4YEAA

Crystal structure of cisplatin bound to a human copper chaperone (dimer) - new refinement
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
67
structure length
67
Chain Sequence
b'PKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper transport protein ATOX1
publication title Crystallography and chemistry should always go together: a cautionary tale of protein complexes with cisplatin and carboplatin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal transport
total genus 19
structure length 67
sequence length 67
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00403 HMA Heavy-metal-associated domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4yeaA00
2GGPA 3QMQA 4QOTA 1YJTA 1W2IA 2K7JA 2GO8A 1S6UA 3KKFA 3FGVA 2GV1A 2GFFA 3K7RA 4A48A 2ROEA 2XMUA 4OJ1A 2IYIA 4Y2KA 2KT3A 3BF4A 3BB5A 1MWZA 1N5SA 2OD4A 2L3MA 2Q3PA 3HFKA 5B0CA 3BR8A 5B0BA 3HX9A 1FEEA 1Y0HA 4HI2A 1YJVA 1LQ9A 2GGPB 3CJKB 2VH7A 1U7LA 1GXUA 1RJJA 5B0AA 2W4PA 1Q8BA 3HHLB 1KVIA 2QYCA 5B0FA 2QLXA 4OJGA 2AP6A 2XMWA 5T7LB 3WDOA 1SQEA 4DN9A 4HI1A 5B0DA 2GCFA 1AW0A 1GXTA 2FTRA 1X8DA 3LO3A 4NPOA 4ZOSA 3CJKA 1TL4A 4NL5A 2G9OA 3BDEA 1N5TA 1Q53A 4HL9A 4OJ3A 1N5VA 2EW9A 4OIXA 1ULRA 1X7VA 3HHLA 5B0GA 3TRGA 1TZ0A 1Y9OA 1OQ6A 2JDJA 1OSDA 1XBWA 2KYZA 2XMMA 2XMVA 1OPZA 2OD6A 3KNGA 2BYCA 4FNHA 5K9FA 1TL5A 3TNVA 4HH0A 4Q2MA 1JWWA 3HF5A 3KG1A 1R6YA 2ASYA 1N5QA 1Q4RA 2OAUA 2OMOA 4YEAA 2IFXA 2XMJA 2HFOA 1APSA 2ACYA 4ZA1A 3KG0A 1FE4A 1Y3KA 3I9ZA 2FIUA 1CPZA 1FVQA 2HIQA 1Q8LA 5A6PA 2KKHA 1VQSA 1JK9B 1OQ3A 1YJUA 4A47A 3BN7A 2HLTA 3BM7A 3MZIA 4YDXA 5F0UA 4FNIA 1SB6A 5A6WA 2K7KA 1Y3JA 3LGMA 1YG0A 2AW0A 2HLUA 3E8OA 2QIFA 2ZDPA 5B08A 3T9NA 4OJHA 2BJDA 1P8GA 3HHLD 2AJ0A 1VQYA 2IYGA 1P6TA 1QUPA 3IWXA 1FESA 2KT2A 3UDCA 5KAKA 2W4CA 2XMTA 4Y2IA 2RILA 2K2PA 1X0PA 2ROGA 2QLWA 1URRA 5B09A 4U9RA 1K0VA 2RMLA 4Q2LA 5B0EA 1CC7A 1SI9A 1TR0A 1YJRA 1V3ZA 2HQIA 2K1RB 2PGCA 3DXSX 4HH1A 5F0WA 2FB0A 1YRXA 2VV5A 2W4DA 2BBEA 2HFNA 3FRYA 3FMBA 2FHMA 3QGPA 2CRLA 2LXFA 1TUVA 2N4CA 1IUJA 2LDIA 5T7LA 4DPOA 2OP5A 2LQ9A 1WD6A 4A4JA 4EFAC 2PD1A 3HDSA 2N4DA 2K1RA 1S6OA 2OFGX 1MWYA 3F44A 5IXUA 4F67A 1KQKA 1FD8A 2OKQA 3DCAA 2BUNA 3LGNA 4DL0C 1FVSA 2XMKA 2AJ1A 2RU9A 3TOQA 2BJEA 2LQBA 1CC8A 2OFHX 4A46A 3MCSA 3BGUA 1AFJA 1FE0A 3IWLA 1AFIA 3HHLC 2ZDOA 4Y2MA 2ROPA 2GA7A 3VTIA 2RSQA 3GZ7A 1KVJA 2N7YA
chains in the Genus database with same CATH superfamily
4MK7A 4JI5J 1PBUA 1QUVA 3LAKA 2XY7A 3Q8YA 3TX0A 4YY3J 1OWXA 3UDEA 1C4CA 3GSDA 3UPFA 2JFKA 4JV1A 3K8WA 1S7HA 3JSMB 2C3YA 2EG1A 3MM9A 3I4HX 5KT5A 4UOFA 1S99A 2HVHA 1FT8A 2FHJA 4NYPA 4CLFA 4NMLA 4FKYA 5F3TA 3IR6B 4OLOA 2VDHA 1U1KA 2WBMA 3T6JA 1AA1B 4YR2A 2V9WA 1J5EJ 2O66A 4ANDA 4F2SA 2XBPA 3FCVA 4P74A 4YHHF 1TMJA 2V34A 1BUXA 2LLZA 2HVEA 4LF4F 2KO1A 1F3FA 1ZZFA 1M1GA 1JLCB 3IWLA 2AT1B 1FJ7A 1X4CA 4I68A 2BJ3A 3SSQA 2JLEA 2MQOA 1H2UX 3KKFA 4LRAA 1IJFB 4Y65A 2BXJA 3QAUA 2ROEA 2F9JA 3BB5A 5L46A 3TEGA 4X4OA 4N41A 3NS7B 3TVKA 2EBEA 3L4BC 5JMNA 4LF7F 3PYGA 1U0HA 3AOCA 3Q8PB 5KT7A 3PEHA 5DS7A 1M1KT 3HCXA 4ZK7M 1CJTA 4XDCA 3L3CA 3VVUA 2Z2ZA 1FVQA 4DX8H 4X2BA 1CQNA 4OJHA 4LFAJ 2IM0A 4PUOB 4EYHB 4USVA 2MZQA 3H5XA 1PSDA 3CCLS 3TO8A 3FRYA 2FZCB 4LBIA 5A8KB 4FYYB 1YGYA 4JI5F 2E9TA 1DURA 1DLOA 3O3LA 1R8HA 2C3PA 4IG0B 1PKUA 1L3KA 1JKHB 2HMIB 1WNEA 3EJMA 2B0GA 4J90A 3E51A 2Q3PA 1JLFA 2B7BB 1S57A 1HQUB 1BQNB 3OVAA 1ZAVA 3ISNC 5F8LA 1B70B 2AEMA 1ZPVA 4L3NA 1VDHA 2G9OA 5KG4A 2HNDB 3A8EA 5ADZA 3W1YC 3M6VA 4TU7A 2ALZA 1RB0A 4PCQA 3H0PA 2Q6CA 2NXNA 2HEKA 4O44A 1NSAA 4J9SA 3KDNA 1HNWJ 1S6QB 1XK8A 2EC0A 4IG3A 4PZVA 3G8SA 1S0VA 3CD6S 2DHSA 2JZ5A 1S77D 3GCXP 4RWWA 4KC5A 1K0VA 1HPZB 4OYIA 1QY7A 3QJJA 2R7XA 4B9VA 1L5UA 2CZ4A 1LWEB 5AXLA 3ZZOA 4ZN1A 1RT3B 4P73A 4QWDA 2CWXA 5KFRA 2N7YA 2BQUA 1GTEA 1TUGB 3W5XA 3CJ4A 3HSZA 4LF9J 3LANA 2CQ2A 4RPFA 1P9YA 2AU0A 2GMLA 3NOCA 4LSLA 5AT1B 3WIUA 1X5PA 2HS4A 1J5OB 2CNKB 4WE1B 3EPGA 3OTCA 4HYKA 1RISA 5KT3A 4JI3J 3DM2A 1O6XA 1KQFB 2R8IA 3PJ9A 3QT5A 4QQBA 4YB5A 1TL3A 2JOQA 5BYQA 4J9LA 1SL2A 1ACMB 5J2NA 4J5OA 4C0OC 1N0VC 3A8KA 3CO9A 2CQ4A 5DQGA 1N4LA 3N5BA 3OTDA 3W66A 4M5IA 5BR8J 2ZDPA 5GMEA 4LR8A 1G2EA 3RB3A 4F8RA 1FESA 3EPIA 1DTQB 1D09B 1Q78A 4NRUA 1VQ5S 3CJ8A 1OS5A 4EWTA 3IM8A 1YITS 4WZQA 3TAMB 3H5SA 5IT9Y 1RA6A 2KB2A 4F4WA 5KFVA 4JI4F 3PKMA 1NKEA 1U1LA 2B4OA 4OX8A 4YB7A 4YR0A 5LSOA 4JYAJ 4D3HA 2HWTA 1NK4A 1FEHA 4DMZA 4GVBA 2H5IB 2P5VA 4ECSA 4DUYF 3DRPB 5EUHA 1CJKA 3LF0A 4Q45A 2OHDA 4OX7A 1QTNB 3OJUA 1ZS6A 3ZNJ1 1NK5A 1U2FA 3KLFA 1SCJB 4J9VA 2WAQD 3AA9A 3NL0A 2CNNB 4P7TA 2WVBA 1D8ZA 1HNWF 4RW7B 3BJYA 3SI8A 3NNHA 4RW8B 4DR4F 2G2OA 4FF2A 1N52B 5CQGA 3BBCA 4F0KA 2LP4A 5BYSA 2MXYA 4OYBA 4F4AA 1N8RT 4ECRA 1WHVA 2DPIA 3BBBA 3D1QA 4DV0F 2E29A 4L6V3 4CT9A 2MKHA 4U7UK 3L95X 4P72A 1GFWB 1NUEA 2IA0A 3MEGB 1S49A 3PIOQ 3HHLC 3ZZTA 1Q16B 1WELA 4LF9F 4R25A 1TL1B 3MAAA 4U7UD 1IBMJ 2GO9A 2DHHA 3M2RA 2DRBA 3CPWR 2WVDA 1N5SA 2DNKA 1NJZA 3FJ2A 4UTGA 4KGKA 1JJ4A 3K58A 1VK8A 3U1LA 2DGSA 1S48A 2E5GA 3NAHA 4LSNA 3HULA 1OQ6A 4I7FB 4PWDA 4LSZB 4WF9Q 5BR8F 1RE1B 1S0NA 1T03B 3BZQA 4YDXA 3LPEA 3BR9A 3CDWA 2OPRB 5J2PB 4X66F 3HK2A 2ZWOA 1EQ0A 2WBRA 3H5UA 1FD2A 5CABA 4EZ6A 2G2ZA 1CJVB 1JLQB 4J91A 5KFPA 3PW0A 1KP6A 4UOGA 1U4BA 1N0UA 3SFUA 2ZH6A 3LGNA 1YIJS 4OI1A 1YQHA 3IC1A 3SCIE 3KK3A 1AZSA 1RAFB 2BJEA 3OLBA 4CNZA 1DBDA 3KK2B 4Y2MA 2PA3A 3QNWB 3B78A 1UW4A 2YKMB 2UXDF 4QOTA 2LMIA 4RKUC 4NXMJ 4LRBA 2FLOA 2FHJD 2E7XA 2FJVA 2XQCA 2L3MA 2MPUA 2PT0A 2L9DA 3E01B 1RJJA 5B0AA 1RXOB 1T95A 4CM0A 3PO4A 4TKTA 3D0IE 4M1KA 2R7VA 1ZM9A 1KTVA 3EZUA 3L7OA 1H74A 1X7VA 1SL1A 4LIWA 1T05A 3HFVA 5HJYA 1BWEA 1QTMA 4RJVA 1YSJA 1FI4A 3QZ8A 3D1OA 5JVGQ 5LMNJ 3OFHA 3J7YU 1X4GA 3OR1A 4OYXA 2K7KA 3LGMA 3GP9A 4NCGA 4C3MA 4QBUA 4WJBA 4OZ0A 4B08A 4JI7J 5EWEA 2IA6A 1O51A 2WSEC 5GMKa 1G1XA 1Y5NB 1JNZB 3KDOA 3QAEA 1UFLA 2J9EA 3TQEA 2MKSA 2ZUGA 1TL7B 2FHOB 2JLGA 3F56A 1FD8A 3M1VA 3I82A 3J80Y 2AX0A 3JB9k 1NAQA 2WVCA 4ZIWA 3OL7A 1NPRA 2DNLA 1VLYA 1W26A 4IH5A 3I31A 4AXIA 4TYBA 2U1AA 1S6PB 4G1QB 2GNKA 3I0RB 3W63A 3NOGA 4LR7A 3LALA 4KFBA 1SKUB 4WWSA 3GIIA 1YJWS 1S76D 2R4FA 1GAOA 1CJUB 1R6YA 2CYYA 1GMWD 4GMKA 4KRWA 3GLJA 2AEFA 3LOUA 2EEYA 5I4MA 3MOJB 2V8GA 3PRVA 1SQFA 2ZH1A 3VZIA 4IO1A 3RB4A 2RILA 3QO9B 4R5PB 3MHYA 4CT8A 4PYAA 2J7UA 4PQUB 2MKIA 1HI8A 3M8RA 2QMXA 2W24A 3TUJC 2OKQA 4CLYA 5IV3A 2RKIB 5AE2A 1NU4A 4KV8B 3NNAA 3D28A 5FIIA 1RKIA 2JH3A 3ZC4A 1PG5B 1HBUB 5F41A 2CWKA 1KRPA 4F36A 2FD2A 4IOAQ 4EBDA 2C22A 2MQNA 2WK4A 4JI2J 5H9EJ 1TZ0A 4ETZA 1U6BA 4Q2MA 4J9QA 2YVSA 3R5JB 3LP0A 2ZBCA 1T9XA 4ZA1A 4NLYA 3DRXA 2HK3A 2EPIA 1F9FA 4PRFA 2XWYA 1JMTA 3MM7A 4KYZA 5DLFA 3TUZC 4KGZB 3MM6A 1IKWB 2DNQA 3CEDA 3GIKA 4ZS6A 8RUCA 1F1BB 4ZLNA 5DG9A 3J7Z5 2XS2A 2B43A 3ICLA 1I1GA 2NZCA 2CA9A 4NXNJ 2AYEA 1RHQB 4IFYA 2WOMA 2G1DA 2FGCA 4PPDA 3QFHA 4ID8A 1VRTB 3OUYB 1U2CA 3UO0A 5DRKA 1NZAA 3TW0A 2E1CA 2A10A 3VAMA 3KK1A 2QYGA 1FDDA 2F4VJ 3BO2A 2LFVA 3B82A 3KJQB 3I4PA 3W2WB 2D7SA 3O5TB 3RW7A 5HROB 1FF2A 3V6KA 1IVZA 3SXLA 4CP5A 4WU2A 2HZCA 4B9TA 3W8PA 3NBPB 1C4AA 2F9DA 1WC5A 2ATCB 4KR0B 1NXIA 3MAQA 2LQ8A 2QG9B 3M8PA 2AGOA 1OQ3A 2HZVA 2CPXA 1H7WA 4O23A 3K0JA 3V81A 2ZD1B 2UUBJ 4H4OA 2XZWA 5H9FJ 1VBZA 1KQSR 1RAOA 1LK5A 1WTBA 4C8OA 1W25A 5K14A 1JJ2R 4EFAC 5HAOA 5EWGA 3FSIA 1HBNB 4J7CA 1U0SA 4K5RA 2GVZA 5KFAA 2BQ3A 2BE2A 4WZMA 5GADI 4RUHA 4OJ3A 4F4ZA 4GKKJ 3A3OB 2BE7D 4DPWA 3H40A 2R9LA 3HD2A 3AB4B 3MTJA 2HHPA 2CQIA 1SV5A 3Q22A 3V4IB 3B54A 4ZPDA 5I3PA 4NLUA 1Q0NA 5K8NA 4K4YA 1I3OB 2OTLS 3PYFA 4WCEQ 2L9NA 2NLWA 1LW2B 4JI6J 1RWMB 2XSJB 1FNMA 3HF5A 2O01C 4H4MA 2JHEA 5KFXA 1VQSA 1WACA 2HRUA 2UUAJ 4RW4A 2M9KA 4PR6A 1TTHB 3TA1A 2J7WA 2F63A 2WW8A 3C14B 4NXNF 3HVAA 3C15B 2H54B 3RTVA 4I6WA 3RR7A 4M5MA 2JLFA 2J6SA 1IBKF 5SUHA 3DRSB 3OL8A 2VKZG 4URGA 2V50A 1HI1A 2RNEA 5KT4A 3DHWC 2NZ4A 2FZGB 5A76A 1RLDA 1RT6B 1UVKA 1REGX 4ZVFA 5KG2A 2F4VF 2VC1A 5F8GA 3D6MB 2W2QP 3RBDA 2DEIA 3W3SA 1RWVB 4F3OA 2K7JA 4UQGA 4DFPA 3PKYA 4ZN3A 4DF8A 2VG5A 3BF4A 1OYEA 2HFSA 1KSPA 2YWGA 2OPSA 5KFYA 4TNOA 5F3ZA 2IVFB 1RUSA 2LVWA 3FMWA 1NHVA 4GKJJ 3WDOA 2KXHA 3NGSA 3MM9B 1TMMA 4FYDA 3LO3A 1PYOB 4NL5A 4W4MA 4DLGA 2JDJA 4OLPA 1F5BA 1VYAA 4WFXA 1K44A 4M5KA 1TUWA 4DX6A 5HQMA 4DF4A 2UUBF 2HVDA 4X64J 3TJ9A 4B3SJ 1N33F 4X4NA 2OJ3A 3SBMA 5E3AA 2DNPA 4AFFA 2C2EA 1ZA1B 2HSEB 2VG7B 4DU8A 2JJ4D 2AZ1A 1PBAA 1X0PA 4ECQA 4EYIB 3US5A 1OY8A 4FN5A 1S97A 3OQ2A 5C24A 2BW7A 5KFFA 4DSJA 3R5DA 3PV8A 4AL7A 4LREA 1FE0A 1RT7A 3RW6A 4BC9A 3KJNB 1OSCA 4Y00A 5LXRA 3JQKA 3D66A 3HHNB 2R7OA 3OHAA 4X4QA 4NLTA 4EUVA 5IQ6A 2DGOA 5M2RA 1E6VA 1FKOA 4NPOA 1CJTB 2ACMA 1U8WA 2MJNA 4CZCA 1ZBTA 1OSDA 2A3JA 4ECVA 3ILIA 1FRHA 2RAQA 2MKCA 3OTOJ 2GIFA 2XHWA 2MQMA 1IKVA 3MZIA 2MSSA 1OIAA 1WI6A 5J2MB 1IKXA 4Q43A 1K1QA 1CS4A 2ZH9A 1LWFA 2H5JB 4K4WA 3M2VA 1HW8A 2X1AA 3PW2A 2E7WA 4QR0A 3HSJA 2QSFA 1DLOB 5H9EK 2NSCA 3DCAA 4CLPA 4DL0C 4F02A 3W9JA 2CPJA 3HSDA 1DQ9A 3G96A 5D0EA 2RDDA 1JLFB 1NK7A 4MKVA 2CVEA 1H0HB 3QIPA 3BEGB 2IY5B 1RYSA 4NZ0A 4WP9A 4FKXA 2G2YA 4ED0A 2VPXB 4PG8A 1UVMA 3C46A 3MF5A 1RT2B 4CRJA 2EW9A 2NQPA 4ZKAA 1IJEB 1S9EA 2NCKL 4O44B 4X64F 2DNMA 2YNHA 1LFPA 4UOHA 4KH0B 4IG3B 1XTZA 3KNAA 3KFWX 1HLWA 3NCRA 4ERDA 4Z37A 1V3RA 4YMEA 2DGVA 1B0PA 3ZZ0A 2PMWA 3GMGA 2UXBF 4ZP7A 4XAKA 3UFCX 5KOXA 3I55S 4FZVA 4R8UA 2VOOA 1CSJA 2O3DA 3DRRA 1XEZA 2MQQA 3SFGA 4LVOP 3GCWP 4XO0A 4IYQA 4A8SA 1FNOA 1CC8A 4MKYA 4DR2F 9RUBA 4PXBA 2XYPB 2GW8A 1M5HA 1HWJA 4KAIA 2CADA 3SEOA 1TP7A 3N6LA 1RBOB 2I5JA 5B0BA 3HX9A 1Y0HA 1LKZA 4RBVA 5H9FK 4I69A 1TL3B 1VQ4S 3GYNA 2KG1A 3CC4S 5J2NB 3OTOF 4B9UA 3V6HA 2ACYA 2P9GA 4RL1A 2LA4A 1RCXB 2HIYA 5F9NA 5A6PA 1M5SA 2QZ8A 4M94A 3B6BA 3J81j 2I2YA 3NGRA 3THTA 4WBFA 2ABYA 3AD8C 3GILA 3MPDA 4YFUA 3GV8B 3MD1A 5F0WA 4JV2A 4IOCQ 3RR8A 3VCDA 3R5BA 4V19J 2CZ9A 2RH3A 3N4WA 4GVBB 5DG8A 3JYTA 3PX6A 2AJFE 1T02A 3DHXA 2ZHOA 2PDAA 1F2HA 2GIRA 4EEYA 1CJKB 2V2ZA 2QFJA 1NJWA 4FXWA 2XGQA 3KLHA 2BRKA 3KLFB 2CPZA 2W2MP 5G4DA 4LBPA 4NLXA 1WC4A 4AT1B 4CLKA 1KKHA 2HGLA 4ZP6A 4CO5A 1H2TZ 4ZLLA 2DY1A 2C2KB 1CPZA 4KHRA 1QVGR 3GJSB 2HLUA 4Q7AA 4J9OA 2WRMA 1BLUA 4PG5A 3PACA 2GS8A 4N77A 1YBAA 1HBMA 2DH7A 4F04B 1RU2A 1HARA 3H8YA 3ULHA 4KH1B 2VPYB 3EVMA 4KSEB 3DXSX 5L39A 3UN3A 1TK5A 2V8VA 2VG6A 1N88A 2ZH5A 1DARA 4NZ7A 2B9EA 4NMXA 1U02A 2GQQA 3CIZA 3M2RB 4Z2XA 2FPHX 2QT7A 2MZSA 3QATA 3T1YF 3K5MA 5KFLA 5LMUF 2BM0A 3ILLA 1R0BG 4DR7J 2GGPB 4MIBA 3VAIA 3JAMU 1NSPA 2M2BA 4LSNB 2V4QA 2GIQA 4ZVHA 4PWDB 2O1PA 3MR3A 3O1LA 3C2PA 3G8QA 2HRTA 3IAS9 2QA4G 1S1XA 3EGVA 1F9HA 1WOPA 2FIUA 2HAFA 4O3QA 5AJ3F 3MFIA 3BM7A 3H2VE 3BGRA 4NX9A 2XM3A 2ZH4A 5D4NA 3I9V9 5KFZA 1IQZA 4K0KJ 1KFDA 1WC1A 1X9SA 3R7BB 5HJXA 1RZMA 4U8VA 2LEAA 3KK3B 1AZSB 2M8DB 3AJ1A 1FHTA 1JLCA 2SXLA 3HDSA 2QE5A 3CJ0A 3JSBA 3R27A 1M5VC 4MJKA 4WK1A 1IWGA 3KMQA 3KHGA 5KFEA 2R7QA 3GIJA 2GJFA 4O3NA 2VKRA 4ZPVR 4FS2A 3WQPA 2RDJA 1UJ4A 3UVJA 2DR6A 1REVA 1V3SA 4ES1A 3BYPA 3GFZA 2W4PA 1T05B 5FDLA 1D9FA 3SV3A 3CSKA 2P8IA 1CBKA 5HSPA 3DOKB 4DUTA 3UCZP 3K5NA 2DNRA 3NS6A 3OR1B 1DJ0A 1UZDA 4NCGB 4F26A 1K47A 1S1WA 3VZHA 1NB2A 4PEOA 5GAHI 5A8KA 1NSKL 1CULA 4OZNA 4Q0BA 1U09A 3DOMB 3QGPA 1TK8A 2OELA 4IG0A 1L3SA 4QIWD 2V67A 4XTTA 1SC4B 1R0CB 2IM1A 4NLDA 2KM8B 3PR4A 3PEJA 4JI1F 1ZA2B 2XMAA 2MZJA 2EI5A 4C8YA 4IKAA 4KFBB 2M0GB 3DLLQ 5A8RA 2E5IA 3SQGA 2EC2A 2HNDA 1XQIA 1ELOA 4OYZA 3H20A 1UWAA 1JJCB 2VIHA 2PMZD 2LU1A 4DL7A 4OV1A 5HLFA 3QRRA 4DV4F 2Q1LA 3MI7X 3FEXB 1WHYA 2MLZA 4ZMMA 4BDPA 2DNYA 4ED7A 4K0KF 4OI2A 3BN7A 3PHTA 4L74A 2HQ3A 4QU6A 2CJKA 3TZWA 3LTOA 5D3GA 1PGZA 2AGPA 3BH7B 2GAGC 5KG3A 3N79A 2FHMA 2YPZA 4QW8A 3Q2TC 1D9DA 4X4PA 1C1BA 2IM2A 1NJYA 4MK8A 2BOAA 1MWQA 3OTEA 2K06A 1NMEB 2ROPA 4RO0A 1GEHA 2G1HA 3VGTA 2UV8G 4WXOA 4P9SA 1U1RA 3GE9A 3UNYA 1J5OA 3CD7A 2E1PA 2QO3A 4W92B 1WJ9A 4WFNQ 2KXFA 2DITA 3VAKA 2PIIA 2CQ0A 1MMDA 1LXNA 3CJ3A 2ZH7A 3MM7B 2VZ9A 4NZ6A 3MM6B 2C2OB 2H4YB 4JOUA 4HLBA 3M2UA 4TVAB 3CMAS 1EARA 3IA0A 2NYIA 3MCMA 4ICLB 1RKJA 4FPRA 2E66A 4XPEA 3QJLA 1TKZA 5J1NA 2V9KA 4NA3A 4IFYB 2WOMB 2FJWA 2ALYB 4OYPA 2EK6A 2ZM6J 3KK1B 4CO2A 3ONQA 5G0RB 1M90T 4QJVA 1RTHA 1JXVA 1HNZJ 1SUQA 2DBBA 4AQYF 2GO8A 3DRPA 3D1HA 3CC7S 2A6OA 4KPYA 1EKRA 4P7VA 4AYBD 4ILMA 3UCUP 2L41A 4TY9A 4K4VA 3PVXA 3WHIA 1EP4A 4KTQA 4C48A 1KHVA 4N76A 1K73T 3M8PB 2V4RA 2XYHB 3BQ2A 4YR3A 1WOSA 2CVIA 1X4DA 3X3UA 2G13A 1WC0A 3D68A 3V81B 4NLQA 4A47A 3N6MA 2P9CA 2RVJA 1KDNA 2XNRA 3S1TA 2CQHA 2E1AA 3T9NA 2HHVA 1UVLA 5GADU 1MSWD 5K14B 1HQ2A 1KBRA 4E0DA 3H4DA 4B9MA 2KHDA 4OZ5A 1T9YA 2BE2B 4LF8J 3PO5A 2F5GA 4ANCA 4ZHRB 4DV5J 1TV6A 2YH0A 2XO7A 1SV5B 2IJNA 3GR0A 2MZTA 1KNZA 2FC9A 3W64A 1NK0A 2HKEA 1NLKL 3CMES 3LP2A 2J0WA 2E5LF 2AKWB 2UUWA 2VUGA 2LECA 3BDEA 3R6GB 3IS9A 1N36J 3G6YA 1T03A 3CWJA 4H4MB 3Q8RB 2V6AA 1ICEB 2XTJP 4RW4B 3ZZUA 3C6TA 1APSA 5ETOA 4DV6F 3GYXB 3PY8A 3V4MA 2KFZA 2HFZA 3BKFA 3PNIA 1MNEA 2CJQA 4NCBA 4JI8J 5IWAJ 2KJWA 1P8GA 5DZ7A 3CCWA 2RHQB 1HWKA 2E7VA 4C8LA 3QRQA 3N9UC 2ZM6F 2KHCA 3X1LB 3BPSP 2QLJB 2WHOA 5CYMA 4ELUA 2N4DA 1HNZF 1FXDA 2PE8A 3UI3A 1VR6A 2ZE2A 2E9ZA 5DO2A 2FVCA 4P75A 2VC0A 4TLQA 1HNIB 1M0SA 2VG5B 3WX8A 2OPSB 2BDPA 1YJTA 1JLBA 4CCHA 1IBLF 1Y5LB 5B0CA 3QT7A 2OMLA 1S72S 1Q86T 4NLRA 4HACA 2ZZMA 2YKNA 3HD1A 4LF6J 1F0XA 4PWWA 1TKTA 4HVZA 2XC9A 2BKPA 4HL9A 3CDEA 1RHJB 2UVWA 2FJXA 3QSYB 1Y9OA 3KUGA 2A2DA 5IC6B 1LOUA 2YKQA 2EG2A 2PFFB 2RE1A 3R6LB 1UW9A 4H54A 2M8HA 4IO9Q 2QIFA 3P3DA 4DL2A 4AD6A 5A2QU 2NUHA 1P6TA 3L09A 1S5ZA 5C24B 4USIA 3OL6A 1NJXA 2VV5A 3EUNA 2C2DA 3JSRA 1XNQJ 2YWWA 2HBRB 4DV5F 3W2VA 2YXLA 7FD1A 2Y1RI 2BEFA 1FTRA 1RT7B 4FBUA 1VI7A 5D0GA 1IXKA 2R3VA 2R7WA 3R7SB 4AUKA 2Y1LB 2VONA 4USHA 2R8KA 3MR6A 3AOBA 2B6AA 2RUGA 1HWIA 1UEVA 2LDYA 2HRYA 5LJ3Y 4Y2CA 5HBMA 1JNRB 1FKOB 2VBZA 3FC9A 2ZNZA 2YWEA 2MZRA 3RU0A 4QW9A 2Z8QA 3AQPA 1HD0A 2R42A 5KFBA 2BYCA 4N5SA 2DRDA 4DV3J 3OVSA 2UP1A 3D6HB 3QGGA 2HWIA 5KT2A 1WDTA 1CS4B 4WU3A 3RAQA 1LWFB 2E5HA 2IVYA 1YZ7A 3M2VB 1YWXA 4NEYA 5B08A 1S1VA 4B02A 2N3OA 4QU7A 2HNZA 3H2LA 2MKKA 1YJRA 2OI2A 2RS2A 3MM5A 2ZOGA 3BQ1A 1HWLA 1MMNA 1WD6A 2D9PA 3P8BB 3TX8A 4JUZA 3FBFA 4F67A 2G0CA 4TN2A 2CQGA 2Y0BB 4K4ZA 3QPIA 4DR3F 3PW5A 1GQEA 3QLHA 3QIPB 5CHCB 4P2MA 2DHXA 1NK8A 4G3IA 1RLCL 3TZYA 3S01A 4X4VA 1A7GE 4RUCA 2ZWPA 5KG6A 4USJC 4ED3A 4I0WA 3PG9A 1RADB 2E44A 1X5OA 4F2RA 1S9EB 3JTPA 5CYQA 2YNHB 5LXYA 1UPMB 1X8DA 3CJKA 4TY8A 4MFBA 4YDDB 5KFWA 5DDRC 2AIRB 5ETLA 2XMVA 4LVNP 2C1EB 3CCTA 3PZPA 4ED2A 4BHQA 1FXRA 2PC6A 4LRFA 1RHUB 3KOAA 3G8TA 2DCUB 4DUZF 4HTIA 2HBQB 3M6XA 3Q8UA 2NR0A 5KAKA 4R8UB 2ZH8A 3DRRB 4Q44A 3T6BA 1VRTA 4CH1A 4ELTA 3MMAA 4LRDA 3GONA 3D2WA 4DBQA 1FRJA 4J9NA 1FFWB 4DQIA 2NXJA 5L9NA 2CJYB 1N6QA 1RDRA 1HBOA 4DS4A 3BGUA 3Q86A 4WTOB 1N5YA 1MN9A 2I5JB 3B4DA 4ZPBA 4B3TJ 3JS9A 2JVOA 1WF0A 3K5OA 1Q82T 1VQNS 2FJAB 2BJ8A 3WC2A 4ZPCA 2ZNYA 2DNOA 3H25A 4USMA 3OLAA 2D74B 1XMOJ 3PM9A 4DV3F 2OSRA 4NLPA 3OL9A 3CCZA 4UZBA 1HL6A 1VCTA 2YNIA 3TWZA 3RUBL 2ZD1A 3TR5A 4RNFA 3H42A 1YJUA 5HL7Q 4UY85 3JXOA 2DCLA 5F0UA 3P96A 4DR5F 3ELHA 5D0RA 2AJ0A 4HT7A 4YHHJ 1RAHB 1BQXA 1TKXA 1RABB 2KJVA 1A0OB 3AY0A 2DT9A 4ZLPA 2VPZB 1YI2S 4NLVA 1KS2A 2DJWA 4TQRA 3JYTB 4OI3A 1MWYA 2ADCA 2AZ3A 3MURP 1VHFA 3M6UA 4A8WA 1X31C 4B17A 2DY9A 2ADBA 2BV3A 5HANA 4M8LA 5J1EB 2RU3A 3CTRA 1YJ7A 5IV4A 4Y2KA 2EVZA 2HGNA 2WTFA 2CJXB 4LF7J 2EKNA 4QWAA 3M7VA 4DLEA 4DSLA 5HP1B 4ZCLA 3C16A 1VLOA 4X65F 1RACB 2CUYA 2YWKA 5C42A 4B3MF 3DRSA 1TU0B 4ID5A 2RD5C 2NXUA 2IYGA 3PX4A 3V5RA 2VBYA 2VG6B 4M5DB 2FLLA 3AFGA 1RT4A 2B8PA 4IQXA 5IZHA 3R5GA 3N5FA 4QWBA 1JLGA 3NMRA 3CULA 1VBXA 2XY6A 3T5JA 4DL6A 4DS5A 1SJRA 3DFEA 3SSSA 2BUNA 4ZPWR 4B3TF 1UWBB 1UL3A 1XWLA 3JQMA 1FRLA 3GJTB 1XMOF 2FLNA 4B3RF 3HFKA 2YBVA 2MLYA 3I5AA 3U1MA 3Q8QB 1PC4A 4HR2A 2HZAA 3IWNC 2QFIA 1RSCA 1AROP 3FZ2A 1UFWA 5DG7A 2EXUA 1HNXJ 4O3OA 9ATCB 1S1XB 2YX1A 4A8QA 3HHLA 5CAAA 1DZ5A 3A13A 1ZYQA 3BGRB 3SZ2A 2MKYA 3I5BA 4N47A 2IMOA 2VG7A 4FXDA 2RB7A 1TAQA 1X4FA 2HLTA 1FKPA 2BJDA 1VQYA 3UR3C 4F0MA 2K2PA 4J9UE 5HQ8A 3W65A 4FDFA 1WKKA 4TXSA 4ZCIA 3G71S 1X4EA 2HW3A 4XDDA 4ANEA 2Z57B 4L75A 4JI0F 5CCLA 3BBFA 3RYLA 3UVJB 4K5SA 3SMZA 1REVB 1NJIT 2IC3A 1TELA 4E98A 3NS5A 2XMUA 3THPA 4I6AA 5FDLB 2WW4A 1U47A 4IQMA 2XO6A 3PYEA 4ILRA 4LFCJ 2LA6A 3BQ0A 3K2YA 5KFTA 4DG1A 3ENVA 3KYLA 1LXJA 2CPIA 5GAHU 3TJAA 4TQSA 3TRGA 3RRGA 1R31A 5K9FA 2OD6A 4ZVTB 2MLXA 2J8SA 3CNQP 5J2MA 4DCJB 1ZH5A 2B7CB 1FO1A 1S1WB 1HQEA 4PQAA 1ZTTA 5E7OB 3KLGA 2DXFA 2XB2D 2GHWA 1CULB 1ZAWA 4Q0BB 4USKA 1T94A 3D67A 3I0SA 3G86A 3IMQJ 5EN1A 4JBCA 2DR9A 2HFNA 4O0IA 3EGZA 4JI4J 1X9MA 3CCSS 2K1RA 1CQMA 1GMUA 2FQQB 2DGQA 4DQRA 1WG4A 1C0TA 1QAYA 1P9QC 2DISA 5A8RB 2V2KA 1QDUB 4DUYJ 1U49A 5K5MA 4ZVUB 3SQGB 3A3PB 4LRCA 1HNXF 1HWUA 1RT2A 2P6TA 5HLFB 1SH3A 3ZTSA 3M30B 3VR1A 2FY1A 4B3OA 2IVMA 5K8OA 2BW2A 1EJ7L 2BOPA 4IRCA 3DGPA 3CCES 3JQJA 1XR6A 4DR4J 1PAEX 4YEAA 3THVA 4BC7A 1TFWA 3SCJE 1RHRB 2HIQA 2O67A 2YKOA 2CPDA 1YRUA 1XC9A 1LNQA 5D3GB 3ZTRA 3KXDA 4RLEA 1QSLA 4DV0J 4KO0A 1FFSB 6AT1B 4P2SA 2XULA 1XR7A 5LT5A 1EZZB 2HQFA 1C1BB 3MTKA 3R8YA 2CDRB 4ECWA 1UAWA 5THWA 2DHAA 1YKWA 3AD7C 1WDDA 3BSOA 2N4CA 3G2XA 5T14A 3CIMA 4NA2A 3NY0A 1KLNA 2XZDB 3CGIA 3LWMA 3HFZB 2NSBA 5HVFA 4USWA 4C2MA 3O6QA 4FVMA 3CDUA 3GTYX 4CO0A 4LFCF 2CAJA 4MIWA 4EI2A 2QC3A 4RW9A 4HHHA 3ISND 4F4XA 4CLTA 1LQ9A 1X5SA 1VBKA 4QIVA 3N28A 5L1KA 5EX3A 2L08A 2UU9J 2QL5B 4DV2F 1LEOA 4OYOA 3FRZA 4HI1A 2RT3A 2P9EA 3EYZA 2DGUA 1UVJA 1U8SA 2QX0A 2WCXA 3M2UB 2LQ5A 4HH0A 1CEZA 4WYLA 2OEMA 2CZVC 1BD6A 5KG7A 2OMOA 4KPCA 3MPYA 2JRSA 3BS9A 3C66A 2GX8A 1TKZB 4X66J 1VBYA 3DYAA 2AD9A 2AWZA 3BGOP 1IKYB 5F9LA 1BWVA 2DO0A 2QMWA 3MAHA 2HHHJ 4FPIA 1KC8T 1Z4UA 2L9WA 3PYDA 4QPTA 1HNVA 5KFQA 3K59A 2A0FB 2H4WB 2QTWA 4OZJA 1S9GA 1HYSA 1U1NA 2J9DA 4OQJA 3U27A 1RTHB 2B8QA 1SUQB 4I56A 3Q8VA 1JLAA 2UXDJ 5C2CA 3PDNA 1YVFA 3Q83A 4YOEA 2ZH2A 2Y9HA 4A8FA 3DLEA 3S6EA 4WFBQ 4K50A 3W7BA 4HHJA 1AB8A 4U95A 2LXUA 5IC4B 2HQDA 3U02A 2IBKA 1EP4B 1B7YB 1F3VA 3M6WA 4RUAA 3GV5B 3QYYA 2RRAA 3VGVA 3EM1A 5B0DA 4CDIA 4OI4A 3KJVA 1ZETA 3VGUA 1WC3A 4CO3A 2IM3A 2OAUA 2AYGA 2NUUG 2AX1A 1Q8LA 3QBCA 4YUDA 1WHWA 1YG0A 2GJIA 2UVRA 3OXGA 2W7OA 5LSRA 4L73A 1EKSA 2W9BA 2KVIA 1SXLA 5B0EA 1CC7A 1RBAA 3A1YG 3KHLA 1FWKA 4UUWA 1WEXA 3HSGA 1LWXA 4OHYA 1TV6B 5J1PA 4UW2A 2HHQA 2X1BA 5KFIA 5HN0A 3MUVP 2N7CA 3KHHA 3NKYA 2R7UA 2QLFB 1Q8IA 2GGPA 3CB4A 2EKYA 4FF4A 3U7JA 2UU9F 1RTDA 2F8HA 2R2TA 4MTPA 3LP2B 1S12A 1KD1T 3R2CJ 3IS9B 4G6VB 1QSYA 5B0FA 1RAJA 5GVQA 3EWGA 3C6TB 1IR0A 2VQEJ 2DEJA 3RAMA 2OIHA 4OV6A 5JUMA 3OR2A 3JAMY 4ECTA 2HHHF 4LFBF 1UCNA 4ZJQA 3NCPA 5CYMB 4ITSA 3LH2S 2V69A 4FS1A 4QZVB 2HNYA 5A0YB 2QEXS 5D4LA 2XG8A 5E33A 2YH1A 1QJHA 5EWFA 2ZE2B 2VA2A 2IJFA 3ZTOA 4QIFA 1UP1A 2OH2A 2V8HA 1KQKA 3ET6A 4X4SA 1JLBB 3R97A 3DLHA 2AJQA 4EZ9A 3RBXA 4KKOA 2VQFJ 2M7SA 3DGVA 4W98A 3DKDA 4X84A 3BSNA 4HACB 1H7XA 2YKNB 2CQPA 3D54A 2Z2LA 2CDQA 2XSFA 2K3IA 2KL8A 5IT4A 1TKTB 2VH7A 3DOKA 4ETXA 3PR5B 1U1OA 5FLXY 2E5JA 4EK2A 4YN3B 4KY3A 2DH9A 4ED5A 5CXTA 3KG4A 1WF2A 5T7LA 1OPZA 3TEHB 4U6PA 1S4EA 2CIMA 3R3TA 4ILLA 4NLGA 3RB0A 3F73A 1BMQB 3AB2B 2OSQA 1FTCA 4RWXA 3DI6A 3FBEA 2AF6A 2XI2A 3DOMA 1Q79A 2LEPA 4P2XA 2L48A 2V8PA 3W2VB 3QIDA 5KT6A 4DV7F 1VRUA 2VFUA 4K59A 1GT8A 1RTZA 2DYAA 1R0AA 1PO6A 3RB6A 3UDVA 2VODA 2D3UA 4LT6A 3HVWA 3GYGA 4HHUA 4WYWA 2B6AB 4OZLA 1R3NA 4Q8EA 3RBZA 5HBMB 3QMQA 2BM1A 1Q5VA 4A8YA 3DDNA 1MW7A 2BQRA 2JC0A 3Q2SC 1BGXT 3GJRB 1QAJA 3GV7B 5IOLA 4M5HA 1U25A 2QV6A 2VQEF 4ZVEA 5KFDA 3CJSA 1NH7A 4ZPTR 2QA4S 1H6KX 1NDLA 2DK2A 2WVFA 2P2CB 2D1CA 2ZZNA 3NNCA 1R89A 4CO1A 1S1VB 4I1TA 1Q95G 2HK2A 1RHKB 4IH6A 2HNZB 3T5LA 1T3OA 2FJBB 2EFQA 3MM5B 1SC6A 2V2QA 2HHSA 2JNJA 2PGCA 1VQKS 2QSWA 1DQAA 2LDIA 2OP5A 5DJBA 2VQFF 3O8WA 3QLHB 3QWPA 3LUYA 3HHKA 5F8MA 2D3ZA 1X4AA 1QD1A 2DO4A 1YX2A 2AYMA 2M4MA 2JFDA 3OFGA 3AXKA 1QE1A 2K8GA 3F41A 3ADAC 5D78A 3NG8A 3OFFA 1T8EA 3P4UB 2DGWA 5KG0A 5E0OA 1L3TA 5CYQB 3PCOB 3CJKB 5H1SV 4TY8B 2MY7A 3TP2A 4MFBB 3M4XA 1KVIA 3OFEA 3C3LA 3GU0A 3QRPA 2ILYA 2CJBA 1SPBP 4QCLA 1S4FA 2EFPA 2H9ZA 3EZOA 4FXVA 4ICLA 2Q79A 1NDKA 2CKWA 4CM2A 1U2RA 1AUSL 2Y0SD 1RQ0A 1VQOS 1RWKB 1KWMA 4TYAA 1R8AA 1NEEA 3QJPA 3AOAA 1IBKJ 4KHMA 4MYUA 1L3UA 5L1JA 3EXCX 1S7IA 3MMAB 2Z58B 2XCPA 2VBWA 1SJQA 2A1BA 3FUYA 2DHGA 2DTJA 1N6QB 3V6JA 4DFMA 5G0RA 3TARA 1HBOB 1BHNA 2ZKUA 1N5YB 1FERA 4K2XA 2CQ3A 1TQLA 2YNGA 5KFSA 3C19A 1EHWA 4ENOA 3VTIA 1HD1A 3J81U 1YJ9S 2D3OR 2DR7A 4KQZA 2VBXA 1JJHA 1XN9A 5LM7E 1VC0A 2G0IA 1YTYA 1C1CA 3J7A1 3VF0B 3JTOA 4DFKA 2KZMA 4KBIA 2YNIB 2CQCA 1R7IA 3E2EA 1DHMA 4MKBA 4ED4A 2IDEA 1SQGA 1N33J 1RWUA 3SCLE 1R8PA 3WBZA 2JL9A 1RU1A 4HKQA 1TKXB 2X1FA 4WTYA 1UEUA 4K4XA 2PI5A 5DM6Q 2DR8A 1B4SA 4JV0A 1V6HA 2V8DA 4ZHRA 2XEXA 4O3SA 3VVTA 2WSFC 1FDAA 4CH0S 2D41A 5CZVA 1RK8A 1LV5A 2OFHX 5AXMA 4RU2A 4YQWA 1DTTA 2YTCA 5J2QA 1IR1A 1RP5A 1RWOB 1O5JA 2POKA 1S6UA 3NCQA 1MN7A 2C3OA 3M9NB 5LJ5Y 4F50A 1X4HA 3J7ZT 3C16B 1SQEA 1Y00A 1HR0J 5E3PA 1NRKA 5RUBA 3KNGA 5KG1A 1HI0P 1H73A 4UF4A 5C42B 1GK8A 3TAPA 3MM8A 3FFIA 1IBCB 4ID5B 5EGYA 3LP1A 1HW9A 4AL5A 2VJVA 1RT4B 2WVEA 3NGKA 1JLGB 3V6DA 2M3DA 2VHGA 3BV8A 5HI7A 3MEDA 3NGTA 1NKBA 4EU0A 2R7RA 4NASA 4IH7A 3NWRA 3DMJA 1S59A 1HNIA 2VOPA 3H59A 3IN5A 2PI4A 1EQMA 2RDIA 1CLFA 4EBCA 4MT1A 2EK1A 2AHOB 2ZITA 4PXEA 2E9RX 2DNGA 3KUEA 2GAHC 1RWNB 2RQ4A 4V1Ak 2RRBA 4OJ1A 2PEBA 4EO6A 5GAGI 5MAOA 1W2BR 2BJ9A 4A8KA 2CFXA 1MU2A 1NDPA 3ZZYA 1U1PA 3HHLB 1H72C 1T9TA 1NBEB 2DRAA 1PYTA 4OIXA 4X4TA 1RCOB 1N34F 1TL5A 3FQKA 3TNVA 3ZZZA 4U96A 2ASYA 5I42A 4M5NA 5CCMA 4OZ1A 5FD1A 1FKPB 3WC0A 2ZUAA 2GHVC 3DLJA 4MKAA 3GFXA 5DDQC 4JB8B 4B9LA 3D3CJ 2UXBJ 3ILOA 1S1UA 3IGVA 2W9AA 2XI3A 4Y2IA 4KB7A 1SKRA 3KLEA 3OXLA 3BREA 2HURA 3P5BP 4ELVA 4ED1A 2F8MA 4P2FA 2Z2YB 4DR2J 1NM2A 1OMSA 2FY8A 2IC3B 5A2QY 2OEKA 2BZ2A 4OX6A 3OTBA 2CXEA 3C6UA 3I96A 2GV1A 3FCWA 4PG7A 3MPWA 3RAXA 5KFGA 4DG1B 4QR2A 1HR0F 4JP8A 1GMWA 2A6MA 5GAEI 2F3JA 4YY3F 3HLUA 3HT0A 2EFVA 1SC3B 1GXTA 4C8NA 2Q66A 3DLKA 5DDOC 1FFGB 1FRKA 4CYUA 1HQEB 2FGOA 3KLGB 2KFNA 4Y2AA 1YBTA 3D9BA 4IDKA 4AE5A 1WSVA 1FK9A 3I0SB 4OHXA 1ZM2A 4DI6A 1QSSA 3ZXWA 3H7HB 1OY6A 2K1RB 4RBTA 2J9CA 3VAHA 4ECXA 2J76E 1J5EF 4C8MA 4MAKA 1X4BA 3T1AA 1C0TB 2JC1A 4HDHA 1TVRA 1P27B 2ZVIA 2VFVA 4FYVB 3HMJG 1CVJA 5D77A 3GSIA 1AFIA 4M5GA 3FVYA 4Y28C 5E2QA 3PX0A 4H4KA 3K17A 2CNLB 2B51A 1PCAA 4B3OB 4WIQA 4Z7YA 2H3EB 2QYCA 3DGPB 8ATCB 1NPKA 3VAJA 4CLZA 4WPAA 5KG5A 3V2UC 1AW0A 3B4MA 1MG7A 1V5VA 3FK4A 1H38A 5HMZA 1ULRA 1DY3A 1Q8KA 2IAJA 3AXMA 2F1FA 3GG0A 1FDNA 5HVGA 2M5YA 1C2PA 2XMJA 3QZ7A 5KFUA 2MQPA 4KO0B 1LWCA 3KLIA 4UQTA 1BXNA 2HS3A 4KGVB 3LPYA 3D3BJ 1KQGB 2ROGA 4CLUA 4PG4A 2W7PA 3CMQA 1VQ6S 2I1RA 2FB0A 4ES2A 2W8KA 1D8YA 4LFAF 3DDIA 2IBOA 5ETQA 5CD4H 1U6FA 2BANB 3T1YJ 4LUBA 4I2QA 3MDFA 5LMUJ 1ROFA 3MUTP 2Z2MA 4RW9B 2CPYA 4K7QA 1HFEL 1T11A 2DH8A 3EZ5A 4RNMA 2JVRA 3T19A 1FRIA 5ETNA 5E3CA 4NLSA 3VQSA 2VD3A 2XZTB 1JIHA 3CF5Q 1R43A 4LF1A 2KXNB 3IFEA 3LWLA 3FNNA 4RNHA 1QAIA 3VV2B 5AJ3J 2LEBA 1WG5A 4DPXA 3DYAB 5CD4A 1SH2A 2C42A 3MCNA 5L1LA 2H48B 3H90A 4LR9A 1BE4A 2CNOB 1SB6A 1U6ZA 5LL6d 4WKYA 4LF2A 1HNVB 1X9WA 4DXLA 2V4JB 2LKZA 1S9GB 1YRTA 1HYSB 2QL9B 3DOLA 1JLAB 1F60B 1Y4ZB 1UPPA 4A4JA 2MHNA 2X1GA 2NPIA 5F8IA 4ZLJA 4P10A 5J1EA 5E41A 2LQBA 2H5EA 3DLEB 2GA7A 3HVRA 2XGPA 2ZEJA 3K7RA 5JVHQ 2LCWA 2R8GA 2VFSA 2M52A 3PXGa 4WFZA 2HPUA 3KJVB 2KH9A 3FZBA 5HP1A 2C2NA 2MY8A 3MR7A 2QGFB 1SL0A 3OSPA 1VOMA 1D1UA 2J0QD 4MMOA 2B5JA 4EGLA 4ZOSA 1M5PC 4C8KA 2A2CA 3M32A 1FNXH 4FNHA 4DQQA 2OPPA 4JI3F 1U24A 1B64A 2AQ4A 2GC8A 2M70A 3MMBA 3T5HA 3SDEA 4LJMA 4M5DA 3UN5A 2KVQE 2BR0A 1IQTA 3J7AN 2W9BB 4UUXA 1T0TV 1UTAA 2COLA 4WXWA 2O5DA 2YNFA 1VFJA 4D3GA 5BJRA 2LQJA 5L38A 4L72B 1V3ZA 4HH1A 3W9HA 5IT0A 3O44A 1SIWB 2LXFA 1TUVA 4YB6A 5ETMA 1UWBA 4JI1J 2GZOA 4WKRA 2BJ1A 1FVSA 1JLEA 2ZZTA 2FUG9 2A18A 3GR1A 1RTDB 2F40A 4F7VA 1YLXA 3IP0A 1F9EB 3FGVA 1TK0A 1GNKA 1HIYA 1H2VZ 1NCLA 4KE5A 4JYAF 2WZ1A 5JXSA 1WI8A 4DV4J 1FDBA 1WWHA 4I2PA 5KTQA 3BN4A 3PW4A 2GCFA 4CLWA 3R5CA 3OR2B 4C11A 2LYVA 3GFHA 4DDFA 5C25A 1Q4RA 2I6WA 1WKJA 1Y10A 3I9ZA 2PEHA 2HFUA 2OLWA 2XNQA 3HP6A 5L1IA 2AGQA 2GQCA 2HNYB 5AXKA 1AUDA 4NE9C 1RYRA 3W61A 3G82A 3CC2S 3DC2A 1PJ5A 5FLXU 4NLWA 4F0HA 1PYSB 4J9PA 4DR1J 4K4TA 3D0GE 1SH0A 1EX8A 3ET6B 2DNZA 4CLLA 5DQHA 4KKOB 4F25A 1S6OA 3W5ZA 3AJDA 3W62A 1T9UA 3MEEA 4IRKA 4C9DA 3Q24A 2DD8S 1SKWA 4N8NA 3EX7B 3SQOP 3CD5A 3TI0A 3MMCA 4R0EA 4DSFA 4ZDNA 1F5AA 3NRBA 1UVNA 1MLAA 4NRTA 4ZCMA 1IBMF 3IXQA 3HXMA 3MEKA 2AEJA 3PFEA 3NLCA 2QLXA 5T7LB 2XMWA 3CCUS 4QPXA 2OO4A 4DV1J 3T3FA 2VFTA 3CJ5A 2JX2A 1N48A 4H4KC 3OVBA 3DI6B 5D0HA 1BY9A 2XY5A 5KFNA 5T41A 4BBYA 4FP9A 1WUUA 3GQCA 3AAWB 1VRUB 4DOZA 2BX6A 2CPFA 1K9MT 1WKLA 3CDBA 1U1MA 1R0AB 5B09A 3ENAA 4KT0C 2RMLA 4CTAB 1SI9A 2B4PA 3M8WA 4UT4A 3M9OB 2NXEA 1KOOA 4QIEA 1RT5B 3FBBA 4AQYJ 2RQCA 2B56A 2DNNA 4IR1A 2DB1A 3LAMA 3IR7B 3M30A 5F8NA 1KONA 3OJSA 1D9AA 3MR2A 3BGFA 3TVYA 2EFNA 5D6GA 3EICA 4NXMF 2CG8A 2J6TA 3JTNA 2VF3A 3GB0A 5MLCV 1WEZA 2OEJA 2AYBA 2FVQA 2GQ2A 4NCAA 1N5VA 1X0FA 2DXEA 5KFOA 2DIVA 2ZJPQ 4RX6A 3M9MB 1NK9A 4URQU 2XCAA 3L7UA 1U26A 4OZ3A 4DR1F 5ETSA 3LW5C 4FYXB 5LMNF 1UFKA 1S9FA 1U48A 5D4OA 6FD1A 1YJNS 2EWHA 3Q23A 2W4DA 2F4FA 4JI7F 4OYMA 3I56S 1H98A 4RNOA 1F5CA 3TOQA 3EE3A 1SIZA 1QE1B 5I3QA 4ZPAA 3P49B 1NDCA 1KR4A 4I6YA 2W7AA 2ASDA 1S1TA 1T7PA 2BMBA 1KLMA 3CW2C 1RT1A 4DV1F 1YHQS 2N82B 2E5LJ 4DQSA 2OGUA 4C98A 1FKAF 4OJGA 5IFMA 7AT1B 1VS3A 1UJ5A 4RBUA 4DV6J 1IR2A 2XMMA 2RUSA 2GMHA 2X3DA 3CXCR 4ZVGA 3DLGB 1N5QA 2IFXA 1IKYA 1YBUA 2HVIA 3GJQB 2DGTA 2BE9B 2CQ1A 4KHPJ 3OW2R 2J9DE 3DN9A 4ES3A 4Y3CA 1VISA 2KU7A 1ZM4A 2W8LA 1NHUA 2ASJA 2CPHA 1ZOTA 3IRXB 2W25A 2JEIA 4ALZA 4M5LA 2Z56B 3AODA 2GJ2A 2YNGB 1BC6A 4ZVRB 2HAIA 4OI6A 1HMVA 2KI2A 1WSRA 2UVUA 1IBLJ 1RTIB 4CWBA 4PWUA 3IG1B 2RSQA 1E6YA 1C1CB 1DRZA 1SJFA 4WIIA 1V9OA 3SCKE 5M2UA 1FEEA 4X62J 3HI9A 3BH6B 2ZC3A 1FJEB 2UXCJ 2WONA 2ZKTA 3G9CA 4ZP9A 1JQGA 3NWGA 1KN6A 4DJBA 3CJTA 1GMVA 3UQSA 2MMYA 2I9SA 3CO0P 4JI2F 2VJUA 1DAXA 2MDAA 4Y34A 2RF2A 4DPUA 4ED8A 4CIOA 1HKAA 2Z0GA 4LMZA 3KTQA 1S10A 4FF3A 2YX4A 2UUCJ 3CVKA 4NI2A 4K4UA 1J2VA 3UNGC 2C2MB 3HZGA 2V94A 1VMBA 3LA0A 5ITHA 4RW6A 3A8IA 1IUJA 2GMJA 3R1HA 1DTTB 5J2QB 1EETA 1NPPA 1WEYA 3QGHA 2J0SD 3HVTA 4MIAA 4U7CA 1PILA 3G6ES 1B0VA 2YPYA 1I6JA 3ITHA 3MOZA 5I3UA 1XMBA 2APOA 5HATA 1MROA 4TLRA 2DR5A 1A6LA 1GXLA 1ZM3A 1Q8BA 2HWHA 4YS2A 3CJQA 3HJVA 1HHTP 2XHCA 2YQ3A 4I4BA 1SJ1A 1UVIA 3MM8B 3FFIB 3OT9A 1X5TA 3BKTA 3LP1B 1W7WA 2V2VA 2H65B 4KHPF 3GG1A 1DFDA 4FYWB 3AJ2A 1SBRA 2F7VA 3V6DB 1RAAB 1NZ8A 3MEDB 2UVVA 5BXIA 5A0YA 4ED6A 3T41A 2W2OP 3ZTQA 3CCRS 1EIYB 3MECA 4QYRA 1EAYC 5K8MA 4NYZA 4R0JA 3DMJB 1RAEB 2KM8C 4M5JA 1NHKL 5GAGU 4BCAA 4E8UA 2F8EX 2CG4A 4LIRA 4DR3J 2MHEA 5DM7Q 4NLOA 2WB4A 3P5TL 2IPOB 5HMYA 1ZPWX 3EDRB 5U47A 6FDRA 3MCOA 2DKOB 1URNA 3POTA 1UZHA 4M63A 1G4CA 4X62F 4ZVPB 2FYXA 3BKUA 1NSQA 2UXCF 1MU2B 1IM4A 2IYIA 1WORA 4GKKF 5AE3A 3BSAA 3ZFVA 2QRRA 4PPZA 2FTRA 3VAFA 5I42B 3M05A 5GMDA 3HHEA 4DUZJ 4HEA9 2HFOA 4USTA 4OX9J 3M8QA 4JI6F 1U0HB 1VC6A 2UUCF 4P71A 2KKHA 1S1UB 4C0HA 3EMTA 3DLBA 1B7FA 3ISZA 3KLEB 5M2PA 4DQPA 2J8AA 2UUAF 5K20B 2KN4A 2QLWA 2BKNA 4OZ2A 4DPYA 2BBEA 3FMBA 5JJBA 4IRDA 2GHPA 1PJ7A 2KT5A 2UZAA 3RG6A 1I5OB 3WX4A 2U2FA 5GAEU 3C6UB 2B9WA 4J9RA 3PRDA 3KWMA 3UWTA 4ZJLA 4S0MA 3AD9C 1LW0A 2HG4A 1B0TA 2CJAA 1XIQA 4F4YA 2HVZA 2OPQA 4DR6J 3F0NA 1D3WA 3DLKB 2QLBB 4O0NA 2OTJS 4CYUB 3VWSA 4B9SA 4OHZA 3D0HE 2WB1D 2F65A 2ERRA 4ZIVA 4GKJF 3TZZA 1QLNA 4IDKB 2ZOMA 1FK9B 1NNDA 2VU5A 3R5AA 1WOOA 4DR5J 1FE4A 2J0XA 2I0XA 4OFZA 1Y3KA 4DSIA 1Q7LB 3OD2A 2G0JA 5A8WA 2FHKA 1Y7PA 2FJDB 1PC5A 3I6PA 3HJFA 4B3SF 1VRQC 2V68A 1TVRB 3MXHP 3TA2A 5ETVA 3OPKA 2GVDA 3BGLA 3DRYA 3NGUA 2PSZA 4WP8A 3F44A 2VL1A 4DPTA 4OL8A 3FCHA 4CQ1A 4JV5J 2XMKA 3HO1A 5BYRA 3K57A 3KMSA 3UN2A 1L3VA 4A8MP 4IFVA 2ATLA 2RQKA 1AT1B 8AT1B 2MB0B 1RTJA 2OUGA 2HQCA 2EFOA 2XWXA 1XERA 4KGXB 2Y8WA 4WP3A 5E3RA 5D15A 2ZC4A 1GXUA 3H2UB 2X7IA 5ETTA 5DLGA 2IAJB 4CI0B 5CH7B 2KG0A 4X65J 1T9WA 4OX9F 1FWLA 1R27B 2YKPA 1LWCB 3KLIB 4LSLB 4UOCA 3ZNUA 4B3MJ 4NWBA 3DM2B 4DL3A 1T9VA 2DXDA 5DZ6A 4Y0FA 2ZBQA 5IT9U 3BSCA 4WFYA 4RU9A 1SKSA 4U67Q 1UEKA 4CNYA 1P1TA 2NREA 2YWHA 2ZBPA 1IWAA 1C0UA 4U9RA 3D6FB 4RZRA 1S0MA 1JB0C 2D9OA 1Q1KA 5HVHA 4I2QB 2W9CA 2MTLA 3UD3P 1F2GA 2B4UA 5L8RC 4G1PA 4B3RJ 1NK6A 4DR6F 3D7SB 1YK9A 7FDRA 3G4SS 2WSCC 4QWCA 5EHHA 4F3MA 2RQMA 3K5PA 2MGZA 3SIPB 4DWIA 1VQMS 3I32A 2H51B 1VQPS 2R2UA 4IR9A 3J81Y 4O4GA 4FBTA 3W5YA 3RRHA 4DZ6A 3G6XA 2LU2A 4OHVA 1P1LA 3UCGA 2W1BA 5IM0A 2IIHA 4DCOB 3KG0A 2IRUA 2QA1A 1M1HA 4RUBA 3I87A 2W01A 1CG2A 1QAXA 2DNHA 2NS1B 4EBEA 3RRKA 2E1MC 3DOLB 2C3MA 1QUPA 2V0NA 3R7NB 1BQMA 2K3KA 1UA1A 4JV5F 1VIXA 3TUIC 5KFKA 4JI0J 4C6AA 1RBLA 1RI7A 2AJ1A 4P6QA 3QQCD 4A46A 3I5CA 2I38A 3TUPA 2N3LA 2Y1IA 2VA3A 1W2IA 4YB1P 3T5KA 1N32J 4ATNA 2BRLA 2UV8A 3NGDA 3P6YC 2B5JB 3NP5A 5HMWA 3CJRA 3MAAB 5D4PA 3M32B 4NA1A 3EGNA 3W8GA 4WFAQ 4N8OA 2OPPB 1N5TA 1M5OC 4EMDA 5B0GA 2BKOA 3IO1A 3MMBB 3SDEB 3K8VA 3R9LA 3JSMA 1KVKA 2BABA 4OI0A 1NO8A 4K2JA 4DHVA 1Z1ZA 1VC5A 1N54B 1FRMA 1LK7A 4RR5A 2YNFB 4L76A 3MGJA 2AV5A 3K5LA 3W9IA 1Z2ZA 4OYWA 3PRBA 3MPVA 2MQ8A 2BACA 3TZXA 2HGMA 2XMTA 2C28A 3UR0A 1JLEB 2MZ1A 5C7PA 3EVWA 3MMJA 2VB6A 4LQ9A 3OHBA 2FVRA 1XMQJ 2M88A 2HHTA 4Y6IA 1H3DA 2ZBRA 3A8JA 4V19X 2YQ0A 2MKJA 4I2PB 4UY8T 3DDKA 2KT3A 4XK8C 4U8YA 4ZVQB 1U7LA 4HTJA 3RGIA 3KHRA 4IUFA 2MYFA 4CO4A 4C11B 5C25B 4URSA 3KJFB 5B7WA 3D4JA 3VHQA 1XBWA 1VGYA 2R2RA 3NMAA 1NKCA 4AL6A 3GIRA 5L9XA 2IRXA 3G82B 1JK9B 1VK3A 1PIEA 1Y3JA 3SYZA 2CJ9A 3J80U 2C2ZB 3VAGA 1R6VA 4LF5J 1HHSA 1Q7YT 2KT2A 3HM9A 1URRA 2XLKA 1I51B 1TR0A 4W90B 3MEEB 2Y1JA 4GRSA 4DU7A 1FA0A 4PUOA 2PFDA 5E3QA 3HT3A 3MMCB 3CJ2A 4QYZJ 3NXZA 1N32F 2G4BA 3IAM9 3ZO7A 5ETPA 2AMCB 2XLJA 3M1VB 4OHWA 5HO4A 2EFGA 3FBCA 4I67A 4DV2J 4N56A 1ZTWA 1JKHA 2HMIA 3ENWA 4KIAA 4GO7X 1YZ6A 4C3LA 3IR5B 2EBGA 1N56A 2MJUA 4DR7F 2ZVSA 1HQUA 1BQNA 2RIJA 1SC1B 2R8HA 2HHUA 1VJQA 3R1LA 5EX0A 3CCVS 2XLIA 4NEZA 2KRBA 3UDLA 4FF1A 3RJMB 2PN6A 5F8JA 3IBFB 1Z2LA 5ETRA 3QT6A 2VDIA 1S6QA 3IGNA 1G6BA 1XMQF 3R2DJ 1G7CB 2HHWA 1HPZA 1SVDA 2Y8YA 1OPIA 5IXUA 1FJGJ 2VPWB 1LWEA 1K8AT 3GZ7A 1KVJA 2FVPA 1Y11A 4TU9A 4I64A 1RT3A 3L9ZA 2Q6BA 1FXLA 3DNCA 5DGAA 1JXEA 3BPDA 3BR8A 2W2PP 3EDQB 1AYEA 2HHXA 3C8YA 5KFMA 4HDGA 5CYJA 3GPAA 2AP6A 2DPJA 3HKWA 2YQ1A 4A8XA 1DQ8A 2C2RA 3ZTPA 3IBWA 4WE1A 5SZTA 4LF5F 1TKDA 2HS0A 3LP0B 2PO4A 3T9ZA 2XS7A 4CLSA 5AE1A 2QL7B 1FRXA 4Q2LA 1RWWB 3UD4P 4DSEA 2BANA 2NPFA 2Q43A 2IMWP 2AJ2A 1DTQA 1T3NA 1VQ8S 2PMHA 2DIUA 4GVLA 2QN6B 3MWBA 4J37A 1S1TB 5AXNA 4C4WA 1KLMB 3TAMA 2R8JA 4QIGA 3EVOA 1I94J 1RT1B 3N0VA 3AT1B 4BWMA 2D69A 5LOQA 2HQGA 2KRRA 2IJRA 1VIOA 4DL4A 2JEGA 4PAAA 5LSLA 3PJWA 1Y5IB 1KFSA 1D0EA 1G3OA 3M8ZA 4MK9A 1B3TA 5KFCA 2LXIA 3MUMP 2MSTA 1M5KC 1K0TA 4ECYA 5C2GA 3ETMA 4GO5X 1UKUA 1UJ6A 3FSYA 2X51A 1XJWB 4LFBJ 4F4KA 4DSKA 3CCQS 2QMUB 3TA0A 1OYDA 4CH7A 2JSXA 4BLGA 1ZZNA 2V4JA 3ZZRA 3M8YA 2AW0A 4RW7A 4DL5A 2KZZA 1MMLA 1GX6A 4RW8A 3SV4A 3MPUB 2J6UA 1FCAA 2VICA 2ASLA 1RA7A 4QWEA 1FJGF 1HMVB 1YRXA 1FX2A 4P52A 4H4OB 2ZJRQ 2YY3A 4PXDA 2YKAA 1WG1A 3A3NB 4EO8A 3N01A 4XIUA 1E6YB 3WIVA 1R8BA 3CT9A 3G87A 2R7SA 3NEKA 2MQLA 2GVZB 3MEGA 2WONB 3ENQA 4A48A 4Z7CA 3QSIA 2QA2A 2OD4A 1TL1A 2DVIA 3VALA 4PG6A 1YJVA 2FC8A 4A8OA 1V5IB 1GX5A 1OO0B 3DU6A 4DN9A 1S0OA 2ZH3A 2V63A 3KLVA 4NOHA 3Q0AA 4C7QA 4DCPB 2XYGB 5A6WA 3ILJA 2XS5A 2RF2B 1JWWA 2FJEB 4IOBA 1FX4A 3O2IA 4I7FA 5DDPC 3AH6A 3CCJS 4NI2B 4PABA 4FNIA 4DV7J 1AXQA 1PJ6A 3D6TB 1VQLS 4RW6B 2Z4PA 1GTHA 1EETB 2HQIA 2OPRA 1ZAXA 5J2PA 1HHQA 4HT5A 3SSRA 4LQ3A 1KHWA 2HBYB 3HVTB 3RZAA 1I94F 1UA0A 4UZCA 3HZEA 2OFGX 2RJZA 3ITHB 2J7KA 1CJVA 1JLQA 5I3UB 3GFYA 3T1HJ 2ZFHA 1MROB 4DFJA 1AFJA 3A12A 3S7RA 3TAQA 2H1YA 4KGMA 3HKZD 3WZ0A 4WK3A 3KK2A 4DX5A 1MWZA 2YKMA 1GH8A 1FJCA 5IQQA 5HK4A 4ZVOB 4G1IA 3OBIA 4E2FB 4C8ZA 2JEFA 3E01A 3NAIA 1SJ3P 3FSXA 5C5JA 2YWFA 4ZITA 4QYZK 4J9KA 3TYTA 1HA1A 4N7TA 5CZXA 4RNNA 3BO3A 1A9NB 2KFYA 1F6TA 2NYHA 3MECB 3BDPA 1B99A 1VQ9S 4C97A 1RHMB 3HHLD 3UE2A 2X3GA 3JSYA 3UW1A 3UDCA 2ZHBA 2W4CA 4ZVSB 3K89A 1X60A 1R8CA 2KYXA 4Q8FA 2LQ9A 1VJWA 3FDSA 4NYOA 3POTB 3J7YI 2VASA 2ZOFA 2IHR1 1WF1A 3PIPQ 4LF8F 2FVSA 1TL7A 2KDOA 3M8SA 1VQ7S 1TAUA 3H5YA 3Q8SB 3AQOA 4DZDA 4O3PA 3IBCB 3MR5A 3CDAA 5KFJA 2YX7A 4G1QA 1S6PA 3ETOA 4XPCA 3I0RA 5ETKA 1RGVA 1TL4A 4PKDB 1LFWA 3M8QB 2BA9A 2KYZA 2I8EA 2R7TA 1YDLA 3Q89A 3DU5A 3GWCA 2R2SA 4L3KA 1E6VB 3QFWA 1N36F 2RS8A 2NXCA 4B9NA 4X4RA 1CJUA 3IM9A 2D3O1 4FVCA 4CTAA 2ZJQQ 1XNRJ 2ZBIA 4K4SA 1IKVB 1J27A 2DGXA 2B4VA 4ZP8A 4JI8F 5IWAF 1IKXB 5DETA 4G65A 3T1HF 1RT5A 3AHPA 2HBZB 3RBEA 4ER8A 3QO9A 4R5PA 4ECUA 1JXLA 3LQVA 1LW0B 4PQUA 3FEZA 5F8HA 3OSNA 1RAGB 5DQIA 2OPQB 3AA8A 2GFFA 2RKIA 3U1NA 2FLPA 3TVZA 1RWXB 2HYIB 5K8PA 2FZKB 1EB0A 4KV8A 3FEYB 2CQDA 3L7PA 3CUNA 4BS2A 2C3UA 1HBUA 2RRNA 4X4UA 2BJ7A 4LF6F 2JEJA 5IS2A 4ZCKA 2ZHAA 3PTWA 3S8SA 4KJIA 2KTQA 3FKBA 5A8WB 1KOHA 1NH8A 1IN0A 4C0BA 4GC6A 2CQBA 3MD3A 1OJ4A 3HHDA 2GVDB 2RHSB 3DXBA 4OYAA 4J9MA 2JWNA 1IKWA 1ITPA 5HMXA 4YP3A 4USUA 5EDWA 1KTQA 1S79A 4ECZA 1Q5YA 4IFVB 3GIMA 4O3RA 1XNQF 2RU9A 1O8BA 3TQ1A 2QJ3A 1O0PA 3B8HA 3QGIA 1RTJB 2ZDOA 4MYTA 3VGSA 3OUYA 2HFVA 3W60A 3KUHA 1JX4A 4HI2A 3A4TA 2BVZA 3MFHA 2FDNA 3PFOA 3BO4A 3IRWP 1U1QA 5D8HB 3EGWB 3W2WA 3DLGA 3E3XA 1PAUB 5HROA 3CD0A 4PYDA 4DEZA 4TU8A 2VFRA 1UMJA 4QR1A 3OV7A 1SJ4P 3PJXA 2J5AA 3NBPA 2IDLA 4C3KA 1XNRF 1IM6A 2W2NP 2B3TB 4K8RA 3TANA 3E8OA 3IRXA 1C0UB 2CPEA 3QT8A 3VQTA 1WC6A 3TJ8A 4MH8A 3LGHA 2ILZA 4BWJA 5HQLA 1NB7A 1WTFA 3OXFA 4PXCA 1U45A 2W9CB 1UETA 2P6SA 2CRLA 2Y3YA 1RTIA 4DPOA 2B9YA 3IG1A 1QVFR 1VHIA 5CA5A 3MCSA 2B9XA 2AJ4A 1HBNA 1TFYA 5KOWA 4LF4J 3BYRA 2MGZB 2UUTA 3PHEA 4Q5VA 3G6VA 2IRYA 1XR5A 4DN0A 1WHXA 2V5HG 3D5MA 3PW7A 5FJ4A 1FWPA 5E5NA 5DGBA 1OY9A 4O4GB 3CE8A 1N34J 3V4IA 3ZZPA 3P45B 5IM0B 1Q53A 3EXYA 3KLHB 3CCMS 3KG1A 3H98A 1K1SA 3QWUA 2Z30B 4O4RA 1LW2A 4LBHA 4OMFG 2XSJA 3N6NA 1BQMB 2MEWA 4AXJA 5KFHA 3IWXA 4ZJOA 1RAIB 1RWPB 3FQLA 1Q81T 3C14A 2E1RA 3C15A 4DX7A 1QM9A 3UD5A 1HBMB 2PD1A 2PA8D 4GC7A 1KEKA 3H4BA 4F3QA 1RT6A 4M95A 3HPOA
chains in the Genus database with same CATH topology
1Q8IA 1XMBA 2GGPA 3T1YF 4MK7A 3K5MA 2APOA 3CB4A 1QUVA 2EKYA 5KFLA 1MROA 3LAKA 2XY7A 4TLRA 4FF4A 2DR5A 3U7JA 2UU9F 1RTDA 5LMUF 1A6LA 2F8HA 2BM0A 2R2TA 4MTPA 1GXLA 1OWXA 3LP2B 2GGPB 1C4CA 4MIBA 3GSDA 1KD1T 1ZM3A 3VAIA 3IS9B 4G6VB 2M2BA 1Q8BA 2HWHA 1QSYA 5B0FA 3UPFA 4LSNB 2JFKA 2V4QA 1HHTP 2GIQA 2YQ3A 1RAJA 4ZVHA 4JV1A 3K8WA 4PWDB 1S7HA 5GVQA 4I4BA 1SJ1A 2O1PA 3MR3A 1UVIA 3O1LA 3JSMB 3C2PA 3C6TB 2C3YA 3MM8B 2EG1A 3FFIB 3G8QA 1X5TA 1IR0A 3MM9A 3LP1B 3IAS9 2QA4G 3I4HX 1S1XA 5KT5A 1S99A 4KHPF 3GG1A 1DFDA 3AJ2A 1SBRA 3RAMA 2OIHA 2F7VA 2FIUA 2HVHA 3V6DB 5JUMA 3OR2A 1FT8A 3JAMY 4O3QA 5AJ3F 2FHJA 3MFIA 4ECTA 2HHHF 4NYPA 3BM7A 3H2VE 3MEDB 3BGRA 2UVVA 4LFBF 4NX9A 5A0YA 4NMLA 4ED6A 2ZH4A 3CCRS 5D4NA 5F3TA 3IR6B 4OLOA 3MECA 3NCPA 4QYRA 5CYMB 1U1KA 2WBMA 3I9V9 4ITSA 3LH2S 5KFZA 3T6JA 4NYZA 4R0JA 5K8MA 4YR2A 3DMJB 2V9WA 4FS1A 1IQZA 1KFDA 2O66A 4QZVB 2HNYA 4F2SA 2KM8C 1X9SA 5A0YB 2XBPA 2QEXS 5D4LA 2XG8A 5E33A 5GAGU 4BCAA 2YH1A 1QJHA 2LEAA 5EWFA 4E8UA 4YHHF 2F8EX 2ZE2B 3KK3B 2CG4A 2VA2A 4LIRA 2IJFA 2M8DB 3AJ1A 1FHTA 1JLCA 2MHEA 2LLZA 4QIFA 2SXLA 1UP1A 2OH2A 5DM7Q 3HDSA 2QE5A 4NLOA 2V8HA 3CJ0A 4LF4F 3JSBA 2KO1A 1KQKA 2WB4A 3R27A 4X4SA 3P5TL 1ZZFA 1M5VC 5HMYA 4MJKA 4WK1A 1JLBB 3KMQA 3DLHA 2AJQA 1ZPWX 4EZ9A 3KHGA 5U47A 4KKOA 1JLCB 3IWLA 6FDRA 5KFEA 1URNA 3POTA 2R7QA 3GIJA 4M63A 1FJ7A 4X62F 2M7SA 4O3NA 2J0SD 2VKRA 4ZPVR 1X4CA 4I68A 2UXCF 3SSQA 2JLEA 2MQOA 1H2UX 4X84A 3KKFA 3BSNA 1MU2B 1H7XA 2YKNB 1IM4A 1IJFB 2CQPA 3D54A 4FS2A 2Z2LA 2CDQA 2BXJA 3QAUA 2ROEA 4Y65A 2RDJA 2IYIA 2F9JA 1UJ4A 3BB5A 2XSFA 2K3IA 5IT4A 1TKTB 1REVA 4GKKF 1V3SA 4ES1A 5AE3A 2VH7A 3BSAA 3DOKA 4ETXA 3GFZA 3ZFVA 4X4OA 2W4PA 4N41A 3TVKA 3PR5B 2EBEA 1T05B 1U1OA 2QRRA 5FDLA 1D9FA 3SV3A 4PPZA 5FLXY 2FTRA 3CSKA 4LF7F 2E5JA 3VAFA 5I42B 2DH9A 4ED5A 3M05A 5CXTA 3DOKB 3KG4A 1WF2A 3Q8PB 5T7LA 1OPZA 3UCZP 3K5NA 2DNRA 3NS6A 5KT7A 3HHEA 3PEHA 4U6PA 5DS7A 2CIMA 3OR1B 1M1KT 3R3TA 1DJ0A 4ZK7M 4ILLA 4NLGA 3RB0A 4HEA9 2HFOA 4XDCA 3F73A 3L3CA 4NCGB 3M8QA 4JI6F 1VC6A 2UUCF 4F26A 1FVQA 3AB2B 2OSQA 2KKHA 1S1UB 4C0HA 4DX8H 1FTCA 4RWXA 3DLBA 4X2BA 3DI6A 1CQNA 1B7FA 1S1WA 3ISZA 2AF6A 2XI2A 4OJHA 3KLEB 5M2PA 3DOMA 3VZHA 4DQPA 1Q79A 5GAHI 2LEPA 2J8AA 2UUAF 5A8KA 2L48A 2IM0A 4PUOB 3W2VB 3QIDA 2KN4A 5KT6A 4DV7F 2QLWA 4EYHB 1VRUA 4OZNA 2VFUA 4Q0BA 2MZQA 4K59A 3H5XA 1PSDA 1U09A 1GT8A 3CCLS 3TO8A 2BBEA 3FRYA 3FMBA 3QGPA 5JJBA 4IRDA 1R0AA 1PO6A 2GHPA 5A8KB 1TK8A 2KT5A 1YGYA 2UZAA 3RB6A 4IG0A 3WX4A 2U2FA 2VODA 5GAEU 1L3SA 2D3UA 4QIWD 4LT6A 3C6UB 3HVWA 2B9WA 4J9RA 4JI5F 4WYWA 2B6AB 2E9TA 1DURA 4OZLA 1DLOA 2IM1A 1R3NA 3PRDA 4Q8EA 4NLDA 3KWMA 2KM8B 3O3LA 1R8HA 2C3PA 3PR4A 3PEJA 4IG0B 4JI1F 3UWTA 1L3KA 1JKHB 3QMQA 2BM1A 2MZJA 5HBMB 4A8YA 2HMIB 3DDNA 1LW0A 2EI5A 2HG4A 1WNEA 1B0TA 2CJAA 4C8YA 1MW7A 2B0GA 4IKAA 4KFBB 2M0GB 4F4YA 2BQRA 2JC0A 3E51A 3DLLQ 5A8RA 2Q3PA 3Q2SC 1JLFA 1BGXT 2HVZA 2E5IA 1QAJA 3GV7B 2OPQA 2B7BB 1D3WA 3SQGA 2HNDA 3DLKB 1HQUB 1BQNB 1ELOA 2OTJS 1U25A 2QV6A 3OVAA 3H20A 1ZAVA 3ISNC 3VWSA 5F8LA 2PMZD 2LU1A 2VQEF 4B9SA 4ZVEA 4OHZA 3D0HE 1ZPVA 4DL7A 4OV1A 5HLFA 4L3NA 4DV4F 2G9OA 5KG4A 2HNDB 2Q1LA 2WB1D 3MI7X 5KFDA 3A8EA 5ADZA 2ERRA 4GKJF 1QLNA 1NH7A 4ZPTR 2QA4S 1H6KX 3FEXB 3M6VA 4IDKB 2DK2A 2ZOMA 1FK9B 4TU7A 1WHYA 2ALZA 1NNDA 2D1CA 2ZZNA 3R5AA 4PCQA 3NNCA 1R89A 2Q6CA 4CO1A 4ZMMA 4BDPA 2DNYA 1FE4A 2J0XA 2I0XA 1S1VB 1Y3KA 4I1TA 4OFZA 4DSIA 4ED7A 1Q7LB 4O44A 4K0KF 4OI2A 3BN7A 4IH6A 2HNZB 3T5LA 4J9SA 5A8WA 2HQ3A 4QU6A 1S6QB 2FHKA 1XK8A 2EC0A 4IG3A 1T3OA 1Y7PA 2FJDB 1PC5A 2FJBB 3G8SA 2CJKA 1S0VA 3I6PA 2EFQA 3CD6S 3HJFA 2DHSA 3MM5B 1SC6A 2JZ5A 4B3SF 5D3GA 1S77D 1K0VA 4RWWA 4KC5A 2HHSA 1PGZA 1HPZB 2PGCA 1TVRB 3MXHP 1QY7A 1VQKS 2AGPA 3QJJA 2R7XA 3TA2A 5KG3A 3N79A 2FHMA 3OPKA 2QSWA 1DQAA 4QW8A 4B9VA 2LDIA 1L5UA 2CZ4A 3BGLA 2OP5A 5DJBA 2VQFF 3DRYA 3Q2TC 1D9DA 3O8WA 3QLHB 3QWPA 1C1BA 1LWEB 2PSZA 3LUYA 3HHKA 4X4PA 3F44A 2IM2A 2VL1A 5AXLA 1NJYA 3FCHA 4CQ1A 4OL8A 5F8MA 2D3ZA 1X4AA 3ZZOA 2XMKA 4MK8A 2DO4A 3HO1A 5BYRA 3K57A 1RT3B 2AYMA 3KMSA 2M4MA 3OTEA 1L3VA 2JFDA 2ROPA 4QWDA 3OFGA 4A8MP 4IFVA 5KFRA 2N7YA 2BQUA 2ATLA 2RQKA 2UV8G 1GTEA 1QE1A 2K8GA 3F41A 2MB0B 5D78A 3NG8A 1RTJA 3OFFA 4WXOA 1T8EA 3CJ4A 2DGWA 1U1RA 3GE9A 2EFOA 2XWXA 1XERA 5KG0A 5E0OA 1L3TA 5CYQB 1J5OA 5E3RA 3CJKB 3LANA 2ZC4A 5H1SV 4TY8B 2MY7A 2CQ2A 3TP2A 3CD7A 1GXUA 4MFBB 3M4XA 1KVIA 3H2UB 2QO3A 2AU0A 4W92B 5DLGA 2GMLA 2IAJB 3OFEA 4LSLA 4WFNQ 4CI0B 1X5PA 3C3LA 5CH7B 2HS4A 1J5OB 2KXFA 2KG0A 2ILYA 2DITA 4WE1B 3EPGA 2CJBA 3OTCA 4OX9F 3VAKA 4HYKA 1RISA 1R27B 1MMDA 2CQ0A 2PIIA 3DM2A 5KT3A 2YKPA 4QCLA 1LXNA 1S4FA 2EFPA 2H9ZA 1KQFB 3CJ3A 4FXVA 2R8IA 2ZH7A 1LWCB 3KLIB 4LSLB 4ICLA 2Q79A 3MM7B 4YB5A 4QQBA 2VZ9A 1TL3A 2CKWA 2JOQA 4UOCA 5BYQA 4J9LA 1SL2A 1U2RA 5J2NA 4NZ6A 2Y0SD 1RQ0A 3MM6B 4J5OA 4JOUA 4C0OC 1VQOS 4NWBA 3DM2B 4HLBA 4DL3A 3M2UA 1N0VC 3CMAS 4TYAA 4Y0FA 3CO9A 2CQ4A 1R8AA 3IA0A 1NEEA 2NYIA 4ICLB 3QJPA 5DQGA 1RKJA 3N5BA 3OTDA 3BSCA 4WFYA 4RU9A 4KHMA 1N4LA 4FPRA 2ZDPA 2E66A 1SKSA 4U67Q 4MYUA 1L3UA 5L1JA 4XPEA 3QJLA 3EXCX 1G2EA 3RB3A 4CNYA 1P1TA 1TKZA 5J1NA 3MMAB 4F8RA 1FESA 2V9KA 4NA3A 2NREA 2XCPA 2YWHA 3EPIA 4IFYB 2VBWA 2WOMB 1DTQB 1C0UA 1SJQA 4U9RA 2FJWA 2A1BA 1Q78A 4NRUA 2DHGA 4RZRA 1S0MA 1VQ5S 2DTJA 1JB0C 1N6QB 2EK6A 3V6JA 1OS5A 2D9OA 4DFMA 1Q1KA 5G0RA 4EWTA 1HBOB 3TARA 1YITS 4WZQA 3TAMB 3H5SA 4I2QB 2ZKUA 5IT9Y 2W9CA 1N5YB 1FERA 1RA6A 2KB2A 3KK1B 4F4WA 5KFVA 3UD3P 1F2GA 2B4UA 4K2XA 5L8RC 4JI4F 2CQ3A 1TQLA 2YNGA 4CO2A 3ONQA 5KFSA 5G0RB 3PKMA 1NKEA 4QJVA 1M90T 1U1LA 4G1PA 3VTIA 2B4OA 1RTHA 4OX8A 4YB7A 4YR0A 1YJ9S 1NK6A 1SUQA 4DR6F 5LSOA 2DBBA 2D3OR 4D3HA 2HWTA 2GO8A 7FDRA 4AQYF 1NK4A 2DR7A 3DRPA 1FEHA 4DMZA 3G4SS 3D1HA 2WSCC 4KQZA 3CC7S 4QWCA 5EHHA 4KPYA 2P5VA 4F3MA 2VBXA 2RQMA 3K5PA 1JJHA 1XN9A 4DUYF 4ECSA 1VC0A 1YTYA 4P7VA 2MGZA 4AYBD 4DWIA 4ILMA 1C1CA 3UCUP 3J7A1 3DRPB 5EUHA 3VF0B 3JTOA 2L41A 4TY9A 1VQMS 3I32A 4DFKA 2KZMA 3LF0A 4Q45A 1VQPS 2R2UA 4OX7A 3OJUA 4KBIA 2YNIB 4IR9A 1NK5A 4K4VA 3PVXA 3J81Y 1EP4A 1R7IA 2CQCA 4KTQA 1U2FA 4O4GA 3E2EA 3KLFA 4FBTA 1KHVA 4N76A 1K73T 2WAQD 3RRHA 3AA9A 1DHMA 3G6XA 3M8PB 3NL0A 2LU2A 4OHVA 4MKBA 1P1LA 2V4RA 4P7TA 3UCGA 3BQ2A 5IM0A 4YR3A 1D8ZA 1RWUA 2CVIA 1HNWF 3KG0A 4RW7B 3SCLE 3BJYA 1X4DA 1R8PA 2IRUA 3WBZA 3SI8A 2QA1A 2G13A 2JL9A 3X3UA 3NNHA 3I87A 3V81B 4RW8B 4NLQA 4DR4F 1CG2A 1QAXA 4HKQA 4A47A 2DNHA 4FF2A 3N6MA 1TKXB 1N52B 2P9CA 5CQGA 2X1FA 2RVJA 2XNRA 2NS1B 3S1TA 5BYSA 2MXYA 2CQHA 2E1AA 3T9NA 4EBEA 4WTYA 1UEUA 3RRKA 2E1MC 3DOLB 2HHVA 2C3MA 1QUPA 1UVLA 4K4XA 5GADU 2V0NA 1MSWD 1N8RT 5K14B 2PI5A 4ECRA 1WHVA 1BQMA 2K3KA 5DM6Q 2DR8A 2DPIA 4E0DA 3D1QA 3H4DA 4DV0F 1UA1A 4JV5F 2E29A 4B9MA 4L6V3 4JV0A 1VIXA 1V6HA 3TUIC 2KHDA 2V8DA 4ZHRA 2XEXA 4O3SA 4OZ5A 4CT9A 2MKHA 4U7UK 5KFKA 2WSFC 2BE2B 1FDAA 3L95X 3PO5A 4CH0S 2D41A 1RI7A 2IA0A 5CZVA 2AJ1A 1RK8A 1LV5A 4ZHRB 4P6QA 3MEGB 1S49A 2OFHX 3PIOQ 5AXMA 4A46A 4RU2A 4YQWA 1DTTA 2YTCA 3HHLC 5J2QA 1TV6A 3I5CA 2YH0A 2XO7A 2I38A 3ZZTA 1Q16B 2N3LA 1RP5A 2Y1IA 1SV5B 1WELA 2VA3A 2IJNA 4LF9F 1O5JA 4R25A 1TL1B