4UZCA

Kshv lana (orf73) c-terminal domain, spiral: hexagonal crystal form
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
134
structure length
134
Chain Sequence
YQQPPVPYRQIDDCPAKARPQHIFYRRFLGKDGRRDPKCQWKFAVIFWGNDPYGLKKLSQAFQFGGVKAGPVSCLPHPGPDQSPITYCVYVYCQNKDTSKKVQMARLAWEASHPLAGNLQSSIVKFKKPLPLTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ORF 73
publication title The 3D Structure of Kaposi Sarcoma Herpesvirus Lana C-Terminal Domain Bound to DNA.
pubmed doi rcsb
source organism Human herpesvirus 8
molecule tags Viral protein
total genus 34
structure length 134
sequence length 134
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-09-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.390 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Epstein Barr virus nuclear antigen-1, DNA-binding domain 4uzcA00
2YQ1A 1VHIA 4K2JA 2YQ0A 2YPZA 4UZCA 4BLGA 4UZBA 1B3TA 2YPYA 5A76A
chains in the Genus database with same CATH superfamily
3KLEA 4PQUA 4ZPTR 4IOCQ 2XEXA 4WF9Q 2CQPA 3W62A 4LFBJ 4QIVA 3MD3A 4JV0A 2WVCA 2CPXA 2RQ4A 4PXEA 3R6LB 3R5DA 1JLCA 2DT9A 3OFFA 3IA0A 4DXLA 1IBLF 2RS2A 3MMAB 2VV5A 2Z30B 3MR5A 4HDHA 1GXLA 1WF2A 3VR1A 2KFZA 3S6EA 4DV3F 2ZE2A 3LPYA 3GILA 3FCWA 4LFAJ 4JP8A 5IZHA 4XTTA 1SKRA 4OQJA 4LF4F 2VG6A 4B02A 3TUIC 3HF5A 4FF1A 2HWIA 3VAFA 1EKRA 3NGDA 4A47A 4H4OA 4LIRA 2HQIA 1DLOA 4ECSA 2R2RA 5HP1A 2E1AA 1R8CA 1N32F 2QLFB 2E9ZA 5I4MA 1Y5NB 4LF8J 2V8GA 2BJ7A 1KTQA 1L3KA 3MTJA 1RT6B 1SQGA 4ILLA 2BE2B 1T02A 4JI8F 1PAEX 2K1RA 2E5LF 1VQSA 1U6ZA 3CJTA 3MR3A 2AD9A 4C9DA 1UVIA 4E8UA 1TELA 3M8PB 4KGZB 3B6BA 4YY3F 1VISA 2MKCA 3H2UB 3V6HA 1PSDA 3BR8A 2XZTB 1U1PA 5HVGA 3EPGA 3BBBA 4A46A 2IM2A 1X60A 5JVHQ 1Y0HA 3JSRA 2QSFA 3MMAA 3R9LA 5HROB 4IRCA 3KNGA 5BYQA 2CJ9A 4PPZA 2IC3B 4X4TA 4RZRA 2MQMA 1IBKF 3G8QA 2FHJA 1MWYA 4TU7A 3MECB 3IAM9 4DSJA 1OPZA 1NRKA 2J9DE 4DQIA 4NA3A 2OEJA 2KYXA 3TA0A 1WEXA 2MZJA 2D1CA 4L3NA 3ZNUA 4HTJA 5D8HB 1RWKB 4PKDB 4DV2J 4CLYA 4K4YA 4P9SA 4MYTA 4LVNP 3R27A 1UL3A 3IRWP 5FD1A 2R2SA 1AA1B 2JJ4D 2QIFA 3QGIA 2AHOB 2UXBJ 1C1BA 1CC7A 2Q79A 5J1NA 1D3WA 3FBEA 1ULRA 3AJDA 2QGFB 4WU2A 3JSYA 1HQEB 4R25A 1IKWB 4LBPA 1RT6A 5E0OA 2C28A 4M95A 2BE7D 2BE2A 3TEGA 2JX2A 3LP1B 1ZM2A 1VCTA 3OXLA 4K4VA 5KTQA 3ADAC 5KFTA 1B4SA 1EJ7L 1ZS6A 1TKZA 1T7PA 1W26A 5IM0B 5C2CA 3HZEA 2J76E 3TRGA 3VAIA 1VYAA 1B3TA 3M8PA 1RCOB 4KHPF 1S6OA 3MEDA 2K3IA 2OI2A 4EFAC 3D6TB 4I67A 5D6GA 4F0KA 1REVB 1H74A 4QWEA 4YP3A 3UW1A 3A8IA 2APOA 1UWBB 2CQIA 3O5TB 1GXUA 2YWEA 4NMLA 1GFWB 5DETA 3TNVA 5HROA 3A8JA 3JSMB 3TQEA 3R97A 4DQPA 2E5HA 2QYCA 2Y9HA 1U48A 3M6VA 2CDRB 3KYLA 4PWUA 3MUVP 1U4BA 2XSJA 3MECA 1WSRA 1K73T 2G1HA 2CQDA 5D4LA 4FF3A 2V4QA 3CPWR 3QO9B 2XY5A 2ZDPA 2YKMB 1AB8A 4FYDA 2QSWA 2ZH2A 1IM6A 4QR2A 4J9LA 2B9YA 4N76A 4ICLB 4X66J 1U1LA 2W9AA 1WI6A 3RZAA 4ED5A 4D3GA 4V19X 4DR4F 3JTPA 2HAFA 2XG8A 5GAGI 2MQLA 2Q3PA 2DNMA 1UP1A 4B9NA 2ZZMA 4WYLA 3MM6B 1X31C 4KYZA 2NXNA 2YNGB 1A9NB 4LIWA 2CG8A 3P49B 2HFNA 2MKJA 1IKWA 1Z2ZA 1CLFA 3ILJA 2QLBB 1WHXA 3LP1A 2LU2A 5ETSA 5F0UA 1YLXA 5KG3A 1S5ZA 2A0FB 5IM0A 3THVA 4OV6A 1TAUA 3QGHA 4QQBA 1FWLA 2EI5A 1XC9A 2D3O1 1REVA 3PHTA 2YWWA 3DDNA 1UWBA 2HNZB 3W63A 3HULA 4U8YA 4JI5F 3AQOA 2KH9A 2F7VA 3JSMA 4K4WA 4ZP8A 1W7WA 4UW2A 5KFLA 1HLWA 2DGQA 4FPIA 1VQOS 1FESA 1RWWB 1DTQB 3SQGB 3CO0P 4EU0A 4QJVA 1FDDA 4ECXA 3HFVA 1HI1A 3NAHA 2IM1A 2IYGA 3RBXA 4K0KF 4DX7A 4WXWA 3QO9A 1JIHA 1UEUA 4AT1B 2YKMA 4Q8FA 4Q5VA 2R7OA 2UXCF 4UY8T 1SVDA 4ICLA 1Q1KA 4WTOB 3NL0A 4UZBA 4Q43A 1XMBA 2R8IA 2FLNA 4HT7A 1C2PA 3TJ8A 3N0VA 5DGAA 4Y28C 1URRA 2ZM6F 3MCSA 2BRKA 3G82B 4G65A 4ZLLA 4C6AA 3MM6A 3G8TA 2F9JA 2FDNA 5EN1A 1U6FA 2GGPB 1VOMA 2HFVA 4ZIWA 4DCPB 4DBQA 4NL5A 1HNZJ 5MAOA 4NLQA 5LSOA 4A4JA 3M4XA 4WK3A 2DY9A 2QA2A 4XPCA 2BEFA 4OI6A 3QFWA 2BANB 1G4CA 1EP4B 1N0UA 3EWGA 2W7OA 2DO4A 1P9YA 2JNJA 3BPDA 1KEKA 2B3TB 2HNZA 4O3OA 5IT9Y 4M5IA 1S0OA 1QJHA 4PQAA 2V69A 3K5NA 3RRGA 4IRDA 4DV0J 2VIHA 2IJRA 4JYAJ 2JHEA 1Z2LA 1DTQA 1NK5A 1YBAA 3SQGA 3G2XA 1VRTA 1LWFA 2XMWA 1DQ8A 1Q8LA 1C0UB 2DY1A 1VC5A 5D3GB 4E0DA 3AQPA 4OYPA 2NSCA 3P5TL 3NGSA 2MXYA 1YJUA 3M9MB 3PFOA 2I8EA 2QG9B 3OFHA 3OTCA 1GTEA 1T94A 2M5YA 4JI0F 3IWNC 3RB6A 1CVJA 2HNDA 2QFJA 2UUCF 4TN2A 1KHWA 2DGVA 1WTBA 5IT0A 4GKKF 4J9PA 3G82A 2ZH7A 3W65A 2CQ3A 1O5JA 3PX4A 3JTNA 4NASA 4ZITA 4ANCA 3FKBA 4YR2A 2Y1JA 1YSJA 1TL7A 2HHVA 2GGPA 4TU9A 2RKIB 4Y00A 3OHAA 4DV4F 2AV5A 3NBPB 5F8LA 1TFYA 4JV1A 3TUPA 3KK3B 3T41A 3Q8RB 1GMWD 2F9DA 2E7VA 4O0IA 3T5HA 4WP8A 2PC6A 2RH3A 2BANA 2GFFA 1GEHA 3E8OA 2N82B 1EP4A 1X5OA 4U8VA 2MZRA 4X64J 2PN6A 4O3PA 2HPUA 1C4CA 1RLDA 2MLZA 3DLEB 2JRSA 1RAFB 1VBXA 4O4RA 1YI2S 2NS1B 5GAEI 2Y0BB 4URSA 4XIUA 1U7LA 3T6BA 4HLBA 3OXGA 3JS9A 2DHAA 1C0UA 3BSNA 4DFKA 3MEKA 2DKOB 3J80Y 5D3GA 1PBUA 4PXCA 4CYUA 2IFXA 4RUHA 1Q78A 3BDPA 2C2KB 2KFNA 2ZH3A 3WBZA 2KU7A 1UZDA 2QTWA 3HSDA 4H4KC 4MKBA 4L75A 2VQFF 3C15B 5HN0A 3VALA 2MJUA 3HHLD 2QLJB 1X0FA 3CCVS 1ZOTA 2ABYA 1U8SA 2RSQA 1HNVA 4RUBA 1N36F 1Q8BA 3KMSA 1HBMB 1UJ4A 1BWEA 4OIXA 5LSRA 1U0SA 3EGZA 2RKIA 2RRBA 5HBMB 4F4AA 3D67A 3HHDA 1S1TB 3DLJA 4NE9C 4CM2A 3KK3A 2ACMA 5KT5A 3CDAA 2QJ3A 2DHSA 4DFJA 4LF6F 5EDWA 3NP5A 3DLEA 5J1PA 4GVLA 5L1LA 4QU6A 1UKUA 4KFBB 2FLOA 3K59A 1FCAA 2ZNZA 4ZVSB 2O66A 5D0GA 1B0TA 2FJVA 3HVAA 4QIGA 4R5PB 2F4VF 2VBWA 4KIAA 3MEEB 2ZHBA 3NGTA 4K2JA 4YHHJ 2VQEJ 4EGLA 4I64A 1B7YB 2DNYA 2KG1A 1FX2A 2YX7A 1QUVA 4LR9A 4FP9A 2R2UA 2AT1B 4ETZA 1NPKA 1GH8A 1X9MA 3KUGA 1S0MA 4DHVA 2HZCA 2NUUG 4J9OA 1UVJA 2DHXA 1L5UA 4OYAA 4NA1A 2AJQA 3KLFB 3THPA 1KHVA 2OPQB 5CYMB 1UFLA 3PYGA 4ZMMA 4P72A 3UCGA 5EX3A 1VGYA 4OYXA 1KP6A 1HHSA 4QW8A 4GKJF 1ZAWA 3Q8VA 1Y5IB 2ZEJA 2V9WA 1UFWA 2HK2A 2ZITA 4CH1A 2KN4A 2FVRA 1R8BA 2AEMA 2VU5A 3FBBA 4NA2A 5HBMA 4TLQA 2UUAF 4DUYF 1Y3JA 3OD2A 4B9VA 3ISZA 3TI0A 1S1TA 4U7UK 3TQ1A 4NXNJ 1IKYB 4P73A 1RTJB 1MMLA 1WG1A 3CJKA 3PTWA 2YWFA 2OEKA 4KFBA 3MPYA 4NRUA 4M5NA 2ZZNA 1NHKL 4K2XA 1CJTB 1VMBA 4N8OA 5H9FK 4F26A 4LQ9A 4AL5A 5E3RA 3FBFA 4R5PA 4DV5J 1IKVA 1QAYA 3MEEA 2JL9A 4C0HA 5KFJA 4QBUA 4ED7A 4HTIA 4X4UA 2ZVSA 1QSLA 3D6HB 4JUZA 1XERA 4ES1A 3AJ1A 3AD8C 5CQGA 4AXIA 3D6MB 2ADBA 2Y8WA 3R5BA 3HD1A 2VG5A 4KT0C 2Q6BA 2V8PA 2UVVA 3PFEA 3ETMA 2DNHA 5HJXA 4NX9A 2O1PA 2D41A 3D9BA 1MSWD 2OPQA 3GLJA 5CYMA 1RA6A 1S9FA 4BC9A 3S8SA 1Q16B 3K8VA 4B9MA 3BDEA 2B51A 1K0VA 3F0NA 1LXNA 3UN2A 1IBMF 2W8LA 3VAGA 1VBZA 3EUNA 3G87A 2V67A 1F5AA 1NSQA 1QM9A 2BUNA 1JJHA 2QC3A 2FGCA 2K3KA 3KLHB 1IKYA 1RTJA 1TUGB 1UJ6A 4A8OA 1LFWA 1ZPVA 2FJWA 1CJUB 2DXEA 1CJTA 2B4VA 1T9WA 1SH2A 3L3CA 2C3MA 3CJRA 4KH1B 4QW9A 4USKA 4TQSA 2DJWA 1Y4ZB 3LWLA 2RVJA 3MDFA 5E2QA 3ISND 3TAMB 1SJQA 1SUQA 2IAJB 1NK0A 1S6UA 3RG6A 1TUWA 2AYGA 2ILYA 3KWMA 4FXDA 1LW2B 4LFCF 2PDAA 4ZK7M 1Y7PA 2G0JA 4DU7A 3GFZA 1HBOB 4F4YA 3PZPA 2LA4A 5HQ8A 1NKCA 4LF9J 4C97A 4J9VA 2HEKA 3BREA 3BQ0A 2ERRA 2KM8C 3GIIA 2BMBA 2XZDB 2VBXA 2FC8A 1PG5B 1U1MA 4B3MF 1FXRA 4RJVA 4F2SA 3GYXB 2LQBA 1VRQC 2CXEA 5E5NA 5D78A 2CQ0A 4WWSA 3GU0A 1JLGB 3KLHA 4KRWA 1T05B 5DQIA 1NHUA 5DDPC 2BKNA 4LRBA 3ZTQA 3F41A 3IAS9 4LSLB 1RK8A 5F8MA 2RQCA 1P6TA 3KMQA 1NZAA 3GCXP 5DDRC 3KNAA 2W2NP 3I31A 1N5VA 3TX0A 2LDIA 1H38A 3NRBA 3TANA 1CJUA 3FEYB 1W25A 1N88A 3G8SA 5L38A 3QBCA 4DV3J 3DLBA 3FC9A 3CMES 5B0FA 2KT3A 1UVNA 3CJ8A 2C2RA 1TAQA 3QNWB 4LF4J 2CQGA 2OSRA 4RBUA 3TAMA 2ZJQQ 1SH3A 2DH7A 3J7ZT 1WORA 2IAJA 5HK4A 1VQ6S 2HS0A 2ZDOA 1F9EB 4GMKA 1DY3A 4CLKA 1RLCL 4YR0A 2XLKA 1LW2A 2GVDB 3WIUA 2P5VA 4HEA9 3LQVA 2HIQA 2DGXA 1HBOA 5T14A 2NPIA 4F67A 1CEZA 2B4PA 1UZHA 1B70B 4ID8A 5K8PA 2BJ1A 2PA8D 4MK7A 5GAHI 3PDNA 5E3QA 5B0BA 3W61A 2J0QD 3QYYA 4WIIA 1E6YB 2ZH5A 4DOZA 3UNYA 3RRKA 3MM8B 4DR1F 3RBDA 1X8DA 1RU2A 3DXBA 2JVOA 4DV1F 2P8IA 2JLGA 1JLGA 3R5GA 1QTMA 1DARA 1ROFA 5B0GA 1BQXA 1BQNB 3GSIA 1QD1A 3VAMA 4H4KA 2HYIB 3NG8A 4JBCA 5D0EA 5KT3A 4JI4F 1HMVB 3DI6B 2DPIA 5LL6d 1IBKJ 4ECVA 4H4MB 4WFNQ 4MMOA 1HA1A 3OUYB 4DX8H 4F4WA 4Q45A 2V50A 2DEIA 1TVRB 5ETRA 1VQNS 2KI2A 1JQGA 2X7IA 3W64A 2V68A 2OFGX 3VQTA 1CC8A 2J0WA 3VV2B 4X4OA 3UFCX 2B43A 4WFXA 2YVSA 2P6SA 2MYFA 2A6MA 5AXMA 2J9EA 2MSSA 1WF1A 1GTHA 4X4SA 4IRKA 4JI2J 2KJVA 2GQQA 1V6HA 3NS6A 1Q0NA 3PKMA 4EO8A 3MAAB 1F9FA 3WIVA 1E6YA 5IT9U 4CTAB 4UTGA 1LK7A 4FBTA 4JV5J 4L6V3 3MM8A 1FDBA 1NHVA 2QA4S 4KHPJ 2MSTA 2F8MA 1FWKA 3TJAA 3U27A 2DYAA 5EHHA 2VPYB 5KFSA 5LM7E 3C14B 3MPUB 2IA0A 2ZH1A 3T19A 2J0SD 1BQNA 4WJBA 4QCLA 2VC0A 4MAKA 4RW9B 5M2UA 1RADB 3HSGA 1WSVA 1HMVA 3DI6A 4NMXA 1SV5B 2G9OA 4OYWA 4YUDA 2HMIB 5CA5A 1R0BG 2XYGB 1CQNA 2ZNYA 4NLXA 4DS5A 4DR5F 2RD5C 1FJGF 5KAKA 4DQSA 3OUYA 5CYJA 3D1HA 2E29A 3MMCB 1HHTP 1FK9B 4R0EA 2MQPA 1N5QA 2DXDA 3HHLC 4MJKA 3LO3A 1T9UA 4MKYA 1N6QB 1PIEA 5KFHA 3QSIA 4DR4J 4B9UA 5KFEA 1MG7A 3TEHB 2YPYA 2OSQA 1HNWF 2KTQA 3BO3A 3PJXA 4OYZA 3IR6B 2H5EA 1H2UX 3FGVA 2X51A 2HAIA 3GWCA 3X3UA 3HM9A 5ETPA 3PR4A 2V2KA 3IC1A 2NREA 3QRPA 2VOPA 1A7GE 2DNLA 3AOCA 4NLOA 1TK0A 3MAAA 2R7WA 1WC1A 4PXDA 2WW8A 3CD7A 1FDNA 2WBMA 1QAIA 3KLIB 2CPEA 2V6AA 1E6VB 2XB2D 3MI7X 3PVXA 1U0HB 1IN0A 2RNEA 1RWXB 3J80U 5JUMA 3GR0A 4RPFA 4ANDA 3C14A 1S1VB 2FD2A 1QAJA 4MK9A 4IG0B 2AZ3A 5A8KB 3CXCR 1D9AA 1X4BA 4MTPA 1S6PB 4PEOA 1SV5A 5BYRA 3MM7A 3FSXA 1HIYA 2LECA 2C2OB 1NJYA 4B08A 2JC1A 3TOQA 2Z58B 2XZWA 4I68A 2NYIA 2ZJPQ 4RWWA 3MMCA 4O0NA 1FK9A 2KM8B 3QWPA 3R5CA 3I9ZA 1D9FA 5KFQA 1N6QA 1ZAXA 1TL1B 1FJCA 4LVOP 4F4XA 3OSNA 3FMWA 1S97A 1QY7A 3PRVA 4BDPA 5IQQA 2PGCA 2DISA 4C2MA 3EZ5A 4ZN3A 2EBEA 3DRSB 3RAMA 3ZNJ1 4EZ6A 4IFVA 2MHNA 1HHQA 3NCPA 2DO0A 1O8BA 4LMZA 5B7WA 2CNOB 2GIFA 4UF4A 1S57A 2MKKA 1U02A 4F2RA 4YFUA 1DQAA 1FF2A 1YK9A 2A6OA 4MH8A 4ANEA 2MKHA 4USTA 4DR6J 3KLIA 4ZCMA 2VF3A 1U0HA 1X5SA 1EARA 4DQQA 3KLVA 1JJCB 3IG1B 4LR8A 2HKEA 2VFSA 3LF0A 3NAIA 1WACA 2FLPA 2EW9A 2VH7A 1UETA 1M1KT 1M1HA 3T1HF 4ZDNA 4PG6A 2VJUA 1D9DA 5IOLA 3SV4A 4F02A 2AX0A 2CYYA 5A8KA 5HMZA 2XM3A 4ZHRB 1S6PA 3U1NA 3W8PA 4LF5J 8ATCB 2HFOA 3CVKA 2H4YB 2CPHA 1K8AT 4FPRA 2XO7A 1OWXA 1UPPA 3KG0A 1FA0A 1TMJA 2M9KA 3ENVA 1KNZA 2R3VA 1TL1A 1WF0A 3PRDA 4FN5A 1S79A 2H5IB 3KDOA 1K1QA 5B0DA 5EWEA 1VS3A 2K7KA 3W5ZA 2UUCJ 1PCAA 3GZ7A 5E3CA 1J5EJ 1G3OA 1WI8A 2AWZA 4GKKJ 3DRSA 1Q53A 2HVDA 3TAPA 1IJEB 1T3OA 4MKAA 1WC6A 3HJFA 2L3MA 4ZVEA 2W01A 2W25A 4PRFA 2HRTA 5KT7A 3L7OA 1WHYA 1KVIA 4YB7A 1FFSB 3KJFB 2OHDA 4OHYA 1WTFA 3LALA 3D7SB 2DRBA 4FYWB 1F5CA 2V94A 4PG4A 3SFUA 3K7RA 1OYDA 2V2QA 4XK8C 2WK4A 3Q22A 1R6VA 1FRHA 1YHQS 4PYAA 3IG1A 2DCUB 1RCXB 2R7QA 1J27A 9ATCB 3PNIA 2JEIA 2HIYA 3ISNC 1OYEA 1HARA 4C8OA 1FRIA 5HVFA 1WNEA 1SIWB 4KC5A 4ZHRA 4KO0B 2EVZA 3HVWA 2BA9A 4I6AA 2FTRA 4X2BA 2KVIA 2XMVA 2IM0A 3SXLA 3CDEA 4Q2LA 3O2IA 2ZUAA 2FHKA 3SEOA 1S1UB 5CXTA 1Q5YA 2MQ8A 4QIFA 3CEDA 3J7AN 1Q86T 3M1VB 2KDOA 3H5XA 2AJFE 3FRZA 2HSEB 2RDIA 4MIBA 1HNXJ 1ELOA 2OPSB 5KFNA 1RBOB 3DLHA 2MKIA 3QAUA 5DQHA 2JH3A 3HO1A 4DR2F 4C7QA 2HVEA 5KFCA 3KTQA 1YKWA 1LEOA 2KVQE 2L9WA 1TTHB 3RB3A 2A3JA 1U49A 2GAHC 1XMOJ 4WBFA 1OQ3A 3N6LA 1O51A 1X4CA 4I2PB 4LF6J 3HHLB 1EQ0A 3A8KA 3VZIA 3PXGa 5CH7B 3SCLE 1GMUA 4ZPVR 2IRYA 5DDOC 1W2BR 4O3QA 1RI7A 2HBQB 4PWDA 3H90A 4FVMA 4B17A 3VCDA 1H2TZ 4Q2MA 1AUSL 5G0RB 1JKHB 4DV7J 2V4RA 4Y6IA 1NSPA 3CCES 3IGVA 2MGZB 4P52A 2IMWP 4DSKA 1N34J 1X0PA 2W24A 3M1VA 3R7BB 2JEGA 3UN5A 5BR8F 3ZTPA 3MCOA 1S59A 1X7VA 4GC6A 2OELA 1VK8A 4WYWA 5A0YB 3GJSB 1UEKA 5F8IA 1ZA1B 5L39A 2CJQA 2OPSA 4EEYA 4KPCA 1G2EA 4FXWA 3PYEA 2XCPA 1ZTWA 3B54A 3IS9B 3QRQA 4GO7X 2MQNA 1KRPA 5KFGA 3D4JA 3AXMA 3SYZA 1I94J 3HKZD 2J8AA 1SQFA 2VL1A 2UUAJ 3FSYA 3M8ZA 4RX6A 4IOBA 3ZC4A 3QJJA 4OI0A 2V8HA 3T5KA 3HFKA 1ZH5A 4OHWA 5ETMA 1WC3A 2HZAA 2OEMA 2F8EX 2WRMA 3WC0A 4I2PA 6FDRA 3HHLA 1FVQA 5EWGA 4O3SA 2VFTA 4ILRA 3NNCA 2FQQB 4D3HA 3CO9A 1RZMA 3T5LA 2CPYA 2VICA 3RB4A 1LWXA 3VVTA 3SDEA 4JI1F 5I3PA 5J1EB 3LP2A 1WHVA 3GFXA 1LK5A 3QGPA 4OZJA 2BV3A 1UFKA 1FKAF 2DGTA 4TXSA 3DLLQ 1D1UA 2PEHA 1SB6A 5G0RA 3SBMA 1JKHA 1R43A 2MMYA 1F3VA 2B8QA 2BKOA 2MGZA 1ZZFA 5ADZA 1MLAA 2D74B 3OVAA 2U1AA 1FJEB 1FFWB 2HNYB 2HHXA 2WW4A 1RT5A 5BXIA 1U09A 1XNRF 3UDEA 4DF8A 5A0YA 2GS8A 2FPHX 2HQGA 2R7VA 3GE9A 3OQ2A 5HSPA 1JK9B 4ZVFA 2YQ3A 2KHDA 2CAJA 1DTTB 2FIUA 3IS9A 4C8KA 4XDCA 4ZCLA 1WKKA 4F36A 5C5JA 2WCXA 1SKSA 2HGLA 1IBMJ 3GJTB 2M88A 2J7WA 1Q7YT 1UEVA 3AJ2A 5E7OB 2Y3YA 1M90T 3CCLS 2Z2YB 1ZM4A 1S6QB 3Q8PB 3CNQP 3BKUA 1YITS 2K2PA 3AOAA 3FZBA 2C3UA 1ZTTA 4ZCKA 5I3QA 1FE0A 5FIIA 4G1IA 4M5DA 2UVUA 2AIRB 4B9SA 3CF5Q 2OH2A 5KG1A 2JSXA 3J7Z5 2E9RX 4P74A 3HMJG 3OVBA 4GVBB 2QE5A 4AL6A 2DXFA 5J1EA 4LR7A 1EB0A 2ZHOA 3HPOA 2LQ5A 3JXOA 3K0JA 3Q0AA 2HHWA 3H4DA 3MXHP 2GCFA 1RYRA 1NMEB 3VHQA 5K20B 4OLPA 4O44A 1V3RA 4C11B 3ITHB 3ZZOA 2BQ3A 2LEBA 5AJ3F 3I5AA 2KO1A 2HNYA 2YXLA 2RRAA 5L1IA 2LXIA 2RE1A 4LFCJ 5F3TA 1KQGB 2DTJA 2B9WA 2G4BA 1B0VA 1ZBTA 3GONA 3JQKA 2L9NA 3CCTA 4A48A 3BQ2A 1TMMA 2QX0A 3M30B 2XMMA 4ZN1A 4DPTA 1GQEA 5HANA 1DTTA 4M5JA 2M8HA 3TVKA 2MPUA 1HWJA 3BZQA 4DUTA 2PMWA 4CIOA 1KKHA 1R31A 4OZ2A 1N56A 3FNNA 1IUJA 2DRDA 1RT4A 1OIAA 3THTA 2DNKA 3BBFA 4OX6A 3OTOF 4AFFA 2GVZB 4A8MP 4K4UA 3L7UA 4KHRA 3D68A 1F0XA 1KQFB 4QYZK 4JOUA 4N56A 1U2CA 2RU9A 5T7LB 1YGYA 1FXDA 2HHHF 4WFAQ 2POKA 1NK7A 5I3UB 1UW9A 2C2ZB 3FBCA 3BPSP 2ASDA 2PFDA 2C1EB 2B4OA 1FXLA 3QT8A 1VLOA 4HVZA 2DB1A 4WU3A 1LNQA 4C11A 3ITHA 3MPWA 4I0WA 8RUCA 2IIHA 1FKOB 2YKNB 5DG8A 2PT0A 4BS2A 2GC8A 4DL7A 4P2MA 5ETLA 2VKZG 3P96A 1SI9A 3G71S 2IVFB 4WFZA 3HT3A 1TKXB 4HDGA 3MEGB 4NEYA 2HHTA 4QWAA 2ZWOA 3M30A 2IM3A 2RQKA 3VGUA 3KHLA 2ZKUA 3M8WA 2QV6A 3BJYA 4F7VA 2VA2A 3OW2R 1HYSB 3CD0A 4EBCA 3FQKA 1XMQJ 3N6MA 4CH0S 4LRAA 5IWAJ 2Z2MA 3IR5B 4QYZJ 3M6WA 4K5SA 2GVZA 3KHGA 4DV1J 2BX6A 2H3EB 3M2VB 3UVJB 3OBIA 4LF7F 2N7CA 1JB0C 3SSRA 4M5MA 3ZZYA 1T8EA 3DOLB 3I56S 3R5JB 3QJPA 4LRDA 3K5LA 2WB4A 4JI4J 2WONA 4M5LA 5D15A 4ECZA 2W2OP 5K5MA 2BR0A 2I38A 3EZOA 2OPPB 1BUXA 3N4WA 2HHQA 1P8GA 4ZPDA 2IHR1 2VPXB 5AE1A 4IDKB 3JB9k 3LA0A 1LXJA 4ZIVA 2YQ1A 5DO2A 2E1MC 4Y65A 4CO1A 1X9WA 5M2PA 3DRPB 1KQSR 2BW2A 3ZTSA 5KOXA 1P1LA 2E9TA 1F5BA 2V8DA 2CA9A 1N0VC 4OZ3A 1Q8IA 1LW0A 1JLCB 3Q86A 4C3MA 1OJ4A 2D9OA 1RDRA 3MEGA 2DNPA 4KY3A 5MLCV 3CDWA 3O6QA 4NYPA 1YJ7A 3RTVA 4NRTA 5AE2A 2RS8A 1F60B 1HYSA 4B3RJ 3KK1B 4A8XA 3QT6A 4U6PA 4MFBA 2AW0A 2PFFB 4GC7A 4IQXA 4X4QA 1RKJA 4TY8B 1H98A 3DU5A 3HHKA 4CM0A 1NZ8A 4LFAF 4U7CA 1HQUA 4H4OB 2IBKA 2UXDJ 2AGOA 1MROB 1R0AB 3DRRB 4F0HA 3DOLA 1TK8A 4IH5A 4OI1A 1QLNA 2HRUA 3FK4A 3QIPA 4NCGB 3P6YC 3FDSA 4IYQA 3ULHA 1TQLA 4OJGA 4EYIB 2EKNA 2BOAA 2LQ9A 4CLUA 3H2VE 2OPPA 3KUHA 4DR5J 4DJBA 3KK2A 1KOOA 2EFVA 4HHUA 3UD5A 3EMTA 4BWJA 3LTOA 3SSQA 3H7HB 2RDJA 2CQHA 3BR9A 2X3DA 4YS2A 3GV5B 2YWHA 3DRPA 3GV8B 3MTKA 4F3MA 3WZ0A 4I4BA 1U1RA 4LJMA 3C46A 1FDAA 3I0SB 2M8DB 2YX1A 5FDLB 1OO0B 1HNWJ 4Z7YA 4CLWA 1WKLA 3N6NA 1NXIA 2DGSA 3B4DA 2GNKA 4LBHA 5A76A 2DNRA 1DURA 2CPIA 1FKPB 2RF2B 1K47A 4RNFA 2X3GA 4WFYA 3PRBA 3H5YA 3KK1A 1F9HA 4H54A 1WC0A 2NXCA 3L09A 3HK2A 1NK4A 1JX4A 2MHEA 1HKAA 1VIXA 4TY8A 4J9SA 4Z7CA 1OMSA 1D8ZA 3IM9A 1KVKA 2K06A 5DLGA 3CT9A 1F6TA 2YH0A 3MMJA 1Q7LB 5L1JA 3GYNA 1MROA 1R0AA 3DRRA 3M2UB 1AW0A 4DUZJ 1XBWA 3WHIA 3F73A 4DV2F 1H7XA 5LSLA 4NCGA 1C1BB 1H6KX 1AZSA 2R2TA 5DRKA 3DC2A 1HR0F 1WEYA 1YQHA 2VFRA 2UXBF 1WG4A 3VQSA 4ZP9A 3DFEA 2KG0A 4Q44A 3RYLA 4EYHB 1MNEA 2RT3A 1FFGB 3C6TB 3RBEA 3M8RA 4J9MA 3N01A 4YB6A 4O3NA 4WKRA 3JAMY 1VQMS 1TKZB 5L9XA 4ECRA 1APSA 2GHPA 1KLMA 2OAUA 1L3TA 1H0HB 2I5JB 3MEDB 4RW7B 2UUTA 3EDRB 4TY9A 3I0SA 5FDLA 3H42A 4AE5A 1RWNB 2IBOA 3K17A 4M5KA 1IR0A 5J2NB 4CLSA 2MZ1A 2ZWPA 2K8GA 4TU8A 1RAAB 1CJVA 3QATA 1GAOA 2FVPA 4WCEQ 1Y10A 1FKPA 1HD1A 2RF2A 2HBYB 4CDIA 3CW2C 3S01A 2RHSB 5LMNF 3M8YA 4CO2A 1SBRA 2XQCA 4ZPCA 4YB1P 2ZHAA 4NXMF 1IBCB 3M2RB 4RR5A 4KPYA 2XSJB 2B7CB 3CD6S 1N52B 2HS3A 4QOTA 2MQQA 3CC7S 4A8WA 2XI2A 3MMBB 2N3LA 5DGBA 2YPZA 5K8OA 3A4TA 3OXFA 1VIOA 1J5OA 2FJDB 1IR2A 3HZGA 3T1HJ 4DSFA 3UE2A 3M2UA 3ONQA 2RQMA 3SMZA 3EGVA 2GMJA 4NCBA 4X66F 2M52A 3SQOP 2WAQD 5JJBA 2AYEA 4DR3J 1S9EB 4Z37A 5KT6A 2C22A 1QVGR 2EBGA 3DLKA 3KJQB 4OX9F 4PG7A 3C6TA 3RB0A 1DRZA 3HI9A 4RNHA 1GNKA 2GJIA 1HWKA 1V3SA 2R42A 1VI7A 3NGUA 2I5JA 4RW7A 4G1QB 3FQLA 2MKSA 5ETTA 2R7TA 1GX5A 1JNRB 2H51B 3BH6B 4Q8EA 5J2NA 4J37A 1WJ9A 5LOQA 3CGIA 2CWXA 2DNNA 2VDHA 2MJNA 1RT1B 1FT8A 2M2BA 1S0VA 2CFXA 3VGVA 3UN3A 1MN9A 1J2VA 1XJWB 2DEJA 3IM8A 3M2RA 4N5SA 1N5TA 1NPPA 2FB0A 2W8KA 3NGKA 3MMBA 5CZVA 1HBNA 3M05A 2Z2LA 2NSBA 3OFEA 3HVTB 4RU9A 1BGXT 4USVA 3D66A 2ZUGA 3CCRS 2HURA 3TAQA 4A8FA 3EVOA 2E1PA 4RU2A 3NY0A 4J9KA 1S77D 2LU1A 3EE3A 2FJAB 4KBIA 4FKXA 1GMVA 5DJBA 3BSOA 1S9EA 7FDRA 2Q1LA 2E7XA 1G7CB 4PYDA 1L3SA 2O5DA 4IOAQ 2CNLB 3GJRB 3DHXA 2OUGA 4B3TJ 1FRMA 2W2QP 4NPOA 4JI3F 2BYCA 2VODA 1CULB 4K4TA 1U1KA 1UWAA 2ZC3A 3HCXA 3PEHA 2R9LA 5F8GA 2UZAA 1S10A 1SIZA 3OR1B 2HBRB 1HNZF 2B4UA 2XTJP 4G1QA 1FWPA 4F8RA 2UUBF 1JXEA 1S7HA 2EWHA 6AT1B 2XY7A 5HLFB 4UQTA 4MIAA 1RT1A 2XHCA 2KFYA 2B0GA 1IXKA 3OTDA 1M5HA 4OHXA 1PGZA 1VRTB 1LWFB 4ED1A 1QDUB 1RTZA 3T9ZA 3NEKA 1MU2B 3D1QA 4K4ZA 4DV0F 2HQ3A 1BHNA 2V9KA 2GIRA 1BWVA 3AD9C 2SXLA 2R8HA 4FYYB 3HVTA 3W9IA 3TW0A 3AT1B 3CJ3A 5G4DA 4HACB 1NJXA 2FGOA 2HNDB 5T41A 1KOHA 2JVRA 2Q66A 1KONA 2PO4A 2DNZA 2VG7A 5A6WA 2CZ9A 3PO4A 1TL5A 2XHWA 3HDSA 3CCWA 1PYTA 1S1WB 1MWQA 5L1KA 4DS4A 1S48A 1TL7B 5KFYA 2DRAA 2AZ1A 4P6QA 4OZ5A 2Y8YA 5KG0A 2VDIA 1CULA 5DG9A 3ENQA 3OR1A 1WC5A 1RHMB 3EZUA 3TWZA 1S4FA 1RU1A 3CJ4A 3GV7B 4DV6F 5A8RB 5KFKA 3GQCA 2AQ4A 4KKOA 1F2HA 2MQOA 4B9TA 4CZCA 4ZPWR 4HT5A 5HLFA 3UQSA 2OIHA 3NOGA 5GADU 5CD4A 2AU0A 3E3XA 4X64F 4JI7F 1WOPA 3H20A 4ED0A 1JJ4A 4DR7F 4AXJA 1BE4A 3CCUS 1NH8A 5LT5A 2RJZA 4WK1A 1MU2A 1LWCA 1FE4A 2DHGA 5ETOA 4CYUB 1RACB 3DXSX 1HW8A 1H3DA 2AJ4A 3CD5A 4HACA 1X4FA 2BJ8A 2X1GA 2EC2A 1IVZA 1QAXA 1KFSA 3Q8SB 2M70A 4WP3A 5D4PA 4JI1J 4QR1A 2XS2A 3MPVA 2E7WA 1ZZNA 1S99A 3VWSA 1R8AA 2CRLA 1S1WA 5KFIA 1D0EA 1KSPA 1HNVB 3IFEA 2QL5B 2OP5A 1QE1B 4KSEB 5A2QY 4G6VB 5AE3A 2E5IA 1YJ9S 3RUBL 3PEJA 2R8KA 2W9BB 4CO0A 1GT8A 4C48A 5JXSA 2JOQA 3C19A 4RW4A 1LOUA 1N8RT 1S76D 3QRRA 5HVHA 1SKWA 1I5OB 4WIQA 4NZ0A 4A8KA 5A8RA 4PWWA 3SCJE 2ZBCA 2CZVC 2XMJA 3UD4P 3N5BA 1R7IA 2VUGA 1AUDA 3PYFA 4NEZA 3A3NB 3ELHA 3ICLA 1PC5A 4DPUA 1YG0A 1FJ7A 2CG4A 1M5OC 3DDKA 4EWTA 2DH9A 2E5GA 2Y0SD 3GMGA 3BO4A 5I42B 3M7VA 3OLBA 4IO1A 3AODA 2FLLA 3DOKA 3H4BA 2BJ3A 2MDAA 2IVYA 2YKAA 3D6FB 2XO6A 3KG1A 4NLGA 5E3PA 2ASLA 4PR6A 1NSAA 4DFMA 2EG2A 2AGPA 4YOEA 1KR4A 4CWBA 2Z0GA 1TK5A 1S0NA 1D8YA 5GMKa 1T0TV 3DDIA 2PMHA 1YDLA 5HO4A 1JLAB 1B7FA 3G9CA 1XN9A 4Y0FA 1QE1A 2VHGA 3I5CA 2A2DA 2GO9A 3TZWA 1JLEA 2W9BA 1CSJA 3T1YF 3AA8A 2CPJA 3Q2TC 2M0GB 5KFPA 1TV6B 3P8BB 2CADA 2X1BA 1IQZA 3UPFA 3OR2A 4K59A 1OQ6A 5EGYA 4FXVA 3PW0A 3IGNA 4C8NA 2OMOA 2QFIA 3CJKB 3IWXA 4NXNF 3PX6A 2F1FA 4J5OA 5KFOA 2UUWA 4UT4A 5EX0A 1P9QC 3B8HA 2QLXA 4PZVA 5IFMA 1EETB 3B78A 1IJFB 5CCLA 1Q95G 4CLFA 4I69A 1C1CA 1U1OA 1IKVB 2EEYA 4IR1A 3CMQA 1TR0A 5J2QB 4WXOA 1X4GA 5B08A 1SPBP 5I42A 2RB7A 5IC6B 2MZTA 3GPAA 2VG5B 3QZ7A 2DH8A 3GIJA 5J2MB 4NLVA 4ED3A 2ZBRA 4J7CA 3MD1A 3TR5A 4CO3A 2F4FA 4IFYB 3CJQA 4OHZA 1R89A 3MR6A 3J7YI 4I7FA 3I0RB 5B0AA 1DAXA 4ZVOB 4DFPA 3IO1A 3OJUA 2OPRA 1JLAA 4USIA 3HSZA 1ZETA 3OPKA 2NQPA 4F4KA 5HMYA 5HMWA 1NDKA 4KGKA 3MR7A 5K14B 3MHYA 3O8WA 1XNQJ 3MGJA 4M5HA 3BYRA 1VJQA 1YJWS 1AFJA 1TV6A 3FRYA 2LYVA 4PPDA 4U95A 2YNIA 3LPEA 3GCWP 4KE5A 2J6UA 3O3LA 4OMFG 1SC3B 4ECTA 2H48B 2B56A 2VB6A 2BOPA 2GQ2A 1WWHA 1K44A 3LH2S 2AJ1A 1EETA 3AAWB 3EVMA 3AA9A 2UV8A 3FEXB 3G6ES 4P75A 2XS5A 2ALYB 1X4EA 1Q4RA 1VRUB 1RAJA 5J2QA 2HVZA 2P6TA 1SUQB 4Z2XA 4DSLA 1ITPA 1YTYA 4ILMA 1WDDA 3G6XA 4ED6A 1NDLA 3CJ0A 3W1YC 3CJ5A 2BM0A 2MB0B 2QT7A 2L9DA 4ZJOA 2XNQA 5J2MA 4DL5A 4F0MA 3JAMU 4ZLPA 4BWMA 3NMRA 2YBVA 2VBZA 5C25A 2I9SA 2W2MP 4IFYA 1CQMA 2F5GA 4ER8A 1C0TB 5AXNA 1P1TA 3I0RA 5A8WB 4ALZA 2AYBA 1K1SA 4L74A 4DLGA 1T9YA 2P2CB 4X4VA 1JLQB 3DRXA 2RRNA 2I0XA 1PAUB 3KLGB 5GAGU 5K14A 1NCLA 3AB2B 2NLWA 3NWRA 1X4HA 3I87A 3NOCA 2NZ4A 4R8UA 3MAQA 5E41A 4LQ3A 1SCJB 4KJIA 2CJYB 3S7RA 3NLCA 3IBFB 4KR0B 5AT1B 3NS7B 2CQ2A 2H4WB 4B3OB 5DS7A 1CJKA 4DX5A 1JMTA 4NI2A 1YZ6A 1QSYA 3BB5A 4WZMA 5KFBA 3N5FA 2CNKB 2A18A 1QUPA 4QZVB 4ZLNA 1HWIA 4E2FB 3W60A 3MM5A 2PE8A 1HWLA 5K8NA 2N3OA 3PW4A 3W8GA 1VRUA 1N5YB 3K58A 1HPZB 2R7XA 3IR7B 5K8MA 2DITA 4OYOA 1RBAA 5KFXA 2EKYA 4USUA 1UJ5A 3CDBA 2ZBIA 1HW9A 4DX6A 1VC6A 3C3LA 1S72S 1FERA 3MUTP 7AT1B 3T5JA 4PG8A 2DGWA 2N4CA 2XLIA 3HFZB 4FYXB 3MF5A 1EKSA 2MY7A 1FEEA 1IM4A 3PIOQ 2UVWA 3PV8A 4JI6J 1C0TA 2ASJA 5A8WA 5DM7Q 3RR7A 4USWA 1RQ0A 2W4DA 1JLQA 4GO5X 2YNHA 3EICA 3OVSA 3KLGA 3LGMA 1S4EA 4ZP6A 4CCHA 2IDLA 1FRXA 3PW7A 3PO5A 4I56A 2ZD1B 3KHRA 1IBLJ 4B3OA 4RW6B 3A12A 4JB8B 2Q6CA 1UVLA 3V5RA 4ES3A 4CLLA 3BYPA 1TP7A 2IRUA 3PR5B 1OPIA 1PYOB 4LRCA 1RTDB 3UR3C 4U9RA 4BLGA 5KFWA 1N5YA 1HPZA 3DLGB 1U1NA 3HX9A 4M94A 3ENWA 3NGRA 2EC0A 4CO4A 4C3KA 4LSZB 2KZMA 1KVJA 2KL8A 4LBIA 3H5SA 2GMHA 2AEJA 1DFDA 3GIMA 1Y3KA 1N32J 3R7NB 2HLTA 2BJDA 1UVKA 1WDTA 4YB5A 1HR0J 2QL7B 1GX6A 2YWGA 1U45A 2UP1A 6FD1A 5U47A 2F40A 3V81B 1U24A 2ZJRQ 4JI8J 1DJ0A 4ZVRB 3H2LA 4JI2F 2E5LJ 2R4FA 5IC4B 5KFAA 3BN4A 1PJ5A 4J9QA 1FTCA 1Q81T 4NZ6A 2EFPA 4YY3J 2DR7A 3HT0A 3HHEA 2D9PA 1O0PA 2D3OR 2LMIA 3V4IB 2FZCB 3H59A 3EM1A 4DN0A 1UTAA 4JV5F 4J9NA 2ZD1A 1RUSA 2YKOA 2PIIA 4RW6A 3RAQA 2N4DA 3BGRB 1RT2B 4K7QA 1VFJA 4AL7A 1CPZA 1VR6A 4ES2A 5LMNJ 4FS1A 4OFZA 4NXMJ 1RTDA 3PW5A 2IC3A 4CNYA 3DLGA 3F44A 3NS5A 4NLDA 5GAEU 1AT1B 2B6AB 4KGMA 3CCSS 1HI0P 1R27B 5F41A 4ZVPB 2R8JA 3R6GB 2V34A 1C4AA 3UD3P 1KDNA 2UU9F 3ILOA 3OSPA 4L72B 2VOOA 4X65F 1VQ5S 1Q8KA 1XTZA 4UZCA 2XYPB 1RTIB 2P9EA 4CQ1A 3TO8A 4G3IA 5SZTA 4NOHA 2MZSA 2EK6A 3I32A 3V81A 3H40A 3R8YA 4OX9J 2KXHA 4LRFA 4NZ7A 2BW7A 3JQJA 3BO2A 4Q7AA 2CPZA 5KFRA 1HQEA 1RE1B 3D0HE 1T3NA 2XS7A 1RHKB 1S9GB 3CC2S 2JLEA 4TQRA 1RHRB 1AXQA 3W9JA 3V4IA 4NLTA 4HI1A 4OYIA 3H25A 3ZZTA 2AKWB 1XR5A 3BGRA 3FEZA 1RT2A 4ECQA 1SJ4P 4HR2A 5CHCB 2VC1A 4FF2A 3MM7B 1VBKA 2ATCB 1GXTA 4DL6A 1K0TA 3W7BA 2HHUA 2XGQA 1NKEA 4IO9Q 4AQYF 1KLNA 1G1XA 4FVCA 3WX4A 3SCIE 2B6AA 4L76A 2JFDA 2ROPA 3D1OA 4FZVA 4UUXA 3RW6A 2VFVA 4Y2IA 5A2QU 3VAJA 4ECWA 5AXKA 2CVEA 5C24B 3PHEA 3EGWB 1FNMA 4IFVB 4TKTA 3MURP 3FJ2A 2FZGB 3RGIA 3J7A1 1RTIA 1NNDA 5BJRA 5D4NA 4ATNA 4ETXA 2WSEC 2ZC4A 3UO0A 2YNGA 3E2EA 4XAKA 4QPXA 4JI3J 2AJ2A 1KFDA 5EUHA 1CS4B 1S9GA 4DF4A 2VJVA 2CJBA 3JTOA 3J7YU 3C8YA 4B3SF 2UUBJ 2BABA 4DR6F 1B99A 4DN9A 4ZOSA 2ZOFA 1FNOA 4BCAA 4JI5J 3NXZA 4U67Q 1SC1B 3ILLA 4QR0A 1XWLA 3AOBA 3A1YG 3BV8A 3MWBA 2O3DA 4FDFA 4NLRA 2CPFA 4EBEA 3CIMA 3K2YA 4K0KJ 1W2IA 4NCAA 2GJ2A 4XDDA 4OJ1A 2G0CA 4LF5F 3R7SB 2RU3A 4DSEA 2WVFA 3CDUA 4USMA 3I9V9 2UXCJ 4C8LA 2KXNB 4N77A 1PO6A 2ILZA 2GHVC 2HBZB 3PG9A 2QO3A 4OJHA 1HQ2A 4DZ6A 2G2ZA 4ZJQA 3IMQJ 4P7VA 3DN9A 5M2RA 1JWWA 1NB7A 3UI3A 3BN7A 2ZM6J 2CQBA 5C24A 1CG2A 3GYGA 1NDPA 3MCMA 2OFHX 1T95A 2VONA 1J5EF 4IR9A 3H0PA 4C0OC 2Z56B 2M7SA 1AROP 2PI5A 4G1PA 4FS2A 2PMZD 4KH0B 4BHQA 2HS4A 3L9ZA 1MN7A 1CS4A 3HJVA 2LVWA 5F9LA 4W92B 2DBBA 2FHMA 1N4LA 1GK8A 4WE1B 4L3KA 2JWNA 2FVSA 4DV6J 2OJ3A 3QLHB 3QQCD 5B0EA 2QLWA 3G6VA 5L46A 2E5JA 3K57A 2KB2A 3TA1A 2GHWA 4JI7J 1ZM3A 1LKZA 4C0BA 4XPEA 2LQ8A 4DR7J 3WC2A 3RAXA 1FI4A 2W7AA 2ZVIA 1WUUA 4O4GB 2QA4G 3CJ2A 5HMXA 1RTHB 4YDXA 2HWHA 1SL2A 3OL9A 4WFBQ 3OTBA 1FO1A 3EPIA 3PM9A 2ALZA 4E98A 1UCNA 2NCKL 3EVWA 2C42A 1PILA 1X4AA 4X4RA 4K50A 2H5JB 4X62F 4JI0J 1RHUB 4PCQA 3O44A 4DI6A 1MWZA 1SJFA 2EPIA 2V63A 4C3LA 1RWUA 3OJSA 2F8HA 1NU4A 4BBYA 4J9RA 3MAHA 4YN3B 1MMNA 3D54A 3FFIB 2CZ4A 2HFZA 3H98A 3N9UC 1HNXF 1XEZA 2FY8A 4RUAA 2F63A 4KB7A 2FJXA 2J7KA 3FUYA 3KG4A 4EUVA 3ZTRA 2PSZA 2GX8A 3CIZA 2FJBB 4OZLA 4DV4J 3J81Y 1ACMB 2U2FA 5IXUA 4I1TA 1EX8A 5HAOA 4WE1A 1KD1T 2FJEB 1DBDA 2CJAA 3ZZPA 3QT7A 5JMNA 3NBPA 5DQGA 3QLHA 2CPDA 3US5A 2I6WA 3X1LB 3WDOA 2Z8QA 1XMOF 7FD1A 5KFUA 4WTYA 1OSCA 3U02A 1JNZB 2CVIA 2LKZA 4M63A 1MW7A 3V2UC 4CLTA 3T1AA 2BM1A 5CAAA 1WOOA 3Q83A 1YRXA 3AH6A 4PWDB 3HXMA 3V4MA 4O4GA 1RTHA 5DZ6A 3UDVA 2C3OA 1NUEA 3D0IE 1NK9A 3VGSA 4OJ3A 1YJNS 2M4MA 2KKHA 5LMUF 4I6YA 1VQKS 3U1LA 4BC7A 3IP0A 3BKTA 1FD2A 3FSIA 4DV7F 2W1BA 2VQFJ 5DZ7A 3PY8A 1YJRA 1N34F 3AHPA 4EBDA 3NMAA 2CKWA 1NLKL 3D28A 3BGFA 2C2EA 4IQMA 4HH0A 3FFIA 1RHQB 3C15A 3R2DJ 2NZCA 1RWMB 1N36J 5ITHA 5D0HA 2DVIA 2F3JA 2OTLS 2OLWA 4N8NA 3TVZA 3T1YJ 2E44A 3EYZA 1HBMA 3BGLA 1I94F 1RXOB 4F04B 1EQMA 2VFUA 3J81j 4YQWA 3R5AA 1NSKL 1SKUB 2BJ9A 4Y2KA 2M3DA 5CCMA 3DCAA 1ICEB 2B8PA 2ADCA 5GAHU 1RHJB 5KG5A 3CC4S 5D77A 3POTB 2H1YA 1RJJA 3SDEB 4W98A 3LP2B 1CBKA 2C2MB 2HLUA 1RA7A 3GR1A 2PD1A 2G1DA 2X1AA 2F4VJ 4ZPBA 4RUCA 1OY8A 1RWPB 3IWLA 3O1LA 3ZZUA 3SCKE 2HWTA 2EFOA 1S12A 1NPRA 2O01C 2D3UA 1RT5B 1F2GA 1B64A 3TP2A 3TZYA 3ZXWA 3AD7C 1VQYA 5KT4A 2CQ1A 3E01B 2V4JB 1JXLA 2IA6A 4UOGA 1M0SA 1V3ZA 3EGNA 3KLFA 4ZP7A 4GKJJ 1WD6A 2OKQA 4KAIA 1I6JA 2DGOA 4X4PA 4V19J 2VBYA 4DUYJ 3CWJA 4ZVUB 2GZOA 5F8JA 3W5YA 2RIJA 1WG5A 1YWXA 4DWIA 4ZKAA 3D3BJ 4W4MA 3U7JA 1T11A 4M5DB 1KQKA 4CO5A 4URQU 1WHWA 1XR6A 3TX8A 4ITSA 3LOUA 5F8HA 3G86A 3RRHA 5F0WA 3POTA 1RAEB 2HHPA 5H9FJ 5C42B 4RW8B 1U2FA 3MUMP 5KT2A 1RGVA 4OX8A 2XSFA 2D69A 1KN6A 2BACA 3GG0A 4O44B 5JVGQ 3PIPQ 1IR1A 2XBPA 4Y3CA 4EZ9A 1M5VC 3UR0A 3I5BA 5B0CA 4DL3A 4M8LA 1R8HA 2AGQA 2HFSA 4OHVA 4KTQA 2WVDA 2ZH9A 3PACA 4UOHA 5DLFA 4ECYA 3OL6A 3E01A 2V4JA 5D0RA 2CJKA 3EXCX 5RUBA 2FVCA 4USHA 1R3NA 3OTEA 5HQLA 4W90B 1VBYA 2D3ZA 2LXUA 2WOMB 3KOAA 4P2SA 3ZO7A 1RT4B 2RMLA 4EMDA 1V5VA 2I2YA 4LSNB 2XWXA 4Y2CA 1HL6A 2DK2A 2COLA 1X5PA 5GMEA 2RILA 1N33F 3BSCA 3OLAA 2HG4A 2JLFA 1FX4A 3TZXA 2RUSA 9RUBA 2DR6A 3W9HA 5HJYA 1U6BA 5KG6A 1TZ0A 2H9ZA 3TA2A 4DCJB 3I55S 3SI8A 3GIKA 3C66A 4ED4A 4YDDB 3FCHA 5C42A 4RW8A 3IXQA 1RT3B 3MM9B 4IH7A 4OV1A 1T9TA 3W3SA 1H7WA 3UDCA 3IBWA 2MZQA 3Q23A 2A2CA 1LFPA 3M32B 4I2QB 3K8WA 2Z2ZA 4IKAA 4ZVHA 2WSCC 4DPOA 1RB0A 2A1BA 3KXDA 4WPAA 2B9XA 3MOJB 4KHMA 1F1BB 2FHOB 4UOCA 4DQRA 3RU0A 4FKYA 4K4XA 3ZZZA 3K89A 4DPYA 3LGNA 1YIJS 2EK1A 1RT7B 5ETQA 4NLYA 4KQZA 2ASYA 1Q79A 3FMBA 1YZ7A 3H5UA 2JEFA 2NXEA 2F65A 4B3MJ 2WOMA 3A3OB 4LSNA 3HP6A 2R7UA 4AD6A 4P71A 3M6XA 1TL4A 1XMQF 2AMCB 1LWEB 1Y9OA 4EK2A 5IWAF 1PYSB 2BQRA 3DYAB 1DHMA 3DM2B 5CYQB 2B9EA 1L3VA 5K9FA 1S49A 2UV8G 1M5KC 4IUFA 2C3YA 1T05A 3I4HX 2GQCA 2WONB 4LSLA 3LAMA 2BBEA 3MFHA 4FNIA 2FZKB 3DGVA 2XLJA 5BYSA 1RT3A 3MM9A 3Q8QB 5ETVA 5E33A 1N5SA 3UNGC 1FRJA 2KT5A 4DZDA 4ZJLA 3M32A 3QWUA 2IPOB 4I2QA 4DG1B 3NWGA 4RNOA 2HK3A 4UQGA 1H73A 2ZOMA 4NLUA 4N7TA 3W2WB 1RABB 3EDQB 1LW0B 2CQ4A 2E66A 4LF1A 2QZ8A 3B82A 5KFVA 4I6WA 4J9UE 4PABA 1KTVA 1RT7A 2GVDA 1SJ3P 2HVIA 4LREA 3G6YA 1HFEL 2W2PP 3MFIA 1I3OB 2HW3A 2WB1D 4MFBB 4K5RA 3BKFA 1FRLA 1JJ2R 3KJVB 3BS9A 3E51A 2RHQB 4B3RF 2VKRA 4DR1J 1RWOB 4P2FA 1LWEA 3H8YA 3QJLA 4OI2A 2DR8A 1HQUB 3DYAA 3DM2A 5CYQA 3BSAA 3NNHA 1SL1A 2K7JA 2ZZTA 4HHJA 2WSFC 2QL9B 1ZAVA 4HH1A 4J90A 3QIPB 3FZ2A 3RBZA 2UXDF 4WZQA 2QMXA 5KFMA 4X84A 2HRYA 2MKYA 2H65B 3RW7A 2ACYA 4UY85 4P2XA 3KK2B 2QEXS 4EI2A 1F3FA 3D3CJ 5J2PB 3Q8YA 3D2WA 4H4MA 1NJWA 4IH6A 1BY9A 4CH7A 3BBCA 1EHWA 4ZVQB 2ZBPA 2J7UA 4DG1A 1HWUA 2DGUA 3W2WA 3PYDA 2UU9J 2FHJD 1TVRA 1YRUA 2LDYA 1X9SA 4X65J 2CIMA 4ID5B 4DPXA 1RKIA 1NK6A 4QWDA 4LFBF 5F8NA 2XYHB 3DRYA 2ZH4A 1T9VA 4CT8A 1TFWA 3G4SS 4MT1A 3CTRA 2AP6A 4KGXB 1X4DA 2XULA 2VZ9A 3D0GE 3KJVA 5ETKA 3T3FA 2YKPA 4IG3B 2ZH6A 3GFYA 4CLZA 2KYZA 3C16B 4CTAA 1NKBA 2J6TA 2DD8S 3NKYA 1SJ1A 1TKDA 2PEBA 4PAAA 1FD8A 2WVEA 4RBVA 1U1QA 1TU0B 1PC4A 4A8YA 4TYBA 1RP5A 2EFQA 3VGTA 2IMOA 3ET6B 1Y5LB 3S1TA 1AZSB 2AYMA 4DUZF 4RW9A 1UVMA 2AEFA 1FJGJ 4NYZA 2ATLA 4AQYJ 1VQLS 4LUBA 1WELA 5LJ5Y 2HMIA 4LF8F 5J2PA 2YX4A 5L9NA 1VK3A 2VASA 1VDHA 3QSYB 2LCWA 1JLFB 2LP4A 2HFUA 1V5IB 1URNA 1KLMB 3HD2A 5C7PA 1FEHA 1PJ7A 4V1Ak 1R8PA 4KV8B 4DSIA 4HHHA 2GV1A 2VPZB 5D4OA 3J81U 2IJNA 3OFGA 4ID5A 3GTYX 2YY3A 4ED2A 4N47A 4R0JA 4LF2A 2C2NA 3PJ9A 2QRRA 1CJVB 2NPFA 4TVAB 3Q24A 1OY6A 2CQCA 2QN6B 5C2GA 5IV3A 3V6JA 1Z1ZA 2V0NA 2MLYA 2DIVA 2FY1A 3RR8A 3HVRA 3HHNB 3KDNA 3LWMA 3TYTA 4IG3A 3PJWA 2VPWB 3CCZA 1Q82T 2Y1LB 4B3SJ 4J91A 3T6JA 1J5OB 3P5BP 3C16A 1HBUB 5KFDA 2XNRA 1E6VA 5AXLA 4M5GA 5F3ZA 3BF4A 4RO0A 3EXYA 1FTRA 4OYBA 2LQJA 4DMZA 1UPMB 5THWA 1S1VA 3ET6A 4N41A 2ZBQA 3K5MA 2C3PA 2QYGA 1DQ9A 3WX8A 4IG0A 3DKDA 1NJIT 3PKYA 2JZ5A 5SUHA 4OI4A 3BEGB 5KFZA 5FLXY 1KS2A 5IS2A 1EZZB 2XY6A 3VTIA 3IN5A 1QTNB 3DLKB 1TL3B 4DR3F 1T9XA 1M1GA 2A10A 4MIWA 5LJ3Y 3LP0B 4FNHA 2P9CA 1UW4A 4F4ZA 4RKUC 1JLFA 3TARA 3A8EA 1VLYA 2GA7A 5GVQA 2E1RA 1TKTB 4DDFA 4KV8A 4CRJA 3ENAA 2G2OA 3QMQA 3HLUA 2CWKA 1RSCA 5HQMA 3KFWX 1FRKA 4ERDA 2H54B 3UDLA 2LEPA 5H9EK 2XGPA 3R2CJ 4UUWA 4QWCA 4MKVA 3IRXB 1YX2A 2XMAA 4RBTA 1Z4UA 2J9DA 3SIPB 1K9MT 1FVSA 2HZVA 3HKWA 2LLZA 2MLXA 2HQCA 4CLPA 1WKJA 2DHHA 1BXNA 3M6UA 1EIYB 1HBNB 3VAHA 2QMWA 1HBUA 3OL8A 4A8QA 2R7RA 2V8VA 3DNCA 4EO6A 5KG4A 4C8YA 2ZOGA 3LAKA 4K4SA 1I51B 2I1RA 5CD4H 1SC4B 5EWFA 2GO8A 2G13A 5CABA 1X5TA 5HI7A 4M1KA 3OT9A 4YEAA 4ELTA 1IWAA 3V6KA 3L95X 4FBUA 2CJXB 1KBRA 1U26A 4NLPA 4DL2A 1TL3A 4DU8A 3LP0A 1EAYC 3TVYA 4X62J 1A6LA 5HATA 2XMKA 2XMTA 4OL8A 4ZPAA 1TKTA 1NK8A 1QSSA 4B3TF 1RAGB 3QZ8A 5H9EJ 3R1LA 2J9CA 3PX0A 1ZYQA 2BDPA 2RAQA 2G2YA 2AX1A 2IDEA 1VQ7S 2IRXA 2Z4PA 3KKFA 3GG1A 3I96A 3IRXA 3CCMS 2PA3A 1U8WA 2KRRA 4ZVTB 1WOSA 4DL0C 2CDQA 2AJ0A 5GMDA 4PXBA 4F3OA 4P7TA 3CULA 3VF0B 2YNFB 4ZCIA 3IBCB 3DHWC 1NEEA 4C4WA 1YVFA 3DOMB 1AFIA 3AXKA 1MMDA 1B0PA 4A8SA 2UVRA 4ELUA 4HI2A 1VQ8S 3DU6A 4XO0A 2VG7B 3QT5A 3K5PA 1WC4A 1XIQA 4FYVB 3UCZP 4DEZA 1U47A 2OO4A 5LMUJ 3C6UB 4KO0A 4Y2AA 2DIUA 2NR0A 4U7UD 2JC0A 1NAQA 4UOFA 4DLEA 3I82A 3CJSA 3UCUP 1U25A 2IY5B 1SH0A 1G6BA 1ZM9A 1S1UA 4ELVA 2WBRA 3DMJB 1GMWA 2YTCA 3MPDA 1SJRA 4ECUA 2IJFA 5KG7A 3AFGA 3A13A 3A3PB 4KKOB 5ETNA 3QAEA 2HGMA 4K8RA 2CUYA 1RAIB 4DR2J 4QPTA 8AT1B 2W9CB 4L73A 1ZA2B 2JDJA 1SC6A 1PJ6A 2DNQA 4URGA 1LWCB 2AF6A 3V6DB 3VZHA 2YNFA 4TYAA 4JYAF 2V2VA 3GP9A 1YBTA 4HYKA 3DOMA 3C2PA 3D5MA 2BVZA 2NYHA 3FCVA 3GFHA 3KJNB 1QVFR 3CE8A 1JXVA 4DL4A 1YJVA 3VAKA 2RUGA 3L7PA 5CZXA 3FVYA 4NWBA 2EG1A 2C2DA 5HL7Q 1H72C 3Q8UA 3C6UA 1LQ9A 3G96A 1U2RA 2JEJA 1NH7A 3M8QB 1Y11A 2QA1A 1BLUA 3M8SA 4USJC 2FC9A 4HKQA 5BR8J 1NBEB 1RWVB 3DMJA 3BH7B 2B7BB 4RW4B 1OY9A 4B9LA 2KRBA 3MR2A 3AB4B 1PKUA 2W7PA 1YBUA 1A0OB 1BMQB 1SQEA 5IV4A 3OL7A 4NLSA 3Q89A 1P27B 1BQMB 3LGHA 3QPIA 5DM6Q 1VC0A 3BGOP 1FHTA 1LV5A 2XMUA 2W9CA 3W66A 1V9OA 4S0MA 4F25A 2DNOA 3I6PA 4DCOB 3R1HA 2DPJA 3TZZA 1PBAA 3V6DA 2BRLA 4ZVGA 1NB2A 1O6XA 4RWXA 2NUHA 1L3UA 4MK8A 4RNNA 3DOKB 4Y2MA 3PCOB 2XI3A 2V2ZA 5KFFA 1RBLA 1VHFA 2BE9B 3SFGA 3NCQA 3TJ9A 1S7IA 4ZA1A 2BXJA 3MOZA 4WP9A 3QIDA 2L41A 2Z57B 3U1MA 1R6YA 2EXUA 5FJ4A 3W5XA 4ZS6A 4NLWA 4Q0BB 2WVBA 4JV2A 2ROEA 3ZFVA 3CCJS 2VA3A 3BGUA 5B09A 1T03B 2BKPA 2DCLA 2HVHA 2DR5A 3ETOA 3M8QA 3CMAS 4HL9A 1IQTA 1JLEB 2YWKA 1DZ5A 3P3DA 3OV7A 1RISA 1XNRJ 1SL0A 1S1XB 2J0XA 4QIEA 3OR2B 2ROGA 4C98A 2HGNA 4ENOA 2L08A 2GMLA 1RYSA 3GSDA 1BQMA 4QYRA 1M5SA 4PG5A 3JQMA 4GRSA 2DR9A 3BQ1A 4AYBD 3CSKA 1C1CB 2LXFA 4Y34A 4RLEA 4ZLJA 4RL1A 4F50A 1YJTA 1N33J 1WEZA 3M9NB 4QU7A 3LUYA 1I1GA 4PUOB 2WZ1A 2CNNB 3F56A 4P10A 1NJZA 3SZ2A 3N28A 3M9OB 3KUEA 4YHHF 1S6QA 1ZPWX 2W4PA 1VHIA 3Q2SC 2VQEF 2O67A 2XC9A 3W2VB 2MTLA 1BD6A 2XWYA 3JYTB 2YQ0A 4OZ0A 2GJFA 1XR7A 2OMLA 3NCRA 4Q0BA 4GVBA 2IVMA 4I7FB 3CCQS 3BM7A 4OI3A 1JLBB 2OPRB 2BJEA 4U96A 2YH1A 1T03A 1KWMA 1REGX 3ILIA 4WKYA 2OD6A 1Y00A 3TUZC 1XQIA 4YR3A 2XCAA 2LEAA 5AJ3J 4ED8A 3EX7B 5DG7A 1D09B 2WTFA 3GJQB 5LXRA 1TUVA 1VQ9S 1UAWA 1S1XA 4CT9A 4OZNA 1XNQF 2YNIB 3GB0A 5A6PA 4YMEA 3ZTOA 5KG2A 3KHHA 3SV3A 1IWGA 1BC6A 2ZH8A 3R3TA 2LA6A 2IYIA 4FF4A 3MZIA 2R8GA 3OHBA 1HI8A 1NM2A 2N7YA 3WQPA 1N48A 5KOWA 2KT2A 3MCNA 4KGVB 2PI4A 3OTOJ 1HNIB 1H2VZ 2E1CA 2KXFA 1FNXH 4PUOA 4CP5A 1VJWA 2EFGA 4DV5F 2MEWA 2G0IA 2BQUA 2W4CA 5IT4A 3DGPB 5E3AA 1YRTA 2Y1RI 2D7SA 2KJWA 2FUG9 2B5JB 3NNAA 3B4MA 3VVUA 3W2VA 2HHHJ 3P4UB 3JYTA 1R0CB 2EFNA 1IKXB 4MYUA 5C25B 3AY0A 2ZFHA 4O23A 1HD0A 4QIWD 5T7LA 4F3QA 2J5AA 5I3UA 2HHSA 1JLBA 1NO8A 1M5PC 4DPWA 2OGUA 1Q5VA 2KZZA 2WHOA 3T9NA 5H1SV 1SXLA 3PW2A 3LW5C 2Q43A 3P45B 1N54B 4C8MA 4R8UB 4OX7A 3QGGA 3KLEB 4PQUB 1FKOA 2J6SA 2DNGA 2YKNA 5GADI 3TUJC 4TNOA 4CNZA 2P9GA 2HQDA 5IQ6A 3CB4A 2BZ2A 4OYMA 1CJKB 4NI2B 2OTJS 3L4BC 2GW8A 1UMJA 1TKXA 2L48A 2X1FA 1NDCA 5L8RC 3QFHA 2FVQA 4OZ1A 4TLRA 2QMUB 2Y1IA 2OD4A 1OSDA 2ZKTA 3CUNA 4OLOA 2JFKA 2R7SA 2J8SA 3EJMA 3MM5B 3HSJA 2LFVA 1HNIA 2ZE2B 4CI0B 1AYEA 3ZZRA 1RAHB 4LF7J 3DGPA 4NYOA 5FLXU 4QWBA 4O3RA 3GIRA 1UA1A 2VG6B 4LT6A 1RAOA 1OS5A 2B5JA 3M2VA 3UVJA 2GAGC 2HQFA 1DLOB 1IKXA 3I4PA 1KC8T 5F9NA 2NXUA 4X4NA 2VD3A 2GIQA 1UA0A 2NXJA 3JSBA 5HP1B 3K5OA 4RNMA 3RJMB 3ZZ0A 2KHCA 3N79A 1XK8A 3SSSA 4LF9F 1VQPS 2YNHB 4JI6F 1VQ4S 2V5HG 5DDQC 2RDDA 4IDKA 4C8ZA 2FYXA 5LXYA 3UWTA 2YKQA 2K1RB 3LANA 2MY8A 4AUKA
chains in the Genus database with same CATH topology
2YQ1A 1VHIA 4K2JA 2YQ0A 2YPZA 4UZCA 4BLGA 4UZBA 1B3TA 2YPYA 5A76A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YQ1 A;  1VHI A;  4K2J A;  2YQ0 A;  2YPZ A;  4UZC A;  4BLG A;  4UZB A;  1B3T A;  2YPY A;  5A76 A; 
#chains in the Genus database with same CATH topology
 3KLE A;  4PQU A;  4ZPT R;  4IOC Q;  2XEX A;  4WF9 Q;  2CQP A;  3W62 A;  4LFB J;  4QIV A;  3MD3 A;  4JV0 A;  2WVC A;  2CPX A;  2RQ4 A;  4PXE A;  3R6L B;  3R5D A;  1JLC A;  2DT9 A;  3OFF A;  3IA0 A;  4DXL A;  1IBL F;  2RS2 A;  3MMA B;  2VV5 A;  2Z30 B;  3MR5 A;  4HDH A;  1GXL A;  1WF2 A;  3VR1 A;  2KFZ A;  3S6E A;  4DV3 F;  2ZE2 A;  3LPY A;  3GIL A;  3FCW A;  4LFA J;  4JP8 A;  5IZH A;  4XTT A;  1SKR A;  4OQJ A;  4LF4 F;  2VG6 A;  4B02 A;  3TUI C;  3HF5 A;  4FF1 A;  2HWI A;  3VAF A;  1EKR A;  3NGD A;  4A47 A;  4H4O A;  4LIR A;  2HQI A;  1DLO A;  4ECS A;  2R2R A;  5HP1 A;  2E1A A;  1R8C A;  1N32 F;  2QLF B;  2E9Z A;  5I4M A;  1Y5N B;  4LF8 J;  2V8G A;  2BJ7 A;  1KTQ A;  1L3K A;  3MTJ A;  1RT6 B;  1SQG A;  4ILL A;  2BE2 B;  1T02 A;  4JI8 F;  1PAE X;  2K1R A;  2E5L F;  1VQS A;  1U6Z A;  3CJT A;  3MR3 A;  2AD9 A;  4C9D A;  1UVI A;  4E8U A;  1TEL A;  3M8P B;  4KGZ B;  3B6B A;  4YY3 F;  1VIS A;  2MKC A;  3H2U B;  3V6H A;  1PSD A;  3BR8 A;  2XZT B;  1U1P A;  5HVG A;  3EPG A;  3BBB A;  4A46 A;  2IM2 A;  1X60 A;  5JVH Q;  1Y0H A;  3JSR A;  2QSF A;  3MMA A;  3R9L A;  5HRO B;  4IRC A;  3KNG A;  5BYQ A;  2CJ9 A;  4PPZ A;  2IC3 B;  4X4T A;  4RZR A;  2MQM A;  1IBK F;  3G8Q A;  2FHJ A;  1MWY A;  4TU7 A;  3MEC B;  3IAM 9;  4DSJ A;  1OPZ A;  1NRK A;  2J9D E;  4DQI A;  4NA3 A;  2OEJ A;  2KYX A;  3TA0 A;  1WEX A;  2MZJ A;  2D1C A;  4L3N A;  3ZNU A;  4HTJ A;  5D8H B;  1RWK B;  4PKD B;  4DV2 J;  4CLY A;  4K4Y A;  4P9S A;  4MYT A;  4LVN P;  3R27 A;  1UL3 A;  3IRW P;  5FD1 A;  2R2S A;  1AA1 B;  2JJ4 D;  2QIF A;  3QGI A;  2AHO B;  2UXB J;  1C1B A;  1CC7 A;  2Q79 A;  5J1N A;  1D3W A;  3FBE A;  1ULR A;  3AJD A;  2QGF B;  4WU2 A;  3JSY A;  1HQE B;  4R25 A;  1IKW B;  4LBP A;  1RT6 A;  5E0O A;  2C28 A;  4M95 A;  2BE7 D;  2BE2 A;  3TEG A;  2JX2 A;  3LP1 B;  1ZM2 A;  1VCT A;  3OXL A;  4K4V A;  5KTQ A;  3ADA C;  5KFT A;  1B4S A;  1EJ7 L;  1ZS6 A;  1TKZ A;  1T7P A;  1W26 A;  5IM0 B;  5C2C A;  3HZE A;  2J76 E;  3TRG A;  3VAI A;  1VYA A;  1B3T A;  3M8P A;  1RCO B;  4KHP F;  1S6O A;  3MED A;  2K3I A;  2OI2 A;  4EFA C;  3D6T B;  4I67 A;  5D6G A;  4F0K A;  1REV B;  1H74 A;  4QWE A;  4YP3 A;  3UW1 A;  3A8I A;  2APO A;  1UWB B;  2CQI A;  3O5T B;  1GXU A;  2YWE A;  4NML A;  1GFW B;  5DET A;  3TNV A;  5HRO A;  3A8J A;  3JSM B;  3TQE A;  3R97 A;  4DQP A;  2E5H A;  2QYC A;  2Y9H A;  1U48 A;  3M6V A;  2CDR B;  3KYL A;  4PWU A;  3MUV P;  1U4B A;  2XSJ A;  3MEC A;  1WSR A;  1K73 T;  2G1H A;  2CQD A;  5D4L A;  4FF3 A;  2V4Q A;  3CPW R;  3QO9 B;  2XY5 A;  2ZDP A;  2YKM B;  1AB8 A;  4FYD A;  2QSW A;  2ZH2 A;  1IM6 A;  4QR2 A;  4J9L A;  2B9Y A;  4N76 A;  4ICL B;  4X66 J;  1U1L A;  2W9A A;  1WI6 A;  3RZA A;  4ED5 A;  4D3G A;  4V19 X;  4DR4 F;  3JTP A;  2HAF A;  2XG8 A;  5GAG I;  2MQL A;  2Q3P A;  2DNM A;  1UP1 A;  4B9N A;  2ZZM A;  4WYL A;  3MM6 B;  1X31 C;  4KYZ A;  2NXN A;  2YNG B;  1A9N B;  4LIW A;  2CG8 A;  3P49 B;  2HFN A;  2MKJ A;  1IKW A;  1Z2Z A;  1CLF A;  3ILJ A;  2QLB B;  1WHX A;  3LP1 A;  2LU2 A;  5ETS A;  5F0U A;  1YLX A;  5KG3 A;  1S5Z A;  2A0F B;  5IM0 A;  3THV A;  4OV6 A;  1TAU A;  3QGH A;  4QQB A;  1FWL A;  2EI5 A;  1XC9 A;  2D3O 1;  1REV A;  3PHT A;  2YWW A;  3DDN A;  1UWB A;  2HNZ B;  3W63 A;  3HUL A;  4U8Y A;  4JI5 F;  3AQO A;  2KH9 A;  2F7V A;  3JSM A;  4K4W A;  4ZP8 A;  1W7W A;  4UW2 A;  5KFL A;  1HLW A;  2DGQ A;  4FPI A;  1VQO S;  1FES A;  1RWW B;  1DTQ B;  3SQG B;  3CO0 P;  4EU0 A;  4QJV A;  1FDD A;  4ECX A;  3HFV A;  1HI1 A;  3NAH A;  2IM1 A;  2IYG A;  3RBX A;  4K0K F;  4DX7 A;  4WXW A;  3QO9 A;  1JIH A;  1UEU A;  4AT1 B;  2YKM A;  4Q8F A;  4Q5V A;  2R7O A;  2UXC F;  4UY8 T;  1SVD A;  4ICL A;  1Q1K A;  4WTO B;  3NL0 A;  4UZB A;  4Q43 A;  1XMB A;  2R8I A;  2FLN A;  4HT7 A;  1C2P A;  3TJ8 A;  3N0V A;  5DGA A;  4Y28 C;  1URR A;  2ZM6 F;  3MCS A;  2BRK A;  3G82 B;  4G65 A;  4ZLL A;  4C6A A;  3MM6 A;  3G8T A;  2F9J A;  2FDN A;  5EN1 A;  1U6F A;  2GGP B;  1VOM A;  2HFV A;  4ZIW A;  4DCP B;  4DBQ A;  4NL5 A;  1HNZ J;  5MAO A;  4NLQ A;  5LSO A;  4A4J A;  3M4X A;  4WK3 A;  2DY9 A;  2QA2 A;  4XPC A;  2BEF A;  4OI6 A;  3QFW A;  2BAN B;  1G4C A;  1EP4 B;  1N0U A;  3EWG A;  2W7O A;  2DO4 A;  1P9Y A;  2JNJ A;  3BPD A;  1KEK A;  2B3T B;  2HNZ A;  4O3O A;  5IT9 Y;  4M5I A;  1S0O A;  1QJH A;  4PQA A;  2V69 A;  3K5N A;  3RRG A;  4IRD A;  4DV0 J;  2VIH A;  2IJR A;  4JYA J;  2JHE A;  1Z2L A;  1DTQ A;  1NK5 A;  1YBA A;  3SQG A;  3G2X A;  1VRT A;  1LWF A;  2XMW A;  1DQ8 A;  1Q8L A;  1C0U B;  2DY1 A;  1VC5 A;  5D3G B;  4E0D A;  3AQP A;  4OYP A;  2NSC A;  3P5T L;  3NGS A;  2MXY A;  1YJU A;  3M9M B;  3PFO A;  2I8E A;  2QG9 B;  3OFH A;  3OTC A;  1GTE A;  1T94 A;  2M5Y A;  4JI0 F;  3IWN C;  3RB6 A;  1CVJ A;  2HND A;  2QFJ A;  2UUC F;  4TN2 A;  1KHW A;  2DGV A;  1WTB A;  5IT0 A;  4GKK F;  4J9P A;  3G82 A;  2ZH7 A;  3W65 A;  2CQ3 A;  1O5J A;  3PX4 A;  3JTN A;  4NAS A;  4ZIT A;  4ANC A;  3FKB A;  4YR2 A;  2Y1J A;  1YSJ A;  1TL7 A;  2HHV A;  2GGP A;  4TU9 A;  2RKI B;  4Y00 A;  3OHA A;  4DV4 F;  2AV5 A;  3NBP B;  5F8L A;  1TFY A;  4JV1 A;  3TUP A;  3KK3 B;  3T41 A;  3Q8R B;  1GMW D;  2F9D A;  2E7V A;  4O0I A;  3T5H A;  4WP8 A;  2PC6 A;  2RH3 A;  2BAN A;  2GFF A;  1GEH A;  3E8O A;  2N82 B;  1EP4 A;  1X5O A;  4U8V A;  2MZR A;  4X64 J;  2PN6 A;  4O3P A;  2HPU A;  1C4C A;  1RLD A;  2MLZ A;  3DLE B;  2JRS A;  1RAF B;  1VBX A;  4O4R A;  1YI2 S;  2NS1 B;  5GAE I;  2Y0B B;  4URS A;  4XIU A;  1U7L A;  3T6B A;  4HLB A;  3OXG A;  3JS9 A;  2DHA A;  1C0U A;  3BSN A;  4DFK A;  3MEK A;  2DKO B;  3J80 Y;  5D3G A;  1PBU A;  4PXC A;  4CYU A;  2IFX A;  4RUH A;  1Q78 A;  3BDP A;  2C2K B;  2KFN A;  2ZH3 A;  3WBZ A;  2KU7 A;  1UZD A;  2QTW A;  3HSD A;  4H4K C;  4MKB A;  4L75 A;  2VQF F;  3C15 B;  5HN0 A;  3VAL A;  2MJU A;  3HHL D;  2QLJ B;  1X0F A;  3CCV S;  1ZOT A;  2ABY A;  1U8S A;  2RSQ A;  1HNV A;  4RUB A;  1N36 F;  1Q8B A;  3KMS A;  1HBM B;  1UJ4 A;  1BWE A;  4OIX A;  5LSR A;  1U0S A;  3EGZ A;  2RKI A;  2RRB A;  5HBM B;  4F4A A;  3D67 A;  3HHD A;  1S1T B;  3DLJ A;  4NE9 C;  4CM2 A;  3KK3 A;  2ACM A;  5KT5 A;  3CDA A;  2QJ3 A;  2DHS A;  4DFJ A;  4LF6 F;  5EDW A;  3NP5 A;  3DLE A;  5J1P A;  4GVL A;  5L1L A;  4QU6 A;  1UKU A;  4KFB B;  2FLO A;  3K59 A;  1FCA A;  2ZNZ A;  4ZVS B;  2O66 A;  5D0G A;  1B0T A;  2FJV A;  3HVA A;  4QIG A;  4R5P B;  2F4V F;  2VBW A;  4KIA A;  3MEE B;  2ZHB A;  3NGT A;  4K2J A;  4YHH J;  2VQE J;  4EGL A;  4I64 A;  1B7Y B;  2DNY A;  2KG1 A;  1FX2 A;  2YX7 A;  1QUV A;  4LR9 A;  4FP9 A;  2R2U A;  2AT1 B;  4ETZ A;  1NPK A;  1GH8 A;  1X9M A;  3KUG A;  1S0M A;  4DHV A;  2HZC A;  2NUU G;  4J9O A;  1UVJ A;  2DHX A;  1L5U A;  4OYA A;  4NA1 A;  2AJQ A;  3KLF B;  3THP A;  1KHV A;  2OPQ B;  5CYM B;  1UFL A;  3PYG A;  4ZMM A;  4P72 A;  3UCG A;  5EX3 A;  1VGY A;  4OYX A;  1KP6 A;  1HHS A;  4QW8 A;  4GKJ F;  1ZAW A;  3Q8V A;  1Y5I B;  2ZEJ A;  2V9W A;  1UFW A;  2HK2 A;  2ZIT A;  4CH1 A;  2KN4 A;  2FVR A;  1R8B A;  2AEM A;  2VU5 A;  3FBB A;  4NA2 A;  5HBM A;  4TLQ A;  2UUA F;  4DUY F;  1Y3J A;  3OD2 A;  4B9V A;  3ISZ A;  3TI0 A;  1S1T A;  4U7U K;  3TQ1 A;  4NXN J;  1IKY B;  4P73 A;  1RTJ B;  1MML A;  1WG1 A;  3CJK A;  3PTW A;  2YWF A;  2OEK A;  4KFB A;  3MPY A;  4NRU A;  4M5N A;  2ZZN A;  1NHK L;  4K2X A;  1CJT B;  1VMB A;  4N8O A;  5H9F K;  4F26 A;  4LQ9 A;  4AL5 A;  5E3R A;  3FBF A;  4R5P A;  4DV5 J;  1IKV A;  1QAY A;  3MEE A;  2JL9 A;  4C0H A;  5KFJ A;  4QBU A;  4ED7 A;  4HTI A;  4X4U A;  2ZVS A;  1QSL A;  3D6H B;  4JUZ A;  1XER A;  4ES1 A;  3AJ1 A;  3AD8 C;  5CQG A;  4AXI A;  3D6M B;  2ADB A;  2Y8W A;  3R5B A;  3HD1 A;  2VG5 A;  4KT0 C;  2Q6B A;  2V8P A;  2UVV A;  3PFE A;  3ETM A;  2DNH A;  5HJX A;  4NX9 A;  2O1P A;  2D41 A;  3D9B A;  1MSW D;  2OPQ A;  3GLJ A;  5CYM A;  1RA6 A;  1S9F A;  4BC9 A;  3S8S A;  1Q16 B;  3K8V A;  4B9M A;  3BDE A;  2B51 A;  1K0V A;  3F0N A;  1LXN A;  3UN2 A;  1IBM F;  2W8L A;  3VAG A;  1VBZ A;  3EUN A;  3G87 A;  2V67 A;  1F5A A;  1NSQ A;  1QM9 A;  2BUN A;  1JJH A;  2QC3 A;  2FGC A;  2K3K A;  3KLH B;  1IKY A;  1RTJ A;  1TUG B;  1UJ6 A;  4A8O A;  1LFW A;  1ZPV A;  2FJW A;  1CJU B;  2DXE A;  1CJT A;  2B4V A;  1T9W A;  1SH2 A;  3L3C A;  2C3M A;  3CJR A;  4KH1 B;  4QW9 A;  4USK A;  4TQS A;  2DJW A;  1Y4Z B;  3LWL A;  2RVJ A;  3MDF A;  5E2Q A;  3ISN D;  3TAM B;  1SJQ A;  1SUQ A;  2IAJ B;  1NK0 A;  1S6U A;  3RG6 A;  1TUW A;  2AYG A;  2ILY A;  3KWM A;  4FXD A;  1LW2 B;  4LFC F;  2PDA A;  4ZK7 M;  1Y7P A;  2G0J A;  4DU7 A;  3GFZ A;  1HBO B;  4F4Y A;  3PZP A;  2LA4 A;  5HQ8 A;  1NKC A;  4LF9 J;  4C97 A;  4J9V A;  2HEK A;  3BRE A;  3BQ0 A;  2ERR A;  2KM8 C;  3GII A;  2BMB A;  2XZD B;  2VBX A;  2FC8 A;  1PG5 B;  1U1M A;  4B3M F;  1FXR A;  4RJV A;  4F2S A;  3GYX B;  2LQB A;  1VRQ C;  2CXE A;  5E5N A;  5D78 A;  2CQ0 A;  4WWS A;  3GU0 A;  1JLG B;  3KLH A;  4KRW A;  1T05 B;  5DQI A;  1NHU A;  5DDP C;  2BKN A;  4LRB A;  3ZTQ A;  3F41 A;  3IAS 9;  4LSL B;  1RK8 A;  5F8M A;  2RQC A;  1P6T A;  3KMQ A;  1NZA A;  3GCX P;  5DDR C;  3KNA A;  2W2N P;  3I31 A;  1N5V A;  3TX0 A;  2LDI A;  1H38 A;  3NRB A;  3TAN A;  1CJU A;  3FEY B;  1W25 A;  1N88 A;  3G8S A;  5L38 A;  3QBC A;  4DV3 J;  3DLB A;  3FC9 A;  3CME S;  5B0F A;  2KT3 A;  1UVN A;  3CJ8 A;  2C2R A;  1TAQ A;  3QNW B;  4LF4 J;  2CQG A;  2OSR A;  4RBU A;  3TAM A;  2ZJQ Q;  1SH3 A;  2DH7 A;  3J7Z T;  1WOR A;  2IAJ A;  5HK4 A;  1VQ6 S;  2HS0 A;  2ZDO A;  1F9E B;  4GMK A;  1DY3 A;  4CLK A;  1RLC L;  4YR0 A;  2XLK A;  1LW2 A;  2GVD B;  3WIU A;  2P5V A;  4HEA 9;  3LQV A;  2HIQ A;  2DGX A;  1HBO A;  5T14 A;  2NPI A;  4F67 A;  1CEZ A;  2B4P A;  1UZH A;  1B70 B;  4ID8 A;  5K8P A;  2BJ1 A;  2PA8 D;  4MK7 A;  5GAH I;  3PDN A;  5E3Q A;  5B0B A;  3W61 A;  2J0Q D;  3QYY A;  4WII A;  1E6Y B;  2ZH5 A;  4DOZ A;  3UNY A;  3RRK A;  3MM8 B;  4DR1 F;  3RBD A;  1X8D A;  1RU2 A;  3DXB A;  2JVO A;  4DV1 F;  2P8I A;  2JLG A;  1JLG A;  3R5G A;  1QTM A;  1DAR A;  1ROF A;  5B0G A;  1BQX A;  1BQN B;  3GSI A;  1QD1 A;  3VAM A;  4H4K A;  2HYI B;  3NG8 A;  4JBC A;  5D0E A;  5KT3 A;  4JI4 F;  1HMV B;  3DI6 B;  2DPI A;  5LL6 d;  1IBK J;  4ECV A;  4H4M B;  4WFN Q;  4MMO A;  1HA1 A;  3OUY B;  4DX8 H;  4F4W A;  4Q45 A;  2V50 A;  2DEI A;  1TVR B;  5ETR A;  1VQN S;  2KI2 A;  1JQG A;  2X7I A;  3W64 A;  2V68 A;  2OFG X;  3VQT A;  1CC8 A;  2J0W A;  3VV2 B;  4X4O A;  3UFC X;  2B43 A;  4WFX A;  2YVS A;  2P6S A;  2MYF A;  2A6M A;  5AXM A;  2J9E A;  2MSS A;  1WF1 A;  1GTH A;  4X4S A;  4IRK A;  4JI2 J;  2KJV A;  2GQQ A;  1V6H A;  3NS6 A;  1Q0N A;  3PKM A;  4EO8 A;  3MAA B;  1F9F A;  3WIV A;  1E6Y A;  5IT9 U;  4CTA B;  4UTG A;  1LK7 A;  4FBT A;  4JV5 J;  4L6V 3;  3MM8 A;  1FDB A;  1NHV A;  2QA4 S;  4KHP J;  2MST A;  2F8M A;  1FWK A;  3TJA A;  3U27 A;  2DYA A;  5EHH A;  2VPY B;  5KFS A;  5LM7 E;  3C14 B;  3MPU B;  2IA0 A;  2ZH1 A;  3T19 A;  2J0S D;  1BQN A;  4WJB A;  4QCL A;  2VC0 A;  4MAK A;  4RW9 B;  5M2U A;  1RAD B;  3HSG A;  1WSV A;  1HMV A;  3DI6 A;  4NMX A;  1SV5 B;  2G9O A;  4OYW A;  4YUD A;  2HMI B;  5CA5 A;  1R0B G;  2XYG B;  1CQN A;  2ZNY A;  4NLX A;  4DS5 A;  4DR5 F;  2RD5 C;  1FJG F;  5KAK A;  4DQS A;  3OUY A;  5CYJ A;  3D1H A;  2E29 A;  3MMC B;  1HHT P;  1FK9 B;  4R0E A;  2MQP A;  1N5Q A;  2DXD A;  3HHL C;  4MJK A;  3LO3 A;  1T9U A;  4MKY A;  1N6Q B;  1PIE A;  5KFH A;  3QSI A;  4DR4 J;  4B9U A;  5KFE A;  1MG7 A;  3TEH B;  2YPY A;  2OSQ A;  1HNW F;  2KTQ A;  3BO3 A;  3PJX A;  4OYZ A;  3IR6 B;  2H5E A;  1H2U X;  3FGV A;  2X51 A;  2HAI A;  3GWC A;  3X3U A;  3HM9 A;  5ETP A;  3PR4 A;  2V2K A;  3IC1 A;  2NRE A;  3QRP A;  2VOP A;  1A7G E;  2DNL A;  3AOC A;  4NLO A;  1TK0 A;  3MAA A;  2R7W A;  1WC1 A;  4PXD A;  2WW8 A;  3CD7 A;  1FDN A;  2WBM A;  1QAI A;  3KLI B;  2CPE A;  2V6A A;  1E6V B;  2XB2 D;  3MI7 X;  3PVX A;  1U0H B;  1IN0 A;  2RNE A;  1RWX B;  3J80 U;  5JUM A;  3GR0 A;  4RPF A;  4AND A;  3C14 A;  1S1V B;  2FD2 A;  1QAJ A;  4MK9 A;  4IG0 B;  2AZ3 A;  5A8K B;  3CXC R;  1D9A A;  1X4B A;  4MTP A;  1S6P B;  4PEO A;  1SV5 A;  5BYR A;  3MM7 A;  3FSX A;  1HIY A;  2LEC A;  2C2O B;  1NJY A;  4B08 A;  2JC1 A;  3TOQ A;  2Z58 B;  2XZW A;  4I68 A;  2NYI A;  2ZJP Q;  4RWW A;  3MMC A;  4O0N A;  1FK9 A;  2KM8 B;  3QWP A;  3R5C A;  3I9Z A;  1D9F A;  5KFQ A;  1N6Q A;  1ZAX A;  1TL1 B;  1FJC A;  4LVO P;  4F4X A;  3OSN A;  3FMW A;  1S97 A;  1QY7 A;  3PRV A;  4BDP A;  5IQQ A;  2PGC A;  2DIS A;  4C2M A;  3EZ5 A;  4ZN3 A;  2EBE A;  3DRS B;  3RAM A;  3ZNJ 1;  4EZ6 A;  4IFV A;  2MHN A;  1HHQ A;  3NCP A;  2DO0 A;  1O8B A;  4LMZ A;  5B7W A;  2CNO B;  2GIF A;  4UF4 A;  1S57 A;  2MKK A;  1U02 A;  4F2R A;  4YFU A;  1DQA A;  1FF2 A;  1YK9 A;  2A6O A;  4MH8 A;  4ANE A;  2MKH A;  4UST A;  4DR6 J;  3KLI A;  4ZCM A;  2VF3 A;  1U0H A;  1X5S A;  1EAR A;  4DQQ A;  3KLV A;  1JJC B;  3IG1 B;  4LR8 A;  2HKE A;  2VFS A;  3LF0 A;  3NAI A;  1WAC A;  2FLP A;  2EW9 A;  2VH7 A;  1UET A;  1M1K T;  1M1H A;  3T1H F;  4ZDN A;  4PG6 A;  2VJU A;  1D9D A;  5IOL A;  3SV4 A;  4F02 A;  2AX0 A;  2CYY A;  5A8K A;  5HMZ A;  2XM3 A;  4ZHR B;  1S6P A;  3U1N A;  3W8P A;  4LF5 J;  8ATC B;  2HFO A;  3CVK A;  2H4Y B;  2CPH A;  1K8A T;  4FPR A;  2XO7 A;  1OWX A;  1UPP A;  3KG0 A;  1FA0 A;  1TMJ A;  2M9K A;  3ENV A;  1KNZ A;  2R3V A;  1TL1 A;  1WF0 A;  3PRD A;  4FN5 A;  1S79 A;  2H5I B;  3KDO A;  1K1Q A;  5B0D A;  5EWE A;  1VS3 A;  2K7K A;  3W5Z A;  2UUC J;  1PCA A;  3GZ7 A;  5E3C A;  1J5E J;  1G3O A;  1WI8 A;  2AWZ A;  4GKK J;  3DRS A;  1Q53 A;  2HVD A;  3TAP A;  1IJE B;  1T3O A;  4MKA A;  1WC6 A;  3HJF A;  2L3M A;  4ZVE A;  2W01 A;  2W25 A;  4PRF A;  2HRT A;  5KT7 A;  3L7O A;  1WHY A;  1KVI A;  4YB7 A;  1FFS B;  3KJF B;  2OHD A;  4OHY A;  1WTF A;  3LAL A;  3D7S B;  2DRB A;  4FYW B;  1F5C A;  2V94 A;  4PG4 A;  3SFU A;  3K7R A;  1OYD A;  2V2Q A;  4XK8 C;  2WK4 A;  3Q22 A;  1R6V A;  1FRH A;  1YHQ S;  4PYA A;  3IG1 A;  2DCU B;  1RCX B;  2R7Q A;  1J27 A;  9ATC B;  3PNI A;  2JEI A;  2HIY A;  3ISN C;  1OYE A;  1HAR A;  4C8O A;  1FRI A;  5HVF A;  1WNE A;  1SIW B;  4KC5 A;  4ZHR A;  4KO0 B;  2EVZ A;  3HVW A;  2BA9 A;  4I6A A;  2FTR A;  4X2B A;  2KVI A;  2XMV A;  2IM0 A;  3SXL A;  3CDE A;  4Q2L A;  3O2I A;  2ZUA A;  2FHK A;  3SEO A;  1S1U B;  5CXT A;  1Q5Y A;  2MQ8 A;  4QIF A;  3CED A;  3J7A N;  1Q86 T;  3M1V B;  2KDO A;  3H5X A;  2AJF E;  3FRZ A;  2HSE B;  2RDI A;  4MIB A;  1HNX J;  1ELO A;  2OPS B;  5KFN A;  1RBO B;  3DLH A;  2MKI A;  3QAU A;  5DQH A;  2JH3 A;  3HO1 A;  4DR2 F;  4C7Q A;  2HVE A;  5KFC A;  3KTQ A;  1YKW A;  1LEO A;  2KVQ E;  2L9W A;  1TTH B;  3RB3 A;  2A3J A;  1U49 A;  2GAH C;  1XMO J;  4WBF A;  1OQ3 A;  3N6L A;  1O51 A;  1X4C A;  4I2P B;  4LF6 J;  3HHL B;  1EQ0 A;  3A8K A;  3VZI A;  3PXG a;  5CH7 B;  3SCL E;  1GMU A;  4ZPV R;  2IRY A;  5DDO C;  1W2B R;  4O3Q A;  1RI7 A;  2HBQ B;  4PWD A;  3H90 A;  4FVM A;  4B17 A;  3VCD A;  1H2T Z;  4Q2M A;  1AUS L;  5G0R B;  1JKH B;  4DV7 J;  2V4R A;  4Y6I A;  1NSP A;  3CCE S;  3IGV A;  2MGZ B;  4P52 A;  2IMW P;  4DSK A;  1N34 J;  1X0P A;  2W24 A;  3M1V A;  3R7B B;  2JEG A;  3UN5 A;  5BR8 F;  3ZTP A;  3MCO A;  1S59 A;  1X7V A;  4GC6 A;  2OEL A;  1VK8 A;  4WYW A;  5A0Y B;  3GJS B;  1UEK A;  5F8I A;  1ZA1 B;  5L39 A;  2CJQ A;  2OPS A;  4EEY A;  4KPC A;  1G2E A;  4FXW A;  3PYE A;  2XCP A;  1ZTW A;  3B54 A;  3IS9 B;  3QRQ A;  4GO7 X;  2MQN A;  1KRP A;  5KFG A;  3D4J A;  3AXM A;  3SYZ A;  1I94 J;  3HKZ D;  2J8A A;  1SQF A;  2VL1 A;  2UUA J;  3FSY A;  3M8Z A;  4RX6 A;  4IOB A;  3ZC4 A;  3QJJ A;  4OI0 A;  2V8H A;  3T5K A;  3HFK A;  1ZH5 A;  4OHW A;  5ETM A;  1WC3 A;  2HZA A;  2OEM A;  2F8E X;  2WRM A;  3WC0 A;  4I2P A;  6FDR A;  3HHL A;  1FVQ A;  5EWG A;  4O3S A;  2VFT A;  4ILR A;  3NNC A;  2FQQ B;  4D3H A;  3CO9 A;  1RZM A;  3T5L A;  2CPY A;  2VIC A;  3RB4 A;  1LWX A;  3VVT A;  3SDE A;  4JI1 F;  5I3P A;  5J1E B;  3LP2 A;  1WHV A;  3GFX A;  1LK5 A;  3QGP A;  4OZJ A;  2BV3 A;  1UFK A;  1FKA F;  2DGT A;  4TXS A;  3DLL Q;  1D1U A;  2PEH A;  1SB6 A;  5G0R A;  3SBM A;  1JKH A;  1R43 A;  2MMY A;  1F3V A;  2B8Q A;  2BKO A;  2MGZ A;  1ZZF A;  5ADZ A;  1MLA A;  2D74 B;  3OVA A;  2U1A A;  1FJE B;  1FFW B;  2HNY B;  2HHX A;  2WW4 A;  1RT5 A;  5BXI A;  1U09 A;  1XNR F;  3UDE A;  4DF8 A;  5A0Y A;  2GS8 A;  2FPH X;  2HQG A;  2R7V A;  3GE9 A;  3OQ2 A;  5HSP A;  1JK9 B;  4ZVF A;  2YQ3 A;  2KHD A;  2CAJ A;  1DTT B;  2FIU A;  3IS9 A;  4C8K A;  4XDC A;  4ZCL A;  1WKK A;  4F36 A;  5C5J A;  2WCX A;  1SKS A;  2HGL A;  1IBM J;  3GJT B;  2M88 A;  2J7W A;  1Q7Y T;  1UEV A;  3AJ2 A;  5E7O B;  2Y3Y A;  1M90 T;  3CCL S;  2Z2Y B;  1ZM4 A;  1S6Q B;  3Q8P B;  3CNQ P;  3BKU A;  1YIT S;  2K2P A;  3AOA A;  3FZB A;  2C3U A;  1ZTT A;  4ZCK A;  5I3Q A;  1FE0 A;  5FII A;  4G1I A;  4M5D A;  2UVU A;  2AIR B;  4B9S A;  3CF5 Q;  2OH2 A;  5KG1 A;  2JSX A;  3J7Z 5;  2E9R X;  4P74 A;  3HMJ G;  3OVB A;  4GVB B;  2QE5 A;  4AL6 A;  2DXF A;  5J1E A;  4LR7 A;  1EB0 A;  2ZHO A;  3HPO A;  2LQ5 A;  3JXO A;  3K0J A;  3Q0A A;  2HHW A;  3H4D A;  3MXH P;  2GCF A;  1RYR A;  1NME B;  3VHQ A;  5K20 B;  4OLP A;  4O44 A;  1V3R A;  4C11 B;  3ITH B;  3ZZO A;  2BQ3 A;  2LEB A;  5AJ3 F;  3I5A A;  2KO1 A;  2HNY A;  2YXL A;  2RRA A;  5L1I A;  2LXI A;  2RE1 A;  4LFC J;  5F3T A;  1KQG B;  2DTJ A;  2B9W A;  2G4B A;  1B0V A;  1ZBT A;  3GON A;  3JQK A;  2L9N A;  3CCT A;  4A48 A;  3BQ2 A;  1TMM A;  2QX0 A;  3M30 B;  2XMM A;  4ZN1 A;  4DPT A;  1GQE A;  5HAN A;  1DTT A;  4M5J A;  2M8H A;  3TVK A;  2MPU A;  1HWJ A;  3BZQ A;  4DUT A;  2PMW A;  4CIO A;  1KKH A;  1R31 A;  4OZ2 A;  1N56 A;  3FNN A;  1IUJ A;  2DRD A;  1RT4 A;  1OIA A;  3THT A;  2DNK A;  3BBF A;  4OX6 A;  3OTO F;  4AFF A;  2GVZ B;  4A8M P;  4K4U A;  3L7U A;  4KHR A;  3D68 A;  1F0X A;  1KQF B;  4QYZ K;  4JOU A;  4N56 A;  1U2C A;  2RU9 A;  5T7L B;  1YGY A;  1FXD A;  2HHH F;  4WFA Q;  2POK A;  1NK7 A;  5I3U B;  1UW9 A;  2C2Z B;  3FBC A;  3BPS P;  2ASD A;  2PFD A;  2C1E B;  2B4O A;  1FXL A;  3QT8 A;  1VLO A;  4HVZ A;  2DB1 A;  4WU3 A;  1LNQ A;  4C11 A;  3ITH A;  3MPW A;  4I0W A;  8RUC A;  2IIH A;  1FKO B;  2YKN B;  5DG8 A;  2PT0 A;  4BS2 A;  2GC8 A;  4DL7 A;  4P2M A;  5ETL A;  2VKZ G;  3P96 A;  1SI9 A;  3G71 S;  2IVF B;  4WFZ A;  3HT3 A;  1TKX B;  4HDG A;  3MEG B;  4NEY A;  2HHT A;  4QWA A;  2ZWO A;  3M30 A;  2IM3 A;  2RQK A;  3VGU A;  3KHL A;  2ZKU A;  3M8W A;  2QV6 A;  3BJY A;  4F7V A;  2VA2 A;  3OW2 R;  1HYS B;  3CD0 A;  4EBC A;  3FQK A;  1XMQ J;  3N6M A;  4CH0 S;  4LRA A;  5IWA J;  2Z2M A;  3IR5 B;  4QYZ J;  3M6W A;  4K5S A;  2GVZ A;  3KHG A;  4DV1 J;  2BX6 A;  2H3E B;  3M2V B;  3UVJ B;  3OBI A;  4LF7 F;  2N7C A;  1JB0 C;  3SSR A;  4M5M A;  3ZZY A;  1T8E A;  3DOL B;  3I56 S;  3R5J B;  3QJP A;  4LRD A;  3K5L A;  2WB4 A;  4JI4 J;  2WON A;  4M5L A;  5D15 A;  4ECZ A;  2W2O P;  5K5M A;  2BR0 A;  2I38 A;  3EZO A;  2OPP B;  1BUX A;  3N4W A;  2HHQ A;  1P8G A;  4ZPD A;  2IHR 1;  2VPX B;  5AE1 A;  4IDK B;  3JB9 k;  3LA0 A;  1LXJ A;  4ZIV A;  2YQ1 A;  5DO2 A;  2E1M C;  4Y65 A;  4CO1 A;  1X9W A;  5M2P A;  3DRP B;  1KQS R;  2BW2 A;  3ZTS A;  5KOX A;  1P1L A;  2E9T A;  1F5B A;  2V8D A;  2CA9 A;  1N0V C;  4OZ3 A;  1Q8I A;  1LW0 A;  1JLC B;  3Q86 A;  4C3M A;  1OJ4 A;  2D9O A;  1RDR A;  3MEG A;  2DNP A;  4KY3 A;  5MLC V;  3CDW A;  3O6Q A;  4NYP A;  1YJ7 A;  3RTV A;  4NRT A;  5AE2 A;  2RS8 A;  1F60 B;  1HYS A;  4B3R J;  3KK1 B;  4A8X A;  3QT6 A;  4U6P A;  4MFB A;  2AW0 A;  2PFF B;  4GC7 A;  4IQX A;  4X4Q A;  1RKJ A;  4TY8 B;  1H98 A;  3DU5 A;  3HHK A;  4CM0 A;  1NZ8 A;  4LFA F;  4U7C A;  1HQU A;  4H4O B;  2IBK A;  2UXD J;  2AGO A;  1MRO B;  1R0A B;  3DRR B;  4F0H A;  3DOL A;  1TK8 A;  4IH5 A;  4OI1 A;  1QLN A;  2HRU A;  3FK4 A;  3QIP A;  4NCG B;  3P6Y C;  3FDS A;  4IYQ A;  3ULH A;  1TQL A;  4OJG A;  4EYI B;  2EKN A;  2BOA A;  2LQ9 A;  4CLU A;  3H2V E;  2OPP A;  3KUH A;  4DR5 J;  4DJB A;  3KK2 A;  1KOO A;  2EFV A;  4HHU A;  3UD5 A;  3EMT A;  4BWJ A;  3LTO A;  3SSQ A;  3H7H B;  2RDJ A;  2CQH A;  3BR9 A;  2X3D A;  4YS2 A;  3GV5 B;  2YWH A;  3DRP A;  3GV8 B;  3MTK A;  4F3M A;  3WZ0 A;  4I4B A;  1U1R A;  4LJM A;  3C46 A;  1FDA A;  3I0S B;  2M8D B;  2YX1 A;  5FDL B;  1OO0 B;  1HNW J;  4Z7Y A;  4CLW A;  1WKL A;  3N6N A;  1NXI A;  2DGS A;  3B4D A;  2GNK A;  4LBH A;  5A76 A;  2DNR A;  1DUR A;  2CPI A;  1FKP B;  2RF2 B;  1K47 A;  4RNF A;  2X3G A;  4WFY A;  3PRB A;  3H5Y A;  3KK1 A;  1F9H A;  4H54 A;  1WC0 A;  2NXC A;  3L09 A;  3HK2 A;  1NK4 A;  1JX4 A;  2MHE A;  1HKA A;  1VIX A;  4TY8 A;  4J9S A;  4Z7C A;  1OMS A;  1D8Z A;  3IM9 A;  1KVK A;  2K06 A;  5DLG A;  3CT9 A;  1F6T A;  2YH0 A;  3MMJ A;  1Q7L B;  5L1J A;  3GYN A;  1MRO A;  1R0A A;  3DRR A;  3M2U B;  1AW0 A;  4DUZ J;  1XBW A;  3WHI A;  3F73 A;  4DV2 F;  1H7X A;  5LSL A;  4NCG A;  1C1B B;  1H6K X;  1AZS A;  2R2T A;  5DRK A;  3DC2 A;  1HR0 F;  1WEY A;  1YQH A;  2VFR A;  2UXB F;  1WG4 A;  3VQS A;  4ZP9 A;  3DFE A;  2KG0 A;  4Q44 A;  3RYL A;  4EYH B;  1MNE A;  2RT3 A;  1FFG B;  3C6T B;  3RBE A;  3M8R A;  4J9M A;  3N01 A;  4YB6 A;  4O3N A;  4WKR A;  3JAM Y;  1VQM S;  1TKZ B;  5L9X A;  4ECR A;  1APS A;  2GHP A;  1KLM A;  2OAU A;  1L3T A;  1H0H B;  2I5J B;  3MED B;  4RW7 B;  2UUT A;  3EDR B;  4TY9 A;  3I0S A;  5FDL A;  3H42 A;  4AE5 A;  1RWN B;  2IBO A;  3K17 A;  4M5K A;  1IR0 A;  5J2N B;  4CLS A;  2MZ1 A;  2ZWP A;  2K8G A;  4TU8 A;  1RAA B;  1CJV A;  3QAT A;  1GAO A;  2FVP A;  4WCE Q;  1Y10 A;  1FKP A;  1HD1 A;  2RF2 A;  2HBY B;  4CDI A;  3CW2 C;  3S01 A;  2RHS B;  5LMN F;  3M8Y A;  4CO2 A;  1SBR A;  2XQC A;  4ZPC A;  4YB1 P;  2ZHA A;  4NXM F;  1IBC B;  3M2R B;  4RR5 A;  4KPY A;  2XSJ B;  2B7C B;  3CD6 S;  1N52 B;  2HS3 A;  4QOT A;  2MQQ A;  3CC7 S;  4A8W A;  2XI2 A;  3MMB B;  2N3L A;  5DGB A;  2YPZ A;  5K8O A;  3A4T A;  3OXF A;  1VIO A;  1J5O A;  2FJD B;  1IR2 A;  3HZG A;  3T1H J;  4DSF A;  3UE2 A;  3M2U A;  3ONQ A;  2RQM A;  3SMZ A;  3EGV A;  2GMJ A;  4NCB A;  4X66 F;  2M52 A;  3SQO P;  2WAQ D;  5JJB A;  2AYE A;  4DR3 J;  1S9E B;  4Z37 A;  5KT6 A;  2C22 A;  1QVG R;  2EBG A;  3DLK A;  3KJQ B;  4OX9 F;  4PG7 A;  3C6T A;  3RB0 A;  1DRZ A;  3HI9 A;  4RNH A;  1GNK A;  2GJI A;  1HWK A;  1V3S A;  2R42 A;  1VI7 A;  3NGU A;  2I5J A;  4RW7 A;  4G1Q B;  3FQL A;  2MKS A;  5ETT A;  2R7T A;  1GX5 A;  1JNR B;  2H51 B;  3BH6 B;  4Q8E A;  5J2N A;  4J37 A;  1WJ9 A;  5LOQ A;  3CGI A;  2CWX A;  2DNN A;  2VDH A;  2MJN A;  1RT1 B;  1FT8 A;  2M2B A;  1S0V A;  2CFX A;  3VGV A;  3UN3 A;  1MN9 A;  1J2V A;  1XJW B;  2DEJ A;  3IM8 A;  3M2R A;  4N5S A;  1N5T A;  1NPP A;  2FB0 A;  2W8K A;  3NGK A;  3MMB A;  5CZV A;  1HBN A;  3M05 A;  2Z2L A;  2NSB A;  3OFE A;  3HVT B;  4RU9 A;  1BGX T;  4USV A;  3D66 A;  2ZUG A;  3CCR S;  2HUR A;  3TAQ A;  4A8F A;  3EVO A;  2E1P A;  4RU2 A;  3NY0 A;  4J9K A;  1S77 D;  2LU1 A;  3EE3 A;  2FJA B;  4KBI A;  4FKX A;  1GMV A;  5DJB A;  3BSO A;  1S9E A;  7FDR A;  2Q1L A;  2E7X A;  1G7C B;  4PYD A;  1L3S A;  2O5D A;  4IOA Q;  2CNL B;  3GJR B;  3DHX A;  2OUG A;  4B3T J;  1FRM A;  2W2Q P;  4NPO A;  4JI3 F;  2BYC A;  2VOD A;  1CUL B;  4K4T A;  1U1K A;  1UWA A;  2ZC3 A;  3HCX A;  3PEH A;  2R9L A;  5F8G A;  2UZA A;  1S10 A;  1SIZ A;  3OR1 B;  2HBR B;  1HNZ F;  2B4U A;  2XTJ P;  4G1Q A;  1FWP A;  4F8R A;  2UUB F;  1JXE A;  1S7H A;  2EWH A;  6AT1 B;  2XY7 A;  5HLF B;  4UQT A;  4MIA A;  1RT1 A;  2XHC A;  2KFY A;  2B0G A;  1IXK A;  3OTD A;  1M5H A;  4OHX A;  1PGZ A;  1VRT B;  1LWF B;  4ED1 A;  1QDU B;  1RTZ A;  3T9Z A;  3NEK A;  1MU2 B;  3D1Q A;  4K4Z A;  4DV0 F;  2HQ3 A;  1BHN A;  2V9K A;  2GIR A;  1BWV A;  3AD9 C;  2SXL A;  2R8H A;  4FYY B;  3HVT A;  3W9I A;  3TW0 A;  3AT1 B;  3CJ3 A;  5G4D A;  4HAC B;  1NJX A;  2FGO A;  2HND B;  5T41 A;  1KOH A;  2JVR A;  2Q66 A;  1KON A;  2PO4 A;  2DNZ A;  2VG7 A;  5A6W A;  2CZ9 A;  3PO4 A;  1TL5 A;  2XHW A;  3HDS A;  3CCW A;  1PYT A;  1S1W B;  1MWQ A;  5L1K A;  4DS4 A;  1S48 A;  1TL7 B;  5KFY A;  2DRA A;  2AZ1 A;  4P6Q A;  4OZ5 A;  2Y8Y A;  5KG0 A;  2VDI A;  1CUL A;  5DG9 A;  3ENQ A;  3OR1 A;  1WC5 A;  1RHM B;  3EZU A;  3TWZ A;  1S4F A;  1RU1 A;  3CJ4 A;  3GV7 B;  4DV6 F;  5A8R B;  5KFK A;  3GQC A;  2AQ4 A;  4KKO A;  1F2H A;  2MQO A;  4B9T A;  4CZC A;  4ZPW R;  4HT5 A;  5HLF A;  3UQS A;  2OIH A;  3NOG A;  5GAD U;  5CD4 A;  2AU0 A;  3E3X A;  4X64 F;  4JI7 F;  1WOP A;  3H20 A;  4ED0 A;  1JJ4 A;  4DR7 F;  4AXJ A;  1BE4 A;  3CCU S;  1NH8 A;  5LT5 A;  2RJZ A;  4WK1 A;  1MU2 A;  1LWC A;  1FE4 A;  2DHG A;  5ETO A;  4CYU B;  1RAC B;  3DXS X;  1HW8 A;  1H3D A;  2AJ4 A;  3CD5 A;  4HAC A;  1X4F A;  2BJ8 A;  2X1G A;  2EC2 A;  1IVZ A;  1QAX A;  1KFS A;  3Q8S B;  2M70 A;  4WP3 A;  5D4P A;  4JI1 J;  4QR1 A;  2XS2 A;  3MPV A;  2E7W A;  1ZZN A;  1S99 A;  3VWS A;  1R8A A;  2CRL A;  1S1W A;  5KFI A;  1D0E A;  1KSP A;  1HNV B;  3IFE A;  2QL5 B;  2OP5 A;  1QE1 B;  4KSE B;  5A2Q Y;  4G6V B;  5AE3 A;  2E5I A;  1YJ9 S;  3RUB L;  3PEJ A;  2R8K A;  2W9B B;  4CO0 A;  1GT8 A;  4C48 A;  5JXS A;  2JOQ A;  3C19 A;  4RW4 A;  1LOU A;  1N8R T;  1S76 D;  3QRR A;  5HVH A;  1SKW A;  1I5O B;  4WIQ A;  4NZ0 A;  4A8K A;  5A8R A;  4PWW A;  3SCJ E;  2ZBC A;  2CZV C;  2XMJ A;  3UD4 P;  3N5B A;  1R7I A;  2VUG A;  1AUD A;  3PYF A;  4NEZ A;  3A3N B;  3ELH A;  3ICL A;  1PC5 A;  4DPU A;  1YG0 A;  1FJ7 A;  2CG4 A;  1M5O C;  3DDK A;  4EWT A;  2DH9 A;  2E5G A;  2Y0S D;  3GMG A;  3BO4 A;  5I42 B;  3M7V A;  3OLB A;  4IO1 A;  3AOD A;  2FLL A;  3DOK A;  3H4B A;  2BJ3 A;  2MDA A;  2IVY A;  2YKA A;  3D6F B;  2XO6 A;  3KG1 A;  4NLG A;  5E3P A;  2ASL A;  4PR6 A;  1NSA A;  4DFM A;  2EG2 A;  2AGP A;  4YOE A;  1KR4 A;  4CWB A;  2Z0G A;  1TK5 A;  1S0N A;  1D8Y A;  5GMK a;  1T0T V;  3DDI A;  2PMH A;  1YDL A;  5HO4 A;  1JLA B;  1B7F A;  3G9C A;  1XN9 A;  4Y0F A;  1QE1 A;  2VHG A;  3I5C A;  2A2D A;  2GO9 A;  3TZW A;  1JLE A;  2W9B A;  1CSJ A;  3T1Y F;  3AA8 A;  2CPJ A;  3Q2T C;  2M0G B;  5KFP A;  1TV6 B;  3P8B B;  2CAD A;  2X1B A;  1IQZ A;  3UPF A;  3OR2 A;  4K59 A;  1OQ6 A;  5EGY A;  4FXV A;  3PW0 A;  3IGN A;  4C8N A;  2OMO A;  2QFI A;  3CJK B;  3IWX A;  4NXN F;  3PX6 A;  2F1F A;  4J5O A;  5KFO A;  2UUW A;  4UT4 A;  5EX0 A;  1P9Q C;  3B8H A;  2QLX A;  4PZV A;  5IFM A;  1EET B;  3B78 A;  1IJF B;  5CCL A;  1Q95 G;  4CLF A;  4I69 A;  1C1C A;  1U1O A;  1IKV B;  2EEY A;  4IR1 A;  3CMQ A;  1TR0 A;  5J2Q B;  4WXO A;  1X4G A;  5B08 A;  1SPB P;  5I42 A;  2RB7 A;  5IC6 B;  2MZT A;  3GPA A;  2VG5 B;  3QZ7 A;  2DH8 A;  3GIJ A;  5J2M B;  4NLV A;  4ED3 A;  2ZBR A;  4J7C A;  3MD1 A;  3TR5 A;  4CO3 A;  2F4F A;  4IFY B;  3CJQ A;  4OHZ A;  1R89 A;  3MR6 A;  3J7Y I;  4I7F A;  3I0R B;  5B0A A;  1DAX A;  4ZVO B;  4DFP A;  3IO1 A;  3OJU A;  2OPR A;  1JLA A;  4USI A;  3HSZ A;  1ZET A;  3OPK A;  2NQP A;  4F4K A;  5HMY A;  5HMW A;  1NDK A;  4KGK A;  3MR7 A;  5K14 B;  3MHY A;  3O8W A;  1XNQ J;  3MGJ A;  4M5H A;  3BYR A;  1VJQ A;  1YJW S;  1AFJ A;  1TV6 A;  3FRY A;  2LYV A;  4PPD A;  4U95 A;  2YNI A;  3LPE A;  3GCW P;  4KE5 A;  2J6U A;  3O3L A;  4OMF G;  1SC3 B;  4ECT A;  2H48 B;  2B56 A;  2VB6 A;  2BOP A;  2GQ2 A;  1WWH A;  1K44 A;  3LH2 S;  2AJ1 A;  1EET A;  3AAW B;  3EVM A;  3AA9 A;  2UV8 A;  3FEX B;  3G6E S;  4P75 A;  2XS5 A;  2ALY B;  1X4E A;  1Q4R A;  1VRU B;  1RAJ A;  5J2Q A;  2HVZ A;  2P6T A;  1SUQ B;  4Z2X A;  4DSL A;  1ITP A;  1YTY A;  4ILM A;  1WDD A;  3G6X A;  4ED6 A;  1NDL A;  3CJ0 A;  3W1Y C;  3CJ5 A;  2BM0 A;  2MB0 B;  2QT7 A;  2L9D A;  4ZJO A;  2XNQ A;  5J2M A;  4DL5 A;  4F0M A;  3JAM U;  4ZLP A;  4BWM A;  3NMR A;  2YBV A;  2VBZ A;  5C25 A;  2I9S A;  2W2M P;  4IFY A;  1CQM A;  2F5G A;  4ER8 A;  1C0T B;  5AXN A;  1P1T A;  3I0R A;  5A8W B;  4ALZ A;  2AYB A;  1K1S A;  4L74 A;  4DLG A;  1T9Y A;  2P2C B;  4X4V A;  1JLQ B;  3DRX A;  2RRN A;  2I0X A;  1PAU B;  3KLG B;  5GAG U;  5K14 A;  1NCL A;  3AB2 B;  2NLW A;  3NWR A;  1X4H A;  3I87 A;  3NOC A;  2NZ4 A;  4R8U A;  3MAQ A;  5E41 A;  4LQ3 A;  1SCJ B;  4KJI A;  2CJY B;  3S7R A;  3NLC A;  3IBF B;  4KR0 B;  5AT1 B;  3NS7 B;  2CQ2 A;  2H4W B;  4B3O B;  5DS7 A;  1CJK A;  4DX5 A;  1JMT A;  4NI2 A;  1YZ6 A;  1QSY A;  3BB5 A;  4WZM A;  5KFB A;  3N5F A;  2CNK B;  2A18 A;  1QUP A;  4QZV B;  4ZLN A;  1HWI A;  4E2F B;  3W60 A;  3MM5 A;  2PE8 A;  1HWL A;  5K8N A;  2N3O A;  3PW4 A;  3W8G A;  1VRU A;  1N5Y B;  3K58 A;  1HPZ B;  2R7X A;  3IR7 B;  5K8M A;  2DIT A;  4OYO A;  1RBA A;  5KFX A;  2EKY A;  4USU A;  1UJ5 A;  3CDB A;  2ZBI A;  1HW9 A;  4DX6 A;  1VC6 A;  3C3L A;  1S72 S;  1FER A;  3MUT P;  7AT1 B;  3T5J A;  4PG8 A;  2DGW A;  2N4C A;  2XLI A;  3HFZ B;  4FYX B;  3MF5 A;  1EKS A;  2MY7 A;  1FEE A;  1IM4 A;  3PIO Q;  2UVW A;  3PV8 A;  4JI6 J;  1C0T A;  2ASJ A;  5A8W A;  5DM7 Q;  3RR7 A;  4USW A;  1RQ0 A;  2W4D A;  1JLQ A;  4GO5 X;  2YNH A;  3EIC A;  3OVS A;  3KLG A;  3LGM A;  1S4E A;  4ZP6 A;  4CCH A;  2IDL A;  1FRX A;  3PW7 A;  3PO5 A;  4I56 A;  2ZD1 B;  3KHR A;  1IBL J;  4B3O A;  4RW6 B;  3A12 A;  4JB8 B;  2Q6C A;  1UVL A;  3V5R A;  4ES3 A;  4CLL A;  3BYP A;  1TP7 A;  2IRU A;  3PR5 B;  1OPI A;  1PYO B;  4LRC A;  1RTD B;  3UR3 C;  4U9R A;  4BLG A;  5KFW A;  1N5Y A;  1HPZ A;  3DLG B;  1U1N A;  3HX9 A;  4M94 A;  3ENW A;  3NGR A;  2EC0 A;  4CO4 A;  4C3K A;  4LSZ B;  2KZM A;  1KVJ A;  2KL8 A;  4LBI A;  3H5S A;  2GMH A;  2AEJ A;  1DFD A;  3GIM A;  1Y3K A;  1N32 J;  3R7N B;  2HLT A;  2BJD A;  1UVK A;  1WDT A;  4YB5 A;  1HR0 J;  2QL7 B;  1GX6 A;  2YWG A;  1U45 A;  2UP1 A;  6FD1 A;  5U47 A;  2F40 A;  3V81 B;  1U24 A;  2ZJR Q;  4JI8 J;  1DJ0 A;  4ZVR B;  3H2L A;  4JI2 F;  2E5L J;  2R4F A;  5IC4 B;  5KFA A;  3BN4 A;  1PJ5 A;  4J9Q A;  1FTC A;  1Q81 T;  4NZ6 A;  2EFP A;  4YY3 J;  2DR7 A;  3HT0 A;  3HHE A;  2D9P A;  1O0P A;  2D3O R;  2LMI A;  3V4I B;  2FZC B;  3H59 A;  3EM1 A;  4DN0 A;  1UTA A;  4JV5 F;  4J9N A;  2ZD1 A;  1RUS A;  2YKO A;  2PII A;  4RW6 A;  3RAQ A;  2N4D A;  3BGR B;  1RT2 B;  4K7Q A;  1VFJ A;  4AL7 A;  1CPZ A;  1VR6 A;  4ES2 A;  5LMN J;  4FS1 A;  4OFZ A;  4NXM J;  1RTD A;  3PW5 A;  2IC3 A;  4CNY A;  3DLG A;  3F44 A;  3NS5 A;  4NLD A;  5GAE U;  1AT1 B;  2B6A B;  4KGM A;  3CCS S;  1HI0 P;  1R27 B;  5F41 A;  4ZVP B;  2R8J A;  3R6G B;  2V34 A;  1C4A A;  3UD3 P;  1KDN A;  2UU9 F;  3ILO A;  3OSP A;  4L72 B;  2VOO A;  4X65 F;  1VQ5 S;  1Q8K A;  1XTZ A;  4UZC A;  2XYP B;  1RTI B;  2P9E A;  4CQ1 A;  3TO8 A;  4G3I A;  5SZT A;  4NOH A;  2MZS A;  2EK6 A;  3I32 A;  3V81 A;  3H40 A;  3R8Y A;  4OX9 J;  2KXH A;  4LRF A;  4NZ7 A;  2BW7 A;  3JQJ A;  3BO2 A;  4Q7A A;  2CPZ A;  5KFR A;  1HQE A;  1RE1 B;  3D0H E;  1T3N A;  2XS7 A;  1RHK B;  1S9G B;  3CC2 S;  2JLE A;  4TQR A;  1RHR B;  1AXQ A;  3W9J A;  3V4I A;  4NLT A;  4HI1 A;  4OYI A;  3H25 A;  3ZZT A;  2AKW B;  1XR5 A;  3BGR A;  3FEZ A;  1RT2 A;  4ECQ A;  1SJ4 P;  4HR2 A;  5CHC B;  2VC1 A;  4FF2 A;  3MM7 B;  1VBK A;  2ATC B;  1GXT A;  4DL6 A;  1K0T A;  3W7B A;  2HHU A;  2XGQ A;  1NKE A;  4IO9 Q;  4AQY F;  1KLN A;  1G1X A;  4FVC A;  3WX4 A;  3SCI E;  2B6A A;  4L76 A;  2JFD A;  2ROP A;  3D1O A;  4FZV A;  4UUX A;  3RW6 A;  2VFV A;  4Y2I A;  5A2Q U;  3VAJ A;  4ECW A;  5AXK A;  2CVE A;  5C24 B;  3PHE A;  3EGW B;  1FNM A;  4IFV B;  4TKT A;  3MUR P;  3FJ2 A;  2FZG B;  3RGI A;  3J7A 1;  1RTI A;  1NND A;  5BJR A;  5D4N A;  4ATN A;  4ETX A;  2WSE C;  2ZC4 A;  3UO0 A;  2YNG A;  3E2E A;  4XAK A;  4QPX A;  4JI3 J;  2AJ2 A;  1KFD A;  5EUH A;  1CS4 B;  1S9G A;  4DF4 A;  2VJV A;  2CJB A;  3JTO A;  3J7Y U;  3C8Y A;  4B3S F;  2UUB J;  2BAB A;  4DR6 F;  1B99 A;  4DN9 A;  4ZOS A;  2ZOF A;  1FNO A;  4BCA A;  4JI5 J;  3NXZ A;  4U67 Q;  1SC1 B;  3ILL A;  4QR0 A;  1XWL A;  3AOB A;  3A1Y G;  3BV8 A;  3MWB A;  2O3D A;  4FDF A;  4NLR A;  2CPF A;  4EBE A;  3CIM A;  3K2Y A;  4K0K J;  1W2I A;  4NCA A;  2GJ2 A;  4XDD A;  4OJ1 A;  2G0C A;  4LF5 F;  3R7S B;  2RU3 A;  4DSE A;  2WVF A;  3CDU A;  4USM A;  3I9V 9;  2UXC J;  4C8L A;  2KXN B;  4N77 A;  1PO6 A;  2ILZ A;  2GHV C;  2HBZ B;  3PG9 A;  2QO3 A;  4OJH A;  1HQ2 A;  4DZ6 A;  2G2Z A;  4ZJQ A;  3IMQ J;  4P7V A;  3DN9 A;  5M2R A;  1JWW A;  1NB7 A;  3UI3 A;  3BN7 A;  2ZM6 J;  2CQB A;  5C24 A;  1CG2 A;  3GYG A;  1NDP A;  3MCM A;  2OFH X;  1T95 A;  2VON A;  1J5E F;  4IR9 A;  3H0P A;  4C0O C;  2Z56 B;  2M7S A;  1ARO P;  2PI5 A;  4G1P A;  4FS2 A;  2PMZ D;  4KH0 B;  4BHQ A;  2HS4 A;  3L9Z A;  1MN7 A;  1CS4 A;  3HJV A;  2LVW A;  5F9L A;  4W92 B;  2DBB A;  2FHM A;  1N4L A;  1GK8 A;  4WE1 B;  4L3K A;  2JWN A;  2FVS A;  4DV6 J;  2OJ3 A;  3QLH B;  3QQC D;  5B0E A;  2QLW A;  3G6V A;  5L46 A;  2E5J A;  3K57 A;  2KB2 A;  3TA1 A;  2GHW A;  4JI7 J;  1ZM3 A;  1LKZ A;  4C0B A;  4XPE A;  2LQ8 A;  4DR7 J;  3WC2 A;  3RAX A;  1FI4 A;  2W7A A;  2ZVI A;  1WUU A;  4O4G B;  2QA4 G;  3CJ2 A;  5HMX A;  1RTH B;  4YDX A;  2HWH A;  1SL2 A;  3OL9 A;  4WFB Q;  3OTB A;  1FO1 A;  3EPI A;  3PM9 A;  2ALZ A;  4E98 A;  1UCN A;  2NCK L;  3EVW A;  2C42 A;  1PIL A;  1X4A A;  4X4R A;  4K50 A;  2H5J B;  4X62 F;  4JI0 J;  1RHU B;  4PCQ A;  3O44 A;  4DI6 A;  1MWZ A;  1SJF A;  2EPI A;  2V63 A;  4C3L A;  1RWU A;  3OJS A;  2F8H A;  1NU4 A;  4BBY A;  4J9R A;  3MAH A;  4YN3 B;  1MMN A;  3D54 A;  3FFI B;  2CZ4 A;  2HFZ A;  3H98 A;  3N9U C;  1HNX F;  1XEZ A;  2FY8 A;  4RUA A;  2F63 A;  4KB7 A;  2FJX A;  2J7K A;  3FUY A;  3KG4 A;  4EUV A;  3ZTR A;  2PSZ A;  2GX8 A;  3CIZ A;  2FJB B;  4OZL A;  4DV4 J;  3J81 Y;  1ACM B;  2U2F A;  5IXU A;  4I1T A;  1EX8 A;  5HAO A;  4WE1 A;  1KD1 T;  2FJE B;  1DBD A;  2CJA A;  3ZZP A;  3QT7 A;  5JMN A;  3NBP A;  5DQG A;  3QLH A;  2CPD A;  3US5 A;  2I6W A;  3X1L B;  3WDO A;  2Z8Q A;  1XMO F;  7FD1 A;  5KFU A;  4WTY A;  1OSC A;  3U02 A;  1JNZ B;  2CVI A;  2LKZ A;  4M63 A;  1MW7 A;  3V2U C;  4CLT A;  3T1A A;  2BM1 A;  5CAA A;  1WOO A;  3Q83 A;  1YRX A;  3AH6 A;  4PWD B;  3HXM A;  3V4M A;  4O4G A;  1RTH A;  5DZ6 A;  3UDV A;  2C3O A;  1NUE A;  3D0I E;  1NK9 A;  3VGS A;  4OJ3 A;  1YJN S;  2M4M A;  2KKH A;  5LMU F;  4I6Y A;  1VQK S;  3U1L A;  4BC7 A;  3IP0 A;  3BKT A;  1FD2 A;  3FSI A;  4DV7 F;  2W1B A;  2VQF J;  5DZ7 A;  3PY8 A;  1YJR A;  1N34 F;  3AHP A;  4EBD A;  3NMA A;  2CKW A;  1NLK L;  3D28 A;  3BGF A;  2C2E A;  4IQM A;  4HH0 A;  3FFI A;  1RHQ B;  3C15 A;  3R2D J;  2NZC A;  1RWM B;  1N36 J;  5ITH A;  5D0H A;  2DVI A;  2F3J A;  2OTL S;  2OLW A;  4N8N A;  3TVZ A;  3T1Y J;  2E44 A;  3EYZ A;  1HBM A;  3BGL A;  1I94 F;  1RXO B;  4F04 B;  1EQM A;  2VFU A;  3J81 j;  4YQW A;  3R5A A;  1NSK L;  1SKU B;  2BJ9 A;  4Y2K A;  2M3D A;  5CCM A;  3DCA A;  1ICE B;  2B8P A;  2ADC A;  5GAH U;  1RHJ B;  5KG5 A;  3CC4 S;  5D77 A;  3POT B;  2H1Y A;  1RJJ A;  3SDE B;  4W98 A;  3LP2 B;  1CBK A;  2C2M B;  2HLU A;  1RA7 A;  3GR1 A;  2PD1 A;  2G1D A;  2X1A A;  2F4V J;  4ZPB A;  4RUC A;  1OY8 A;  1RWP B;  3IWL A;  3O1L A;  3ZZU A;  3SCK E;  2HWT A;  2EFO A;  1S12 A;  1NPR A;  2O01 C;  2D3U A;  1RT5 B;  1F2G A;  1B64 A;  3TP2 A;  3TZY A;  3ZXW A;  3AD7 C;  1VQY A;  5KT4 A;  2CQ1 A;  3E01 B;  2V4J B;  1JXL A;  2IA6 A;  4UOG A;  1M0S A;  1V3Z A;  3EGN A;  3KLF A;  4ZP7 A;  4GKJ J;  1WD6 A;  2OKQ A;  4KAI A;  1I6J A;  2DGO A;  4X4P A;  4V19 J;  2VBY A;  4DUY J;  3CWJ A;  4ZVU B;  2GZO A;  5F8J A;  3W5Y A;  2RIJ A;  1WG5 A;  1YWX A;  4DWI A;  4ZKA A;  3D3B J;  4W4M A;  3U7J A;  1T11 A;  4M5D B;  1KQK A;  4CO5 A;  4URQ U;  1WHW A;  1XR6 A;  3TX8 A;  4ITS A;  3LOU A;  5F8H A;  3G86 A;  3RRH A;  5F0W A;  3POT A;  1RAE B;  2HHP A;  5H9F J;  5C42 B;  4RW8 B;  1U2F A;  3MUM P;  5KT2 A;  1RGV A;  4OX8 A;  2XSF A;  2D69 A;  1KN6 A;  2BAC A;  3GG0 A;  4O44 B;  5JVG Q;  3PIP Q;  1IR1 A;  2XBP A;  4Y3C A;  4EZ9 A;  1M5V C;  3UR0 A;  3I5B A;  5B0C A;  4DL3 A;  4M8L A;  1R8H A;  2AGQ A;  2HFS A;  4OHV A;  4KTQ A;  2WVD A;  2ZH9 A;  3PAC A;  4UOH A;  5DLF A;  4ECY A;  3OL6 A;  3E01 A;  2V4J A;  5D0R A;  2CJK A;  3EXC X;  5RUB A;  2FVC A;  4USH A;  1R3N A;  3OTE A;  5HQL A;  4W90 B;  1VBY A;  2D3Z A;  2LXU A;  2WOM B;  3KOA A;  4P2S A;  3ZO7 A;  1RT4 B;  2RML A;  4EMD A;  1V5V A;  2I2Y A;  4LSN B;  2XWX A;  4Y2C A;  1HL6 A;  2DK2 A;  2COL A;  1X5P A;  5GME A;  2RIL A;  1N33 F;  3BSC A;  3OLA A;  2HG4 A;  2JLF A;  1FX4 A;  3TZX A;  2RUS A;  9RUB A;  2DR6 A;  3W9H A;  5HJY A;  1U6B A;  5KG6 A;  1TZ0 A;  2H9Z A;  3TA2 A;  4DCJ B;  3I55 S;  3SI8 A;  3GIK A;  3C66 A;  4ED4 A;  4YDD B;  3FCH A;  5C42 A;  4RW8 A;  3IXQ A;  1RT3 B;  3MM9 B;  4IH7 A;  4OV1 A;  1T9T A;  3W3S A;  1H7W A;  3UDC A;  3IBW A;  2MZQ A;  3Q23 A;  2A2C A;  1LFP A;  3M32 B;  4I2Q B;  3K8W A;  2Z2Z A;  4IKA A;  4ZVH A;  2WSC C;  4DPO A;  1RB0 A;  2A1B A;  3KXD A;  4WPA A;  2B9X A;  3MOJ B;  4KHM A;  1F1B B;  2FHO B;  4UOC A;  4DQR A;  3RU0 A;  4FKY A;  4K4X A;  3ZZZ A;  3K89 A;  4DPY A;  3LGN A;  1YIJ S;  2EK1 A;  1RT7 B;  5ETQ A;  4NLY A;  4KQZ A;  2ASY A;  1Q79 A;  3FMB A;  1YZ7 A;  3H5U A;  2JEF A;  2NXE A;  2F65 A;  4B3M J;  2WOM A;  3A3O B;  4LSN A;  3HP6 A;  2R7U A;  4AD6 A;  4P71 A;  3M6X A;  1TL4 A;  1XMQ F;  2AMC B;  1LWE B;  1Y9O A;  4EK2 A;  5IWA F;  1PYS B;  2BQR A;  3DYA B;  1DHM A;  3DM2 B;  5CYQ B;  2B9E A;  1L3V A;  5K9F A;  1S49 A;  2UV8 G;  1M5K C;  4IUF A;  2C3Y A;  1T05 A;  3I4H X;  2GQC A;  2WON B;  4LSL A;  3LAM A;  2BBE A;  3MFH A;  4FNI A;  2FZK B;  3DGV A;  2XLJ A;  5BYS A;  1RT3 A;  3MM9 A;  3Q8Q B;  5ETV A;  5E33 A;  1N5S A;  3UNG C;  1FRJ A;  2KT5 A;  4DZD A;  4ZJL A;  3M32 A;  3QWU A;  2IPO B;  4I2Q A;  4DG1 B;  3NWG A;  4RNO A;  2HK3 A;  4UQG A;  1H73 A;  2ZOM A;  4NLU A;  4N7T A;  3W2W B;  1RAB B;  3EDQ B;  1LW0 B;  2CQ4 A;  2E66 A;  4LF1 A;  2QZ8 A;  3B82 A;  5KFV A;  4I6W A;  4J9U E;  4PAB A;  1KTV A;  1RT7 A;  2GVD A;  1SJ3 P;  2HVI A;  4LRE A;  3G6Y A;  1HFE L;  2W2P P;  3MFI A;  1I3O B;  2HW3 A;  2WB1 D;  4MFB B;  4K5R A;  3BKF A;  1FRL A;  1JJ2 R;  3KJV B;  3BS9 A;  3E51 A;  2RHQ B;  4B3R F;  2VKR A;  4DR1 J;  1RWO B;  4P2F A;  1LWE A;  3H8Y A;  3QJL A;  4OI2 A;  2DR8 A;  1HQU B;  3DYA A;  3DM2 A;  5CYQ A;  3BSA A;  3NNH A;  1SL1 A;  2K7J A;  2ZZT A;  4HHJ A;  2WSF C;  2QL9 B;  1ZAV A;  4HH1 A;  4J90 A;  3QIP B;  3FZ2 A;  3RBZ A;  2UXD F;  4WZQ A;  2QMX A;  5KFM A;  4X84 A;  2HRY A;  2MKY A;  2H65 B;  3RW7 A;  2ACY A;  4UY8 5;  4P2X A;  3KK2 B;  2QEX S;  4EI2 A;  1F3F A;  3D3C J;  5J2P B;  3Q8Y A;  3D2W A;  4H4M A;  1NJW A;  4IH6 A;  1BY9 A;  4CH7 A;  3BBC A;  1EHW A;  4ZVQ B;  2ZBP A;  2J7U A;  4DG1 A;  1HWU A;  2DGU A;  3W2W A;  3PYD A;  2UU9 J;  2FHJ D;  1TVR A;  1YRU A;  2LDY A;  1X9S A;  4X65 J;  2CIM A;  4ID5 B;  4DPX A;  1RKI A;  1NK6 A;  4QWD A;  4LFB F;  5F8N A;  2XYH B;  3DRY A;  2ZH4 A;  1T9V A;  4CT8 A;  1TFW A;  3G4S S;  4MT1 A;  3CTR A;  2AP6 A;  4KGX B;  1X4D A;  2XUL A;  2VZ9 A;  3D0G E;  3KJV A;  5ETK A;  3T3F A;  2YKP A;  4IG3 B;  2ZH6 A;  3GFY A;  4CLZ A;  2KYZ A;  3C16 B;  4CTA A;  1NKB A;  2J6T A;  2DD8 S;  3NKY A;  1SJ1 A;  1TKD A;  2PEB A;  4PAA A;  1FD8 A;  2WVE A;  4RBV A;  1U1Q A;  1TU0 B;  1PC4 A;  4A8Y A;  4TYB A;  1RP5 A;  2EFQ A;  3VGT A;  2IMO A;  3ET6 B;  1Y5L B;  3S1T A;  1AZS B;  2AYM A;  4DUZ F;  4RW9 A;  1UVM A;  2AEF A;  1FJG J;  4NYZ A;  2ATL A;  4AQY J;  1VQL S;  4LUB A;  1WEL A;  5LJ5 Y;  2HMI A;  4LF8 F;  5J2P A;  2YX4 A;  5L9N A;  1VK3 A;  2VAS A;  1VDH A;  3QSY B;  2LCW A;  1JLF B;  2LP4 A;  2HFU A;  1V5I B;  1URN A;  1KLM B;  3HD2 A;  5C7P A;  1FEH A;  1PJ7 A;  4V1A k;  1R8P A;  4KV8 B;  4DSI A;  4HHH A;  2GV1 A;  2VPZ B;  5D4O A;  3J81 U;  2IJN A;  3OFG A;  4ID5 A;  3GTY X;  2YY3 A;  4ED2 A;  4N47 A;  4R0J A;  4LF2 A;  2C2N A;  3PJ9 A;  2QRR A;  1CJV B;  2NPF A;  4TVA B;  3Q24 A;  1OY6 A;  2CQC A;  2QN6 B;  5C2G A;  5IV3 A;  3V6J A;  1Z1Z A;  2V0N A;  2MLY A;  2DIV A;  2FY1 A;  3RR8 A;  3HVR A;  3HHN B;  3KDN A;  3LWM A;  3TYT A;  4IG3 A;  3PJW A;  2VPW B;  3CCZ A;  1Q82 T;  2Y1L B;  4B3S J;  4J91 A;  3T6J A;  1J5O B;  3P5B P;  3C16 A;  1HBU B;  5KFD A;  2XNR A;  1E6V A;  5AXL A;  4M5G A;  5F3Z A;  3BF4 A;  4RO0 A;  3EXY A;  1FTR A;  4OYB A;  2LQJ A;  4DMZ A;  1UPM B;  5THW A;  1S1V A;  3ET6 A;  4N41 A;  2ZBQ A;  3K5M A;  2C3P A;  2QYG A;  1DQ9 A;  3WX8 A;  4IG0 A;  3DKD A;  1NJI T;  3PKY A;  2JZ5 A;  5SUH A;  4OI4 A;  3BEG B;  5KFZ A;  5FLX Y;  1KS2 A;  5IS2 A;  1EZZ B;  2XY6 A;  3VTI A;  3IN5 A;  1QTN B;  3DLK B;  1TL3 B;  4DR3 F;  1T9X A;  1M1G A;  2A10 A;  4MIW A;  5LJ3 Y;  3LP0 B;  4FNH A;  2P9C A;  1UW4 A;  4F4Z A;  4RKU C;  1JLF A;  3TAR A;  3A8E A;  1VLY A;  2GA7 A;  5GVQ A;  2E1R A;  1TKT B;  4DDF A;  4KV8 A;  4CRJ A;  3ENA A;  2G2O A;  3QMQ A;  3HLU A;  2CWK A;  1RSC A;  5HQM A;  3KFW X;  1FRK A;  4ERD A;  2H54 B;  3UDL A;  2LEP A;  5H9E K;  2XGP A;  3R2C J;  4UUW A;  4QWC A;  4MKV A;  3IRX B;  1YX2 A;  2XMA A;  4RBT A;  1Z4U A;  2J9D A;  3SIP B;  1K9M T;  1FVS A;  2HZV A;  3HKW A;  2LLZ A;  2MLX A;  2HQC A;  4CLP A;  1WKJ A;  2DHH A;  1BXN A;  3M6U A;  1EIY B;  1HBN B;  3VAH A;  2QMW A;  1HBU A;  3OL8 A;  4A8Q A;  2R7R A;  2V8V A;  3DNC A;  4EO6 A;  5KG4 A;  4C8Y A;  2ZOG A;  3LAK A;  4K4S A;  1I51 B;  2I1R A;  5CD4 H;  1SC4 B;  5EWF A;  2GO8 A;  2G13 A;  5CAB A;  1X5T A;  5HI7 A;  4M1K A;  3OT9 A;  4YEA A;  4ELT A;  1IWA A;  3V6K A;  3L95 X;  4FBU A;  2CJX B;  1KBR A;  1U26 A;  4NLP A;  4DL2 A;  1TL3 A;  4DU8 A;  3LP0 A;  1EAY C;  3TVY A;  4X62 J;  1A6L A;  5HAT A;  2XMK A;  2XMT A;  4OL8 A;  4ZPA A;  1TKT A;  1NK8 A;  1QSS A;  4B3T F;  1RAG B;  3QZ8 A;  5H9E J;  3R1L A;  2J9C A;  3PX0 A;  1ZYQ A;  2BDP A;  2RAQ A;  2G2Y A;  2AX1 A;  2IDE A;  1VQ7 S;  2IRX A;  2Z4P A;  3KKF A;  3GG1 A;  3I96 A;  3IRX A;  3CCM S;  2PA3 A;  1U8W A;  2KRR A;  4ZVT B;  1WOS A;  4DL0 C;  2CDQ A;  2AJ0 A;  5GMD A;  4PXB A;  4F3O A;  4P7T A;  3CUL A;  3VF0 B;  2YNF B;  4ZCI A;  3IBC B;  3DHW C;  1NEE A;  4C4W A;  1YVF A;  3DOM B;  1AFI A;  3AXK A;  1MMD A;  1B0P A;  4A8S A;  2UVR A;  4ELU A;  4HI2 A;  1VQ8 S;  3DU6 A;  4XO0 A;  2VG7 B;  3QT5 A;  3K5P A;  1WC4 A;  1XIQ A;  4FYV B;  3UCZ P;  4DEZ A;  1U47 A;  2OO4 A;  5LMU J;  3C6U B;  4KO0 A;  4Y2A A;  2DIU A;  2NR0 A;  4U7U D;  2JC0 A;  1NAQ A;  4UOF A;  4DLE A;  3I82 A;  3CJS A;  3UCU P;  1U25 A;  2IY5 B;  1SH0 A;  1G6B A;  1ZM9 A;  1S1U A;  4ELV A;  2WBR A;  3DMJ B;  1GMW A;  2YTC A;  3MPD A;  1SJR A;  4ECU A;  2IJF A;  5KG7 A;  3AFG A;  3A13 A;  3A3P B;  4KKO B;  5ETN A;  3QAE A;  2HGM A;  4K8R A;  2CUY A;  1RAI B;  4DR2 J;  4QPT A;  8AT1 B;  2W9C B;  4L73 A;  1ZA2 B;  2JDJ A;  1SC6 A;  1PJ6 A;  2DNQ A;  4URG A;  1LWC B;  2AF6 A;  3V6D B;  3VZH A;  2YNF A;  4TYA A;  4JYA F;  2V2V A;  3GP9 A;  1YBT A;  4HYK A;  3DOM A;  3C2P A;  3D5M A;  2BVZ A;  2NYH A;  3FCV A;  3GFH A;  3KJN B;  1QVF R;  3CE8 A;  1JXV A;  4DL4 A;  1YJV A;  3VAK A;  2RUG A;  3L7P A;  5CZX A;  3FVY A;  4NWB A;  2EG1 A;  2C2D A;  5HL7 Q;  1H72 C;  3Q8U A;  3C6U A;  1LQ9 A;  3G96 A;  1U2R A;  2JEJ A;  1NH7 A;  3M8Q B;  1Y11 A;  2QA1 A;  1BLU A;  3M8S A;  4USJ C;  2FC9 A;  4HKQ A;  5BR8 J;  1NBE B;  1RWV B;  3DMJ A;  3BH7 B;  2B7B B;  4RW4 B;  1OY9 A;  4B9L A;  2KRB A;  3MR2 A;  3AB4 B;  1PKU A;  2W7P A;  1YBU A;  1A0O B;  1BMQ B;  1SQE A;  5IV4 A;  3OL7 A;  4NLS A;  3Q89 A;  1P27 B;  1BQM B;  3LGH A;  3QPI A;  5DM6 Q;  1VC0 A;  3BGO P;  1FHT A;  1LV5 A;  2XMU A;  2W9C A;  3W66 A;  1V9O A;  4S0M A;  4F25 A;  2DNO A;  3I6P A;  4DCO B;  3R1H A;  2DPJ A;  3TZZ A;  1PBA A;  3V6D A;  2BRL A;  4ZVG A;  1NB2 A;  1O6X A;  4RWX A;  2NUH A;  1L3U A;  4MK8 A;  4RNN A;  3DOK B;  4Y2M A;  3PCO B;  2XI3 A;  2V2Z A;  5KFF A;  1RBL A;  1VHF A;  2BE9 B;  3SFG A;  3NCQ A;  3TJ9 A;  1S7I A;  4ZA1 A;  2BXJ A;  3MOZ A;  4WP9 A;  3QID A;  2L41 A;  2Z57 B;  3U1M A;  1R6Y A;  2EXU A;  5FJ4 A;  3W5X A;  4ZS6 A;  4NLW A;  4Q0B B;  2WVB A;  4JV2 A;  2ROE A;  3ZFV A;  3CCJ S;  2VA3 A;  3BGU A;  5B09 A;  1T03 B;  2BKP A;  2DCL A;  2HVH A;  2DR5 A;  3ETO A;  3M8Q A;  3CMA S;  4HL9 A;  1IQT A;  1JLE B;  2YWK A;  1DZ5 A;  3P3D A;  3OV7 A;  1RIS A;  1XNR J;  1SL0 A;  1S1X B;  2J0X A;  4QIE A;  3OR2 B;  2ROG A;  4C98 A;  2HGN A;  4ENO A;  2L08 A;  2GML A;  1RYS A;  3GSD A;  1BQM A;  4QYR A;  1M5S A;  4PG5 A;  3JQM A;  4GRS A;  2DR9 A;  3BQ1 A;  4AYB D;  3CSK A;  1C1C B;  2LXF A;  4Y34 A;  4RLE A;  4ZLJ A;  4RL1 A;  4F50 A;  1YJT A;  1N33 J;  1WEZ A;  3M9N B;  4QU7 A;  3LUY A;  1I1G A;  4PUO B;  2WZ1 A;  2CNN B;  3F56 A;  4P10 A;  1NJZ A;  3SZ2 A;  3N28 A;  3M9O B;  3KUE A;  4YHH F;  1S6Q A;  1ZPW X;  2W4P A;  1VHI A;  3Q2S C;  2VQE F;  2O67 A;  2XC9 A;  3W2V B;  2MTL A;  1BD6 A;  2XWY A;  3JYT B;  2YQ0 A;  4OZ0 A;  2GJF A;  1XR7 A;  2OML A;  3NCR A;  4Q0B A;  4GVB A;  2IVM A;  4I7F B;  3CCQ S;  3BM7 A;  4OI3 A;  1JLB B;  2OPR B;  2BJE A;  4U96 A;  2YH1 A;  1T03 A;  1KWM A;  1REG X;  3ILI A;  4WKY A;  2OD6 A;  1Y00 A;  3TUZ C;  1XQI A;  4YR3 A;  2XCA A;  2LEA A;  5AJ3 J;  4ED8 A;  3EX7 B;  5DG7 A;  1D09 B;  2WTF A;  3GJQ B;  5LXR A;  1TUV A;  1VQ9 S;  1UAW A;  1S1X A;  4CT9 A;  4OZN A;  1XNQ F;  2YNI B;  3GB0 A;  5A6P A;  4YME A;  3ZTO A;  5KG2 A;  3KHH A;  3SV3 A;  1IWG A;  1BC6 A;  2ZH8 A;  3R3T A;  2LA6 A;  2IYI A;  4FF4 A;  3MZI A;  2R8G A;  3OHB A;  1HI8 A;  1NM2 A;  2N7Y A;  3WQP A;  1N48 A;  5KOW A;  2KT2 A;  3MCN A;  4KGV B;  2PI4 A;  3OTO J;  1HNI B;  1H2V Z;  2E1C A;  2KXF A;  1FNX H;  4PUO A;  4CP5 A;  1VJW A;  2EFG A;  4DV5 F;  2MEW A;  2G0I A;  2BQU A;  2W4C A;  5IT4 A;  3DGP B;  5E3A A;  1YRT A;  2Y1R I;  2D7S A;  2KJW A;  2FUG 9;  2B5J B;  3NNA A;  3B4M A;  3VVU A;  3W2V A;  2HHH J;  3P4U B;  3JYT A;  1R0C B;  2EFN A;  1IKX B;  4MYU A;  5C25 B;  3AY0 A;  2ZFH A;  4O23 A;  1HD0 A;  4QIW D;  5T7L A;  4F3Q A;  2J5A A;  5I3U A;  2HHS A;  1JLB A;  1NO8 A;  1M5P C;  4DPW A;  2OGU A;  1Q5V A;  2KZZ A;  2WHO A;  3T9N A;  5H1S V;  1SXL A;  3PW2 A;  3LW5 C;  2Q43 A;  3P45 B;  1N54 B;  4C8M A;  4R8U B;  4OX7 A;  3QGG A;  3KLE B;  4PQU B;  1FKO A;  2J6S A;  2DNG A;  2YKN A;  5GAD I;  3TUJ C;  4TNO A;  4CNZ A;  2P9G A;  2HQD A;  5IQ6 A;  3CB4 A;  2BZ2 A;  4OYM A;  1CJK B;  4NI2 B;  2OTJ S;  3L4B C;  2GW8 A;  1UMJ A;  1TKX A;  2L48 A;  2X1F A;  1NDC A;  5L8R C;  3QFH A;  2FVQ A;  4OZ1 A;  4TLR A;  2QMU B;  2Y1I A;  2OD4 A;  1OSD A;  2ZKT A;  3CUN A;  4OLO A;  2JFK A;  2R7S A;  2J8S A;  3EJM A;  3MM5 B;  3HSJ A;  2LFV A;  1HNI A;  2ZE2 B;  4CI0 B;  1AYE A;  3ZZR A;  1RAH B;  4LF7 J;  3DGP A;  4NYO A;  5FLX U;  4QWB A;  4O3R A;  3GIR A;  1UA1 A;  2VG6 B;  4LT6 A;  1RAO A;  1OS5 A;  2B5J A;  3M2V A;  3UVJ A;  2GAG C;  2HQF A;  1DLO B;  1IKX A;  3I4P A;  1KC8 T;  5F9N A;  2NXU A;  4X4N A;  2VD3 A;  2GIQ A;  1UA0 A;  2NXJ A;  3JSB A;  5HP1 B;  3K5O A;  4RNM A;  3RJM B;  3ZZ0 A;  2KHC A;  3N79 A;  1XK8 A;  3SSS A;  4LF9 F;  1VQP S;  2YNH B;  4JI6 F;  1VQ4 S;  2V5H G;  5DDQ C;  2RDD A;  4IDK A;  4C8Z A;  2FYX A;  5LXY A;  3UWT A;  2YKQ A;  2K1R B;  3LAN A;  2MY8 A;  4AUK A; 
#chains in the Genus database with same CATH homology
 2YQ1 A;  1VHI A;  4K2J A;  2YQ0 A;  2YPZ A;  4UZC A;  4BLG A;  4UZB A;  1B3T A;  2YPY A;  5A76 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...