4YEAA

Crystal structure of cisplatin bound to a human copper chaperone (dimer) - new refinement
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
67
structure length
67
Chain Sequence
PKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper transport protein ATOX1
publication title Crystallography and chemistry should always go together: a cautionary tale of protein complexes with cisplatin and carboplatin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal transport
total genus 19
structure length 67
sequence length 67
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4yeaA00
5B0BA 1Y3KA 1YJUA 1MWZA 2XMKA 1OSDA 5T7LB 1Q53A 1SI9A 4HH1A 5A6WA 5F0UA 3BM7A 3HHLC 2RMLA 3TRGA 3TNVA 1CC8A 2K1RB 1RJJA 4QOTA 2GO8A 2KYZA 4OJ3A 2N4DA 5KAKA 2OMOA 1WD6A 4YDXA 1APSA 2GGPA 1KVJA 3CJKA 5B09A 1SQEA 1FE0A 3IWXA 1GXUA 1Y9OA 1X8DA 2L3MA 1YJRA 2RSQA 2IYGA 3LGMA 3LGNA 3HHLA 4Y2KA 3QGPA 1CC7A 2K2PA 3DCAA 1TL4A 5A6PA 2VV5A 2W4DA 2ROPA 2HIQA 2OD4A 2XMWA 2G9OA 4ZOSA 2LXFA 2OKQA 2QLXA 4HI2A 1TR0A 2BBEA 4HL9A 2OD6A 2ROEA 2AP6A 2AJ0A 2EW9A 2GCFA 1W2IA 1VQSA 3HDSA 2FTRA 2RILA 3K7RA 1ULRA 2K7KA 2XMTA 4OJGA 1OPZA 5B0DA 3E8OA 2RU9A 1LQ9A 3BGUA 4OJHA 3T9NA 1P6TA 2BJDA 1X0PA 2AW0A 2HFOA 2XMVA 4OIXA 1VQYA 1QUPA 2LQBA 3KNGA 2PGCA 4A48A 4A46A 4F67A 3BR8A 1FD8A 3HHLD 1K0VA 3HF5A 3IWLA 1S6UA 5B0CA 1JWWA 3DXSX 4DN9A 5B0FA 1YRXA 2FHMA 2HLUA 1TUVA 1U7LA 3MCSA 2QLWA 4HH0A 1AFJA 3HHLB 1TL5A 5B08A 2OFGX 1AFIA 1FVQA 4Y2IA 2XMUA 2PD1A 3LO3A 1IUJA 2GFFA 1CPZA 2KT2A 2LDIA 3BN7A 1N5VA 3FGVA 1JK9B 2LQ9A 3KKFA 2BYCA 2CRLA 3GZ7A 4A47A 1S6OA 4ZA1A 1YJTA 4Q2LA 2BJEA 3FRYA 3I9ZA 1FESA 2N7YA 1TZ0A 4OJ1A 5K9FA 1Y3JA 2ROGA 2AJ1A 1Y0HA 3F44A 2FB0A 3HFKA 1AW0A 1OQ3A 2N4CA 3MZIA 1R6YA 2GGPB 1Q8BA 1Q8LA 3CJKB 2Q3PA 4NL5A 1OQ6A 2HLTA 5T7LA 2ACYA 2HQIA 4NPOA 1URRA 3UDCA 2W4CA 2K1RA 2XMJA 2BUNA 4HI1A 2W4PA 2GA7A 5B0EA 4Y2MA 4DPOA 2ZDPA 4FNIA 5B0GA 2IYIA 2KT3A 2ZDOA 2JDJA 2ASYA 3BF4A 2OAUA 4YEAA 1MWYA 1YJVA 2XMMA 4EFAC 1X7VA 1YG0A 3QMQA 5F0WA 5B0AA 4DL0C 3BB5A 1FE4A 1FVSA 2QIFA 1XBWA 3BDEA 3KG1A 2OFHX 1SB6A 1Q4RA 1V3ZA 2KKHA 2QYCA 2IFXA 4A4JA 1GXTA 2FIUA 1N5SA 2HFNA 2K7JA 3VTIA 2VH7A 3HX9A 4Q2MA 1P8GA 1KQKA 1FEEA 5IXUA 2OP5A 1KVIA 3FMBA 3KG0A 1N5TA 1N5QA 3TOQA 2GV1A 4U9RA 4FNHA 3WDOA
chains in the Genus database with same CATH superfamily
2V67A 1RT4A 4K4VA 4JUZA 4QYZJ 1XWLA 1HYSB 3A12A 1UPMB 4DWIA 4JB8B 3HKWA 4J7CA 1Y9OA 1UTAA 3CE8A 4ZP7A 3HZEA 2BZ2A 2RS8A 2MZSA 2YX1A 3CDUA 4N77A 2MLXA 1N8RT 1FO1A 3CMAS 2AGPA 4U8YA 1NSQA 1IKYA 1RT4B 1QUPA 2GMLA 5IZHA 3QRPA 4P2MA 2LDYA 2YQ0A 3BH6B 1EHWA 3TW0A 1WEZA 4ZJLA 6FDRA 1R3NA 2DNRA 3CUNA 2Y8YA 1JLGA 5KFOA 1H74A 5D4LA 2B7CB 2KHCA 3DYAB 1NCLA 2DR8A 1JJ4A 2FVSA 3SDEA 3PJWA 2LQ8A 2W4PA 5GMDA 5F8NA 3MR3A 4U8VA 2DHHA 3UD5A 3KXDA 4ZMMA 4NMLA 3LPEA 1XIQA 4P73A 5D0RA 1JLGB 4DX6A 4DUYF 2YNHA 2PMHA 3PJXA 4RU2A 3SMZA 1KQGB 3BH7B 1CBKA 4C7QA 2XSJA 4MYTA 1KVJA 3M8QB 1T9VA 1KONA 2YX7A 3LPYA 3I0RA 3LALA 2DNMA 2DR5A 2GCFA 2AGQA 1P1LA 4ECTA 3GFHA 2NPIA 2KYXA 3FJ2A 1U1PA 2D3OR 1VQYA 4USJC 2B9WA 1F3VA 4M5MA 2IIHA 4RNHA 5L39A 2XSJB 1FKAF 4K50A 4YY3F 1M0SA 4QR1A 1FJGF 3PO5A 1Q95G 4ZPCA 4DF8A 3EZOA 1KOHA 4RBUA 1BE4A 5CZXA 7FD1A 4FYXB 1XTZA 1UW9A 3G86A 2FHKA 1S9FA 3SV4A 3OV7A 2QL7B 5A8KA 3ICLA 3A3OB 4P2XA 2F65A 4CYUA 4QW9A 4RLEA 3MEEA 3O5TB 3PKMA 3QFWA 5ETPA 3G6YA 2XGQA 4AL6A 3BYRA 2QMUB 3PIOQ 1FJ7A 4NLDA 4U9RA 2H3EB 3GFXA 5A8KB 2I2YA 1R6VA 5M2RA 2GVZA 1Q16B 4YDXA 2QE5A 3MEEB 4DQSA 3E51A 1WTFA 4PG5A 3V6JA 2PI4A 4F50A 5G0RA 3M30B 3U1LA 1S48A 2YKMA 2AEFA 3OL6A 1YIJS 3TA2A 4RUHA 3NRBA 2GVZB 1XERA 3QJLA 3OFHA 2ZBIA 3ETMA 1FKPA 2YPZA 2ZH4A 1IN0A 3R6LB 1X4GA 4NLPA 5G0RB 2FJEB 3G96A 3KLEA 2YKMB 2FB0A 1TKZA 2HLTA 1NB7A 4J9MA 2RD5C 2H51B 4F8RA 1FKPB 3RW6A 3BB5A 4KR0B 4DV7J 3GIMA 4CH7A 1VDHA 9ATCB 2V4QA 2K7JA 3KLEB 3PRBA 4MTPA 3CIZA 3TOQA 3QIDA 2KL8A 3NL0A 1UZHA 4GKKJ 5BYRA 5DG7A 2I8EA 1TKZB 3UD4P 1U24A 3K89A 1X60A 4WP9A 2CNLB 3CF5Q 3EDQB 1HBNA 1XQIA 4TU7A 3U1MA 2CPJA 4MKBA 5D6GA 3PW5A 5B0DA 3UNYA 2YKQA 1REVB 4NLWA 5ETQA 1HIYA 4ALZA 2GC8A 3KUEA 2JEIA 1RU1A 5KFIA 4USWA 4B9SA 2HPUA 3PYGA 1IBKF 4X64J 2VD3A 1YZ6A 1HBNB 4DFKA 2VPXB 4LBIA 2WVFA 2A2DA 4J90A 3H42A 2BKNA 3KMSA 5KFVA 5HATA 3J7YU 3EGNA 4IQMA 4CCHA 3K5OA 2EBEA 2UUAJ 2F8EX 5KFDA 1OJ4A 4H4MA 4OYBA 5I3PA 2CQ1A 3T1HF 2DRDA 4M5IA 4LSLA 3DLGA 1TKTA 3G8SA 3KUHA 2J0SD 4IRDA 1SKWA 2DPIA 5FJ4A 1MWZA 2XLJA 2UVVA 4TLRA 1LXJA 4C8KA 4H4MB 4G3IA 2HQGA 3DRXA 3MTKA 2WB4A 4LSLB 3NGUA 2VQFF 1TKTB 4OI3A 3PX4A 3GFYA 1RHMB 3EDRB 1RACB 4LFCJ 3G71S 1NAQA 4KGMA 2B51A 1X9WA 4DN0A 3SCJE 1SJ4P 1VIXA 4ZJQA 3K5LA 1XNQF 2HWHA 4NA2A 4DV0F 3I5BA 4Y28C 1RT5A 3ET6A 3R8YA 2BOPA 3OD2A 4KHPF 4ID8A 4PYDA 1Q5VA 3TZWA 1UVMA 4B02A 4I67A 2AJ2A 2D1CA 3NCRA 1Y10A 2AKWB 2BX6A 2KM8C 2XCPA 2Y1IA 4NCAA 3PKYA 2VASA 3ET6B 3AAWB 2QLFB 4Y00A 2L9NA 2GS8A 1WHVA 4I6YA 3D1HA 3W9IA 3GIIA 1S10A 5J2MB 3MPWA 4OZNA 1K0TA 4CRJA 1HW8A 2KT5A 2KZMA 5L9NA 4USVA 3WC2A 2H5IB 3OBIA 1GXUA 3LGMA 1F1BB 2E5IA 2UU9J 2MQQA 1I94J 3THTA 2W4DA 4LRDA 2AIRB 2LECA 2BW2A 4PEOA 2U1AA 3D67A 2DB1A 2LQBA 2DY9A 2ZHAA 2CJYB 1IM6A 5DJBA 4HH0A 3LW5C 2L9DA 2XQCA 2IVYA 2WOMA 2V9WA 3RW7A 1H2TZ 3A8IA 2QFIA 3D4JA 1S72S 3R6GB 1AROP 2HQIA 4OV1A 2BA9A 3S6EA 4V1Ak 1U26A 1BC6A 3MTJA 1JLFA 1XNRJ 1BWVA 3TQEA 4AT1B 4L6V3 3ZXWA 2Y8WA 4P7VA 2HBZB 2WOMB 3HCXA 4ES2A 4WFZA 5D0HA 4OLOA 1UAWA 4D3HA 3HVTA 2Y0SD 4DV6F 3IS9A 1FRHA 2B56A 1YRUA 1JLFB 1U2FA 3VAGA 4EGLA 5HJXA 3OVBA 2CPFA 2D7SA 1JQGA 4OX6A 2WZ1A 4XAKA 1T03A 4LVNP 2XS2A 4Z2XA 3H5UA 1Q8IA 3MF5A 3K5NA 2EVZA 3W7BA 2BANA 3IS9B 4JYAF 3OJUA 1S6UA 3UVJA 2YVSA 3A3NB 1I5OB 1DBDA 4NCGA 1F9EB 1E6YA 2C2MB 2RDDA 3CCMS 1GMWD 3JSMA 1OIAA 1HNXF 1T03B 1FDNA 2XM3A 1HNZF 2J8SA 3DDNA 1ZAWA 2BANB 3MMCA 3PRVA 3U02A 2ASDA 2DH7A 3UVJB 3UNGC 5B0GA 3T5JA 3V2UC 1EP4A 4NCGB 1RHRB 1E6YB 2COLA 1U48A 4PG7A 1B64A 1NH8A 4HDHA 3RR8A 3KLHA 1YJWS 2CPZA 2L48A 1RDRA 3KG0A 4C3MA 2Y1LB 2KO1A 2DGSA 1SI9A 2N3OA 3KLFA 3V81A 2MY8A 1P1TA 5J1PA 3IM9A 1EP4B 4JI7F 4RNFA 1CQMA 2ZWOA 3KLHB 3QAUA 4NLQA 2WVEA 2RB7A 2D69A 2EWHA 2W9CB 3KTQA 4DFMA 3KFWX 1RAGB 4OZ0A 2LFVA 2CJ9A 2DNNA 1YRXA 1J5EJ 1DQAA 2ZNZA 4ZLJA 4KGVB 4HT5A 1EQ0A 2HKEA 4RBTA 1D09B 4F2SA 1UA1A 3G87A 2BQUA 3AQOA 2Q1LA 1R89A 3PM9A 3J81Y 4IOAQ 2XCAA 1PAEX 1Q7LB 4AXJA 5KFWA 2AEMA 2ASYA 2LQJA 4N56A 5H9FK 3OJSA 4PKDB 3PHEA 1N36J 1RK8A 4NLUA 4N5SA 2ZH2A 2CQ3A 3M7VA 4LQ9A 4EU0A 1OY8A 1R0AB 1X4BA 1NM2A 2QGFB 2J0WA 4XPEA 5FD1A 2G13A 4WIQA 4K4TA 4OL8A 1TAUA 4F25A 2HIQA 3M6VA 3PW4A 3ISNC 3A13A 4ANCA 1X0PA 4NCBA 2HGMA 1H0HB 3LOUA 4TKTA 3RRKA 2OPPA 3KLGB 2HVHA 4ETXA 2LU1A 1HQ2A 3QQCD 1FVQA 3P5TL 1XJWB 2Z2MA 1ZA1B 3SFUA 1HNWJ 2V0NA 2IAJA 4X62J 1WOPA 1D1UA 4IRCA 4DFPA 1F9FA 2RQCA 2OPPB 5IT0A 1QLNA 1KWMA 2G0CA 1MU2A 3QMQA 2I1RA 4P75A 1Q8KA 1V3ZA 4BWMA 2IAJB 4K0KF 2IBOA 1XR7A 4DLEA 3EYZA 1UFLA 2RRAA 3HHLC 1V5IB 1UWAA 4Q43A 3QO9A 3CJKA 1PIEA 2CQ2A 2QO3A 2VJUA 1MU2B 4WFYA 2M8DB 4ECZA 1J2VA 1EARA 1RHJB 2XLIA 4MIAA 2VICA 3MHYA 1MSWD 5E0OA 1RQ0A 1S6PA 1VRTA 2R8HA 5L46A 4B3OB 3L3CA 1SH3A 1U1MA 3QO9B 4F2RA 1F60B 3O2IA 3NGTA 2AQ4A 4EK2A 2CQCA 1S1XA 1GX5A 5KT2A 4HDGA 2F9DA 5JJBA 1KSPA 2F4FA 3BQ2A 3K5PA 4QWAA 4DQIA 1F5CA 2CDRB 3UR3C 4YR3A 3IAS9 1CQNA 1GEHA 3NKYA 1G2EA 2OI2A 3VGVA 1RI7A 1IKWA 2Y1JA 1S6PB 1B0TA 1WELA 4QBUA 4HI1A 1S1XB 1VIOA 2OAUA 4OZ2A 2F5GA 4TYBA 2P9EA 2PEHA 3H7HB 2JRSA 1UEKA 2PDAA 1NNDA 1X4HA 1PYSB 1HARA 4F3MA 3I96A 3W9HA 1FTCA 5EX0A 5IWAJ 2QRRA 4ZIVA 2BXJA 2V69A 2EKNA 4WU2A 5DG9A 1O5JA 2QT7A 3FC9A 3SQGA 3D6TB 3AB4B 1RADB 2MKHA 3SYZA 3RB0A 2R2SA 3N9UC 3EM1A 4DEZA 2ZH6A 2CZ4A 2MZRA 1FFSB 2C3PA 3CJ8A 1RTJA 5CAAA 1RBOB 3SQGB 2UUWA 4NEZA 4NZ0A 3BBCA 3V4IB 4DV1J 1AA1B 5ETKA 2C2DA 4ECSA 1TU0B 3BBFA 1LFPA 3ISND 2HFSA 1SJFA 5IV4A 3T6BA 2NZCA 3QGHA 4FNIA 1RTJB 3H40A 3NS5A 3DI6A 3OSPA 3EUNA 4OX9F 2DGXA 2FZGB 4NYZA 4DFJA 4X4TA 4I6WA 5DG8A 5FIIA 1S9EB 1WHXA 4C0BA 5E33A 1APSA 2DK2A 3DI6B 5BR8J 1VJWA 3QT7A 2IBKA 2AYBA 3EJMA 3I5CA 2CVIA 4ZVSB 4L75A 4KO0A 3R5AA 3QLHA 4NLOA 4DMZA 3HHLD 4DPUA 2RVJA 3G8TA 2UUTA 3Q23A 2LU2A 4O3OA 4I64A 2RQMA 4NLGA 3E01A 1RZMA 2FJAB 1GFWB 1U1LA 3TA1A 2NQPA 4NLTA 4CLYA 3QNWB 3PIPQ 2E5LF 3BBBA 2R7XA 3QLHB 4OZJA 4PQUA 3CCZA 1MNEA 2Q3PA 3P45B 5D3GA 4B3TJ 4P52A 2ZM6J 4LRFA 4PUOA 2H4YB 3E01B 2C28A 3WC0A 2C42A 5EGYA 4LT6A 2J0QD 2DGQA 3CJSA 5KFAA 4C3KA 2LEBA 1FRXA 5GVQA 5HVGA 4PQUB 5D3GB 3GJTB 2HNDA 2QG9B 2DEIA 1RWOB 2VOPA 5KT4A 1S0MA 4PUOB 2JLEA 1HWLA 1V6HA 3UFCX 1HKAA 1AT1B 5DM6Q 4DXLA 4MKVA 2OD4A 2XNQA 4FYWB 2W7PA 1QUVA 2XWYA 1IWGA 2XYGB 1RE1B 1ZM9A 2DXEA 2RDIA 1HR0J 1EIYB 2DCUB 2HNDB 5B0CA 2ZH1A 4WBFA 5KFMA 4ILMA 4YB7A 2CQ0A 2V34A 4QJVA 1IJEB 4GC7A 1FRKA 5IC4B 2DRAA 3B6BA 4CO3A 2P8IA 5FLXY 3ZFVA 2CWKA 1R0BG 2V5HG 3MAAA 3NS7B 4O44A 3GONA 4CO4A 1Z4UA 4EFAC 1S49A 4DCJB 4P72A 4O3SA 1NK6A 2I9SA 3KUGA 4FVCA 2QYCA 2CPDA 4S0MA 4TYAA 4UOGA 3NCQA 3T1YF 1R0CB 4RBVA 2CQGA 1U4BA 3P8BB 3M8ZA 4NLXA 5GADU 3MAAB 2KFZA 4O44B 3AOBA 4UOHA 4Q7AA 2MLYA 1L3TA 5KFNA 2Q79A 5HAOA 2A6OA 3CW2C 4IQXA 1IM4A 3TX8A 1VC0A 1IBMF 1KQFB 4HL9A 2E1AA 5D8HB 1PJ5A 2VG5A 5F8JA 1JIHA 3HFVA 4F67A 4F0MA 3BJYA 1WKJA 1RT1A 5EWFA 1B7FA 4DR7J 1QM9A 2RHSB 3UI3A 3QT5A 2EG1A 4AQYJ 1TUWA 1NDPA 1KBRA 1XEZA 1QJHA 1Q7YT 4HTIA 2HHSA 2HGNA 2V6AA 4M5LA 3W9JA 2YTCA 1VBYA 2VG5B 3ZC4A 1RT1B 1S99A 3OT9A 3NNHA 4Y2MA 2KXNB 1F2GA 1T05A 5EN1A 4DCOB 4LF8J 4J9NA 2BOAA 1EETA 1N52B 3TJ9A 4EZ6A 3OTCA 3MD1A 1OPIA 2V8HA 1TMJA 3DOKB 3NAHA 1M1KT 4J9SA 1FTRA 3OL8A 4CO1A 3R2DJ 1SCJB 3QJPA 2ZKUA 5ETOA 1T05B 2EFGA 3SIPB 2DIUA 8RUCA 5J2NA 1EETB 1CC7A 3SI8A 3B4MA 1GMWA 3H4BA 3BGFA 4J5OA 3GV5B 3KDOA 2H9ZA 2H48B 3KK1A 5KG4A 3OTOJ 1KFSA 3AY0A 3ELHA 2PMWA 4J9KA 5J2NB 1HQUA 1T3NA 2PIIA 1GNKA 2HFUA 3PW0A 2HHHF 1VHIA 1ZPWX 4Q8FA 4K5SA 1OQ3A 3Q0AA 3HD2A 3RYLA 3M9NB 3FSIA 1YRTA 4ZN3A 2ZEJA 2P9GA 2LMIA 2GMJA 1IKXA 5KFEA 4X65F 4AUKA 2I5JA 1HQUB 5EUHA 3KG1A 1VC6A 1LK7A 5DDOC 3D0HE 2RF2A 2X51A 1BHNA 3AH6A 1WORA 5E3QA 2P6TA 1URNA 3N5FA 5IOLA 2CIMA 4NI2A 1U8SA 3AD9C 1IKXB 1C0UA 4LR8A 1RAAB 4DJBA 2HNZA 3PYFA 3CJ3A 4FKYA 2RF2B 1U1KA 1NZ8A 4LSZB 5HMWA 2AJ0A 2Z2ZA 4OJGA 2UUCJ 1NK8A 3KLIA 2MGZA 4WCEQ 2D3UA 3GYNA 5HLFA 4NI2B 3B54A 1C0UB 3R2CJ 2GQCA 2V94A 2B5JA 1S12A 4DV2J 3ZNUA 1NDKA 3PW2A 3AD7C 2HNZB 1N5VA 3I5AA 1YI2S 1VRUA 1JNZB 1OYDA 4J37A 4FKXA 3CC4S 3NY0A 2D3ZA 2OIHA 2MGZB 4LIWA 5KG1A 1XR6A 5HLFB 1S7IA 2W4CA 1JXEA 1CJTB 4H4OA 2B5JB 2NSBA 3L7OA 2UVWA 4IUFA 4TQRA 5CYJA 1SUQA 3T6JA 3M8RA 1V3RA 1ZZNA 1NDLA 3ZTQA 1VRUB 2EC2A 3J7ZT 5KG3A 5IXUA 4LSNA 1KVIA 3LP2B 4A8XA 3NMAA 2AF6A 3H5YA 1S1TA 4G6VB 1HNVA 3R27A 2MEWA 2OMLA 1RJJA 8AT1B 1FRMA 5B09A 2QC3A 3PR4A 4K4WA 1SUQB 3UN2A 3D1QA 3JAMY 2DITA 4LSNB 4DPTA 4FF3A 5K5MA 4WYLA 1LQ9A 9RUBA 4ZPDA 4WU3A 4CI0B 4GKJJ 4TU9A 5A2QU 2DGWA 1SJ3P 1O6XA 1C4AA 1SH2A 3BSCA 3CO9A 4HACA 1B4SA 2IPOB 1D3WA 3QT6A 4J9VA 4KFBA 3M9OB 4LVOP 4DR3F 2CG4A 2J7WA 4F26A 1NUEA 1MG7A 5HANA 4Y65A 3SEOA 4JOUA 3FSYA 4HT7A 4XDDA 1AZSA 3A8KA 1U6BA 3MFHA 3I9V9 4LF4J 2RT3A 2R8IA 3DRSA 4KC5A 5C25A 4KFBB 1X4DA 2MJUA 3KHRA 1UEUA 5B7WA 3VAKA 2PA3A 3EE3A 2BJ3A 2GHPA 4TXSA 2ZKTA 2F3JA 3KMQA 3T9ZA 1AZSB 2B4OA 4A8QA 1FE0A 1PKUA 4QYZK 3DRSB 5C25B 4M94A 3HK2A 1ZA2B 3Q8RB 2J0XA 3KK3B 3F73A 1VQSA 2H5JB 2EC0A 4F02A 1HBUA 2HURA 2XS5A 2JSXA 1UZDA 2Q43A 3DXSX 3D3CJ 1MMDA 5J2QA 3AHPA 2KXFA 3MEDA 2Z0GA 5CD4H 1R7IA 5KT3A 3TQ1A 3LAMA 3RAQA 3V6DB 4DUTA 4QU7A 2AU0A 1N6QA 3PRDA 3UCUP 2R8JA 2CJKA 2MSSA 1RAIB 2WVBA 3ZTOA 3TZXA 3MEDB 3VTIA 3NWRA 3PO4A 2YWEA 2SXLA 1UFWA 4DR2J 2ACMA 3ZZYA 4U6PA 3TNVA 4BC7A 2R9LA 3VGTA 3ZO7A 3KJNB 2V9KA 1OO0B 1H7WA 3T5LA 4CLLA 3TR5A 2KG0A 2CWXA 1XMBA 1Z1ZA 3KK2A 4IFVB 1D8ZA 3BGRA 4JV1A 1TUVA 1GAOA 2LDIA 3BKUA 3FGVA 1N34J 4DU7A 4X4UA 4DR5F 5LMUF 1TMMA 4LJMA 4RUBA 1NK0A 2MQMA 4DR1J 3W8PA 3KK2B 1U6FA 4R25A 4HYKA 3MECA 1ZH5A 2UXDJ 3BGRB 2ZBRA 1CLFA 1MWYA 1TV6A 4B9LA 2HFNA 4DV3J 5LMNF 1VQ5S 2OTJS 1JJHA 5L9XA 2YWFA 4B17A 2VQEF 1WNEA 2XEXA 3IXQA 3LWMA 4DV5F 1RKIA 4FXDA 3MECB 4J9OA 2DY1A 2HBRB 5ETMA 1NKCA 4E8UA 3JTOA 3HHLA 3Q83A 5AT1B 4IOCQ 4F4AA 4C6AA 1QSYA 2DNYA 4YR0A 4X4QA 2C2OB 1DAXA 5EX3A 4GO5X 3TUIC 2EPIA 4UT4A 2E7VA 3PR5B 4Q0BA 2B43A 3HHLB 4Y2IA 4LF9F 2MHNA 4P10A 2ZUGA 4Y34A 1X9MA 1QVGR 3JQJA 2HBYB 3GWCA 5KFCA 1HBOA 3NLCA 4Q0BB 3U7JA 2AV5A 2CJAA 3BKFA 4JBCA 4OMFG 4L72B 4D3GA 3ILIA 3F0NA 3AA8A 5F0WA 3TAQA 4ZHRA 2JFDA 3HHKA 4PG8A 1WG4A 1N4LA 4LFAF 1TQLA 2HQFA 2NSCA 2HHQA 1N5QA 2FVQA 2R7VA 4X84A 1HBOB 2MQ8A 2N4DA 2C3MA 3NGKA 3FQLA 3TAPA 3OHAA 4I2PA 2EFVA 2LVWA 2ZVIA 2BKOA 3CCWA 3OXGA 2B8PA 3KJVA 4URSA 2P5VA 2KG1A 3N79A 2EW9A 3CULA 4PWDA 3FEXB 2KVIA 4DQPA 3PJ9A 1N54B 3THVA 2QLJB 1YDLA 3GCWP 1EKSA 2BE7D 3PG9A 2JHEA 3DRRB 4FF2A 3TUZC 4I2PB 5ETLA 3M2UA 3BGOP 2PC6A 5I3QA 4PZVA 3KJVB 3K0JA 4BCAA 1YJTA 4PWDB 1P9YA 3G6XA 3EVMA 3DHXA 2OH2A 5GAEU 5C24A 3KHHA 2ASJA 2FLLA 3DDIA 3M2UB 4JV5J 2KTQA 3H4DA 2F8HA 4WK3A 2DGVA 1FEEA 2GIRA 3IR7B 3CPWR 1UKUA 4B08A 1ZZFA 5C24B 4OI6A 4OYIA 4LF6J 4ID5A 4B3RJ 2OMOA 4TY8A 2VU5A 3F41A 4RL1A 1CULB 3R7SB 2ZC4A 1U1NA 2J9DA 1BMQB 5LOQA 4DUZF 1FA0A 4ED8A 2W9BB 3HM9A 4FVMA 2ATLA 4ID5B 3C6UA 2C2ZB 2OPQB 5HVFA 1RTIB 4I56A 3I6PA 1CPZA 4ZJOA 4C2MA 2VBZA 1HBMA 1S0NA 1PILA 2O3DA 1HD0A 2OPRA 2HAFA 1N32J 1T9TA 3K8WA 3RBZA 4CLUA 3D3BJ 1N33F 5KOWA 2R7RA 2O67A 2FJBB 3WX8A 3CWJA 3OVAA 4TNOA 1YBTA 3AOCA 3I32A 1XC9A 1HBMB 2ZHOA 4DCPB 5GADI 2ZHBA 3KJQB 1FERA 2XC9A 1UVIA 2OPRB 3O6QA 3DLLQ 3FEZA 2NXUA 5A6WA 4JV0A 3CJ5A 1REGX 4QOTA 1UFKA 2JEJA 3RTVA 1QTMA 3I55S 1YQHA 4RPFA 2ZE2A 3J7Z5 1U49A 2BV3A 2K3KA 2HFVA 5JVHQ 3MGJA 4WTYA 2XO6A 4P2FA 2GAHC 4RJVA 1GX6A 1SJRA 4PAAA 4QR0A 4JI4J 2KJVA 2GHVC 2GX8A 4USMA 3BO3A 1NK7A 4DL6A 2ZE2B 1AXQA 1IJFB 1Q86T 4DR4F 1BY9A 4ZPVR 4I69A 2BMBA 2QMWA 4C11A 4OZ3A 1X5TA 4LBHA 4PXBA 2M9KA 3MOZA 3UO0A 4TY9A 1Q4RA 3D5MA 2BEFA 3KOAA 3TA0A 2A1BA 2NCKL 2VB6A 1DZ5A 1YJUA 2QN6B 2Y9HA 2BR0A 2AYMA 2UVRA 1TFWA 1CJUA 2B6AA 2RUSA 1TK5A 1K9MT 3Q86A 1UW4A 2K7KA 3T5KA 4KYZA 4OHXA 4WP8A 1UJ6A 1FD8A 4P74A 4EBCA 4U95A 2F8MA 1CJUB 2W7AA 3W1YC 1U8WA 4X66F 2OTLS 2HRTA 2BYCA 3GZ7A 4USTA 1U0HA 4NLSA 3W66A 4NRTA 2CKWA 4K2JA 3QRQA 1JMTA 1MLAA 1HQEA 3H2LA 3TVZA 1ZS6A 1GXLA 3OXLA 4DSIA 2AT1B 4LRAA 2W25A 2X3GA 1B0VA 2VC1A 5MLCV 2AZ1A 4YN3B 1Y5NB 2DGUA 1UWBA 1VLOA 4NXNJ 1CC8A 2KYZA 1AUSL 2HWTA 3TANA 2CPEA 1HQEB 1PYTA 2IA6A 3UPFA 5DDPC 3PEHA 2FHOB 2XY5A 2Z58B 3HDSA 2EKYA 3V6HA 1YX2A 2F9JA 1UWBB 3PXGa 2XS7A 4NYOA 1RWNB 3B4DA 3CJQA 3IR6B 2YH0A 5T41A 4OI1A 2H4WB 1SPBP 1AFIA 2Y3YA 1LWCB 1JB0C 3D1OA 3RRHA 4ZP9A 4YQWA 2VFUA 1NSAA 5T7LA 5KFKA 4NPOA 1QVFR 2ASLA 4Q45A 1CS4A 2KXHA 3C6TA 1NJZA 3MCMA 4OI4A 4DR6J 4QPXA 4LF5F 2DR9A 1FE4A 4X4RA 3UN3A 5DM7Q 2DO0A 3N6NA 2LEAA 1P9QC 3AJ2A 2UXBJ 4ECVA 4EZ9A 4Q2MA 4C98A 5I3UA 4KBIA 3G6VA 5E5NA 3UDVA 5T7LB 2NUUG 2F4VF 1FXRA 2VUGA 1CEZA 3ENAA 3DLEA 3C3LA 1YVFA 3C14B 2XNRA 3OTEA 2JFKA 1JLQA 5FDLA 4OYAA 4QWDA 3C6TB 1I51B 4MT1A 1E6VA 4FBUA 1OS5A 4HKQA 3GU0A 3D54A 2K2PA 2A3JA 3WIUA 2YNGB 5I3UB 2HIYA 3EVOA 3M32B 3DLBA 4J9UE 2OUGA 2IJRA 4E98A 3HZGA 3FBFA 3Q2TC 2G4BA 1JLQB 5FDLB 2KRBA 1E6VB 3TI0A 1G7CB 4DU8A 5F8HA 2O66A 4JI6F 4DF4A 2HZAA 1IUJA 2GFFA 1YJ7A 1RKJA 4ZA1A 2CDQA 1X4CA 1TZ0A 1QE1A 3W64A 1EX8A 5HMZA 3M8PA 1TVRA 4JV2A 2IM0A 4ZVPB 2OEJA 2RKIA 3GIJA 1X0FA 1LXNA 2ZDPA 5KFGA 3SCLE 1SC1B 1TL1A 1RCXB 4NOHA 1NK9A 2FQQB 1QE1B 3SQOP 3MUTP 1B3TA 4ZS6A 3M8PB 3IBWA 1VLYA 3NGDA 3RR7A 2RKIB 3DDKA 1TKXA 4FP9A 3QRRA 3QIPA 2ZZTA 1VQKS 2JJ4D 1UVNA 4XTTA 1F2HA 4ZOSA 2W2OP 2DHSA 3B8HA 1TR0A 4DUYJ 3N0VA 4CO0A 5K8NA 2V8DA 4FS1A 2CA9A 3PEJA 4X4SA 3GLJA 5LJ3Y 1R8PA 2F7VA 4ENOA 2LEPA 4B3MF 5MAOA 2HK2A 1K73T 3RB4A 2KN4A 4F3QA 3QIPB 1WKKA 3EZUA 3GE9A 1HYSA 4QIVA 4RR5A 2L9WA 5HQMA 1WF0A 4Q2LA 2BJEA 3QBCA 1SQGA 5J2PA 2CFXA 4DI6A 4YY3J 5HMYA 3X3UA 1FJGJ 2MSTA 5EWEA 3TYTA 4P71A 4AE5A 3Q8QB 3PACA 2FLPA 3C19A 1GXTA 2JNJA 1N5YA 3P96A 2DNKA 3AB2B 2FD2A 5J2PB 2FYXA 1T02A 2ZZNA 2R7OA 2LLZA 3DYAA 4IR1A 2CQBA 4WKYA 2J8AA 2Z8QA 5HO4A 3IN5A 2WSFC 2AZ3A 5F8IA 1VR6A 2ERRA 1R43A 1JLCA 3GPAA 4O4GA 1N5YB 3HSGA 1DRZA 1VBXA 2AW0A 1SL0A 3K58A 3R5GA 2RH3A 4UF4A 5ETNA 1FFGB 2R8GA 3PY8A 4UZBA 2QA1A 4U96A 3M8QA 4ECUA 2VKRA 1B70B 2CAJA 1JLCB 3ENWA 2YPYA 4O4GB 2NXEA 2PEBA 2FVRA 4MK8A 2EG2A 3C66A 2GGPB 4ZCLA 2VBWA 4IO9Q 1VQ4S 5IC6B 2YWGA 2FPHX 3L7UA 1YJVA 2WSEC 1RGVA 4OI2A 5ETVA 2HHVA 1L3VA 5IS2A 1K8AT 5CA5A 1TELA 3ETOA 2OEMA 3HVWA 2FLOA 2AMCB 5KT6A 2APOA 5H9EJ 2J9EA 4LRBA 4R8UA 3O8WA 4USKA 4MKYA 4OYPA 5KFFA 3MXHP 3H98A 1KR4A 2NYIA 2FLNA 2HRYA 5KOXA 3DMJA 2D9PA 4WK1A 3KWMA 2E5JA 1OYEA 1ZETA 1TKDA 4R8UB 1S0VA 1LWFA 2MJNA 3CCES 4KH1B 3AJDA 1FESA 4OJ1A 1D0EA 3DMJB 1T9YA 3M30A 3WIVA 4KV8A 2DPJA 5DGAA 1SC6A 3RG6A 2NS1B 3JSBA 1RT3A 1IBKJ 1LWFB 3JS9A 3QATA 3NMRA 1GMUA 1IQTA 2EFNA 4IYQA 4N7TA 4DSLA 4YS2A 1X5PA 4KV8B 1YJ9S 4RUCA 1RT3B 3T1HJ 3J81U 1WOSA 5D4OA 3WQPA 1K1QA 2J6SA 5A6PA 2GJFA 1IBLF 4JI1F 2CQDA 2IMWP 3VVTA 3TEGA 2RAQA 3HULA 4CLPA 2ZWPA 2XO7A 4KSEB 5B08A 5KFPA 4LR7A 2VQFJ 5GAEI 3C15A 3TX0A 3CO0P 2LCWA 1A9NB 5DZ7A 3FFIA 1EZZB 1XNQJ 2F63A 2B9YA 4DV0J 5IQ6A 1REVA 4KHPJ 3RBEA 2UUBF 1S57A 3BR9A 4JI2F 4CO2A 3C15B 2IFXA 2YNIA 2PFDA 4W90B 3FFIB 3GG1A 4GRSA 3K5MA 3DU6A 1Z2ZA 4NLVA 1EB0A 1SQEA 4OX8A 4W98A 2W8KA 3MPUB 5IFMA 1X9SA 3IGNA 1SKSA 2YNIB 4JI0F 3GJSB 1U09A 5IQQA 4O0IA 3OL9A 3H2VE 5CD4A 3H20A 4RNNA 1G3OA 4KJIA 2M2BA 2ZJPQ 2DIVA 2HLUA 2AYGA 1PBUA 2OEKA 4K59A 4PWUA 1TK0A 3QWUA 1MN7A 4RW4B 4AL5A 1NMEB 2AJ1A 2NLWA 4DPYA 2M70A 3HP6A 4B9VA 1JJ2R 1KS2A 3CJ4A 1YTYA 4WZMA 2K1RA 4LR9A 1ZM4A 3VCDA 2V2QA 3H5SA 1YG0A 2CZ9A 2VHGA 4C8LA 1KTVA 5ETTA 2MKSA 1KEKA 1N0VC 3W5YA 4XPCA 2N82B 1UJ4A 2VA3A 1HPZA 5AE2A 3HI9A 4WFAQ 5KFXA 4UUXA 4XDCA 3TWZA 4YDDB 2NXJA 5IT4A 4JI5F 2K1RB 2IJFA 3DLJA 4TU8A 3I31A 5CH7B 3MAQA 2VF3A 3MEKA 1SL2A 1MWQA 2DXDA 4YUDA 2Y0BB 1S4EA 1HPZB 3OTBA 2CPXA 4DV6J 5L1LA 2Z30B 2FJDB 2G0IA 5J2MA 4E0DA 4LQ3A 4DSEA 4PABA 3EPGA 2ZH9A 2XTJP 1HI0P 1GT8A 4CWBA 4N47A 2EEYA 1VOMA 4OQJA 2ZH5A 3FCVA 2MZTA 1DHMA 4JYAJ 2RRNA 2ACYA 2BUNA 2RQKA 4DPOA 3EGVA 2JDJA 3CEDA 3AODA 4IDKA 3J80Y 1HNXJ 3WHIA 4G65A 3UE2A 6FD1A 1HNZJ 3D68A 1N5SA 2ZOFA 1KLNA 3N6MA 3D66A 3R5CA 3TZYA 1WF1A 1SQFA 2KFYA 4ZVHA 3TRGA 1FNXH 4KHRA 2VKZG 1WC1A 1HMVA 4O3QA 3NNAA 1NB2A 5L8RC 2VODA 2FJXA 2RSQA 1IQZA 2GAGC 4IDKB 1CVJA 1ZM3A 2MZQA 2ABYA 1M1HA 1C2PA 2FUG9 3FCHA 5HQ8A 2HFOA 2PGCA 2VA2A 1HMVB 2XZWA 1NDCA 4JI7J 4OI0A 1S59A 2JLFA 4OYWA 4DX8H 2QLWA 5KFQA 2DNPA 2DD8S 4DOZA 5C2GA 2ZFHA 3G2XA 2ATCB 1A7GE 4LFBF 4F0KA 2D74B 2MKYA 4HTJA 1WSVA 3CNQP 1K1SA 1VRQC 2UXCF 4WJBA 2G0JA 1G6BA 3OSNA 3H59A 2GJIA 1H2VZ 1U2RA 1WDDA 3GIRA 4NXMF 3PDNA 1IXKA 4PXCA 1VISA 3EVWA 3S01A 5JUMA 4KGKA 3DFEA 2D41A 2V2KA 3FSXA 2W2QP 1M1GA 3FVYA 2XMTA 2RU9A 3BPSP 3CB4A 1Q81T 2A6MA 1T7PA 1WHYA 3AFGA 2UVUA 4R0JA 4ES1A 3C46A 1TP7A 4DSKA 2IM3A 4JI3F 3S1TA 5F8GA 2QA4G 1C1BA 4ANDA 1XMQF 2QJ3A 4DX7A 2BRLA 3FNNA 3RGIA 3VGUA 2HBQB 2W9CA 3M2RA 2ZDOA 3EZ5A 2GNKA 1I6JA 1T0TV 5ETRA 3BDEA 4C4WA 1UMJA 4A4JA 1FFWB 3PYDA 1C1BB 3BS9A 2XGPA 1W2BR 1F5AA 1PC5A 2X3DA 5SZTA 3M2RB 3W2WA 4ZLNA 1MN9A 2I0XA 5FLXU 1NJWA 3MAHA 1RWUA 1JLBA 4K0KJ 2CQHA 3HMJG 4WXOA 2ZJRQ 1RHQB 3HLUA 3BV8A 1H72C 2H65B 3W2WB 4R5PA 1R0AA 3HHNB 3GV7B 2ILYA 1FDAA 1JLBB 1WEXA 4F04B 3ILOA 4JI8F 2FDNA 2RU3A 7FDRA 4V19J 1Y3JA 3ZZZA 3CVKA 2V68A 1Q8BA 4PPZA 4YFUA 2QL5B 4R5PB 3OLBA 3Q8UA 2HWIA 2EFOA 2NYHA 3KLGA 2X1BA 2GIFA 1JKHA 1SB6A 5HMXA 5D77A 5DS7A 3SXLA 4RUAA 3MFIA 2WHOA 1RBAA 3W2VA 2CUYA 3G4SS 2OGUA 2NXCA 3IWXA 1YJRA 4LUBA 2YBVA 3A8JA 4X4PA 1DURA 1JKHB 3ONQA 5KFZA 2G9OA 3NGSA 1L3SA 1WC0A 5DRKA 1QAXA 4NX9A 1OSCA 1YSJA 1ICEB 3G9CA 2OLWA 3CD5A 3W2VB 3RB3A 1SIWB 3CJTA 5HROA 3AXMA 1U1OA 3GJRB 2MYFA 2M3DA 1EAYC 4K2XA 1EKRA 3HHEA 2CRLA 2BJ8A 2BJ1A 3T5HA 3PZPA 3W60A 1H7XA 4BDPA 3L09A 1HLWA 3CD7A 2DH8A 1R6YA 3CC7S 4YHHF 2HRUA 1VHFA 4K4XA 4ZPWR 5HROB 4FS2A 3QJJA 1TK8A 4XIUA 1VK3A 4B3OA 3CIMA 4ZVUB 1Q82T 2W8LA 1IR2A 4QWEA 4ZPAA 4JP8A 2XMKA 3BDPA 5KFLA 3DOMB 4HH1A 3ZNJ1 3GSDA 3VZIA 3RBDA 1J27A 4PXDA 3QGPA 1TFYA 2NUHA 1FNOA 4ECWA 4IRKA 4Y3CA 4OX9J 3GSIA 4RW6B 3D6HB 3ITHB 4MIWA 1F5BA 4RW9A 3ZZ0A 1Y5IB 2BJDA 4Y6IA 4J9LA 3HF5A 2EI5A 4WXWA 3I4HX 4AYBD 4Q8EA 1R8AA 3FUYA 5LJ5Y 1RWKB 2ZH3A 1AFJA 5HK4A 4HLBA 3J7A1 2RUGA 1XR5A 3QZ7A 4X2BA 1YKWA 4RW9B 1RSCA 1S97A 3R5BA 4CLZA 3CCSS 1URRA 2XMJA 3MR7A 1YJNS 3NP5A 3K2YA 1X4EA 3CD6S 2M0GB 3PFOA 4A8OA 3PX0A 1RYRA 1RTDB 3DLKB 4CIOA 4O4RA 2E5LJ 3V4IA 4LF7F 3GIKA 5AJ3F 3NXZA 3Q8VA 1FJEB 1JX4A 3BO2A 1MROB 5L1KA 4ZVRB 2B0GA 1C4CA 4KPYA 1PCAA 3FDSA 2CQIA 2Q6CA 5DDRC 2WONA 4LF2A 2CJQA 1QY7A 1W2IA 1MMLA 2E1CA 2BDPA 2OPSB 1RWMB 2VG7A 1GQEA 5E3AA 1DQ8A 3ZTRA 1Q1KA 1S9EA 3UW1A 1SIZA 4DZDA 1HFEL 2BRKA 3R7NB 2CQ4A 5DQGA 2C2KB 3FRZA 2A2CA 3E2EA 2HQCA 2WONB 1V9OA 4X4NA 2DNLA 5ITHA 2MXYA 2VG7B 3JAMU 5CQGA 2DCLA 3GR0A 3UWTA 2AYEA 2CNOB 1HI8A 3JB9k 1N56A 3NCPA 1B0PA 1DARA 2ZUAA 3SSSA 2UP1A 1NSPA 3BSNA 2CQPA 1IKYB 1FX2A 3GR1A 4RO0A 4DV4F 1M5VC 4DL4A 4HR2A 2W2MP 3VF0B 4M63A 3JYTA 4B3SF 2KRRA 4RW8A 1NLKL 1IR1A 2X1AA 4B9TA 1WD6A 4K7QA 3C16A 2ZOGA 1HHTP 1R8BA 4L3NA 1TL4A 5K8PA 4GO7X 3T1YJ 2CXEA 4MH8A 3SDEB 2E9TA 3PX6A 4ED6A 3JYTB 4RW8B 1XMOF 3PHTA 3C16B 4RX6A 3QGIA 5K8MA 2GW8A 1S1VA 3CJ0A 3SBMA 4I6AA 1IBMJ 2YNHB 5E3RA 1GTEA 3FRYA 2JWNA 3UD3P 3EGWB 4M5DA 5BYQA 2V63A 1N48A 1WC4A 1VQ7S 4ZIWA 2WVCA 3I0RB 3P3DA 1S1VB 2LKZA 1D9DA 3KLVA 1DJ0A 4CNYA 3CCJS 1HNIA 2WCXA 4A8YA 2X1GA 3NBPA 3KHGA 5KG0A 5C5JA 4M5DB 4ELTA 4PYAA 1SL1A 2RIJA 4LIRA 2M88A 1YBAA 3ADAC 3GQCA 4OZ5A 2ZBPA 3TO8A 4QZVB 3IWNC 3DKDA 3OL7A 1T3OA 2HS3A 1HNIB 1G4CA 4P9SA 3BO4A 2OSQA 3NBPB 2CJBA 4CYUB 2RNEA 3CCTA 4I0WA 3IM8A 3LAKA 2E1PA 2CNKB 3BN7A 2XWXA 2CPIA 5DQHA 1A0OB 3DNCA 4I1TA 5K9FA 3PYEA 2MLZA 4CT9A 3CJRA 5F9LA 3OR2A 2CG8A 5J1EA 3D2WA 4L73A 2C2RA 3HFZB 3X1LB 3G82A 3ZTSA 2FC8A 4W4MA 2WW4A 1B7YB 3SCIE 2HHHJ 3DU5A 2XI3A 2Z56B 1IKVA 3S7RA 3UR0A 3NEKA 5B0BA 5KFTA 3TJ8A 5LT5A 1RU2A 3OR2B 5J1EB 5IV3A 4PCQA 4CH0S 3G82B 4X65J 1N0UA 2WBRA 3QAEA 3D28A 1GTHA 3VAIA 2HS0A 1NKEA 7AT1B 4DL7A 1RA6A 3T19A 3HSJA 1IKVB 3E8OA 2C22A 3DOKA 4ER8A 3P5BP 2WTFA 3ZZRA 4MK9A 1NJYA 4ZDNA 3TAMA 3MCSA 4K8RA 1W7WA 1S77D 2ZNYA 1M5HA 4FDFA 2FY1A 1SKRA 4PPDA 5D4PA 4CP5A 3V6KA 3FKBA 1ITPA 4OYMA 4ZVGA 2DNOA 4GVBA 2W24A 3TAMB 2IA0A 4QQBA 4ES3A 2BVZA 3QT8A 3JSRA 3EPIA 2XULA 1S76D 2ZITA 2OP5A 3EMTA 1R8HA 5F0UA 4FZVA 1LV5A 3VZHA 3DHWC 1U1QA 1ZPVA 5IT9Y 4GVBB 3CXCR 5GAGU 2E5GA 3QSIA 5K14A 1RAFB 5KFYA 2N3LA 2QLBB 2M5YA 1EJ7L 3DCAA 3MPDA 2DRBA 1U25A 1WG1A 1X4AA 2OD6A 5LM7E 1WC3A 2HVEA 2B9XA 1OPZA 3NAIA 4DDFA 2KH9A 4K4YA 4KHMA 1RWXB 1SV5A 4F4XA 4ZPBA 4EI2A 4CLTA 3DLGB 1N88A 5K14B 1SVDA 2DKOB 4F4YA 4KY3A 4EYIB 3CDEA 2FY8A 4DV7F 1VQMS 4G1QA 4M5NA 3I9ZA 2MKJA 3UDEA 1Y0HA 1O51A 1CG2A 1YGYA 3PV8A 4GKKF 2DTJA 2HZCA 1SV5B 5I42A 2B4VA 2V8GA 1PC4A 1S0OA 1KTQA 2DR6A 1ZYQA 1L3KA 3A1YG 4M5JA 4DR3J 4G1QB 2QMXA 3MM9A 3WX4A 1V5VA 2ZBCA 1KDNA 4DSJA 4WZQA 1RT5B 3BM7A 5I42B 4F0HA 1NPKA 3MCOA 3MUMP 3MOJB 3ISZA 4M8LA 4OLPA 1CJTA 2HZVA 4ILLA 1T11A 3DRYA 4X64F 3L95X 2VV5A 4CO5A 1U45A 2XG8A 3BSAA 3TVKA 3MM9B 2G2OA 1I1GA 2VG6A 3T9NA 5DDQC 3H90A 4DL2A 3G6ES 3LP2A 2O1PA 3L9ZA 4XO0A 1RTHA 4PQAA 2HFZA 4BHQA 2UUAF 2FHMA 4LMZA 1PAUB 2UV8A 4J9QA 2XY6A 1SJQA 1NH7A 3JQKA 5KFUA 3EGZA 1FNMA 2MQOA 3VV2B 2FVCA 2XZTB 2L08A 1MMNA 3SFGA 2NREA 4NLRA 1FEHA 2IMOA 2VG6B 3RU0A 4CM0A 1LWXA 1RTHB 2ZH8A 3JXOA 2C3UA 4ZP8A 4Z7YA 3B82A 5GMEA 3M8SA 1RBLA 4CLFA 1VCTA 2B4PA 2OFHX 2QYGA 3N01A 1QDUB 1W25A 2ZC3A 2MY7A 1F6TA 4LFCF 1WC5A 1OSDA 3H8YA 4P7TA 4DBQA 2HK3A 1UVLA 4AFFA 2AX1A 1BXNA 4GMKA 3AQPA 2FVPA 3SV3A 1NZAA 2VONA 2HGLA 2OKQA 4E2FB 2FHJD 2VFTA 5I4MA 3DC2A 1R31A 3GG0A 4ED1A 1H38A 3KNGA 5A76A 5ETSA 1JWWA 1CSJA 4DN9A 1SC3B 2J6TA 1X5SA 3N28A 4BC9A 1X5OA 1VMBA 4PWWA 1S1WA 4K4UA 3ZZPA 2Z2YB 3HVTB 3GILA 1KHWA 1JLEA 3KK3A 1NU4A 3GV8B 2MKCA 2J9DE 2Z4PA 1GH8A 2C3YA 1QAIA 1M5KC 2XMMA 2C2EA 1JLAA 1ELOA 2UU9F 1S1WB 1I94F 4KH0B 1ROFA 3R7BB 1G1XA 4DR5J 2CVEA 3C8YA 2ZBQA 4N8OA 3RAMA 5LMUJ 3RRGA 3UCGA 1JLEB 3CCUS 2HYIB 5GAHI 3V6DA 1NK4A 4KRWA 4C0OC 3EICA 3JSMB 2AJQA 5F8LA 4Z7CA 1JLAB 3Q24A 2V8PA 2PFFB 2X7IA 2JVOA 5LMNJ 2DNHA 4ZLPA 3SZ2A 3K17A 1KFDA 2VQEJ 3MMCB 4DLGA 4J9RA 1S7HA 4DV5J 2DNQA 1IVZA 2HVDA 2O01C 1UA0A 2C2NA 3D6MB 1XNRF 4EUVA 1YITS 3I0SA 2J7KA 3SSQA 2WK4A 2W2NP 2YKAA 1LOUA 1QTNB 3KLFB 3V81B 1QD1A 1FHTA 2WW8A 3MI7X 1H98A 2IHR1 4IFVA 3VAHA 2C3OA 1LNQA 4LF9J 4QW8A 3BKTA 4WKRA 3KNAA 2DJWA 3L4BC 3I0SB 4WP3A 2J9CA 1RAOA 2HG4A 4CZCA 2GJ2A 4G1IA 1VS3A 1RHUB 2U2FA 2KI2A 5LSRA 5RUBA 2HHXA 3FZ2A 1BQNA 3LGNA 2DNGA 4N76A 1H73A 5H9EK 3FCWA 2ZJQQ 3CCVS 4LFAJ 3PTWA 5KG2A 1ZTWA 2ADCA 3DN9A 1ULRA 3W5ZA 4KQZA 4ZVOB 4LF1A 5F9NA 3A3PB 1ZOTA 4U67Q 1KNZA 3IWLA 1RLDA 2VJVA 5A8WA 3ZTPA 1BQNB 5CZVA 4DPWA 4F4KA 1U0SA 1ZM2A 4M5KA 2V4RA 4EBDA 5CYQA 4TVAB 5EHHA 5DGBA 2PMZD 4QU6A 5A8WB 1VQPS 3CDBA 3W3SA 3QGGA 1L3UA 2R4FA 1OWXA 2QIFA 4ZITA 4ZK7M 4OYZA 4O3NA 1OMSA 3OFGA 4TLQA 4KIAA 1KOOA 5CYQB 3EX7B 5CHCB 3T3FA 1RAEB 2DVIA 3BREA 2X1FA 3HO1A 2HSEB 1Q53A 2NR0A 2R7UA 1RA7A 4ETZA 2HNYA 5KG5A 1X8DA 4URGA 1J5EF 3AD8C 4ITSA 2GVDA 3HSZA 2YKNA 2HQDA 4FYVB 2XHCA 3CSKA 4J91A 2DT9A 3PVXA 5BXIA 4A46A 2HNYB 3CT9A 3LA0A 1TL5A 2GVDB 2YKNB 4KT0C 3RUBL 3M1VA 5D0GA 2ZOMA 4I68A 4DUZJ 3HVAA 1N36F 2HHPA 3VWSA 5EDWA 1SC4B 3I87A 3R5DA 5SUHA 1VC5A 3CJKB 1FDBA 4RU9A 3P4UB 4HHHA 2MQNA 4MFBA 1LW2A 3DRRA 4R0EA 3M1VB 2FIUA 1H6KX 4M5HA 1BQXA 1RXOB 2MTLA 1VRTB 4HEA9 5KG6A 1N33J 2OELA 3U1NA 1KD1T 4U7UD 1ZAVA 3D9BA 4A8WA 3M9MB 4MFBB 1LW2B 1WJ9A 1FDDA 3KDNA 2G2ZA 2PSZA 1NEEA 2Z57B 1IKWB 1HNWF 3ULHA 4X62F 3DGVA 1DY3A 5D4NA 2M4MA 1Z2LA 4RWXA 1RYSA 2MZJA 1WSRA 1LKZA 2WAQD 2FZCB 4OYXA 1VK8A 2OFGX 4O0NA 3KG4A 2W2PP 1EQMA 4DHVA 4PXEA 3FBCA 1CULA 4P6QA 3IC1A 4QR2A 2J76E 1FRIA 2V2VA 2YWHA 4BBYA 2O5DA 2IVFB 4ZVEA 2GA7A 5B0EA 2W9BA 2R3VA 3KHLA 1VBKA 2MKKA 4DL0C 1RT7A 4AL7A 5D0EA 2OPQA 1IBCB 4ZLLA 4DR4J 1RTIA 3QPIA 4WWSA 3R1LA 4CLKA 3WDOA 2IRXA 6AT1B 3IO1A 5E2QA 1ZAXA 2GO8A 3TARA 2IM2A 4RNMA 1D9FA 3GB0A 1RT7B 4AXIA 4FN5A 2HVZA 2BABA 2XMWA 1SBRA 2BBEA 1L5UA 1WUUA 2FGOA 1JNRB 3LANA 4OZ1A 2FZKB 3H25A 4OJHA 3NOGA 5KG7A 1U7LA 5BYSA 3BQ0A 1HHSA 3FK4A 3KYLA 1NPRA 1HWKA 4YB6A 4EBEA 4O23A 2E5HA 2LQ9A 3T41A 2AHOB 2BM1A 5DETA 2A10A 3Q8PB 3F44A 4YB1P 4O3RA 3QZ8A 5IWAF 2M8HA 4RWWA 2V4JA 2JH3A 2XYPB 2KT3A 1F3FA 2LQ5A 3CJ2A 4YEAA 5LL6d 4X66J 4USHA 2YKPA 3RBXA 4ED4A 2P9CA 1O8BA 4KO0B 1I3OB 1NBEB 4YR2A 1TL3A 3PFEA 1UEVA 2IVMA 2N7CA 1D8YA 4IG0A 4OJ3A 2V4JB 1S6QA 4OHVA 2XHWA 5DZ6A 3OLAA 4HVZA 4ELVA 1HWUA 3MR6A 2VIHA 1TL3B 2LP4A 3IBCB 4DV1F 1RWVB 2VFRA 2ALZA 4FXVA 1RB0A 2DNZA 4IG0B 1UL3A 4DL5A 1FRLA 4A48A 2R2UA 2I6WA 2LXUA 3HKZD 3FMWA 4YB5A 1S6QB 5KFHA 1ZTTA 5E3CA 1U1RA 1K44A 4NZ7A 3J7AN 4WFBQ 3IFEA 4C8MA 1H3DA 2E66A 2VL1A 4OHZA 2GQQA 3LP1A 3D6FB 1AUDA 4ILRA 2R42A 3J7YI 2CZVC 5B0AA 5BR8F 2BQRA 1XBWA 2KKHA 3W5XA 2BKPA 4IR9A 1FF2A 2E7WA 5GAGI 4ZVTB 1Q5YA 3IP0A 4NASA 3VAMA 1Y3KA 3LP1B 4UTGA 1PBAA 1YWXA 2Q66A 3ZZTA 2DHAA 4LF5J 3AXKA 2GMHA 3EXCX 2VC0A 4TQSA 4Y2KA 1HW9A 4ED3A 3K57A 3HPOA 3OUYA 4OZLA 3Q89A 2LYVA 2F4VJ 4OIXA 4ECXA 3ILLA 4HHJA 3R97A 2WBMA 4B3TF 2KU7A 2ZM6F 3VHQA 4MAKA 3MEGA 2XMUA 3LO3A 2DO4A 3GFZA 3GYXB 1LWEA 1VYAA 5HBMA 1FRJA 5M2PA 1BQMA 4AD6A 5F41A 3OUYB 4CNZA 4MIBA 1Y4ZB 4NWBA 4WYWA 2MDAA 3N4WA 3A8EA 2NXNA 4USIA 3LH2S 1BD6A 2E1RA 2EBGA 4CLSA 1RABB 4C97A 1KLMA 4JI6J 4Q5VA 3MEGB 4ZCKA 4A8FA 3M2VA 4A8KA 4LRCA 4WPAA 1VJQA 2VZ9A 4L3KA 1LWEB 5HBMB 2I38A 1TTHB 1BQMB 4J9PA 2VH7A 4O3PA 2B3TB 2A0FB 3M05A 3H0PA 3RZAA 2VOOA 3UQSA 1LWCA 1VQ8S 2FHJA 1HR0F 2QA4S 1KLMB 1Q0NA 1WKLA 4OFZA 4ZP6A 2ZVSA 3M2VB 2G2YA 2XY7A 1T94A 1Y11A 1WACA 5THWA 4DS4A 2YY3A 3H2UB 2YH1A 2JEGA 2ROEA 4WTOB 3LQVA 4ED5A 2ILZA 3BGUA 3SSRA 1UP1A 3AJ1A 3DM2A 4I4BA 3DOLA 1V3SA 3C14A 1PO6A 3E3XA 1MW7A 1S6OA 2W01A 2M7SA 4OYOA 2RQ4A 2KVQE 2XZDB 3M6UA 3F56A 2M52A 2R7QA 3IG1A 1AW0A 2UZAA 3K8VA 2YNGA 4B3MJ 3M32A 4ECRA 1RT6A 2QX0A 3DM2B 3DOLB 3TZZA 2POKA 3BF4A 3R1HA 2VFSA 4KB7A 4KE5A 3IR5B 2D3O1 5HN0A 5CCMA 4OHWA 1GK8A 2WRMA 4TN2A 3IG1B 4UUWA 5KFBA 4NE9C 1X31C 3KK1B 3IRWP 5AXNA 1WI6A 2E44A 1RT6B 2XLKA 3N5BA 2IJNA 2B9EA 5AXMA 3QYYA 4DR7F 4K4SA 2L3MA 2BQ3A 2JX2A 2E29A 4A8MP 2V2ZA 4PG4A 4AQYF 2GHWA 2KFNA 5G4DA 3HXMA 4IH6A 1T9XA 2MMYA 8ATCB 2J7UA 3SCKE 4ED0A 3D7SB 3N6LA 4FPIA 3MDFA 2QTWA 5KFSA 4DG1A 5K8OA 2KM8B 2I5JB 3MM5A 4EO8A 4C9DA 4USUA 3ENVA 5KFJA 2G1DA 4U7CA 5HL7Q 4L76A 4LF8F 3I56S 1S1UA 3KKFA 4BLGA 4YP3A 3MR2A 5HI7A 2QV6A 2ROGA 4NYPA 4HHUA 1T9UA 3S8SA 5BJRA 3P49B 5U47A 1S4FA 2GIQA 4DG1B 3MM5B 4ZKAA 1UPPA 4MK7A 3W62A 1HHQA 3M8WA 2MHEA 1M5SA 1FK9A 1S1UB 1FX4A 2FGCA 4ED2A 3KLIB 2OHDA 1NO8A 5LSOA 1BWEA 3TVYA 4DL3A 2AD9A 1TAQA 3G8QA 3OR1A 2JL9A 5KAKA 2RHQB 3OTOF 2JOQA 4H4KC 1FK9B 4PR6A 1ACMB 2AGOA 1HA1A 1VQNS 4F4ZA 2WB1D 1RUSA 4X4VA 2AJ4A 3MURP 3J80U 1J5OA 1WOOA 4H4OB 3OR1B 3JTNA 3MM7A 4FBTA 1U2CA 2HW3A 2EK1A 3CMES 5A8RA 3THPA 3W8GA 1S1TB 1HNVB 1JJCB 1J5OB 2N4CA 3MZIA 2QZ8A 3WZ0A 4MKAA 4X4OA 4NL5A 1KP6A 2E1MC 3MM7B 3I4PA 3CD0A 3FQKA 3VVUA 4WE1A 4BS2A 2W7OA 2OSRA 4B9NA 5A8RB 3CGIA 1U6ZA 2VPWB 1FCAA 2KHDA 1KQKA 2H5EA 2CYYA 3FMBA 2YQ3A 2GV1A 4F4WA 3IGVA 4EWTA 2UUCF 5HQLA 1KVKA 4CT8A 1O0PA 3VALA 2GGPA 5JXSA 4OHYA 5IM0A 4KPCA 4WE1B 4HACB 3VAJA 4DV2F 4QIFA 2RRBA 4Q44A 2QFJA 2LXFA 3OFEA 1S79A 5KT5A 2HAIA 1FI4A 1K0VA 3O44A 2HHWA 2XI2A 3GTYX 1RHKB 3CCRS 4DQRA 5IM0B 1FWKA 2L41A 1WC6A 2V8VA 3HJFA 3JQMA 2DR7A 1JXLA 2VDIA 1IBLJ 4UY8T 1K47A 3ZZUA 4CDIA 4JI1J 5D78A 3K59A 2BE9B 5JVGQ 2JEFA 3A4TA 1M5OC 2UV8G 5H9FJ 1M90T 3QWPA 3FBBA 3RB6A 3NGRA 1X7VA 3HSDA 1SH0A 3OTDA 1HBUB 2PE8A 3JSYA 4MYUA 3HX9A 2V50A 1A6LA 2RJZA 2JZ5A 3EWGA 1C1CA 4ED7A 1LW0A 5J2QB 1VQ6S 4ANEA 5E41A 4GKJF 2UUBJ 3BPDA 2PO4A 4JI2J 4QWCA 3DLHA 4RZRA 3T1AA 4KGZB 2KB2A 5CCLA 4HI2A 1SKUB 5AXLA 4F36A 1RLCL 1N6QB 1HI1A 3Q8SB 1C1CB 2XMVA 1FWLA 3H5XA 1LW0B 3BGLA 4ZCIA 3JTPA 4NEYA 3NWGA 5LXRA 2IY5B 4Z37A 2PD1A 4LF4F 2XB2D 4F3OA 4A47A 1NK5A 3MM6A 3NG8A 4JI0J 3AOAA 2Y1RI 2LA6A 4V19X 2JLGA 2PN6A 3UDCA 1WF2A 3LP0A 1VQ9S 5F3TA 5KFRA 4FF4A 2XYHB 2MQPA 2QA2A 2R7SA 1HD1A 2MPUA 4IG3A 3MM6B 1D9AA 1UVKA 1RWWB 1X4FA 2AJFE 1FD2A 2JC0A 2W1BA 2R7TA 3DRPA 1T9WA 1M5PC 2CADA 3MM8A 2HMIA 1NKBA 3LP0B 3GP9A 2NZ4A 2HHTA 2BJ9A 2ZZMA 3ENQA 1QSSA 1KQSR 3V5RA 1HWJA 3TUPA 4IG3B 2C1EB 1NHVA 2H54B 5F8MA 1TUGB 4OX7A 4CLWA 4YMEA 3DRPB 3C2PA 2RILA 3K7RA 3R5JB 4QCLA 2VPYB 4IO1A 3MM8B 1B99A 2HMIB 4JI5J 4KGXB 2MKIA 2J6UA 1VFJA 1TV6B 3TEHB 2FJWA 5C42A 1Y00A 2KT2A 3ILJA 1Q79A 2KZZA 1HL6A 4QIWD 5H1SV 1YHQS 1YZ7A 4ZVQB 3POTA 2A18A 1NRKA 4DR2F 2ZH7A 1NSKL 2BJ7A 1LEOA 2QEXS 4NA1A 5AXKA 5C42B 1NXIA 4ZPTR 4FPRA 5C2CA 5DLGA 3VQSA 4RW4A 1QAYA 2MQLA 3POTB 4K5RA 4Y0FA 2RMLA 3M4XA 1NJXA 1GMVA 5C7PA 3UDLA 4C3LA 4ATNA 3RAXA 5D15A 2DXFA 5M2UA 3BQ1A 1T8EA 3PW7A 2QLXA 1N34F 1PGZA 3TUJC 4KKOA 3IBFB 2ALYB 1DTTA 5K20B 3MPYA 2DYAA 2NPFA 2DISA 4DR1F 4ZHRB 2UXDF 2D9OA 2B4UA 5CYMA 2DGOA 4DV3F 4KKOB 1DTTB 4DQQA 2HS4A 2MB0B 3MMAA 3R9LA 2VBXA 2B7BB 3OXFA 3VR1A 3J81j 1PJ7A 1ZBTA 1FJCA 5CYMB 2IRUA 1RCOB 2AX0A 1P8GA 2CJXB 4LFBJ 1YBUA 3VAFA 1P27B 2JC1A 2RE1A 4A8SA 1FXLA 1YLXA 2EFQA 3MMAB 2QSFA 2PA8D 2YXLA 3Q22A 2UXCJ 1R8CA 2P6SA 2ROPA 4NXMJ 4IFYA 4KTQA 3BZQA 1P6TA 3GYGA 3GJQB 1U47A 5B0FA 4K4ZA 1RISA 3L7PA 1T95A 5E7OB 2VFVA 3OPKA 4EYHB 3NS6A 1JK9B 3D0GE 2E9RX 4UOFA 4IFYB 5L1JA 4M95A 1F0XA 2YQ1A 4QIEA 3IAM9 4TY8B 1OQ6A 4KAIA 4WFNQ 4C0HA 2K06A 3U27A 2BW7A 3FBEA 1WWHA 3VQTA 2CNNB 4IKAA 2GZOA 4JI3J 4C48A 4WFXA 4DZ6A 4CH1A 3MWBA 1PJ6A 4C8YA 2WSCC 4PRFA 1XMQJ 5A2QY 4B9UA 4XK8C 1R27B 1RP5A 2QL9B 3C6UB 2IM1A 5L1IA 2IRYA 4CTAA 4FXWA 2Z2LA 5KTQA 1NJIT 1DLOA 3LWLA 2FC9A 1XK8A 3AA9A 3HVRA 3HT0A 1FT8A 4DX5A 3BYPA 3US5A 3LF0A 4CTAB 3HT3A 5EWGA 2RDJA 5L38A 1KN6A 4FYDA 3LUYA 4G1PA 2KJWA 1AB8A 2DHGA 3B78A 1DLOB 3MMJA 1IWAA 4JV5F 3PCOB 2W9AA 2E9ZA 2N7YA 5F3ZA 4GC6A 3QSYB 2IC3A 3HFKA 1VGYA 4M5GA 2P2CB 2R7WA 2VDHA 4Y2CA 1LK5A 4ECQA 4LF6F 3CTRA 1OY6A 4B3RF 4U7UK 3UN5A 2G1HA 2BACA 1FVSA 1UETA 1S5ZA 3MD3A 4JI8J 1UVJA 2RS2A 2HHUA 3NNCA 2IC3B 1Y7PA 1PSDA 4I7FA 3W65A 2EFPA 2H1YA 4N8NA 1QAJA 3TJAA 3Q8YA 3W63A 2YWKA 4CM2A 1PG5B 4NMXA 2PT0A 4C11B 2DGTA 1FWPA 3R3TA 1N32F 4I7FB 1FKOA 3VGSA 2LA4A 2XSFA 1IR0A 3DXBA 4B9MA 2QSWA 4NZ6A 1CJKA 4OV6A 3HHDA 2K3IA 3M6XA 3IRXA 4RNOA 4DSFA 3CDWA 3FEYB 1F9HA 1FKOB 5E3PA 2B6AB 1CJVA 2DHXA 1BGXT 3OFFA 4ECYA 3ZZOA 1CJKB 1KHVA 4UY85 4PG6A 3CCQS 2FJVA 4W92B 1DFDA 3BSOA 3IRXB 5DQIA 2BE2A 2GO9A 1N5TA 5DLFA 1WTBA 3W61A 2GQ2A 4YHHJ 3HD1A 4JI4F 1CJVB 1NHUA 1RWPB 1VQOS 1WG5A 4C8OA 2R8KA 2VPZB 5AE3A 2XMAA 4QYRA 5KT7A 1U0HB 1PYOB 3O1LA 2DBBA 2BE2B 2YX4A 2FTRA 1VBZA 2HQ3A 2E7XA 1S9GA 4WF9Q 3BR8A 5CABA 1NPPA 2DH9A 4FF1A 3D0IE 4ERDA 1AYEA 5ADZA 1W26A 1UJ5A 1Y5LB 2EK6A 3BEGB 4UQGA 1RTZA 4QWBA 1RAJA 5HJYA 4ZVFA 5A0YA 2J5AA 4LBPA 1S9GB 1VI7A 1C0TA 3M6WA 4CQ1A 3CMQA 4URQU 3O3LA 4H54A 1U02A 3CC2S 1XN9A 4ZN1A 2HVIA 3V4MA 1BUXA 5A0YB 3OW2R 4IH7A 4UZCA 5CXTA 5GAHU 3CDAA 3DGPA 1C0TB 2ADBA 4NRUA 4EO6A 4DPXA 5LSLA 4F7VA 2IYGA 2LXIA 4EEYA 2HEKA 3AT1B 3IA0A 2WVDA 3I82A 2AP6A 3FZBA 4LF7J 1QSLA 5AJ3J 3DGPB 1CS4B 2B8QA 4ZCMA 3KJFB 1WI8A 2AEJA 4QIGA 3NOCA 2YNFA 3Q2SC 2JVRA 4GVLA 3DOMA 3LGHA 2F40A 1RAHB 4L74A 3MUVP 3PNIA 5IT9U 2F1FA 4I2QA 1TL7A 2VBYA 2YWWA 1KRPA 3LTOA 3CCLS 3DLEB 1BLUA 4RW6A 4RW7A 4YOEA 1YK9A 1RT2A 3ITHA 2PI5A 3RJMB 4NXNF 2YNFB 3MMBA 4MMOA 1UCNA 1H2UX 1WDTA 3GMGA 3MCNA 5HSPA 2IYIA 3UCZP 4QPTA 3WBZA 1VQLS 5GMKa 4WIIA 3M8YA 2XBPA 1NHKL 3BN4A 2R2RA 4I2QB 1TL7B 2R2TA 5AE1A 1FXDA 2DEJA 4NLYA 3EXYA 3OQ2A 4LREA 3OVSA 1HWIA 1JXVA 4RW7B 3MR5A 1DTQA 1RT2B 1WHWA 3MMBB 1OY9A 4P2SA 4BWJA 5HP1A 2BM0A 4UW2A 1KKHA 4N41A 4IOBA 3OHBA 3HJVA 1Q78A 4ELUA 3TP2A 1SJ1A 4Y2AA 4DV4J 4H4KA 1RTDA 1TVRB 3DLKA 4B3SJ 4NA3A 2EXUA 1DTQB 5J1NA 4MJKA 2YKOA 2ZD1A 2OO4A 4UQTA 1TL1B 5HP1B 4ICLA 2MZ1A 1DQ9A 1MROA 2Q6BA 4RKUC 5LXYA 1WEYA 3GCXP 4DR6F 3MPVA 1KC8T 4UOCA 2CPHA 4FYYB 5DO2A 2UXBF 1SXLA 5HVHA 2IDEA 1LFWA 4DS5A 4IH5A 1TKXB 2AWZA 1XMOJ 1Q8LA 2ZD1B 2IDLA 4ICLB 2OPSA 3P6YC 3QFHA 4C8ZA 5JMNA 2CPYA 5T14A 4M1KA 4EMDA 3IMQJ 2KDOA 2K8GA 4C8NA 4FNHA 2OJ3A
chains in the Genus database with same CATH topology
1HNVA 3R27A 2KFYA 4ZVHA 3TRGA 1FNXH 1RT4A 3IO1A 5E2QA 4KHRA 4K4VA 1ZAXA 4JUZA 2OMLA 1RJJA 2VKZG 2GO8A 4QYZJ 1XWLA 1HYSB 1HMVA 4O3QA 3NNAA 4DWIA 1FRMA 3HKWA 5B09A 5L8RC 1Y9OA 3PR4A 4K4WA 2RSQA 3TARA 1IQZA 2FJXA 2VODA 4IDKB 2IM2A 1SUQB 3CE8A 4ZP7A 3HZEA 4RNMA 1ZM3A 1D9FA 2BZ2A 2RS8A 3GB0A 1RT7B 4AXIA 4FN5A 2HVZA 2BABA 2MZQA 3D1QA 2ABYA 2XMWA 3JAMY 2MZSA 1SBRA 1C2PA 2YX1A 2BBEA 3CDUA 2DITA 1L5UA 4N77A 4LSNB 2FGOA 1N8RT 1JNRB 2FUG9 3FCHA 4FF3A 3LANA 4OZ1A 1FO1A 5K5MA 5HQ8A 3H25A 4WYLA 3CMAS 1LQ9A 4OJHA 2AGPA 2HFOA 1IKYA 4ZPDA 1RT4B 1QUPA 2PGCA 2GMLA 2VA2A 5IZHA 4WU3A 1HMVB 2LDYA 4CI0B 2XZWA 5KG7A 4TU9A 4OI0A 2JLFA 4DX8H 1U7LA 5BYSA 2DGWA 2QLWA 3BQ0A 3TW0A 1SJ3P 1WEZA 1HHSA 1C4AA 1SH2A 2DNPA 5KFQA 3KYLA 3BSCA 3CO9A 6FDRA 1HWKA 4YB6A 1R3NA 2DD8S 2DNRA 4EBEA 4O23A 4DOZA 2E5HA 2LQ9A 3CUNA 2ZFHA 1JLGA 1D3WA 5KFOA 4KFBA 3M9OB 4DR3F 2BM1A 4LVOP 5DETA 2A10A 2CG4A 1A7GE 5D4LA 2J7WA 4F26A 2B7CB 3Q8PB 3F44A 4LFBF 2KHCA 4YB1P 3DYAB 2DR8A 2D74B 1JJ4A 2FVSA 4O3RA 4HTJA 3SDEA 4Y65A 3PJWA 3SEOA 3QZ8A 4JOUA 3FSYA 4HT7A 4XDDA 5F8NA 2W4PA 5IWAF 2M8HA 4RWWA 3MR3A 2V4JA 2JH3A 2KT3A 2LQ5A 3CJ2A 1U6BA 1K1SA 4YEAA 5LL6d 3MFHA 3I9V9 4ZMMA 4NMLA 2RT3A 2UXCF 4USHA 4WJBA 2R8IA 1G6BA 2YKPA 3DRSA 4KC5A 3OSNA 2P9CA 3H59A 5C25A 1O8BA 2GJIA 4KO0B 1JLGB 4KFBB 1X4DA 4YR2A 1H2VZ 1TL3A 2MJUA 3PFEA 3KHRA 1UEUA 1UEVA 1U2RA 4NXMF 2IVMA 4DUYF 5B7WA 3VAKA 2N7CA 2PA3A 2YNHA 3PDNA 2PMHA 1D8YA 3PJXA 1IXKA 4IG0A 4PXCA 2GHPA 4TXSA 2ZKTA 2F3JA 4RU2A 3KMQA 3T9ZA 3SMZA 1KQGB 2B4OA 4OJ3A 4C7QA 2V4JB 2XSJA 3S01A 4MYTA 1KVJA 1S6QA 5JUMA 3M8QB 4A8QA 1FE0A 4OHVA 2XHWA 4KGKA 3DFEA 2D41A 3OLAA 1KONA 2V2KA 2YX7A 3LPYA 3DRSB 4HVZA 4ELVA 1HWUA 3FSXA 3MR6A 3I0RA 5C25B 3LALA 4M94A 3HK2A 2DNMA 1TL3B 3Q8RB 2DR5A 2J0XA 3KK3B 3F73A 2GCFA 4DV1F 1VQSA 2AGQA 1P1LA 2VFRA 3FVYA 2XMTA 3GFHA 4FXVA 4ECTA 2ALZA 2EC0A 4F02A 1HBUA 2DNZA 2NPIA 2RU9A 2XS5A 4IG0B 2KYXA 3CB4A 1UL3A 3FJ2A 1U1PA 1Q81T 4DL5A 2D3OR 1FRLA 1VQYA 2JSXA 4USJC 4A48A 2Q43A 1T7PA 2B9WA 2R2UA 2LXUA 4RNHA 5L39A 3HKZD 2XSJB 3FMWA 1FKAF 4YB5A 3DXSX 4K50A 1S6QB 1WHYA 4YY3F 1M0SA 2UVUA 4QR1A 1MMDA 5KFHA 1FJGF 5J2QA 1ZTTA 3AHPA 5E3CA 4R0JA 4ES1A 3C46A 1TP7A 1U1RA 2KXFA 4DSKA 3PO5A 4ZPCA 2IM3A 4DF8A 4NZ7A 4JI3F 3S1TA 5F8GA 3MEDA 2Z0GA 5CD4H 1KOHA 2QA4G 4RBUA 5CZXA 1C1BA 7FD1A 4WFBQ 1R7IA 5KT3A 1XMQF 1XTZA 3G86A 3IFEA 3TQ1A 2FHKA 3LAMA 4C8MA 3RAQA 1H3DA 1S9FA 2BRLA 3SV4A 3V6DB 3FNNA 3OV7A 2E66A 2VL1A 4OHZA 5A8KA 2GQQA 2W9CA 3ICLA 4QU7A 3LP1A 2AU0A 1N6QA 3M2RA 3PRDA 3UCUP 2R8JA 1AUDA 4ILRA 2ZDOA 4QW9A 4RLEA 3EZ5A 3MEEA 2CJKA 2MSSA 3J7YI 3O5TB 2GNKA 3PKMA 1I6JA 2CZVC 3G6YA 5B0AA 2XGQA 5BR8F 2BQRA 1XBWA 3BDEA 2KKHA 4AL6A 4C4WA 1UMJA 3PIOQ 4A4JA 4IR9A 3MEDB 1FF2A 2E7WA 3VTIA 1FJ7A 3PO4A 1C1BB 3BS9A 5GAGI 2XGPA 2YWEA 1W2BR 2SXLA 1UFWA 4NLDA 4U9RA 3VAMA 1Y3KA 3ZZYA 3GFXA 5A8KB 1F5AA 4U6PA 3LP1B 2I2YA 1PC5A 3TNVA 5M2RA 5SZTA 3M2RB 3W2WA 1Q16B 4YDXA 4BC7A 2QE5A 2R9LA 1YWXA 2Q66A 3ZZTA 2DHAA 3MEEB 4DQSA 3E51A 2GMHA 2I0XA 3EXCX 1NJWA 2VC0A 2V9KA 4Y2KA 3MAHA 1HW9A 4TQSA 4ED3A 1WTFA 1OO0B 1RWUA 4PG5A 3K57A 3V6JA 2PI4A 3HPOA 1JLBA 4F50A 1H7WA 3T5LA 5G0RA 3OUYA 2CQHA 3M30B 4OZLA 3U1LA 3HMJG 1S48A 2LYVA 4WXOA 2YKMA 3TR5A 2ZJRQ 2KG0A 3OL6A 1YIJS 3HLUA 3TA2A 4OIXA 1XMBA 1Z1ZA 3KK2A 4ECXA 4IFVB 4RUHA 3NRBA 4HHJA 1XERA 3W2WB 2WBMA 3QJLA 1D8ZA 4R5PA 1R0AA 4B3TF 3OFHA 2ZBIA 2KU7A 3HHNB 3BGRA 3GV7B 2ZM6F 4MAKA 4JV1A 3MEGA 1TUVA 1FKPA 2ILYA 2ZH4A 1IN0A 1X4GA 1FDAA 1GAOA 2XMUA 3LO3A 2DO4A 2LDIA 3GFZA 1LWEA 3GYXB 1JLBB 3FGVA 1WEXA 5HBMA 4NLPA 5G0RB 1FRJA 5M2PA 1BQMA 4JI8F 2FJEB 5F41A 4CNZA 3OUYB 3G96A 2FDNA 4MIBA 2RU3A 3KLEA 7FDRA 4V19J 4X4UA 4DR5F 1Y3JA 1Y4ZB 4NWBA 4WYWA 2MDAA 2YKMB 3N4WA 3ZZZA 2FB0A 3A8EA 5LMUF 4LJMA 3CVKA 1NK0A 2MQMA 4USIA 1Q8BA 1TKZA 2HLTA 3KK2B 3LH2S 1BD6A 1U6FA 2E1RA 4PPZA 2EBGA 4R25A 4YFUA 1NB7A 4J9MA 4HYKA 4C97A 3MECA 4R5PB 2RD5C 1ZH5A 3OLBA 4F8RA 3BGRB 1KLMA 4Q5VA 3MEGB 2HWIA 1FKPB 2EFOA 4ZCKA 4A8FA 1CLFA 1MWYA 3M2VA 3KLGA 1TV6A 3RW6A 4A8KA 2X1BA 3BB5A 2VZ9A 4KR0B 1LWEB 1JKHA 4B9LA 1SB6A 5HBMB 3GIMA 2I38A 4CH7A 2V4QA 1BQMB 2HFNA 2K7JA 4J9PA 5LMNF 2VH7A 3KLEB 1VQ5S 2OTJS 4O3PA 5HMXA 3PRBA 4MTPA 5D77A 5DS7A 2B3TB 3CIZA 1JJHA 3M05A 3TOQA 5L9XA 2YWFA 4B17A 3QIDA 2VQEF 3NL0A 3RZAA 1WNEA 2XEXA 2VOOA 3UQSA 5BYRA 5DG7A 1LWCA 1VQ8S 3SXLA 4RUAA 2I8EA 1TKZB 3IXQA 3MFIA 3LWMA 2WHOA 4DV5F 3UD4P 1U24A 2FHJA 3W2VA 1HR0F 1RKIA 4FXDA 3MECB 2QA4S 4J9OA 1KLMB 3G4SS 4OFZA 4ZP6A 2ZVSA 3IWXA 1NKCA 3M2VB 3CF5Q 4E8UA 1YJRA 2XY7A 4LUBA 3JTOA 3HHLA 4X4PA 1T94A 1WACA 1DURA 1JKHB 1HBNA 5THWA 3ONQA 5KFZA 4DS4A 2G9OA 4TU7A 2YY3A 3H2UB 1L3SA 4IOCQ 2YH1A 3U1MA 5DRKA 2CPJA 2DNYA 2ROEA 1QSYA 2JEGA 3LQVA 4ED5A 4MKBA 1QAXA 4YR0A 4NX9A 5D6GA 4X4QA 3PW5A 1DAXA 2ILZA 5EX3A 5B0DA 3BGUA 1OSCA 4GO5X 1YSJA 2YKQA 3G9CA 3TUIC 3SSRA 1REVB 1UP1A 4NLWA 2OLWA 2EPIA 3CD5A 3W2VB 3RB3A 1SIWB 3AJ1A 3DM2A 3PR5B 4ALZA 5HROA 4Q0BA 2B43A 2GC8A 4I4BA 3DOLA 2JEIA 1U1OA 5KFIA 1V3SA 4B9SA 2HPUA 1PO6A 3HHLB 2MYFA 1IBKF 4Y2IA 2VD3A 2M3DA 4LF9F 4K2XA 1HBNB 2MHNA 3E3XA 1MW7A 4DFKA 2VPXB 3HHEA 2CRLA 1S6OA 3T5HA 2M7SA 3PZPA 2ZUGA 2RQ4A 1H7XA 4BDPA 4Y34A 3L09A 2A2DA 2M52A 2R7QA 3F56A 3M6UA 3IG1A 1X9MA 1AW0A 2UZAA 3CD7A 2DH8A 1QVGR 3KMSA 5KFVA 3GWCA 3K8VA 1R6YA 3CC7S 5KFCA 2YNGA 3J7YU 3EGNA 4IQMA 2HRUA 1HBOA 4YHHF 3M32A 3NLCA 4ECRA 3K5OA 4CCHA 2EBEA 1RT6A 1VHFA 4K4XA 3DM2B 4ZPWR 5HROB 4Q0BB 2F8EX 3DOLB 5KFDA 3U7JA 4FS2A 2AV5A 4H4MA 2CJAA 1TK8A 4JBCA 4OMFG 2POKA 4L72B 3BF4A 4XIUA 4D3GA 1VK3A 3R1HA 5I3PA 2VFSA 4B3OA 2CQ1A 3AA8A 4KB7A 3T1HF 5F0WA 4KE5A 3TAQA 4ZHRA 3IR5B 4LSLA 2JFDA 3CIMA 3DLGA 5HN0A 3HHKA 5CCMA 4OHWA 4PG8A 1WG4A 1TKTA 1Q82T 1N4LA 3G8SA 4LFAF 1TQLA 2WRMA 2NSCA 2HHQA 2W8LA 4QWEA 4TN2A 1N5QA 3IG1B 4UUWA 4IRDA 2J0SD 2FVQA 5KFBA 2R7VA 4ZPAA 3KK1B 1SKWA 2DPIA 5FJ4A 1MWZA 2XMKA 4X84A 5KFLA 3IRWP 3BDPA 4HH1A 1WI6A 5AXNA 1HBOB 2XLJA 2E44A 1RT6B 2UVVA 4TLRA 3GSDA 2XLKA 2N4DA 3N5BA 1LXJA 2IJNA 4C8KA 4H4MB 5AXMA 3QYYA 4G3IA 2C3MA 3VZIA 4DR7F 3NGKA 3FQLA 3TAPA 4K4SA 3OHAA 4I2PA 3RBDA 2L3MA 3DRXA 2EFVA 2BQ3A 2LVWA 2JX2A 2E29A 4PXDA 4A8MP 3QGPA 3MTKA 2WB4A 3CCWA 4LSLB 4PG4A 4AQYF 1TFYA 2NUHA 1FNOA 2GHWA 3OXGA 2VQFF 4ECWA 4IRKA 1TKTB 4OI3A 4Y3CA 3PX4A 3KJVA 4URSA 2KFNA 3GFYA 2P5VA 5G4DA 4RW6B 3HXMA 4IH6A 3N79A 2KG1A 2EW9A 2MMYA 3CULA 4PWDA 3FEXB 2KVIA 3ITHB 4DQPA 2J7UA 3G71S 1N54B 1NAQA 3SCKE 4MIWA 1F5BA 4KGMA 4RW9A 4ED0A 3THVA 3ZZ0A 1Y5IB 2B51A 2BJDA 1X9WA 4DN0A 3SCJE 1SJ4P 3N6LA 1VIXA 3MDFA 4Y6IA 4J9LA 3HF5A 2EI5A 4WXWA 3K5LA 5KFSA 4DG1A 2JHEA 3DRRB 3I4HX 5K8OA 4AYBD 2KM8B 4Q8EA 1XNQF 2I5JB 2HWHA 1R8AA 3MM5A 4NA2A 4DV0F 3I5BA 4EO8A 5LJ5Y 4Y28C 1RT5A 4FF2A 4C9DA 3ENVA 3TUZC 2ZH3A 4I2PB 5KFJA 2BOPA 4KHPF 4ID8A 2G1DA 4U7CA 1AFJA 5HL7Q 4G6VB 3M2UA 4HLBA 2PC6A 4LF8F 3J7A1 2RUGA 5I3QA 3I56S 1XR5A 1S1UA 3KJVB 3KKFA 3K0JA 3QZ7A 4X2BA 4BCAA 1YJTA 1UVMA 4PWDB 4YP3A 3MR2A 5HI7A 2QV6A 2ROGA 3G6XA 4B02A 4NYPA 2OH2A 3DHXA 4I67A 4RW9B 2D1CA 1S97A 3NCRA 3R5BA 5GAEU 5C24A 3KHHA 2ASJA 3S8SA 2KM8C 5BJRA 2XCPA 3P49B 2FLLA 5U47A 2Y1IA 3CCSS 4NCAA 1