4YEAA

Crystal structure of cisplatin bound to a human copper chaperone (dimer) - new refinement
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
67
structure length
67
Chain Sequence
PKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords Copper transport protein ATOX1
publication title Crystallography and chemistry should always go together: a cautionary tale of protein complexes with cisplatin and carboplatin.
pubmed doi rcsb
source organism Homo sapiens
total genus 19
structure length 67
sequence length 67
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4yeaA00
2K7KA 2ACYA 1X0PA 2HLTA 4ZOSA 4NL5A 4A46A 3K7RA 3KG1A 4Q2LA 3LGNA 1Y3JA 4NPOA 5B0GA 2AW0A 2IYIA 3T9NA 3HHLC 3WDOA 1U7LA 1QUPA 1Y0HA 2OAUA 3KNGA 4DL0C 2LQ9A 2LXFA 1Y3KA 4OJ1A 5K9FA 1SQEA 5B0BA 2G9OA 2HFNA 4A47A 2JDJA 3UDCA 5B08A 1APSA 1X8DA 2OP5A 4Y2IA 2RSQA 4HL9A 2RMLA 2Q3PA 1N5SA 5B09A 2GV1A 2OD6A 1X7VA 2ROPA 2PD1A 3BR8A 1YG0A 2LQBA 4QOTA 1AFIA 2K1RB 2OFGX 2OD4A 2RU9A 2W4PA 1MWYA 2N7YA 1FVQA 1GXTA 1R6YA 4OJGA 2HQIA 2N4CA 2L3MA 4HI2A 2W4CA 2ASYA 1AFJA 1TR0A 3HX9A 5B0EA 1P6TA 1K0VA 2K7JA 2HLUA 2W4DA 3IWLA 4U9RA 5F0WA 1KQKA 2LDIA 5A6WA 2FB0A 1WD6A 3MZIA 1FVSA 1FESA 1XBWA 2XMJA 3FGVA 5B0DA 1FEEA 4HH1A 1TUVA 2BUNA 2BYCA 2FIUA 2FTRA 1YJVA 2ZDOA 3TRGA 4A48A 1CC8A 3LO3A 3CJKA 1OSDA 2GO8A 1TL5A 1TZ0A 4Q2MA 1CC7A 2QLXA 1RJJA 1W2IA 3QMQA 2ROEA 5B0AA 4OIXA 5T7LA 3CJKB 1OQ6A 4F67A 2IFXA 2PGCA 3QGPA 1VQSA 1FE4A 1URRA 2XMTA 1KVJA 3BDEA 2CRLA 1JK9B 2RILA 3HHLD 4OJHA 2IYGA 1VQYA 1GXUA 1Q53A 3HHLA 1MWZA 2QLWA 2AP6A 3FMBA 5T7LB 5F0UA 3MCSA 2HIQA 4HH0A 3DCAA 3I9ZA 1LQ9A 1V3ZA 5IXUA 2VH7A 3TNVA 4Y2MA 4DN9A 3BF4A 3HHLB 2XMKA 2KT3A 1SB6A 2AJ0A 1YJTA 1Q4RA 2K2PA 1YRXA 1ULRA 1YJRA 2BBEA 1CPZA 5A6PA 3BB5A 4YDXA 2OFHX 2GA7A 1OPZA 2OMOA 2KYZA 2GCFA 4Y2KA 1JWWA 3LGMA 1S6OA 1Q8LA 1Y9OA 3BN7A 4FNIA 5B0FA 1S6UA 1P8GA 3TOQA 1Q8BA 3DXSX 3BGUA 2KKHA 4HI1A 4YEAA 2GFFA 2XMWA 1TL4A 2FHMA 2EW9A 2KT2A 3E8OA 3IWXA 3KG0A 4OJ3A 2GGPA 2BJDA 2OKQA 3VTIA 4ZA1A 1YJUA 2AJ1A 2K1RA 3F44A 2BJEA 1N5VA 4FNHA 4EFAC 1FD8A 1FE0A 1N5TA 1IUJA 2HFOA 2QYCA 2XMVA 3BM7A 2QIFA 3FRYA 3GZ7A 2ZDPA 3HDSA 3HF5A 3HFKA 4A4JA 1AW0A 1N5QA 2GGPB 2XMMA 1KVIA 2VV5A 2N4DA 2XMUA 4DPOA 3KKFA 2ROGA 5B0CA 1OQ3A 1SI9A 5KAKA
chains in the Genus database with same CATH superfamily
5HP1A 3I5BA 4DR7J 2Q43A 4A46A 3HVTA 1F9HA 2KFNA 5A8RB 1NRKA 3OL6A 3KLGA 1ZYQA 4UY85 3VZHA 3MD1A 5HANA 1TL1B 3MR7A 3DLBA 2QX0A 3H20A 1TR0A 1TUGB 1F9FA 4H4KA 2HS0A 1JJCB 3AOBA 4B3MJ 1IJEB 3EYZA 2RQCA 2XS2A 1IVZA 4ELTA 1BMQB 2W01A 1N8RT 2AP6A 3LAKA 2JFDA 1FK9B 1IM6A 4W90B 3VWSA 2EG2A 2HQGA 1HWLA 3SV3A 2AGOA 1IXKA 4UOFA 3L4BC 3CCTA 3RW7A 2FVQA 1H72C 4RNMA 4WP9A 2K1RA 2AGPA 1N5VA 3OTCA 6AT1B 3UN5A 4ZP9A 1P27B 2FJEB 5CXTA 2GMHA 2IM1A 1HNZF 2ZD1A 3KUHA 3W5XA 3PRBA 3HLUA 1PO6A 1M5KC 4CNYA 1HWKA 2YPZA 3M4XA 1X8DA 2DXEA 2R7OA 3DLEB 5HN0A 3PRDA 1R0AA 4O4RA 1HIYA 2BOAA 2FLOA 3DOMA 5ETVA 1T9VA 4OZ0A 1SIWB 2JLFA 4JI3F 2ZH9A 1RHUB 3A8IA 2DEIA 4ATNA 1F5BA 2WVFA 2DCLA 4USWA 1TKZB 1QAXA 4JP8A 5E3RA 3CDEA 5D15A 4O3QA 1FKOB 1RSCA 4NLSA 1SIZA 2HAFA 2QJ3A 3P45B 1TKXA 4UY8T 1G6BA 3HT0A 1N33F 5C24B 4NLPA 1G7CB 3VV2B 2CZ9A 3OSNA 4RKUC 3CCMS 5E3PA 1T03A 2BJDA 1C4AA 1NJYA 2HFOA 1OWXA 3MFIA 4KHRA 4RW4B 5CYQA 2Z8QA 1DTQB 1VI7A 3CMQA 3VGVA 1OPIA 3CD6S 1R8PA 4QW8A 4KKOA 2BRLA 1Y10A 3M8ZA 2LP4A 2F3JA 3PCOB 4DL2A 4X4OA 2GMLA 4NEYA 3HVRA 2NLWA 1RT3A 3RG6A 3MPDA 1TUVA 1BQXA 2DTJA 4TY9A 3QLHB 4C0OC 3RB3A 1QJHA 2JVOA 2WCXA 2RHQB 1VMBA 3O1LA 1S57A 2DD8S 5CD4A 1X60A 1MNEA 1V3ZA 3FCHA 2I6WA 2XMKA 4ILMA 2AJ0A 3LW5C 2QLFB 1EQMA 2CPXA 4ANEA 2ZBCA 4JUZA 5KFWA 3ZTOA 5M2PA 3J7A1 2KM8C 1GK8A 4YR0A 3MAAB 2QG9B 1YZ6A 2DGOA 4TQRA 5KFPA 1RI7A 1BE4A 2RKIA 1D9FA 1XMOF 4MKYA 4F8RA 2NZCA 2OLWA 4PXDA 4ZITA 1QUPA 3DRYA 3HM9A 2W9CB 1VR6A 1WC0A 4NRUA 1BQNA 2UVUA 1NDPA 1SL1A 2WTFA 3GJRB 4QQBA 1SUQB 1KN6A 2AZ1A 1WI8A 2CJKA 3QT7A 2ZKUA 2WSCC 2NR0A 5ETPA 4YMEA 1FDDA 2CQ0A 2DO4A 4YHHJ 4WJBA 3DRPA 2CDQA 1VOMA 3GE9A 2V8HA 4DL7A 4C6AA 2XY6A 1H7WA 4ED2A 3T19A 1IBKJ 4RU9A 3T1YJ 2QMXA 2OEMA 1WHXA 2QZ8A 2FVRA 4O44B 1FRHA 2NSCA 3DNCA 4FYDA 5HLFB 4CLZA 1Q8KA 2WOMB 1TL3B 4JI8F 1RWUA 2AYMA 4XIUA 1NAQA 4WFZA 4A4JA 2GJ2A 3OXLA 3R5GA 2C3OA 4CLUA 4Q2LA 2KXHA 1HFEL 1JLFB 4B3MF 4B3OA 2QA2A 1IWGA 3R5DA 3RU0A 1ZTTA 4FPRA 1U09A 4C3MA 2DHHA 2W2PP 4R5PB 4RW9A 4LRFA 3JTPA 1VISA 2LFVA 2K3KA 2LXUA 2J9DA 3IM9A 3AD8C 3R1HA 5HVFA 2IRUA 3CCZA 1U2CA 3VVUA 3BKTA 3OFFA 3KJVA 1VYAA 1FKAF 4KTQA 3C6UB 2KL8A 2OEJA 3Q23A 1WF2A 4CO4A 3HVWA 5FIIA 5IQ6A 4X64J 2YKNB 4LSLA 1RQ0A 3FCVA 3IBFB 1X4GA 4DSLA 3A3PB 1S1XB 2VASA 2RUSA 1KS2A 4G1IA 4U95A 4MFBA 4OYPA 2W25A 3EZ5A 5AE3A 1K73T 2QFIA 3DXSX 2FVCA 2B9XA 3NS5A 1VS3A 2FZGB 2GQQA 4AL7A 3U1LA 1AXQA 3G82B 3HSZA 1KVIA 4FBUA 1U45A 3MM8B 2IM3A 4X4SA 3MR3A 4NXNJ 4USTA 2QT7A 3POTB 2RF2A 3RZAA 4ZPDA 5AXLA 1RXOB 2DH8A 1LFWA 4IR1A 3UCUP 3Q86A 4PPZA 3JXOA 1YIJS 4L3KA 3W66A 2HS4A 5KFMA 1VQLS 2XS7A 2ZBRA 4XDDA 1WG5A 1KHVA 4HDGA 1CC7A 3CJ2A 2DIVA 1M90T 2V34A 1LEOA 1HQEA 1K47A 3NKYA 2X1FA 2IJNA 1D3WA 4YDDB 3EICA 1EJ7L 2CJQA 2JHEA 4ZK7M 2GAHC 2YKMA 3S01A 1FWLA 3CULA 1JLCB 4QR2A 5F9LA 4QW9A 1A9NB 3SDEB 3HSJA 3UW1A 3C15B 4WU3A 2RH3A 1NK6A 4RBUA 1U8WA 2XG8A 3H98A 4C98A 4FPIA 3V6KA 4K4WA 4DN0A 1LXNA 3D9BA 3GYNA 4WFBQ 5JVHQ 1VQ6S 3KTQA 5B0BA 4HHUA 4Y65A 2KDOA 1WEZA 2YTCA 2E1CA 2V9WA 3ZTRA 4DQQA 1YJ9S 3M8PB 3LP0A 3AA9A 2L3MA 3L9ZA 2KYXA 2XULA 4NASA 1CJTA 1NHKL 1LWFB 2MGZB 3UE2A 3CCSS 3TX8A 2Q66A 4AFFA 1GT8A 5T7LA 2RQ4A 3O6QA 4XPEA 3D0IE 3LTOA 1DY3A 1C1CB 2ACMA 4O3OA 1RTDB 3A8EA 3ZZTA 4DR1F 2D7SA 5CYJA 3O5TB 2IRYA 2HNZB 2EVZA 3RR8A 2Z2MA 4CO2A 3CDBA 1RAJA 2RDIA 2GA7A 2W9BA 5U47A 1YDLA 3D7SB 2ZE2A 1CJVA 1L5UA 1WACA 5C2GA 1NK5A 2AV5A 2YQ0A 5IC6B 4DUZF 2DJWA 3TAMB 2KHCA 2ZHOA 3NNAA 2ZWPA 2J5AA 3JSBA 1HNVB 1DQAA 4IH7A 3UVJA 1SJ4P 2JLEA 3Q8RB 4YHHF 4TY8B 1PAEX 1N88A 2RU9A 5ETMA 2D1CA 4BLGA 4QIVA 1XMBA 2M3DA 2N3OA 5EGYA 2ZZTA 2WONB 4NCAA 2A10A 1CQMA 4CQ1A 1L3VA 3R7NB 3LA0A 2B43A 4OJHA 4M94A 1HBOA 4E8UA 3IP0A 3CTRA 3US5A 3CC2S 1ZA2B 3CCES 3CMES 3BYPA 1XNQJ 4I2PB 1BY9A 1YJTA 3I32A 4G1QA 2J6UA 2JEFA 3MF5A 2N82B 2A6OA 2BEFA 2MLXA 4P2FA 2ZVIA 3SCIE 1GX5A 4OJ3A 2CZVC 1JX4A 3QO9A 1Z1ZA 4GVLA 4X62J 3FRYA 5ETKA 3DDIA 5DDRC 3JQKA 2Z2ZA 3EVMA 4ZOSA 2DK2A 1QE1B 2B5JB 3LGNA 5D0HA 2NYHA 3OQ2A 4ANDA 1S6QB 1QAIA 2H9ZA 5J1EA 3FBBA 4X64F 4NA1A 2DY9A 2VG7B 3KJFB 5F8MA 3SIPB 3FGVA 5D78A 2D69A 3TUIC 3R5JB 1VQ5S 2IM0A 5IZHA 2FVPA 3J7YU 3J80U 3MCSA 2DPIA 5C42B 1MROA 4M95A 2G1DA 3CPWR 4TXSA 5IFMA 4NXNF 4GKKJ 4F4XA 3PM9A 1R8BA 4FNIA 1WC5A 2F5GA 3UD3P 2CJXB 2EEYA 4L3NA 1HPZB 5KG5A 2OKQA 3LAMA 1PJ7A 3F44A 3Q2TC 3GONA 1DZ5A 2BOPA 3FMWA 2CPZA 1DQ8A 1FO1A 4LRAA 1RAHB 5A8RA 5B7WA 3M1VB 5MLCV 1IN0A 4NXMJ 2HFNA 2KM8B 4IH5A 1TL1A 2ZOMA 3LH2S 4FYVB 3OJSA 1VJQA 2OD4A 3I4HX 2ABYA 4KH0B 3M05A 5HBMA 2P5VA 5H1SV 3HKWA 4EUVA 1D9DA 4ER8A 3W3SA 4C4WA 4QWEA 4DI6A 2I8EA 2ZH4A 1Y11A 5CH7B 3CJKB 4K4UA 1FK9A 3WBZA 4DHVA 2D3ZA 2OPQA 4ZVQB 2YWFA 1SC3B 1ACMB 2I2YA 3GLJA 1UAWA 4B9SA 4Y2MA 2CPEA 3TWZA 2M7SA 2ASLA 4ECQA 3NAIA 2G13A 2ILYA 2OMOA 4R8UB 4OZ5A 1R8AA 4DR2J 4ELVA 1Q8BA 3EUNA 2L9DA 5H9EK 1S7IA 4QU6A 2X1BA 3TR5A 4UQTA 1Q0NA 4DR3J 4DV1F 3DRRB 1X5SA 2I5JB 3FNNA 4EO6A 4ECXA 5IC4B 2HWTA 3DLEA 2VONA 3PFEA 3RAMA 4JI0J 4JV0A 4IG0B 3M2VB 4BC9A 3PV8A 2RS2A 4X4UA 1Z2LA 3JSRA 1NHVA 4A48A 1EETB 1Q7LB 1CG2A 2PFFB 1I94F 2G4BA 5LM7E 3IR6B 3H90A 4CH7A 3I56S 3VALA 2XCAA 3PY8A 5IWAJ 2CQDA 1TKZA 3MM7B 2MQOA 4C48A 4F26A 4CP5A 1FKOA 3QATA 2DR5A 2XO6A 1TKTB 5HAOA 1NM2A 2RUGA 5C24A 3S7RA 2YKPA 2Y1IA 4U7UK 2E5IA 4AL6A 2MEWA 3BKUA 2HVZA 4GO5X 4EBEA 3MPWA 3ZC4A 2UVRA 5LSOA 2VPYB 3LPEA 1U26A 1H3DA 3Q8UA 3T1AA 4RW4A 2QYCA 1TUWA 3BPSP 3IAS9 5IM0B 3OHBA 3CCWA 2AD9A 2Z2YB 4CDIA 4YS2A 2KVQE 5GAHU 3NXZA 4UQGA 4QIEA 3KMQA 4LFBF 3H5XA 4M5KA 2CQGA 3GFYA 5DDQC 4DEZA 3A8JA 1RHJB 1LWEB 4Q45A 2WK4A 4N8OA 4NZ6A 3QLHA 1FESA 2D9OA 1YRTA 3LO3A 3FSYA 2C2ZB 1VQ7S 5GAHI 3GFHA 3QMQA 2BJ8A 5J2PB 1WSVA 1B70B 1JIHA 4O0NA 1SQGA 2D3UA 3JQJA 3U7JA 8ATCB 1LV5A 3FZ2A 3THVA 2UXBJ 1FI4A 1JLBB 2RVJA 2D3OR 1N4LA 2CFXA 1CPZA 2G0CA 4HACA 2M0GB 3GIRA 1VCTA 2NCKL 3CJ0A 3MAAA 2QTWA 3PTWA 1GXLA 1S0MA 4CTAB 2R8GA 3MMBB 5ETRA 2VA3A 4LBIA 1VQMS 3BZQA 1RT7A 4ZLNA 4B3SJ 1MMLA 1J5EJ 2F40A 3SCLE 5GADU 2H54B 1TAUA 1SKSA 3VAFA 4GC6A 2J0XA 5ETOA 5JXSA 4I6AA 1UW9A 2EFGA 1SUQA 4CO5A 2XTJP 3IGVA 3H8YA 2MZTA 3CJTA 3N0VA 1XC9A 3GG0A 4DSFA 3E2EA 2F7VA 2FJVA 4NLRA 1NJZA 1WC3A 1B0TA 5GADI 2G0JA 2FB0A 5F9NA 2ZJRQ 4ZVSB 2XZWA 3TRGA 3THTA 4IH6A 2W8LA 2VQFF 5LL6d 2XGQA 2HRYA 4F0HA 4GKKF 2K3IA 3CJ3A 1VBYA 1BD6A 1HNIB 4NLQA 3PXGa 5HQMA 4QWCA 3KK3B 3Q24A 4OX9J 5KOWA 3RAXA 1NSPA 1N36J 4O44A 4KH1B 1RT5B 2B4VA 4TYBA 5IT9Y 3W9HA 2GVDB 3T5LA 5D0EA 2WOMA 3T41A 2G2YA 1TL3A 4G1PA 3CJ5A 1SH0A 1HL6A 4NXMF 1FFSB 5GAGU 3O44A 1TKDA 4FNHA 1FD8A 2XCPA 3ZNUA 4IKAA 3CJQA 1PBAA 3RB0A 1CJUB 1H0HB 5KAKA 3D3CJ 2C3YA 2XM3A 1R7IA 2CJBA 4HKQA 4FS2A 1F9EB 3CUNA 4HT7A 4O3SA 2R7QA 4R5PA 5GAGI 2MPUA 4HL9A 2QSWA 2ZNYA 2CYYA 5DETA 3UFCX 1UKUA 5F8LA 1YHQS 2G2OA 2JOQA 1NJIT 4HI2A 2HZCA 4LF6J 1Y5IB 3HFZB 2LU2A 2P2CB 1G1XA 3MPUB 4ED0A 2BYCA 1RA6A 3C6UA 2OMLA 3IN5A 2VIHA 1RAIB 4USKA 3G6ES 4URQU 1KQFB 2YKNA 4DR2F 2VFVA 3PW4A 2KN4A 4DR6F 3J80Y 2QLBB 2JEIA 1U24A 3TW0A 4DR3F 1S1XA 1ZTWA 2NUUG 2MQ8A 5KFFA 3GB0A 1SKUB 1JWWA 2APOA 3KLFB 1FDNA 5ITHA 4K4TA 1B7FA 2CNKB 3KHRA 2D74B 3G82A 1P1TA 4AUKA 3VTIA 2XS5A 3MM8A 5EX3A 1RTHB 2QA1A 3KKFA 1CS4B 3POTA 1NU4A 4KIAA 2IYIA 3U27A 1D8ZA 1T0TV 2LEBA 3C19A 1AA1B 3OR1B 3EGZA 3QAUA 5L1KA 2DH7A 1HNXJ 5E33A 5IWAF 4BC7A 1BGXT 5HJXA 5M2RA 3GCXP 2N4CA 4OHWA 2IM2A 2C1EB 2QYGA 4AXIA 2EKNA 1O51A 3E01B 2MKKA 4C3KA 4C7QA 1YX2A 2GQCA 1S10A 4GMKA 3D6HB 2ZZMA 2LU1A 3V6HA 3KLEB 4F2SA 3KOAA 2AKWB 5CD4H 4LMZA 1EARA 1X4DA 5HMWA 1N52B 2FJBB 4GVBB 3MOZA 2YKOA 4OZLA 1U02A 2WB1D 1LFPA 3Q8PB 3QGHA 2BKOA 3LGMA 1JLCA 2HBQB 5EWEA 2IHR1 3SDEA 3AOCA 4PG6A 1FXLA 3K5PA 5ETTA 1HD0A 3ZO7A 1BQMA 2E7VA 3KJNB 3NGDA 1OQ3A 3IRXA 4H54A 4C2MA 4ZPAA 1EP4B 3P96A 3H25A 2HBRB 3IGNA 3UO0A 2B7CB 2RMLA 3M8PA 4Q7AA 4PG4A 4WXWA 2IA0A 3ZTPA 3PKYA 3GJSB 4RW8B 4RJVA 3IMQJ 3QJLA 4O23A 4JV2A 2VD3A 1LWFA 2MKCA 2GW8A 4ZVFA 2SXLA 1WHVA 1VGYA 4DG1B 1OSDA 2DGSA 1ICEB 5I3UB 1C1CA 5D4LA 1RTDA 3PJ9A 1HLWA 1D9AA 2QL9B 4X65F 2Y3YA 2JRSA 3P4UB 4LVNP 4CCHA 5CQGA 4FKYA 2MKYA 5LMNJ 1J5EF 2HHQA 1SXLA 2GCFA 1U1OA 3FZBA 3KG0A 4CT8A 1Q82T 1QSLA 1XTZA 1NJWA 1IR2A 3TAMA 2R8KA 2I0XA 2L48A 2MLYA 4B9UA 3B82A 4WF9Q 1HNVA 3G87A 1UP1A 3UWTA 2XLIA 1R89A 4LQ3A 2PA8D 5E3CA 3MEEB 2XWYA 4IQMA 4DF4A 5DLGA 2GIRA 3J7AN 3GIJA 1GXTA 3D1OA 3JAMY 4Q8EA 2HKEA 4OX9F 2WW8A 2P9EA 1N36F 2WONA 1R0BG 1D8YA 5E5NA 4Y0FA 4PR6A 1QVFR 4I64A 3UR0A 2PGCA 2ZH5A 3N28A 2UU9J 3GJTB 4I2PA 4CO3A 3OT9A 2HQCA 4I67A 1BLUA 1N54B 3D67A 3D2WA 1VQKS 2B56A 4ZPWR 4LIWA 1ZM3A 2CJYB 4M63A 4ZPCA 3QIPB 4CM2A 3PG9A 2M8HA 1D1UA 4WZMA 3CCRS 4NE9C 3ITHB 4CYUB 5I42B 2YKAA 1HW9A 1N5QA 4B17A 1NHUA 1QE1A 1FTCA 2B5JA 4DV3F 3OLAA 4DL6A 4FN5A 1KFSA 2OTJS 1BWEA 3CMAS 1J2VA 2CPJA 5LJ5Y 3KNGA 3AT1B 1S6QA 3DGVA 2HQ3A 2B9WA 2DITA 4CH1A 1O0PA 3V4MA 1YQHA 4U9RA 2XI2A 1I5OB 5DZ7A 2XMJA 2E1AA 2JWNA 1CC8A 3LP1A 4ZVHA 3LF0A 3M9MB 3PX6A 4YY3J 4M5MA 5C42A 1RAFB 2IJRA 1RISA 2IYGA 2ZZNA 2IBKA 3R7BB 2UP1A 3NWGA 1IQTA 1RABB 3AXMA 3DFEA 3BQ1A 2QEXS 1RT4B 1HPZA 2VFUA 3BN7A 3CJRA 3P5BP 3MURP 1KLNA 4OLOA 1JXVA 4WFYA 4ETZA 1R0CB 2DBBA 2C3MA 1FX4A 5B0CA 3QT5A 3ILIA 3M1VA 2DISA 4CWBA 1HMVB 2YQ3A 2ZH3A 4AXJA 1C1BB 3P8BB 4USUA 2B51A 1MN9A 3MM9A 4E2FB 1KBRA 2GMJA 1T3NA 4O4GB 2GS8A 2CPDA 4OZNA 2FDNA 3PACA 1SJ1A 4ES2A 1FEEA 3FC9A 3CJKA 4QIWD 3CC4S 1S12A 1PIEA 5AXNA 3HK2A 4OHYA 3ULHA 3G6VA 2CRLA 5M2UA 5CCLA 4KE5A 1KVKA 2LMIA 5DJBA 4R8UA 2A3JA 4USMA 5KFLA 2C2EA 1RKJA 2ERRA 3SCKE 2AHOB 5J2QA 3JSMB 3AD9C 1RTJA 3TUPA 1JXEA 1B64A 5KFQA 2DGWA 3DRRA 3FBFA 1S0OA 1HW8A 2LEAA 2YNHA 4DCOB 3C16B 4NI2A 4U67Q 3AD7C 3WIVA 4IG0A 3VR1A 3M2VA 1E6VB 3ADAC 3IAM9 3W7BA 1S4FA 2HK3A 3J81j 4KRWA 4JV1A 1X4CA 1EETA 4U8YA 1KQKA 3TJAA 4DUTA 1WF0A 2CKWA 2DGQA 2B4PA 3RTVA 2XYPB 3MM7A 1HD1A 2H48B 3CT9A 1JNRB 4J9VA 1TKTA 2C2NA 2DNLA 2HSEB 1FX2A 2MY7A 3EDRB 2OPSA 1TK8A 2H3EB 3ENVA 3CDUA 5HMXA 4IRKA 2CVEA 2NS1B 1ZZFA 2HFZA 3CC7S 2RDDA 3TZZA 3I55S 5IM0A 3WC0A 1U1PA 3CGIA 2YBVA 3VGSA 2UUBJ 4PKDB 3KLHB 3NL0A 1HWJA 3N9UC 1HBMB 4DPWA 2BQUA 1U2RA 4WFAQ 4JI2F 1KP6A 4NCBA 2GVZB 2E5LJ 1UVMA 4IRCA 1TMMA 3QT6A 4QWDA 1LWEA 2UU9F 5KFOA 1HWIA 1UA1A 7FDRA 5KFDA 1P9QC 1QLNA 1X4FA 4KGZB 2MMYA 1RACB 1VRUB 2DNRA 5J2PA 2MTLA 1REVB 2HVEA 1LKZA 2RS8A 2VZ9A 2IBOA 4A8WA 2BQRA 2XMTA 1RT1B 1NPKA 1UPPA 4X66J 1JLBA 3NOCA 2NYIA 2HHSA 2MY8A 3QSIA 1GAOA 4NLTA 4ECSA 3W8PA 3NY0A 4I7FB 2VFSA 4DX7A 4CTAA 4Z37A 1RHRB 3MMBA 1P8GA 2Q79A 3WX4A 2B9YA 1BC6A 1VC0A 5GMDA 5F3ZA 3CXCR 2ZH2A 3R1LA 3M30B 3X3UA 2HS3A 3T5KA 3OJUA 2FC8A 3DDKA 4PRFA 3JTOA 2LXIA 3K5NA 2F8EX 1U6FA 1WTBA 2UXDJ 1UVJA 5DQGA 2EG1A 1F2GA 4YY3F 1URNA 4RW7B 4B3RF 2HHHJ 3TVYA 4WXOA 3KK1B 2OO4A 2H1YA 3VZIA 3DGPB 4DQPA 1HNIA 1YKWA 4W98A 2R2TA 3KK3A 4DS5A 4ZN3A 3M6VA 3KHGA 3OFEA 4RBTA 1RT5A 2HNYB 2GVDA 4M5LA 1NH8A 3HHLB 4CLFA 4OZJA 2H65B 2E66A 2OFHX 4YB5A 1QSSA 1RAAB 1YJNS 3S1TA 2BJ9A 3NCQA 3TOQA 4CH0S 3PVXA 2MHEA 3VHQA 1CJUA 1FNMA 4ED6A 1OY8A 2M2BA 1NKEA 4PG8A 4K2XA 4LQ9A 4DOZA 4OX7A 5LSLA 1RT6B 3MTJA 4DXLA 3CD0A 2HHVA 1AUDA 3THPA 1KHWA 3BQ0A 3PW0A 2KHDA 1Q78A 1AFIA 3GILA 3K5LA 2I9SA 1FRJA 4TN2A 1WEYA 4O3RA 2FJAB 5EDWA 3SXLA 1T05B 1U1KA 3SYZA 1IR0A 1HYSA 2BE2B 1G2EA 4G6VB 4PYAA 1S59A 3OHAA 1U6BA 4RUCA 5T14A 3VAIA 3KLFA 2XSJB 1PILA 1ZETA 5CYMB 2COLA 4FKXA 1RTHA 2MSTA 2XMWA 3K2YA 1HBNB 2H5EA 2WAQD 1CSJA 5GAEU 1UPMB 1ZZNA 4DL4A 2K7KA 2E29A 1IKYA 4RU2A 1X9SA 4ZLPA 3KG1A 3V4IA 3OR1A 1IBCB 3MCOA 2IC3B 5CABA 3WHIA 5JJBA 2DT9A 2ROPA 5GAEI 2LQBA 4ED3A 3Q8QB 4H4OB 1KD1T 3W9IA 4NLXA 3E01A 1RU1A 3HX9A 2RT3A 3R6LB 4ANCA 1YJ7A 5SZTA 4WBFA 4DX5A 4KGMA 2CUYA 3KLEA 3HD1A 3C66A 2RJZA 4EZ9A 4LBHA 2CWXA 1NH7A 4GVBA 4LJMA 1Q81T 2DNKA 1Q5YA 5HQ8A 4F3MA 2VFTA 2UUBF 2DNNA 4FYWB 4NMXA 3V81B 3EXYA 3BBBA 1A6LA 1VK8A 3GQCA 5F8NA 4ILRA 1Y7PA 4LR7A 5GMEA 1XEZA 1T9XA 2QIFA 3M7VA 4RO0A 2PT0A 1EP4A 4OV6A 4ZCLA 2R9LA 4I6YA 2MKSA 4Z7YA 4OJ1A 4DSKA 3C14B 4RW8A 4IOCQ 1Q95G 4KV8B 2RRBA 3BR8A 2Y1JA 4D3GA 1UEKA 3BV8A 5AE1A 3PHTA 1SJQA 1LWCB 4J9SA 5F8HA 1DLOB 2ADCA 3NS7B 4FDFA 3IWLA 4DG1A 2LDIA 5I3UA 1FVSA 2RRAA 2EK1A 4DU7A 2B4UA 4CLLA 2BABA 4U7UD 2KU7A 4QPTA 2ROEA 4CO1A 2UUAJ 3EWGA 1FJGF 3J7Z5 5DLFA 3I0SB 1SCJB 1PYSB 2QV6A 3GFXA 2AGQA 1GH8A 3M6XA 2ZEJA 5KFAA 4ZKAA 5DZ6A 2R7WA 1EAYC 5J2NB 4K5RA 2UXDF 5KG2A 1KKHA 1NDKA 4P2XA 4EFAC 1QTMA 2ZOGA 1GNKA 3D0GE 2HHHF 3AODA 2AEJA 1Y5NB 3MEEA 2AJ4A 3MR5A 2XYHB 2DNHA 5J2MA 4WPAA 4C9DA 2OAUA 4B3TF 2OP5A 2XNQA 1J5OB 2KO1A 2JX2A 2OD6A 4MIAA 4KBIA 2GJFA 1M5HA 4DPXA 2OFGX 1EIYB 2HFUA 4DV2J 2W4DA 2DH9A 4DUYJ 3PIPQ 3ZZZA 1RA7A 3CIZA 4N47A 2FQQB 2V68A 3DMJB 1A0OB 2HVIA 2YY3A 3MEKA 1AUSL 4DX6A 3QIPA 1S1UB 1S1WB 3BS9A 4M5HA 4FXDA 4KPYA 4ZS6A 5AJ3J 3ITHA 4CYUA 1ZAXA 3MMAB 1R31A 5I42A 4NLYA 1S0VA 4WU2A 2FHMA 5KFHA 3CF5Q 5L8RC 1WORA 3OTOJ 4YUDA 4RWXA 3OSPA 3PDNA 1KTVA 1S48A 1J27A 2CA9A 1CLFA 3J7ZT 2C2OB 5KG0A 4TU8A 3H4DA 4ICLB 1TFYA 3QJJA 2KXFA 3EJMA 1TAQA 2FD2A 1UMJA 2RIJA 2CIMA 1I6JA 3V2UC 3PIOQ 4JV5F 2GHWA 4PQUB 4FBTA 1XBWA 4LF7F 3KDNA 5EHHA 3M2RB 3NCPA 3FBEA 1VRTB 2RE1A 4RNNA 2X1GA 5K14B 4LUBA 3PZPA 1KVJA 3EPIA 3PJXA 1X5TA 3BGRB 3D0HE 1U1MA 1RT4A 4AQYJ 5KFEA 2ALZA 3BYRA 5AXMA 4CLTA 3F73A 1S6PB 2IA6A 1SC1B 3K58A 2DXDA 5C2CA 4MKVA 2ZM6J 1YTYA 4L74A 1HMVA 2ADBA 3HJFA 3HHDA 1C1BA 2DRDA 4TLRA 3CD7A 2W7OA 2E5JA 2B3TB 4O4GA 2A2DA 2HMIB 2R42A 2V8VA 4IO1A 3JB9k 2JL9A 3RBDA 2F9JA 4P7VA 3I6PA 3QQCD 3RJMB 5KFUA 1FJCA 1JKHB 5C5JA 4X84A 2G1HA 5KG4A 2VB6A 1NKBA 1VQ4S 1RP5A 4KFBB 1UW4A 3D5MA 2PE8A 4I0WA 2HQFA 5DG7A 2VDIA 2B8PA 2J7WA 5H9EJ 3W62A 3I9ZA 1RWKB 1LQ9A 5IXUA 1U1RA 1EKSA 4YQWA 2M5YA 3JSMA 4DWIA 1QUVA 3FFIB 2R7VA 4LRDA 5HO4A 2HAIA 4ZLLA 4PZVA 2UUCJ 2RRNA 5B0FA 4EEYA 5DDOC 1TMJA 2EW9A 3HSDA 3EGNA 4MKAA 1R3NA 1ZPVA 1UVLA 1SJFA 1JMTA 2H5IB 1RAOA 2DR6A 1IBLF 3C16A 4WK1A 1IM4A 2WBMA 5KFRA 2CNNB 3WX8A 1X0FA 1Z4UA 1E6VA 3N6NA 3H42A 3UDCA 3P3DA 4ENOA 3D6MB 2KH9A 1HHTP 1KFDA 2UUAF 3JYTA 3FJ2A 2A6MA 1XNRJ 4LRCA 2QMUB 2CG4A 4RUAA 3GG1A 3HVTB 4B02A 1W26A 3R6GB 2AX0A 5HL7Q 4Y6IA 2WVEA 3NP5A 1FWPA 1FE4A 1L3UA 3UQSA 2IY5B 3OUYB 1IBMJ 3I5CA 4URGA 2KT3A 2VPZB 1YRXA 3M8RA 3OVAA 1HKAA 4K4SA 4CT9A 3FEZA 3D1QA 4JI4F 5D6GA 3UD4P 4ZPBA 2P6SA 1NB2A 5L1JA 2HRTA 4ZA1A 2PIIA 5KT2A 1VBZA 1C2PA 2GGPB 3UCZP 1HBMA 3PYGA 3SSSA 4USJC 4ALZA 5HMYA 5DDPC 2AJ2A 5SUHA 2GVZA 3A8KA 4WYWA 5I3QA 1JNZB 3CCLS 3D4JA 3N5BA 2V4RA 1JJHA 3G86A 2VICA 1YSJA 3V6DB 2K1RB 5KFGA 4X4QA 4DR4F 5KFVA 2Y9HA 1VRUA 2ZJPQ 3BBCA 1REVA 3L7PA 1FNOA 5HK4A 2CZ4A 5MAOA 4FF2A 5KT5A 1YK9A 1UZDA 1FTRA 4BWMA 3OFHA 4A8YA 3MAHA 3PYFA 3TEHB 2ASDA 1PYTA 2W2MP 2Q6BA 4IDKB 4I2QB 3GSIA 3LUYA 3K8WA 5KFTA 3GCWP 3OTOF 3GIKA 4I7FA 2VJVA 3FKBA 2XHWA 1LK7A 5JVGQ 1XMQJ 3TJ9A 4QU7A 3B6BA 1SC6A 1L3TA 2I38A 5A8WB 1AYEA 4KYZA 4QBUA 1BUXA 2XY7A 3BGUA 3KHLA 4LF9F 2IDLA 5L9NA 3D6TB 3T6JA 5CAAA 2E1RA 2R2UA 1YGYA 2M4MA 3GYGA 2OPPB 3NRBA 2XMAA 4AT1B 3PW5A 1ZM2A 2VQEF 4LF8J 1LNQA 1V9OA 4RW7A 2CQ4A 3KLIA 3BSOA 4RUHA 3DHWC 2VKRA 1CEZA 1M1HA 2EFOA 1UEUA 1JLQB 5DG9A 1S79A 4ZCKA 3KK1A 2C42A 3DGPA 3I4PA 4WWSA 4AQYF 4MYTA 4QR1A 1RWOB 2IIHA 1NK8A 4UF4A 3H7HB 5LMUJ 4DR7F 2HWIA 5H9FK 2HNYA 3WZ0A 3QRPA 3BSAA 4QYRA 3VAMA 3HHLA 4KR0B 4PAAA 4KHPJ 2J76E 4OYOA 4OX8A 3BSCA 2ZM6F 1BWVA 3K8VA 4RZRA 2VG5A 2W2NP 3H2VE 1S6UA 2H51B 2CQCA 4LFCJ 4ZVPB 3CDWA 3B54A 2WSFC 1VRQC 1FF2A 3PX0A 2W1BA 2FVSA 3GJQB 1CQNA 8RUCA 2ZH6A 1FKPB 2BKNA 4IOBA 1U1LA 4X4TA 3VF0B 2YWEA 3TAQA 4N76A 2F63A 4C0BA 3HI9A 5D4PA 2RU3A 3OW2R 1FRXA 2HIYA 1M1GA 3VQTA 1T05A 3GV7B 2V2QA 2YKQA 2BE2A 3UN3A 3JSYA 2BACA 2YWHA 2UUCF 3G4SS 1GEHA 2FYXA 2VL1A 2R4FA 2QSFA 2WB4A 1S0NA 1GXUA 2WSEC 2D3O1 1UCNA 2XSJA 1OMSA 5J1PA 2BBEA 1MG7A 2EBEA 2AJQA 1U2FA 3ELHA 1VQ8S 1AROP 1HBNA 1ZOTA 4Y2CA 3DRPB 1S9FA 1ELOA 4KO0B 3QSYB 2WW4A 2VV5A 5F8IA 2ACYA 2BZ2A 4F04B 2IC3A 1XNRF 2DGTA 4L72B 3GR0A 4EZ6A 2ATLA 1T9TA 4TYAA 1Y3KA 1TV6B 4B9MA 5G0RB 5HVHA 2BJ3A 4H4OA 3MR2A 2ZKTA 5BR8J 4I6WA 1HQUB 3HHKA 2VBZA 2V63A 3N4WA 5BJRA 1F6TA 4FVMA 2MHNA 4I56A 1IBMF 1H2VZ 4ZP6A 3HO1A 5E0OA 4CIOA 4FF1A 3NMRA 4UUXA 2FPHX 1VQPS 3W65A 1HHSA 1SJRA 3OL8A 4OMFG 2AIRB 2Z2LA 1S5ZA 3BJYA 4K0KJ 3TA0A 1MWZA 1TP7A 3MXHP 3V81A 2VH7A 2UZAA 4K4VA 1YJRA 3P5TL 1BHNA 2YXLA 2DNQA 1SVDA 4MK7A 2LQ8A 2AWZA 3PW2A 4NLVA 5D3GB 5IV4A 4B9TA 2HGNA 3NAHA 4GKJJ 2RB7A 3OXFA 3HFKA 3M9NB 3KXDA 4LSLB 2W2QP 4QYZK 3BO2A 4IG3B 3H5UA 1KTQA 1I1GA 3T5JA 3C14A 1Q7YT 4XK8C 1H6KX 4KV8A 2RHSB 3LALA 3RB6A 3DM2B 4F36A 1DLOA 2V4QA 3ETOA 4Q8FA 3HULA 5D8HB 3UN2A 4OZ3A 2V94A 1WC1A 2HQDA 3I5AA 1N5YB 3LANA 1C4CA 1XMQF 2B6AB 9ATCB 1S49A 1ZAVA 2A2CA 1JLGB 2EK6A 2YX4A 1RU2A 2V67A 4ZJLA 2C2KB 5B0AA 3I0SA 1TQLA 2D41A 2EFVA 1K1QA 2IMWP 4F50A 4RNFA 1RBLA 1T9YA 2GQ2A 5A0YB 4DV5J 4N56A 3TVKA 1ULRA 3I82A 5J2NA 3CCQS 1F3VA 2V5HG 1FDBA 3NS6A 1X4HA 4LF8F 3E8OA 5JUMA 3RRGA 2MJNA 3NNHA 1ROFA 4ECVA 1F0XA 4NMLA 3C3LA 4QZVB 1HQEB 2MSSA 3MECB 2EXUA 1D09B 2JNJA 3I9V9 1IBKF 2AMCB 2YNFA 3T1YF 3SI8A 1TELA 3W5YA 2FLNA 3DKDA 2GNKA 2AEMA 3M2UB 4LIRA 1MWYA 3G8QA 2C2RA 4OJGA 1XWLA 2K7JA 5F0WA 1YVFA 1LW2B 4F25A 2QL7B 2KVIA 2KRRA 4P74A 4N5SA 3BDPA 4LFCF 2HVHA 3TAPA 1CULB 5ETNA 1S1UA 1S1WA 3ZZOA 3LP0B 1HNZJ 3OR2B 3MMAA 4ED4A 3LGHA 1KQSR 5L1LA 4Y2KA 4WZQA 3W61A 2QL5B 4HI1A 1NB7A 2M9KA 1F60B 4ETXA 1MLAA 2BM1A 3UDVA 1IUJA 3BM7A 1VC6A 2XYGB 4ICLA 3DXBA 4P75A 4Y2AA 4FP9A 1PJ5A 3H0PA 3D28A 4ITSA 2O5DA 3A13A 4BS2A 1K44A 5K8MA 3M8QB 2GHPA 2YH0A 1Y4ZB 4TKTA 3UPFA 4PQUA 3AJ1A 4KHMA 1N33J 3M2RA 2W9AA 2RQMA 1VRTA 2FHKA 2CADA 4U96A 3ISZA 5IS2A 5K14A 1H7XA 1L3KA 2F1FA 2HYIB 1RJJA 2I1RA 3BGRA 1RHQB 3IG1B 3MM5B 3J7YI 1S1TB 2HG4A 1QTNB 3QFWA 1T9UA 4ECUA 4W92B 3KDOA 1NMEB 1N32J 2A0FB 1U47A 1NEEA 5KFCA 1S6PA 3IR7B 2NUHA 4F4YA 1FJEB 4P6QA 2DIUA 1U0HB 4JI6J 1PSDA 1FT8A 1OIAA 1I3OB 1T8EA 1NSQA 3HFVA 1AZSB 1NNDA 2DR8A 3DI6B 1RWWB 3NGUA 4I4BA 1UJ5A 3QZ7A 7FD1A 2MZJA 1DTTB 3JS9A 3W2VB 2HMIA 3SSRA 9RUBA 1JLEB 2PD1A 4F0KA 4QOTA 3CSKA 1VLYA 1ZA1B 2N7YA 3ZTSA 3OLBA 4FF3A 2PFDA 4HTJA 1JKHA 4PPDA 4K59A 1SJ3P 1RWVB 4EI2A 4KFBA 1XR5A 2NXEA 1C0TB 3ZFVA 2LKZA 1L3SA 3QJPA 4KQZA 2GC8A 3R2CJ 2CPFA 1LWXA 1QSYA 4KGKA 4OX6A 3H5SA 4GKJF 4TQSA 1WHYA 2DNOA 3FFIA 1V5IB 5LXRA 5KFXA 5A6PA 4TVAB 2E7XA 1OPZA 4PXEA 3FVYA 4DFKA 3OTBA 1M5SA 3D54A 2BQ3A 3GWCA 5DQIA 3D1HA 5ETSA 1QVGR 2XMVA 6FDRA 2ZDPA 2ZHBA 4L73A 2V2KA 4X4NA 2UVWA 1RT2B 4K8RA 2C3PA 2YWGA 4ED7A 4PWUA 1OYDA 4RWWA 2W2OP 5K9FA 5KFZA 2Q3PA 4J7CA 2GV1A 4ZIVA 2QRRA 1RK8A 4ID5B 3KJQB 4HLBA 3CEDA 3QNWB 1NDLA 2HBYB 1UL3A 3UDEA 1JB0C 2DVIA 3F41A 4NLDA 4DV5F 1WOSA 4CLYA 3OBIA 1S1VB 5DM7Q 2MZQA 1DJ0A 4JI8J 2QLXA 2QLJB 1JQGA 3FEXB 3OUYA 2BRKA 1Y00A 3GV5B 2ZVSA 5EWFA 1OJ4A 2KFZA 1DTQA 1SB6A 5HBMB 2HURA 4A8KA 4LSZB 4U7CA 1XR7A 4BDPA 3GV8B 3DLKB 3NBPB 2EFQA 4J9RA 3VGUA 2J8SA 4F0MA 4EMDA 4O0IA 2WBRA 2GGPA 3DYAB 1TVRB 1X4AA 1N5TA 2OPQB 4PWWA 5KT7A 4V19X 2GIFA 2VC1A 3QZ8A 4U8VA 1XNQF 3NGSA 2LQ9A 4MK9A 3V6DA 5KFYA 1N5SA 1VQ9S 3FEYB 3RBEA 3AB2B 3WIUA 1FA0A 1R6YA 3GSDA 4FXWA 2VF3A 3BPDA 1AFJA 2Z0GA 4X62F 1K0VA 4ZVGA 1IKWB 2V2ZA 3MZIA 2J7KA 4L75A 2RAQA 3A1YG 2CQIA 4IDKA 2WVCA 4I2QA 3OTDA 1RCOB 2HZVA 4QR0A 2FUG9 3C6TB 4USHA 3TNVA 4AD6A 2OTLS 3TI0A 5A8WA 3J81U 1M1KT 2ZNZA 1O8BA 3CIMA 5FLXU 2W9CA 1CVJA 4OHXA 3MEGB 5DO2A 2KKHA 3WQPA 4UOCA 2VA2A 2KT2A 4QWAA 1S77D 3MEDB 4NYPA 3W8GA 2BDPA 2OPPA 4MIBA 2YQ1A 4LF5J 2VBXA 4ZPTR 2V4JB 1SKWA 4LSNB 4DV4J 3CCJS 2O01C 1MMNA 1JLQA 3UNGC 1KONA 2RNEA 1KSPA 3ICLA 3BN4A 2BW2A 1V3RA 4ZVUB 4GRSA 4V19J 4C11B 4H4MB 4N41A 3RBXA 2BXJA 4WFXA 1N32F 3AQPA 2DNPA 4WFNQ 5HLFA 2R3VA 2D9PA 1EZZB 1VIOA 2HEKA 1OY6A 4AL5A 5LSRA 2J7UA 2HHXA 4JI6F 2GJIA 1YBAA 1WC4A 2LA6A 2U1AA 2BE7D 3NNCA 5L1IA 1JLFA 4NRTA 4EGLA 4C8LA 2HFVA 3SBMA 2OHDA 1X9MA 4OI1A 3QPIA 5EX0A 1FKPA 4BWJA 2V0NA 3SEOA 4RX6A 1RLCL 3BGLA 1FRMA 4P10A 3ILJA 4DFJA 4FXVA 3IS9B 4HTIA 3RYLA 4HYKA 4HACB 2B8QA 4N7TA 1OS5A 1U7LA 4KT0C 4PXCA 1RTIB 2RDJA 4DR1J 4WYLA 2KZMA 2CQPA 4C8YA 2CNLB 5KT6A 2G0IA 1RT7B 4DF8A 3MI7X 2IVMA 5A6WA 3ZNJ1 2GO8A 1SKRA 2KFYA 4DUZJ 1DFDA 3N6MA 1WWHA 3D6FB 1VQYA 1B4SA 1OYEA 4JI0F 3HT3A 1LXJA 3VGTA 3LPYA 1N6QB 1ITPA 4LFAJ 2WRMA 1NBEB 1Q86T 3N01A 5D77A 4NYZA 4K5SA 1FRIA 1FXDA 4KO0A 3OL7A 1N0VC 1FE0A 5IT4A 1PC5A 2WVDA 2M88A 3DLLQ 1X0PA 1WKKA 2A18A 1TV6A 5G0RA 4ES3A 4C8NA 4DQRA 4L76A 6FD1A 2FY1A 1HQUA 1GMWD 1VDHA 3EDQB 5B09A 1YITS 3HZGA 4ED1A 1NZAA 1EQ0A 2XNRA 4KGVB 2P9CA 2Y8WA 4USVA 1DARA 4ECZA 2XY5A 2OELA 1YRUA 2M8DB 4QJVA 4PXBA 3K57A 1NSKL 3CWJA 1EX8A 4QCLA 1WF1A 3RAQA 4ED8A 4IR9A 1JLAB 1B99A 1ZAWA 3MAQA 2DPJA 3C15A 1IKVB 1WJ9A 3B78A 4ZDNA 2UUWA 2ZC3A 4I68A 5CHCB 3TP2A 1GQEA 1K1SA 4OI3A 2R2SA 1TFWA 2XC9A 3DN9A 5IQQA 5D3GA 1F1BB 4ID8A 2DXFA 5G4DA 1RAEB 4DPTA 4F67A 4E0DA 3FBCA 2J9EA 4DSJA 3SQGB 2BVZA 5BYRA 3HDSA 4IG3A 3Q8YA 4YB1P 1YBTA 2IAJB 1KOHA 3BSNA 4LVOP 4A8MP 1HR0J 1GX6A 2MZRA 4J9NA 3Q8VA 3BR9A 2MGZA 3DM2A 3HHLC 2QN6B 1PAUB 2UXBF 5F8GA 2N7CA 2XLKA 2B4OA 2V6AA 2OH2A 1G4CA 5F3TA 1WKLA 2CJ9A 1N5YA 2B6AA 2HNZA 2ZWOA 2R2RA 1HNWJ 3B4MA 1JLGA 4EK2A 1SBRA 3ETMA 1RHMB 1YJWS 2EC2A 1UWBB 2UV8G 2FHOB 4DR5J 3ZZPA 3MD3A 3RUBL 4B3SF 2ZUGA 2F8MA 2QFJA 4OIXA 1VC5A 1RHKB 1I51B 4EU0A 1Q8IA 5A0YA 5K8OA 1W7WA 3I87A 4PWDB 1MSWD 1Q4RA 4Y28C 3EGWB 4LF5F 3DHXA 5I3PA 4KJIA 4XPCA 2AYGA 2LVWA 1S9GB 1KR4A 1Y9OA 3QWPA 4DV4F 2HHWA 1V3SA 4DPUA 2MXYA 4TY8A 1XJWB 1OY9A 1YJUA 3KK2B 2C3UA 3MECA 3G6YA 2DHXA 3R7SB 3UI3A 1NDCA 4KAIA 2E1MC 4FF4A 1NKCA 4F2RA 4PUOB 2VOOA 2OSRA 1U1QA 3F56A 3T9NA 4EBDA 1R43A 1RDRA 4ECRA 1VJWA 3M2UA 4DS4A 2CDRB 2BANB 1XQIA 5C25B 2XSFA 2BR0A 2GO9A 2Y1LB 2VBYA 1BQMB 2HQIA 4CM0A 1LW2A 3DOKB 3IRXB 1W2BR 3CVKA 1CULA 2R7SA 2KT5A 3BH6B 2V8GA 5D4NA 3QGIA 2OSQA 1KRPA 3QGPA 2W8KA 1JK9B 4DV1J 2LQJA 1SH3A 3OR2A 3PKMA 1N48A 3OPKA 3EE3A 3J81Y 1Y5LB 1VBXA 2PA3A 1VQOS 5FLXY 3IR5B 4NA2A 1NK9A 4LF6F 1UTAA 2FJWA 4RNHA 1T02A 2HHUA 1SC4B 1FXRA 2E5HA 4GC7A 2MQMA 3EVOA 4WTYA 5EUHA 2LECA 3GZ7A 4DV7J 1S4EA 2XMMA 4YP3A 4UW2A 1NK4A 1I94J 2VG7A 1X5OA 2HRUA 3MOJB 2RQKA 5HROB 2VG6B 2OEKA 3M8QA 3HKZD 4UOHA 3FSXA 1NK0A 5D0GA 2B7BB 3BEGB 3A4TA 1RWNB 3N6LA 3G6XA 4BBYA 3K5MA 4LFAF 2DNZA 3PJWA 2FLPA 3N79A 1YJVA 3GMGA 3QT8A 3HZEA 4Z7CA 1RLDA 4UOGA 3IG1A 3HXMA 3MM5A 4NZ7A 2FHJA 1S1TA 1VBKA 4P2MA 4WKYA 3PEHA 2CPHA 5F41A 2W7AA 4OYXA 4PQAA 4HH0A 1HNXF 4NLWA 3Q22A 4R0JA 2BW7A 1TL7B 2MQQA 2KG0A 4K50A 2JC1A 2R7XA 1NO8A 3PO4A 4NA3A 3D66A 1QD1A 3R5BA 1UVKA 3K5OA 3NGTA 4LFBJ 3P6YC 1M5PC 3QFHA 1U0HA 2PMHA 4DN9A 3UR3C 1AZSA 2VJUA 2BA9A 3AB4B 5IT9U 5KFKA 3DI6A 1NSAA 1S97A 2QA4S 2LEPA 2JZ5A 1DTTA 3K7RA 1S72S 3W2VA 1MWQA 5B0GA 1RAGB 4CI0B 1SV5B 3W63A 1JLEA 3HHNB 3SQOP 5B08A 2DHGA 2FC9A 3HVAA 3U02A 2PMZD 1B7YB 3CJ4A 3H2UB 2ZJQQ 1IWAA 3BGOP 1XIQA 3M6UA 4LR9A 3I31A 2HLUA 3MR6A 1C0TA 2BX6A 2ZDOA 3L3CA 1AB8A 1W25A 4J9QA 2EI5A 4IOAQ 5FD1A 4WIIA 2X7IA 2E5GA 2DRAA 1VQSA 4MT1A 4J5OA 4N77A 3A12A 4CZCA 5GVQA 1IKXB 1PJ6A 3FMBA 4D3HA 1B0VA 1ZM9A 2OI2A 3SV4A 1VHFA 1TK5A 2I5JA 1HR0F 3H4BA 4CLWA 3GIIA 3DLJA 2MZ1A 1SH2A 5D0RA 1DRZA 5ADZA 4NLUA 2XLJA 4P73A 3PHEA 1S7HA 4RUBA 3LP1B 3OL9A 5FJ4A 4GO7X 2F4VJ 3PX4A 4Q0BB 3W2WB 1HI1A 3M9OB 4ZP8A 1QDUB 4FS1A 1RT2A 1RB0A 2VQFJ 2P9GA 2ZH8A 3KMSA 3PR5B 1Q1KA 1HNWF 2HW3A 4HDHA 5AE2A 1Y3JA 1N56A 4OV1A 2ZBPA 4MK8A 4IO9Q 4NX9A 5DG8A 3DDNA 4ID5A 4DR5F 1FNXH 5LMNF 4USIA 1X4EA 3SFGA 2JJ4D 3CD5A 4KPCA 5ETLA 3LOUA 2R8IA 1JJ4A 2JLGA 3PR4A 1NCLA 3B8HA 5A8KB 2BMBA 2HK2A 3QBCA 1S1VA 1R6VA 3HPOA 3MMCB 3I0RB 1VIXA 2XHCA 4ZHRB 4ES1A 3KFWX 4EWTA 2VKZG 5KT3A 3L09A 2QMWA 3MM9B 4E98A 2UVVA 2Z30B 2PSZA 1MU2B 4PG5A 2LLZA 2KTQA 3DLKA 3NBPA 4ZMMA 3TUZC 2CWKA 2CNOB 2EKYA 4A8QA 5D4OA 3DYAA 2Z4PA 1IJFB 1TVRA 4P2SA 4J9OA 4I1TA 1NPRA 3NWRA 3ZZYA 1ZH5A 1X31C 2MZSA 2P8IA 2NPIA 1V5VA 1PBUA 5J2QB 4WK3A 4DR6J 4OYMA 1RZMA 1DHMA 5LOQA 1RTJB 2DNYA 4C8OA 3L7UA 1WHWA 1IKWA 1CJKB 2MQPA 1T3OA 4A8FA 4JBCA 2YNGB 5K20B 3QAEA 2YNHB 5KT4A 2FTRA 4JYAJ 4NI2B 4IUFA 1PC4A 1B0PA 1HWUA 2KB2A 2HHTA 2EFPA 3HHLD 4DSEA 3C6TA 3CJSA 4Q5VA 4DCPB 4J37A 2PI4A 3EZUA 4DV7F 3RGIA 1V6HA 2RD5C 2E1PA 4WE1B 3MEGA 3AOAA 2W24A 5E3AA 4ECTA 3MEDA 4OFZA 3DC2A 4ERDA 2X3DA 1UWAA 2MDAA 2YWWA 1UETA 3VAJA 2KZZA 4PYDA 3BQ2A 3VAGA 2V4JA 2O67A 2ZBQA 4NWBA 2OPSB 2AEFA 4LSNA 4U6PA 2HHPA 4DSIA 3KYLA 3UNYA 2QGFB 4QIGA 3G96A 2ZUAA 2LXFA 3TARA 5FDLB 2DRBA 4HEA9 2ZH1A 5HVGA 4C11A 4QWBA 4H4MA 3PO5A 5H9FJ 3BO3A 2AYBA 1WDTA 3NG8A 2V8PA 2ASYA 3CNQP 1EB0A 3S6EA 4C8MA 3ILLA 4HH1A 5GMKa 2XWXA 2LDYA 3GIMA 1U1NA 3JAMU 2CXEA 2H4YB 1UZHA 2Q6CA 4ILLA 4EYIB 3OD2A 4RL1A 5I4MA 3MDFA 3UDLA 4OQJA 3BB5A 3HP6A 1U49A 4XAKA 3ZXWA 3CB4A 5KFSA 4DCJB 1TL4A 3IS9A 3AA8A 4PCQA 3T1HJ 2AQ4A 2JFKA 3QIDA 4FYYB 2VPWB 1RTIA 1FERA 2FZCB 4NEZA 3A3NB 1Y0HA 4RW6B 4X65J 1S76D 4H4KC 1S9EB 1MW7A 4DBQA 3DU5A 1VQNS 3PYDA 4DDFA 1KQGB 1K0TA 5LXYA 3ET6B 4ZN1A 1RGVA 2A1BA 2E44A 1FJ7A 3CO0P 2Y8YA 2MLZA 2ZH7A 3M8SA 3H5YA 3W64A 2FIUA 3PRVA 5AXKA 3BKFA 5A2QU 2CPIA 1N6QA 2F4VF 3N5FA 3R2DJ 4DFMA 2O1PA 2V69A 2QA4G 1CS4A 1LK5A 4M5NA 2OPRB 4J90A 1VLOA 1DQ9A 1PKUA 3ENQA 5CZXA 3CO9A 4JOUA 1E6YB 4YEAA 5K8NA 1R8HA 4RLEA 2AJ1A 2PMWA 2UV8A 3EVWA 4EO8A 5E3QA 2HGLA 5T41A 1LW0B 2YH1A 3VAKA 3WDOA 3L7OA 3EPGA 1FDAA 2JDJA 2AJFE 1XN9A 4WTOB 4RPFA 2CG8A 4P72A 3GU0A 3O8WA 1Q79A 3NGRA 3SSQA 4LREA 3U1MA 2JSXA 1P9YA 4OYBA 1JLAA 3DRSB 3ZTQA 4Q2MA 1FFWB 3BGFA 3GPAA 4NYOA 2VFRA 4DV3J 2VODA 2KI2A 1IKVA 1Q53A 4DV6J 4P7TA 2X1AA 4ECYA 2E5LF 4RBVA 4J9PA 3KHHA 4EYHB 1IR1A 2F65A 4DLGA 2XZTB 4QYZJ 4JI5J 3BH7B 1RTZA 3GP9A 1HYSB 3SQGA 3AJ2A 3IO1A 1H38A 2MYFA 3R8YA 4IQXA 1XR6A 2IAJA 3IFEA 2WZ1A 5C7PA 1T95A 4PABA 2C22A 4M8LA 3TQEA 2AT1B 5HQLA 1FEHA 4X66F 4NPOA 4Q44A 4JYAF 2CQ1A 2DNGA 3NEKA 2E9RX 3I96A 4UZBA 4YR3A 3CE8A 1EKRA 2W4PA 4YN3B 1FD2A 1UWBA 2BV3A 5IT0A 1M5VC 5B0EA 4J9KA 2NQPA 1IKYB 4F4WA 4LF2A 1X9WA 2M70A 3OV7A 2V9KA 1KLMB 3SMZA 3V4IB 2JEGA 2PEHA 1TZ0A 1GTHA 1HARA 2BJ1A 2YWKA 2Z57B 5DS7A 1RCXB 1URRA 4FVCA 3LQVA 4IFVB 1N0UA 4C97A 4PWDA 3M32B 1H2UX 2LA4A 1RKIA 2V50A 4LT6A 4XO0A 3ONQA 1S9GA 4ED5A 4ZVEA 1HBUB 3KK2A 1K9MT 4MYUA 3R27A 4DZDA 3K0JA 3JTNA 3RRHA 3FQLA 2HWHA 4A8SA 3DLGB 3W5ZA 3MWBA 4LRBA 4PUOA 2MJUA 2FGCA 2Y0SD 3IWNC 2YVSA 4AE5A 2XO7A 2YNIB 4HHHA 2YX7A 2BANA 4M5JA 4NCGB 5C25A 2CQBA 2RSQA 4M5GA 4WKRA 1F2HA 3MGJA 3DOKA 4KB7A 4P52A 2FJDB 1NLKL 2AZ3A 5EWGA 4KC5A 3TO8A 1JXLA 3CJ8A 2HGMA 4M5DB 4MH8A 5F0UA 2J9CA 2NREA 3PEJA 2L08A 2IVYA 3OVBA 3T1HF 4WP8A 2ASJA 3IC1A 4HHJA 4DQIA 4A8OA 2KYZA 1EHWA 3MCNA 1WELA 1RWMB 4I69A 1Z2ZA 2IDEA 3BREA 3EXCX 2MQNA 2EWHA 1U8SA 3OFGA 5RUBA 2GIQA 2MKJA 3AY0A 5HROA 2VG6A 4NZ0A 1SQEA 2H4WB 4IRDA 8AT1B 1X7VA 5HJYA 2WVBA 3FUYA 4KY3A 3VAHA 3C2PA 1TU0B 2MB0B 3KWMA 2BKPA 5HMZA 4CO0A 1YBUA 4O3PA 5KOXA 1UFWA 5J2MB 1WI6A 4DPYA 2C2MB 3PFOA 1QAYA 4DX8H 1X4BA 4TU7A 1UFKA 1TL7A 4IFYB 5DRKA 1LOUA 4UT4A 1WDDA 1F5CA 3G9CA 2DKOB 5L38A 4JI2J 1NZ8A 2L9WA 4YFUA 3NGKA 1KC8T 1FRKA 4B9LA 3LP2B 4ZLJA 2BJ7A 7AT1B 3PNIA 1WTFA 5L46A 2XQCA 4MJKA 1RBAA 1NUEA 2XMUA 4DPOA 1MN7A 2EC0A 1DBDA 3QWUA 1SV5A 4QIFA 4LR8A 1N34J 1R8CA 3MMJA 3CCUS 2DCUB 2G9OA 3SCJE 4YB7A 2FJXA 4C0HA 1YG0A 3GR1A 3Q89A 2IMOA 4F4ZA 4DV6F 4F02A 3DOLB 4ECWA 2PC6A 2GAGC 3OXGA 5KFNA 2FGOA 5B0DA 3LWLA 2J6TA 2KRBA 3AAWB 3KLVA 1FCAA 2YX1A 4JI5F 3C46A 1C0UB 5A2QY 1W2IA 1IQZA 1IKXA 1D0EA 1QAJA 4FZVA 4MAKA 5E2QA 4Q43A 2VUGA 2BE9B 4F3QA 4OL8A 3MPVA 3TX0A 2CVIA 1DAXA 4OI4A 1H98A 2OGUA 4CLSA 2DGXA 2R8JA 4B3RJ 4Y00A 1FFGB 3MM6B 3MFHA 2K06A 2Z58B 4YOEA 4Q0BA 3IWXA 3W2WA 4A8XA 3IA0A 2M52A 3G2XA 3MPYA 1F5AA 3ZZUA 2CQ2A 2ALYB 5E7OB 5KTQA 4OZ1A 3TA2A 3MUVP 2HNDB 2B0GA 2AYEA 2POKA 5K8PA 5HP1B 2WHOA 5CZVA 4UUWA 3IXQA 2IVFB 2ATCB 5A8KA 2B9EA 4B9VA 3MMCA 3KLGB 3I0RA 2HVDA 4OYWA 4ZHRA 3A3OB 1SL2A 1WD6A 2MQLA 3WC2A 2U2FA 2NXCA 2J6SA 4OYIA 3CDAA 4HVZA 4R0EA 4X4RA 2DHAA 1MU2A 3M8YA 1OQ6A 1KOOA 5LJ3Y 3Q0AA 4K4ZA 1RYSA 5BYQA 2QLWA 1PGZA 3IBWA 4DV0J 3KLHA 3EX7B 4X4VA 2QE5A 4ZVTB 4CLPA 4DV2F 3TQ1A 4DUYF 4L6V3 2OJ3A 4R25A 5IOLA 2DO0A 4WCEQ 2GFFA 3U1NA 1B3TA 2ZHAA 1Q5VA 1SL0A 2Y1RI 2FLLA 4OHZA 4Y3CA 2NXUA 2VU5A 1U6ZA 3SZ2A 2ZD1B 5EN1A 1ZBTA 3UD5A 4F4KA 4ZVOB 5AJ3F 1RT1A 2CQ3A 3D3BJ 1CJKA 2VHGA 2C2DA 2YNGA 4OI6A 1SPBP 2P6TA 4F3OA 1R0AB 5K5MA 3DOMB 4ZJOA 1H73A 1PCAA 2JC0A 2XI3A 3FRZA 1PYOB 1VK3A 4NOHA 5IV3A 3L95X 5CCMA 1VHIA 3ZZ0A 3ILOA 1X5PA 3E51A 3JYTB 3M30A 3AXKA 4JI7J 3R97A 4URSA 4YR2A 1Q16B 4WE1A 3PW7A 3FQKA 1YWXA 3BF4A 3R5AA 1A7GE 3BBFA 3Q2SC 2R7RA 4B08A 4Y34A 3TEGA 2VBWA 5BXIA 3R3TA 4XTTA 1TKXB 4MMOA 4DL3A 2ZITA 4KSEB 1UJ6A 1BXNA 1T03B 1XK8A 2JH3A 1CBKA 3QRRA 2Z56B 1ZS6A 4LF4J 5FDLA 5KFJA 5CYQB 3O3LA 1HI8A 3HJVA 1UVNA 1HHQA 3LWMA 2PDAA 4TU9A 4KKOB 1U0SA 2QO3A 2VC0A 4TLQA 4K7QA 3Q8SB 4P9SA 4EBCA 4UZCA 4UTGA 2E9TA 3K89A 4K4XA 2KXNB 2XB2D 2V8DA 2J0SD 2YPYA 5J1NA 5KG7A 3EMTA 4OI2A 3HSGA 1RT3B 2UUTA 2DYAA 3M6WA 3BDEA 2RILA 2X3GA 4J9UE 3IBCB 1WOOA 2X51A 1NK7A 4FYXB 2W7PA 1RT6A 2DHSA 4BCAA 2DR7A 4CLKA 1N34F 3GFZA 5HI7A 1WOPA 1DURA 3KUGA 1RWPB 4TNOA 5ETQA 1QM9A 1AW0A 2EBGA 3AQOA 3QGGA 1WUUA 1UEVA 5AT1B 2Y0BB 2RKIB 1XERA 3MTKA 4RW6A 2V2VA 1S9EA 3ISNC 4ZJQA 4C3LA 2UXCJ 1FJGJ 1NXIA 1UFLA 1GFWB 4OHVA 3ET6A 1BQNB 4DQSA 3UCGA 4RNOA 1WC6A 3Q83A 1JJ2R 3GTYX 3TA1A 4P71A 4HR2A 4ELUA 1HA1A 2JVRA 5CYMA 4ZP7A 1UJ4A 3KLIB 4KGXB 2PO4A 1RE1B 3NCRA 2OPRA 3RW6A 4G3IA 4MKBA 3B4DA 3TJ8A 2KJWA 2PI5A 4O3NA 2FY8A 5BYSA 3TYTA 4NLGA 4B3TJ 1H74A 3TUJC 1KWMA 3K17A 5THWA 1E6YA 2DGVA 2CQHA 2O66A 3CW2C 5CA5A 1T94A 1NJXA 5KG1A 2IJFA 4OI0A 3H59A 4N8NA 1T7PA 1M0SA 1LW0A 1SI9A 4ZIWA 5HSPA 1ZM4A 3TZXA 4V1Ak 2E7WA 4ZCIA 2VG5B 3KNAA 1PG5B 1RBOB 4A47A 1O6XA 1VFJA 2DEJA 4Y2IA 4B3OB 1R27B 2IPOB 4DFPA 4CRJA 1UVIA 1SQFA 3T3FA 5L9XA 3V6JA 4RW9B 1KDNA 2MKHA 4DV0F 2FZKB 3DRSA 3KUEA 2ZBIA 2BUNA 2VOPA 5DQHA 2R7UA 2GHVC 2E9ZA 2J0WA 3QYYA 2C28A 2NZ4A 2NPFA 3KJVB 2MKIA 4G65A 4JB8B 4S0MA 3W9JA 1RADB 4DMZA 3G8SA 2K2PA 3NMAA 4ZVRB 4BHQA 4YDXA 3HD2A 1Q8LA 3FSIA 3HHEA 2DB1A 4MFBB 4JI1J 4JV5J 3DRXA 3RRKA 1F3FA 1MMDA 1LWCA 1GTEA 4LF7J 1ZPWX 2AX1A 3PYEA 2RF2B 3M8WA 5HATA 1WG4A 3K59A 4DL5A 2OIHA 3NLCA 4JI7F 2L41A 2W4CA 1KLMA 1GMVA 2EFNA 1U25A 3TVZA 3P49B 4K2JA 3MUTP 3GYXB 4J91A 1WEXA 2XZDB 1RUSA 2BM0A 1UA0A 3C8YA 3IM8A 2NXNA 3NOGA 4IFVA 3M32A 2VPXB 5L39A 2CPYA 3T5HA 2HIQA 1HBUA 4OLPA 5A76A 4X2BA 4LF4F 3R9LA 3T9ZA 3FK4A 3VQSA 5DGBA 2QC3A 1J5OA 2YKMB 1OO0B 2LYVA 3DLGA 3ZZRA 5LMUF 2YNIA 2HLTA 4M1KA 3TZWA 4KHPF 4NCGA 3HCXA 2AW0A 2IRXA 3DU6A 4DL0C 2CJAA 1P1LA 3ENAA 1YI2S 2ILZA 3H2LA 3X1LB 3DMJA 4W4MA 4OYAA 3RR7A 1FVQA 2N3LA 3TZYA 5F8JA 4C8ZA 4M5DA 3AH6A 4DJBA 3MHYA 4DU8A 1CJTB 2FHJD 1GMWA 1TK0A 5JMNA 1S99A 4DZ6A 1IBLJ 2F4FA 1KEKA 4M5IA 5LT5A 1WNEA 2DNMA 3O2IA 3SFUA 5T7LB 2G2ZA 1QY7A 3DCAA 3VVTA 2F8HA 3MCMA 1REGX 5KFBA 4JI3J 1HQ2A 3RB4A 4F4AA 1GMUA 3KG4A 2UXCF 2XGPA 2LCWA 2W9BB 1T11A 5DGAA 4MIWA 2ZE2B 1CJVB 4Z2XA 3T6BA 2LQ5A 2O3DA 3AFGA 3R5CA 1U4BA 1FRLA 1NPPA 4NL5A 1YLXA 3AJDA 3JQMA 1YZ7A 2R8HA 3OVSA 5DM6Q 1OSCA 3IRWP 1APSA 2XBPA 2J0QD 3HMJG 3UVJB 3FDSA 4C8KA 5KG6A 1H2TZ 2KJVA 1FHTA 4JI4J 4J9LA 3G71S 1P6TA 2KG1A 2L9NA 1O5JA 4DLEA 1RYRA 2GZOA 4HT5A 3E3XA 2YNFB 2JEJA 1TL5A 2ZFHA 3EZOA 1G3OA 4NLOA 3QRQA 4IFYA 2IFXA 3OTEA 3V5RA 4PEOA 3FCWA 5BR8F 4LBPA 1HBOB 2HZAA 3LP2A 2CAJA 1HI0P 2GX8A 1WKJA 2F9DA 1U48A 3MUMP 4OYZA 4G1QB 1S6OA 4DR4J 2DR9A 2VDHA 4AYBD 3G8TA 3CCVS 2DY1A 2XEXA 5E41A 2NXJA 4K4YA 3QO9B 4X4PA 4K0KF 3ENWA 2DGUA 1WG1A 2K8GA 3VCDA 5KG3A 2HFSA 3AHPA 2ZC4A 3TANA 1T9WA 3RBZA 1FWKA 1M5OC 3W60A 3DOLA 4WIQA 4LF1A 2NSBA 1XMOJ 1TTHB 4OZ2A 1KNZA 4IYQA 4QPXA 5J1EB 2R7TA 1RWXB 2HBZB 1C0UA 2J9DE 3D68A 4LF9J 3BO4A 4F7VA 2AU0A 5KFIA 3DLHA 2HPUA 4B9NA 3EM1A 4YB6A 4ZCMA 2J8AA 4MTPA 3EGVA 3S8SA 3ISND 2OUGA 4JI1F 3H40A 1K8AT 3F0NA 4ZPVR 4XDCA 3W1YC 2H5JB 1AT1B 2VQEJ 2ZOFA 3MM6A 4J9MA 1MROB 4CNZA 2PEBA 2AF6A 4PG7A 1WSRA 2Q1LA 4RR5A 2BJEA 2EPIA 4WP3A 2PN6A 3HF5A 2HNDA 2N4DA 2ROGA
chains in the Genus database with same CATH topology
3UWTA 5HP1A 2ACYA 2HHPA 3I5BA 2BZ2A 2IC3A 1XNRF 2DGTA 2Q43A 1R89A 4L72B 2XLIA 3GR0A 4A46A 4DSIA 4LQ3A 2PA8D 5E3CA 3KYLA 3HVTA 4EZ6A 2ATLA 4QIGA 3MEEB 4TYAA 3G96A 2XWYA 2KFNA 2LXFA 1Y3KA 3TARA 1TV6B 5FDLB 4B9MA 4IQMA 5G0RB 2DRBA 5A8RB 1NRKA 4DF4A 4H4OA 4HEA9 5DLGA 2ZH1A 3MR2A 3OL6A 2ZKTA 3KLGA 1ZYQA 4C11A 4QWBA 4H4MA 4I6WA 4UY85 2GIRA 3VZHA 1HQUB 3HHKA 2VBZA 3N4WA 5BJRA 3GIJA 1GXTA 5H9FJ 3MD1A 3BO3A 3D1OA 3PO5A 2AYBA 3JAMY 4Q8EA 1TL1B 4OX9F 2WW8A 4FVMA 3DLBA 3NG8A 2P9EA 2MHNA 2ASYA 3H20A 4I56A 1TR0A 1N36F 1H2VZ 2WONA 1IBMF 1F9FA 4ZP6A 4H4KA 2HS0A 3S6EA 3HO1A 1IJEB 5E0OA 4C8MA 4HH1A 5GMKa 4CIOA 4FF1A 3NMRA 2XWXA 4UUXA 2FPHX 1D8YA 3EYZA 2LDYA 5E5NA 4Y0FA 1VQPS 4PR6A 2RQCA 3GIMA 1HHSA 1SJRA 2XS2A 3OL8A 1U1NA 1QVFR 4I64A 4ELTA 4OMFG 3UR0A 2PGCA 2Z2LA 3BJYA 2ZH5A 3N28A 1N8RT 3TA0A 1MWZA 4I2PA 4CO3A 2AP6A 1TP7A 4I67A 3MXHP 1BLUA 3LAKA 2Q6CA 2JFDA 1FK9B 1N54B 3D2WA 1VQKS 2B56A 4ZPWR 3V81A 4W90B 2VH7A 4ILLA 2UZAA 4EYIB 4K4VA 3VWSA 4LIWA 1ZM3A 2EG2A 4M63A 5I4MA 1YJRA 3MDFA 3P5TL 3UDLA 4OQJA 4ZPCA 1HWLA 3BB5A 3QIPB 3SV3A 3HP6A 2AGOA 1IXKA 1U49A 4XAKA 2DNQA 2M8HA 1D1UA 4MK7A 3CCTA 3RW7A 2AWZA 3PW2A 2FVQA 4WZMA 3CCRS 3CB4A 4NLVA 5D3GB 4RNMA 3ITHB 5KFSA 1TL4A 4B9TA 1N4LA 5I42B 2HGNA 2YKAA 1HW9A 2K1RA 3NAHA 2AGPA 2RB7A 1N5VA 3OXFA 3OTCA 3IS9A 3AA8A 3HFKA 3M9NB 4LSLB 4PCQA 1N5QA 4B17A 1NHUA 2JFKA 2AQ4A 3QIDA 1QE1A 1FTCA 2B5JA 4DV3F 4ZP9A 3OLAA 1P27B 2FJEB 3BO2A 5CXTA 4IG3B 2VPWB 4DL6A 4FN5A 1KFSA 2OTJS 1BWEA 2GMHA 3H5UA 1KTQA 1I1GA 2IM1A 3CMAS 3T5JA 1J2VA 1HNZF 1Q7YT 2CPJA 2ZD1A 1RTIA 1FERA 4XK8C 3PRBA 3HLUA 5LJ5Y 1PO6A 1M5KC 1Y0HA 3KNGA 4CNYA 1H6KX 4KV8A 1HWKA 4RW6B 1S76D 1S6QA 4H4KC 1S9EB 3M4XA 1MW7A 1X8DA 3LALA 3RB6A 4DBQA 3DM2B 2R7OA 3DU5A 3DLEB 5HN0A 1VQNS 3PRDA 1DLOA 4DDFA 2V4QA 1R0AA 2HQ3A 3ETOA 2B9WA 2DITA 4O4RA 4Q8FA 1KQGB 2FLOA 5LXYA 5D8HB 1K0TA 2V94A 4CH1A 3DOMA 1O0PA 3V4MA 1RGVA 2A1BA 2E44A 1FJ7A 1YQHA 4U9RA 2ZH7A 4OZ0A 2XI2A 3I5AA 1N5YB 3M8SA 1SIWB 3LANA 3H5YA 2JLFA 1C4CA 1XMQF 2B6AB 2E1AA 2XMJA 4JI3F 2JWNA 2FIUA 1S49A 1ZAVA 2ZH9A 2A2CA 1CC8A 1JLGB 2EK6A 2YX4A 3LP1A 4ZVHA 3LF0A 3M9MB 5AXKA 3PX6A 4ATNA 5B0AA 3I0SA 1F5BA 2CPIA 1TQLA 5C42A 2IYGA 1RISA 2DCLA 2D41A 1N6QA 2F4VF 3N5FA 2IBKA 2ZZNA 1TKZB 1QAXA 2EFVA 4DFMA 2UP1A 2O1PA 1K1QA 3NWGA 5E3RA 2IMWP 3CDEA 4O3QA 2QA4G 1IQTA 4F50A 4RNFA 1LK5A 1FKOB 2OPRB 4NLSA 2GQ2A 1SIZA 5A0YB 4N56A 3TVKA 3DFEA 1ULRA 1TKXA 1DQ9A 3I82A 3BQ1A 4UY8T 1G6BA 3ENQA 2QEXS 5J2NA 1RT4B 3CCQS 1N33F 5C24B 4NLPA 1HPZA 1G7CB 1FDBA 2V5HG 2VFUA 3NS6A 5CZXA 3BN7A 3CO9A 4JOUA 3OSNA 1X4HA 3MURP 4RKUC 4OLOA 3CCMS 1KLNA 4LF8F 1E6YB 4YEAA 5K8NA 3E8OA 5E3PA 5JUMA 1R8HA 3RRGA 1T03A 2BJDA 2MJNA 4RLEA 1ROFA 3NNHA 2AJ1A 2UV8A 4ECVA 1C4AA 1F0XA 4NMLA 1NJYA 4WFYA 3C3LA 2HFOA 1OWXA 3MFIA 4KHRA 1HQEB 4QZVB 4ETZA 2DBBA 4RW4B 2C3MA 2MSSA 5CYQA 5B0CA 2Z8QA 1DTQB 1VI7A 3MECB 5E3QA 4EO8A 2HGLA 5T41A 3M1VA 2DISA 1LW0B 2YH1A 3I9V9 1IBKF 1HMVB 1OPIA 2YQ3A 2YNFA 3CD6S 3VAKA 1R8PA 4QW8A 3WDOA 3T1YF 3L7OA 4KKOA 2ZH3A 3SI8A 4AXJA 3EPGA 1FDAA 2JDJA 1C1BB 2FLNA 2B51A 2AJFE 2BRLA 1XN9A 3MM9A 2GNKA 3M2UB 4LIRA 2F3JA 1MWYA 2GMJA 3G8QA 4O4GB 1T3NA 4DL2A 2C2RA 2CPDA 3O8WA 1Q79A 4OJGA 4X4OA 2GMLA 3SSQA 4OZNA 1XWLA 3HVRA 2K7JA 5F0WA 3U1MA 2FDNA 2NLWA 1YVFA 3PACA 1SJ1A 4ES2A 1RT3A 1LW2B 2JSXA 1FEEA 1TUVA 4F25A 2KVIA 1JLAA 3CJKA 3DRSB 4QIWD 1BQXA 2KRRA 2DTJA 4TY9A 4N5SA 4Q2MA 3QLHB 3CC4S 4C0OC 3RB3A 3BGFA 5AXNA 3HK2A 3BDPA 4LFCF 4NYOA 4OHYA 2HVHA 2VFRA 3TAPA 1QJHA 3ULHA 3G6VA 2CRLA 2KI2A 2JVOA 2WCXA 5M2UA 2VODA 1VMBA 1S1UA 1IKVA 1Q53A 3O1LA 1S1WA 5CCLA 3ZZOA 2DD8S 4P7TA 2X1AA 4ECYA 3LP0B 2E5LF 4RBVA 1MNEA 1V3ZA 3FCHA 4J9PA 4KE5A 2XMKA 4ILMA 2LMIA 2AJ0A 5DJBA 4R8UA 3KHHA 3OR2B 4EYHB 3MMAA 2A3JA 3LW5C 4DLGA 5KFLA 2C2EA 1RKJA 2ERRA 3SCKE 5J2QA 1KQSR 2CPXA 5L1LA 4QYZJ 2ZBCA 4Y2KA 3JSMB 4WZQA 4JUZA 5KFWA 1HYSB 3SQGA 3AJ2A 3IO1A 1H38A 5M2PA 3J7A1 1RTJA 2MYFA 1JXEA 4IQXA 4HI1A 2KM8C 1NB7A 1XR6A 4YR0A 2IAJA 1F60B 2M9KA 3IFEA 4ETXA 1B64A 5KFQA 2BM1A 2DGWA 3DRRA 2DGOA 1IUJA 4TQRA 3BM7A 5KFPA 1VC6A 1RI7A 2RKIA 1S0OA 1D9FA 1T95A 2C22A 1HW8A 4M8LA 2LEAA 1XMOF 4ICLA 4MKYA 4F8RA 3DXBA 1FEHA 2OLWA 4X66F 4Y2AA 4PXDA 2YNHA 4NPOA 4Q44A 4FP9A 4U67Q 1QUPA 3DRYA 4IG0A 4JYAF 2CQ1A 3HM9A 3D28A 2W9CB 3VR1A 4NRUA 3M2VA 4ITSA 2O5DA 2DNGA 1BQNA 2UVUA 4BS2A 2E9RX 1E6VB 3I96A 3IAM9 5K8MA 3W7BA 4YR3A 3M8QB 2GHPA 1SL1A 2YH0A 3CE8A 2W4PA 2WTFA 1Y4ZB 1S4FA 4TKTA 4QQBA 3UPFA 1SUQB 1KN6A 4KRWA 4JV1A 4PQUA 3AJ1A 4KHMA 1FD2A 1UWBA 1WI8A 1X4CA 1EETA 2BV3A 5IT0A 1M5VC 5B0EA 4J9KA 2CJKA 1KQKA 2NQPA 3M2RA 2W9AA 2RQMA 1IKYB 1VRTA 2ZKUA 2WSCC 1WF0A 2CKWA 4F4WA 1X9WA 2M70A 3OV7A 2FHKA 2V9KA 2NR0A 1KLMB 2DGQA 2B4PA 3SMZA 4YMEA 3RTVA 3V4IB 1FDDA 2CQ0A 3ISZA 3MM7A 5IS2A 5K14A 1L3KA 1H7XA 2DO4A 2JEGA 1HD1A 2PEHA 2F1FA 1TZ0A 3CT9A 1GTHA 1JNRB 1HARA 2HYIB 2YWKA 1RJJA 4WJBA 2I1RA 5DS7A 1TKTA 2DNLA 3BGRA 3DRPA 3IG1B 1URRA 4FVCA 2CDQA 3LQVA 3MM5B 4IFVB 1VOMA 1N0UA 4C97A 3J7YI 4PWDA 3GE9A 1S1TB 2V8HA 3M32B 4DL7A 2HG4A 1H2UX 2MY7A 2XY6A 1H7WA 4ED2A 4ECUA 2OPSA 3T19A 2LA4A 1TK8A 4RU9A 1RKIA 4W92B 3ENVA 3CDUA 5HMXA 2QMXA 4LT6A 4XO0A 4IRKA 3ONQA 1S9GA 1WHXA 2QZ8A 4ED5A 2FVRA 4ZVEA 1U47A 4O44B 1FRHA 1HBUB 1NEEA 2NSCA 2CVEA 2NS1B 3DNCA 4FYDA 5KFCA 5HLFB 1S6PA 3KK2A 1K9MT 2WOMB 4MYUA 1ZZFA 2HFZA 3R27A 3CC7S 3IR7B 2NUHA 4F4YA 3K0JA 1TL3B 1FJEB 4JI8F 1RWUA 2AYMA 4P6QA 4XIUA 3I55S 1NAQA 2DIUA 3JTNA 4WFZA 5IM0A 3RRHA 3FQLA 3WC0A 4A4JA 3CGIA 1U1PA 2GJ2A 1PSDA 1FT8A 2HWHA 1OIAA 3DLGB 4A8SA 3MWBA 3OXLA 1T8EA 4PKDB 4PUOA 2MJUA 3KLHB 2FGCA 3NL0A 2Y0SD 2C3OA 1HWJA 1NNDA 3IWNC 2YVSA 4AE5A 2XO7A 2DR8A 3N9UC 2YNIB 3DI6B 1HBMB 4Q2LA 2KXHA 1HFEL 4I4BA 2BQUA 1JLFB 1U2RA 4B3MF 1UJ5A 2YX7A 3QZ7A 4WFAQ 4B3OA 2QA2A 2BANA 4NCGB 7FD1A 5C25A 2MZJA 1DTTB 3R5DA 4JI2F 3RU0A 2CQBA 1ZTTA 3W2VB 4NCBA 4FPRA 2RSQA 2HMIA 1UVMA 4IRCA 3SSRA 1JLEB 2PD1A 1U09A 4C3MA 4WKRA 4QOTA 4R5PB 4RW9A 3CSKA 3MGJA 4QWDA 3DOKA 1VLYA 4KB7A 3JTPA 1LWEA 2N7YA 2UU9F 5KFOA 2FJDB 2K3KA 1HWIA 2LXUA 2J9DA 3OLBA 1UA1A 4FF3A 7FDRA 5EWGA 4HTJA 1JKHA 5KFDA 3R1HA 1P9QC 4PPDA 4KC5A 3TO8A 1JXLA 1X4FA 1QLNA 2IRUA 4K59A 1SJ3P 2MMYA 3CCZA 4KFBA 1XR5A 1VRUB 2DNRA 5J2PA 2HGMA 3OFFA 4M5DB 1C0TB 1REVB 3ZFVA 1LKZA 3KJVA 2RS8A 2VZ9A 2LKZA 2IBOA 4A8WA 1FKAF 1L3SA 2BQRA 4KTQA 3C6UB 3QJPA 3Q23A 2XMTA 1RT1B 4KQZA 1WF2A 2GC8A 4CO4A 2CPFA 4MH8A 3HVWA 1QSYA 5FIIA 5IQ6A 4KGKA 4OX6A 2YKNB 4LSLA 3H5SA 4GKJF 1JLBA 5F0UA 2J9CA 2NREA 3PEJA 1RQ0A 4TQSA 1WHYA 2DNOA 2NYIA 3FFIA 2HHSA 2L08A 2IVYA 2MY8A 3OVBA 3T1HF 5LXRA 1GAOA 4NLTA 2ASJA 1X4GA 5KFXA 4ECSA 4DSLA 3IC1A 4HHJA 5A6PA 4I7FB 4DQIA 1S1XB 2E7XA 2VASA 4A8OA 1KS2A 1OPZA 4G1IA 4PXEA 2KYZA 4MFBA 2W25A 3EZ5A 2VFSA 3FVYA 5AE3A 4DFKA 3OTBA 4CTAA 4Z37A 1M5SA 1WELA 3MMBA 1P8GA 1Z2ZA 4I69A 3D54A 1K73T 2Q79A 2BQ3A 3GWCA 3WX4A 2B9YA 3DXSX 5DQIA 2FVCA 3BREA 3D1HA 3EXCX 2B9XA 2MQNA 3NS5A 2D3OR 1VC0A 1BC6A 1VS3A 2EWHA 1QVGR 1U8SA 2GQQA 5F3ZA 4AL7A 3CXCR 2ZH2A 3R1LA 2XMVA 3U1LA 6FDRA 1AXQA 3OFGA 2ZDPA 3M30B 2ZHBA 1KVIA 4FBUA 2V2KA 4X4NA 1U45A 3MM8B 2GIQA 3X3UA 2HS3A 2IM3A