FKPB 3JYTB 2BRKA 5F8IA 5J2QB 3QGHA 4U7CA 4EYIB 4QW9A 4ED8A 3KLIB 4Y2AA 4O3QA 2ZD1A 5DLGA 5KG7A 2BQ3A 3BSAA 2XI2A 3QIPB 3IS9B 1TKTA 4WYLA 4NLPA 4O4RA 5L9XA 2V4RA 2UVVA 2B6AA 3MEGA 3N6NA 5I3UA 3QIDA 4O3SA 1TQLA 3I0SB 2UVWA 1QE1B 5I3UB 1YVFA 1RTDA 5DG9A 2IM1A 4FS1A 1QE1A 3RBEA 3H2LA 1DTTB 4ECXA 2VG7B 1JLEA 2AX1A 1UWBA 5KFEA 2W9CA 3CJ0A 4Q8EA 1TKTB 5DQIA 3CO9A 4NLVA 3KHHA 3BQ2A 1RT3B 3T19A 4Q44A 1SH2A 3GV7B 1S49A 4J9QA 4HYKA 4QWCA 3PZPA 1ZTWA 3PVXA 3RAQA 2IBKA 2AWZA 1T03A 4DG1B 2FVRA 1JX4A 5KFQA 1JLFA 3Q8QB 3PW7A 1JLEB 1NHVA 3PR4A 4ECQA 4NLSA 2BANA 3KK2A 5KG1A 3PW4A 2WK4A 1RT4B 1TL3B 3DRSB 3EPGA 5HP1B 1BQNB 2WOMB 4JV0A 3SFUA 2FVPA 2ILYA 3T5LA 4RW7A 5DGAA 3MR3A 4RW6A 2ASJA 1NNDA 2W9BA 3H5SA 4URSA 2D41A 3DOKB 3KLGA 3KOAA 4IG0A 5KFJA 1J5OB 4RZRA 2YNGA 4M94A 4IOBA 1C0UA 1VRUB 3M9NB 4JV1A 4LSLA 1REVB 1S1TA 3V6DB 1U09A 3KK1B 2FJVA 1SV5A 3OSPA 3FSIA 3MEEA 3QGIA 4Q43A 1LW2B 3IGVA 4OL8A 1IKVB 4YQWA 4KB7A 4EEYA 1IKYB 2JEIA 2R8JA 4RUCA 4PUOA 3BGRB 3NGDA 4GC7A 1TKXB 1LWFA 2YKNB 2HNDA 2JEJA 4J9LA 3DM2A 1JKHA 3KLFA 1FKOB 4O3OA 4QPXA 4RW7B 2V4QA 4LQ3A 4WZMA 3KHLA 5HP1A 4MFBB 2C2RA 4MFBA 2D7SA 4KKOA 3CJ2A 4IFYB 4ZVHA 4LQ9A 2R8HA 4DL5A 4ZHRA 1S1WB 4WFXA 1S0OA 5K14B 3LAMA 3QIPA 4I2PB 3MF5A 3LP2A 2WCXA 3VQSA 4RNMA 1RTIB 1S1XA 1N48A 2JC1A 2OPPB 4MIAA 4TLRA 1HYSB 4FBTA 3G6VA 2J6UA 1S1UB 3MEDB 3LP0A 4F4ZA 3DLEB 1JLBA 3C6TA 1TL1B 4F4WA 2VA3A 1R0AA 4RW9B 3ICLA 5K14A 4M95A 1UWBB 4IFVB 4IR9A 5KFSA 5KG5A 3TVKA 2J6TA 4KSEB 4EO6A 3IG1A 5L1IA 2FJWA 1QAJA 4O3NA 1LWCA 4ZVGA 4F4XA 1CSJA 3MEGB 3H4DA 3H5UA 4KV8B 1S1VA 1S9EB 4I2QA 4RNOA 2IJFA 3IN5A 4DL2A 4ID5B 4ICLB 4DL4A 1TKXA 1IKYA 2YKNA 5KG2A 4ICLA 4ID5A 2ZE2A 2HWIA 4PUOB 4O3PA 2RF2B 5KFCA 1DLOA 4WFZA 4IDKA 3KLEA 2OPSA 3PJWA 2R8GA 1BQNA 2WOMA 1QAIA 2VG5B 5J2NA 3C6UB 1RT4A 1TL3A 3DRSA 3FDSA 1N4LA 4NLTA 5J2QA 4YMEA 4RW6B 5KFRA 4NLRA 1S0MA 3BJYA 3QYYA 3OLBA 2UVRA 4K50A 2YNIB 4WZQA 2RKIB 2XCPA 4RNHA
chains in the Genus database with same CATH superfamily
5F8LA 9ATCB 2HNYA 3BPSP 2GHPA 3BDPA 2XY6A 3NGSA 2OTJS 2G2ZA 1TV6B 1FVSA 2DD8S 5AE3A 5HVGA 3OW2R 2HQIA 2YPZA 3CCRS 1RTIA 3I9V9 5LM7E 4MK8A 3R7NB 4E98A 4F8RA 1WOOA 1XN9A 3Q89A 3OL6A 4X4RA 4JI8J 1PILA 3UDVA 1JJCB 3KLHB 4CO1A 2RB7A 4DN0A 4QWDA 3Q2TC 2CQ0A 3M2UA 3Q8VA 4DR2J 2HHUA 1GEHA 3CGIA 5B0DA 2QMXA 1FJGF 2Z2MA 1Q82T 2UVUA 4XAKA 4P2SA 3CT9A 4BHQA 2QFJA 1IXKA 2NYIA 2PSZA 2MSTA 3W8GA 2GQCA 2K7KA 3AXMA 2YWGA 4MKYA 1AZSA 3W3SA 1P1LA 1ZETA 1NEEA 4RW8A 4DR4J 1T9WA 3KJNB 3EVOA 4DMZA 4OI2A 4L3NA 4NLYA 3L7UA 3MI7X 3QZ7A 3H25A 4DHVA 4N8NA 4FYYB 1VHFA 1BWVA 4URGA 1GFWB 4R0EA 4LBPA 5AE2A 1F60B 4ZS6A 1U1OA 4DDFA 1R43A 2ZFHA 1RAOA 3AA9A 5M2PA 2Y9HA 1K1SA 1QVGR 3CB4A 1SKSA 4CI0B 3R2CJ 4FNIA 4YY3J 1Q81T 5J2PB 4CO2A 4NOHA 1RTHA 2M7SA 5A8KB 1KLNA 1KONA 3I6PA 1JWWA 4NZ0A 3CCQS 3RRGA 1VQNS 3THTA 5KFAA 4DL0C 2BQRA 1UVNA 3KDOA 1M5SA 2P9GA 4OZNA 5B09A 2B4OA 1FJCA 1SIZA 1TK5A 4LSLB 3V6DA 1I6JA 1XERA 2N3LA 2RH3A 3ZTSA 3CD5A 4CM2A 4TKTA 4DLGA 4DFJA 1RT7A 1VIXA 2A0FB 3R1HA 4I6YA 2ZD1B 1IVZA 3FMWA 2C2EA 4WPAA 5KT5A 3CCTA 2C3MA 1YJNS 2KT5A 5I3QA 4PXBA 4IRCA 5ETLA 3WIVA 3CJKB 2DPIA 5E33A 3THPA 5CYMB 3BSOA 4UT4A 3I5AA 4EWTA 3DRRA 1SL2A 1SUQA 3O1LA 1RBOB 5A8RB 1OQ6A 2DISA 2QN6B 2VFSA 4ECVA 1RT1A 5E3CA 2CQ3A 3LP0B 1VQYA 1YQHA 1HNIA 3P5TL 4EMDA 4EYHB 1MN9A 2GZOA 4NLWA 4Y0FA 3CJTA 1QAYA 1G3OA 1H98A 3M2VB 4HACA 3RRKA 3U02A 4K4UA 1ZBTA 3UD4P 3C2PA 2PGCA 4W98A 5CABA 4DFPA 1RAFB 2O66A 3UO0A 1QLNA 2NQPA 2WBMA 1SH3A 5D4PA 5DDOC 1JLGB 5KT4A 3HP6A 5ETMA 3DOLA 1YITS 4LFAJ 3JTPA 2C42A 4USUA 2YNIA 2UUAJ 1T95A 2YVSA 3C3LA 4K4SA 2PD1A 1RP5A 2RDJA 3BEGB 2NUUG 4DL7A 4PYAA 4U6PA 2E5JA 3PYEA 2KFYA 2IVFB 4DF8A 2JLEA 1LWEA 1HBOA 2OPSB 2RRBA 4A8QA 3FRYA 1MU2B 3H7HB 1MROA 2IRYA 3OR1A 1N6QB 1FD8A 1SH0A 4ZVEA 3QLHB 2OO4A 1UP1A 3KNAA 2OLWA 4DN9A 1XJWB 3L9ZA 3ZZYA 5F3TA 3TUZC 1MWZA 1X31C 5HMYA 2XWXA 3T1YJ 2W9BB 2DRAA 5DDPC 1OSCA 2KDOA 1U2RA 3BS9A 4JI5J 3LTOA 5CH7B 3BYPA 2KXFA 1PJ7A 2VBZA 5A76A 1OMSA 1XMQJ 4A48A 2YBVA 3BH6B 4PQUB 3C15B 2VKZG 4L74A 5E5NA 1SUQB 2D3ZA 5D78A 4ZVQB 3WC2A 1HBNA 4NZ6A 4HH1A 2DNMA 2V2ZA 3GJSB 2KO1A 3C19A 2RDIA 3C6TB 2DXFA 2VUGA 3DLEA 4DSEA 5HI7A 1FNXH 4J37A 2VA2A 4CRJA 4O3RA 2Q1LA 3CCJS 2P2CB 3D6TB 3VAGA 1CJUA 5HL7Q 1NXIA 1YJRA 2OEMA 2KT2A 2LP4A 1VRTA 2O1PA 3FNNA 3M30A 1FO1A 3B82A 3ZZ0A 2VPXB 4NL5A 1JNZB 1KTVA 2LVWA 3S01A 2XSJB 3NXZA 4FVMA 3HZGA 1GXLA 4R5PA 3K7RA 5T14A 1BWEA 2KL8A 1VQSA 3NOGA 5DO2A 3M9OB 1T7PA 4PG4A 5AT1B 3JSMA 1D8ZA 3DDNA 3HVWA 2KXHA 4P2MA 4A47A 5A2QU 3D7SB 5C42A 5D0RA 2AX0A 5T7LA 3BDEA 1YX2A 1WSRA 3ZNJ1 1NDPA 4ZPDA 4LT6A 1AUSL 1WJ9A 3M6UA 3R2DJ 2HK2A 2E9ZA 1GX6A 5K8OA 1UVLA 2JNJA 2VICA 1N5YA 4RUHA 3QJPA 4GRSA 4DPUA 2ZJQQ 2H5IB 1RXOB 1T3NA 1W7WA 3SDEB 1VQMS 1S6PB 4KHRA 2ZJPQ 3PCOB 1VK8A 1KVJA 2CVIA 2HMIA 2QGFB 4Z37A 1DZ5A 1FJ7A 4GKKF 3DRRB 2CPDA 2HGLA 2GIFA 2EK6A 4ED4A 3PIPQ 3BV8A 2J8SA 1J27A 3D68A 2W7PA 2V94A 1L5UA 3MMBA 4I7FA 3K89A 3SBMA 3AA8A 3SCIE 1ICEB 2J7UA 2C2OB 3MUMP 1DARA 3QSYB 2ROPA 2I1RA 4KFBA 3NWRA 4OX6A 4DEZA 2XB2D 1VOMA 1KC8T 3C46A 4KV8A 4X66F 5GMEA 4KPYA 2UXDF 2E7XA 3RUBL 1U24A 3Q8RB 3CPWR 1X4CA 3NNAA 4KT0C 1O8BA 2NZCA 3LF0A 5KFTA 2FUG9 2FD2A 1HQEB 2XI3A 2F4VJ 3PYFA 1CJVB 2FC8A 1FTRA 3ZFVA 5EDWA 2AJQA 2AJ0A 3B78A 2LXIA 3TUJC 4WTOB 5KFOA 4B9UA 3UVJB 1Q5YA 1QDUB 3G8TA 3HJVA 4HHUA 4KH1B 2A2DA 2WRMA 5C2CA 2YNHB 1W2IA 3GZ7A 4I68A 4LUBA 3MM5A 2XTJP 4J9SA 2ALZA 3MWBA 1RUSA 2EVZA 4WTYA 3V2UC 4ZJOA 1M5PC 5K8MA 2ZDPA 4ZIWA 4HVZA 5KG3A 3N6LA 4Q7AA 1S10A 4S0MA 1IR0A 2IDEA 2E5LJ 1KRPA 1HNWF 1FWPA 2KVQE 5E7OB 3ITHA 4NMLA 2VQFF 2RAQA 4ZP8A 2HNZB 2PFDA 2MYFA 2OD4A 2C28A 1Y0HA 3PW0A 3DYAA 1CULA 2GFFA 3OBIA 2LEBA 1WWHA 3FJ2A 2YWWA 1DTQB 2Q79A 2ZVIA 2MEWA 4ZN3A 4OZ3A 2PN6A 5J2MA 4EZ6A 3I0RB 4RW4A 1FWKA 2P9CA 2RVJA 3C14B 3OD2A 4NA3A 4CLKA 3R5BA 3CCWA 3QGPA 1APSA 3FC9A 2RHQB 3N5BA 4DSJA 1RHJB 4GKJJ 3IR7B 3I9ZA 2V5HG 2C3OA 4QCLA 2LXFA 3WHIA 2QLJB 2N7CA 3HHKA 4O0IA 2XMAA 1T11A 1NMEB 1Z4UA 3W9JA 3OUYB 1FXRA 2XCPA 2KZMA 3OFEA 1U0SA 2MKHA 3UCGA 1BD6A 4NCAA 2CQ4A 4UY85 4FN5A 4ZPVR 2YTCA 1JLAB 4UTGA 3OL9A 1JLQB 1V5VA 3PACA 4KRWA 2W7AA 2RF2A 1UW9A 1SJFA 4IG0B 2HLUA 1CQMA 4DPXA 4P7VA 3Q8SB 2SXLA 2OH2A 2F8MA 1F5CA 3R1LA 3BB5A 3ILJA 3LAKA 2VOOA 1R8PA 1FKPA 3LW5C 4LVNP 1FKAF 4DL3A 1HQUA 2HRUA 1KQFB 3GIIA 4PYDA 4E2FB 5IWAF 4AL6A 1FK9B 1HPZA 3VGSA 4OYPA 3J7YI 1WORA 2K7JA 4P71A 3ENWA 3QBCA 1U6BA 2FJDB 1JJ2R 5IM0B 2MZTA 4C97A 1R0BG 1S99A 3CJSA 3M2RB 4QR2A 1KKHA 2BE2A 5THWA 3CW2C 2DITA 2GV1A 4N8OA 1RE1B 4PPDA 2FHKA 3CDWA 3EDRB 4ENOA 1FJEB 2IMOA 5E3AA 2C22A 2UXCJ 3SCJE 3GG0A 3AODA 1VGYA 2X1AA 2VHGA 1VQ4S 2ZM6J 4I6WA 2F40A 4CQ1A 4K4YA 4FYDA 5ETPA 4C7QA 2VG5A 3A8KA 3HHLC 4Q8FA 1S79A 4U7UK 3MURP 1FJGJ 1NDCA 2X7IA 2R2UA 3CTRA 1LW0A 3FQLA 7FD1A 2DGVA 1KOOA 3CO0P 1T02A 3BR9A 4DV4J 1M0SA 1NDKA 2AT1B 2FHMA 2QO3A 2Z30B 3M8PA 4QYRA 3TZZA 1U1QA 3T1HJ 1S1VB 4V19J 2FHOB 4A8YA 3UN5A 1YJVA 2E9RX 4F50A 2ATCB 2OPQA 2CDQA 4UZCA 3EGNA 5F41A 2J0XA 3GSDA 2VFVA 4MT1A 4ES2A 2MKIA 2ZJRQ 2XHWA 3H20A 2OPRA 2J0QD 5C24A 1YJWS 3VAJA 2Y8WA 4QYZK 3MEDA 5ETKA 2F4VF 2HHQA 3D6HB 1HNZJ 3T5JA 4KYZA 4OX8A 2ZDOA 2DR6A 3MPDA 4XDDA 1FDAA 5ETNA 3NCPA 2GW8A 3QGGA 3V81B 2DCUB 1OO0B 1SKUB 3I96A 4P9SA 1LW2A 2W2OP 3LP2B 1MLAA 2ZVSA 5FLXY 4UQGA 2RQCA 4LF6F 3DRXA 1VLOA 2FJXA 2DH8A 4F2RA 1WKLA 8ATCB 1FD2A 5CYMA 3VQTA 1FDBA 1TZ0A 2GGPB 2JLGA 4G1PA 2PE8A 4CT8A 1H7WA 5B0BA 4WFAQ 3CJ3A 1XMOF 4QW8A 3DXSX 4QOTA 4K4WA 4FXVA 2HKEA 5CQGA 2R2SA 2GQQA 2M52A 4I6AA 4V1Ak 4TU8A 1L3UA 4PG6A 3OTOJ 1L3SA 3JSYA 4CLSA 2ZH1A 4U7UD 3GIJA 1SL1A 4FKYA 5GADI 5D3GB 2OD6A 3I4HX 4HEA9 4W4MA 5KFVA 3KTQA 1HARA 2UV8G 3M1VB 4DCJB 1FCAA 4KPCA 4UOCA 3KK2B 4JI7J 5HAOA 1F0XA 1VQPS 1SKWA 2V2VA 4NWBA 1L3TA 2OTLS 1RHQB 2PA3A 4WKRA 3OXGA 4O4GA 4LRCA 4JI8F 1FRKA 5C42B 3F0NA 4QU7A 1S1UA 1UVKA 1FKPB 2QA1A 2AGPA 2BRKA 2QC3A 4U7CA 1AA1B 1ZH5A 1FRIA 2W1BA 4X84A 4EGLA 2XMVA 1BLUA 2Q66A 4DUYJ 3D4JA 2LEAA 1PAEX 1QJHA 4OYBA 2WVEA 3D6MB 4PEOA 4YB6A 2A1BA 5L9XA 5HQ8A 2F9JA 3JSRA 3MEGA 3DLJA 6FDRA 4O3SA 2ABYA 3I0SB 2GGPA 2UVWA 2VC0A 2W4CA 3K0JA 3RBEA 2IM1A 2QA4G 1N33F 2K1RA 1KQKA 2NR0A 3IP0A 1WTFA 2KM8C 3F44A 1JLEA 3HD2A 1KEKA 1RCXB 3W64A 4ZCIA 2W9CA 2U2FA 1ZZFA 2HRTA 5D4OA 4NLVA 3GFHA 4LF1A 4JI0F 3KHHA 1RHKB 2Y0BB 3BQ2A 1NH7A 1XNRJ 1XEZA 3WZ0A 1R8AA 4USTA 3VALA 4J9QA 1HR0J 2IBKA 2R7QA 1ZTWA 4K5RA 4LRAA 4DG1B 1URRA 4YDXA 3UW1A 5RUBA 1PGZA 2GAGC 1JLEB 1WC1A 1HNXJ 3HO1A 4NLSA 1XQIA 3ONQA 5KG1A 1IWAA 3AOBA 3DRSB 1K44A 3GR0A 4OZ2A 5HP1B 2WOMB 1LK7A 1RWVB 3DDIA 4Q5VA 3T5LA 3DN9A 4RW7A 4OV1A 4X4UA 1MW7A 2ASJA 3X1LB 4X4PA 3M6WA 3GPAA 3HJFA 3HM9A 2X1GA 3G6ES 3KLGA 3FGVA 3MR6A 1HWKA 2UU9F 4MIWA 1JK9B 4OI0A 1TUWA 4USWA 2UXCF 2UV8A 4DQSA 3U1NA 4YEAA 1TKDA 3E8OA 4RBVA 2MQPA 3M9NB 5HJYA 4OJ1A 1Y3KA 4LSLA 3V6DB 1S1TA 1VC6A 5H9FJ 1RBAA 2AEMA 2VPWB 3L7OA 1SV5A 4JP8A 2BJDA 2FJAB 3HDSA 4M5DA 4Q43A 2B7BB 2H4WB 4F0HA 4CIOA 1GH8A 5GMKa 4OHXA 2GNKA 3FK4A 5EX3A 2ERRA 3ZZTA 4DV0J 2X1FA 4C0BA 1DQ9A 3EM1A 3TARA 3IWNC 2M88A 4DU7A 2VONA 4DR1J 4L76A 1YIJS 4L6V3 4M5LA 1SJ3P 4OYOA 1UFLA 5D15A 5GAHU 5LMUF 4XIUA 1TKXB 1LWFA 2JEJA 3KLFA 2OIHA 1FKOB 3GJRB 4C8OA 2DH7A 4LQ3A 3GCWP 4WZMA 3KHLA 4MFBB 4UUWA 1CQNA 4N76A 1TL7B 3QPIA 5GADU 3CJ2A 4ZVHA 4LQ9A 4JI2F 3EGVA 3VAKA 5B0CA 1U02A 1BQXA 1U4BA 3HI9A 1M90T 4NCBA 3PTWA 3K58A 5E0OA 4GVBB 4F3QA 2B51A 5AJ3J 3VAMA 3VQSA 4IUFA 3J81U 1S1XA 3KXDA 2CQDA 1I94F 1T0TV 4TLRA 4ITSA 4URQU 2YX4A 3IAS9 4ATNA 2HZVA 5I3PA 3LP0A 2DRDA 2PMZD 5IC6B 2WSCC 2G9OA 3LH2S 4C48A 2G1DA 3TANA 4F4WA 2RHSB 5J1NA 1P27B 2LU2A 3NGUA 4K0KJ 2E9TA 4P7TA 2JFDA 2HAFA 5ETRA 5IM0A 1CC7A 1U1LA 4OYAA 1IBMJ 1RKJA 2E66A 3MPYA 2EFVA 2O3DA 2J6TA 2DHGA 2CJYB 3VVUA 2ZWOA 1IR1A 4WP9A 1QAJA 5F0WA 3CJKA 4ZVGA 1G7CB 1CSJA 2VPYB 2VODA 2C3YA 2DH9A 1ELOA 1R8CA 4ID5B 4ICLB 4DL4A 2YKNA 5KG2A 4MYTA 2HWIA 3M32A 4IYQA 3PRDA 4PUOB 1CG2A 3SCLE 5D6GA 2RF2B 3TAQA 4WFZA 2E1CA 4G6VB 4OFZA 2OPSA 2XMTA 1BQNA 1QAIA 2HVEA 1RT4A 2PEHA 3FDSA 1GNKA 2DK2A 2JVOA 3HHLB 4IH7A 3B54A 4M5GA 5KFRA 1JQGA 1RAEB 2OSRA 3QYYA 4R0JA 4B3TJ 3PRVA 4P73A 3KWMA 2B9WA 4HLBA 2IHR1 4RNHA 3TZXA 2RKIA 2D3UA 2J76E 3ENQA 2AKWB 5FIIA 3MPVA 2BYCA 2VG6B 2AW0A 3DFEA 5EUHA 3NS6A 3DMJA 3CDUA 3BQ0A 2CVEA 1KOHA 2KHDA 3ZO7A 3RTVA 1M1GA 2CQGA 2YXLA 3N9UC 2R7VA 1Y00A 3OR1B 2EC0A 1TKZA 1RA6A 4LVOP 1HNIB 4C11B 4ALZA 2FLOA 2RU3A 1RT2B 3KYLA 3ZZPA 4XDCA 2AYBA 4DV1J 1T9YA 1NU4A 4H4MB 4I2PA 4DZ6A 2HBQB 3DLLQ 2MY7A 1YJ7A 7AT1B 3IG1B 1CJTA 3CJ8A 2LQJA 2MQNA 3I5CA 2F8EX 2CJQA 2DNNA 4LSNB 1WSVA 2V2KA 2J5AA 2YWEA 1RAIB 3IAM9 3DLKA 3LP1A 1DBDA 2QLXA 4DJBA 4YB1P 2O01C 3KK3A 2PMHA 3PW2A 2ZNZA 3WX8A 2XO6A 2ZHAA 3CIZA 4ED1A 4RU9A 2HNDB 4F25A 4CLUA 2YKQA 1IWGA 3D6FB 3EGWB 3QO9A 4WE1A 5DDQC 3EJMA 3P96A 4C6AA 2QEXS 1O51A 1TU0B 1SB6A 1HKAA 2NXEA 4EUVA 3A8EA 3ET6B 3MUVP 4DF4A 1SJ4P 1IKVA 3OR2A 4Q2MA 4NCGB 1W25A 2XBPA 4J9NA 4ZK7M 3VWSA 1S72S 2BOPA 2M70A 1O5JA 2HBYB 4TYBA 2F1FA 2R7SA 3GV5B 4YHHF 2YWHA 3I56S 4J9KA 2NXJA 4DI6A 1LK5A 2H51B 4WFYA 3RB6A 2V9WA 4OIXA 2W4DA 2CRLA 4FS2A 2UP1A 1RISA 3I4PA 5H1SV 2B6AB 1TP7A 1WEXA 3P3DA 3Q22A 5DM7Q 1LXJA 4ECSA 3QFHA 2K06A 3D0HE 4KH0B 2CG8A 1X4EA 4NLQA 5KT3A 1SL0A 2L08A 1V6HA 1RT2A 4QPTA 4OLOA 1GXUA 3BO4A 2D9OA 4NA1A 3DOKA 3PYDA 4CTAA 3VV2B 2BJ9A 2MQMA 4I56A 1U7LA 2HQ3A 3O2IA 2KFNA 4JV5J 2FGCA 3TRGA 3M7VA 2Q6BA 4MKBA 1NK4A 4CO5A 2RMLA 1RAGB 3M8QB 1NCLA 1Z2LA 4J9OA 1RWOB 3D3CJ 2XLKA 2ADBA 1UW4A 4X4NA 2MGZB 4XK8C 1JLBB 4I69A 2WBRA 1RHRB 4M1KA 1A7GE 1RWMB 3SI8A 2CWXA 3E01A 1VQKS 2VDIA 1HL6A 2XMWA 3ADAC 4EI2A 1WNEA 3KG4A 1FE4A 1UEUA 2YH0A 5D0GA 4X62F 3MECB 4KIAA 4OYIA 1VJWA 4JI1F 1FXLA 3D2WA 4AQYF 3SCKE 1XR5A 3G2XA 4DX7A 1IKXA 2HS3A 2Y8YA 1VLYA 2MQOA 3MD3A 1Y7PA 2R7OA 3G82B 2DBBA 2BVZA 3SV4A 3KG1A 1XMOJ 2AYEA 3IBCB 1A6LA 2HGMA 4DX8H 3LANA 3DM2B 2E5GA 3AOCA 1AFIA 5F8JA 5IV4A 2JRSA 3GONA 4H4OB 5KFYA 5CD4H 1FRJA 3MECA 1BE4A 2VFUA 3FKBA 4B9NA 4JV5F 1TL1A 5IQQA 2R3VA 4JYAJ 2BQUA 3A3OB 1OY8A 2ZOGA 1Y9OA 1RI7A 3W63A 2CZ4A 1V5IB 4O44B 4IG3B 3TAMA 1DJ0A 1YG0A 5I42A 2KJWA 3GFYA 4H54A 4WXWA 2VQEF 2CPYA 2OPPA 2FVQA 2X51A 5CA5A 5EWEA 1N32J 4DV0F 2W01A 2HW3A 2NS1B 3OQ2A 3DLGA 3K8VA 4JI5F 2QL5B 4GO7X 2JLFA 2VOPA 1PJ6A 4AL5A 1XMQF 2MKYA 2RQKA 1SQFA 2KT3A 2BKOA 4QJVA 1K9MT 1RHUB 1RT1B 2QLWA 4ED0A 3RB0A 5C25A 3T3FA 1UPPA 4RNNA 5IT0A 4K8RA 2IC3B 4DL6A 1IN0A 1TFYA 1FE0A 2VFRA 3N4WA 2LKZA 3TNVA 4CH7A 3ILOA 5LMNF 4JI6F 1OY6A 4WKYA 1LWCB 1H72C 2IYGA 3KJVA 2GX8A 3I87A 1RABB 1GMUA 5U47A 3J80U 3R8YA 5L39A 1C4AA 1JLQA 1XTZA 1CJKB 4CO0A 5C25B 1FFWB 1IBLJ 2D3OR 1RTJA 2IC3A 1KNZA 1DURA 2MQ8A 5J1EA 2AF6A 3CDBA 3W61A 1U6ZA 3JXOA 1ZTTA 2XHCA 1DFDA 2QA4S 2VASA 1FK9A 2YKMB 1RB0A 4PXEA 4LF6J 5K8NA 2DYAA 2KI2A 3HFKA 3J7Z5 3H5YA 2W8LA 4JI2J 1UVIA 3TX8A 1M5VC 1UCNA 1ZAWA 5ITHA 2ZWPA 1NH8A 2BOAA 3Q8YA 4UOGA 4R8UB 2OJ3A 3EGZA 4C3KA 2OPRB 3R9LA 1HFEL 3OTEA 3NCRA 4OZ1A 1HWIA 1X4DA 2IPOB 3GJQB 4PXCA 2F4FA 5A8RA 3FFIB 2XGPA 4OX9J 2CXEA 2HEKA 2PT0A 2NXNA 1RWPB 5BR8F 2UZAA 1DTTA 4A8FA 4LFBF 1CPZA 5LT5A 3CC7S 1YRTA 2EI5A 3R97A 2YQ0A 3JQMA 4C8NA 1X5PA 2IYIA 3SV3A 4B02A 1WF2A 1QM9A 3MTKA 4P10A 3W1YC 5CHCB 2R7UA 2OAUA 1UJ4A 3KJVB 3MAQA 2HMIB 1VFJA 4LREA 1PBUA 3B4DA 3SEOA 5LMUJ 1RYSA 4FBUA 2BKPA 1SI9A 1H2TZ 2JDJA 4YS2A 4YR0A 1P9QC 4Y6IA 4Z2XA 5KFKA 1YJ9S 4NXMJ 3K57A 4E0DA 3OT9A 5A0YA 2EFGA 5CZVA 1S57A 1R8HA 4KO0A 2BV3A 4WBFA 1HW9A 4TQRA 2FDNA 2CPFA 1S76D 1U0HB 1YKWA 5M2UA 5CCMA 3GU0A 5HMXA 1HPZB 2ADCA 3RBZA 2E7VA 4LF5F 4NLGA 2YNGB 4ECTA 3GV8B 3L09A 4A46A 3TAMB 3OV7A 1LKZA 1NK7A 1NJWA 5KOWA 4WP3A 4A8OA 5KFBA 1VS3A 2A2CA 2BJ7A 4XPEA 4USVA 4ZA1A 1KHVA 2JVRA 4NMXA 4ECRA 2QL7B 1YWXA 3HF5A 3NWGA 5AXLA 5KFXA 3MUTP 2FVSA 1IBMF 4UY8T 2WW8A 1RAHB 5E3PA 1R27B 2MTLA 3H4BA 3R6LB 1YSJA 3W9HA 3MMBB 4CYUB 3MR2A 1Q8BA 3MM7B 1N0UA 4QIEA 4A8XA 4G1QA 4MKVA 3M4XA 2MKSA 2DCLA 4HH0A 2QLBB 1HI8A 4PAAA 3NAHA 4HACB 4WFBQ 5HBMB 2VG6A 1OJ4A 2CJ9A 2YX1A 3EVWA 2W2NP 3MCNA 4LIWA 4QZVB 3PXGa 3RG6A 2AJFE 3IRXA 2YWKA 2DR7A 2W9CB 2GCFA 2JZ5A 3QO9B 1RYRA 2JH3A 1RAJA 3CUNA 1RTJB 1SC4B 1WI6A 3UD3P 5A6PA 4LF4J 3FZBA 3DYAB 1CULB 4OI3A 5J1EB 3UQSA 1QY7A 2GJ2A 3VGTA 2EBGA 3HHLA 2QTWA 2KYZA 2H9ZA 4KE5A 5HK4A 1RWUA 4P2FA 3ZZUA 1JNRB 2AZ3A 4U67Q 1PC4A 3HKZD 4HI2A 3LWMA 5DM6Q 2AV5A 4FPRA 1D8YA 4FZVA 3UCUP 4K4ZA 1CEZA 1CJTB 4DQRA 1BUXA 5A6WA 1S7HA 3D1HA 2JL9A 5KFGA 4C8KA 2HHWA 5DDRC 2FLLA 4QIVA 3BSCA 2JWNA 2R8IA 3UFCX 2EK1A 1HNVA 1U25A 4L73A 5J1PA 2E1MC 3I5BA 4ED3A 2ZBCA 4J9RA 1I51B 3PYGA 2KVIA 2FHJD 4LRFA 3FRZA 1HQ2A 5E2QA 4MTPA 4RW9A 2H5EA 1NPKA 1Q16B 2G1HA 1K47A 3OLAA 4U8VA 2W7OA 4DV7J 3PY8A 2MDAA 1MMLA 2ROGA 3HVTB 5J2PA 2QFIA 3UR3C 1NK5A 1SC3B 1T9UA 2GC8A 2I8EA 4WCEQ 4TU7A 2K2PA 2QG9B 3UNYA 2XYGB 4P2XA 3BQ1A 1WDTA 3P6YC 1WKKA 1DLOB 1VQ5S 4DR2F 4WE1B 1VISA 1PKUA 4L72B 4FP9A 2RU9A 2HRYA 3EZ5A 5EN1A 4DCPB 2NCKL 2LQBA 4Q0BA 4ZPAA 4LBIA 1CJUB 3OVSA 2CQPA 2JX2A 2DGXA 1OIAA 4DX6A 1MNEA 3SSRA 4I2QB 3BSNA 1KWMA 3ILLA 1R7IA 3NS5A 3Q83A 5EWFA 3GMGA 1WI8A 2MZRA 4JI4F 3EUNA 2IBOA 3EX7B 1PYTA 2AJ1A 3DXBA 3M6XA 5KT7A 1F9FA 1OS5A 2WW4A 4ANCA 5GAHI 3K59A 5KT2A 3AJ1A 4GKKJ 1HYSA 2DNRA 3TJ8A 4ETZA 3G6YA 2OKQA 1N5VA 1WC4A 4MKAA 1WKJA 2LLZA 5KG0A 4IG3A 3MM8A 2QX0A 1KTQA 4DR3F 3A3NB 1WHWA 4USIA 5KFUA 1JLCB 4YOEA 1S0NA 1Y5NB 4CYUA 4G1QB 2OUGA 2E7WA 2XC9A 3SZ2A 1Q4RA 1ZM4A 3A8JA 1REVA 2MZSA 4Y2KA 4EBDA 4NRUA 1HNVB 4A8SA 3MR5A 2KH9A 3CJ4A 2B9XA 1JMTA 1RZMA 2GIRA 3VF0B 3UCZP 4ED6A 1Y11A 1YBTA 2GHVC 4MIBA 3UDCA 2GJFA 1E6VB 4AQYJ 5G0RA 5LOQA 5HO4A 4IR1A 3OTCA 5HN0A 3H0PA 2CQIA 8RUCA 3PR5B 1YGYA 1N88A 3PNIA 1HD1A 2WB4A 3OTBA 2NUHA 2R9LA 1S6QB 1EKRA 3L3CA 1S59A 2CADA 3ISND 1T05A 1DQ8A 3CWJA 3OXLA 1Y5IB 4XO0A 2CPHA 2BW2A 2BANB 1ZAVA 1S6OA 2E1AA 3FBBA 3H8YA 3IM8A 1G6BA 4NLOA 2EKNA 1NSQA 1I1GA 3MMAA 1NPRA 1RT6A 5HATA 2BJ8A 3GYGA 1IBLF 3JYTB 3GLJA 1WEYA 4DR6F 5J2QB 4JI3J 1BY9A 1X4AA 2RRNA 5G4DA 3AD9C 4O3QA 5DLGA 3AOAA 1X60A 5KG7A 4IQMA 2HYIB 4AYBD 1N32F 3BSAA 1R3NA 3MXHP 3MR7A 5CCLA 3M8ZA 4TLQA 2V4JA 2YWFA 4WYLA 2MKJA 3MM5B 4OMFG 2V4RA 2R7TA 1T3OA 3N6NA 2GHWA 1QE1B 5I3UB 1LOUA 1YVFA 3BPDA 3GIRA 4ILMA 2Q6CA 1R89A 2HIYA 1DTTB 2AP6A 4C11A 4ZVTB 5BJRA 1YI2S 4G1IA 5KFEA 2ZH2A 2WSFC 3LGMA 1NBEB 3QJJA 2EWHA 2KXNB 4Q8EA 1NM2A 1U48A 4LFBJ 2PMWA 3W8PA 1RT3B 4YB5A 3T9NA 4Q44A 1XWLA 5DS7A 2WVFA 3L95X 5GVQA 1K8AT 1AW0A 3PZPA 3QT6A 1IUJA 4YHHJ 1EIYB 2XSFA 3KJQB 1H2VZ 1Q53A 1AFJA 2M8DB 3PW7A 1QSLA 1NHVA 2M0GB 4OYZA 4ZITA 1Q86T 3KK2A 5F3ZA 2WK4A 4ELTA 1KQGB 2CDRB 1DAXA 3HZEA 2RSQA 2QT7A 3C8YA 1BQNB 1FFGB 4OZ0A 4JV0A 2FVPA 4BS2A 5DGAA 3K5PA 5LJ5Y 1X8DA 4RW6A 4DSKA 1NNDA 2X1BA 3DCAA 2MZ1A 2LQ9A 1NAQA 4CP5A 2BXJA 2LDYA 2V8HA 4C3LA 2B9YA 3KOAA 1RWWB 3CCMS 1YJUA 3UN2A 4IG0A 2UUBJ 4FKXA 5KFJA 4RZRA 4M94A 2R7WA 4C4WA 2J9CA 1TUGB 4IOBA 1C0UA 4RPFA 4NA2A 2IY5B 4JV1A 1REVB 1Q7LB 2MZQA 1KP6A 1B7FA 3KUGA 4DV6F 2FJVA 1WG4A 4ETXA 4X4OA 3B8HA 3MEEA 2QMWA 1AB8A 2CJKA 4FVCA 4DR3J 4DR6J 4F0KA 4J5OA 4OL8A 1U2FA 2F63A 2C3UA 3HHDA 4WF9Q 2GAHC 4YQWA 1U1PA 2NPIA 1RU2A 2OSQA 2CJBA 5BXIA 4A8WA 4RUCA 1PC5A 2R8JA 2H54B 5B0GA 4PWWA 4C98A 3W5YA 3NGDA 1MMDA 1SC6A 2DNOA 3J80Y 2AMCB 2HNDA 1JB0C 3J7ZT 3G8SA 1U1NA 1NHKL 3DGPA 5KOXA 1DY3A 2IRXA 3PO5A 4USHA 4O3OA 2V4QA 4RW7B 1FX2A 1TFWA 5HP1A 1GQEA 2YKPA 4K59A 5K9FA 4KKOA 1X9SA 4IFYB 1AT1B 4DL5A 1S1WB 5K14B 4I2PB 1AYEA 1RK8A 1TK0A 2A6MA 1RTIB 1N48A 4NE9C 5DZ6A 3OVAA 2JC1A 2MY8A 4MIAA 1DRZA 1RADB 3G6VA 4ERDA 2Z56B 3AY0A 1ULRA 3MEDB 4F4ZA 4KGXB 3ZXWA 1F9EB 3EE3A 1JLBA 2XYHB 2VA3A 1CS4A 3VHQA 1GAOA 1N5TA 1LV5A 2F5GA 2VZ9A 1DQAA 2N4DA 2LCWA 5KFSA 3TVKA 2F3JA 1J5EF 3RR8A 4KSEB 3MM7A 4M5MA 2ACYA 5L1IA 2FJWA 1REGX 1D9DA 5T41A 2G13A 2N3OA 3H4DA 1S1VA 1V9OA 2DNYA 2Y1RI 3JAMY 1EQMA 3JTNA 4LFCF 1TKXA 1IKYA 3EMTA 2KG0A 4CNZA 1LFWA 2P5VA 3O3LA 3U1LA 2R8GA 3BN7A 4NXNF 2VG5B 2MPUA 3CC2S 3C6UB 3DRSA 2HGNA 2MHEA 2YQ3A 3POTA 4NLTA 4YMEA 2OGUA 4RW6B 2J7WA 2VBXA 1VCTA 5HSPA 4K50A 3OLBA 2KRBA 4UOFA 5CAAA 5IC4B 2IVMA 2RKIB 4DUYF 1RT5B 3S1TA 5DETA 1Q78A 3Q86A 2HVDA 3C16A 4Y2IA 3DRPB 1WHXA 3TA2A 2AQ4A 3C15A 2HG4A 4JI4J 2QV6A 3NEKA 3ULHA 3PW5A 4WU2A 4ZLJA 4CO3A 4DR4F 1BQMA 3OJUA 4ZPWR 1VHIA 1WC6A 4H4OA 2AJ4A 2IA0A 1D09B 2Z2LA 3TP2A 2MGZA 1NK0A 3IGNA 2CPEA 4KKOB 4DU8A 2AHOB 4J7CA 2XG8A 2DO4A 3FCHA 2FZGB 4I7FB 3GTYX 1S1WA 1KFDA 3MDFA 4NEYA 4WU3A 1EQ0A 2ZBQA 4RWWA 2IMWP 3V4MA 2DEJA 4LSNA 2GVDB 3DI6B 2IM3A 3BBCA 1H73A 3D0IE 4DV3J 2IA6A 1Y10A 3KNGA 3M8PB 3R6GB 2WTFA 3D5MA 5IQ6A 1K1QA 4BBYA 1TKZB 4OLPA 1PYOB 1UA0A 4F2SA 1HNXF 4A4JA 2DNKA 1VI7A 2GA7A 3SSQA 2ZBPA 3PFOA 3CMAS 2VKRA 4F4KA 2Y1IA 4K0KF 2EFNA 4HDHA 3EYZA 2BJ1A 1F2HA 2Y3YA 2V6AA 3CJRA 2G0IA 4CH0S 4NYZA 1X4FA 1CLFA 3DDKA 3GILA 3M1VA 2JOQA 3IMQJ 4PPZA 4UOHA 4ZLLA 2VJVA 1L3KA 1U8WA 1HR0F 4PQAA 1T9XA 1SXLA 1XK8A 3IFEA 5DGBA 4B3MJ 1TL5A 5IZHA 3EWGA 4EO8A 4F3OA 2N4CA 2HVHA 3QT7A 2R8KA 5J2NB 1Q8KA 3KLVA 2ZZNA 1HHQA 2A18A 2LYVA 3CCZA 1S9GA 4CNYA 2AGOA 4JBCA 1Z2ZA 3UDLA 4IO9Q 3GYNA 1WHVA 3WQPA 2MQLA 4I4BA 1SBRA 2VPZB 3RR7A 3D3BJ 3R7BB 2HFVA 1AUDA 4NX9A 3D54A 4CLPA 3RU0A 3ENVA 4DOZA 1L3VA 4BWMA 3AQPA 5HROA 1X9MA 2DKOB 3VTIA 2A10A 3HFVA 1T03B 2G2YA 2HQDA 2LEPA 4FYXB 3H98A 3KUHA 5EGYA 1NJYA 3Q8PB 4OHYA 3T5HA 3OL7A 3EICA 2JSXA 1RAAB 2IM0A 3SQGB 5C2GA 4YFUA 3HPOA 3C6UA 4ZIVA 1R8BA 5HMWA 5KG4A 3Q2SC 2WB1D 2MJUA 2N7YA 5KFHA 5G0RB 1MMNA 2WZ1A 1RT3A 3EXYA 2F8HA 3MTJA 4BLGA 2FLNA 4NI2B 2LFVA 2CNKB 3NGRA 1C2PA 3M8SA 4FF3A 2JEFA 4PABA 2C2ZB 4Y2MA 1S77D 4RUBA 1NHUA 2J9DA 1FXDA 3LPYA 1Z1ZA 4ZVUB 3KHGA 3NNHA 1SJQA 2V8GA 2XMMA 1WC5A 1VBZA 2FY1A 1FKOA 2I6WA 4DS4A 3PX6A 3NGKA 3TQEA 3TZWA 4IRKA 4Q2LA 3M8YA 5K20B 4HI1A 5I4MA 3BKUA 3FSYA 2E44A 2QIFA 2E1RA 3BN4A 4DPOA 4DR7F 2CNOB 1KS2A 1TMJA 2G0JA 2ACMA 3DLHA 3MPUB 2VFTA 3PX0A 2R7RA 3M9MB 1DTQA 4U8YA 2M9KA 4RWXA 5BYSA 4KGZB 5C24B 1Q5VA 1SV5B 2FZCB 2GMHA 2PFFB 4BCAA 3RJMB 1ROFA 5KFZA 3THVA 1HQUB 1PBAA 2BKNA 3QT8A 2QA2A 5A0YB 1H7XA 5JVGQ 1G2EA 3B4MA 1KHWA 3A8IA 1PYSB 1P9YA 4TXSA 3J7YU 1S4EA 4DV6J 3ZZZA 1HNWJ 1IBKF 5I42B 3DC2A 1QTMA 1R6VA 3U1MA 4BC7A 2EFQA 3H90A 2XSJA 1LW0B 2AJ2A 1FRLA 1GMWD 4R5PB 1MN7A 1N0VC 1NZ8A 1FEHA 1ZM9A 2EFOA 3M6VA 4QBUA 2YNFA 1HWJA 1LEOA 2XZDB 3QAUA 4KGKA 4K7QA 5M2RA 7FDRA 3Q23A 1M5HA 4P6QA 3G6XA 3L7PA 1FTCA 1N8RT 2JEGA 2BM1A 4U96A 3PV8A 2B4UA 4X62J 2CQHA 4A8MP 3GE9A 2CA9A 2W24A 4ZVRB 3GQCA 2HZAA 3NBPA 2CQ2A 3GIKA 3K5OA 4O44A 1RWKB 1RDRA 1B0TA 3BGLA 1Q1KA 3LPEA 2XS2A 3FCWA 3T6BA 3KHRA 3NRBA 1S0VA 4YN3B 2QJ3A 1ZYQA 2DHHA 1QUPA 3HHLD 3Q0AA 3ZTQA 2RNEA 2W25A 2B4VA 3LWLA 5F8GA 2BA9A 3E3XA 1VQ6S 4X66J 2FPHX 3NCQA 3M8QA 2D69A 4O23A 3KK1A 4AD6A 1HW8A 3DNCA 3LGNA 4USKA 2W2QP 4BWJA 2CPZA 5B7WA 2B43A 4Q0BB 1M1KT 4FPIA 4DV2J 1J5OA 3QFWA 1C1CB 1FT8A 5CYJA 3UR0A 1FVQA 2BZ2A 2M5YA 4OHWA 3CVKA 2OI2A 5F0UA 3NS7B 1D3WA 1UZHA 2OMLA 2AU0A 1CBKA 2O5DA 3RGIA 3H2UB 3NL0A 1UWAA 3NOCA 1NK9A 3CC4S 5KFPA 2DXEA 5KFFA 2ZH6A 1KSPA 2RT3A 2FZKB 2ILZA 1HQEA 1S9FA 1HA1A 1HNZF 1KDNA 1X0PA 2EXUA 4HR2A 4J90A 4B3SF 1QTNB 1E6YA 4MK9A 5H9EK 5D3GA 2GIQA 1U1MA 3VCDA 2QYGA 3MFHA 3CJ5A 2VQFJ 3T1HF 2A6OA 1FI4A 1PG5B 1R31A 2FJBB 1EETA 2I5JB 2ASYA 3AD8C 5A8WA 5A2QY 1JKHB 2VH7A 4G3IA 4FNHA 4WK3A 5LSLA 3BGOP 1PSDA 2CQBA 2L9WA 5GMDA 2EEYA 3CCES 1ZZNA 2YKAA 3A1YG 3FMBA 4Y3CA 3GP9A 4P72A 5D77A 4OJHA 1T9TA 2ZKTA 5MLCV 3CCSS 3FQKA 3JQJA 4ER8A 2MB0B 1IM6A 4NYOA 4IQXA 1B4SA 1LNQA 1WOPA 1HHSA 2RILA 3MZIA 3TO8A 3M2RA 5D8HB 4CLTA 3SIPB 4I1TA 1NDLA 2BRLA 1Y5LB 1X7VA 3DOLB 1MG7A 2P8IA 3ENAA 4OI1A 1J2VA 2DIUA 3PHEA 1K0TA 2BE9B 3QWPA 5HBMA 2YX7A 3GWCA 4ES3A 1B0VA 3W2WA 3DRPA 2V8VA 3N79A 1VK3A 4DFMA 1KLMB 3S7RA 3M2VA 4O4GB 5ADZA 5B08A 3OJSA 4OJ3A 4ECZA 4DPWA 4LF8J 2V50A 1MROB 4F26A 2EW9A 5LXRA 2E5HA 2XEXA 3PJ9A 4F36A 2M4MA 1N36F 2BEFA 3N0VA 4QR0A 4RR5A 4Y34A 3TUPA 3HULA 2W8KA 4ZHRB 2GMJA 3AT1B 3CMES 3ZZOA 5EHHA 2AGQA 3W65A 1SC1B 2FIUA 2UUBF 2GS8A 2BJ3A 2KU7A 4LRBA 3BGRA 1X4BA 4MAKA 2ZE2B 1LFPA 2VD3A 2GVDA 1LWFB 3H42A 4N56A 4ECYA 4RLEA 3KLFB 2BR0A 4X65J 2EC2A 3KDNA 1S9GB 2FYXA 3NNCA 2M8HA 4DSLA 4IRDA 4KBIA 1TL4A 2B8PA 2IM2A 1PCAA 2E5IA 1UVMA 3GR1A 3MAAA 1FNOA 2KHCA 2V63A 3ELHA 1JJ4A 1IM4A 2UUTA 3T1AA 2MKKA 2ZITA 4KQZA 4PQUA 2BE2B 2XULA 3NKYA 1Q8IA 2KTQA 1HBNB 1IQTA 4NCGA 2IJNA 3K8WA 3BGUA 3TI0A 1ZOTA 4CM0A 1S6QA 3LO3A 2LECA 2HFZA 4J9PA 2PI4A 1RTDB 1FX4A 2EG2A 3EZUA 3JSMB 2C2DA 2RD5C 5IWAJ 3FZ2A 2LA6A 4F02A 3GCXP 4NASA 3M05A 5KFNA 4TU9A 4IDKB 1FNMA 3CCUS 2HHSA 2ZH5A 1ITPA 2DHSA 1N6QA 1VR6A 3P49B 3TOQA 5DLFA 1S12A 1VRTB 4M5JA 5HLFB 2DNGA 4QIFA 3ZTRA 4RW8B 1YDLA 2V0NA 1RA7A 3EXCX 5HMZA 4LMZA 1S9EA 1XIQA 2R4FA 4RO0A 4JI6J 3H2VE 4ECUA 4ANEA 1UEKA 5KFWA 4RUAA 2Z57B 4ZJQA 1F3FA 1MWQA 4WXOA 5IT4A 5DG8A 5L1LA 4FF1A 3I82A 1QVFR 2NLWA 3EVMA 3NAIA 1KLMA 1TAUA 2CYYA 4P74A 2V68A 3UD5A 1HWLA 5L8RC 2DR9A 2DGWA 4PRFA 2CUYA 2J9EA 4LF4F 4JUZA 2VBYA 2ASDA 4RKUC 4TY9A 4UQTA 2YKMA 3G86A 4C3MA 1JJHA 1WOSA 4M5NA 5IFMA 1UMJA 1Y4ZB 1FF2A 2RDDA 3P8BB 3PKYA 2YY3A 3O8WA 4I67A 3K17A 4DR5F 2D3O1 1F9HA 1TV6A 1R0CB 2DVIA 2ZH8A 4HKQA 2XLIA 4DR7J 1AZSB 3PFEA 3CDEA 5HROB 4KHMA 4OV6A 5CXTA 3R27A 5ETSA 5GAGU 3QWUA 3CIMA 4IH5A 4B17A 1RQ0A 4H4KC 4TY8A 3IC1A 3VR1A 3TQ1A 1RT7B 1H38A 4MMOA 4OX7A 3KLEB 3F56A 2AEJA 3DGVA 5DQGA 3MM6A 2BMBA 1E6VA 5E3QA 5BR8J 2VDHA 4Y2CA 2L9NA 2QSFA 1S97A 4L75A 4F0MA 2R2RA 3MHYA 3U27A 3RB4A 1TTHB 4DV5F 1FRMA 2J9DE 2EKYA 1HI0P 1YHQS 2EBEA 2B8QA 2Q3PA 1YRXA 3GFXA 2NPFA 9RUBA 1ZAXA 2HHVA 4LF5J 3HSZA 3FVYA 1CC8A 2XWYA 3MAHA 4PCQA 3VZHA 2AD9A 2XS5A 1KFSA 4NXMF 3OFHA 1UETA 3NP5A 3W62A 2F65A 2MMYA 3V6KA 5C5JA 2J6SA 1GTHA 2QRRA 3PX4A 3KLIB 4Y2AA 1AROP 4X64J 2XY5A 5D0EA 3VVTA 2BQ3A 1NJXA 1HBMB 2XI2A 3PO4A 4JYAF 1FESA 3CDAA 1B0PA 2GVZB 4LR9A 4NLPA 2N82B 4ZKAA 3K5MA 5L9NA 4O4RA 2UVVA 1CVJA 4DSIA 2B6AA 3RYLA 5I3UA 3QIDA 2VC1A 1TQLA 4X65F 3GSIA 1RTDA 5DG9A 1GMWA 2P9EA 3H2LA 3R5GA 3F73A 4ECXA 4DPYA 2XQCA 2CIMA 4WP8A 2AX1A 1CS4B 4K5SA 4OZLA 1B70B 2HLTA 3ZTOA 3CJ0A 1NO8A 3J7A1 1EB0A 5DRKA 2Z8QA 5JJBA 2Z58B 2BUNA 3HSJA 2BABA 3G8QA 3L4BC 2G0CA 4OJGA 5D4LA 1SH2A 4CLLA 4TVAB 2MQQA 3UVJA 1RTZA 3RAQA 3PVXA 1F3VA 2LQ5A 3UDEA 3AJDA 2XY7A 2FVRA 1JX4A 3AB4B 1M5KC 3C16B 3HSGA 3Q8QB 4DFKA 2DR5A 3UN3A 2LQ8A 1YZ7A 2Z2ZA 2ZEJA 3PR4A 2KM8B 5EX0A 3IRWP 2BANA 4ES1A 4ECQA 2IIHA 3PW4A 1TL3B 2B56A 4RX6A 3SFUA 1WG5A 2ILYA 3FBFA 4PG5A 3POTB 1H3DA 3Q24A 3MR3A 1VQ7S 5KTQA 4C8ZA 4USJC 3A3PB 2DB1A 1U45A 2BDPA 3N5FA 4ZJLA 1W26A 4CDIA 3T9ZA 3CULA 4F04B 1WUUA 1HLWA 1O0PA 4OQJA 1J5OB 1LWXA 2YNGA 1OQ3A 4I64A 2ZHBA 4RBTA 1VC0A 1VRUB 1SPBP 1TUVA 2HSEB 2L9DA 3HHNB 3KK1B 3HVRA 2PC6A 5ETVA 2ZOFA 2MXYA 3FSIA 3OSPA 3QJLA 2OEKA 1UAWA 4JI0J 3V5RA 1N34J 1WF0A 1LW2B 2HHXA 1KN6A 1X4HA 1IKVB 4K2JA 1UEVA 3J81Y 3TX0A 2DGOA 1B3TA 4ZOSA 2ZNYA 2R7XA 1KR4A 1PJ5A 4ZPBA 3RZAA 2JEIA 3W5XA 4F4AA 3KKFA 4DLEA 3PKMA 3UNGC 5FLXU 4GC7A 4DQQA 4G65A 2MSSA 2HFOA 3LGHA 4F7VA 4J9LA 1JKHA 2BM0A 2NXUA 5B0EA 2LDIA 3F41A 1Q0NA 1V3SA 3FUYA 5B0AA 4QPXA 8AT1B 1FHTA 3T1YF 1X5OA 1VDHA 3AHPA 4UW2A 4DWIA 2Y0SD 3Q8UA 4NZ7A 3DU5A 2F7VA 3R7SB 2DEIA 4MFBA 3TEHB 4I0WA 2X3DA 4NI2A 1E6YB 2R8HA 2ZH7A 4ZHRA 1S0OA 2NREA 4CLZA 2FGOA 1WTBA 5L46A 4M8LA 3ZC4A 2UXBF 5MAOA 2PI5A 3SSSA 1UJ5A 2OPPB 4FBTA 5D4NA 1NB7A 2J6UA 2HS4A 3ETMA 1U1RA 1S1UB 2K8GA 3DLEB 2L3MA 1RKIA 2CAJA 2V8DA 4DQIA 3C6TA 1TL1B 2VV5A 3FBCA 1O6XA 1VBKA 1R0AA 5HQMA 4RW9B 3ICLA 5B0FA 5K14A 2DTJA 3T6JA 1S7IA 4LIRA 5AJ3F 3MMJA 3SXLA 5AXKA 1XNRF 1UPMB 1IJFB 2HVZA 2J0SD 4O3NA 4AE5A 4F4XA 3QQCD 3HLUA 3MEGB 1WC3A 4I2QA 4ID8A 2AZ1A 5LL6d 3W5ZA 3CSKA 5H9FK 3CD0A 2LMIA 4DL2A 3M32B 1VQ9S 3PG9A 3CF5Q 2FHJA 1U2CA 1X9WA 4ICLA 4ID5A 1N33J 4HL9A 1F5BA 4OYMA 3DU6A 1DLOA 3IBWA 4ELVA 2YH1A 1VC5A 2F9DA 3NG8A 1NKCA 5J2NA 4KC5A 1KD1T 2XO7A 3MMCA 1N4LA 3RBXA 4NLRA 4M5KA 1S0MA 2CNLB 4N77A 3BJYA 2AYMA 2LU1A 2UVRA 5IT9Y 2YNIB 2VQEJ 2Z0GA 3H5XA 2CQ1A 4JV2A 4X2BA 4DR5J 1T05B 4CLYA 1JLFB 4XPCA 1JLCA 2DNLA 2QZ8A 3RAMA 4TQSA 3PIOQ 2VIHA 4AUKA 2HVIA 3A13A 4LF2A 3DLGB 1WELA 1VRUA 1S1XB 3I32A 2XCAA 3DMJB 1UJ6A 2WSEC 1NPPA 1ZM2A 2DY9A 2OFHX 2RS8A 3R5JB 4HTIA 4EK2A 1C0UB 4EBEA 5CYQA 1BHNA 4JOUA 3G71S 2VG7A 5H9EJ 4N41A 4WWSA 4AFFA 2O67A 2MZJA 4K2XA 4WIIA 1WEZA 3KG0A 2V9KA 2ALYB 3IXQA 3TJAA 3RBDA 3CEDA 1SJRA 2G4BA 2HNZA 1NKEA 1AXQA 2KKHA 2DGTA 3D28A 4Y65A 3KMQA 3DLKB 3LP1B 5HLFA 1GT8A 1WF1A 4IH6A 2J7KA 2UU9J 4FXDA 1HMVA 3OSNA 4DV3F 4PWDA 3PEHA 2KYXA 2HHHF 3ISZA 3P45B 2E29A 2HWTA 3VGUA 1OWXA 2BX6A 5KAKA 2I38A 3TUIC 3RB3A 4DV1F 1WDDA 3IO1A 5K5MA 3DRYA 1HBUA 3D1QA 3HMJG 3CCVS 4B3SJ 3JYTA 3R3TA 3FEYB 3MFIA 4EU0A 2RUGA 4FYVB 4ZP7A 5LJ3Y 2WVDA 3NY0A 3NBPB 2HK3A 2DPJA 4LF7F 1RTHB 2CNNB 4IFYA 2JHEA 1WG1A 2UXDJ 1XC9A 1XNQF 1NJIT 4M63A 2FB0A 1C1BA 1LWEB 1HBOB 2RUSA 3AB2B 1S48A 1SVDA 2V2QA 2QL9B 2W2PP 2WVBA 3G96A 2HBRB 2ZKUA 1N5SA 3QSIA 1B64A 3SFGA 1OPZA 1QD1A 3MMCB 4DZDA 4CCHA 2CWKA 3TWZA 1X5TA 1NSKL 3FCVA 4C8LA 2B4PA 1ZA2B 2OELA 3KLGB 2CZ9A 4WYWA 1NKBA 5KG6A 4EBCA 4B3RF 3MM6B 4KR0B 2GQ2A 4X64F 3X3UA 2HFUA 3CJQA 4U95A 3AFGA 1I5OB 5FDLB 5JUMA 4LR7A 1X5SA 2BBEA 2HS0A 4N47A 3HFZB 5F9LA 1I94J 1D9FA 4NRTA 1DHMA 4NPOA 3M2UB 1M5OC 1Y3JA 4B3OA 1I3OB 1UL3A 3MD1A 3PEJA 4KGMA 2C2MB 3TA0A 3LALA 3OFFA 3U7JA 3IRXB 1TR0A 1RWNB 4L3KA 1RWXB 3V81A 2DHXA 4KO0B 3B6BA 3FBEA 1HWUA 3N28A 4NLDA 4PWUA 5CD4A 5IT9U 4KFBB 2H1YA 3OFGA 4ILRA 2YQ1A 1XBWA 1C1CA 2ZOMA 4ZN1A 1PAUB 2KRRA 5IOLA 4GMKA 1HMVB 4YR2A 2XGQA 5DG7A 3DLBA 2DY1A 4TNOA 4C2MA 4PWDB 4ED2A 1JLAA 2RIJA 1IBCB 3BBFA 4YR3A 4K4VA 2OPQB 2DRBA 1RCOB 2XMKA 4XTTA 1HI1A 1WHYA 4FYWB 2HIQA 3I31A 3KUEA 4ANDA 3GJTB 2R2TA 1NK6A 1ZS6A 1YK9A 3MOZA 2CPXA 3HVAA 1BQMB 1YZ6A 2FC9A 1IKWA 3E51A 4PG7A 4WK1A 4ZP6A 2I9SA 4O0NA 2RRAA 3MCOA 2M2BA 1HBMA 2ZUAA 3IA0A 5HQLA 1GK8A 4WFNQ 1OY9A 3IS9A 2CKWA 2HQGA 2ZHOA 1N5YB 1F6TA 1F5AA 3IBFB 4R8UA 5F8HA 3V6JA 4DUZJ 1C1BB 1C0TB 5DJBA 5F9NA 1TELA 2FVCA 4GVLA 4NLXA 2XZTB 4KGVB 4AXIA 1H2UX 4QQBA 2BE7D 3MEEB 4LJMA 4QU6A 4TN2A 5AXMA 4NXNJ 3D0GE 1HBUB 4DV4F 2OFGX 1VRQC 4F3MA 3EPIA 1ZM3A 1QAXA 4PXDA 3CCLS 1A9NB 4X4SA 2V67A 1SKRA 3NMRA 1KVKA 4ZMMA 5HJXA 4EFAC 2ZC4A 2H3EB 3OXFA 2RJZA 2K3KA 2DT9A 3KK3B 3D1OA 3KJFB 4ZVOB 2CG4A 3DKDA 1JIHA 2K1RB 5BYQA 3TA1A 2KG1A 3AD7C 4P52A 3WC0A 4B9LA 4PR6A 1YBUA 3VZIA 4V19X 3G82A 1FRXA 3R5CA 4D3GA 4LFCJ 1PO6A 2ZZTA 2WONA 1X4GA 2P6TA 3IWLA 3DGPB 3UI3A 4YP3A 3SYZA 2J0WA 4J9MA 3OUYA 2DR8A 1X0FA 3HX9A 4J91A 2MLXA 3AXKA 2YKOA 4H4KA 4ECWA 1D9AA 5A8KA 2NSBA 2VU5A 3CMQA 4ZVSB 3M8WA 4MJKA 3BO2A 2XNQA 2J8AA 3MCMA 3MM8B 3D9BA 4OZ5A 1C0TA 2L48A 5KFIA 2KB2A 1TK8A 3C66A 3JSBA 4ZPCA 2I2YA 1N52B 1MU2A 2CZVC 2W2MP 4LR8A 5FDLA 3ZZRA 2VB6A 1S4FA 5ETOA 1V3ZA 5K8PA 1IKWB 4B9SA 4LF9J 2RE1A 3BZQA 4OHVA 4H4MA 3W60A 2W4PA 3HCXA 3VAHA 1N56A 1BC6A 3WIUA 3ITHB 4NLUA 1NK8A 2EPIA 1J5EJ 3DI6A 4IOAQ 3OHBA 4B3RJ 3J7AN 2KJVA 5D0HA 3E2EA 3MOJB 1OPIA 1FWLA 3J81j 2Z4PA 1ZPVA 3PHTA 4HT5A 3S8SA 4QWAA 3ILIA 3O5TB 4DG1A 2FTRA 4N5SA 2NYHA 1XNQJ 3C14A 1SIWB 4TY8B 2B5JB 4B3MF 3I0RA 4RW4B 1BXNA 2QSWA 1IQZA 2YNHA 2HFSA 2ROEA 2XMUA 3H59A 2MKCA 2MLZA 3GYXB 4OYWA 4GC6A 1MSWD 1NUEA 3MGJA 2WHOA 1N34F 3W7BA 3E01B 1RT6B 2DNZA 2NXCA 1XR6A 2JJ4D 5JXSA 2GJIA 4N7TA 2HFNA 4U9RA 4RBUA 2AYGA 3JS9A 3R5DA 2W9AA 3T5KA 2CPJA 1CJVA 1Q8LA 2V34A 1H0HB 3OR2B 1RT5A 3US5A 4YY3F 4B9VA 1UTAA 3LOUA 2Q43A 4DCOB 2UXBJ 5E41A 3N6MA 5DQHA 2B7CB 2B5JA 4ZDNA 2CQCA 4Q45A 3MM9A 4JI7F 1S5ZA 3OL8A 2NZ4A 4MH8A 1K0VA 2ZH4A 2H5JB 1RHMB 3BREA 3GFZA 1T94A 4QYZJ 1EJ7L 2C1EB 1FEEA 3QRRA 1URNA 3W66A 1YRUA 2ZM6F 3QRQA 4PG8A 3KLIA 4CLFA 3FFIA 1EHWA 5AE1A 1RU1A 2IRUA 3WBZA 3BKTA 1R0AB 1XR7A 2XYPB 3CD7A 1EKSA 4K4TA 3ZTPA 5JMNA 3V4IA 4BDPA 2V4JB 1GTEA 2VJUA 4K4XA 1TVRA 3ETOA 3HD1A 1Q95G 1JLGA 4DV7F 3D67A 5KFMA 3DHWC 3SQOP 2XLJA 2GO8A 4IOCQ 2BJEA 4DSFA 2H65B 1TMMA 4CH1A 3RAXA 1P6TA 3W2WB 5KFLA 3WX4A 4LSZB 3BKFA 3PJXA 2ATLA 1FDNA 4KHPJ 3JTOA 4ZVFA 4HT7A 1KBRA 5L38A 1GX5A 3QLHA 3QZ8A 4DV2F 2HPUA 4DUTA 1ZA1B 3HT3A 5KT6A 1VQLS 4GO5X 2BACA 4USMA 4ILLA 3TW0A 4ED7A 2IAJB 2P6SA 3AH6A 3HSDA 1VYAA 2DJWA 4ZCMA 1Q7YT 1OSDA 1WACA 4LBHA 4KJIA 1U49A 3BGFA 2XS7A 1RBLA 2LA4A 3UPFA 2QYCA 4Z7YA 3V6HA 4DS5A 3GIMA 1EETB 2I5JA 2C2KB 4A8KA 2UUCF 3ISNC 1VIOA 1A0OB 4OX9F 4ZP9A 4AT1B 2KFZA 2XZWA 1WD6A 5CYQB 4QIWD 3CE8A 1QUVA 1Q79A 2HURA 1UFWA 4C0OC 1F1BB 1D0EA 1FDDA 1P8GA 4M5DB 4C8MA 2HNYB 3BBBA 3D66A 3FSXA 3JQKA 4C0HA 2L41A 3HXMA 4ED5A 4CO4A 3O44A 4LRDA 4IFVA 1U47A 1TVRB 3BYRA 2FLPA 3HVTA 2FY8A 4P75A 2EG1A 2HHTA 3BR8A 4QWEA 2HHHJ 4OYXA 4C8YA 2HBZB 2IDLA 4NEZA 4ZVPB 4M5HA 1G4CA 5LXYA 2HQFA 3P4UB 4DXLA 1UZDA 4IKAA 1CJKA 1OYEA 2OP5A 4FDFA 5IV3A 3K5LA 2B3TB 2H4YB 3QAEA 1LQ9A 2DXDA 3EDQB 3FEZA 3IR6B 2ZH9A 4F4YA 3RW6A 5F8NA 2COLA 2I0XA 5SUHA 5L1KA 3KMSA 1TL7A 2AEFA 4TYAA 3H40A 1IBKJ 2IAJA 2ASLA 3A12A 4Y00A 4KTQA 3AAWB 3DOMB 1RJJA 3K5NA 2QE5A 1D1UA 3IWXA 1S6PA 3QMQA 4Z7CA 3MCSA 4AL7A 2OHDA 4W90B 3AQOA 1H74A 3SMZA 4FXWA 3KLHA 5KFDA 4LF8F 3W9IA 2X3GA 2K3IA 1N36J 1ZPWX 1N5QA 4B3OB 2MLYA 4QIGA 3W2VB 3NMAA 4WIQA 3OVBA 1NLKL 2HWHA 4LF7J 3SQGA 3OHAA 4MK7A 1UA1A 3IR5B 3DOMA 3JB9k 3V4IB 1EP4A 2JC0A 5LSRA 4AXJA 2A3JA 4RNFA 2GMLA 1JXLA 4X4VA 1VBXA 3I0SA 1S1TB 2ZZMA 2HHPA 2BW7A 3I55S 2IJRA 1EX8A 3GB0A 1VBYA 2YNFB 4Y28C 5EWGA 2Z2YB 1RGVA 1BMQB 2PEBA 2HAIA 3OTOF 2C3PA 3A4TA 2V69A 3G87A 4HDGA 4KAIA 4IO1A 1H6KX 1EAYC 3VAIA 2CJXB 4UZBA 1EP4B 2VF3A 4KY3A 4B08A 1NB2A 2D9PA 1K73T 1VQ8S 5L1JA 4CLWA 3N01A 4JI3F 4CT9A 6AT1B 4FF4A 5GAEU 3RRHA 1GMVA 1IJEB 1FA0A 1JXEA 3QATA 4ZCLA 1FERA 2B0GA 2IVYA 2ZC3A 5J2MB 5JVHQ 2POKA 2UUWA 2YPYA 5CZXA 4ZLPA 5F8MA 1BGXT 2H48B 3PM9A 4OI4A 4C9DA 1NSAA 1XMBA 3HKWA 3MMAB 5HANA 4OHZA 6FD1A 3IM9A 1B99A 2B9EA 2WONB 2QLFB 4QWBA 5HVFA 1T8EA 2APOA 2KZZA 3ET6A 3QT5A 5F8IA 2WVCA 3QGHA 4ED8A 1RSCA 4QW9A 4EYIB 1JXVA 1T9VA 4PZVA 2ZD1A 1UFKA 1VJQA 3QIPB 3IS9B 1TKTA 1YLXA 3HT0A 4YB7A 1NJZA 4UUXA 2PO4A 3G9CA 3TZYA 4W92B 4D3HA 5ETTA 1YBAA 5DZ7A 4RJVA 3VAFA 1V3RA 3BF4A 1LXNA 4DR1F 2D1CA 1PIEA 2UUCJ 4J9VA 4EZ9A 5IS2A 4FS1A 1QE1A 2LXUA 3JAMU 1VQOS 2ZUGA 3BM7A 2VG7B 3VGVA 1B7YB 3CD6S 4X4QA 1UWBA 2DGSA 4F67A 5IXUA 3HK2A 3PRBA 4M5IA 4HTJA 2GO9A 4LF9F 2HZCA 4HHJA 3MPWA 1TKTB 3M30B 5DQIA 3CO9A 4R25A 1HIYA 1F2GA 2DNPA 3T19A 4E8UA 4DUZF 3TAPA 3TVZA 2DNHA 2RQMA 3GV7B 1TAQA 4B9MA 1S49A 4HYKA 4QWCA 2XMJA 2AWZA 1T03A 2JFKA 1ACMB 5KFQA 1JLFA 3RW7A 1MWYA 3ZNUA 1N54B 1U26A 1YJTA 1RT4B 1VMBA 3EPGA 4YUDA 5HVHA 4ZPTR 2CFXA 2Y1JA 5T7LB 2AIRB 3K2YA 3KFWX 2OMOA 4DV5J 2W9BA 3T41A 3H5SA 1C4CA 4URSA 2D41A 4LFAF 3DOKB 4CTAB 3MM9B 3O6QA 2CJAA 2M3DA 4JB8B 4DPTA 1UVJA 5A8WB 2E1PA 3NGTA 2DO0A 2GVZA 1SQGA 2PA8D 1NRKA 4UF4A 1R6YA 5ETQA 4DBQA 3LQVA 1U09A 2DHAA 3QRPA 5GAGI 1EZZB 3MEKA 3GG1A 3TEGA 4DX5A 1FRHA 3NLCA 3MAAB 3QGIA 4KHPF 2NSCA 4BC9A 1U1KA 5E3RA 3IGVA 2C2NA 3OPKA 2FJEB 2KN4A 4B3TF 2D74B 2MHNA 2XM3A 2PIIA 2WAQD 3UE2A 4JI1J 3DHXA 4FF2A 3S6EA 4KB7A 2Y1LB 2ZBRA 4NYPA 3R5AA 2VBWA 4EEYA 2DNQA 1HHTP 4CZCA 1IKYB 3CNQP 4GVBA 4PUOA 3BGRB 3BH7B 4ELUA 1SJ1A 2YKNB 4X4TA 1U8SA 3DM2A 5LSOA 1WC0A 3EZOA 5FD1A 1U6FA 3W2VA 1M1HA 4OI6A 1NSPA 3PDNA 2C2RA 3AJ2A 3FEXB 3P5BP 5GAEI 1IR2A 2D7SA 2VL1A 3QNWB 4MYUA 4WFXA 4WJBA 3M8RA 3LAMA 3QIPA 1P1TA 1HD0A 3LP2A 1RLCL 2G2OA 2WCXA 3MF5A 4J9UE 3SDEA 4CWBA 5C7PA 1EARA 2UUAF 4RNMA 5SZTA 2DGUA 3TR5A 4DQPA 3LUYA 2CPIA 3HHEA 1HYSB 3LA0A 4QR1A 4ZLNA 4B9TA 1UKUA 2PDAA 5FJ4A 3TJ9A 5AXNA 4PKDB 4M95A 2OEJA 1UWBB 4IFVB 3UWTA 4IR9A 1SQEA 3G4SS 2E5LF 5KG5A 1GXTA 1RACB 1SCJB 2HQCA 2R42A 4OZJA 4EO6A 3IG1A 1S6UA 1W2BR 4RU2A 1QSYA 1YTYA 3BO3A 1LWCA 1NZAA 3WDOA 3H5UA 4KV8B 1S9EB 2ZBIA 4RL1A 3TYTA 4RNOA 2DIVA 2IJFA 3CXCR 1KQSR 3IN5A 1QSSA 2XNRA 2MJNA 3OTDA 2ZE2A 4O3PA 4YDDB 1G1XA 2RS2A 2QMUB 2RQ4A 4ZCKA 4IDKA 3KLEA 3PJWA 5KFCA 2ZH3A 2WOMA 2FQQB 2IFXA 1FFSB 1TL3A 2DGQA 5J2QA 2V8PA 1RLDA 2U1AA 4GKJF 1KVIA 3TVYA 5LMNJ 5BYRA 4HHHA 1U0HA 1IKXB 4WZQA 2EFPA 1OYDA
chains in the Genus database with same CATH topology
5F8LA 2HNYA 2GHPA 3BDPA 2XY6A 2OTJS 5AE3A 1TV6B 1FVSA 2DD8S 3OW2R 2HQIA 3CCRS 1RTIA 3I9V9 4E98A 4MK8A 4F8RA 1XN9A 3OL6A 4X4RA 1PILA 4CO1A 4DN0A 3KLHB 2RB7A 4QWDA 3Q2TC 2CQ0A 3M2UA 2HHUA 3CGIA 5B0DA 2QMXA 1FJGF 2Z2MA 1Q82T 2UVUA 4XAKA 4P2SA 3CT9A 4BHQA 2QFJA 1IXKA 2PSZA 2NYIA 2MSTA 2GQCA 2K7KA 2YWGA 4MKYA 3W3SA 1P1LA 1ZETA 1NEEA 4RW8A 4DMZA 4OI2A 4L3NA 4NLYA 3QZ7A 3MI7X 4DHVA 4N8NA 1VHFA 4URGA 4R0EA 5AE2A 1F60B 4ZS6A 1U1OA 4DDFA 1R43A 2ZFHA 3AA9A 5M2PA 1K1SA 1QVGR 3CB4A 1SKSA 4CI0B 4FNIA 1Q81T 5J2PB 4CO2A 4NOHA 1RTHA 2M7SA 5A8KB 1KLNA 1KONA 3I6PA 1JWWA 4NZ0A 3CCQS 3RRGA 1VQNS 3THTA 5KFAA 4DL0C 2BQRA 1UVNA 1M5SA 2P9GA 4OZNA 5B09A 2B4OA 1FJCA 1SIZA 1TK5A 4LSLB 3V6DA 1I6JA 1XERA 2N3LA 2RH3A 3CD5A 4TKTA 4DLGA 4DFJA 1RT7A 1VIXA 3R1HA 4I6YA 2ZD1B 3FMWA 2C2EA 5KT5A 3CCTA 2C3MA 1YJNS 2KT5A 5I3QA 4PXBA 4IRCA 3CJKB 2DPIA 5E33A 3THPA 5CYMB 3BSOA 3I5AA 4EWTA 3DRRA 1SL2A 1SUQA 3O1LA 5A8RB 4ECVA 1OQ6A 2DISA 2VFSA 1RT1A 5E3CA 2CQ3A 3LP0B 1VQYA 1YQHA 1HNIA 3P5TL 4EYHB 4Y0FA 4NLWA 1QAYA 1G3OA 1H98A 3M2VB 3RRKA 3U02A 4K4UA 1ZBTA 3UD4P 3C2PA 2PGCA 4DFPA 1QLNA 2O66A 2NQPA 2WBMA 1SH3A 5D4PA 5DDOC 1JLGB 5KT4A 3HP6A 3DOLA 1YITS 3JTPA 2C42A 2YNIA 1T95A 2YVSA 3C3LA 4K4SA 2PD1A 1RP5A 2RDJA 3BEGB 2NUUG 4DL7A 4U6PA 2E5JA 2KFYA 2IVFB 4DF8A 2JLEA 1LWEA 1HBOA 2OPSB 2RRBA 4A8QA 3FRYA 1MU2B 1MROA 2IRYA 3OR1A 1N6QB 1FD8A 1SH0A 4ZVEA 3QLHB 2OO4A 1UP1A 3KNAA 2OLWA 4DN9A 3ZZYA 5F3TA 3TUZC 1MWZA 2DRAA 5HMYA 2XWXA 2W9BB 5DDPC 1OSCA 2KDOA 1U2RA 3BS9A 5CH7B 2KXFA 2VBZA 2IA6A 4JI1F 4A48A 3H25A 4PQUB 5DG7A 2VKZG 5E5NA 1SUQB 2D3ZA 5D78A 3WC2A 1HBNA 4NZ6A 4HH1A 2DNMA 2KO1A 2RDIA 3C6TB 2VUGA 3DLEA 4DSEA 5HI7A 1FNXH 4J37A 2VA2A 4O3RA 2Q1LA 3CCJS 3VAGA 5HL7Q 1YJRA 3M30A 2KT2A 2O1PA 1VRTA 3FNNA 3ZZ0A 1FO1A 3B82A 2VPXB 4NL5A 1JNZB 1KTVA 2LVWA 3S01A 2XSJB 4FVMA 3HZGA 1GXLA 4R5PA 3K7RA 5T14A 1BWEA