2XS7A

Crystal structure of the rrm domain of mouse deleted in azoospermia- like in complex with sycp3 rna, uuguuu
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
86
structure length
86
Chain Sequence
LPEGKIMPNTVFVGGIDVRMDETEIRSFFARYGSVKEVKIITDRTGVSKGYGFVSFYNDVDVQKIVESQINFHGKKLKLGPAIRKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Kinked Beta-Strands Mediate High-Affinity Recognition of Mrna Targets by the Germ-Cell Regulator Dazl
pubmed doi rcsb
source organism Mus musculus
molecule tags Rna binding protein/rna
molecule keywords DELETED IN AZOOSPERMIA-LIKE
total genus 18
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2010-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2xs7A00
2DK2A 2F9JA 2DNPA 1Q82T 2MPUA 2FHOB 4IUFA 4CIOA 2KG0A 2MQQA 2CQIA 2LA4A 2QEXS 1FXLA 1K9MT 4ZKAA 3IWNC 4QU6A 2MKSA 1OPIA 1M5PC 2LMIA 1U6BA 3NS5A 3I56S 3LPYA 2F3JA 4FXWA 4W90B 2CJKA 2HYIB 2XS2A 3SDEA 5JVHQ 2MKHA 2OTLS 3Q2SC 3CPWR 2JVOA 2DGUA 4LMZA 5IFMA 1VQPS 1WF0A 1DZ5A 2DH7A 3CULA 1R8HA 2D9OA 5LXYA 2KVIA 3G8SA 2YKAA 2KXHA 5LJ5Y 4C7QA 2G1DA 2MSTA 1X4CA 4CQ1A 5IM0B 3K0JA 1QM9A 4F25A 1H2VZ 2I38A 5CA5A 3LQVA 1ZZFA 3Q2TC 1VQLS 2MJNA 5LSOA 2MZQA 4C4WA 1VQ7S 1WEZA 2MJUA 3CC2S 3H2VE 1UP1A 3UCUP 3RW6A 2CQPA 2ERRA 2XNRA 2KRBA 1KOOA 1U2FA 2GO9A 1XN9A 4IO9Q 3P6YC 1WF2A 2DB1A 2XSFA 1WEYA 3CXCR 1CVJA 1WI6A 2G4BA 2X1FA 2HGNA 2JRSA 4WFAQ 3DLLQ 3ULHA 5GAHU 3BS9A 5DM7Q 2CQ0A 2MB0B 3SMZA 2DGVA 1YJ9S 1H2TZ 2CPJA 3V4MA 2XB2D 1IQTA 1WF1A 3P3DA 1VBYA 1SJ4P 4YUDA 2DGSA 2B0GA 4IOAQ 2DHGA 2RNEA 3J7ZT 2MHNA 2CQGA 5DDQC 3MD3A 3BO4A 1YJWS 2L08A 1FJEB 2CPDA 1HD1A 2J8AA 2DNRA 1OO0B 5MLCV 2N82B 2QA4S 3OW2R 2YH0A 4ED5A 4YB1P 2K3KA 2MZJA 4OZ1A 4U67Q 4F02A 1RKJA 4EGLA 2DGOA 3CMES 2DH9A 5DDPC 3G9CA 1O0PA 3MUMP 2RT3A 4TU7A 2DGQA 2XS7A 3NNCA 1K73T 3SXLA 1M5KC 1NU4A 1VBXA 4UY8T 2M52A 2GHPA 2VODA 4PRFA 2LKZA 1VQ4S 2CPIA 3VAGA 3TYTA 2AD9A 2DGXA 2CQDA 2YTCA 1PGZA 2M88A 1WELA 4F26A 3CCMS 2MZSA 3S6EA 5IM0A 2LYVA 1PO6A 2JX2A 2MY8A 3CCRS 1SJFA 3N9UC 2N3LA 4WIIA 1FNXH 1P27B 2CQ3A 2D9PA 2E5HA 2JWNA 4A8XA 2DGTA 2LA6A 3MUVP 2RS2A 3MD1A 1N88A 3SDEB 2DISA 2RQ4A 1YI2S 2M8HA 1NO8A 4WF9Q 4V19X 4RU2A 2KM8C 3UD4P 2KI2A 2MZ1A 3FEXB 3IRWP 4W92B 5DM6Q 1WG4A 1ZH5A 2HGMA 2CQBA 1X5TA 1U1QA 2WBRA 2RQCA 2VOOA 3J7YU 3RW7A 5HL7Q 2DNMA 2DNGA 2AYBA 1A9NB 2KN4A 1X4EA 2G0CA 1H2UX 1HL6A 4WFBQ 2KXFA 3HHNB 1A7GE 1BY9A 3VAJA 3TP2A 1S72S 2FC8A 2M9KA 3MUTP 1YHQS 2DNZA 4YOEA 1X4GA 1W2BR 1DRZA 1WHVA 1URNA 2DGWA 1HD0A 4Z2XA 1Q7YT 1UFWA 3G4SS 3CF5Q 2CQ1A 2MZRA 3NMRA 2CQ4A 1WWHA 2X1AA 2MKJA 3U1MA 2RU3A 1H6KX 3DXBA 4LJMA 2FPHX 4QU7A 3U1LA 2MQOA 5DDRC 2ZJQQ 5CXTA 1U1OA 2NZ4A 3CCVS 2BOPA 1KOHA 2M0GB 1S79A 4OZ0A 3R1LA 1VBZA 2DO0A 3CCES 2KHCA 2F9DA 2KFYA 2CPFA 4P6QA 1U6FA 5GAGU 3PIOQ 2BZ2A 3CTRA 1QVFR 1QVGR 2J0SD 3MI7X 2ADCA 5DDOC 1VQKS 3CUNA 3CCUS 2RRAA 1YWXA 5GADU 1FJ7A 2LXUA 2J76E 2ZJRQ 1WG5A 2OSQA 3VAHA 3R1HA 2NLWA 1M5VC 1SJRA 4UQTA 4TU9A 1KQSR 3EGNA 5LXRA 4IOCQ 1D8ZA 3ZZYA 2LEAA 5GVQA 3H2UB 2I2YA 1DHMA 2LEBA 2O3DA 3ZZZA 1YTYA 5EN1A 2CPXA 2MQPA 2MMYA 5D77A 2CPHA 2N7CA 2E5GA 3NNAA 2KH9A 3P5TL 2DIUA 1K8AT 3P49B 2AYMA 3EGZA 1WHYA 1U1RA 2M2BA 2DHXA 4PR6A 5H1SV 2LCWA 1AUDA 2YWKA 3TO8A 5ITHA 1X4BA 1YJNS 1SXLA 3FEYB 2HGLA 2CPYA 1SJQA 2DHAA 2DNOA 5IQQA 1FO1A 5DETA 5HO4A 4WCEQ 1X4DA 3R27A 3UD3P 1UW4A 3S01A 5GMKa 2U2FA 2DNHA 4QQBA 2MQLA 3L3CA 1X4FA 1G2EA 1FJCA 2FC9A 1VQ5S 1X4AA 3VALA 2KRRA 1OIAA 3VAMA 4M5DB 3B4MA 3MURP 1M5OC 2M7SA 1WG1A 1WHWA 1DBDA 2KT5A 3CCSS 1U1PA 2MQNA 2DNKA 1X0FA 1VQ6S 5FJ4A 3CD6S 4ERDA 2X1GA 2VONA 5BJRA 1U1MA 2Q79A 2E44A 4CH0S 3CC4S 1HA1A 2HZCA 1WHXA 2KG1A 2E5IA 2CPEA 1VC5A 2OJ3A 1JJHA 1JMTA 3MXHP 2MXYA 3VAFA 2L41A 4WKRA 2MY7A 3UCGA 2DIVA 4TU8A 1M90T 3G71S 2VOPA 2OIHA 2CQCA 3NS6A 3S7RA 2KM8B 3UWTA 1X5PA 2DH8A 3NNHA 2YH1A 1L3KA 3THTA 2OTJS 1VC0A 4Y00A 1SJ3P 3S8SA 2FY1A 3HI9A 3MDFA 1NJIT 3VF0B 1VQOS 1VC6A 2CQ2A 2JVRA 2N3OA 2MGZB 1FHTA 2L9WA 4LIRA 2MGZA 1JJ2R 3VAKA 1N8RT 2DNYA 5CYJA 1F9FA 1VQ9S 2ZJPQ 1X5OA 2EVZA 1P1TA 2MSSA 2MKCA 1UAWA 2SXLA 2V94A 1M1KT 3CC7S 2EK6A 1N52B 2PE8A 1N54B 3G6ES 1WEXA 1WI8A 1WTBA 2J0QD 2CPZA 2U1AA 1U1NA 1Q81T 2DITA 3US5A 1YITS 4QPTA 3MOJB 2LQ5A 2AYEA 2A3JA 2DNNA 3D2WA 2CQHA 5LSLA 3THPA 2HVZA 2ADBA 2DO4A 1VQNS 2AYGA 1FT8A 1R8PA 5JVGQ 4C0OC 2MKKA 4BS2A 2K8GA 3BO3A 2MKIA 3BO2A 1OWXA 3UE2A 3UCZP 2EK1A 2LECA 1JJ4A 1D9AA 3CMAS 1U1KA 2PEHA 1YIJS 2KYXA 2UP1A 1B7FA 4WFNQ 4FXVA 4TLQA 2RRBA 2E5JA 2OSRA 2KXNB 3JB9k 2M8DB 2QFJA 4PKDB 1KD1T 2M4MA 3B4DA 3BEGB 2DNQA 2MZTA 2D3OR 3CCJS 1KC8T 2KU7A 2DHSA 2XNQA 4Y0FA 4J5OA 1Q86T 5GAEU 3VAIA 2RVJA 1ZZNA 4CH1A 2RUGA 3PIPQ 2RS8A 3CCLS 2MYFA 2M70A 2X1BA 3G96A 1VQMS 1VQ8S 3G8TA 1U1LA 2DNLA 3I55S 1X4HA 5LJ3Y 5D78A 2MQMA 1RK8A 3CCQS 2XS5A 3EX7B 2LXIA 1X5SA
chains in the Genus database with same CATH superfamily
2DK2A 3MM8B 5H9EJ 4YS2A 1RLDA 4MFBA 4OYIA 4USHA 4NCAA 4HVZA 1U26A 4EBCA 3KJNB 1REVB 1NDCA 4DV3J 1UJ5A 4NLVA 2Q6BA 2XLIA 2OHDA 2QEXS 1Y7PA 4NA2A 1OY9A 1K9MT 4AQYF 3MEGB 1RT3A 1Q53A 4ZLLA 3KUGA 4DCPB 3G6VA 2HVIA 1MMLA 3TR5A 3D1QA 1F3VA 2LMIA 5AXNA 1U6BA 3ZTOA 4M5NA 3KG1A 4DR3J 4ECXA 1RZMA 1SBRA 1TKZB 1IXKA 5HN0A 1AXQA 4W90B 2CJKA 4RKUC 3VV2B 4BLGA 3JSRA 5A8KA 3SDEA 5JVHQ 3DRPA 2MKHA 4OI3A 1X7VA 3N5BA 1YX2A 2IMOA 2YX1A 2KDOA 3M6WA 3Q2SC 4IH5A 1NSQA 4P2MA 2HS4A 2BE2A 3SSRA 2IJNA 1TV6B 5C2GA 3D5MA 1YBAA 3MPVA 5C25B 5LXYA 2ACMA 5IT0A 4A8SA 1T95A 4DSLA 3ZXWA 4G6VB 4KFBA 2G1DA 3BGUA 2CNKB 3NGUA 1FVSA 2YKNA 2V50A 5ADZA 3DFEA 5GMDA 2W7OA 4OZNA 2XZTB 4Y3CA 2D74B 5E3RA 3UVJA 4DOZA 2W9CA 1U0HB 4F2RA 3KWMA 1QM9A 3NCPA 2J9EA 3DRSB 3NY0A 2BRKA 4HEA9 3G82B 4I4BA 4QIWD 1JLEB 2OPRA 3MM5A 4JI0F 4DL4A 2HVHA 4ZIVA 3ILIA 1Y5IB 2OFGX 1CS4B 5LOQA 2CZ4A 2Y8WA 4DV2F 3H2VE 4LBPA 1RHKB 1RT7B 5ETOA 3TW0A 4CLKA 5LT5A 3UCUP 2FUG9 2ZC3A 2QA4G 1Y3KA 2ERRA 4ED4A 1OSCA 2BYCA 4NLWA 4ZVFA 4PWDB 4TYAA 4AXIA 4U7UK 4XIUA 4V19J 4RW9A 1NSAA 2GO9A 2B9EA 3K58A 1R0AB 3X1LB 1V5VA 3ZTRA 1FKOB 1CJVB 1T9TA 1WF2A 2DB1A 4I2QB 4ZVTB 1JWWA 1WI6A 2G4BA 1U8SA 2X1FA 3BF4A 4Y2MA 2EFQA 2D1CA 4U96A 1NKBA 4OZJA 4P71A 1FE4A 5C5JA 4MH8A 3UNGC 3SMZA 2DGVA 1UZHA 4P10A 4QR0A 4DEZA 2JLGA 4O44A 2CPJA 1UEKA 2FJXA 1T05B 3P3DA 4TKTA 4JI8J 1GMUA 2UV8G 4YUDA 2HAIA 1JXVA 3N5FA 2CFXA 2YPYA 3IFEA 4H4MB 2RNEA 9ATCB 1MWYA 4IOBA 4ICLA 2QL9B 1MU2A 2L08A 2LU2A 4RJVA 1NAQA 2CPDA 1AROP 1FRKA 2VPXB 2J8AA 2YX4A 4USIA 2CXEA 1X9MA 1ELOA 3ILOA 3GU0A 1B0VA 4ZVPB 3RAMA 5E2QA 2KYZA 4GKJF 2WW4A 1P9QC 3I6PA 2FZKB 2N82B 2QA4S 1T05A 3DLEB 4OX7A 3R5DA 1N5SA 1C4CA 4YB1P 2UUAF 1CBKA 2V0NA 1O5JA 4HTIA 4J9PA 4NASA 4X65J 1RT1A 1RKJA 4EGLA 3MR2A 3MGJA 3G9CA 1O0PA 2ILZA 2XMUA 3DKDA 4NZ7A 3NGKA 1W7WA 2PA3A 2B43A 2NYIA 4EMDA 5BR8F 1N33J 4MK7A 4P74A 1RWUA 1TKXB 2EPIA 2PN6A 3TUZC 1D3WA 1K73T 2AJ0A 3SXLA 1RI7A 1SQGA 4OYAA 4RW7B 3PRVA 5IWAJ 1VBXA 1S10A 5K14A 2OP5A 4UY8T 2GHPA 3R2DJ 4ED0A 5EX0A 3BM7A 3KLVA 3JSMB 1FD8A 1IJEB 2VODA 4PRFA 3JQJA 5L9XA 4DQIA 2LKZA 4OHYA 5FDLB 1N6QB 5M2RA 3TOQA 4QWAA 3DLBA 2RDDA 3VAGA 2WSFC 3AFGA 3OR2A 4DR5J 2DGXA 1ZAWA 1HMVA 4DV0J 2V2ZA 2ZDPA 2FJAB 3BR8A 3FCHA 1OPZA 3G82A 4ID5A 1TVRB 4DZ6A 3J80U 3CCMS 1GTEA 2PSZA 3S6EA 4TQRA 1QY7A 1S9GA 4NA3A 4LRAA 4KB7A 1RT6B 3CJKA 5IS2A 5GAHI 2EFPA 2W2NP 2HHVA 4URQU 1CJKA 2JX2A 3MHYA 4R0EA 3GIJA 1UW9A 2Z2MA 1RTIB 2O67A 3Q0AA 2R3VA 3IR6B 3A1YG 3N9UC 5ETRA 2GAGC 3SCJE 3UO0A 3TA1A 4YFUA 1P27B 2CQ3A 2G1HA 1FWLA 3N79A 4P52A 3RAQA 2I8EA 3MUVP 1S12A 4ZPTR 3W2VB 4C48A 3CW2C 4J9MA 2P5VA 4DV1F 1Y5NB 4WFZA 4YR2A 1VCTA 4F0HA 5F8HA 4QW8A 2IC3B 2RQ4A 5D8HB 2YX7A 4DR2J 1XTZA 1EZZB 1NO8A 4ECVA 3IR7B 1TKZA 4CLZA 3EVOA 5B08A 4WK3A 4RW4B 1T9UA 1XNRJ 1VQYA 2E1CA 5KFHA 2Q66A 1RWOB 4I6WA 2KM8C 1BQXA 5IT9U 3DGPA 4Z7CA 2F4VF 2ZH9A 2ZZTA 4DSIA 3M32B 3AJ2A 4I6AA 2FJEB 4NYZA 3FEXB 1FX4A 3IRWP 5HP1B 1KRPA 1K0VA 4DV0F 3T5HA 1JLFB 2HURA 1AA1B 4UY85 4P2FA 1NXIA 1PAEX 2G0JA 4WZQA 3TVYA 2QLBB 1HNIB 4IG0A 1X5TA 2BA9A 2V6AA 3KK1B 2VHGA 1S0NA 1VGYA 4DFMA 3J7AN 4OLPA 3HK2A 3QO9B 2VFSA 5IWAF 4NWBA 1RTHA 1PJ5A 1X4EA 5HQ8A 1A9NB 1N34F 5U47A 3QIPB 1OY6A 1FCAA 2VG6B 3BJYA 2H48B 3O6QA 4XTTA 5KFCA 1HNXF 1C1CA 3HHLB 4F4KA 1A7GE 1MMDA 1BY9A 3UDCA 4KIAA 2J0WA 4NLQA 2APOA 4C6AA 3VAJA 5CZVA 3HJFA 3LF0A 5D6GA 3I0RB 4LF1A 2E9RX 4ZP7A 1FNMA 3OLAA 3ILJA 2FC8A 4M5MA 2N7YA 5CCMA 3MUTP 3HD2A 4DQPA 2IAJB 1NHVA 3PRDA 4DFPA 4QWEA 4F8RA 2VBXA 2RMLA 1URNA 1LWFB 2H51B 1FRJA 4A8FA 2UXCJ 2QGFB 4QYZJ 2HHQA 1T9WA 3Q8VA 3CE8A 1CG2A 4DF4A 1DY3A 3LP1B 2DJWA 5JXSA 5KOXA 1XMQF 2F7VA 4LF5J 2CVIA 1S6PA 3EPIA 1UFWA 5B0EA 1Q7YT 4JV1A 2AV5A 4TVAB 1NEEA 4KKOA 1WORA 2CQ4A 2IDEA 2CJBA 1WSRA 2B8QA 2MKJA 3K89A 3MMBA 1UVIA 4JI4J 4LJMA 4NPOA 3C16B 5M2UA 5L46A 3AH6A 1X9WA 3BGFA 3U1LA 1UVJA 2MQOA 5IT4A 5HVGA 3BN7A 2ROGA 1GTHA 3M8RA 1Y5LB 2COLA 1WC3A 2IM3A 4AFFA 3CCVS 4G1QA 1BMQB 3UW1A 1HI0P 2BOPA 3C2PA 4BBYA 1Y4ZB 1VBZA 1UMJA 2KHCA 2LVWA 2ZFHA 3AY0A 2LLZA 3BH7B 3C16A 4IH6A 3FFIB 2IJRA 2H3EB 4P6QA 2XEXA 5E5NA 2GMHA 2WB1D 3C6TA 5GAGU 3TI0A 4Q8EA 4JI5F 1QVFR 1Q7LB 3D66A 4KKOB 5AE3A 4L3KA 2J0SD 2ZDOA 1HBUB 1HQ2A 1RJJA 2WONA 3VZHA 1CULA 5DDOC 3C15B 3ONQA 3R5AA 5HANA 3MFHA 3CCUS 3CUNA 3PW0A 2IMWP 2V8GA 3N0VA 3R5GA 4NI2A 5K8NA 5GADU 2K1RA 4WFXA 1HNZJ 4KPYA 4OQJA 4DV7F 3A8KA 1RAOA 2R2RA 5F8JA 1WG5A 3EE3A 2AX1A 4EWTA 2IDLA 2NLWA 5CD4H 3O2IA 2IAJA 1CJTB 1S1UB 3VVTA 2K3IA 4OHZA 2HMIA 1D8ZA 4FYYB 4JI3F 2ROEA 3D6HB 2Y8YA 4JI5J 3IO1A 1NHUA 2AIRB 2LEAA 3LGHA 1FJCA 2QJ3A 2WW8A 2CVEA 4ZMMA 4X4NA 1M5SA 1N5QA 1N5YA 4C8YA 5HQMA 5ETLA 4TY9A 3CJSA 5KFBA 1MG7A 1HYSA 8ATCB 2CPXA 1RSCA 3LP0B 1PYTA 4ZCMA 2N7CA 3KK1A 2B9YA 4LFCJ 1VLYA 3NWGA 4MKVA 3RBZA 3J7A1 2KH9A 1JLQA 3UN2A 2R7OA 5H9FJ 2AYMA 2CUYA 5LL6d 1S0MA 1K8AT 2XYHB 4GO7X 4QIGA 1HBOB 4NZ6A 5L38A 2MLZA 2LQJA 4EYHB 3M6XA 1RE1B 1L3SA 1U24A 4YN3B 4IRDA 2I9SA 2G2YA 3HM9A 2R2UA 1F9HA 1D9DA 1VOMA 2RKIA 1RAIB 1UTAA 2FHJD 5B09A 1PCAA 1HQUA 1SJQA 4HACB 3AB4B 5IQQA 1FO1A 3IM8A 3PHEA 4LRDA 4RUHA 5HO4A 3BSNA 4PYDA 1O6XA 4CO0A 3UD3P 3HZGA 1ULRA 1XR5A 2ZBPA 3ISNC 1YVFA 3OUYA 1VRUA 3G86A 4QQBA 3L3CA 1NMEB 7FDRA 3GP9A 3OV7A 3W5XA 2FC9A 4ZJQA 1A0OB 1FA0A 1F1BB 1X4AA 1MROA 3B78A 2V9WA 1NH7A 3FZ2A 3SCKE 5D4NA 1ZTTA 4MK8A 4JI6F 2AQ4A 3VAMA 1E6YA 3EUNA 3B4MA 2Z2ZA 3LANA 2XMAA 1W26A 1WG1A 3KLHA 4ZPDA 4R8UB 3CCSS 3W2WA 1M5OC 2HS0A 2G2ZA 3KHLA 2MQNA 2GJ2A 1F5AA 1TVRA 2QA1A 3R7BB 4ZVEA 3J80Y 4WP9A 1RAEB 4CLSA 4EK2A 2DCLA 4OZLA 2Q1LA 2BRLA 5E3PA 4CLLA 5T14A 4OYZA 3GV5B 4E0DA 4OL8A 3C19A 5FJ4A 4ERDA 1C0TB 3HZEA 2B6AB 5FD1A 5HJYA 2E44A 5FDLA 2BQUA 1RQ0A 1UPMB 5BYRA 3UN3A 2AEMA 2VF3A 1HA1A 1BGXT 2B9WA 1WHXA 2HZCA 3FCVA 2VBWA 1JX4A 3KOAA 1KTVA 4CH7A 4NLGA 2CPEA 2GHVC 3PRBA 2M3DA 2VQFF 1JMTA 2KB2A 3HX9A 1TKXA 3FBFA 4C11B 2HPUA 4J9NA 2NUHA 3SIPB 1KONA 5KFWA 5A2QU 3VAFA 2MY7A 2FLNA 4WKRA 3M8SA 3EZUA 2PGCA 1HNVB 4UTGA 2DIVA 4TU8A 2BJDA 2R8KA 4B9SA 2QZ8A 4N76A 1X0PA 5K8MA 2C28A 2GS8A 2HRYA 3NGSA 3ZZUA 1TL7A 3P5BP 3G71S 4K8RA 1LV5A 1JXEA 2FYXA 1V3ZA 3NS6A 2GX8A 2LDIA 2VBZA 3KHGA 4HKQA 3WHIA 4JV2A 4ANDA 5DG9A 4FNIA 5K20B 2DH8A 1RAFB 4K4UA 1CLFA 3W3SA 3FCWA 1JNRB 1HQEB 5CH7B 1QTNB 2IVFB 2OLWA 4LSNA 3EZ5A 4B3OB 1SJ3P 1GXLA 2HHUA 4KR0B 5H9FK 3GE9A 1T9YA 4DR6J 1NPRA 1KSPA 5KFVA 1RKIA 2JVRA 2IA0A 3M8YA 4X64J 2MGZB 1RT4B 1T9XA 1FHTA 4ENOA 3BZQA 4KH0B 5J2NA 2WVBA 5KFUA 2L9WA 1NK4A 3RRHA 2MGZA 1JJ2R 1RU1A 1S57A 2C2OB 2FHJA 3IXQA 2DNYA 3Q8PB 4FVCA 4J9SA 1B99A 1Z2ZA 1G7CB 3V6HA 1UVNA 5E33A 3CGIA 3BQ2A 3MAQA 4UUXA 1FRLA 2GCFA 3ISZA 3PW5A 4PQAA 1JLGA 3G8QA 1HHTP 2DR9A 1CJVA 2ZWOA 1B4SA 3GIKA 2OKQA 1S77D 3OTOJ 1UAWA 2FVQA 2AJFE 3LP2A 2QT7A 1K44A 3PACA 3BR9A 4ZIWA 3CC7S 2EK6A 1N52B 4OV1A 2J0QD 3CCTA 2WSEC 1LWEB 5C24A 4IQXA 2CG4A 5ETNA 4KJIA 4KGZB 4QU7A 3KLFB 3T1YF 4B9NA 2DITA 3KLEB 3KNAA 1T0TV 3PM9A 2AYEA 1E6VA 4PABA 4X65F 1ZETA 3DRSA 2WVEA 1SPBP 3HVWA 2FJVA 4WIQA 2ZHOA 1U0HA 2HVZA 3OTBA 3RU0A 3QLHB 3UVJB 4LF8F 2C22A 2J9DA 4AL5A 4RWWA 3LUYA 3UDVA 1VQNS 2V2KA 1M0SA 2ZVSA 2AZ3A 3M05A 1S6OA 4UOGA 3C14A 2IA6A 2XHCA 4BS2A 3SQOP 3LOUA 1OQ6A 5C25A 3JTNA 3W1YC 2MKIA 1VQSA 1FFSB 2BE2B 2UUTA 5JMNA 3G87A 1TZ0A 2W4PA 2XI2A 2W25A 1NSPA 1TK5A 2FJWA 4AT1B 4C9DA 1APSA 4PAAA 2JSXA 2WVDA 3W2WB 2FVPA 4LFBJ 1FFGB 1R6VA 4IR1A 3PXGa 3J81j 2FDNA 1F5BA 2KYXA 5F8NA 2HW3A 1LXJA 3N01A 4PPDA 4F4YA 4WFNQ 1PYSB 3PR4A 4PZVA 2WOMA 3HKZD 4JBCA 2IPOB 4TLQA 1JJCB 3Q24A 2AGQA 5B0CA 2AGOA 3PEJA 1VISA 3OL9A 2AX0A 4LUBA 9RUBA 1SQFA 3RRKA 3JB9k 3MPWA 3PJXA 3IBCB 2QFJA 2CIMA 3HXMA 1KQGB 1RU2A 2XLKA 2Y9HA 4WYLA 4ATNA 1KD1T 3B4DA 2OI2A 3BEGB 2MZTA 4TY8B 1WC1A 5D0GA 2RKIB 2YNGB 4QZVB 4DG1B 3TZZA 4X4QA 4NXMJ 2ADCA 3FSXA 2F8HA 3ITHB 3GCWP 3MM8A 5KT5A 2VU5A 1MNEA 4OJGA 4Y0FA 4IG3B 4O4RA 1DFDA 5ETVA 3V81B 3VVUA 2RS8A 2ZD1A 1U09A 2MYFA 4I7FB 4LVOP 2VASA 4OYBA 1DLOB 2QO3A 4C3KA 1S4EA 2B7CB 3NOCA 4ZHRA 3FDSA 2OELA 1VQMS 2NPIA 1NJYA 3Q22A 2DNLA 2QSFA 3DHXA 2K06A 3IWLA 5ETTA 3M7VA 3PW4A 4XDDA 1QLNA 2PEBA 5LJ3Y 1N36F 1FFWB 5D78A 2MQMA 2FQQB 5KT4A 2UXCF 5J1NA 1HARA 2WCXA 1KS2A 3OTDA 4EO6A 2HSEB 5KAKA 2VB6A 3NG8A 1R89A 3MEEA 3KJFB 5KFRA 4LF7J 4TY8A 2BJ3A 3ISND 3B54A 5L39A 2YNIA 4C0BA 3KLGA 1H3DA 2XG8A 4YY3J 3W65A 1ACMB 4ELTA 5GAGI 2CQIA 2LA4A 1ROFA 3I32A 5A8RB 4ZKAA 1WC6A 3OPKA 3MPUB 3R5JB 4GVLA 1GH8A 4QU6A 1TMMA 2MKSA 2WOMB 2DR7A 2CWXA 4KGKA 4WP3A 3Q8QB 1AB8A 3PG9A 4FXWA 4PG8A 3M9NB 4ED6A 2HFUA 3IBWA 3S1TA 1QE1B 1S5ZA 1HWUA 4Y2KA 4CYUA 2XS2A 1F9EB 4IFYB 2J9CA 1PILA 2OEKA 3A13A 1Y00A 4M63A 1NHKL 4XK8C 3KHRA 1DTTB 1JKHA 1REGX 2VC1A 2WBMA 4B3SF 3OXFA 2JVOA 2DGUA 2B5JB 3W5YA 1IBKJ 5D15A 1HR0F 2BE7D 3CULA 2XWYA 3IA0A 1R8HA 4WU2A 3U7JA 3QRPA 2AP6A 2KVIA 2UU9F 3TQ1A 4EZ9A 4B02A 2XMWA 1UFLA 3HVAA 3CD7A 4DR2F 1FEHA 3QJLA 3Q23A 2V68A 4F4XA 5I3UA 1FKPB 3LAKA 1VRQC 1UVLA 3DI6A 1H2VZ 2RUSA 3SSQA 1MMNA 3ZZRA 3ADAC 3TNVA 3GILA 4OYOA 1E6VB 3RG6A 5F9LA 1ZZFA 1CSJA 4IDKB 5DQIA 4QW9A 2VPZB 2OFHX 2BW2A 2MLYA 2OGUA 3FQKA 4ILRA 4A8OA 2XGQA 3SZ2A 1WEZA 3KLFA 3EGVA 1UWAA 2XSJA 3I9ZA 3GV7B 1S6PB 2XY7A 1T11A 4BWJA 3AA8A 1YK9A 3KK3B 3VGUA 1B64A 1PG5B 1HPZA 3MF5A 1U2FA 1GFWB 2FTRA 3NEKA 5E0OA 3VGVA 4QIVA 3EPGA 4A4JA 2CNNB 2Z58B 3CDAA 5KFNA 4OI2A 5DG8A 4IRCA 5GMEA 2OD4A 1Q8KA 2KHDA 2BXJA 4M5IA 3DRYA 2CKWA 4HLBA 1U02A 2HGNA 1RHUB 2JRSA 2HHXA 4KGMA 3BS9A 1EKRA 3CJ3A 5LMUF 2LQBA 4RNOA 2J6SA 3D6MB 4UOHA 2XMTA 3V4MA 2XB2D 5C42A 4F0KA 3F56A 3I87A 2UUBJ 1Q16B 3F0NA 3KK2A 2DGSA 1TMJA 4MAKA 3J7ZT 2DT9A 4JP8A 2HHTA 2MHNA 3BPDA 2NPFA 1HIYA 2IYIA 5BR8J 1YJWS 2L3MA 4LF7F 4JYAF 4M5JA 4IG0B 1KHVA 1VIOA 2GA7A 3SV4A 2DNRA 4J9LA 1TR0A 3W60A 4WZMA 1XBWA 2ZWPA 4Y2AA 2V34A 1RAJA 4JUZA 4ZA1A 3H5SA 3FSIA 3M2RB 4PYAA 4L75A 3HO1A 3M32A 2AGPA 1OY8A 4ED5A 1UJ6A 2X51A 2YWWA 2R8IA 3BQ0A 1SC6A 1S1TB 4Q43A 3QNWB 5EHHA 4URGA 2V69A 2DGOA 3H4BA 2CJ9A 5DDPC 1T3NA 1AW0A 3O3LA 3R3TA 5CQGA 2W9BA 3CMQA 2JDJA 4IO1A 1H7XA 4ILMA 4TU7A 2DGQA 3R2CJ 4C11A 4Y34A 4I69A 1GXUA 4CI0B 3G6XA 3OQ2A 1UEVA 2RJZA 1M5KC 4JI8F 1UKUA 5THWA 3BKUA 4R5PB 5EWFA 4FN5A 2J0XA 4DLGA 3OSNA 3G6YA 1VQ4S 3RB4A 1RWWB 2R7VA 1LWCA 2CPIA 2EFGA 3DM2B 5EGYA 1XNRF 3CDBA 3QPIA 2AD9A 5FLXU 3ZTPA 2CQDA 5G0RA 4C8NA 1PGZA 3K5OA 1R3NA 5EDWA 2V4JB 1JLBB 1LNQA 1UJ4A 3HVTB 3NP5A 1S49A 5KFJA 1EQMA 3GYGA 1YRTA 4RL1A 3DGVA 4GMKA 4FVMA 4ZPVR 1QSSA 3NL0A 3AXMA 3DYAA 4P73A 5IM0A 4J9QA 2N4DA 1E6YB 2VD3A 8RUCA 2HQDA 2V4JA 3HVTA 1U48A 1NKCA 2L9DA 5GADI 3JQMA 2MY8A 3BGRA 3T3FA 1YZ6A 4X4TA 4PXCA 2ZE2A 1SJFA 3HHDA 2LU1A 3PY8A 2UV8A 2D9PA 2DR8A 4HT5A 4NRUA 2E5HA 3M4XA 5F8LA 3OUYB 2C42A 1C0UB 1G1XA 5I42B 4NCBA 2HZAA 5KFGA 2LA6A 1NJZA 2FD2A 3MD1A 2BMBA 2RDJA 5KFAA 3NAIA 4GKKF 1J2VA 4QWBA 2QLWA 1HHQA 3QWPA 2C1EB 4V19X 5HROA 2FIUA 4RLEA 4RU2A 2AMCB 5HBMB 3HDSA 5AXKA 1KKHA 4OHXA 1RT1B 1S1TA 3IAM9 4K2XA 4IYQA 3U02A 3UD4P 3AD9C 2KI2A 3AJDA 1HWIA 3DLEA 3DN9A 4ZN1A 2WB4A 4NLSA 4H4KC 2HWHA 3AB2B 4M1KA 4B3MF 1ZH5A 3KKFA 1YRXA 3M8WA 2HGMA 1C4AA 1C1BB 2IM2A 4KRWA 2KO1A 1U1QA 2WBRA 2QYCA 5A76A 5J2QA 4ZLPA 2VQEF 2DNGA 3GSIA 4A48A 2ZC4A 4M95A 1S76D 3GB0A 5KFYA 1KVKA 2KN4A 4QR1A 4QR2A 3UDEA 4HI1A 4WBFA 1C1BA 1CC8A 2KXFA 1EP4B 4HTJA 5C42B 1WD6A 2AHOB 4MMOA 2R7XA 1MN7A 4N5SA 4LFCF 1PC5A 1QAYA 5CCLA 4QWDA 2FGCA 2XTJP 3H20A 2JNJA 3I4PA 4NA1A 2ZH6A 1IBKF 4K4TA 2LEPA 5LMUJ 1OS5A 2UUWA 2R2SA 3OHBA 4X4UA 3BB5A 4KV8B 4M5GA 3SCIE 3QZ8A 2QYGA 3FQLA 1HWJA 2A10A 2VL1A 1DRZA 1H0HB 2YNHB 4C8ZA 4O3QA 1RWMB 5KT7A 2PMZD 1GEHA 1SH0A 1YJRA 1M5HA 3IGVA 3OXGA 4H54A 2DGWA 4LF2A 4NEZA 3V2UC 3VHQA 4ECUA 1NJXA 4FF2A 1Y9OA 4FP9A 3W66A 3E01A 3G4SS 3CF5Q 2BR0A 4ZVQB 1N32F 1XWLA 5KOWA 1S97A 5HVFA 2MZRA 1N56A 3GIIA 1RTDB 3LA0A 5B7WA 4YHHJ 3NMRA 2AJ4A 2C3UA 1H6KX 1AZSB 4DX5A 1N34J 1KLNA 2CA9A 3NGDA 2AJ2A 2F1FA 3BSAA 1QAXA 5D0HA 2FPHX 3Q8SB 3DI6B 2V2VA 3GJRB 1P1LA 3DOKA 3M2VB 1NSKL 3M8PA 4KFBB 3K8WA 4ES2A 4WXOA 3CCES 1FDDA 2KFYA 1MLAA 1ZA1B 4J9UE 4BC7A 4ZVSB 3PIOQ 4FF1A 1IKWB 1J5OB 1RACB 2VICA 1QVGR 1BC6A 2QA2A 3UR3C 2WTFA 1SC3B 4KGXB 4UOCA 3D6FB 4ALZA 2XMMA 4ANEA 2JC0A 4CM2A 3PKMA 2BE9B 4XO0A 4A8WA 4IFYA 3QRRA 4NXNF 2VKRA 4MJKA 1I5OB 5D4PA 4X66J 2RRAA 2MDAA 3PR5B 2LXUA 1F0XA 2J76E 1WC5A 1CEZA 2RD5C 4C2MA 3W9HA 2P9EA 3I0SA 2ZJRQ 2OSQA 1SL1A 1KQSR 2PI4A 4UQTA 4LRCA 4M5KA 3QGGA 3OBIA 1KFDA 5IXUA 1QDUB 4M8LA 5L1KA 2KJVA 5D0RA 1UZDA 4ECWA 5HLFA 4LF9J 1KP6A 5DGBA 1TKDA 2J7KA 4I0WA 1JK9B 3D54A 3R5BA 4YB5A 1MWZA 3CJ8A 1QSYA 1RHQB 1C1CB 3HHLA 4FBTA 3M2RA 1JLAB 4QPXA 1TELA 1DHMA 1XK8A 4MKAA 2DEJA 1RLCL 1XR7A 3KJQB 1WDDA 3QIPA 1SJ1A 3BDEA 1YTYA 1IKVA 3BYPA 4JI7F 1S9FA 1TK0A 4O0IA 2ZH5A 2MMYA 1NB2A 3B8HA 4P7TA 3T19A 1RHJB 3CWJA 2KT3A 5B0DA 4HR2A 4EBEA 3QT6A 3SQGA 4NEYA 3EGZA 1IWAA 1U49A 1JLFA 3NCRA 3N6MA 2XCPA 2BJ9A 3OL6A 3NOGA 3U1NA 1SKSA 4FXDA 4J9KA 2F4VJ 1R43A 3DGPB 1HW8A 5H1SV 2VIHA 1AUDA 2FVRA 1V3SA 3M6UA 3HHLD 2J6UA 2YWKA 3Q86A 4QIFA 4IG3A 1VK8A 1X4BA 3E51A 2YKQA 4DL5A 4RW6A 1KN6A 1SXLA 3FEYB 4RW4A 1IR0A 2HBRB 2VUGA 2HGLA 1RT2B 4I6YA 1FEEA 5DETA 4PUOA 1UW4A 2ROPA 4RNFA 4WTOB 5GMKa 5SZTA 2ZOFA 4O23A 4N47A 2R8GA 1TFWA 2DNHA 1F5CA 2Z2LA 1B0PA 1R7IA 3GFZA 3QT8A 1G2EA 1LOUA 1RT5B 2RB7A 4OMFG 4WP8A 3BGOP 5E3CA 5KFPA 4WYWA 1U4BA 1PJ7A 1NJWA 1H74A 4JI3J 4QIEA 2KRRA 5AXMA 4E98A 4I56A 3FBEA 3K2YA 3TEGA 3MMAA 3B6BA 5C2CA 2RILA 2M7SA 3MURP 2KT5A 2AW0A 4L73A 3EDQB 4B9UA 5KT3A 1HW9A 1X0FA 4ECZA 2GIFA 2HWTA 2XWXA 2ZVIA 1D0EA 3CD6S 2HK2A 3POTA 3W9JA 2VONA 2Q79A 1D9FA 3C14B 1GMWD 1GQEA 1HI1A 3RBXA 6AT1B 4QCLA 3JSMA 3PX4A 2E5IA 2P9GA 5K14B 3ICLA 1FTCA 2QMWA 4KY3A 5HK4A 4OI1A 1TUVA 3X3UA 4X62J 4NLRA 4Q2LA 3GFHA 1FXLA 1NB7A 2EG2A 1G6BA 3EXCX 4M5DA 1NDLA 2MXYA 2CDRB 4G65A 5CD4A 4NE9C 2GGPB 2XZWA 3KLEA 1XMOJ 2EEYA 3UCGA 4Q44A 3OL7A 4E2FB 2H4WB 2CJAA 2WAQD 1NPKA 4X4PA 2FZGB 4LBHA 3BV8A 3MR3A 5BXIA 5H9EK 3MECA 1FDAA 1KQFB 4OFZA 4K59A 2GVDA 2VV5A 4WTYA 2IRUA 5ETQA 3WX8A 1Y10A 2UUAJ 1N5VA 4DR3F 1X5PA 1AFJA 3NNHA 1FXDA 4K4XA 2YH1A 3NS7B 3KLGB 3J7YI 3MAAA 2ALZA 4YDXA 4CLUA 1ZAVA 3GG1A 3L7UA 2NS1B 4N8OA 4Y00A 4ES1A 5KG7A 2PFFB 1JLGB 4B08A 1OYDA 2ASJA 2PI5A 1FD2A 3CJ5A 4NLYA 4ID8A 2OEJA 1MU2B 4CDIA 1NJIT 4ELVA 4DV3F 2BOAA 2VZ9A 1VQOS 1VLOA 2BJ1A 3KMQA 1L3UA 3I9V9 2QTWA 2N3OA 4DSJA 3PYFA 4DV4J 1RISA 3NGTA 3QGIA 4K5RA 5J2NB 4ED1A 5HVHA 4O44B 3T1AA 4GVBA 5DG7A 2HQCA 1T7PA 2RH3A 2XI3A 1F9FA 3GYNA 3MZIA 4DPXA 1VQ9S 2ZJPQ 5L1JA 1S4FA 3GFYA 3GONA 2EVZA 3OFFA 3UFCX 4ZHRB 4DV7J 1U45A 1N48A 1NK9A 5F8GA 1SVDA 2J8SA 4O4GB 1LXNA 3V81A 2VA3A 4DSKA 4LSNB 1P1TA 2MKYA 3FBCA 3AA9A 7AT1B 1IKVB 4HI2A 2JHEA 2HHWA 2DKOB 2VKZG 3CCZA 2HK3A 2YNGA 4WK1A 3TJAA 5KFEA 1F6TA 2V94A 3DC2A 3W5ZA 2R8JA 2C2RA 4AUKA 3HSJA 1A6LA 1R8AA 3QJJA 2PE8A 1VDHA 3FSYA 1N54B 1O51A 1WEXA 1WI8A 3IWXA 2UUBF 2I1RA 4FBUA 2DD8S 1TU0B 4X62F 3IBFB 4I2PB 4QJVA 1Q81T 2OEMA 1YITS 2HNZA 4LVNP 1KBRA 1HBMA 1NPPA 1S9EB 4QPTA 2E7WA 2ZH7A 3VZIA 3LO3A 2DRBA 3MOJB 1Q8IA 2E1RA 5KFXA 3PKYA 1I6JA 1ZPWX 4HH1A 3W9IA 4U8YA 2ADBA 1EARA 2E7VA 3ZZPA 2AYGA 2HBYB 2D3UA 5JVGQ 1SIZA 2MKKA 3K59A 3E2EA 4C3LA 3FVYA 1IKWA 1J5OA 2IBKA 5DS7A 2IRXA 4NLTA 4DDFA 4LSZB 5F8IA 4DR1J 3UCZP 2LECA 2E5LF 1GMVA 1D9AA 4LREA 1U2CA 3MR5A 3DOKB 5A8KB 3QFWA 4WXWA 4KHRA 4EI2A 2PEHA 1YIJS 5DGAA 4IR9A 3WX4A 3H5XA 2W7AA 1MROB 2CAJA 2UP1A 4PQUA 2YWEA 2H54B 4KTQA 1S9EA 2EKYA 4MTPA 3LTOA 4USVA 1EJ7L 3IAS9 4I2PA 5HJXA 1VIXA 3MEGA 4C0HA 2CJXB 4DQSA 3QQCD 3DDNA 4BC9A 3GV8B 4CT9A 1LWEA 4DR5F 1RTDA 5IC6B 3WIUA 3RGIA 1REVA 1VR6A 1KFSA 1JIHA 4PKDB 4RBTA 4K4SA 2M4MA 4HL9A 4XPEA 4U7UD 2VFRA 4JYAJ 3KFWX 4B3SJ 3TUJC 3L4BC 1FDNA 2DHHA 3K7RA 2KU7A 3QWUA 5SUHA 5K8PA 1PBUA 1ZPVA 3MCOA 1H73A 3J81U 5GAEU 4ELUA 1NUEA 1RXOB 2JC1A 3KUEA 3TVKA 4ETZA 3HPOA 1CJUA 4CH1A 3H4DA 5KFTA 1UWBA 3CCLS 4JV5F 1AT1B 4WKYA 4ZLJA 4URSA 2JFKA 3G96A 2QL5B 4RWXA 1H72C 3G8TA 2R2TA 3TUPA 1XEZA 2E29A 2CZ9A 3OD2A 1U1LA 4OI0A 2ZBQA 2BANA 1Y11A 4DFKA 2YY3A 2JEFA 1DJ0A 5KG1A 1RTZA 2DTJA 2YQ3A 2VG5B 4GC7A 2XS5A 2LXIA 1FKAF 1LWXA 2X3GA 2OMOA 2LDYA 3UR0A 2HKEA 5A6WA 3BKTA 1SH2A 5J2QB 4ZPWR 1YJTA 2V5HG 1FK9B 1BQNB 2NXJA 3KDNA 4LIWA 1LQ9A 1YBTA 1LFWA 2DNPA 2MPUA 4OX8A 4DU8A 4F3MA 1PKUA 5CAAA 1K1QA 1ZM3A 4IUFA 2G9OA 2GAHC 3H98A 1KQKA 2MQQA 3MM9B 2V63A 2O01C 4RR5A 3SV3A 3QJPA 3VTIA 2YBVA 4RNMA 1BQMA 2JL9A 3MECB 4HH0A 2XC9A 2LXFA 1ITPA 1NK0A 4WPAA 1M5PC 2UVRA 1X60A 3CNQP 4ZS6A 3DLHA 5HBMA 3I56S 2GGPA 3LPYA 4A47A 1R0CB 4NI2B 3I5BA 4AYBD 4N41A 3MCSA 2GVZA 3UNYA 3HD1A 2OPSB 3DXSX 2HYIB 3TX0A 3RTVA 4KHPJ 3T41A 2NZCA 2KFZA 2OTLS 4LF4J 1CULB 2Z57B 3G2XA 4M5LA 4Y28C 2WONB 4NXMF 2ZBIA 2J9DE 3GIMA 5I42A 1YJ7A 3CPWR 1QD1A 3DNCA 3HCXA 5D4LA 5IFMA 3KTQA 2DH7A 4Q45A 2V8HA 3C6TB 2IVMA 2HVEA 2D9OA 3G8SA 3HHLC 3E3XA 4L3NA 2O5DA 3POTB 4TN2A 4ZVOB 2IFXA 3HFKA 5LJ5Y 1OQ3A 3CJRA 4USKA 2NXUA 3M8ZA 4G1QB 4CO3A 4DJBA 4PXDA 4UF4A 5IM0B 3MTKA 2PMHA 2E7XA 3MEDA 4DV6F 1IBMF 1TL3A 2AT1B 5HMXA 3PYEA 5CA5A 3Q2TC 4UOFA 5DLFA 3JSBA 5G0RB 5DJBA 2ZHBA 2MZQA 2ATLA 1O8BA 3ENVA 3DM2A 1LWCB 1UP1A 3KG0A 1DQAA 2A18A 1VRUB 1ZM2A 1N36J 3FEZA 5HATA 4LFBF 5LMNJ 4KHMA 1SC1B 4YDDB 2H65B 1TL5A 2V4QA 3HSDA 1HQUB 2P6SA 2XSFA 3DLKB 2PDAA 4BCAA 3N28A 3OR1B 6FD1A 2ZH1A 1CVJA 1BWEA 3WQPA 3QBCA 2VA2A 1X31C 2NCKL 3ULHA 1OMSA 3QATA 4N77A 2WK4A 1EB0A 2CQ0A 4N8NA 4ZVUB 1YJ9S 4OZ2A 1ZBTA 1H2TZ 1BE4A 4LRBA 4PCQA 2QRRA 4ZP9A 2RQMA 5KFSA 4DPYA 5A8WA 1WF1A 1GMWA 1HBOA 2M5YA 2VG6A 2XYGB 3ETOA 3HSZA 1VBYA 3KLIB 4DL2A 2B0GA 4IOAQ 2CWKA 2DHGA 3QO9A 1NKEA 2CQGA 4IQMA 1NZAA 5DDQC 3OTOF 3OVAA 2XMKA 3EZOA 3BO4A 4A8MP 2DRAA 1YSJA 1S1VB 2ABYA 3GYXB 3LP0A 2MQ8A 4P7VA 4P9SA 3A4TA 1IM6A 1UEUA 1WACA 4ZITA 3DMJA 3KLIA 3DHWC 2ZH4A 1N5YB 5JJBA 4EU0A 2CJYB 2UVUA 3IM9A 3OW2R 4W98A 5HP1A 4ECSA 5AE2A 1YGYA 2K3KA 2MZJA 1RA7A 3H40A 4OZ1A 5F3TA 3AXKA 2R8HA 5B0BA 5RUBA 1Q95G 2W24A 3HT3A 4JI0J 5B0AA 3CMES 2AEJA 1DAXA 1F3FA 2DH9A 2HRTA 3NRBA 4CLTA 2RE1A 4ZVHA 3MAHA 2QMXA 1EIYB 3MUMP 2ZKTA 3FGVA 1RWXB 2FY8A 3DLKA 4G1IA 5J1EB 4JI1F 2XS7A 3NNCA 1YBUA 2V67A 3WC2A 2CNOB 2Y1IA 1IBCB 2EWHA 1NU4A 3H42A 3KDOA 3KNGA 2M52A 3KK3A 4GC6A 4NLUA 1IUJA 4MKBA 2JZ5A 2VFTA 2V8VA 2C2ZB 5ETPA 2OAUA 4ED8A 2Y1LB 4DQQA 4DF8A 2XSJB 1IKYB 4CLFA 2NXCA 4PXBA 1FF2A 1J5EJ 3CJTA 1VYAA 1RTIA 3TYTA 4UZCA 2YTCA 1CJKB 3OVBA 3CJ4A 1F2HA 4CLPA 2BQ3A 1RT6A 5C7PA 2MZSA 1N0UA 3M2VA 2UVVA 3TAQA 3PTWA 2FJDB 1FERA 3I5CA 4HHJA 4UUWA 4ZOSA 4FF4A 3HVRA 2QLJB 4WE1A 1UETA 3QFHA 4KYZA 1UCNA 1H38A 3CCRS 2B4VA 1KWMA 4X84A 3M9OB 4U9RA 1UL3A 2N3LA 1RBAA 4WIIA 1AZSA 2LFVA 3CIMA 4DX7A 5K8OA 1BD6A 3OSPA 1N6QA 1WC0A 3PJ9A 3MM7B 4A8XA 2B5JA 2EG1A 3IGNA 1DTTA 4L72B 1I3OB 3E01B 1B3TA 1SKUB 1N88A 2H5JB 1TK8A 4CYUB 3RZAA 4JV5J 1NK5A 3NAHA 4CLWA 2GVZB 1YI2S 3DRXA 3N6NA 4OJHA 4F25A 4EEYA 2HQIA 1SL2A 2DR5A 4A8KA 2HHHJ 3M1VB 2BACA 4OI4A 3DLGA 1IBLF 4I64A 3B82A 4Q5VA 1IJFB 2ZH2A 4H4KA 3ZNUA 4FYXB 4JI6J 4DV5F 4JI2F 2H1YA 5F9NA 3FJ2A 5HMWA 1SKRA 2I5JB 2MZ1A 4ZK7M 3K8VA 2BW7A 3I0RA 3MM9A 5G4DA 3CO0P 5DM6Q 1WG4A 2DXDA 2F63A 3Q83A 1WKKA 1T02A 1EP4A 5ETMA 1FK9A 3T1HF 5BYSA 2EXUA 5LMNF 2VOOA 3J7YU 2GQCA 5HL7Q 3GMGA 4DUYJ 4G1PA 2AYBA 3D3CJ 2Y0BB 1H2UX 5A2QY 1PC4A 1HL6A 1JNZB 3D3BJ 4OLOA 1HNIA 2W9AA 4A8YA 2A6OA 1YJVA 4LF4F 5I4MA 2RRNA 3IS9A 5EWGA 3BDPA 2FZCB 4RBVA 1SI9A 3HHNB 2AJ1A 4ED7A 1CPZA 3MR7A 4X66F 3KHHA 5J2MB 1SL0A 5L1IA 4BDPA 1OYEA 1IBMJ 1S72S 1L5UA 2M9KA 5KG2A 1YHQS 4BWMA 4KO0B 4OX9F 3PV8A 3HJVA 1VJWA 1W2BR 1DURA 2LQ8A 4FZVA 4PEOA 2FLOA 3UN5A 1B0TA 1OSDA 2POKA 3M6VA 3R97A 1RYRA 5IC4B 3UQSA 3QSYB 3Q8RB 1JLCA 3HF5A 3W63A 3E8OA 4DV1J 4OZ5A 1HD0A 2V2QA 4Z2XA 4J7CA 4Q2MA 4L6V3 5J2PA 3P96A 1KVIA 2CQ1A 2YWGA 2WZ1A 3JSYA 1WWHA 2X1AA 2IM0A 3AQPA 3MM5B 4OJ1A 4FS2A 3BSCA 4E8UA 2ZE2B 4DR7F 2W8KA 5CYMA 3R7NB 3BQ1A 3T5JA 2BBEA 3AOCA 3P4UB 5DDRC 1XJWB 2GIRA 5ETKA 1U1OA 4O3NA 3DYAB 3KXDA 4TYBA 1KOHA 1D8YA 2OO4A 4Z7YA 4ZVGA 4OZ0A 5CYMB 3R1LA 1KHWA 1V3RA 1T8EA 1KVJA 2D69A 4OYWA 2W01A 2CPFA 1U6FA 2EW9A 3PDNA 4LF8J 5KG4A 1TV6A 4DUYF 3D6TB 5B0GA 1FRHA 4P75A 3AODA 4IFVA 1RGVA 4NMLA 2Q6CA 3MI7X 4DPWA 3QT7A 4ZPAA 1UFKA 1PIEA 2XY5A 1VQKS 5KFQA 2HFVA 1I51B 1FVQA 4C98A 4DMZA 4R5PA 4ZVRB 4ETXA 3OVSA 4F4ZA 2ASLA 4Q7AA 2JEIA 2K7JA 3O44A 2C2EA 6FDRA 1FJ7A 3VQTA 1JXLA 3DDKA 1NK8A 3PFOA 3R1HA 3TVZA 1M5VC 1VMBA 2YVSA 4F36A 1RHRB 1URRA 4IRKA 3I82A 1TP7A 1TAQA 2RAQA 3D9BA 2W9BB 2YKOA 4IOCQ 2CZVC 3ZC4A 1IR1A 3T1YJ 1FJGF 2ALYB 1P6TA 5C24B 1G4CA 1HBNB 5L8RC 1U8WA 4FDFA 4NCGB 3ZZYA 2DR6A 3EDRB 4RUCA 4ITSA 1VHFA 2VDHA 5KFMA 3M2UA 1IVZA 2BJEA 1DTQB 2BKNA 4LF5F 3JAMU 2XHWA 1U0SA 2DY1A 1LK5A 2OMLA 3SI8A 7FD1A 1KR4A 2GQQA 2YPZA 4O4GA 5D77A 2MQPA 3FRZA 4K7QA 1GX5A 5KG5A 3OLBA 5A6PA 3LPEA 4FYWB 3NNAA 2XCAA 3P5TL 3RR8A 2DIUA 3P8BB 4H4MA 3GJTB 5KG3A 2UZAA 3CO9A 3KG4A 2RU9A 3TWZA 2ZBRA 2B56A 5HQLA 3R7SB 3KMSA 4B9TA 2QIFA 5KFIA 1W25A 3GR1A 2XM3A 2HRUA 2K7KA 4X64F 3SEOA 4ZJLA 4DL6A 2LCWA 1QSLA 3C6UA 3HP6A 1ZS6A 2GIQA 3TO8A 3FKBA 1YJNS 2IYGA 2FLPA 3DLGB 3LWLA 4DX6A 1PYOB 4O0NA 5AT1B 2VG7B 2L9NA 2V9KA 2DVIA 2CPYA 4HHHA 2DNOA 2F5GA 2R7QA 3MAAB 2C2NA 3VQSA 2GQ2A 2BABA 4WCEQ 2ZH3A 1LK7A 3NLCA 1HPZB 3R27A 4RW9B 1R0AA 2J7UA 2U2FA 2FJBB 4DV2J 2JLEA 2Q3PA 2YKMB 2MQLA 1TL7B 1RT7A 1X4FA 1QAIA 3OHAA 3QGHA 4USMA 1IR2A 5DLGA 4PPZA 1PJ6A 3SSSA 4YEAA 3ZTQA 3VALA 1Q1KA 5A0YA 1JLEA 2OPRB 2EC0A 4O3RA 4M5DB 1WHWA 1D09B 1PAUB 4WWSA 3EVWA 3H7HB 4K2JA 4LR9A 1UVMA 2XULA 1VK3A 2IRYA 2YKNB 1VQ6S 3CSKA 4KH1B 4B3RF 2R7SA 3IRXA 3RJMB 4ZN3A 2ZBCA 5E41A 1U1MA 1IKYA 1C0TA 1R0BG 1U2RA 4ZP8A 5EUHA 4K50A 3MM6B 4JOUA 4KC5A 4A46A 3UPFA 3CC4S 3M30B 2EFNA 2KG1A 3HFZB 3RAXA 2YQ1A 2L48A 2Z0GA 3CDUA 5D4OA 1VC5A 3KLHB 2OJ3A 1EETB 2VH7A 4CM0A 3MXHP 3TQEA 2B4PA 3TAPA 3MMJA 4ZJOA 1T9VA 2IIHA 2W8LA 2QV6A 1M90T 1KNZA 4LRFA 4P2SA 1TFYA 4MYTA 1V6HA 2P8IA 1SV5A 2VOPA 2ZUGA 4RO0A 1QUPA 2KM8B 2W2OP 1QJHA 2BKOA 2V8DA 5HMYA 1NCLA 3TUIC 2IM1A 1IKXA 4GO5X 5HI7A 1VC0A 4K4ZA 3D4JA 4K0KJ 5KTQA 4ZPBA 3MEEB 4OYMA 3TX8A 1V5IB 2VFVA 4LQ9A 2ZNYA 2A1BA 2FY1A 3HI9A 3MDFA 5KFFA 4OJ3A 3JYTA 1SUQB 1F60B 2I0XA 2E1MC 2K2PA 3N6LA 5KFLA 3VF0B 3W7BA 4CO4A 4DN9A 4DZDA 2LP4A 4RPFA 2RDIA 1SKWA 4ECTA 1F2GA 1H98A 4N56A 2CADA 2BDPA 4LIRA 4Q0BA 1N8RT 4H4OB 3V6KA 1RTJA 4NZ0A 3BKFA 3ZTSA 1X5OA 3JYTB 4X4SA 4K4WA 4AD6A 4J9VA 3LW5C 2D3ZA 3FZBA 3HHEA 3PNIA 2E5LJ 1FRIA 4FYDA 1M1GA 3RBEA 2WSCC 4LBIA 1LW2A 1S6QB 4C8MA 3RBDA 3D67A 3ZO7A 4DPOA 4OZ3A 2MKCA 2VPYB 4RUBA 4ER8A 1IKXB 3D0GE 3O1LA 4RW8A 5F8MA 1JLAA 3LWMA 2JJ4D 3AT1B 4DG1A 4MKYA 1EQ0A 1EAYC 2NXEA 1FI4A 3GLJA 1M1KT 2OH2A 3MPYA 1SV5B 1XR6A 1FTRA 4OHVA 4ZPCA 4DUZJ 2HMIB 2CPZA 5HLFB 3TZYA 3HLUA 2DBBA 5ETSA 4B3TF 1U1NA 2W2MP 4NYPA 3KJVA 3US5A 1V9OA 2LQ5A 3GG0A 2A3JA 3BBCA 3TZWA 3D2WA 1X9SA 2AWZA 4FKYA 4IH7A 4LF6F 4O3PA 4LFAF 2MHEA 2K1RB 2AF6A 5LSLA 1LW0A 2FHMA 2G2OA 3MEDB 2X3DA 2HFZA 3MEKA 2KFNA 2EI5A 4NOHA 1FT8A 3F44A 2HHPA 1T94A 3M30A 4CT8A 3EYZA 2FHKA 5GAEI 3TEHB 1HBUA 3Q89A 3RYLA 4O3SA 4NLOA 2VQEJ 2HZVA 4OHWA 3ZFVA 1RAGB 2RQKA 2GNKA 1GT8A 1WC4A 3MWBA 5CYQB 4CLYA 4CRJA 4V1Ak 3V4IA 2NQPA 3VGSA 5JUMA 5AE1A 3V5RA 2YNFB 3EICA 3CJQA 1GAOA 3CMAS 2HNYB 3L9ZA 4NRTA 4X4OA 4CO1A 3SYZA 1U1KA 3LGMA 1XNQF 2NSBA 5A0YB 3V6JA 4YP3A 4F67A 5AJ3J 4WFYA 2QX0A 2RHQB 4UQGA 4FXVA 3RUBL 2RRBA 2R7TA 2OSRA 3HMJG 4KE5A 5DO2A 2PMWA 1IM4A 1HWKA 1NH8A 2F40A 3I5AA 3IG1A 5D0EA 5IV4A 2UUCJ 1KLMB 3T5KA 3DOMB 4U7CA 3GIRA 2F8EX 3OFGA 3SBMA 5BYQA 4ZCKA 1K0TA 1LKZA 2KT2A 4N7TA 5KT2A 2DHSA 3CIZA 1LWFA 4HDHA 2YNHA 4J5OA 3TA2A 3IR5B 1Q86T 4K4VA 3C6UB 4JB8B 4KV8A 2RUGA 3PIPQ 4FF3A 4GRSA 1WUUA 2M70A 2X1BA 2HAFA 2ZH8A 1SCJB 4F4AA 2IY5B 3BBBA 4KT0C 3WBZA 2KVQE 2W4CA 5F0UA 5CABA 3I55S 4MIBA 4DL3A 3CJ2A 3K5PA 2DCUB 1X4HA 3AD7C 1RYSA 1RWVB 3RW6A 5MAOA 3GJQB 4KQZA 1EKSA 3MCNA 4D3HA 3TARA 1XIQA 3CCQS 1P9YA 1X5SA 3DDIA 2Z2YB 3A3PB 2F9JA 3TJ9A 4C8LA 1NBEB 1FE0A 3NGRA 2Q43A 1DTQA 1XQIA 4EYIB 4ECRA 1Q82T 2FHOB 3GSDA 2EKNA 1HFEL 1RB0A 2HBQB 4Z37A 2D41A 4CIOA 1HBNA 2KG0A 2A6MA 4MIAA 1RUSA 1RAAB 1XMBA 3MTJA 4D3GA 1HKAA 2W7PA 4DWIA 4DUTA 1HR0J 2PT0A 4MK9A 1Q8BA 3IWNC 1Z2LA 4K0KF 4BHQA 3RRGA 1OPIA 3CEDA 3T1HJ 4PQUB 4DU7A 1RWKB 2JEJA 3NS5A 2JH3A 3R9LA 4U95A 4OI6A 1FRMA 1M1HA 1RBLA 1Z1ZA 1WOSA 2F3JA 3CJ0A 4LR8A 5HROB 2UUCF 4TNOA 2C2MB 3P45B 1KTQA 3MPDA 3NKYA 1OJ4A 4J37A 4O3OA 3BYRA 3SFUA 1S0OA 1YJUA 1JQGA 1EX8A 2QLFB 3U27A 3AAWB 4LMZA 1C0UA 4MIWA 1VQPS 1WF0A 2PC6A 3FBBA 1DZ5A 1CC7A 4JI2J 2DY9A 4AQYJ 2YKAA 1ZA2B 2KXHA 1YLXA 4C7QA 2RHSB 4LQ3A 3VGTA 2E66A 2MSTA 2B9XA 4R0JA 4CWBA 1X4CA 1WJ9A 4RU9A 3PW7A 4YR3A 4CQ1A 4F50A 1K47A 3K0JA 1TQLA 3OXLA 4R8UA 1R27B 4HHUA 4DPTA 2B4OA 2I38A 3A3NB 3CB4A 4LFAJ 3LQVA 4C8KA 2WVCA 4AL7A 1WSVA 1JLBA 2JFDA 2MEWA 4LSLB 1HBMB 2OUGA 3TANA 1XMQJ 1HMVB 1VQLS 2MJNA 3QGPA 5LSOA 2XQCA 4C4WA 4X4VA 1Q0NA 2XYPB 2MJUA 3CT9A 2CRLA 1YQHA 3L7PA 3OR2B 3QIDA 3T9NA 3CC2S 2R7UA 5J2PB 3CD5A 1N33F 4OX6A 3OJSA 2CQPA 1DARA 1J27A 3TAMB 3R6GB 2XBPA 2XNRA 3ZZ0A 4W4MA 1LEOA 2KRBA 2C3PA 5KFOA 1JLCB 1S1XB 1QUVA 1KOOA 4JI7J 1XN9A 4IO9Q 4FNHA 2HNDB 1QTMA 4Y2CA 2NREA 4B3TJ 4F4WA 1HNWJ 5E3AA 1ZM9A 1MWQA 1WEYA 3CXCR 5AXLA 4KO0A 5DZ7A 2ZITA 4M5HA 1S1WA 4CO2A 4ECYA 1HNXJ 4B9LA 4U6PA 3ETMA 4WFAQ 3PFEA 1LFPA 2EFOA 3AOAA 4XAKA 5GAHU 5DM7Q 3DLLQ 1XMOF 2RIJA 2R7RA 2MB0B 3P6YC 1NM2A 5J2MA 4PWUA 4GVBB 3IS9B 1IQTA 1KDNA 5D3GB 3T9ZA 2AKWB 4OYXA 3K57A 3M8QB 2DXEA 2GMJA 1WOPA 4Y6IA 1SJ4P 4Y65A 3D0HE 4K5SA 1JLQB 3OJUA 3R5CA 4GKKJ 4DFJA 3MD3A 3K5NA 1HNWF 1FJEB 1NLKL 3HSGA 1FESA 2VJUA 1HD1A 2N4CA 1HYSB 1CQNA 5MLCV 1OO0B 3BBFA 4OYPA 3KK2B 3D0IE 4XDCA 1HNZF 5EX3A 3BPSP 3DOLA 2VQFJ 3DRRA 2IJFA 2YH0A 2HHSA 3K17A 2EBGA 2I5JA 2J7WA 3OTCA 2GVDB 2R42A 4DR4F 4U67Q 4F02A 2NR0A 4F3QA 2I6WA 3NMAA 3JQKA 1CJTA 1FRXA 1S1UA 2HFSA 2QE5A 3A8EA 2BEFA 5KFKA 1T03B 2RT3A 4USUA 1TAUA 4I2QA 3GJSB 2C3MA 3N4WA 5KG6A 1FKOA 4NYOA 1HLWA 1YZ7A 3QSIA 4FPRA 1FJGJ 3GPAA 4F0MA 3NBPA 1ZTWA 1RWPB 5M2PA 3IC1A 4PWDA 1FX2A 3DCAA 3C15A 3FNNA 4UW2A 2BM0A 4DV5J 3PYGA 4DCOB 1IN0A 2BM1A 3VCDA 4CZCA 4OV6A 4B17A 3KYLA 3H25A 4YMEA 2BX6A 2O1PA 2Z8QA 3FRYA 2ZEJA 3AOBA 3HHKA 4WE1B 3FFIA 2M88A 1WELA 3EWGA 4F26A 4IDKA 1XERA 2YKPA 3I31A 3NWRA 1RWNB 1W2IA 4WU3A 2OPQB 3OL8A 4ZP6A 1Q5YA 2KZZA 1NDPA 2DRDA 1UA0A 1AUSL 3WIVA 5FIIA 2OPQA 2C3OA 2VC0A 3MMAB 5LM7E 2LYVA 2W9CB 1FXRA 2ASYA 2HIQA 1PO6A 4CTAB 2XMJA 5DQGA 1AFIA 1FWPA 2HQ3A 2YWFA 3MFIA 3T5LA 1RT5A 2FGOA 3TZXA 1FNXH 1GX6A 2XO7A 1R6YA 4EUVA 3PO4A 1BWVA 2JWNA 3MMBB 4F04B 2D7SA 5I3QA 4DXLA 2DGTA 2R4FA 2RS2A 1WDTA 3F73A 3NBPB 3UDLA 3W8PA 2GO8A 2V4RA 3SDEB 2DISA 1RT2A 2M8HA 2IHR1 3AQOA 4WF9Q 1ZOTA 3LH2S 5KFZA 3A8JA 1T03A 3Q8UA 1WTFA 2GC8A 2W4DA 4RW6B 5B0FA 2AEFA 2RF2A 1GXTA 2XLJA 4F2SA 1S0VA 3QYYA 4KGVB 1RABB 1RT3B 3CCWA 5A8RA 2VFUA 3DOLB 2AZ1A 5K9FA 4W92B 3A3OB 3OTEA 1MN9A 1QAJA 4C8OA 2YNIB 2VBYA 1S59A 1UVKA 4IKAA 4KHPF 3EVMA 2PA8D 1I1GA 4HT7A 2CQBA 3QMQA 3PVXA 4QYZK 2QN6B 3D28A 3F41A 3T6JA 2RQCA 2H9ZA 4LF6J 1IQZA 2CG8A 3O8WA 2DNMA 3RW7A 3EMTA 1FWKA 2HWIA 2B7BB 3L7OA 2G0CA 2YXLA 1H7WA 3JAMY 1U7LA 5KT6A 4WFBQ 3M2UB 2HG4A 3QT5A 4LR7A 4USJC 3FUYA 5A8WB 3K5LA 4NCGA 1TKTB 2Z30B 2YWHA 3TP2A 4B3MJ 1VFJA 1Y3JA 3GCXP 3LALA 3O5TB 4YB7A 2PO4A 1DLOA 5LSRA 5AJ3F 4FS1A 3K5MA 4I7FA 2Y1JA 3C3LA 2ZD1B 4A8QA 5IT9Y 1S48A 1WKJA 2Y0SD 2DNZA 2PFDA 4YOEA 2MTLA 2VDIA 1X4GA 2H5IB 3D68A 1R8BA 3I0SB 2RF2B 1WHVA 2C3YA 3OR1A 5L9NA 3ITHA 3TA0A 3QZ7A 2HNDA 1S1XA 1NDKA 2IC3A 3AJ1A 1Q5VA 2FVCA 4USWA 1DQ9A 4PG6A 4AE5A 3RB6A 3TAMA 1EHWA 3W2VA 4DHVA 1VHIA 2WVFA 2P9CA 4NL5A 1AYEA 4IFVB 3FMBA 4J9OA 1L3TA 4USTA 3ILLA 3U1MA 5DZ6A 2RU3A 3C46A 3DXBA 4P72A 2HFOA 4LSLA 3ZZTA 4F7VA 3PO5A 2XMVA 1XNQJ 5J1PA 3M8PB 2E1AA 2HLUA 3WZ0A 1TL3B 2KL8A 1K1SA 2O66A 4CTAA 4RNNA 3V6DA 2DPJA 2ZJQQ 5CXTA 2BJ8A 2NZ4A 2HLTA 1S9GB 3PCOB 2M0GB 3CJKB 3LAMA 1S79A 4ZDNA 2Y3YA 2DO0A 4QOTA 4ID5B 4ECQA 2F9DA 1YDLA 3H2LA 3EXYA 3PW2A 3H0PA 2BZ2A 3CTRA 5HAOA 4UT4A 4XPCA 1XC9A 4U8VA 2UXDJ 3HT0A 1MSWD 2NXNA 1VI7A 2JLFA 4OIXA 1HI8A 1RP5A 3NXZA 1UA1A 1TL1B 1IBLJ 1T3OA 4DR7J 1BUXA 3QLHA 2MLXA 4RW7A 1YWXA 1KEKA 3EJMA 2UXBJ 4DR1F 5CZXA 2ZM6F 1RHMB 2HEKA 2EC2A 2KJWA 3VAHA 1SJRA 4OX9J 4TU9A 1VS3A 3GZ7A 2GMLA 2B4UA 1VQ7S 1BQMB 3EGNA 3ENQA 5LXRA 4YR0A 1N0VC 1SQEA 1S6UA 3GWCA 3JTPA 1U47A 2FB0A 4MYUA 2F8MA 3QAEA 1BXNA 1CQMA 1UPPA 1NZ8A 5GVQA 2X7IA 3EM1A 3GFXA 3H2UB 4PXEA 3DRRB 3LP2B 2I2YA 1RCOB 2ZZMA 2LEBA 2O3DA 4KBIA 1BQNA 3UD5A 4NXNJ 2KKHA 3MOZA 3ZZZA 4S0MA 2UU9J 5EN1A 4DSFA 1Q8LA 2J5AA 5IZHA 3PX6A 4X2BA 3L09A 3EGWB 2CPHA 2VG5A 2E5GA 1TUGB 4G3IA 3HFVA 4WJBA 4ICLB 3JTOA 3P49B 2ATCB 2JOQA 1WHYA 2ZOGA 3H59A 3M8QA 1ZM4A 1U1RA 2V8PA 3BREA 2A2DA 5D3GA 2M2BA 1RT4A 1N5TA 2CNLB 5F41A 3QRQA 5T7LB 4I68A 2HIYA 2DHXA 4PR6A 4DCJB 5HMZA 4TQSA 1SC4B 2QMUB 4J91A 1CJUB 3QAUA 4CO5A 1Q4RA 3UI3A 5L1LA 1ZZNA 3PEHA 5E7OB 5ITHA 4DN0A 1HWLA 4AL6A 3W62A 4HYKA 3M1VA 1S1WB 3H5YA 4K4YA 4Q8FA 1SH3A 2DHAA 1HQEA 3VR1A 5KFDA 4NMXA 4DSEA 3DOMA 2B3TB 2QL7B 3OFHA 5IOLA 1KLMA 1NRKA 1X4DA 1Q78A 1I94F 3IG1B 3MCMA 4RNHA 3RB0A 3S01A 4RUAA 3ET6B 3PYDA 2AU0A 2UVWA 4DV4F 2GFFA 3MM7A 2HQGA 3NCQA 4EFAC 5DQHA 2H4YB 3A12A 4NX9A 2D3O1 2OPPB 4RX6A 2CYYA 4TXSA 3ENAA 4F3OA 4KAIA 5EWEA 4ED3A 1CS4A 4DLEA 4DS5A 1VQ5S 4PG5A 2E9TA 1HNVA 3BGRB 3CD0A 3VWSA 1NK7A 4Y2IA 4QYRA 1Y0HA 2P6TA 1RCXB 2CJQA 1OIAA 2A2CA 3D1HA 4ZCLA 3ZZOA 4X4RA 2XO6A 2QC3A 4B9VA 3MMCA 3CDWA 4RBUA 1DBDA 2HNYA 1VRTB 3OT9A 4J90A 4YB6A 4AXJA 1U1PA 2YNFA 2LQ9A 3WDOA 4ZLNA 2DNKA 2VPWB 2J6TA 4I67A 3R6LB 4YY3F 4DR6F 5CYQA 4R25A 3V4IB 4M94A 3IN5A 2XGPA 2X1GA 2GZOA 5BJRA 2B6AA 3BN4A 2BVZA 2BKPA 1RAHB 2ILYA 2RSQA 2Z56B 4CH0S 1N4LA 2E1PA 3BSOA 1HHSA 1P8GA 4JV0A 1B70B 4DL0C 1L3VA 1LW0B 4DPUA 1VRTA 3DRPB 4LT6A 2IVYA 3MMCB 1JJHA 1DQ8A 3DLJA 5J1EA 4QWCA 2GW8A 2L41A 2HNZB 3WC0A 3KJVB 4GKJJ 5K5MA 1WNEA 5F3ZA 3H90A 4FYVB 2OPPA 4ILLA 2AJQA 2ZNZA 2HQFA 2OIHA 2CQCA 2P2CB 2R9LA 2HBZB 2NSCA 3S7RA 2R7WA 4CCHA 3ENWA 3OFEA 2G13A 1GNKA 1R31A 3ET6A 3T6BA 3UWTA 4JI1J 2KZMA 3W8GA 1PSDA 2G0IA 3FK4A 3A8IA 1L3KA 1I94J 1TTHB 2W1BA 3DMJB 3THTA 3RR7A 4HACA 2OTJS 4P2XA 3SCLE 1Z4UA 4DV6J 4MFBB 1WOOA 2QSWA 1YRUA 2BJ7A 5DRKA 3S8SA 3D1OA 1S1VA 2CDQA 4CNYA 1U6ZA 3Q8YA 1RBOB 3LGNA 4DI6A 1VC6A 2W2PP 4CP5A 2CQ2A 4C97A 1NK6A 1TL4A 5T7LA 4UZBA 3D7SB 3R8YA 2C2KB 3DU5A 4ES3A 5KG0A 1FNOA 1TUWA 3VAKA 3TRGA 4PG4A 5CYJA 4I1TA 5HSPA 4FPIA 3W61A 5IQ6A 2BUNA 4JI4F 2Z4PA 3JS9A 3I96A 1SB6A 2IBOA 2HFNA 1KC8T 3IP0A 4FKXA 1U25A 2MSSA 1RADB 2BQRA 2SXLA 4ZCIA 8AT1B 3DU6A 2ZM6J 2VJVA 4KPCA 4QBUA 2OD6A 1RDRA 1X8DA 3G6ES 1WTBA 2DYAA 3ELHA 3H5UA 4ED2A 2NUUG 5FLXY 2F4FA 1YKWA 2HS3A 3L95X 2U1AA 2EFVA 2UXDF 5IV3A 4DBQA 3J81Y 4MT1A 3GQCA 2DNNA 1G3OA 1EETA 2CQHA 4KSEB 3PHTA 5I3PA 3THPA 3PX0A 2FVSA 2UXBF 1JB0C 2DO4A 4EO8A 2HHHF 1TL1A 1FKPA 3C8YA 3TJ8A 1R8PA 5I3UB 1B7YB 2FLLA 1ICEB 2F65A 3W64A 3SFGA 3MM6A 4C0OC 2ZZNA 3PZPA 2K8GA 4ANCA 3IRXB 4LF9F 3BO3A 1ZAXA 3RB3A 4TLRA 4B3OA 2ZUAA 2ZHAA 3BO2A 3FC9A 3PJWA 1OWXA 3UE2A 3HULA 3GR0A 1JKHB 2EK1A 2QG9B 3BGLA 1JJ4A 4HDGA 4EZ6A 4PWWA 2A0FB 2WRMA 1QE1A 3KUHA 2OPSA 2XY6A 2EBEA 2BV3A 5E3QA 1MW7A 1NNDA 3V6DB 2PD1A 2C2DA 2E9ZA 3ZNJ1 1S7HA 2QLXA 3J7Z5 1B7FA 2KTQA 2B51A 4DR4J 1S99A 2E5JA 2GHWA 2YKMA 3AHPA 1PBAA 3JXOA 2ZKUA 2ZOMA 2QFIA 3HKWA 2KXNB 3IMQJ 4DUZF 1IWGA 2Y1RI 1FDBA 2M8DB 2HVDA 3CDEA 2JEGA 2DXFA 3GTYX 4L76A 4PUOB 3H8YA 3C66A 2W2QP 4RZRA 2NYHA 1SIWB 3FMWA 3THVA 3LP1A 3M9MB 2DNQA 2DEIA 1BLUA 4RW8B 2VG7A 2D3OR 1VJQA 5T41A 3CCJS 1GK8A 2DPIA 2XNQA 3CVKA 1LW2B 1S6QA 4NLPA 3VAIA 3MR6A 1RA6A 4YHHF 2RVJA 2WHOA 3AD8C 2H5EA 4DL7A 2GV1A 4DS4A 4NLXA 1Q79A 1BHNA 2GJIA 4YQWA 1J5EF 1D1UA 2ACYA 4J9RA 1VQ8S 2YQ0A 5F0WA 4B3RJ 2PIIA 1RTJB 4L74A 1VBKA 1C2PA 4H4OA 1TKTA 1WKLA 2BANB 3BH6B 1S7IA 1N32J 4NLDA 4DX8H 5CHCB 4PG7A 2GJFA 1YG0A 3I4HX 3SQGB 1ZYQA 4Q0BB 4DQRA 4B9MA 1RK8A 1RTHB 1R8CA 1UWBB 2XZDB 4C3MA 3EX7B 2B8PA 4EBDA 2ASDA 1SUQA 4CNZA
chains in the Genus database with same CATH topology
2DK2A 3MM8B 5H9EJ 4MFBA 4USHA 4NCAA 4HVZA 1U26A 4EBCA 1REVB 1UJ5A 4NLVA 2Q6BA 2XLIA 2QEXS 1Y7PA 4NA2A 1K9MT 4AQYF 3MEGB 1RT3A 1Q53A 2HVIA 3G6VA 1MMLA 3TR5A 3D1QA 2LMIA 5AXNA 1U6BA 3KG1A 4ECXA 1TKZB 1SBRA 1IXKA 5HN0A 1AXQA 4W90B 2CJKA 4RKUC 3JSRA 5A8KA 3SDEA 5JVHQ 3DRPA 2MKHA 4OI3A 1X7VA 3N5BA 3Q2SC 2IMOA 2YX1A 2KDOA 3M6WA 4IH5A 2HS4A 2BE2A 3SSRA 2IJNA 1TV6B 3D5MA 1YBAA 3MPVA 5C25B 5LXYA 5IT0A 4A8SA 1T95A 4DSLA 4G6VB 4KFBA 2G1DA 3BGUA 1FVSA 2YKNA 5ADZA 3DFEA 2W7OA 4OZNA 4Y3CA 2D74B 5E3RA 4DOZA 2W9CA 4F2RA 3KWMA 1QM9A 3NCPA 2J9EA 3DRSB 2BRKA 4HEA9 4I4BA 4QIWD 1JLEB 2OPRA 3MM5A 4JI0F 4DL4A 2HVHA 1Y5IB 2OFGX 2CZ4A 4DV2F 3H2VE 5LT5A 3TW0A 1RT7B 3UCUP 2XLKA 3RW6A 2FUG9 2ZC3A 2QA4G 1Y3KA 2ERRA 1OSCA 2BYCA 4NLWA 4ZVFA 4PWDB 4TYAA 4AXIA 4U7UK 4XIUA 4V19J 4RW9A 1R0AB 2GO9A 3K58A 3X1LB 1FKOB 1WF2A 2DB1A 4I2QB 1JWWA 1WI6A 2G4BA 1U8SA 2X1FA 3BF4A 4Y2MA 2EFQA 2D1CA 1NKBA 4OZJA 1FE4A 5C5JA 4MH8A 3UNGC 3SMZA 2DGVA 4DEZA 4QR0A 2JLGA 4O44A 2CPJA 2FJXA 1T05B 3P3DA 4TKTA 2UV8G 4YUDA 2HAIA 3N5FA 2CFXA 3IFEA 4H4MB 2RNEA 1MWYA 4IOBA 4ICLA 1MU2A 2L08A 2LU2A 1NAQA 2CPDA 1AROP 1FRKA 2VPXB 2J8AA 2YX4A 4USIA 1X9MA 1ELOA 4GKJF 3RAMA 1B0VA 5E2QA 2KYZA 1P9QC 3I6PA 2N82B 2QA4S 1T05A 3DLEB 4OX7A 3R5DA 1N5SA 1C4CA 4YB1P 2UUAF 2V0NA 1O5JA 4HTIA 4J9PA 1RT1A 1RKJA 4EGLA 3MR2A 3MGJA 3G9CA 1O0PA 2ILZA 2XMUA 4NZ7A 3NGKA 2PA3A 2B43A 2NYIA 5BR8F 4MK7A 1RWUA 1TKXB 2EPIA 2PN6A 3TUZC 1D3WA 1K73T 2AJ0A 3SXLA 1RI7A 4RW7B 1VBXA 4UY8T 1S10A 5K14A 2OP5A 2GHPA 4ED0A 5EX0A 3BM7A 3KLVA 3JSMB 1FD8A 1IJEB 2VODA 4PRFA 5L9XA 4DQIA 2LKZA 4OHYA 5FDLB 1N6QB 5M2RA 3TOQA 4QWAA 3DLBA 3VAGA 2WSFC 3OR2A 2DGXA 1ZAWA 1HMVA 2ZDPA 2FJAB 3BR8A 3FCHA 1OPZA 4ID5A 1TVRB 3CCMS 1GTEA 2PSZA 3S6EA 4TQRA 1QY7A 1S9GA 4NA3A 3CJKA 4KB7A 1RT6B 5IS2A 5GAHI 2EFPA 2HHVA 4URQU 2JX2A 3MHYA 4R0EA 3GIJA 2Z2MA 1RTIB 2O67A 3Q0AA 3IR6B 3A1YG 3N9UC 3SCJE 3TA1A 4YFUA 1P27B 2CQ3A 3N79A 3RAQA 2I8EA 3MUVP 4ZPTR 3W2VB 4DL5A 4B9MA 4J9MA 2P5VA 4DV1F 1Y5NB 4WFZA 4YR2A 5F8HA 4QW8A 2IC3B 2RQ4A 5D8HB 2YX7A 1XTZA 1NO8A 4ECVA 3IR7B 1TKZA 5B08A 4WK3A 4RW4B 1VQYA 2E1CA 5KFHA 2Q66A 4I6WA 2KM8C 1BQXA 3DGPA 2F4VF 2ZH9A 3M32B 4I6AA 2FJEB 4NYZA 3FEXB 3IRWP 5HP1B 1K0VA 1KRPA 4DV0F 3T5HA 1JLFB 4WZQA 3TVYA 1HNIB 4IG0A 1X5TA 2BA9A 1S0NA 3KK1B 1VGYA 4DFMA 4OLPA 3HK2A 3QO9B 2VFSA 5IWAF 4NWBA 1RTHA 1X4EA 5HQ8A 1A9NB 1N34F 5U47A 3QIPB 1FCAA 2VG6B 3BJYA 3O6QA 5KFCA 1HNXF 1C1CA 3HHLB 4F4KA 1A7GE 1MMDA 1BY9A 3UDCA 4KIAA 2J0WA 4NLQA 2APOA 3VAJA 5CZVA 3LF0A 5D6GA 3I0RB 2E9RX 4ZP7A 1FNMA 3OLAA 2FC8A 5CCMA 2N7YA 3MUTP 4DQPA 2IAJB 1NHVA 3PRDA 4DFPA 4QWEA 4F8RA 2VBXA 2RMLA 1URNA 1LWFB 2HHQA 1FRJA 4QYZJ 3CE8A 1CG2A 4DF4A 3LP1B 2DJWA 5JXSA 5KOXA 1XMQF 2F7VA 2CVIA 1S6PA 3EPIA 1UFWA 5B0EA 1Q7YT 4JV1A 2AV5A 1NEEA 4KKOA 3MMBA 2CQ4A 1UVIA 2CJBA 2MKJA 4LJMA 4NPOA 5M2UA 3AH6A 1X9WA 3BGFA 3U1LA 1UVJA 2MQOA 5IT4A 3BN7A 2ROGA 1GTHA 3M8RA 1Y5LB 2COLA 2IM3A 4AFFA 3CCVS 2BOPA 4G1QA 3C2PA 3UW1A 1HI0P 4BBYA 1Y4ZB 1VBZA 1UMJA 3AY0A 2KHCA 2LVWA 2ZFHA 2LLZA 4IH6A 5E5NA 4P6QA 3FFIB 3GILA 1UVLA 2XEXA 2GMHA 2WB1D 3C6TA 5GAGU 3TI0A 1QVFR 4JI5F 1Q7LB 4KKOB 5AE3A 2J0SD 2ZDOA 1HBUB 1RJJA 2WONA 3VZHA 5DDOC 3ONQA 3CUNA 3R5AA 3MFHA 3CCUS 2IMWP 3PW0A 2V8GA 3N0VA 4KPYA 5K8NA 5GADU 2K1RA 4WFXA 4OQJA 4DV7F 2R2RA 5F8JA 1WG5A 4EWTA 2AX1A 5CD4H 2NLWA 3O2IA 2IAJA 1S1UB 2K3IA 4OHZA 2HMIA 1D8ZA 4JI3F 2ROEA 3IO1A 1NHUA 2LEAA 4ZMMA 2WW8A 2CVEA 4X4NA 1M5SA 1N5QA 1N5YA 4C8YA 4TY9A 5KFBA 1HYSA 2CPXA 3LP0B 4ZCMA 2N7CA 3KK1A 2B9YA 1VLYA 3NWGA 3J7A1 2KH9A 1JLQA 2R7OA 5H9FJ 2AYMA 5LL6d 1S0MA 1K8AT 4GO7X 4QIGA 1HBOB 4NZ6A 5L38A 4EYHB 2LQJA 3M6XA 1L3SA 1U24A 4IRDA 2I9SA 3HM9A 2R2UA 1D9DA 1VOMA 2RKIA 2FHJD 2FJWA 5B09A 1SJQA 1HQUA 5IQQA 4RUHA 3AB4B 4ECYA 1FO1A 3PHEA 5HO4A 3BSNA 4CO0A 3UD3P 3HZGA 1ULRA 1XR5A 3ISNC 1YVFA 3OUYA 1VRUA 3G86A 4QQBA 3L3CA 7FDRA 3OV7A 2FC9A 1FA0A 1X4AA 1MROA 3B78A 2V9WA 1NH7A 3FZ2A 3SCKE 5D4NA 1ZTTA 4MK8A 4JI6F 2AQ4A 3VAMA 1E6YA 3EUNA 3B4MA 4DSIA 3LANA 1M5OC 3KLHA 1WG1A 3CCSS 4ZPDA 4R8UB 4B3RF 3W2WA 2HS0A 3KHLA 2MQNA 2GJ2A 1F5AA 1TVRA 2QA1A 4ZVEA 3J80Y 2UVRA 2R7VA 5T14A 2AGOA 2DCLA 4OZLA 2Q1LA 2BRLA 5E3PA 3GV5B 4OL8A 4E0DA 5FJ4A 4ERDA 1C0TB 3HZEA 2B6AB 5FD1A 2E44A 5FDLA 2BQUA 1RQ0A 5BYRA 1HA1A 1BGXT 2B9WA 1WHXA 2HZCA 1JX4A 2VBWA 3KOAA 1KTVA 4CH7A 4NLGA 2CPEA 2GHVC 3PRBA 2M3DA 2VQFF 1JMTA 2KB2A 3HX9A 1TKXA 4C11B 2HPUA 4J9NA 2NUHA 5KFWA 1KONA 3VAFA 4WKRA 2FLNA 2MY7A 3M8SA 3EZUA 2PGCA 1HNVB 4TU8A 2DIVA 2R8KA 2BJDA 4B9SA 2QZ8A 4N76A 1X0PA 5K8MA 2C28A 2HRYA 3ZZUA 1LV5A 3G71S 1JXEA 1V3ZA 3NS6A 2GX8A 2LDIA 2VBZA 3KHGA 4HKQA 4JV2A 5DG9A 4FNIA 2DH8A 4K4UA 1CLFA 3W3SA 1JNRB 1HQEB 5CH7B 2IVFB 3EZ5A 2OLWA 4LSNA 1SJ3P 1GXLA 2HHUA 4KR0B