4UZCA

Kshv lana (orf73) c-terminal domain, spiral: hexagonal crystal form
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
134
structure length
134
Chain Sequence
YQQPPVPYRQIDDCPAKARPQHIFYRRFLGKDGRRDPKCQWKFAVIFWGNDPYGLKKLSQAFQFGGVKAGPVSCLPHPGPDQSPITYCVYVYCQNKDTSKKVQMARLAWEASHPLAGNLQSSIVKFKKPLPLTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords ORF 73
publication title The 3D Structure of Kaposi Sarcoma Herpesvirus Lana C-Terminal Domain Bound to DNA.
pubmed doi rcsb
source organism Human herpesvirus 8
total genus 34
structure length 134
sequence length 134
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-09-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.390 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Epstein Barr virus nuclear antigen-1, DNA-binding domain 4uzcA00
2YPYA 4UZBA 1B3TA 1VHIA 2YQ0A 2YPZA 4UZCA 5A76A 4BLGA 2YQ1A 4K2JA
chains in the Genus database with same CATH superfamily
2NLWA 3NAIA 2C2NA 3R5AA 4B3SF 2OO4A 3AQPA 5KG6A 2LA4A 4WU3A 3GFZA 1RCXB 4UUWA 4X2BA 3KFWX 3OTCA 2KXHA 2HBYB 1M5OC 1T95A 2E1PA 5EX0A 4G6VB 3CC7S 5I42A 1RT1A 5DETA 1FFGB 1H73A 1YG0A 2MZQA 5I4MA 4USMA 4QW9A 2P8IA 5AXNA 2WW4A 3KG4A 3IR6B 1X5TA 1D0EA 2LECA 2B3TB 4IFYA 3FRZA 3WC0A 2IM3A 2A10A 2Y0BB 4JI7J 5J1EA 1HHSA 2XC9A 2XSJA 1WTFA 2WHOA 4QJVA 1ZM3A 4OYOA 3KLHB 5T41A 5KFEA 1KQGB 1FRJA 3L7OA 4NLRA 1L3TA 1UETA 2F8EX 4YOEA 5B0FA 4GO7X 4HL9A 2QLBB 4C11B 2QA4G 3UDLA 4USJC 4B3OA 2UUTA 2DITA 3SBMA 3FQKA 4M5NA 1OJ4A 5A2QU 3GYGA 5HVGA 3W9JA 4M5DB 2ZFHA 2W9AA 3FEXB 3HZEA 1NJYA 1AFJA 4X4NA 3R6GB 2LP4A 3R1LA 4IOAQ 3CXCR 4ED4A 2DNOA 4LRDA 2IDLA 3OR2B 2LDIA 1FRLA 3AY0A 4K0KJ 3JTPA 3LW5C 2HHXA 2YNHB 4GKJJ 2M70A 4HH0A 2ALYB 1LWFA 3W5XA 1X60A 1FNOA 4CH1A 3MM5A 1S57A 3T19A 3QIDA 4QWEA 2GFFA 4ZPBA 1ITPA 4DN9A 4O0IA 4MK8A 2RAQA 4HTJA 4DR5F 3G87A 3GYNA 2CFXA 1QSYA 4F8RA 2KZMA 1XC9A 4WFAQ 4X64F 1KONA 3A3NB 4BC7A 2AT1B 2DYAA 2AZ1A 1VQLS 4EMDA 2HHSA 3HVRA 2AQ4A 2Z2LA 2YKNB 4CO1A 3KKFA 4RKUC 1VBYA 2HK3A 2QRRA 2MKKA 2QV6A 3MUTP 5H9EK 2MYFA 1SC1B 3VVUA 2ZDPA 5KFBA 2HFVA 1LXJA 5A6PA 4FVCA 3AD8C 1N6QA 2X1FA 3M9NB 2HIYA 3JB9k 1TL1B 2ZHOA 5CZVA 2J7KA 4LQ3A 3BBFA 1U1KA 4USKA 3HO1A 3TZWA 1TV6A 3ILOA 2H48B 1B4SA 4RWWA 2VZ9A 3GV7B 3BV8A 3M6VA 1HWKA 2MHEA 3CDWA 2MKJA 1S6UA 1VBKA 1KTQA 1BHNA 2WK4A 1UJ4A 2J9EA 5A2QY 1NH8A 1FNXH 2VH7A 3IN5A 5DG7A 4ZJOA 2M9KA 1CULA 3HPOA 3N9UC 1F5BA 1Y3KA 4TXSA 4PYDA 1FRKA 1M1GA 1RBOB 4C3KA 3CJ0A 5KFJA 2ADBA 2PDAA 1FDDA 4DX6A 4PG5A 5ETRA 1NMEB 6FDRA 2M8DB 4UZBA 2JNJA 3RAMA 3Q8PB 3PCOB 2ASYA 3M8RA 3EPIA 4J9SA 3B6BA 4FKYA 3PY8A 1TL4A 4KH1B 4OJHA 2XYHB 4ZDNA 2W7OA 1CC7A 5HP1B 4DHVA 5DLGA 4R0JA 2ZITA 4JB8B 1FWPA 2Y9HA 2DNYA 1XQIA 4PCQA 5IM0B 4OHVA 2OFGX 3D54A 3US5A 3RUBL 4N41A 1HW8A 4F4YA 4B9UA 2DRAA 1GMVA 3OHBA 2ZWOA 5H9FJ 5BYSA 2XMKA 4KTQA 2G1DA 3OVSA 3ICLA 4Q0BB 2XY6A 1QAIA 1EAYC 1CJUB 3IR5B 4HVZA 5AE2A 3MM7B 3PFOA 3FBBA 3VV2B 2R2UA 2HVHA 4K5RA 3PW4A 1BE4A 3CDEA 1JJCB 3VTIA 3V6DA 3KJNB 5F8MA 1FJGF 2UUWA 3AHPA 2HZCA 2PEHA 4NASA 2EFNA 3V4MA 5D15A 3FVYA 4V19J 2WZ1A 4ES2A 4ILRA 3A13A 1R6YA 4DQRA 3MTJA 4NXNJ 3ZTQA 3I5BA 4HT7A 2KHDA 3V4IB 5KFUA 2BM1A 3HT3A 2IRXA 4QYZJ 2K2PA 1X5PA 4PXDA 4XDCA 4ED1A 1RHQB 3D6HB 1X5SA 4Y00A 1RT7A 3E01B 2J0WA 4Y2KA 3B54A 1K8AT 4KR0B 3JAMY 4OYIA 1SBRA 2VA2A 3C14B 4Y2IA 4YFUA 4DSKA 4WTOB 4MKAA 3LOUA 1L3UA 2RQKA 1G4CA 2UUBJ 5C2CA 3D4JA 4M5KA 1NSQA 4YDXA 3R1HA 1KKHA 4IFVB 2X1BA 2D3UA 2F9DA 1RT2B 2WVEA 5KT3A 1RISA 3HHEA 3AT1B 3OL9A 4AXIA 2B4PA 3I82A 3QT8A 3BBBA 3MD3A 2DXDA 4JP8A 1T9UA 3D66A 4WYLA 4HHJA 2CPYA 3DHWC 1B99A 2BANB 4USVA 4EGLA 8AT1B 2CJXB 4L76A 1CLFA 1MMLA 4TY8A 3B4DA 4OI4A 1QTMA 5KFPA 1RT3A 4OYAA 2EVZA 4N76A 1RHUB 1SJ4P 1IQZA 1GTHA 3V81A 2UUAF 1AW0A 2KJWA 2W9BB 2CJ9A 2VFUA 4JOUA 5CYMB 2WVFA 2QSWA 1RHJB 3I5AA 2DGWA 3EGWB 2RKIA 1VYAA 2CQ2A 5D3GB 2BM0A 4LSZB 1NSAA 1JLAB 3DU5A 1WKLA 2B56A 1NK7A 2YKMB 5DO2A 1VI7A 2B4VA 1DURA 3G6ES 2Y8YA 3VCDA 1QLNA 3MPUB 2IIHA 3N6NA 4OV1A 1HWIA 3IG1A 3KDNA 5AXLA 1RSCA 2C3YA 4C2MA 4H4KA 1UJ6A 3QPIA 3RW7A 3D5MA 1PO6A 2RRBA 1UCNA 3DU6A 3S7RA 4DR1J 1QE1B 1RTJB 3GV8B 3FKBA 1HNZJ 2QLFB 4OYMA 2BMBA 3G8QA 1VQNS 2RRAA 4B3TF 1J5OA 3H4BA 4FKXA 2RMLA 3GTYX 1QUVA 4UOHA 1C0TB 1K47A 4RPFA 2VDIA 4M5IA 5DZ7A 4CLWA 1S6PB 5J2PA 5KOXA 5E41A 1U7LA 1KFSA 4NMLA 4L6V3 1VC6A 1N56A 3M8QB 4DFKA 4RBVA 1X7VA 1VQ8S 5EUHA 3Q2TC 2OPPB 3CD6S 2ZJRQ 1TK8A 5IZHA 4ECWA 3PYFA 3TZYA 2VODA 4KO0B 2DHXA 1IBCB 3CC2S 1OPIA 1YJVA 3J7YU 2BYCA 3BH7B 2W9CB 4NZ7A 4DU8A 1R0AA 1DAXA 4A4JA 2CQCA 1N0VC 3C16A 4AD6A 4ANEA 4FYYB 3H98A 3N28A 1PYOB 5KG4A 2IMWP 5JXSA 2HNDB 5CABA 3SQGA 4ZLJA 1RAEB 3ETMA 2VOOA 2BBEA 2R8IA 4NOHA 2MZ1A 3KJVA 3MDFA 3W1YC 2RE1A 2F4VJ 4KGXB 1VRTA 1D9AA 2NXUA 4CWBA 4NL5A 2B9EA 3F0NA 4IR9A 3CW2C 2MZTA 4OIXA 3JYTB 5F8NA 3Q8SB 2MPUA 2KFYA 1JLGB 5CYJA 5GAHI 4W98A 2DR6A 3DRRA 5L1KA 3MI7X 4KPYA 3KK1A 3PO4A 2ZWPA 4ANCA 1ZETA 3TJ9A 2CDRB 5F3ZA 3D6FB 2UUCJ 1WEYA 4DX5A 3QFWA 2OMOA 5JVGQ 2DISA 2DR8A 3HT0A 1WI6A 2ZNZA 5IT4A 3CTRA 2IVYA 2XLKA 2BRLA 4HDHA 5KFQA 5KT4A 1UVMA 5D0EA 1U24A 5D4NA 1C4AA 4PXCA 3I0RA 4M5GA 3VWSA 3OJUA 4K4SA 2EKNA 1WKJA 3KG0A 7FD1A 2BA9A 4OFZA 1OQ3A 1XWLA 4TY9A 2E5GA 4DPUA 4LF6F 4A46A 4DXLA 4U96A 1NHUA 2F3JA 3K89A 4YS2A 3HHLA 3CJ3A 3T1YJ 2OI2A 3TANA 1BY9A 5D6GA 3MMCA 4FBUA 3HFZB 1OSDA 4PUOB 3JTNA 1Q95G 3Q8UA 3RBZA 4HLBA 3MAAB 2V69A 4HHHA 1NK9A 4DX7A 4X4SA 2CG8A 2YNFB 4DMZA 1S0OA 2DH8A 1MROA 5ETSA 5MLCV 1RQ0A 4IKAA 4ED3A 4FNIA 2VPYB 4LF4J 3QT5A 3Q24A 2DNLA 3LO3A 3UR3C 3P4UB 2I8EA 5J2QB 1KS2A 4OHZA 1SKSA 4M95A 1MMNA 3KNGA 5IQ6A 4NYOA 2KH9A 2MQQA 1S9EB 3ZZUA 4PWUA 3W63A 2KFZA 4ZJLA 3W9HA 1VLYA 2JOQA 2PFDA 1HNIB 1NLKL 3ZTPA 3EVMA 3GONA 3ZC4A 1J27A 1XBWA 3I31A 3QAEA 3M2RB 3K2YA 5CQGA 4DUYJ 5F9LA 4EO8A 2DEIA 2HWTA 3AOCA 2RNEA 2AEMA 4BWMA 2MGZA 3AXKA 4ERDA 3CCUS 3TI0A 1ZAWA 2GIRA 2XSFA 4Y2MA 3LALA 1I94J 2P6SA 4PQAA 3R5JB 1IM4A 5KFVA 4WFBQ 3VHQA 4N77A 2VU5A 3PKMA 2YKQA 4DL2A 2G1HA 1LW2B 4B08A 1CG2A 1CJKA 4FXVA 3P3DA 3FSXA 1KOHA 1F5CA 2VPXB 1N33J 2H1YA 4DR6J 2AJ1A 2JVRA 4XTTA 4LFAJ 1U1MA 1TAQA 2NPFA 3H4DA 2QT7A 2HYIB 3R5DA 4J9NA 4DN0A 1RA6A 2LXFA 3QRQA 4JI4F 1N32J 4OZ5A 2MSTA 1R8AA 2E5LJ 2H54B 2ZHAA 3CCMS 2XMTA 2HVIA 2V4JB 3HCXA 1U09A 3HMJG 4HI1A 4A8XA 3CMAS 3C6TA 1U6ZA 2BR0A 5KFLA 5K8NA 1LWCB 4PPZA 4CO4A 3K8VA 3HJVA 2IBOA 1NNDA 4AL7A 3W3SA 2DH7A 2GQQA 3W60A 1XMBA 2GMJA 3CJ2A 4ED6A 1PYSB 3GYXB 3N6LA 3A8IA 5DDPC 1R3NA 4RW4B 1YDLA 2J8SA 3GFHA 3SCIE 4RU9A 2W2PP 3DGVA 2QFIA 4BLGA 4LFCJ 4JV1A 1B70B 4D3GA 3MF5A 2J7WA 1I3OB 1WEZA 2JC1A 4MFBB 3HULA 1DTQA 4JI6J 1EKRA 4H4OA 3MGJA 2NSBA 3D0IE 3DI6A 4OHWA 4ELVA 1N4LA 4HKQA 1VQKS 1FD2A 5DG9A 1T9XA 2W24A 4O44A 2EXUA 2B6AB 3CDBA 4NI2A 1QUPA 3FUYA 4CLYA 4ZCMA 3DLKA 2H51B 2W4CA 4ZMMA 3EPGA 2Y1RI 5KT5A 4DOZA 2AYEA 3MUMP 5A0YA 4YDDB 3NAHA 1HBMA 3M30A 1ZYQA 2WONA 4C6AA 1T05A 2DRBA 1CBKA 1FRIA 2UXBF 4FNHA 2ASDA 1E6VA 4ILMA 2UU9J 4CTAB 5E3QA 5CCMA 3GJRB 1NK0A 4PG8A 5DJBA 1RXOB 1X0PA 2E66A 2QC3A 3SCLE 2M52A 4WJBA 5GADU 2OPQB 4MIWA 4O3QA 1KEKA 2ATLA 3EJMA 1NUEA 2OD6A 1OSCA 5K8MA 2V8GA 4ZVOB 2V63A 1X31C 1S1TA 2CVEA 3MR5A 4B02A 1RAAB 4P2XA 2G0IA 2ZZNA 1DQAA 1R0CB 2CNOB 1UWBA 5BR8F 4DV5J 2DNNA 3HKWA 1C0UB 3LWMA 3SYZA 3T1YF 2FVCA 1KBRA 1KSPA 2HQFA 3B82A 4WZMA 4CZCA 1SL1A 2BOPA 4DSEA 3THVA 1R0BG 4IDKA 5U47A 3BPSP 3H25A 3D1HA 3PRVA 3NG8A 2KU7A 2EI5A 4OQJA 1TZ0A 2WBRA 2VPZB 3SEOA 1SUQB 2BJ9A 3TUZC 3DMJB 1BQXA 2GV1A 3DRPB 3IA0A 3QBCA 5IOLA 3ZO7A 2L41A 2RF2A 4YR0A 1QDUB 1KQFB 3TX0A 4B3RF 4F2RA 2XQCA 5B08A 1TL5A 3CUNA 1RAGB 1CC8A 2AGOA 1NZAA 1SI9A 2R7QA 2CZVC 1HBOA 2XYPB 4X4UA 1NKCA 3OXFA 4ELUA 2RVJA 2QTWA 3P96A 3TZZA 3IR7B 2GGPB 3NCPA 1JKHB 1YBTA 2PEBA 4LMZA 1NDLA 1QTNB 3UO0A 4M5LA 3VGUA 3KK2B 3MHYA 3V6HA 1IXKA 2KKHA 4C8KA 4AQYJ 3PXGa 4ELTA 4PABA 3TARA 4KRWA 4R8UB 1Y5IB 2NS1B 3J7A1 5DDQC 3NBPB 2XMVA 1MU2B 4RW7A 4ECVA 4C11A 2FQQB 3R5CA 3RYLA 5HQLA 4OX9F 4FF2A 1P9QC 4TU8A 3NOGA 1UZHA 4WKRA 3V5RA 1H2VZ 3LAKA 3CDAA 2R8JA 4DPYA 1TTHB 2LXIA 2VFRA 2FHJA 4GMKA 3RBXA 4DWIA 4ECSA 3FBEA 4DG1B 2CNKB 4NA3A 2QGFB 2JHEA 3ZTSA 4I4BA 3RZAA 5KFOA 3TZXA 1SH3A 2CQBA 2CDQA 3DFEA 1T03B 3DYAB 2XY5A 3UR0A 1RHMB 1UL3A 1DY3A 2HIQA 2DCLA 1WHWA 4NLTA 2QLJB 4J9UE 4PQUA 2M8HA 4YMEA 1RT5A 3W2WA 4UY8T 4G1QB 4DFPA 1ZAXA 3TQ1A 5J1PA 1SL2A 4B9VA 4KHPJ 3E51A 4Y65A 1SH2A 2KL8A 1GNKA 4LFBJ 1S59A 2GO9A 1T3NA 4J7CA 3M1VB 1N54B 2AJ4A 1RWNB 2KRRA 1JLQB 4WFYA 2RUSA 4RUCA 2YKNA 2VBYA 1YJNS 2OKQA 2KDOA 3ZNJ1 3DRSB 3CO0P 4F4ZA 3HHDA 3GCWP 4LFCF 2NPIA 4O0NA 1WG5A 1XJWB 3MPYA 5HMWA 1QSSA 2D3OR 3AB2B 4W92B 2FY1A 3P6YC 2V34A 1VS3A 2V8PA 4LBIA 1YZ6A 1RWPB 5K8PA 2HKEA 2XZWA 1QAJA 2IPOB 3NNCA 1AT1B 1CJTA 4LT6A 4NA1A 3D0GE 1WC5A 1YK9A 5B09A 1RBLA 3RR8A 4B9MA 4FYWB 4I7FB 3M2VB 3W5YA 4OX6A 3TAPA 3POTB 1Q86T 4RW9A 5EWEA 4Z7CA 3M7VA 2AW0A 4L73A 3M8WA 4YEAA 1FEEA 1FD8A 4E98A 2EEYA 3TOQA 1X4CA 4DPOA 5I3PA 2EFQA 4K4TA 1ZS6A 3OL8A 2GVDB 3Q22A 1HNVA 3ITHA 1PC4A 3CEDA 1F9HA 2UU9F 1RT4A 2AYBA 1RDRA 5HQ8A 4F04B 4DV3J 3TA2A 5AE3A 2CNLB 4WK3A 5I3UB 3J7YI 2K1RB 5HP1A 1F9EB 2CPHA 2OLWA 2B9YA 2DNMA 2F63A 1UA1A 2MZJA 1J2VA 4DUZF 1Q82T 3KWMA 3M6UA 4LVOP 3OFFA 5ETNA 3GWCA 2B7BB 1RT6A 1U0HA 2F9JA 1H74A 3D7SB 1NPKA 3OW2R 1S6QA 4K5SA 3DRYA 4NA2A 4QIFA 2LQ8A 4RLEA 4PG4A 4Q7AA 3BQ1A 5J2MB 3MM6B 2VQEF 4IQXA 3RRKA 3I32A 1HHTP 4JV5J 3HI9A 5IC6B 4IH7A 1RYRA 3MM7A 2ZH8A 1ZTWA 4LF5F 4DF8A 4WE1A 2QL9B 4GC6A 3W8GA 5DS7A 5CAAA 1SIZA 2B0GA 5LOQA 3MPVA 4C0BA 1BUXA 3CWJA 3H8YA 5C42B 4OI1A 4X84A 3PX0A 5FD1A 4CYUA 3CMES 4DQPA 2KHCA 1RWXB 4LF1A 2RIJA 4H4MB 4LF8F 4ZA1A 1ICEB 2ROGA 1T9YA 2B7CB 3D67A 3PVXA 1UMJA 2IAJA 2KO1A 1Q78A 1VQYA 1RTIB 4IYQA 1L3KA 1D8YA 1D9FA 4F25A 1LXNA 1EQ0A 1LW0A 3V4IA 2ZH9A 4I2PB 2DY9A 4EZ6A 3UD5A 2V0NA 4LRFA 3GR1A 2HRUA 2OEKA 2PT0A 3FCHA 3E01A 5KAKA 4DV2J 4RX6A 2RD5C 2N7YA 3AJ2A 3KK3B 2FJXA 2DR9A 2E9TA 2IVFB 3EYZA 2LQJA 1U25A 1NSPA 2ZOFA 2BV3A 2AU0A 5F0WA 3RB4A 4LJMA 2OJ3A 3ENVA 2DH9A 2EFGA 1JNZB 3FFIB 4UW2A 3JSMA 1VJQA 2UVWA 1JLEB 2FY8A 4JI8J 3HHLD 9RUBA 4OI2A 1RWKB 4RR5A 3MCNA 2XI2A 1E6YB 2PSZA 3Q8YA 2HHQA 1QJHA 2CQ0A 3PJWA 4CLZA 1X0FA 3GP9A 1HPZA 1B0TA 1WG1A 2G2ZA 3CCJS 2CPIA 5D0RA 2BANA 3W5ZA 2CYYA 1H2TZ 1WKKA 3UD4P 1REVA 3T5LA 5M2PA 1O8BA 1KP6A 3BDPA 2N4DA 1U4BA 2RHSB 2OHDA 1RB0A 1MWZA 3DLHA 2EPIA 2W9BA 3DLGA 3MR6A 4UQGA 5CYMA 4AL5A 1D1UA 2HHWA 1AUSL 1M90T 1YIJS 2D3ZA 3QMQA 1DRZA 4GO5X 2AYMA 2HNZA 3GIJA 1JLAA 4IG3A 4Q2MA 1HYSA 2L08A 5AXMA 3MWBA 2MQLA 3MOZA 1N5VA 1K44A 1P8GA 2CRLA 1FDBA 2OSRA 4C8NA 1RABB 2XMAA 1U1RA 3CE8A 2R2TA 2R42A 1B3TA 5C24B 3H5SA 5M2UA 4P7VA 2GW8A 3A8KA 2ALZA 3CT9A 1RCOB 2BACA 1RTJA 2QG9B 1JIHA 4ICLA 1BLUA 4FVMA 4XAKA 4A8FA 3PX4A 2QMXA 2V4RA 1IM6A 1NJIT 1TL3B 1C0TA 1FJEB 2KG0A 3O44A 3F73A 1TKZA 4KHMA 1T7PA 5F9NA 3LGNA 3I9ZA 1DTTB 4OZJA 3TEHB 1NB2A 4X66J 3G6XA 4JI5F 1RHRB 3GFYA 1HFEL 1N52B 2NR0A 4C97A 4J37A 1T0TV 1UW9A 5HVFA 3LGMA 3TUIC 4JI3J 4HHUA 2DPIA 2VASA 2BJ7A 3D6MB 5HLFB 1UVKA 1KVIA 2EFPA 1U2RA 1S0NA 4A8KA 4LIWA 2YWGA 2GVZA 3QGIA 1RKIA 3BQ0A 5F8LA 2XZDB 2ZZTA 4ECRA 4KJIA 4J5OA 1WSVA 1EETA 3EGZA 1VRUB 4RUBA 4DR7F 4YHHJ 1QVFR 1TVRA 3QO9B 2JL9A 4CNYA 4Q43A 3G86A 3MPWA 2OMLA 2V6AA 3PX6A 2HWHA 1VISA 2HNDA 4OYWA 2XGQA 1RADB 3DLEA 4WU2A 2GNKA 4ZVSB 5LMNF 2PD1A 2GJ2A 2MZRA 4YR2A 5A8KB 4ZVFA 1VBZA 3BKTA 4NX9A 3CVKA 2RS2A 3JYTA 4OHYA 1V5VA 4AYBD 1SKRA 2E7VA 3M4XA 3KLEB 3NWGA 3KUHA 3GJTB 4U8YA 2LQ5A 1YGYA 4OI3A 3PNIA 4MYUA 2HW3A 3T6BA 1WHYA 1SCJB 1S9GB 1SXLA 1VBXA 3HFVA 1NK8A 2RDIA 5DGAA 4FYXB 5HI7A 2D1CA 4QBUA 1FK9B 2VONA 3VGTA 2LMIA 3Q8VA 2W2OP 3D6TB 4DL3A 5KFWA 5HSPA 4J9KA 5LJ3Y 1DBDA 2UP1A 2PFFB 4RW8A 2CWXA 3DLJA 1LK7A 4P52A 1KN6A 2R3VA 2FHMA 1M5KC 3IRXB 3BGFA 4B17A 5KFGA 2C28A 4F3QA 3EM1A 4LR8A 4JI1F 1C1CB 2HSEB 1UPMB 4GVLA 3QGHA 2IC3A 3W7BA 4RBTA 3CIZA 1X9SA 3R5BA 3T1HF 1WELA 2HFNA 4PPDA 4N56A 2B4UA 1HQUB 1SVDA 4ZVUB 1ZH5A 2FGCA 4Y3CA 1F3FA 2RUGA 5IFMA 3RRGA 4DL6A 1MLAA 1BMQB 2AEFA 4Y0FA 1WC6A 3PO5A 2ZEJA 1RU1A 3O5TB 4DV1F 4GVBA 2JEJA 1KDNA 1JLCB 4ZN1A 3S8SA 1FKOA 2ZH4A 2WTFA 1WHVA 5J2QA 3MMAA 1X5OA 4M5JA 2QLXA 2HHPA 2YPZA 2LEPA 2GX8A 2Z58B 1N36J 3D28A 4ILLA 4WFNQ 2FD2A 1HNIA 4YP3A 3TAMB 1APSA 4WIQA 4KV8A 3KTQA 1FXDA 4K4WA 4IOCQ 3U1LA 4DR3J 1VK8A 2YQ0A 4FF3A 4KPCA 2CAJA 4N8NA 1ZA1B 4NXMF 2G0JA 2AMCB 3TA1A 2GIQA 1MWQA 1IKYA 3RU0A 3BGRA 2HAFA 1R7IA 2AHOB 5ITHA 5FLXU 4X4QA 1XNQJ 2LEAA 1HMVB 3V6JA 2GMHA 2KI2A 1NM2A 4XPCA 3IS9A 3C15B 2AGQA 4DPWA 2H9ZA 1CS4A 4R5PB 2BQ3A 4OHXA 1S9FA 4ECYA 2QFJA 1FHTA 3NCQA 1VK3A 4H54A 1SH0A 2O5DA 2FVSA 3VAGA 4X62J 1HA1A 2IM2A 1U26A 2W01A 2WOMB 1WWHA 2V2ZA 1K9MT 2J9DE 2X3GA 2FJEB 4LSNB 4WPAA 4F4WA 1VQSA 2VFVA 1AZSA 3MOJB 2HQDA 3DRXA 3M8PA 3M9OB 2MEWA 3SFGA 2KXNB 3QAUA 2ZD1A 2XMWA 3MMBA 2WSEC 3RAQA 1R8PA 1HL6A 3RB0A 1C1BB 3KLIA 5KFNA 2V4JA 3GSIA 4CLLA 2BKNA 3LP2A 1KVKA 2VV5A 3NKYA 2VUGA 2KFNA 1WDDA 4YN3B 3DOLA 2FHJD 3O1LA 3PHTA 3MCOA 2XS2A 4K2JA 4WBFA 2FLLA 1HD0A 2UXCF 1LWCA 2DHAA 4OI0A 2FC9A 2PC6A 6FD1A 3BF4A 1RTHA 4WP3A 1PSDA 2P9EA 3DOKA 2XULA 3THPA 2KVIA 2IVMA 2FJDB 3FMBA 2Z30B 4O23A 5E3RA 3KMSA 2XCPA 3GG0A 4AT1B 4PXBA 3OFEA 4IQMA 2JDJA 1RAJA 4AE5A 2LYVA 1HW9A 1RTDB 4MFBA 4X4OA 5I42B 1VDHA 7FDRA 1HR0J 3G9CA 3EMTA 3VAIA 1K1SA 5FLXY 2YNIA 5CCLA 3J7ZT 1N88A 2XO7A 2V8HA 3UE2A 4IFYB 2Z2ZA 2DR7A 1SQFA 1YLXA 2N82B 5G0RA 2JLFA 4DR4J 4QIGA 2R7VA 3ZXWA 4G1PA 2VDHA 2YH0A 5GMDA 3RJMB 2R8KA 2OIHA 1AA1B 1S1WA 4X65F 1XIQA 4C8YA 2ZH6A 4L75A 4UOCA 3M9MB 4XO0A 2R7WA 1Q16B 4PRFA 2FPHX 3ILJA 4LR9A 1DFDA 3P45B 3NGKA 4DR2J 2ATCB 2QL7B 3OSPA 2DXEA 5KFRA 4B3OB 3IWNC 2C42A 3EXYA 4I0WA 4F4XA 4DV6J 3OUYA 2OPQA 1HHQA 2MKIA 3MM9A 3VQSA 5D0HA 2LLZA 2E1MC 3HVWA 5DLFA 3WX8A 2CZ4A 2P2CB 2ZZMA 2J9DA 3SV3A 1TKXA 2YX7A 3H2UB 1LWFB 1FXRA 5L9XA 4URQU 2W8LA 1EKSA 3MM5B 4QR1A 1UEVA 3A1YG 2J7UA 2VKZG 5IV3A 3J80Y 2MQNA 4NLVA 4RU2A 2RILA 5B0CA 2KT5A 3L95X 4K4XA 1PAUB 1FX2A 4QZVB 1CVJA 4PEOA 3CJSA 1VLOA 4GC7A 3DRPA 1FF2A 2CZ9A 4MJKA 3OLAA 5ETMA 1NDCA 4MKVA 3PYEA 3W2VB 4MT1A 3FRYA 1PJ5A 1EJ7L 5H9FK 3KLFA 1N6QB 2K06A 3CCQS 4P10A 2YWHA 3MZIA 3OTOJ 4MKYA 2MTLA 1UFLA 2EC0A 3OD2A 1FKPB 5KG3A 2C2KB 1T9WA 3LPYA 5GMKa 1WF1A 1NEEA 1HARA 3VAJA 2XNRA 5IQQA 2OELA 5LL6d 2DHGA 4DR3F 5KFCA 1Q5VA 3QIPA 1FJ7A 2VOPA 1IR0A 2C1EB 2HPUA 3A8JA 1L3VA 4JI2J 4P6QA 1X4DA 2VF3A 3B8HA 4UUXA 1ACMB 3C19A 3F41A 2FUG9 4JYAF 4DFJA 2D7SA 1SC6A 4R8UA 1HIYA 1QSLA 4IUFA 2EBEA 2GQ2A 3CCTA 3SFUA 1UTAA 4A48A 1MU2A 1CULB 2Q43A 5KG7A 3V2UC 4RBUA 3QGPA 4V1Ak 2EW9A 4CIOA 5BJRA 3BKFA 1N34J 1VIXA 1RJJA 4X62F 4ECXA 9ATCB 2ZBPA 1JJHA 4MH8A 5IXUA 4QYZK 2RH3A 2GQCA 1Q7LB 1LV5A 3ETOA 2ZM6J 3QLHA 1K0TA 1YQHA 4ZP7A 5KG2A 3TVKA 4UF4A 3QT7A 1TAUA 3QRRA 4IRCA 3DXSX 3MEDA 1XMQF 2W2MP 5L38A 2Q6BA 1T03A 2AJQA 2O01C 2FVRA 4OYPA 1R89A 1C2PA 3A12A 2XHCA 4G1QA 3CMQA 5KTQA 7AT1B 1IR1A 3L09A 1KHWA 4ID5B 4KY3A 3AJDA 4ZLPA 2GHPA 4Q8EA 2OD4A 1N5YA 1WOOA 3G8SA 4QWBA 3M1VA 3IGNA 4JI0F 3PACA 4NLXA 1H38A 2HNYA 2KJVA 3KUEA 2ZHBA 4DV0J 3UNGC 4I69A 1VMBA 3QJPA 4NEYA 4ECQA 2C2DA 4NE9C 3I55S 5EHHA 2J6UA 4CI0B 2GS8A 2IYIA 3FSYA 2KN4A 3V6DB 2N3LA 3E8OA 4CP5A 3KMQA 1R8BA 4LF9J 2P6TA 1XNRF 1IKWB 1Z4UA 3IBCB 2HLTA 4ZHRA 2R8GA 2C2EA 4DFMA 3ONQA 5CXTA 2VPWB 2PA3A 3D1QA 2VQFF 1LKZA 5HN0A 3HF5A 1AUDA 3DM2B 3DGPA 2X1GA 2E7XA 1OQ6A 2HQ3A 4K8RA 1K73T 4RNOA 3OVBA 4PG6A 1QAXA 4ZPCA 5ETPA 2B5JA 1X4BA 3TRGA 3R97A 3IC1A 4B9TA 1JXVA 1B0PA 3FEYB 2HMIA 3WQPA 2EFOA 1Q1KA 1WSRA 3SSSA 3CJ5A 4KFBB 1NKEA 3OPKA 3H7HB 2XNQA 1X4FA 3LP1A 2EK1A 2NZ4A 1FA0A 1FVSA 1WOPA 1KOOA 2OFHX 2HFOA 5JVHQ 5ETOA 3F44A 5MAOA 1W7WA 1IBMF 1HQ2A 5I3UA 2K1RA 2R2RA 1WC4A 4M5MA 2HWIA 3OT9A 1RWMB 4V19X 4F3OA 5E2QA 6AT1B 2W4DA 1N0UA 5HANA 3NXZA 4N47A 4Y2AA 4IRDA 5A8WB 4ECTA 3GPAA 4O3SA 4Q2LA 2DNRA 2EKYA 3NS5A 4C9DA 4QPTA 2KT2A 2BJDA 3JQKA 2Z57B 3MM6A 3JAMU 1RT3B 4TQRA 3P5TL 3H5YA 4YY3F 1LEOA 1LWEB 3V81B 1UEUA 4LF7F 3GSDA 1PBAA 1IBLF 2IJFA 8ATCB 2ILYA 2A0FB 1HBUB 1S1XB 3UPFA 3U7JA 3KHGA 1PKUA 2UVUA 4R25A 5IT0A 2J0QD 2GO8A 5KT2A 1I5OB 3VAMA 3FK4A 4DV4F 2I1RA 3IG1B 2IRYA 3DXBA 3UVJA 2OGUA 2ZDOA 2O67A 3CPWR 5DDRC 3K5PA 4OYBA 3EUNA 5CZXA 1EX8A 3HKZD 3JSYA 2RB7A 1J5OB 1VQ5S 4M8LA 3AOBA 3W8PA 4USWA 2XTJP 4DQSA 3ZTRA 1L3SA 1I51B 2FLOA 4ZPTR 3ISNC 4OJ3A 3SXLA 2VJUA 3I56S 5IWAJ 3QZ7A 1TMMA 3ULHA 1YX2A 2WVCA 2X7IA 3KK3A 4Z37A 1VQOS 4X4PA 4DI6A 4ETXA 2AV5A 3PG9A 5DQGA 4P7TA 1BGXT 1O6XA 2JWNA 3O2IA 4ZS6A 4DL0C 5K5MA 4CRJA 3FFIA 4JI7F 1JLEA 1UVJA 1LOUA 2IA6A 1A7GE 5D78A 5I3QA 3JQMA 1R0AB 3KHRA 2A1BA 3C16B 4N8OA 2LXUA 1E6YA 1PGZA 3PYGA 1S1UB 3SQGB 4CQ1A 2YX4A 3KJVB 1SQEA 1WJ9A 1JLFB 5DQHA 3TO8A 1I6JA 3EGVA 1VRTB 2BXJA 3KJFB 2PMHA 4DCJB 2V9WA 2J8AA 2KYXA 3MECA 3D1OA 1ELOA 1WDTA 3R6LB 4ES1A 5K14A 1Z2ZA 1DLOA 4ZVRB 2EFVA 2DGQA 2CQ3A 3W61A 4CT8A 2A2CA 2F65A 2AX0A 3D0HE 4GKKJ 3OXGA 3DRRB 4WFZA 3KK1B 1IVZA 4KC5A 1QAYA 1UZDA 4K0KF 2OP5A 4DV0F 1YJ7A 2PI5A 2H5IB 3G6YA 4DV7J 4GKJF 3BREA 3RW6A 2UXDJ 3WIUA 2X51A 3J81U 4CH7A 3RG6A 4B3MJ 3LF0A 1X9MA 1TQLA 2ZE2B 5EDWA 1V3SA 1GMWA 4C0OC 4WWSA 3I0RB 3U1MA 4B9LA 5C24A 1UPPA 3IP0A 1U48A 4EFAC 2A6OA 2QN6B 2NQPA 3BBCA 4QU7A 5HBMB 2M4MA 3I4PA 1TL3A 2OTJS 3TWZA 3TVYA 1MNEA 4OZ3A 4CLKA 3HHLB 3PM9A 1CJVA 1SJ1A 1M5HA 2CPJA 1PCAA 3MMCB 5J2NA 2Y1IA 3IBFB 1RU2A 3QSYB 3VVTA 3H42A 1YRTA 5B0DA 3NWRA 2JZ5A 2L48A 1XMOJ 4ZN3A 1PBUA 3OR1A 2MLYA 2JFKA 1YJ9S 1OIAA 4O3PA 2K3KA 1S12A 4L72B 3M32B 5C5JA 4JUZA 2XM3A 3IM8A 4B3SJ 1VQPS 4NCGA 2CPFA 2DRDA 2HFUA 1Y5LB 5CH7B 2R7RA 3N0VA 3QATA 2WCXA 4WTYA 3UD3P 4KGMA 2HGLA 5KFXA 4HTIA 4WZQA 2V8DA 1LWXA 2M3DA 4P2MA 4NCBA 3WC2A 2CQIA 1VQ7S 5D4PA 1QM9A 4C3MA 3RAXA 4QIVA 5B7WA 2K7JA 3GU0A 4RZRA 2FDNA 2D9PA 1H2UX 2MGZB 5A8KA 5LSOA 5A8RA 5EX3A 2ABYA 1GK8A 2YPYA 2MQ8A 3J81Y 3SCKE 3SSQA 3KLEA 4KQZA 4LBPA 2JC0A 1BQNB 4LR7A 4DLEA 2VG7A 1CQNA 4EYIB 2GAHC 4USHA 1U8SA 3PYDA 3PW2A 1H7WA 1CJKB 3FMWA 4C0HA 3BH6B 1SIWB 2QZ8A 4LIRA 4DSFA 4EEYA 3GB0A 2B43A 3GG1A 4BHQA 1OWXA 3Q89A 1S1VA 4RNHA 3PIPQ 5E5NA 1WNEA 1VC5A 4ZP9A 5IT9U 2IYGA 2VBWA 4PWWA 3FBFA 3KOAA 4M1KA 1Q8LA 4NYPA 4F4AA 1CEZA 1WC1A 1FRHA 2KXFA 2LQBA 3BO2A 2AF6A 4TU9A 1WOSA 1U02A 5L46A 1NKBA 3L4BC 3FZ2A 3S1TA 4IH5A 3HHNB 2HK2A 4JBCA 1S99A 3TEGA 4DR5J 4OJGA 3DOMA 4NCAA 3TUJC 3R7SB 4LSLA 4ZK7M 2DGVA 5LMUJ 3T5JA 4KH0B 1JK9B 4N5SA 1SKUB 1GT8A 1Y11A 3PW7A 4NXNF 2XWYA 4DPXA 1FVQA 4NMXA 4ETZA 2RDJA 1Q53A 2WSCC 2MKYA 3R2CJ 2Y3YA 5J1NA 1ZA2B 3K5NA 3K0JA 2FZKB 1TKTA 3GE9A 2DD8S 3E2EA 3Q2SC 3C6UB 2R7UA 1DTQB 1RLCL 2HEKA 4CM2A 3SCJE 4ED2A 4AL6A 3DI6B 1MW7A 2ZH7A 4F50A 1PG5B 3AAWB 4QQBA 2M88A 3NCRA 2XEXA 4O44B 1OY8A 2H5JB 4I6AA 2BKOA 2UUBF 2WBMA 3DLKB 3LP0A 1AYEA 3R7BB 1X4EA 2WRMA 5IV4A 1M0SA 2VIHA 1HQEA 3DDNA 5A0YB 1NK6A 4DDFA 4TVAB 1HBMB 3M30B 2WONB 3T1AA 2EC2A 2BW7A 1T05B 2PE8A 4TLRA 1U6BA 3EICA 1C4CA 1ZM9A 1E6VB 4J90A 5IT9Y 4RJVA 3VAFA 2XYGB 1S0VA 5D77A 1KC8T 3HK2A 2LVWA 4EUVA 5AXKA 4I67A 2AYGA 1K0VA 4KBIA 4IOBA 4LSNA 5B0BA 4F0HA 1UJ5A 1HKAA 4RW6A 4FS2A 2I6WA 2AZ3A 3R27A 3UW1A 1T02A 4P71A 3G8TA 1NZ8A 1WF2A 2BKPA 1S1TB 3UWTA 1UVLA 1SV5A 3QFHA 1C1BA 4OYXA 3MPDA 3K5LA 3MR3A 1DQ8A 4OX7A 3VR1A 4ZJQA 1YKWA 3Q8RB 2GCFA 1R8CA 2FYXA 2DGXA 2DO0A 3SIPB 1JWWA 3VQTA 3UN2A 3H40A 1S4EA 2Z56B 1Q7YT 3I0SB 3BSNA 3SDEA 3BSOA 2V8VA 4CM0A 4E8UA 4WF9Q 4DR1F 3QJJA 1U1NA 1FTCA 2LEBA 1G3OA 2ZC4A 4KB7A 1HNZF 4WP8A 4NLWA 5T7LB 1HNXJ 2FIUA 2RF2B 1WHXA 4ZOSA 4OZNA 3HVTB 5B0GA 3HFKA 4KKOA 2SXLA 1FJGJ 2CJAA 1RTDA 3SV4A 3DNCA 1N8RT 3ET6A 2W1BA 2N7CA 1GXUA 1HBOB 1CSJA 2BDPA 4HACA 2Q6CA 1VJWA 1RI7A 1VGYA 1JNRB 1Q79A 3NRBA 2H4YB 3UQSA 4ZPVR 1S10A 1ZZFA 2OPSA 2AJFE 3R8YA 2G9OA 2LU2A 2ZOGA 1KLMA 3TJAA 5DQIA 1BD6A 4MK9A 2E7WA 4OV6A 3IAM9 2MJNA 4KIAA 2DNHA 2FZCB 1OY6A 1TP7A 2Y1LB 5CYQA 1YHQS 1RKJA 3J7AN 3MUVP 4PWDA 4RW7B 1NJWA 4Z7YA 2NZCA 2YNGA 4ZPWR 3NMRA 4LQ9A 4ZVGA 4DEZA 4M5HA 2F4VF 2J6TA 1KQKA 4EU0A 1EQMA 2YQ3A 1WC0A 2IBKA 5HAOA 1X4GA 2JLEA 2VJVA 2ACYA 1HLWA 3B78A 3CJKA 3WDOA 4RNNA 2D9OA 3N79A 1FXLA 2RHQB 2AX1A 3TQEA 2ZKUA 2DK2A 1RAHB 1GX6A 2UUCF 1ZAVA 4UQTA 4PQUB 1R43A 3ADAC 4O3OA 1RT5B 3W2WB 4DL4A 1B7FA 2RDDA 2WB1D 1FE4A 2R8HA 2M5YA 3NNHA 3CC4S 2HBRB 4CLUA 3ILLA 4I56A 2J9CA 3C2PA 2QA1A 1QD1A 2GAGC 3DLBA 4F02A 1MMDA 2UUAJ 3QT6A 3OTBA 2ZH5A 5LMUF 3I87A 2ADCA 1S7HA 4C4WA 4GRSA 5RUBA 1YZ7A 3EE3A 3EWGA 4CLFA 3G82A 2Y0SD 2BE2A 2PI4A 3W2VA 4ED5A 2XS7A 1FRXA 3GV5B 5ADZA 1V5IB 3F56A 4F7VA 3UNYA 1S7IA 4ZLNA 1VOMA 4U7UK 2YKOA 2D74B 2N4CA 3QYYA 3HHKA 1WACA 5C25A 4IG0A 1FKPA 1HBNA 3NY0A 3BJYA 2DR5A 1RWVB 2I9SA 2M0GB 1KWMA 2XMUA 1CJTB 2MY7A 3PHEA 1S0MA 4B3TJ 3OJSA 3G96A 3KLGA 2V2KA 2FJWA 1FI4A 1XK8A 4LF4F 2F8HA 1FO1A 2MJUA 4RW9B 5LSRA 2A2DA 2MKSA 2V68A 3LANA 3HSJA 3A8EA 1HWUA 3GILA 2Z4PA 1HNVB 1N48A 1RYSA 3CCZA 3ENQA 3H90A 3ITHB 1PAEX 3T6JA 2NXJA 4ZCIA 2G4BA 1RT4B 4F0MA 4DUYF 3KUGA 4CLTA 3A3PB 4HDGA 4UZCA 2OH2A 3GJQB 1KQSR 3EX7B 1TUGB 2IJNA 2XZTB 2FJBB 4J9VA 2QEXS 2QSFA 2ZBIA 3KLHA 4BWJA 5K8OA 2DBBA 2BJEA 3EDQB 5DM6Q 1I94F 1S5ZA 4C8OA 4TN2A 2DIVA 1RGVA 1P9YA 2DXFA 2G2OA 3TNVA 2J0SD 4NLGA 1RT6B 1U1OA 1U0HB 1RZMA 2HZVA 4KE5A 1U45A 2IJRA 1S6QB 2FJVA 2KM8C 4Z2XA 1VQ6S 1EZZB 4M5DA 1EP4B 3OL6A 1NAQA 4ID5A 1N33F 4DR6F 3Q23A 2HBQB 4LFAF 4K7QA 3TA0A 2BZ2A 2HGMA 4J9OA 3OR2A 1S72S 3VZHA 1F2GA 2B4OA 4WE1B 4HH1A 4DSLA 1N32F 4LRAA 3W65A 2EK6A 2YNHA 1TR0A 3CO9A 2AJ2A 1HNXF 3PV8A 2L9WA 4TNOA 3JSBA 2E5LF 2OTLS 4JV0A 3LTOA 1SPBP 3MTKA 1URRA 4CYUB 5EWFA 1KVJA 2QIFA 3T9NA 1UP1A 1NPRA 1IKWA 1DHMA 2BOAA 2YQ1A 4KHRA 1RE1B 5LXRA 1D8ZA 1JJ4A 2MXYA 3T5KA 2IAJB 4EBCA 1DARA 4FYVB 4DJBA 3DM2A 5HO4A 4ENOA 1LW0B 2GJIA 1MG7A 4BDPA 4LF6J 4AUKA 2CQGA 1GAOA 3GLJA 1WF0A 5L1LA 1ZM2A 2HZAA 4Y2CA 2BJ1A 1GMWD 2GZOA 4LREA 2MLZA 3TAQA 2IA0A 4JI6F 1TL1A 4PXEA 1RWWB 3P5BP 2O66A 1BC6A 4NLOA 3RGIA 4KFBA 2XI3A 4WYWA 1YJTA 4MIBA 1IJEB 2IHR1 1FDNA 3JSMB 3U02A 4JV2A 5HATA 5L39A 2A3JA 3BYRA 4L3KA 1ZM4A 2R7SA 4NRTA 1H72C 2ZBRA 2Q3PA 4ES3A 3OTEA 2LFVA 4EYHB 2RSQA 3PFEA 1T9VA 2PGCA 1HPZB 2R7OA 1K1QA 2AJ0A 3WHIA 3JQJA 4MAKA 1M5SA 5A8WA 4F26A 1FX4A 3K58A 4DUTA 2Q66A 4MK7A 1REVB 1U6FA 5ETQA 3MM8B 4KYZA 1WEXA 3R7NB 3SZ2A 2OEJA 4ZPDA 1FJCA 4ED7A 4WXOA 4I2QB 1DJ0A 1LWEA 1VFJA 5HROB 3DCAA 3DLGB 3AFGA 3X3UA 3D9BA 2K3IA 5IM0A 1HBUA 2PO4A 1S1XA 5KG1A 1AB8A 2B51A 2HNZB 2E5IA 4IG3B 3K7RA 1KRPA 5F8JA 1JX4A 1IBKJ 3VGVA 2XO6A 2MZSA 1HYSB 1N5QA 3U1NA 1RA7A 4UOGA 5H9EJ 5AE1A 5L1IA 1SJ3P 1Y3JA 2IRUA 4DV5F 2FVPA 2Q1LA 1TK0A 2E44A 4J9PA 1OMSA 2IY5B 1VQ9S 2CJKA 1UAWA 5IS2A 3MFIA 2CIMA 4Q0BA 3O3LA 2VG5B 3CCVS 4FS1A 3C3LA 1CJUA 4A8SA 1HWJA 4U9RA 4JI4J 2R2SA 4ICLB 3D2WA 1V3ZA 5GAGI 4OX8A 3TVZA 4DCOB 3ZTOA 2E1AA 1W2IA 2QJ3A 4KT0C 2WW8A 1OY9A 2BRKA 1TKZB 1P6TA 4DL7A 2NSCA 1Y10A 1N5SA 4BBYA 3O6QA 1CPZA 3CJ4A 2UV8A 4O4GB 4PZVA 5JMNA 2K8GA 4WCEQ 2YWEA 4LF2A 3MR7A 1G1XA 2GVZB 3CDUA 4OLPA 3V6KA 4NLPA 2HQIA 1IJFB 1ZZNA 3EDRB 1EETB 1MWYA 3OV7A 4RO0A 3NGUA 4AQYF 5DGBA 2XHWA 1TVRB 1D3WA 1B0VA 4YB6A 4C48A 2H5EA 3UFCX 3Q86A 4OMFG 3ZZYA 1AXQA 4J91A 1ZOTA 2FHOB 4A8MP 3N5BA 1S1UA 3T5HA 5EN1A 2YX1A 3C14A 4K2XA 3VGSA 1F1BB 2BW2A 1JLFA 3DLEB 2V2VA 3FJ2A 1X9WA 3M8SA 1VC0A 5G4DA 3IO1A 1YBUA 3IRWP 2G0CA 2ASJA 4IFVA 1AROP 3FSIA 5JJBA 5EGYA 1RT2A 5GAEU 2AGPA 3OQ2A 2DNPA 5KFDA 2UXBJ 1UFKA 2CA9A 5CHCB 4FP9A 3UDCA 4LVNP 1FKAF 1IKXB 2QX0A 2FTRA 1GX5A 3H5XA 1Q8BA 1SJRA 2ZE2A 3GIMA 4DQQA 2KT3A 2V50A 2CPEA 4L3NA 2PMWA 4KHPF 3HZGA 2LU1A 4USTA 2A18A 2ZJQQ 4LFBF 4RW8B 4A8QA 4MTPA 1OYDA 3JXOA 4QCLA 3OFGA 1TFYA 3KNAA 1U49A 3K8WA 1D9DA 5D3GA 2O3DA 3IWXA 2CPXA 5HBMA 4DS5A 2QLWA 5LXYA 2YY3A 2WVDA 2YKMA 5BR8J 4YUDA 1P27B 3VAKA 3VAHA 1U1PA 5SUHA 2IC3B 1S48A 2H65B 3MAQA 4WXWA 1NU4A 2ROEA 5ETKA 1JLBB 1A0OB 1RP5A 1FRMA 1SJFA 3AODA 3MEGB 1S76D 2FGOA 4FXDA 2AEJA 3BSCA 1O51A 1Z2LA 3NGSA 1NSKL 5CD4H 5KFSA 5F0UA 4AFFA 2MKCA 1QE1A 2BABA 3FBCA 2C3PA 3GJSB 3RR7A 3L7PA 4GVBB 3RB3A 3M32A 5BXIA 2EBGA 4J9RA 4IRKA 4B3RJ 5L1JA 1FKOB 3K59A 3M2UB 2KTQA 1ULRA 2CUYA 3MMAB 2Y1JA 1S6PA 3BGOP 3QZ8A 1F0XA 1WTBA 2NUUG 1YTYA 3BPDA 4UT4A 1TMJA 1NDKA 4FF4A 4QU6A 3FCVA 1BQMB 3UCUP 3BDEA 1W26A 3M8QA 2W2QP 1U1QA 2JSXA 2OPPA 3CJRA 2QYCA 4KV8B 3NS7B 3Q83A 4KO0A 3X1LB 3BGUA 1X4AA 1VHFA 1A6LA 4DV3F 3OTDA 1NRKA 3CSKA 3PIOQ 1H0HB 1BXNA 1IKYB 1F9FA 3BGRB 2V94A 1YVFA 3BYPA 2HS4A 2W9CA 1RBAA 2GJFA 3M6XA 1UKUA 4F36A 1ZTTA 2DGOA 3RTVA 1TL7B 2YWFA 4HEA9 3IS9B 1BQNA 5HK4A 1CS4B 4RUAA 4OX9J 2V9KA 5KFMA 2HHUA 4WFXA 2UVVA 5HMXA 2IDEA 2ASLA 1IBKF 4DL5A 1VRQC 5HJYA 4AXJA 3HM9A 3C8YA 3M05A 2BUNA 4P9SA 1OYEA 1GQEA 4OZ1A 1YITS 4A8YA 3MEEB 3I6PA 2XB2D 1AZSB 1LK5A 1BWEA 2MDAA 1URNA 4Y34A 4X4RA 1JLGA 2V5HG 3M8PB 2HGNA 3G6VA 1FE0A 4X4VA 5KT6A 2ZD1B 2DIUA 4JV5F 3MMBB 2ZH3A 3KJQB 3UCZP 5AT1B 3MCMA 4OJ1A 1IKVB 4FBTA 3KLIB 2HVEA 4H4KC 2J5AA 2HQCA 4OZ2A 4OZLA 4UOFA 1XERA 2VB6A 3LP2B 1FWKA 2VFTA 4RNFA 5KFFA 2W2NP 2FJAB 1KHVA 1Y7PA 2BE9B 2AKWB 1J5EJ 4DU7A 3DOLB 1WC3A 3VALA 1NJXA 2KB2A 2WSFC 3PRBA 2HS0A 2VD3A 4F0KA 2NREA 1RTHB 3DOKB 3AB4B 3PR4A 2ZH1A 3ENWA 1LFPA 1PILA 5DM7Q 5M2RA 5LM7E 2G2YA 5DZ6A 5H1SV 3PRDA 4J9MA 2HRTA 2C2RA 5HMZA 4ALZA 2V2QA 2YH1A 1XR5A 5FDLB 1KNZA 3TYTA 4Y6IA 2F7VA 3H20A 1V3RA 4E0DA 3FCWA 3QNWB 2QMUB 3C6UA 1FNMA 4ECZA 4LRCA 3KYLA 2VKRA 2DB1A 4CT9A 2ZNYA 4PUOA 4DV2F 1YRUA 3BS9A 3MAAA 3PKYA 2YNIB 4FYDA 2CWKA 4USUA 2EG1A 2YNFA 2K7KA 2CVIA 4RUHA 2C3MA 5A76A 4U67Q 3HSZA 1FFSB 5G0RB 3JTOA 3EZ5A 2M2BA 2E1RA 4ED0A 1BWVA 2CQDA 2MKHA 5IC4B 3IFEA 3BR8A 1S1WB 4JI8F 1RLDA 1VCTA 4MIAA 2KZZA 1S9EA 4NEZA 5FIIA 4MMOA 3W66A 5HMYA 1TUWA 2QMWA 3TUPA 3K5OA 4N7TA 3HJFA 3NGDA 3RRHA 2MHNA 3OVAA 3M2RA 2A6MA 4FDFA 3OSNA 2DVIA 2VBZA 2D3O1 3OUYB 4CLSA 4K4YA 2FLPA 1NO8A 2ZVSA 3IXQA 3MM9B 3I96A 5ETVA 3C46A 2JX2A 2E5HA 4DUZJ 1Z1ZA 4PR6A 4M94A 2DGSA 2H4WB 2VG6B 4FN5A 1EHWA 1TKXB 4D3HA 3R9LA 3IWLA 1LW2A 2Z0GA 4EWTA 2I5JB 5JUMA 1NPPA 2RU9A 3ZZPA 2JEFA 3CD7A 2NYIA 2WVBA 1ROFA 4LBHA 1RTZA 3QSIA 2JRSA 2GA7A 2CQPA 1UEKA 2VQEJ 3I0SA 2DTJA 2OPRB 2LQ9A 5FJ4A 3DN9A 5C7PA 2BX6A 2KM8B 1SL0A 1JMTA 2E29A 4WIIA 2PA8D 3HHLC 4LF5J 1UW4A 2MQPA 3MR2A 5T7LA 5E0OA 3ZZTA 2LDYA 1XR7A 3HVTA 1LQ9A 5SZTA 1S77D 2WB4A 4RL1A 2U2FA 3S6EA 2PIIA 3HDSA 4FPRA 3KLFB 3H0PA 4LF8J 3U27A 2ERRA 1SQGA 4X66F 2PMZD 3CIMA 2VBXA 2CQHA 1P1LA 1T9TA 4JI3F 1S97A 4F67A 2BVZA 1GXLA 4C3LA 1U47A 2F4FA 1HD1A 1KFDA 3QIPB 1O0PA 3JSRA 4QWCA 4RW4A 3J80U 3UDEA 4YR3A 2R4FA 4YHHF 4ZIWA 5KFYA 2IFXA 3UN3A 1YRXA 2E9ZA 2L9NA 4G65A 1RT1B 4DSIA 4URSA 3L3CA 5K9FA 1NHKL 1VHIA 2YXLA 2W7PA 5F8HA 1W25A 3B4MA 1NB7A 3CCRS 3BN4A 4CDIA 2I2YA 1YJWS 5L9NA 1UWAA 2B6AA 2XLJA 2P9GA 3HD1A 3K17A 3W64A 3AD7C 3QGGA 4Q5VA 5J1EB 3GFXA 3QLHB 1KR4A 2HHVA 2XSJB 2JEGA 1TELA 2CJYB 3IBWA 4L74A 3CJQA 2CXEA 2CJQA 1TUVA 1JXEA 5A6WA 1VR6A 3MEDB 5KFZA 4DF4A 3CCES 4NLUA 4O3NA 2AWZA 2HHHJ 4HT5A 4K4VA 1Q81T 2ZBCA 4EBEA 2LA6A 3LPEA 4PAAA 2GMLA 2IM1A 1UVNA 3O8WA 4G1IA 4CTAA 2YWWA 2J76E 4Y28C 5THWA 2CJBA 4OLOA 1J5EF 1FDAA 2C3OA 3MXHP 4RWXA 5KG5A 4FZVA 1N5YB 1UVIA 2H3EB 4DSJA 4E2FB 3I5CA 1UFWA 4IO1A 3IAS9 3GIRA 4ANDA 4WK1A 2LKZA 2HNYB 4NWBA 2CPZA 2JLGA 2DHSA 2APOA 3K57A 1NBEB 3M6WA 3RB6A 5L8RC 2ILZA 3S01A 4C8MA 2VC1A 2M7SA 1IWGA 1KTVA 2D69A 4QPXA 1LFWA 1VIOA 3CJTA 3NMAA 1C0UA 2QA2A 4F4KA 2NXNA 4R0EA 1T94A 2YVSA 4ZHRB 4I68A 3C66A 2XY7A 3CGIA 4W4MA 4EBDA 3K5MA 3FEZA 2CPDA 4ZKAA 3ELHA 3L7UA 1SUQA 2Z2MA 1YSJA 4K59A 4YQWA 1JB0C 3DMJA 3DGPB 4ZVQB 3DHXA 4CO0A 2NCKL 3M8ZA 1PC5A 1YBAA 1HI1A 1PJ6A 1JXLA 2B5JB 2DNKA 4JI5J 1U1LA 5B0AA 1NDPA 2HMIB 1N36F 1B7YB 3DKDA 1TV6B 1YJUA 4FF1A 4J9QA 4TYBA 4OL8A 2JVOA 3JS9A 4CO3A 3UN5A 2GGPA 1JKHA 3LP1B 4ZP6A 2QO3A 3NP5A 4UY85 3KK2A 2KVQE 1L5UA 1NHVA 4CO2A 2GIFA 4QWAA 4DR7J 2B9XA 5KFAA 3G4SS 1XNQF 3OL7A 1RUSA 3CNQP 2F8MA 1ZPWX 3SQOP 3EVWA 4B9SA 3LUYA 3NBPA 1Y4ZB 2G13A 3AH6A 5D4LA 3P49B 1O5JA 2E9RX 1WUUA 1FERA 1XTZA 1W2BR 5HJXA 4HI2A 4C8ZA 5LMNJ 3KHHA 4DZ6A 2XMJA 1EP4A 1DQ9A 3EZOA 1NJZA 4PYAA 2CQ4A 4U6PA 1M1KT 4CCHA 4DG1A 4EZ9A 3GIKA 5F41A 3IMQJ 3VZIA 3FGVA 2R7TA 2P5VA 5GAEI 5HL7Q 5LT5A 3IGVA 1P1TA 4XDDA 3KHLA 3DYAA 3ZZ0A 3QQCD 3QJLA 3D3CJ 2VA3A 3ZNUA 2QE5A 5E3PA 4NLQA 2KYZA 4F2SA 1RWOB 2UZAA 2QL5B 2C22A 3L9ZA 2JFDA 2NXCA 3ZZOA 2HAIA 2IMOA 2F5GA 2CADA 1GTEA 3UVJB 2E5JA 4O4RA 1HNWJ 3UDVA 2RJZA 4ER8A 5F3TA 1X4HA 2COLA 1JLQA 2HS3A 2IM0A 4NLDA 1RACB 4ZPAA 2UV8G 3SMZA 4DS4A 1GH8A 4JI1J 3NS6A 3DRSA 4KAIA 2MLXA 1RK8A 5EWGA 1Q0NA 3T1HJ 4EO6A 2HVZA 1S4FA 2QYGA 3FDSA 1HR0F 1V6HA 2OEMA 2XGPA 1D09B 4NLYA 1N5TA 3EGNA 3CJ8A 3AA8A 5CD4A 4DV1J 3D68A 1KD1T 2KG1A 2JEIA 4DR4F 4I7FA 3M2VA 3MAHA 3HSDA 2KRBA 3BR9A 5E3AA 3POTA 3HP6A 1RT7B 2RQMA 3WX4A 5C2GA 4KGZB 2Y8WA 2HHHF 4I1TA 2XCAA 3AQOA 4W90B 3THTA 2GVDA 4DR2F 3VF0B 1S49A 4NLSA 1FFWB 3RBDA 3EZUA 2W8KA 3MECB 3N5FA 3MM8A 4NXMJ 5K14B 3OHAA 1M1HA 3G71S 4DV6F 2BEFA 4WP9A 4CLPA 1DLOB 1H3DA 4RNMA 3H59A 2DEJA 3GZ7A 4I2QA 4XK8C 5D0GA 2FHKA 4LUBA 2ACMA 1Y5NB 4IR1A 3SI8A 5HROA 3AJ1A 3PEHA 4P72A 1UA0A 3CD0A 2NYHA 3LH2S 2ZUAA 1NH7A 4P75A 2DGUA 3BZQA 4P73A 2GHWA 2B8QA 2YWKA 4P2FA 3GMGA 1RAFB 1R27B 2R7XA 3DDKA 4ZVPB 5F8IA 2B8PA 3CD5A 4TY8B 4QOTA 1GFWB 1JQGA 2XLIA 2RRNA 5J2MA 3ZZRA 4DX8H 2VG5A 2AP6A 2P9CA 2B9WA 2ZJPQ 2C2OB 4CH0S 1R8HA 3MFHA 1SKWA 3HLUA 2RKIB 4FXWA 1HWLA 4I6WA 1QVGR 3CCLS 5AJ3J 2RT3A 2DNGA 5C42A 2O1PA 8RUCA 4U7UD 2BQUA 1CJVB 4ZVEA 2UVRA 3MMJA 1F2HA 3PTWA 4H4MA 5J2NB 1JJ2R 2UXCJ 2MB0B 2ZC3A 3OTOF 1XN9A 2MQMA 4O4GA 1F60B 3BN7A 4QR2A 3AOAA 5B0EA 3QRPA 1RTIA 3OR1B 4HYKA 1MN7A 3ENAA 3CCWA 3AD9C 4I2PA 1H98A 5F8GA 4NZ0A 3SSRA 4JI2F 1KLNA 1WD6A 3W9IA 4J9LA 5KFHA 2J6SA 4NCGB 2W7AA 3N6MA 4KSEB 4I6YA 5ETLA 2AD9A 1PJ7A 4I64A 4IH6A 5J2PB 2POKA 4Q44A 2JJ4D 4DCPB 5T14A 5D8HB 3LGHA 3FQLA 3BB5A 1G7CB 4DQIA 3DLLQ 5HQMA 1TU0B 1N34F 2HHTA 1IWAA 3A3OB 3HVAA 5A8RB 3H5UA 2ZM6F 2F1FA 4TQSA 4TYAA 4X65J 3QWUA 2RU3A 3N01A 2DNQA 5E7OB 4C98A 3HSGA 4G3IA 1SB6A 4NPOA 2D41A 2DT9A 5KFIA 2VG7B 1XEZA 5KT7A 1R6VA 4BC9A 1IKXA 3BKUA 3ILIA 3WBZA 5BYRA 4YB1P 3PW5A 1TFWA 4LRBA 3BQ2A 4P2SA 4K50A 4F3MA 2HVDA 4OZ0A 5GADI 3PW0A 4NRUA 1QY7A 3KLVA 1OO0B 1Q8KA 1RAOA 4TLQA 3MD1A 3AXMA 1S1VB 4U95A 4K4ZA 4YB7A 3P8BB 1HNWF 3GQCA 1U8WA 2U1AA 3KG1A 1NK4A 4Q8FA 1I1GA 4QWDA 2C3UA 5BYQA 5KOWA 1H7XA 3QWPA 2FZGB 2ZKTA 4ED8A 4ITSA 2VICA 4QIEA 4C7QA 4LF9F 1YJRA 1JLBA 2AIRB 4ZLLA 1U2FA 4WKYA 2HURA 4TKTA 3MEGA 2Q79A 3DOMB 2QA4S 2XG8A 2FB0A 1GXTA 4BCAA 4DLGA 4URGA 4LSLB 4DPTA 4QIWD 1S79A 2DGTA 3TJ8A 2DJWA 3LQVA 3A4TA 4MYTA 4K4UA 1H6KX 3TR5A 3I9V9 2BQRA 3E3XA 1SC4B 2NXEA 1NXIA 2V4QA 3M2UA 3BEGB 1TKTB 3H2LA 1HI8A 3GCXP 1DTTA 2DHHA 2FLNA 2E1CA 4PKDB 5D4OA 3R5GA 1BQMA 2J0XA 3HD2A 2HQGA 2RQ4A 1R31A 5HLFA 3WIVA 1DZ5A 2MY8A 1AFIA 4A47A 5E3CA 3CB4A 3MURP 1T3OA 1MROB 2C2MB 3PJ9A 4ZCKA 4M63A 2OUGA 3LP0B 3H2VE 3CF5Q 2HG4A 1VRUA 4JYAJ 2BJ8A 1HQEB 3DC2A 1M5VC 1G6BA 4NZ6A 3QO9A 1TL7A 2I0XA 4QR0A 3PZPA 5KG0A 1ZPVA 3PDNA 1A9NB 2XMMA 4HR2A 3N4WA 2Z8QA 3LA0A 1HI0P 4S0MA 1MN9A 2CQ1A 2RQCA 1OS5A 4NYZA 2WAQD 3CCSS 3UI3A 1VQMS 3KDOA 3MEEA 4RW6B 2X1AA 3FNNA 1WORA 4YB5A 3NNAA 3D3BJ 1Q5YA 2CG4A 1EARA 5HVHA 2VL1A 4ECUA 3ZFVA 1XMQJ 3R2DJ 1V9OA 3BSAA 2N3OA 1SV5B 1IR2A 2YBVA 2XBPA 1U2CA 1IKVA 5LSLA 1S9GA 3NLCA 1SJQA 2FVQA 3DDIA 4FPIA 1G2EA 5AJ3F 1WI8A 2ZOMA 1FK9A 3NGRA 4ZITA 5GVQA 4DBQA 3GR0A 2MSSA 1U0SA 2VFSA 4KGKA 2MMYA 2HLUA 4X4TA 3PEJA 1XR6A 5KFKA 2JH3A 2L3MA 1YI2S 4JI0J 2HRYA 3SDEB 1IUJA 1F6TA 2DKOB 2OSQA 4TU7A 2HFZA 4XPEA 2YKAA 5GAGU 3MEKA 2GC8A 1Q8IA 3IRXA 5LJ5Y 5K20B 2EG2A 3TP2A 1RHKB 2XWXA 5FDLA 4IO9Q 1C1CA 3PR5B 4KKOB 3HX9A 3OLBA 1XNRJ 1FWLA 1Q4RA 3G2XA 3ET6B 3C6TB 2XS5A 4QYRA 1LNQA 5GMEA 4HACB 2I38A 5IWAF 3WZ0A 2CNNB 1HQUA 2VQFJ 4ATNA 3PJXA 2ZH2A 1Y0HA 4X64J 3CULA 1RAIB 1OPZA 4U7CA 3AA9A 2OPSB 2MQOA 4BS2A 3EXCX 3OXLA 1KLMB 1CQMA 1JLCA 3NEKA 4UTGA 3HXMA 1M5PC 4XIUA 3FZBA 1SC3B 3LWLA 2HFSA 2GHVC 5CYQB 1TK5A 3OFHA 1F5AA 1FEHA 2ZUGA 3BO3A 3NOCA 4PWDB 4H4OB 1EB0A 2W25A 2R9LA 2BE7D 2CKWA 1RWUA 1ZBTA 1PIEA 3J81j 4ZVTB 2DCUB 5DG8A 4P74A 1IQTA 3LAMA 4OYZA 5KFTA 4ID8A 2YNGB 4B9NA 4MKBA 3TAMA 1T8EA 2VHGA 4ZCLA 4CO5A 1B64A 3GIIA 2DY1A 4NI2B 2DO4A 1T11A 3I4HX 3KXDA 1F3VA 2W4PA 3Q0AA 1IBMJ 5DDOC 4ZVHA 4A8OA 1GEHA 3CJKB 1FESA 3TW0A 4EI2A 1HMVA 5GAHU 3T41A 1VQ4S 4GKKF 3RBEA 3BGLA 3FC9A 3C15A 3TX8A 1S6OA 4C8LA 4R5PA 3Q8QB 4Q45A 2VG6A 3BM7A 2Z2YB 2RS8A 1NK5A 2DPJA 3EVOA 2ROPA 2I5JA 1FTRA 3ISND 4DV7F 1MSWD 1FCAA 2UXDF 2DNZA 3MCSA 1FT8A 4USIA 2ZBQA 3W62A 1Y00A 2WOMA 4DZDA 4B3MF 1WG4A 2F40A 4QW8A 3T3FA 2PN6A 3NL0A 5E33A 5ETTA 4ZIVA 4YY3J 3T9ZA 3UCGA 2OPRA 4LF7J 2C2ZB 1IBLJ 2FC8A 4O3RA 2YTCA 2YKPA 1EIYB 1YWXA 3J7Z5 1X8DA 3OBIA 5DRKA 3NGTA 2BJ3A 2X3DA 2OAUA 4OI6A 4EK2A 1GMUA 3G82B 2NUHA 1Y9OA 2BE2B 4KGVB 4ZP8A 1PYTA 1REGX 2VC0A 3M8YA 1UWBB 2L9DA 4DV4J 2LCWA 2EWHA 1TKDA 4U8VA 2ZVIA 5C25B 4IG0B 2V67A 4A8WA 1HBNB 3R3TA 3IM9A 1IN0A 4IDKB 5CA5A 1XMOF 3ZZZA 3ISZA 2HBZB 4CNZA 3BO4A 4PG7A 1NCLA 3KLGB
chains in the Genus database with same CATH topology
2YPYA 4UZBA 1B3TA 1VHIA 2YQ0A 2YPZA 4UZCA 5A76A 4BLGA 2YQ1A 4K2JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YPY A;  4UZB A;  1B3T A;  1VHI A;  2YQ0 A;  2YPZ A;  4UZC A;  5A76 A;  4BLG A;  2YQ1 A;  4K2J A; 
#chains in the Genus database with same CATH topology
 2NLW A;  3NAI A;  2C2N A;  3R5A A;  4B3S F;  2OO4 A;  3AQP A;  5KG6 A;  2LA4 A;  4WU3 A;  3GFZ A;  1RCX B;  4UUW A;  4X2B A;  3KFW X;  3OTC A;  2KXH A;  2HBY B;  1M5O C;  1T95 A;  2E1P A;  5EX0 A;  4G6V B;  3CC7 S;  5I42 A;  1RT1 A;  5DET A;  1FFG B;  1H73 A;  1YG0 A;  2MZQ A;  5I4M A;  4USM A;  4QW9 A;  2P8I A;  5AXN A;  2WW4 A;  3KG4 A;  3IR6 B;  1X5T A;  1D0E A;  2LEC A;  2B3T B;  4IFY A;  3FRZ A;  3WC0 A;  2IM3 A;  2A10 A;  2Y0B B;  4JI7 J;  5J1E A;  1HHS A;  2XC9 A;  2XSJ A;  1WTF A;  2WHO A;  4QJV A;  1ZM3 A;  4OYO A;  3KLH B;  5T41 A;  5KFE A;  1KQG B;  1FRJ A;  3L7O A;  4NLR A;  1L3T A;  1UET A;  2F8E X;  4YOE A;  5B0F A;  4GO7 X;  4HL9 A;  2QLB B;  4C11 B;  2QA4 G;  3UDL A;  4USJ C;  4B3O A;  2UUT A;  2DIT A;  3SBM A;  3FQK A;  4M5N A;  1OJ4 A;  5A2Q U;  3GYG A;  5HVG A;  3W9J A;  4M5D B;  2ZFH A;  2W9A A;  3FEX B;  3HZE A;  1NJY A;  1AFJ A;  4X4N A;  3R6G B;  2LP4 A;  3R1L A;  4IOA Q;  3CXC R;  4ED4 A;  2DNO A;  4LRD A;  2IDL A;  3OR2 B;  2LDI A;  1FRL A;  3AY0 A;  4K0K J;  3JTP A;  3LW5 C;  2HHX A;  2YNH B;  4GKJ J;  2M70 A;  4HH0 A;  2ALY B;  1LWF A;  3W5X A;  1X60 A;  1FNO A;  4CH1 A;  3MM5 A;  1S57 A;  3T19 A;  3QID A;  4QWE A;  2GFF A;  4ZPB A;  1ITP A;  4DN9 A;  4O0I A;  4MK8 A;  2RAQ A;  4HTJ A;  4DR5 F;  3G87 A;  3GYN A;  2CFX A;  1QSY A;  4F8R A;  2KZM A;  1XC9 A;  4WFA Q;  4X64 F;  1KON A;  3A3N B;  4BC7 A;  2AT1 B;  2DYA A;  2AZ1 A;  1VQL S;  4EMD A;  2HHS A;  3HVR A;  2AQ4 A;  2Z2L A;  2YKN B;  4CO1 A;  3KKF A;  4RKU C;  1VBY A;  2HK3 A;  2QRR A;  2MKK A;  2QV6 A;  3MUT P;  5H9E K;  2MYF A;  1SC1 B;  3VVU A;  2ZDP A;  5KFB A;  2HFV A;  1LXJ A;  5A6P A;  4FVC A;  3AD8 C;  1N6Q A;  2X1F A;  3M9N B;  2HIY A;  3JB9 k;  1TL1 B;  2ZHO A;  5CZV A;  2J7K A;  4LQ3 A;  3BBF A;  1U1K A;  4USK A;  3HO1 A;  3TZW A;  1TV6 A;  3ILO A;  2H48 B;  1B4S A;  4RWW A;  2VZ9 A;  3GV7 B;  3BV8 A;  3M6V A;  1HWK A;  2MHE A;  3CDW A;  2MKJ A;  1S6U A;  1VBK A;  1KTQ A;  1BHN A;  2WK4 A;  1UJ4 A;  2J9E A;  5A2Q Y;  1NH8 A;  1FNX H;  2VH7 A;  3IN5 A;  5DG7 A;  4ZJO A;  2M9K A;  1CUL A;  3HPO A;  3N9U C;  1F5B A;  1Y3K A;  4TXS A;  4PYD A;  1FRK A;  1M1G A;  1RBO B;  4C3K A;  3CJ0 A;  5KFJ A;  2ADB A;  2PDA A;  1FDD A;  4DX6 A;  4PG5 A;  5ETR A;  1NME B;  6FDR A;  2M8D B;  4UZB A;  2JNJ A;  3RAM A;  3Q8P B;  3PCO B;  2ASY A;  3M8R A;  3EPI A;  4J9S A;  3B6B A;  4FKY A;  3PY8 A;  1TL4 A;  4KH1 B;  4OJH A;  2XYH B;  4ZDN A;  2W7O A;  1CC7 A;  5HP1 B;  4DHV A;  5DLG A;  4R0J A;  2ZIT A;  4JB8 B;  1FWP A;  2Y9H A;  2DNY A;  1XQI A;  4PCQ A;  5IM0 B;  4OHV A;  2OFG X;  3D54 A;  3US5 A;  3RUB L;  4N41 A;  1HW8 A;  4F4Y A;  4B9U A;  2DRA A;  1GMV A;  3OHB A;  2ZWO A;  5H9F J;  5BYS A;  2XMK A;  4KTQ A;  2G1D A;  3OVS A;  3ICL A;  4Q0B B;  2XY6 A;  1QAI A;  1EAY C;  1CJU B;  3IR5 B;  4HVZ A;  5AE2 A;  3MM7 B;  3PFO A;  3FBB A;  3VV2 B;  2R2U A;  2HVH A;  4K5R A;  3PW4 A;  1BE4 A;  3CDE A;  1JJC B;  3VTI A;  3V6D A;  3KJN B;  5F8M A;  1FJG F;  2UUW A;  3AHP A;  2HZC A;  2PEH A;  4NAS A;  2EFN A;  3V4M A;  5D15 A;  3FVY A;  4V19 J;  2WZ1 A;  4ES2 A;  4ILR A;  3A13 A;  1R6Y A;  4DQR A;  3MTJ A;  4NXN J;  3ZTQ A;  3I5B A;  4HT7 A;  2KHD A;  3V4I B;  5KFU A;  2BM1 A;  3HT3 A;  2IRX A;  4QYZ J;  2K2P A;  1X5P A;  4PXD A;  4XDC A;  4ED1 A;  1RHQ B;  3D6H B;  1X5S A;  4Y00 A;  1RT7 A;  3E01 B;  2J0W A;  4Y2K A;  3B54 A;  1K8A T;  4KR0 B;  3JAM Y;  4OYI A;  1SBR A;  2VA2 A;  3C14 B;  4Y2I A;  4YFU A;  4DSK A;  4WTO B;  4MKA A;  3LOU A;  1L3U A;  2RQK A;  1G4C A;  2UUB J;  5C2C A;  3D4J A;  4M5K A;  1NSQ A;  4YDX A;  3R1H A;  1KKH A;  4IFV B;  2X1B A;  2D3U A;  2F9D A;  1RT2 B;  2WVE A;  5KT3 A;  1RIS A;  3HHE A;  3AT1 B;  3OL9 A;  4AXI A;  2B4P A;  3I82 A;  3QT8 A;  3BBB A;  3MD3 A;  2DXD A;  4JP8 A;  1T9U A;  3D66 A;  4WYL A;  4HHJ A;  2CPY A;  3DHW C;  1B99 A;  2BAN B;  4USV A;  4EGL A;  8AT1 B;  2CJX B;  4L76 A;  1CLF A;  1MML A;  4TY8 A;  3B4D A;  4OI4 A;  1QTM A;  5KFP A;  1RT3 A;  4OYA A;  2EVZ A;  4N76 A;  1RHU B;  1SJ4 P;  1IQZ A;  1GTH A;  3V81 A;  2UUA F;  1AW0 A;  2KJW A;  2W9B B;  2CJ9 A;  2VFU A;  4JOU A;  5CYM B;  2WVF A;  2QSW A;  1RHJ B;  3I5A A;  2DGW A;  3EGW B;  2RKI A;  1VYA A;  2CQ2 A;  5D3G B;  2BM0 A;  4LSZ B;  1NSA A;  1JLA B;  3DU5 A;  1WKL A;  2B56 A;  1NK7 A;  2YKM B;  5DO2 A;  1VI7 A;  2B4V A;  1DUR A;  3G6E S;  2Y8Y A;  3VCD A;  1QLN A;  3MPU B;  2IIH A;  3N6N A;  4OV1 A;  1HWI A;  3IG1 A;  3KDN A;  5AXL A;  1RSC A;  2C3Y A;  4C2M A;  4H4K A;  1UJ6 A;  3QPI A;  3RW7 A;  3D5M A;  1PO6 A;  2RRB A;  1UCN A;  3DU6 A;  3S7R A;  4DR1 J;  1QE1 B;  1RTJ B;  3GV8 B;  3FKB A;  1HNZ J;  2QLF B;  4OYM A;  2BMB A;  3G8Q A;  1VQN S;  2RRA A;  4B3T F;  1J5O A;  3H4B A;  4FKX A;  2RML A;  3GTY X;  1QUV A;  4UOH A;  1C0T B;  1K47 A;  4RPF A;  2VDI A;  4M5I A;  5DZ7 A;  4CLW A;  1S6P B;  5J2P A;  5KOX A;  5E41 A;  1U7L A;  1KFS A;  4NML A;  4L6V 3;  1VC6 A;  1N56 A;  3M8Q B;  4DFK A;  4RBV A;  1X7V A;  1VQ8 S;  5EUH A;  3Q2T C;  2OPP B;  3CD6 S;  2ZJR Q;  1TK8 A;  5IZH A;  4ECW A;  3PYF A;  3TZY A;  2VOD A;  4KO0 B;  2DHX A;  1IBC B;  3CC2 S;  1OPI A;  1YJV A;  3J7Y U;  2BYC A;  3BH7 B;  2W9C B;  4NZ7 A;  4DU8 A;  1R0A A;  1DAX A;  4A4J A;  2CQC A;  1N0V C;  3C16 A;  4AD6 A;  4ANE A;  4FYY B;  3H98 A;  3N28 A;  1PYO B;  5KG4 A;  2IMW P;  5JXS A;  2HND B;  5CAB A;  3SQG A;  4ZLJ A;  1RAE B;  3ETM A;  2VOO A;  2BBE A;  2R8I A;  4NOH A;  2MZ1 A;  3KJV A;  3MDF A;  3W1Y C;  2RE1 A;  2F4V J;  4KGX B;  1VRT A;  1D9A A;  2NXU A;  4CWB A;  4NL5 A;  2B9E A;  3F0N A;  4IR9 A;  3CW2 C;  2MZT A;  4OIX A;  3JYT B;  5F8N A;  3Q8S B;  2MPU A;  2KFY A;  1JLG B;  5CYJ A;  5GAH I;  4W98 A;  2DR6 A;  3DRR A;  5L1K A;  3MI7 X;  4KPY A;  3KK1 A;  3PO4 A;  2ZWP A;  4ANC A;  1ZET A;  3TJ9 A;  2CDR B;  5F3Z A;  3D6F B;  2UUC J;  1WEY A;  4DX5 A;  3QFW A;  2OMO A;  5JVG Q;  2DIS A;  2DR8 A;  3HT0 A;  1WI6 A;  2ZNZ A;  5IT4 A;  3CTR A;  2IVY A;  2XLK A;  2BRL A;  4HDH A;  5KFQ A;  5KT4 A;  1UVM A;  5D0E A;  1U24 A;  5D4N A;  1C4A A;  4PXC A;  3I0R A;  4M5G A;  3VWS A;  3OJU A;  4K4S A;  2EKN A;  1WKJ A;  3KG0 A;  7FD1 A;  2BA9 A;  4OFZ A;  1OQ3 A;  1XWL A;  4TY9 A;  2E5G A;  4DPU A;  4LF6 F;  4A46 A;  4DXL A;  4U96 A;  1NHU A;  2F3J A;  3K89 A;  4YS2 A;  3HHL A;  3CJ3 A;  3T1Y J;  2OI2 A;  3TAN A;  1BY9 A;  5D6G A;  3MMC A;  4FBU A;  3HFZ B;  1OSD A;  4PUO B;  3JTN A;  1Q95 G;  3Q8U A;  3RBZ A;  4HLB A;  3MAA B;  2V69 A;  4HHH A;  1NK9 A;  4DX7 A;  4X4S A;  2CG8 A;  2YNF B;  4DMZ A;  1S0O A;  2DH8 A;  1MRO A;  5ETS A;  5MLC V;  1RQ0 A;  4IKA A;  4ED3 A;  4FNI A;  2VPY B;  4LF4 J;  3QT5 A;  3Q24 A;  2DNL A;  3LO3 A;  3UR3 C;  3P4U B;  2I8E A;  5J2Q B;  1KS2 A;  4OHZ A;  1SKS A;  4M95 A;  1MMN A;  3KNG A;  5IQ6 A;  4NYO A;  2KH9 A;  2MQQ A;  1S9E B;  3ZZU A;  4PWU A;  3W63 A;  2KFZ A;  4ZJL A;  3W9H A;  1VLY A;  2JOQ A;  2PFD A;  1HNI B;  1NLK L;  3ZTP A;  3EVM A;  3GON A;  3ZC4 A;  1J27 A;  1XBW A;  3I31 A;  3QAE A;  3M2R B;  3K2Y A;  5CQG A;  4DUY J;  5F9L A;  4EO8 A;  2DEI A;  2HWT A;  3AOC A;  2RNE A;  2AEM A;  4BWM A;  2MGZ A;  3AXK A;  4ERD A;  3CCU S;  3TI0 A;  1ZAW A;  2GIR A;  2XSF A;  4Y2M A;  3LAL A;  1I94 J;  2P6S A;  4PQA A;  3R5J B;  1IM4 A;  5KFV A;  4WFB Q;  3VHQ A;  4N77 A;  2VU5 A;  3PKM A;  2YKQ A;  4DL2 A;  2G1H A;  1LW2 B;  4B08 A;  1CG2 A;  1CJK A;  4FXV A;  3P3D A;  3FSX A;  1KOH A;  1F5C A;  2VPX B;  1N33 J;  2H1Y A;  4DR6 J;  2AJ1 A;  2JVR A;  4XTT A;  4LFA J;  1U1M A;  1TAQ A;  2NPF A;  3H4D A;  2QT7 A;  2HYI B;  3R5D A;  4J9N A;  4DN0 A;  1RA6 A;  2LXF A;  3QRQ A;  4JI4 F;  1N32 J;  4OZ5 A;  2MST A;  1R8A A;  2E5L J;  2H54 B;  2ZHA A;  3CCM S;  2XMT A;  2HVI A;  2V4J B;  3HCX A;  1U09 A;  3HMJ G;  4HI1 A;  4A8X A;  3CMA S;  3C6T A;  1U6Z A;  2BR0 A;  5KFL A;  5K8N A;  1LWC B;  4PPZ A;  4CO4 A;  3K8V A;  3HJV A;  2IBO A;  1NND A;  4AL7 A;  3W3S A;  2DH7 A;  2GQQ A;  3W60 A;  1XMB A;  2GMJ A;  3CJ2 A;  4ED6 A;  1PYS B;  3GYX B;  3N6L A;  3A8I A;  5DDP C;  1R3N A;  4RW4 B;  1YDL A;  2J8S A;  3GFH A;  3SCI E;  4RU9 A;  2W2P P;  3DGV A;  2QFI A;  4BLG A;  4LFC J;  4JV1 A;  1B70 B;  4D3G A;  3MF5 A;  2J7W A;  1I3O B;  1WEZ A;  2JC1 A;  4MFB B;  3HUL A;  1DTQ A;  4JI6 J;  1EKR A;  4H4O A;  3MGJ A;  2NSB A;  3D0I E;  3DI6 A;  4OHW A;  4ELV A;  1N4L A;  4HKQ A;  1VQK S;  1FD2 A;  5DG9 A;  1T9X A;  2W24 A;  4O44 A;  2EXU A;  2B6A B;  3CDB A;  4NI2 A;  1QUP A;  3FUY A;  4CLY A;  4ZCM A;  3DLK A;  2H51 B;  2W4C A;  4ZMM A;  3EPG A;  2Y1R I;  5KT5 A;  4DOZ A;  2AYE A;  3MUM P;  5A0Y A;  4YDD B;  3NAH A;  1HBM A;  3M30 A;  1ZYQ A;  2WON A;  4C6A A;  1T05 A;  2DRB A;  1CBK A;  1FRI A;  2UXB F;  4FNH A;  2ASD A;  1E6V A;  4ILM A;  2UU9 J;  4CTA B;  5E3Q A;  5CCM A;  3GJR B;  1NK0 A;  4PG8 A;  5DJB A;  1RXO B;  1X0P A;  2E66 A;  2QC3 A;  3SCL E;  2M52 A;  4WJB A;  5GAD U;  2OPQ B;  4MIW A;  4O3Q A;  1KEK A;  2ATL A;  3EJM A;  1NUE A;  2OD6 A;  1OSC A;  5K8M A;  2V8G A;  4ZVO B;  2V63 A;  1X31 C;  1S1T A;  2CVE A;  3MR5 A;  4B02 A;  1RAA B;  4P2X A;  2G0I A;  2ZZN A;  1DQA A;  1R0C B;  2CNO B;  1UWB A;  5BR8 F;  4DV5 J;  2DNN A;  3HKW A;  1C0U B;  3LWM A;  3SYZ A;  3T1Y F;  2FVC A;  1KBR A;  1KSP A;  2HQF A;  3B82 A;  4WZM A;  4CZC A;  1SL1 A;  2BOP A;  4DSE A;  3THV A;  1R0B G;  4IDK A;  5U47 A;  3BPS P;  3H25 A;  3D1H A;  3PRV A;  3NG8 A;  2KU7 A;  2EI5 A;  4OQJ A;  1TZ0 A;  2WBR A;  2VPZ B;  3SEO A;  1SUQ B;  2BJ9 A;  3TUZ C;  3DMJ B;  1BQX A;  2GV1 A;  3DRP B;  3IA0 A;  3QBC A;  5IOL A;  3ZO7 A;  2L41 A;  2RF2 A;  4YR0 A;  1QDU B;  1KQF B;  3TX0 A;  4B3R F;  4F2R A;  2XQC A;  5B08 A;  1TL5 A;  3CUN A;  1RAG B;  1CC8 A;  2AGO A;  1NZA A;  1SI9 A;  2R7Q A;  2CZV C;  1HBO A;  2XYP B;  4X4U A;  1NKC A;  3OXF A;  4ELU A;  2RVJ A;  2QTW A;  3P96 A;  3TZZ A;  3IR7 B;  2GGP B;  3NCP A;  1JKH B;  1YBT A;  2PEB A;  4LMZ A;  1NDL A;  1QTN B;  3UO0 A;  4M5L A;  3VGU A;  3KK2 B;  3MHY A;  3V6H A;  1IXK A;  2KKH A;  4C8K A;  4AQY J;  3PXG a;  4ELT A;  4PAB A;  3TAR A;  4KRW A;  4R8U B;  1Y5I B;  2NS1 B;  3J7A 1;  5DDQ C;  3NBP B;  2XMV A;  1MU2 B;  4RW7 A;  4ECV A;  4C11 A;  2FQQ B;  3R5C A;  3RYL A;  5HQL A;  4OX9 F;  4FF2 A;  1P9Q C;  4TU8 A;  3NOG A;  1UZH A;  4WKR A;  3V5R A;  1H2V Z;  3LAK A;  3CDA A;  2R8J A;  4DPY A;  1TTH B;  2LXI A;  2VFR A;  2FHJ A;  4GMK A;  3RBX A;  4DWI A;  4ECS A;  3FBE A;  4DG1 B;  2CNK B;  4NA3 A;  2QGF B;  2JHE A;  3ZTS A;  4I4B A;  3RZA A;  5KFO A;  3TZX A;  1SH3 A;  2CQB A;  2CDQ A;  3DFE A;  1T03 B;  3DYA B;  2XY5 A;  3UR0 A;  1RHM B;  1UL3 A;  1DY3 A;  2HIQ A;  2DCL A;  1WHW A;  4NLT A;  2QLJ B;  4J9U E;  4PQU A;  2M8H A;  4YME A;  1RT5 A;  3W2W A;  4UY8 T;  4G1Q B;  4DFP A;  1ZAX A;  3TQ1 A;  5J1P A;  1SL2 A;  4B9V A;  4KHP J;  3E51 A;  4Y65 A;  1SH2 A;  2KL8 A;  1GNK A;  4LFB J;  1S59 A;  2GO9 A;  1T3N A;  4J7C A;  3M1V B;  1N54 B;  2AJ4 A;  1RWN B;  2KRR A;  1JLQ B;  4WFY A;  2RUS A;  4RUC A;  2YKN A;  2VBY A;  1YJN S;  2OKQ A;  2KDO A;  3ZNJ 1;  3DRS B;  3CO0 P;  4F4Z A;  3HHD A;  3GCW P;  4LFC F;  2NPI A;  4O0N A;  1WG5 A;  1XJW B;  3MPY A;  5HMW A;  1QSS A;  2D3O R;  3AB2 B;  4W92 B;  2FY1 A;  3P6Y C;  2V34 A;  1VS3 A;  2V8P A;  4LBI A;  1YZ6 A;  1RWP B;  5K8P A;  2HKE A;  2XZW A;  1QAJ A;  2IPO B;  3NNC A;  1AT1 B;  1CJT A;  4LT6 A;  4NA1 A;  3D0G E;  1WC5 A;  1YK9 A;  5B09 A;  1RBL A;  3RR8 A;  4B9M A;  4FYW B;  4I7F B;  3M2V B;  3W5Y A;  4OX6 A;  3TAP A;  3POT B;  1Q86 T;  4RW9 A;  5EWE A;  4Z7C A;  3M7V A;  2AW0 A;  4L73 A;  3M8W A;  4YEA A;  1FEE A;  1FD8 A;  4E98 A;  2EEY A;  3TOQ A;  1X4C A;  4DPO A;  5I3P A;  2EFQ A;  4K4T A;  1ZS6 A;  3OL8 A;  2GVD B;  3Q22 A;  1HNV A;  3ITH A;  1PC4 A;  3CED A;  1F9H A;  2UU9 F;  1RT4 A;  2AYB A;  1RDR A;  5HQ8 A;  4F04 B;  4DV3 J;  3TA2 A;  5AE3 A;  2CNL B;  4WK3 A;  5I3U B;  3J7Y I;  2K1R B;  5HP1 A;  1F9E B;  2CPH A;  2OLW A;  2B9Y A;  2DNM A;  2F63 A;  1UA1 A;  2MZJ A;  1J2V A;  4DUZ F;  1Q82 T;  3KWM A;  3M6U A;  4LVO P;  3OFF A;  5ETN A;  3GWC A;  2B7B B;  1RT6 A;  1U0H A;  2F9J A;  1H74 A;  3D7S B;  1NPK A;  3OW2 R;  1S6Q A;  4K5S A;  3DRY A;  4NA2 A;  4QIF A;  2LQ8 A;  4RLE A;  4PG4 A;  4Q7A A;  3BQ1 A;  5J2M B;  3MM6 B;  2VQE F;  4IQX A;  3RRK A;  3I32 A;  1HHT P;  4JV5 J;  3HI9 A;  5IC6 B;  4IH7 A;  1RYR A;  3MM7 A;  2ZH8 A;  1ZTW A;  4LF5 F;  4DF8 A;  4WE1 A;  2QL9 B;  4GC6 A;  3W8G A;  5DS7 A;  5CAA A;  1SIZ A;  2B0G A;  5LOQ A;  3MPV A;  4C0B A;  1BUX A;  3CWJ A;  3H8Y A;  5C42 B;  4OI1 A;  4X84 A;  3PX0 A;  5FD1 A;  4CYU A;  3CME S;  4DQP A;  2KHC A;  1RWX B;  4LF1 A;  2RIJ A;  4H4M B;  4LF8 F;  4ZA1 A;  1ICE B;  2ROG A;  1T9Y A;  2B7C B;  3D67 A;  3PVX A;  1UMJ A;  2IAJ A;  2KO1 A;  1Q78 A;  1VQY A;  1RTI B;  4IYQ A;  1L3K A;  1D8Y A;  1D9F A;  4F25 A;  1LXN A;  1EQ0 A;  1LW0 A;  3V4I A;  2ZH9 A;  4I2P B;  2DY9 A;  4EZ6 A;  3UD5 A;  2V0N A;  4LRF A;  3GR1 A;  2HRU A;  2OEK A;  2PT0 A;  3FCH A;  3E01 A;  5KAK A;  4DV2 J;  4RX6 A;  2RD5 C;  2N7Y A;  3AJ2 A;  3KK3 B;  2FJX A;  2DR9 A;  2E9T A;  2IVF B;  3EYZ A;  2LQJ A;  1U25 A;  1NSP A;  2ZOF A;  2BV3 A;  2AU0 A;  5F0W A;  3RB4 A;  4LJM A;  2OJ3 A;  3ENV A;  2DH9 A;  2EFG A;  1JNZ B;  3FFI B;  4UW2 A;  3JSM A;  1VJQ A;  2UVW A;  1JLE B;  2FY8 A;  4JI8 J;  3HHL D;  9RUB A;  4OI2 A;  1RWK B;  4RR5 A;  3MCN A;  2XI2 A;  1E6Y B;  2PSZ A;  3Q8Y A;  2HHQ A;  1QJH A;  2CQ0 A;  3PJW A;  4CLZ A;  1X0F A;  3GP9 A;  1HPZ A;  1B0T A;  1WG1 A;  2G2Z A;  3CCJ S;  2CPI A;  5D0R A;  2BAN A;  3W5Z A;  2CYY A;  1H2T Z;  1WKK A;  3UD4 P;  1REV A;  3T5L A;  5M2P A;  1O8B A;  1KP6 A;  3BDP A;  2N4D A;  1U4B A;  2RHS B;  2OHD A;  1RB0 A;  1MWZ A;  3DLH A;  2EPI A;  2W9B A;  3DLG A;  3MR6 A;  4UQG A;  5CYM A;  4AL5 A;  1D1U A;  2HHW A;  1AUS L;  1M90 T;  1YIJ S;  2D3Z A;  3QMQ A;  1DRZ A;  4GO5 X;  2AYM A;  2HNZ A;  3GIJ A;  1JLA A;  4IG3 A;  4Q2M A;  1HYS A;  2L08 A;  5AXM A;  3MWB A;  2MQL A;  3MOZ A;  1N5V A;  1K44 A;  1P8G A;  2CRL A;  1FDB A;  2OSR A;  4C8N A;  1RAB B;  2XMA A;  1U1R A;  3CE8 A;  2R2T A;  2R42 A;  1B3T A;  5C24 B;  3H5S A;  5M2U A;  4P7V A;  2GW8 A;  3A8K A;  2ALZ A;  3CT9 A;  1RCO B;  2BAC A;  1RTJ A;  2QG9 B;  1JIH A;  4ICL A;  1BLU A;  4FVM A;  4XAK A;  4A8F A;  3PX4 A;  2QMX A;  2V4R A;  1IM6 A;  1NJI T;  1TL3 B;  1C0T A;  1FJE B;  2KG0 A;  3O44 A;  3F73 A;  1TKZ A;  4KHM A;  1T7P A;  5F9N A;  3LGN A;  3I9Z A;  1DTT B;  4OZJ A;  3TEH B;  1NB2 A;  4X66 J;  3G6X A;  4JI5 F;  1RHR B;  3GFY A;  1HFE L;  1N52 B;  2NR0 A;  4C97 A;  4J37 A;  1T0T V;  1UW9 A;  5HVF A;  3LGM A;  3TUI C;  4JI3 J;  4HHU A;  2DPI A;  2VAS A;  2BJ7 A;  3D6M B;  5HLF B;  1UVK A;  1KVI A;  2EFP A;  1U2R A;  1S0N A;  4A8K A;  4LIW A;  2YWG A;  2GVZ A;  3QGI A;  1RKI A;  3BQ0 A;  5F8L A;  2XZD B;  2ZZT A;  4ECR A;  4KJI A;  4J5O A;  1WSV A;  1EET A;  3EGZ A;  1VRU B;  4RUB A;  4DR7 F;  4YHH J;  1QVF R;  1TVR A;  3QO9 B;  2JL9 A;  4CNY A;  4Q43 A;  3G86 A;  3MPW A;  2OML A;  2V6A A;  3PX6 A;  2HWH A;  1VIS A;  2HND A;  4OYW A;  2XGQ A;  1RAD B;  3DLE A;  4WU2 A;  2GNK A;  4ZVS B;  5LMN F;  2PD1 A;  2GJ2 A;  2MZR A;  4YR2 A;  5A8K B;  4ZVF A;  1VBZ A;  3BKT A;  4NX9 A;  3CVK A;  2RS2 A;  3JYT A;  4OHY A;  1V5V A;  4AYB D;  1SKR A;  2E7V A;  3M4X A;  3KLE B;  3NWG A;  3KUH A;  3GJT B;  4U8Y A;  2LQ5 A;  1YGY A;  4OI3 A;  3PNI A;  4MYU A;  2HW3 A;  3T6B A;  1WHY A;  1SCJ B;  1S9G B;  1SXL A;  1VBX A;  3HFV A;  1NK8 A;  2RDI A;  5DGA A;  4FYX B;  5HI7 A;  2D1C A;  4QBU A;  1FK9 B;  2VON A;  3VGT A;  2LMI A;  3Q8V A;  2W2O P;  3D6T B;  4DL3 A;  5KFW A;  5HSP A;  4J9K A;  5LJ3 Y;  1DBD A;  2UP1 A;  2PFF B;  4RW8 A;  2CWX A;  3DLJ A;  1LK7 A;  4P52 A;  1KN6 A;  2R3V A;  2FHM A;  1M5K C;  3IRX B;  3BGF A;  4B17 A;  5KFG A;  2C28 A;  4F3Q A;  3EM1 A;  4LR8 A;  4JI1 F;  1C1C B;  2HSE B;  1UPM B;  4GVL A;  3QGH A;  2IC3 A;  3W7B A;  4RBT A;  3CIZ A;  1X9S A;  3R5B A;  3T1H F;  1WEL A;  2HFN A;  4PPD A;  4N56 A;  2B4U A;  1HQU B;  1SVD A;  4ZVU B;  1ZH5 A;  2FGC A;  4Y3C A;  1F3F A;  2RUG A;  5IFM A;  3RRG A;  4DL6 A;  1MLA A;  1BMQ B;  2AEF A;  4Y0F A;  1WC6 A;  3PO5 A;  2ZEJ A;  1RU1 A;  3O5T B;  4DV1 F;  4GVB A;  2JEJ A;  1KDN A;  1JLC B;  4ZN1 A;  3S8S A;  1FKO A;  2ZH4 A;  2WTF A;  1WHV A;  5J2Q A;  3MMA A;  1X5O A;  4M5J A;  2QLX A;  2HHP A;  2YPZ A;  2LEP A;  2GX8 A;  2Z58 B;  1N36 J;  3D28 A;  4ILL A;  4WFN Q;  2FD2 A;  1HNI A;  4YP3 A;  3TAM B;  1APS A;  4WIQ A;  4KV8 A;  3KTQ A;  1FXD A;  4K4W A;  4IOC Q;  3U1L A;  4DR3 J;  1VK8 A;  2YQ0 A;  4FF3 A;  4KPC A;  2CAJ A;  4N8N A;  1ZA1 B;  4NXM F;  2G0J A;  2AMC B;  3TA1 A;  2GIQ A;  1MWQ A;  1IKY A;  3RU0 A;  3BGR A;  2HAF A;  1R7I A;  2AHO B;  5ITH A;  5FLX U;  4X4Q A;  1XNQ J;  2LEA A;  1HMV B;  3V6J A;  2GMH A;  2KI2 A;  1NM2 A;  4XPC A;  3IS9 A;  3C15 B;  2AGQ A;  4DPW A;  2H9Z A;  1CS4 A;  4R5P B;  2BQ3 A;  4OHX A;  1S9F A;  4ECY A;  2QFJ A;  1FHT A;  3NCQ A;  1VK3 A;  4H54 A;  1SH0 A;  2O5D A;  2FVS A;  3VAG A;  4X62 J;  1HA1 A;  2IM2 A;  1U26 A;  2W01 A;  2WOM B;  1WWH A;  2V2Z A;  1K9M T;  2J9D E;  2X3G A;  2FJE B;  4LSN B;  4WPA A;  4F4W A;  1VQS A;  2VFV A;  1AZS A;  3MOJ B;  2HQD A;  3DRX A;  3M8P A;  3M9O B;  2MEW A;  3SFG A;  2KXN B;  3QAU A;  2ZD1 A;  2XMW A;  3MMB A;  2WSE C;  3RAQ A;  1R8P A;  1HL6 A;  3RB0 A;  1C1B B;  3KLI A;  5KFN A;  2V4J A;  3GSI A;  4CLL A;  2BKN A;  3LP2 A;  1KVK A;  2VV5 A;  3NKY A;  2VUG A;  2KFN A;  1WDD A;  4YN3 B;  3DOL A;  2FHJ D;  3O1L A;  3PHT A;  3MCO A;  2XS2 A;  4K2J A;  4WBF A;  2FLL A;  1HD0 A;  2UXC F;  1LWC A;  2DHA A;  4OI0 A;  2FC9 A;  2PC6 A;  6FD1 A;  3BF4 A;  1RTH A;  4WP3 A;  1PSD A;  2P9E A;  3DOK A;  2XUL A;  3THP A;  2KVI A;  2IVM A;  2FJD B;  3FMB A;  2Z30 B;  4O23 A;  5E3R A;  3KMS A;  2XCP A;  3GG0 A;  4AT1 B;  4PXB A;  3OFE A;  4IQM A;  2JDJ A;  1RAJ A;  4AE5 A;  2LYV A;  1HW9 A;  1RTD B;  4MFB A;  4X4O A;  5I42 B;  1VDH A;  7FDR A;  1HR0 J;  3G9C A;  3EMT A;  3VAI A;  1K1S A;  5FLX Y;  2YNI A;  5CCL A;  3J7Z T;  1N88 A;  2XO7 A;  2V8H A;  3UE2 A;  4IFY B;  2Z2Z A;  2DR7 A;  1SQF A;  1YLX A;  2N82 B;  5G0R A;  2JLF A;  4DR4 J;  4QIG A;  2R7V A;  3ZXW A;  4G1P A;  2VDH A;  2YH0 A;  5GMD A;  3RJM B;  2R8K A;  2OIH A;  1AA1 B;  1S1W A;  4X65 F;  1XIQ A;  4C8Y A;  2ZH6 A;  4L75 A;  4UOC A;  3M9M B;  4XO0 A;  2R7W A;  1Q16 B;  4PRF A;  2FPH X;  3ILJ A;  4LR9 A;  1DFD A;  3P45 B;  3NGK A;  4DR2 J;  2ATC B;  2QL7 B;  3OSP A;  2DXE A;  5KFR A;  4B3O B;  3IWN C;  2C42 A;  3EXY A;  4I0W A;  4F4X A;  4DV6 J;  3OUY A;  2OPQ A;  1HHQ A;  2MKI A;  3MM9 A;  3VQS A;  5D0H A;  2LLZ A;  2E1M C;  3HVW A;  5DLF A;  3WX8 A;  2CZ4 A;  2P2C B;  2ZZM A;  2J9D A;  3SV3 A;  1TKX A;  2YX7 A;  3H2U B;  1LWF B;  1FXR A;  5L9X A;  4URQ U;  2W8L A;  1EKS A;  3MM5 B;  4QR1 A;  1UEV A;  3A1Y G;  2J7U A;  2VKZ G;  5IV3 A;  3J80 Y;  2MQN A;  4NLV A;  4RU2 A;  2RIL A;  5B0C A;  2KT5 A;  3L95 X;  4K4X A;  1PAU B;  1FX2 A;  4QZV B;  1CVJ A;  4PEO A;  3CJS A;  1VLO A;  4GC7 A;  3DRP A;  1FF2 A;  2CZ9 A;  4MJK A;  3OLA A;  5ETM A;  1NDC A;  4MKV A;  3PYE A;  3W2V B;  4MT1 A;  3FRY A;  1PJ5 A;  1EJ7 L;  5H9F K;  3KLF A;  1N6Q B;  2K06 A;  3CCQ S;  4P10 A;  2YWH A;  3MZI A;  3OTO J;  4MKY A;  2MTL A;  1UFL A;  2EC0 A;  3OD2 A;  1FKP B;  5KG3 A;  2C2K B;  1T9W A;  3LPY A;  5GMK a;  1WF1 A;  1NEE A;  1HAR A;  3VAJ A;  2XNR A;  5IQQ A;  2OEL A;  5LL6 d;  2DHG A;  4DR3 F;  5KFC A;  1Q5V A;  3QIP A;  1FJ7 A;  2VOP A;  1IR0 A;  2C1E B;  2HPU A;  3A8J A;  1L3V A;  4JI2 J;  4P6Q A;  1X4D A;  2VF3 A;  3B8H A;  4UUX A;  1ACM B;  3C19 A;  3F41 A;  2FUG 9;  4JYA F;  4DFJ A;  2D7S A;  1SC6 A;  4R8U A;  1HIY A;  1QSL A;  4IUF A;  2EBE A;  2GQ2 A;  3CCT A;  3SFU A;  1UTA A;  4A48 A;  1MU2 A;  1CUL B;  2Q43 A;  5KG7 A;  3V2U C;  4RBU A;  3QGP A;  4V1A k;  2EW9 A;  4CIO A;  5BJR A;  3BKF A;  1N34 J;  1VIX A;  1RJJ A;  4X62 F;  4ECX A;  9ATC B;  2ZBP A;  1JJH A;  4MH8 A;  5IXU A;  4QYZ K;  2RH3 A;  2GQC A;  1Q7L B;  1LV5 A;  3ETO A;  2ZM6 J;  3QLH A;  1K0T A;  1YQH A;  4ZP7 A;  5KG2 A;  3TVK A;  4UF4 A;  3QT7 A;  1TAU A;  3QRR A;  4IRC A;  3DXS X;  3MED A;  1XMQ F;  2W2M P;  5L38 A;  2Q6B A;  1T03 A;  2AJQ A;  2O01 C;  2FVR A;  4OYP A;  1R89 A;  1C2P A;  3A12 A;  2XHC A;  4G1Q A;  3CMQ A;  5KTQ A;  7AT1 B;  1IR1 A;  3L09 A;  1KHW A;  4ID5 B;  4KY3 A;  3AJD A;  4ZLP A;  2GHP A;  4Q8E A;  2OD4 A;  1N5Y A;  1WOO A;  3G8S A;  4QWB A;  3M1V A;  3IGN A;  4JI0 F;  3PAC A;  4NLX A;  1H38 A;  2HNY A;  2KJV A;  3KUE A;  2ZHB A;  4DV0 J;  3UNG C;  4I69 A;  1VMB A;  3QJP A;  4NEY A;  4ECQ A;  2C2D A;  4NE9 C;  3I55 S;  5EHH A;  2J6U A;  4CI0 B;  2GS8 A;  2IYI A;  3FSY A;  2KN4 A;  3V6D B;  2N3L A;  3E8O A;  4CP5 A;  3KMQ A;  1R8B A;  4LF9 J;  2P6T A;  1XNR F;  1IKW B;  1Z4U A;  3IBC B;  2HLT A;  4ZHR A;  2R8G A;  2C2E A;  4DFM A;  3ONQ A;  5CXT A;  2VPW B;  2PA3 A;  3D1Q A;  2VQF F;  1LKZ A;  5HN0 A;  3HF5 A;  1AUD A;  3DM2 B;  3DGP A;  2X1G A;  2E7X A;  1OQ6 A;  2HQ3 A;  4K8R A;  1K73 T;  4RNO A;  3OVB A;  4PG6 A;  1QAX A;  4ZPC A;  5ETP A;  2B5J A;  1X4B A;  3TRG A;  3R97 A;  3IC1 A;  4B9T A;  1JXV A;  1B0P A;  3FEY B;  2HMI A;  3WQP A;  2EFO A;  1Q1K A;  1WSR A;  3SSS A;  3CJ5 A;  4KFB B;  1NKE A;  3OPK A;  3H7H B;  2XNQ A;  1X4F A;  3LP1 A;  2EK1 A;  2NZ4 A;  1FA0 A;  1FVS A;  1WOP A;  1KOO A;  2OFH X;  2HFO A;  5JVH Q;  5ETO A;  3F44 A;  5MAO A;  1W7W A;  1IBM F;  1HQ2 A;  5I3U A;  2K1R A;  2R2R A;  1WC4 A;  4M5M A;  2HWI A;  3OT9 A;  1RWM B;  4V19 X;  4F3O A;  5E2Q A;  6AT1 B;  2W4D A;  1N0U A;  5HAN A;  3NXZ A;  4N47 A;  4Y2A A;  4IRD A;  5A8W B;  4ECT A;  3GPA A;  4O3S A;  4Q2L A;  2DNR A;  2EKY A;  3NS5 A;  4C9D A;  4QPT A;  2KT2 A;  2BJD A;  3JQK A;  2Z57 B;  3MM6 A;  3JAM U;  1RT3 B;  4TQR A;  3P5T L;  3H5Y A;  4YY3 F;  1LEO A;  1LWE B;  3V81 B;  1UEU A;  4LF7 F;  3GSD A;  1PBA A;  1IBL F;  2IJF A;  8ATC B;  2ILY A;  2A0F B;  1HBU B;  1S1X B;  3UPF A;  3U7J A;  3KHG A;  1PKU A;  2UVU A;  4R25 A;  5IT0 A;  2J0Q D;  2GO8 A;  5KT2 A;  1I5O B;  3VAM A;  3FK4 A;  4DV4 F;  2I1R A;  3IG1 B;  2IRY A;  3DXB A;  3UVJ A;  2OGU A;  2ZDO A;  2O67 A;  3CPW R;  5DDR C;  3K5P A;  4OYB A;  3EUN A;  5CZX A;  1EX8 A;  3HKZ D;  3JSY A;  2RB7 A;  1J5O B;  1VQ5 S;  4M8L A;  3AOB A;  3W8P A;  4USW A;  2XTJ P;  4DQS A;  3ZTR A;  1L3S A;  1I51 B;  2FLO A;  4ZPT R;  3ISN C;  4OJ3 A;  3SXL A;  2VJU A;  3I56 S;  5IWA J;  3QZ7 A;  1TMM A;  3ULH A;  1YX2 A;  2WVC A;  2X7I A;  3KK3 A;  4Z37 A;  1VQO S;  4X4P A;  4DI6 A;  4ETX A;  2AV5 A;  3PG9 A;  5DQG A;  4P7T A;  1BGX T;  1O6X A;  2JWN A;  3O2I A;  4ZS6 A;  4DL0 C;  5K5M A;  4CRJ A;  3FFI A;  4JI7 F;  1JLE A;  1UVJ A;  1LOU A;  2IA6 A;  1A7G E;  5D78 A;  5I3Q A;  3JQM A;  1R0A B;  3KHR A;  2A1B A;  3C16 B;  4N8O A;  2LXU A;  1E6Y A;  1PGZ A;  3PYG A;  1S1U B;  3SQG B;  4CQ1 A;  2YX4 A;  3KJV B;  1SQE A;  1WJ9 A;  1JLF B;  5DQH A;  3TO8 A;  1I6J A;  3EGV A;  1VRT B;  2BXJ A;  3KJF B;  2PMH A;  4DCJ B;  2V9W A;  2J8A A;  2KYX A;  3MEC A;  3D1O A;  1ELO A;  1WDT A;  3R6L B;  4ES1 A;  5K14 A;  1Z2Z A;  1DLO A;  4ZVR B;  2EFV A;  2DGQ A;  2CQ3 A;  3W61 A;  4CT8 A;  2A2C A;  2F65 A;  2AX0 A;  3D0H E;  4GKK J;  3OXG A;  3DRR B;  4WFZ A;  3KK1 B;  1IVZ A;  4KC5 A;  1QAY A;  1UZD A;  4K0K F;  2OP5 A;  4DV0 F;  1YJ7 A;  2PI5 A;  2H5I B;  3G6Y A;  4DV7 J;  4GKJ F;  3BRE A;  3RW6 A;  2UXD J;  3WIU A;  2X51 A;  3J81 U;  4CH7 A;  3RG6 A;  4B3M J;  3LF0 A;  1X9M A;  1TQL A;  2ZE2 B;  5EDW A;  1V3S A;  1GMW A;  4C0O C;  4WWS A;  3I0R B;  3U1M A;  4B9L A;  5C24 A;  1UPP A;  3IP0 A;  1U48 A;  4EFA C;  2A6O A;  2QN6 B;  2NQP A;  3BBC A;  4QU7 A;  5HBM B;  2M4M A;  3I4P A;  1TL3 A;  2OTJ S;  3TWZ A;  3TVY A;  1MNE A;  4OZ3 A;  4CLK A;  3HHL B;  3PM9 A;  1CJV A;  1SJ1 A;  1M5H A;  2CPJ A;  1PCA A;  3MMC B;  5J2N A;  2Y1I A;  3IBF B;  1RU2 A;  3QSY B;  3VVT A;  3H42 A;  1YRT A;  5B0D A;  3NWR A;  2JZ5 A;  2L48 A;  1XMO J;  4ZN3 A;  1PBU A;  3OR1 A;  2MLY A;  2JFK A;  1YJ9 S;  1OIA A;  4O3P A;  2K3K A;  1S12 A;  4L72 B;  3M32 B;  5C5J A;  4JUZ A;  2XM3 A;  3IM8 A;  4B3S J;  1VQP S;  4NCG A;  2CPF A;  2DRD A;  2HFU A;  1Y5L B;  5CH7 B;  2R7R A;  3N0V A;  3QAT A;  2WCX A;  4WTY A;  3UD3 P;  4KGM A;  2HGL A;  5KFX A;  4HTI A;  4WZQ A;  2V8D A;  1LWX A;  2M3D A;  4P2M A;  4NCB A;  3WC2 A;  2CQI A;  1VQ7 S;  5D4P A;  1QM9 A;  4C3M A;  3RAX A;  4QIV A;  5B7W A;  2K7J A;  3GU0 A;  4RZR A;  2FDN A;  2D9P A;  1H2U X;  2MGZ B;  5A8K A;  5LSO A;  5A8R A;  5EX3 A;  2ABY A;  1GK8 A;  2YPY A;  2MQ8 A;  3J81 Y;  3SCK E;  3SSQ A;  3KLE A;  4KQZ A;  4LBP A;  2JC0 A;  1BQN B;  4LR7 A;  4DLE A;  2VG7 A;  1CQN A;  4EYI B;  2GAH C;  4USH A;  1U8S A;  3PYD A;  3PW2 A;  1H7W A;  1CJK B;  3FMW A;  4C0H A;  3BH6 B;  1SIW B;  2QZ8 A;  4LIR A;  4DSF A;  4EEY A;  3GB0 A;  2B43 A;  3GG1 A;  4BHQ A;  1OWX A;  3Q89 A;  1S1V A;  4RNH A;  3PIP Q;  5E5N A;  1WNE A;  1VC5 A;  4ZP9 A;  5IT9 U;  2IYG A;  2VBW A;  4PWW A;  3FBF A;  3KOA A;  4M1K A;  1Q8L A;  4NYP A;  4F4A A;  1CEZ A;  1WC1 A;  1FRH A;  2KXF A;  2LQB A;  3BO2 A;  2AF6 A;  4TU9 A;  1WOS A;  1U02 A;  5L46 A;  1NKB A;  3L4B C;  3FZ2 A;  3S1T A;  4IH5 A;  3HHN B;  2HK2 A;  4JBC A;  1S99 A;  3TEG A;  4DR5 J;  4OJG A;  3DOM A;  4NCA A;  3TUJ C;  3R7S B;  4LSL A;  4ZK7 M;  2DGV A;  5LMU J;  3T5J A;  4KH0 B;  1JK9 B;  4N5S A;  1SKU B;  1GT8 A;  1Y11 A;  3PW7 A;  4NXN F;  2XWY A;  4DPX A;  1FVQ A;  4NMX A;  4ETZ A;  2RDJ A;  1Q53 A;  2WSC C;  2MKY A;  3R2C J;  2Y3Y A;  5J1N A;  1ZA2 B;  3K5N A;  3K0J A;  2FZK B;  1TKT A;  3GE9 A;  2DD8 S;  3E2E A;  3Q2S C;  3C6U B;  2R7U A;  1DTQ B;  1RLC L;  2HEK A;  4CM2 A;  3SCJ E;  4ED2 A;  4AL6 A;  3DI6 B;  1MW7 A;  2ZH7 A;  4F50 A;  1PG5 B;  3AAW B;  4QQB A;  2M88 A;  3NCR A;  2XEX A;  4O44 B;  1OY8 A;  2H5J B;  4I6A A;  2BKO A;  2UUB F;  2WBM A;  3DLK B;  3LP0 A;  1AYE A;  3R7B B;  1X4E A;  2WRM A;  5IV4 A;  1M0S A;  2VIH A;  1HQE A;  3DDN A;  5A0Y B;  1NK6 A;  4DDF A;  4TVA B;  1HBM B;  3M30 B;  2WON B;  3T1A A;  2EC2 A;  2BW7 A;  1T05 B;  2PE8 A;  4TLR A;  1U6B A;  3EIC A;  1C4C A;  1ZM9 A;  1E6V B;  4J90 A;  5IT9 Y;  4RJV A;  3VAF A;  2XYG B;  1S0V A;  5D77 A;  1KC8 T;  3HK2 A;  2LVW A;  4EUV A;  5AXK A;  4I67 A;  2AYG A;  1K0V A;  4KBI A;  4IOB A;  4LSN A;  5B0B A;  4F0H A;  1UJ5 A;  1HKA A;  4RW6 A;  4FS2 A;  2I6W A;  2AZ3 A;  3R27 A;  3UW1 A;  1T02 A;  4P71 A;  3G8T A;  1NZ8 A;  1WF2 A;  2BKP A;  1S1T B;  3UWT A;  1UVL A;  1SV5 A;  3QFH A;  1C1B A;  4OYX A;  3MPD A;  3K5L A;  3MR3 A;  1DQ8 A;  4OX7 A;  3VR1 A;  4ZJQ A;  1YKW A;  3Q8R B;  2GCF A;  1R8C A;  2FYX A;  2DGX A;  2DO0 A;  3SIP B;  1JWW A;  3VQT A;  3UN2 A;  3H40 A;  1S4E A;  2Z56 B;  1Q7Y T;  3I0S B;  3BSN A;  3SDE A;  3BSO A;  2V8V A;  4CM0 A;  4E8U A;  4WF9 Q;  4DR1 F;  3QJJ A;  1U1N A;  1FTC A;  2LEB A;  1G3O A;  2ZC4 A;  4KB7 A;  1HNZ F;  4WP8 A;  4NLW A;  5T7L B;  1HNX J;  2FIU A;  2RF2 B;  1WHX A;  4ZOS A;  4OZN A;  3HVT B;  5B0G A;  3HFK A;  4KKO A;  2SXL A;  1FJG J;  2CJA A;  1RTD A;  3SV4 A;  3DNC A;  1N8R T;  3ET6 A;  2W1B A;  2N7C A;  1GXU A;  1HBO B;  1CSJ A;  2BDP A;  4HAC A;  2Q6C A;  1VJW A;  1RI7 A;  1VGY A;  1JNR B;  1Q79 A;  3NRB A;  2H4Y B;  3UQS A;  4ZPV R;  1S10 A;  1ZZF A;  2OPS A;  2AJF E;  3R8Y A;  2G9O A;  2LU2 A;  2ZOG A;  1KLM A;  3TJA A;  5DQI A;  1BD6 A;  4MK9 A;  2E7W A;  4OV6 A;  3IAM 9;  2MJN A;  4KIA A;  2DNH A;  2FZC B;  1OY6 A;  1TP7 A;  2Y1L B;  5CYQ A;  1YHQ S;  1RKJ A;  3J7A N;  3MUV P;  4PWD A;  4RW7 B;  1NJW A;  4Z7Y A;  2NZC A;  2YNG A;  4ZPW R;  3NMR A;  4LQ9 A;  4ZVG A;  4DEZ A;  4M5H A;  2F4V F;  2J6T A;  1KQK A;  4EU0 A;  1EQM A;  2YQ3 A;  1WC0 A;  2IBK A;  5HAO A;  1X4G A;  2JLE A;  2VJV A;  2ACY A;  1HLW A;  3B78 A;  3CJK A;  3WDO A;  4RNN A;  2D9O A;  3N79 A;  1FXL A;  2RHQ B;  2AX1 A;  3TQE A;  2ZKU A;  2DK2 A;  1RAH B;  1GX6 A;  2UUC F;  1ZAV A;  4UQT A;  4PQU B;  1R43 A;  3ADA C;  4O3O A;  1RT5 B;  3W2W B;  4DL4 A;  1B7F A;  2RDD A;  2WB1 D;  1FE4 A;  2R8H A;  2M5Y A;  3NNH A;  3CC4 S;  2HBR B;  4CLU A;  3ILL A;  4I56 A;  2J9C A;  3C2P A;  2QA1 A;  1QD1 A;  2GAG C;  3DLB A;  4F02 A;  1MMD A;  2UUA J;  3QT6 A;  3OTB A;  2ZH5 A;  5LMU F;  3I87 A;  2ADC A;  1S7H A;  4C4W A;  4GRS A;  5RUB A;  1YZ7 A;  3EE3 A;  3EWG A;  4CLF A;  3G82 A;  2Y0S D;  2BE2 A;  2PI4 A;  3W2V A;  4ED5 A;  2XS7 A;  1FRX A;  3GV5 B;  5ADZ A;  1V5I B;  3F56 A;  4F7V A;  3UNY A;  1S7I A;  4ZLN A;  1VOM A;  4U7U K;  2YKO A;  2D74 B;  2N4C A;  3QYY A;  3HHK A;  1WAC A;  5C25 A;  4IG0 A;  1FKP A;  1HBN A;  3NY0 A;  3BJY A;  2DR5 A;  1RWV B;  2I9S A;  2M0G B;  1KWM A;  2XMU A;  1CJT B;  2MY7 A;  3PHE A;  1S0M A;  4B3T J;  3OJS A;  3G96 A;  3KLG A;  2V2K A;  2FJW A;  1FI4 A;  1XK8 A;  4LF4 F;  2F8H A;  1FO1 A;  2MJU A;  4RW9 B;  5LSR A;  2A2D A;  2MKS A;  2V68 A;  3LAN A;  3HSJ A;  3A8E A;  1HWU A;  3GIL A;  2Z4P A;  1HNV B;  1N48 A;  1RYS A;  3CCZ A;  3ENQ A;  3H90 A;  3ITH B;  1PAE X;  3T6J A;  2NXJ A;  4ZCI A;  2G4B A;  1RT4 B;  4F0M A;  4DUY F;  3KUG A;  4CLT A;  3A3P B;  4HDG A;  4UZC A;  2OH2 A;  3GJQ B;  1KQS R;  3EX7 B;  1TUG B;  2IJN A;  2XZT B;  2FJB B;  4J9V A;  2QEX S;  2QSF A;  2ZBI A;  3KLH A;  4BWJ A;  5K8O A;  2DBB A;  2BJE A;  3EDQ B;  5DM6 Q;  1I94 F;  1S5Z A;  4C8O A;  4TN2 A;  2DIV A;  1RGV A;  1P9Y A;  2DXF A;  2G2O A;  3TNV A;  2J0S D;  4NLG A;  1RT6 B;  1U1O A;  1U0H B;  1RZM A;  2HZV A;  4KE5 A;  1U45 A;  2IJR A;  1S6Q B;  2FJV A;  2KM8 C;  4Z2X A;  1VQ6 S;  1EZZ B;  4M5D A;  1EP4 B;  3OL6 A;  1NAQ A;  4ID5 A;  1N33 F;  4DR6 F;  3Q23 A;  2HBQ B;  4LFA F;  4K7Q A;  3TA0 A;  2BZ2 A;  2HGM A;  4J9O A;  3OR2 A;  1S72 S;  3VZH A;  1F2G A;  2B4O A;  4WE1 B;  4HH1 A;  4DSL A;  1N32 F;  4LRA A;  3W65 A;  2EK6 A;  2YNH A;  1TR0 A;  3CO9 A;  2AJ2 A;  1HNX F;  3PV8 A;  2L9W A;  4TNO A;  3JSB A;  2E5L F;  2OTL S;  4JV0 A;  3LTO A;  1SPB P;  3MTK A;  1URR A;  4CYU B;  5EWF A;  1KVJ A;  2QIF A;  3T9N A;  1UP1 A;  1NPR A;  1IKW A;  1DHM A;  2BOA A;  2YQ1 A;  4KHR A;  1RE1 B;  5LXR A;  1D8Z A;  1JJ4 A;  2MXY A;  3T5K A;  2IAJ B;  4EBC A;  1DAR A;  4FYV B;  4DJB A;  3DM2 A;  5HO4 A;  4ENO A;  1LW0 B;  2GJI A;  1MG7 A;  4BDP A;  4LF6 J;  4AUK A;  2CQG A;  1GAO A;  3GLJ A;  1WF0 A;  5L1L A;  1ZM2 A;  2HZA A;  4Y2C A;  2BJ1 A;  1GMW D;  2GZO A;  4LRE A;  2MLZ A;  3TAQ A;  2IA0 A;  4JI6 F;  1TL1 A;  4PXE A;  1RWW B;  3P5B P;  2O66 A;  1BC6 A;  4NLO A;  3RGI A;  4KFB A;  2XI3 A;  4WYW A;  1YJT A;  4MIB A;  1IJE B;  2IHR 1;  1FDN A;  3JSM B;  3U02 A;  4JV2 A;  5HAT A;  5L39 A;  2A3J A;  3BYR A;  4L3K A;  1ZM4 A;  2R7S A;  4NRT A;  1H72 C;  2ZBR A;  2Q3P A;  4ES3 A;  3OTE A;  2LFV A;  4EYH B;  2RSQ A;  3PFE A;  1T9V A;  2PGC A;  1HPZ B;  2R7O A;  1K1Q A;  2AJ0 A;  3WHI A;  3JQJ A;  4MAK A;  1M5S A;  5A8W A;  4F26 A;  1FX4 A;  3K58 A;  4DUT A;  2Q66 A;  4MK7 A;  1REV B;  1U6F A;  5ETQ A;  3MM8 B;  4KYZ A;  1WEX A;  3R7N B;  3SZ2 A;  2OEJ A;  4ZPD A;  1FJC A;  4ED7 A;  4WXO A;  4I2Q B;  1DJ0 A;  1LWE A;  1VFJ A;  5HRO B;  3DCA A;  3DLG B;  3AFG A;  3X3U A;  3D9B A;  2K3I A;  5IM0 A;  1HBU A;  2PO4 A;  1S1X A;  5KG1 A;  1AB8 A;  2B51 A;  2HNZ B;  2E5I A;  4IG3 B;  3K7R A;  1KRP A;  5F8J A;  1JX4 A;  1IBK J;  3VGV A;  2XO6 A;  2MZS A;  1HYS B;  1N5Q A;  3U1N A;  1RA7 A;  4UOG A;  5H9E J;  5AE1 A;  5L1I A;  1SJ3 P;  1Y3J A;  2IRU A;  4DV5 F;  2FVP A;  2Q1L A;  1TK0 A;  2E44 A;  4J9P A;  1OMS A;  2IY5 B;  1VQ9 S;  2CJK A;  1UAW A;  5IS2 A;  3MFI A;  2CIM A;  4Q0B A;  3O3L A;  2VG5 B;  3CCV S;  4FS1 A;  3C3L A;  1CJU A;  4A8S A;  1HWJ A;  4U9R A;  4JI4 J;  2R2S A;  4ICL B;  3D2W A;  1V3Z A;  5GAG I;  4OX8 A;  3TVZ A;  4DCO B;  3ZTO A;  2E1A A;  1W2I A;  2QJ3 A;  4KT0 C;  2WW8 A;  1OY9 A;  2BRK A;  1TKZ B;  1P6T A;  4DL7 A;  2NSC A;  1Y10 A;  1N5S A;  4BBY A;  3O6Q A;  1CPZ A;  3CJ4 A;  2UV8 A;  4O4G B;  4PZV A;  5JMN A;  2K8G A;  4WCE Q;  2YWE A;  4LF2 A;  3MR7 A;  1G1X A;  2GVZ B;  3CDU A;  4OLP A;  3V6K A;  4NLP A;  2HQI A;  1IJF B;  1ZZN A;  3EDR B;  1EET B;  1MWY A;  3OV7 A;  4RO0 A;  3NGU A;  4AQY F;  5DGB A;  2XHW A;  1TVR B;  1D3W A;  1B0V A;  4YB6 A;  4C48 A;  2H5E A;  3UFC X;  3Q86 A;  4OMF G;  3ZZY A;  1AXQ A;  4J91 A;  1ZOT A;  2FHO B;  4A8M P;  3N5B A;  1S1U A;  3T5H A;  5EN1 A;  2YX1 A;  3C14 A;  4K2X A;  3VGS A;  1F1B B;  2BW2 A;  1JLF A;  3DLE B;  2V2V A;  3FJ2 A;  1X9W A;  3M8S A;  1VC0 A;  5G4D A;  3IO1 A;  1YBU A;  3IRW P;  2G0C A;  2ASJ A;  4IFV A;  1ARO P;  3FSI A;  5JJB A;  5EGY A;  1RT2 A;  5GAE U;  2AGP A;  3OQ2 A;  2DNP A;  5KFD A;  2UXB J;  1UFK A;  2CA9 A;  5CHC B;  4FP9 A;  3UDC A;  4LVN P;  1FKA F;  1IKX B;  2QX0 A;  2FTR A;  1GX5 A;  3H5X A;  1Q8B A;  1SJR A;  2ZE2 A;  3GIM A;  4DQQ A;  2KT3 A;  2V50 A;  2CPE A;  4L3N A;  2PMW A;  4KHP F;  3HZG A;  2LU1 A;  4UST A;  2A18 A;  2ZJQ Q;  4LFB F;  4RW8 B;  4A8Q A;  4MTP A;  1OYD A;  3JXO A;  4QCL A;  3OFG A;  1TFY A;  3KNA A;  1U49 A;  3K8W A;  1D9D A;  5D3G A;  2O3D A;  3IWX A;  2CPX A;  5HBM A;  4DS5 A;  2QLW A;  5LXY A;  2YY3 A;  2WVD A;  2YKM A;  5BR8 J;  4YUD A;  1P27 B;  3VAK A;  3VAH A;  1U1P A;  5SUH A;  2IC3 B;  1S48 A;  2H65 B;  3MAQ A;  4WXW A;  1NU4 A;  2ROE A;  5ETK A;  1JLB B;  1A0O B;  1RP5 A;  1FRM A;  1SJF A;  3AOD A;  3MEG B;  1S76 D;  2FGO A;  4FXD A;  2AEJ A;  3BSC A;  1O51 A;  1Z2L A;  3NGS A;  1NSK L;  5CD4 H;  5KFS A;  5F0U A;  4AFF A;  2MKC A;  1QE1 A;  2BAB A;  3FBC A;  2C3P A;  3GJS B;  3RR7 A;  3L7P A;  4GVB B;  3RB3 A;  3M32 A;  5BXI A;  2EBG A;  4J9R A;  4IRK A;  4B3R J;  5L1J A;  1FKO B;  3K59 A;  3M2U B;  2KTQ A;  1ULR A;  2CUY A;  3MMA B;  2Y1J A;  1S6P A;  3BGO P;  3QZ8 A;  1F0X A;  1WTB A;  2NUU G;  1YTY A;  3BPD A;  4UT4 A;  1TMJ A;  1NDK A;  4FF4 A;  4QU6 A;  3FCV A;  1BQM B;  3UCU P;  3BDE A;  1W26 A;  3M8Q A;  2W2Q P;  1U1Q A;  2JSX A;  2OPP A;  3CJR A;  2QYC A;  4KV8 B;  3NS7 B;  3Q83 A;  4KO0 A;  3X1L B;  3BGU A;  1X4A A;  1VHF A;  1A6L A;  4DV3 F;  3OTD A;  1NRK A;  3CSK A;  3PIO Q;  1H0H B;  1BXN A;  1IKY B;  1F9F A;  3BGR B;  2V94 A;  1YVF A;  3BYP A;  2HS4 A;  2W9C A;  1RBA A;  2GJF A;  3M6X A;  1UKU A;  4F36 A;  1ZTT A;  2DGO A;  3RTV A;  1TL7 B;  2YWF A;  4HEA 9;  3IS9 B;  1BQN A;  5HK4 A;  1CS4 B;  4RUA A;  4OX9 J;  2V9K A;  5KFM A;  2HHU A;  4WFX A;  2UVV A;  5HMX A;  2IDE A;  2ASL A;  1IBK F;  4DL5 A;  1VRQ C;  5HJY A;  4AXJ A;  3HM9 A;  3C8Y A;  3M05 A;  2BUN A;  4P9S A;  1OYE A;  1GQE A;  4OZ1 A;  1YIT S;  4A8Y A;  3MEE B;  3I6P A;  2XB2 D;  1AZS B;  1LK5 A;  1BWE A;  2MDA A;  1URN A;  4Y34 A;  4X4R A;  1JLG A;  2V5H G;  3M8P B;  2HGN A;  3G6V A;  1FE0 A;  4X4V A;  5KT6 A;  2ZD1 B;  2DIU A;  4JV5 F;  3MMB B;  2ZH3 A;  3KJQ B;  3UCZ P;  5AT1 B;  3MCM A;  4OJ1 A;  1IKV B;  4FBT A;  3KLI B;  2HVE A;  4H4K C;  2J5A A;  2HQC A;  4OZ2 A;  4OZL A;  4UOF A;  1XER A;  2VB6 A;  3LP2 B;  1FWK A;  2VFT A;  4RNF A;  5KFF A;  2W2N P;  2FJA B;  1KHV A;  1Y7P A;  2BE9 B;  2AKW B;  1J5E J;  4DU7 A;  3DOL B;  1WC3 A;  3VAL A;  1NJX A;  2KB2 A;  2WSF C;  3PRB A;  2HS0 A;  2VD3 A;  4F0K A;  2NRE A;  1RTH B;  3DOK B;  3AB4 B;  3PR4 A;  2ZH1 A;  3ENW A;  1LFP A;  1PIL A;  5DM7 Q;  5M2R A;  5LM7 E;  2G2Y A;  5DZ6 A;  5H1S V;  3PRD A;  4J9M A;  2HRT A;  2C2R A;  5HMZ A;  4ALZ A;  2V2Q A;  2YH1 A;  1XR5 A;  5FDL B;  1KNZ A;  3TYT A;  4Y6I A;  2F7V A;  3H20 A;  1V3R A;  4E0D A;  3FCW A;  3QNW B;  2QMU B;  3C6U A;  1FNM A;  4ECZ A;  4LRC A;  3KYL A;  2VKR A;  2DB1 A;  4CT9 A;  2ZNY A;  4PUO A;  4DV2 F;  1YRU A;  3BS9 A;  3MAA A;  3PKY A;  2YNI B;  4FYD A;  2CWK A;  4USU A;  2EG1 A;  2YNF A;  2K7K A;  2CVI A;  4RUH A;  2C3M A;  5A76 A;  4U67 Q;  3HSZ A;  1FFS B;  5G0R B;  3JTO A;  3EZ5 A;  2M2B A;  2E1R A;  4ED0 A;  1BWV A;  2CQD A;  2MKH A;  5IC4 B;  3IFE A;  3BR8 A;  1S1W B;  4JI8 F;  1RLD A;  1VCT A;  4MIA A;  2KZZ A;  1S9E A;  4NEZ A;  5FII A;  4MMO A;  3W66 A;  5HMY A;  1TUW A;  2QMW A;  3TUP A;  3K5O A;  4N7T A;  3HJF A;  3NGD A;  3RRH A;  2MHN A;  3OVA A;  3M2R A;  2A6M A;  4FDF A;  3OSN A;  2DVI A;  2VBZ A;  2D3O 1;  3OUY B;  4CLS A;  4K4Y A;  2FLP A;  1NO8 A;  2ZVS A;  3IXQ A;  3MM9 B;  3I96 A;  5ETV A;  3C46 A;  2JX2 A;  2E5H A;  4DUZ J;  1Z1Z A;  4PR6 A;  4M94 A;  2DGS A;  2H4W B;  2VG6 B;  4FN5 A;  1EHW A;  1TKX B;  4D3H A;  3R9L A;  3IWL A;  1LW2 A;  2Z0G A;  4EWT A;  2I5J B;  5JUM A;  1NPP A;  2RU9 A;  3ZZP A;  2JEF A;  3CD7 A;  2NYI A;  2WVB A;  1ROF A;  4LBH A;  1RTZ A;  3QSI A;  2JRS A;  2GA7 A;  2CQP A;  1UEK A;  2VQE J;  3I0S A;  2DTJ A;  2OPR B;  2LQ9 A;  5FJ4 A;  3DN9 A;  5C7P A;  2BX6 A;  2KM8 B;  1SL0 A;  1JMT A;  2E29 A;  4WII A;  2PA8 D;  3HHL C;  4LF5 J;  1UW4 A;  2MQP A;  3MR2 A;  5T7L A;  5E0O A;  3ZZT A;  2LDY A;  1XR7 A;  3HVT A;  1LQ9 A;  5SZT A;  1S77 D;  2WB4 A;  4RL1 A;  2U2F A;  3S6E A;  2PII A;  3HDS A;  4FPR A;  3KLF B;  3H0P A;  4LF8 J;  3U27 A;  2ERR A;  1SQG A;  4X66 F;  2PMZ D;  3CIM A;  2VBX A;  2CQH A;  1P1L A;  1T9T A;  4JI3 F;  1S97 A;  4F67 A;  2BVZ A;  1GXL A;  4C3L A;  1U47 A;  2F4F A;  1HD1 A;  1KFD A;  3QIP B;  1O0P A;  3JSR A;  4QWC A;  4RW4 A;  3J80 U;  3UDE A;  4YR3 A;  2R4F A;  4YHH F;  4ZIW A;  5KFY A;  2IFX A;  3UN3 A;  1YRX A;  2E9Z A;  2L9N A;  4G65 A;  1RT1 B;  4DSI A;  4URS A;  3L3C A;  5K9F A;  1NHK L;  1VHI A;  2YXL A;  2W7P A;  5F8H A;  1W25 A;  3B4M A;  1NB7 A;  3CCR S;  3BN4 A;  4CDI A;  2I2Y A;  1YJW S;  5L9N A;  1UWA A;  2B6A A;  2XLJ A;  2P9G A;  3HD1 A;  3K17 A;  3W64 A;  3AD7 C;  3QGG A;  4Q5V A;  5J1E B;  3GFX A;  3QLH B;  1KR4 A;  2HHV A;  2XSJ B;  2JEG A;  1TEL A;  2CJY B;  3IBW A;  4L74 A;  3CJQ A;  2CXE A;  2CJQ A;  1TUV A;  1JXE A;  5A6W A;  1VR6 A;  3MED B;  5KFZ A;  4DF4 A;  3CCE S;  4NLU A;  4O3N A;  2AWZ A;  2HHH J;  4HT5 A;  4K4V A;  1Q81 T;  2ZBC A;  4EBE A;  2LA6 A;  3LPE A;  4PAA A;  2GML A;  2IM1 A;  1UVN A;  3O8W A;  4G1I A;  4CTA A;  2YWW A;  2J76 E;  4Y28 C;  5THW A;  2CJB A;  4OLO A;  1J5E F;  1FDA A;  2C3O A;  3MXH P;  4RWX A;  5KG5 A;  4FZV A;  1N5Y B;  1UVI A;  2H3E B;  4DSJ A;  4E2F B;  3I5C A;  1UFW A;  4IO1 A;  3IAS 9;  3GIR A;  4AND A;  4WK1 A;  2LKZ A;  2HNY B;  4NWB A;  2CPZ A;  2JLG A;  2DHS A;  2APO A;  3K57 A;  1NBE B;  3M6W A;  3RB6 A;  5L8R C;  2ILZ A;  3S01 A;  4C8M A;  2VC1 A;  2M7S A;  1IWG A;  1KTV A;  2D69 A;  4QPX A;  1LFW A;  1VIO A;  3CJT A;  3NMA A;  1C0U A;  2QA2 A;  4F4K A;  2NXN A;  4R0E A;  1T94 A;  2YVS A;  4ZHR B;  4I68 A;  3C66 A;  2XY7 A;  3CGI A;  4W4M A;  4EBD A;  3K5M A;  3FEZ A;  2CPD A;  4ZKA A;  3ELH A;  3L7U A;  1SUQ A;  2Z2M A;  1YSJ A;  4K59 A;  4YQW A;  1JB0 C;  3DMJ A;  3DGP B;  4ZVQ B;  3DHX A;  4CO0 A;  2NCK L;  3M8Z A;  1PC5 A;  1YBA A;  1HI1 A;  1PJ6 A;  1JXL A;  2B5J B;  2DNK A;  4JI5 J;  1U1L A;  5B0A A;  1NDP A;  2HMI B;  1N36 F;  1B7Y B;  3DKD A;  1TV6 B;  1YJU A;  4FF1 A;  4J9Q A;  4TYB A;  4OL8 A;  2JVO A;  3JS9 A;  4CO3 A;  3UN5 A;  2GGP A;  1JKH A;  3LP1 B;  4ZP6 A;  2QO3 A;  3NP5 A;  4UY8 5;  3KK2 A;  2KVQ E;  1L5U A;  1NHV A;  4CO2 A;  2GIF A;  4QWA A;  4DR7 J;  2B9X A;  5KFA A;  3G4S S;  1XNQ F;  3OL7 A;  1RUS A;  3CNQ P;  2F8M A;  1ZPW X;  3SQO P;  3EVW A;  4B9S A;  3LUY A;  3NBP A;  1Y4Z B;  2G13 A;  3AH6 A;  5D4L A;  3P49 B;  1O5J A;  2E9R X;  1WUU A;  1FER A;  1XTZ A;  1W2B R;  5HJX A;  4HI2 A;  4C8Z A;  5LMN J;  3KHH A;  4DZ6 A;  2XMJ A;  1EP4 A;  1DQ9 A;  3EZO A;  1NJZ A;  4PYA A;  2CQ4 A;  4U6P A;  1M1K T;  4CCH A;  4DG1 A;  4EZ9 A;  3GIK A;  5F41 A;  3IMQ J;  3VZI A;  3FGV A;  2R7T A;  2P5V A;  5GAE I;  5HL7 Q;  5LT5 A;  3IGV A;  1P1T A;  4XDD A;  3KHL A;  3DYA A;  3ZZ0 A;  3QQC D;  3QJL A;  3D3C J;  2VA3 A;  3ZNU A;  2QE5 A;  5E3P A;  4NLQ A;  2KYZ A;  4F2S A;  1RWO B;  2UZA A;  2QL5 B;  2C22 A;  3L9Z A;  2JFD A;  2NXC A;  3ZZO A;  2HAI A;  2IMO A;  2F5G A;  2CAD A;  1GTE A;  3UVJ B;  2E5J A;  4O4R A;  1HNW J;  3UDV A;  2RJZ A;  4ER8 A;  5F3T A;  1X4H A;  2COL A;  1JLQ A;  2HS3 A;  2IM0 A;  4NLD A;  1RAC B;  4ZPA A;  2UV8 G;  3SMZ A;  4DS4 A;  1GH8 A;  4JI1 J;  3NS6 A;  3DRS A;  4KAI A;  2MLX A;  1RK8 A;  5EWG A;  1Q0N A;  3T1H J;  4EO6 A;  2HVZ A;  1S4F A;  2QYG A;  3FDS A;  1HR0 F;  1V6H A;  2OEM A;  2XGP A;  1D09 B;  4NLY A;  1N5T A;  3EGN A;  3CJ8 A;  3AA8 A;  5CD4 A;  4DV1 J;  3D68 A;  1KD1 T;  2KG1 A;  2JEI A;  4DR4 F;  4I7F A;  3M2V A;  3MAH A;  3HSD A;  2KRB A;  3BR9 A;  5E3A A;  3POT A;  3HP6 A;  1RT7 B;  2RQM A;  3WX4 A;  5C2G A;  4KGZ B;  2Y8W A;  2HHH F;  4I1T A;  2XCA A;  3AQO A;  4W90 B;  3THT A;  2GVD A;  4DR2 F;  3VF0 B;  1S49 A;  4NLS A;  1FFW B;  3RBD A;  3EZU A;  2W8K A;  3MEC B;  3N5F A;  3MM8 A;  4NXM J;  5K14 B;  3OHA A;  1M1H A;  3G71 S;  4DV6 F;  2BEF A;  4WP9 A;  4CLP A;  1DLO B;  1H3D A;  4RNM A;  3H59 A;  2DEJ A;  3GZ7 A;  4I2Q A;  4XK8 C;  5D0G A;  2FHK A;  4LUB A;  2ACM A;  1Y5N B;  4IR1 A;  3SI8 A;  5HRO A;  3AJ1 A;  3PEH A;  4P72 A;  1UA0 A;  3CD0 A;  2NYH A;  3LH2 S;  2ZUA A;  1NH7 A;  4P75 A;  2DGU A;  3BZQ A;  4P73 A;  2GHW A;  2B8Q A;  2YWK A;  4P2F A;  3GMG A;  1RAF B;  1R27 B;  2R7X A;  3DDK A;  4ZVP B;  5F8I A;  2B8P A;  3CD5 A;  4TY8 B;  4QOT A;  1GFW B;  1JQG A;  2XLI A;  2RRN A;  5J2M A;  3ZZR A;  4DX8 H;  2VG5 A;  2AP6 A;  2P9C A;  2B9W A;  2ZJP Q;  2C2O B;  4CH0 S;  1R8H A;  3MFH A;  1SKW A;  3HLU A;  2RKI B;  4FXW A;  1HWL A;  4I6W A;  1QVG R;  3CCL S;  5AJ3 J;  2RT3 A;  2DNG A;  5C42 A;  2O1P A;  8RUC A;  4U7U D;  2BQU A;  1CJV B;  4ZVE A;  2UVR A;  3MMJ A;  1F2H A;  3PTW A;  4H4M A;  5J2N B;  1JJ2 R;  2UXC J;  2MB0 B;  2ZC3 A;  3OTO F;  1XN9 A;  2MQM A;  4O4G A;  1F60 B;  3BN7 A;  4QR2 A;  3AOA A;  5B0E A;  3QRP A;  1RTI A;  3OR1 B;  4HYK A;  1MN7 A;  3ENA A;  3CCW A;  3AD9 C;  4I2P A;  1H98 A;  5F8G A;  4NZ0 A;  3SSR A;  4JI2 F;  1KLN A;  1WD6 A;  3W9I A;  4J9L A;  5KFH A;  2J6S A;  4NCG B;  2W7A A;  3N6M A;  4KSE B;  4I6Y A;  5ETL A;  2AD9 A;  1PJ7 A;  4I64 A;  4IH6 A;  5J2P B;  2POK A;  4Q44 A;  2JJ4 D;  4DCP B;  5T14 A;  5D8H B;  3LGH A;  3FQL A;  3BB5 A;  1G7C B;  4DQI A;  3DLL Q;  5HQM A;  1TU0 B;  1N34 F;  2HHT A;  1IWA A;  3A3O B;  3HVA A;  5A8R B;  3H5U A;  2ZM6 F;  2F1F A;  4TQS A;  4TYA A;  4X65 J;  3QWU A;  2RU3 A;  3N01 A;  2DNQ A;  5E7O B;  4C98 A;  3HSG A;  4G3I A;  1SB6 A;  4NPO A;  2D41 A;  2DT9 A;  5KFI A;  2VG7 B;  1XEZ A;  5KT7 A;  1R6V A;  4BC9 A;  1IKX A;  3BKU A;  3ILI A;  3WBZ A;  5BYR A;  4YB1 P;  3PW5 A;  1TFW A;  4LRB A;  3BQ2 A;  4P2S A;  4K50 A;  4F3M A;  2HVD A;  4OZ0 A;  5GAD I;  3PW0 A;  4NRU A;  1QY7 A;  3KLV A;  1OO0 B;  1Q8K A;  1RAO A;  4TLQ A;  3MD1 A;  3AXM A;  1S1V B;  4U95 A;  4K4Z A;  4YB7 A;  3P8B B;  1HNW F;  3GQC A;  1U8W A;  2U1A A;  3KG1 A;  1NK4 A;  4Q8F A;  1I1G A;  4QWD A;  2C3U A;  5BYQ A;  5KOW A;  1H7X A;  3QWP A;  2FZG B;  2ZKT A;  4ED8 A;  4ITS A;  2VIC A;  4QIE A;  4C7Q A;  4LF9 F;  1YJR A;  1JLB A;  2AIR B;  4ZLL A;  1U2F A;  4WKY A;  2HUR A;  4TKT A;  3MEG A;  2Q79 A;  3DOM B;  2QA4 S;  2XG8 A;  2FB0 A;  1GXT A;  4BCA A;  4DLG A;  4URG A;  4LSL B;  4DPT A;  4QIW D;  1S79 A;  2DGT A;  3TJ8 A;  2DJW A;  3LQV A;  3A4T A;  4MYT A;  4K4U A;  1H6K X;  3TR5 A;  3I9V 9;  2BQR A;  3E3X A;  1SC4 B;  2NXE A;  1NXI A;  2V4Q A;  3M2U A;  3BEG B;  1TKT B;  3H2L A;  1HI8 A;  3GCX P;  1DTT A;  2DHH A;  2FLN A;  2E1C A;  4PKD B;  5D4O A;  3R5G A;  1BQM A;  2J0X A;  3HD2 A;  2HQG A;  2RQ4 A;  1R31 A;  5HLF A;  3WIV A;  1DZ5 A;  2MY8 A;  1AFI A;  4A47 A;  5E3C A;  3CB4 A;  3MUR P;  1T3O A;  1MRO B;  2C2M B;  3PJ9 A;  4ZCK A;  4M63 A;  2OUG A;  3LP0 B;  3H2V E;  3CF5 Q;  2HG4 A;  1VRU A;  4JYA J;  2BJ8 A;  1HQE B;  3DC2 A;  1M5V C;  1G6B A;  4NZ6 A;  3QO9 A;  1TL7 A;  2I0X A;  4QR0 A;  3PZP A;  5KG0 A;  1ZPV A;  3PDN A;  1A9N B;  2XMM A;  4HR2 A;  3N4W A;  2Z8Q A;  3LA0 A;  1HI0 P;  4S0M A;  1MN9 A;  2CQ1 A;  2RQC A;  1OS5 A;  4NYZ A;  2WAQ D;  3CCS S;  3UI3 A;  1VQM S;  3KDO A;  3MEE A;  4RW6 B;  2X1A A;  3FNN A;  1WOR A;  4YB5 A;  3NNA A;  3D3B J;  1Q5Y A;  2CG4 A;  1EAR A;  5HVH A;  2VL1 A;  4ECU A;  3ZFV A;  1XMQ J;  3R2D J;  1V9O A;  3BSA A;  2N3O A;  1SV5 B;  1IR2 A;  2YBV A;  2XBP A;  1U2C A;  1IKV A;  5LSL A;  1S9G A;  3NLC A;  1SJQ A;  2FVQ A;  3DDI A;  4FPI A;  1G2E A;  5AJ3 F;  1WI8 A;  2ZOM A;  1FK9 A;  3NGR A;  4ZIT A;  5GVQ A;  4DBQ A;  3GR0 A;  2MSS A;  1U0S A;  2VFS A;  4KGK A;  2MMY A;  2HLU A;  4X4T A;  3PEJ A;  1XR6 A;  5KFK A;  2JH3 A;  2L3M A;  1YI2 S;  4JI0 J;  2HRY A;  3SDE B;  1IUJ A;  1F6T A;  2DKO B;  2OSQ A;  4TU7 A;  2HFZ A;  4XPE A;  2YKA A;  5GAG U;  3MEK A;  2GC8 A;  1Q8I A;  3IRX A;  5LJ5 Y;  5K20 B;  2EG2 A;  3TP2 A;  1RHK B;  2XWX A;  5FDL A;  4IO9 Q;  1C1C A;  3PR5 B;  4KKO B;  3HX9 A;  3OLB A;  1XNR J;  1FWL A;  1Q4R A;  3G2X A;  3ET6 B;  3C6T B;  2XS5 A;  4QYR A;  1LNQ A;  5GME A;  4HAC B;  2I38 A;  5IWA F;  3WZ0 A;  2CNN B;  1HQU A;  2VQF J;  4ATN A;  3PJX A;  2ZH2 A;  1Y0H A;  4X64 J;  3CUL A;  1RAI B;  1OPZ A;  4U7C A;  3AA9 A;  2OPS B;  2MQO A;  4BS2 A;  3EXC X;  3OXL A;  1KLM B;  1CQM A;  1JLC A;  3NEK A;  4UTG A;  3HXM A;  1M5P C;  4XIU A;  3FZB A;  1SC3 B;  3LWL A;  2HFS A;  2GHV C;  5CYQ B;  1TK5 A;  3OFH A;  1F5A A;  1FEH A;  2ZUG A;  3BO3 A;  3NOC A;  4PWD B;  4H4O B;  1EB0 A;  2W25 A;  2R9L A;  2BE7 D;  2CKW A;  1RWU A;  1ZBT A;  1PIE A;  3J81 j;  4ZVT B;  2DCU B;  5DG8 A;  4P74 A;  1IQT A;  3LAM A;  4OYZ A;  5KFT A;  4ID8 A;  2YNG B;  4B9N A;  4MKB A;  3TAM A;  1T8E A;  2VHG A;  4ZCL A;  4CO5 A;  1B64 A;  3GII A;  2DY1 A;  4NI2 B;  2DO4 A;  1T11 A;  3I4H X;  3KXD A;  1F3V A;  2W4P A;  3Q0A A;  1IBM J;  5DDO C;  4ZVH A;  4A8O A;  1GEH A;  3CJK B;  1FES A;  3TW0 A;  4EI2 A;  1HMV A;  5GAH U;  3T41 A;  1VQ4 S;  4GKK F;  3RBE A;  3BGL A;  3FC9 A;  3C15 A;  3TX8 A;  1S6O A;  4C8L A;  4R5P A;  3Q8Q B;  4Q45 A;  2VG6 A;  3BM7 A;  2Z2Y B;  2RS8 A;  1NK5 A;  2DPJ A;  3EVO A;  2ROP A;  2I5J A;  1FTR A;  3ISN D;  4DV7 F;  1MSW D;  1FCA A;  2UXD F;  2DNZ A;  3MCS A;  1FT8 A;  4USI A;  2ZBQ A;  3W62 A;  1Y00 A;  2WOM A;  4DZD A;  4B3M F;  1WG4 A;  2F40 A;  4QW8 A;  3T3F A;  2PN6 A;  3NL0 A;  5E33 A;  5ETT A;  4ZIV A;  4YY3 J;  3T9Z A;  3UCG A;  2OPR A;  4LF7 J;  2C2Z B;  1IBL J;  2FC8 A;  4O3R A;  2YTC A;  2YKP A;  1EIY B;  1YWX A;  3J7Z 5;  1X8D A;  3OBI A;  5DRK A;  3NGT A;  2BJ3 A;  2X3D A;  2OAU A;  4OI6 A;  4EK2 A;  1GMU A;  3G82 B;  2NUH A;  1Y9O A;  2BE2 B;  4KGV B;  4ZP8 A;  1PYT A;  1REG X;  2VC0 A;  3M8Y A;  1UWB B;  2L9D A;  4DV4 J;  2LCW A;  2EWH A;  1TKD A;  4U8V A;  2ZVI A;  5C25 B;  4IG0 B;  2V67 A;  4A8W A;  1HBN B;  3R3T A;  3IM9 A;  1IN0 A;  4IDK B;  5CA5 A;  1XMO F;  3ZZZ A;  3ISZ A;  2HBZ B;  4CNZ A;  3BO4 A;  4PG7 A;  1NCL A;  3KLG B; 
#chains in the Genus database with same CATH homology
 2YPY A;  4UZB A;  1B3T A;  1VHI A;  2YQ0 A;  2YPZ A;  4UZC A;  5A76 A;  4BLG A;  2YQ1 A;  4K2J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...