2XS7A

Crystal structure of the rrm domain of mouse deleted in azoospermia- like in complex with sycp3 rna, uuguuu
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
86
structure length
86
Chain Sequence
b'LPEGKIMPNTVFVGGIDVRMDETEIRSFFARYGSVKEVKIITDRTGVSKGYGFVSFYNDVDVQKIVESQINFHGKKLKLGPAIRKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DELETED IN AZOOSPERMIA-LIKE
publication title Kinked Beta-Strands Mediate High-Affinity Recognition of Mrna Targets by the Germ-Cell Regulator Dazl
pubmed doi rcsb
source organism Mus musculus
molecule tags Rna binding protein/rna
total genus 18
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2010-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2xs7A00
2CQDA 4LMZA 1U2FA 3UD3P 3UCGA 3G4SS 3NNHA 3Q2TC 2DGQA 2RT3A 1U1NA 2E44A 2LQ5A 2RRBA 1U1LA 1FHTA 1WI8A 1ZH5A 3G9CA 2F3JA 1VQLS 1X4DA 1FNXH 4CH1A 1N52B 4WCEQ 1X4GA 2M8HA 4F02A 5GVQA 5D78A 2BZ2A 3R1HA 3UE2A 5GAHU 2PE8A 3MXHP 4F25A 2JWNA 4ZKAA 1VQ9S 2XS7A 3I55S 1NJIT 1QVFR 1A9NB 4PR6A 1HD0A 2ADCA 2DO4A 3CCMS 2CQ1A 1K73T 2LCWA 2I38A 5DDOC 2CQBA 2U1AA 3FEYB 1U6FA 2RQ4A 4LJMA 2MJNA 3V4MA 3CC2S 2D9PA 2DNLA 1UFWA 4WF9Q 2PEHA 1YJNS 3CC4S 3L3CA 1FO1A 1SJQA 4M5DB 4J5OA 2CPEA 3S8SA 4ED5A 2M7SA 5DDRC 2KM8B 4PRFA 3SXLA 1WHYA 2MQOA 5CXTA 4FXWA 1DHMA 3B4MA 2DGUA 2MY8A 1Q7YT 2L08A 2DB1A 5GMKa 4YB1P 2KXNB 2DISA 5IQQA 2MKIA 1X4AA 2RNEA 3VAMA 2MZ1A 1Q81T 2B0GA 3MD3A 1VQ5S 2DNPA 1DBDA 1WG1A 2CPJA 2FC8A 2KH9A 3BO2A 1WHXA 1U1MA 1FT8A 1KQSR 2N82B 3H2VE 4TU8A 1N54B 2K3KA 1OPIA 3MUMP 4OZ1A 3CCVS 3R1LA 2E5HA 3VAHA 2N3OA 1U1PA 2DIUA 3EX7B 1YI2S 4PKDB 2DGTA 5DM6Q 3P6YC 4QU6A 2AYEA 2DNZA 2YKAA 2MGZA 2DGXA 2E5GA 4OZ0A 2LA6A 5LJ5Y 4ERDA 2LMIA 4CIOA 3VAJA 2Q79A 3P3DA 4Z2XA 1WEXA 1DZ5A 3EGZA 1ZZFA 2LEAA 4WIIA 3S6EA 4C0OC 5IM0A 2MZTA 2MJUA 3I56S 3CXCR 2AYGA 2KU7A 4W92B 2LXIA 1YITS 2DH7A 2MSTA 4F26A 3H2UB 4TU7A 2HZCA 2MPUA 2RVJA 1K9MT 3UWTA 2KRRA 2GO9A 3VAKA 2WBRA 2NLWA 2OTJS 2AYMA 1U1QA 1X4CA 2KRBA 2OTLS 1U1RA 3BEGB 4RU2A 3CC7S 1QVGR 1HA1A 5HL7Q 2LKZA 3RW7A 2CPZA 3BO3A 2LECA 2QFJA 5D77A 2X1FA 4UQTA 5BJRA 3B4DA 3DXBA 3VAFA 1X4FA 5H1SV 1M5KC 1KC8T 1WHVA 3SDEA 3PIPQ 3CMES 2V94A 2K8GA 3CCRS 2HGNA 2MZRA 2E5JA 4IOAQ 2DGWA 2GHPA 3THPA 2MQPA 2OJ3A 2KHCA 5EN1A 5LJ3Y 2MKHA 2FPHX 2M70A 4Y0FA 1VQ8S 1WF2A 3ZZZA 2MHNA 2DNMA 2MMYA 1X0FA 2DNKA 3JB9k 1P27B 1QM9A 3S01A 3VALA 4C7QA 2A3JA 2KFYA 4TLQA 2XSFA 3OW2R 1X4BA 1UAWA 1FJ7A 1AUDA 5IFMA 5CA5A 3CCUS 1B7FA 1YJ9S 1HD1A 2JRSA 2KT5A 4LIRA 3MURP 1RKJA 1L3KA 2LEBA 2RQCA 3FEXB 2CPYA 5JVHQ 4FXVA 1JJHA 4CH0S 1WELA 2M8DB 1NO8A 1WEYA 4QU7A 1VQ6S 3CMAS 2DGOA 1M5VC 2QEXS 5LSLA 1WG4A 3DLLQ 3IRWP 2MQMA 2MQLA 2ERRA 1R8HA 3G96A 1UW4A 5GADU 1K8AT 3CCSS 3G8TA 1VBXA 1URNA 1N88A 3BS9A 3CULA 5GAEU 2E5IA 1WTBA 3P49B 2KG1A 2J8AA 1WF1A 2M88A 2FY1A 5DDPC 1OIAA 3UD4P 2ZJPQ 4Y00A 2MGZB 2CJKA 4EGLA 1U1OA 1M5PC 1X4EA 2VODA 5LSOA 2M52A 3CCLS 2CQ3A 2EVZA 2DH8A 2HVZA 2BOPA 2DNRA 1UP1A 2L9WA 2JVRA 1KD1T 1FXLA 1H2UX 3MUVP 5IM0B 2CQCA 1Q82T 1FJCA 3RW6A 2CQPA 1VQMS 2CQGA 2YH0A 1OWXA 2N3LA 2J0SD 4CQ1A 2RU3A 1HL6A 3CUNA 1X5PA 2MKSA 2MB0B 2LXUA 2M2BA 1SJ3P 1N8RT 4IUFA 3NNAA 3MOJB 1PO6A 2J76E 1M90T 3ZZYA 2DNNA 1M5OC 2XNQA 4U67Q 1VC5A 5FJ4A 1XN9A 3CCQS 2DH9A 3Q2SC 4WFBQ 2MKKA 3CPWR 5ITHA 3J7ZT 1SJ4P 1OO0B 2DNYA 4IOCQ 2CQ4A 1PGZA 2DNOA 2RS2A 1WI6A 4TU9A 3K0JA 4W90B 1WEZA 5CYJA 3MDFA 3TO8A 2ZJQQ 2VONA 2MY7A 3G8SA 1VQ4S 2KYXA 1SJFA 3SDEB 3P5TL 2MXYA 1YJWS 2CPIA 5DETA 3NS5A 2DIVA 2KG0A 3G6ES 3NMRA 2XB2D 1F9FA 1X4HA 2MYFA 2U2FA 3R27A 3MD1A 2AD9A 5DM7Q 2MKJA 2VOOA 2LA4A 1Q86T 2CPXA 2RUGA 2QA4S 1VQKS 4WFAQ 2OIHA 3BO4A 2KI2A 1KOOA 2VOPA 2MZJA 3ULHA 2ADBA 2D3OR 2F9JA 1VQOS 4IO9Q 2DNQA 3MUTP 3D2WA 2CPDA 1D8ZA 3LPYA 4A8XA 1ZZNA 3TP2A 2EK6A 3G71S 2G4BA 2MZQA 1WWHA 2I2YA 2DHGA 3US5A 2DHXA 1X5OA 2YWKA 5JVGQ 2RRAA 1WHWA 1U1KA 2X1BA 1O0PA 1IQTA 3CF5Q 1KOHA 2HGLA 3U1LA 1VQNS 2DGSA 1YWXA 1VC0A 2HYIB 4WFNQ 2CPFA 3THTA 2DGVA 3NS6A 2FHOB 2KXHA 2LYVA 1H2VZ 2JVOA 5MLCV 1VQ7S 4P6QA 3HHNB 3CTRA 2M0GB 3VAIA 2DK2A 2KXFA 2UP1A 1WF0A 4QQBA 2F9DA 1DRZA 2MSSA 1VQPS 2X1AA 4C4WA 1JMTA 1H2TZ 3S7RA 2CPHA 1SJRA 5DDQC 4YUDA 4BS2A 3VF0B 2DNGA 1WG5A 2J0QD 2OSQA 2RS8A 1P1TA 5HO4A 3J7YU 2YTCA 3TYTA 1G2EA 2AYBA 2M4MA 2MKCA 3EGNA 1S79A 2DHSA 1U6BA 2G1DA 1S72S 1H6KX 2KVIA 1SXLA 2OSRA 3MI7X 2KM8C 3CD6S 2KN4A 5GAGU 1NU4A 4V19X 5LXRA 2MZSA 2CQ2A 1VBZA 3CCJS 2DITA 2CQHA 3PIOQ 3UCZP 1M1KT 4QPTA 2MQQA 2DNHA 1FJEB 3N9UC 1YTYA 1X5SA 3SMZA 3NNCA 1VBYA 3VAGA 2JX2A 1D9AA 1A7GE 2HGMA 3U1MA 1CVJA 4WKRA 3HI9A 1R8PA 2DHAA 2SXLA 2YH1A 1YHQS 1RK8A 2CQ0A 2X1GA 2DO0A 2XNRA 2FC9A 2MQNA 2G0CA 2O3DA 2N7CA 2M9KA 1VC6A 1X5TA 1JJ4A 2L41A 1W2BR 2D9OA 5LXYA 3CCES 4YOEA 2NZ4A 3IWNC 2EK1A 3LQVA 2XS5A 1BY9A 1YIJS 2CQIA 3UCUP 4UY8T 1JJ2R 2XS2A 2ZJRQ
chains in the Genus database with same CATH superfamily
4RW7A 1U2FA 3M8YA 3PW7A 5G0RB 3IC1A 1ZTTA 4CH1A 3FNNA 1IJEB 3ZO7A 2ZDPA 4GO7X 1PKUA 4KFBB 1FWLA 3GG0A 1OY8A 1S1UB 2GFFA 1S6QB 3C15A 4OI1A 2B7CB 4KSEB 2RQ4A 4NLUA 4OI4A 3KK1A 1YJNS 1SL0A 2CJBA 4LSNB 3NG8A 2LEPA 1RCOB 1FTRA 1QDUB 2Q3PA 3JXOA 2MQOA 2V8PA 1BWEA 3AODA 2Q1LA 4CLYA 3Q89A 4Z7YA 4G65A 1WG1A 2KH9A 5KFPA 3KLGB 1EP4B 2K3KA 3MMJA 1U1PA 2JEIA 1JKHB 3CNQP 4EZ6A 2AYEA 1UJ4A 1Q53A 1RHJB 3H20A 4OX9F 1GTEA 4QIFA 1UJ5A 2LMIA 5EX0A 1TL7B 2R2TA 2LEAA 4HT7A 2B4VA 2PIIA 2FDNA 4F4KA 3A8JA 3R5BA 4CTAB 2AYMA 3H5SA 1HHTP 1X4CA 2A6OA 1WACA 2WVEA 2AV5A 3CJSA 1HBNB 5D77A 2B9YA 4RUCA 3T1YJ 4OMFG 3DU6A 3LTOA 1HNXJ 4YP3A 3B4DA 3Q8YA 3W63A 3W7BA 4DSLA 3TX0A 2HBYB 2YQ3A 3CE8A 5KOXA 2BM0A 1KDNA 1SH0A 1I6JA 2E5JA 1YGYA 1HBOB 1KTQA 5HATA 3VGTA 4R8UA 2E5LJ 3R5DA 4USUA 2V68A 1C4CA 3RBDA 2QLBB 1KEKA 4K4YA 4J90A 3DM2A 4B02A 4Y6IA 3DLHA 1JLGB 2J7UA 5LMNF 3LUYA 2P6TA 2KFYA 3QWPA 1LWFB 5B0GA 1VCTA 4ID8A 4CLTA 3O1LA 3NGSA 5IFMA 3GTYX 2F5GA 4HKQA 4LF4J 1AFIA 3NWRA 4TNOA 4C3KA 2VIHA 4RW8B 4WP8A 5T7LA 1TV6A 2DGOA 2XI3A 5GADI 1OYEA 3RRKA 1MMLA 4QWDA 4EZ9A 4WFXA 2JEGA 1WKLA 4KV8B 4DU7A 3PX4A 4KQZA 1OIAA 3UD4P 2VPZB 4OLOA 1X4EA 2QN6B 3JTOA 2L9WA 1AFJA 3MUVP 3MCOA 5H9FK 3EVMA 3DGPB 5DG7A 1WJ9A 3VHQA 1V5VA 3P45B 2RKIA 2MKSA 3K5PA 2M2BA 4H4OA 3I0RB 2C3OA 5IXUA 2GA7A 3PM9A 1LNQA 2DRBA 3CCQS 1X7VA 2WCXA 3W8GA 4DX8H 4C3MA 2ZUGA 2FJBB 2QO3A 4X4UA 2MKYA 5GMEA 3HHEA 1T9VA 2KYXA 3SDEB 3MM8B 4ZDNA 2CNLB 3NMRA 1S0NA 1N36J 2OEJA 2OI2A 2R7UA 2KT2A 4G6VB 1ELOA 2GIQA 5DM7Q 1IVZA 3G82A 3MF5A 3NBPA 3D3BJ 2E66A 2XLKA 1NDLA 5H9FJ 4K0KJ 2YPYA 2ZE2A 3SIPB 3GIJA 3LPYA 2ACYA 4Q8EA 4DL4A 4DR6J 3CVKA 4HVZA 3U1LA 1KVIA 3J80U 1NNDA 1YBUA 1WNEA 4RNNA 4K7QA 3KDNA 1BD6A 4DR3F 3V81B 1U26A 1VJQA 1NHVA 1DRZA 3M9MB 2ZBRA 3A12A 5CAAA 1RACB 3HT0A 4TY8A 1NK6A 5IQ6A 3QRPA 1TK0A 4KPCA 5K20B 1XR5A 2AHOB 5GAGI 4KHRA 4M1KA 3RR7A 1S1VB 1ZOTA 2V6AA 5ETPA 2AGOA 5CD4A 3JQKA 3I87A 3CDUA 2K1RA 4M5GA 2UXCF 3N28A 3TJ8A 1SV5A 5AXLA 2N7YA 1X5SA 1RK8A 2CQ0A 2HVEA 5E5NA 1B7YB 3H5UA 2MQNA 5HP1A 1X5TA 2YWHA 1W2BR 1U25A 4KKOB 4PWUA 4Q44A 2H48B 1X0PA 2JLFA 2LQ5A 3A8KA 1HI0P 1YG0A 1EAYC 2M8HA 1FI4A 4I6AA 4LRBA 3C46A 4EYIB 3VGSA 1NJIT 1A9NB 1R8AA 4DBQA 2CQBA 1DAXA 2F4FA 3SQGA 5D3GB 1VR6A 3FFIB 2GV1A 3CC2S 4U9RA 3SV4A 1XK8A 1UFWA 3K8VA 1SUQB 3WC2A 4M5DB 1REVA 3AH6A 4LT6A 3NMAA 5HBMB 5KFRA 3CD5A 1ZA1B 4Y34A 2ZH2A 3OL8A 3LO3A 1P8GA 2DISA 3HD1A 5IQQA 2DR8A 2HBZB 1TKZA 3VAMA 1VRQC 2B8PA 5I42A 2E9RX 3GFZA 1N54B 3CCVS 2E5HA 3ZTRA 3OTDA 1R0AA 2B3TB 1GNKA 4CM0A 1TL3B 2GO8A 2XO6A 4B9MA 4JB8B 3M8WA 4LR7A 4HTIA 2HFUA 1IBMF 4P71A 4DL5A 4DCPB 5J2MB 4OHVA 4PWDB 3CXCR 4X65F 2XSJA 4WP3A 2R8HA 3PRDA 7AT1B 2MPUA 2RVJA 2B4UA 2YWEA 1NJXA 1LW2B 4I2PB 2FUG9 2CKWA 2XY5A 2WBRA 3CC7S 4ED1A 4FKYA 4RW7B 3ZXWA 1J2VA 5D0GA 2X1FA 4UQTA 2CJXB 1HBUB 1XMQF 2QIFA 6FD1A 1B0VA 1MROA 4M63A 5AE3A 5D15A 2V9WA 2KZZA 3GJQB 1I1GA 1JLEA 3I4PA 3C15B 4ZLLA 1VQ8S 1H7XA 3OHAA 3FCHA 2HS4A 2M5YA 3I0SA 2LDIA 1HNVA 2AJ1A 4OJ3A 5LMNJ 5ETKA 1AUSL 4DFJA 3BB5A 3RAMA 1G7CB 3GP9A 2FGCA 5D0HA 4A48A 3HFZB 3D6MB 4FYDA 3CJ4A 4KHPF 1Q79A 2R2UA 4Q5VA 3QFHA 1NBEB 1TMMA 2QC3A 3EGVA 1CC8A 3AT1B 3FVYA 5HMYA 1WOSA 2GNKA 1XNQF 4Y00A 2CJKA 1F5BA 3PO4A 3ZTOA 5CH7B 2FJVA 2DNRA 1UP1A 3M6UA 4KGMA 3QRRA 4L76A 5KFVA 4WYLA 2CQCA 1KHWA 1J27A 4J9MA 3VQTA 3M6XA 1L3VA 4DUZF 2VA3A 5B0FA 4LF1A 1KLNA 1ZM3A 5HVGA 3MOJB 1X8DA 1M90T 1M5OC 3DGVA 4IRCA 1HPZA 1YJVA 2AGPA 2JLEA 1MU2A 3I9V9 1Y11A 4FS2A 2BJEA 3KLVA 1F0XA 1VRTA 2VONA 1BQNA 2VD3A 4DL6A 3LP0A 1SQEA 1XERA 2DIVA 4XTTA 5KOWA 3MD1A 3BREA 3OFGA 4R8UB 4WFAQ 1C2PA 2F9JA 2R7WA 3QJLA 3OD2A 5IC4B 3MUTP 3D2WA 3DM2B 2OAUA 4A8XA 1WOPA 1HLWA 1UFLA 1TU0B 4DHVA 2YPZA 1SH2A 4G1IA 1VC0A 2WW8A 2RMLA 2W2NP 1NZAA 1VQ7S 1GMVA 4OYZA 4USJC 2KXFA 1WF0A 4WTOB 1UETA 3VZIA 4DR3J 2VG6A 5T7LB 1TV6B 3M2UA 4LUBA 1RYRA 2CZ9A 3VF0B 2DNGA 4DLGA 4PYAA 3JSBA 4K4WA 3PEHA 4X4OA 4P2XA 2WSCC 2XMUA 2XZTB 1BUXA 1R6VA 2KVIA 3J7AN 2MHEA 3W64A 4P9SA 2JEFA 2CG8A 3CCJS 4NMLA 2UXCJ 4I64A 2RKIB 2UV8A 1D9AA 3U1MA 1JJ4A 4Y2KA 3IWNC 1RAEB 4ZITA 3KLIA 2NXUA 1NH7A 3NNHA 1JIHA 4CM2A 5J1EA 3UN3A 4NA3A 1QSLA 4ED7A 4WK3A 3ZZ0A 2BZ2A 3GPAA 1ROFA 4DV7F 2JWNA 1CULA 2WW4A 3TWZA 3G82B 3NBPB 4DXLA 1IR0A 1U6FA 3V4MA 3VCDA 2ZE2B 4OV6A 1H73A 4B08A 5KFSA 4WF9Q 2PEHA 4FN5A 3FBBA 2CPEA 5DDRC 1UEVA 1UZDA 3SXLA 2HFVA 1DHMA 3NY0A 3WHIA 1LEOA 1RBOB 1RQ0A 4DI6A 3R5GA 4U8YA 2C42A 2HSEB 3MFHA 2FIUA 3RB6A 5HVFA 4TY8B 3KHRA 3PYFA 2HMIA 2CFXA 2DBBA 2ALZA 4NCBA 2VG7A 2JDJA 2DGTA 1H72C 3KJVA 4ES2A 3FK4A 1UKUA 2ABYA 3N6MA 2V63A 2HHXA 3KDOA 3PFOA 1S1TA 3M1VA 1B70B 1WEXA 2K1RB 4RW6A 4USMA 1IBMJ 1SV5B 4KTQA 4YR3A 2Z2MA 4TYBA 2D41A 2W9AA 4OJ1A 4X65J 1C4AA 2VFSA 2NQPA 5HP1B 2QSWA 2FZGB 2P6SA 3RZAA 1IKYA 3EXYA 4ENOA 1Y3KA 2HBQB 3D66A 3IAM9 1JB0C 1H98A 1H0HB 2UVUA 1RWKB 4KH0B 2EBEA 1TMJA 2OHDA 3IRXA 1LWCA 4RX6A 3DKDA 4KO0A 4DV6F 1XMQJ 4NOHA 3A3NB 2VKRA 2MQPA 5LJ3Y 3CIZA 2OO4A 5J1NA 4TKTA 3JAMU 3SQGB 5EHHA 5DLGA 4YEAA 2PT0A 1P27B 5IT4A 4DV0F 1REVB 3VWSA 1L3UA 4Q2LA 3VQSA 1PC5A 3VGVA 2ZFHA 1HD1A 1CC7A 2GC8A 1S5ZA 3HULA 1KHVA 4EO6A 3A8EA 1C1CA 1JX4A 1TKZB 4LREA 5JVHQ 5I42B 5IT9U 2QEXS 4HH0A 1Q5YA 4KHPJ 1R0AB 1OY6A 3CCSS 3GSIA 3GJRB 3P49B 2DR6A 3BKFA 2NREA 4TXSA 2O01C 1SKUB 2C2NA 1XNQJ 5A0YA 1AROP 4A8SA 1JLBA 3H5XA 4ZJQA 3CJ8A 1SBRA 2XSJB 1XWLA 2YH0A 3SSRA 3T41A 4CQ1A 1TZ0A 1AZSA 4P73A 5IS2A 4DUZJ 4F4YA 1HHSA 3GFYA 4V1Ak 4OV1A 4ZHRA 5KFTA 4TU9A 4O3NA 4YR2A 1PC4A 4W90B 1FKAF 2GJFA 2KFZA 1TAUA 2D1CA 4UZBA 4OZ2A 1MROB 2MLXA 3KK3A 2U2FA 4RNHA 1RHMB 2HNYA 4EK2A 4ED6A 3JSYA 3HDSA 3L9ZA 4Q45A 2KO1A 4JI0F 2DR7A 2DXFA 1HKAA 2A10A 2IJRA 2MZQA 1T11A 3I0SB 1HNVB 1Y5LB 2Y1LB 3PJ9A 4WFNQ 1RDRA 2KXHA 5KFZA 5BYSA 2HFZA 2ZNYA 2MLZA 3L7PA 4I2QA 2F1FA 3O44A 3IP0A 1MWZA 2CA9A 3M8PA 5HO4A 2VFRA 4LQ3A 1OQ6A 3KUEA 3ETOA 2AF6A 4KC5A 1S72S 3A4TA 1PCAA 3NLCA 1DLOA 2CQHA 5F8GA 2AJFE 3MGJA 1YTYA 3PTWA 1F1BB 2DHAA 3FSXA 3KKFA 1VC6A 1NPKA 2D9OA 3CJ3A 2AWZA 4DUTA 2KFNA 2UZAA 4B3SF 4DZ6A 1MU2B 4YFUA 2J7KA 1VRTB 1BQNB 4F2SA 3LA0A 3RRHA 4N77A 5CD4H 3LP0B 1KFDA 2WSEC 4GVBA 5H9EK 1KS2A 2BW2A 5GVQA 2XS7A 1SL1A 3HF5A 4PR6A 4DV7J 3O3LA 4ZA1A 3BH7B 2UXDF 2C2OB 4J7CA 2QGFB 1UWAA 3EZ5A 1NJYA 4J5OA 1XTZA 4WXWA 1FRMA 4ED5A 2V50A 2KM8B 4U7UD 2B5JA 4ZLNA 4XAKA 3DOKA 3H2LA 1F3FA 1G3OA 3KG4A 4MIBA 5GMKa 4NLGA 2GIRA 2BQUA 1N5SA 2MZ1A 4DPTA 1APSA 2VG6B 3QATA 3M2UB 1HFEL 1C0TA 5HQMA 1Q8BA 4C3LA 4X4TA 5H9EJ 4PAAA 2EKYA 4LFAF 2DNZA 4JI8F 3A13A 4ZPDA 2XCPA 4ILLA 1RI7A 1O5JA 3QMQA 4OYMA 1IKVA 4LF9F 5KFMA 2JOQA 3PEJA 4YN3B 4ZP8A 1RT5A 1MW7A 4I0WA 2YNFA 4CO0A 4X4VA 1GQEA 2OTLS 3KLIB 2DCLA 5F8HA 3AY0A 3TW0A 3DFEA 3FBEA 2Y8WA 1YX2A 4ED4A 5F3ZA 5J1EB 5H1SV 2EFVA 2QL9B 1KN6A 2HGNA 2J7WA 4ZOSA 4AXJA 4IOAQ 3MM6A 2CWXA 2GHPA 3THPA 3W2VA 4B3TF 5KFQA 4J9PA 4DV6J 1D9FA 5E41A 2CNKB 1P9YA 3D6HB 1Y5NB 5KFBA 1HWUA 4ELVA 1MMNA 3GCWP 2XWXA 9ATCB 4CP5A 4CYUA 4DQPA 4DV0J 1IKWA 5B7WA 1YZ7A 2HRUA 2V4QA 1J5EF 1R8BA 4CLZA 2I5JA 2M8DB 1VQSA 4I6WA 4A8WA 2HMIB 1VLYA 5E3AA 3A3PB 5L8RC 3K7RA 5CCLA 2CWKA 1WTBA 3KJVB 2OPRA 3PDNA 3H8YA 2WK4A 1MWYA 1RAFB 1D1UA 1S1TB 2DJWA 3M1VB 1RZMA 4RW6B 4CLLA 2ZKUA 2Z2YB 2CQGA 3FRYA 1F3VA 1IUJA 1SJ3P 3CCZA 2QLJB 4J37A 1ZAWA 3LALA 4F8RA 3QGIA 2JHEA 4EBEA 1IKYB 4QIWD 1VC5A 3HO1A 1CJVA 4IOCQ 1JLFA 1XC9A 1I3OB 1WI6A 3GONA 1NJWA 1Z2LA 2XG8A 5CYJA 4P7VA 2GMLA 3EDQB 4OYWA 3W60A 5IWAF 3IRXB 1NB7A 1LWCB 4KO0B 3KNAA 5BYQA 2AW0A 1T9UA 3R27A 3RGIA 3GE9A 3GMGA 4K5RA 2MKJA 5E3PA 3ZZRA 1VQKS 3IS9A 3TAQA 3DU5A 1TL4A 1Y0HA 2D3OR 3TQEA 1RT6A 3BSOA 1HW9A 3GILA 4QPXA 1WWHA 2OP5A 4JI0J 2IVFB 1U1KA 1NEEA 4K4SA 1FA0A 4B3RF 3AXMA 4EBCA 4ZCIA 2RQKA 3ZC4A 1RHRB 1T95A 1C1CB 2F9DA 4ZVEA 2MSSA 2DCUB 5A2QU 2X1AA 5L1KA 2RQMA 1JWWA 5F3TA 3HP6A 1RHUB 2XZWA 1GT8A 3M4XA 4R0EA 3HZEA 1SXLA 1X9WA 5A8KA 2BQRA 4DX6A 4NWBA 1RWPB 1T9YA 5A0YB 4JI4F 1VBZA 1JLBB 1LXNA 4H4MA 4WU2A 1RAOA 3DRRA 2YWGA 1AZSB 2VA2A 3HI9A 3FSIA 3Q83A 3G6XA 3KHHA 4DSJA 4I68A 3THVA 1QE1A 2EK1A 4HLBA 2YNGA 4ZHRB 1F2GA 2Y1IA 3ISND 1N5TA 3AJDA 2F8HA 4B3SJ 4ZCKA 3G9CA 2F3JA 5I4MA 4WCEQ 4WJBA 5GAHI 1X4GA 4IKAA 2G2ZA 3KK3B 1FJGF 4XPEA 3UE2A 2V8HA 2V5HG 5JXSA 2HNYB 4ILMA 2V8DA 2I38A 5HLFA 3SCLE 5C24A 3Q24A 1T05B 3PRBA 5A6WA 4DN9A 8ATCB 2UXDJ 3QSYB 2DHHA 1NPPA 3U1NA 4ED3A 1XR6A 3TA1A 2PFDA 1Z1ZA 4N56A 1OMSA 3R9LA 3BO2A 3CWJA 4I2QB 3M8PB 1S0MA 4NRUA 2ZD1A 2UVRA 4PUOA 1FFWB 3HJVA 5HMWA 2ROEA 2FD2A 4FYVB 1RSCA 1GEHA 1PIEA 2WVFA 2DGXA 1S6PA 2LA6A 4LFAJ 2GQCA 1RGVA 1U49A 4JI8J 1DLOB 1TAQA 1U2RA 2VG5A 3D0GE 2AYGA 3EJMA 1U24A 2MSTA 1MWQA 2JJ4D 2XHCA 2AJQA 4LF9J 3OXLA 1Q0NA 3C2PA 1EIYB 5ADZA 3DLJA 2WBMA 4F50A 2HNZA 3JQJA 2K2PA 2GHWA 4LIWA 2EC0A 1X4FA 1M5KC 1B0PA 4GVBB 3QIPA 1SC6A 4HL9A 2JFDA 4L75A 3LAMA 1GFWB 4RNMA 1GX5A 4DN0A 3IR5B 3VVTA 3MPWA 3MMCA 1S59A 5KG2A 3R97A 1YRTA 4B3TJ 1X0FA 3TJ9A 4A8FA 3JB9k 2DY1A 4DS4A 3U02A 3IO1A 2RIJA 5DQIA 3D1HA 4TLQA 1TL5A 3CDAA 1SCJB 2XSFA 2B5JB 3DOKB 2DXDA 4AE5A 3H25A 5HK4A 3PVXA 1EJ7L 4C8KA 3TAPA 4JI3J 3AJ1A 5I3PA 1NO8A 1J5EJ 1RTHA 2HKEA 3CMAS 1M5VC 3PNIA 3DLLQ 3PHEA 3J7YI 2I8EA 4UY85 3G8TA 1URNA 1N88A 2E5IA 4P75A 2M88A 2HPUA 2P9EA 2QG9B 1ZTWA 4OYOA 1SKWA 4EGLA 1M5PC 5L46A 3IR7B 3HHDA 2ZBPA 4ICLA 1H2UX 2FJAB 3SCKE 2FTRA 1GMWA 3L7UA 1FNMA 1RT5B 3RG6A 4ANEA 1D8YA 4NPOA 5FLXU 2YNFB 4NLRA 4WFBQ 2X51A 3R5AA 1OO0B 3ZTPA 3OPKA 3W9IA 3EDRB 4KAIA 3GIKA 5E3CA 4DS5A 4O23A 3BSNA 4DDFA 1HBMA 2CVIA 5KT5A 2DPJA 2YNHA 4TY9A 3MM6B 4MKBA 1QUPA 3MCMA 4DV4J 1REGX 2R7OA 3W2VB 4ED2A 1VYAA 6AT1B 2UU9F 3ICLA 2NSCA 5KFIA 1D8ZA 2YKOA 4ANCA 5K5MA 2HWTA 1O8BA 1U8SA 2E7WA 4CYUB 2H4YB 1IKWB 4NYZA 2F8MA 4C6AA 1P6TA 2ZNZA 1LWEA 3DN9A 3S1TA 1FDAA 3BV8A 4V19J 2QMUB 1V9OA 2I5JB 2UV8G 4ZP7A 1FVQA 2NSBA 4NLDA 4M5JA 3O8WA 4CT8A 2J0QD 4C11A 3AQOA 4ID5A 2FVRA 1BWVA 4EWTA 4NLWA 5L38A 3MAHA 3OL9A 2OPRB 1VISA 1AA1B 1VIOA 4NYPA 1FE0A 2KM8C 3UR3C 3DLEA 2AQ4A 3W61A 2K06A 5EWFA 1RJJA 3V2UC 2E1CA 2ZITA 1KQFB 2ASYA 4ZLPA 4JI4J 1QSSA 4JI6F 2NS1B 2SXLA 1NK5A 2VUGA 4LBIA 2I1RA 3CCES 3LF0A 1CJVB 1RKIA 3LP2A 2XS2A 1JLFB 5F8MA 4LBHA 2PFFB 3UVJA 2W24A 3Q2TC 4JP8A 4NL5A 1KBRA 4O4RA 2Z58B 1PJ5A 3D67A 1CJKA 5D78A 1YKWA 1DTQA 2HQFA 5E2QA 3D7SB 2BRLA 1FK9A 1FJGJ 3IS9B 3JTPA 2IMWP 2ADCA 2WB4A 2JFKA 1S0OA 4UT4A 3F73A 3Q8SB 1RT6B 1TKXB 3M2RA 4ZPWR 1SI9A 1U8WA 3NL0A 2M7SA 2QA4G 1N48A 1D09B 1OS5A 1G4CA 1Q7YT 2QRRA 4MKVA 1JJCB 4O4GA 3BGUA 2FC8A 2BQ3A 1RWNB 3IN5A 1OQ3A 4F4WA 3D68A 5CZXA 4J9QA 4NZ6A 3UW1A 4ZVQB 4PKDB 1EARA 1N5QA 1FERA 3LGNA 1YQHA 4A4JA 5A8KB 4LVNP 2NUUG 5E33A 3DYAA 2Q79A 4KBIA 2R7SA 3TUPA 4H4MB 5I3UB 3LGMA 4WK1A 3DRRB 1VIXA 3M8QB 4NEZA 2IRYA 1W26A 3DXSX 4LR8A 2XWYA 4HEA9 2NLWA 4GC7A 1QE1B 2KRBA 1U1RA 4FF4A 4XIUA 1VHIA 4DSIA 4WKYA 3W2WA 3I32A 4KRWA 2IFXA 2V94A 1QAYA 2HFOA 4LF7J 1VK3A 4USIA 5KT7A 2FPHX 1VRUA 1TQLA 5HLFB 3PW2A 4CRJA 5C24B 3D0HE 3N01A 1XR7A 2HS0A 3TOQA 3P4UB 1TUWA 2K7JA 4ECWA 1GH8A 4RU9A 4PQUA 4JI7F 2Q66A 1V3ZA 4OYAA 3CO0P 4F04B 1FWKA 1TK8A 2ZD1B 3EUNA 5B08A 4PXEA 4C8NA 5GAEU 1T9WA 2KG1A 5DDPC 3OTBA 3UI3A 1S6PB 2EVZA 3BGRB 1Q8KA 3UFCX 3E2EA 4LFBF 3GZ7A 1VFJA 3FBCA 3GLJA 4DF4A 3RW6A 2EEYA 3EPIA 2YKQA 4C8OA 2MEWA 1N0VC 1Q78A 2FVPA 4RKUC 3M8ZA 3RBZA 1S6UA 3D1QA 1V6HA 1KNZA 2DH9A 3UQSA 2XYPB 2GQQA 2FLLA 3QSIA 4XDCA 2HIYA 4C2MA 1T02A 2W7OA 3N0VA 2YXLA 3CDWA 4X66F 1H74A 3AOCA 4ECVA 2V2KA 3ISNC 4J9NA 5C42A 2L9DA 2G2OA 4DPUA 3MMCB 3IG1B 3QO9A 2KI2A 1KOOA 4MKAA 2E9ZA 4ED8A 2XY7A 2UU9J 5LSRA 3MEGA 4CCHA 3BF4A 1S1WA 4ITSA 2C3UA 1SH3A 1WOOA 2FJWA 3E01A 4ZCLA 3MEKA 4ECQA 4IR1A 3QIDA 2NXNA 2UP1A 3AB2B 3RBEA 5B0DA 3OBIA 2FB0A 1RTHB 4LRDA 1U4BA 4UOCA 1OYDA 3OJSA 5HJYA 3UNGC 4LRCA 2GAGC 2KDOA 3FZ2A 2A0FB 3DOLB 1U6BA 2WZ1A 4KGXB 4PCQA 3CJQA 1ZM2A 1NDKA 4DUYF 4MH8A 2IC3A 4ICLB 3PFEA 3NNCA 5HQ8A 2JX2A 1PJ7A 4WKRA 3DGPA 2QA1A 4JI6J 3JTNA 5RUBA 5K8PA 3IA0A 1MN9A 1RWOB 1UZHA 1L3TA 3RB0A 2ZH9A 3Q23A 2HQCA 4WPAA 1GMWD 1JNZB 3QJPA 4YQWA 3T1YF 2IVMA 1HNXF 1AW0A 1QUVA 4K4TA 1FNXH 3BN4A 2W01A 1HBMB 2YNHB 2R2SA 4DR7F 3MM8A 1X60A 1S99A 4YB5A 4KJIA 2RDJA 2QYGA 4LQ9A 4PYDA 4O3QA 4RBTA 2DNLA 2J9DE 3KUHA 3BPSP 3S8SA 4MFBA 3U7JA 3PJWA 3AOAA 1CJUB 2V2ZA 3B4MA 4ECUA 2Z57B 5KFUA 3HD2A 2DB1A 2VBZA 5EX3A 3BKUA 4LRAA 1X4AA 2XMAA 3AD9C 1IBLF 1DBDA 3P96A 1KQSR 2N82B 2WSFC 3HXMA 3UN5A 4C11B 2HQIA 4EI2A 4ID5B 2YKMA 5KFNA 3IBFB 1YI2S 1X31C 2VC1A 4B9VA 3DLEB 5LJ5Y 1BMQB 4UOHA 4DL3A 2RHSB 1ZPVA 3HSGA 1OPZA 2IAJA 5DS7A 1PYOB 1GTHA 2KHDA 4NLYA 2X7IA 4F26A 3NEKA 3DC2A 3P5BP 5D4OA 1NDPA 5K14A 1YBTA 2EKNA 3MPVA 4MIAA 1TP7A 1R6YA 3OL7A 5JUMA 5HSPA 1CQMA 9RUBA 1RWUA 3HK2A 3LP2B 1WORA 4Y2AA 2HHTA 3EVWA 3UVJB 2J9EA 3D0IE 4ANDA 4AFFA 3TX8A 4HHHA 4Q2MA 3VAFA 2OELA 7FD1A 1KC8T 2PGCA 1CJKB 3UO0A 3TUZC 3UNYA 1DTQB 1FK9B 1Y7PA 2HWIA 4IRDA 4HH1A 2AMCB 2BE2A 5JJBA 1FVSA 4J9VA 3S01A 4Q0BA 1AYEA 4YDXA 3M2RB 3GQCA 2KJVA 3EXCX 2W7PA 5HJXA 2HW3A 3I6PA 3L09A 2Z2ZA 3H4BA 4YHHF 1IJFB 5CA5A 2JRSA 4LIRA 4CDIA 5DLFA 3K2YA 1M0SA 4M94A 2IHR1 2E1PA 1J5OA 1RP5A 4QU7A 4OX6A 4JI7J 2H54B 1YBAA 2XO7A 3K5MA 1VBXA 2CRLA 3HCXA 3BJYA 3J81j 2J8AA 4J9SA 2EWHA 3DYAB 4DV1F 1FJCA 1VQMS 3WIVA 4ELUA 1UA0A 4QIGA 2HZAA 2MTLA 2ASDA 1X5PA 4PG5A 1TUGB 1ICEB 2DNNA 2EC2A 2R3VA 3ENWA 4X4RA 3M9NB 3VGUA 3AOBA 4A8OA 2HHPA 3W2WB 4C8MA 2EFNA 3ILOA 3TO8A 2MY7A 1RU1A 3GSDA 3T9ZA 5A76A 4X66J 1UWBA 3BGFA 2J6SA 1HBUA 2VBYA 2D74B 4XK8C 3T9NA 5IC6B 3BO4A 1VRUB 3HHKA 4NEYA 5G4DA 5KFCA 3CCTA 2DNQA 3M6WA 3KNGA 5IV4A 2Y0SD 1BGXT 2DHXA 5JVGQ 4P10A 3C3LA 1O0PA 3E8OA 4QYZK 3AAWB 1YWXA 3C8YA 2FHOB 3QGHA 2GQ2A 4PQUB 4BWMA 4LRFA 4N7TA 1RBAA 2OH2A 1JK9B 2HIQA 3OFHA 3MMAA 3RRGA 4KPYA 2FJDB 1PAEX 3BZQA 4K4ZA 1DY3A 3BQ0A 1LFPA 5D0EA 4LF2A 5IT0A 2BANA 3EGNA 2DHSA 5F8LA 3EICA 3LP1A 1NU4A 4NLVA 3LWMA 3H4DA 3MZIA 3OUYA 4QR2A 4QWAA 5KFFA 4DUYJ 1N32J 4QYZJ 3QJJA 2PA8D 3MAAA 3C14A 1UFKA 3A1YG 2DO0A 3GIMA 2G0CA 2V2QA 4X4SA 1OSDA 3BR8A 5C2CA 1S7HA 2GAHC 2PI4A 5ETVA 2RT3A 4DX5A 1RADB 3T6JA 4PQAA 2HAFA 1NK7A 2ZWOA 1RCXB 1TKTA 4ILRA 1NSKL 4RL1A 3FMWA 5C42B 2ZDOA 4AXIA 4DR7J 4NLOA 3QO9B 3T5HA 1Q5VA 1FDBA 3EZUA 2MJNA 3MEGB 1S1WB 3PV8A 1CEZA 3J80Y 3E01B 2ALYB 2VPXB 5KFOA 4FXWA 4NX9A 5KT3A 1U0SA 1X9MA 2HVHA 5DZ7A 1U6ZA 2H5JB 4ZN3A 2KL8A 2I0XA 2RNEA 1Q81T 2B0GA 2DNPA 4DV2F 3IXQA 1ZETA 3BDEA 4TU8A 1IBLJ 1RT2A 1NXIA 5KFKA 1K1QA 4QCLA 2FLPA 1BHNA 3TNVA 2B51A 3DDKA 2BJ8A 3P6YC 1YLXA 4CI0B 4KGVB 4NE9C 1JXEA 4P72A 1ZM4A 1JQGA 4D3HA 2DR5A 3DMJA 2IC3B 2PN6A 5LL6d 1LK7A 2LXIA 4I1TA 1HQEA 2GO9A 4OHYA 3GJTB 1QVGR 1ZS6A 4J9KA 3QT7A 3VZHA 2H65B 2RSQA 2V2VA 1WHVA 5DJBA 5LM7E 2W4CA 1U48A 3LOUA 1AB8A 3Q0AA 2DGWA 1NKCA 1NPRA 3D54A 4MK9A 3ZZZA 1TFYA 4A46A 4RZRA 4C7QA 3CEDA 3ZNUA 2ZVSA 3ENQA 4AUKA 4IQXA 5L9XA 2J9DA 4L73A 4MFBB 1BQMA 1X4BA 3CCUS 1B7FA 2N4DA 4FKXA 3MURP 4YHHJ 3G6YA 1YSJA 2C28A 1VQ6S 3TUIC 3WIUA 1WG4A 4G3IA 3QQCD 1HI8A 5CYMA 4DZDA 1IKXA 1NRKA 3H59A 5KG0A 2P8IA 4EO8A 2QFIA 2YKMB 4K50A 4M5HA 4DMZA 2RE1A 2VC0A 2M52A 3MTKA 1FX2A 2IAJB 4FVMA 3B54A 3B8HA 5HMXA 2VICA 2B6AA 4DV1J 5F8NA 2CNNB 4DQQA 1OWXA 1BLUA 2NPIA 1RABB 2OLWA 5K14B 1I94F 3BN7A 2IA6A 4AQYF 2CVEA 5ITHA 4YB7A 2DNOA 3ENVA 4I7FA 3K57A 1VQ4S 4AL7A 5L9NA 3TEHB 1YJWS 4U96A 4IH6A 2LA4A 2QA4S 3PY8A 2BE2B 2NR0A 4E0DA 4Q0BB 2EK6A 1VMBA 1FTCA 2G4BA 2DHGA 2VV5A 3LAKA 1X5OA 4WFYA 2HFNA 3IM8A 3J81U 3CF5Q 3GIIA 3OVAA 1N6QA 1H2VZ 3PX0A 4W98A 3H0PA 2DK2A 2BJDA 4C97A 2VJVA 3ENAA 1J5OB 4YB6A 4MIWA 4BS2A 2GJIA 2BX6A 3EWGA 1RBLA 3QT5A 4CT9A 3PYEA 2MKCA 3FZBA 3K5LA 4YR0A 2OSRA 3CD6S 2N4CA 3QFWA 3TR5A 2C2EA 5KG1A 2ATCB 3V4IA 3D9BA 3PIOQ 4DV3F 4NZ0A 2EFGA 2EFQA 3SMZA 3Q86A 3NP5A 5K8NA 3PW4A 4DR2F 2FJEB 3HFVA 3M9OB 3MPUB 4KR0B 4ECXA 5CYQA 2R42A 1UWBB 3N5FA 3E51A 2PE8A 4J9UE 1TL1B 4WWSA 3R7SB 1MNEA 1H7WA 1U02A 3CCMS 5C25A 3FDSA 3FEYB 3MPDA 4RUBA 3R2DJ 2QMWA 3K89A 4FNHA 3M30A 4R0JA 4M95A 2MY8A 4OQJA 2B9WA 3VR1A 1ZAVA 2Q6CA 1B64A 3NKYA 1MLAA 2MKIA 1VQ5S 3MD3A 3KJFB 3MMAB 2ZH6A 1RAAB 1NJZA 3AJ2A 3GIRA 3GV7B 4F36A 2XMJA 4DV2J 2ZWPA 4X4NA 4LF8J 1UVLA 2AX0A 2BANB 3RJMB 1WSVA 2V8VA 1IBKF 5B0BA 3LP1B 2ZZNA 4PABA 5DGBA 3OUYB 3EGZA 1NK9A 2J0XA 2ZKTA 3OR1B 2J0WA 3N6LA 3MAAB 4QOTA 5C7PA 1O51A 3C14B 4N47A 3G86A 4OIXA 2ILYA 2XMMA 4OLPA 1FESA 2AJ2A 2PSZA 5KFAA 1K47A 2ACMA 1RU2A 3DXBA 1S57A 4NA1A 1FEHA 1NKEA 1TKTB 4K8RA 3CCRS 2F8EX 2MQ8A 1TVRA 2ZZTA 2OPSA 4WXOA 2V4RA 1BXNA 3DOMA 2KVQE 1Y4ZB 4U7UK 3PW5A 1A6LA 4KE5A 1NM2A 4OJHA 3HT3A 4JV2A 4DG1A 1L3KA 3FEXB 2PO4A 3ONQA 2CPYA 3Q22A 4NLPA 2HNDA 3GU0A 5ETSA 3C6UA 1RT2B 5CQGA 3HX9A 3GG1A 4Q7AA 1FNOA 3HSDA 1WSRA 2HHQA 2XI2A 1NLKL 4MMOA 3W1YC 3RAQA 2LFVA 1U1OA 2DVIA 2CQ3A 3N6NA 3R6GB 5DQGA 3DMJB 1TR0A 2JVRA 2NUHA 5HROA 2Y1JA 2YBVA 3QGPA 5LOQA 4ZPCA 2RU3A 1HL6A 3BYRA 1CS4A 1HQEB 4N8OA 4ZN1A 5D4NA 1HHQA 1I94J 4UOFA 2E7XA 4AQYJ 2PC6A 4C8LA 4ZIVA 5T14A 3OR2B 1WEZA 2L9NA 5F0UA 1P9QC 1KQKA 3NOCA 2CPIA 2NCKL 4DLEA 2E1MC 2UVVA 5GMDA 1S12A 3JAMY 1F60B 3KHLA 5KFGA 4ETXA 4FBUA 5M2RA 2MZJA 3ULHA 3W65A 3DLBA 4IH7A 2JEJA 4C0HA 4MAKA 2VPWB 3TP2A 2YWKA 1BQMB 3EYZA 1KOHA 4K5SA 4DFPA 4N41A 2HYIB 1RLDA 3THTA 4CLWA 4AL6A 1Y9OA 5IT9Y 3VAIA 3VTIA 4AYBD 3H7HB 1NSQA 2DEJA 3LGHA 5CYMB 3EPGA 5J2QA 1IKXB 1Y5IB 1HI1A 3J7YU 3MCNA 2YTCA 5KFWA 2DKOB 5KFLA 3QAUA 4ZVUB 1S79A 4OYIA 1NSPA 3ZFVA 4FF3A 5KFJA 1ULRA 2UUCF 5LXRA 2CAJA 2B6AB 4JI1F 3ZTQA 4DV3J 3NGTA 1VBYA 3VAGA 2FYXA 5KG3A 1KLMA 3BGOP 2O3DA 3QZ8A 1S48A 2N7CA 2L41A 1F5CA 5LXYA 4YOEA 3LQVA 4DR2J 2AJ0A 3PRVA 3UCUP 1SPBP 5MAOA 2DGQA 2YKNA 4I7FB 1U1LA 2O5DA 3AHPA 1MG7A 3EZOA 4KT0C 5DO2A 2YX4A 3GWCA 2Y3YA 1WDDA 3MXHP 5A8RA 2GIFA 3D3CJ 1HD0A 4K59A 4KB7A 5B0AA 5IV3A 4BDPA 1NUEA 2HS3A 4E2FB 3WZ0A 1PILA 4OI0A 1RHKB 3FQKA 5ETRA 1RHQB 4DQSA 2VH7A 4RW4A 5CHCB 3FSYA 2UVWA 3KJQB 1N6QB 4GKJF 3PKMA 3BYPA 4TN2A 4YB1P 4HTJA 2DEIA 3M05A 3TQ1A 1RB0A 4CNZA 3IM9A 2YY3A 3HHLA 3PG9A 3J7Z5 2N3OA 3GJSB 2B56A 2IJNA 2B43A 4Y3CA 1LV5A 5KFEA 3FC9A 3QLHA 3R5CA 3TRGA 1B99A 4CIOA 4WTYA 4ZPBA 1IBKJ 3MR3A 2UXBF 3SYZA 3V4IB 2VQEF 2ZC4A 1LWXA 2UUTA 2IY5B 2RB7A 2HZCA 3T3FA 2GMHA 2HLTA 1K9MT 3MM7A 3CJ5A 5AE2A 2IVYA 5LMUF 2XEXA 1AXQA 4NASA 3CW2C 4OX8A 5CYQB 3W8PA 2V8GA 1R89A 4PZVA 3EVOA 3SQOP 2K8GA 1S7IA 3R6LB 2BV3A 3N5BA 3X1LB 2KHCA 5C25B 1FEEA 3D28A 2MHNA 1U7LA 2DNKA 2E9TA 1FD8A 4DL0C 3VALA 3I5CA 2OMOA 3IBWA 1T05A 2BJ7A 3O6QA 5AXMA 3D1OA 3R8YA 4DX7A 3M30B 4Y28C 1UAWA 3CDEA 1YJ9S 3D6FB 2WAQD 4RNOA 2COLA 2H51B 2IIHA 4CLPA 1R8HA 2W1BA 2BVZA 4DSKA 1K8AT 3NCQA 2YQ1A 3QWUA 1M1HA 3Q8RB 2VKZG 3CULA 2IM0A 1VQYA 1WF1A 3TI0A 1WKKA 4JYAF 2P9GA 2ASLA 1KR4A 4MT1A 1SJ1A 1JLCA 1PSDA 3OV7A 4F7VA 2BACA 3NAIA 4BLGA 2CADA 2QL7B 1CLFA 2C2DA 4B17A 2HQGA 2Q43A 3V6KA 2HZVA 4UUXA 2GZOA 5FJ4A 3A8IA 2DNYA 4X4PA 2KYZA 2LXFA 4DL2A 5BYRA 2F63A 2HLUA 1SJFA 1PBUA 4QW8A 5FDLA 2OUGA 1X4HA 1M1GA 1N34F 3G8QA 4J9OA 1TVRB 2ZH4A 2OPSB 3P8BB 3HM9A 2CJYB 3QZ7A 2IYGA 1RE1B 3DOMB 4IO1A 1W7WA 2EFOA 2I2YA 2C1EB 2HHVA 1UPMB 1FF2A 1QD1A 4JUZA 3BGLA 4DCJB 3AD8C 4DG1B 5DG8A 5D4PA 1VOMA 1S76D 2M0GB 3GCXP 2GW8A 3SBMA 2HNDB 2OFHX 5EGYA 3C6UB 4C4WA 1RT1A 4MK7A 1RWVB 1JMTA 3R5JB 5CABA 4DSEA 2VU5A 4NI2A 1DARA 5AT1B 2KB2A 1H6KX 2X3DA 3MI7X 3CDBA 3SEOA 2GVDA 2OD4A 2HURA 2UUCJ 1HWIA 5HROB 2QLWA 1M1KT 1FRIA 1UCNA 4QPTA 1RAJA 2ZHBA 3N9UC 2QZ8A 2XHWA 2D3ZA 4JI1J 1CVJA 1CS4B 4R25A 2RH3A 4MYTA 2M9KA 2DR9A 3HMJG 4BHQA 3FCVA 4FYYB 4UY8T 3C6TA 4EUVA 2FVCA 3G4SS 3EGWB 2RRBA 3WX4A 1WI8A 1ZH5A 3QPIA 1ZA2B 2KZMA 2A6MA 4DPWA 2B9XA 2JC0A 1PYSB 3ADAC 3V6JA 3V6HA 4QJVA 1UVMA 4U7CA 2AP6A 1R3NA 5KG5A 2D9PA 4FNIA 4ECYA 2BW7A 4GMKA 4URQU 1G6BA 3FMBA 2VDHA 4LVOP 2QLXA 5B0EA 3D5MA 3OVBA 2XZDB 2HVIA 1CQNA 3ILIA 4PPDA 4JI3F 5A2QY 4GKJJ 3DRPA 2VPYB 4QWCA 1PAUB 1WHXA 4PXBA 5J2QB 1P1LA 3O2IA 3R1LA 3VAHA 2BOAA 3UPFA 4AT1B 1V3RA 2NXCA 3H40A 3SZ2A 4RWXA 2ILZA 4PG4A 3I4HX 2IM2A 1TFWA 1XEZA 2GGPA 3JSMA 2LQ9A 4HI2A 4ERDA 3PYGA 2W2OP 4GC6A 4ZP6A 4C0OC 2AZ1A 2MJUA 2HWHA 2UXBJ 2VQEJ 2F4VF 2HRTA 1KLMB 4HHUA 2KT3A 1YJ7A 3U27A 2RJZA 4LF6F 3IGVA 2OTJS 4Q8FA 2ROGA 5HL7Q 2VFVA 4I4BA 3CMQA 5LMUJ 3LANA 1HNIA 2AEMA 2YKNB 4F4AA 3NWGA 1GXTA 1YJUA 4CO3A 4FP9A 2APOA 1IWAA 1CJTA 5A8RB 4CO1A 4QR1A 4RR5A 4DV4F 1KSPA 2ZHOA 5EN1A 1F9EB 3QBCA 3TVKA 3OQ2A 5M2PA 4DL7A 3KK2A 5F8JA 3QGGA 4CWBA 3BDPA 1KP6A 2Z30B 3T5LA 3W9JA 1TKXA 1NHKL 4RW4B 3WX8A 5KFYA 2F65A 3PR5B 1AUDA 2C2MB 4AL5A 1LXJA 1S10A 4F0HA 2LEBA 2FHMA 4E8UA 4LSLB 4FXVA 1JJHA 4CH0S 2QJ3A 3SSQA 3HHLB 1UW9A 2K7KA 2EBGA 2ERRA 5GAEI 2OD6A 2XLIA 2NPFA 1ZPWX 4IFVA 2FY1A 2P9CA 3QLHB 1URRA 1NDCA 2ZC3A 4O0NA 4YMEA 3ZZPA 4OX9J 2Y8YA 3HHLD 4JYAJ 2R8JA 2D69A 2YX7A 1FXLA 1T3OA 1Q82T 3M7VA 2GCFA 4LBPA 4MYUA 2EXUA 1FCAA 5I3UA 3CUNA 4F0KA 3EMTA 3HLUA 1N8RT 3MM7B 1SIZA 4BWJA 3M8QA 3ZZYA 2XNQA 3CIMA 3ZNJ1 4FS1A 4HDHA 1U0HA 3Q2SC 2XMKA 2FHJA 3K0JA 4X64F 2VDIA 2BXJA 1GXUA 1Y3JA 3P5TL 2MXYA 2IMOA 3NS5A 2DT9A 5D8HB 3FQLA 2R7VA 2OIHA 1N34J 5ETQA 3KK1B 1KRPA 1Q8IA 1UPPA 3W5XA 4ZJLA 3MM9A 3DDNA 2L48A 3US5A 3HJFA 2X1BA 1S49A 3L4BC 3MAQA 2HGLA 4FYWB 4JBCA 2E1RA 3KMQA 2CDQA 2XM3A 3NS6A 4TYAA 4X84A 4NRTA 5KFXA 2LU1A 3MR2A 4HT5A 1N4LA 3DLGA 2FVSA 4CNYA 1DQ8A 2JL9A 5D0RA 2Q6BA 1Y00A 2XTJP 3GV8B 4AD6A 1FKOA 5B09A 2RS8A 3MCSA 4PPZA 4B9SA 1G2EA 2AEJA 4DWIA 1D3WA 2G1DA 3ZZTA 4P74A 4WE1A 4V19X 2YQ0A 1OJ4A 2MZSA 2CQ2A 5L39A 1JLCB 2NYIA 2DITA 2R7RA 2W9CA 3BGRA 4ZVSB 3NGKA 5FLXY 4C9DA 4UF4A 1VBKA 2XNRA 4UZCA 2GJ2A 4C48A 1S4FA 2QT7A 1RWWB 2XYHB 1VK8A 1EQMA 3I82A 3SI8A 2AU0A 3LW5C 2W8KA 1N5YA 1N52B 2ZVIA 8RUCA 4QYRA 1RT4A 4F02A 1GAOA 3KLFA 5FDLB 5M2UA 2X3GA 4LF7F 4ZKAA 3GV5B 4L72B 2CJQA 4P7TA 3DHXA 2NYHA 2DO4A 1WD6A 2U1AA 1NCLA 3V6DA 3IG1A 1SC3B 2VBWA 3W3SA 4YDDB 4G1PA 1SJQA 2I6WA 3KJNB 1FRXA 3MPYA 2BR0A 3Q8PB 1NHUA 5E7OB 3SV3A 5E3QA 5ETTA 2L08A 4WYWA 4ZVRB 4PWWA 2ZZMA 2G13A 1RT1B 2ZUAA 4O3RA 1U1MA 1FT8A 3MR6A 3G87A 3LWLA 4DV5F 4TLRA 2BYCA 3EX7B 4NCAA 4A47A 3R3TA 5ETOA 4NI2B 2BBEA 3DOLA 2E5GA 4OZ0A 2GVDB 2QL5B 3VAJA 4OFZA 2VFUA 3FJ2A 3NAHA 1RA6A 1CG2A 2HVDA 3IMQJ 3I56S 2V34A 2C2RA 2NXEA 4H4OB 1HQ2A 4J91A 1YITS 1H3DA 4H4KA 1HMVA 1HWKA 1TUVA 3UWTA 2F4VJ 2XYGB 3VAKA 2H5IB 1U1QA 3TARA 3CJKA 2WB1D 4RU2A 4ZPVR 3LH2S 4LF6J 2CZ4A 3C6TB 4RW9A 1T9XA 2F40A 3DRSA 2OEMA 5KT2A 2QFJA 3CSKA 2EFPA 1FFSB 3HVWA 4F4ZA 2V0NA 3CMES 4ES3A 4NA2A 3R2CJ 3T1AA 1R8CA 1YRUA 2OJ3A 2VBXA 2IYIA 3ETMA 1LK5A 1TELA 3GYNA 3POTA 2DNMA 2MMYA 2BJ3A 1QM9A 2J8SA 3AFGA 4ZMMA 1SL2A 3OTOF 4WZQA 4USVA 1U45A 2KT5A 3OVSA 1BQXA 3MTJA 1CJUA 2BUNA 4ETZA 3DRPB 4FBTA 2BABA 3T5KA 1F6TA 2E7VA 3RBXA 4N5SA 1WEYA 5F41A 1T0TV 4UTGA 3M8RA 1S1XA 2DD8S 2MQMA 2MQLA 2MLYA 3FKBA 5GADU 1Y10A 4JI5F 4UW2A 4ZCMA 2Z2LA 1QTNB 1IBCB 3RB3A 2ROPA 1NZ8A 2Z0GA 2ZJPQ 4FYXB 3OLBA 2BRKA 2GGPB 5D6GA 3JSMB 3TZZA 3CCLS 4CLSA 4OYBA 2BOPA 1Q95G 4RUAA 1MN7A 3KXDA 1YJRA 4S0MA 3ZZOA 3H90A 1UEKA 4JV1A 4QWBA 5E0OA 4HACA 3NCRA 4UUWA 2J76E 3CB4A 2E29A 1RT7A 3W5YA 4M5KA 1B4SA 1HNIB 3PCOB 4ZP9A 3MDFA 1FRLA 3G8SA 2V9KA 4X64J 2HQ3A 2NZCA 5DETA 3G6ES 1KWMA 1CJTB 5BXIA 2XB2D 4MJKA 2MYFA 4QWEA 2W4DA 1FXDA 2RD5C 2CPXA 2RUGA 1KFSA 5K8MA 2VOPA 2B9EA 1ZM9A 2ZEJA 1VQOS 3KK2B 4IO9Q 5AJ3F 5DGAA 1RUSA 4OHZA 1N0UA 1XBWA 2RRAA 2IBOA 1IQTA 3H5YA 3IBCB 2EG2A 2LYVA 2JVOA 1HQUA 5MLCV 4KYZA 1DJ0A 2QMXA 2YVSA 5AXNA 4HYKA 3S7RA 5DDQC 1WG5A 1QJHA 4HHJA 2B7BB 2M4MA 4IFVB 4ED0A 4C0BA 4IOBA 4CLUA 4Z7CA 2KN4A 1GMUA 5GAGU 1YDLA 2OPQA 3QNWB 2XY6A 2MQQA 3GR1A 2M3DA 1S77D 3BKTA 1A7GE 2HGMA 4DF8A 2RDDA 1RAHB 5ETNA 1YHQS 4XDDA 2LQBA 1U0HB 3W9HA 1YIJS 3NGRA 3WBZA 1RT3A 3F56A 2FY8A 4LMZA 1GK8A 5IOLA 3UCGA 4B9TA 4ECZA 4X4QA 5EUHA 3TJAA 1X4DA 4C98A 1JLEB 3FBFA 3FGVA 4RPFA 2KTQA 3RYLA 4O3OA 1WC5A 3HFKA 2FHJD 2ZM6F 3UN2A 4ZVOB 1K73T 1M5SA 2ZHAA 4LJMA 4DPYA 3MM9B 3PX6A 6FDRA 4IG3A 3NOGA 1B0TA 3L3CA 1FO1A 3KHGA 4IFYA 1RISA 2ZH7A 1CBKA 3BBBA 2CUYA 4D3GA 1PG5B 2DRAA 1HYSA 1WHYA 4USWA 5CXTA 3DI6A 2AT1B 2DGUA 1IN0A 3ZTSA 3DHWC 1K0TA 2G0JA 4YS2A 1MMDA 3DLGB 1RWXB 2W4PA 4ES1A 1RTZA 2L3MA 3W66A 1FKOB 3MUMP 2W9BA 1T03A 2DIUA 4DV5J 2WOMA 1DTTA 4QU6A 2A1BA 2D3UA 2D3O1 2MGZA 4X2BA 4EYHB 4WE1B 3TEGA 3I5BA 1SQGA 3PHTA 3OJUA 4MKYA 3P3DA 4OI2A 1O6XA 2W9CB 5A8WA 2D7SA 2KU7A 4W92B 3G6VA 2Y9HA 2HHWA 5JMNA 4TU7A 3HHLC 1HPZB 1WC3A 2GS8A 4B9UA 4O3SA 3DCAA 5EWGA 4PG7A 3UD5A 3RW7A 4CO4A 3BO3A 2LECA 4Y2IA 3C66A 2Z56B 3OT9A 1FXRA 2AX1A 1ITPA 3OFEA 2ZOMA 2C22A 5I3QA 1N5YB 3ILLA 2WHOA 2CNOB 3NS7B 2FLNA 1K44A 1RT4B 1YK9A 3PW0A 3EE3A 3HVAA 4NLXA 3KLFB 4XO0A 2WVDA 3B6BA 2EI5A 3HSZA 2RF2A 4Y0FA 2XMTA 1LQ9A 1IQZA 3V6DB 4W4MA 3WQPA 1S9EA 3FUYA 2V69A 1E6YA 1YJTA 2H4WB 8AT1B 2RILA 2IJFA 3OW2R 2RAQA 5K9FA 5HI7A 2R7XA 4MK8A 3OTOJ 1RKJA 2FVQA 4M5NA 4TVAB 2G1HA 2FZCB 4U8VA 5LSLA 5KFHA 3C16A 5HMZA 5IZHA 1T9TA 4IDKA 2XBPA 3BS9A 3HVRA 4JI5J 2A2CA 1EX8A 3D4JA 4GO5X 2HRYA 2W7AA 1EETA 2ZH3A 2C3YA 2DH8A 2ZOFA 4ZPAA 4RUHA 3PYDA 5T41A 1KD1T 1S9FA 1TKDA 3TZYA 3DDIA 1N32F 3JYTA 5J2PA 1WTFA 1HMVB 4J9LA 3MEDA 3T1HF 4ZJOA 2LXUA 4IUFA 4WBFA 3NNAA 3WDOA 2ASJA 3MECA 1BC6A 4U67Q 2DPIA 2P2CB 3R7BB 4NCGA 3CJKB 2XGQA 3CPWR 4E98A 3M6VA 4RW9B 4HDGA 2IM1A 3DRSB 3AD7C 2PA3A 1HW8A 2CG4A 1IM6A 3I96A 1ZYQA 4EBDA 3CGIA 2PMHA 3QT6A 3L7OA 5LT5A 1HWLA 2ZBCA 3NRBA 1CULB 1UA1A 2O1PA 1F9FA 2VOOA 1SC1B 2ADBA 1WKJA 3POTB 3K59A 2HK2A 2K3IA 4OZJA 5AJ3J 3DRYA 3RR8A 4C8ZA 1WHWA 1RA7A 2HK3A 3ISZA 1JLQA 4OYPA 1KTVA 4QIVA 2DGSA 5DG9A 2R4FA 4CLKA 2DGVA 5HN0A 2RDIA 2HAIA 5EWEA 1U09A 2QE5A 4P6QA 3HHNB 2BE7D 2LP4A 4IG0A 2XULA 1S1XB 2O66A 5K8OA 2EW9A 2CPHA 2VG7B 2CIMA 4ZVGA 4IQMA 3TYTA 5CZVA 2P5VA 3DNCA 3R7NB 3GYXB 4GRSA 4FDFA 3TUJC 3OHBA 3HKWA 5F9NA 1XNRF 1DQAA 3MOZA 2IRXA 4B3OA 4P52A 2J5AA 2DNHA 1R8PA 2YH1A 4HACB 4CLFA 4LSZB 3JS9A 4DQRA 1C1BA 2NZ4A 1RT7B 2QYCA 2XS5A 1NK4A 4RLEA 2CQIA 2ATLA 5L1LA 5L1JA 3HVTA 2DTJA 4YY3F 1Q7LB 1VS3A 2R8KA 3R1HA 3GFXA 4QZVB 2VASA 1QVFR 3HKZD 2CQ1A 3NGUA 5ETMA 2ZM6J 2H1YA 3HZGA 2AIRB 3MFIA 1KQGB 3J7A1 1QSYA 3ITHA 4G1QA 1F5AA 2ZBQA 3Q8UA 1HQUB 4Q43A 3AA9A 3M2VA 2J6UA 2HHSA 4DEZA 5BR8F 1OPIA 4NYOA 4OZ1A 4Z37A 3IAS9 1CSJA 1VGYA 2PMWA 1PJ6A 2BKOA 2YKAA 1FFGB 4L3KA 2CJAA 3IWXA 2OPQB 1NMEB 1FWPA 3PKYA 5IM0A 1T7PA 4M5MA 3BBFA 4ZS6A 5DQHA 4JOUA 1F2HA 2DH7A 4OI6A 3H2UB 1JLAA 1N56A 2Z8QA 4R5PA 4ELTA 2AZ3A 1VI7A 3B82A 1JXVA 4QR0A 2G2YA 2GVZA 4P2FA 1RT3B 1RTJA 1Z4UA 1UL3A 4H54A 2HBRB 3H98A 7FDRA 3KMSA 3MM5A 2MZRA 3T5JA 4DR5F 4PXCA 2EPIA 3T19A 3SCIE 1TL1A 2GHVC 1FD2A 5HQLA 4IG3B 2B4PA 4HR2A 1F9HA 4IFYB 3V5RA 2HQDA 1WC1A 3TVZA 1TK5A 3KLHA 2JZ5A 1HYSB 3DI6B 1S0VA 3PXGa 1EHWA 4KH1B 4ALZA 2RQCA 3GYGA 1YVFA 3BPDA 1WELA 2WONA 1IR2A 2W9BB 1T03B 4EMDA 1UTAA 1PBAA 2WOMB 1DTTB 4RBVA 4M8LA 3F41A 3I5AA 2MGZB 1FDNA 3NCPA 5AE1A 1FRJA 4K2XA 4EFAC 5J1PA 3OL6A 4EU0A 3DLKA 5L1IA 3H42A 5A8WB 2VJUA 4KGKA 3BBCA 5EDWA 3KWMA 4O0IA 2J0SD 2LVWA 2BJ1A 4URSA 2MB0B 3NXZA 3OR1A 3K58A 5B0CA 2LQ8A 1N5VA 3M32A 4K4XA 3T1HJ 2XCAA 4ECTA 2MKKA 1NKBA 1HNWF 5KTQA 1PGZA 1HR0F 2RS2A 1S6OA 3BSCA 2Y1RI 4DCOB 3OTCA 1KVKA 4Y2MA 2KG0A 2CYYA 4LF5F 2VFTA 4I67A 1NSAA 3CJTA 5KG6A 3ZZUA 4DPOA 1QAXA 1WC6A 3OSPA 3FCWA 2AD9A 2XC9A 1M5HA 1RTIA 2RF2B 2BMBA 4ZVFA 1QAIA 2KKHA 1RAIB 1S9EB 4ZIWA 2BM1A 4OX7A 1E6YB 1H38A 1VHFA 1NK0A 1IR1A 1HNZF 1ZAXA 2CDRB 4ER8A 2LQJA 2BEFA 2CPFA 2IM3A 4RJVA 1C0TB 4BCAA 1QY7A 2V4JA 3PZPA 4WP9A 4CO5A 4KHMA 1VQPS 3C16B 2ZH5A 1R27B 2IDEA 4LF8F 4IDKB 1S4EA 5KFDA 2IA0A 4USTA 3ILJA 4DFKA 1EETB 4F3MA 3PR4A 1OSCA 1IKVB 2CJ9A 2FGOA 1VDHA 1DQ9A 1XNRJ 3OFFA 1FJEB 2YX1A 1UVIA 3X3UA 3JYTB 2UUBF 5J2PB 2VZ9A 4ZLJA 3MEDB 2EG1A 1SC4B 3ET6A 4FVCA 2X1GA 3MMBA 4PEOA 3MECB 4ECRA 4F3OA 4GVLA 5KT6A 1D0EA 2W2QP 1E6VA 4NCGB 2XMVA 1BY9A 3TA2A 1NK8A 1R43A 2VB6A 2ZJRQ 3UD3P 2YKPA 3CJ0A 1L3SA 2E44A 2MDAA 2QTWA 1XQIA 4ZPTR 4U6PA 1PYTA 4YY3J 3OR2A 1K0VA 5IWAJ 1LKZA 1U47A 3KG1A 4GKKF 3MHYA 3DRXA 4IR9A 1VQ9S 1FKPA 2ZH8A 5KT4A 4N76A 3UDCA 2LCWA 5DDOC 2AKWB 4NZ7A 4X62F 2ZOGA 1EZZB 3M8SA 4MTPA 3J81Y 4ZVPB 2OEKA 3TAMA 3KFWX 1JLQB 1FRKA 4B3RJ 4JV5F 2AEFA 3MEEA 2DY9A 4NLSA 3N4WA 2KXNB 4DFMA 1Q16B 2LDYA 4U95A 4IG0B 2DRDA 4LFCF 2HG4A 2CPJA 1EKSA 3OTEA 3H2VE 1LW0A 5BR8J 4ZVTB 1Z2ZA 1XIQA 4F0MA 3G2XA 4FPIA 1IXKA 1DURA 2PI5A 5DM6Q 2YNIA 2C2KB 1S97A 3UDEA 3QYYA 1G1XA 2DYAA 5J2NA 5HANA 5SZTA 4B3OB 5D4LA 1I51B 1ZZFA 4NLQA 3K17A 5KG4A 2MZTA 2PDAA 4K2JA 1LOUA 1T94A 2A2DA 2QSFA 2UUAF 3CO9A 1C1BB 2BDPA 3IWLA 3BEGB 1B3TA 3HVTB 2H9ZA 1EKRA 2BKNA 5BJRA 1HARA 4N8NA 1FX4A 1QAJA 1A0OB 4H4KC 1RWMB 1I5OB 5DZ6A 2M70A 3BQ1A 4K4UA 4NXMF 4DR5J 3N79A 2KJWA 2A18A 5C2GA 3KOAA 5F0WA 2RHQB 4M5IA 2XQCA 2B8QA 3RUBL 3SCJE 4TQRA 4JI2F 3ITHB 1KVJA 4OZ3A 3BM7A 2IBKA 4OZNA 2YWWA 4G1QB 1N33F 1FJ7A 2B4OA 4NXNF 3KLEA 3M2VB 2QX0A 3O5TB 1SVDA 1XJWB 4OZ5A 1XMOF 1SKRA 1C0UA 3BH6B 3I31A 4PXDA 1FDDA 4DOZA 4F67A 1GXLA 2LU2A 4L6V3 1UVNA 2E1AA 4F2RA 2R7QA 3RU0A 3JQMA 1UVJA 4A8YA 2VODA 3OXGA 5LSOA 3KTQA 4B9LA 3JSRA 4DPXA 1R31A 2CZVC 5IM0B 4HI1A 2O67A 4I56A 1FRHA 1S9GA 2N3LA 5THWA 1X9SA 4Y2CA 1JLAB 3TZXA 2YNGB 1NH8A 1EQ0A 4R5PB 1PO6A 1XMBA 2WRMA 4DR4F 1XN9A 3RAXA 4O44A 4ZK7M 3J7ZT 1RTDA 2OPPA 2GVZB 1L5UA 1RTJB 2CQ4A 4OHXA 1HNWJ 3Q8QB 5G0RA 1HR0J 1TTHB 3IGNA 4OI3A 2H3EB 2FQQB 1R0CB 1WUUA 2VL1A 3MWBA 3CJ2A 3MM5B 4FPRA 3HPOA 4F3QA 4KFBA 2VQFF 2WTFA 2HHHF 4KGZB 4LF5J 2Z4PA 1S1UA 1S6QA 5KAKA 2JLGA 1D9DA 3IFEA 4OZLA 2R7TA 2C3MA 2POKA 2CPDA 5F8IA 4WIQA 2W8LA 3G71S 2AJ4A 2HFSA 2VHGA 4LSNA 3KLHB 3PACA 4EEYA 4ATNA 3RB4A 1UEUA 1VLOA 2CXEA 1VQNS 1HNZJ 1YZ6A 1NB2A 3FRZA 3GB0A 4DR1F 2IDLA 4CO2A 3CTRA 2W25A 4QQBA 3AB4B 3T6BA 4DJBA 2R2RA 2WONB 1R7IA 3AQPA 2FJXA 3KLGA 1EP4A 4PUOB 4JV0A 2AGQA 2V67A 2FLOA 2QA2A 1P1TA 4C8YA 1HWJA 4B3MF 4ECSA 1K1SA 1KKHA 3BSAA 1JKHA 1EB0A 1OY9A 5AXKA 3Q8VA 4FF2A 2WVCA 4DQIA 4KIAA 2VG5B 1TL7A 2ZBIA 3VV2B 1LFWA 3DLKB 4OL8A 5SUHA 3HSJA 3GR0A 5DRKA 3QAEA 2R8GA 2GMJA 2UUBJ 3L95X 3WC0A 4IYQA 3UDVA 3M32B 3VVUA 4CTAA 2HNZB 5ETLA 2J6TA 1ACMB 1HIYA 3SFGA 1JJ2R 3TVYA 3BR9A 2CQDA 3KG0A 1HBNA 1IM4A 1U1NA 1FHTA 3D6TB 3QIPB 1VQLS 3KYLA 2YWFA 2BJ9A 3IR6B 3W5ZA 5GAHU 5E3RA 2W2PP 4F25A 2H5EA 4GKKJ 1V3SA 3I55S 1RTIB 1HBOA 4P2SA 2RRNA 3GFHA 3CD7A 2F7VA 3CD0A 1RYSA 1DFDA 4QBUA 2RU9A 3CC4S 1JLGA 5F9LA 4X62J 4ZVHA 2XMWA 1LWFA 3TANA 4PRFA 3PJXA 4WFZA 1GX6A 3K5OA 3W62A 3AXKA 4J9RA 4UOGA 4JV5J 2LLZA 1T3NA 2BE9B 2V4JB 1UVKA 1JNRB 3UDLA 4RW8A 2HEKA 4LFCJ 4NMXA 2OMLA 2W2MP 4UQGA 3PO5A 3QRQA 4KV8A 2NXJA 1IWGA 3OLAA 1CPZA 3KUGA 1QLNA 3BQ2A 1AT1B 3SSSA 4BBYA 3AA8A 4Z2XA 1DZ5A 4B9NA 4OHWA 4WIIA 3S6EA 1W2IA 3F0NA 3ET6B 4TQSA 2OFGX 2XLJA 3MMBB 4F4XA 3I0RA 5FIIA 2KRRA 2R8IA 5U47A 4BC9A 2UUAJ 1E6VB 1HA1A 3FEZA 2LKZA 2CPZA 3SFUA 3UR0A 4LR9A 1Q8LA 2FZKB 1WDTA 4O3PA 4FF1A 3SDEA 1KONA 2J9CA 3PIPQ 2R9LA 2E5LF 1FKPB 2IPOB 2MKHA 4Y65A 4KY3A 2QLFB 1RAGB 1WF2A 1WC0A 1FE4A 4NXMJ 4FXDA 4OJGA 5CCMA 2A3JA 4DU8A 4RWWA 3TAMB 1LWEB 1SKSA 1UJ6A 2BKPA 3CCWA 4LF4F 4JI2J 3MEEB 2HHUA 1MSWD 1N33J 3ELHA 3V81A 4WZMA 3CT9A 4NXNJ 2JH3A 1QTMA 4XPCA 1RLCL 3IRWP 1LW0B 1R0BG 4RBUA 3G96A 4FZVA 1UW4A 1XMOJ 2PEBA 4RNFA 1SB6A 1YRXA 2YNIB 3NGDA 3OXFA 2C2ZB 3A3OB 5J2NB 5HAOA 3QT8A 4PG8A 3F44A 2I9SA 1S1VA 2HVZA 1RXOB 4USHA 4IRKA 2DXEA 1NAQA 2ZH1A 2CQPA 2JC1A 2PD1A 3CJRA 5C5JA 2RUSA 4A8QA 4I6YA 2JNJA 3I9ZA 5FD1A 3K8WA 4KKOA 4BC7A 1SJ4P 2VF3A 5A6PA 4DR4J 4OYXA 4CH7A 4L3NA 1V5IB 3TA0A 5KG7A 2ZJQQ 4L74A 2PMZD 2G0IA 1N36F 4CZCA 4M5LA 3OSNA 4P2MA 3RTVA 2GX8A 4K0KF 1Q86T 4PG6A 4WU3A 3C19A 2VQFJ 2HHHJ 3EM1A 5D3GA 1ZBTA 3FFIA 4DR6F 1JXLA 1ZZNA 2FHKA 4QIEA 1SUQA 4M5DA 4K4VA 1Q4RA 2JSXA 4URGA 1VJWA 4QW9A 1SQFA 1W25A 2WVBA 2XGPA 5HBMA 3K5NA 4USKA 2OGUA 4A8MP 4O4GB 3KLEB 2UUWA 3E3XA 4I69A 2C3PA 4DR1J 2OKQA 4A8KA 4LSLA 1SIWB 1C0UB 1UMJA 1H2TZ 4YUDA 1SJRA 2OSQA 2QV6A 1BE4A 2AYBA 1Q1KA 1TL3A 1WC4A 2Y0BB 2BA9A 1U2CA 4B3MJ 1T8EA 3TZWA 4IH5A 4LFBJ 5J2MA 3UCZP 4PWDA 3LPEA 3MR5A 1S9GB 2G9OA 2IRUA 4NLTA 2FC9A 1LW2A 4I2PA 4RO0A 4DSFA 4O44B 1RTDB 5HVHA 2OPPB 3B78A 3MR7A
chains in the Genus database with same CATH topology
2FJEB 3ISND 3M9OB 4LMZA 4RW7A 1U2FA 3UCGA 1N5TA 4B9TA 4KR0B 2F8HA 4ECZA 3PW7A 5G0RB 4X4QA 4ECXA 4ZCKA 5CYQA 3G9CA 5EUHA 2F3JA 3IC1A 5I4MA 1X4DA 1ZTTA 4C98A 4CH1A 3FNNA 1IJEB 4WCEQ 4WJBA 5GAHI 1UWBB 1X4GA 3N5FA 1JLEB 4IKAA 2ZDPA 3KK3B 4GO7X 3FGVA 1FJGF 2KTQA 4XPEA 3RYLA 4O3OA 2V8HA 3E51A 4KFBB 2PE8A 3UE2A 3HFKA 2V5HG 3GG0A 1TL1B 5JXSA 2FHJD 2HNYB 1S1UB 2GFFA 1S6QB 1MNEA 2ZM6F 1H7WA 4OI1A 3CCMS 5C25A 4ILMA 1K73T 2V8DA 1M5SA 2I38A 3FDSA 2ZHAA 5HLFA 3FEYB 3SCLE 2B7CB 4KSEB 2RQ4A 5C24A 4LJMA 3MM9B 4NLUA 3PX6A 3Q24A 1T05B 3PRBA 6FDRA 5A6WA 4IG3A 4OI4A 3KK1A 4DN9A 1YJNS 1B0TA 3L3CA 1FO1A 2QMWA 3KHGA 1SL0A 4IFYA 2CJBA 1RISA 2ZH7A 4LSNB 3NG8A 4D3GA 2LEPA 4FNHA 2DRAA 1FTRA 1HYSA 3M30A 1WHYA 2Q3PA 2MQOA 5CXTA 3U1NA 4R0JA 4ED3A 1XR6A 3DI6A 4M95A 3TA1A 2DGUA 1IN0A 2MY8A 1Z1ZA 1BWEA 4N56A 4OQJA 3DHWC 2B9WA 1K0TA 3VR1A 1ZAVA 2Q1LA 2Q6CA 1B64A 1MMDA 3DLGB 3NKYA 2MKIA 2W4PA 4ES1A 1VQ5S 3MD3A 3MMAB 2ZH6A 1NJZA 1WG1A 3BO2A 2KH9A 2L3MA 3CWJA 4I2QB 3AJ2A 5KFPA 3KLGB 1EP4B 3GV7B 2K3KA 1FKOB 3MUMP 2XMJA 3M8PB 1S0MA 4NRUA 2W9BA 3MMJA 2ZD1A 4X4NA 1UVLA 1U1PA 1T03A 2UVRA 2DIUA 4PUOA 2AX0A 2BANB 5HMWA 2JEIA 2ROEA 1JKHB 2FD2A 2WOMA 4EZ6A 1DTTA 4QU6A 2AYEA 2A1BA 2D3UA 1UJ4A 1Q53A 2MGZA 2V8VA 4EYHB 2DGXA 5B0BA 1IBKF 4WE1B 1S6PA 2LA6A 4X2BA 3H20A 4OX9F 3I5BA 1GTEA 3LP1B 1UJ5A 4QIFA 2GQCA 2ZZNA 2LMIA 5EX0A 1RGVA 3OJUA 1U49A 5DGBA 4MKYA 2R2TA 3P3DA 3OUYB 1DLOB 1TAQA 4OI2A 3EGZA 1U2RA 2VG5A 1NK9A 2LEAA 2W9CB 2J0XA 2ZKTA 5A8WA 2D7SA 3D0GE 4HT7A 2AYGA 2KU7A 2B4VA 4W92B 2PIIA 2FDNA 3OR1B 1U24A 2MSTA 3G6VA 4F4KA 2J0WA 2HHWA 3N6LA 4TU7A 2JJ4D 4QOTA 3HHLC 1O51A 4N47A 2AJQA 1HPZB 3R5BA 3OXLA 4B9UA 4CTAB 4O3SA 3G86A 4OIXA 3DCAA 2AYMA 2ILYA 3H5SA 5EWGA 3C2PA 1HHTP 1X4CA 2XMMA 4PG7A 4OLPA 1WACA 5ADZA 3DLJA 3RW7A 2WBMA 4CO4A 1FESA 2HNZA 3BO3A 2AV5A 4F50A 2LECA 2K2PA 4Y2IA 3C66A 2GHWA 1HBNB 5D77A 2B9YA 4LIWA 2PSZA 1FXRA 4RUCA 2AX1A 4OMFG 5KFAA 3DU6A 3OFEA 4YP3A 2ZOMA 3B4DA 2C22A 5I3QA 3DXBA 1N5YB 2EC0A 3W7BA 1X4FA 1M5KC 4DSLA 2WHOA 4NA1A 2FLNA 1B0PA 1FEHA 1NKEA 2YQ3A 3CE8A 5KOXA 3QIPA 1RT4B 2BM0A 3PW0A 1SC6A 3HVAA 1TKTB 4HL9A 4NLXA 3KLFB 2JFDA 3CCRS 2F8EX 1SH0A 3LAMA 1I6JA 2E5JA 4XO0A 1YGYA 4RNMA 1HBOB 1GX5A 2EI5A 4DN0A 1KTQA 1TVRA 3IR5B 2OPSA 4WXOA 4R8UA 2V4RA 2RF2A 3MPWA 3MMCA 4Y0FA 2XMTA 3R5DA 5KG2A 1LQ9A 1YRTA 1C4CA 1IQZA 3DOMA 1X0FA 4A8FA 3RBDA 3V6DB 3JB9k 4DS4A 3U02A 1KEKA 1S9EA 4K4YA 3DM2A 4B02A 4Y6IA 1Y4ZB 3DLHA 1JLGB 1E6YA 2J7UA 3IO1A 4U7UK 2RIJA 5DQIA 5LMNF 3D1HA 3LUYA 1YJTA 2P6TA 3QWPA 2KFYA 2RILA 2IJFA 1LWFB 1TL5A 3CDAA 4TLQA 2XSFA 4ID8A 5B0GA 3PW5A 2B5JB 3OW2R 1A6LA 3O1LA 5K9FA 5HI7A 3DOKB 2R7XA 4KE5A 4MK8A 5IFMA 4AE5A 4OJHA 3HT3A 3H25A 4JV2A 4DG1A 3PVXA 1RKJA 4C8KA 4HKQA 1L3KA 3TAPA 2FVQA 3AJ1A 3FEXB 2PO4A 3ONQA 2CPYA 5I3PA 1AFIA 3Q22A 4NLPA 2HNDA 4TNOA 4C3KA 1NO8A 4RW8B 1RTHA 3CMAS 5T7LA 1TV6A 2DGOA 2XI3A 3C6UA 3PNIA 5GADI 1M5VC 5LSLA 5KFHA 3DLLQ 3RRKA 1MMLA 4QWDA 1RT2B 3PHEA 4EZ9A 5CQGA 4WFXA 2JEGA 5HMZA 5IZHA 3J7YI 2I8EA 4UY85 3HX9A 4IDKA 3GG1A 3G8TA 4Q7AA 1FNOA 2XBPA 4KV8B 1N88A 3BS9A 3PX4A 1URNA 2HHQA 2XI2A 3HVRA 2E5IA 4KQZA 2M88A 2A2CA 2HPUA 1OIAA 2P9EA 4MMOA 2VPZB 3UD4P 4GO5X 2HRYA 2W7AA 1EETA 1ZTWA 1SKWA 3RAQA 4EGLA 1U1OA 4OLOA 1M5PC 1X4EA 2DVIA 3IR7B 2CQ3A 3HHDA 3N6NA 5DQGA 2ZH3A 2C3YA 2DH8A 3JTOA 2ZOFA 1TR0A 3DMJB 4ZPAA 2L9WA 1AFJA 2JVRA 4RUHA 4ICLA 5T41A 1KD1T 2NUHA 1H2UX 3MUVP 1S9FA 2FJAB 5HROA 1TKDA 3SCKE 2Y1JA 5DG7A 1N32F 3QGPA 2FTRA 3JYTA 5J2PA 1WTFA 4ZPCA 2RU3A 1HMVB 1FNMA 1HL6A 2RKIA 4J9LA 2MKSA 3MEDA 3T1HF 1RT5B 3K5PA 2LXUA 2M2BA 4H4OA 1D8YA 3I0RB 4IUFA 3NNAA 1HQEB 4N8OA 3WDOA 2C3OA 4NPOA 2ASJA 3MECA 5IXUA 2GA7A 3PM9A 1BC6A 2YNFB 4U67Q 4NLRA 5D4NA 2DPIA 2DRBA 4NCGA 2XGQA 3CJKB 3CCQS 4WFBQ 3CPWR 4E98A 2X51A 3R5AA 1X7VA 1OO0B 3M6VA 2WCXA 4RW9B 3OPKA 4DX8H 4HDGA 2E7XA 2IM1A 3DRSB 4C3MA 2PC6A 4C8LA 2ZUGA 2FJBB 2QO3A 2PA3A 1HW8A 4KAIA 2CG4A 5T14A 4X4UA 3I96A 3OR2B 1ZYQA 4EBDA 1WEZA 2L9NA 3CGIA 5F0UA 3GIKA 3HHEA 1P9QC 1KQKA 2PMHA 2KYXA 5E3CA 3L7OA 4DS5A 3SDEB 5LT5A 3MM8B 4ZDNA 1HWLA 2CPIA 2ZBCA 4O23A 3NRBA 3BSNA 1UA1A 4DLEA 4DDFA 3NMRA 2E1MC 2O1PA 1HBMA 1S0NA 2CVIA 5KT5A 2DPJA 2UVVA 2YNHA 1F9FA 4TY9A 2R7UA 2KT2A 4G6VB 3MM6B 4MKBA 1QUPA 3JAMY 2R7OA 1ELOA 2GIQA 1F60B 3W2VB 3KHLA 5DM7Q 4ED2A 2VOOA 2UU9F 5KFGA 4ETXA 3MF5A 3ICLA 3NBPA 4FBUA 5M2RA 2NSCA 2E66A 2XLKA 2MZJA 3ULHA 5H9FJ 3POTB 2ADBA 3K59A 2ZE2A 3DLBA 5KFIA 4IH7A 3GIJA 1D8ZA 3LPYA 2YKOA 2K3IA 2JEJA 2ACYA 5K5MA 4C0HA 4MAKA 2HWTA 1O8BA 2VPWB 3TP2A 1U8SA 4OZJA 4Q8EA 2E7WA 4DL4A 3DRYA 3RR8A 4C8ZA 2YWKA 3CVKA 1WHWA 1RA7A 4HVZA 3ISZA 1IKWB 1BQMB 1JLQA 4NYZA 3EYZA 1KOHA 1KTVA 2F8MA 4K5SA 4QIVA 3U1LA 4DFPA 1KVIA 4N41A 2DGSA 5DG9A 1P6TA 2ZNZA