4UZCA

Kshv lana (orf73) c-terminal domain, spiral: hexagonal crystal form
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
134
structure length
134
Chain Sequence
YQQPPVPYRQIDDCPAKARPQHIFYRRFLGKDGRRDPKCQWKFAVIFWGNDPYGLKKLSQAFQFGGVKAGPVSCLPHPGPDQSPITYCVYVYCQNKDTSKKVQMARLAWEASHPLAGNLQSSIVKFKKPLPLTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The 3D Structure of Kaposi Sarcoma Herpesvirus Lana C-Terminal Domain Bound to DNA.
pubmed doi rcsb
source organism Human herpesvirus 8
molecule tags Viral protein
molecule keywords ORF 73
total genus 34
structure length 134
sequence length 134
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-09-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.390 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Epstein Barr virus nuclear antigen-1, DNA-binding domain 4uzcA00
4UZBA 2YQ0A 4BLGA 2YQ1A 2YPYA 4K2JA 4UZCA 1VHIA 5A76A 1B3TA 2YPZA
chains in the Genus database with same CATH superfamily
1KBRA 5KG1A 1HNWF 5F9NA 5GAEI 2R2SA 5GMDA 3IR7B 2FD2A 4LFBJ 4PG4A 1UJ4A 1GXTA 3DLEB 3MM8A 5H1SV 1FNXH 1M5SA 3B8HA 4OHXA 3I56S 1I1GA 3Q0AA 4EYHB 3KHGA 1HKAA 3AA8A 4A46A 1IBLJ 5I42A 3HD2A 2HRUA 1WTFA 4K4ZA 4DV7J 1MN9A 5J2QB 2AJ4A 3MF5A 2XNQA 4OZLA 4XAKA 2FLNA 1NHUA 1J5EF 3I96A 2OEMA 2DY1A 4OX7A 3CVKA 3DXBA 1WF2A 4NA3A 2H1YA 3H5YA 4G3IA 3FQLA 5AE2A 1HW8A 1U4BA 1QSSA 2VG5A 3GIJA 3UNYA 1JMTA 1RLDA 2Q1LA 2HNDA 1DURA 3DLBA 1HWKA 4AL5A 1VISA 3DGPA 1N5SA 5J1PA 3FFIA 4WYLA 1LEOA 4LF4F 3VQSA 3G71S 4P9SA 3ZTRA 5HVGA 2GVZB 2FGOA 2B9EA 2M5YA 2AGQA 2KB2A 3OR1B 5HSPA 4IRDA 2ZBCA 3MM9B 5K5MA 4CLKA 3LP1A 4YS2A 4I6YA 4TYAA 3SI8A 3NY0A 3J7YU 5M2PA 4FP9A 3BPDA 3PHEA 1KQSR 4CNYA 2XZTB 4RW6A 5KG4A 3R1LA 5D4LA 5LMUF 3TQ1A 3GONA 4Q0BA 1HMVA 2CDQA 1R8PA 3GR0A 2WVEA 3MCOA 4URSA 3ZZ0A 2FVPA 4UY8T 3T6JA 4ECSA 2MKKA 3PEHA 3G4SS 3DLGA 4DV6J 3BGLA 4KYZA 4Q43A 5AJ3J 2CUYA 3KXDA 1VK8A 4WTOB 5FIIA 1JK9B 1UAWA 3ISZA 4ANDA 4NRTA 3LP2A 3GJSB 3DGVA 3F73A 2BJDA 1NPPA 1A6LA 1Q7YT 5KFDA 5IT0A 4C3KA 1LW0B 2X1BA 2H5JB 2J9DA 1TAQA 3MM5A 2HFUA 1U09A 2LMIA 2LQ5A 3R7SB 3RAXA 2DO0A 1YJVA 2GVDB 1LWCB 2K1RB 3T3FA 4U9RA 2B4PA 4TU8A 4O3OA 5LSOA 3BPSP 3GE9A 3NMAA 3G9CA 1ICEB 4QW9A 3BS9A 2UVRA 2M9KA 2XY5A 4M5DA 1LFPA 4PEOA 3RU0A 2HBZB 1HPZA 1TP7A 2VF3A 3N79A 3QQCD 2OTLS 4V19X 4X64F 2KI2A 2YKPA 2ZH4A 1VQMS 1WHVA 4WE1A 1U1LA 5AJ3F 2DNKA 4ENOA 1S1WA 4DF8A 4C8ZA 1L3TA 4F3MA 1CJUA 4U8VA 3S8SA 3QYYA 1T9WA 2JC0A 1NPKA 1K73T 1V3SA 1BGXT 4UY85 1LWCA 2DR9A 1WKJA 1VLOA 1WC5A 1RT7B 3OD2A 2KFNA 4FPIA 3OQ2A 1NRKA 4E8UA 3DRSB 5A8KA 3R6GB 3Q23A 3PW7A 1NZ8A 5KFGA 4NPOA 4ZIVA 5D78A 3RB4A 2WW8A 3W1YC 4LRAA 3CJ4A 1IKXA 1FFGB 2EW9A 3OFGA 4PWDA 1JNZB 1UETA 3EGNA 4XDCA 3KJNB 4UOCA 1ZPWX 2VPYB 4KKOB 4ZLNA 2B6AA 5KFXA 4ZVFA 3AD9C 4F04B 2XMAA 1KVIA 2R7TA 1KKHA 5J2MA 4FF4A 4ECZA 1MMLA 4RW7A 2RUGA 4F26A 4ZKAA 4ELUA 2OP5A 2DCUB 3F44A 4KO0A 1X4HA 4O44A 3VGSA 2EBEA 3CDAA 4I68A 2IJRA 2P6SA 3BEGB 1BQNA 4M5DB 4DBQA 1RWPB 1WC1A 3O3LA 1FE4A 4LRCA 3IRXB 2CXEA 2EC2A 2DNGA 3HDSA 4LVOP 1R6YA 2VPZB 4ZVGA 4J9LA 4DR3F 2BQRA 2AZ3A 4KHMA 5KFYA 3VAIA 2KT3A 2V34A 4PWUA 4QBUA 3DRXA 3IM9A 3MM5B 1MWZA 1KQGB 2KXHA 3A8EA 4CQ1A 3KUEA 2EPIA 3BGOP 3F41A 1BQMA 1KLMA 3I82A 5E2QA 2MQPA 1JNRB 5SZTA 2IC3B 3FJ2A 1IKVB 1SH2A 3Q8YA 3LO3A 2XWXA 2W9CA 4DQRA 4NXMJ 3K0JA 1T05B 5E7OB 1F1BB 1UJ6A 4X84A 1K0VA 2VDIA 4PG7A 2BW2A 4K8RA 3W2VB 1X4AA 4GKJF 2XWYA 1U1KA 2PA3A 3W65A 2D74B 2R2TA 3BKUA 1U47A 1SC6A 1VJWA 2N4DA 1BQNB 4ZCIA 4ZLLA 1R7IA 3AOCA 4ECWA 4JI3F 1WDDA 4LSLB 3BYRA 3IC1A 5U47A 4CWBA 3SSSA 4CLLA 2J7WA 1EP4B 1FRXA 3CE8A 1JQGA 3T6BA 3AT1B 3NS6A 3ZZZA 1VC6A 4QYZJ 1CC8A 2CQ2A 2H51B 2GHWA 2RB7A 5KFVA 3ZNJ1 1RT5A 2O01C 3POTA 4LBHA 4PG8A 2Z2ZA 4HEA9 2DXDA 2XEXA 3LP1B 3UQSA 2EFOA 3AA9A 3OR1A 1RU1A 2RDDA 5HMWA 2ZUAA 4DEZA 4EWTA 5K8PA 4K4YA 2CQHA 4RX6A 2ROPA 3UWTA 3BGRB 2XB2D 2D3UA 1KFDA 3NXZA 3HI9A 2ZH5A 2OELA 4YB5A 3CCMS 4LSLA 4ES3A 1SQEA 4DUTA 4LQ3A 3D6TB 4DV5F 1WSVA 4L76A 3T9ZA 3GIKA 1VQKS 3CTRA 4OYIA 2MXYA 4ID8A 3EGZA 2ZKUA 3MPUB 2AEJA 3QMQA 3EGWB 1I5OB 3CDBA 1YX2A 2LEPA 2VG5B 3IBFB 3NOGA 2JLFA 4C8MA 3TAPA 4DS5A 3CJ2A 2B51A 4DJBA 2B4OA 1J27A 2XCPA 1J2VA 3C6UB 1NEEA 3BKFA 2WCXA 3MTJA 4JYAJ 2GHPA 2LVWA 5HP1B 3V6KA 1D9FA 1HPZB 2C1EB 4NYPA 2DGTA 2L9DA 3R5GA 3J7YI 2LEBA 3CCWA 3N6NA 2YNIB 2XYHB 2EWHA 2G9OA 4ZHRA 1JIHA 1R8CA 4JBCA 5HQMA 5I3QA 3HHDA 3V81A 3ET6A 5KFRA 1R27B 1W25A 3DLEA 3MM8B 3GR1A 3GQCA 2E5LJ 4ZJOA 2MQQA 4LF9F 4AXIA 3HJFA 1H7XA 2RQKA 1DLOA 3KG0A 1TQLA 2E5IA 3IMQJ 5KT4A 2V6AA 2HMIB 3VGUA 2VG6A 3CIMA 1NHVA 2GW8A 2YNGA 5J2NB 4UT4A 3H25A 2E9RX 1K1SA 4KV8A 3VAMA 4Q8EA 4I0WA 4RR5A 1TL7A 5J2MB 3MAHA 3EYZA 2Y8YA 2AJQA 2RH3A 4HLBA 2KXFA 2ZC4A 3IA0A 2FZKB 5A8RA 3H40A 1SKSA 4ZP7A 5C25B 5B08A 3G6VA 1D1UA 3NGSA 3MD1A 3OTDA 5KTQA 1TL7B 3IAM9 3BN4A 4ZVUB 3CCZA 4MAKA 4P10A 2FJDB 2LDIA 2PA8D 2VC1A 2ZDOA 1V3ZA 5ITHA 2C42A 2MKYA 1HMVB 2QO3A 1FHTA 4OHWA 2HMIA 2Y1JA 4DCJB 1HNVA 2AWZA 2ZWPA 4F7VA 1RAGB 3FSXA 1KN6A 2CPJA 1F6TA 2MZ1A 4NLRA 1N8RT 1M1HA 3SEOA 2ZH2A 2G1HA 5ETQA 2ZZNA 1NPRA 1UWBB 1VBZA 5L1KA 1EP4A 2N7CA 2PIIA 4EYIB 1TFWA 1CLFA 5DM6Q 1S7HA 2HQCA 2DEJA 1DARA 3LW5C 2RRNA 1RADB 4C11B 3DGPB 5F8GA 3G82A 3J7AN 3OBIA 3TA0A 2Z2MA 5C42A 4MIAA 3D4JA 3HSGA 4A47A 4FS1A 4AL6A 3FK4A 4IDKA 3BJYA 2GVDA 2HNYB 2QMWA 2NXNA 3KDOA 1G3OA 2HGLA 2OHDA 5DQGA 3CD0A 3D5MA 2CNLB 2NXCA 3WDOA 2VDHA 3V6DA 3TAQA 1TKTB 2ZH3A 1WDTA 2J0SD 1IUJA 2VOPA 2GQ2A 3EUNA 3JTPA 1RTHA 1SC4B 5KG0A 1H7WA 2E1MC 4TKTA 3OLAA 4K50A 1GFWB 1LW2A 4ZPCA 2V2KA 1RYRA 1RTDA 2YQ1A 4LF2A 1M5VC 2QFIA 3R5JB 4BWMA 3M9MB 2RE1A 1JKHB 4B3SJ 2IFXA 2E9TA 2YWGA 1FO1A 1BMQB 4X4TA 3RBEA 1VBXA 3DLJA 4YB6A 4WWSA 4M95A 4QIVA 2QA4S 4FXVA 3D28A 4Q0BB 4LRFA 4M63A 2I9SA 3N6MA 4GVLA 5EDWA 2VC0A 4ZPTR 1RACB 4R25A 2O3DA 4RZRA 1WEZA 2JHEA 5GADU 3PJWA 2VPXB 1BXNA 2Z2LA 4ZCKA 2DGVA 1WC4A 3H59A 3H5SA 5ETOA 5HJYA 4ZP6A 5FLXU 3T1HF 1TELA 1EAYC 5IOLA 1YJ9S 5F8NA 1RAJA 4ICLA 2CPEA 2F4FA 2NSBA 4NLSA 4X4VA 1K44A 2DIUA 3K59A 2XCAA 2OTJS 3A12A 3IFEA 3QT7A 3MFIA 4DSIA 4YB1P 4RL1A 3BSCA 1KEKA 3TARA 5CXTA 2H5EA 4TNOA 2JEGA 2RMLA 3M6WA 3GV7B 3IRWP 3DYAB 4AFFA 5GAHI 8RUCA 1JJCB 3TZYA 2JJ4D 4B3MF 2YXLA 1Q5YA 3EDRB 2OD6A 1EKRA 1T11A 3DOLA 1TVRA 3DM2A 3M8PA 2HWIA 5FDLA 4CO2A 5KOWA 2OPSA 4PYAA 3HKWA 3HZGA 4N8NA 3TEGA 5T7LA 3DMJA 3ENVA 3PRBA 1RWOB 1SXLA 3UCUP 4OX8A 2OFHX 1TKXB 1SJ3P 2VPWB 3L7UA 1A0OB 2XYPB 5J2QA 4H54A 2DXEA 3CCSS 3TAMA 1XEZA 5GAGI 4PUOA 2KVIA 4NL5A 2MGZB 5CABA 1WKKA 2D7SA 2DHSA 2B9YA 2DNZA 4NWBA 3HSJA 2YX1A 4PG6A 4XDDA 4DMZA 1TK0A 4OHYA 1O5JA 3PM9A 4IYQA 4JI8F 3KUGA 4NEZA 1IKXB 1V9OA 2RNEA 4O3PA 2CJBA 5LMNJ 1X0FA 2HRYA 3DDNA 4OIXA 1JLFA 3D6FB 3M32B 2UVWA 5CCLA 2MJUA 4MFBA 3PEJA 4BWJA 5DRKA 3HHKA 1HQEB 1CSJA 2OEJA 1RXOB 3RR7A 5IV4A 2M7SA 3GSDA 3NS5A 3WHIA 5IM0A 4QWAA 3UW1A 4NCGB 1D8YA 3AODA 3OSNA 1XNQF 1CJVA 1O6XA 1WEXA 1B4SA 5CQGA 2CZ9A 2HS3A 2P9GA 3FRYA 2Y3YA 5HMZA 5CYQA 1HHTP 2HHUA 1P1TA 2I8EA 3CDWA 5DDOC 4AQYJ 1D3WA 3KHLA 4JV5F 1NNDA 3ITHA 2NR0A 4Q5VA 4K4VA 5I4MA 4ETXA 5J2PA 3CJ8A 4V1Ak 2JEFA 1N32J 1FJ7A 1CEZA 4A8SA 3T41A 4HI2A 2IJFA 1FF2A 4CDIA 4C2MA 2PSZA 2K1RA 4DXLA 4BDPA 5HVFA 4CO0A 1IWAA 2BX6A 4EBDA 3Q8VA 3OR2A 4OZNA 1XC9A 2PFFB 1B0PA 2DRDA 4DL7A 2VIHA 1Y5NB 3MUVP 5I3PA 2BANB 3PDNA 3MPWA 4HVZA 4PYDA 3HHLA 4JV2A 4KAIA 3PR4A 1FWKA 4G1IA 3WX4A 2BJEA 2IM3A 3M30B 4KGVB 1QY7A 3T5KA 3FBBA 4OYZA 4MIWA 2V94A 1TV6B 2GGPA 5KFEA 4WKRA 1I3OB 4ED5A 2W4CA 5IS2A 2XO6A 1YBTA 2QLBB 4DUYF 2JC1A 2GQCA 1REVA 1F9FA 2BKNA 3PRDA 4RLEA 5HJXA 3MAAA 5LSRA 4ED4A 3VCDA 4AT1B 4GMKA 1X9WA 5D0GA 3TJ9A 5DG9A 3GIRA 2R7WA 1GEHA 1M0SA 4KTQA 2IA0A 2WHOA 4DPUA 1CJVB 1O8BA 3D3CJ 1S4EA 1S49A 2PFDA 2VJUA 4ILLA 1ACMB 3GMGA 2YTCA 1VRUB 3O5TB 3RB0A 4HH1A 2OAUA 3MM9A 4LF1A 4KH0B 1WHYA 5BR8J 1R43A 2C2OB 4LBIA 1HQEA 4QIGA 4OZ1A 5DQHA 1N56A 2L9WA 2HHQA 4DUZJ 1N54B 1U1NA 4FF3A 1FXDA 3IS9B 4M8LA 4KFBA 4RBVA 4DV2F 1IQZA 5HBMB 1U2RA 4QQBA 2DD8S 5KFWA 1KQFB 3EZOA 4PAAA 2HURA 3GP9A 3V4IA 1QVGR 1IJEB 3FZBA 2JOQA 3NL0A 2R2UA 1V5IB 4RW8A 5LXRA 1JLQA 4AXJA 4DV7F 3IBCB 4CLZA 3I9V9 1YJTA 1X5OA 2KJVA 3DI6B 1U0HA 3IGVA 1F5CA 3IP0A 1Q8KA 3JS9A 5HK4A 1Y3JA 2OFGX 3CJ5A 3SDEB 2B56A 4DPXA 4UQGA 4DQQA 4DL2A 4LF8J 2MZJA 3DOLB 3CB4A 2M52A 4KGZB 2RU9A 4E0DA 2KO1A 4HT7A 3KLVA 3C2PA 3OV7A 3AY0A 5GMKa 2VQFF 1IBKJ 1SV5B 5T14A 3PKYA 4LSZB 2POKA 5L8RC 4JI0F 3W5XA 4CP5A 2GMHA 1RAIB 4HDHA 3GU0A 2F40A 2IRXA 1QE1B 2IDLA 2NREA 1NB2A 3GCWP 4DFJA 2GIFA 1J5EJ 2CQGA 2J9EA 2L9NA 2VZ9A 1C1CA 4DG1B 4DCOB 2JSXA 5F3TA 2R7SA 2N4CA 3QGHA 1VRQC 2MHNA 4RW8B 1SJ1A 2WK4A 5B0AA 2AYGA 2KRRA 2NCKL 5B0EA 4PXDA 4NZ6A 2P9CA 1BUXA 4R0EA 1T0TV 2MSTA 2RSQA 3FZ2A 4KE5A 4XTTA 1NK6A 2CPIA 2EG1A 4ZVSB 1VQLS 2R8HA 4X4QA 2GNKA 4P7TA 2GX8A 3GYXB 4WF9Q 1Q1KA 1C2PA 4ZP8A 2V2ZA 3OL8A 2VFTA 1OY6A 3EE3A 4LUBA 4NASA 4UOGA 3KNAA 1JLGB 2FPHX 4MT1A 4Y6IA 5A0YA 2BRKA 5L38A 5LOQA 3DRYA 2XI2A 4J9OA 2DVIA 3PY8A 4PABA 3TQEA 1WC6A 1HR0J 4Y2MA 2XMWA 5JVHQ 1NBEB 1LW2B 2M70A 3RW6A 4CO5A 2RAQA 4C7QA 3K5NA 4OZ3A 3LGNA 3UR3C 3PW5A 2VG7B 3GLJA 5DDPC 3BSNA 2OKQA 1HI1A 5HROB 3PYEA 2ZHAA 2XZWA 3D0GE 3K7RA 3AQOA 5KFMA 2K7KA 3OJSA 1MWYA 3QGPA 4ZVHA 5DQIA 1HWIA 3H20A 5KT7A 1SC3B 4Z7CA 3WC2A 3FCVA 2KKHA 4OFZA 1U1MA 4F8RA 2VBXA 2HVZA 2ZDPA 4NLQA 1P6TA 4CT8A 1X5TA 3BGUA 5GAHU 4XPEA 3MAQA 2ACMA 5EGYA 2QLXA 3TVKA 1VQ8S 2CVIA 4JI5J 2YNFA 2VU5A 2X7IA 4DV0F 2Q3PA 3BR9A 4IRKA 1YVFA 3G82B 4R5PB 3CPWR 4ECQA 4MYUA 5L1LA 4OMFG 5F41A 3IO1A 3PKMA 4QW8A 2HQGA 5E3PA 1L3KA 5KT6A 2BJ3A 4HDGA 2RQCA 2C28A 1XMBA 3HT0A 3RBZA 3KK3B 5D0HA 2QLFB 5B0DA 2XI3A 2YY3A 4AL7A 1K1QA 2KZZA 2RVJA 1SJRA 5GADI 3CCES 2L08A 1JXLA 1DQ9A 1NMEB 1Q79A 3FEXB 2ZBPA 1HNXJ 2A18A 3FDSA 3O44A 1C4AA 2BV3A 1CC7A 4DPOA 1ZTWA 1JLGA 3E2EA 2GMLA 2OH2A 2IY5B 5D8HB 1RT1B 3V2UC 3TW0A 4LF7J 3T5LA 3VZHA 1AFIA 4YY3J 1W2IA 1IBMF 5E3AA 1REVB 3CMQA 5F0UA 2LLZA 4EO8A 3OUYA 4NEYA 3TUZC 2C22A 4KGKA 3EXYA 2K7JA 2ADCA 1RA6A 2YKMB 4JB8B 4C8KA 4B3TF 1QSLA 2HHHF 4OLPA 4DOZA 4CM2A 2LP4A 2HAIA 2OPRB 1ZOTA 3D3BJ 4MK7A 2FHMA 2UP1A 2QN6B 1P1LA 1RWXB 1SQGA 2DEIA 2RQMA 3CO9A 1NJWA 4CLPA 4RBUA 4RUBA 2ZZMA 2CJAA 3FCWA 2M88A 1Y5IB 2QIFA 2PO4A 1DRZA 1ZYQA 4PQUA 1WNEA 3G8QA 1SUQA 1VS3A 2HVEA 3KHRA 2KL8A 2X51A 4ED0A 5A2QY 4QYZK 4NZ0A 2UXBF 1FE0A 3OL7A 3I87A 3QRQA 1FRHA 4DV3F 1RDRA 2D1CA 2V4RA 2AHOB 4FYYB 4KSEB 3SBMA 2KG0A 4Y28C 5DJBA 2RU3A 3DI6A 2WVDA 3C6UA 3AHPA 3KLGB 3D6MB 1YRTA 2HWHA 2P6TA 1TVRB 4FYXB 3TOQA 3HVRA 1XIQA 2J7UA 3MEGA 4QYRA 3TYTA 3EXCX 2FJVA 3BBBA 2RILA 1S6OA 3W62A 1D9DA 2VA3A 2HVHA 1KONA 5KFFA 1BC6A 1A7GE 2DNYA 2HFVA 4RNHA 5HLFA 1JXVA 5KFKA 3G8TA 5A0YB 4LSNB 4BC9A 3EGVA 5F9LA 1ZAXA 5K9FA 2K06A 4W4MA 3DN9A 4Y2IA 5LJ5Y 1TFYA 1PAUB 3FEZA 3MCMA 1EKSA 4IOAQ 1N5QA 4WXOA 3W63A 1HBMA 3A13A 4F36A 3Q8PB 1VDHA 1VQ9S 4C0HA 1GTEA 4LF9J 1CVJA 3PACA 1Q8IA 3KMSA 4ECXA 1WHXA 1RT5B 1GAOA 2PE8A 3POTB 1CG2A 4ZCLA 3RAMA 1PYSB 2NQPA 2K2PA 3R7NB 3T5HA 4RUCA 5B0GA 3TWZA 2HK3A 1WTBA 5JMNA 3ILOA 2DH8A 4RWXA 2BJ1A 2IIHA 2MLXA 3M4XA 5ADZA 4P6QA 2R4FA 1UZHA 4DFMA 1LV5A 2HYIB 3QJPA 2E1PA 2KTQA 4DL6A 5HAOA 3QT6A 1S6QB 2J6UA 4I67A 4NLGA 2DNHA 4B17A 1YK9A 2ZEJA 3PYDA 3GCXP 3LQVA 2X3GA 4I2PB 3MUTP 1CULB 1T94A 3LANA 3PXGa 3J7ZT 3IGNA 4H4KC 1FA0A 1NK0A 2VV5A 4YOEA 2ZKTA 3RGIA 3HFKA 3SCIE 1S10A 2B8QA 4IO1A 2I2YA 4JI3J 2LU2A 1ZM2A 3HVWA 4FS2A 2IC3A 4NXNF 1RWUA 2IVMA 5A8WA 4DPTA 2VBYA 2PMHA 1QSYA 4RO0A 4RPFA 3R9LA 4JV5J 3NWGA 4NA1A 2ASLA 4A8FA 2IVYA 5K14B 1APSA 2AYMA 3E01A 1JLQB 3CIZA 3HFZB 4DQIA 3NGKA 3GYGA 1SPBP 3AJ1A 5LM7E 2W25A 3EZ5A 2AYEA 1GMUA 2F5GA 3LP0B 1LXNA 2D3ZA 5J2PB 1UFWA 5HBMA 2UUWA 4OJ3A 2AJ1A 2ATLA 4AUKA 2NLWA 2WBMA 3EDQB 4KO0B 4RUAA 1URNA 4K0KF 2DGWA 1IBMJ 1IKYB 3GFYA 4BLGA 3MR7A 1N33J 3BH6B 4TY8B 2CQ4A 2DHAA 3BDEA 2W4DA 1NUEA 2NPFA 1HHSA 3QGIA 1HBOA 2B5JB 3BZQA 2V67A 3BO2A 5H9EJ 4QU6A 5IM0B 1VRUA 1Y9OA 3LGHA 5AXLA 3OFFA 3N5FA 3DLKA 2RHQB 3SV4A 1F9EB 1CBKA 2FHJA 4KBIA 2YWHA 2W9BB 2JLEA 1DQ8A 4F4XA 2NPIA 4DL5A 2B3TB 4ZJQA 3CJ3A 4FBTA 1N34F 4N8OA 1PC4A 4Q2MA 2MKSA 4USJC 3R1HA 4WCEQ 2IDEA 1RA7A 2BKOA 2MSSA 3WQPA 2PD1A 4E2FB 3MHYA 1ZM4A 1JLBA 2F1FA 3ICLA 2D3OR 1NDKA 2BXJA 1KOOA 1HBNB 2KVQE 3ILJA 3QWPA 4F25A 5DETA 1W7WA 3CEDA 4X65J 2GGPB 4DR2J 4LF6J 2WAQD 1FRIA 1K47A 1PYOB 3FUYA 3NAIA 2A10A 2DCLA 2H5IB 2PDAA 2EK6A 3BBCA 3CCLS 4YB7A 3NGTA 2YNHA 4DDFA 1U1QA 4B02A 2CNOB 4Q44A 2R8IA 1R6VA 9ATCB 3AD8C 2GQQA 4USUA 3I9ZA 2GMJA 4A8YA 2JEIA 2FJBB 4P71A 3J80Y 2FLPA 1NJZA 3P4UB 4Y3CA 3AOAA 4ZPBA 2RS8A 1T8EA 1H2TZ 1GXLA 3AJDA 3R2DJ 1FT8A 5H9FK 4DLEA 2BW7A 2UXBJ 1RBLA 2ZOFA 3H98A 4ECVA 4K5SA 3UPFA 2V68A 2FLOA 4UOHA 4KIAA 1IKWA 2PMZD 1Q82T 3OVBA 1RAOA 3MR5A 5G0RB 4F67A 4X4SA 3A3NB 6FDRA 2YPYA 4NX9A 1ZETA 4JV1A 1M1GA 4HHJA 1VBYA 2AZ1A 2HLUA 1IWGA 4HL9A 4WU2A 5KFSA 3UDEA 2UUTA 3TI0A 1S7IA 2VH7A 4FDFA 2PT0A 1FJGF 2Q6CA 4DR2F 4GRSA 1FXRA 1X4EA 2QMUB 4G65A 3UR0A 1S1XB 4DV4F 2JFKA 2VD3A 1HLWA 3NRBA 3M8RA 3W7BA 1TL4A 2YNGB 4EGLA 5KFBA 1NDCA 3MD3A 3JSRA 1ZAVA 3IR6B 4O23A 3KLFB 2FHOB 4DV2J 1RWWB 4IR1A 4ETZA 2ZVIA 1U0SA 2VASA 3DKDA 2IJNA 2FY8A 3QFWA 3M8ZA 4UW2A 5AXNA 3I0RB 3M7VA 3IAS9 2C3PA 5IT9Y 1PO6A 2CPHA 4G1QA 2G1DA 3PJXA 5CZXA 2P5VA 5C24A 3M2RB 2C2NA 1UEVA 2V4JB 1SL0A 4HACA 3VWSA 2GVZA 5CAAA 1S97A 1PIEA 1CQNA 5LMUJ 1T03A 3H90A 5B0CA 2H4WB 9RUBA 1J5OB 4F4ZA 3QWUA 5T7LB 1R8HA 4EBEA 5D0EA 1V3RA 2Z30B 2DNLA 1TL5A 1YSJA 4LBPA 4CRJA 4OLOA 1OY8A 2KYXA 4NMLA 4NLUA 2VQFJ 1IBKF 2XGQA 1HR0F 2F9DA 3AB2B 4J9VA 2QT7A 5IWAJ 3M2VA 4ZOSA 1G7CB 3UE2A 3VVTA 5IT4A 4WFAQ 2QA2A 4JV0A 3AXKA 2HS0A 2R2RA 1WSRA 1XWLA 3OXFA 3DRPA 3QFHA 4RW4A 3TUJC 2WONB 1U1PA 4IQXA 2XSJB 2IHR1 3BGRA 4IG3A 3JSMB 1ZZNA 1NJYA 4USWA 3HO1A 3MR2A 4CLWA 4H4OB 4USTA 3SQOP 3C46A 4J9UE 1SIZA 5IC4B 3W66A 3CCVS 3SXLA 4RUHA 1C0UA 2I0XA 2G4BA 1FXLA 2WTFA 4C9DA 3NG8A 4LFAF 2YH0A 3LWLA 5L1IA 2KN4A 3DRRA 4GVBA 3UD3P 3PFEA 1FK9A 1S1UB 2WB1D 4PRFA 1XMQJ 4O44B 1FTRA 2B0GA 2Q43A 1FTCA 2CG4A 4MKYA 3J7A1 3N6LA 1YJRA 5HMYA 4RW9A 1RT6A 3K17A 5KFCA 3MZIA 1N5VA 3O2IA 4N7TA 3GFZA 3SSRA 2CNNB 1VR6A 4QPXA 4KKOA 1Y4ZB 3G6ES 2ZWOA 1F0XA 5ETMA 1F9HA 1PCAA 2Y1RI 1HD1A 2F65A 2A1BA 1VIOA 1RHRB 3VGVA 2VUGA 1SI9A 3PYGA 3UCGA 3CMAS 4B3OA 4KV8B 1DJ0A 2LKZA 1E6VB 3P3DA 1S0VA 5EUHA 4ZK7M 1S59A 1AA1B 3MDFA 1WOOA 2QSFA 3O1LA 2BDPA 1U2CA 2YKQA 4JUZA 2W7OA 3DRPB 4M5MA 1NSQA 3JQKA 3SCJE 5H9EK 2OI2A 3JXOA 4Q2LA 2XZDB 2AX0A 3GYNA 3KLHB 1KHVA 1NDLA 2MYFA 2R7QA 5MAOA 4JI8J 4ZN1A 4EI2A 1RHKB 1TUWA 4NLOA 5E0OA 1H2VZ 2IAJA 3W2WB 2XM3A 4CH0S 1RWNB 3EM1A 2AJ2A 2AKWB 2XMKA 3M9OB 5HP1A 2BJ9A 3MPVA 5CHCB 5AXMA 4EUVA 5CD4H 3QSIA 2F8EX 1ZA2B 2C2MB 3A3OB 1JLEB 1WOPA 3CCUS 1T03B 1RCXB 1NSKL 1X7VA 4Y34A 2B6AB 1U6FA 2R9LA 1X4GA 3N4WA 2RHSB 3TA2A 4A8MP 3T1YJ 1KC8T 3HVAA 2HEKA 2JVOA 1RT3B 3Q2SC 1IBCB 2DTJA 2OMLA 4J7CA 3OTCA 4JI2F 4DR3J 1L3SA 4JI6J 1LWFA 1T3OA 2R8JA 2FIUA 3HSDA 3QIPA 4RNFA 3L09A 3QIDA 2XULA 1QDUB 2I6WA 2OSRA 5IV3A 3KK1B 5EWEA 4A8KA 1HBUA 3VAFA 2RRAA 4O0NA 1RT7A 1QD1A 2XMUA 2QSWA 4WKYA 3OLBA 3GV5B 1W2BR 1RWKB 3PJ9A 5J1NA 2V9KA 1TK8A 5KFNA 3MPDA 4J90A 1YITS 2XLKA 1OPIA 1WUUA 2R42A 4WE1B 1VCTA 1YGYA 3G86A 3IG1A 2UV8G 2VKZG 3PNIA 4M5JA 4RBTA 3JAMY 4DF4A 2WOMB 3BO4A 1PG5B 2I38A 4FVMA 3IWXA 1Q4RA 4JOUA 5EX0A 5G0RA 3W2WA 4QCLA 4X4UA 2Z2YB 2BA9A 2EFPA 4YUDA 3R97A 3KHHA 1DLOB 2EXUA 2YWFA 2ZBIA 2VKRA 3RJMB 1KNZA 2IM2A 2JDJA 3B82A 4X65F 1C0UB 1M5HA 2NZCA 2VBWA 1NK5A 4FXDA 1ZM9A 1P27B 2HFOA 4TLQA 8ATCB 3PV8A 2BJ7A 3ADAC 2UU9J 5KFLA 2X3DA 1KVKA 4LR7A 1CJTA 3W60A 3PX6A 3CWJA 2XSJA 3HHLD 5F8MA 3M6XA 4DN0A 4DU8A 2OD4A 5DO2A 4OX6A 3OFEA 4RW4B 2DH7A 4DPYA 3RW7A 2Y9HA 1YDLA 1U6BA 1PKUA 1T95A 1B7YB 2H54B 3MEEA 3J80U 1FESA 4I2PA 3HKZD 1A9NB 2BM1A 4I2QB 1P8GA 2Q66A 4B9UA 1PC5A 1RTZA 2FYXA 4OJ1A 3W9HA 3GG1A 7FD1A 2C2DA 1UVMA 2LEAA 2LA6A 2UUAJ 4MMOA 5IQQA 2J6SA 1JJ2R 2PEHA 2ZH9A 4NCBA 3DDIA 4DSKA 7AT1B 2XMVA 1FK9B 1S1UA 2AGPA 2L3MA 1NKBA 2JNJA 1RABB 2VFVA 1UW4A 1TUVA 2W2PP 2YX7A 4HACB 4RW6B 4Y65A 1SKWA 4OX9J 2AJFE 3BF4A 4K4UA 1GX6A 1LXJA 1JJHA 1Q5VA 5KFZA 1LK5A 3SSQA 4F4YA 5DG7A 3HJVA 3KLIB 1YQHA 2FZGB 4PPZA 1FERA 3CC4S 3K57A 4IO9Q 3DDKA 2D3O1 2UU9F 1ZS6A 3OTOJ 1WACA 3TR5A 4ZMMA 1N36F 1U8SA 3PR5B 4OQJA 1HYSA 5HQLA 1OSDA 1R89A 1IN0A 4LSNA 5HN0A 3U02A 4I7FA 2HVDA 1N6QB 2R7VA 3FFIB 3VZIA 4B9LA 2GIRA 2E5GA 7FDRA 4DCPB 2RD5C 1RYSA 1RJJA 2JVRA 3HCXA 1PBUA 4JI0J 2B9WA 3JSBA 3D1OA 2YWKA 1QAIA 2CQ1A 1S1WB 5AXKA 2BBEA 3T1HJ 3PIPQ 1F3VA 4PKDB 3ZO7A 3Q22A 1T05A 2XMTA 3P49B 1HD0A 4ZLJA 3PX4A 2BQ3A 2D41A 1U1OA 1YTYA 5A8WB 1KSPA 1H38A 1VBKA 1KFSA 4ES1A 2V4JA 3T1YF 2DXFA 4TY9A 4OX9F 4ZP9A 2QEXS 3CJRA 3D0IE 2CJKA 2J8AA 3HVTA 2V2QA 2QC3A 1N88A 4I69A 4JI6F 2BM0A 4WP9A 5A6WA 1WG1A 1X8DA 3IRXA 2ABYA 1PSDA 4MK9A 4A4JA 2CADA 1VQ4S 3NCPA 2OJ3A 2R8KA 2RKIB 3OHAA 4XK8C 1NK9A 1HA1A 4PG5A 1FDBA 1JLCA 3NBPA 3R7BB 2ZUGA 5KFOA 2XY6A 3PYFA 3MTKA 3O6QA 3S6EA 4CTAB 4F3OA 4C3LA 3IG1B 3M8WA 4HR2A 4U7CA 4J9RA 4CLUA 4OJGA 3Q8RB 3OHBA 3KJVB 1HNIA 2CDRB 3V4MA 1GTHA 1VJQA 4M94A 3W8GA 1HBNA 4QOTA 2A0FB 5D77A 3KLEB 4X62F 3MECB 1ZBTA 3TA1A 4JI2J 3FNNA 4ELTA 1OIAA 1X31C 3DLGB 1EZZB 3C19A 4HTIA 2FVCA 4LRDA 2HFNA 1K9MT 4PWDB 3N28A 3PHTA 4N77A 1Z2ZA 4TQRA 5BXIA 5IZHA 4QIEA 1YJWS 1KTQA 3I0SB 1NXIA 5E3CA 5ETVA 2MJNA 3AAWB 1HQUB 3AXMA 3QIPB 5ETNA 4DHVA 1T3NA 3EICA 3R3TA 2YWWA 1P9QC 3LTOA 4URQU 2UXCJ 1RTIA 1YJ7A 3CT9A 3U1LA 2FJWA 2UUCF 4F4KA 4OZ5A 4YN3B 4MKBA 4O3QA 4JI4J 2OUGA 1HBOB 2B5JA 2LDYA 1IQTA 1C4CA 1VQNS 3KK3A 4C4WA 3G6XA 2KT5A 2QL7B 1XQIA 2J0QD 4PXCA 3B6BA 3BR8A 2LQ9A 1FX4A 4ID5B 3VR1A 3NNAA 3J81j 3OTEA 2PGCA 5B0FA 1H2UX 4H4MA 3IM8A 1BHNA 2EKYA 3C66A 1TR0A 3P45B 1CQMA 1NU4A 1QAXA 3TNVA 3MFHA 4CO1A 1UVKA 2DISA 1JLBB 1YKWA 4IH5A 4ES2A 2IMOA 2V5HG 4FPRA 2CIMA 2DNPA 3WBZA 1UVLA 1LOUA 3MI7X 4WFBQ 2U1AA 4A8OA 1NK4A 2IYGA 3BV8A 5D0RA 2W7PA 1N52B 4RNNA 4YY3F 3IR5B 4FYDA 2LCWA 1GH8A 1VYAA 3ZTQA 4M5IA 2LXFA 2ASYA 4CZCA 4OYPA 1OO0B 3D0HE 5HO4A 1FJGJ 1MMNA 4I56A 1X4BA 3FRZA 3M2UA 3JTNA 2DGQA 2YKAA 4G6VB 4JI7F 5RUBA 2HHHJ 3OPKA 2Z56B 4KHPF 5C5JA 4QR2A 1ZA1B 2Z58B 4B3MJ 4I64A 1MROB 3X1LB 1WORA 4IG0A 3QAEA 1VC5A 4KPYA 3VAJA 4DR7J 4K4TA 5LL6d 5SUHA 2XQCA 3CGIA 4A8XA 4O0IA 3HXMA 1HW9A 1UTAA 3KYLA 2VICA 2B9XA 1YZ7A 2RF2B 4AD6A 3PVXA 2EK1A 3ULHA 4KGMA 4IFYB 2KRBA 1LQ9A 3LPEA 4NLPA 4USHA 2HG4A 2DGOA 3ISND 3P6YC 2KDOA 4OYAA 1B70B 3THPA 2HW3A 2GAGC 4ANEA 5LXYA 2MLYA 3GTYX 1T9YA 1AT1B 3NWRA 4HHUA 4C0BA 1KRPA 3UDLA 1I6JA 3TO8A 4IG3B 3QT5A 3G96A 3TUPA 1JLAB 5JJBA 2KXNB 2EVZA 1FNOA 3K5LA 1S9EB 2CPDA 4CO4A 3FMBA 2KJWA 4IFVB 1Y00A 3CJKB 2O67A 1CULA 2F8MA 3I5BA 4QWCA 2HLTA 4ZS6A 2XLIA 3GSIA 1KHWA 1RISA 2F8HA 4K5RA 4OYOA 4P2FA 2AD9A 4W92B 4QR1A 3J81Y 3C14A 4NE9C 3UD4P 1FKOB 5K20B 2M8DB 2AJ0A 3VGTA 1N5YA 4LF5J 3HF5A 4CT9A 4DR1J 2DRAA 3G87A 1FKPB 4FYVB 1L3UA 4DWIA 1VGYA 2DNMA 4DI6A 1LWEB 3TRGA 4ED6A 3C6TB 1MW7A 2PMWA 3NNHA 1MMDA 4WK3A 5M2RA 3K89A 4UZCA 4NLDA 3T1AA 3LAMA 5KG5A 1KR4A 1MU2B 2FB0A 2IYIA 5HL7Q 2SXLA 1UFLA 2WSCC 4CLYA 4B9SA 2RIJA 4B3RJ 2MQMA 1N4LA 3ZFVA 1HARA 4X64J 1AXQA 4IQMA 2BZ2A 2OPPA 3VAHA 3HT3A 4NLVA 4O4GB 4U95A 1IVZA 4OV1A 1Q86T 2LECA 2HBQB 1EETB 2BACA 4F50A 2EEYA 1EB0A 1D09B 2HS4A 1Q53A 2ZBQA 3C6TA 3GJTB 4KQZA 3FSIA 1TKDA 2KZMA 4ZVEA 1F2GA 2C2RA 1FKPA 2KYZA 4AE5A 4J9PA 1OY9A 2V8VA 3FSYA 3TJ8A 2JLGA 1VOMA 2V50A 3MMBB 3QLHA 5DZ6A 4XPCA 5L39A 3QAUA 1FNMA 1Q8BA 2B4UA 2LYVA 3G2XA 1T02A 1VHIA 2DYAA 3I4PA 3A4TA 4IG0B 4PR6A 1XNRJ 1CS4B 2CVEA 4ZVPB 2ZH8A 3BQ0A 3ZTOA 3CC2S 4N56A 1NO8A 2J7KA 2IBKA 1GQEA 1S9EA 4FNHA 1B7FA 2Z57B 4BC7A 3K5MA 2MTLA 2PN6A 1JLAA 3HHNB 3UO0A 3HHLB 2YQ0A 2BE9B 3EVOA 4GC6A 1RAAB 2BANA 2ZBRA 4K7QA 3UDVA 4LIRA 5LJ3Y 4GKKF 1R8BA 2YNHB 3M6VA 5GAEU 1WF1A 3D54A 3BM7A 4FN5A 4DS4A 2LQJA 4P72A 4CLFA 2J76E 2CG8A 4YDXA 2QJ3A 4ER8A 2E5HA 3CJQA 2ILYA 4ED2A 2DHGA 2CAJA 2LXUA 4WYWA 5DDQC 1H72C 4WIIA 5BJRA 1HI8A 4YP3A 1IR1A 2CJXB 3NP5A 1FFWB 2CZ4A 2WSEC 4AYBD 2E7WA 1RBAA 3NGUA 8AT1B 2HHXA 1AUSL 3MCNA 5JVGQ 3FEYB 5F3ZA 4LF5F 1PGZA 4CLSA 2DR5A 3MR6A 2A2CA 1ZPVA 2ZHBA 1YIJS 1PJ6A 4I6AA 2FLLA 3MURP 3NCQA 4KGXB 4QPTA 1HFEL 4QZVB 1K8AT 2QG9B 1HWJA 3WZ0A 1CJKA 2AQ4A 4ALZA 2KHCA 3TANA 3Q86A 4JI7J 2VODA 3QO9B 2Y0SD 3AFGA 4OZ2A 2QFJA 1ZAWA 4D3GA 3MR3A 2DHXA 1Q16B 3UN2A 5KFPA 1UKUA 1QAJA 1YWXA 4TU9A 4OI0A 4JYAF 1IKYA 4QWBA 3LGMA 3OXLA 1AROP 5HATA 1SJQA 1MG7A 3Q83A 1I94F 4R5PA 1HNZJ 5K8MA 3C16A 2MY8A 1IM6A 2YNFB 2B4VA 3TVYA 4DX5A 1SJ4P 4F0MA 1RHUB 3H42A 4LT6A 2R7RA 2E5LF 1U48A 3M6UA 3SQGA 5KG6A 1UZDA 3UN3A 5EHHA 3KJVA 2HQIA 4PXEA 1YBUA 3VAKA 5CYMB 3MMAB 2ALYB 3DMJB 3P5TL 4KH1B 4EU0A 1S0NA 3VVUA 3K2YA 5EWFA 3OT9A 4LRBA 2ZH7A 2MZTA 1M90T 2GJFA 4ECYA 1UVIA 2UV8A 3N5BA 5BR8F 2MZQA 1M1KT 4WFNQ 3IN5A 1U45A 4JP8A 1ULRA 1Y10A 2EBGA 2H3EB 4IH7A 4UUXA 2JRSA 4ZLPA 4F02A 1RU2A 3JTOA 2V4QA 2W8LA 1U02A 1S9GB 3SFUA 3CD6S 3MM7A 2C3UA 2BEFA 4CO3A 4N5SA 2UVUA 1C1BB 3MECA 3D1QA 2KHDA 3F0NA 1R0CB 3I32A 2W2OP 2EG2A 4OI6A 2IBOA 2ZFHA 3ETMA 4H4KA 4U7UK 2FC8A 2RF2A 1Y11A 2FZCB 3I5CA 4EEYA 4O4GA 3CF5Q 3IWNC 2HAFA 1C0TA 5LT5A 3FCHA 2XGPA 2FHJD 4ED8A 3ZZTA 1MROA 1UVJA 4OZJA 1GT8A 4MKAA 4L75A 2IA6A 2ZNZA 3PO4A 1WEYA 3AJ2A 4B08A 2QTWA 4M5HA 1NJIT 3BYPA 2W9AA 1U7LA 2H4YB 3QT8A 2ROEA 2MY7A 2FVQA 3AH6A 3TP2A 1F2HA 2CQPA 2V8GA 2HHWA 2DH9A 2XSFA 4V19J 1UCNA 2DT9A 2U2FA 3I4HX 5F8HA 1T9XA 4HI1A 4YR0A 2NSCA 2GZOA 4DX8H 4F4WA 1NZAA 5CYMA 2UUBF 5DG8A 1SVDA 4JI1F 3DM2B 3M8PB 1Q7LB 3CCJS 3CCTA 4L73A 3SQGB 1U49A 1Q95G 2JH3A 5L9XA 3ENWA 3OXGA 3V4IB 1TK5A 2IMWP 2LQBA 4RJVA 3L9ZA 3MEEB 4B3TJ 3IS9A 4KJIA 1UA0A 2HPUA 2X1AA 1NKCA 1S0OA 1ELOA 2H65B 3D2WA 3SZ2A 4ELVA 4DSJA 3SCKE 1OMSA 2Z8QA 2IVFB 3U1NA 1XMOJ 3HPOA 2DGSA 3QGGA 3KFWX 2ZH1A 3OR2B 1DTQA 4DX6A 1G6BA 1RAEB 2KU7A 1OSCA 1TKZB 3BGFA 2YKMA 2G2OA 4O3NA 4C48A 5HMXA 4JI5F 2NXJA 1WHWA 3OW2R 4Y2KA 6FD1A 4X4NA 1HNVB 2VB6A 1WG5A 3H2UB 3TEHB 3QPIA 4PQAA 1RT4A 1NJXA 1QAYA 1DHMA 4IR9A 2AX1A 1QLNA 2X1GA 4CI0B 4P7VA 2QYGA 4CYUB 5ETSA 4NLYA 1MN7A 2HFZA 5F0WA 3J81U 4OL8A 2HGNA 1S6PB 3TUIC 1XERA 3D9BA 4P2XA 3HP6A 2ZM6J 2BABA 4L6V3 2V0NA 2BKPA 4ERDA 2ZZTA 4DL4A 1RTDB 4LF6F 1WG4A 1HNIB 3WIVA 2XMMA 3OL9A 2P9EA 3D66A 1S12A 3L4BC 5AE3A 2GHVC 1B99A 3M30A 1RCOB 2PI4A 1XNQJ 3FBEA 3QRPA 3HMJG 5IT9U 2OPPB 4ZDNA 4DN9A 1TL3B 4K2JA 4MK8A 3DU5A 3VF0B 1T9VA 1XBWA 2YBVA 3QZ7A 1Y0HA 2RUSA 4BHQA 4XIUA 1KD1T 2MB0B 2YQ3A 1NSPA 2DNNA 1RHQB 3FBFA 3RAQA 4ZHRB 1FKAF 1HNXF 2DK2A 5D6GA 1CS4A 3SCLE 4ZIWA 3OTBA 2CJQA 2NZ4A 3ITHB 3ETOA 1T7PA 3H0PA 3MWBA 3N01A 3C15A 4C97A 5C7PA 3J7Z5 3M8QB 3IBWA 4QWEA 3RB6A 3I55S 3PTWA 2BYCA 2ZC3A 4Z7YA 4FZVA 2NYHA 3W9JA 2LXIA 1VRTB 1KOHA 3KJQB 3R5DA 1Y5LB 2MQ8A 4CH7A 4ZPWR 3KLHA 5CH7B 2HQ3A 2V8DA 2HZCA 1HHQA 4URGA 1PILA 2HBYB 3I5AA 4PWWA 4Q7AA 3KJFB 1FVQA 3MCSA 2PC6A 2YKNB 3A3PB 3D1HA 2G0JA 2MEWA 2FJEB 4OI2A 3VTIA 2OIHA 4DSLA 3BKTA 3Q8QB 2B8PA 5DM7Q 4PPDA 1B0TA 4B9TA 3U27A 4WP3A 2OSQA 2VFSA 2FDNA 2EI5A 4E98A 3PZPA 2Y1IA 3EJMA 1LWEA 1N33F 2E29A 3EWGA 1EHWA 2XS7A 2J9DE 4K2XA 1IJFB 1TKXA 5D3GB 2FJXA 1DY3A 4ATNA 4UUWA 1S99A 1C1CB 4I4BA 4MJKA 3ELHA 4MIBA 2K8GA 4RW9B 1FEEA 2E7XA 4DG1A 4GC7A 1D0EA 4HKQA 1BY9A 4K0KJ 1PAEX 2P8IA 3EPIA 5ETTA 5FDLB 4YDDB 3D68A 2HRTA 5DGBA 1QE1A 4BS2A 1I94J 2QLWA 1QUPA 4I2QA 2OPQA 3DRRB 4NI2A 4PZVA 3RBXA 3H2LA 2VQEF 4DLGA 4IFVA 1NAQA 3NNCA 1OYEA 2CQIA 1CPZA 1RTHB 1UEKA 1WJ9A 2YNIA 3CNQP 5C2CA 4C0OC 4IUFA 4LF4J 2OLWA 4H4OA 1CJTB 3I31A 1RTJA 1VQYA 4K4WA 4AQYF 1KLMB 1UVNA 2LA4A 2GA7A 4RNMA 3JSMA 4NYZA 1BE4A 1JB0C 1X0PA 3F56A 2XTJP 3W64A 3MOJB 2A3JA 1QTNB 1XNRF 1JJ4A 4Y2AA 3DOKB 3PX0A 3EZUA 3G8SA 5L9NA 3HM9A 3UD5A 1B0VA 2W2MP 1YRUA 1ZZFA 3R5BA 4ITSA 5E3RA 3ZNUA 1X60A 1VI7A 2H9ZA 4L72B 3UCZP 5C42B 4LIWA 2AMCB 1BWEA 1TAUA 1TTHB 3W5YA 3MM6A 4K4SA 2G2YA 1TL1A 2F9JA 1ZTTA 1FRKA 2G2ZA 2E44A 1N36J 5T41A 2WOMA 3M9NB 2CPFA 4ZPVR 3SIPB 1RAFB 1EJ7L 4RW7B 2NYIA 1J5OA 2DBBA 1RP5A 1JKHA 1FCAA 2WB4A 1VHFA 1WI8A 2LQ8A 2WVCA 3CD5A 4MTPA 1YG0A 2XO7A 3GIMA 1N0VC 1OQ6A 2EFQA 2BE2A 4RKUC 2CPZA 1HQ2A 2DR7A 2E1AA 2ZE2B 4G1QB 1R3NA 3DLHA 2DGXA 1BLUA 3ENAA 3HD1A 1RTIB 3PO5A 4FKXA 4C98A 3A8JA 4DUYJ 2IPOB 4LR8A 2BJ8A 2I5JA 4KHRA 4WFYA 3KK1A 1UPPA 2Q6BA 2ZH6A 2WONA 1TZ0A 5A8KB 2XC9A 3GV8B 4OHVA 2MMYA 1MWQA 2CPXA 2XHWA 5AT1B 3CCRS 4GKJJ 3NCRA 4J9MA 1S76D 1U26A 5C25A 2QV6A 3S1TA 3ZZYA 4KT0C 2O1PA 5J1EB 1KVJA 2W24A 4C11A 5I3UB 2B7CB 1DTTB 4DV4J 2ASJA 4KR0B 4O4RA 3PW0A 3OL6A 2CQCA 2F4VF 5BYQA 1FJCA 1EQ0A 3C15B 1JLCB 4P74A 1MLAA 2AP6A 2CJ9A 1S1VB 5F8LA 1SIWB 5KT3A 1H6KX 4X66F 3M8SA 4J9KA 2FVRA 2VBZA 4ZPDA 1HNZF 1JWWA 2MLZA 4NMXA 4DU7A 3PW4A 2ASDA 1DFDA 1X5SA 5DDRC 1UL3A 2HIYA 2JZ5A 4WTYA 3V81B 2C2EA 1O51A 2JEJA 1YRXA 3M1VA 3FGVA 1R8AA 3GZ7A 5CZVA 5K8OA 2ROGA 3I0SA 3MPYA 1B64A 1S1VA 4ZPAA 1LKZA 3KDNA 5GAGU 3QJLA 4W90B 1OJ4A 2VFUA 4Z37A 3BBFA 4DR5F 4O3SA 1X4FA 4HH0A 5C2GA 5KG2A 1XMOF 3JQMA 3H5UA 5CYQB 1S1XA 1Z4UA 2DHHA 2GV1A 3THTA 2FGCA 3N9UC 3TX8A 5I3UA 2AYBA 2A2DA 3PFOA 4J37A 1NM2A 3GFHA 4K4XA 1H0HB 1HWUA 3QNWB 5IXUA 1M5PC 4DR6F 3CO0P 5IWAF 1S6PA 4R0JA 3DC2A 1RHMB 1GK8A 3WIUA 5A2QU 4KHPJ 5ETLA 2CYYA 2KH9A 1UFKA 3NBPB 4OI3A 2HKEA 3H5XA 2VJVA 4DQPA 2VG6B 3GILA 1RT4B 1GMWA 1F60B 4S0MA 2WRMA 3M32A 4WIQA 4LFCJ 1HYSB 3DRSA 5KFJA 2I5JB 4YR2A 1JX4A 4GVBB 4FXWA 4WFZA 5D4OA 2ZM6F 3Q89A 4DV0J 3RG6A 5KOXA 4NLXA 1DTQB 3CD7A 1WWHA 4TXSA 2L41A 4QIFA 1YHQS 1RUSA 4YR3A 1X4DA 4F0KA 3EVMA 4IOBA 5ETRA 1F5AA 2CQBA 4B3SF 3UFCX 2RDJA 2D69A 1UA1A 1VQ7S 2PI5A 3CUNA 3HX9A 4XO0A 2QL5B 2ZNYA 4NCAA 1TL1B 2MDAA 1S72S 3HHEA 5J1EA 1RB0A 3M2VB 3ILLA 3MXHP 5L46A 1KS2A 1TU0B 3U1MA 2COLA 3AQPA 3KWMA 4RU2A 3R2CJ 3JSYA 3PIOQ 2CA9A 3S7RA 1PJ7A 1VQOS 3EVWA 1VQ6S 3DOKA 4Y00A 4Y0FA 3AOBA 2P2CB 1NLKL 4I7FB 1IKVA 3FBCA 3OJUA 3GIIA 2ACYA 1RTJB 3ZXWA 1YJNS 4IRCA 4PXBA 5EWGA 4LFBF 4NXMF 3ZTPA 1G2EA 2MKJA 5C24B 2HBRB 4OYWA 3G6YA 1RK8A 2ALZA 3L3CA 1X9SA 1O0PA 1RQ0A 3H4BA 4DQSA 2FUG9 3I0RA 4MYTA 5CYJA 4DL3A 2ZE2A 3RR8A 1AFJA 1UEUA 1W26A 1OS5A 1RKJA 2RQ4A 3T5JA 1N48A 3RTVA 2DNQA 3UDCA 3GPAA 3B4MA 1SKRA 1S6QA 1RGVA 1VK3A 2BUNA 2K3KA 2BOPA 2DGUA 1M5OC 1C0TB 5IFMA 2AT1B 1NB7A 3UVJA 2UVVA 1Q81T 1YI2S 3H2VE 5EN1A 1ZM3A 3MM6B 2ZJPQ 2AEFA 2J5AA 4TQSA 5D3GA 3TJAA 3MUMP 1SB6A 4QIWD 2NXEA 5THWA 1KP6A 3W2VA 1SH3A 2ZJRQ 4UTGA 2GO8A 2DJWA 2MKCA 2Y1LB 1AB8A 3E01B 2CRLA 3E51A 5F8JA 4USKA 3BSOA 3E8OA 1Z1ZA 5DGAA 1HBUB 3QSYB 1WF0A 1BQMB 3MMJA 1TKTA 2DITA 3KG1A 1REGX 1VQSA 2QZ8A 2YKNA 2AGOA 4JI1J 5CCMA 2MQOA 4ZN3A 2XS2A 2HFSA 1NH8A 2QMXA 3M1VB 5FD1A 5IC6B 4A8QA 1GX5A 1RT3A 2W01A 3R8YA 2OPQB 4NI2B 4U6PA 1CJUB 4J9NA 1WI6A 3MEGB 3R27A 4NLTA 3QRRA 2VOOA 3VALA 1AW0A 3VHQA 4CIOA 4EMDA 1FDAA 4ZJLA 2CQDA 2XY7A 1LK7A 4NXNJ 2F7VA 2MHEA 3OSPA 2VFRA 3UNGC 3PG9A 1OWXA 3A1YG 3V5RA 3RRGA 1RHJB 2XLJA 2J6TA 2F4VJ 4TVAB 5DLFA 1DTTA 2KG1A 2XMJA 2IAJB 2Z4PA 3M8YA 2X1FA 2OMOA 4B9MA 4W98A 3W61A 2CKWA 2K3IA 1RI7A 2HZAA 2OGUA 2YKOA 3ZZOA 2WSFC 4Q45A 3C16B 1SUQB 3DNCA 2KFYA 3EMTA 2W7AA 5M2UA 3P96A 2V2VA 3LALA 3KLFA 3GJQB 1RWVB 1EARA 5KFHA 1EX8A 4P75A 3PRVA 1B3TA 1VIXA 2WBRA 4FBUA 5DS7A 1UW9A 3THVA 1LWFB 3L7OA 2EFNA 3M05A 3MEKA 4C6AA 3DLKB 3Q2TC 2AV5A 4B3OB 1N32F 1FRLA 1GMVA 4OYBA 2G0CA 2YX4A 5A76A 2Y0BB 5E33A 3K58A 1CJKB 1IM4A 4HYKA 1FD8A 4ED7A 4ED3A 1Q0NA 1M5KC 2BE2B 1WD6A 1VRTA 4WBFA 5A8RB 4RU9A 3RB3A 2CQ3A 2RDIA 2A6OA 4NA2A 1FDDA 1IR0A 1Q8LA 4KPCA 4WJBA 1U8WA 5J2NA 2NS1B 2CPYA 4ZVQB 4GKKJ 1X5PA 2Z0GA 5CA5A 4DV1F 4QJVA 5KG7A 3LP0A 4YMEA 5F8IA 3KK2A 2IRYA 2KM8B 1RLCL 1UMJA 1XR7A 3ET6B 2M0GB 3R5AA 2UXCF 1TKZA 2IM0A 2M4MA 1ROFA 4PQUB 1KDNA 4DV3J 1HWLA 5D4PA 5FJ4A 4WZQA 4X4RA 2YH1A 2ZITA 1LW0A 4J91A 2FQQB 2R3VA 4L74A 4YQWA 1TL3A 2V63A 5B0BA 2EC0A 2GJ2A 2MPUA 3NGRA 4UOFA 4P2SA 4WZMA 5JXSA 4F2SA 3LP2B 2CFXA 2BRLA 3N0VA 2RRBA 5G4DA 2HHTA 2YVSA 1F3FA 4WK1A 3CW2C 1RT6B 1TUGB 2E1CA 4NYOA 2WZ1A 2AIRB 3RUBL 3W5ZA 4ZCMA 1DAXA 3QLHB 3EPGA 5E41A 4LQ9A 3ONQA 5E5NA 3VAGA 5KAKA 3A8KA 2V9WA 4N76A 1JXEA 2W9BA 5HROA 3M2RA 3LF0A 2G13A 2Q79A 1EETA 4LVNP 4LMZA 2KFZA 3CDUA 3V6JA 1G1XA 1HBMB 3CJSA 3V6HA 5KFUA 3SYZA 2FVSA 1TMMA 1UJ5A 2CNKB 2OEKA 1HI0P 3BO3A 4LREA 4TY8A 3A8IA 1LWXA 2MZRA 1VMBA 2M3DA 5IQ6A 5HLFB 1FJEB 4TYBA 2UXDJ 1SCJB 1DQAA 5JUMA 4PCQA 1YZ6A 3FVYA 4FKYA 2HNDB 3QATA 1U24A 2Y8WA 4U8YA 5KG3A 1QVFR 3MEDA 1KQKA 2HHPA 3B78A 1S57A 3RRKA 3TZWA 4LR9A 3GB0A 4QWDA 4ECTA 4OYMA 3JAMU 3FKBA 3KLGA 3C8YA 2C2KB 2HWTA 3ZZUA 3M8QA 2VHGA 1FKOA 4KRWA 2W9CB 2C3MA 2XS5A 1S48A 4DZDA 2UUBJ 4L3NA 4X2BA 4EFAC 2NUHA 2VG7A 5I42B 3O8WA 1X4CA 4DZ6A 4EZ9A 4C8LA 2J9CA 4M5KA 1URRA 1WC3A 3CJKA 2DPJA 3CMES 3FMWA 1NCLA 5K8NA 4X4PA 4ZVTB 2HHVA 2W1BA 3KNGA 1U6ZA 3LAKA 1H73A 1FX2A 2AW0A 2FC9A 3DU6A 5LMNF 1QM9A 2ZOGA 2ZD1A 1YJUA 4GO7X 3SMZA 4RWWA 2H48B 4FNIA 2E5JA 2JX2A 2ZOMA 5DZ7A 1PBAA 3RYLA 4USMA 2UXDF 4DR1F 3US5A 3HK2A 3NS7B 4J9SA 4F3QA 1RT2A 4OJHA 6AT1B 1OPZA 3P8BB 4IFYA 1WELA 1AZSB 1F5BA 3GJRB 4NZ7A 4P73A 2YPZA 4FYWB 2M8HA 4ANCA 3KOAA 1P9YA 1SKUB 2IRUA 5KFQA 5AE1A 1RBOB 1PYTA 1SH0A 3OUYB 2BQUA 2FHKA 3NGDA 3D6HB 4R8UA 1N5TA 4CYUA 4EZ6A 5FLXY 3MM7B 4X4OA 3CC7S 4EO6A 2MZSA 4EK2A 1IKWB 2ZVSA 4DR5J 1H98A 4FVCA 3OVAA 2J0WA 3EX7B 1ITPA 4C3MA 2KM8C 2XNRA 2QRRA 1SV5A 2DNOA 1VC0A 1IR2A 4CCHA 1S77D 1D9AA 2M2BA 3QJJA 3K8WA 4D3HA 1MSWD 1Y3KA 4DL0C 4IOCQ 1XK8A 2B43A 4DR7F 3Q8SB 4HT5A 1YLXA 2G0IA 1VLYA 2GAHC 3MMAA 4C8NA 3TZXA 1SL2A 1Q78A 4OI1A 3BN7A 2W2NP 1SQFA 1XR6A 3B54A 3FQKA 3LH2S 2EFVA 3DOMB 3RZAA 4KB7A 1PJ5A 2MQLA 5HQ8A 2C2ZB 2QGFB 3U7JA 3RBDA 4X62J 3CXCR 1TV6A 2GJIA 4KFBB 1LNQA 2V8PA 5HI7A 2JWNA 4A8WA 2XG8A 3CJ0A 4IKAA 2E9ZA 2HQFA 2C3YA 1K0TA 2J8SA 5EX3A 3PCOB 2V8HA 4Q8FA 1FWPA 5ETKA 3RRHA 2HVIA 1XTZA 2N3LA 2DNRA 4N47A 3B4DA 1H74A 2B7BB 3OVSA 1R0BG 4CH1A 5D4NA 4FF1A 3WX8A 5GMEA 4TU7A 2E66A 4DR4J 3I6PA 3K5PA 2VA2A 4JI4F 1R31A 4DUZF 1LFWA 2HQDA 4UZBA 3SV3A 1S4FA 5A6PA 2MQNA 2QA1A 2BR0A 1QTMA 3JB9k 1RZMA 3MAAB 1HNWJ 4OI4A 3CCQS 3NOCA 2CZVC 2KT2A 1S1TB 5HVHA 3KLEA 2CQ0A 2XHCA 1UWAA 2HIQA 5B7WA 4CNZA 2O5DA 2BMBA 3MOZA 4Y2CA 2F3JA 4NCGA 3BREA 1NHKL 2DKOB 3KUHA 5K14A 1GXUA 2ZHOA 1GNKA 2W8KA 2QLJB 1U2FA 3W9IA 4F4AA 1XMQF 2WVBA 2YWEA 1L5UA 1S5ZA 3OFHA 3BSAA 2FJAB 2DO4A 4TN2A 4P2MA 1R0AB 1AUDA 4DV1J 1KWMA 1MU2A 2LU1A 3HVTB 4DX7A 4DR4F 2RJZA 5GVQA 2VQEJ 4FF2A 2JL9A 4M5NA 1BQXA 2PEBA 4DPWA 3Q24A 2QL9B 2MGZA 3KMQA 3D7SB 2EKNA 4M5GA 3ISNC 3DFEA 2E1RA 2V69A 3KKFA 4LF7F 4Z2XA 4ECUA 4K59A 2E7VA 3MMBA 3SDEA 3AD7C 1FWLA 4U96A 1N0UA 4KY3A 1HL6A 5H9FJ 3DXSX 3C14B 4DSEA 1SBRA 4U7UD 3ENQA 3FC9A 5KFTA 4BBYA 3DYAA 1I51B 4LFAJ 1KLNA 3GG0A 5ETPA 4ED1A 1Y7PA 1NSAA 2UZAA 2DR6A 3H8YA 3T9NA 1FDNA 1H3DA 1GMWD 2WW4A 1OQ3A 3K8VA 1R0AA 1NK8A 3IWLA 1N6QA 1VQ5S 2APOA 3ILIA 2I1RA 1S79A 4MFBB 2EFGA 1IXKA 4OZ0A 1JLFB 4NRUA 1XN9A 3R5CA 3NAHA 4WU3A 4O3RA 4P52A 4YFUA 4YHHF 1OYDA 5KT5A 5LSLA 3DHXA 2R7XA 3KLIA 4TLRA 1MNEA 4ILMA 1IBLF 1QJHA 1T9TA 3TAMB 4PUOB 1QUVA 1RAHB 2BE7D 2GS8A 3TX0A 4ZA1A 1S1TA 4YEAA 3K5OA 2C3OA 2CWXA 2L48A 3CJTA 2GO9A 3ZZRA 5CD4A 3BQ1A 4USVA 1C1BA 5E3QA 3MGJA 4NOHA 4OV6A 1XR5A 1N5YB 4DSFA 3TVZA 1S9GA 1BWVA 3CSKA 4I1TA 3X3UA 1U1RA 3BH7B 3DLLQ 2ZD1B 4RNOA 2CJYB 2NUUG 3QBCA 4CLTA 1SL1A 1KTVA 1VFJA 1S9FA 4M5LA 3BQ2A 1D8ZA 4LJMA 1NH7A 2DY9A 5BYRA 2HNZA 1E6YB 4OHZA 3BDPA 2HK2A 2XYGB 4B3RF 1RSCA 3Q8UA 2QE5A 3R6LB 4ECRA 1VQPS 2W4PA 5KFAA 1WC0A 2GFFA 2OPRA 5L1JA 3GWCA 1N34J 2GIQA 3ZZPA 1SJFA 3HLUA 1EQMA 2AF6A 4USIA 3VV2B 3SFGA 1FFSB 3CULA 4UF4A 2AU0A 4QR0A 4IDKB 3KG4A 4U67Q 1L3VA 2WVFA 4B9NA 5D15A 3IXQA 3KK2B 4WFXA 2QA4G 1S6UA 2D9PA 3VQTA 4H4MB 4NLWA 1V6HA 3DOMA 3UI3A 1FRJA 3OTOF 2HGMA 4ILRA 3LOUA 4UQTA 3HSZA 4ZVOB 2BVZA 3H4DA 1DZ5A 3NMRA 2W2QP 2FTRA 4DFPA 3HHLC 4CM0A 2R7UA 1RT1A 1NKEA 1XJWB 3W3SA 3LA0A 4DV5J 3MMCA 2FY1A 4X66J 1HIYA 4MH8A 3QO9A 4ZITA 3M2UB 1UWBA 2VONA 1AYEA 2ZJQQ 1X9MA 2O66A 2LFVA 2DRBA 1FVSA 2CWKA 3D67A 3ZTSA 3JYTB 4C8YA 4DR6J 1YBAA 4N41A 3MMCB 4KC5A 1SC1B 1FI4A 4J5OA 1FEHA 3NLCA 4IH6A 3DHWC 4ZVRB 4BCAA 1FRMA 4WPAA 3TZZA 3V6DB 3NEKA 3QZ8A 3LUYA 3ZC4A 3S01A 2IM1A 2HNYA 5BYSA 4DV6F 4C8OA 2ILZA 4QU7A 4OYXA 4B9VA 1WOSA 1Z2LA 1TMJA 2MKHA 4F2RA 3E3XA 2HSEB 2VL1A 3L95X 4I6WA 4WXWA 1RT2B 1V5VA 2RT3A 5KT2A 2AEMA 2BOAA 2NXUA 1JLEA 1S0MA 3HULA 1RWMB 4ID5A 1DBDA 2R8GA 5KFIA 2OPSB 2N7YA 3P5BP 4HHHA 2ADBA 3DCAA 2ATCB 2D9OA 2RKIA 3NKYA 3UN5A 2DPIA 4MKVA 3CDEA 2J0XA 2N82B 4LFCF 4EBCA 1ZH5A 1NK7A 2MKIA 1E6YA 2HNZB 2HZVA 3LWMA 3WC0A 1G4CA 1EIYB 3PW2A 3HZEA 1RE1B 4L3KA 4GO5X 5DLGA 2RS2A 1HQUA 4M1KA 4J9QA 1WKLA 4F0HA 3GFXA 2QX0A 2F63A 3HFVA 3L7PA 3BB5A 2XBPA 2N3OA 2UUAF 3KTQA 2ERRA 1U25A 3JQJA 2GCFA 3AB4B 1E6VA 4HTJA 4ICLB 1U0HB 4R8UB 4YHHJ 3JYTA 2DR8A 2R7OA 2HHSA 3T19A 5B09A 3C3LA 3H7HB 2DIVA 5MLCV 4WP8A 4DFKA 1AZSA 5HANA 2UUCJ 3MEDB 4G1PA 1NDPA 2GC8A 1FD2A 1UP1A 2OO4A 1T9UA 2QYCA 3LPYA 2DB1A 2A6MA 3UVJB 4CTAA 1UPMB 3W8PA 1RKIA 4LF8F 4A48A 2JFDA 1BD6A
chains in the Genus database with same CATH topology
4UZBA 2YQ0A 4BLGA 2YQ1A 2YPYA 4K2JA 4UZCA 1VHIA 5A76A 1B3TA 2YPZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UZB A;  2YQ0 A;  4BLG A;  2YQ1 A;  2YPY A;  4K2J A;  4UZC A;  1VHI A;  5A76 A;  1B3T A;  2YPZ A; 
#chains in the Genus database with same CATH topology
 1KBR A;  5KG1 A;  1HNW F;  5F9N A;  5GAE I;  2R2S A;  5GMD A;  3IR7 B;  2FD2 A;  4LFB J;  4PG4 A;  1UJ4 A;  1GXT A;  3DLE B;  3MM8 A;  5H1S V;  1FNX H;  1M5S A;  3B8H A;  4OHX A;  3I56 S;  1I1G A;  3Q0A A;  4EYH B;  3KHG A;  1HKA A;  3AA8 A;  4A46 A;  1IBL J;  5I42 A;  3HD2 A;  2HRU A;  1WTF A;  4K4Z A;  4DV7 J;  1MN9 A;  5J2Q B;  2AJ4 A;  3MF5 A;  2XNQ A;  4OZL A;  4XAK A;  2FLN A;  1NHU A;  1J5E F;  3I96 A;  2OEM A;  2DY1 A;  4OX7 A;  3CVK A;  3DXB A;  1WF2 A;  4NA3 A;  2H1Y A;  3H5Y A;  4G3I A;  3FQL A;  5AE2 A;  1HW8 A;  1U4B A;  1QSS A;  2VG5 A;  3GIJ A;  3UNY A;  1JMT A;  1RLD A;  2Q1L A;  2HND A;  1DUR A;  3DLB A;  1HWK A;  4AL5 A;  1VIS A;  3DGP A;  1N5S A;  5J1P A;  3FFI A;  4WYL A;  1LEO A;  4LF4 F;  3VQS A;  3G71 S;  4P9S A;  3ZTR A;  5HVG A;  2GVZ B;  2FGO A;  2B9E A;  2M5Y A;  2AGQ A;  2KB2 A;  3OR1 B;  5HSP A;  4IRD A;  2ZBC A;  3MM9 B;  5K5M A;  4CLK A;  3LP1 A;  4YS2 A;  4I6Y A;  4TYA A;  3SI8 A;  3NY0 A;  3J7Y U;  5M2P A;  4FP9 A;  3BPD A;  3PHE A;  1KQS R;  4CNY A;  2XZT B;  4RW6 A;  5KG4 A;  3R1L A;  5D4L A;  5LMU F;  3TQ1 A;  3GON A;  4Q0B A;  1HMV A;  2CDQ A;  1R8P A;  3GR0 A;  2WVE A;  3MCO A;  4URS A;  3ZZ0 A;  2FVP A;  4UY8 T;  3T6J A;  4ECS A;  2MKK A;  3PEH A;  3G4S S;  3DLG A;  4DV6 J;  3BGL A;  4KYZ A;  4Q43 A;  5AJ3 J;  2CUY A;  3KXD A;  1VK8 A;  4WTO B;  5FII A;  1JK9 B;  1UAW A;  3ISZ A;  4AND A;  4NRT A;  3LP2 A;  3GJS B;  3DGV A;  3F73 A;  2BJD A;  1NPP A;  1A6L A;  1Q7Y T;  5KFD A;  5IT0 A;  4C3K A;  1LW0 B;  2X1B A;  2H5J B;  2J9D A;  1TAQ A;  3MM5 A;  2HFU A;  1U09 A;  2LMI A;  2LQ5 A;  3R7S B;  3RAX A;  2DO0 A;  1YJV A;  2GVD B;  1LWC B;  2K1R B;  3T3F A;  4U9R A;  2B4P A;  4TU8 A;  4O3O A;  5LSO A;  3BPS P;  3GE9 A;  3NMA A;  3G9C A;  1ICE B;  4QW9 A;  3BS9 A;  2UVR A;  2M9K A;  2XY5 A;  4M5D A;  1LFP A;  4PEO A;  3RU0 A;  2HBZ B;  1HPZ A;  1TP7 A;  2VF3 A;  3N79 A;  3QQC D;  2OTL S;  4V19 X;  4X64 F;  2KI2 A;  2YKP A;  2ZH4 A;  1VQM S;  1WHV A;  4WE1 A;  1U1L A;  5AJ3 F;  2DNK A;  4ENO A;  1S1W A;  4DF8 A;  4C8Z A;  1L3T A;  4F3M A;  1CJU A;  4U8V A;  3S8S A;  3QYY A;  1T9W A;  2JC0 A;  1NPK A;  1K73 T;  1V3S A;  1BGX T;  4UY8 5;  1LWC A;  2DR9 A;  1WKJ A;  1VLO A;  1WC5 A;  1RT7 B;  3OD2 A;  2KFN A;  4FPI A;  3OQ2 A;  1NRK A;  4E8U A;  3DRS B;  5A8K A;  3R6G B;  3Q23 A;  3PW7 A;  1NZ8 A;  5KFG A;  4NPO A;  4ZIV A;  5D78 A;  3RB4 A;  2WW8 A;  3W1Y C;  4LRA A;  3CJ4 A;  1IKX A;  1FFG B;  2EW9 A;  3OFG A;  4PWD A;  1JNZ B;  1UET A;  3EGN A;  4XDC A;  3KJN B;  4UOC A;  1ZPW X;  2VPY B;  4KKO B;  4ZLN A;  2B6A A;  5KFX A;  4ZVF A;  3AD9 C;  4F04 B;  2XMA A;  1KVI A;  2R7T A;  1KKH A;  5J2M A;  4FF4 A;  4ECZ A;  1MML A;  4RW7 A;  2RUG A;  4F26 A;  4ZKA A;  4ELU A;  2OP5 A;  2DCU B;  3F44 A;  4KO0 A;  1X4H A;  4O44 A;  3VGS A;  2EBE A;  3CDA A;  4I68 A;  2IJR A;  2P6S A;  3BEG B;  1BQN A;  4M5D B;  4DBQ A;  1RWP B;  1WC1 A;  3O3L A;  1FE4 A;  4LRC A;  3IRX B;  2CXE A;  2EC2 A;  2DNG A;  3HDS A;  4LVO P;  1R6Y A;  2VPZ B;  4ZVG A;  4J9L A;  4DR3 F;  2BQR A;  2AZ3 A;  4KHM A;  5KFY A;  3VAI A;  2KT3 A;  2V34 A;  4PWU A;  4QBU A;  3DRX A;  3IM9 A;  3MM5 B;  1MWZ A;  1KQG B;  2KXH A;  3A8E A;  4CQ1 A;  3KUE A;  2EPI A;  3BGO P;  3F41 A;  1BQM A;  1KLM A;  3I82 A;  5E2Q A;  2MQP A;  1JNR B;  5SZT A;  2IC3 B;  3FJ2 A;  1IKV B;  1SH2 A;  3Q8Y A;  3LO3 A;  2XWX A;  2W9C A;  4DQR A;  4NXM J;  3K0J A;  1T05 B;  5E7O B;  1F1B B;  1UJ6 A;  4X84 A;  1K0V A;  2VDI A;  4PG7 A;  2BW2 A;  4K8R A;  3W2V B;  1X4A A;  4GKJ F;  2XWY A;  1U1K A;  2PA3 A;  3W65 A;  2D74 B;  2R2T A;  3BKU A;  1U47 A;  1SC6 A;  1VJW A;  2N4D A;  1BQN B;  4ZCI A;  4ZLL A;  1R7I A;  3AOC A;  4ECW A;  4JI3 F;  1WDD A;  4LSL B;  3BYR A;  3IC1 A;  5U47 A;  4CWB A;  3SSS A;  4CLL A;  2J7W A;  1EP4 B;  1FRX A;  3CE8 A;  1JQG A;  3T6B A;  3AT1 B;  3NS6 A;  3ZZZ A;  1VC6 A;  4QYZ J;  1CC8 A;  2CQ2 A;  2H51 B;  2GHW A;  2RB7 A;  5KFV A;  3ZNJ 1;  1RT5 A;  2O01 C;  3POT A;  4LBH A;  4PG8 A;  2Z2Z A;  4HEA 9;  2DXD A;  2XEX A;  3LP1 B;  3UQS A;  2EFO A;  3AA9 A;  3OR1 A;  1RU1 A;  2RDD A;  5HMW A;  2ZUA A;  4DEZ A;  4EWT A;  5K8P A;  4K4Y A;  2CQH A;  4RX6 A;  2ROP A;  3UWT A;  3BGR B;  2XB2 D;  2D3U A;  1KFD A;  3NXZ A;  3HI9 A;  2ZH5 A;  2OEL A;  4YB5 A;  3CCM S;  4LSL A;  4ES3 A;  1SQE A;  4DUT A;  4LQ3 A;  3D6T B;  4DV5 F;  1WSV A;  4L76 A;  3T9Z A;  3GIK A;  1VQK S;  3CTR A;  4OYI A;  2MXY A;  4ID8 A;  3EGZ A;  2ZKU A;  3MPU B;  2AEJ A;  3QMQ A;  3EGW B;  1I5O B;  3CDB A;  1YX2 A;  2LEP A;  2VG5 B;  3IBF B;  3NOG A;  2JLF A;  4C8M A;  3TAP A;  4DS5 A;  3CJ2 A;  2B51 A;  4DJB A;  2B4O A;  1J27 A;  2XCP A;  1J2V A;  3C6U B;  1NEE A;  3BKF A;  2WCX A;  3MTJ A;  4JYA J;  2GHP A;  2LVW A;  5HP1 B;  3V6K A;  1D9F A;  1HPZ B;  2C1E B;  4NYP A;  2DGT A;  2L9D A;  3R5G A;  3J7Y I;  2LEB A;  3CCW A;  3N6N A;  2YNI B;  2XYH B;  2EWH A;  2G9O A;  4ZHR A;  1JIH A;  1R8C A;  4JBC A;  5HQM A;  5I3Q A;  3HHD A;  3V81 A;  3ET6 A;  5KFR A;  1R27 B;  1W25 A;  3DLE A;  3MM8 B;  3GR1 A;  3GQC A;  2E5L J;  4ZJO A;  2MQQ A;  4LF9 F;  4AXI A;  3HJF A;  1H7X A;  2RQK A;  1DLO A;  3KG0 A;  1TQL A;  2E5I A;  3IMQ J;  5KT4 A;  2V6A A;  2HMI B;  3VGU A;  2VG6 A;  3CIM A;  1NHV A;  2GW8 A;  2YNG A;  5J2N B;  4UT4 A;  3H25 A;  2E9R X;  1K1S A;  4KV8 A;  3VAM A;  4Q8E A;  4I0W A;  4RR5 A;  1TL7 A;  5J2M B;  3MAH A;  3EYZ A;  2Y8Y A;  2AJQ A;  2RH3 A;  4HLB A;  2KXF A;  2ZC4 A;  3IA0 A;  2FZK B;  5A8R A;  3H40 A;  1SKS A;  4ZP7 A;  5C25 B;  5B08 A;  3G6V A;  1D1U A;  3NGS A;  3MD1 A;  3OTD A;  5KTQ A;  1TL7 B;  3IAM 9;  3BN4 A;  4ZVU B;  3CCZ A;  4MAK A;  4P10 A;  2FJD B;  2LDI A;  2PA8 D;  2VC1 A;  2ZDO A;  1V3Z A;  5ITH A;  2C42 A;  2MKY A;  1HMV B;  2QO3 A;  1FHT A;  4OHW A;  2HMI A;  2Y1J A;  4DCJ B;  1HNV A;  2AWZ A;  2ZWP A;  4F7V A;  1RAG B;  3FSX A;  1KN6 A;  2CPJ A;  1F6T A;  2MZ1 A;  4NLR A;  1N8R T;  1M1H A;  3SEO A;  2ZH2 A;  2G1H A;  5ETQ A;  2ZZN A;  1NPR A;  1UWB B;  1VBZ A;  5L1K A;  1EP4 A;  2N7C A;  2PII A;  4EYI B;  1TFW A;  1CLF A;  5DM6 Q;  1S7H A;  2HQC A;  2DEJ A;  1DAR A;  3LW5 C;  2RRN A;  1RAD B;  4C11 B;  3DGP B;  5F8G A;  3G82 A;  3J7A N;  3OBI A;  3TA0 A;  2Z2M A;  5C42 A;  4MIA A;  3D4J A;  3HSG A;  4A47 A;  4FS1 A;  4AL6 A;  3FK4 A;  4IDK A;  3BJY A;  2GVD A;  2HNY B;  2QMW A;  2NXN A;  3KDO A;  1G3O A;  2HGL A;  2OHD A;  5DQG A;  3CD0 A;  3D5M A;  2CNL B;  2NXC A;  3WDO A;  2VDH A;  3V6D A;  3TAQ A;  1TKT B;  2ZH3 A;  1WDT A;  2J0S D;  1IUJ A;  2VOP A;  2GQ2 A;  3EUN A;  3JTP A;  1RTH A;  1SC4 B;  5KG0 A;  1H7W A;  2E1M C;  4TKT A;  3OLA A;  4K50 A;  1GFW B;  1LW2 A;  4ZPC A;  2V2K A;  1RYR A;  1RTD A;  2YQ1 A;  4LF2 A;  1M5V C;  2QFI A;  3R5J B;  4BWM A;  3M9M B;  2RE1 A;  1JKH B;  4B3S J;  2IFX A;  2E9T A;  2YWG A;  1FO1 A;  1BMQ B;  4X4T A;  3RBE A;  1VBX A;  3DLJ A;  4YB6 A;  4WWS A;  4M95 A;  4QIV A;  2QA4 S;  4FXV A;  3D28 A;  4Q0B B;  4LRF A;  4M63 A;  2I9S A;  3N6M A;  4GVL A;  5EDW A;  2VC0 A;  4ZPT R;  1RAC B;  4R25 A;  2O3D A;  4RZR A;  1WEZ A;  2JHE A;  5GAD U;  3PJW A;  2VPX B;  1BXN A;  2Z2L A;  4ZCK A;  2DGV A;  1WC4 A;  3H59 A;  3H5S A;  5ETO A;  5HJY A;  4ZP6 A;  5FLX U;  3T1H F;  1TEL A;  1EAY C;  5IOL A;  1YJ9 S;  5F8N A;  1RAJ A;  4ICL A;  2CPE A;  2F4F A;  2NSB A;  4NLS A;  4X4V A;  1K44 A;  2DIU A;  3K59 A;  2XCA A;  2OTJ S;  3A12 A;  3IFE A;  3QT7 A;  3MFI A;  4DSI A;  4YB1 P;  4RL1 A;  3BSC A;  1KEK A;  3TAR A;  5CXT A;  2H5E A;  4TNO A;  2JEG A;  2RML A;  3M6W A;  3GV7 B;  3IRW P;  3DYA B;  4AFF A;  5GAH I;  8RUC A;  1JJC B;  3TZY A;  2JJ4 D;  4B3M F;  2YXL A;  1Q5Y A;  3EDR B;  2OD6 A;  1EKR A;  1T11 A;  3DOL A;  1TVR A;  3DM2 A;  3M8P A;  2HWI A;  5FDL A;  4CO2 A;  5KOW A;  2OPS A;  4PYA A;  3HKW A;  3HZG A;  4N8N A;  3TEG A;  5T7L A;  3DMJ A;  3ENV A;  3PRB A;  1RWO B;  1SXL A;  3UCU P;  4OX8 A;  2OFH X;  1TKX B;  1SJ3 P;  2VPW B;  3L7U A;  1A0O B;  2XYP B;  5J2Q A;  4H54 A;  2DXE A;  3CCS S;  3TAM A;  1XEZ A;  5GAG I;  4PUO A;  2KVI A;  4NL5 A;  2MGZ B;  5CAB A;  1WKK A;  2D7S A;  2DHS A;  2B9Y A;  2DNZ A;  4NWB A;  3HSJ A;  2YX1 A;  4PG6 A;  4XDD A;  4DMZ A;  1TK0 A;  4OHY A;  1O5J A;  3PM9 A;  4IYQ A;  4JI8 F;  3KUG A;  4NEZ A;  1IKX B;  1V9O A;  2RNE A;  4O3P A;  2CJB A;  5LMN J;  1X0F A;  2HRY A;  3DDN A;  4OIX A;  1JLF A;  3D6F B;  3M32 B;  2UVW A;  5CCL A;  2MJU A;  4MFB A;  3PEJ A;  4BWJ A;  5DRK A;  3HHK A;  1HQE B;  1CSJ A;  2OEJ A;  1RXO B;  3RR7 A;  5IV4 A;  2M7S A;  3GSD A;  3NS5 A;  3WHI A;  5IM0 A;  4QWA A;  3UW1 A;  4NCG B;  1D8Y A;  3AOD A;  3OSN A;  1XNQ F;  1CJV A;  1O6X A;  1WEX A;  1B4S A;  5CQG A;  2CZ9 A;  2HS3 A;  2P9G A;  3FRY A;  2Y3Y A;  5HMZ A;  5CYQ A;  1HHT P;  2HHU A;  1P1T A;  2I8E A;  3CDW A;  5DDO C;  4AQY J;  1D3W A;  3KHL A;  4JV5 F;  1NND A;  3ITH A;  2NR0 A;  4Q5V A;  4K4V A;  5I4M A;  4ETX A;  5J2P A;  3CJ8 A;  4V1A k;  2JEF A;  1N32 J;  1FJ7 A;  1CEZ A;  4A8S A;  3T41 A;  4HI2 A;  2IJF A;  1FF2 A;  4CDI A;  4C2M A;  2PSZ A;  2K1R A;  4DXL A;  4BDP A;  5HVF A;  4CO0 A;  1IWA A;  2BX6 A;  4EBD A;  3Q8V A;  3OR2 A;  4OZN A;  1XC9 A;  2PFF B;  1B0P A;  2DRD A;  4DL7 A;  2VIH A;  1Y5N B;  3MUV P;  5I3P A;  2BAN B;  3PDN A;  3MPW A;  4HVZ A;  4PYD A;  3HHL A;  4JV2 A;  4KAI A;  3PR4 A;  1FWK A;  4G1I A;  3WX4 A;  2BJE A;  2IM3 A;  3M30 B;  4KGV B;  1QY7 A;  3T5K A;  3FBB A;  4OYZ A;  4MIW A;  2V94 A;  1TV6 B;  2GGP A;  5KFE A;  4WKR A;  1I3O B;  4ED5 A;  2W4C A;  5IS2 A;  2XO6 A;  1YBT A;  2QLB B;  4DUY F;  2JC1 A;  2GQC A;  1REV A;  1F9F A;  2BKN A;  3PRD A;  4RLE A;  5HJX A;  3MAA A;  5LSR A;  4ED4 A;  3VCD A;  4AT1 B;  4GMK A;  1X9W A;  5D0G A;  3TJ9 A;  5DG9 A;  3GIR A;  2R7W A;  1GEH A;  1M0S A;  4KTQ A;  2IA0 A;  2WHO A;  4DPU A;  1CJV B;  1O8B A;  3D3C J;  1S4E A;  1S49 A;  2PFD A;  2VJU A;  4ILL A;  1ACM B;  3GMG A;  2YTC A;  1VRU B;  3O5T B;  3RB0 A;  4HH1 A;  2OAU A;  3MM9 A;  4LF1 A;  4KH0 B;  1WHY A;  5BR8 J;  1R43 A;  2C2O B;  4LBI A;  1HQE A;  4QIG A;  4OZ1 A;  5DQH A;  1N56 A;  2L9W A;  2HHQ A;  4DUZ J;  1N54 B;  1U1N A;  4FF3 A;  1FXD A;  3IS9 B;  4M8L A;  4KFB A;  4RBV A;  4DV2 F;  1IQZ A;  5HBM B;  1U2R A;  4QQB A;  2DD8 S;  5KFW A;  1KQF B;  3EZO A;  4PAA A;  2HUR A;  3GP9 A;  3V4I A;  1QVG R;  1IJE B;  3FZB A;  2JOQ A;  3NL0 A;  2R2U A;  1V5I B;  4RW8 A;  5LXR A;  1JLQ A;  4AXJ A;  4DV7 F;  3IBC B;  4CLZ A;  3I9V 9;  1YJT A;  1X5O A;  2KJV A;  3DI6 B;  1U0H A;  3IGV A;  1F5C A;  3IP0 A;  1Q8K A;  3JS9 A;  5HK4 A;  1Y3J A;  2OFG X;  3CJ5 A;  3SDE B;  2B56 A;  4DPX A;  4UQG A;  4DQQ A;  4DL2 A;  4LF8 J;  2MZJ A;  3DOL B;  3CB4 A;  2M52 A;  4KGZ B;  2RU9 A;  4E0D A;  2KO1 A;  4HT7 A;  3KLV A;  3C2P A;  3OV7 A;  3AY0 A;  5GMK a;  2VQF F;  1IBK J;  1SV5 B;  5T14 A;  3PKY A;  4LSZ B;  2POK A;  5L8R C;  4JI0 F;  3W5X A;  4CP5 A;  2GMH A;  1RAI B;  4HDH A;  3GU0 A;  2F40 A;  2IRX A;  1QE1 B;  2IDL A;  2NRE A;  1NB2 A;  3GCW P;  4DFJ A;  2GIF A;  1J5E J;  2CQG A;  2J9E A;  2L9N A;  2VZ9 A;  1C1C A;  4DG1 B;  4DCO B;  2JSX A;  5F3T A;  2R7S A;  2N4C A;  3QGH A;  1VRQ C;  2MHN A;  4RW8 B;  1SJ1 A;  2WK4 A;  5B0A A;  2AYG A;  2KRR A;  2NCK L;  5B0E A;  4PXD A;  4NZ6 A;  2P9C A;  1BUX A;  4R0E A;  1T0T V;  2MST A;  2RSQ A;  3FZ2 A;  4KE5 A;  4XTT A;  1NK6 A;  2CPI A;  2EG1 A;  4ZVS B;  1VQL S;  2R8H A;  4X4Q A;  2GNK A;  4P7T A;  2GX8 A;  3GYX B;  4WF9 Q;  1Q1K A;  1C2P A;  4ZP8 A;  2V2Z A;  3OL8 A;  2VFT A;  1OY6 A;  3EE3 A;  4LUB A;  4NAS A;  4UOG A;  3KNA A;  1JLG B;  2FPH X;  4MT1 A;  4Y6I A;  5A0Y A;  2BRK A;  5L38 A;  5LOQ A;  3DRY A;  2XI2 A;  4J9O A;  2DVI A;  3PY8 A;  4PAB A;  3TQE A;  1WC6 A;  1HR0 J;  4Y2M A;  2XMW A;  5JVH Q;  1NBE B;  1LW2 B;  2M70 A;  3RW6 A;  4CO5 A;  2RAQ A;  4C7Q A;  3K5N A;  4OZ3 A;  3LGN A;  3UR3 C;  3PW5 A;  2VG7 B;  3GLJ A;  5DDP C;  3BSN A;  2OKQ A;  1HI1 A;  5HRO B;  3PYE A;  2ZHA A;  2XZW A;  3D0G E;  3K7R A;  3AQO A;  5KFM A;  2K7K A;  3OJS A;  1MWY A;  3QGP A;  4ZVH A;  5DQI A;  1HWI A;  3H20 A;  5KT7 A;  1SC3 B;  4Z7C A;  3WC2 A;  3FCV A;  2KKH A;  4OFZ A;  1U1M A;  4F8R A;  2VBX A;  2HVZ A;  2ZDP A;  4NLQ A;  1P6T A;  4CT8 A;  1X5T A;  3BGU A;  5GAH U;  4XPE A;  3MAQ A;  2ACM A;  5EGY A;  2QLX A;  3TVK A;  1VQ8 S;  2CVI A;  4JI5 J;  2YNF A;  2VU5 A;  2X7I A;  4DV0 F;  2Q3P A;  3BR9 A;  4IRK A;  1YVF A;  3G82 B;  4R5P B;  3CPW R;  4ECQ A;  4MYU A;  5L1L A;  4OMF G;  5F41 A;  3IO1 A;  3PKM A;  4QW8 A;  2HQG A;  5E3P A;  1L3K A;  5KT6 A;  2BJ3 A;  4HDG A;  2RQC A;  2C28 A;  1XMB A;  3HT0 A;  3RBZ A;  3KK3 B;  5D0H A;  2QLF B;  5B0D A;  2XI3 A;  2YY3 A;  4AL7 A;  1K1Q A;  2KZZ A;  2RVJ A;  1SJR A;  5GAD I;  3CCE S;  2L08 A;  1JXL A;  1DQ9 A;  1NME B;  1Q79 A;  3FEX B;  2ZBP A;  1HNX J;  2A18 A;  3FDS A;  3O44 A;  1C4A A;  2BV3 A;  1CC7 A;  4DPO A;  1ZTW A;  1JLG A;  3E2E A;  2GML A;  2OH2 A;  2IY5 B;  5D8H B;  1RT1 B;  3V2U C;  3TW0 A;  4LF7 J;  3T5L A;  3VZH A;  1AFI A;  4YY3 J;  1W2I A;  1IBM F;  5E3A A;  1REV B;  3CMQ A;  5F0U A;  2LLZ A;  4EO8 A;  3OUY A;  4NEY A;  3TUZ C;  2C22 A;  4KGK A;  3EXY A;  2K7J A;  2ADC A;  1RA6 A;  2YKM B;  4JB8 B;  4C8K A;  4B3T F;  1QSL A;  2HHH F;  4OLP A;  4DOZ A;  4CM2 A;  2LP4 A;  2HAI A;  2OPR B;  1ZOT A;  3D3B J;  4MK7 A;  2FHM A;  2UP1 A;  2QN6 B;  1P1L A;  1RWX B;  1SQG A;  2DEI A;  2RQM A;  3CO9 A;  1NJW A;  4CLP A;  4RBU A;  4RUB A;  2ZZM A;  2CJA A;  3FCW A;  2M88 A;  1Y5I B;  2QIF A;  2PO4 A;  1DRZ A;  1ZYQ A;  4PQU A;  1WNE A;  3G8Q A;  1SUQ A;  1VS3 A;  2HVE A;  3KHR A;  2KL8 A;  2X51 A;  4ED0 A;  5A2Q Y;  4QYZ K;  4NZ0 A;  2UXB F;  1FE0 A;  3OL7 A;  3I87 A;  3QRQ A;  1FRH A;  4DV3 F;  1RDR A;  2D1C A;  2V4R A;  2AHO B;  4FYY B;  4KSE B;  3SBM A;  2KG0 A;  4Y28 C;  5DJB A;  2RU3 A;  3DI6 A;  2WVD A;  3C6U A;  3AHP A;  3KLG B;  3D6M B;  1YRT A;  2HWH A;  2P6T A;  1TVR B;  4FYX B;  3TOQ A;  3HVR A;  1XIQ A;  2J7U A;  3MEG A;  4QYR A;  3TYT A;  3EXC X;  2FJV A;  3BBB A;  2RIL A;  1S6O A;  3W62 A;  1D9D A;  2VA3 A;  2HVH A;  1KON A;  5KFF A;  1BC6 A;  1A7G E;  2DNY A;  2HFV A;  4RNH A;  5HLF A;  1JXV A;  5KFK A;  3G8T A;  5A0Y B;  4LSN B;  4BC9 A;  3EGV A;  5F9L A;  1ZAX A;  5K9F A;  2K06 A;  4W4M A;  3DN9 A;  4Y2I A;  5LJ5 Y;  1TFY A;  1PAU B;  3FEZ A;  3MCM A;  1EKS A;  4IOA Q;  1N5Q A;  4WXO A;  3W63 A;  1HBM A;  3A13 A;  4F36 A;  3Q8P B;  1VDH A;  1VQ9 S;  4C0H A;  1GTE A;  4LF9 J;  1CVJ A;  3PAC A;  1Q8I A;  3KMS A;  4ECX A;  1WHX A;  1RT5 B;  1GAO A;  2PE8 A;  3POT B;  1CG2 A;  4ZCL A;  3RAM A;  1PYS B;  2NQP A;  2K2P A;  3R7N B;  3T5H A;  4RUC A;  5B0G A;  3TWZ A;  2HK3 A;  1WTB A;  5JMN A;  3ILO A;  2DH8 A;  4RWX A;  2BJ1 A;  2IIH A;  2MLX A;  3M4X A;  5ADZ A;  4P6Q A;  2R4F A;  1UZH A;  4DFM A;  1LV5 A;  2HYI B;  3QJP A;  2E1P A;  2KTQ A;  4DL6 A;  5HAO A;  3QT6 A;  1S6Q B;  2J6U A;  4I67 A;  4NLG A;  2DNH A;  4B17 A;  1YK9 A;  2ZEJ A;  3PYD A;  3GCX P;  3LQV A;  2X3G A;  4I2P B;  3MUT P;  1CUL B;  1T94 A;  3LAN A;  3PXG a;  3J7Z T;  3IGN A;  4H4K C;  1FA0 A;  1NK0 A;  2VV5 A;  4YOE A;  2ZKT A;  3RGI A;  3HFK A;  3SCI E;  1S10 A;  2B8Q A;  4IO1 A;  2I2Y A;  4JI3 J;  2LU2 A;  1ZM2 A;  3HVW A;  4FS2 A;  2IC3 A;  4NXN F;  1RWU A;  2IVM A;  5A8W A;  4DPT A;  2VBY A;  2PMH A;  1QSY A;  4RO0 A;  4RPF A;  3R9L A;  4JV5 J;  3NWG A;  4NA1 A;  2ASL A;  4A8F A;  2IVY A;  5K14 B;  1APS A;  2AYM A;  3E01 A;  1JLQ B;  3CIZ A;  3HFZ B;  4DQI A;  3NGK A;  3GYG A;  1SPB P;  3AJ1 A;  5LM7 E;  2W25 A;  3EZ5 A;  2AYE A;  1GMU A;  2F5G A;  3LP0 B;  1LXN A;  2D3Z A;  5J2P B;  1UFW A;  5HBM A;  2UUW A;  4OJ3 A;  2AJ1 A;  2ATL A;  4AUK A;  2NLW A;  2WBM A;  3EDQ B;  4KO0 B;  4RUA A;  1URN A;  4K0K F;  2DGW A;  1IBM J;  1IKY B;  3GFY A;  4BLG A;  3MR7 A;  1N33 J;  3BH6 B;  4TY8 B;  2CQ4 A;  2DHA A;  3BDE A;  2W4D A;  1NUE A;  2NPF A;  1HHS A;  3QGI A;  1HBO A;  2B5J B;  3BZQ A;  2V67 A;  3BO2 A;  5H9E J;  4QU6 A;  5IM0 B;  1VRU A;  1Y9O A;  3LGH A;  5AXL A;  3OFF A;  3N5F A;  3DLK A;  2RHQ B;  3SV4 A;  1F9E B;  1CBK A;  2FHJ A;  4KBI A;  2YWH A;  2W9B B;  2JLE A;  1DQ8 A;  4F4X A;  2NPI A;  4DL5 A;  2B3T B;  4ZJQ A;  3CJ3 A;  4FBT A;  1N34 F;  4N8O A;  1PC4 A;  4Q2M A;  2MKS A;  4USJ C;  3R1H A;  4WCE Q;  2IDE A;  1RA7 A;  2BKO A;  2MSS A;  3WQP A;  2PD1 A;  4E2F B;  3MHY A;  1ZM4 A;  1JLB A;  2F1F A;  3ICL A;  2D3O R;  1NDK A;  2BXJ A;  1KOO A;  1HBN B;  2KVQ E;  3ILJ A;  3QWP A;  4F25 A;  5DET A;  1W7W A;  3CED A;  4X65 J;  2GGP B;  4DR2 J;  4LF6 J;  2WAQ D;  1FRI A;  1K47 A;  1PYO B;  3FUY A;  3NAI A;  2A10 A;  2DCL A;  2H5I B;  2PDA A;  2EK6 A;  3BBC A;  3CCL S;  4YB7 A;  3NGT A;  2YNH A;  4DDF A;  1U1Q A;  4B02 A;  2CNO B;  4Q44 A;  2R8I A;  1R6V A;  9ATC B;  3AD8 C;  2GQQ A;  4USU A;  3I9Z A;  2GMJ A;  4A8Y A;  2JEI A;  2FJB B;  4P71 A;  3J80 Y;  2FLP A;  1NJZ A;  3P4U B;  4Y3C A;  3AOA A;  4ZPB A;  2RS8 A;  1T8E A;  1H2T Z;  1GXL A;  3AJD A;  3R2D J;  1FT8 A;  5H9F K;  4DLE A;  2BW7 A;  2UXB J;  1RBL A;  2ZOF A;  3H98 A;  4ECV A;  4K5S A;  3UPF A;  2V68 A;  2FLO A;  4UOH A;  4KIA A;  1IKW A;  2PMZ D;  1Q82 T;  3OVB A;  1RAO A;  3MR5 A;  5G0R B;  4F67 A;  4X4S A;  3A3N B;  6FDR A;  2YPY A;  4NX9 A;  1ZET A;  4JV1 A;  1M1G A;  4HHJ A;  1VBY A;  2AZ1 A;  2HLU A;  1IWG A;  4HL9 A;  4WU2 A;  5KFS A;  3UDE A;  2UUT A;  3TI0 A;  1S7I A;  2VH7 A;  4FDF A;  2PT0 A;  1FJG F;  2Q6C A;  4DR2 F;  4GRS A;  1FXR A;  1X4E A;  2QMU B;  4G65 A;  3UR0 A;  1S1X B;  4DV4 F;  2JFK A;  2VD3 A;  1HLW A;  3NRB A;  3M8R A;  3W7B A;  1TL4 A;  2YNG B;  4EGL A;  5KFB A;  1NDC A;  3MD3 A;  3JSR A;  1ZAV A;  3IR6 B;  4O23 A;  3KLF B;  2FHO B;  4DV2 J;  1RWW B;  4IR1 A;  4ETZ A;  2ZVI A;  1U0S A;  2VAS A;  3DKD A;  2IJN A;  2FY8 A;  3QFW A;  3M8Z A;  4UW2 A;  5AXN A;  3I0R B;  3M7V A;  3IAS 9;  2C3P A;  5IT9 Y;  1PO6 A;  2CPH A;  4G1Q A;  2G1D A;  3PJX A;  5CZX A;  2P5V A;  5C24 A;  3M2R B;  2C2N A;  1UEV A;  2V4J B;  1SL0 A;  4HAC A;  3VWS A;  2GVZ A;  5CAA A;  1S97 A;  1PIE A;  1CQN A;  5LMU J;  1T03 A;  3H90 A;  5B0C A;  2H4W B;  9RUB A;  1J5O B;  4F4Z A;  3QWU A;  5T7L B;  1R8H A;  4EBE A;  5D0E A;  1V3R A;  2Z30 B;  2DNL A;  1TL5 A;  1YSJ A;  4LBP A;  4CRJ A;  4OLO A;  1OY8 A;  2KYX A;  4NML A;  4NLU A;  2VQF J;  1IBK F;  2XGQ A;  1HR0 F;  2F9D A;  3AB2 B;  4J9V A;  2QT7 A;  5IWA J;  3M2V A;  4ZOS A;  1G7C B;  3UE2 A;  3VVT A;  5IT4 A;  4WFA Q;  2QA2 A;  4JV0 A;  3AXK A;  2HS0 A;  2R2R A;  1WSR A;  1XWL A;  3OXF A;  3DRP A;  3QFH A;  4RW4 A;  3TUJ C;  2WON B;  1U1P A;  4IQX A;  2XSJ B;  2IHR 1;  3BGR A;  4IG3 A;  3JSM B;  1ZZN A;  1NJY A;  4USW A;  3HO1 A;  3MR2 A;  4CLW A;  4H4O B;  4UST A;  3SQO P;  3C46 A;  4J9U E;  1SIZ A;  5IC4 B;  3W66 A;  3CCV S;  3SXL A;  4RUH A;  1C0U A;  2I0X A;  2G4B A;  1FXL A;  2WTF A;  4C9D A;  3NG8 A;  4LFA F;  2YH0 A;  3LWL A;  5L1I A;  2KN4 A;  3DRR A;  4GVB A;  3UD3 P;  3PFE A;  1FK9 A;  1S1U B;  2WB1 D;  4PRF A;  1XMQ J;  4O44 B;  1FTR A;  2B0G A;  2Q43 A;  1FTC A;  2CG4 A;  4MKY A;  3J7A 1;  3N6L A;  1YJR A;  5HMY A;  4RW9 A;  1RT6 A;  3K17 A;  5KFC A;  3MZI A;  1N5V A;  3O2I A;  4N7T A;  3GFZ A;  3SSR A;  2CNN B;  1VR6 A;  4QPX A;  4KKO A;  1Y4Z B;  3G6E S;  2ZWO A;  1F0X A;  5ETM A;  1F9H A;  1PCA A;  2Y1R I;  1HD1 A;  2F65 A;  2A1B A;  1VIO A;  1RHR B;  3VGV A;  2VUG A;  1SI9 A;  3PYG A;  3UCG A;  3CMA S;  4B3O A;  4KV8 B;  1DJ0 A;  2LKZ A;  1E6V B;  3P3D A;  1S0V A;  5EUH A;  4ZK7 M;  1S59 A;  1AA1 B;  3MDF A;  1WOO A;  2QSF A;  3O1L A;  2BDP A;  1U2C A;  2YKQ A;  4JUZ A;  2W7O A;  3DRP B;  4M5M A;  1NSQ A;  3JQK A;  3SCJ E;  5H9E K;  2OI2 A;  3JXO A;  4Q2L A;  2XZD B;  2AX0 A;  3GYN A;  3KLH B;  1KHV A;  1NDL A;  2MYF A;  2R7Q A;  5MAO A;  4JI8 J;  4ZN1 A;  4EI2 A;  1RHK B;  1TUW A;  4NLO A;  5E0O A;  1H2V Z;  2IAJ A;  3W2W B;  2XM3 A;  4CH0 S;  1RWN B;  3EM1 A;  2AJ2 A;  2AKW B;  2XMK A;  3M9O B;  5HP1 A;  2BJ9 A;  3MPV A;  5CHC B;  5AXM A;  4EUV A;  5CD4 H;  3QSI A;  2F8E X;  1ZA2 B;  2C2M B;  3A3O B;  1JLE B;  1WOP A;  3CCU S;  1T03 B;  1RCX B;  1NSK L;  1X7V A;  4Y34 A;  2B6A B;  1U6F A;  2R9L A;  1X4G A;  3N4W A;  2RHS B;  3TA2 A;  4A8M P;  3T1Y J;  1KC8 T;  3HVA A;  2HEK A;  2JVO A;  1RT3 B;  3Q2S C;  1IBC B;  2DTJ A;  2OML A;  4J7C A;  3OTC A;  4JI2 F;  4DR3 J;  1L3S A;  4JI6 J;  1LWF A;  1T3O A;  2R8J A;  2FIU A;  3HSD A;  3QIP A;  4RNF A;  3L09 A;  3QID A;  2XUL A;  1QDU B;  2I6W A;  2OSR A;  5IV3 A;  3KK1 B;  5EWE A;  4A8K A;  1HBU A;  3VAF A;  2RRA A;  4O0N A;  1RT7 A;  1QD1 A;  2XMU A;  2QSW A;  4WKY A;  3OLB A;  3GV5 B;  1W2B R;  1RWK B;  3PJ9 A;  5J1N A;  2V9K A;  1TK8 A;  5KFN A;  3MPD A;  4J90 A;  1YIT S;  2XLK A;  1OPI A;  1WUU A;  2R42 A;  4WE1 B;  1VCT A;  1YGY A;  3G86 A;  3IG1 A;  2UV8 G;  2VKZ G;  3PNI A;  4M5J A;  4RBT A;  3JAM Y;  4DF4 A;  2WOM B;  3BO4 A;  1PG5 B;  2I38 A;  4FVM A;  3IWX A;  1Q4R A;  4JOU A;  5EX0 A;  5G0R A;  3W2W A;  4QCL A;  4X4U A;  2Z2Y B;  2BA9 A;  2EFP A;  4YUD A;  3R97 A;  3KHH A;  1DLO B;  2EXU A;  2YWF A;  2ZBI A;  2VKR A;  3RJM B;  1KNZ A;  2IM2 A;  2JDJ A;  3B82 A;  4X65 F;  1C0U B;  1M5H A;  2NZC A;  2VBW A;  1NK5 A;  4FXD A;  1ZM9 A;  1P27 B;  2HFO A;  4TLQ A;  8ATC B;  3PV8 A;  2BJ7 A;  3ADA C;  2UU9 J;  5KFL A;  2X3D A;  1KVK A;  4LR7 A;  1CJT A;  3W60 A;  3PX6 A;  3CWJ A;  2XSJ A;  3HHL D;  5F8M A;  3M6X A;  4DN0 A;  4DU8 A;  2OD4 A;  5DO2 A;  4OX6 A;  3OFE A;  4RW4 B;  2DH7 A;  4DPY A;  3RW7 A;  2Y9H A;  1YDL A;  1U6B A;  1PKU A;  1T95 A;  1B7Y B;  2H54 B;  3MEE A;  3J80 U;  1FES A;  4I2P A;  3HKZ D;  1A9N B;  2BM1 A;  4I2Q B;  1P8G A;  2Q66 A;  4B9U A;  1PC5 A;  1RTZ A;  2FYX A;  4OJ1 A;  3W9H A;  3GG1 A;  7FD1 A;  2C2D A;  1UVM A;  2LEA A;  2LA6 A;  2UUA J;  4MMO A;  5IQQ A;  2J6S A;  1JJ2 R;  2PEH A;  2ZH9 A;  4NCB A;  3DDI A;  4DSK A;  7AT1 B;  2XMV A;  1FK9 B;  1S1U A;  2AGP A;  2L3M A;  1NKB A;  2JNJ A;  1RAB B;  2VFV A;  1UW4 A;  1TUV A;  2W2P P;  2YX7 A;  4HAC B;  4RW6 B;  4Y65 A;  1SKW A;  4OX9 J;  2AJF E;  3BF4 A;  4K4U A;  1GX6 A;  1LXJ A;  1JJH A;  1Q5V A;  5KFZ A;  1LK5 A;  3SSQ A;  4F4Y A;  5DG7 A;  3HJV A;  3KLI B;  1YQH A;  2FZG B;  4PPZ A;  1FER A;  3CC4 S;  3K57 A;  4IO9 Q;  3DDK A;  2D3O 1;  2UU9 F;  1ZS6 A;  3OTO J;  1WAC A;  3TR5 A;  4ZMM A;  1N36 F;  1U8S A;  3PR5 B;  4OQJ A;  1HYS A;  5HQL A;  1OSD A;  1R89 A;  1IN0 A;  4LSN A;  5HN0 A;  3U02 A;  4I7F A;  2HVD A;  1N6Q B;  2R7V A;  3FFI B;  3VZI A;  4B9L A;  2GIR A;  2E5G A;  7FDR A;  4DCP B;  2RD5 C;  1RYS A;  1RJJ A;  2JVR A;  3HCX A;  1PBU A;  4JI0 J;  2B9W A;  3JSB A;  3D1O A;  2YWK A;  1QAI A;  2CQ1 A;  1S1W B;  5AXK A;  2BBE A;  3T1H J;  3PIP Q;  1F3V A;  4PKD B;  3ZO7 A;  3Q22 A;  1T05 A;  2XMT A;  3P49 B;  1HD0 A;  4ZLJ A;  3PX4 A;  2BQ3 A;  2D41 A;  1U1O A;  1YTY A;  5A8W B;  1KSP A;  1H38 A;  1VBK A;  1KFS A;  4ES1 A;  2V4J A;  3T1Y F;  2DXF A;  4TY9 A;  4OX9 F;  4ZP9 A;  2QEX S;  3CJR A;  3D0I E;  2CJK A;  2J8A A;  3HVT A;  2V2Q A;  2QC3 A;  1N88 A;  4I69 A;  4JI6 F;  2BM0 A;  4WP9 A;  5A6W A;  1WG1 A;  1X8D A;  3IRX A;  2ABY A;  1PSD A;  4MK9 A;  4A4J A;  2CAD A;  1VQ4 S;  3NCP A;  2OJ3 A;  2R8K A;  2RKI B;  3OHA A;  4XK8 C;  1NK9 A;  1HA1 A;  4PG5 A;  1FDB A;  1JLC A;  3NBP A;  3R7B B;  2ZUG A;  5KFO A;  2XY6 A;  3PYF A;  3MTK A;  3O6Q A;  3S6E A;  4CTA B;  4F3O A;  4C3L A;  3IG1 B;  3M8W A;  4HR2 A;  4U7C A;  4J9R A;  4CLU A;  4OJG A;  3Q8R B;  3OHB A;  3KJV B;  1HNI A;  2CDR B;  3V4M A;  1GTH A;  1VJQ A;  4M94 A;  3W8G A;  1HBN A;  4QOT A;  2A0F B;  5D77 A;  3KLE B;  4X62 F;  3MEC B;  1ZBT A;  3TA1 A;  4JI2 J;  3FNN A;  4ELT A;  1OIA A;  1X31 C;  3DLG B;  1EZZ B;  3C19 A;  4HTI A;  2FVC A;  4LRD A;  2HFN A;  1K9M T;  4PWD B;  3N28 A;  3PHT A;  4N77 A;  1Z2Z A;  4TQR A;  5BXI A;  5IZH A;  4QIE A;  1YJW S;  1KTQ A;  3I0S B;  1NXI A;  5E3C A;  5ETV A;  2MJN A;  3AAW B;  1HQU B;  3AXM A;  3QIP B;  5ETN A;  4DHV A;  1T3N A;  3EIC A;  3R3T A;  2YWW A;  1P9Q C;  3LTO A;  4URQ U;  2UXC J;  1RTI A;  1YJ7 A;  3CT9 A;  3U1L A;  2FJW A;  2UUC F;  4F4K A;  4OZ5 A;  4YN3 B;  4MKB A;  4O3Q A;  4JI4 J;  2OUG A;  1HBO B;  2B5J A;  2LDY A;  1IQT A;  1C4C A;  1VQN S;  3KK3 A;  4C4W A;  3G6X A;  2KT5 A;  2QL7 B;  1XQI A;  2J0Q D;  4PXC A;  3B6B A;  3BR8 A;  2LQ9 A;  1FX4 A;  4ID5 B;  3VR1 A;  3NNA A;  3J81 j;  3OTE A;  2PGC A;  5B0F A;  1H2U X;  4H4M A;  3IM8 A;  1BHN A;  2EKY A;  3C66 A;  1TR0 A;  3P45 B;  1CQM A;  1NU4 A;  1QAX A;  3TNV A;  3MFH A;  4CO1 A;  1UVK A;  2DIS A;  1JLB B;  1YKW A;  4IH5 A;  4ES2 A;  2IMO A;  2V5H G;  4FPR A;  2CIM A;  2DNP A;  3WBZ A;  1UVL A;  1LOU A;  3MI7 X;  4WFB Q;  2U1A A;  4A8O A;  1NK4 A;  2IYG A;  3BV8 A;  5D0R A;  2W7P A;  1N52 B;  4RNN A;  4YY3 F;  3IR5 B;  4FYD A;  2LCW A;  1GH8 A;  1VYA A;  3ZTQ A;  4M5I A;  2LXF A;  2ASY A;  4CZC A;  4OYP A;  1OO0 B;  3D0H E;  5HO4 A;  1FJG J;  1MMN A;  4I56 A;  1X4B A;  3FRZ A;  3M2U A;  3JTN A;  2DGQ A;  2YKA A;  4G6V B;  4JI7 F;  5RUB A;  2HHH J;  3OPK A;  2Z56 B;  4KHP F;  5C5J A;  4QR2 A;  1ZA1 B;  2Z58 B;  4B3M J;  4I64 A;  1MRO B;  3X1L B;  1WOR A;  4IG0 A;  3QAE A;  1VC5 A;  4KPY A;  3VAJ A;  4DR7 J;  4K4T A;  5LL6 d;  5SUH A;  2XQC A;  3CGI A;  4A8X A;  4O0I A;  3HXM A;  1HW9 A;  1UTA A;  3KYL A;  2VIC A;  2B9X A;  1YZ7 A;  2RF2 B;  4AD6 A;  3PVX A;  2EK1 A;  3ULH A;  4KGM A;  4IFY B;  2KRB A;  1LQ9 A;  3LPE A;  4NLP A;  4USH A;  2HG4 A;  2DGO A;  3ISN D;  3P6Y C;  2KDO A;  4OYA A;  1B70 B;  3THP A;  2HW3 A;  2GAG C;  4ANE A;  5LXY A;  2MLY A;  3GTY X;  1T9Y A;  1AT1 B;  3NWR A;  4HHU A;  4C0B A;  1KRP A;  3UDL A;  1I6J A;  3TO8 A;  4IG3 B;  3QT5 A;  3G96 A;  3TUP A;  1JLA B;  5JJB A;  2KXN B;  2EVZ A;  1FNO A;  3K5L A;  1S9E B;  2CPD A;  4CO4 A;  3FMB A;  2KJW A;  4IFV B;  1Y00 A;  3CJK B;  2O67 A;  1CUL A;  2F8M A;  3I5B A;  4QWC A;  2HLT A;  4ZS6 A;  2XLI A;  3GSI A;  1KHW A;  1RIS A;  2F8H A;  4K5R A;  4OYO A;  4P2F A;  2AD9 A;  4W92 B;  4QR1 A;  3J81 Y;  3C14 A;  4NE9 C;  3UD4 P;  1FKO B;  5K20 B;  2M8D B;  2AJ0 A;  3VGT A;  1N5Y A;  4LF5 J;  3HF5 A;  4CT9 A;  4DR1 J;  2DRA A;  3G87 A;  1FKP B;  4FYV B;  1L3U A;  4DWI A;  1VGY A;  2DNM A;  4DI6 A;  1LWE B;  3TRG A;  4ED6 A;  3C6T B;  1MW7 A;  2PMW A;  3NNH A;  1MMD A;  4WK3 A;  5M2R A;  3K89 A;  4UZC A;  4NLD A;  3T1A A;  3LAM A;  5KG5 A;  1KR4 A;  1MU2 B;  2FB0 A;  2IYI A;  5HL7 Q;  2SXL A;  1UFL A;  2WSC C;  4CLY A;  4B9S A;  2RIJ A;  4B3R J;  2MQM A;  1N4L A;  3ZFV A;  1HAR A;  4X64 J;  1AXQ A;  4IQM A;  2BZ2 A;  2OPP A;  3VAH A;  3HT3 A;  4NLV A;  4O4G B;  4U95 A;  1IVZ A;  4OV1 A;  1Q86 T;  2LEC A;  2HBQ B;  1EET B;  2BAC A;  4F50 A;  2EEY A;  1EB0 A;  1D09 B;  2HS4 A;  1Q53 A;  2ZBQ A;  3C6T A;  3GJT B;  4KQZ A;  3FSI A;  1TKD A;  2KZM A;  4ZVE A;  1F2G A;  2C2R A;  1FKP A;  2KYZ A;  4AE5 A;  4J9P A;  1OY9 A;  2V8V A;  3FSY A;  3TJ8 A;  2JLG A;  1VOM A;  2V50 A;  3MMB B;  3QLH A;  5DZ6 A;  4XPC A;  5L39 A;  3QAU A;  1FNM A;  1Q8B A;  2B4U A;  2LYV A;  3G2X A;  1T02 A;  1VHI A;  2DYA A;  3I4P A;  3A4T A;  4IG0 B;  4PR6 A;  1XNR J;  1CS4 B;  2CVE A;  4ZVP B;  2ZH8 A;  3BQ0 A;  3ZTO A;  3CC2 S;  4N56 A;  1NO8 A;  2J7K A;  2IBK A;  1GQE A;  1S9E A;  4FNH A;  1B7F A;  2Z57 B;  4BC7 A;  3K5M A;  2MTL A;  2PN6 A;  1JLA A;  3HHN B;  3UO0 A;  3HHL B;  2YQ0 A;  2BE9 B;  3EVO A;  4GC6 A;  1RAA B;  2BAN A;  2ZBR A;  4K7Q A;  3UDV A;  4LIR A;  5LJ3 Y;  4GKK F;  1R8B A;  2YNH B;  3M6V A;  5GAE U;  1WF1 A;  3D54 A;  3BM7 A;  4FN5 A;  4DS4 A;  2LQJ A;  4P72 A;  4CLF A;  2J76 E;  2CG8 A;  4YDX A;  2QJ3 A;  4ER8 A;  2E5H A;  3CJQ A;  2ILY A;  4ED2 A;  2DHG A;  2CAJ A;  2LXU A;  4WYW A;  5DDQ C;  1H72 C;  4WII A;  5BJR A;  1HI8 A;  4YP3 A;  1IR1 A;  2CJX B;  3NP5 A;  1FFW B;  2CZ4 A;  2WSE C;  4AYB D;  2E7W A;  1RBA A;  3NGU A;  8AT1 B;  2HHX A;  1AUS L;  3MCN A;  5JVG Q;  3FEY B;  5F3Z A;  4LF5 F;  1PGZ A;  4CLS A;  2DR5 A;  3MR6 A;  2A2C A;  1ZPV A;  2ZHB A;  1YIJ S;  1PJ6 A;  4I6A A;  2FLL A;  3MUR P;  3NCQ A;  4KGX B;  4QPT A;  1HFE L;  4QZV B;  1K8A T;  2QG9 B;  1HWJ A;  3WZ0 A;  1CJK A;  2AQ4 A;  4ALZ A;  2KHC A;  3TAN A;  3Q86 A;  4JI7 J;  2VOD A;  3QO9 B;  2Y0S D;  3AFG A;  4OZ2 A;  2QFJ A;  1ZAW A;  4D3G A;  3MR3 A;  2DHX A;  1Q16 B;  3UN2 A;  5KFP A;  1UKU A;  1QAJ A;  1YWX A;  4TU9 A;  4OI0 A;  4JYA F;  1IKY A;  4QWB A;  3LGM A;  3OXL A;  1ARO P;  5HAT A;  1SJQ A;  1MG7 A;  3Q83 A;  1I94 F;  4R5P A;  1HNZ J;  5K8M A;  3C16 A;  2MY8 A;  1IM6 A;  2YNF B;  2B4V A;  3TVY A;  4DX5 A;  1SJ4 P;  4F0M A;  1RHU B;  3H42 A;  4LT6 A;  2R7R A;  2E5L F;  1U48 A;  3M6U A;  3SQG A;  5KG6 A;  1UZD A;  3UN3 A;  5EHH A;  3KJV A;  2HQI A;  4PXE A;  1YBU A;  3VAK A;  5CYM B;  3MMA B;  2ALY B;  3DMJ B;  3P5T L;  4KH1 B;  4EU0 A;  1S0N A;  3VVU A;  3K2Y A;  5EWF A;  3OT9 A;  4LRB A;  2ZH7 A;  2MZT A;  1M90 T;  2GJF A;  4ECY A;  1UVI A;  2UV8 A;  3N5B A;  5BR8 F;  2MZQ A;  1M1K T;  4WFN Q;  3IN5 A;  1U45 A;  4JP8 A;  1ULR A;  1Y10 A;  2EBG A;  2H3E B;  4IH7 A;  4UUX A;  2JRS A;  4ZLP A;  4F02 A;  1RU2 A;  3JTO A;  2V4Q A;  2W8L A;  1U02 A;  1S9G B;  3SFU A;  3CD6 S;  3MM7 A;  2C3U A;  2BEF A;  4CO3 A;  4N5S A;  2UVU A;  1C1B B;  3MEC A;  3D1Q A;  2KHD A;  3F0N A;  1R0C B;  3I32 A;  2W2O P;  2EG2 A;  4OI6 A;  2IBO A;  2ZFH A;  3ETM A;  4H4K A;  4U7U K;  2FC8 A;  2RF2 A;  1Y11 A;  2FZC B;  3I5C A;  4EEY A;  4O4G A;  3CF5 Q;  3IWN C;  2HAF A;  1C0T A;  5LT5 A;  3FCH A;  2XGP A;  2FHJ D;  4ED8 A;  3ZZT A;  1MRO A;  1UVJ A;  4OZJ A;  1GT8 A;  4MKA A;  4L75 A;  2IA6 A;  2ZNZ A;  3PO4 A;  1WEY A;  3AJ2 A;  4B08 A;  2QTW A;  4M5H A;  1NJI T;  3BYP A;  2W9A A;  1U7L A;  2H4Y B;  3QT8 A;  2ROE A;  2MY7 A;  2FVQ A;  3AH6 A;  3TP2 A;  1F2H A;  2CQP A;  2V8G A;  2HHW A;  2DH9 A;  2XSF A;  4V19 J;  1UCN A;  2DT9 A;  2U2F A;  3I4H X;  5F8H A;  1T9X A;  4HI1 A;  4YR0 A;  2NSC A;  2GZO A;  4DX8 H;  4F4W A;  1NZA A;  5CYM A;  2UUB F;  5DG8 A;  1SVD A;  4JI1 F;  3DM2 B;  3M8P B;  1Q7L B;  3CCJ S;  3CCT A;  4L73 A;  3SQG B;  1U49 A;  1Q95 G;  2JH3 A;  5L9X A;  3ENW A;  3OXG A;  3V4I B;  1TK5 A;  2IMW P;  2LQB A;  4RJV A;  3L9Z A;  3MEE B;  4B3T J;  3IS9 A;  4KJI A;  1UA0 A;  2HPU A;  2X1A A;  1NKC A;  1S0O A;  1ELO A;  2H65 B;  3D2W A;  3SZ2 A;  4ELV A;  4DSJ A;  3SCK E;  1OMS A;  2Z8Q A;  2IVF B;  3U1N A;  1XMO J;  3HPO A;  2DGS A;  3QGG A;  3KFW X;  2ZH1 A;  3OR2 B;  1DTQ A;  4DX6 A;  1G6B A;  1RAE B;  2KU7 A;  1OSC A;  1TKZ B;  3BGF A;  2YKM A;  2G2O A;  4O3N A;  4C48 A;  5HMX A;  4JI5 F;  2NXJ A;  1WHW A;  3OW2 R;  4Y2K A;  6FD1 A;  4X4N A;  1HNV B;  2VB6 A;  1WG5 A;  3H2U B;  3TEH B;  3QPI A;  4PQA A;  1RT4 A;  1NJX A;  1QAY A;  1DHM A;  4IR9 A;  2AX1 A;  1QLN A;  2X1G A;  4CI0 B;  4P7V A;  2QYG A;  4CYU B;  5ETS A;  4NLY A;  1MN7 A;  2HFZ A;  5F0W A;  3J81 U;  4OL8 A;  2HGN A;  1S6P B;  3TUI C;  1XER A;  3D9B A;  4P2X A;  3HP6 A;  2ZM6 J;  2BAB A;  4L6V 3;  2V0N A;  2BKP A;  4ERD A;  2ZZT A;  4DL4 A;  1RTD B;  4LF6 F;  1WG4 A;  1HNI B;  3WIV A;  2XMM A;  3OL9 A;  2P9E A;  3D66 A;  1S12 A;  3L4B C;  5AE3 A;  2GHV C;  1B99 A;  3M30 A;  1RCO B;  2PI4 A;  1XNQ J;  3FBE A;  3QRP A;  3HMJ G;  5IT9 U;  2OPP B;  4ZDN A;  4DN9 A;  1TL3 B;  4K2J A;  4MK8 A;  3DU5 A;  3VF0 B;  1T9V A;  1XBW A;  2YBV A;  3QZ7 A;  1Y0H A;  2RUS A;  4BHQ A;  4XIU A;  1KD1 T;  2MB0 B;  2YQ3 A;  1NSP A;  2DNN A;  1RHQ B;  3FBF A;  3RAQ A;  4ZHR B;  1FKA F;  1HNX F;  2DK2 A;  5D6G A;  1CS4 A;  3SCL E;  4ZIW A;  3OTB A;  2CJQ A;  2NZ4 A;  3ITH B;  3ETO A;  1T7P A;  3H0P A;  3MWB A;  3N01 A;  3C15 A;  4C97 A;  5C7P A;  3J7Z 5;  3M8Q B;  3IBW A;  4QWE A;  3RB6 A;  3I55 S;  3PTW A;  2BYC A;  2ZC3 A;  4Z7Y A;  4FZV A;  2NYH A;  3W9J A;  2LXI A;  1VRT B;  1KOH A;  3KJQ B;  3R5D A;  1Y5L B;  2MQ8 A;  4CH7 A;  4ZPW R;  3KLH A;  5CH7 B;  2HQ3 A;  2V8D A;  2HZC A;  1HHQ A;  4URG A;  1PIL A;  2HBY B;  3I5A A;  4PWW A;  4Q7A A;  3KJF B;  1FVQ A;  3MCS A;  2PC6 A;  2YKN B;  3A3P B;  3D1H A;  2G0J A;  2MEW A;  2FJE B;  4OI2 A;  3VTI A;  2OIH A;  4DSL A;  3BKT A;  3Q8Q B;  2B8P A;  5DM7 Q;  4PPD A;  1B0T A;  4B9T A;  3U27 A;  4WP3 A;  2OSQ A;  2VFS A;  2FDN A;  2EI5 A;  4E98 A;  3PZP A;  2Y1I A;  3EJM A;  1LWE A;  1N33 F;  2E29 A;  3EWG A;  1EHW A;  2XS7 A;  2J9D E;  4K2X A;  1IJF B;  1TKX A;  5D3G B;  2FJX A;  1DY3 A;  4ATN A;  4UUW A;  1S99 A;  1C1C B;  4I4B A;  4MJK A;  3ELH A;  4MIB A;  2K8G A;  4RW9 B;  1FEE A;  2E7X A;  4DG1 A;  4GC7 A;  1D0E A;  4HKQ A;  1BY9 A;  4K0K J;  1PAE X;  2P8I A;  3EPI A;  5ETT A;  5FDL B;  4YDD B;  3D68 A;  2HRT A;  5DGB A;  1QE1 A;  4BS2 A;  1I94 J;  2QLW A;  1QUP A;  4I2Q A;  2OPQ A;  3DRR B;  4NI2 A;  4PZV A;  3RBX A;  3H2L A;  2VQE F;  4DLG A;  4IFV A;  1NAQ A;  3NNC A;  1OYE A;  2CQI A;  1CPZ A;  1RTH B;  1UEK A;  1WJ9 A;  2YNI A;  3CNQ P;  5C2C A;  4C0O C;  4IUF A;  4LF4 J;  2OLW A;  4H4O A;  1CJT B;  3I31 A;  1RTJ A;  1VQY A;  4K4W A;  4AQY F;  1KLM B;  1UVN A;  2LA4 A;  2GA7 A;  4RNM A;  3JSM A;  4NYZ A;  1BE4 A;  1JB0 C;  1X0P A;  3F56 A;  2XTJ P;  3W64 A;  3MOJ B;  2A3J A;  1QTN B;  1XNR F;  1JJ4 A;  4Y2A A;  3DOK B;  3PX0 A;  3EZU A;  3G8S A;  5L9N A;  3HM9 A;  3UD5 A;  1B0V A;  2W2M P;  1YRU A;  1ZZF A;  3R5B A;  4ITS A;  5E3R A;  3ZNU A;  1X60 A;  1VI7 A;  2H9Z A;  4L72 B;  3UCZ P;  5C42 B;  4LIW A;  2AMC B;  1BWE A;  1TAU A;  1TTH B;  3W5Y A;  3MM6 A;  4K4S A;  2G2Y A;  1TL1 A;  2F9J A;  1ZTT A;  1FRK A;  2G2Z A;  2E44 A;  1N36 J;  5T41 A;  2WOM A;  3M9N B;  2CPF A;  4ZPV R;  3SIP B;  1RAF B;  1EJ7 L;  4RW7 B;  2NYI A;  1J5O A;  2DBB A;  1RP5 A;  1JKH A;  1FCA A;  2WB4 A;  1VHF A;  1WI8 A;  2LQ8 A;  2WVC A;  3CD5 A;  4MTP A;  1YG0 A;  2XO7 A;  3GIM A;  1N0V C;  1OQ6 A;  2EFQ A;  2BE2 A;  4RKU C;  2CPZ A;  1HQ2 A;  2DR7 A;  2E1A A;  2ZE2 B;  4G1Q B;  1R3N A;  3DLH A;  2DGX A;  1BLU A;  3ENA A;  3HD1 A;  1RTI B;  3PO5 A;  4FKX A;  4C98 A;  3A8J A;  4DUY J;  2IPO B;  4LR8 A;  2BJ8 A;  2I5J A;  4KHR A;  4WFY A;  3KK1 A;  1UPP A;  2Q6B A;  2ZH6 A;  2WON A;  1TZ0 A;  5A8K B;  2XC9 A;  3GV8 B;  4OHV A;  2MMY A;  1MWQ A;  2CPX A;  2XHW A;  5AT1 B;  3CCR S;  4GKJ J;  3NCR A;  4J9M A;  1S76 D;  1U26 A;  5C25 A;  2QV6 A;  3S1T A;  3ZZY A;  4KT0 C;  2O1P A;  5J1E B;  1KVJ A;  2W24 A;  4C11 A;  5I3U B;  2B7C B;  1DTT B;  4DV4 J;  2ASJ A;  4KR0 B;  4O4R A;  3PW0 A;  3OL6 A;  2CQC A;  2F4V F;  5BYQ A;  1FJC A;  1EQ0 A;  3C15 B;  1JLC B;  4P74 A;  1MLA A;  2AP6 A;  2CJ9 A;  1S1V B;  5F8L A;  1SIW B;  5KT3 A;  1H6K X;  4X66 F;  3M8S A;  4J9K A;  2FVR A;  2VBZ A;  4ZPD A;  1HNZ F;  1JWW A;  2MLZ A;  4NMX A;  4DU7 A;  3PW4 A;  2ASD A;  1DFD A;  1X5S A;  5DDR C;  1UL3 A;  2HIY A;  2JZ5 A;  4WTY A;  3V81 B;  2C2E A;  1O51 A;  2JEJ A;  1YRX A;  3M1V A;  3FGV A;  1R8A A;  3GZ7 A;  5CZV A;  5K8O A;  2ROG A;  3I0S A;  3MPY A;  1B64 A;  1S1V A;  4ZPA A;  1LKZ A;  3KDN A;  5GAG U;  3QJL A;  4W90 B;  1OJ4 A;  2VFU A;  4Z37 A;  3BBF A;  4DR5 F;  4O3S A;  1X4F A;  4HH0 A;  5C2G A;  5KG2 A;  1XMO F;  3JQM A;  3H5U A;  5CYQ B;  1S1X A;  1Z4U A;  2DHH A;  2GV1 A;  3THT A;  2FGC A;  3N9U C;  3TX8 A;  5I3U A;  2AYB A;  2A2D A;  3PFO A;  4J37 A;  1NM2 A;  3GFH A;  4K4X A;  1H0H B;  1HWU A;  3QNW B;  5IXU A;  1M5P C;  4DR6 F;  3CO0 P;  5IWA F;  1S6P A;  4R0J A;  3DC2 A;  1RHM B;  1GK8 A;  3WIU A;  5A2Q U;  4KHP J;  5ETL A;  2CYY A;  2KH9 A;  1UFK A;  3NBP B;  4OI3 A;  2HKE A;  3H5X A;  2VJV A;  4DQP A;  2VG6 B;  3GIL A;  1RT4 B;  1GMW A;  1F60 B;  4S0M A;  2WRM A;  3M32 A;  4WIQ A;  4LFC J;  1HYS B;  3DRS A;  5KFJ A;  2I5J B;  4YR2 A;  1JX4 A;  4GVB B;  4FXW A;  4WFZ A;  5D4O A;  2ZM6 F;  3Q89 A;  4DV0 J;  3RG6 A;  5KOX A;  4NLX A;  1DTQ B;  3CD7 A;  1WWH A;  4TXS A;  2L41 A;  4QIF A;  1YHQ S;  1RUS A;  4YR3 A;  1X4D A;  4F0K A;  3EVM A;  4IOB A;  5ETR A;  1F5A A;  2CQB A;  4B3S F;  3UFC X;  2RDJ A;  2D69 A;  1UA1 A;  1VQ7 S;  2PI5 A;  3CUN A;  3HX9 A;  4XO0 A;  2QL5 B;  2ZNY A;  4NCA A;  1TL1 B;  2MDA A;  1S72 S;  3HHE A;  5J1E A;  1RB0 A;  3M2V B;  3ILL A;  3MXH P;  5L46 A;  1KS2 A;  1TU0 B;  3U1M A;  2COL A;  3AQP A;  3KWM A;  4RU2 A;  3R2C J;  3JSY A;  3PIO Q;  2CA9 A;  3S7R A;  1PJ7 A;  1VQO S;  3EVW A;  1VQ6 S;  3DOK A;  4Y00 A;  4Y0F A;  3AOB A;  2P2C B;  1NLK L;  4I7F B;  1IKV A;  3FBC A;  3OJU A;  3GII A;  2ACY A;  1RTJ B;  3ZXW A;  1YJN S;  4IRC A;  4PXB A;  5EWG A;  4LFB F;  4NXM F;  3ZTP A;  1G2E A;  2MKJ A;  5C24 B;  2HBR B;  4OYW A;  3G6Y A;  1RK8 A;  2ALZ A;  3L3C A;  1X9S A;  1O0P A;  1RQ0 A;  3H4B A;  4DQS A;  2FUG 9;  3I0R A;  4MYT A;  5CYJ A;  4DL3 A;  2ZE2 A;  3RR8 A;  1AFJ A;  1UEU A;  1W26 A;  1OS5 A;  1RKJ A;  2RQ4 A;  3T5J A;  1N48 A;  3RTV A;  2DNQ A;  3UDC A;  3GPA A;  3B4M A;  1SKR A;  1S6Q A;  1RGV A;  1VK3 A;  2BUN A;  2K3K A;  2BOP A;  2DGU A;  1M5O C;  1C0T B;  5IFM A;  2AT1 B;  1NB7 A;  3UVJ A;  2UVV A;  1Q81 T;  1YI2 S;  3H2V E;  5EN1 A;  1ZM3 A;  3MM6 B;  2ZJP Q;  2AEF A;  2J5A A;  4TQS A;  5D3G A;  3TJA A;  3MUM P;  1SB6 A;  4QIW D;  2NXE A;  5THW A;  1KP6 A;  3W2V A;  1SH3 A;  2ZJR Q;  4UTG A;  2GO8 A;  2DJW A;  2MKC A;  2Y1L B;  1AB8 A;  3E01 B;  2CRL A;  3E51 A;  5F8J A;  4USK A;  3BSO A;  3E8O A;  1Z1Z A;  5DGA A;  1HBU B;  3QSY B;  1WF0 A;  1BQM B;  3MMJ A;  1TKT A;  2DIT A;  3KG1 A;  1REG X;  1VQS A;  2QZ8 A;  2YKN A;  2AGO A;  4JI1 J;  5CCM A;  2MQO A;  4ZN3 A;  2XS2 A;  2HFS A;  1NH8 A;  2QMX A;  3M1V B;  5FD1 A;  5IC6 B;  4A8Q A;  1GX5 A;  1RT3 A;  2W01 A;  3R8Y A;  2OPQ B;  4NI2 B;  4U6P A;  1CJU B;  4J9N A;  1WI6 A;  3MEG B;  3R27 A;  4NLT A;  3QRR A;  2VOO A;  3VAL A;  1AW0 A;  3VHQ A;  4CIO A;  4EMD A;  1FDA A;  4ZJL A;  2CQD A;  2XY7 A;  1LK7 A;  4NXN J;  2F7V A;  2MHE A;  3OSP A;  2VFR A;  3UNG C;  3PG9 A;  1OWX A;  3A1Y G;  3V5R A;  3RRG A;  1RHJ B;  2XLJ A;  2J6T A;  2F4V J;  4TVA B;  5DLF A;  1DTT A;  2KG1 A;  2XMJ A;  2IAJ B;  2Z4P A;  3M8Y A;  2X1F A;  2OMO A;  4B9M A;  4W98 A;  3W61 A;  2CKW A;  2K3I A;  1RI7 A;  2HZA A;  2OGU A;  2YKO A;  3ZZO A;  2WSF C;  4Q45 A;  3C16 B;  1SUQ B;  3DNC A;  2KFY A;  3EMT A;  2W7A A;  5M2U A;  3P96 A;  2V2V A;  3LAL A;  3KLF A;  3GJQ B;  1RWV B;  1EAR A;  5KFH A;  1EX8 A;  4P75 A;  3PRV A;  1B3T A;  1VIX A;  2WBR A;  4FBU A;  5DS7 A;  1UW9 A;  3THV A;  1LWF B;  3L7O A;  2EFN A;  3M05 A;  3MEK A;  4C6A A;  3DLK B;  3Q2T C;  2AV5 A;  4B3O B;  1N32 F;  1FRL A;  1GMV A;  4OYB A;  2G0C A;  2YX4 A;  5A76 A;  2Y0B B;  5E33 A;  3K58 A;  1CJK B;  1IM4 A;  4HYK A;  1FD8 A;  4ED7 A;  4ED3 A;  1Q0N A;  1M5K C;  2BE2 B;  1WD6 A;  1VRT A;  4WBF A;  5A8R B;  4RU9 A;  3RB3 A;  2CQ3 A;  2RDI A;  2A6O A;  4NA2 A;  1FDD A;  1IR0 A;  1Q8L A;  4KPC A;  4WJB A;  1U8W A;  5J2N A;  2NS1 B;  2CPY A;  4ZVQ B;  4GKK J;  1X5P A;  2Z0G A;  5CA5 A;  4DV1 F;  4QJV A;  5KG7 A;  3LP0 A;  4YME A;  5F8I A;  3KK2 A;  2IRY A;  2KM8 B;  1RLC L;  1UMJ A;  1XR7 A;  3ET6 B;  2M0G B;  3R5A A;  2UXC F;  1TKZ A;  2IM0 A;  2M4M A;  1ROF A;  4PQU B;  1KDN A;  4DV3 J;  1HWL A;  5D4P A;  5FJ4 A;  4WZQ A;  4X4R A;  2YH1 A;  2ZIT A;  1LW0 A;  4J91 A;  2FQQ B;  2R3V A;  4L74 A;  4YQW A;  1TL3 A;  2V63 A;  5B0B A;  2EC0 A;  2GJ2 A;  2MPU A;  3NGR A;  4UOF A;  4P2S A;  4WZM A;  5JXS A;  4F2S A;  3LP2 B;  2CFX A;  2BRL A;  3N0V A;  2RRB A;  5G4D A;  2HHT A;  2YVS A;  1F3F A;  4WK1 A;  3CW2 C;  1RT6 B;  1TUG B;  2E1C A;  4NYO A;  2WZ1 A;  2AIR B;  3RUB L;  3W5Z A;  4ZCM A;  1DAX A;  3QLH B;  3EPG A;  5E41 A;  4LQ9 A;  3ONQ A;  5E5N A;  3VAG A;  5KAK A;  3A8K A;  2V9W A;  4N76 A;  1JXE A;  2W9B A;  5HRO A;  3M2R A;  3LF0 A;  2G13 A;  2Q79 A;  1EET A;  4LVN P;  4LMZ A;  2KFZ A;  3CDU A;  3V6J A;  1G1X A;  1HBM B;  3CJS A;  3V6H A;  5KFU A;  3SYZ A;  2FVS A;  1TMM A;  1UJ5 A;  2CNK B;  2OEK A;  1HI0 P;  3BO3 A;  4LRE A;  4TY8 A;  3A8I A;  1LWX A;  2MZR A;  1VMB A;  2M3D A;  5IQ6 A;  5HLF B;  1FJE B;  4TYB A;  2UXD J;  1SCJ B;  1DQA A;  5JUM A;  4PCQ A;  1YZ6 A;  3FVY A;  4FKY A;  2HND B;  3QAT A;  1U24 A;  2Y8W A;  4U8Y A;  5KG3 A;  1QVF R;  3MED A;  1KQK A;  2HHP A;  3B78 A;  1S57 A;  3RRK A;  3TZW A;  4LR9 A;  3GB0 A;  4QWD A;  4ECT A;  4OYM A;  3JAM U;  3FKB A;  3KLG A;  3C8Y A;  2C2K B;  2HWT A;  3ZZU A;  3M8Q A;  2VHG A;  1FKO A;  4KRW A;  2W9C B;  2C3M A;  2XS5 A;  1S48 A;  4DZD A;  2UUB J;  4L3N A;  4X2B A;  4EFA C;  2NUH A;  2VG7 A;  5I42 B;  3O8W A;  1X4C A;  4DZ6 A;  4EZ9 A;  4C8L A;  2J9C A;  4M5K A;  1URR A;  1WC3 A;  3CJK A;  2DPJ A;  3CME S;  3FMW A;  1NCL A;  5K8N A;  4X4P A;  4ZVT B;  2HHV A;  2W1B A;  3KNG A;  1U6Z A;  3LAK A;  1H73 A;  1FX2 A;  2AW0 A;  2FC9 A;  3DU6 A;  5LMN F;  1QM9 A;  2ZOG A;  2ZD1 A;  1YJU A;  4GO7 X;  3SMZ A;  4RWW A;  2H48 B;  4FNI A;  2E5J A;  2JX2 A;  2ZOM A;  5DZ7 A;  1PBA A;  3RYL A;  4USM A;  2UXD F;  4DR1 F;  3US5 A;  3HK2 A;  3NS7 B;  4J9S A;  4F3Q A;  1RT2 A;  4OJH A;  6AT1 B;  1OPZ A;  3P8B B;  4IFY A;  1WEL A;  1AZS B;  1F5B A;  3GJR B;  4NZ7 A;  4P73 A;  2YPZ A;  4FYW B;  2M8H A;  4ANC A;  3KOA A;  1P9Y A;  1SKU B;  2IRU A;  5KFQ A;  5AE1 A;  1RBO B;  1PYT A;  1SH0 A;  3OUY B;  2BQU A;  2FHK A;  3NGD A;  3D6H B;  4R8U A;  1N5T A;  4CYU A;  4EZ6 A;  5FLX Y;  3MM7 B;  4X4O A;  3CC7 S;  4EO6 A;  2MZS A;  4EK2 A;  1IKW B;  2ZVS A;  4DR5 J;  1H98 A;  4FVC A;  3OVA A;  2J0W A;  3EX7 B;  1ITP A;  4C3M A;  2KM8 C;  2XNR A;  2QRR A;  1SV5 A;  2DNO A;  1VC0 A;  1IR2 A;  4CCH A;  1S77 D;  1D9A A;  2M2B A;  3QJJ A;  3K8W A;  4D3H A;  1MSW D;  1Y3K A;  4DL0 C;  4IOC Q;  1XK8 A;  2B43 A;  4DR7 F;  3Q8S B;  4HT5 A;  1YLX A;  2G0I A;  1VLY A;  2GAH C;  3MMA A;  4C8N A;  3TZX A;  1SL2 A;  1Q78 A;  4OI1 A;  3BN7 A;  2W2N P;  1SQF A;  1XR6 A;  3B54 A;  3FQK A;  3LH2 S;  2EFV A;  3DOM B;  3RZA A;  4KB7 A;  1PJ5 A;  2MQL A;  5HQ8 A;  2C2Z B;  2QGF B;  3U7J A;  3RBD A;  4X62 J;  3CXC R;  1TV6 A;  2GJI A;  4KFB B;  1LNQ A;  2V8P A;  5HI7 A;  2JWN A;  4A8W A;  2XG8 A;  3CJ0 A;  4IKA A;  2E9Z A;  2HQF A;  2C3Y A;  1K0T A;  2J8S A;  5EX3 A;  3PCO B;  2V8H A;  4Q8F A;  1FWP A;  5ETK A;  3RRH A;  2HVI A;  1XTZ A;  2N3L A;  2DNR A;  4N47 A;  3B4D A;  1H74 A;  2B7B B;  3OVS A;  1R0B G;  4CH1 A;  5D4N A;  4FF1 A;  3WX8 A;  5GME A;  4TU7 A;  2E66 A;  4DR4 J;  3I6P A;  3K5P A;  2VA2 A;  4JI4 F;  1R31 A;  4DUZ F;  1LFW A;  2HQD A;  4UZB A;  3SV3 A;  1S4F A;  5A6P A;  2MQN A;  2QA1 A;  2BR0 A;  1QTM A;  3JB9 k;  1RZM A;  3MAA B;  1HNW J;  4OI4 A;  3CCQ S;  3NOC A;  2CZV C;  2KT2 A;  1S1T B;  5HVH A;  3KLE A;  2CQ0 A;  2XHC A;  1UWA A;  2HIQ A;  5B7W A;  4CNZ A;  2O5D A;  2BMB A;  3MOZ A;  4Y2C A;  2F3J A;  4NCG A;  3BRE A;  1NHK L;  2DKO B;  3KUH A;  5K14 A;  1GXU A;  2ZHO A;  1GNK A;  2W8K A;  2QLJ B;  1U2F A;  3W9I A;  4F4A A;  1XMQ F;  2WVB A;  2YWE A;  1L5U A;  1S5Z A;  3OFH A;  3BSA A;  2FJA B;  2DO4 A;  4TN2 A;  4P2M A;  1R0A B;  1AUD A;  4DV1 J;  1KWM A;  1MU2 A;  2LU1 A;  3HVT B;  4DX7 A;  4DR4 F;  2RJZ A;  5GVQ A;  2VQE J;  4FF2 A;  2JL9 A;  4M5N A;  1BQX A;  2PEB A;  4DPW A;  3Q24 A;  2QL9 B;  2MGZ A;  3KMQ A;  3D7S B;  2EKN A;  4M5G A;  3ISN C;  3DFE A;  2E1R A;  2V69 A;  3KKF A;  4LF7 F;  4Z2X A;  4ECU A;  4K59 A;  2E7V A;  3MMB A;  3SDE A;  3AD7 C;  1FWL A;  4U96 A;  1N0U A;  4KY3 A;  1HL6 A;  5H9F J;  3DXS X;  3C14 B;  4DSE A;  1SBR A;  4U7U D;  3ENQ A;  3FC9 A;  5KFT A;  4BBY A;  3DYA A;  1I51 B;  4LFA J;  1KLN A;  3GG0 A;  5ETP A;  4ED1 A;  1Y7P A;  1NSA A;  2UZA A;  2DR6 A;  3H8Y A;  3T9N A;  1FDN A;  1H3D A;  1GMW D;  2WW4 A;  1OQ3 A;  3K8V A;  1R0A A;  1NK8 A;  3IWL A;  1N6Q A;  1VQ5 S;  2APO A;  3ILI A;  2I1R A;  1S79 A;  4MFB B;  2EFG A;  1IXK A;  4OZ0 A;  1JLF B;  4NRU A;  1XN9 A;  3R5C A;  3NAH A;  4WU3 A;  4O3R A;  4P52 A;  4YFU A;  4YHH F;  1OYD A;  5KT5 A;  5LSL A;  3DHX A;  2R7X A;  3KLI A;  4TLR A;  1MNE A;  4ILM A;  1IBL F;  1QJH A;  1T9T A;  3TAM B;  4PUO B;  1QUV A;  1RAH B;  2BE7 D;  2GS8 A;  3TX0 A;  4ZA1 A;  1S1T A;  4YEA A;  3K5O A;  2C3O A;  2CWX A;  2L48 A;  3CJT A;  2GO9 A;  3ZZR A;  5CD4 A;  3BQ1 A;  4USV A;  1C1B A;  5E3Q A;  3MGJ A;  4NOH A;  4OV6 A;  1XR5 A;  1N5Y B;  4DSF A;  3TVZ A;  1S9G A;  1BWV A;  3CSK A;  4I1T A;  3X3U A;  1U1R A;  3BH7 B;  3DLL Q;  2ZD1 B;  4RNO A;  2CJY B;  2NUU G;  3QBC A;  4CLT A;  1SL1 A;  1KTV A;  1VFJ A;  1S9F A;  4M5L A;  3BQ2 A;  1D8Z A;  4LJM A;  1NH7 A;  2DY9 A;  5BYR A;  2HNZ A;  1E6Y B;  4OHZ A;  3BDP A;  2HK2 A;  2XYG B;  4B3R F;  1RSC A;  3Q8U A;  2QE5 A;  3R6L B;  4ECR A;  1VQP S;  2W4P A;  5KFA A;  1WC0 A;  2GFF A;  2OPR A;  5L1J A;  3GWC A;  1N34 J;  2GIQ A;  3ZZP A;  1SJF A;  3HLU A;  1EQM A;  2AF6 A;  4USI A;  3VV2 B;  3SFG A;  1FFS B;  3CUL A;  4UF4 A;  2AU0 A;  4QR0 A;  4IDK B;  3KG4 A;  4U67 Q;  1L3V A;  2WVF A;  4B9N A;  5D15 A;  3IXQ A;  3KK2 B;  4WFX A;  2QA4 G;  1S6U A;  2D9P A;  3VQT A;  4H4M B;  4NLW A;  1V6H A;  3DOM A;  3UI3 A;  1FRJ A;  3OTO F;  2HGM A;  4ILR A;  3LOU A;  4UQT A;  3HSZ A;  4ZVO B;  2BVZ A;  3H4D A;  1DZ5 A;  3NMR A;  2W2Q P;  2FTR A;  4DFP A;  3HHL C;  4CM0 A;  2R7U A;  1RT1 A;  1NKE A;  1XJW B;  3W3S A;  3LA0 A;  4DV5 J;  3MMC A;  2FY1 A;  4X66 J;  1HIY A;  4MH8 A;  3QO9 A;  4ZIT A;  3M2U B;  1UWB A;  2VON A;  1AYE A;  2ZJQ Q;  1X9M A;  2O66 A;  2LFV A;  2DRB A;  1FVS A;  2CWK A;  3D67 A;  3ZTS A;  3JYT B;  4C8Y A;  4DR6 J;  1YBA A;  4N41 A;  3MMC B;  4KC5 A;  1SC1 B;  1FI4 A;  4J5O A;  1FEH A;  3NLC A;  4IH6 A;  3DHW C;  4ZVR B;  4BCA A;  1FRM A;  4WPA A;  3TZZ A;  3V6D B;  3NEK A;  3QZ8 A;  3LUY A;  3ZC4 A;  3S01 A;  2IM1 A;  2HNY A;  5BYS A;  4DV6 F;  4C8O A;  2ILZ A;  4QU7 A;  4OYX A;  4B9V A;  1WOS A;  1Z2L A;  1TMJ A;  2MKH A;  4F2R A;  3E3X A;  2HSE B;  2VL1 A;  3L95 X;  4I6W A;  4WXW A;  1RT2 B;  1V5V A;  2RT3 A;  5KT2 A;  2AEM A;  2BOA A;  2NXU A;  1JLE A;  1S0M A;  3HUL A;  1RWM B;  4ID5 A;  1DBD A;  2R8G A;  5KFI A;  2OPS B;  2N7Y A;  3P5B P;  4HHH A;  2ADB A;  3DCA A;  2ATC B;  2D9O A;  2RKI A;  3NKY A;  3UN5 A;  2DPI A;  4MKV A;  3CDE A;  2J0X A;  2N82 B;  4LFC F;  4EBC A;  1ZH5 A;  1NK7 A;  2MKI A;  1E6Y A;  2HNZ B;  2HZV A;  3LWM A;  3WC0 A;  1G4C A;  1EIY B;  3PW2 A;  3HZE A;  1RE1 B;  4L3K A;  4GO5 X;  5DLG A;  2RS2 A;  1HQU A;  4M1K A;  4J9Q A;  1WKL A;  4F0H A;  3GFX A;  2QX0 A;  2F63 A;  3HFV A;  3L7P A;  3BB5 A;  2XBP A;  2N3O A;  2UUA F;  3KTQ A;  2ERR A;  1U25 A;  3JQJ A;  2GCF A;  3AB4 B;  1E6V A;  4HTJ A;  4ICL B;  1U0H B;  4R8U B;  4YHH J;  3JYT A;  2DR8 A;  2R7O A;  2HHS A;  3T19 A;  5B09 A;  3C3L A;  3H7H B;  2DIV A;  5MLC V;  4WP8 A;  4DFK A;  1AZS A;  5HAN A;  2UUC J;  3MED B;  4G1P A;  1NDP A;  2GC8 A;  1FD2 A;  1UP1 A;  2OO4 A;  1T9U A;  2QYC A;  3LPY A;  2DB1 A;  2A6M A;  3UVJ B;  4CTA A;  1UPM B;  3W8P A;  1RKI A;  4LF8 F;  4A48 A;  2JFD A;  1BD6 A; 
#chains in the Genus database with same CATH homology
 4UZB A;  2YQ0 A;  4BLG A;  2YQ1 A;  2YPY A;  4K2J A;  4UZC A;  1VHI A;  5A76 A;  1B3T A;  2YPZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...