2XS7A

Crystal structure of the rrm domain of mouse deleted in azoospermia- like in complex with sycp3 rna, uuguuu
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
86
structure length
86
Chain Sequence
LPEGKIMPNTVFVGGIDVRMDETEIRSFFARYGSVKEVKIITDRTGVSKGYGFVSFYNDVDVQKIVESQINFHGKKLKLGPAIRKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DELETED IN AZOOSPERMIA-LIKE
publication title Kinked Beta-Strands Mediate High-Affinity Recognition of Mrna Targets by the Germ-Cell Regulator Dazl
pubmed doi rcsb
source organism Mus musculus
molecule tags Rna binding protein/rna
total genus 18
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2010-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2xs7A00
1WTBA 2DGOA 1PO6A 5EN1A 2MGZB 2FY1A 2K8GA 2X1BA 4C7QA 2L9WA 4TU8A 1WEXA 2E5JA 4W90B 1Q82T 1OWXA 3G4SS 2I38A 2LYVA 2GHPA 3MURP 1CVJA 1DZ5A 4PKDB 5DETA 4Y0FA 2O3DA 1U1QA 3N9UC 1U1LA 2XS2A 2CPDA 1FNXH 3J7ZT 2CPIA 1X4CA 2DHGA 2AYEA 2DH8A 2DITA 3EGZA 1WHXA 1WF1A 2DIVA 3MUMP 2N7CA 4CH0S 2PE8A 3NMRA 2JVOA 3CC4S 2M7SA 1SJ3P 3MUTP 2MKKA 2ZJQQ 3SXLA 2MQOA 3CTRA 2DGSA 3MXHP 2MB0B 3I55S 2J76E 4QU6A 1H6KX 1S79A 2D3OR 2MPUA 1OPIA 1O0PA 2LEBA 1VQOS 4UY8T 2XNRA 3BEGB 2KRRA 2CQGA 1VQ5S 5FJ4A 1X4BA 2CPJA 1KOHA 2DNOA 2LEAA 1U1RA 1VQ9S 1X0FA 2G0CA 3CC7S 2OSRA 3H2VE 2LQ5A 2L41A 1QM9A 3Q2TC 2DNZA 1YIJS 2CPFA 1YHQS 2DH9A 2YKAA 2KRBA 4PR6A 3B4DA 2LA6A 2YH0A 1YJ9S 5GADU 1B7FA 2OJ3A 1D8ZA 3UE2A 2MZSA 1FHTA 3MUVP 2N3LA 4YUDA 2XS7A 2QFJA 2DGWA 3BO3A 3R1LA 2CQBA 2M52A 3US5A 1VQMS 5CA5A 5GAEU 3BO4A 4IOAQ 2DK2A 3CD6S 2KT5A 2MSTA 1K8AT 3SDEB 1AUDA 1JJ4A 3MOJB 4A8XA 5LXYA 3G6ES 1VQPS 2MQLA 2QA4S 5D77A 1H2VZ 2MQPA 5HO4A 2CPHA 1WHYA 4F26A 4TU7A 2DHAA 1U1MA 1YTYA 3I56S 3CCMS 1VQ7S 4QQBA 1N54B 2MXYA 2MJUA 2HGNA 3CCQS 2XB2D 1HD1A 5DDRC 2KI2A 1WF0A 3MD3A 1YI2S 3MD1A 2RS8A 5GAGU 3G9CA 2EVZA 2DGVA 2M8DB 2JVRA 4CIOA 2VONA 2DHSA 1U6BA 1VBXA 2MY7A 2HGLA 2MQQA 1VQ6S 2HVZA 5DM6Q 1K9MT 2FC9A 2BZ2A 2DO0A 5MLCV 1IQTA 3THPA 1U6FA 1VQKS 3NNAA 3UWTA 2MSSA 3S01A 4FXWA 2EK6A 1X4GA 3S7RA 3S8SA 3CUNA 1VQ4S 4WF9Q 3BS9A 1U2FA 1Q81T 4BS2A 3SDEA 1VC5A 3Q2SC 4WFAQ 2HYIB 4IUFA 5LSOA 2DNGA 2WBRA 4J5OA 3NS5A 3S6EA 4IO9Q 1VQ8S 4TLQA 5JVHQ 5GAHU 2DNNA 1SJ4P 3CCES 2M9KA 2YTCA 1M5PC 2J0QD 3P6YC 2CPZA 2LECA 2OTLS 2DNPA 3VALA 2NZ4A 2I2YA 1X4FA 5LJ5Y 1WI6A 3G96A 4QPTA 2CPEA 1YWXA 2KH9A 2Q79A 1WHWA 1N88A 3IWNC 2RT3A 3CCSS 2ADCA 3CCRS 1U1PA 5DDOC 1FO1A 2MZ1A 2FC8A 2KM8C 1NU4A 4F02A 4UQTA 4WKRA 1DBDA 3FEYB 2J0SD 5DDQC 2CQ1A 3R27A 3U1MA 3LPYA 2KYXA 1M1KT 3PIPQ 2U1AA 1X5TA 2L08A 4M5DB 3VF0B 2MGZA 1NO8A 1M5VC 2VOPA 2CQHA 5CXTA 2LXUA 1X4HA 1M5KC 1H2TZ 2MKIA 2AYMA 5LSLA 2ZJPQ 3ULHA 1KC8T 2ADBA 1WELA 2OTJS 3H2UB 2E44A 3VAJA 4CH1A 2LMIA 1FT8A 2MKJA 2OSQA 2E5HA 2CQ3A 2MKHA 2N82B 1U1OA 2DO4A 2M2BA 2D9PA 3IRWP 5IFMA 4W92B 1Q86T 1M90T 3P5TL 2DHXA 2MY8A 2RQ4A 3JB9k 4WCEQ 1X4EA 4IOCQ 1Q7YT 3EGNA 1U1NA 3TP2A 2U2FA 2DIUA 1WEYA 2KU7A 2KM8B 4P6QA 3RW7A 2G1DA 1NJIT 2OIHA 4WFNQ 3J7YU 1X5SA 1SJFA 2UP1A 1PGZA 1WEZA 2KN4A 1UW4A 1SXLA 3DXBA 3VAFA 1YJNS 4CQ1A 1R8HA 1VQNS 3D2WA 2CQCA 3EX7B 3CF5Q 3CCUS 2AD9A 2PEHA 3PIOQ 2DB1A 3LQVA 1F9FA 1X4DA 5D78A 2J8AA 2DGUA 2CQPA 1X4AA 1KOOA 3MDFA 1SJRA 1VC6A 5LXRA 2VODA 1FJCA 2KXHA 1G2EA 3UCGA 1DHMA 1RK8A 3TYTA 2MYFA 3R1HA 3P49B 3RW6A 2DGTA 5IM0B 2CQIA 2M8HA 3CULA 2DNRA 4LJMA 3THTA 3G8SA 2F9JA 1WHVA 1URNA 1N52B 1YJWS 2LKZA 3CMES 3K0JA 5CYJA 4Y00A 3DLLQ 4ZKAA 3HI9A 2CJKA 2DISA 1HD0A 4OZ0A 3NNCA 2HGMA 2CPXA 3VAMA 4LIRA 3VAIA 2F3JA 2RNEA 2RQCA 3CCVS 1FJ7A 3ZZZA 4C0OC 3CMAS 2RUGA 1XN9A 2DNKA 3V4MA 2M0GB 2CQDA 4ERDA 2NLWA 1WG5A 2RS2A 5ITHA 1QVFR 2X1AA 4RU2A 2N3OA 2CQ4A 4U67Q 3L3CA 2DNHA 1D9AA 1VBZA 2E5GA 2XNQA 1WG4A 2MQMA 3OW2R 5H1SV 2KHCA 4YB1P 3NNHA 2KXFA 2RVJA 2B0GA 2AYBA 2HZCA 1P1TA 1OIAA 1VBYA 1A7GE 2CQ2A 2MZRA 2RRBA 1H2UX 2M88A 2LA4A 5IM0A 3FEXB 3UD4P 5DM7Q 3SMZA 2MKCA 3TO8A 2MHNA 2VOOA 2DNMA 2MZQA 1WWHA 2AYGA 2RU3A 1WF2A 1UP1A 1X5OA 5JVGQ 2MKSA 5HL7Q 1UFWA 1SJQA 1JJ2R 2MZJA 1HA1A 1ZZFA 1L3KA 1WI8A 2GO9A 2KG1A 2A3JA 2BOPA 1N8RT 1VQLS 4QU7A 2DH7A 3ZZYA 1S72S 2CPYA 4C4WA 4EGLA 3G8TA 1P27B 2XSFA 4YOEA 3CXCR 1K73T 2G4BA 5LJ3Y 1A9NB 4FXVA 1DRZA 2JX2A 2D9OA 1HL6A 1R8PA 3UD3P 1KD1T 2YWKA 1ZH5A 1WG1A 5BJRA 2YH1A 2MZTA 2KVIA 1JMTA 2JRSA 1YITS 2DNQA 1U1KA 2SXLA 3MI7X 2DGXA 2M4MA 3CCJS 2QEXS 1OO0B 4Z2XA 2DGQA 3B4MA 2LCWA 4LMZA 1UAWA 2X1FA 4WIIA 2XS5A 3G71S 2ERRA 3BO2A 2MQNA 2MJNA 1W2BR 2M70A 2ZJRQ 1M5OC 3VAHA 2FHOB 4TU9A 1BY9A 1QVGR 4V19X 1X5PA 3UCUP 3HHNB 2LXIA 2EK1A 5GMKa 1ZZNA 3CPWR 1RKJA 2E5IA 2F9DA 5GVQA 3U1LA 4WFBQ 2V94A 2CQ0A 1FJEB 2MMYA 1KQSR 1JJHA 3NS6A 5IQQA 2DNYA 2KXNB 3P3DA 4F25A 3CCLS 4ED5A 1FXLA 2KFYA 3VAGA 1VC0A 4OZ1A 5DDPC 3VAKA 3UCZP 2RRAA 2X1GA 3CC2S 2K3KA 4PRFA 2JWNA 2FPHX 2KG0A 2DNLA
chains in the Genus database with same CATH superfamily
4RW7A 3MPUB 1XQIA 3OJUA 3D9BA 4GRSA 4FBTA 4U96A 2AV5A 1GTHA 1S1VB 3TANA 2XY6A 5FD1A 2CJQA 4KGXB 3W5XA 4CH0S 2MKKA 2MB0B 3H0PA 1S79A 4LSNA 1XBWA 6FD1A 3VGUA 1REVB 1H0HB 4PQUB 5C2CA 1GAOA 3M6UA 5HP1B 1K1QA 1RHUB 3PJ9A 4LF5J 3CE8A 5HQ8A 2DKOB 1L3TA 1DURA 2W2OP 1UFLA 1ZETA 3OTDA 5KFOA 3IC1A 5B0GA 2W2NP 5KFFA 4IOAQ 2DK2A 5A0YA 1NKCA 4OLPA 5CCLA 2OI2A 1SCJB 5LXYA 1DQAA 4RW4A 4FF2A 2P5VA 5T14A 2YPYA 1N54B 4OZJA 3KUGA 4AD6A 3GSIA 1TL1A 2ZH6A 4AYBD 2MY7A 5EWEA 4DZDA 4OYOA 5KFRA 4M5LA 3GV5B 1D3WA 3A13A 3RAXA 4OHXA 1DLOB 1KS2A 2OFHX 2ZM6F 4X4QA 3JQMA 3GE9A 3DU6A 4NCBA 1RGVA 3KMQA 4AUKA 4ECZA 1CULB 2Q79A 4RLEA 1UW9A 2WOMB 4C8MA 2ADCA 4K4VA 1SKRA 2DJWA 2HLTA 1NDKA 2GQCA 2CQ1A 1VHIA 1PKUA 3Q8QB 2AIRB 2ZZMA 4FYDA 1FD8A 3NGSA 3PR5B 2L08A 1WKKA 4IFYA 1V3SA 4UY85 1M5KC 4IR9A 2PFDA 4FKYA 5I4MA 2ADBA 4M5HA 3TX8A 2E44A 1FNMA 1SC1B 4N7TA 3VAJA 3EGVA 4AQYF 4P2XA 2BACA 3IRWP 3ZZUA 4G6VB 3A8EA 1M90T 2QG9B 1IKXB 3OXLA 2ZHOA 2UUTA 1C0TA 4TY8A 3PFEA 1UEKA 3ETMA 4RO0A 2OIHA 4IOBA 3VGSA 2D3ZA 4MKVA 5F8HA 3ZC4A 1IJEB 2CXEA 5JXSA 2OPPB 3FKBA 1GK8A 1LFPA 1YJ7A 2DNRA 3G8SA 1HIYA 4DL5A 3PV8A 1LEOA 3AD9C 3EICA 3HI9A 5G0RB 4ZS6A 4Y2IA 3NNCA 2H54B 2CPXA 2HZAA 4I2QB 2CZ4A 3CCVS 3ZZZA 2EPIA 5KG0A 5A6WA 4JI6J 4C3KA 1MW7A 2N3OA 1R3NA 3BM7A 1U48A 1RWNB 2QLBB 5ETKA 2KHCA 4IH6A 4ZVHA 1C1CB 3DRSB 4DXLA 4F3MA 1H2UX 3IXQA 2R7RA 4A47A 5DM7Q 1HQUA 3ZO7A 3K5MA 4YB7A 2E9RX 2BABA 1AUSL 5LL6d 3W2WA 4RW9B 5C5JA 3UDEA 4KH0B 4LRAA 2XI2A 1TK5A 1FDAA 1Y3JA 2BEFA 4N77A 4D3GA 5L9NA 2XMJA 2EFGA 2FJDB 4CLPA 2YQ3A 4QYRA 3H90A 5B0DA 1IBKJ 4ILRA 2O1PA 1FRHA 4QIEA 3ZZ0A 2R2SA 1TFYA 3TUIC 4XIUA 2C42A 3PW4A 4MYUA 2OD6A 3ETOA 1RACB 3HHNB 5GMKa 2A2DA 5GVQA 3EZUA 2YKPA 4OZ3A 1WOSA 2F1FA 4DL6A 5CYQB 4PUOB 4DG1A 2IRYA 2NXNA 1VMBA 4DPXA 3QAEA 2E1PA 2BUNA 3VCDA 3MM6A 4TU8A 3PX4A 2QFIA 1TQLA 3EDQB 1IR1A 2W7OA 4XPEA 2V9WA 1FK9A 3OJSA 3T1HJ 1HNIB 1X4CA 2AYEA 3EGZA 2QLFB 1SJ3P 1T05A 2YNHA 2HVHA 3L09A 4H4KA 4G1PA 2HIYA 4H4MB 4J9RA 5H9FK 2B9EA 3IMQJ 4IQXA 4V1Ak 1FXRA 2DNOA 2LEAA 3IFEA 3PXGa 2LQ5A 5KFIA 1D09B 4PR6A 4F4KA 1NB7A 5DQHA 4WIQA 2ZVIA 4HTIA 1KTVA 3MGJA 4V19J 2V8VA 4R5PA 1PCAA 1RLCL 4I64A 4ZIVA 3KJQB 4M63A 4N47A 4ED2A 1R0AA 3ENAA 1KRPA 2CDQA 3RGIA 4JI1F 1VGYA 5D77A 1LWEB 2RD5C 4QR0A 3TOQA 2WVCA 4DV1F 2YNIA 3UNYA 1YGYA 4OI4A 1S1TB 2DEJA 4K4YA 1PILA 2DY1A 1HNZJ 2DHSA 3RB6A 4DR4J 2FZCB 3POTA 4CT9A 1UVIA 5MLCV 5I3UB 2IRXA 3OLBA 1RTHB 2ROEA 1EZZB 1VQ4S 3GTYX 5D15A 4FNIA 3W63A 3BS9A 1R8CA 2EKNA 2QGFB 1T3OA 2CFXA 3AHPA 3N5BA 4LF1A 3EWGA 3TZZA 2HQFA 4ANCA 2VG7B 2MDAA 1TZ0A 3IM8A 3NCPA 3Q0AA 2I2YA 3S1TA 3FMBA 3AJ2A 2BDPA 1H72C 2XMUA 4KH1B 2YX1A 4I0WA 1GMWA 4ZVSB 4Y2KA 4OV1A 2VFVA 3PW5A 4K7QA 1JLAA 1Z2LA 1KC8T 1FTRA 2V2VA 4A48A 2IM2A 4IR1A 1G7CB 3FNNA 1B3TA 2OSQA 3W8PA 5J1EB 4FF4A 3ZZRA 3HKWA 5KG6A 4IOCQ 4OMFG 4OLOA 4X4RA 3D68A 3RW7A 1X31C 4WFNQ 2J0WA 2KN4A 2FY8A 2C2RA 4CT8A 1SQFA 4A8FA 2FIUA 4ZN3A 5A8RA 4PABA 1REGX 1UETA 5ETSA 4ED3A 2DR9A 3SFGA 3SCLE 2J9DE 2YNFA 4NLWA 2OPQB 3MCNA 2VFTA 5L38A 3K5NA 4F2RA 5IS2A 4JI5F 2XMWA 3HFKA 3QT6A 3CJTA 3R5DA 4RU2A 2IA6A 4U67Q 2HURA 1WC0A 5KFVA 3HSDA 2MQMA 3CDUA 4OYMA 1MN7A 1NK5A 3D54A 2ILZA 4WYLA 5HJYA 1RLDA 4RNOA 2VICA 2VDIA 1U8WA 3M32B 2L48A 2MZRA 4EZ6A 3T5JA 3C14A 3C16B 4JI8F 2CNKB 1S9GB 3ZZPA 4EK2A 1M1GA 4ZPAA 4OJ3A 1RWKB 3THVA 1UP1A 2MKSA 4K4UA 3D3BJ 5F41A 5KT6A 2GO9A 2Y1IA 3OSNA 3TUJC 1VRTA 2FJXA 3D1QA 3PEJA 2VG5A 1A9NB 3BPSP 2YWKA 1HBNA 4ZHRB 3CCTA 4OHZA 4NLOA 2DGXA 2XYHB 5LMUJ 4JBCA 2XMMA 1P1LA 3LP2B 3NWGA 5KFEA 2KZMA 4M5JA 3N6LA 1KVJA 2WAQD 4K0KF 4C8ZA 4RZRA 2MMYA 4L76A 4RUAA 3P3DA 1EKSA 2XG8A 5FLXU 1YDLA 1U47A 1Y00A 2WHOA 5DJBA 1T03B 2ZWPA 2KG0A 1WTBA 4DR1F 3IBWA 2QJ3A 3SFUA 2GHPA 1DZ5A 3CB4A 3E01B 1N56A 2GC8A 4RUCA 2DHGA 5DG7A 1WF1A 2RQKA 5J2MA 1B0VA 2ZJQQ 2MQOA 1CS4B 4KFBA 1TKZB 5BYSA 4MJKA 4TQSA 3W5ZA 5KOWA 4DV0F 1X4BA 1R8AA 1KOHA 3GR1A 5KG3A 2AJ0A 3FK4A 2F65A 1YIJS 1OMSA 3CJ0A 4WXWA 1HQ2A 1IWAA 3I31A 1Y0HA 3UI3A 3K8VA 4GO5X 3VVUA 2R7XA 1NK6A 2XS7A 5ETQA 3R1LA 2CQBA 4GKJF 4ZP8A 4X4UA 2KT5A 4LREA 4MK8A 4A8XA 4J91A 2FLLA 4MTPA 1MMDA 2YWGA 3NP5A 3DI6B 5J2NB 5IT9Y 2XZDB 1S59A 2GAHC 2NPFA 3ZZTA 4QQBA 2HGNA 1UFKA 4USJC 1X9MA 1WF0A 3MD3A 1RBAA 3J80U 3HDSA 2M8DB 2HMIB 1T9VA 3M30A 4R0JA 3A8JA 1WC4A 1NPRA 2HNYB 4LIWA 2ZM6J 4CYUA 1HI1A 3P4UB 5CD4H 3M8QA 3PYGA 2CIMA 1L3SA 4KRWA 3JYTA 5HROA 1M5HA 5F3TA 1JLQB 2RILA 4OIXA 3IAS9 3I82A 2RKIB 1WOOA 1Y9OA 1PAUB 3AODA 3RU0A 4ZLLA 2C2DA 1LXJA 3M9OB 1XERA 3PKYA 2H48B 2QT7A 4ECXA 2C3YA 4X62F 5KFZA 3OL9A 4JI7F 2Y0SD 1YG0A 2XM3A 3C6UB 4WKRA 4KBIA 3K57A 2PSZA 1UWBA 2QA1A 1PYOB 2CQHA 4AQYJ 3PRBA 3AA9A 3EVMA 2MKIA 3Q83A 4DSEA 1QUPA 1B70B 4DN9A 3UW1A 1H3DA 4PQAA 2C2NA 4L6V3 2R7SA 3MCOA 2ALZA 1N36F 3LH2S 4BCAA 3BSCA 2DRDA 1T9TA 2G1DA 1DTTB 1P9YA 1QTNB 3BSOA 1YJNS 3CF5Q 4KV8A 1LW2B 4NLTA 2YX7A 4KO0B 2H5JB 4DV5F 4MIAA 4DV3F 2F8MA 1W25A 3M6VA 3W9JA 1U26A 5FDLB 4C98A 5K14B 1OSDA 2V4JA 3T5LA 1URNA 4BC7A 3CMES 3CJRA 5CYJA 2VKRA 4F50A 1HI0P 5C24A 3FBEA 1F9EB 1HD0A 1KTQA 2WK4A 2GVZB 1XK8A 2FJVA 1RAIB 5HVGA 5B0AA 1WJ9A 1RTJB 5ITHA 2KFZA 3OR1A 2A6OA 1TK0A 1R6YA 5CZXA 4JB8B 1XC9A 2PMZD 2VJUA 3N79A 3R2DJ 3HVTA 1CPZA 2KKHA 1VRQC 2Z0GA 4LVNP 2BE9B 5H9EJ 2LVWA 4K4XA 1RT5B 2MKCA 3TO8A 4JV2A 1S76D 1K44A 2J8SA 1HBOA 2B6AA 5KG2A 1RWVB 3PRDA 4DPOA 2A2CA 3RB3A 2R7QA 3OUYB 5F9NA 2VJVA 1WKLA 1VI7A 3EPIA 1R8PA 4HH0A 3MCSA 1ZH5A 1WG1A 2VPWB 3K2YA 3KJNB 2V8PA 2LQJA 3CCJS 2HVEA 4CRJA 2E1AA 4QW9A 2CJYB 5KG5A 1DQ8A 2ZZNA 4Y2MA 4C8YA 3H2LA 2RRNA 4Q2MA 4DFMA 4CTAA 3CPWR 1KNZA 4P7VA 3CJ8A 3RTVA 1FRKA 2RUSA 2VB6A 3C6TB 3MEGB 3AXMA 3FBFA 3QWUA 4KGZB 3T5HA 1HBMA 3TZXA 2HIQA 4WFZA 1MG7A 5DG8A 3VVTA 4CLTA 5MAOA 2UXDF 1J5OA 4YFUA 4ZLPA 4X4PA 4FF3A 4PAAA 2FLNA 2MGZB 1WDTA 2K8GA 2BJ8A 3MAQA 3CDAA 4DF4A 5D0EA 2OEJA 4QPXA 5E7OB 1S0VA 1RT4A 3A8KA 4ELTA 2DITA 4LQ3A 3GP9A 4Q43A 3MUMP 2PE8A 5A0YB 5SZTA 2NXJA 3SXLA 3I55S 1S1UA 3DHXA 1EX8A 1B99A 1URRA 4FPRA 3RZAA 3ITHA 3TQEA 2OKQA 3PG9A 2XY5A 3HHKA 1TL1B 5CABA 4YR2A 1Q8KA 1N33J 3HHEA 1P8GA 3I87A 2YQ1A 1D8ZA 3BDPA 3MAAA 1S99A 2QMWA 3HHLC 3US5A 3KUHA 4JI1J 5AE3A 4DSLA 5T7LA 4I68A 1EIYB 2JLEA 2AF6A 4DV1J 2AGPA 3SEOA 3MOJB 3FQLA 4DV7F 4J9MA 3L7PA 2HG4A 1Z4UA 4ZVOB 2AEMA 1R89A 3CCMS 5KFMA 1BLUA 3PHEA 1NRKA 5HSPA 3IA0A 2VONA 1U6BA 3PVXA 1U6ZA 2HNZA 4FYWB 1Q95G 3EE3A 3LP1A 2OD4A 4IFYB 1U45A 3PACA 2W2QP 3T6JA 2XGQA 5I42A 3H8YA 2IAJA 4IUFA 2PT0A 2ZEJA 3BDEA 3GJSB 2UUBJ 5KFPA 2DR5A 4ID5A 4ENOA 4J5OA 2HZVA 1Y5NB 3S6EA 2AKWB 4GC7A 2DNNA 2VC0A 2M9KA 3C2PA 2LECA 2E66A 1SIWB 2COLA 1L3VA 4YS2A 3J80Y 2NXCA 4TY8B 2F5GA 3CT9A 2A1BA 4UQTA 3FEYB 3ISNC 3LPYA 4ZA1A 1FWLA 4HHUA 3BGLA 1CJTA 4I69A 3SBMA 1BQMA 3HHDA 1LW0A 5HMYA 9RUBA 2PN6A 4ILLA 4MIBA 2AW0A 3KG1A 1TV6B 1XNRF 2DIUA 2KYZA 1RKIA 1KFDA 2G1HA 2XSJB 3I5AA 2EG2A 3RBDA 2V2KA 4OX6A 3BH7B 4NLYA 1KQGB 4OYXA 2FVSA 2EBEA 2MQ8A 2W9AA 1YRTA 1HYSA 2E9ZA 4OI0A 1X4AA 4JI3F 5L1JA 3QFHA 4O4RA 4CP5A 3CD5A 3H5SA 4F3QA 1S6PB 3P49B 2AHOB 4ZP6A 1UJ5A 2M8HA 1RAJA 4LJMA 2CJAA 4H54A 3R97A 4AT1B 4Y00A 5GMEA 5F8MA 3O8WA 1SKSA 4ED7A 2ZDPA 4PWUA 1NSQA 3MEDA 1U0HA 3N28A 1E6VB 5D6GA 2XGPA 2GNKA 3BR8A 1PAEX 3TUZC 3K17A 1MU2A 3H98A 4DJBA 1QJHA 4JI8J 3DKDA 2A0FB 2HS4A 1T95A 3F41A 3VZHA 2JZ5A 3MEEA 3V2UC 5L39A 3UD4P 4ES2A 2CNOB 2CYYA 3C15B 2MZQA 2RF2A 2ZOGA 2VG6B 4RUBA 3FRZA 1QY7A 4FYXB 4PG6A 1HA1A 4ED4A 2E5LF 5T41A 2LU1A 1TTHB 4QU7A 1CC7A 4B02A 5CYMB 1VQYA 4G1IA 2Y8WA 2BKNA 3G8TA 1OS5A 3M2RA 3T9ZA 1XMOF 2HK3A 2JX2A 2QYGA 1HL6A 2FB0A 2YH1A 2O66A 4DR6J 4LMZA 2UV8A 4B3RF 3LANA 3QT8A 2GMHA 2OHDA 2VL1A 1IJFB 4IRCA 4B3MF 3RJMB 4K0KJ 1PC4A 1FK9B 2AJ4A 3LAKA 4V19X 1X5PA 2EK1A 2QE5A 1RWOB 2HQIA 1FJEB 1JJHA 3ENWA 3FCWA 1T05B 4OYPA 2YNHB 2Q6BA 3I0RA 3IAM9 4DR1J 4ES1A 5DDPC 1VIXA 2RRAA 3UO0A 2K3KA 5A2QY 3BGRA 3F56A 3E2EA 5LSRA 4YN3B 1RT7A 2HAIA 1U2RA 2IMWP 2DCUB 1FX4A 3BKFA 3MURP 1PYSB 1U1QA 2O3DA 2C2KB 5HQLA 2XS2A 2QTWA 1QE1A 3T1AA 4WTYA 1R0AB 3A3PB 4DV0J 3LO3A 3AAWB 1O0PA 2ZH5A 5DZ7A 1ZYQA 3AD8C 5L9XA 5FJ4A 4ES3A 4Z37A 2XYGB 3QPIA 2OSRA 4CLSA 4MK7A 1D8YA 4OYBA 2BJ3A 4GKJJ 1XR6A 2LA6A 1T3NA 2QIFA 1CQNA 4FN5A 1TVRA 3DHWC 3UE2A 3NS7B 3BO3A 2E29A 4ZK7M 4CM2A 5CA5A 1TKDA 4HDGA 3M2UB 2MSTA 1K8AT 3E51A 4K4WA 1FX2A 5D3GA 4ZPBA 5A8KA 2R8GA 2CPHA 4UZBA 3ET6A 3W9IA 2MJUA 3CO0P 4IRKA 1F6TA 1KLMA 1RT6A 1HBUA 4P7TA 2Z8QA 2HVZA 5DM6Q 3BBBA 4WPAA 3SSRA 4ZPDA 2W8KA 4ED1A 3EPGA 1VQKS 1B7YB 4NZ0A 4M1KA 2EK6A 4KGKA 3D6FB 2VQEF 5L8RC 5HBMA 2GGPA 3QRRA 3MR3A 3PY8A 2HYIB 1G3OA 1FA0A 2EG1A 3PX0A 3OR2B 1N6QA 2YKNA 1O51A 4IO9Q 3RBXA 4X62J 3OHBA 1M5PC 4NZ7A 3KJVA 4JI7J 3DDKA 2D41A 4NRTA 3K5PA 3KLGA 5BYQA 2KH9A 4OJGA 1BHNA 3GFZA 3TA2A 1JLBA 3CCSS 2OPSA 1GXLA 1FO1A 1UZDA 1HNWJ 2GMJA 3HZEA 5B0CA 3AT1B 4O4GA 1P9QC 1S0OA 1GX5A 4ANDA 2YXLA 2VOPA 5CXTA 3F0NA 5IV3A 2V67A 5KG7A 1WELA 2OTJS 3H2UB 5A8RB 3TAQA 3RBZA 3QAUA 1N36J 1TFWA 3FBBA 1KWMA 2V0NA 4DR3F 4NCGA 4ZVPB 2RQ4A 2X51A 2BQUA 1WC6A 8ATCB 1HMVA 5KAKA 2DHHA 4IRDA 2JLFA 1WEZA 3UDCA 1HKAA 2OP5A 4AL5A 4DU7A 3OL8A 3NEKA 4WU2A 4DV3J 4RX6A 4NA1A 4NLRA 3MAHA 3LQVA 1K47A 1X4DA 3MPDA 1GXTA 1SUQA 1TKTA 4LT6A 2A10A 3Q24A 1VC6A 5LXRA 1NZ8A 2JL9A 3GYXB 2ZHAA 2FHJA 2LQ9A 3CSKA 3CULA 2R2RA 4ATNA 2BQRA 1RBLA 3HSGA 1KVIA 4KPYA 4LSLA 2ZD1A 1U25A 1NUEA 4KGMA 2V63A 4RUHA 2MKYA 2DNKA 1Y3KA 2WONA 3ZNUA 2QL5B 1Y11A 1TL7B 1WG4A 3CWJA 4QR1A 1HBNB 2RVJA 3P96A 2CQ2A 3JSMA 1NKEA 1SBRA 2WVDA 4DQIA 2HS3A 3V6HA 1PYTA 1X5OA 2ZH2A 1S10A 2IC3A 1U24A 1CJUA 4K4SA 4HEA9 1C1BA 3I4HX 2ROGA 5LJ3Y 1ACMB 4CLKA 5CZVA 1TUGB 1IKVA 2JEGA 2ABYA 1U1KA 3IWLA 3MI7X 4JP8A 4L75A 4M5DA 3B4MA 1RT3B 3SCJE 1LWFB 3BO2A 2ZHBA 4RW8A 3UN2A 3GJRB 3DM2A 3CCZA 1BY9A 3QWPA 2MHEA 5AT1B 1JLFB 5J2MB 2H65B 5DQGA 2NSBA 1QUVA 3JSBA 1NPPA 2EFVA 2UXDJ 1WD6A 2UXCF 2H3EB 1NK8A 1EP4B 4KFBB 4ETXA 3ZFVA 4LVOP 3PO4A 4PRFA 1F2HA 2GO8A 2ZVSA 4OQJA 3GJQB 3ENVA 1JNRB 1CBKA 3KOAA 1YSJA 3MTJA 1JK9B 1MROA 4DS5A 3J7ZT 2DIVA 3N6MA 1FFWB 2XWXA 4L72B 3HT0A 2ASDA 1RDRA 3DOLA 3RBEA 3BQ0A 2D3OR 4NI2A 1NK0A 2R2TA 4PG8A 1Q1KA 2BOAA 1UPPA 3KK3A 4J90A 4C2MA 3QSYB 1DTQA 1ELOA 4U95A 3EM1A 4AFFA 1YHQS 2KRBA 4X4NA 3M30B 1F0XA 1RTIB 4X4VA 1I51B 5JUMA 3UN3A 1FHTA 3UDVA 2QFJA 2FVQA 1AA1B 3TR5A 1I6JA 3WX8A 5HROB 4HL9A 4WK1A 4KQZA 5EWGA 4QIGA 4KJIA 4J9QA 3DMJA 2UUWA 2AX0A 3MM7B 3P8BB 3UN5A 3M6WA 4N8NA 2VPXB 4H4OB 4M8LA 3RUBL 3GIKA 5E0OA 3KLEB 2QA4G 1Q5VA 2B5JA 4KKOA 4DR5F 1HD1A 2FTRA 1RTDA 4DL3A 3ZTOA 2V50A 4L73A 2R8JA 2WVFA 4ZCLA 4ALZA 1UWBB 3S7RA 3Q8VA 3LA0A 2VIHA 3R5GA 1R31A 5CAAA 1S5ZA 5LSOA 2DNGA 2WSFC 4OYIA 4DQRA 1BMQB 2XI3A 5IOLA 4ECUA 3M4XA 4LRDA 5DGBA 2UUCF 1JIHA 3BJYA 3W9HA 3G96A 1FEHA 3SZ2A 3MM8B 1HARA 2QLWA 4NLSA 2DVIA 3M8YA 2XY7A 4C11B 1YRXA 4Q8EA 4F4AA 3D0HE 3GFXA 3U1MA 1M1KT 3HJVA 4X2BA 1PJ6A 1TKXA 4OZNA 3EUNA 2ASJA 4MKYA 4OX7A 3RB4A 2FLOA 3OSPA 4KV8B 2QMUB 2YKMA 4N5SA 4W92B 1XNRJ 4P52A 5KT2A 3JS9A 5C42A 4W4MA 3G82A 4XDDA 2ZUAA 1RAAB 1ZAXA 2CG4A 3ZNJ1 5C24B 4U8YA 1FFGB 1TR0A 2ZC3A 4LF7F 3GIRA 4USIA 1PGZA 1RP5A 3IS9A 2LDYA 2AEFA 1GTEA 4JI3J 3OR1B 5F8GA 3D2WA 4DX6A 1RT2B 3PIOQ 1IKYB 2F40A 4YY3F 1FRJA 4KPCA 1TP7A 1KOOA 3MDFA 3BZQA 5D0HA 1N48A 1DHMA 4DR2J 1ZM2A 2DGTA 2LKZA 4C48A 1VCTA 2XC9A 2RHSB 2DISA 1Q78A 4OZ0A 1HBOB 2B6AB 5HVHA 1NHVA 5U47A 3GWCA 1RHKB 5BR8F 3HPOA 3PZPA 5J2PA 2CQ4A 3K89A 3CDWA 1KQFB 5ETRA 2UXBF 5IWAJ 2I9SA 2RJZA 3OW2R 1YLXA 4RKUC 2P9EA 2X7IA 2J7KA 1X60A 2G2ZA 5GAEI 4J9OA 1JJCB 2LA4A 3NGDA 4WXOA 4LF9F 2MHNA 2E5LJ 3BSAA 2W4DA 2FD2A 2EFOA 1Y5LB 3AB2B 3DOKA 4DS4A 1E6YA 3W62A 1TMJA 4CTAB 4B3SF 4JI4F 1XMOJ 3VV2B 2EI5A 4L74A 4C4WA 2BE2A 1HBMB 4YOEA 3V6DA 1KD1T 4B3RJ 5AJ3F 1ZA1B 5B09A 1J5OB 4B3MJ 4LF6F 1NPKA 2R8HA 4PXCA 3QRQA 1RHJB 3OVAA 1NK4A 5I3QA 2ERRA 2PO4A 4LFCF 3TEHB 3PW0A 2MJNA 5L1KA 1RT4B 1LWCA 1NH8A 2MLZA 3DRXA 2LDIA 3BKTA 3I5CA 3E8OA 1BXNA 2YNGA 1JLEA 2VPYB 1KQSR 1EHWA 3NS6A 4DCPB 3MM5A 2ZKTA 1KONA 2VFSA 3C46A 4HHJA 4MFBA 4JI2F 4TKTA 3DGPA 3ITHB 3QT5A 3HHLB 2FY1A 3HSJA 2X1BA 2BW2A 4AXIA 1S1WA 2E5JA 3G4SS 2ZKUA 3DYAB 1AROP 3KLIA 2ZNZA 5DO2A 1FNXH 2CPIA 4DZ6A 2HHTA 4DHVA 1H7XA 2QLJB 4XTTA 1QAIA 4M94A 3FC9A 5C25A 1SB6A 4HHHA 2P6SA 2HK2A 4UY8T 5EX3A 4I7FB 5KFTA 5J2QA 2GFFA 1RU2A 1VQSA 4YR0A 2CPJA 2EC0A 2L9NA 1VQ9S 3CC7S 2R4FA 1KBRA 4O3RA 3LP1B 5THWA 4JV0A 4A8OA 4P75A 1OJ4A 5I42B 3A1YG 3M6XA 4ZVGA 2NSCA 1YVFA 3MFHA 2DEIA 3TRGA 3I56S 2MXYA 5IT4A 3I32A 3QO9A 2P9GA 3W8GA 2B4UA 3PW7A 4CCHA 4K2XA 1V3ZA 2VQEJ 4RR5A 2CUYA 1JXEA 3GJTB 3SV4A 2V5HG 4B9VA 2H1YA 1CJTB 1D9DA 4WF9Q 3D0IE 1SJ1A 1BQMB 2LP4A 3Q2SC 1LW0B 2AEJA 2JEFA 1FKPA 1UA1A 4R8UA 3HHLD 2YTCA 1Y4ZB 2AJ2A 2K7JA 2DRBA 2CPZA 4UUXA 5K8NA 5DZ6A 3FEZA 3H20A 3BN7A 4U7UD 3MMCB 2HWTA 1JX4A 1W7WA 5DDQC 2Q6CA 2KYXA 5RUBA 2XBPA 3KK2B 1TUWA 3J81j 2BXJA 1S4FA 1HYSB 7FDRA 3R8YA 4UZCA 4CH1A 4DR3J 4NEYA 3A4TA 4F4ZA 1S1VA 1YKWA 4CNYA 2V8DA 3DOMB 2JJ4D 2E1MC 2JH3A 1X4EA 4NEZA 2ZBPA 2WSCC 4Q2LA 3OBIA 1BC6A 1REVA 1SJFA 3MEDB 2IJFA 1HQEA 3RB0A 3VWSA 2HHXA 2G2OA 4KTQA 2R2UA 2CWKA 1MU2B 2YY3A 1F9FA 9ATCB 3MWBA 2BQ3A 2CVEA 2OPRA 2CNLB 2W7AA 3MEEB 4Q0BA 3HMJG 4FVCA 1SI9A 1HLWA 2KFNA 2F4VF 3QJLA 5F8LA 1SKUB 2RF2B 2RQMA 3JSRA 2AJ1A 2IM1A 1EB0A 4DX7A 5F8IA 3M8PA 4E0DA 1BQNA 1S7HA 2XZTB 3EXYA 2M0GB 3MOZA 2W2MP 1R43A 2I5JA 4DWIA 4DSKA 3BPDA 3M2RB 4WFXA 5IZHA 4KGVB 2AWZA 3GR0A 4X65J 3AY0A 3KK1A 3O2IA 1NJXA 3WZ0A 1OQ3A 3OTCA 4DL7A 2UVRA 2H9ZA 1DLOA 4DL2A 4I2PB 1EQMA 1NCLA 5CD4A 4E2FB 3ZTSA 1UFWA 3LGNA 1JJ2R 1CEZA 1PBAA 2BOPA 1VQLS 3KDOA 3Q8RB 4EGLA 3A3NB 3I0RB 1K73T 2WOMA 4FPIA 2DCLA 4ZVQB 1HHSA 1I94F 1SH3A 1RT7B 2R7UA 4FF1A 1OO0B 2I0XA 2EW9A 2JDJA 4Q8FA 1RYRA 3BB5A 2G0JA 4UUWA 1XIQA 2XHWA 3AQOA 4NCAA 8RUCA 4DPYA 4OX8A 2LQBA 3DDIA 4M5NA 2PIIA 2UXCJ 3JQKA 4WFBQ 1NAQA 4GKKF 1RAEB 3BN4A 1IKXA 3MMAA 4DUYF 4OZ1A 3VAKA 5C2GA 3VQSA 1YZ7A 3BF4A 2DNLA 5EN1A 3CJ5A 2NXEA 2XMVA 2LYVA 5AXLA 4Y0FA 1TVRB 2FVRA 3OFFA 3IBFB 3AH6A 3NAIA 2JLGA 4NWBA 1SQGA 2DH8A 1UL3A 4ZLNA 2M7SA 2YX4A 4C8NA 5EHHA 4Y3CA 4K5SA 4FS2A 1OY6A 3PEHA 1CJVB 1UEVA 2MLXA 5G0RA 3ET6B 1RT1A 4I2QA 4NMXA 4GVBB 1LK7A 2DYAA 3NY0A 3OTEA 3LWLA 1U09A 3QBCA 2GGPB 4RNHA 2JOQA 1T94A 2BRKA 4DR5J 3TNVA 1N6QB 3U1NA 2YKNB 2MQPA 1WHYA 1MNEA 4F4XA 3KJVB 5LMNF 5H9FJ 3P45B 2R7TA 4UTGA 1XWLA 1FCAA 3NG8A 4A8MP 2GCFA 1JLBB 1WTFA 4CLUA 2ASLA 1VBXA 2HGLA 2QYCA 1K9MT 3L95X 3G8QA 3QZ7A 3TAMA 2N4CA 3OTBA 4LBIA 2MLYA 3NGTA 3O5TB 1U8SA 3D6TB 3NGUA 1ZAWA 2ZWOA 2JC0A 3TZWA 2XMKA 1LQ9A 2UU9F 2VDHA 3KHRA 1IBCB 2J0QD 2OTLS 2QMXA 1M1HA 5J1PA 1FDDA 1WNEA 4DL4A 1AFIA 4NCGB 1SQEA 3HJFA 3JQJA 3B78A 4LBPA 5A8WB 4IDKB 4PUOA 2C2ZB 4CO2A 1S6QB 3B82A 2UUAF 3GCXP 3PIPQ 2C1EB 2XMTA 5KFXA 2AYMA 5LSLA 3ULHA 4ZCIA 3RRGA 1SUQB 4B9LA 1TKTB 2QSWA 1FT8A 4PXDA 3K7RA 1FD2A 3RR8A 3WQPA 2CQ3A 1HNIA 4P9SA 4LF7J 4PWDB 3RAMA 2XCAA 1F2GA 4TYAA 3D5MA 1ZTTA 4LF8J 3MPYA 2ZH3A 2KO1A 2CA9A 2Z2YB 2ZD1B 4UOCA 2Z57B 1NJYA 4PYDA 1S48A 2W7PA 1UW4A 4YY3J 3DXBA 3LGHA 3HSZA 4DSIA 2CQCA 2HAFA 2R42A 4P73A 1RYSA 2GW8A 4EFAC 3M1VA 1FJCA 1EQ0A 2V8GA 3JSMB 2KZZA 3UCGA 1G6BA 2B43A 1RADB 3RW6A 5LT5A 2QLXA 4NXMF 4XPCA 1WHVA 5BR8J 1N52B 4MYTA 1VYAA 2C2MB 4HDHA 5B0BA 3C19A 2HQGA 5L1IA 1HWUA 3N0VA 2RMLA 4EMDA 3PNIA 5KG1A 3UDLA 2UXBJ 3VAIA 2F3JA 3G87A 3UVJB 2RNEA 1RABB 1KR4A 1HWLA 2RQCA 1CJUB 3V4MA 1C1BB 1M0SA 2RS2A 2BW7A 2AP6A 1UWAA 2DBBA 2DNHA 1ULRA 2KTQA 4NYZA 2BANA 4RL1A 2QN6B 4LF9J 3OFGA 4YR3A 5I3UA 3GSDA 1RTHA 2YWEA 2CJXB 3MTKA 4A8YA 4JV1A 1X9SA 4B3SJ 1NM2A 4JI4J 1G4CA 2AT1B 3DM2B 2R7WA 1VIOA 2BMBA 2KG1A 2Z2ZA 1SH2A 2VG7A 4Q44A 2Y1RI 3NLCA 4QWDA 1B0PA 5AJ3J 1BGXT 4H4KC 2HNDB 4LF6J 1I3OB 1NXIA 4FKXA 2CADA 2ZH1A 5KFQA 3SSQA 4LFAF 2HW3A 1WACA 2NYHA 3KHHA 4P2SA 4LFCJ 3M9NB 2M4MA 2FHJD 1FKOB 2F4FA 3IR5B 4Z2XA 5IC6B 2XS5A 3TI0A 1QAYA 2O01C 3WHIA 3DLKA 3F44A 2FJBB 2J9EA 1TL5A 2HBQB 2DR7A 2HHHF 2LXIA 4ZVUB 1ZZNA 5EX0A 5F0UA 4JI2J 2Y3YA 3GZ7A 3PR4A 2DNYA 2H5EA 2Z30B 4NI2B 1VC0A 4HTJA 1V3RA 3GB0A 1IQZA 3R2CJ 1Q0NA 1G1XA 1WEXA 4W90B 1UVLA 1RA7A 2V34A 1U1LA 4WP8A 5F3ZA 2L9DA 3GG0A 1YZ6A 1RWUA 1IBLF 3V6KA 2FVPA 4NL5A 4IFVA 3W2VB 2VQFJ 3I9V9 2JVOA 1FEEA 2W1BA 3R5BA 3HFZB 3CTRA 5KFJA 1FTCA 2HFUA 3CIMA 3WIUA 1IM6A 2B5JB 1HNVB 4MIWA 3Q2TC 4B9NA 4NLXA 4RJVA 3BREA 3MM9B 2HRUA 2B9YA 4YUDA 5BXIA 3KLFB 1VQMS 3Q8SB 3QGPA 3C16A 1JJ4A 1S9GA 3AQPA 2VF3A 4CNZA 1GQEA 4NLUA 3ADAC 5E3RA 2NS1B 4ED0A 3DFEA 4HI2A 1YTYA 3V4IB 2XZWA 3AJDA 3TA1A 3JTNA 2HVIA 1CG2A 1H38A 4DX8H 4MKBA 1L3UA 1U7LA 2ZBRA 5HI7A 2MQQA 3NOGA 2FC9A 3PJXA 4ZHRA 1JB0C 1X4GA 2ZH4A 1U2FA 1Q81T 1V5VA 3SDEA 4B3OA 4IQMA 1VR6A 1JLCB 4U7CA 4J9NA 2YKMB 5GAHU 1N5SA 1WSVA 3CCES 1NDLA 1IR2A 2GIRA 5HQMA 1HR0F 4QJVA 5LJ5Y 1WI6A 1YWXA 1XR5A 1Q79A 5HATA 3G82B 4USVA 1WHWA 2C2OB 2RT3A 2FJWA 5E5NA 3BQ1A 1T03A 3UQSA 4HR2A 1SPBP 2HHPA 3AA8A 1VJWA 2Q43A 4QWCA 2XMAA 1H2TZ 2LQ8A 2HFZA 3P5BP 4Z7YA 3CD0A 3W66A 3FCVA 2DO4A 3E01A 3HVAA 2CNNB 3FFIA 2B51A 3EZ5A 3P5TL 4Y28C 2HWIA 1CS4A 4CLFA 3GIIA 3UR0A 2KM8B 1CQMA 5KFHA 2WW4A 3GQCA 4KHRA 1KP6A 1SXLA 3PYEA 5J2PB 1JLGB 5SUHA 1HPZA 2DB1A 2J8AA 4CO4A 3AXKA 5ETLA 2ROPA 1J2VA 2VODA 1HNZF 4YDDB 2F4VJ 3QQCD 1NMEB 2MYFA 3R1HA 3BGOP 2NCKL 2F9JA 3QRPA 3OQ2A 1ROFA 2KJVA 4OI3A 3NAHA 3QLHA 3J7AN 4DL0C 4PYAA 1PIEA 2BM1A 4NE9C 2CQDA 1JNZB 2AJFE 1QVFR 4PEOA 4I6WA 2X1AA 3JAMU 2BE2B 3VTIA 4G65A 5E3CA 4EZ9A 4UOFA 3BQ2A 3NKYA 4ETZA 1BWEA 4M5GA 4LFBF 4QIFA 1P1TA 4K8RA 3EZOA 2HNYA 1NH7A 1D1UA 2W9BA 2PFFB 1PG5B 4DV6F 1NZAA 2VOOA 3AB4B 2RU3A 3R7NB 5KT4A 1GFWB 1N5QA 2PA3A 1F3VA 1WI8A 4JV5F 2A3JA 2ZDOA 1N8RT 2YNGB 1JLEB 1KHWA 4ZJLA 1BUXA 3MM5B 4P2MA 5ETTA 3QIPB 4ZPWR 3D4JA 3OTOF 5EWFA 1MMLA 1DRZA 3UD3P 4MFBB 1D9FA 2ZNYA 1UZHA 3C6UA 2MZTA 3I0SB 4OYZA 4UOGA 4B9UA 2K1RA 2ZOFA 3IO1A 2UZAA 1S1WB 4WJBA 2HVDA 1FNOA 2DXFA 3Q22A 3KTQA 4CH7A 1RAOA 3GLJA 1W2BR 4MK9A 1QLNA 4GKKJ 3NL0A 3KLIB 4KC5A 2CRLA 4DUYJ 1FVSA 1BE4A 3ZTPA 3SQOP 2V2ZA 2NUUG 4MAKA 3QSIA 2IM3A 3AD7C 2OFGX 3M2VA 5J2QB 2CDRB 2DGOA 4K2JA 1PO6A 2HFSA 4C7QA 4J7CA 3KHGA 3WC0A 1OWXA 2I38A 1T9XA 4K4ZA 1CVJA 1LKZA 4DLGA 2P8IA 2XCPA 2FHMA 3FGVA 2CPDA 1YBTA 2KB2A 1ZS6A 3O6QA 4XK8C 3F73A 1ZPWX 3LGMA 4URSA 1VS3A 3H40A 2IIHA 4LSZB 3PDNA 1H6KX 4B17A 2MPUA 4QYZK 3TVZA 4HKQA 3BEGB 2MEWA 3GIMA 4ZPCA 5B08A 2W4CA 4QWBA 2BYCA 2ACMA 2X3DA 4IH7A 4PG7A 3V81A 1RTJA 2BJEA 5HJXA 1QM9A 4JI0F 4F7VA 3EJMA 5GADU 1JKHB 3OT9A 2OJ3A 3RRHA 1R6VA 5D0RA 3MUVP 2N3LA 1QSLA 1VISA 2M52A 4IYQA 4RNFA 3CD6S 2XWYA 1RT5A 4HI1A 5JJBA 4OHVA 5LMNJ 1LXNA 4P71A 3QNWB 1SKWA 1FKPB 5HO4A 4F26A 4DF8A 3ILJA 4EYHB 3CCQS 5B7WA 2I6WA 1EKRA 3G9CA 2RS8A 1NK9A 4X4SA 3WDOA 1VLYA 1NDPA 4ID8A 3KNGA 3K58A 5LOQA 4FXWA 3RRKA 2FHKA 5B0EA 2ZBCA 1KLNA 2UU9J 1VC5A 2VD3A 2XLIA 4DU8A 5JVHQ 4P74A 1GH8A 4A4JA 3C6TA 3MEGA 4QIVA 2BRLA 1VDHA 1I1GA 2UUAJ 2AZ1A 4P72A 4DMZA 4ZDNA 2HWHA 1VJQA 2F8EX 1IR0A 2GVDB 3NGKA 4ZCMA 1SV5B 5E33A 3BSNA 3C66A 2MGZA 1HQEB 4W98A 2HQCA 4IG0A 2JSXA 1KFSA 3BH6B 1AW0A 3G2XA 2E1RA 3TZYA 4DPUA 4F0HA 2N82B 1SVDA 1AZSA 2M2BA 2OPRB 1TAQA 3W65A 4PXBA 1YX2A 2RE1A 1KKHA 4Q0BB 1N5VA 4F0KA 4QOTA 1SC4B 1Q7YT 3IBCB 4LF4F 3D7SB 5AXNA 3HKZD 1WEYA 3M8PB 4WFYA 4RW7B 1X5SA 1T9WA 4YEAA 1GNKA 1BQNB 2JFDA 3GG1A 2RIJA 3PYFA 4ITSA 4CQ1A 1WSRA 2I5JB 1VLOA 1IVZA 2W01A 2PC6A 2IDLA 3KMSA 2C28A 5FIIA 4ZVEA 3UD5A 4NXMJ 3KK1B 3IR7B 1RQ0A 2RHQB 5KFUA 2Q3PA 4WP3A 3THTA 3HULA 4LSNB 1I5OB 4F2SA 2BJ9A 1RI7A 3MR2A 3QJJA 3A3OB 4ZKAA 4ICLA 4X66F 4NLVA 3MCMA 3GFYA 2R8IA 2HGMA 3GU0A 4DUZF 4GVLA 3VAMA 4LIRA 4RWWA 3VR1A 1H7WA 4C0OC 4L3KA 3K59A 2E7VA 4EI2A 1GT8A 3CJSA 3U02A 3L3CA 4ZMMA 3K5LA 3VGVA 2LFVA 5DRKA 4ER8A 1NHUA 4ZPTR 1N5YA 3MECA 2D1CA 2PI5A 1N0VC 3DRPA 1RWMB 1NBEB 4EYIB 4G1QA 3TVKA 2IMOA 4RW4B 5FLXY 1YRUA 3GYNA 5JVGQ 1RJJA 4M5IA 2B9XA 4PZVA 1F5BA 1S72S 4CO5A 4LFAJ 3MMAB 3JAMY 1EARA 4FXVA 4AE5A 4DOZA 3EMTA 1ZOTA 3PYDA 2KVIA 3MHYA 2ATCB 4DUTA 2BJ7A 3T41A 2PMHA 1ZM9A 3D1HA 1C4AA 4PG5A 2QEXS 2LCWA 1RXOB 2HHHJ 1J5EF 4NA2A 4NLPA 2ZJRQ 3VAHA 4TU9A 3UCUP 1RKJA 5D4NA 3NXZA 1XNQF 3U27A 4P2FA 4USWA 3M8RA 1TV6A 3CCLS 1B64A 4FS1A 5EGYA 2VASA 4O0IA 2KL8A 1RT1B 2FPHX 4DSJA 4DV4F 3GV7B 2J9DA 2XSJA 3N4WA 2L9WA 4J9LA 5IQ6A 4ZVRB 2AX1A 1IBLJ 4NXNF 3N9UC 2XTJP 3QATA 4EU0A 2Z58B 3Q8YA 2Q66A 2DR6A 4ZIWA 4IKAA 4ZCKA 1S6PA 4KHMA 1C0TB 3OLAA 4F36A 2VFRA 4U6PA 4DFPA 2H5IB 2WRMA 4ZN1A 2GJ2A 4CDIA 4F3OA 1NDCA 3WC2A 3G86A 2CG8A 1ZTWA 2KT2A 3H2VE 1NHKL 1E6VA 3G6YA 3B4DA 1YJ9S 3HLUA 3H4BA 4J9PA 2ILYA 3TAMB 3N01A 1FRLA 3BBFA 4RW6A 3JXOA 3R7SB 3B6BA 2CZVC 3BYRA 3NCRA 5D4PA 5AE2A 3C15A 1U2CA 1NK7A 2B8PA 2VG6A 4TXSA 2OMLA 4TU7A 2YPZA 2JEJA 4ZJOA 1YJVA 2VPZB 5CYMA 2JVRA 5KFAA 4M95A 4CIOA 2W24A 2WCXA 3FSYA 2DO0A 1FVQA 1IM4A 2ZE2A 3TJ9A 2OELA 3CUNA 5GMDA 4JI5J 3W64A 2BKPA 4RNMA 4PXEA 1T11A 2C3OA 2YBVA 2V4RA 1HQUB 2FUG9 2G0IA 2APOA 5ETPA 2WVBA 2IVFB 4ECVA 3W2WB 4C0BA 2B4PA 1HR0J 2H51B 3KFWX 1Z1ZA 1UVKA 2VHGA 2Z56B 3VALA 4OYAA 5KG4A 5BYRA 4RBUA 3H5XA 3IWNC 3T1YF 5IT9U 5DDOC 4CO3A 1NU4A 2VKZG 4USMA 4C3LA 3GV8B 2VFUA 4M5KA 3R27A 2B3TB 4NLQA 1NO8A 2BR0A 1M5VC 1YQHA 1APSA 1CJKA 3R9LA 1S9EA 4O3QA 2E5HA 2Z2MA 2V6AA 3M1VB 1OYEA 4DCJB 3BYPA 4PG4A 2GV1A 3WX4A 1TK8A 1N33F 2GHVC 2KDOA 3KHLA 3JB9k 1YJUA 3U7JA 3QGIA 4KT0C 4DG1B 3TP2A 2U2FA 4TLRA 1XEZA 2FZKB 2KU7A 2HFVA 5HMWA 1NJIT 2IDEA 1ICEB 3ENQA 4O0NA 2CJ9A 1RHMB 2QO3A 3MM6B 2FZGB 2D69A 2HFOA 1C0UA 4CWBA 3V6JA 3CCUS 5KFNA 3DDNA 4B9TA 2OEMA 4KY3A 2VBXA 2BANB 4PPDA 4OI2A 4F4WA 4B9MA 2DY9A 3TYTA 3DLGA 3M2UA 2HHSA 2XYPB 5I3PA 1J27A 3FMWA 1P6TA 4RBVA 4F04B 1R7IA 2UUBF 1FFSB 2RUGA 3C3LA 2N4DA 4OJ1A 1GXUA 4A46A 4LFBJ 5HLFA 4FVMA 4KYZA 1U4BA 2RDJA 2E5GA 3W7BA 1JXLA 5KFYA 3NOCA 3EVOA 5KOXA 1OIAA 3CJ4A 4R5PB 2XLJA 4DV6J 4ZPVR 4FBUA 1RWXB 4X4OA 2C22A 1KVKA 4OI1A 5DLFA 2R9LA 2DNMA 4JV5J 2VUGA 4BC9A 3DLKB 3OR2A 2YNIB 1V9OA 3OTOJ 1B0TA 2DH7A 3ZZYA 2H4WB 4WU3A 3I9ZA 4DEZA 4WTOB 4OHWA 3CXCR 2IPOB 3KKFA 3ONQA 3POTB 5KFSA 3D66A 2B9WA 4OI6A 2DNQA 2PA8D 4F67A 5CCMA 4USTA 3SI8A 4ZITA 2UVWA 3DRYA 4CZCA 3WBZA 1FE4A 1UJ4A 4FNHA 2IJRA 1QVGR 2ZH8A 3I6PA 4IFVB 3DCAA 3MF5A 1FERA 1FDNA 4O44A 1TL3A 2OAUA 4I6YA 4CO1A 4XDCA 5HAOA 4ED5A 2KFYA 3VAGA 3OL6A 2NYIA 2P9CA 4N8OA 1FJGF 5KFBA 1K0VA 1HHQA 4LR9A 5M2UA 1TAUA 1JLAB 2M3DA 1SL2A 2E9TA 4GC6A 2L3MA 1GEHA 1RWPB 2ZFHA 1GX6A 2DXEA 2N7CA 3NMRA 4ED8A 2ATLA 1Q5YA 3D1OA 4BWMA 1XMQF 2W25A 3H42A 2EXUA 1NSAA 3TX0A 4J9VA 2DRAA 1OPIA 1YBUA 3BBCA 2ZC4A 2XNRA 2NPIA 3NMAA 4JI0J 3QGHA 2EBGA 3CNQP 3DLEA 1AYEA 2IVMA 2G0CA 4WP9A 2VBZA 2CPFA 2YKAA 4MT1A 1TL7A 1IBMF 4YB5A 3ELHA 1Q53A 1OQ6A 2J5AA 1X7VA 1Q4RA 2YNFB 1R0CB 3CO9A 4OZ2A 3SDEB 3C8YA 4B3OB 1AFJA 3CW2C 1VQPS 2QA4S 4DR6F 1UPMB 4TNOA 2G13A 4DLEA 1NKBA 3CDBA 4C6AA 4DV5J 1S12A 3ILLA 2G2YA 3VZIA 3RR7A 3DRRA 2HHUA 1VHFA 3C14B 3PJWA 4ECQA 1RT3A 4CLYA 5IC4B 2ALYB 4JUZA 1LWFA 5KTQA 3G6VA 4QWAA 2V8HA 1TMMA 5KFGA 1GMWD 1CC8A 1VQ8S 5G4DA 3NBPA 1QAXA 3FFIB 4QCLA 1JLFA 1VRTB 4QPTA 2VG5B 3CJKA 3TWZA 3PKMA 3GMGA 5ADZA 4HACA 2UVVA 1VK3A 4K50A 1MN9A 4KB7A 1EP4A 3A8IA 1IKWA 2IBKA 4GMKA 5KFKA 1EETA 3BGUA 2B4OA 1ZM4A 3QZ8A 2D7SA 2QV6A 3J81U 2ZJPQ 1HPZB 4OL8A 2XO7A 2VC1A 1B4SA 4N76A 2VV5A 2MKJA 2IRUA 4C8KA 5IFMA 1Y10A 1Q86T 4LF4J 4Y6IA 4EBDA 2B4VA 3MEKA 4U7UK 2Y8YA 3H59A 4XO0A 4P6QA 3J7A1 3FZ2A 3LW5C 3KG0A 1K0TA 3QLHB 1EJ7L 3D67A 3M8ZA 2POKA 2GJIA 2AD9A 3SQGA 4C8LA 2K7KA 2B56A 2GQ2A 1RTIA 3X1LB 1ITPA 2CQPA 2XULA 4I6AA 2W9BB 4X66J 2FYXA 4DUZJ 2GS8A 3Q8UA 3L7OA 1T9YA 5A76A 3MM7A 2OLWA 5E2QA 1K1SA 4H4OA 3M8SA 3MPVA 4YHHF 1FJ7A 3KLEA 3HX9A 4DQSA 3FSXA 2ZOMA 4DV2F 2BM0A 3K5OA 4ECRA 1S4EA 4LUBA 2YWWA 2K1RB 2M88A 1HNWF 3FEXB 1SL1A 7AT1B 5E41A 2XHCA 2UVUA 3GONA 3HXMA 2PGCA 3QT7A 1OY8A 1UEUA 1P27B 3MM8A 3M2VB 2BKOA 4CYUB 1JQGA 4C11A 1J5EJ 1JMTA 3M8QB 1KN6A 4DV7J 2SXLA 3JYTB 4NA3A 3LPEA 2X1FA 3MMBA 1LV5A 1Q8LA 4KHPF 4DR7F 2W9CA 1XNQJ 3M05A 4I56A 4WE1A 4BHQA 4TVAB 2QZ8A 3M9MB 1Q7LB 2CZ9A 1RAFB 4WZMA 3PM9A 2BVZA 2M5YA 3T3FA 1WKJA 4DV4J 2ZZTA 3KLVA 3H25A 3CC2S 3LP0A 3H5UA 2MTLA 3JTPA 2EKYA 4NXNJ 3SYZA 2V69A 3V81B 4HT7A 5CQGA 4DX5A 5K8PA 4EWTA 5L46A 4PKDB 1RT2A 3SCKE 1O8BA 1IKYA 2JNJA 1UKUA 2EC2A 1CLFA 4RNNA 3DLBA 3R5CA 4LF2A 3E3XA 1WHXA 3ZTQA 2Q1LA 3HD2A 3X3UA 5E3PA 2EFPA 3FBCA 2J76E 1S49A 4QU6A 3NCQA 2YKOA 4O3NA 3L7UA 2J0XA 3R6LB 2HHVA 2KRRA 2OUGA 3SCIE 4F0MA 2DH9A 1UJ6A 4J9UE 2YH0A 4HT5A 5A2QU 2MZSA 1MLAA 2GIFA 2W4PA 4URQU 4URGA 1RTZA 1OPZA 2V4JB 1AUDA 1EAYC 1HWJA 4E8UA 3G6ES 5DQIA 4DPTA 3HFVA 1YBAA 1LOUA 3OHAA 3CEDA 3RAQA 1VQ7S 4FDFA 4AXJA 2LLZA 3IG1A 3MR5A 1YI2S 3L4BC 1WDDA 4TYBA 4X84A 4NYPA 4X64F 2FQQB 3GILA 4RWXA 3HCXA 5ETOA 4A8QA 1VQ6S 3HVTB 4ZJQA 3KXDA 4IG3A 2WW8A 4LR7A 3THPA 1U6FA 2MSSA 3S8SA 2RB7A 4IG0B 4XAKA 2GJFA 1DARA 1HW8A 3FJ2A 3RG6A 3NS5A 4U9RA 4BDPA 2W2PP 1AZSB 2HBZB 3T1YJ 2ASYA 2NUHA 4O23A 8AT1B 3DC2A 3KLHA 2CPEA 4RPFA 1N88A 1MWQA 5HMXA 2MZ1A 2KM8C 2VH7A 1DBDA 2J0SD 5KFCA 3J7YI 1QAJA 3LF0A 5D8HB 2C2EA 4FP9A 3HHLA 1FI4A 2DD8S 1FRXA 2LXUA 5KT5A 4HLBA 2I1RA 2X3GA 5KFWA 4ILMA 2QSFA 1DFDA 1O5JA 3DYAA 2XO6A 1T02A 2MKHA 4S0MA 4J9KA 1RB0A 4ZP7A 2GIQA 3HD1A 1U1NA 2E7XA 4EEYA 4ICLB 3HK2A 4I7FA 3J7YU 3CD7A 1VK8A 3VAFA 2G9OA 1R8HA 5KFLA 1HW9A 1RU1A 4QBUA 3J81Y 2RAQA 5D78A 5H9EK 3IRXA 1N5YB 2B7BB 3MECB 1KSPA 2ZH9A 5J1NA 1RK8A 3NWRA 3DRPB 2DPIA 1ZPVA 4CLWA 1WC1A 3QIDA 3H5YA 1S1UB 4G1QB 4IO1A 3HT3A 2HS0A 2F63A 1MWZA 1RISA 3KUEA 1TUVA 4DBQA 3L9ZA 4A8KA 1HNXF 2QRRA 3MAAB 3M8WA 4C9DA 3CJ3A 4AL7A 1XTZA 2A6MA 5T7LB 1KQKA 1F9HA 4NASA 5IM0A 4LBHA 3AFGA 1U02A 1WWHA 1N32F 2HEKA 2OH2A 5HL7Q 4RU9A 1WC5A 3CVKA 3HVRA 2E7WA 3CCWA 3RYLA 4KAIA 2XSFA 4ANEA 2ZBIA 4Z7CA 2HNZB 3MMCA 2F7VA 4BBYA 3Q8PB 2LU2A 1S1XA 5F8NA 2D3UA 2JRSA 3TVYA 2DGQA 4PCQA 3DU5A 3KK2A 2IAJB 1QTMA 3G71S 1C4CA 2MQNA 4ID5B 2GA7A 3BR9A 4Y2AA 2E5IA 3DOMA 3U1LA 2CQ0A 1FJGJ 5IQQA 2Y1JA 4F8RA 1VRUA 1KHVA 4C0HA 2KXNB 1FXLA 5IV4A 4WWSA 2X1GA 4DR2F 1JWWA 5M2RA 4DN0A 3MMJA 2JWNA 5D0GA 3WIVA 2EFNA 1Q82T 4Q5VA 5HN0A 1XR7A 5LM7E 1XMQJ 3OL7A 3T19A 3HP6A 1FDBA 1N5TA 4RW6B 1SH0A 4Y34A 3W3SA 5IWAF 3I4PA 1U49A 2F8HA 2C3UA 3Q23A 4MMOA 2Y0BB 2ZBQA 1OSCA 2DGSA 1S9FA 2V68A 1N4LA 3GPAA 2FGOA 3DGVA 2J6SA 2GZOA 4EBEA 1VQ5S 4PWWA 2FDNA 2B8QA 3FUYA 4U8VA 1X0FA 3PW2A 1IBMJ 3CDEA 4JYAF 1B7FA 3G6XA 5HMZA 3BV8A 1DJ0A 2ZE2B 3KDNA 2HHWA 4Y2CA 3O3LA 2Z2LA 4I2PA 1ZA2B 2MQLA 1H2VZ 1QSSA 4I4BA 1R8BA 1U1MA 4LRBA 4PQUA 1U0HB 2XB2D 3W60A 4FXDA 5HP1A 3MD1A 3AOAA 4I67A 2BBEA 4QR2A 3LTOA 1QD1A 1IQTA 2PEBA 3NNAA 2NQPA 2QA2A 3UWTA 1UMJA 3CGIA 1IWGA 4B9SA 1CJKB 4WFAQ 4CI0B 1S9EB 2HQ3A 4CM0A 2KT3A 4E98A 2XQCA 3HO1A 4TLQA 4OX9F 4WKYA 2WTFA 2HBRB 5AE1A 2DNPA 3HF5A 1RWWB 1FXDA 1HFEL 1FF2A 2AJQA 1M5SA 4OJHA 3QJPA 3SIPB 4QIWD 4IH5A 1U1PA 4NLGA 3UPFA 4HVZA 4B3TF 5JMNA 1XMBA 2U1AA 4BLGA 3VF0B 1C0UB 2AZ3A 2JFKA 4ECYA 2Z4PA 2IBOA 2QL7B 2K3IA 3Q86A 2LMIA 3OVSA 4GO7X 2BA9A 5IXUA 2IY5B 2KHDA 1A0OB 5C7PA 2DHXA 2AGQA 2MY8A 3DLGB 2J7WA 4NMLA 1CULA 3D0GE 4N56A 6AT1B 1S0MA 3LAMA 4FYYB 2NZCA 3EGNA 5KT7A 2J6TA 1CJVA 3BGRB 3PX6A 1HWKA 2UP1A 4LRFA 3FZBA 1O6XA 1N34F 2C3PA 4R25A 4GVBA 5HLFB 3IR6B 2YKQA 3KWMA 4MKAA 3TUPA 5EUHA 3ILOA 2HBYB 1Y7PA 3JTOA 1F5AA 1QE1B 2NREA 1SJRA 4YDXA 2KXHA 4UQGA 1NJWA 3B8HA 1WC3A 2CQIA 2WBMA 1PJ5A 3W1YC 1H73A 3VGTA 1YJWS 3QGGA 3FQKA 4YHHJ 4OZ5A 3AOCA 3GIJA 4X4TA 2WZ1A 6FDRA 4DV2J 4R0EA 2VA3A 2CJBA 1NSKL 5H1SV 1RHQB 5A6PA 2HZCA 1RCXB 1FRMA 2FVCA 4DFJA 2OPPA 1A7GE 2RRBA 1PBUA 4NOHA 1W26A 2HKEA 1C2PA 5D3GB 2I8EA 5A8KB 4DI6A 1SJQA 3MR7A 2ZITA 4J37A 1IUJA 1RZMA 2OO4A 4O44B 2HHQA 1TL3B 1KLMB 2IM0A 1RT6B 3OXGA 1HBUB 2G4BA 1FE0A 2RU9A 2D9OA 2EEYA 5A8WA 2WVEA 4IDKA 1C1CA 3DRSA 5BJRA 1PSDA 1RUSA 5ETMA 4DQQA 4KHPJ 1S6QA 4DR7J 5HBMB 2HFNA 1UAWA 2PMWA 4OV6A 3N6NA 2YVSA 1BWVA 4EO8A 4RW9A 1M5OC 3I5BA 4HH1A 5F8JA 2N7YA 4MH8A 3KLGB 2V94A 2DTJA 4FYVB 4NRUA 4ECSA 4QZVB 3IWXA 4PWDA 2H4YB 2RDDA 2OPSB 4J9SA 3UCZP 2XEXA 1RCOB 4O4GB 3FDSA 4NZ6A 3D6MB 3DLEB 2UUCJ 3LOUA 2OEKA 1DQ9A 3CJ2A 2RDIA 5DETA 3UNGC 5K5MA 3R7BB 4YMEA 2YWHA 2GQQA 4F4YA 5M2PA 1ZAVA 3ISZA 2QC3A 1VBKA 4USKA 1NB2A 4Q45A 1LNQA 3MUTP 2PI4A 3MXHP 4X65F 5HK4A 1HMVB 2GAGC 5CYQA 1KDNA 4ZLJA 2LEBA 1TELA 3V5RA 3JSYA 3TARA 1BD6A 2E1CA 3UVJA 1LWXA 2OMOA 2QX0A 5GAGI 1OY9A 3SV3A 3NGRA 2L41A 2DNZA 3EDRB 1QSYA 3DRRB 1PJ7A 1S0NA 4LF5F 2JC1A 1XJWB 1R27B 4UW2A 3BO4A 4Y65A 1NEEA 4H4MA 4LSLB 2GMLA 2DHAA 2CKWA 3MR6A 3NBPB 4X64J 1SL0A 3CIZA 4LR8A 4DCOB 5DDRC 3CJKB 5GAGU 3EVWA 2EVZA 1LK5A 2WONB 2CWXA 1DAXA 2IA0A 2HNDA 4HACB 3DN9A 2BJ1A 2O5DA 3IP0A 2Y9HA 3IM9A 2LEPA 4O3SA 1IKWB 1EETB 3TAPA 4M5MA 3S01A 1HI8A 1FKOA 3FCHA 4LQ9A 4OZLA 4BS2A 3OFEA 5L1LA 3PFOA 1NSPA 1T9UA 2J6UA 2AGOA 1LWEA 1Z2ZA 2VU5A 3FVYA 1AT1B 2IC3B 3O44A 3KJFB 3W5YA 1S1TA 1X4FA 1S77D 4KIAA 5KT3A 1T0TV 3MPWA 3CCRS 1RE1B 3CMQA 1RHRB 2PDAA 1IKVB 1SIZA 1AB8A 4M5DB 2QL9B 2WB1D 1S7IA 5HVFA 4JOUA 2K2PA 4I1TA 4RW8B 3SQGB 3AJ1A 4CO0A 4ED6A 1U1OA 1T7PA 3PO5A 3ZTRA 2D9PA 3CJQA 3GCWP 5E3AA 4NX9A 3W2VA 1RBOB 1H98A 4NLDA 5B0FA 2K06A 2FJAB 2HLUA 2V2QA 3GYGA 4WZQA 2J9CA 3DXSX 1BQXA 2NR0A 3OPKA 3T5KA 3D28A 1YJRA 3K8WA 1HNVA 4WK3A 1VQNS 3EX7B 4A8WA 1DY3A 4ZOSA 1MROB 3MM9A 2DGUA 4L3NA 5J1EA 3T9NA 1OYDA 4ZP9A 4C3MA 1Q8BA 1G2EA 4RBTA 3KLFA 1RAHB 1VFJA 3DOLB 5E3QA 1IN0A 3K0JA 2IYIA 3DLLQ 3KYLA 1FKAF 1H74A 2BE7D 3KK3B 3HVWA 1HNXJ 5D4LA 4O3OA 3V4IA 3N5FA 3DLHA 1DTQB 3CMAS 1XN9A 1MWYA 4ERDA 3LWMA 2J7UA 2C3MA 1VBZA 1D9AA 4YQWA 1R0BG 3VQTA 5CH7B 1TL4A 4JI6F 3NNHA 4PPZA 2AYBA 1FWKA 1UA0A 1F5CA 3NRBA 2GX8A 1N32J 2R7OA 4UF4A 4G3IA 4UOHA 5K8OA 3TJ8A 1A6LA 2OPQA 4ZVTB 3MMBB 2ZH7A 3DMJB 3PRVA 1UTAA 2EWHA 2AYGA 2W9CB 1JLCA 4DDFA 4WE1B 4KR0B 1X8DA 3QYYA 3FRYA 2BX6A 3IGNA 3TJAA 2MZJA 1ZZFA 4KKOB 3ICLA 3SSSA 2CPYA 1RTDB 3Q89A 3HZGA 4O3PA 5D4OA 4K4TA 4TQRA 3LP0B 5DLGA 5EDWA 2WSEC 1KEKA 3M32A 4LF8F 1IBKF 4CLZA 3VHQA 4WIIA 1S57A 2M70A 2BJDA 5GAHI 2FHOB 4ZVFA 5AXMA 2HQDA 2F9DA 3OV7A 2R7VA 1U0SA 3M7VA 1NJZA 3EXCX 4OYWA 2PD1A 1AXQA 2XLKA 3A12A 2IFXA 4ECWA 3OVBA 3EGWB 4FZVA 1TKXB 1NNDA 4DPWA 1TU0B 1JLGA 1S6OA 4YP3A 1NLKL 5HANA 2HSEB 4EBCA 4USUA 3LP2A 1RA6A 5C42B 3CC4S 3MZIA 3T1HF 4KSEB 4ELVA 4YB6A 1VQOS 2HRYA 4C8OA 4P10A 2CQGA 2VZ9A 4N41A 3IG1B 4JYAJ 3IS9B 4NPOA 2DT9A 1U1RA 1FESA 3LALA 5K8MA 2AMCB 4NYOA 4B08A 2WB4A 4IG3B 4UT4A 2B7CB 1UVMA 2DGWA 3ZZOA 5GAEU 1W2IA 1SC6A 1ZBTA 2ZUGA 5KFDA 4OHYA 1IXKA 4EUVA 1VOMA 3B54A 3TEGA 1TKZA 4QYZJ 1Y5IB 4USHA 2RH3A 2IYGA 5K9FA 1QDUB 2DR8A 2KI2A 4KE5A 3KLHB 2R3VA 1LFWA 4ELUA 5ETNA 2DGVA 2P6TA 2OGUA 3QIPA 4DQPA 2BZ2A 3DNCA 1GMUA 3PTWA 3I0SA 1MMNA 2EFQA 4DR4F 4WBFA 5AXKA 5IT0A 2UV8G 3D3CJ 4OX9J 2VBYA 1MSWD 5ETVA 2CAJA 4TY9A 2IHR1 2WBRA 3DOKB 2D3O1 1E6YB 3DI6A 5J2NA 1SJ4P 2A18A 4DFKA 3P6YC 5CHCB 2NZ4A 4B3TJ 3J7Z5 4ECTA 2HMIA 1UCNA 3V6DB 2VQFF 2FC8A 4F02A 4K59A 3MFIA 4TN2A 3I96A 1X5TA 2GHWA 3OD2A 3EYZA 2AQ4A 1X4HA 2LXFA 2W8LA 2O67A 1JLQA 4AL6A 2FLPA 1LWCB 3QFWA 2IVYA 3IRXB 3UR3C 2RKIA 4OFZA 4Q7AA 4A8SA 2D74B 2KJWA 3D6HB 4QWEA 5DGAA 3QMQA 1YJTA 2Y1LB 3DLJA 3T6BA 1I94J 2ACYA 1WORA 2V4QA 2JHEA 4WCEQ 3H4DA 4DSFA 2YWFA 2NXUA 1N34J 2JEIA 2VA2A 3R3TA 1T8EA 1JXVA 3DGPB 3PCOB 3PHTA 1L5UA 3OXFA 1FWPA 4C97A 3TA0A 1ZM3A 1WOPA 2PEHA 2CVIA 3ZXWA 1JKHA 1X0PA 1N0UA 4WYWA 3R5AA 4K5RA 5K20B 5DS7A 1PC5A 1HWIA 2DPJA 5IM0B 1CSJA 2VBWA 5DG9A 3W61A 1HHTP 2RSQA 5C25B 4EO6A 2CJKA 1V6HA 1UVJA 1DTTA 1WUUA 4QW8A 2YQ0A 2NLWA 1WG5A 2DXDA 1FRIA 2P2CB 1LW2A 2R8KA 1D0EA 4HYKA 2XNQA 5GADI 4YB1P 3UFCX 7FD1A 2KXFA 2HPUA 4KO0A 1GMVA 1S1XB 2B0GA 3KG4A 2HRTA 1X9WA 3R5JB 1VBYA 2FJEB 5FDLA 5K14A 3SMZA 3FSIA 1WF2A 2AU0A 1SC3B 1F1BB 2BV3A 2GVZA 2KVQE 3R6GB 1L3KA 2FGCA 3TQ1A 3QO9B 3IGVA 1RSCA 4LRCA 1VRUB 5F9LA 2V9KA 3HM9A 4BWJA 1F3FA 1V5IB 1RAGB 1YITS 3KNAA 3H7HB 2GVDA 3AOBA 1SV5A 3BGFA 3BKUA 1Q16B 1Q8IA 3OFHA 3GFHA 3TW0A 4CLLA 1F60B 4R8UB 5LMUF 1S6UA 3ISND 2IJNA 4D3HA 3O1LA 5F0WA 3IN5A 1YK9A 3OUYA 3LUYA 3ILIA 4F25A 1S97A 1UVNA
chains in the Genus database with same CATH topology
2EKYA 4RW7A 3SYZA 1RT7A 2HAIA 1U2RA 3V81B 2IMWP 4HT7A 1G1XA 5CQGA 1WEXA 4W90B 5K8PA 4EWTA 3OJUA 2DCUB 1UVLA 3MURP 4FBTA 4PKDB 1RT2A 1RA7A 3SCKE 2O3DA 1U1QA 1O8BA 1U1LA 1IKYA 2AV5A 5F3ZA 1GTHA 2XS2A 1S1VB 1UKUA 2L9DA 3TANA 2XY6A 3GG0A 1QE1A 1CLFA 4RNNA 3DLBA 3R5CA 3E3XA 1RWUA 1WHXA 1IBLF 5FD1A 3V6KA 2FVPA 2CJQA 4NL5A 4IFVA 3W2VB 2Q1LA 3I9V9 4CH0S 3T1AA 4WTYA 2JVOA 3X3UA 5E3PA 1FEEA 2EFPA 2MKKA 1R0AB 3R5BA 3CTRA 5KFJA 2MB0B 1FTCA 2J76E 1S49A 4QU6A 3NCQA 3LO3A 3AAWB 1S79A 2YKOA 3CIMA 4LSNA 1XBWA 4O3NA 1O0PA 2J0XA 6FD1A 2ZH5A 1ZYQA 2HHVA 2KRRA 1REVB 1H0HB 4PQUB 3SCIE 5L9XA 5FJ4A 4ES3A 2B5JB 4Z37A 1GAOA 3M6UA 5HP1B 1HNVB 1K1QA 3QPIA 2OSRA 4MIWA 3Q2TC 3CE8A 4MK7A 5HQ8A 1D8YA 4B9NA 2DH9A 4NLXA 1UJ6A 1XR6A 2LA6A 2YH0A 1T3NA 2QIFA 3BREA 1CQNA 3MM9B 2HRUA 4FN5A 4HT5A 1TVRA 3DHWC 3UE2A 2MZSA 1L3TA 1DURA 1UFLA 2B9YA 4YUDA 1ZETA 3OTDA 5KFOA 3BO3A 2E29A 3IC1A 4ZK7M 3KLFB 5B0GA 1VQMS 2W4PA 5CA5A 5KFFA 3Q8SB 2DK2A 1TKDA 4HDGA 4URQU 4IOAQ 5A0YA 1NKCA 4URGA 3M2UB 4OLPA 2MSTA 3QGPA 1OPZA 1K8AT 3E51A 2V4JB 5CCLA 1AUDA 1JJ4A 1S9GA 4K4WA 1HWJA 4E8UA 5LXYA 3G6ES 5DQIA 1DQAA 3AQPA 4CNZA 5D3GA 1YBAA 1LOUA 3OHAA 4RW4A 1GQEA 4ZPBA 4NLUA 5A8KA 5E3RA 3CEDA 2R8GA 2P5VA 5T14A 4FF2A 2CPHA 2NS1B 4ED0A 3DFEA 3RAQA 4HI2A 1YTYA 3V4IB 2XZWA 1VQ7S 1N54B 4OZJA 2MJUA 4AXJA 2LLZA 3IG1A 3TA1A 3MR5A 4IRKA 3JTNA 2HVIA 1CG2A 1YI2S 1H38A 4TYBA 1TL1A 4X84A 4DX8H 1KLMA 1RT6A 4MKBA 1HBUA 4NYPA 4X64F 1L3UA 4P7TA 2ZH6A 3GILA 4RWXA 1U7LA 2Z8QA 5HI7A 4AYBD 2MY7A 2MQQA 5EWEA 4A8QA 1VQ6S 2HVZA 3HVTB 5DM6Q 5KFRA 4IG3A 2FC9A 3PJXA 4ZHRA 3SSRA 2WW8A 3GV5B 3THPA 1JB0C 1U6FA 4ZPDA 2W8KA 1D3WA 4ED1A 3EPGA 1VQKS 2MSSA 4M1KA 4NZ0A 2EK6A 3RAXA 1X4GA 3S8SA 4KGKA 4OHXA 2VQEF 5L8RC 5HBMA 2ZH4A 1DLOB 2RB7A 1U2FA 1Q81T 2GGPA 3SDEA 1KS2A 2OFHX 4IG0B 4XAKA 2ZM6F 3MR3A 4X4QA 3PY8A 4IQMA 4B3OA 1DARA 2HYIB 1JLCB 1G3OA 1HW8A 1FA0A 2EG1A 3FJ2A 3PX0A 3GE9A 4U7CA 4J9NA 2YKMB 3OR2B 3NS5A 4U9RA 1N6QA 4BDPA 2YKNA 1O51A 4IO9Q 5GAHU 3DU6A 1N5SA 3CCES 3OHBA 1M5PC 4NZ7A 2GIRA 3KJVA 2ASYA 4NCBA 2NUHA 4O23A 3DDKA 2D41A 4NRTA 1RGVA 3K5PA 3DC2A 3KLGA 1HR0F 3KMQA 4QJVA 5LJ5Y 1WI6A 3KLHA 2CPEA 1YWXA 1XR5A 5BYQA 2KH9A 1Q79A 4OJGA 4AUKA 4ECZA 3GFZA 2Q79A 3TA2A 1WHWA 4RLEA 1JLBA 2WOMB 1N88A 4C8MA 2RT3A 3CCSS 2OPSA 2ADCA 1GXLA 4K4VA 2FJWA 1SKRA 5HMXA 1FO1A 2MZ1A 2VH7A 2KM8C 2DJWA 2GMJA 5E5NA 3BQ1A 1T03A 3HZEA 1DBDA 2J0SD 2HLTA 5KFCA 3J7YI 3UQSA 5B0CA 2GQCA 1QAJA 4O4GA 2CQ1A 3LF0A 2ZZMA 3Q8QB 1P9QC 2HHPA 1S0OA 3AA8A 4FYDA 1FD8A 1GX5A 1VJWA 3PR5B 2C2EA 2Q43A 4FP9A 3HHLA 5D8HB 2DD8S 2L08A 4IFYA 1FRXA 1V3SA 4UY85 2VOPA 4QWCA 5CXTA 2LXUA 5KT5A 1M5KC 4HLBA 1H2TZ 4IR9A 2I1RA 2X3GA 5KFWA 5I4MA 5KG7A 2HFZA 1WELA 2ADBA 2OTJS 4ILMA 2QSFA 3H2UB 5A8RB 3TAQA 1DFDA 3TX8A 1O5JA 2E44A 1FNMA 3VAJA 3DYAA 3CD0A 1T02A 3QAUA 2MKHA 4AQYF 2DO4A 3E01A 2BACA 1TFWA 4J9KA 3IRWP 3HVAA 3ZZUA 3FFIA 4G6VB 2B51A 3A8EA 2V0NA 3EZ5A 1M90T 4ZP7A 1IKXB 3P5TL 2GIQA 3OXLA 4DR3F 4Y28C 4NCGA 2RQ4A 2ZHOA 2X51A 2BQUA 2UUTA 1C0TA 1HMVA 4TY8A 1U1NA 2HWIA 2E7XA 5KAKA 3PFEA 4EEYA 3GIIA 4ICLB 3UR0A 2KM8B 4IRDA 3HK2A 1CQMA 4I7FA 5KFHA 2OIHA 3J7YU 2JLFA 4IOBA 3CD7A 3GQCA 4KHRA 1WEZA 3UDCA 1SXLA 1VK8A 2OP5A 3VAFA 2D3ZA 4AL5A 2G9OA 5J2PB 1R8HA 5KFLA 1JLGB 1HW9A 3OL8A 5SUHA 4WU2A 4RX6A 4NA1A 4NLRA 4QBUA 1HPZA 3J81Y 3MAHA 2DB1A 3LQVA 1X4DA 5D78A 5F8HA 3ZC4A 1GXTA 2J8AA 1SUQA 1TKTA 3IRXA 1IJEB 4LT6A 1N5YB 4CO4A 2A10A 2B7BB 3MECB 3Q24A 1VC6A 5LXRA 2ROPA 5JXSA 1KSPA 1J2VA 2JL9A 2OPPB 3GYXB 4YDDB 2ZHAA 1HNZF 2VODA 2ZH9A 1LFPA 5J1NA 1RK8A 2FHJA 2LQ9A 2MYFA 3DRPB 3R1HA 2DPIA 1ZPVA 3CSKA 3QIDA 3H5YA 3CULA 2DNRA 1S1UB 3G8SA 2F9JA 2R2RA 4G1QB 4ATNA 4DL5A 4IO1A 3HT3A 3PV8A 2BQRA 3OQ2A 2HS0A 1KVIA 1ROFA 3HI9A 5G0RB 4ZS6A 4KPYA 4Y2IA 2KJVA 1MWZA 4LSLA 4OI3A 1RISA 3NNCA 2ZD1A 2CPXA 1U25A 4I2QB 4KGMA 3NAHA 3QLHA 4DL0C 2CZ4A 3CCVS 4RUHA 3ZZZA 2EPIA 2BM1A 5A6WA 5KG0A 2DNKA 1Y3KA 2CQDA 4C3KA 1MW7A 1JNZB 2AJFE 1QVFR 4I6WA 1TUVA 2X1AA 4DBQA 2N3OA 1R3NA 2BE2B 3BM7A 3VTIA 4A8KA 2WONA 5E3CA 1HNXF 4EZ9A 1U48A 2QRRA 3BQ2A 1WG4A 3NKYA 4ETZA 2KHCA 3CWJA 4IH6A 4QR1A 1BWEA 4ZVHA 1HBNB 4LFBF 1C1CB 2RVJA 3DRSB 4C9DA 4QIFA 1P1TA 3CJ3A 2HNYA 3P96A 4F3MA 1NH7A 2CQ2A 3JSMA 1H2UX 4AL7A 1D1UA 1XTZA 5T7LB 1NKEA 2W9BA 2PFFB 1SBRA 3IXQA 4DQIA 1KQKA 2R7RA 5IM0A 2HS3A 4A47A 5DM7Q 1HQUA 3K5MA 4YB7A 2E9RX 2BABA 4DV6F 1NZAA 2VOOA 3AB4B 3V6HA 1WWHA 2RU3A 5LL6d 1N32F 3W2WA 4RW9B 1X5OA 2OH2A 5KT4A 5C5JA 5HL7Q 4RU9A 2ZH2A 1N5QA 2PA3A 2XI2A 1WI8A 4JV5F 1TK5A 1FDAA 2A3JA 1Y3JA 2IC3A 1U24A 2ZDOA 2YNGB 1JLEB 1KHWA 1S10A 1N8RT 4K4SA 4HEA9 3CVKA 1C1BA 3HVRA 4N77A 4D3GA 2E7WA 3MM5B 3CCWA 3RYLA 4KAIA 2XMJA 2XSFA 2EFGA 2FJDB 3I4HX 3QIPB 4ZPWR 5L9NA 2ZBIA 3OTOF 2ROGA 4WF9Q