1N6QB

Hiv-1 reverse transcriptase crosslinked to pre-translocation aztmp-terminated dna (complex n)
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
429
structure length
429
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*AP*T*GP*CP*AP*TP*GP*GP*CP*GP*CP*CP*CP*GP*AP*AP*CP*AP*G
publication title Structures of HIV-1 Reverse Transcriptase with Pre- and Post-translocation AZTMP-terminated DNA
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/immune system/dna
total genus 100
structure length 429
sequence length 429
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2002-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1n6qB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1n6qB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1n6qB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1n6qB03
4MKBA 3G6XA 4EEYA 4LQ3A 3DDKA 5CYMB 1JKHA 4YP3A 2IM2A 3EZUA 2WTFA 1N5YA 2C22A 3KLFA 4O44A 1YVFA 4NLQA 1S6PB 1JLBB 1TQLA 1IKVB 2ZE2B 4RW4A 3QLHA 1UWBB 4RNMA 4I2QA 5F9NA 4IDKB 3LP1B 4RW9A 1RYRA 3EPGA 3NAHA 4IFYB 4NRUA 5J2NB 4B3OA 2D3UA 4ZPDA 2JC0A 5HBMA 4TYAA 3MR3A 3V6HA 4H4OB 1LWFA 5KFYA 1TL3B 5F8LA 4IFVB 3H5UA 1NHVA 1RT2B 4IH5A 2XI2A 4KE5A 1JIHA 4K4TA 4FBTA 1S1TA 2J6UA 1JLQB 4J9PA 4NYZA 1C0UA 4DG1B 3M9MB 5KFVA 2BRLA 4WZMA 5L1IA 3BGRA 4ECSA 1RT6B 3G6VA 1FKOA 1HMVB 2YKMA 4TN2A 5EWGA 3V4IA 3C6TB 2R2UA 3T1AA 1K1QA 3JSMA 3RBDA 4ID5B 2YNGA 2HNDB 2FVCA 4U6PA 4I2PA 2ZD1B 2UUWA 4PQUB 3MFIA 1TL1B 3PJXA 4ZHRB 2IJFA 4U7CA 2E9ZA 3FDSA 1KHVA 3I5AA 5CYMA 3H40A 3KJVB 4TY8B 1NNDA 1S6PA 3DRPB 1RT1B 3PW2A 1JLBA 3SFGA 1IKVA 2ZE2A 5KG0A 1UWBA 3M9OB 2IBKA 5KFMA 1JLFB 4ECTA 4IDKA 3LP1A 1IKYB 1MU2B 1QUVA 3DRSB 4G3IA 3FFIB 3CDUA 4IFYA 4QW9A 2BANB 1RT5B 5J2NA 4QWDA 5KFGA 2F8EX 2ALZA 1LW2B 3DYAB 4H4OA 1K1SA 2JEFA 5I3UB 1TL3A 1SH2A 4IFVA 4K4YA 1RT2A 4ZPBA 3ICLA 3Q8SB 4NLVA 5I42B 4YMEA 5F8NA 1JLQA 1LWCB 4MFBB 2C2EA 4DG1A 3LP2B 1S1WB 3KLHB 5KG1A 4F4ZA 1RT6A 2UVVA 1HMVA 1S1XB 2RF2A 3DLEB 3C6TA 2YNHB 3GYNA 2BR0A 5EDWA 4ID5A 2BQ3A 2HNDA 4ZP6A 5KFSA 1CSJA 1TKXB 2OPPB 5KG2A 2ZD1A 3MR6A 1S49A 4PQUA 1TL1A 4M94A 4ZHRA 2XC9A 4ECVA 3UPFA 4LQ9A 2FJVA 3LP0B 1KLMB 3VQSA 4EBEA 3KJVA 3CJ5A 1W25A 1QAIA 4RUAA 2R8HA 2WB4A 4TY8A 3IGNA 3DRPA 1RT1A 2IM1A 2XCPA 4LSNB 1J5OB 4Y2CA 1HQUB 3QZ8A 2VG5B 4J9RA 1JLFA 1IKYA 2HNYA 1MU2A 3DRSA 4K50A 2W8LA 2AX0A 3FFIA 2R8JA 3IS9B 1RTHB 1S9GB 2BANA 1RT5A 4KV8B 3BREA 1Z4UA 3Q8RB 2ILYA 2D7SA 1LW2A 3DYAA 4NZ0A 5I3UA 4K4XA 2FLLA 3LALA 5KFIA 4NLPA 5L9XA 1S1VB 5I42A 5KFNA 3MECB 1LWCA 4MFBA 3MEGB 3IN5A 1SUQB 3LP2A 4K4VA 1XR7A 2XI3A 4O44B 3N6LA 4NLTA 1REVB 4O3QA 1S1WA 4RNOA 3KLHA 1D1UA 3H4DA 4KHMA 4WXWA 4URQU 2FLNA 4KFBB 4DEZA 4ECUA 1S1XA 3DLEA 3GV7B 2YNHA 1S0MA 2AX1A 4NLXA 5C42B 5HROB 5KT2A 5KFUA 4KAIA 5F8GA 1TKXA 5HBMB 1KHWA 2OPPA 3M9NB 4J9KA 1S0OA 3CJ4A 4Y2AA 2C28A 3T5LA 2GIQA 4YQWA 3LP0A 1KLMA 5KG7A 1RAJA 4Q44A 3Q8PB 4QWBA 2W7OA 2W9BB 2WK4A 1C1CB 3MR5A 4ZMMA 4NLRA 3KMSA 4LSNA 1J5OA 3H98A 4ZVHA 1HQUA 2VG5A 2GC8A 4EYHB 5KFXA 4R0EA 1IM4A 3PW7A 4J9SA 3IS9A 4IG3B 1RTHA 1S9GA 4KV8A 4ZP7A 4ZPCA 5KFKA 1S4FA 4MK9A 4XO0A 1RA7A 3BJYA 3QGHA 4DL5A 3DMJB 1S1VA 5DG9A 1EP4B 4QWAA 2W9AA 1S9FA 3MECA 3DI6B 3MEGA 1T3NA 1SUQA 4IH7A 4NRTA 3E01B 1REVA 4JUZA 3GV5B 4RW7B 5KG6A 2AGPA 4TQSA 4KFBA 2AU0A 4ZPAA 4J9LA 2WRMA 4TLRA 1TKTB 5DQGA 1C0TB 5C42A 5HROA 2I5JB 4NLYA 2JEIA 2R8IA 3OLBA 3DOKB 5EWFA 3RB4A 3QGIA 3RAQA 4R8UB 3EPIA 2UVRA 1GX5A 1C2PA 4IR9A 5DQIA 3HVWA 5KFZA 3UR0A 2W9BA 1C1CA 3SFUA 3V6JA 2FVQA 4ZP8A 1TV6B 4WYLA 4FS2A 2ASLA 4IR1A 4MKAA 2RF2B 4KHRA 4QWEA 4IG3A 4JV2A 2VG7B 3FSIA 1S9EB 4GC7A 3OSPA 1TVRB 4ECRA 3ISNC 1TKZB 3DMJA 1EP4A 5C24B 4EYIB 5KFBA 3DI6A 3SI8A 4I7FB 1FK9B 2YNFB 1RA6A 3E01A 4R5PB 2DPIA 4ED1A 3H5YA 3BQ2A 3H5XA 4RW7A 3RB3A 4KSEB 2HNYB 4NLWA 2R8GA 3M8QB 1TKTA 5J1EB 1C0TA 3I0RB 2V4RA 4IG0B 2I5JA 3RB6A 2V0NA 4FBUA 2RDIA 2YNIB 1JLEB 3DOKA 4DL4A 2YKNB 3OL7A 4R8UA 2UVWA 3D28A 5KG5A 1FKPB 3PZPA 2ASJA 2JC1A 4GC6A 4URSA 1T94A 1DLOB 3UDLA 2BE2B 3GILA 3UQSA 3OHAA 3MF5A 5L1KA 5T14A 1TV6A 2J6SA 1SV5B 2OPSB 1QAJA 3DRRB 4O4GB 2E9RX 2AWZA 5F8HA 3CJ3A 2XCAA 1HQEB 3OL9A 2CKWA 2VG7A 3GIMA 1S9EA 1S10A 1TVRA 1IKWB 1VRUB 5DQHA 5KFFA 5DG7A 3DLKB 1TKZA 3CDEA 3M8PB 3BSOA 3QIDA 4ECXA 1DTQB 5C24A 4I7FA 1FK9A 2YNFA 3T5HA 3PW4A 1JX4A 4R5PA 2JEJA 3CDWA 4X2BA 4NLSA 5F8MA 5HP1B 3NGDA 3MEDB 4TYBA 3KLVA 2WHOA 2AGOA 3M8QA 5J1EA 3I0RA 5KFAA 2IJNA 4IG0A 3E51A 2YNIA 1JLEA 2IAJB 2C2RA 2YKNA 2QE5A 1S48A 1FKPA 3TAMB 1S6QB 3LANA 2ASDA 2WONB 4ECYA 3FRZA 3I5CA 3GV8B 2IM3A 1JLCB 1DLOA 2BE2A 1S0NA 1T05B 4IOBA 5KFEA 3NKYA 3BQ0A 1N56A 3V81B 1OS5A 1MMLA 1TP7A 1SV5A 2OPSA 1RT7B 3DRRA 4O4GA 2IA6A 5KFWA 1JLAB 1HQEA 2RKIB 2HMIB 3HVTB 3PJWA 1HARA 5KFDA 2V4QA 4MK8A 5KFCA 1VRUA 1IKWA 4PWDA 3IRXB 3PHEA 3DLKA 4ECZA 3M8PA 3KMQA 3H5SA 1DTQA 5KG4A 1N4LA 3G6YA 4Y34A 2HAIA 2OPRB 4YR2A 2VG6B 3KLEB 1VRTB 4DL6A 4ED7A 1T03B 2O5DA 4FS1A 5HP1A 4F4WA 4DL3A 3MEDA 3CJ2A 4PUOB 5KFPA 1EETB 2HWIA 4TQRA 1ZTTA 2W9CB 1S97A 4LSLB 3ITHB 4ED3A 1LW0B 3KOAA 2R2SA 4M95A 2IAJA 1RTDB 2RDJA 3CO9A 3TAMA 1S6QA 4MIBA 2QV6A 3FQLA 2WONA 4O3PA 3MR2A 2JEGA 3T19A 2BQUA 4Q8EA 1JLCA 2R2RA 1DTTB 1T05A 4G1QB 4NCGB 3V81A 2R2TA 5C5JA 4O4RA 5F8JA 2VA3A 1RT7A 4QPXA 5KT6A 1JLAA 2FVSA 4ZVEA 2BQRA 2RKIA 2HMIA 3HVTA 3GQCA 1IKXB 3T5KA 4KO0B 4MH8A 2FVPA 5KT3A 3IRXA 3JYTB 1R0AB 1WNEA 1U09A 3TQ1A 4O3RA 4WFZA 3OSNA 1N6QB 3HVAA 3HKWA 4Q0BB 3MFHA 3FQKA 3BQ1A 3NBPB 2XGQA 3NMAA 5L1LA 5JUMA 2OPRA 3KK2B 1RT4B 2JLEA 2VG6A 1VRTA 4RW8B 3KLEA 1T03A 3MEEB 1RDRA 4O3OA 5KFQA 4ECQA 1RTIB 4ECWA 4J9MA 2AGQA 3KK1B 3TVKA 4PUOA 5EWEA 4RUCA 3G86A 2IMWP 1EETA 2W9CA 3BSCA 4ICLB 4LSLA 3CVKA 3DM2B 3ITHA 1LW0A 4ED8A 3KHHA 3BSNA 2DPJA 4NLGA 2OPQB 1RTDA 2R8KA 4O3SA 5JXSA 4DL7A 4J9NA 2ZKUA 5J2QA 2WOMB 1RTJB 5J2PB 5D3GB 1DTTA 3H59A 3D5MA 4G1QA 4NCGA 1C1BB 1JLGB 3QGGA 3GIIA 1BQNB 2FJXA 4NLUA 5C25B 2EC0A 4F4XA 5KT7A 1IKXA 3PW5A 1ZETA 4KO0A 2VA2A 4KBIA 2D3ZA 3JYTA 1R0AA 3H4BA 3KHLA 4RZRA 5L1JA 3Q8QB 4IKAA 1N6QA 2IM0A 4Q0BA 4O3NA 4RW6B 3NBPA 4YR3A 4WZQA 4RU9A 4RNHA 4KKOB 2GIRA 3KK2A 4K4UA 1RT4A 4RW8A 5KG3A 4IRKA 2FVRA 4IRCA 2B5JB 3MEEA 2E9TA 5KFOA 1RTIA 3KK1A 4HKQA 3QZ7A 2W7PA 3QYYA 1RT3B 2AQ4A 4WFYA 4ICLA 3CIZA 4ED0A 3PVXA 3N6NA 3DM2A 2CJQA 1BQMB 5KT4A 4Q43A 3PW0A 5DG8A 1HPZB 4PWDB 2OPQA 4EBDA 2UUTA 5KT5A 5KFLA 1RYSA 1LWEB 2IC3B 3I0SB 2WOMA 1RTJA 3KLGB 5J2PA 5D3GA 1SH0A 3BR9A 2I1RA 4ZP9A 5F9LA 3GIJA 2ATLA 3KNAA 3I5BA 2B6AB 4OL8A 2C2DA 5DGAA 1C1BA 1JLGA 5EUHA 1HNIB 1BQNA 5C25A 1QE1B 3V6KA 2XGPA 5DGBA 3KLIB 3QO9B 1D0EA 1S1UB 1XR5A 1XR6A 1HNVB 3NAIA 4Y3CA 4RNFA 4WXOA 3DLGB 2HNZB 4RW6A 5KFTA 3MTKA 5FDLB 3GIKA 4KKOA 4F4YA 4EO6A 4Q45A 3LAMA 3LAKA 4URGA 4J9QA 3KK3B 1ZTWA 2B5JA 4IRDA 4JV1A 3H2LA 1RT3A 3PR5B 2FLPA 4WE1B 4TY9A 3ISND 3QIPB 2WCXA 4ZVGA 4DL2A 4EBCA 4JV0A 3C6UB 2OH2A 1BQMA 3IG1B 5K14B 5DLGA 4HYKA 1HPZA 5DLFA 3DOLB 4QWCA 3V6DB 5J2MB 2FJWA 4H4MB 1HYSB 3N6MA 4K4ZA 1LWEA 2IC3A 3I0SA 2W8KA 4K4SA 3KLGA 1SH3A 4EO8A 3RAXA 3IGVA 5CYQB 5HLFB 3HHKA 2B6AA 4ZVFA 1JKHB 3OL8A 1N5YB 3KLFB 1N48A 1HNIA 3T5JA 4RNNA 1QE1A 3NL0A 4RW4B 3QLHB 3CJ0A 4I2QB 5F8IA 3OHBA 2V9WA 3KLIA 3QO9A 4RW9B 1S1UA 4MK7A 5KFHA 4ED6A 2D41A 4NLOA 1HNVA 4ED2A 4B3OB 2ILZA 4XPEA 2HWHA 3DLGA 2HNZA 1NHUA 2J6TA 1LWFB 5J2QB 2XWYA 5FDLA 4QW8A 1GX6A 5KFRA 3RBEA 1S1TB 2B43A 5KFJA 3KK3A 3OLAA 4MIAA 2BRKA 1C0UB 1I6JA 4WYWA 3RB0A 4NLDA 4WE1A 3KHGA 4TXSA 4K4WA 3QIPA 3BGRB 3CWJA 4XPCA 3PR4A 3OL6A 4IQXA 3C6UA 1FKOB 4KB7A 4J9OA 2YKMB 3IG1A 5K14A 3V4IB 3KHRA 4Q8FA 3BSAA 2UVUA 3DOLA 4F50A 3JSMB 3V6DA 4IH6A 2YNGB 5J2MA 4H4MA 1HYSA 1JXLA 4I2PB 4YR0A 4WFXA 4H54A 5CYQA 5HLFA
chains in the Genus database with same CATH superfamily
3DLJA 3HULA 3M6XA 1WOOA 1S6PB 1JLBB 1Q7YT 1DHMA 5IWAF 1Q81T 2D3UA 3OR2B 4GKJJ 4ZK7M 3H5UA 2C3PA 2PN6A 4YB7A 4ECSA 3FGVA 5HN0A 4ID5B 4OI2A 5GMKa 4Q2MA 4I2PA 2UUWA 1F9EB 2NCKL 1HLWA 2Y9HA 2VJUA 2UUAF 3DRPB 1IKVA 3C14B 3M9OB 2XZWA 1FE0A 1VLOA 1S12A 4QW9A 2BANB 3PXGa 1U1OA 1MMNA 4A8OA 4ZPBA 4DPWA 1JLQA 1T0TV 4DF4A 4LF9F 3EGNA 2ZH5A 1SJ3P 4ALZA 2FJEB 1S1XB 1Y00A 1PGZA 5KFSA 3M2UB 1TL1A 3EVMA 4OYAA 5THWA 1XNQJ 2BJ3A 7FD1A 5I3PA 3EGVA 3ZO7A 1HQUB 1RTZA 1JLFA 1FI4A 3IS9B 2XYHB 1HWKA 2KVIA 2LQ8A 1KQSR 3LTOA 1HD1A 2MKYA 2LVWA 2HQDA 2M3DA 2X1AA 3HVRA 4ZJOA 3GV7B 3HJFA 1TKXA 4J9KA 5CD4H 5JJBA 5H9FJ 4F3MA 2DT9A 1VC6A 2V8GA 3K58A 4DN9A 3M30A 5AXLA 2YQ0A 1TAUA 3MEGA 1T3NA 3VAGA 3ENWA 2GGPA 1KN6A 2XZDB 1VMBA 1EZZB 5FLXU 4NLYA 3CSKA 1N34J 2B7CB 4R8UB 1U6BA 1K8AT 3ADAC 3UR0A 4B17A 3SFUA 4DI6A 1Y7PA 1FFGB 1TV6B 4EMDA 2LDYA 4E2FB 4Y0FA 3ISNC 4DUZF 3DMJA 1V9OA 4PG8A 3H5XA 4P2XA 2HNYB 3OTDA 1TKTA 5C7PA 2MKCA 2D3OR 2RDIA 1HI8A 4DL4A 4IUFA 2P9CA 3WZ0A 2BOPA 1EKSA 3CJ3A 3W9IA 2QYCA 1SIZA 2VG7A 1Q5YA 3DLKB 2C3UA 2RS8A 3P45B 2E5HA 1JX4A 4R5PA 2YQ3A 1G1XA 1ZAXA 1RBAA 3FKBA 2RS2A 3TVYA 2BKOA 3BGOP 2ZBIA 5LM7E 3V81B 3DC2A 4B9SA 1SQFA 4UOGA 2RHSB 3PY8A 4C0OC 4A46A 3M8PA 3DLBA 2E5LJ 2MZ1A 2J9DE 4DV6J 1HI0P 4LMZA 4D3GA 1IR0A 2M7SA 4E98A 1Y5NB 4C11A 4EUVA 4DS4A 2DNOA 1T05A 3I6PA 4I6AA 4O4RA 5F8JA 4CLZA 3AY0A 1SQGA 4MH8A 3JYTB 1R0AB 1U09A 2MQNA 3OSNA 4OZLA 4MYUA 3KLEA 4O3OA 2IMWP 2W9CA 2DXDA 3B4DA 3KHHA 1QUPA 2O01C 3GJQB 2ZKUA 4P6QA 1S72S 3CB4A 2J9DA 1RAHB 3TZYA 4ZLJA 1C1BB 3DXBA 5C25B 4ZN1A 2GVZA 5KT7A 1YDLA 1LXJA 2HGLA 3Q8QB 5U47A 1VQNS 3NBPA 4NYOA 4B9LA 2W4PA 3N28A 3TO8A 2AQ4A 1Q0NA 4DR7F 2YX7A 1CJTB 3PVXA 2COLA 1BQMB 5KT4A 1ICEB 4JI0J 2YVSA 3C15A 4XDDA 3KLGB 3BR9A 5F9LA 5L8RC 3F44A 3W5ZA 4B3TF 2JOQA 2C2DA 5DGAA 1JWWA 3KLIB 1S1UB 3QQCD 3QRPA 1FRHA 3DLGB 3R7NB 2HZCA 3HMJG 3JSBA 4KHPJ 1T9UA 4OI1A 4Q45A 4NXNF 2B5JA 2KJVA 4CTAB 4JI4F 1SH3A 1BHNA 1S7HA 4OX6A 1N5YB 2ABYA 2L9DA 5DETA 1QE1A 2EFGA 3QLHB 2JDJA 3UFCX 1S5ZA 1S0VA 3AXKA 2V6AA 3RAMA 2O1PA 2GMJA 3NOGA 3D3BJ 4IQXA 4CLTA 3UNYA 1BMQB 2YKMB 4F50A 4DR4F 2EVZA 1HNZF 4H54A 5CYQA 3T6JA 5DO2A 2HZAA 1NSKL 2MY8A 2F65A 4RNMA 1X5SA 3P5BP 3BO4A 2WSFC 1VJWA 1TL3B 1Q16B 1F5CA 3DU5A 2DNRA 3MOJB 4LUBA 1BXNA 5KFVA 4B08A 1RT6B 3V4IA 4J9VA 1JJ4A 3GCWP 4DU7A 4ZHRB 4ZN3A 5HAOA 3VGVA 1EIYB 3KJVB 4USTA 3M05A 2RAQA 4WBFA 2ZE2A 2DH7A 1H72C 4IDKA 2F4VF 1P6TA 5BYRA 3DRSB 2MGZA 2HQ3A 5LSRA 4WKRA 2FIUA 1NU4A 1JNRB 4C3LA 5HQMA 2NXCA 2X51A 3OXGA 1U0HB 2E1AA 2CZVC 4K8RA 4I68A 1MSWD 1NK5A 3C16A 4OHVA 4PRFA 3QAUA 1RTHB 2ILYA 2R3VA 3J7AN 1Z2ZA 4CYUA 2HLTA 4URQU 2AW0A 3AD7C 2ZBRA 1FJEB 1IUJA 2DR5A 3CULA 1QAYA 3A8JA 3CW2C 2C28A 4YQWA 3R2CJ 4Q44A 3EMTA 4C9DA 1ZM3A 4CO0A 4K2XA 1BWEA 4ZPCA 1H7WA 2Z2YB 1S4FA 2AT1B 4XO0A 1JJHA 4A8XA 6FDRA 3RRKA 2ZH4A 2W9AA 3DI6B 2EBGA 2XY5A 3K5NA 3GV5B 1RZMA 3TJ8A 4ES2A 2FZGB 2I5JB 3RAQA 3NGRA 3UVJA 3FSXA 1FFSB 1ZS6A 2RF2B 1Y9OA 4QWEA 1FTRA 1HQ2A 4X65F 1RGVA 1EHWA 2PDAA 3LWMA 4LF4J 1X9SA 5B0GA 1RA6A 5HVFA 5AE1A 3BDPA 2W7AA 2A18A 3M32B 2GMLA 2MJNA 3D4JA 4URSA 2KRRA 3M2RA 5A2QU 3DDIA 2F3JA 1HQEB 5CXTA 3ENVA 3LGNA 2DXEA 2ZH8A 3MM7A 3WDOA 1K9MT 2ZC3A 2B56A 1DJ0A 2LCWA 3D7SB 4B3RF 1K0VA 3M8QA 2XNRA 4IG0A 3E51A 4JI1J 1XMQF 5FIIA 1Y3KA 2NXUA 2ASDA 2WONB 3R5GA 1VQMS 1S0NA 3NKYA 1W2IA 1KP6A 3FBEA 1TP7A 2EKNA 4L76A 3CCES 2WZ1A 1NPPA 2RKIB 2E5IA 4OYIA 2F7VA 3PJWA 1XERA 1NB2A 5A6PA 3P96A 3IR6B 3LWLA 2HAIA 2DHAA 1FD8A 4FS1A 4F4WA 1KR4A 3FCHA 4KC5A 5F3ZA 3DN9A 1FRKA 1QSYA 1RAGB 2RDJA 5DJBA 3ULHA 2M8DB 1Y0HA 3GIRA 2MQOA 2HK2A 3IWXA 2CQPA 3QJJA 1HHQA 2M9KA 4O3RA 1PBAA 4ILLA 2J7WA 1XWLA 4LSLA 4BWJA 3U7JA 5J2PB 2BVZA 1NK8A 1JLGB 2GS8A 3RU0A 2BV3A 1SJ4P 3PW5A 3OVSA 3KHLA 5EHHA 3IP0A 4AYBD 4CIOA 2W1BA 2V4JA 2HZVA 3AOCA 2I2YA 1D8ZA 4A8SA 1RLCL 2DGXA 3MEEA 1VGYA 2E9TA 4KH0B 3OR1B 1X60A 2BE7D 2LQ9A 4ICLA 1TFWA 4Q43A 4C0BA 1GT8A 5KT5A 1DURA 2I1RA 1Q1KA 3OTBA 4PABA 4N77A 1HNXJ 2UZAA 4J9QA 4JV1A 5ETLA 2CWKA 4TY9A 5K14B 3QPIA 5DLFA 1U45A 2GMHA 2GZOA 2DCUB 5E0OA 1GQEA 4EO8A 4I56A 1G4CA 4DR2F 3VCDA 3NGTA 4DV5F 3D6FB 2Q6CA 2FD2A 3CJ0A 1EAYC 3F56A 2V9WA 2D41A 2P9EA 2XMAA 1U1KA 3BGLA 3BB5A 1FXLA 4D3HA 2BRKA 2RRBA 4OX9J 2NYIA 4TXSA 4GKKJ 1NKEA 4KB7A 3EICA 2C2OB 5F3TA 4PKDB 2CQBA 2QLWA 1M5SA 4B3SJ 4EEYA 1YRTA 1GTEA 2RRNA 2IDEA 2VUGA 3BDEA 1KBRA 5CABA 2JH3A 2VQFF 3NAHA 3ZFVA 4WF9Q 1VQ4S 5LL6d 1RWVB 3M9MB 1VQOS 5EWGA 1W26A 4NWBA 4NASA 2MMYA 4YN3B 1NNDA 1S6PA 1JLBA 5KG0A 2MQQA 4G3IA 1HA1A 2VDHA 1VBXA 3CD6S 3OR2A 2EW9A 1FFWB 2A2DA 3M7VA 2HVEA 1UJ5A 2C3YA 2EFNA 4ID5A 3RR7A 4IOCQ 1M1HA 3NMRA 2FJVA 3UNGC 1WF0A 3DRPA 4CT9A 4TNOA 5D15A 2NZCA 5DS7A 2EFPA 2BANA 1ZYQA 3SYZA 2KYZA 2MB0B 5KFIA 1PIEA 1RADB 3GYGA 2YPZA 3BBBA 2HG4A 5IV4A 1S1XA 2AX1A 2FHJD 5HBMB 3M2UA 3DRYA 1Q8LA 4DX5A 1HWLA 1HQUA 2DGQA 2F4FA 1XJWB 1BY9A 3IS9A 5KFKA 2NPIA 3R5JB 3D54A 2YWEA 4DFMA 3TZZA 2V2KA 4HH1A 2Y1LB 1EQMA 2BXJA 3QGIA 4CLUA 1FJGJ 1YI2S 2FVQA 4ZP8A 4KPCA 4FPIA 3MM8B 3FSIA 3W65A 3M8WA 3OSPA 2CQ3A 2R7WA 1TKZB 4LVNP 2NUHA 2CPFA 1P1LA 1YZ7A 3AQOA 1FK9B 3BQ2A 2E7XA 1I5OB 4R8UA 3UDLA 1V5IB 5B09A 1TV6A 4CH0S 2XCAA 3KDOA 2H3EB 1U6FA 2AMCB 5DQHA 2VBWA 1FWLA 2FGOA 4MKVA 1SKRA 3TJAA 5M2PA 2DNMA 3C8YA 4A48A 1NO8A 1NK4A 3RW6A 2KL8A 4P75A 4AFFA 4M8LA 4MK8A 4DR1J 1UAWA 1T02A 3DLKA 2HFUA 4KY3A 1AFIA 1R89A 1CVJA 1J2VA 1ZTTA 3TYTA 1LW0B 1B0TA 1FT8A 1LKZA 1DTTB 3V81A 2ZBPA 4CH7A 2ROEA 5KT6A 2FVSA 2MSSA 4USHA 2KHCA 4OJ3A 1FVSA 3UW1A 2G4BA 3LPEA 1CEZA 3CJ8A 3KG1A 2ZH9A 3SSRA 4DSLA 3D6HB 3DM2B 4E8UA 3PO5A 1RTJB 1X4BA 4QPTA 2AEJA 1FTCA 1U48A 1YZ6A 3G87A 3IO1A 2AP6A 1X9MA 3JYTA 1R0AA 3UE2A 4X4SA 1SVDA 1RBLA 4DR3F 1KRPA 3MPDA 2FVRA 4X4VA 2LDIA 2Y1JA 1R8BA 5DG8A 3EVWA 1YJWS 3KJQB 3Q83A 5D0HA 1C1BA 5EUHA 3QNWB 5C25A 5LT5A 1O51A 4ER8A 2K2PA 1WDTA 2CPZA 2G2ZA 4MT1A 2HNZB 1GNKA 2X1FA 2OEJA 4YY3F 5HMWA 4CQ1A 4U7UK 3QIPB 1CJTA 1BQMA 1WKKA 2DGUA 2U1AA 3KG0A 3KLGA 4DUYJ 4A8WA 2LEBA 3A13A 2MEWA 2BOAA 3CMES 4K0KF 3KLIA 4ED6A 1S1UA 1U4BA 2OFGX 2DR6A 2J0QD 2HWHA 3DLGA 3CC2S 3CTRA 3MAAB 3BPDA 4WYWA 2HHHF 4K4WA 3BH6B 4CTAA 4LREA 2UV8G 3OTOJ 4ERDA 4ID8A 1N5YA 3VZHA 2CDRB 3QLHA 2G0CA 2QRRA 3V6HA 3MR7A 2CQHA 3CCJS 1RT2B 4KE5A 4C6AA 1VDHA 3ZZYA 2N3OA 4NYZA 1RWUA 2B7BB 3TUPA 1ZOTA 1HMVB 2YKMA 1T3OA 3VVTA 4CT8A 4JI8J 4PQUB 3PJXA 2NS1B 4OZ0A 2Q43A 3T3FA 2ZWOA 3DXSX 2ZEJA 5KFMA 1LW2B 2ZITA 1TL3A 4YOEA 3G2XA 4NLVA 4YMEA 1LK5A 4O23A 2DD8S 1RT6A 4DSFA 4EWTA 1T11A 4WFAQ 4DQIA 2O3DA 4ZHRA 1HKAA 1X4DA 3KJVA 2BBEA 5DZ6A 3DRSA 4G1IA 1KVJA 4KV8B 3IM9A 1GK8A 4LJMA 4GVLA 1TZ0A 2K7JA 1U1NA 2YWWA 3POTB 5AXMA 4N41A 4O44B 5SUHA 4FP9A 1U1LA 2KXFA 4OYWA 3CEDA 1U0HA 1FX4A 4F2SA 4W4MA 2J5AA 3MR5A 1U7LA 4OJHA 1X0FA 3BO2A 4J90A 1RTHA 3ZNJ1 3IXQA 2GJFA 1MROB 2ZJRQ 2RUSA 1R43A 2ZDOA 4OHZA 1ZA1B 4YDXA 4RW7B 2ZNYA 3MM5B 5IOLA 1Q79A 5DQIA 1KOOA 2H54B 4G1PA 2RNEA 3UN3A 1YQHA 3ZZOA 1SJFA 3J7ZT 4GC7A 1O8BA 3JXOA 1LV5A 3UR3C 3DI6A 4I7FB 2DPIA 1F3VA 2R8GA 1HR0F 2I5JA 2GA7A 2JRSA 4LFAF 4GC6A 3PIOQ 2DGVA 3DGPB 2J6SA 1OWXA 3C19A 1WF1A 1DQ8A 2VZ9A 4AL6A 2XS2A 3HZEA 1QJHA 1FF2A 4F2RA 3M32A 1CJVB 2AJ2A 5ETNA 2QE5A 3B78A 4CO3A 3I5CA 2IM3A 1SXLA 2PI4A 3S7RA 4X4NA 4ZITA 1G6BA 1HQEA 4PPDA 1NPKA 1VQLS 3PV8A 4LFCF 3VALA 1PAEX 4DL3A 1B70B 2A6MA 4PUOB 1FRIA 3QSYB 2HBYB 4NYPA 4BCAA 4C0HA 5DRKA 2PA8D 1DZ5A 2WONA 4G1QB 2CNKB 4I6WA 4BBYA 2RKIA 2CUYA 1HI1A 1WWHA 2XB2D 2KDOA 5C2CA 4TLQA 1XEZA 1CS4B 2PGCA 2CNOB 2AGQA 3K59A 3CVKA 2OGUA 2R7VA 3CJQA 4O3SA 5E3PA 2ZHAA 1IBCB 2VICA 4JV5F 1ZETA 4KBIA 3B6BA 4ED4A 4PAAA 2HHTA 1OQ6A 1UPPA 2ZFHA 1R0BG 3SXLA 3T1HF 2E29A 1TK0A 3J7YU 2ZDPA 8RUCA 1WF2A 4YFUA 5J2PA 2P6SA 1ZBTA 1JLGA 1HBMB 2QL5B 1YRUA 1XR5A 2J9CA 4UOFA 5RUBA 1C4AA 2XS7A 1U47A 5FDLB 3WIUA 4F4YA 3HKZD 4EO6A 1IN0A 1OY8A 2VL1A 3OR1A 2FLPA 3F41A 3V5RA 1TL7B 1WC3A 1YKWA 5J2MB 1HYSB 4K4ZA 2PA3A 5AJ3J 4DV1J 1YGYA 3EDQB 3MM6B 4OYOA 4X84A 2FHKA 3H90A 4DLGA 4ZJLA 3UDEA 1IBMJ 4XPEA 2RU9A 3DKDA 1RAIB 4JI6F 4DX7A 2DHXA 1S1TB 1P9YA 1C0UB 4EK2A 4NLDA 4LF7J 3OL6A 3PR4A 5K14A 2UXBJ 5BR8J 3EDRB 2RQCA 1DQAA 2W4CA 1URRA 5L46A 2WTFA 2M0GB 2EKYA 4IOAQ 1RI7A 2I0XA 2GVDB 2AJFE 1NKCA 2QMUB 5IT4A 3LO3A 4X4TA 2W2NP 3CF5Q 3P3DA 4DSJA 2KI2A 1M5PC 5D8HB 1OJ4A 3DLLQ 2NXNA 2DIVA 5MAOA 5LMNF 2WBMA 2LQ5A 5DZ7A 1SJ1A 4O0NA 1GH8A 1P9QC 2FC9A 4P2FA 2HHVA 3DU6A 5CCMA 1VC5A 1TUWA 3HHNB 1EARA 1GTHA 2V94A 2DR8A 4JI7F 2YWGA 5KG1A 3GYNA 2BR0A 5KOXA 4DPTA 1BGXT 3AJDA 1WHWA 1L3SA 5IWAJ 3BKUA 1J5OB 1M0SA 1OYDA 2MQMA 3Q8RB 3ILIA 2GAGC 5B0EA 4NLPA 3IWNC 5EN1A 1KEKA 3WIVA 5IT9U 3B4MA 2UUAJ 2WK4A 3KMSA 3H98A 1IM4A 2MY7A 4LF9J 2GNKA 4FPRA 3NS5A 2VBZA 1PILA 1U0SA 5E2QA 3OLBA 1XIQA 3EPIA 1FWPA 4KTQA 1WC1A 2EK6A 4IR1A 4KHRA 3BKFA 2HRUA 2PO4A 2VODA 3UD5A 4ECRA 2IIHA 3SSQA 1FNXH 5SZTA 5IXUA 4LF1A 3DFEA 2WVFA 2E44A 4ED1A 3T41A 4DCOB 1UEUA 1AXQA 4HT7A 3OL7A 1I94J 2VFSA 3GILA 2XHCA 1GXUA 2CVIA 3AHPA 5F8HA 2MXYA 4ES3A 3CCVS 3MM8A 1NJWA 5DG7A 1UVNA 1TKZA 3S6EA 1DTQB 1FK9A 3QFWA 1WSVA 4CNYA 5E5NA 1UVKA 5H9FK 2HIYA 3OQ2A 2CYYA 4ECYA 4WTYA 3GV8B 3BQ0A 2VBYA 1PC4A 4J91A 5KFWA 4M5DB 2CJAA 3K5LA 3R3TA 4S0MA 5ETRA 2QZ8A 5KG4A 4U67Q 3T1YJ 3IFEA 4Y34A 3TEHB 2O5DA 5AE2A 1EETB 4TQRA 2UXDF 2YKAA 2Y3YA 2ACYA 4O3PA 1X4GA 4JP8A 4QR2A 5B0CA 1RHKB 5KT3A 3CCUS 1YBTA 3MFHA 3NMAA 3Q0AA 3OJSA 2MKHA 2EK1A 2K1RB 2MQLA 4U7UD 2DPJA 1LW0A 4CRJA 3BSNA 2JLFA 2JSXA 1DTTA 1U26A 3GIIA 2Q3PA 2N4CA 5HQ8A 3O8WA 2GV1A 4NA2A 2KG0A 1SB6A 4RZRA 2Y0BB 2EBEA 3LUYA 2AD9A 2DR9A 4RW6B 3H2UB 2ASYA 1XK8A 2QTWA 4LBHA 2F9DA 1KQKA 5KFOA 4PXEA 3THVA 2N7CA 2BZ2A 3DM2A 1WD6A 2CJQA 4OHXA 2F8HA 1SC6A 2FLOA 1RTJA 1AB8A 4DSEA 2V2VA 4FYYB 5ETVA 1U6ZA 2M4MA 3L09A 2CZ4A 3KK3B 1P27B 4WE1B 2WCXA 1FERA 3R5DA 3IG1B 4HYKA 2PT0A 4A4JA 2Z30B 4IO1A 3AJ2A 4PG5A 5HLFB 3NWRA 3HHKA 4JI3F 3W5XA 3PCOB 2PI5A 5F8IA 5JMNA 1N0UA 4FYWB 2Q6BA 2HNZA 4ITSA 3GR1A 4DR7J 2MLYA 1G7CB 4OZ2A 3QIPA 1F0XA 3JSMB 3CT9A 1QLNA 2RMLA 4MKBA 4Q5VA 3TEGA 2Z57B 1NKBA 2YX1A 1X4AA 5ETQA 2DVIA 4RWXA 4WK1A 1S7IA 3I96A 2AJ4A 5D78A 4NRUA 4NXNJ 1CQMA 4IFVB 3EZ5A 4C97A 2EG1A 3MAAA 2BRLA 4JI4J 3TX0A 3W8GA 1QSSA 3EGWB 1ZPVA 3BO3A 2IHR1 3MFIA 3ZTRA 3LGHA 1QTMA 2DNZA 1CLFA 5CQGA 3PW2A 3SFGA 3HK2A 2P9GA 4CO4A 4G65A 2ALZA 1K1SA 1RT2A 3U02A 3ELHA 4XAKA 1RJJA 3UD3P 4FDFA 1B7FA 4DR4J 1HMVA 5F0WA 1HNZJ 4PQUA 2L08A 1DFDA 4GKJF 2EPIA 2HHXA 3JAMU 4FF3A 1HWUA 2DY9A 4LF8J 3GYXB 1Z4UA 1LW2A 2XLKA 1N88A 3MECB 3GR0A 3N6LA 2CPIA 2LXFA 3FNNA 1H3DA 3TI0A 4KFBB 4DEZA 1R27B 1A9NB 4PG7A 3CJ4A 2B51A 5KG7A 3Q8PB 3CDBA 2UV8A 3MZIA 2O66A 3MUVP 2F4VJ 1CJKB 3GB0A 4EYHB 4NXMF 4KV8A 3CCWA 4DL5A 5K8OA 4NRTA 4DMZA 1XNQF 3NCPA 4TVAB 1FXDA 3DOMB 2I6WA 3SCIE 4USUA 2JEIA 1NSQA 3CCSS 4DV0F 3CE8A 3R5BA 3O5TB 1SL0A 2AZ3A 4DQQA 5GAGI 5DDQC 2VB6A 4K2JA 5CAAA 4FNHA 4N5SA 1S9EB 1B7YB 3W60A 1U1RA 1MROA 2P2CB 2A2CA 1CBKA 2IFXA 2YNFB 2VPWB 3EJMA 3H5YA 1D8YA 4TKTA 4RW7A 3OFEA 3SV4A 1NZAA 3MM5A 1NDLA 2V4RA 1OMSA 2YNIB 2KFZA 2CAJA 2QO3A 5KG5A 1Q78A 3VAMA 2R7UA 2ZZNA 2BE2B 3OHAA 3W9JA 2E9RX 4JOUA 3GIMA 1NM2A 3FRYA 5B7WA 3US5A 1N34F 5IZHA 4NCBA 4I7FA 2I9SA 4NLSA 2G1DA 3HF5A 4J37A 4KYZA 3HHDA 5KFAA 1PKUA 1E6YB 1T9YA 4Y65A 1N56A 4IOBA 1YHQS 3KXDA 3DGPA 2CIMA 3NGUA 2QN6B 1JLAB 2HFSA 4X65J 3FMWA 1XMOF 5IT9Y 2J0WA 2OPRB 2R7SA 2VG6B 4DU8A 1T03B 4DQSA 4RU2A 1SPBP 1CJVA 4CO2A 3FQLA 1YWXA 4KH1B 1UKUA 2R2RA 3GSIA 1SIWB 4Y2IA 2FVPA 2G1HA 4Y28C 1WNEA 5H9EK 3GTYX 3FQKA 4I1TA 1NK7A 5L1LA 2SXLA 3R7BB 1OY6A 4PUOA 4KPYA 5HVGA 1G2EA 4L73A 3LOUA 3O2IA 1VK3A 4B3MF 1VISA 1HWJA 3M8ZA 4G1QA 1VQ6S 1UPMB 4HTIA 2LU1A 2VH7A 3FBBA 3FSYA 1Q8IA 3RZAA 4DDFA 3PEHA 3HJVA 3JQJA 1CS4A 3JTPA 2DY1A 1T9TA 2HKEA 2UUTA 3FUYA 4NLUA 2ATLA 1K44A 3I5BA 4NX9A 4K5SA 5I4MA 1F2HA 4WFNQ 4OX7A 3L95X 2V8HA 2W24A 3DNCA 5CHCB 2ZOMA 1L5UA 4URGA 1MLAA 2HQFA 4IRDA 4Y2KA 2XS5A 3H42A 4EGLA 2W8KA 5GVQA 3V2UC 2RT3A 5GAEU 1HBMA 4RW4B 3VVUA 4ZPVR 2AYEA 4NOHA 4NLOA 1LWFB 5J2QB 2MJUA 5FDLA 2MKSA 2DIUA 2VPZB 2H5IB 2ZC4A 4X4OA 1YG0A 2BDPA 1H98A 3BSAA 1TL7A 2EEYA 2YNGB 5J2MA 1HYSA 3GE9A 5CYJA 3UCZP 1T9VA 3MM6A 2IM2A 1N5TA 2J0SD 3FZ2A 3B8HA 2UUCF 2XBPA 1UWBB 3LP1B 2AV5A 3FZBA 3S01A 1RYRA 5J2NB 4USIA 5LSLA 2GIFA 1S1TA 3CMAS 1C0UA 4DG1B 4W90B 3OV7A 2HGMA 3PJ9A 2LECA 3DRXA 2E7WA 3KKFA 1H7XA 2BKPA 4U9RA 2IRUA 4DR2J 2DGSA 2E9ZA 2BJ9A 2YH0A 3TA0A 1R8CA 2GVDA 4N7TA 5KFGA 3CPWR 2NUUG 4L3NA 4NZ6A 1SH2A 2ALYB 3MWBA 4EFAC 1Q53A 1BWVA 4GVBB 4KR0B 2M88A 1S1WB 3KLHB 1IVZA 1QSLA 2YNHB 2XMKA 2BEFA 2B4VA 2OELA 4DFKA 4DSIA 4M94A 3UPFA 4FNIA 4LQ9A 3SBMA 3ZZ0A 4RUAA 1QAIA 1RUSA 2HYIB 2XCPA 2E5JA 1XQIA 3H20A 1YJ7A 1V3ZA 3DDNA 2FLLA 1S1VB 4WTOB 2K3IA 5T7LB 5D0RA 4K4VA 2XI3A 3NLCA 4RNOA 3KTQA 1FRJA 2R7RA 4KHMA 1JQGA 2FLNA 1PJ5A 4WWSA 1IBLF 2PE8A 2VFUA 2KB2A 2HBRB 2CPHA 2VQEJ 3AJ1A 1J5OA 1WTBA 3MHYA 2GC8A 2DCLA 4WIIA 2B8QA 4ZPTR 1EP4B 4AD6A 3A1YG 4PEOA 4QWAA 1LK7A 3ILLA 4RL1A 3PKMA 3GCXP 4ZPAA 2GFFA 3W62A 4KGZB 1FDDA 2ZHBA 5KFZA 1VQ8S 2BUNA 2DNLA 2LXUA 3OT9A 2FHJA 3OVAA 2AJ1A 4RUBA 3HD2A 2QT7A 3MMBB 3ONQA 3RRGA 2LLZA 2QLXA 3RG6A 5M2UA 2ZUAA 5IC4B 3OW2R 4UTGA 5LJ5Y 3RB3A 2CPYA 3W2VB 3A12A 1FA0A 4ZCIA 1JNZB 3H8YA 2NQPA 4UUWA 4WP8A 4M5LA 2X1BA 3L7OA 4USKA 1IKWB 5KFFA 3VR1A 1T9WA 3R27A 2HHSA 3PW4A 4ZVOB 3W9HA 1KQGB 3NGDA 3FMBA 1RXOB 4HDHA 1DQ9A 2IJNA 3JAMY 4OYPA 3RTVA 2C2RA 1S6QB 2R7QA 3KJFB 3J81U 2DJWA 2CRLA 1VHIA 1V3RA 2H1YA 3K5OA 2QLBB 2W2MP 2GJIA 3H5SA 1DTQA 3G82B 2BM0A 3FJ2A 2DRDA 2NREA 4HHUA 1MWZA 1X0PA 3CUNA 2J8SA 2ZOFA 3D9BA 2W4DA 2MQ8A 2L3MA 3MR2A 3CJSA 1RBOB 3NNHA 3CCMS 3I9ZA 2BQRA 4M5DA 4LFBF 4UZCA 4F8RA 1QVFR 2JJ4D 4OZNA 4N76A 4JI1F 3ZZPA 2V8PA 3TWZA 3WX8A 4ETXA 1RDRA 2QLJB 1S6UA 4A8KA 1EETA 4DCPB 2MZJA 3ISZA 1RP5A 1Q95G 5KOWA 4RR5A 3H59A 3D5MA 1SL1A 1F1BB 2FJXA 2NSCA 5K8MA 1OSCA 1OQ3A 1XBWA 2VA2A 2D3ZA 2E7VA 1H2VZ 1R3NA 3GFZA 5HVHA 2HFZA 5L9NA 4LR9A 2G2OA 3QATA 1N36F 4NCAA 3ETOA 5E41A 2K1RA 4F3QA 4PZVA 2QSFA 4PWDB 4PYAA 1WG4A 2E5GA 3KYLA 3AD8C 4CDIA 3I32A 2CQIA 1TK5A 1S79A 4TU7A 1YBAA 3GZ7A 4RNFA 2PD1A 1FEHA 2CQ0A 4RW6A 2GHVC 2IPOB 2MZSA 2B4PA 1X5TA 4OMFG 3OPKA 5BXIA 4NZ7A 1AZSB 3V6DB 2VV5A 3N6MA 8ATCB 2R42A 1CPZA 1KTQA 4UQGA 4MK7A 4RWWA 2QLFB 4ED2A 1RU2A 4DR3J 1EB0A 3Q22A 3RBEA 2RB7A 3KK3A 4WE1A 4ELVA 4F0HA 2KFYA 4A8YA 3IG1A 2VBXA 3MD3A 1I3OB 1QAXA 4PPZA 1NH7A 5HLFA 4PQAA 2QL9B 5CYMB 1N5SA 2C22A 3R9LA 3QRQA 5F9NA 2YH1A 3T6BA 2RVJA 2JC0A 3MR3A 4H4OB 4YY3J 4DV7J 2L9NA 1NJYA 5IS2A 3A8IA 3FEYB 1MWQA 4C48A 3SV3A 3HI9A 3JSMA 1L3UA 2HNDB 1OY9A 4U7CA 4K0KJ 5GADU 4UZBA 3FCWA 5HATA 4KGKA 2CJKA 3GMGA 3Q2SC 4IFVA 1GMVA 1PYTA 4B3SF 1SKUB 4I0WA 2IBOA 2UVVA 2JWNA 2ACMA 2KFNA 5K8PA 4ECVA 2WB4A 3I4PA 4XTTA 3S8SA 2HQIA 4I4BA 4YHHF 4K50A 3WHIA 2AX0A 1UW9A 1W7WA 3ETMA 3D67A 2M5YA 3ZZRA 2AYGA 3PDNA 3H4DA 1ZM9A 4DUTA 4DX8H 1KOHA 1RLDA 1PBUA 3GJTB 5HMYA 4JB8B 4RPFA 1Z1ZA 2CVEA 2QA2A 4ZP7A 4K5RA 4JYAJ 1RACB 1S9FA 3MECA 4QIGA 2XWXA 1VS3A 5KG6A 4KFBA 2I38A 4TLRA 3ZTOA 3TZWA 3PO4A 1Q7LB 2BJ7A 3RB4A 3MD1A 3R1HA 5ETTA 3AH6A 2OKQA 3D0GE 4HI1A 4WYLA 1CJKA 2V68A 5AT1B 4MKAA 3NP5A 3Q86A 1HW9A 4WP3A 1UMJA 1NDPA 4C8YA 1JMTA 3OUYB 4J7CA 1N5QA 1R7IA 3HDSA 1RWMB 3IRWP 4F25A 4PCQA 4ZA1A 3I0RB 4U95A 1NJIT 4KT0C 4WU3A 1JLEB 2YKNB 1FKPB 1I51B 3BR8A 2JC1A 2H9ZA 2Y0SD 4B9VA 3C3LA 2VFVA 3NGSA 1S9EA 1RWXB 5CH7B 1CC8A 2J7KA 3GJSB 2YNFA 4C2MA 1LWXA 5ETOA 1B0VA 2WAQD 4P7TA 4TYBA 3OVBA 4U96A 1V3SA 2YNIA 2W2OP 2IJRA 2OEMA 1IQZA 3Q2TC 4F4AA 2BE2A 2CZ9A 2X1GA 2D1CA 4OLOA 1PJ7A 4M1KA 2V63A 1G3OA 5E33A 3CCZA 4FXDA 5ETSA 3ZZTA 1HR0J 2ZJQQ 1WACA 1FEEA 3FK4A 4LFAJ 1RTDB 1IBKF 2QA4S 1E6YA 4UF4A 1VC0A 2HVHA 3IM8A 2VA3A 4OI6A 1JLAA 2JHEA 3PYDA 2UUBF 5ETPA 3R5CA 1N0VC 2ZZTA 2XLJA 3HKWA 2OPRA 1AT1B 2VG6A 1T03A 2LU2A 4J9MA 1KFSA 3SSSA 3GFHA 3M4XA 1RWPB 1B99A 2OPQB 2M8HA 1LFWA 3LH2S 2M52A 2CJ9A 2XO6A 3QGGA 1WJ9A 2CQGA 2EC0A 2AHOB 1X31C 4Y2MA 1YSJA 5L1JA 2IM0A 2X3GA 4I69A 2PMWA 4IRKA 2PFDA 4IRCA 4PXCA 5HI7A 4C8OA 4ZCLA 3G96A 4CO5A 1IR2A 1RYSA 1LWEB 2IC3B 3RBZA 4RUHA 4MMOA 4F7VA 3CCTA 1VYAA 1VRQC 5DGBA 2QX0A 4Y3CA 3M1VB 1X4HA 4KQZA 3GIKA 3ZTSA 3GFXA 1YTYA 4ZLPA 2E1CA 4M5NA 2QG9B 2B3TB 5IV3A 4DL2A 4EBCA 3J81Y 3D1QA 4H4MB 4WP9A 3JTNA 4GMKA 3OL8A 2PMZD 2DKOB 3FEXB 3I82A 3Q24A 1UA0A 4X4RA 3RJMB 1X4EA 2CADA 1LEOA 2EFOA 1GEHA 4CH1A 1HHSA 4QYRA 3RB0A 2GQQA 3VAFA 1FKOB 4Q8FA 4LF6F 4ANEA 1BE4A 2KG1A 2ZH3A 5L39A 3DDKA 3MI7X 4RW4A 4IFYB 2Y1IA 1LWFA 2BACA 3JTOA 1SKWA 1NHVA 4IH5A 1A7GE 2XI2A 4ZLLA 4K4TA 3BPSP 5J1PA 1SL2A 4ETZA 4DX6A 2YNGA 3NS6A 4F26A 1NZ8A 1UJ6A 2DEJA 2EFVA 1UWBA 3LP1A 1RT5B 5J2NA 3DYAB 1U1MA 4KJIA 2DITA 4DG1A 1RU1A 4F4ZA 2K3KA 3KFWX 4BS2A 3VF0B 2AZ1A 2OPPB 5T41A 1KLMB 4DS5A 4FF1A 4J9RA 3MM9B 1Q4RA 5D0EA 3K89A 4ZPWR 3CC7S 4NZ0A 3GJRB 4GVBA 5CZXA 1L3VA 4RBTA 1CG2A 1S1WA 5LMNJ 3KLHA 4IYQA 2YNHA 1RKIA 3EVOA 4MAKA 1NDCA 2E1MC 4HDGA 1RAJA 4QWBA 4ZVHA 2FHOB 2P6TA 3PW7A 4J9SA 3NNCA 2DTJA 1N5VA 2KN4A 1S1VA 3KUEA 2F1FA 4B02A 5T7LA 4HEA9 2ZM6F 3QT7A 3BF4A 3JSRA 4TQSA 3SEOA 4EU0A 4ZS6A 4J9UE 2UVRA 2UXCJ 1WKLA 2FY8A 5E3CA 3D1HA 2PC6A 3J7A1 3VV2B 4FS2A 4L3KA 2HSEB 3IBFB 4JV2A 3GWCA 1EP4A 2WSEC 5C24B 1WHVA 5GMEA 3HHLD 4KSEB 3FC9A 4DV2F 2MSTA 2CJYB 1P8GA 1DLOB 1FX2A 1KWMA 2RU3A 1W2BR 2BABA 1TUVA 3MMBA 3A4TA 2MPUA 3QIDA 5LXYA 1OSDA 4V19X 3M8SA 3H7HB 2BA9A 3RR8A 2WHOA 1VQ5S 2RILA 3QT8A 3W2VA 1UVIA 3TAMB 1TL4A 2NPFA 3MUTP 2P5VA 2HIQA 4LRFA 1WDDA 2XTJP 3HVTB 4OX8A 4BDPA 1HARA 1IKWA 3UDVA 3PHEA 3PX0A 1QTNB 4A8FA 4FXWA 3OFGA 1REGX 3U1NA 3G6YA 2KT2A 3SIPB 2Y8YA 5LMUF 2XO7A 4ZLNA 1S97A 5DM7Q 2VFTA 3BYPA 1XC9A 3ITHB 2R2SA 1SJRA 4DV3F 4BWMA 1S6QA 1TKDA 2BQUA 2AEFA 1HFEL 4ZVSB 5HO4A 1N6QB 3BQ1A 3MDFA 3ENAA 3G82A 1O6XA 2C2ZB 1IQTA 3BSCA 4ZVTB 1FNOA 1GMWD 3QT6A 4DZDA 2HHUA 3MMAB 2B8PA 5D3GB 3QSIA 4LF5F 3R5AA 3Q23A 3F73A 5HMXA 3H4BA 2GO9A 3NCRA 4IKAA 4RU9A 1NEEA 4KKOB 3VAIA 1F9FA 1RWNB 3B82A 4PG4A 2W7PA 1RT3B 3K2YA 1WEYA 4EBDA 2Y8WA 2ZHOA 3I0SB 5B0DA 1R6YA 4OL8A 4AUKA 2W25A 1WUUA 4HVZA 2JLGA 4ZIWA 2C1EB 3D0IE 1ZZFA 3LAKA 2IYGA 3RW7A 3C14A 3I55S 1RWOB 1L3TA 1HW8A 4DL0C 1VBZA 3CGIA 1JKHB 1NSPA 3T5JA 5BYSA 3OHBA 1PYOB 2ZNZA 3TNVA 2G2YA 3MAHA 4FXVA 2DBBA 1KTVA 2PIIA 5D4OA 3RBXA 4I64A 2OI2A 2CPDA 1AZSA 3V6DA 1DBDA 4CI0B 1JXLA 2V67A 4YR0A 1UWAA 5HQLA 3QMQA 3TX8A 2RQMA 2D69A 2DXFA 4O0IA 1WC5A 1Q86T 4CCHA 1IWAA 1UZHA 2MLZA 5F8LA 3ENQA 4LRCA 5AJ3F 4DV1F 4X64J 4AXJA 4WZMA 1APSA 5L1IA 3R1LA 2WVDA 2XYPB 4QIEA 1EKRA 3T1AA 3RBDA 4JI5F 4JI3J 1IBMF 1K73T 2MKIA 5CYMA 5E3QA 3WQPA 1EQ0A 3ILOA 1QUVA 2FZKB 4H4OA 4QYZJ 3W66A 2UXBF 4QCLA 3ICLA 2KM8B 2CWXA 3FEZA 2B9YA 2HNDA 4ILMA 1CSJA 4USJC 4DR6F 2DRBA 3CJ5A 1W25A 3W3SA 4LSNB 4YDDB 3QZ8A 4C3KA 2VG5B 2HNYA 3JB9k 1B3TA 1WG5A 4Y6IA 1B4SA 1GAOA 3TW0A 5LJ3Y 4NMXA 2A0FB 5IQQA 5GAHU 1H74A 2KO1A 5C42B 4P73A 5KFUA 2F63A 2ZZMA 3J7Z5 4Y2AA 2HPUA 1D9FA 2RD5C 2W7OA 1CULB 2RQ4A 3TZXA 2KH9A 5K9FA 3VTIA 3RRHA 3MPYA 2RQKA 3QGHA 1YJNS 4QU6A 2RIJA 4NPOA 3UN2A 3TAPA 3MCMA 3HO1A 4LIRA 3HCXA 2MZQA 1SBRA 1C0TB 2GQ2A 2R8IA 3TR5A 3DOKB 4IR9A 2HRTA 2GAHC 2L41A 2G13A 2XSJB 3CJTA 2XHWA 3QT5A 5IQ6A 1UFWA 5KFBA 1X8DA 1DARA 4RX6A 5J1EB 3RB6A 3CD5A 4J5OA 1HBNB 1T94A 1FDNA 4NXMJ 1NK9A 3H0PA 1QAJA 1FWKA 2J0XA 1NBEB 4JI2J 2JL9A 2UU9F 4X4UA 5KAKA 1AW0A 2KKHA 2BYCA 3OUYA 4ED5A 3PYEA 2E1PA 3I0RA 2DGTA 4DV0J 3Q8VA 1JLEA 2IAJB 2YKNA 1SC1B 1FKPA 1SJQA 1R0CB 3MEKA 3GU0A 4PXBA 1RT7B 4USWA 2V4QA 5KFCA 2DB1A 1D3WA 2XMVA 2DO0A 1I94F 2QL7B 2HVIA 3AAWB 4ENOA 4X66F 4F4KA 4CM0A 4G6VB 3CO9A 3OTEA 3Q8UA 5HJYA 5C5JA 2B9WA 2AEMA 4FF2A 4WKYA 2CXEA 3TQ1A 1HL6A 3B54A 2EWHA 4DPXA 4C8ZA 3P49B 4GO7X 5JUMA 4ZDNA 2RH3A 3TVKA 5EWEA 2VC0A 1RTDA 2R8KA 1TAQA 3V4MA 1J5EF 2ZVIA 4AQYJ 3HD1A 3EGZA 4OYZA 3T1YF 3MTJA 1BQNB 2OD6A 1XMOJ 2N82B 1IWGA 3D68A 1VQ9S 3FBFA 1YJRA 2GHWA 4N8OA 1NH8A 3TANA 3K0JA 3N01A 2H5EA 2OPQA 2DEIA 1X7VA 4WPAA 4ZP9A 2AKWB 1N33J 3SMZA 1FNMA 5C2GA 2B4UA 2XGPA 1HIYA 1SC3B 3O44A 2FHMA 1PAUB 1FJ7A 2FGCA 5E3RA 3IBCB 1LOUA 2ZJPQ 2J7UA 4FN5A 2EFQA 3UO0A 4X62J 2KXNB 3AFGA 4B3MJ 1UEKA 1UZDA 3PKYA 1HNWF 4W92B 1LWEA 2IC3A 3RAXA 1H73A 3IGVA 3NWGA 5K8NA 1N48A 2KU7A 2DISA 3W7BA 2Z4PA 3M1VA 4B3OB 2E1RA 2OEKA 2XWYA 2KZZA 1GX6A 4P72A 2QMXA 4OI0A 1F5BA 3CWJA 3BM7A 5ETMA 5E3AA 4H4MA 2BX6A 2J76E 3GONA 3MMCB 2D74B 3VAHA 4CM2A 1JJ2R 4ZCKA 4NE9C 1OO0B 4J9PA 2NR0A 3CD0A 2V2QA 3CC4S 1HHTP 1FKOA 4TN2A 5L38A 1OPZA 3VGSA 2IRYA 4TY8B 4DPOA 2XMTA 3BH7B 2IBKA 1IKYB 1X5OA 4CLSA 3FFIB 4IFYA 2F5GA 2R7OA 4C8NA 1YJ9S 3LP2B 2YX4A 1Q82T 5D0GA 2Z58B 2RF2A 3DLEB 3NS7B 3GG0A 2UUCJ 1H6KX 1RHJB 2LA4A 1S9GB 1RT5A 3W61A 2HHWA 3DYAA 4K4XA 4HR2A 3KJNB 4HL9A 3SDEB 1YBUA 3IN5A 5EX3A 4ECUA 1FESA 3EXCX 2OPPA 1S0OA 2GIQA 1KLMA 1NLKL 4PWWA 4NLRA 1U2FA 3HLUA 3MM9A 3SCJE 2C3OA 2CPJA 3QWPA 3BEGB 3MMJA 1UW4A 2VDIA 1ZPWX 2LEPA 3CO0P 5A6WA 2BM1A 2MKJA 5EWFA 4LF8F 5ITHA 3IMQJ 1PC5A 4A8MP 5IC6B 1UJ4A 2Z2MA 3VHQA 1U2RA 3SQGB 3HFKA 1TFYA 3ET6B 1NRKA 1VIXA 4EZ6A 1NJXA 1IBLJ 1YLXA 1DAXA 3PZPA 2YY3A 2XMJA 3HHLB 2MZRA 1TTHB 3GSDA 3UQSA 1SV5B 3PHTA 3OXFA 1F60B 3D1OA 4ZJQA 3BSOA 5C24A 4LSZB 5F8MA 5HP1B 5B08A 4RLEA 2FUG9 2HBZB 3PM9A 4ES1A 4UQTA 2YWKA 1LFPA 1GFWB 4AXIA 4HLBA 1DLOA 4P52A 2RE1A 4V19J 1OS5A 5B0AA 3AA8A 2FC8A 3K5MA 5LSOA 5CA5A 1NUEA 2Q1LA 3DHXA 2PSZA 2B4OA 2MLXA 1X4FA 2EI5A 4YR2A 3MXHP 4DL6A 1VRTB 2HWTA 2HQCA 2EC2A 5KFPA 2V50A 2M2BA 1E6VB 3TAMA 4MIBA 1TU0B 4DV4F 4Q8EA 1SCJB 3I87A 3CMQA 5B0FA 3AD9C 4QPXA 3A8EA 3HM9A 3HVTA 4QR1A 3DLHA 3EUNA 2W01A 3PRDA 1RKJA 3HVAA 2IA0A 3KK2B 1RT4B 2JLEA 4PXDA 2V5HG 1WC6A 2MHNA 1S76D 1SC4B 3ITHA 4OV6A 4Z7YA 4DL7A 3U1LA 3BBFA 3TP2A 1MMDA 2ZBQA 4DR5F 5H9EJ 1RISA 4OIXA 3EYZA 2R7TA 1N6QA 1WELA 4C98A 5KG3A 3QYYA 1U49A 3IAS9 1S59A 1SI9A 4USVA 3WC2A 1LNQA 1HPZB 3MMAA 1VQPS 5D3GA 3EWGA 1XNRF 2OFHX 5A76A 1HNIB 4LFBJ 3DGVA 4X4QA 4F0KA 4P74A 2KT5A 5KFTA 3LPYA 4KKOA 3PFEA 2QFJA 1IJEB 2Z56B 2IMOA 1RK8A 1RT3A 2GW8A 4RBVA 1S57A 1B0PA 3OBIA 3C6UB 1WOSA 1FJCA 5HANA 4DPUA 3BGFA 3I0SA 4KIAA 3I31A 3UI3A 2OAUA 5EGYA 3KLFB 4ANCA 2NLWA 4I2QB 2HS0A 3D6TB 4I6YA 4BC9A 1N36J 2FY1A 1TMMA 1KVKA 2J6TA 2HW3A 2B0GA 5FD1A 1BLUA 4DHVA 2CQCA 2WW8A 2DNYA 4XPCA 3MAQA 4J9OA 1WEXA 4QJVA 2YKQA 4FKYA 4WFXA 4FYDA 5FLXY 1JKHA 1YVFA 3A3OB 1FXRA 2R7XA 4ILRA 5HBMA 4DWIA 5KFYA 4FBTA 3VQTA 1N32F 2CJBA 5GMDA 1AUSL 3G6VA 3UN5A 2A3JA 2DK2A 1URNA 2WW4A 3A8KA 4OZJA 3X3UA 3K17A 3G9CA 1MN7A 2OO4A 3TAQA 4GO5X 1MU2B 3LW5C 2ZKTA 2F8EX 2EG2A 2JEFA 1F3FA 3D3CJ 2OSQA 5F8NA 4MFBB 3M2VB 3NNAA 2G9OA 2DO4A 4H4KA 3HFVA 3VQSA 3P5TL 3QWUA 1KFDA 1CC7A 2AJ0A 4Y2CA 2ZBCA 2W8LA 1YJTA 2HGNA 4DCJB 3BREA 2N7YA 2D7SA 4F36A 3KUGA 4I67A 1M90T 1U1PA 1NDKA 1XR7A 2DGWA 2ZH6A 3HSJA 3ZTPA 5HROB 2C3MA 4DUZJ 2HFOA 4DQRA 2FB0A 2RJZA 4KRWA 2W9BB 1C1CB 3PACA 4LSNA 2VG5A 5KFXA 4R0EA 4OHYA 2X7IA 3THTA 1RA7A 4TU8A 3BJYA 2KT3A 2APOA 3K7RA 3HX9A 1AFJA 4B9MA 2AU0A 2KZMA 1GXTA 2QA4G 5C42A 2MKKA 1JK9B 1Q8KA 5MLCV 5HSPA 1CULA 1HBUB 4YHHJ 5GAHI 3AOBA 2WVCA 1TVRB 5JVGQ 2Z8QA 3SI8A 5HMZA 1RCXB 2VQEF 1C0TA 4UT4A 3O1LA 5A0YB 3DOKA 1YITS 4ANDA 1ACMB 3MF5A 5T14A 3TRGA 2XSJA 1RB0A 1A0OB 1S10A 1VRUB 1RE1B 2NSBA 1LQ9A 3CIMA 3BYRA 2DHGA 5G0RB 4K7QA 4X2BA 2QIFA 5J1EA 4Z7CA 4CO1A 3NG8A 1HBNA 3LANA 3FVYA 3FRZA 4QR0A 1JLCB 2DRAA 2OIHA 4H4KC 3G71S 1U25A 1U2CA 4UY85 4ECZA 2CA9A 1KD1T 4QOTA 2HWIA 2KM8C 2IAJA 3W5YA 3ZNUA 1R8HA 5ADZA 4LIWA 4W98A 1J27A 4FVCA 2U2FA 1M5HA 1RT7A 2CFXA 3GQCA 3QBCA 4DN0A 4NMLA 4KO0B 2N3LA 3TVZA 4B3TJ 2Q79A 1TUGB 3OTCA 1Y5IB 4MTPA 3E2EA 1Y3JA 4FKXA 4ECQA 1RTIB 2FZCB 4QIFA 4RUCA 3G86A 2LYVA 4V1Ak 2L9WA 1U8WA 4OZ3A 2WOMB 3C66A 4FZVA 2C2MB 4DOZA 3PRVA 1HBOB 4DF8A 1T95A 4YR3A 3L7PA 3BGUA 4K4UA 3TUIC 2DHHA 2BW7A 3GPAA 4WFYA 3CIZA 1IBKJ 1V6HA 2K7KA 2XZTB 1ZH5A 1RWKB 4P7VA 2AYBA 2B6AB 4CLKA 1BQNA 2UUBJ 1VQ7S 2LA6A 3LA0A 3PTWA 5LXRA 1XN9A 1MNEA 3CXCR 1ZAWA 3ISND 4ZVGA 2VASA 4JV0A 3MOZA 5DLGA 2H48B 3DOLB 1P1TA 3AOAA 1H38A 2IY5B 4OHWA 4KGMA 6AT1B 5F0UA 4NA1A 3IBWA 4CLYA 2CDQA 4RW9B 2FQQB 3AODA 2ILZA 1NHUA 5KFRA 3EM1A 2LQJA 1ZZNA 4N56A 1M1GA 3KHGA 3BGRB 1H2TZ 3I9V9 3L9ZA 4IH6A 2L48A 2CG8A 1RHQB 1Q5VA 4YP3A 2JVRA 3POTA 4O44A 3CDAA 2E66A 1ZAVA 4TU9A 1N54B 1D9DA 4B3OA 1KVIA 4C8LA 1NMEB 1JJCB 4A47A 2J6UA 4LBIA 1BQXA 5A8KB 1R8AA 2LMIA 3N5BA 4CLFA 4QQBA 2R2UA 3R7SB 2IVMA 5CZVA 2ZD1B 2IJFA 3JSYA 4RO0A 1KHVA 3MMCA 1KC8T 1F9HA 1VR6A 5A2QY 2H4YB 2XEXA 1WC4A 1X4CA 2M70A 4WFBQ 2DNGA 3Q8SB 1UVJA 2BJ8A 4LF6J 4YB6A 1QD1A 3U1MA 4M5IA 2NXEA 2HVZA 3VZIA 4L72B 2DNNA 1MWYA 5KG2A 2D3O1 3LP0B 3TA1A 3EX7B 4DV7F 2BJ1A 4TY8A 3IGNA 2QMWA 1IKYA 2PFFB 3FFIA 2R8JA 2MZTA 3RGIA 2KRBA 3PFOA 3HT0A 1HWIA 1VI7A 3LP2A 1REVB 1EX8A 3W63A 1VCTA 3N5FA 1KNZA 3DLEA 1S0MA 4NLXA 4KAIA 2PEBA 1VJQA 4UUXA 5FJ4A 5DM6Q 1S9GA 2AF6A 3UD4P 1TK8A 1PJ6A 3SDEA 4RJVA 3I4HX 2CNNB 2AGPA 1S99A 3MPUB 3S1TA 3O3LA 3CJRA 2FTRA 4B3RJ 2VKZG 2ASLA 3K57A 4M5GA 2ADBA 1XMQJ 3L4BC 4Z37A 2MDAA 4K59A 2MHEA 4LF2A 3IC1A 2E5LF 3BBCA 5K5MA 4DV6F 4F02A 1VLYA 2QSWA 2ASJA 4JYAF 3BS9A 2XMUA 5L1KA 2HLUA 2OPSB 3DRRB 1PO6A 1KLNA 2CKWA 4OLPA 3SQOP 4Q2LA 2ZM6J 3SQGA 4ECXA 3ET6A 4BC7A 3MEDB 4DXLA 1NAQA 2ZVSA 1S48A 1LXNA 3HHLA 5KFEA 2VIHA 2JFKA 1SV5A 3W2WB 5GAGU 2HMIB 4ZIVA 5KFDA 4RKUC 2CQ2A 4NI2B 5JVHQ 4WU2A 2QEXS 1WKJA 3N79A 2W2PP 1N4LA 4CWBA 3J7YI 5HP1A 4DV2J 3AB4B 2V34A 4CP5A 1GMUA 4M95A 1M5OC 4JI0F 1WI6A 5IFMA 4NCGB 2R2TA 3QJLA 1IKXB 2HRYA 2ZWPA 2HAFA 2OMLA 4KGVB 2JZ5A 2LQBA 2HEKA 4Q0BB 2J9EA 3MCSA 1ZM2A 1UEVA 3OJUA 1VRTA 2OTJS 4NEZA 3D66A 2VU5A 4KHPF 5KTQA 1E6VA 1RQ0A 3ZXWA 5LOQA 2LEAA 3OD2A 3P6YC 1RHUB 3J80U 3ZTQA 3M8YA 2RDDA 1IM6A 2GIRA 3ZC4A 4DV5J 5LMUJ 3KK2A 1RT4A 1ROFA 3HP6A 1AA1B 3QZ7A 2XNQA 4B9UA 2JVOA 4DV3J 2DNQA 3N6NA 1SH0A 3KNAA 2HFVA 1CJUB 3NRBA 1GMWA 1U02A 2W2QP 1X9WA 4DPYA 4WXOA 1BC6A 4C7QA 1F6TA 3MTKA 5A8WB 2VQFJ 2OH2A 2V8DA 1HPZA 2HURA 4LF5J 4N8NA 4K4SA 4ELUA 1WC0A 1HNIA 2IVYA 3NL0A 3EE3A 3HHLC 2JFDA 2GX8A 2VF3A 4MIAA 1UCNA 1UFKA 1NCLA 3C6UA 4E0DA 3KHRA 2XY7A 2XY6A 3HZGA 2F8MA 3H25A 2FJWA 2CQ1A 3EXYA 3KLFA 2B9EA 4M5MA 4L74A 1TQLA 1KONA 4I2QA 1IR1A 4HI2A 3T9ZA 4C8KA 2XM3A 2I8EA 3PYGA 4U8YA 3PX6A 9ATCB 2BJDA 3C6TB 1ULRA 1A6LA 2OHDA 3WC0A 4HACB 3HFZB 3H40A 3THPA 1L3KA 2HK3A 1RT1B 4KGXB 4ECTA 3CDUA 2FJBB 2V69A 3JQMA 2QJ3A 5I3UB 2ZH7A 5I42B 3CCQS 1LWCB 4P10A 3HSGA 2VFRA 5J1NA 1RAOA 4LRDA 4AL5A 4OYBA 3MR6A 2RHQB 1S49A 1PYSB 2XC9A 2XLIA 2LFVA 2ROPA 2B9XA 1FHTA 2HHQA 3MUMP 2IM1A 1F5AA 1MU2A 3PEJA 1IJFB 4DLEA 2LXIA 3N4WA 3LALA 1NPRA 4MFBA 1SUQB 3J81j 3M2VA 4WXWA 4LF4F 4JI5J 3NOCA 1I1GA 1ITPA 2QYGA 4ZVQB 4C4WA 3N0VA 3T5LA 4P9SA 2MTLA 1UP1A 4FYXB 4IG3B 3HSZA 2QFIA 2AJQA 1UVMA 2F9JA 5DG9A 4WJBA 4AE5A 3GLJA 3E01B 5A8RB 1UETA 4JUZA 4DJBA 3G4SS 2XG8A 4DR6J 2WRMA 5HROA 4BLGA 1Q8BA 1FCAA 3HVWA 7AT1B 2W9BA 1C1CA 3V6JA 3W8PA 1F2GA 4QYZK 2H65B 3LGMA 1O0PA 4L75A 4UW2A 4DFPA 4USMA 2XSFA 3OFHA 3TARA 3BZQA 3IA0A 2V0NA 1RABB 3D0HE 2UVWA 1Z2LA 1FD2A 4EI2A 2O67A 3A3PB 1HBUA 3RUBL 4NL5A 4O4GB 1DY3A 3ILJA 4RBUA 2OMOA 3OL9A 3MPWA 1TVRA 2BE9B 1QM9A 5K20B 3CDEA 2VJVA 2UXCF 4HTJA 2AGOA 5D4PA 4M5KA 5A0YA 2C2KB 3R97A 3K8WA 5D4LA 2ERRA 3BN4A 2R9LA 1S4EA 1MMLA 1NK6A 1KDNA 2DH8A 1BD6A 1WHYA 2A10A 3UCUP 1AUDA 1VRUA 3IRXB 1NJZA 4OZ1A 3KMQA 1FO1A 5G0RA 4ED7A 2G0IA 3CJ2A 3KOAA 3TUJC 2BW2A 2KHDA 1AYEA 2UP1A 4LVOP 4PYDA 2QV6A 1JLCA 6FD1A 4HH0A 1TMJA 1QY7A 4ZVEA 4M5JA 2UU9J 3R6GB 2VC1A 2ZOGA 5IM0B 3C46A 2VD3A 3Q89A 4RW8B 1HNXF 5KFQA 3KK1B 1JXEA 1GXLA 2RRAA 3KUHA 5H1SV 1VK8A 4J9NA 4CLLA 5HJXA 3NY0A 4IO9Q 3HPOA 4PWUA 5D77A 2PEHA 4OV1A 5AXKA 2VOPA 1JB0C 3TQEA 4KO0A 3IAM9 3R6LB 4RNHA 2XULA 3DCAA 1FDBA 2QA1A 1RTIA 4X66J 3CJKB 4OX9F 4GKKF 1PCAA 1WORA 5D4NA 2WVBA 1N8RT 2WOMA 3D2WA 3OXLA 3GIJA 2F40A 4OJGA 2HHHJ 4LRAA 2XMMA 2BMBA 5F41A 2POKA 5EX0A 3QO9B 1XR6A 1HNVB 3NAIA 1HBOA 5B0BA 3G8SA 4F04B 5DDOC 3P4UB 2CG4A 2GCFA 3KWMA 3AQPA 2YTCA 1J5EJ 2Z2LA 3X1LB 1M1KT 4ZVFA 2B6AA 3AA9A 1FE4A 1UA1A 3DHWC 3PRBA 4PG6A 3CCLS 2HS3A 3M8RA 1RWWB 3VGTA 2QC3A 4QW8A 4ZVUB 5KFJA 1NB7A 4B9TA 4OI3A 4DSKA 1WEZA 3DOLA 5DDPC 3NCQA 2GJ2A 4I2PB 1UVLA 4LQ3A 3PIPQ 3G8TA 3EZUA 4P2SA 1O5JA 1IKVB 3R8YA 1H0HB 4RW9A 4LRBA 3EPGA 2CPEA 4TYAA 2KTQA 1JIHA 5ETKA 1JLQB 1YX2A 2YBVA 3OFFA 3BGRA 3ZZZA 1FRXA 1HNWJ 3VAKA 1K1QA 3EZOA 3D6MB 1WSRA 4U6PA 2R4FA 1TL1B 3M6VA 2WB1D 3J80Y 2IRXA 1YRXA 2A6OA 1JLFB 3DOMA 2DHSA 4LR7A 2OTLS 3MCOA 4K4YA 2RUGA 3KNGA 2C2EA 4ZVRB 5A8KA 4CLWA 3AT1B 1EJ7L 4HT5A 2WVEA 1UFLA 5EDWA 2BQ3A 1TKXB 2ZD1A 2FJAB 1XMBA 1FJGF 4X64F 1MW7A 1V5VA 1VBKA 1UL3A 3M30B 3QJPA 1ELOA 3QAEA 3NEKA 4OZ5A 2G0JA 3MEGB 4NLTA 4ZOSA 4O3QA 2MYFA 1KQFB 1IXKA 2ZH2A 1D1UA 2HBQB 3UWTA 2FYXA 2GGPB 3FBCA 4HHJA 3M9NB 3LP0A 4OQJA 4YUDA 5M2RA 4ZMMA 1K0TA 4ZVPB 3WBZA 2HFNA 4MK9A 4F67A 2KXHA 3DMJB 1REVA 2D9PA 4QZVB 3JS9A 1TKTB 4AL7A 2J8AA 3PNIA 2KYXA 1FRLA 4ZCMA 4YEAA 2VG7B 1RHRB 4DR1F 2OP5A 4EYIB 1VBYA 4R5PB 4NEYA 3F0NA 3PYFA 4LFCJ 3FCVA 4NLWA 3GFYA 2WBRA 2Z0GA 4HHHA 4FBUA 2CQDA 4U8VA 2HQGA 4WK3A 1M5KC 4OJ1A 3TOQA 2H4WB 1VQKS 4N47A 1AROP 2BKNA 2IYIA 1KSPA 2QGFB 2GO8A 3M8PB 3W1YC 3VWSA 1D9AA 2CQ4A 2JEJA 3CDWA 3R2DJ 5AXNA 3KLVA 1FDAA 4DFJA 1Y5LB 2OLWA 4C11B 4R25A 4LBPA 4P71A 1MG7A 1T05B 2OPSA 2C2NA 3DRRA 3IR5B 2IA6A 4DZ6A 3MPVA 3QRRA 2VKRA 4IQMA 3KLEB 4JV5J 1WOPA 1B64A 5CCLA 3MEDA 2W9CB 5DDRC 2XYGB 1S6OA 3T1HJ 2ZUGA 4JI2F 2JEGA 2RSQA 2CJXB 4OI4A 3M6UA 3W2WA 4BHQA 2HMIA 2GVZB 3I56S 2YXLA 3GG1A 4NI2A 2H5JB 1WI8A 2VHGA 1HD0A 3CD7A 4WFZA 3V6KA 2XMWA 3NBPB 1ZA2B 2AIRB 2Y1RI 1WTFA 4ECWA 4M63A 1FKAF 4PR6A 1YK9A 1YIJS 1NHKL 4ED8A 2OSRA 3MCNA 5JXSA 3C15B 5J2QA 5GAEI 2ADCA 4M5HA 4NCGA 4DUYF 4F4XA 4LR8A 1IKXA 3VAJA 1T8EA 4Q0BA 4O3NA 4A8QA 2B5JB 4HKQA 4FF4A 2LP4A 2VPXB 1Y10A 4DV4J 4JI6J 1R31A 3OTOF 1NK0A 2P8IA 3PX4A 2OUGA 1QE1B 3HHEA 4QIWD 1S77D 3UCGA 1NSAA 3CCRS 3LAMA 5HL7Q 1ZTWA 4AQYF 2AYMA 3PR5B 3AXMA 1M5VC 8AT1B 3Q8YA 4DR5J 4C8MA 5CYQB 4UOCA 2JNJA 4JI8F 1CJUA 4YB1P 2C42A 5KFHA 2YPYA 1DRZA 2B43A 5A8WA 3OLAA 1I6JA 4DBQA 2YKPA 2BJEA 3K5PA 1N33F 1U8SA 1VOMA 4ELTA 3V4IB 2DYAA 3CNQP 1QDUB 2UVUA 1XNRJ 4JI7J 2JX2A 1TR0A 3M6WA 3G6XA 4F3OA 3BV8A 4NLQA 3P8BB 2ZE2B 1OYEA 2FJDB 3PG9A 4IDKB 4Y00A 4UY8T 2K8GA 4X62F 2MGZB 4ZPDA 1Y4ZB 1PG5B 4QBUA 2GQCA 4MJKA 2FDNA 2FVCA 1H2UX 1WHXA 3FDSA 3I5AA 2V2ZA 1VHFA 1VQSA 1R6VA 2XQCA 4WIQA 1C4CA 3C16B 3HXMA 2ROGA 3E8OA 4QWDA 4QIVA 2IVFB 3TJ9A 2HS4A 4CYUB 3SCKE 1Y11A 5HK4A 3G8QA 1T9XA 1U24A 3C6TA 3IWLA 4ZP6A 4HACA 3H2VE 4EBEA 2R8HA 3TA2A 4C3MA 1RT1A 4GRSA 4DQPA 3KG4A 2H51B 5I3UA 1N32J 3G6ES 5L9XA 2GHPA 5I42A 5KFNA 1LWCA 1PSDA 4QU7A 5KT2A 4FVMA 5F8GA 1KHWA 1VFJA 3UVJB 1XTZA 4L6V3 3E3XA 2YWFA 2IDLA 1RAFB 1OPIA 1N52B 1FRMA 5D6GA 1YJVA 1MN9A 1SUQA 4IH7A 5AE3A 1UTAA 5IT0A 4B9NA 4J9LA 1WG1A 2VOOA 5DQGA 2DNPA 1RCOB 1GX5A 1C2PA 3HT3A 1NXIA 3M2RB 3NGKA 3RYLA 4IG3A 3KDNA 3MM7B 1T7PA 2N4DA 3E01A 5A8RA 3MURP 3T9NA 3M8QB 4IG0B 1ZM4A 2DGOA 3D28A 4OYMA 3SCLE 4XK8C 3K8VA 2UXDJ 5I3QA 2AWZA 4EZ9A 4YS2A 3BKTA 1K47A 1OIAA 1KS2A 3W64A 2LKZA 3L3CA 3T5HA 1QVGR 4X4PA 2OD4A 4ATNA 4FYVB 2YWHA 1VIOA 4ZKAA 1RAAB 3AB2B 2DH9A 4O4GA 2D9OA 2DR7A 2WSCC 2NZ4A 1CQNA 3C2PA 4PWDA 4WCEQ 3UDCA 2MQPA 4P2MA 4UOHA 4MYTA 2ZH1A 4LSLB 4ED3A 2NXJA 3N9UC 4CNZA 1D09B 1JXVA 3T19A 5G4DA 1TELA 1KKHA 4NA3A 3QFHA 1SKSA 2DNHA 3T5KA 2Z2ZA 3IRXA 4Z2XA 4XIUA 3LF0A 3BN7A 2V4JB 2XGQA 4OFZA 2VONA 2CNLB 3MEEB 5BJRA 4ICLB 4NLGA 2K06A 9RUBA 3GP9A 4CZCA 2HVDA 4MKYA 1RHMB 1TL5A 1YJUA 2A1BA 4OYXA 2KVQE 5IM0A 1BUXA 3JQKA 5BYQA 4WZQA 2YQ1A 3A3NB 4Q7AA 2KJWA 4RW8A 3KK1A 4LT6A 2EXUA 2YKOA 4ED0A 3PW0A 4LF7F 1RAEB 2FPHX 4R0JA 5KFLA 2NYHA 3MGJA 5BR8F 3U27A 2X3DA 4AT1B 1D0EA 1VQYA 2V9KA 4F0MA 4YB5A 2PMHA 3WX4A 3IR7B 2DNKA 1RSCA 1FVQA 1SQEA 3H2LA 3O6QA 3L7UA 3CJKA 4QWCA 4MIWA 3ZZUA 2VPYB 5GADI 2ATCB 3HSDA 2V8VA 4RNNA 4JBCA 1X5PA 4XDCA 3VGUA 3QO9A 3TUZC 4CLPA 1HNVA 3LQVA 3QGPA 1R8PA 2CPXA 5E7OB 7FDRA 3SZ2A 2HHPA 2OJ3A 3NXZA 1U1QA 5CD4A 2Q66A
chains in the Genus database with same CATH topology
2W4CA 3DLJA 1URRA 3DDKA 3M6XA 4YP3A 2JVRA 3POTA 2WTFA 2M0GB 4O44A 2EKYA 3CDAA 2E66A 1S6PB 4IOAQ 3MI7X 1JLBB 1ZAVA 4RW4A 1Q7YT 1RI7A 1DHMA 2I0XA 5IWAF 4TU9A 1Q81T 2AJFE 1NKCA 1N54B 4IFYB 1D9DA 4B3OA 2D3UA 5IT4A 3LO3A 4X4TA 1KVIA 3OR2B 2Y1IA 1LWFA 2BACA 3JTOA 3P3DA 4ZK7M 3H5UA 3CF5Q 1NHVA 4IH5A 1A7GE 2XI2A 4K4TA 2KI2A 1M5PC 2C3PA 2PN6A 4A47A 2J6UA 5D8HB 1BQXA 3DLLQ 5A8KB 5J1PA 1SL2A 2DIVA 1R8AA 2LMIA 3N5BA 4YB7A 5MAOA 4ECSA 3FGVA 4QQBA 5HN0A 5LMNF 4ETZA 2WBMA 2R2UA 2LQ5A 2IVMA 5CZVA 4ID5B 2YNGA 4OI2A 1SJ1A 5GMKa 3NS6A 4Q2MA 4I2PA 2ZD1B 2UUWA 4F26A 2IJFA 1GH8A 3JSYA 1KHVA 1P9QC 1UJ6A 2FC9A 3MMCA 2UUAF 2HHVA 3DU6A 3DRPB 2EFVA 5CCMA 1KC8T 1IKVA 1UWBA 3M9OB 2XZWA 1FE0A 1VC5A 3LP1A 3HHNB 5A2QY 4QW9A 2BANB 2XEXA 1RT5B 5J2NA 3PXGa 1U1OA 1X4CA 3DYAB 1GTHA 2M70A 1MMNA 2V94A 4A8OA 1U1MA 2DR8A 4WFBQ 2DNGA 4ZPBA 4KJIA 3Q8SB 1JLQA 2DITA 4JI7F 4DF4A 1UVJA 4DG1A 4LF9F 2YWGA 3EGNA 4YB6A 2ZH5A 1SJ3P 5KG1A 3U1MA 4ALZA 2K3KA 3KFWX 4F4ZA 2FJEB 1S1XB 4BS2A 3VF0B 1Y00A 3GYNA 2HVZA 2BR0A 5KOXA 3VZIA 1PGZA 1BGXT 5KFSA 4L72B 2DNNA 2OPPB 1MWYA 3M2UB 5KG2A 1TL1A 5THWA 5T41A 1WHWA 3LP0B 1KLMB 3TA1A 3EX7B 7FD1A 1L3SA 4DV7F 5I3PA 4TY8A 3IGNA 4DS5A 1J5OB 4FF1A 1HQUB 4J9RA 1JLFA 3MM9B 2QMWA 1IKYA 2PFFB 3FFIA 1Q4RA 2R8JA 3IS9B 1M0SA 1HWKA 2MQMA 4ZPWR 3Q8RB 2KVIA 1KQSR 3CC7S 4NZ0A 2MZTA 5B0EA 4NLPA 1HD1A 2KRBA 3PFOA 1HWIA 1VI7A 5CZXA 3LP2A 1L3VA 4RBTA 3IWNC 1REVB 1CG2A 1S1WA 3KLHA 2LVWA 2M3DA 2X1AA 5EN1A 3HVRA 3N5FA 1KNZA 4IYQA 3DLEA 3GV7B 1KEKA 2YNHA 1S0MA 3HJFA 4NLXA 4KAIA 1RKIA 3B4MA 1TKXA 4MAKA 4J9KA 2E1MC 5CD4H 4HDGA 4UUXA 1RAJA 4QWBA 5JJBA 2WK4A 5H9FJ 4F3MA 5FJ4A 3KMSA 3H98A 4ZVHA 2FHOB 2P6TA 2DT9A 5DM6Q 1VC6A 1IM4A 3PW7A 4J9SA 3NNCA 1S9GA 2MY7A 2V8GA 2AF6A 3K58A 3UD4P 1TK8A 2DTJA 3M30A 5AXLA 1N5VA 4DN9A 2KN4A 1S1VA 2F1FA 4B02A 3SDEA 1TAUA 5T7LA 3MEGA 2GNKA 4HEA9 2ZM6F 4FPRA