4UZCA

Kshv lana (orf73) c-terminal domain, spiral: hexagonal crystal form
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
134
structure length
134
Chain Sequence
b'YQQPPVPYRQIDDCPAKARPQHIFYRRFLGKDGRRDPKCQWKFAVIFWGNDPYGLKKLSQAFQFGGVKAGPVSCLPHPGPDQSPITYCVYVYCQNKDTSKKVQMARLAWEASHPLAGNLQSSIVKFKKPLPLTQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ORF 73
publication title The 3D Structure of Kaposi Sarcoma Herpesvirus Lana C-Terminal Domain Bound to DNA.
pubmed doi rcsb
source organism Human herpesvirus 8
molecule tags Viral protein
total genus 34
structure length 134
sequence length 134
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-09-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.390 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Epstein Barr virus nuclear antigen-1, DNA-binding domain 4uzcA00
4UZCA 2YQ1A 4K2JA 4BLGA 2YPZA 2YQ0A 1B3TA 4UZBA 1VHIA 2YPYA 5A76A
chains in the Genus database with same CATH superfamily
3R6GB 4P7TA 2CPEA 2WSCC 2MQQA 1RHKB 1RWMB 1KP6A 2GVZB 5HVHA 3U7JA 2VFSA 1TQLA 3LA0A 1HD0A 3MM8B 1WHWA 2DIUA 1QTMA 1UP1A 1U0HB 4FYVB 2HRUA 2R2TA 1GTHA 4KKOA 1ZM9A 1FRXA 4IQMA 3J7ZT 4C8OA 1TAQA 4ECZA 1AUSL 3OR1A 4ECWA 2PSZA 4OX9F 2HW3A 4CLUA 3C15A 4C11A 1IVZA 2VODA 1JK9B 1RTHB 3AJ2A 1KLMA 2ZVSA 2AYBA 1XN9A 4YS2A 2B4VA 2EFOA 2W1BA 2OTJS 2G13A 3W64A 2O66A 3OLAA 1H2UX 1HWLA 2L08A 2K1RB 4FBTA 3S1TA 4WYLA 3F73A 4F4XA 3NNHA 4KY3A 4LSLB 3T5LA 3K5LA 3TVYA 4W98A 4ID5B 4RW4B 2MQPA 2XS7A 3NNCA 3QGHA 2PE8A 4P7VA 1DQ9A 5SZTA 2KVQE 3HHEA 1F0XA 2D69A 1ZM3A 1H3DA 4R5PB 2F7VA 2NUUG 1Q1KA 1H74A 2AQ4A 4CO0A 1EETA 4B9TA 2BRLA 1YBUA 2OPRA 2V8GA 3UDVA 5K9FA 3IBFB 1HNVB 3CO9A 1CJVB 3FZ2A 2XHCA 3E8OA 5J2PB 3H7HB 1MG7A 4M95A 1Q79A 2BV3A 2JFDA 5BYQA 5KOWA 5F8NA 2G1DA 4DX8H 5F9NA 2YKQA 4LR8A 3AODA 2GZOA 3TA1A 2XTJP 3KHLA 1IKVA 4A8XA 2J76E 1IBMF 4O3QA 1Q8IA 4JI7F 4FN5A 1YJ9S 2MYFA 4ES2A 1TP7A 1RT7A 1V3ZA 1NHUA 4ED0A 1HQ2A 1CG2A 1DLOB 4USMA 3DRSA 1XNRF 5F0UA 3IAM9 2OELA 3C14B 2KXNB 3JAMY 1O0PA 1S0NA 3K89A 2VBWA 4I2PA 5FJ4A 3DLJA 4KGZB 2BABA 2VG6B 1DY3A 3LF0A 4B3OA 5DZ7A 1H0HB 1Q86T 5LT5A 5F8HA 1FNXH 2WOMB 2E66A 2XSFA 2AJQA 2MQMA 5KFAA 2UXDF 3NKYA 2DRAA 1HHQA 1BUXA 2DNYA 1OYEA 4DQRA 5LSLA 2QA4G 3H2VE 3RAMA 2WZ1A 4C7QA 1U1MA 1XJWB 3P49B 1UZDA 4OLOA 1IKXA 3R3TA 1FRMA 1M0SA 4MT1A 5T7LB 5KFNA 4A8MP 4DLEA 4XPCA 2W2QP 4NXMJ 1HWKA 2DXFA 4PXCA 2MHEA 1PAUB 2QLJB 2H5JB 1QLNA 2YWWA 5GADU 2KM8B 1Q53A 1YG0A 2HFZA 2V4JA 4N77A 2DT9A 1S1VA 2BZ2A 1PG5B 1BQNB 1TL1B 3L7OA 4K0KF 2N3LA 3CDWA 1LWCA 2HVDA 3HVAA 3BPSP 2HK3A 4ZVHA 4HI1A 2P2CB 4N41A 1P8GA 3SEOA 4E98A 1SH0A 1SJRA 4TQRA 1FJ7A 2DB1A 3C3LA 2V8VA 2CPYA 3J7YI 3LP2A 5GMDA 2N3OA 2ZC4A 3M9OB 3D1OA 2LEAA 5KFFA 4ZVPB 4BC7A 2Y0SD 1CJTB 3R5JB 2HMIA 1YZ7A 2K2PA 4C2MA 4HHHA 3OJSA 2L3MA 2FGOA 4RW7B 4PXEA 1FWLA 4KHPF 3PO4A 3BV8A 3GILA 2V8PA 2EG1A 5HBMB 2HWTA 3G6XA 1W2IA 2IAJB 2D74B 4CO4A 3VTIA 5CZXA 2FY8A 3KLVA 3M8QA 2ABYA 2YX7A 2FZCB 3JTOA 2B9WA 2CQDA 4UTGA 4ZVEA 3OFFA 4CT8A 1TELA 3LP0B 2RQCA 3HVRA 1TV6A 2J8AA 1C1CA 4B3TF 3N6MA 2H5IB 3V81B 2ROEA 4IO9Q 3V6KA 5JUMA 3G82A 1SKWA 2A0FB 2ASJA 4X4VA 4ED7A 3I5BA 3N28A 3M2RB 2XO7A 2BR0A 2DNKA 2R7TA 3HZEA 1FTRA 2DNGA 2Z4PA 3S8SA 1HBUB 2HFOA 4DDFA 2VD3A 3ILJA 3DMJA 3TR5A 4YEAA 3NAIA 5F0WA 2IVYA 4FYXB 4QJVA 3C8YA 4IDKB 2XNQA 3D4JA 2WONA 4DS4A 4LT6A 3M2VB 1FF2A 4LRBA 2HFUA 4GC6A 3DOKB 1AYEA 2W9CA 2L9WA 5JMNA 1T9XA 3HSDA 2CQIA 3FCWA 1DRZA 2HQ3A 2IMWP 4EGLA 3CMAS 4OHWA 2CZVC 1GEHA 1QD1A 2DGTA 4C8LA 1U25A 1WHYA 1RT6B 1NPRA 3BKUA 3I4PA 4OL8A 2FPHX 3DOLB 1FE4A 4LBHA 4F2SA 4FXDA 2FHJA 1KQGB 4UOHA 3QGGA 2WRMA 5E7OB 3PX6A 1UFLA 3ZZ0A 3OTOJ 4DQPA 1H7XA 5DDRC 2CG4A 2D41A 4I68A 1T03B 5HP1A 5ETRA 1KD1T 1N33J 2RDJA 2CQ0A 4JI1J 2ZBPA 1DHMA 2AZ1A 2DYAA 5G4DA 2HKEA 2ZWOA 2YQ3A 3ET6A 3PHTA 2DISA 3D28A 3VQTA 3I55S 2EK1A 2NSBA 2AHOB 3SDEB 1N5TA 3Q0AA 3D5MA 4J90A 2DD8S 2GW8A 2PEBA 5ETMA 3LGNA 4ED8A 4ICLB 1VQ7S 1LQ9A 4QIEA 4PPZA 5GAEI 4NXNF 2FDNA 1AZSB 1URNA 2N82B 2E5IA 3HD1A 3QMQA 2VQEJ 3TOQA 3GQCA 4Q0BA 2VF3A 5IT0A 2DNPA 1V3SA 3FDSA 5LMNF 2ALZA 4PPDA 1HR0F 1RA7A 3GB0A 4NZ7A 2ZZTA 1XMOF 1YVFA 4G6VB 3FBCA 2DNMA 2GIQA 2HHTA 4NLRA 4NCGB 4FNIA 3IBWA 3ZTPA 4PRFA 2HFSA 1UA0A 2ZFHA 5HSPA 2EK6A 5DQGA 3O8WA 2HHHJ 3MOJB 2HNYB 2PI4A 3NS7B 1W7WA 4Y2AA 3Q89A 5K14B 2W9AA 5D4PA 2B3TB 2BQRA 2RD5C 3GP9A 1S99A 3D0HE 1P6TA 4I6YA 2RDIA 2E5HA 4I7FA 2UVUA 1IR2A 4JI6F 2E9ZA 2OUGA 4NLGA 2FJAB 2QSFA 3I31A 1S0OA 1NH7A 3JAMU 3TEGA 1KRPA 5GMKa 4I6AA 3AJDA 1NZ8A 4J91A 2KRBA 4OYAA 3Q23A 1S0VA 2VA2A 4DF4A 4K50A 3VCDA 3GONA 3TUJC 2HLUA 3QAUA 2AJ4A 4IYQA 5LL6d 4K2XA 4H4KC 3DHXA 3DDNA 3CUNA 2QMXA 1ZYQA 3FCHA 4PEOA 2KL8A 2ZVIA 3PYDA 1Q81T 2IA6A 4AT1B 2ZM6J 3AOCA 2MQOA 4DLGA 2DO4A 4GVBA 3HHNB 4JV5J 3FRYA 5J1EA 3POTB 1ULRA 4DV1J 5J1NA 4H4MA 5B7WA 4DL6A 2YNFB 4OI3A 1JLCA 1REVA 4USUA 2VBXA 2PA8D 2DNNA 2OPSB 1VOMA 4RNMA 2ZZMA 3DRRB 4N7TA 3C46A 3MPVA 4FS2A 1DFDA 1RAOA 4P2MA 3KHHA 5DLFA 3OV7A 1NMEB 1Q5YA 3OSPA 4F3OA 1XMBA 2AEMA 1S6QA 2FVPA 3ZTSA 1Z4UA 3MTJA 1RTJB 1V5VA 4URQU 2AKWB 4FVCA 5L1IA 2AW0A 3LPEA 1MWZA 4O23A 3TQ1A 3ZO7A 2GAHC 1HBNB 3MCOA 3GFHA 2YQ1A 2R7VA 3KLFA 2VOOA 3DXSX 3I5CA 4JI4F 2DGSA 4DR7J 2JHEA 4Y00A 1ZA1B 1RAHB 1JLGB 1HIYA 2IFXA 3B54A 3DOMA 4A8FA 3QSYB 3MAQA 1M5VC 2Z57B 5KFCA 2BE2A 3BKFA 3PYGA 3PJWA 3RB3A 1H6KX 3PY8A 4TY8B 4C8ZA 4RU2A 1F9HA 3VGSA 1KTQA 4O0NA 3QFHA 2D9OA 3HVWA 3VQSA 2N4DA 2GA7A 1X31C 5B0FA 4CTAB 4OYBA 2DHHA 1UVIA 2E7WA 4Y65A 3ENVA 3ZZUA 5E3RA 1LWFB 2RHQB 1NM2A 2Z2ZA 3N6LA 2DGXA 4F04B 4M8LA 3ZZTA 1SKUB 4TXSA 2LFVA 3CJRA 4ZJQA 1FRJA 4X4RA 4K7QA 1RI7A 5D15A 1FA0A 3GFXA 5KFDA 3H20A 4LF8F 1UJ5A 3D0GE 2HNZB 4QIVA 3MEEA 2IRYA 3NGSA 2H4WB 5A0YB 5AE1A 1NRKA 2MLYA 1CJUA 3MR7A 2MSSA 4X65J 2PA3A 4NLSA 1TL3B 2W8KA 3DLGB 3CMQA 3PRVA 3MTKA 3K5MA 4R25A 2H65B 3HLUA 1XNQJ 2MZSA 5AXNA 4YHHF 4KSEB 3M6UA 3KHRA 1S1UB 2B7CB 4F26A 2B56A 3OQ2A 3DI6A 2B43A 4L3KA 1Q0NA 4OJ3A 4FVMA 5HMXA 1HYSA 1FX4A 1O6XA 5D0GA 2W2NP 2ZBQA 1ZBTA 2BYCA 2GIRA 2JVOA 4R0EA 1NU4A 3N0VA 3WIVA 4PYDA 5A8KB 2Y8WA 4Q44A 1FCAA 1U0SA 3H98A 1PC4A 4KGVB 4D3HA 2ATCB 2ZOGA 4J9PA 2J0WA 4CLPA 1FJGJ 4OYZA 1RWPB 3TUPA 5J2MA 1EKSA 4I64A 4L3NA 3AHPA 3T1YF 1RTIA 4KPYA 2KFYA 2XYGB 3EXYA 4PCQA 2L9NA 5H9FK 5JJBA 2HWHA 2V8DA 4USVA 2AGQA 2DJWA 4EBEA 4LFAF 2W25A 3UD5A 3DLKB 1T9TA 2KKHA 1RWXB 2GQCA 4EFAC 4ZIWA 4JI8J 2IJNA 2OEMA 2AT1B 3E01A 4YB6A 1X4BA 2XQCA 2FTRA 5KFIA 1FDAA 4J9KA 3G86A 4DV7J 2V4RA 1RT2A 1NPKA 2B0GA 3MGJA 5HJXA 4NCBA 4RLEA 2VL1A 1C0TA 2QC3A 2GC8A 5DETA 3NCQA 4R8UB 1UZHA 3HM9A 3TJ9A 1KOOA 2AWZA 3QO9A 3CCES 1VR6A 1FRHA 2IYGA 2ZNZA 4E2FB 1E6VA 5KG7A 1Y3KA 2R8KA 3G9CA 5KG4A 5KFKA 5F3TA 4C48A 1MSWD 1QVFR 4A8KA 5GMEA 2FJVA 1Y9OA 4OZJA 4U7UK 1K0VA 2AZ3A 5BXIA 2VU5A 4O3SA 4X4UA 2HAIA 1NZAA 4GKJJ 4ZVFA 2DNQA 3ELHA 1RCXB 1VISA 2ZJPQ 2MSTA 4HTJA 3JS9A 3HHDA 1G3OA 1JLQB 1FO1A 1TK8A 3UFCX 3GSDA 4USJC 3M9NB 1VRUA 3KHGA 5LMUF 2C2EA 4C9DA 2I5JA 1KVIA 3OPKA 1GTEA 3GPAA 2WBMA 1N0UA 1SIZA 4U7CA 2JRSA 2ROPA 4DMZA 4Z37A 4FF3A 4CO1A 2ACYA 1VK3A 2FY1A 5DS7A 4WZMA 5KT7A 5BYRA 5I42A 2YX4A 1YIJS 2Y1RI 2RIJA 1R0BG 4ZP7A 2EFPA 3FK4A 2Q1LA 1MN9A 4DL4A 3EZUA 4RL1A 4CM0A 1HI0P 4OYOA 2YBVA 2M70A 1N0VC 4LF4J 3QAEA 3R8YA 1CJKB 2HNDA 1FKPB 1S1WA 2KU7A 1QSYA 3G71S 1TUWA 4PG7A 1M5SA 4MK9A 1HNWF 4HEA9 4HDGA 2HG4A 3R5GA 3D6TB 1YJ7A 5KFRA 2FGCA 1NK5A 3CIMA 3TYTA 3BSNA 5C25B 1F2GA 4NASA 5K8OA 4CLZA 1B99A 3CPWR 1JLEB 3WQPA 4WFZA 3MMJA 1HBOB 1U24A 3R9LA 3SSRA 1ROFA 5CCMA 5K8PA 3TUZC 4DV4J 1TMJA 1V3RA 4OZ3A 5IZHA 1M5HA 1N6QB 3NGRA 2DEJA 4B3RF 3SSQA 4ZPVR 1NDPA 3SQGB 3ITHA 1VJQA 2C28A 2FHOB 1OY9A 1WNEA 3W1YC 4LVNP 3QT7A 4V19J 3WZ0A 2UVWA 4UUXA 4B17A 1B0VA 4K4VA 1WOOA 2V2VA 1HHSA 1HI1A 1X4HA 3G8TA 3T3FA 5HL7Q 3GYXB 3HULA 3PX0A 3HPOA 4JI0F 2NQPA 4S0MA 4O3NA 1LFWA 5IM0A 2G2ZA 2G0IA 1HARA 5HLFA 2GJFA 5HMWA 1IJEB 3R1HA 4DPTA 2G9OA 4OMFG 2MZQA 1AUDA 1FK9A 2XZDB 3PRBA 1MU2B 1LW2A 2GNKA 4YMEA 3HT3A 1RISA 1QAYA 2RQMA 1H2TZ 3MEGA 4XK8C 1RT3A 3FC9A 3J7YU 1I94J 5A6PA 1D8YA 2LCWA 2VQFF 1B7YB 2A2CA 1L3VA 1ZM2A 2DBBA 1UJ6A 5KFHA 1VQ4S 3UCZP 1T94A 2Z8QA 1YRXA 2M4MA 2MMYA 3OVSA 1WTFA 2FVRA 2J9CA 5CD4A 3SCLE 2R2RA 4J9UE 5J2NB 1VBXA 4CLFA 4ER8A 2DR9A 2I1RA 4IOBA 3ETOA 2YH1A 4LFBF 5AE3A 3T1HF 1F3FA 1QDUB 1EJ7L 4ANEA 1RQ0A 2E1PA 4OFZA 1K0TA 4DUYJ 3I0SA 2OSRA 1E6YB 3IS9A 4OHVA 1Q8LA 4CLLA 2OH2A 4Q7AA 4F25A 1VIOA 2MY7A 4W92B 2GGPB 2OKQA 3QIPB 1AXQA 4DCJB 3HF5A 3RBZA 4DFKA 2RU3A 4LF1A 1IM4A 4PR6A 2RHSB 4DV2F 3D1QA 4DR1F 4MFBB 5F8LA 2N7CA 2OFGX 2RT3A 1CVJA 4LUBA 5T41A 2KFNA 4OZLA 5HVFA 2LXUA 4DR2J 5DGBA 2C42A 2MJNA 2G1HA 2XMWA 1MROA 4F02A 1S9EA 4DS5A 3CCRS 1IBLJ 2C2KB 2NREA 5C42A 4U8VA 2D3OR 1TK0A 3GJTB 2CJKA 2F8EX 4TU9A 1GNKA 1C4AA 2QEXS 1X0FA 4LR9A 2NS1B 2ADBA 2LMIA 1RLCL 3GSIA 3C16A 1N52B 4X62J 1WTBA 2CJAA 3HX9A 4MKAA 4JP8A 4DX6A 3NMRA 1LFPA 4QWAA 1S48A 2O01C 3Q2TC 1ZPVA 4PUOB 1Q5VA 2C3UA 2Y3YA 4ATNA 3T1AA 1KS2A 1M5OC 3D3BJ 4EMDA 4R0JA 3KXDA 2QIFA 9RUBA 1HNXJ 5AJ3J 2FJWA 4EK2A 3H5UA 4NZ6A 3MMAA 3ZZOA 1PBAA 3J7A1 3ENQA 1T02A 1VCTA 3DM2B 4LR7A 5L8RC 3ZC4A 3BO2A 3GV7B 2X3DA 1NDLA 1U4BA 2R42A 1A0OB 3DLLQ 1PILA 1S9GA 4KV8B 1BQMB 3TARA 3AA8A 2YQ0A 2IC3B 2ZDOA 4MYTA 3MCSA 2BBEA 4FYYB 5H9EK 4WFNQ 4OHXA 2D9PA 4TNOA 3MDFA 2FYXA 4K4XA 2CFXA 1WDTA 4DN9A 2ZE2A 1UVLA 1Z2ZA 3RR7A 3BN7A 4DV6F 3M32A 1M90T 1NH8A 2UV8A 1I3OB 2UVVA 4C8NA 3RRHA 2C3YA 2DR5A 2X3GA 1HQEB 4DXLA 3TAMB 2AMCB 2DHGA 3TZWA 4URGA 4O44A 4OIXA 3ENAA 4BWJA 2W7PA 2YNIA 1GQEA 2Z2YB 3GU0A 4USKA 4F4KA 1A9NB 2CQ2A 3L3CA 3O5TB 3Q8SB 1C1BA 2AD9A 1FX2A 1OMSA 1MNEA 3TAQA 2ZJRQ 4JUZA 2QGFB 3D6FB 1U6FA 4IH5A 1XQIA 4CYUB 5E3CA 3W2WB 4LSNA 3DRPA 2P9EA 1P9QC 2CQ4A 3M30A 4PQUB 4JI2J 3MI7X 4DV5J 4ZVQB 4F0MA 3EJMA 2VH7A 3J7AN 5H9FJ 2HIYA 3CJQA 3IM9A 2MKKA 4ECRA 4TU8A 2DH8A 1TAUA 3OW2R 4DL2A 3DRXA 1UW9A 2WVCA 5IT9Y 3CCMS 4I6WA 4FNHA 3CMES 4NLPA 4Y0FA 2XY7A 2C3PA 3K5OA 2CJXB 2MGZB 3R5AA 4P74A 2GO8A 5ETTA 2A18A 2ILZA 2E5JA 3R2DJ 1HL6A 3N01A 2HQIA 2WSFC 5A8WA 4CCHA 3CT9A 2OPQB 2Q6CA 1IUJA 3Q8VA 4H4KA 5E5NA 4FDFA 4IH7A 3K0JA 3BSCA 4ANCA 3PFEA 2FJXA 2H51B 4B9VA 4ITSA 2XMJA 4OX6A 4RZRA 3J80U 3MM8A 3PM9A 2M9KA 4ID8A 3KK3B 4P2XA 1JLFA 4X4TA 4B9UA 4ECTA 2Z30B 5G0RB 1XR6A 2RU9A 4M5DA 5IWAJ 4NLTA 2GCFA 3BS9A 1NJZA 2E9RX 4K8RA 1B70B 3QWPA 3GV5B 2I8EA 4O3PA 2RQ4A 5B0EA 1GXTA 3AAWB 3KJQB 5CYQB 4LF6J 4A46A 1KQFB 2MPUA 1AT1B 3QRRA 4DCOB 2QL5B 1ZTWA 3J7Z5 4Q5VA 4ZLPA 4G65A 2DIVA 1HMVB 1KLNA 2BRKA 2K1RA 3NMAA 4OX7A 5B0BA 3UCGA 4USWA 2MKYA 2DXDA 3PW2A 3VGUA 4FF4A 1U1KA 3IG1B 2MKHA 3KUEA 4DV3J 5GADI 3BGLA 3PV8A 1LWEB 2MB0B 3C6TB 3RAXA 1R89A 3BGRA 3K58A 4A8QA 2XS5A 2KO1A 4F4ZA 5A8RA 2C3OA 2IHR1 4AYBD 3CCWA 1CPZA 2ROGA 2HVZA 2J0QD 4N8OA 1X5OA 1HNVA 3QZ8A 5C24B 3FSYA 5J2PA 3MFHA 3ZTRA 2FD2A 2HS4A 5MLCV 4IR1A 4J9OA 1XERA 1F2HA 3RW7A 3DU5A 3OVBA 4CRJA 1NJYA 4G3IA 3ZZYA 4KKOB 4AFFA 3LPYA 1K73T 3M7VA 4F8RA 3N6NA 5KG5A 4RNFA 3OR1B 4KT0C 3L4BC 4IFVA 3GYNA 4U7UD 4CLYA 1NLKL 2HK2A 1S6UA 4KIAA 3A8JA 3CE8A 2J7WA 1EAYC 3DDKA 1SL2A 2M3DA 1K44A 4K4YA 5JVGQ 4MIWA 4ZPWR 2FB0A 3C14A 3T5HA 2F65A 2EW9A 3FBBA 1KWMA 2C2RA 4YOEA 2BJDA 3NBPA 2CRLA 3Q86A 5IFMA 4MKYA 2PDAA 3HP6A 5CYMA 2RJZA 1T9UA 1HLWA 1D9DA 4LIWA 2P6TA 3NGTA 4UQTA 3FMWA 3CJKB 4MTPA 2OP5A 4OYIA 3OL8A 4Q8EA 3IWXA 4LF5F 4XIUA 1FFGB 4ED1A 4DX5A 3D67A 3EGVA 2HHSA 4CLKA 3KDOA 5F9LA 4ZLJA 2ZZNA 3V6DB 1U6BA 2GMJA 1S59A 2R4FA 4AL6A 3OVAA 1L3UA 3NGUA 3MR2A 4X4SA 5IT4A 2WHOA 1U02A 1BQNA 3LOUA 4CP5A 1TL1A 4NYOA 1DAXA 4N5SA 2UXBJ 1RT7B 1BWVA 3HVTB 2XWYA 4NOHA 4C0HA 2MY8A 4CO3A 2COLA 5JXSA 3JQMA 3AB2B 3BB5A 3M6XA 3SZ2A 1X4CA 3CJ0A 4I67A 3UR3C 1G2EA 4KO0B 3A12A 1PGZA 4NCAA 2QFJA 4ELUA 3MUVP 4LF7J 3EUNA 3DLHA 3RRKA 1JJ4A 2FUG9 2XSJA 3I96A 2Y0BB 3R7SB 4C97A 1CJTA 2Y8YA 2FZKB 4RW7A 4YDDB 2XMTA 4BDPA 4IOCQ 3HXMA 1U2RA 2ZUGA 2M8HA 3H5YA 2F8MA 4CLSA 5HBMA 4ZLLA 3TVZA 1FWKA 4P71A 4RPFA 4EBDA 2RS8A 3LWMA 1IKXB 4JV1A 1MW7A 2BA9A 3QSIA 3UO0A 2VPWB 3V2UC 1RTZA 3GIRA 5ETOA 3KJFB 4KFBA 1HNIB 4P2SA 3LP0A 3NEKA 4LIRA 2C2NA 3P5BP 1S4FA 3V81A 2V8HA 3OFEA 2E7XA 1GMWD 3QT6A 1OO0B 4ZPTR 4PG8A 3QRQA 4UF4A 3QT8A 1JWWA 2HVIA 1S1VB 4ZOSA 1QUVA 1TKXB 3PW4A 3JSYA 3QGIA 3THPA 1HBUA 2QMWA 2RB7A 3LP2B 4IDKA 1MLAA 2HIQA 1WORA 2ZM6F 3FBEA 3T41A 3M2VA 4NA3A 4JBCA 1NDCA 1GMUA 2CJYB 5J1PA 3OTCA 3HHLA 4X4OA 1BQXA 2UVRA 4EU0A 3N79A 3PDNA 4K5SA 1YITS 2H9ZA 3IRXB 3EVOA 3PZPA 1RT6A 1SKSA 4NMLA 4NLUA 1YRTA 3M8QB 1WOPA 3IGVA 3A3NB 2JVRA 3MM9B 3JXOA 1TU0B 1F9FA 1KBRA 3A8EA 1RYRA 4U6PA 1WWHA 2KZMA 2KHCA 1C1CB 3WIUA 4FP9A 4C0OC 3PX4A 3G82B 5CAAA 1SJQA 3VWSA 3BGOP 3MAHA 4B3MF 3M8SA 2VUGA 2VHGA 1B64A 4B08A 1N32F 1JNRB 4QWDA 3ZNJ1 4EZ6A 3WC2A 1LOUA 3I9V9 1EP4B 3DMJB 3R27A 4HTIA 1T9YA 4MJKA 4ERDA 3SDEA 3MAAB 4ILMA 3UD4P 2E1RA 1NNDA 2DCUB 3QATA 4J5OA 1NAQA 4CWBA 1UVMA 2YWEA 4ICLA 3LAMA 5CHCB 3OBIA 2DTJA 2VG5B 1AZSA 3NOGA 2IY5B 2ZWPA 4ALZA 1RT4B 2POKA 3PNIA 2K3IA 1CC7A 2QG9B 1OJ4A 4J9QA 3PJXA 1DBDA 1FVSA 3LGMA 5KG3A 3QGPA 4KC5A 1ZZFA 1IR0A 2HRTA 2CAJA 2M52A 2XI3A 4HR2A 3J81Y 1U2FA 2UXDJ 3BR9A 2B7BB 2HLTA 3FGVA 4NCGA 1PYTA 3WHIA 3MM7B 2YPZA 1N8RT 2RNEA 4F3QA 4ZA1A 1H73A 2HNYA 2BMBA 3PIOQ 3A1YG 5K14A 3AXKA 4X65F 3MR5A 1U8SA 4C4WA 4XAKA 3IM8A 3NLCA 4ETXA 4LRDA 4DPYA 1KNZA 3TVKA 3G8SA 3VGTA 4DWIA 1XNQF 3OXGA 3P45B 2ACMA 1R0AB 1NK4A 4CO5A 2ZH7A 1NPPA 3G4SS 4P52A 4UOCA 1N5SA 2L48A 1T8EA 1LV5A 4DFJA 1FXRA 2HVEA 4P75A 1FDNA 2HFNA 4K0KJ 4TYBA 1VYAA 2YKAA 2E7VA 3PKYA 2EPIA 2YNGB 3GWCA 1RE1B 1ZZNA 2ADCA 1NKBA 3TQEA 1KFDA 2ZHOA 1VS3A 5EWGA 4NEYA 5DDOC 4RO0A 5I3PA 1OY6A 5EN1A 3KK2A 2R7QA 2HGLA 2ASYA 3NS6A 2E1AA 4RWXA 1FJGF 4FKYA 2LKZA 2U2FA 4LFCF 2IPOB 2V34A 4ELVA 3THTA 2GHVC 2LU2A 4ZN3A 2UUTA 2IDLA 2M8DB 1FXLA 2PN6A 3FFIB 2ZH1A 3EM1A 2YNFA 2PGCA 4ENOA 3T6BA 2VFUA 5LM7E 4TN2A 1SB6A 2O1PA 4QIWD 3CCTA 1C0UA 4JI8F 3DRRA 2ASDA 4NA1A 4KPCA 2ZH2A 4Y28C 4F67A 2ZH9A 4CT9A 4F4WA 4AXIA 1RTJA 4OYPA 2J5AA 2BKOA 1QTNB 4CQ1A 5HO4A 4B3TJ 2B51A 2CQ1A 3CGIA 2R7WA 1YK9A 1X8DA 3NNAA 2P9GA 1YJVA 5D8HB 3FBFA 4UUWA 2B6AB 1U49A 2V9WA 3MWBA 2ZBIA 4TLRA 2NLWA 1JLGA 4UY8T 1PAEX 1P1TA 1FTCA 4WXOA 3DLBA 5SUHA 4F0KA 3X1LB 2VDIA 1R27B 1U6ZA 3ZXWA 1WACA 4QR1A 4TY8A 4YP3A 5EWFA 3THVA 3AOBA 5IS2A 4KGKA 4GKJF 1X5TA 3HI9A 4X4PA 2W4PA 1NK7A 2NXNA 3W3SA 2AEJA 4GVBB 3ETMA 4ILRA 4CTAA 5I3UB 4Q2MA 1OYDA 4TLQA 1VGYA 3ZZRA 2YPYA 1OQ6A 1LWFA 1WI6A 2YXLA 3HJVA 1F1BB 4ZIVA 1R6YA 1JLCB 3KOAA 3I9ZA 2MEWA 2IM0A 5D4LA 5E3PA 4KH1B 3PFOA 3CCJS 3IR5B 3R2CJ 1S6QB 3T5KA 4DEZA 3ISNC 4Z2XA 1YHQS 4LF4F 1ZAXA 1RBOB 5AXMA 1OY8A 3BSOA 1SJ1A 4KGXB 2JFKA 1TL3A 2Q6BA 3DLGA 5KFZA 4F4AA 1BE4A 3RZAA 3B8HA 1HWUA 2W4CA 3R97A 1K1SA 1YJUA 8AT1B 2WVEA 2OTLS 2GHPA 2KYZA 1SUQA 1ITPA 4F7VA 1S1UA 4WK3A 1NBEB 4MIBA 4ZDNA 1NKEA 2GVDA 2O3DA 1RJJA 2EBGA 2QYCA 4ES1A 1IM6A 1DZ5A 4PXBA 1X4FA 2LEPA 4OZ1A 3W60A 3DCAA 3H5XA 4DSJA 2GS8A 4WFAQ 2GQQA 2YWHA 3CCSS 5FLXU 1YRUA 4YUDA 2CWXA 4IG0B 1AROP 1JKHA 2QYGA 5A8KA 3M8RA 4NXNJ 4DSEA 4HACA 1MMLA 4E8UA 1S57A 1F6TA 3UNGC 6AT1B 2MDAA 3CIZA 2MZTA 2RSQA 5LMNJ 1CULB 4WE1A 1XMOJ 2F40A 3SFUA 3U1MA 1R8PA 4ED4A 2CQPA 3KLGB 2FVQA 3BQ1A 1RHQB 1PBUA 3BYRA 2UZAA 3MEEB 2PO4A 1FESA 1DQ8A 3MMCB 3DLKA 2RMLA 1UWAA 2R9LA 1VQLS 2B9YA 1CSJA 3Q2SC 4ZPAA 2VG7B 3GCWP 2LA4A 3FSXA 2FVSA 2W2OP 1HA1A 5DZ6A 4JI6J 2Q79A 4W90B 1NXIA 2HS3A 3RUBL 1KFSA 3EDRB 1NSPA 1WKKA 2XMVA 1WC0A 2WVDA 2GFFA 2QA2A 7AT1B 1S97A 1PJ6A 3IXQA 4TVAB 1H38A 2F9DA 1I5OB 3DI6B 5LXYA 3S6EA 4R8UA 4QIGA 4JI3J 5L1LA 1SIWB 3KK1A 1N88A 3AB4B 4ZHRB 2MQLA 3J81U 1RWKB 1KC8T 2OHDA 1BGXT 2YKMB 4K4TA 3UDCA 4TQSA 5AT1B 2XMAA 1Q8BA 3C6UA 4Y2CA 1IKWB 2XLKA 2P6SA 3RB6A 3CW2C 5KFMA 3SXLA 2RS2A 2OSQA 4JI5J 4ZVRB 4IUFA 2H4YB 2YVSA 4C3LA 4KBIA 4HVZA 2KHDA 1RBLA 3UCUP 4DUYF 1ELOA 3MEDB 5GAGI 3TRGA 2BOAA 5IV4A 5J2MB 4DQQA 1HKAA 2DGOA 1X9SA 4U9RA 4HT5A 2IVMA 2LQ8A 3BKTA 1PYSB 1VFJA 1FEEA 3KG1A 3MCNA 3ISND 2X1BA 4C98A 3M6WA 1GH8A 3UN5A 4FPIA 4RUBA 1HHTP 1FVQA 1Q4RA 3AFGA 5HVGA 2HYIB 4FXVA 2N7YA 3W62A 4DR2F 3CD0A 2WVFA 5HROA 1S1TA 3E01B 3M8YA 5IXUA 2XEXA 3BDEA 2PI5A 3MPDA 3W2VA 4NMXA 1GAOA 3UQSA 3W9HA 1OIAA 4LMZA 3GJQB 3MPYA 1N5YA 3PW7A 4ZPCA 2Z58B 3RJMB 1BXNA 1C0TB 1HPZB 5KFOA 2ZKUA 3AD9C 4OYWA 4JI4J 4X62F 1M1GA 2A3JA 2HPUA 2QLFB 3L95X 3TX8A 2VJUA 4V1Ak 5C25A 3FJ2A 2X7IA 1YI2S 4OX8A 2IRXA 3AH6A 1HQUA 1JLEA 3W5YA 3VVUA 2XB2D 5HQMA 1HBOA 2HVHA 4WIIA 2NXCA 1ZS6A 5EX0A 4WU2A 2OMLA 5KFPA 1VLYA 3NGKA 2M88A 4I2QA 2ZC3A 2J7UA 1X7VA 3NOCA 4FXWA 2CVEA 1HNXF 3SI8A 1R8CA 3DRYA 4X64F 2XGPA 1N6QA 1N56A 2NXUA 3NG8A 4DCPB 4RX6A 1U1NA 1RYSA 1FNMA 2CNOB 2L41A 3VAHA 5D78A 1S10A 2UUCF 2VKZG 1B0PA 1VDHA 1HWJA 1EQMA 3R1LA 2HSEB 1NHVA 3NRBA 1NCLA 2EXUA 4FF2A 3OJUA 1WJ9A 1RU1A 3HDSA 4ES3A 1U1RA 3IO1A 3M4XA 5I42B 4PG5A 5KG1A 4OLPA 1DTTB 4LF8J 4A8OA 5ETVA 2C1EB 1IBCB 2JEJA 4DQIA 2GHWA 3W9JA 3CCZA 3D1HA 3MECB 3BYPA 3PVXA 2W2PP 2HNDB 2V6AA 1VBYA 5C5JA 3V6JA 4NLYA 3EGZA 4PWWA 1OQ3A 1LK7A 2DHAA 1AB8A 3W63A 2EBEA 2HQFA 3D54A 1NKCA 4YHHJ 4DSLA 1EIYB 2CNLB 3TJAA 1Y4ZB 2ZOMA 2IJFA 1J5EF 2KFZA 1JXVA 2W24A 3G6ES 3O44A 3OTBA 1YZ6A 2PT0A 1N34F 2CPIA 2EKNA 1J5OA 2G2OA 1S49A 4NLDA 4BBYA 5J2NA 4MIAA 2OD4A 4RBVA 3MD1A 4WPAA 4OQJA 3IA0A 2G0JA 4KB7A 2RUSA 4XDDA 2GIFA 1WEZA 4HLBA 2IA0A 3H90A 2HGNA 2NUHA 2L9DA 4LBPA 1WUUA 3FKBA 3IFEA 3KJVB 4ECYA 2J6SA 3NCPA 1RT5A 2GGPA 1B0TA 3QIPA 1REGX 3T1YJ 2BJ7A 2F4VJ 3H42A 3KWMA 5KT2A 4RUHA 3KMQA 2QL7B 5IM0B 1SQGA 2FQQB 5C7PA 4RUAA 4LFAJ 3T19A 5DG7A 1ZM4A 3CO0P 4J9SA 2FJDB 2ZD1B 1YJTA 3JQKA 1ZETA 4HHJA 5B0CA 2LXFA 1FK9B 4LRCA 4NLOA 3RGIA 1LW2B 4X84A 2VIHA 3EYZA 4OI1A 1BD6A 3HSJA 5KG2A 2DGUA 2ERRA 2E1CA 4QU6A 3CD7A 1N36F 1FRKA 1SBRA 1U1QA 1WKJA 3KNAA 2Q66A 4M5HA 2CIMA 2OMOA 3M1VA 2V63A 1YBTA 3IRWP 2LQ5A 4DR3F 4GRSA 2ZITA 3PRDA 2BUNA 3I56S 3A3OB 2RUGA 3EGNA 3D6HB 2R7XA 5C2GA 3U1NA 4LF6F 5E0OA 4KJIA 1YJRA 3DYAB 2VASA 3QWUA 1S6OA 2FIUA 4I1TA 2XULA 5GVQA 3TWZA 1VHIA 3MF5A 3DC2A 4DI6A 4WIQA 5ITHA 4FPRA 3WDOA 3I0SB 3IN5A 3IS9B 3D0IE 5LMUJ 3I32A 3P96A 2CDQA 1CS4B 1X5SA 1VJWA 3QPIA 3MMBB 1FFSB 2YH0A 4A47A 4EZ9A 3CJ3A 1C4CA 5DLGA 3CJTA 3VAKA 2HBYB 4DN0A 1CEZA 3NXZA 2KZZA 2IDEA 4H54A 4KV8A 5ETKA 2LQBA 2OPPB 1K47A 2IRUA 1OSDA 2IC3A 3HFZB 2FHJD 2CQHA 5HK4A 4KAIA 3LP1B 5IC4B 2CUYA 1FWPA 3D66A 4O0IA 1U8WA 3SSSA 1NDKA 4LJMA 2G4BA 2HHQA 2BANB 4I56A 1W25A 5HAOA 4JV0A 2XI2A 5AE2A 4QIFA 1HNWJ 2BVZA 2I6WA 4ZN1A 1ZAWA 3CJ4A 3OXLA 2YWGA 3GIJA 2B4PA 1CBKA 1S9FA 1UVJA 1KVJA 2UU9F 2RDDA 2M5YA 3MEKA 4YQWA 2IJRA 1HQEA 2JLEA 5BR8F 3TAMA 1TKTA 2Z2LA 3D9BA 4KE5A 2VFRA 3BO3A 3M2UB 3F0NA 1ZOTA 1N5QA 4B3SF 3EVWA 4V19X 1IKYB 1Q7LB 4EYIB 1RU2A 1WELA 2X1GA 4B3RJ 1RCOB 3MMAB 4ZVGA 3M9MB 3BBCA 2UV8G 3TUIC 3OD2A 3DFEA 4F2RA 1GXUA 4DSFA 1SH2A 4PQUA 1SC1B 3TANA 3CCUS 2C2OB 3U27A 2BX6A 2Z0GA 1R8BA 1U1LA 3DDIA 5DJBA 4GKKF 4M5GA 4GVLA 5D6GA 1BMQB 3BF4A 4JI0J 2CG8A 1VHFA 3OSNA 4C3MA 4YB5A 1JLBA 2U1AA 4DJBA 2XBPA 1FHTA 4K4WA 2MGZA 5MAOA 2OFHX 3ZZPA 2BQ3A 1VIXA 2MZJA 3VZHA 2LQJA 2WTFA 2R2SA 2AYMA 3RBXA 4FYWB 1HI8A 2RILA 4ZP8A 3O2IA 4WWSA 4FS1A 5KT6A 4RNNA 4N56A 1PCAA 3M8PB 1S0MA 1T05B 4HH1A 1NK9A 4F36A 1RHUB 2V67A 1B4SA 4RR5A 2WW4A 1RXOB 2QN6B 1X4DA 3VAJA 4O44B 3JSMB 3P6YC 3EPIA 3HJFA 3KLEA 5L1KA 1RDRA 4GO5X 2K06A 2W2MP 2YKNB 5G0RA 3ZTOA 3LH2S 3CJ5A 3VAGA 4AUKA 5HATA 1S6PB 4OI6A 4DPOA 4G1QB 5CYQA 4NLWA 4HYKA 1RHMB 4G1PA 4LF7F 4IO1A 4LREA 4LFBJ 4DR6J 3HHKA 3LWLA 3DRPB 3AQOA 2EC2A 3M30B 4H4OA 1F3VA 2UUBJ 4Y3CA 4LVOP 1M5KC 4L75A 3N5FA 4QOTA 1Z2LA 5T14A 1Q8KA 5ETNA 3B82A 2EFQA 4MK8A 1BY9A 2JZ5A 2RF2A 3B78A 1XR5A 1FERA 1LEOA 1IXKA 3O3LA 4NL5A 4ZVSB 3ADAC 4DV2J 2MJUA 1U7LA 4DR1J 4KGMA 1D9AA 3V4MA 4QCLA 2WW8A 4O4GB 3NAHA 4IRCA 1S1XA 1WF1A 2J9EA 4WTOB 1J2VA 3ZFVA 2PFDA 5CD4H 2CADA 5DQHA 1UEUA 3FEXB 3GR0A 3GV8B 2JEGA 2B8QA 4DR5J 1V5IB 2IYIA 1NJIT 3CD6S 1PYOB 3L9ZA 3E2EA 2VPYB 5ETPA 5HANA 3DXBA 4YY3F 1O8BA 3KLIA 3VAIA 4LQ3A 3BQ0A 2ZEJA 3LALA 2OJ3A 1JLFB 1H72C 1GK8A 4WK1A 1UCNA 4M5DB 3TZZA 1WEYA 4WP3A 5BJRA 2AJ2A 2XYPB 2DKOB 4O3RA 3ZNUA 3DNCA 3WX8A 2AYEA 4LF2A 2AJFE 2A1BA 2P8IA 3JSRA 3QLHB 5B0AA 1R43A 1S7HA 2DY1A 4WBFA 2FLLA 3L09A 1WHXA 2DNZA 3UWTA 2QMUB 1J27A 2YNHA 4J7CA 3MUMP 4WJBA 4ZS6A 4NZ0A 3P5TL 1ZA2B 1RAIB 3T6JA 2DR8A 2XO6A 2H54B 3VGVA 2C2DA 2ALYB 3GJSB 3IR6B 1JLAB 4IRKA 4JYAJ 3BGRB 1IBKF 3I87A 3PJ9A 3Q8YA 1DJ0A 1NEEA 3HKWA 2CPFA 5KG0A 3CJKA 3LAKA 3T5JA 5A8RB 1KKHA 4CM2A 5LOQA 1DQAA 4B9MA 1Y00A 5KFTA 3FUYA 1UTAA 4DL3A 2IIHA 1EKRA 5J2QA 4C8YA 1FKAF 3RRGA 2BJEA 4Y2IA 3MD3A 3V6DA 1UWBB 1Y5IB 2VFVA 2K7JA 4OHYA 3T9ZA 4DV6J 4WU3A 3KFWX 1Q7YT 4PWDB 4DSIA 3QIDA 3CJ8A 1I51B 4A4JA 4DF8A 3KJNB 5D0RA 2FC8A 2CJ9A 4NLVA 4ZPDA 4IFVB 2MLZA 1TL7A 2PFFB 3PR5B 2E1MC 3Q24A 1Y5LB 1K9MT 2AP6A 3LW5C 5U47A 4ETZA 3HVTA 2X51A 4DFPA 2HHWA 2NXEA 4QWCA 2CKWA 1W26A 1RAAB 2VOPA 1YLXA 3EICA 2UUAF 1PKUA 3MR6A 3PO5A 4KO0A 2D1CA 1FXDA 4JOUA 3KLHB 3EDQB 1W2BR 1VQ9S 2ZBRA 3GIIA 1UA1A 4LF9F 3SBMA 2HRYA 3NBPB 1VQYA 5EDWA 2AEFA 5CYMB 2WB4A 2FJBB 5A6WA 3MZIA 4DR4F 1MN7A 2BM0A 3MM5B 2MKCA 3DHWC 5I3QA 2J0SD 1MWYA 1TL4A 2CDRB 3BEGB 3R6LB 4DUZF 2E9TA 3K7RA 1S76D 3PCOB 3AQPA 2BKNA 3AXMA 3NWGA 4NE9C 1U47A 3WBZA 2RRNA 5DM6Q 2E5LJ 4DG1A 4ZITA 3FNNA 4Y34A 2QFIA 2XGQA 1WC1A 1HNIA 2YX1A 4AQYF 4QQBA 4TKTA 1T0TV 1RWVB 1VQPS 1RB0A 4WF9Q 2J7KA 1M1HA 3OHAA 4JV2A 1TKXA 4QZVB 3AA9A 5F41A 1QAIA 3JTPA 4RW8A 2GAGC 3BO4A 2VBYA 5GAGU 2DNOA 2NYHA 2QT7A 1H7WA 3H0PA 3NP5A 4M5LA 2VICA 1RT1B 3HT0A 3D6MB 5FDLA 2HURA 4CLWA 1V6HA 2J9DA 3K5NA 4NI2A 1LK5A 5KFWA 3IBCB 2EFNA 1SC6A 2XSJB 2XMKA 3AD8C 3EGWB 4YB1P 5HQLA 1RADB 3V6HA 2CXEA 1FKOA 4ZP6A 4DOZA 3JYTB 1URRA 4P73A 3R7BB 5EHHA 2HQGA 3K5PA 4MKVA 3IRXA 3MM6B 4ECVA 1N5VA 4UW2A 2J9DE 3I6PA 3B4MA 4ZKAA 2CNKB 2B4OA 2XMUA 4QWEA 4J9LA 3I5AA 5DDQC 2F1FA 3MUTP 1NSAA 4DFMA 4DV0J 3U02A 3MM9A 3N5BA 4KFBB 3VZIA 1UW4A 1DTQA 1NK6A 2H48B 2D7SA 3BREA 1RZMA 2V2ZA 3GG1A 3QJPA 5LSOA 1TUGB 1KVKA 4YFUA 4CI0B 5KFUA 1SC4B 4N8NA 3I0RB 1RTDB 3RAQA 3OUYB 4I4BA 2V68A 1WSVA 1R3NA 4AE5A 4QPTA 5HI7A 2FLOA 2LA6A 1X9MA 1EP4A 1F9EB 1B7FA 4C8MA 2JC1A 3DGPB 4ZLNA 3TA0A 1YJNS 4D3GA 2WAQD 2MKIA 3M8ZA 3MAAA 3FEYB 1N4LA 1TVRB 3RB4A 3HHLB 5D4NA 4QBUA 2KB2A 2VG5A 3CDAA 2EKYA 3PW5A 2AV5A 2DEIA 1U1OA 1RT4A 1R7IA 4YR0A 2DR7A 4FYDA 4AL7A 4X2BA 3TX0A 3IAS9 2NPFA 1APSA 1QE1A 2FVCA 2YKPA 3AD7C 3K8WA 4ECSA 2VKRA 1YJWS 2KT2A 3MM7A 4QWBA 1DURA 3CDBA 3UI3A 3V4IB 4BWMA 2VC1A 1K8AT 3BBBA 4LF5J 3DLEA 2HFVA 1PSDA 1Y5NB 3CC4S 4M5NA 1QY7A 1V9OA 4DBQA 5KFYA 1G6BA 2QRRA 4K4UA 3NY0A 3V5RA 5AXKA 5EGYA 1WKLA 3EWGA 3QYYA 2ZKTA 3FRZA 4IFYB 1FT8A 2RRAA 1R0AA 1HBMA 5DO2A 1VC5A 2OO4A 1SQFA 2BJ8A 3HSZA 3NCRA 3CULA 4YN3B 1LWXA 1X9WA 3L7UA 1K1QA 1TUVA 1D8ZA 2JEFA 1T3OA 2YNGA 3CF5Q 3H5SA 4ZCIA 4M1KA 1SV5B 2N4CA 1VQSA 1KHVA 4RBTA 1FEHA 1WEXA 2UXCJ 2JWNA 1RLDA 3O1LA 3H4DA 1QSLA 3OLBA 3UR0A 1Q16B 3UVJB 5AXLA 2DH7A 2B9XA 2XZTB 1LW0A 4DZDA 1O51A 1TFYA 4K4SA 1XWLA 4IKAA 1HW9A 2LECA 3HMJG 3FFIA 3OFHA 1QAJA 3FCVA 4NPOA 2I2YA 1OWXA 4Z7YA 3NGDA 3CCQS 5F8JA 4YB7A 2ZUAA 2R8HA 2C2ZB 3F56A 1L5UA 3PEJA 5LJ5Y 4IG3B 3MOZA 4K4ZA 3OR2A 2RAQA 3MHYA 4ZCKA 1UJ4A 1UAWA 3NWRA 3EX7B 3RBDA 3G87A 4XTTA 4JI3F 2V69A 2B6AA 1RHJB 3K57A 1EHWA 4C3KA 1QM9A 2VZ9A 1UPMB 4BS2A 2OI2A 1ICEB 3H2UB 2W7OA 1P9YA 4NXMF 2ZBCA 4JB8B 3HFKA 1YX2A 3EZOA 2HAFA 4PAAA 2RKIB 1ZAVA 5H1SV 5GAHI 1WC6A 1FRLA 2D3UA 1GT8A 3EMTA 4JI5F 4RW6B 3FZBA 3KK2B 2DXEA 4UY85 2XY5A 1RAFB 3CSKA 1FRIA 1BWEA 5I3UA 2GVZA 2C22A 1UMJA 1UEVA 4EO8A 4F0HA 3I4HX 4K2JA 1U0HA 3TJ8A 3TP2A 3R5BA 1TKZB 3MXHP 5D3GB 4ZVOB 1WHVA 4GMKA 3BH7B 4HT7A 2DY9A 5L46A 3MR3A 3GZ7A 4HI2A 5KFVA 4DL7A 1C0UB 2DPJA 1RTHA 4RBUA 2RVJA 1TZ0A 3ZZZA 4RW9B 2HHPA 2Q43A 3GJRB 1SKRA 1GX5A 2W9BB 5K20B 1WD6A 3VF0B 2HGMA 3VVTA 3BBFA 5KT3A 3H4BA 5IQ6A 5KFJA 2QTWA 3TO8A 7FD1A 4LSLA 1L3TA 4OZ2A 4Y2KA 2MXYA 4ID5A 2KT3A 4RW4A 4B3MJ 2B9EA 4OJGA 2DR6A 1N32J 1GX6A 2VV5A 1IN0A 4GO7X 2XLIA 4ZMMA 1FDDA 2B5JB 1VRTB 4R5PA 1LXNA 3VAFA 3RU0A 4WKYA 1JJ2R 2IMOA 2P9CA 3KKFA 2KG0A 1KN6A 1ACMB 4KHRA 3OL7A 4ECXA 4PWUA 1ZTTA 1X60A 2DITA 1CJVA 5CA5A 1GMVA 4NYPA 3QNWB 1FFWB 2H3EB 1D09B 4IG0A 4LBIA 1H98A 4EO6A 4PG4A 4CZCA 3UW1A 2OIHA 4G1IA 2R7OA 4LRAA 4PABA 1D1UA 4CH0S 2MKJA 2FZGB 2R7UA 1CULA 1U26A 8RUCA 3C15B 3A4TA 4C11B 4OV1A 4MH8A 1KLMB 3KLGA 2ZH6A 1T7PA 2IM1A 1YTYA 3RBEA 1DLOA 2CPHA 2LXIA 3LANA 2LQ9A 1SXLA 4Q45A 2G2YA 3AT1B 3MMCA 1NJXA 1HNZJ 4OI2A 4DPXA 4WFBQ 4J9MA 2VG6A 2VG7A 2QZ8A 2W01A 1WF0A 3Q8QB 4DL0C 1S12A 1VQKS 2WOMA 3H8YA 1GXLA 1QVGR 5ETLA 1SUQB 1VC0A 3ZTQA 2LP4A 1EETB 4W4MA 2VB6A 2GVDB 4M94A 1KHWA 2PC6A 4ED3A 3DKDA 2XNRA 2OPRB 3FEZA 3BM7A 1WSRA 1SI9A 5T7LA 4ZHRA 1Y10A 2ZOFA 4EWTA 3PACA 3OTOF 2VBZA 1VBKA 2KM8C 2CNNB 2FJEB 1RAEB 2YKMA 5LXRA 4B9SA 4A8WA 4DU7A 1JKHB 1T11A 1N33F 4OV6A 1VK8A 4JI1F 1IKWA 2E44A 4XDCA 4HACB 3RTVA 4C8KA 1IKVB 2QSWA 1CQMA 1R8HA 1QJHA 2J8SA 3PYFA 5F8GA 3MEDA 4WE1B 4X66J 3JTNA 2HZVA 1RABB 4LFCJ 2F4VF 1VQNS 2B4UA 2NYIA 1F60B 3CC2S 4RUCA 3CDEA 5B0DA 3KUGA 3DRSB 2OEKA 1UFKA 3AOAA 4F4YA 1IJFB 3LUYA 4KHMA 3ILLA 3IC1A 4J9VA 2VQEF 1RUSA 1N48A 4I2PB 4NX9A 1QUPA 4B3OB 2OGUA 3AY0A 2ZDPA 1RKIA 3H59A 3TZYA 3PTWA 1CQNA 3CJ2A 5IQQA 1XMQJ 5KT5A 2HBQB 2DH9A 1QSSA 2CQBA 2Y1JA 1EQ0A 2ILYA 2HQDA 1HPZA 2IAJA 2HHHF 4URSA 5JVHQ 3R5CA 1Q78A 1UEKA 4DHVA 4I69A 3SCKE 2V2QA 3KK1B 2KJWA 2C3MA 3U1LA 2BJ9A 4RWWA 1PC5A 1VBZA 1RWOB 2CQ3A 1G7CB 3A3PB 1X4GA 2EI5A 4ELTA 1F5CA 3C6UB 1WG5A 1H2VZ 2OD6A 4KR0B 5ETQA 5BYSA 2V4JB 1YQHA 4ZCLA 5CYJA 1U45A 2KN4A 3K17A 2C2MB 2HWIA 4QW9A 3LTOA 4DQSA 2HHVA 2KXFA 3K59A 3M2RA 1LWCB 4NRUA 5C2CA 1FJEB 1I1GA 4HHUA 1TL5A 2I38A 1XIQA 1S72S 3G96A 1T9VA 3QJJA 3CCLS 4QR0A 4WZQA 1SJ3P 5IT9U 4OX9J 4P9SA 6FD1A 1S7IA 2CZ9A 2EFVA 3HHLC 2QLWA 1IR1A 5D4OA 5HROB 1DTTA 1S1TB 3RW6A 2BACA 4WP8A 3DOKA 4RJVA 3W2VB 2XZWA 2HMIB 4JV5F 3BH6B 3ILOA 3P3DA 3MECA 4N76A 5L9NA 3UE2A 4DV1F 4KYZA 1N5YB 1SH3A 1JQGA 3KUHA 5IOLA 4P6QA 2V94A 1HW8A 2J6TA 4IQXA 4CLTA 3SIPB 1OSCA 2WCXA 5THWA 3TZXA 3KMSA 2WSEC 3FQLA 3RR8A 1KEKA 2OLWA 4BHQA 1VC6A 4O4RA 4WP9A 3HKZD 3DOLA 2QE5A 1VI7A 1HQUB 4P10A 1TV6B 2MTLA 4PKDB 4IR9A 3BPDA 1NO8A 4I2QB 2MKSA 1X5PA 2BE7D 3M05A 4IRDA 1M1KT 4M5KA 2VC0A 3LQVA 1UVKA 5KFQA 4MKBA 2CPDA 1T03A 4DR7F 1PJ7A 1KQSR 1Q95G 1YKWA 3SYZA 2J6UA 1X0PA 1JX4A 2V4QA 4OI4A 4QYZK 2MQ8A 1WG4A 1MMDA 3CC7S 1JB0C 2JJ4D 5E2QA 1IBMJ 3PW0A 2YY3A 3E3XA 2WK4A 3J80Y 2K3KA 4JI7J 1AW0A 1D0EA 3KJVA 2WONB 3MURP 2LDYA 4WFYA 2QX0A 2W9CB 1VMBA 5ETSA 1XNRJ 1PIEA 2DRDA 3X3UA 2PMWA 1NSQA 4C6AA 2R3VA 3IR7B 2ZD1A 4PQAA 5KG6A 1RK8A 4CNYA 1CLFA 3EE3A 1VQ5S 5L9XA 2JEIA 3B4DA 2LEBA 1LNQA 2SXLA 3MPUB 3W61A 2KJVA 3HSGA 2I0XA 5DG8A 5CZVA 2XM3A 2JLFA 3CB4A 1RAJA 2UP1A 4BLGA 5ADZA 1Q82T 3KNGA 5M2RA 4N47A 2X1AA 2PMHA 1J5OB 3GLJA 3DGVA 3PR4A 2BXJA 5HP1B 4PXDA 1U2CA 1TKDA 5DM7Q 3CJSA 2G0CA 4DR6F 2PIIA 3FSIA 3DYAA 2YKOA 2VPZB 2O5DA 3JSBA 2UUBF 3ET6B 1R31A 4J9NA 5DRKA 3KG0A 5D77A 3HHLD 3N9UC 5EUHA 1Y11A 3CWJA 2CZ4A 3QQCD 3ONQA 1S79A 1RT5B 1XTZA 1CS4A 2KTQA 2BM1A 1C2PA 3MMBA 1VQ6S 2KH9A 1BLUA 1SVDA 4UZCA 3CCVS 2YTCA 4ZVTB 2XYHB 4PZVA 3H25A 4Q0BB 2OPPA 2Y1LB 1EZZB 2NCKL 4DR5F 5K8MA 1UL3A 3I82A 3LP1A 2RE1A 3Q8RB 1PJ5A 2LLZA 4M5IA 3FMBA 1NB2A 3EVMA 3POTA 1QAXA 4KHPJ 2BANA 3OFGA 5IC6B 2AU0A 4ECUA 4OJHA 1F5AA 4TU7A 4DX7A 1AFJA 2OPSA 3LGHA 3M1VB 1SL1A 2UUWA 1JMTA 2D3O1 4F3MA 2AX0A 2AGOA 4B9NA 4WKRA 4WYWA 1D3WA 1T9WA 4I7FB 2PMZD 4DV7F 1NJWA 4PYAA 2DO0A 3BJYA 1M5PC 1ZPWX 3M2UA 1RKJA 1VRQC 2XMMA 1RACB 2KYXA 2EEYA 1IKYA 1HBNA 1SJFA 4X64J 2QL9B 3W7BA 1RWUA 3GFZA 2NPIA 2E29A 2WVBA 4MYUA 4UT4A 4WCEQ 5RUBA 1ZH5A 2UUCJ 4GC7A 2BOPA 5I4MA 3UDEA 4DL5A 2R7RA 2XCAA 3CTRA 3BSAA 4QU7A 2BDPA 4JYAF 4NLQA 4ECQA 4YR2A 1JJHA 3OTEA 2NZCA 3GYGA 4L73A 3QRPA 3H2LA 3GR1A 1JXEA 1KOHA 3RB0A 1WI8A 4USHA 3P8BB 4EI2A 1S4EA 2XS2A 1TFWA 1AA1B 2MQNA 2Q3PA 5J1EB 4UOFA 4H4MB 1NHKL 2ASLA 5KFSA 5D0EA 1REVB 3P4UB 3BN4A 1KQKA 1N54B 3W5ZA 2HBRB 4NWBA 3M8PA 4QPXA 1OS5A 1T05A 2KVIA 4ED6A 5GAEU 3KYLA 2HNZA 4NYZA 1TKTB 1EX8A 2XCPA 3NS5A 4F50A 4LSZB 3PYEA 1FD8A 3JSMA 5A0YA 1R0CB 1J5EJ 5KFBA 2IM2A 2ZHBA 4A8YA 1EARA 2YKNA 1T3NA 1P1LA 2OEJA 4Y2MA 5EX3A 3KLFB 1S6PA 1N34J 3VAMA 5KAKA 3BR8A 2HBZB 2EFGA 4G1QA 4ZP9A 1BHNA 3DOMB 3VR1A 2MZRA 2GJIA 2BE2B 2NR0A 2CQGA 1KONA 5HMYA 1S5ZA 4DV4F 3HK2A 2DNHA 3QBCA 5DG9A 3HO1A 4WTYA 5M2UA 2VPXB 4XPEA 3GMGA 1G4CA 2A6OA 1JLBB 2CYYA 2DHXA 2E5LF 1U48A 5B09A 3OL9A 3OT9A 1WOSA 2CA9A 4O4GA 2KXHA 3MFIA 1WC5A 4ED2A 3MPWA 1RA6A 3A13A 1HR0J 4KTQA 3PXGa 3F44A 3W8GA 4YDXA 4HKQA 2DGQA 5GAHU 4Q43A 3HZGA 1RP5A 1WC3A 3A8IA 2VONA 3GIKA 3HFVA 1N36J 4LQ9A 4Y6IA 3SCIE 4KQZA 2DRBA 3FVYA 3KLEB 1CJUB 1KSPA 3QFWA 4EBCA 4DR3J 2IBOA 5LSRA 1XK8A 2DK2A 4HH0A 3TEHB 2O67A 4FZVA 2CWKA 2FLPA 2ZNYA 3W9IA 4OZNA 1Z1ZA 4M5MA 5EWEA 2R8IA 1JIHA 2XY6A 4DU8A 1I94F 4RNOA 1KTVA 5KFLA 1XBWA 4H4OB 3QLHA 3TW0A 4U8YA 1U1PA 3JB9k 4A48A 1HYSB 2LVWA 3DN9A 2OAUA 2QA4S 3SCJE 2RF2B 2H1YA 4X4NA 5E33A 3JQJA 4OHZA 4OZ5A 7FDRA 2GQ2A 4KH0B 3A8KA 2QA1A 4L72B 4AXJA 3IGNA 4DV0F 1S1XB 2IVFB 1JLAA 4B9LA 5E3AA 1HFEL 2NZ4A 2Z2MA 3ICLA 1FD2A 1JNZB 3SMZA 1RWNB 2AF6A 2D3ZA 2MZ1A 3T9NA 2GMLA 1UETA 1JLQA 2CJBA 3F41A 3VHQA 4A8SA 2P5VA 3TI0A 1U09A 1RTIB 1OPZA 3RG6A 1UWBA 4ED5A 4ANDA 3KLIB 1IQZA 4WXWA 4M63A 3W5XA 5KFGA 3C66A 4PWDA 3N4WA 4J9RA 5L39A 1NUEA 5A2QY 2DNLA 2UU9J 2DCLA 1TK5A 4MK7A 2A6MA 2BQUA 2DVIA 1R6VA 4E0DA 5BR8J 1IBLF 2DPIA 1RT2B 1CJKA 1GMWA 1FKPA 4B3SJ 2W4DA 1FDBA 4QYZJ 1VQOS 1A6LA 4B02A 2DHSA 2JX2A 3BGFA 3HCXA 1AFIA 2WB1D 3QO9B 2RQKA 3KLHA 2AJ1A 2YNHB 4Z7CA 1E6VB 3GCXP 5IV3A 5FIIA 2JSXA 2LYVA 2WBRA 1EB0A 3G2XA 3MM5A 3G6YA 2RRBA 2GV1A 1KR4A 2W8LA 4U67Q 3SFGA 2R2UA 1RAGB 2FC9A 2ZJQQ 1WDDA 4CNZA 5AJ3F 2FLNA 2ZH5A 3US5A 4UZBA 4GKKJ 3IMQJ 3FQKA 2Y9HA 3CVKA 3EZ5A 2ZH4A 1UFWA 1VRUB 3SQGA 1F5BA 2XHWA 2EC0A 2I5JB 3Q22A 5J2QB 4ZJOA 2CQCA 4ILLA 3LO3A 5CABA 1FE0A 4NLXA 4UQGA 3SV3A 1Y0HA 3IP0A 2GX8A 3UNYA 2CVIA 4U95A 5K5MA 2E5GA 2QO3A 1IWAA 5HMZA 4O3OA 1TL7B 2MHNA 3GTYX 1YSJA 3UDLA 5KOXA 1UKUA 4KRWA 5LJ3Y 1A7GE 1IQTA 1UPPA 3S01A 1S1WB 3CDUA 3D3CJ 1S77D 4J37A 4L74A 5DDPC 2AGPA 1MU2A 1RT1A 2XLJA 2UXCF 1WG1A 4U96A 3SV4A 2HHUA 2JL9A 4CO2A 2NSCA 8ATCB 4HL9A 1HWIA 2VFTA 2CPJA 2KRRA 5KFXA 1P27B 2V5HG 3D2WA 3JYTA 3K8VA 5F8IA 3QZ7A 3KTQA 2HEKA 1RBAA 2R8GA 2FHMA 3MM6A 3C2PA 1X4AA 2DNRA 2K7KA 4L76A 1Y3JA 2BE9B 5HQ8A 1SJ4P 2BEFA 5K8NA 2AIRB 3ITHB 4DG1B 1YBAA 4OZ0A 3D68A 3TAPA 3PHEA 4JI2F 3W8PA 4DV5F 1PO6A 2F5GA 4CIOA 3ENWA 2A10A 1E6YA 4MAKA 4K5RA 5KFEA 1D9FA 1IWGA 2EG2A 3Q8PB 3PKMA 2A2DA 3I0RA 3EPGA 1RTDA 2F9JA 4MFBA 1X4EA 3OUYA 4YY3J 4RW8B 5HLFB 2V0NA 2QV6A 3PG9A 2BW2A 4QYRA 4WFXA 4M5JA 1Y7PA 4OYXA 3DGPA 2PD1A 4HDHA 1MWQA 5D0HA 3ISZA 5FDLB 3SQOP 1NK8A 5CXTA 4EYHB 4IOAQ 2H5EA 4NI2B 3MEGB 5KTQA 1RT3B 4I0WA 4ZVUB 4ZPBA 5FD1A 4Q8FA 3D7SB 3Q8UA 1CC8A 1TVRA 3L7PA 3RYLA 5A76A 9ATCB 1FKOB 3BDPA 2BW7A 4UOGA 1WC4A 1TTHB 2X1FA 4NRTA 1LKZA 2YWFA 4BC9A 4USTA 5IWAF 4DUTA 2VA3A 4PUOA 5DGAA 1RHRB 3WC0A 4DPWA 1YDLA 3ILIA 5H9EJ 4QR2A 5FLXY 3AJ1A 3CEDA 2VDHA 1IBKJ 3V4IA 2AX1A 2KI2A 1DTQB 3G6VA 5B08A 2KT5A 1TMMA 1LXJA 2RH3A 3OTDA 2M2BA 3IWLA 4IH6A 2R8JA 4RKUC 3DM2A 3QT5A 4DV3F 4CH7A 1SL0A 5F8MA 2CJQA 1FI4A 2GJ2A 2BJ1A 3GFYA 5F3ZA 4IFYA 3UPFA 2V9KA 1B3TA 1L3SA 2JLGA 2F4FA 1WF2A 4FF1A 1BQMA 1MROB 1RGVA 1T95A 2M7SA 4LRFA 1S9EB 2J0XA 3HD2A 2Y1IA 1DARA 4K59A 3H40A 1FJCA 5C42B 5CQGA 3E51A 3PEHA 4DPUA 2XC9A 4USIA 1L3KA 4FBUA 1SV5A 1R8AA 1TR0A 1VQMS 3CNQP 2HQCA 3C16B 2UUAJ 6FDRA 2AYGA 4YR3A 4LF9J 3R5DA 2IBKA 3CD5A 5DQIA 2XG8A 5M2PA 3UVJA 2AJ0A 1QE1B 3UN3A 4QW8A 4DR4J 2APOA 3WX4A 3TA2A 2MLXA 3O6QA 1RSCA 4DUZJ 3UD3P 2XWXA 2HZAA 1NB7A 5A2QU 1XR7A 3KDNA 3DLEB 1HNZF 4AD6A 2PEHA 1VLOA 4NEZA 4P2FA 5HJYA 1NSKL 2HHXA 5L1JA 4DZ6A 1BC6A 1SPBP 4CYUA 4EUVA 3W2WA 2BKPA 3M6VA 1JJCB 4AQYJ 2I9SA 5E3QA 4IG3A 1O5JA 2NXJA 3BZQA 2JH3A 2VJVA 1HBMB 1FNOA 5HN0A 1RWWB 4DSKA 1KDNA 4P72A 1S9GB 2HS0A 3MCMA 4FKXA 1G1XA 1OPIA 4C0BA 3BGUA 4OJ1A 4TYAA 4PG6A 4RNHA 2V2KA 2YWKA 2B8PA 3S7RA 1GFWB 2CPZA 2Z56B 2DGWA 5CH7B 5E41A 2ZE2B 2F8HA 1I6JA 2CPXA 4Q2LA 3VV2B 3CXCR 2EWHA 4EEYA 2QLBB 2RKIA 3M32B 4XO0A 2GO9A 2DGVA 4RU9A 1YWXA 2OPQA 3UN2A 4CH1A 3J81j 4RW6A 3DU6A 4AL5A 2JNJA 2ZH8A 2F63A 3OL6A 4X66F 2R7SA 3QJLA 1YGYA 2KG1A 2UXBF 4CDIA 2KDOA 1LW0B 2VQFJ 3OHBA 2ATLA 5CCLA 5L38A 4L6V3 2YNIB 3ULHA 2LDIA 3KK3A 5KT4A 3B6BA 1TKZA 2JC0A 4OYMA 4BCAA 5D3GA 1SQEA 3PIPQ 1C1BB 4ZCMA 2F3JA 3G8QA 3OXFA 2K8GA 3VALA 2EVZA 1NK0A 1UVNA 4LSNB 3T1HJ 2JOQA 4NA2A 3TNVA 4RW9A 1XMQF 1HMVA 4MMOA 1MMNA 3GE9A 3OR2B 2W9BA 3W66A 2V50A 2HZCA 3IWNC 2QJ3A 2ZHAA 2GMHA 4ZK7M 1SCJB 5B0GA 3IG1A 4ZJLA 4TY9A 3BQ2A 3R7NB 1VQ8S 1XEZA 3M8WA 2W7AA 1LWEA 3GIMA 2LU1A 1JXLA 2FHKA 3C6TA 3K2YA 4OI0A 3NL0A 2B5JA 1VRTA 3KG4A 2QLXA 3Q83A 3W65A 3EXCX 2IM3A 1XC9A 5A8WB 2JDJA 1SC3B 2BJ3A 2ZH3A 1HD1A 3C19A 2M0GB 3GG0A 5C24A 4X4QA
chains in the Genus database with same CATH topology
4UZCA 2YQ1A 4K2JA 4BLGA 2YPZA 2YQ0A 1B3TA 4UZBA 1VHIA 2YPYA 5A76A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UZC A;  2YQ1 A;  4K2J A;  4BLG A;  2YPZ A;  2YQ0 A;  1B3T A;  4UZB A;  1VHI A;  2YPY A;  5A76 A; 
#chains in the Genus database with same CATH topology
 3R6G B;  4P7T A;  2CPE A;  2WSC C;  2MQQ A;  1RHK B;  1RWM B;  1KP6 A;  2GVZ B;  5HVH A;  3U7J A;  2VFS A;  1TQL A;  3LA0 A;  1HD0 A;  3MM8 B;  1WHW A;  2DIU A;  1QTM A;  1UP1 A;  1U0H B;  4FYV B;  2HRU A;  2R2T A;  1GTH A;  4KKO A;  1ZM9 A;  1FRX A;  4IQM A;  3J7Z T;  4C8O A;  1TAQ A;  4ECZ A;  1AUS L;  3OR1 A;  4ECW A;  2PSZ A;  4OX9 F;  2HW3 A;  4CLU A;  3C15 A;  4C11 A;  1IVZ A;  2VOD A;  1JK9 B;  1RTH B;  3AJ2 A;  1KLM A;  2ZVS A;  2AYB A;  1XN9 A;  4YS2 A;  2B4V A;  2EFO A;  2W1B A;  2OTJ S;  2G13 A;  3W64 A;  2O66 A;  3OLA A;  1H2U X;  1HWL A;  2L08 A;  2K1R B;  4FBT A;  3S1T A;  4WYL A;  3F73 A;  4F4X A;  3NNH A;  4KY3 A;  4LSL B;  3T5L A;  3K5L A;  3TVY A;  4W98 A;  4ID5 B;  4RW4 B;  2MQP A;  2XS7 A;  3NNC A;  3QGH A;  2PE8 A;  4P7V A;  1DQ9 A;  5SZT A;  2KVQ E;  3HHE A;  1F0X A;  2D69 A;  1ZM3 A;  1H3D A;  4R5P B;  2F7V A;  2NUU G;  1Q1K A;  1H74 A;  2AQ4 A;  4CO0 A;  1EET A;  4B9T A;  2BRL A;  1YBU A;  2OPR A;  2V8G A;  3UDV A;  5K9F A;  3IBF B;  1HNV B;  3CO9 A;  1CJV B;  3FZ2 A;  2XHC A;  3E8O A;  5J2P B;  3H7H B;  1MG7 A;  4M95 A;  1Q79 A;  2BV3 A;  2JFD A;  5BYQ A;  5KOW A;  5F8N A;  2G1D A;  4DX8 H;  5F9N A;  2YKQ A;  4LR8 A;  3AOD A;  2GZO A;  3TA1 A;  2XTJ P;  3KHL A;  1IKV A;  4A8X A;  2J76 E;  1IBM F;  4O3Q A;  1Q8I A;  4JI7 F;  4FN5 A;  1YJ9 S;  2MYF A;  4ES2 A;  1TP7 A;  1RT7 A;  1V3Z A;  1NHU A;  4ED0 A;  1HQ2 A;  1CG2 A;  1DLO B;  4USM A;  3DRS A;  1XNR F;  5F0U A;  3IAM 9;  2OEL A;  3C14 B;  2KXN B;  3JAM Y;  1O0P A;  1S0N A;  3K89 A;  2VBW A;  4I2P A;  5FJ4 A;  3DLJ A;  4KGZ B;  2BAB A;  2VG6 B;  1DY3 A;  3LF0 A;  4B3O A;  5DZ7 A;  1H0H B;  1Q86 T;  5LT5 A;  5F8H A;  1FNX H;  2WOM B;  2E66 A;  2XSF A;  2AJQ A;  2MQM A;  5KFA A;  2UXD F;  3NKY A;  2DRA A;  1HHQ A;  1BUX A;  2DNY A;  1OYE A;  4DQR A;  5LSL A;  2QA4 G;  3H2V E;  3RAM A;  2WZ1 A;  4C7Q A;  1U1M A;  1XJW B;  3P49 B;  1UZD A;  4OLO A;  1IKX A;  3R3T A;  1FRM A;  1M0S A;  4MT1 A;  5T7L B;  5KFN A;  4A8M P;  4DLE A;  4XPC A;  2W2Q P;  4NXM J;  1HWK A;  2DXF A;  4PXC A;  2MHE A;  1PAU B;  2QLJ B;  2H5J B;  1QLN A;  2YWW A;  5GAD U;  2KM8 B;  1Q53 A;  1YG0 A;  2HFZ A;  2V4J A;  4N77 A;  2DT9 A;  1S1V A;  2BZ2 A;  1PG5 B;  1BQN B;  1TL1 B;  3L7O A;  4K0K F;  2N3L A;  3CDW A;  1LWC A;  2HVD A;  3HVA A;  3BPS P;  2HK3 A;  4ZVH A;  4HI1 A;  2P2C B;  4N41 A;  1P8G A;  3SEO A;  4E98 A;  1SH0 A;  1SJR A;  4TQR A;  1FJ7 A;  2DB1 A;  3C3L A;  2V8V A;  2CPY A;  3J7Y I;  3LP2 A;  5GMD A;  2N3O A;  2ZC4 A;  3M9O B;  3D1O A;  2LEA A;  5KFF A;  4ZVP B;  4BC7 A;  2Y0S D;  1CJT B;  3R5J B;  2HMI A;  1YZ7 A;  2K2P A;  4C2M A;  4HHH A;  3OJS A;  2L3M A;  2FGO A;  4RW7 B;  4PXE A;  1FWL A;  4KHP F;  3PO4 A;  3BV8 A;  3GIL A;  2V8P A;  2EG1 A;  5HBM B;  2HWT A;  3G6X A;  1W2I A;  2IAJ B;  2D74 B;  4CO4 A;  3VTI A;  5CZX A;  2FY8 A;  3KLV A;  3M8Q A;  2ABY A;  2YX7 A;  2FZC B;  3JTO A;  2B9W A;  2CQD A;  4UTG A;  4ZVE A;  3OFF A;  4CT8 A;  1TEL A;  3LP0 B;  2RQC A;  3HVR A;  1TV6 A;  2J8A A;  1C1C A;  4B3T F;  3N6M A;  2H5I B;  3V81 B;  2ROE A;  4IO9 Q;  3V6K A;  5JUM A;  3G82 A;  1SKW A;  2A0F B;  2ASJ A;  4X4V A;  4ED7 A;  3I5B A;  3N28 A;  3M2R B;  2XO7 A;  2BR0 A;  2DNK A;  2R7T A;  3HZE A;  1FTR A;  2DNG A;  2Z4P A;  3S8S A;  1HBU B;  2HFO A;  4DDF A;  2VD3 A;  3ILJ A;  3DMJ A;  3TR5 A;  4YEA A;  3NAI A;  5F0W A;  2IVY A;  4FYX B;  4QJV A;  3C8Y A;  4IDK B;  2XNQ A;  3D4J A;  2WON A;  4DS4 A;  4LT6 A;  3M2V B;  1FF2 A;  4LRB A;  2HFU A;  4GC6 A;  3DOK B;  1AYE A;  2W9C A;  2L9W A;  5JMN A;  1T9X A;  3HSD A;  2CQI A;  3FCW A;  1DRZ A;  2HQ3 A;  2IMW P;  4EGL A;  3CMA S;  4OHW A;  2CZV C;  1GEH A;  1QD1 A;  2DGT A;  4C8L A;  1U25 A;  1WHY A;  1RT6 B;  1NPR A;  3BKU A;  3I4P A;  4OL8 A;  2FPH X;  3DOL B;  1FE4 A;  4LBH A;  4F2S A;  4FXD A;  2FHJ A;  1KQG B;  4UOH A;  3QGG A;  2WRM A;  5E7O B;  3PX6 A;  1UFL A;  3ZZ0 A;  3OTO J;  4DQP A;  1H7X A;  5DDR C;  2CG4 A;  2D41 A;  4I68 A;  1T03 B;  5HP1 A;  5ETR A;  1KD1 T;  1N33 J;  2RDJ A;  2CQ0 A;  4JI1 J;  2ZBP A;  1DHM A;  2AZ1 A;  2DYA A;  5G4D A;  2HKE A;  2ZWO A;  2YQ3 A;  3ET6 A;  3PHT A;  2DIS A;  3D28 A;  3VQT A;  3I55 S;  2EK1 A;  2NSB A;  2AHO B;  3SDE B;  1N5T A;  3Q0A A;  3D5M A;  4J90 A;  2DD8 S;  2GW8 A;  2PEB A;  5ETM A;  3LGN A;  4ED8 A;  4ICL B;  1VQ7 S;  1LQ9 A;  4QIE A;  4PPZ A;  5GAE I;  4NXN F;  2FDN A;  1AZS B;  1URN A;  2N82 B;  2E5I A;  3HD1 A;  3QMQ A;  2VQE J;  3TOQ A;  3GQC A;  4Q0B A;  2VF3 A;  5IT0 A;  2DNP A;  1V3S A;  3FDS A;  5LMN F;  2ALZ A;  4PPD A;  1HR0 F;  1RA7 A;  3GB0 A;  4NZ7 A;  2ZZT A;  1XMO F;  1YVF A;  4G6V B;  3FBC A;  2DNM A;  2GIQ A;  2HHT A;  4NLR A;  4NCG B;  4FNI A;  3IBW A;  3ZTP A;  4PRF A;  2HFS A;  1UA0 A;  2ZFH A;  5HSP A;  2EK6 A;  5DQG A;  3O8W A;  2HHH J;  3MOJ B;  2HNY B;  2PI4 A;  3NS7 B;  1W7W A;  4Y2A A;  3Q89 A;  5K14 B;  2W9A A;  5D4P A;  2B3T B;  2BQR A;  2RD5 C;  3GP9 A;  1S99 A;  3D0H E;  1P6T A;  4I6Y A;  2RDI A;  2E5H A;  4I7F A;  2UVU A;  1IR2 A;  4JI6 F;  2E9Z A;  2OUG A;  4NLG A;  2FJA B;  2QSF A;  3I31 A;  1S0O A;  1NH7 A;  3JAM U;  3TEG A;  1KRP A;  5GMK a;  4I6A A;  3AJD A;  1NZ8 A;  4J91 A;  2KRB A;  4OYA A;  3Q23 A;  1S0V A;  2VA2 A;  4DF4 A;  4K50 A;  3VCD A;  3GON A;  3TUJ C;  2HLU A;  3QAU A;  2AJ4 A;  4IYQ A;  5LL6 d;  4K2X A;  4H4K C;  3DHX A;  3DDN A;  3CUN A;  2QMX A;  1ZYQ A;  3FCH A;  4PEO A;  2KL8 A;  2ZVI A;  3PYD A;  1Q81 T;  2IA6 A;  4AT1 B;  2ZM6 J;  3AOC A;  2MQO A;  4DLG A;  2DO4 A;  4GVB A;  3HHN B;  4JV5 J;  3FRY A;  5J1E A;  3POT B;  1ULR A;  4DV1 J;  5J1N A;  4H4M A;  5B7W A;  4DL6 A;  2YNF B;  4OI3 A;  1JLC A;  1REV A;  4USU A;  2VBX A;  2PA8 D;  2DNN A;  2OPS B;  1VOM A;  4RNM A;  2ZZM A;  3DRR B;  4N7T A;  3C46 A;  3MPV A;  4FS2 A;  1DFD A;  1RAO A;  4P2M A;  3KHH A;  5DLF A;  3OV7 A;  1NME B;  1Q5Y A;  3OSP A;  4F3O A;  1XMB A;  2AEM A;  1S6Q A;  2FVP A;  3ZTS A;  1Z4U A;  3MTJ A;  1RTJ B;  1V5V A;  4URQ U;  2AKW B;  4FVC A;  5L1I A;  2AW0 A;  3LPE A;  1MWZ A;  4O23 A;  3TQ1 A;  3ZO7 A;  2GAH C;  1HBN B;  3MCO A;  3GFH A;  2YQ1 A;  2R7V A;  3KLF A;  2VOO A;  3DXS X;  3I5C A;  4JI4 F;  2DGS A;  4DR7 J;  2JHE A;  4Y00 A;  1ZA1 B;  1RAH B;  1JLG B;  1HIY A;  2IFX A;  3B54 A;  3DOM A;  4A8F A;  3QSY B;  3MAQ A;  1M5V C;  2Z57 B;  5KFC A;  2BE2 A;  3BKF A;  3PYG A;  3PJW A;  3RB3 A;  1H6K X;  3PY8 A;  4TY8 B;  4C8Z A;  4RU2 A;  1F9H A;  3VGS A;  1KTQ A;  4O0N A;  3QFH A;  2D9O A;  3HVW A;  3VQS A;  2N4D A;  2GA7 A;  1X31 C;  5B0F A;  4CTA B;  4OYB A;  2DHH A;  1UVI A;  2E7W A;  4Y65 A;  3ENV A;  3ZZU A;  5E3R A;  1LWF B;  2RHQ B;  1NM2 A;  2Z2Z A;  3N6L A;  2DGX A;  4F04 B;  4M8L A;  3ZZT A;  1SKU B;  4TXS A;  2LFV A;  3CJR A;  4ZJQ A;  1FRJ A;  4X4R A;  4K7Q A;  1RI7 A;  5D15 A;  1FA0 A;  3GFX A;  5KFD A;  3H20 A;  4LF8 F;  1UJ5 A;  3D0G E;  2HNZ B;  4QIV A;  3MEE A;  2IRY A;  3NGS A;  2H4W B;  5A0Y B;  5AE1 A;  1NRK A;  2MLY A;  1CJU A;  3MR7 A;  2MSS A;  4X65 J;  2PA3 A;  4NLS A;  1TL3 B;  2W8K A;  3DLG B;  3CMQ A;  3PRV A;  3MTK A;  3K5M A;  4R25 A;  2H65 B;  3HLU A;  1XNQ J;  2MZS A;  5AXN A;  4YHH F;  4KSE B;  3M6U A;  3KHR A;  1S1U B;  2B7C B;  4F26 A;  2B56 A;  3OQ2 A;  3DI6 A;  2B43 A;  4L3K A;  1Q0N A;  4OJ3 A;  4FVM A;  5HMX A;  1HYS A;  1FX4 A;  1O6X A;  5D0G A;  2W2N P;  2ZBQ A;  1ZBT A;  2BYC A;  2GIR A;  2JVO A;  4R0E A;  1NU4 A;  3N0V A;  3WIV A;  4PYD A;  5A8K B;  2Y8W A;  4Q44 A;  1FCA A;  1U0S A;  3H98 A;  1PC4 A;  4KGV B;  4D3H A;  2ATC B;  2ZOG A;  4J9P A;  2J0W A;  4CLP A;  1FJG J;  4OYZ A;  1RWP B;  3TUP A;  5J2M A;  1EKS A;  4I64 A;  4L3N A;  3AHP A;  3T1Y F;  1RTI A;  4KPY A;  2KFY A;  2XYG B;  3EXY A;  4PCQ A;  2L9N A;  5H9F K;  5JJB A;  2HWH A;  2V8D A;  4USV A;  2AGQ A;  2DJW A;  4EBE A;  4LFA F;  2W25 A;  3UD5 A;  3DLK B;  1T9T A;  2KKH A;  1RWX B;  2GQC A;  4EFA C;  4ZIW A;  4JI8 J;  2IJN A;  2OEM A;  2AT1 B;  3E01 A;  4YB6 A;  1X4B A;  2XQC A;  2FTR A;  5KFI A;  1FDA A;  4J9K A;  3G86 A;  4DV7 J;  2V4R A;  1RT2 A;  1NPK A;  2B0G A;  3MGJ A;  5HJX A;  4NCB A;  4RLE A;  2VL1 A;  1C0T A;  2QC3 A;  2GC8 A;  5DET A;  3NCQ A;  4R8U B;  1UZH A;  3HM9 A;  3TJ9 A;  1KOO A;  2AWZ A;  3QO9 A;  3CCE S;  1VR6 A;  1FRH A;  2IYG A;  2ZNZ A;  4E2F B;  1E6V A;  5KG7 A;  1Y3K A;  2R8K A;  3G9C A;  5KG4 A;  5KFK A;  5F3T A;  4C48 A;  1MSW D;  1QVF R;  4A8K A;  5GME A;  2FJV A;  1Y9O A;  4OZJ A;  4U7U K;  1K0V A;  2AZ3 A;  5BXI A;  2VU5 A;  4O3S A;  4X4U A;  2HAI A;  1NZA A;  4GKJ J;  4ZVF A;  2DNQ A;  3ELH A;  1RCX B;  1VIS A;  2ZJP Q;  2MST A;  4HTJ A;  3JS9 A;  3HHD A;  1G3O A;  1JLQ B;  1FO1 A;  1TK8 A;  3UFC X;  3GSD A;  4USJ C;  3M9N B;  1VRU A;  3KHG A;  5LMU F;  2C2E A;  4C9D A;  2I5J A;  1KVI A;  3OPK A;  1GTE A;  3GPA A;  2WBM A;  1N0U A;  1SIZ A;  4U7C A;  2JRS A;  2ROP A;  4DMZ A;  4Z37 A;  4FF3 A;  4CO1 A;  2ACY A;  1VK3 A;  2FY1 A;  5DS7 A;  4WZM A;  5KT7 A;  5BYR A;  5I42 A;  2YX4 A;  1YIJ S;  2Y1R I;  2RIJ A;  1R0B G;  4ZP7 A;  2EFP A;  3FK4 A;  2Q1L A;  1MN9 A;  4DL4 A;  3EZU A;  4RL1 A;  4CM0 A;  1HI0 P;  4OYO A;  2YBV A;  2M70 A;  1N0V C;  4LF4 J;  3QAE A;  3R8Y A;  1CJK B;  2HND A;  1FKP B;  1S1W A;  2KU7 A;  1QSY A;  3G71 S;  1TUW A;  4PG7 A;  1M5S A;  4MK9 A;  1HNW F;  4HEA 9;  4HDG A;  2HG4 A;  3R5G A;  3D6T B;  1YJ7 A;  5KFR A;  2FGC A;  1NK5 A;  3CIM A;  3TYT A;  3BSN A;  5C25 B;  1F2G A;  4NAS A;  5K8O A;  4CLZ A;  1B99 A;  3CPW R;  1JLE B;  3WQP A;  4WFZ A;  3MMJ A;  1HBO B;  1U24 A;  3R9L A;  3SSR A;  1ROF A;  5CCM A;  5K8P A;  3TUZ C;  4DV4 J;  1TMJ A;  1V3R A;  4OZ3 A;  5IZH A;  1M5H A;  1N6Q B;  3NGR A;  2DEJ A;  4B3R F;  3SSQ A;  4ZPV R;  1NDP A;  3SQG B;  3ITH A;  1VJQ A;  2C28 A;  2FHO B;  1OY9 A;  1WNE A;  3W1Y C;  4LVN P;  3QT7 A;  4V19 J;  3WZ0 A;  2UVW A;  4UUX A;  4B17 A;  1B0V A;  4K4V A;  1WOO A;  2V2V A;  1HHS A;  1HI1 A;  1X4H A;  3G8T A;  3T3F A;  5HL7 Q;  3GYX B;  3HUL A;  3PX0 A;  3HPO A;  4JI0 F;  2NQP A;  4S0M A;  4O3N A;  1LFW A;  5IM0 A;  2G2Z A;  2G0I A;  1HAR A;  5HLF A;  2GJF A;  5HMW A;  1IJE B;  3R1H A;  4DPT A;  2G9O A;  4OMF G;  2MZQ A;  1AUD A;  1FK9 A;  2XZD B;  3PRB A;  1MU2 B;  1LW2 A;  2GNK A;  4YME A;  3HT3 A;  1RIS A;  1QAY A;  2RQM A;  1H2T Z;  3MEG A;  4XK8 C;  1RT3 A;  3FC9 A;  3J7Y U;  1I94 J;  5A6P A;  1D8Y A;  2LCW A;  2VQF F;  1B7Y B;  2A2C A;  1L3V A;  1ZM2 A;  2DBB A;  1UJ6 A;  5KFH A;  1VQ4 S;  3UCZ P;  1T94 A;  2Z8Q A;  1YRX A;  2M4M A;  2MMY A;  3OVS A;  1WTF A;  2FVR A;  2J9C A;  5CD4 A;  3SCL E;  2R2R A;  4J9U E;  5J2N B;  1VBX A;  4CLF A;  4ER8 A;  2DR9 A;  2I1R A;  4IOB A;  3ETO A;  2YH1 A;  4LFB F;  5AE3 A;  3T1H F;  1F3F A;  1QDU B;  1EJ7 L;  4ANE A;  1RQ0 A;  2E1P A;  4OFZ A;  1K0T A;  4DUY J;  3I0S A;  2OSR A;  1E6Y B;  3IS9 A;  4OHV A;  1Q8L A;  4CLL A;  2OH2 A;  4Q7A A;  4F25 A;  1VIO A;  2MY7 A;  4W92 B;  2GGP B;  2OKQ A;  3QIP B;  1AXQ A;  4DCJ B;  3HF5 A;  3RBZ A;  4DFK A;  2RU3 A;  4LF1 A;  1IM4 A;  4PR6 A;  2RHS B;  4DV2 F;  3D1Q A;  4DR1 F;  4MFB B;  5F8L A;  2N7C A;  2OFG X;  2RT3 A;  1CVJ A;  4LUB A;  5T41 A;  2KFN A;  4OZL A;  5HVF A;  2LXU A;  4DR2 J;  5DGB A;  2C42 A;  2MJN A;  2G1H A;  2XMW A;  1MRO A;  4F02 A;  1S9E A;  4DS5 A;  3CCR S;  1IBL J;  2C2K B;  2NRE A;  5C42 A;  4U8V A;  2D3O R;  1TK0 A;  3GJT B;  2CJK A;  2F8E X;  4TU9 A;  1GNK A;  1C4A A;  2QEX S;  1X0F A;  4LR9 A;  2NS1 B;  2ADB A;  2LMI A;  1RLC L;  3GSI A;  3C16 A;  1N52 B;  4X62 J;  1WTB A;  2CJA A;  3HX9 A;  4MKA A;  4JP8 A;  4DX6 A;  3NMR A;  1LFP A;  4QWA A;  1S48 A;  2O01 C;  3Q2T C;  1ZPV A;  4PUO B;  1Q5V A;  2C3U A;  2Y3Y A;  4ATN A;  3T1A A;  1KS2 A;  1M5O C;  3D3B J;  4EMD A;  4R0J A;  3KXD A;  2QIF A;  9RUB A;  1HNX J;  5AJ3 J;  2FJW A;  4EK2 A;  3H5U A;  4NZ6 A;  3MMA A;  3ZZO A;  1PBA A;  3J7A 1;  3ENQ A;  1T02 A;  1VCT A;  3DM2 B;  4LR7 A;  5L8R C;  3ZC4 A;  3BO2 A;  3GV7 B;  2X3D A;  1NDL A;  1U4B A;  2R42 A;  1A0O B;  3DLL Q;  1PIL A;  1S9G A;  4KV8 B;  1BQM B;  3TAR A;  3AA8 A;  2YQ0 A;  2IC3 B;  2ZDO A;  4MYT A;  3MCS A;  2BBE A;  4FYY B;  5H9E K;  4WFN Q;  4OHX A;  2D9P A;  4TNO A;  3MDF A;  2FYX A;  4K4X A;  2CFX A;  1WDT A;  4DN9 A;  2ZE2 A;  1UVL A;  1Z2Z A;  3RR7 A;  3BN7 A;  4DV6 F;  3M32 A;  1M90 T;  1NH8 A;  2UV8 A;  1I3O B;  2UVV A;  4C8N A;  3RRH A;  2C3Y A;  2DR5 A;  2X3G A;  1HQE B;  4DXL A;  3TAM B;  2AMC B;  2DHG A;  3TZW A;  4URG A;  4O44 A;  4OIX A;  3ENA A;  4BWJ A;  2W7P A;  2YNI A;  1GQE A;  2Z2Y B;  3GU0 A;  4USK A;  4F4K A;  1A9N B;  2CQ2 A;  3L3C A;  3O5T B;  3Q8S B;  1C1B A;  2AD9 A;  1FX2 A;  1OMS A;  1MNE A;  3TAQ A;  2ZJR Q;  4JUZ A;  2QGF B;  3D6F B;  1U6F A;  4IH5 A;  1XQI A;  4CYU B;  5E3C A;  3W2W B;  4LSN A;  3DRP A;  2P9E A;  1P9Q C;  2CQ4 A;  3M30 A;  4PQU B;  4JI2 J;  3MI7 X;  4DV5 J;  4ZVQ B;  4F0M A;  3EJM A;  2VH7 A;  3J7A N;  5H9F J;  2HIY A;  3CJQ A;  3IM9 A;  2MKK A;  4ECR A;  4TU8 A;  2DH8 A;  1TAU A;  3OW2 R;  4DL2 A;  3DRX A;  1UW9 A;  2WVC A;  5IT9 Y;  3CCM S;  4I6W A;  4FNH A;  3CME S;  4NLP A;  4Y0F A;  2XY7 A;  2C3P A;  3K5O A;  2CJX B;  2MGZ B;  3R5A A;  4P74 A;  2GO8 A;  5ETT A;  2A18 A;  2ILZ A;  2E5J A;  3R2D J;  1HL6 A;  3N01 A;  2HQI A;  2WSF C;  5A8W A;  4CCH A;  3CT9 A;  2OPQ B;  2Q6C A;  1IUJ A;  3Q8V A;  4H4K A;  5E5N A;  4FDF A;  4IH7 A;  3K0J A;  3BSC A;  4ANC A;  3PFE A;  2FJX A;  2H51 B;  4B9V A;  4ITS A;  2XMJ A;  4OX6 A;  4RZR A;  3J80 U;  3MM8 A;  3PM9 A;  2M9K A;  4ID8 A;  3KK3 B;  4P2X A;  1JLF A;  4X4T A;  4B9U A;  4ECT A;  2Z30 B;  5G0R B;  1XR6 A;  2RU9 A;  4M5D A;  5IWA J;  4NLT A;  2GCF A;  3BS9 A;  1NJZ A;  2E9R X;  4K8R A;  1B70 B;  3QWP A;  3GV5 B;  2I8E A;  4O3P A;  2RQ4 A;  5B0E A;  1GXT A;  3AAW B;  3KJQ B;  5CYQ B;  4LF6 J;  4A46 A;  1KQF B;  2MPU A;  1AT1 B;  3QRR A;  4DCO B;  2QL5 B;  1ZTW A;  3J7Z 5;  4Q5V A;  4ZLP A;  4G65 A;  2DIV A;  1HMV B;  1KLN A;  2BRK A;  2K1R A;  3NMA A;  4OX7 A;  5B0B A;  3UCG A;  4USW A;  2MKY A;  2DXD A;  3PW2 A;  3VGU A;  4FF4 A;  1U1K A;  3IG1 B;  2MKH A;  3KUE A;  4DV3 J;  5GAD I;  3BGL A;  3PV8 A;  1LWE B;  2MB0 B;  3C6T B;  3RAX A;  1R89 A;  3BGR A;  3K58 A;  4A8Q A;  2XS5 A;  2KO1 A;  4F4Z A;  5A8R A;  2C3O A;  2IHR 1;  4AYB D;  3CCW A;  1CPZ A;  2ROG A;  2HVZ A;  2J0Q D;  4N8O A;  1X5O A;  1HNV A;  3QZ8 A;  5C24 B;  3FSY A;  5J2P A;  3MFH A;  3ZTR A;  2FD2 A;  2HS4 A;  5MLC V;  4IR1 A;  4J9O A;  1XER A;  1F2H A;  3RW7 A;  3DU5 A;  3OVB A;  4CRJ A;  1NJY A;  4G3I A;  3ZZY A;  4KKO B;  4AFF A;  3LPY A;  1K73 T;  3M7V A;  4F8R A;  3N6N A;  5KG5 A;  4RNF A;  3OR1 B;  4KT0 C;  3L4B C;  4IFV A;  3GYN A;  4U7U D;  4CLY A;  1NLK L;  2HK2 A;  1S6U A;  4KIA A;  3A8J A;  3CE8 A;  2J7W A;  1EAY C;  3DDK A;  1SL2 A;  2M3D A;  1K44 A;  4K4Y A;  5JVG Q;  4MIW A;  4ZPW R;  2FB0 A;  3C14 A;  3T5H A;  2F65 A;  2EW9 A;  3FBB A;  1KWM A;  2C2R A;  4YOE A;  2BJD A;  3NBP A;  2CRL A;  3Q86 A;  5IFM A;  4MKY A;  2PDA A;  3HP6 A;  5CYM A;  2RJZ A;  1T9U A;  1HLW A;  1D9D A;  4LIW A;  2P6T A;  3NGT A;  4UQT A;  3FMW A;  3CJK B;  4MTP A;  2OP5 A;  4OYI A;  3OL8 A;  4Q8E A;  3IWX A;  4LF5 F;  4XIU A;  1FFG B;  4ED1 A;  4DX5 A;  3D67 A;  3EGV A;  2HHS A;  4CLK A;  3KDO A;  5F9L A;  4ZLJ A;  2ZZN A;  3V6D B;  1U6B A;  2GMJ A;  1S59 A;  2R4F A;  4AL6 A;  3OVA A;  1L3U A;  3NGU A;  3MR2 A;  4X4S A;  5IT4 A;  2WHO A;  1U02 A;  1BQN A;  3LOU A;  4CP5 A;  1TL1 A;  4NYO A;  1DAX A;  4N5S A;  2UXB J;  1RT7 B;  1BWV A;  3HVT B;  2XWY A;  4NOH A;  4C0H A;  2MY8 A;  4CO3 A;  2COL A;  5JXS A;  3JQM A;  3AB2 B;  3BB5 A;  3M6X A;  3SZ2 A;  1X4C A;  3CJ0 A;  4I67 A;  3UR3 C;  1G2E A;  4KO0 B;  3A12 A;  1PGZ A;  4NCA A;  2QFJ A;  4ELU A;  3MUV P;  4LF7 J;  3EUN A;  3DLH A;  3RRK A;  1JJ4 A;  2FUG 9;  2XSJ A;  3I96 A;  2Y0B B;  3R7S B;  4C97 A;  1CJT A;  2Y8Y A;  2FZK B;  4RW7 A;  4YDD B;  2XMT A;  4BDP A;  4IOC Q;  3HXM A;  1U2R A;  2ZUG A;  2M8H A;  3H5Y A;  2F8M A;  4CLS A;  5HBM A;  4ZLL A;  3TVZ A;  1FWK A;  4P71 A;  4RPF A;  4EBD A;  2RS8 A;  3LWM A;  1IKX B;  4JV1 A;  1MW7 A;  2BA9 A;  3QSI A;  3UO0 A;  2VPW B;  3V2U C;  1RTZ A;  3GIR A;  5ETO A;  3KJF B;  4KFB A;  1HNI B;  4P2S A;  3LP0 A;  3NEK A;  4LIR A;  2C2N A;  3P5B P;  1S4F A;  3V81 A;  2V8H A;  3OFE A;  2E7X A;  1GMW D;  3QT6 A;  1OO0 B;  4ZPT R;  4PG8 A;  3QRQ A;  4UF4 A;  3QT8 A;  1JWW A;  2HVI A;  1S1V B;  4ZOS A;  1QUV A;  1TKX B;  3PW4 A;  3JSY A;  3QGI A;  3THP A;  1HBU A;  2QMW A;  2RB7 A;  3LP2 B;  4IDK A;  1MLA A;  2HIQ A;  1WOR A;  2ZM6 F;  3FBE A;  3T41 A;  3M2V A;  4NA3 A;  4JBC A;  1NDC A;  1GMU A;  2CJY B;  5J1P A;  3OTC A;  3HHL A;  4X4O A;  1BQX A;  2UVR A;  4EU0 A;  3N79 A;  3PDN A;  4K5S A;  1YIT S;  2H9Z A;  3IRX B;  3EVO A;  3PZP A;  1RT6 A;  1SKS A;  4NML A;  4NLU A;  1YRT A;  3M8Q B;  1WOP A;  3IGV A;  3A3N B;  2JVR A;  3MM9 B;  3JXO A;  1TU0 B;  1F9F A;  1KBR A;  3A8E A;  1RYR A;  4U6P A;  1WWH A;  2KZM A;  2KHC A;  1C1C B;  3WIU A;  4FP9 A;  4C0O C;  3PX4 A;  3G82 B;  5CAA A;  1SJQ A;  3VWS A;  3BGO P;  3MAH A;  4B3M F;  3M8S A;  2VUG A;  2VHG A;  1B64 A;  4B08 A;  1N32 F;  1JNR B;  4QWD A;  3ZNJ 1;  4EZ6 A;  3WC2 A;  1LOU A;  3I9V 9;  1EP4 B;  3DMJ B;  3R27 A;  4HTI A;  1T9Y A;  4MJK A;  4ERD A;  3SDE A;  3MAA B;  4ILM A;  3UD4 P;  2E1R A;  1NND A;  2DCU B;  3QAT A;  4J5O A;  1NAQ A;  4CWB A;  1UVM A;  2YWE A;  4ICL A;  3LAM A;  5CHC B;  3OBI A;  2DTJ A;  2VG5 B;  1AZS A;  3NOG A;  2IY5 B;  2ZWP A;  4ALZ A;  1RT4 B;  2POK A;  3PNI A;  2K3I A;  1CC7 A;  2QG9 B;  1OJ4 A;  4J9Q A;  3PJX A;  1DBD A;  1FVS A;  3LGM A;  5KG3 A;  3QGP A;  4KC5 A;  1ZZF A;  1IR0 A;  2HRT A;  2CAJ A;  2M52 A;  2XI3 A;  4HR2 A;  3J81 Y;  1U2F A;  2UXD J;  3BR9 A;  2B7B B;  2HLT A;  3FGV A;  4NCG A;  1PYT A;  3WHI A;  3MM7 B;  2YPZ A;  1N8R T;  2RNE A;  4F3Q A;  4ZA1 A;  1H73 A;  2HNY A;  2BMB A;  3PIO Q;  3A1Y G;  5K14 A;  3AXK A;  4X65 F;  3MR5 A;  1U8S A;  4C4W A;  4XAK A;  3IM8 A;  3NLC A;  4ETX A;  4LRD A;  4DPY A;  1KNZ A;  3TVK A;  3G8S A;  3VGT A;  4DWI A;  1XNQ F;  3OXG A;  3P45 B;  2ACM A;  1R0A B;  1NK4 A;  4CO5 A;  2ZH7 A;  1NPP A;  3G4S S;  4P52 A;  4UOC A;  1N5S A;  2L48 A;  1T8E A;  1LV5 A;  4DFJ A;  1FXR A;  2HVE A;  4P75 A;  1FDN A;  2HFN A;  4K0K J;  4TYB A;  1VYA A;  2YKA A;  2E7V A;  3PKY A;  2EPI A;  2YNG B;  3GWC A;  1RE1 B;  1ZZN A;  2ADC A;  1NKB A;  3TQE A;  1KFD A;  2ZHO A;  1VS3 A;  5EWG A;  4NEY A;  5DDO C;  4RO0 A;  5I3P A;  1OY6 A;  5EN1 A;  3KK2 A;  2R7Q A;  2HGL A;  2ASY A;  3NS6 A;  2E1A A;  4RWX A;  1FJG F;  4FKY A;  2LKZ A;  2U2F A;  4LFC F;  2IPO B;  2V34 A;  4ELV A;  3THT A;  2GHV C;  2LU2 A;  4ZN3 A;  2UUT A;  2IDL A;  2M8D B;  1FXL A;  2PN6 A;  3FFI B;  2ZH1 A;  3EM1 A;  2YNF A;  2PGC A;  4ENO A;  3T6B A;  2VFU A;  5LM7 E;  4TN2 A;  1SB6 A;  2O1P A;  4QIW D;  3CCT A;  1C0U A;  4JI8 F;  3DRR A;  2ASD A;  4NA1 A;  4KPC A;  2ZH2 A;  4Y28 C;  4F67 A;  2ZH9 A;  4CT9 A;  4F4W A;  4AXI A;  1RTJ A;  4OYP A;  2J5A A;  2BKO A;  1QTN B;  4CQ1 A;  5HO4 A;  4B3T J;  2B51 A;  2CQ1 A;  3CGI A;  2R7W A;  1YK9 A;  1X8D A;  3NNA A;  2P9G A;  1YJV A;  5D8H B;  3FBF A;  4UUW A;  2B6A B;  1U49 A;  2V9W A;  3MWB A;  2ZBI A;  4TLR A;  2NLW A;  1JLG A;  4UY8 T;  1PAE X;  1P1T A;  1FTC A;  4WXO A;  3DLB A;  5SUH A;  4F0K A;  3X1L B;  2VDI A;  1R27 B;  1U6Z A;  3ZXW A;  1WAC A;  4QR1 A;  4TY8 A;  4YP3 A;  5EWF A;  3THV A;  3AOB A;  5IS2 A;  4KGK A;  4GKJ F;  1X5T A;  3HI9 A;  4X4P A;  2W4P A;  1NK7 A;  2NXN A;  3W3S A;  2AEJ A;  4GVB B;  3ETM A;  4ILR A;  4CTA A;  5I3U B;  4Q2M A;  1OYD A;  4TLQ A;  1VGY A;  3ZZR A;  2YPY A;  1OQ6 A;  1LWF A;  1WI6 A;  2YXL A;  3HJV A;  1F1B B;  4ZIV A;  1R6Y A;  1JLC B;  3KOA A;  3I9Z A;  2MEW A;  2IM0 A;  5D4L A;  5E3P A;  4KH1 B;  3PFO A;  3CCJ S;  3IR5 B;  3R2C J;  1S6Q B;  3T5K A;  4DEZ A;  3ISN C;  4Z2X A;  1YHQ S;  4LF4 F;  1ZAX A;  1RBO B;  5AXM A;  1OY8 A;  3BSO A;  1SJ1 A;  4KGX B;  2JFK A;  1TL3 A;  2Q6B A;  3DLG A;  5KFZ A;  4F4A A;  1BE4 A;  3RZA A;  3B8H A;  1HWU A;  2W4C A;  3R97 A;  1K1S A;  1YJU A;  8AT1 B;  2WVE A;  2OTL S;  2GHP A;  2KYZ A;  1SUQ A;  1ITP A;  4F7V A;  1S1U A;  4WK3 A;  1NBE B;  4MIB A;  4ZDN A;  1NKE A;  2GVD A;  2O3D A;  1RJJ A;  2EBG A;  2QYC A;  4ES1 A;  1IM6 A;  1DZ5 A;  4PXB A;  1X4F A;  2LEP A;  4OZ1 A;  3W60 A;  3DCA A;  3H5X A;  4DSJ A;  2GS8 A;  4WFA Q;  2GQQ A;  2YWH A;  3CCS S;  5FLX U;  1YRU A;  4YUD A;  2CWX A;  4IG0 B;  1ARO P;  1JKH A;  2QYG A;  5A8K A;  3M8R A;  4NXN J;  4DSE A;  4HAC A;  1MML A;  4E8U A;  1S57 A;  1F6T A;  3UNG C;  6AT1 B;  2MDA A;  3CIZ A;  2MZT A;  2RSQ A;  5LMN J;  1CUL B;  4WE1 A;  1XMO J;  2F40 A;  3SFU A;  3U1M A;  1R8P A;  4ED4 A;  2CQP A;  3KLG B;  2FVQ A;  3BQ1 A;  1RHQ B;  1PBU A;  3BYR A;  2UZA A;  3MEE B;  2PO4 A;  1FES A;  1DQ8 A;  3MMC B;  3DLK A;  2RML A;  1UWA A;  2R9L A;  1VQL S;  2B9Y A;  1CSJ A;  3Q2S C;  4ZPA A;  2VG7 B;  3GCW P;  2LA4 A;  3FSX A;  2FVS A;  2W2O P;  1HA1 A;  5DZ6 A;  4JI6 J;  2Q79 A;  4W90 B;  1NXI A;  2HS3 A;  3RUB L;  1KFS A;  3EDR B;  1NSP A;  1WKK A;  2XMV A;  1WC0 A;  2WVD A;  2GFF A;  2QA2 A;  7AT1 B;  1S97 A;  1PJ6 A;  3IXQ A;  4TVA B;  1H38 A;  2F9D A;  1I5O B;  3DI6 B;  5LXY A;  3S6E A;  4R8U A;  4QIG A;  4JI3 J;  5L1L A;  1SIW B;  3KK1 A;  1N88 A;  3AB4 B;  4ZHR B;  2MQL A;  3J81 U;  1RWK B;  1KC8 T;  2OHD A;  1BGX T;  2YKM B;  4K4T A;  3UDC A;  4TQS A;  5AT1 B;  2XMA A;  1Q8B A;  3C6U A;  4Y2C A;  1IKW B;  2XLK A;  2P6S A;  3RB6 A;  3CW2 C;  5KFM A;  3SXL A;  2RS2 A;  2OSQ A;  4JI5 J;  4ZVR B;  4IUF A;  2H4Y B;  2YVS A;  4C3L A;  4KBI A;  4HVZ A;  2KHD A;  1RBL A;  3UCU P;  4DUY F;  1ELO A;  3MED B;  5GAG I;  3TRG A;  2BOA A;  5IV4 A;  5J2M B;  4DQQ A;  1HKA A;  2DGO A;  1X9S A;  4U9R A;  4HT5 A;  2IVM A;  2LQ8 A;  3BKT A;  1PYS B;  1VFJ A;  1FEE A;  3KG1 A;  3MCN A;  3ISN D;  2X1B A;  4C98 A;  3M6W A;  1GH8 A;  3UN5 A;  4FPI A;  4RUB A;  1HHT P;  1FVQ A;  1Q4R A;  3AFG A;  5HVG A;  2HYI B;  4FXV A;  2N7Y A;  3W62 A;  4DR2 F;  3CD0 A;  2WVF A;  5HRO A;  1S1T A;  3E01 B;  3M8Y A;  5IXU A;  2XEX A;  3BDE A;  2PI5 A;  3MPD A;  3W2V A;  4NMX A;  1GAO A;  3UQS A;  3W9H A;  1OIA A;  4LMZ A;  3GJQ B;  3MPY A;  1N5Y A;  3PW7 A;  4ZPC A;  2Z58 B;  3RJM B;  1BXN A;  1C0T B;  1HPZ B;  5KFO A;  2ZKU A;  3AD9 C;  4OYW A;  4JI4 J;  4X62 F;  1M1G A;  2A3J A;  2HPU A;  2QLF B;  3L95 X;  3TX8 A;  2VJU A;  4V1A k;  5C25 A;  3FJ2 A;  2X7I A;  1YI2 S;  4OX8 A;  2IRX A;  3AH6 A;  1HQU A;  1JLE A;  3W5Y A;  3VVU A;  2XB2 D;  5HQM A;  1HBO A;  2HVH A;  4WII A;  2NXC A;  1ZS6 A;  5EX0 A;  4WU2 A;  2OML A;  5KFP A;  1VLY A;  3NGK A;  2M88 A;  4I2Q A;  2ZC3 A;  2J7U A;  1X7V A;  3NOC A;  4FXW A;  2CVE A;  1HNX F;  3SI8 A;  1R8C A;  3DRY A;  4X64 F;  2XGP A;  1N6Q A;  1N56 A;  2NXU A;  3NG8 A;  4DCP B;  4RX6 A;  1U1N A;  1RYS A;  1FNM A;  2CNO B;  2L41 A;  3VAH A;  5D78 A;  1S10 A;  2UUC F;  2VKZ G;  1B0P A;  1VDH A;  1HWJ A;  1EQM A;  3R1L A;  2HSE B;  1NHV A;  3NRB A;  1NCL A;  2EXU A;  4FF2 A;  3OJU A;  1WJ9 A;  1RU1 A;  3HDS A;  4ES3 A;  1U1R A;  3IO1 A;  3M4X A;  5I42 B;  4PG5 A;  5KG1 A;  4OLP A;  1DTT B;  4LF8 J;  4A8O A;  5ETV A;  2C1E B;  1IBC B;  2JEJ A;  4DQI A;  2GHW A;  3W9J A;  3CCZ A;  3D1H A;  3MEC B;  3BYP A;  3PVX A;  2W2P P;  2HND B;  2V6A A;  1VBY A;  5C5J A;  3V6J A;  4NLY A;  3EGZ A;  4PWW A;  1OQ3 A;  1LK7 A;  2DHA A;  1AB8 A;  3W63 A;  2EBE A;  2HQF A;  3D54 A;  1NKC A;  4YHH J;  4DSL A;  1EIY B;  2CNL B;  3TJA A;  1Y4Z B;  2ZOM A;  2IJF A;  1J5E F;  2KFZ A;  1JXV A;  2W24 A;  3G6E S;  3O44 A;  3OTB A;  1YZ6 A;  2PT0 A;  1N34 F;  2CPI A;  2EKN A;  1J5O A;  2G2O A;  1S49 A;  4NLD A;  4BBY A;  5J2N A;  4MIA A;  2OD4 A;  4RBV A;  3MD1 A;  4WPA A;  4OQJ A;  3IA0 A;  2G0J A;  4KB7 A;  2RUS A;  4XDD A;  2GIF A;  1WEZ A;  4HLB A;  2IA0 A;  3H90 A;  2HGN A;  2NUH A;  2L9D A;  4LBP A;  1WUU A;  3FKB A;  3IFE A;  3KJV B;  4ECY A;  2J6S A;  3NCP A;  1RT5 A;  2GGP A;  1B0T A;  3QIP A;  1REG X;  3T1Y J;  2BJ7 A;  2F4V J;  3H42 A;  3KWM A;  5KT2 A;  4RUH A;  3KMQ A;  2QL7 B;  5IM0 B;  1SQG A;  2FQQ B;  5C7P A;  4RUA A;  4LFA J;  3T19 A;  5DG7 A;  1ZM4 A;  3CO0 P;  4J9S A;  2FJD B;  2ZD1 B;  1YJT A;  3JQK A;  1ZET A;  4HHJ A;  5B0C A;  2LXF A;  1FK9 B;  4LRC A;  4NLO A;  3RGI A;  1LW2 B;  4X84 A;  2VIH A;  3EYZ A;  4OI1 A;  1BD6 A;  3HSJ A;  5KG2 A;  2DGU A;  2ERR A;  2E1C A;  4QU6 A;  3CD7 A;  1N36 F;  1FRK A;  1SBR A;  1U1Q A;  1WKJ A;  3KNA A;  2Q66 A;  4M5H A;  2CIM A;  2OMO A;  3M1V A;  2V63 A;  1YBT A;  3IRW P;  2LQ5 A;  4DR3 F;  4GRS A;  2ZIT A;  3PRD A;  2BUN A;  3I56 S;  3A3O B;  2RUG A;  3EGN A;  3D6H B;  2R7X A;  5C2G A;  3U1N A;  4LF6 F;  5E0O A;  4KJI A;  1YJR A;  3DYA B;  2VAS A;  3QWU A;  1S6O A;  2FIU A;  4I1T A;  2XUL A;  5GVQ A;  3TWZ A;  1VHI A;  3MF5 A;  3DC2 A;  4DI6 A;  4WIQ A;  5ITH A;  4FPR A;  3WDO A;  3I0S B;  3IN5 A;  3IS9 B;  3D0I E;  5LMU J;  3I32 A;  3P96 A;  2CDQ A;  1CS4 B;  1X5S A;  1VJW A;  3QPI A;  3MMB B;  1FFS B;  2YH0 A;  4A47 A;  4EZ9 A;  3CJ3 A;  1C4C A;  5DLG A;  3CJT A;  3VAK A;  2HBY B;  4DN0 A;  1CEZ A;  3NXZ A;  2KZZ A;  2IDE A;  4H54 A;  4KV8 A;  5ETK A;  2LQB A;  2OPP B;  1K47 A;  2IRU A;  1OSD A;  2IC3 A;  3HFZ B;  2FHJ D;  2CQH A;  5HK4 A;  4KAI A;  3LP1 B;  5IC4 B;  2CUY A;  1FWP A;  3D66 A;  4O0I A;  1U8W A;  3SSS A;  1NDK A;  4LJM A;  2G4B A;  2HHQ A;  2BAN B;  4I56 A;  1W25 A;  5HAO A;  4JV0 A;  2XI2 A;  5AE2 A;  4QIF A;  1HNW J;  2BVZ A;  2I6W A;  4ZN1 A;  1ZAW A;  3CJ4 A;  3OXL A;  2YWG A;  3GIJ A;  2B4P A;  1CBK A;  1S9F A;  1UVJ A;  1KVJ A;  2UU9 F;  2RDD A;  2M5Y A;  3MEK A;  4YQW A;  2IJR A;  1HQE A;  2JLE A;  5BR8 F;  3TAM A;  1TKT A;  2Z2L A;  3D9B A;  4KE5 A;  2VFR A;  3BO3 A;  3M2U B;  3F0N A;  1ZOT A;  1N5Q A;  4B3S F;  3EVW A;  4V19 X;  1IKY B;  1Q7L B;  4EYI B;  1RU2 A;  1WEL A;  2X1G A;  4B3R J;  1RCO B;  3MMA B;  4ZVG A;  3M9M B;  3BBC A;  2UV8 G;  3TUI C;  3OD2 A;  3DFE A;  4F2R A;  1GXU A;  4DSF A;  1SH2 A;  4PQU A;  1SC1 B;  3TAN A;  3CCU S;  2C2O B;  3U27 A;  2BX6 A;  2Z0G A;  1R8B A;  1U1L A;  3DDI A;  5DJB A;  4GKK F;  4M5G A;  4GVL A;  5D6G A;  1BMQ B;  3BF4 A;  4JI0 J;  2CG8 A;  1VHF A;  3OSN A;  4C3M A;  4YB5 A;  1JLB A;  2U1A A;  4DJB A;  2XBP A;  1FHT A;  4K4W A;  2MGZ A;  5MAO A;  2OFH X;  3ZZP A;  2BQ3 A;  1VIX A;  2MZJ A;  3VZH A;  2LQJ A;  2WTF A;  2R2S A;  2AYM A;  3RBX A;  4FYW B;  1HI8 A;  2RIL A;  4ZP8 A;  3O2I A;  4WWS A;  4FS1 A;  5KT6 A;  4RNN A;  4N56 A;  1PCA A;  3M8P B;  1S0M A;  1T05 B;  4HH1 A;  1NK9 A;  4F36 A;  1RHU B;  2V67 A;  1B4S A;  4RR5 A;  2WW4 A;  1RXO B;  2QN6 B;  1X4D A;  3VAJ A;  4O44 B;  3JSM B;  3P6Y C;  3EPI A;  3HJF A;  3KLE A;  5L1K A;  1RDR A;  4GO5 X;  2K06 A;  2W2M P;  2YKN B;  5G0R A;  3ZTO A;  3LH2 S;  3CJ5 A;  3VAG A;  4AUK A;  5HAT A;  1S6P B;  4OI6 A;  4DPO A;  4G1Q B;  5CYQ A;  4NLW A;  4HYK A;  1RHM B;  4G1P A;  4LF7 F;  4IO1 A;  4LRE A;  4LFB J;  4DR6 J;  3HHK A;  3LWL A;  3DRP B;  3AQO A;  2EC2 A;  3M30 B;  4H4O A;  1F3V A;  2UUB J;  4Y3C A;  4LVO P;  1M5K C;  4L75 A;  3N5F A;  4QOT A;  1Z2L A;  5T14 A;  1Q8K A;  5ETN A;  3B82 A;  2EFQ A;  4MK8 A;  1BY9 A;  2JZ5 A;  2RF2 A;  3B78 A;  1XR5 A;  1FER A;  1LEO A;  1IXK A;  3O3L A;  4NL5 A;  4ZVS B;  3ADA C;  4DV2 J;  2MJU A;  1U7L A;  4DR1 J;  4KGM A;  1D9A A;  3V4M A;  4QCL A;  2WW8 A;  4O4G B;  3NAH A;  4IRC A;  1S1X A;  1WF1 A;  2J9E A;  4WTO B;  1J2V A;  3ZFV A;  2PFD A;  5CD4 H;  2CAD A;  5DQH A;  1UEU A;  3FEX B;  3GR0 A;  3GV8 B;  2JEG A;  2B8Q A;  4DR5 J;  1V5I B;  2IYI A;  1NJI T;  3CD6 S;  1PYO B;  3L9Z A;  3E2E A;  2VPY B;  5ETP A;  5HAN A;  3DXB A;  4YY3 F;  1O8B A;  3KLI A;  3VAI A;  4LQ3 A;  3BQ0 A;  2ZEJ A;  3LAL A;  2OJ3 A;  1JLF B;  1H72 C;  1GK8 A;  4WK1 A;  1UCN A;  4M5D B;  3TZZ A;  1WEY A;  4WP3 A;  5BJR A;  2AJ2 A;  2XYP B;  2DKO B;  4O3R A;  3ZNU A;  3DNC A;  3WX8 A;  2AYE A;  4LF2 A;  2AJF E;  2A1B A;  2P8I A;  3JSR A;  3QLH B;  5B0A A;  1R43 A;  1S7H A;  2DY1 A;  4WBF A;  2FLL A;  3L09 A;  1WHX A;  2DNZ A;  3UWT A;  2QMU B;  1J27 A;  2YNH A;  4J7C A;  3MUM P;  4WJB A;  4ZS6 A;  4NZ0 A;  3P5T L;  1ZA2 B;  1RAI B;  3T6J A;  2DR8 A;  2XO6 A;  2H54 B;  3VGV A;  2C2D A;  2ALY B;  3GJS B;  3IR6 B;  1JLA B;  4IRK A;  4JYA J;  3BGR B;  1IBK F;  3I87 A;  3PJ9 A;  3Q8Y A;  1DJ0 A;  1NEE A;  3HKW A;  2CPF A;  5KG0 A;  3CJK A;  3LAK A;  3T5J A;  5A8R B;  1KKH A;  4CM2 A;  5LOQ A;  1DQA A;  4B9M A;  1Y00 A;  5KFT A;  3FUY A;  1UTA A;  4DL3 A;  2IIH A;  1EKR A;  5J2Q A;  4C8Y A;  1FKA F;  3RRG A;  2BJE A;  4Y2I A;  3MD3 A;  3V6D A;  1UWB B;  1Y5I B;  2VFV A;  2K7J A;  4OHY A;  3T9Z A;  4DV6 J;  4WU3 A;  3KFW X;  1Q7Y T;  4PWD B;  4DSI A;  3QID A;  3CJ8 A;  1I51 B;  4A4J A;  4DF8 A;  3KJN B;  5D0R A;  2FC8 A;  2CJ9 A;  4NLV A;  4ZPD A;  4IFV B;  2MLZ A;  1TL7 A;  2PFF B;  3PR5 B;  2E1M C;  3Q24 A;  1Y5L B;  1K9M T;  2AP6 A;  3LW5 C;  5U47 A;  4ETZ A;  3HVT A;  2X51 A;  4DFP A;  2HHW A;  2NXE A;  4QWC A;  2CKW A;  1W26 A;  1RAA B;  2VOP A;  1YLX A;  3EIC A;  2UUA F;  1PKU A;  3MR6 A;  3PO5 A;  4KO0 A;  2D1C A;  1FXD A;  4JOU A;  3KLH B;  3EDQ B;  1W2B R;  1VQ9 S;  2ZBR A;  3GII A;  1UA1 A;  4LF9 F;  3SBM A;  2HRY A;  3NBP B;  1VQY A;  5EDW A;  2AEF A;  5CYM B;  2WB4 A;  2FJB B;  5A6W A;  3MZI A;  4DR4 F;  1MN7 A;  2BM0 A;  3MM5 B;  2MKC A;  3DHW C;  5I3Q A;  2J0S D;  1MWY A;  1TL4 A;  2CDR B;  3BEG B;  3R6L B;  4DUZ F;  2E9T A;  3K7R A;  1S76 D;  3PCO B;  3AQP A;  2BKN A;  3AXM A;  3NWG A;  4NE9 C;  1U47 A;  3WBZ A;  2RRN A;  5DM6 Q;  2E5L J;  4DG1 A;  4ZIT A;  3FNN A;  4Y34 A;  2QFI A;  2XGQ A;  1WC1 A;  1HNI A;  2YX1 A;  4AQY F;  4QQB A;  4TKT A;  1T0T V;  1RWV B;  1VQP S;  1RB0 A;  4WF9 Q;  2J7K A;  1M1H A;  3OHA A;  4JV2 A;  1TKX A;  4QZV B;  3AA9 A;  5F41 A;  1QAI A;  3JTP A;  4RW8 A;  2GAG C;  3BO4 A;  2VBY A;  5GAG U;  2DNO A;  2NYH A;  2QT7 A;  1H7W A;  3H0P A;  3NP5 A;  4M5L A;  2VIC A;  1RT1 B;  3HT0 A;  3D6M B;  5FDL A;  2HUR A;  4CLW A;  1V6H A;  2J9D A;  3K5N A;  4NI2 A;  1LK5 A;  5KFW A;  3IBC B;  2EFN A;  1SC6 A;  2XSJ B;  2XMK A;  3AD8 C;  3EGW B;  4YB1 P;  5HQL A;  1RAD B;  3V6H A;  2CXE A;  1FKO A;  4ZP6 A;  4DOZ A;  3JYT B;  1URR A;  4P73 A;  3R7B B;  5EHH A;  2HQG A;  3K5P A;  4MKV A;  3IRX A;  3MM6 B;  4ECV A;  1N5V A;  4UW2 A;  2J9D E;  3I6P A;  3B4M A;  4ZKA A;  2CNK B;  2B4O A;  2XMU A;  4QWE A;  4J9L A;  3I5A A;  5DDQ C;  2F1F A;  3MUT P;  1NSA A;  4DFM A;  4DV0 J;  3U02 A;  3MM9 A;  3N5B A;  4KFB B;  3VZI A;  1UW4 A;  1DTQ A;  1NK6 A;  2H48 B;  2D7S A;  3BRE A;  1RZM A;  2V2Z A;  3GG1 A;  3QJP A;  5LSO A;  1TUG B;  1KVK A;  4YFU A;  4CI0 B;  5KFU A;  1SC4 B;  4N8N A;  3I0R B;  1RTD B;  3RAQ A;  3OUY B;  4I4B A;  2V68 A;  1WSV A;  1R3N A;  4AE5 A;  4QPT A;  5HI7 A;  2FLO A;  2LA6 A;  1X9M A;  1EP4 A;  1F9E B;  1B7F A;  4C8M A;  2JC1 A;  3DGP B;  4ZLN A;  3TA0 A;  1YJN S;  4D3G A;  2WAQ D;  2MKI A;  3M8Z A;  3MAA A;  3FEY B;  1N4L A;  1TVR B;  3RB4 A;  3HHL B;  5D4N A;  4QBU A;  2KB2 A;  2VG5 A;  3CDA A;  2EKY A;  3PW5 A;  2AV5 A;  2DEI A;  1U1O A;  1RT4 A;  1R7I A;  4YR0 A;  2DR7 A;  4FYD A;  4AL7 A;  4X2B A;  3TX0 A;  3IAS 9;  2NPF A;  1APS A;  1QE1 A;  2FVC A;  2YKP A;  3AD7 C;  3K8W A;  4ECS A;  2VKR A;  1YJW S;  2KT2 A;  3MM7 A;  4QWB A;  1DUR A;  3CDB A;  3UI3 A;  3V4I B;  4BWM A;  2VC1 A;  1K8A T;  3BBB A;  4LF5 J;  3DLE A;  2HFV A;  1PSD A;  1Y5N B;  3CC4 S;  4M5N A;  1QY7 A;  1V9O A;  4DBQ A;  5KFY A;  1G6B A;  2QRR A;  4K4U A;  3NY0 A;  3V5R A;  5AXK A;  5EGY A;  1WKL A;  3EWG A;  3QYY A;  2ZKT A;  3FRZ A;  4IFY B;  1FT8 A;  2RRA A;  1R0A A;  1HBM A;  5DO2 A;  1VC5 A;  2OO4 A;  1SQF A;  2BJ8 A;  3HSZ A;  3NCR A;  3CUL A;  4YN3 B;  1LWX A;  1X9W A;  3L7U A;  1K1Q A;  1TUV A;  1D8Z A;  2JEF A;  1T3O A;  2YNG A;  3CF5 Q;  3H5S A;  4ZCI A;  4M1K A;  1SV5 B;  2N4C A;  1VQS A;  1KHV A;  4RBT A;  1FEH A;  1WEX A;  2UXC J;  2JWN A;  1RLD A;  3O1L A;  3H4D A;  1QSL A;  3OLB A;  3UR0 A;  1Q16 B;  3UVJ B;  5AXL A;  2DH7 A;  2B9X A;  2XZT B;  1LW0 A;  4DZD A;  1O51 A;  1TFY A;  4K4S A;  1XWL A;  4IKA A;  1HW9 A;  2LEC A;  3HMJ G;  3FFI A;  3OFH A;  1QAJ A;  3FCV A;  4NPO A;  2I2Y A;  1OWX A;  4Z7Y A;  3NGD A;  3CCQ S;  5F8J A;  4YB7 A;  2ZUA A;  2R8H A;  2C2Z B;  3F56 A;  1L5U A;  3PEJ A;  5LJ5 Y;  4IG3 B;  3MOZ A;  4K4Z A;  3OR2 A;  2RAQ A;  3MHY A;  4ZCK A;  1UJ4 A;  1UAW A;  3NWR A;  3EX7 B;  3RBD A;  3G87 A;  4XTT A;  4JI3 F;  2V69 A;  2B6A A;  1RHJ B;  3K57 A;  1EHW A;  4C3K A;  1QM9 A;  2VZ9 A;  1UPM B;  4BS2 A;  2OI2 A;  1ICE B;  3H2U B;  2W7O A;  1P9Y A;  4NXM F;  2ZBC A;  4JB8 B;  3HFK A;  1YX2 A;  3EZO A;  2HAF A;  4PAA A;  2RKI B;  1ZAV A;  5H1S V;  5GAH I;  1WC6 A;  1FRL A;  2D3U A;  1GT8 A;  3EMT A;  4JI5 F;  4RW6 B;  3FZB A;  3KK2 B;  2DXE A;  4UY8 5;  2XY5 A;  1RAF B;  3CSK A;  1FRI A;  1BWE A;  5I3U A;  2GVZ A;  2C22 A;  1UMJ A;  1UEV A;  4EO8 A;  4F0H A;  3I4H X;  4K2J A;  1U0H A;  3TJ8 A;  3TP2 A;  3R5B A;  1TKZ B;  3MXH P;  5D3G B;  4ZVO B;  1WHV A;  4GMK A;  3BH7 B;  4HT7 A;  2DY9 A;  5L46 A;  3MR3 A;  3GZ7 A;  4HI2 A;  5KFV A;  4DL7 A;  1C0U B;  2DPJ A;  1RTH A;  4RBU A;  2RVJ A;  1TZ0 A;  3ZZZ A;  4RW9 B;  2HHP A;  2Q43 A;  3GJR B;  1SKR A;  1GX5 A;  2W9B B;  5K20 B;  1WD6 A;  3VF0 B;  2HGM A;  3VVT A;  3BBF A;  5KT3 A;  3H4B A;  5IQ6 A;  5KFJ A;  2QTW A;  3TO8 A;  7FD1 A;  4LSL A;  1L3T A;  4OZ2 A;  4Y2K A;  2MXY A;  4ID5 A;  2KT3 A;  4RW4 A;  4B3M J;  2B9E A;  4OJG A;  2DR6 A;  1N32 J;  1GX6 A;  2VV5 A;  1IN0 A;  4GO7 X;  2XLI A;  4ZMM A;  1FDD A;  2B5J B;  1VRT B;  4R5P A;  1LXN A;  3VAF A;  3RU0 A;  4WKY A;  1JJ2 R;  2IMO A;  2P9C A;  3KKF A;  2KG0 A;  1KN6 A;  1ACM B;  4KHR A;  3OL7 A;  4ECX A;  4PWU A;  1ZTT A;  1X60 A;  2DIT A;  1CJV A;  5CA5 A;  1GMV A;  4NYP A;  3QNW B;  1FFW B;  2H3E B;  1D09 B;  4IG0 A;  4LBI A;  1H98 A;  4EO6 A;  4PG4 A;  4CZC A;  3UW1 A;  2OIH A;  4G1I A;  2R7O A;  4LRA A;  4PAB A;  1D1U A;  4CH0 S;  2MKJ A;  2FZG B;  2R7U A;  1CUL A;  1U26 A;  8RUC A;  3C15 B;  3A4T A;  4C11 B;  4OV1 A;  4MH8 A;  1KLM B;  3KLG A;  2ZH6 A;  1T7P A;  2IM1 A;  1YTY A;  3RBE A;  1DLO A;  2CPH A;  2LXI A;  3LAN A;  2LQ9 A;  1SXL A;  4Q45 A;  2G2Y A;  3AT1 B;  3MMC A;  1NJX A;  1HNZ J;  4OI2 A;  4DPX A;  4WFB Q;  4J9M A;  2VG6 A;  2VG7 A;  2QZ8 A;  2W01 A;  1WF0 A;  3Q8Q B;  4DL0 C;  1S12 A;  1VQK S;  2WOM A;  3H8Y A;  1GXL A;  1QVG R;  5ETL A;  1SUQ B;  1VC0 A;  3ZTQ A;  2LP4 A;  1EET B;  4W4M A;  2VB6 A;  2GVD B;  4M94 A;  1KHW A;  2PC6 A;  4ED3 A;  3DKD A;  2XNR A;  2OPR B;  3FEZ A;  3BM7 A;  1WSR A;  1SI9 A;  5T7L A;  4ZHR A;  1Y10 A;  2ZOF A;  4EWT A;  3PAC A;  3OTO F;  2VBZ A;  1VBK A;  2KM8 C;  2CNN B;  2FJE B;  1RAE B;  2YKM A;  5LXR A;  4B9S A;  4A8W A;  4DU7 A;  1JKH B;  1T11 A;  1N33 F;  4OV6 A;  1VK8 A;  4JI1 F;  1IKW A;  2E44 A;  4XDC A;  4HAC B;  3RTV A;  4C8K A;  1IKV B;  2QSW A;  1CQM A;  1R8H A;  1QJH A;  2J8S A;  3PYF A;  5F8G A;  3MED A;  4WE1 B;  4X66 J;  3JTN A;  2HZV A;  1RAB B;  4LFC J;  2F4V F;  1VQN S;  2B4U A;  2NYI A;  1F60 B;  3CC2 S;  4RUC A;  3CDE A;  5B0D A;  3KUG A;  3DRS B;  2OEK A;  1UFK A;  3AOA A;  4F4Y A;  1IJF B;  3LUY A;  4KHM A;  3ILL A;  3IC1 A;  4J9V A;  2VQE F;  1RUS A;  1N48 A;  4I2P B;  4NX9 A;  1QUP A;  4B3O B;  2OGU A;  3AY0 A;  2ZDP A;  1RKI A;  3H59 A;  3TZY A;  3PTW A;  1CQN A;  3CJ2 A;  5IQQ A;  1XMQ J;  5KT5 A;  2HBQ B;  2DH9 A;  1QSS A;  2CQB A;  2Y1J A;  1EQ0 A;  2ILY A;  2HQD A;  1HPZ A;  2IAJ A;  2HHH F;  4URS A;  5JVH Q;  3R5C A;  1Q78 A;  1UEK A;  4DHV A;  4I69 A;  3SCK E;  2V2Q A;  3KK1 B;  2KJW A;  2C3M A;  3U1L A;  2BJ9 A;  4RWW A;  1PC5 A;  1VBZ A;  1RWO B;  2CQ3 A;  1G7C B;  3A3P B;  1X4G A;  2EI5 A;  4ELT A;  1F5C A;  3C6U B;  1WG5 A;  1H2V Z;  2OD6 A;  4KR0 B;  5ETQ A;  5BYS A;  2V4J B;  1YQH A;  4ZCL A;  5CYJ A;  1U45 A;  2KN4 A;  3K17 A;  2C2M B;  2HWI A;  4QW9 A;  3LTO A;  4DQS A;  2HHV A;  2KXF A;  3K59 A;  3M2R A;  1LWC B;  4NRU A;  5C2C A;  1FJE B;  1I1G A;  4HHU A;  1TL5 A;  2I38 A;  1XIQ A;  1S72 S;  3G96 A;  1T9V A;  3QJJ A;  3CCL S;  4QR0 A;  4WZQ A;  1SJ3 P;  5IT9 U;  4OX9 J;  4P9S A;  6FD1 A;  1S7I A;  2CZ9 A;  2EFV A;  3HHL C;  2QLW A;  1IR1 A;  5D4O A;  5HRO B;  1DTT A;  1S1T B;  3RW6 A;  2BAC A;  4WP8 A;  3DOK A;  4RJV A;  3W2V B;  2XZW A;  2HMI B;  4JV5 F;  3BH6 B;  3ILO A;  3P3D A;  3MEC A;  4N76 A;  5L9N A;  3UE2 A;  4DV1 F;  4KYZ A;  1N5Y B;  1SH3 A;  1JQG A;  3KUH A;  5IOL A;  4P6Q A;  2V94 A;  1HW8 A;  2J6T A;  4IQX A;  4CLT A;  3SIP B;  1OSC A;  2WCX A;  5THW A;  3TZX A;  3KMS A;  2WSE C;  3FQL A;  3RR8 A;  1KEK A;  2OLW A;  4BHQ A;  1VC6 A;  4O4R A;  4WP9 A;  3HKZ D;  3DOL A;  2QE5 A;  1VI7 A;  1HQU B;  4P10 A;  1TV6 B;  2MTL A;  4PKD B;  4IR9 A;  3BPD A;  1NO8 A;  4I2Q B;  2MKS A;  1X5P A;  2BE7 D;  3M05 A;  4IRD A;  1M1K T;  4M5K A;  2VC0 A;  3LQV A;  1UVK A;  5KFQ A;  4MKB A;  2CPD A;  1T03 A;  4DR7 F;  1PJ7 A;  1KQS R;  1Q95 G;  1YKW A;  3SYZ A;  2J6U A;  1X0P A;  1JX4 A;  2V4Q A;  4OI4 A;  4QYZ K;  2MQ8 A;  1WG4 A;  1MMD A;  3CC7 S;  1JB0 C;  2JJ4 D;  5E2Q A;  1IBM J;  3PW0 A;  2YY3 A;  3E3X A;  2WK4 A;  3J80 Y;  2K3K A;  4JI7 J;  1AW0 A;  1D0E A;  3KJV A;  2WON B;  3MUR P;  2LDY A;  4WFY A;  2QX0 A;  2W9C B;  1VMB A;  5ETS A;  1XNR J;  1PIE A;  2DRD A;  3X3U A;  2PMW A;  1NSQ A;  4C6A A;  2R3V A;  3IR7 B;  2ZD1 A;  4PQA A;  5KG6 A;  1RK8 A;  4CNY A;  1CLF A;  3EE3 A;  1VQ5 S;  5L9X A;  2JEI A;  3B4D A;  2LEB A;  1LNQ A;  2SXL A;  3MPU B;  3W61 A;  2KJV A;  3HSG A;  2I0X A;  5DG8 A;  5CZV A;  2XM3 A;  2JLF A;  3CB4 A;  1RAJ A;  2UP1 A;  4BLG A;  5ADZ A;  1Q82 T;  3KNG A;  5M2R A;  4N47 A;  2X1A A;  2PMH A;  1J5O B;  3GLJ A;  3DGV A;  3PR4 A;  2BXJ A;  5HP1 B;  4PXD A;  1U2C A;  1TKD A;  5DM7 Q;  3CJS A;  2G0C A;  4DR6 F;  2PII A;  3FSI A;  3DYA A;  2YKO A;  2VPZ B;  2O5D A;  3JSB A;  2UUB F;  3ET6 B;  1R31 A;  4J9N A;  5DRK A;  3KG0 A;  5D77 A;  3HHL D;  3N9U C;  5EUH A;  1Y11 A;  3CWJ A;  2CZ4 A;  3QQC D;  3ONQ A;  1S79 A;  1RT5 B;  1XTZ A;  1CS4 A;  2KTQ A;  2BM1 A;  1C2P A;  3MMB A;  1VQ6 S;  2KH9 A;  1BLU A;  1SVD A;  4UZC A;  3CCV S;  2YTC A;  4ZVT B;  2XYH B;  4PZV A;  3H25 A;  4Q0B B;  2OPP A;  2Y1L B;  1EZZ B;  2NCK L;  4DR5 F;  5K8M A;  1UL3 A;  3I82 A;  3LP1 A;  2RE1 A;  3Q8R B;  1PJ5 A;  2LLZ A;  4M5I A;  3FMB A;  1NB2 A;  3EVM A;  3POT A;  1QAX A;  4KHP J;  2BAN A;  3OFG A;  5IC6 B;  2AU0 A;  4ECU A;  4OJH A;  1F5A A;  4TU7 A;  4DX7 A;  1AFJ A;  2OPS A;  3LGH A;  3M1V B;  1SL1 A;  2UUW A;  1JMT A;  2D3O 1;  4F3M A;  2AX0 A;  2AGO A;  4B9N A;  4WKR A;  4WYW A;  1D3W A;  1T9W A;  4I7F B;  2PMZ D;  4DV7 F;  1NJW A;  4PYA A;  2DO0 A;  3BJY A;  1M5P C;  1ZPW X;  3M2U A;  1RKJ A;  1VRQ C;  2XMM A;  1RAC B;  2KYX A;  2EEY A;  1IKY A;  1HBN A;  1SJF A;  4X64 J;  2QL9 B;  3W7B A;  1RWU A;  3GFZ A;  2NPI A;  2E29 A;  2WVB A;  4MYU A;  4UT4 A;  4WCE Q;  5RUB A;  1ZH5 A;  2UUC J;  4GC7 A;  2BOP A;  5I4M A;  3UDE A;  4DL5 A;  2R7R A;  2XCA A;  3CTR A;  3BSA A;  4QU7 A;  2BDP A;  4JYA F;  4NLQ A;  4ECQ A;  4YR2 A;  1JJH A;  3OTE A;  2NZC A;  3GYG A;  4L73 A;  3QRP A;  3H2L A;  3GR1 A;  1JXE A;  1KOH A;  3RB0 A;  1WI8 A;  4USH A;  3P8B B;  4EI2 A;  1S4E A;  2XS2 A;  1TFW A;  1AA1 B;  2MQN A;  2Q3P A;  5J1E B;  4UOF A;  4H4M B;  1NHK L;  2ASL A;  5KFS A;  5D0E A;  1REV B;  3P4U B;  3BN4 A;  1KQK A;  1N54 B;  3W5Z A;  2HBR B;  4NWB A;  3M8P A;  4QPX A;  1OS5 A;  1T05 A;  2KVI A;  4ED6 A;  5GAE U;  3KYL A;  2HNZ A;  4NYZ A;  1TKT B;  1EX8 A;  2XCP A;  3NS5 A;  4F50 A;  4LSZ B;  3PYE A;  1FD8 A;  3JSM A;  5A0Y A;  1R0C B;  1J5E J;  5KFB A;  2IM2 A;  2ZHB A;  4A8Y A;  1EAR A;  2YKN A;  1T3N A;  1P1L A;  2OEJ A;  4Y2M A;  5EX3 A;  3KLF B;  1S6P A;  1N34 J;  3VAM A;  5KAK A;  3BR8 A;  2HBZ B;  2EFG A;  4G1Q A;  4ZP9 A;  1BHN A;  3DOM B;  3VR1 A;  2MZR A;  2GJI A;  2BE2 B;  2NR0 A;  2CQG A;  1KON A;  5HMY A;  1S5Z A;  4DV4 F;  3HK2 A;  2DNH A;  3QBC A;  5DG9 A;  3HO1 A;  4WTY A;  5M2U A;  2VPX B;  4XPE A;  3GMG A;  1G4C A;  2A6O A;  1JLB B;  2CYY A;  2DHX A;  2E5L F;  1U48 A;  5B09 A;  3OL9 A;  3OT9 A;  1WOS A;  2CA9 A;  4O4G A;  2KXH A;  3MFI A;  1WC5 A;  4ED2 A;  3MPW A;  1RA6 A;  3A13 A;  1HR0 J;  4KTQ A;  3PXG a;  3F44 A;  3W8G A;  4YDX A;  4HKQ A;  2DGQ A;  5GAH U;  4Q43 A;  3HZG A;  1RP5 A;  1WC3 A;  3A8I A;  2VON A;  3GIK A;  3HFV A;  1N36 J;  4LQ9 A;  4Y6I A;  3SCI E;  4KQZ A;  2DRB A;  3FVY A;  3KLE B;  1CJU B;  1KSP A;  3QFW A;  4EBC A;  4DR3 J;  2IBO A;  5LSR A;  1XK8 A;  2DK2 A;  4HH0 A;  3TEH B;  2O67 A;  4FZV A;  2CWK A;  2FLP A;  2ZNY A;  3W9I A;  4OZN A;  1Z1Z A;  4M5M A;  5EWE A;  2R8I A;  1JIH A;  2XY6 A;  4DU8 A;  1I94 F;  4RNO A;  1KTV A;  5KFL A;  1XBW A;  4H4O B;  3QLH A;  3TW0 A;  4U8Y A;  1U1P A;  3JB9 k;  4A48 A;  1HYS B;  2LVW A;  3DN9 A;  2OAU A;  2QA4 S;  3SCJ E;  2RF2 B;  2H1Y A;  4X4N A;  5E33 A;  3JQJ A;  4OHZ A;  4OZ5 A;  7FDR A;  2GQ2 A;  4KH0 B;  3A8K A;  2QA1 A;  4L72 B;  4AXJ A;  3IGN A;  4DV0 F;  1S1X B;  2IVF B;  1JLA A;  4B9L A;  5E3A A;  1HFE L;  2NZ4 A;  2Z2M A;  3ICL A;  1FD2 A;  1JNZ B;  3SMZ A;  1RWN B;  2AF6 A;  2D3Z A;  2MZ1 A;  3T9N A;  2GML A;  1UET A;  1JLQ A;  2CJB A;  3F41 A;  3VHQ A;  4A8S A;  2P5V A;  3TI0 A;  1U09 A;  1RTI B;  1OPZ A;  3RG6 A;  1UWB A;  4ED5 A;  4AND A;  3KLI B;  1IQZ A;  4WXW A;  4M63 A;  3W5X A;  5KFG A;  3C66 A;  4PWD A;  3N4W A;  4J9R A;  5L39 A;  1NUE A;  5A2Q Y;  2DNL A;  2UU9 J;  2DCL A;  1TK5 A;  4MK7 A;  2A6M A;  2BQU A;  2DVI A;  1R6V A;  4E0D A;  5BR8 J;  1IBL F;  2DPI A;  1RT2 B;  1CJK A;  1GMW A;  1FKP A;  4B3S J;  2W4D A;  1FDB A;  4QYZ J;  1VQO S;  1A6L A;  4B02 A;  2DHS A;  2JX2 A;  3BGF A;  3HCX A;  1AFI A;  2WB1 D;  3QO9 B;  2RQK A;  3KLH A;  2AJ1 A;  2YNH B;  4Z7C A;  1E6V B;  3GCX P;  5IV3 A;  5FII A;  2JSX A;  2LYV A;  2WBR A;  1EB0 A;  3G2X A;  3MM5 A;  3G6Y A;  2RRB A;  2GV1 A;  1KR4 A;  2W8L A;  4U67 Q;  3SFG A;  2R2U A;  1RAG B;  2FC9 A;  2ZJQ Q;  1WDD A;  4CNZ A;  5AJ3 F;  2FLN A;  2ZH5 A;  3US5 A;  4UZB A;  4GKK J;  3IMQ J;  3FQK A;  2Y9H A;  3CVK A;  3EZ5 A;  2ZH4 A;  1UFW A;  1VRU B;  3SQG A;  1F5B A;  2XHW A;  2EC0 A;  2I5J B;  3Q22 A;  5J2Q B;  4ZJO A;  2CQC A;  4ILL A;  3LO3 A;  5CAB A;  1FE0 A;  4NLX A;  4UQG A;  3SV3 A;  1Y0H A;  3IP0 A;  2GX8 A;  3UNY A;  2CVI A;  4U95 A;  5K5M A;  2E5G A;  2QO3 A;  1IWA A;  5HMZ A;  4O3O A;  1TL7 B;  2MHN A;  3GTY X;  1YSJ A;  3UDL A;  5KOX A;  1UKU A;  4KRW A;  5LJ3 Y;  1A7G E;  1IQT A;  1UPP A;  3S01 A;  1S1W B;  3CDU A;  3D3C J;  1S77 D;  4J37 A;  4L74 A;  5DDP C;  2AGP A;  1MU2 A;  1RT1 A;  2XLJ A;  2UXC F;  1WG1 A;  4U96 A;  3SV4 A;  2HHU A;  2JL9 A;  4CO2 A;  2NSC A;  8ATC B;  4HL9 A;  1HWI A;  2VFT A;  2CPJ A;  2KRR A;  5KFX A;  1P27 B;  2V5H G;  3D2W A;  3JYT A;  3K8V A;  5F8I A;  3QZ7 A;  3KTQ A;  2HEK A;  1RBA A;  2R8G A;  2FHM A;  3MM6 A;  3C2P A;  1X4A A;  2DNR A;  2K7K A;  4L76 A;  1Y3J A;  2BE9 B;  5HQ8 A;  1SJ4 P;  2BEF A;  5K8N A;  2AIR B;  3ITH B;  4DG1 B;  1YBA A;  4OZ0 A;  3D68 A;  3TAP A;  3PHE A;  4JI2 F;  3W8P A;  4DV5 F;  1PO6 A;  2F5G A;  4CIO A;  3ENW A;  2A10 A;  1E6Y A;  4MAK A;  4K5R A;  5KFE A;  1D9F A;  1IWG A;  2EG2 A;  3Q8P B;  3PKM A;  2A2D A;  3I0R A;  3EPG A;  1RTD A;  2F9J A;  4MFB A;  1X4E A;  3OUY A;  4YY3 J;  4RW8 B;  5HLF B;  2V0N A;  2QV6 A;  3PG9 A;  2BW2 A;  4QYR A;  4WFX A;  4M5J A;  1Y7P A;  4OYX A;  3DGP A;  2PD1 A;  4HDH A;  1MWQ A;  5D0H A;  3ISZ A;  5FDL B;  3SQO P;  1NK8 A;  5CXT A;  4EYH B;  4IOA Q;  2H5E A;  4NI2 B;  3MEG B;  5KTQ A;  1RT3 B;  4I0W A;  4ZVU B;  4ZPB A;  5FD1 A;  4Q8F A;  3D7S B;  3Q8U A;  1CC8 A;  1TVR A;  3L7P A;  3RYL A;  5A76 A;  9ATC B;  1FKO B;  3BDP A;  2BW7 A;  4UOG A;  1WC4 A;  1TTH B;  2X1F A;  4NRT A;  1LKZ A;  2YWF A;  4BC9 A;  4UST A;  5IWA F;  4DUT A;  2VA3 A;  4PUO A;  5DGA A;  1RHR B;  3WC0 A;  4DPW A;  1YDL A;  3ILI A;  5H9E J;  4QR2 A;  5FLX Y;  3AJ1 A;  3CED A;  2VDH A;  1IBK J;  3V4I A;  2AX1 A;  2KI2 A;  1DTQ B;  3G6V A;  5B08 A;  2KT5 A;  1TMM A;  1LXJ A;  2RH3 A;  3OTD A;  2M2B A;  3IWL A;  4IH6 A;  2R8J A;  4RKU C;  3DM2 A;  3QT5 A;  4DV3 F;  4CH7 A;  1SL0 A;  5F8M A;  2CJQ A;  1FI4 A;  2GJ2 A;  2BJ1 A;  3GFY A;  5F3Z A;  4IFY A;  3UPF A;  2V9K A;  1B3T A;  1L3S A;  2JLG A;  2F4F A;  1WF2 A;  4FF1 A;  1BQM A;  1MRO B;  1RGV A;  1T95 A;  2M7S A;  4LRF A;  1S9E B;  2J0X A;  3HD2 A;  2Y1I A;  1DAR A;  4K59 A;  3H40 A;  1FJC A;  5C42 B;  5CQG A;  3E51 A;  3PEH A;  4DPU A;  2XC9 A;  4USI A;  1L3K A;  4FBU A;  1SV5 A;  1R8A A;  1TR0 A;  1VQM S;  3CNQ P;  2HQC A;  3C16 B;  2UUA J;  6FDR A;  2AYG A;  4YR3 A;  4LF9 J;  3R5D A;  2IBK A;  3CD5 A;  5DQI A;  2XG8 A;  5M2P A;  3UVJ A;  2AJ0 A;  1QE1 B;  3UN3 A;  4QW8 A;  4DR4 J;  2APO A;  3WX4 A;  3TA2 A;  2MLX A;  3O6Q A;  1RSC A;  4DUZ J;  3UD3 P;  2XWX A;  2HZA A;  1NB7 A;  5A2Q U;  1XR7 A;  3KDN A;  3DLE B;  1HNZ F;  4AD6 A;  2PEH A;  1VLO A;  4NEZ A;  4P2F A;  5HJY A;  1NSK L;  2HHX A;  5L1J A;  4DZ6 A;  1BC6 A;  1SPB P;  4CYU A;  4EUV A;  3W2W A;  2BKP A;  3M6V A;  1JJC B;  4AQY J;  2I9S A;  5E3Q A;  4IG3 A;  1O5J A;  2NXJ A;  3BZQ A;  2JH3 A;  2VJV A;  1HBM B;  1FNO A;  5HN0 A;  1RWW B;  4DSK A;  1KDN A;  4P72 A;  1S9G B;  2HS0 A;  3MCM A;  4FKX A;  1G1X A;  1OPI A;  4C0B A;  3BGU A;  4OJ1 A;  4TYA A;  4PG6 A;  4RNH A;  2V2K A;  2YWK A;  2B8P A;  3S7R A;  1GFW B;  2CPZ A;  2Z56 B;  2DGW A;  5CH7 B;  5E41 A;  2ZE2 B;  2F8H A;  1I6J A;  2CPX A;  4Q2L A;  3VV2 B;  3CXC R;  2EWH A;  4EEY A;  2QLB B;  2RKI A;  3M32 B;  4XO0 A;  2GO9 A;  2DGV A;  4RU9 A;  1YWX A;  2OPQ A;  3UN2 A;  4CH1 A;  3J81 j;  4RW6 A;  3DU6 A;  4AL5 A;  2JNJ A;  2ZH8 A;  2F63 A;  3OL6 A;  4X66 F;  2R7S A;  3QJL A;  1YGY A;  2KG1 A;  2UXB F;  4CDI A;  2KDO A;  1LW0 B;  2VQF J;  3OHB A;  2ATL A;  5CCL A;  5L38 A;  4L6V 3;  2YNI B;  3ULH A;  2LDI A;  3KK3 A;  5KT4 A;  3B6B A;  1TKZ A;  2JC0 A;  4OYM A;  4BCA A;  5D3G A;  1SQE A;  3PIP Q;  1C1B B;  4ZCM A;  2F3J A;  3G8Q A;  3OXF A;  2K8G A;  3VAL A;  2EVZ A;  1NK0 A;  1UVN A;  4LSN B;  3T1H J;  2JOQ A;  4NA2 A;  3TNV A;  4RW9 A;  1XMQ F;  1HMV A;  4MMO A;  1MMN A;  3GE9 A;  3OR2 B;  2W9B A;  3W66 A;  2V50 A;  2HZC A;  3IWN C;  2QJ3 A;  2ZHA A;  2GMH A;  4ZK7 M;  1SCJ B;  5B0G A;  3IG1 A;  4ZJL A;  4TY9 A;  3BQ2 A;  3R7N B;  1VQ8 S;  1XEZ A;  3M8W A;  2W7A A;  1LWE A;  3GIM A;  2LU1 A;  1JXL A;  2FHK A;  3C6T A;  3K2Y A;  4OI0 A;  3NL0 A;  2B5J A;  1VRT A;  3KG4 A;  2QLX A;  3Q83 A;  3W65 A;  3EXC X;  2IM3 A;  1XC9 A;  5A8W B;  2JDJ A;  1SC3 B;  2BJ3 A;  2ZH3 A;  1HD1 A;  3C19 A;  2M0G B;  3GG0 A;  5C24 A;  4X4Q A; 
#chains in the Genus database with same CATH homology
 4UZC A;  2YQ1 A;  4K2J A;  4BLG A;  2YPZ A;  2YQ0 A;  1B3T A;  4UZB A;  1VHI A;  2YPY A;  5A76 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...